data_5MR5
# 
_entry.id   5MR5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MR5         
WWPDB D_1200002882 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MR5 
_pdbx_database_status.recvd_initial_deposition_date   2016-12-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sandmark, J.' 1 ? 
'Oster, L.'    2 ? 
'Aagaard, A.'  3 ? 
'Roth, R.'     4 ? 
'Dahl, G.'     5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                5492 
_citation.page_last                 5508 
_citation.title                     
;Structure and biophysical characterization of the human full-length neurturin-GFRa2 complex: A role for heparan sulfate in signaling.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA117.000820 
_citation.pdbx_database_id_PubMed   29414779 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sandmark, J.'  1  
primary 'Dahl, G.'      2  
primary 'Oster, L.'     3  
primary 'Xu, B.'        4  
primary 'Johansson, P.' 5  
primary 'Akerud, T.'    6  
primary 'Aagaard, A.'   7  
primary 'Davidsson, P.' 8  
primary 'Bigalke, J.M.' 9  
primary 'Winzell, M.S.' 10 
primary 'Rainey, G.J.'  11 
primary 'Roth, R.G.'    12 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.46 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MR5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     52.070 
_cell.length_a_esd                 ? 
_cell.length_b                     120.300 
_cell.length_b_esd                 ? 
_cell.length_c                     78.670 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MR5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Neurturin                      11706.406 2   ? ? ? ? 
2 polymer     man 'GDNF family receptor alpha-2' 24274.393 2   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                  96.063    19  ? ? ? ? 
4 non-polymer syn GLYCEROL                       92.094    2   ? ? ? ? 
5 water       nat water                          18.015    318 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
;GFR-alpha-2,GDNF receptor beta,GDNFR-beta,Neurturin receptor alpha,NTNR-alpha,RET ligand 2,TGF-beta-related neurotrophic factor receptor 2
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
A,B ? 
2 'polypeptide(L)' no no 
;GTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQD
QACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMT
PNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVN
;
;GTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQD
QACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMT
PNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVN
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   LEU n 
1 4   GLY n 
1 5   ALA n 
1 6   ARG n 
1 7   PRO n 
1 8   CYS n 
1 9   GLY n 
1 10  LEU n 
1 11  ARG n 
1 12  GLU n 
1 13  LEU n 
1 14  GLU n 
1 15  VAL n 
1 16  ARG n 
1 17  VAL n 
1 18  SER n 
1 19  GLU n 
1 20  LEU n 
1 21  GLY n 
1 22  LEU n 
1 23  GLY n 
1 24  TYR n 
1 25  ALA n 
1 26  SER n 
1 27  ASP n 
1 28  GLU n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  PHE n 
1 33  ARG n 
1 34  TYR n 
1 35  CYS n 
1 36  ALA n 
1 37  GLY n 
1 38  ALA n 
1 39  CYS n 
1 40  GLU n 
1 41  ALA n 
1 42  ALA n 
1 43  ALA n 
1 44  ARG n 
1 45  VAL n 
1 46  TYR n 
1 47  ASP n 
1 48  LEU n 
1 49  GLY n 
1 50  LEU n 
1 51  ARG n 
1 52  ARG n 
1 53  LEU n 
1 54  ARG n 
1 55  GLN n 
1 56  ARG n 
1 57  ARG n 
1 58  ARG n 
1 59  LEU n 
1 60  ARG n 
1 61  ARG n 
1 62  GLU n 
1 63  ARG n 
1 64  VAL n 
1 65  ARG n 
1 66  ALA n 
1 67  GLN n 
1 68  PRO n 
1 69  CYS n 
1 70  CYS n 
1 71  ARG n 
1 72  PRO n 
1 73  THR n 
1 74  ALA n 
1 75  TYR n 
1 76  GLU n 
1 77  ASP n 
1 78  GLU n 
1 79  VAL n 
1 80  SER n 
1 81  PHE n 
1 82  LEU n 
1 83  ASP n 
1 84  ALA n 
1 85  HIS n 
1 86  SER n 
1 87  ARG n 
1 88  TYR n 
1 89  HIS n 
1 90  THR n 
1 91  VAL n 
1 92  HIS n 
1 93  GLU n 
1 94  LEU n 
1 95  SER n 
1 96  ALA n 
1 97  ARG n 
1 98  GLU n 
1 99  CYS n 
1 100 ALA n 
1 101 CYS n 
1 102 VAL n 
2 1   GLY n 
2 2   THR n 
2 3   GLY n 
2 4   ALA n 
2 5   ASP n 
2 6   PRO n 
2 7   VAL n 
2 8   VAL n 
2 9   SER n 
2 10  ALA n 
2 11  LYS n 
2 12  SER n 
2 13  ASN n 
2 14  HIS n 
2 15  CYS n 
2 16  LEU n 
2 17  ASP n 
2 18  ALA n 
2 19  ALA n 
2 20  LYS n 
2 21  ALA n 
2 22  CYS n 
2 23  ASN n 
2 24  LEU n 
2 25  ASN n 
2 26  ASP n 
2 27  ASN n 
2 28  CYS n 
2 29  LYS n 
2 30  LYS n 
2 31  LEU n 
2 32  ARG n 
2 33  SER n 
2 34  SER n 
2 35  TYR n 
2 36  ILE n 
2 37  SER n 
2 38  ILE n 
2 39  CYS n 
2 40  ASN n 
2 41  ARG n 
2 42  GLU n 
2 43  ILE n 
2 44  SER n 
2 45  PRO n 
2 46  THR n 
2 47  GLU n 
2 48  ARG n 
2 49  CYS n 
2 50  ASN n 
2 51  ARG n 
2 52  ARG n 
2 53  LYS n 
2 54  CYS n 
2 55  HIS n 
2 56  LYS n 
2 57  ALA n 
2 58  LEU n 
2 59  ARG n 
2 60  GLN n 
2 61  PHE n 
2 62  PHE n 
2 63  ASP n 
2 64  ARG n 
2 65  VAL n 
2 66  PRO n 
2 67  SER n 
2 68  GLU n 
2 69  TYR n 
2 70  THR n 
2 71  TYR n 
2 72  ARG n 
2 73  MET n 
2 74  LEU n 
2 75  PHE n 
2 76  CYS n 
2 77  SER n 
2 78  CYS n 
2 79  GLN n 
2 80  ASP n 
2 81  GLN n 
2 82  ALA n 
2 83  CYS n 
2 84  ALA n 
2 85  GLU n 
2 86  ARG n 
2 87  ARG n 
2 88  ARG n 
2 89  GLN n 
2 90  THR n 
2 91  ILE n 
2 92  LEU n 
2 93  PRO n 
2 94  SER n 
2 95  CYS n 
2 96  SER n 
2 97  TYR n 
2 98  GLU n 
2 99  ASP n 
2 100 LYS n 
2 101 GLU n 
2 102 LYS n 
2 103 PRO n 
2 104 ASN n 
2 105 CYS n 
2 106 LEU n 
2 107 ASP n 
2 108 LEU n 
2 109 ARG n 
2 110 GLY n 
2 111 VAL n 
2 112 CYS n 
2 113 ARG n 
2 114 THR n 
2 115 ASP n 
2 116 HIS n 
2 117 LEU n 
2 118 CYS n 
2 119 ARG n 
2 120 SER n 
2 121 ARG n 
2 122 LEU n 
2 123 ALA n 
2 124 ASP n 
2 125 PHE n 
2 126 HIS n 
2 127 ALA n 
2 128 ASN n 
2 129 CYS n 
2 130 ARG n 
2 131 ALA n 
2 132 SER n 
2 133 TYR n 
2 134 GLN n 
2 135 THR n 
2 136 VAL n 
2 137 THR n 
2 138 SER n 
2 139 CYS n 
2 140 PRO n 
2 141 ALA n 
2 142 ASP n 
2 143 ASN n 
2 144 TYR n 
2 145 GLN n 
2 146 ALA n 
2 147 CYS n 
2 148 LEU n 
2 149 GLY n 
2 150 SER n 
2 151 TYR n 
2 152 ALA n 
2 153 GLY n 
2 154 MET n 
2 155 ILE n 
2 156 GLY n 
2 157 PHE n 
2 158 ASP n 
2 159 MET n 
2 160 THR n 
2 161 PRO n 
2 162 ASN n 
2 163 TYR n 
2 164 VAL n 
2 165 ASP n 
2 166 SER n 
2 167 SER n 
2 168 PRO n 
2 169 THR n 
2 170 GLY n 
2 171 ILE n 
2 172 VAL n 
2 173 VAL n 
2 174 SER n 
2 175 PRO n 
2 176 TRP n 
2 177 CYS n 
2 178 SER n 
2 179 CYS n 
2 180 ARG n 
2 181 GLY n 
2 182 SER n 
2 183 GLY n 
2 184 ASN n 
2 185 MET n 
2 186 GLU n 
2 187 GLU n 
2 188 GLU n 
2 189 CYS n 
2 190 GLU n 
2 191 LYS n 
2 192 PHE n 
2 193 LEU n 
2 194 ARG n 
2 195 ASP n 
2 196 PHE n 
2 197 THR n 
2 198 GLU n 
2 199 ASN n 
2 200 PRO n 
2 201 CYS n 
2 202 LEU n 
2 203 ARG n 
2 204 ASN n 
2 205 ALA n 
2 206 ILE n 
2 207 GLN n 
2 208 ALA n 
2 209 PHE n 
2 210 GLY n 
2 211 ASN n 
2 212 GLY n 
2 213 THR n 
2 214 ASP n 
2 215 VAL n 
2 216 ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 102 Human ? NRTN                          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli'   562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 216 Human ? 'GFRA2, GDNFRB, RETL2, TRNR2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'Chinese Hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NRTN_HUMAN  Q99748 ? 1 
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
96  
2 UNP GFRA2_HUMAN O00451 ? 2 
;GTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQD
QACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMT
PNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVN
;
147 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5MR5 A 1 ? 102 ? Q99748 96  ? 197 ? 96  197 
2 1 5MR5 B 1 ? 102 ? Q99748 96  ? 197 ? 96  197 
3 2 5MR5 C 1 ? 216 ? O00451 147 ? 362 ? 147 362 
4 2 5MR5 D 1 ? 216 ? O00451 147 ? 362 ? 147 362 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MR5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.68 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2.0 M ammonium sulfate and 0.1 M HEPES pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN A200' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-12-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5MR5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.0 
_reflns.d_resolution_low                 30.3 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       60213 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.6 
_reflns.pdbx_Rmerge_I_obs                0.092 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.0 
_reflns_shell.d_res_low                   2.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.59 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.01 
_refine.aniso_B[2][2]                            -0.01 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               32.603 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.912 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MR5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.00 
_refine.ls_d_res_low                             30.28 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     54696 
_refine.ls_number_reflns_R_free                  2898 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.16 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.20609 
_refine.ls_R_factor_R_free                       0.24335 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.20415 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'polyalanine model of 2v5e' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.168 
_refine.pdbx_overall_ESU_R_Free                  0.158 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        4708 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         107 
_refine_hist.number_atoms_solvent             318 
_refine_hist.number_atoms_total               5133 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        30.28 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.019  4926  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.000  0.020  4450  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.283  1.973  6664  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 3.658  3.000  10198 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.609  5.000  592   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 32.431 21.758 256   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.328 15.000 826   ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.954 15.000 74    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.077  0.200  703   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  5568  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  1228  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.761  2.997  2374  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.760  2.996  2373  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.846  4.486  2964  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.846  4.486  2965  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.387  3.464  2552  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.387  3.464  2552  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 3.904  5.059  3701  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 6.008  23.989 5721  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.961  23.867 5614  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.052 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             226 
_refine_ls_shell.number_reflns_R_work             4000 
_refine_ls_shell.percent_reflns_obs               89.06 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.346 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.312 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5MR5 
_struct.title                        'Ligand-receptor complex.' 
_struct.pdbx_descriptor              'Neurturin, GDNF family receptor alpha-2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MR5 
_struct_keywords.text            'Complex, Receptor, Signalling, Ligand-receptor complex, signaling protein' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 18  ? LEU A 20  ? SER A 113 LEU A 115 5 ? 3  
HELX_P HELX_P2  AA2 ARG A 44  ? ARG A 56  ? ARG A 139 ARG A 151 1 ? 13 
HELX_P HELX_P3  AA3 SER B 18  ? GLY B 21  ? SER B 113 GLY B 116 5 ? 4  
HELX_P HELX_P4  AA4 ARG B 44  ? ARG B 56  ? ARG B 139 ARG B 151 1 ? 13 
HELX_P HELX_P5  AA5 HIS C 14  ? LEU C 24  ? HIS C 160 LEU C 170 1 ? 11 
HELX_P HELX_P6  AA6 ASN C 25  ? ARG C 41  ? ASN C 171 ARG C 187 1 ? 17 
HELX_P HELX_P7  AA7 ASN C 50  ? VAL C 65  ? ASN C 196 VAL C 211 1 ? 16 
HELX_P HELX_P8  AA8 PRO C 66  ? PHE C 75  ? PRO C 212 PHE C 221 1 ? 10 
HELX_P HELX_P9  AA9 ASP C 80  ? THR C 90  ? ASP C 226 THR C 236 1 ? 11 
HELX_P HELX_P10 AB1 LEU C 92  ? TYR C 97  ? LEU C 238 TYR C 243 1 ? 6  
HELX_P HELX_P11 AB2 ASN C 104 ? ASP C 115 ? ASN C 250 ASP C 261 1 ? 12 
HELX_P HELX_P12 AB3 ASP C 115 ? ARG C 130 ? ASP C 261 ARG C 276 1 ? 16 
HELX_P HELX_P13 AB4 CYS C 139 ? ASP C 142 ? CYS C 285 ASP C 288 5 ? 4  
HELX_P HELX_P14 AB5 ASN C 143 ? GLY C 153 ? ASN C 289 GLY C 299 1 ? 11 
HELX_P HELX_P15 AB6 SER C 182 ? ASN C 184 ? SER C 328 ASN C 330 5 ? 3  
HELX_P HELX_P16 AB7 MET C 185 ? GLU C 198 ? MET C 331 GLU C 344 1 ? 14 
HELX_P HELX_P17 AB8 ASN C 199 ? GLY C 210 ? ASN C 345 GLY C 356 1 ? 12 
HELX_P HELX_P18 AB9 HIS D 14  ? LEU D 24  ? HIS D 160 LEU D 170 1 ? 11 
HELX_P HELX_P19 AC1 ASN D 25  ? ARG D 41  ? ASN D 171 ARG D 187 1 ? 17 
HELX_P HELX_P20 AC2 ASN D 50  ? VAL D 65  ? ASN D 196 VAL D 211 1 ? 16 
HELX_P HELX_P21 AC3 PRO D 66  ? PHE D 75  ? PRO D 212 PHE D 221 1 ? 10 
HELX_P HELX_P22 AC4 ASP D 80  ? THR D 90  ? ASP D 226 THR D 236 1 ? 11 
HELX_P HELX_P23 AC5 LEU D 92  ? TYR D 97  ? LEU D 238 TYR D 243 1 ? 6  
HELX_P HELX_P24 AC6 ASN D 104 ? THR D 114 ? ASN D 250 THR D 260 1 ? 11 
HELX_P HELX_P25 AC7 ASP D 115 ? CYS D 129 ? ASP D 261 CYS D 275 1 ? 15 
HELX_P HELX_P26 AC8 CYS D 139 ? ASP D 142 ? CYS D 285 ASP D 288 5 ? 4  
HELX_P HELX_P27 AC9 ASN D 143 ? GLY D 153 ? ASN D 289 GLY D 299 1 ? 11 
HELX_P HELX_P28 AD1 SER D 182 ? ASN D 184 ? SER D 328 ASN D 330 5 ? 3  
HELX_P HELX_P29 AD2 MET D 185 ? GLU D 198 ? MET D 331 GLU D 344 1 ? 14 
HELX_P HELX_P30 AD3 ASN D 199 ? GLY D 210 ? ASN D 345 GLY D 356 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 8   SG ? ? ? 1_555 A CYS 70  SG ? ? A CYS 103 A CYS 165 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2  disulf ? ? A CYS 35  SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 130 A CYS 194 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf3  disulf ? ? A CYS 39  SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 134 A CYS 196 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4  disulf ? ? A CYS 69  SG ? ? ? 1_555 B CYS 69  SG ? ? A CYS 164 B CYS 164 1_555 ? ? ? ? ? ? ? 2.076 ? 
disulf5  disulf ? ? B CYS 8   SG ? ? ? 1_555 B CYS 70  SG ? ? B CYS 103 B CYS 165 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf6  disulf ? ? B CYS 35  SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 130 B CYS 194 1_555 ? ? ? ? ? ? ? 2.008 ? 
disulf7  disulf ? ? B CYS 39  SG ? ? ? 1_555 B CYS 101 SG ? ? B CYS 134 B CYS 196 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf8  disulf ? ? C CYS 15  SG ? ? ? 1_555 C CYS 76  SG ? ? C CYS 161 C CYS 222 1_555 ? ? ? ? ? ? ? 2.006 ? 
disulf9  disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 28  SG ? ? C CYS 168 C CYS 174 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf10 disulf ? ? C CYS 39  SG ? ? ? 1_555 C CYS 54  SG ? ? C CYS 185 C CYS 200 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf11 disulf ? ? C CYS 49  SG ? ? ? 1_555 C CYS 95  SG ? ? C CYS 195 C CYS 241 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf12 disulf ? ? C CYS 78  SG ? ? ? 1_555 C CYS 83  SG ? ? C CYS 224 C CYS 229 1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf13 disulf ? ? C CYS 105 SG ? ? ? 1_555 C CYS 177 SG ? ? C CYS 251 C CYS 323 1_555 ? ? ? ? ? ? ? 2.060 ? 
disulf14 disulf ? ? C CYS 112 SG ? ? ? 1_555 C CYS 118 SG ? ? C CYS 258 C CYS 264 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf15 disulf ? ? C CYS 129 SG ? ? ? 1_555 C CYS 147 SG ? ? C CYS 275 C CYS 293 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf16 disulf ? ? C CYS 139 SG ? ? ? 1_555 C CYS 201 SG ? ? C CYS 285 C CYS 347 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf17 disulf ? ? C CYS 179 SG ? ? ? 1_555 C CYS 189 SG ? ? C CYS 325 C CYS 335 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf18 disulf ? ? D CYS 15  SG ? ? ? 1_555 D CYS 76  SG ? ? D CYS 161 D CYS 222 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf19 disulf ? ? D CYS 22  SG ? ? ? 1_555 D CYS 28  SG ? ? D CYS 168 D CYS 174 1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf20 disulf ? ? D CYS 39  SG ? ? ? 1_555 D CYS 54  SG ? ? D CYS 185 D CYS 200 1_555 ? ? ? ? ? ? ? 2.067 ? 
disulf21 disulf ? ? D CYS 49  SG ? ? ? 1_555 D CYS 95  SG ? ? D CYS 195 D CYS 241 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf22 disulf ? ? D CYS 78  SG ? ? ? 1_555 D CYS 83  SG ? ? D CYS 224 D CYS 229 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf23 disulf ? ? D CYS 105 SG ? ? ? 1_555 D CYS 177 SG ? ? D CYS 251 D CYS 323 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf24 disulf ? ? D CYS 112 SG ? ? ? 1_555 D CYS 118 SG ? ? D CYS 258 D CYS 264 1_555 ? ? ? ? ? ? ? 2.083 ? 
disulf25 disulf ? ? D CYS 129 SG ? ? ? 1_555 D CYS 147 SG ? ? D CYS 275 D CYS 293 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf26 disulf ? ? D CYS 139 SG ? ? ? 1_555 D CYS 201 SG ? ? D CYS 285 D CYS 347 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf27 disulf ? ? D CYS 179 SG ? ? ? 1_555 D CYS 189 SG ? ? D CYS 325 D CYS 335 1_555 ? ? ? ? ? ? ? 2.062 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 9   ? ARG A 16  ? GLY A 104 ARG A 111 
AA1 2 THR A 29  ? ALA A 36  ? THR A 124 ALA A 131 
AA2 1 CYS A 70  ? TYR A 75  ? CYS A 165 TYR A 170 
AA2 2 ALA A 96  ? CYS A 101 ? ALA A 191 CYS A 196 
AA3 1 VAL A 79  ? LEU A 82  ? VAL A 174 LEU A 177 
AA3 2 TYR A 88  ? VAL A 91  ? TYR A 183 VAL A 186 
AA4 1 GLY B 9   ? ARG B 16  ? GLY B 104 ARG B 111 
AA4 2 THR B 29  ? ALA B 36  ? THR B 124 ALA B 131 
AA5 1 CYS B 70  ? TYR B 75  ? CYS B 165 TYR B 170 
AA5 2 ALA B 96  ? CYS B 101 ? ALA B 191 CYS B 196 
AA6 1 VAL B 79  ? LEU B 82  ? VAL B 174 LEU B 177 
AA6 2 TYR B 88  ? VAL B 91  ? TYR B 183 VAL B 186 
AA7 1 PRO C 161 ? TYR C 163 ? PRO C 307 TYR C 309 
AA7 2 VAL C 173 ? PRO C 175 ? VAL C 319 PRO C 321 
AA8 1 PRO D 161 ? TYR D 163 ? PRO D 307 TYR D 309 
AA8 2 VAL D 173 ? PRO D 175 ? VAL D 319 PRO D 321 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 13  ? N LEU A 108 O PHE A 32  ? O PHE A 127 
AA2 1 2 N ALA A 74  ? N ALA A 169 O ARG A 97  ? O ARG A 192 
AA3 1 2 N PHE A 81  ? N PHE A 176 O HIS A 89  ? O HIS A 184 
AA4 1 2 N LEU B 13  ? N LEU B 108 O PHE B 32  ? O PHE B 127 
AA5 1 2 N ALA B 74  ? N ALA B 169 O ARG B 97  ? O ARG B 192 
AA6 1 2 N VAL B 79  ? N VAL B 174 O VAL B 91  ? O VAL B 186 
AA7 1 2 N ASN C 162 ? N ASN C 308 O SER C 174 ? O SER C 320 
AA8 1 2 N ASN D 162 ? N ASN D 308 O SER D 174 ? O SER D 320 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 201 ? 4 'binding site for residue SO4 A 201' 
AC2 Software A SO4 202 ? 6 'binding site for residue SO4 A 202' 
AC3 Software A SO4 203 ? 3 'binding site for residue SO4 A 203' 
AC4 Software B SO4 201 ? 6 'binding site for residue SO4 B 201' 
AC5 Software B SO4 202 ? 9 'binding site for residue SO4 B 202' 
AC6 Software B SO4 203 ? 3 'binding site for residue SO4 B 203' 
AC7 Software B SO4 204 ? 3 'binding site for residue SO4 B 204' 
AC8 Software B SO4 205 ? 3 'binding site for residue SO4 B 205' 
AC9 Software B GOL 206 ? 8 'binding site for residue GOL B 206' 
AD1 Software C SO4 401 ? 4 'binding site for residue SO4 C 401' 
AD2 Software C SO4 402 ? 2 'binding site for residue SO4 C 402' 
AD3 Software C SO4 403 ? 2 'binding site for residue SO4 C 403' 
AD4 Software C SO4 404 ? 2 'binding site for residue SO4 C 404' 
AD5 Software C SO4 405 ? 2 'binding site for residue SO4 C 405' 
AD6 Software C SO4 406 ? 5 'binding site for residue SO4 C 406' 
AD7 Software C SO4 407 ? 3 'binding site for residue SO4 C 407' 
AD8 Software C GOL 408 ? 6 'binding site for residue GOL C 408' 
AD9 Software D SO4 401 ? 4 'binding site for residue SO4 D 401' 
AE1 Software D SO4 402 ? 3 'binding site for residue SO4 D 402' 
AE2 Software D SO4 403 ? 2 'binding site for residue SO4 D 403' 
AE3 Software D SO4 404 ? 5 'binding site for residue SO4 D 404' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ARG A  63  ? ARG A 158 . ? 1_555 ? 
2  AC1 4 ARG A  65  ? ARG A 160 . ? 1_555 ? 
3  AC1 4 ARG B  63  ? ARG B 158 . ? 1_555 ? 
4  AC1 4 ARG B  65  ? ARG B 160 . ? 1_555 ? 
5  AC2 6 ARG A  54  ? ARG A 149 . ? 1_555 ? 
6  AC2 6 ARG A  63  ? ARG A 158 . ? 1_555 ? 
7  AC2 6 ARG A  65  ? ARG A 160 . ? 1_555 ? 
8  AC2 6 ALA A  66  ? ALA A 161 . ? 1_555 ? 
9  AC2 6 GLN A  67  ? GLN A 162 . ? 1_555 ? 
10 AC2 6 HOH Z  .   ? HOH A 311 . ? 1_555 ? 
11 AC3 3 ARG A  6   ? ARG A 101 . ? 1_555 ? 
12 AC3 3 ARG A  11  ? ARG A 106 . ? 1_555 ? 
13 AC3 3 GLU A  12  ? GLU A 107 . ? 1_555 ? 
14 AC4 6 ARG B  54  ? ARG B 149 . ? 1_555 ? 
15 AC4 6 ARG B  63  ? ARG B 158 . ? 1_555 ? 
16 AC4 6 ARG B  65  ? ARG B 160 . ? 1_555 ? 
17 AC4 6 ALA B  66  ? ALA B 161 . ? 1_555 ? 
18 AC4 6 GLN B  67  ? GLN B 162 . ? 1_555 ? 
19 AC4 6 HOH AA .   ? HOH B 329 . ? 1_555 ? 
20 AC5 9 ARG A  56  ? ARG A 151 . ? 1_555 ? 
21 AC5 9 SER B  18  ? SER B 113 . ? 1_555 ? 
22 AC5 9 GLU B  19  ? GLU B 114 . ? 1_555 ? 
23 AC5 9 HOH AA .   ? HOH B 311 . ? 1_555 ? 
24 AC5 9 HOH AA .   ? HOH B 315 . ? 1_555 ? 
25 AC5 9 HOH AA .   ? HOH B 321 . ? 1_555 ? 
26 AC5 9 HOH AA .   ? HOH B 344 . ? 1_555 ? 
27 AC5 9 HIS D  116 ? HIS D 262 . ? 1_655 ? 
28 AC5 9 ARG D  119 ? ARG D 265 . ? 1_655 ? 
29 AC6 3 ARG B  6   ? ARG B 101 . ? 1_555 ? 
30 AC6 3 ARG B  11  ? ARG B 106 . ? 1_555 ? 
31 AC6 3 GLU B  12  ? GLU B 107 . ? 1_555 ? 
32 AC7 3 ARG B  6   ? ARG B 101 . ? 1_555 ? 
33 AC7 3 PRO B  7   ? PRO B 102 . ? 1_555 ? 
34 AC7 3 HOH AA .   ? HOH B 302 . ? 1_555 ? 
35 AC8 3 ARG B  54  ? ARG B 149 . ? 1_555 ? 
36 AC8 3 GLN B  55  ? GLN B 150 . ? 1_555 ? 
37 AC8 3 HOH AA .   ? HOH B 327 . ? 1_555 ? 
38 AC9 8 GLU B  76  ? GLU B 171 . ? 1_555 ? 
39 AC9 8 ASP B  77  ? ASP B 172 . ? 1_555 ? 
40 AC9 8 GLU B  78  ? GLU B 173 . ? 1_555 ? 
41 AC9 8 ARG B  97  ? ARG B 192 . ? 1_555 ? 
42 AC9 8 HOH AA .   ? HOH B 301 . ? 1_555 ? 
43 AC9 8 HOH AA .   ? HOH B 338 . ? 1_555 ? 
44 AC9 8 LYS D  29  ? LYS D 175 . ? 1_555 ? 
45 AC9 8 LYS D  30  ? LYS D 176 . ? 1_555 ? 
46 AD1 4 ALA C  131 ? ALA C 277 . ? 1_555 ? 
47 AD1 4 HOH BA .   ? HOH C 517 . ? 1_555 ? 
48 AD1 4 HOH BA .   ? HOH C 552 . ? 1_555 ? 
49 AD1 4 HOH BA .   ? HOH C 567 . ? 1_555 ? 
50 AD2 2 SER C  67  ? SER C 213 . ? 1_555 ? 
51 AD2 2 HOH BA .   ? HOH C 537 . ? 1_555 ? 
52 AD3 2 LEU C  117 ? LEU C 263 . ? 1_555 ? 
53 AD3 2 ARG C  121 ? ARG C 267 . ? 1_555 ? 
54 AD4 2 ARG C  130 ? ARG C 276 . ? 1_555 ? 
55 AD4 2 HOH BA .   ? HOH C 563 . ? 1_555 ? 
56 AD5 2 ASN C  50  ? ASN C 196 . ? 1_555 ? 
57 AD5 2 ARG C  52  ? ARG C 198 . ? 1_555 ? 
58 AD6 5 LEU C  24  ? LEU C 170 . ? 1_555 ? 
59 AD6 5 ASN C  25  ? ASN C 171 . ? 1_555 ? 
60 AD6 5 ASP C  26  ? ASP C 172 . ? 1_555 ? 
61 AD6 5 HOH BA .   ? HOH C 503 . ? 1_555 ? 
62 AD6 5 HOH BA .   ? HOH C 518 . ? 1_555 ? 
63 AD7 3 ASP C  80  ? ASP C 226 . ? 1_555 ? 
64 AD7 3 GLN C  81  ? GLN C 227 . ? 1_555 ? 
65 AD7 3 HOH BA .   ? HOH C 532 . ? 1_555 ? 
66 AD8 6 GLU A  76  ? GLU A 171 . ? 1_555 ? 
67 AD8 6 ASP A  77  ? ASP A 172 . ? 1_555 ? 
68 AD8 6 ARG A  97  ? ARG A 192 . ? 1_555 ? 
69 AD8 6 LYS C  29  ? LYS C 175 . ? 1_555 ? 
70 AD8 6 LYS C  30  ? LYS C 176 . ? 1_555 ? 
71 AD8 6 HOH BA .   ? HOH C 549 . ? 1_555 ? 
72 AD9 4 LEU D  24  ? LEU D 170 . ? 1_555 ? 
73 AD9 4 ASN D  25  ? ASN D 171 . ? 1_555 ? 
74 AD9 4 ASP D  26  ? ASP D 172 . ? 1_555 ? 
75 AD9 4 HOH CA .   ? HOH D 507 . ? 1_555 ? 
76 AE1 3 ASP D  80  ? ASP D 226 . ? 1_555 ? 
77 AE1 3 GLN D  81  ? GLN D 227 . ? 1_555 ? 
78 AE1 3 HOH CA .   ? HOH D 547 . ? 1_555 ? 
79 AE2 2 ARG D  121 ? ARG D 267 . ? 1_555 ? 
80 AE2 2 HOH CA .   ? HOH D 506 . ? 1_555 ? 
81 AE3 5 ARG D  88  ? ARG D 234 . ? 1_555 ? 
82 AE3 5 GLN D  89  ? GLN D 235 . ? 1_555 ? 
83 AE3 5 SER D  94  ? SER D 240 . ? 1_555 ? 
84 AE3 5 GLU D  98  ? GLU D 244 . ? 1_555 ? 
85 AE3 5 HOH CA .   ? HOH D 505 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5MR5 
_atom_sites.fract_transf_matrix[1][1]   0.019205 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002856 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008313 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012851 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A  1 5   ? -5.777  -41.173  -31.505 1.00 58.11 ? 100 ALA A N   1 
ATOM   2    C CA  . ALA A  1 5   ? -6.290  -40.580  -32.772 1.00 59.50 ? 100 ALA A CA  1 
ATOM   3    C C   . ALA A  1 5   ? -7.741  -40.975  -32.996 1.00 56.71 ? 100 ALA A C   1 
ATOM   4    O O   . ALA A  1 5   ? -8.638  -40.139  -32.917 1.00 61.56 ? 100 ALA A O   1 
ATOM   5    C CB  . ALA A  1 5   ? -5.438  -41.018  -33.955 1.00 60.25 ? 100 ALA A CB  1 
ATOM   6    N N   . ARG A  1 6   ? -7.962  -42.259  -33.251 1.00 51.26 ? 101 ARG A N   1 
ATOM   7    C CA  . ARG A  1 6   ? -9.289  -42.753  -33.583 1.00 46.71 ? 101 ARG A CA  1 
ATOM   8    C C   . ARG A  1 6   ? -10.147 -42.907  -32.319 1.00 40.51 ? 101 ARG A C   1 
ATOM   9    O O   . ARG A  1 6   ? -9.702  -43.514  -31.347 1.00 39.72 ? 101 ARG A O   1 
ATOM   10   C CB  . ARG A  1 6   ? -9.166  -44.079  -34.318 1.00 47.43 ? 101 ARG A CB  1 
ATOM   11   C CG  . ARG A  1 6   ? -10.277 -44.293  -35.325 1.00 49.10 ? 101 ARG A CG  1 
ATOM   12   C CD  . ARG A  1 6   ? -10.058 -45.559  -36.137 1.00 48.13 ? 101 ARG A CD  1 
ATOM   13   N NE  . ARG A  1 6   ? -11.332 -46.054  -36.634 1.00 47.16 ? 101 ARG A NE  1 
ATOM   14   C CZ  . ARG A  1 6   ? -11.560 -47.304  -37.024 1.00 46.50 ? 101 ARG A CZ  1 
ATOM   15   N NH1 . ARG A  1 6   ? -10.592 -48.217  -36.994 1.00 47.00 ? 101 ARG A NH1 1 
ATOM   16   N NH2 . ARG A  1 6   ? -12.773 -47.640  -37.444 1.00 44.62 ? 101 ARG A NH2 1 
ATOM   17   N N   . PRO A  1 7   ? -11.371 -42.356  -32.328 1.00 35.94 ? 102 PRO A N   1 
ATOM   18   C CA  . PRO A  1 7   ? -12.184 -42.366  -31.117 1.00 35.15 ? 102 PRO A CA  1 
ATOM   19   C C   . PRO A  1 7   ? -12.787 -43.738  -30.811 1.00 34.01 ? 102 PRO A C   1 
ATOM   20   O O   . PRO A  1 7   ? -12.875 -44.599  -31.687 1.00 31.12 ? 102 PRO A O   1 
ATOM   21   C CB  . PRO A  1 7   ? -13.295 -41.353  -31.428 1.00 35.77 ? 102 PRO A CB  1 
ATOM   22   C CG  . PRO A  1 7   ? -13.437 -41.389  -32.918 1.00 35.95 ? 102 PRO A CG  1 
ATOM   23   C CD  . PRO A  1 7   ? -12.061 -41.684  -33.450 1.00 36.03 ? 102 PRO A CD  1 
ATOM   24   N N   . CYS A  1 8   ? -13.205 -43.908  -29.561 1.00 32.65 ? 103 CYS A N   1 
ATOM   25   C CA  . CYS A  1 8   ? -13.832 -45.123  -29.099 1.00 31.49 ? 103 CYS A CA  1 
ATOM   26   C C   . CYS A  1 8   ? -14.994 -45.516  -30.008 1.00 31.73 ? 103 CYS A C   1 
ATOM   27   O O   . CYS A  1 8   ? -15.942 -44.749  -30.196 1.00 28.90 ? 103 CYS A O   1 
ATOM   28   C CB  . CYS A  1 8   ? -14.327 -44.960  -27.652 1.00 30.36 ? 103 CYS A CB  1 
ATOM   29   S SG  . CYS A  1 8   ? -15.271 -46.381  -27.048 1.00 30.73 ? 103 CYS A SG  1 
ATOM   30   N N   . GLY A  1 9   ? -14.904 -46.720  -30.573 1.00 31.11 ? 104 GLY A N   1 
ATOM   31   C CA  . GLY A  1 9   ? -15.980 -47.270  -31.392 1.00 31.27 ? 104 GLY A CA  1 
ATOM   32   C C   . GLY A  1 9   ? -15.776 -48.737  -31.756 1.00 31.41 ? 104 GLY A C   1 
ATOM   33   O O   . GLY A  1 9   ? -14.784 -49.370  -31.369 1.00 29.99 ? 104 GLY A O   1 
ATOM   34   N N   . LEU A  1 10  ? -16.722 -49.256  -32.529 1.00 32.27 ? 105 LEU A N   1 
ATOM   35   C CA  . LEU A  1 10  ? -16.703 -50.642  -33.000 1.00 33.97 ? 105 LEU A CA  1 
ATOM   36   C C   . LEU A  1 10  ? -15.585 -50.909  -33.974 1.00 32.65 ? 105 LEU A C   1 
ATOM   37   O O   . LEU A  1 10  ? -15.300 -50.091  -34.834 1.00 34.36 ? 105 LEU A O   1 
ATOM   38   C CB  . LEU A  1 10  ? -18.011 -50.997  -33.694 1.00 34.80 ? 105 LEU A CB  1 
ATOM   39   C CG  . LEU A  1 10  ? -19.209 -51.257  -32.801 1.00 37.29 ? 105 LEU A CG  1 
ATOM   40   C CD1 . LEU A  1 10  ? -20.477 -51.296  -33.653 1.00 37.15 ? 105 LEU A CD1 1 
ATOM   41   C CD2 . LEU A  1 10  ? -19.028 -52.561  -32.020 1.00 38.14 ? 105 LEU A CD2 1 
ATOM   42   N N   . ARG A  1 11  ? -14.958 -52.065  -33.812 1.00 31.35 ? 106 ARG A N   1 
ATOM   43   C CA  . ARG A  1 11  ? -13.977 -52.585  -34.751 1.00 31.64 ? 106 ARG A CA  1 
ATOM   44   C C   . ARG A  1 11  ? -14.401 -54.011  -35.093 1.00 32.83 ? 106 ARG A C   1 
ATOM   45   O O   . ARG A  1 11  ? -15.141 -54.645  -34.328 1.00 30.48 ? 106 ARG A O   1 
ATOM   46   C CB  . ARG A  1 11  ? -12.568 -52.599  -34.155 1.00 31.10 ? 106 ARG A CB  1 
ATOM   47   C CG  . ARG A  1 11  ? -12.102 -51.284  -33.533 1.00 33.31 ? 106 ARG A CG  1 
ATOM   48   C CD  . ARG A  1 11  ? -11.759 -50.189  -34.544 1.00 32.94 ? 106 ARG A CD  1 
ATOM   49   N NE  . ARG A  1 11  ? -11.273 -48.997  -33.851 1.00 32.25 ? 106 ARG A NE  1 
ATOM   50   C CZ  . ARG A  1 11  ? -12.000 -47.916  -33.549 1.00 33.76 ? 106 ARG A CZ  1 
ATOM   51   N NH1 . ARG A  1 11  ? -11.436 -46.910  -32.886 1.00 37.81 ? 106 ARG A NH1 1 
ATOM   52   N NH2 . ARG A  1 11  ? -13.278 -47.808  -33.878 1.00 33.86 ? 106 ARG A NH2 1 
ATOM   53   N N   . GLU A  1 12  ? -13.918 -54.489  -36.241 1.00 34.39 ? 107 GLU A N   1 
ATOM   54   C CA  . GLU A  1 12  ? -14.266 -55.789  -36.822 1.00 33.50 ? 107 GLU A CA  1 
ATOM   55   C C   . GLU A  1 12  ? -13.040 -56.534  -37.253 1.00 33.29 ? 107 GLU A C   1 
ATOM   56   O O   . GLU A  1 12  ? -12.112 -55.948  -37.796 1.00 33.85 ? 107 GLU A O   1 
ATOM   57   C CB  . GLU A  1 12  ? -15.084 -55.612  -38.084 1.00 34.58 ? 107 GLU A CB  1 
ATOM   58   C CG  . GLU A  1 12  ? -16.543 -55.394  -37.820 1.00 36.53 ? 107 GLU A CG  1 
ATOM   59   C CD  . GLU A  1 12  ? -17.297 -55.138  -39.088 1.00 37.11 ? 107 GLU A CD  1 
ATOM   60   O OE1 . GLU A  1 12  ? -18.490 -54.797  -38.999 1.00 42.13 ? 107 GLU A OE1 1 
ATOM   61   O OE2 . GLU A  1 12  ? -16.697 -55.288  -40.168 1.00 38.94 ? 107 GLU A OE2 1 
ATOM   62   N N   . LEU A  1 13  ? -13.085 -57.845  -37.071 1.00 32.74 ? 108 LEU A N   1 
ATOM   63   C CA  . LEU A  1 13  ? -11.996 -58.722  -37.414 1.00 33.66 ? 108 LEU A CA  1 
ATOM   64   C C   . LEU A  1 13  ? -12.610 -60.083  -37.742 1.00 32.93 ? 108 LEU A C   1 
ATOM   65   O O   . LEU A  1 13  ? -13.467 -60.565  -36.999 1.00 32.45 ? 108 LEU A O   1 
ATOM   66   C CB  . LEU A  1 13  ? -11.057 -58.854  -36.207 1.00 36.34 ? 108 LEU A CB  1 
ATOM   67   C CG  . LEU A  1 13  ? -9.624  -59.295  -36.456 1.00 38.34 ? 108 LEU A CG  1 
ATOM   68   C CD1 . LEU A  1 13  ? -8.944  -58.385  -37.467 1.00 40.11 ? 108 LEU A CD1 1 
ATOM   69   C CD2 . LEU A  1 13  ? -8.854  -59.308  -35.149 1.00 40.46 ? 108 LEU A CD2 1 
ATOM   70   N N   . GLU A  1 14  ? -12.195 -60.678  -38.856 1.00 31.87 ? 109 GLU A N   1 
ATOM   71   C CA  . GLU A  1 14  ? -12.550 -62.058  -39.163 1.00 32.66 ? 109 GLU A CA  1 
ATOM   72   C C   . GLU A  1 14  ? -11.653 -62.963  -38.348 1.00 30.96 ? 109 GLU A C   1 
ATOM   73   O O   . GLU A  1 14  ? -10.425 -62.795  -38.374 1.00 31.87 ? 109 GLU A O   1 
ATOM   74   C CB  . GLU A  1 14  ? -12.332 -62.369  -40.649 1.00 32.52 ? 109 GLU A CB  1 
ATOM   75   C CG  . GLU A  1 14  ? -13.259 -61.632  -41.592 1.00 33.23 ? 109 GLU A CG  1 
ATOM   76   C CD  . GLU A  1 14  ? -12.996 -61.980  -43.057 1.00 34.99 ? 109 GLU A CD  1 
ATOM   77   O OE1 . GLU A  1 14  ? -12.375 -63.033  -43.358 1.00 35.78 ? 109 GLU A OE1 1 
ATOM   78   O OE2 . GLU A  1 14  ? -13.410 -61.188  -43.910 1.00 35.79 ? 109 GLU A OE2 1 
ATOM   79   N N   . VAL A  1 15  ? -12.242 -63.909  -37.618 1.00 28.50 ? 110 VAL A N   1 
ATOM   80   C CA  . VAL A  1 15  ? -11.438 -64.840  -36.817 1.00 29.79 ? 110 VAL A CA  1 
ATOM   81   C C   . VAL A  1 15  ? -11.940 -66.267  -36.917 1.00 28.94 ? 110 VAL A C   1 
ATOM   82   O O   . VAL A  1 15  ? -13.122 -66.515  -37.153 1.00 31.62 ? 110 VAL A O   1 
ATOM   83   C CB  . VAL A  1 15  ? -11.383 -64.451  -35.310 1.00 29.26 ? 110 VAL A CB  1 
ATOM   84   C CG1 . VAL A  1 15  ? -10.937 -63.001  -35.156 1.00 29.74 ? 110 VAL A CG1 1 
ATOM   85   C CG2 . VAL A  1 15  ? -12.725 -64.657  -34.642 1.00 28.63 ? 110 VAL A CG2 1 
ATOM   86   N N   . ARG A  1 16  ? -11.017 -67.189  -36.718 1.00 30.57 ? 111 ARG A N   1 
ATOM   87   C CA  . ARG A  1 16  ? -11.341 -68.597  -36.574 1.00 31.83 ? 111 ARG A CA  1 
ATOM   88   C C   . ARG A  1 16  ? -11.757 -68.837  -35.149 1.00 29.45 ? 111 ARG A C   1 
ATOM   89   O O   . ARG A  1 16  ? -11.050 -68.410  -34.235 1.00 28.76 ? 111 ARG A O   1 
ATOM   90   C CB  . ARG A  1 16  ? -10.114 -69.447  -36.888 1.00 36.69 ? 111 ARG A CB  1 
ATOM   91   C CG  . ARG A  1 16  ? -9.923  -69.708  -38.372 1.00 42.69 ? 111 ARG A CG  1 
ATOM   92   C CD  . ARG A  1 16  ? -9.389  -71.112  -38.630 1.00 48.56 ? 111 ARG A CD  1 
ATOM   93   N NE  . ARG A  1 16  ? -9.861  -71.625  -39.915 1.00 54.33 ? 111 ARG A NE  1 
ATOM   94   C CZ  . ARG A  1 16  ? -9.262  -71.437  -41.094 1.00 58.33 ? 111 ARG A CZ  1 
ATOM   95   N NH1 . ARG A  1 16  ? -8.128  -70.737  -41.200 1.00 58.11 ? 111 ARG A NH1 1 
ATOM   96   N NH2 . ARG A  1 16  ? -9.807  -71.966  -42.188 1.00 59.18 ? 111 ARG A NH2 1 
ATOM   97   N N   . VAL A  1 17  ? -12.851 -69.559  -34.933 1.00 28.10 ? 112 VAL A N   1 
ATOM   98   C CA  . VAL A  1 17  ? -13.320 -69.739  -33.574 1.00 28.76 ? 112 VAL A CA  1 
ATOM   99   C C   . VAL A  1 17  ? -12.276 -70.464  -32.716 1.00 29.03 ? 112 VAL A C   1 
ATOM   100  O O   . VAL A  1 17  ? -12.169 -70.187  -31.531 1.00 27.91 ? 112 VAL A O   1 
ATOM   101  C CB  . VAL A  1 17  ? -14.714 -70.403  -33.445 1.00 30.25 ? 112 VAL A CB  1 
ATOM   102  C CG1 . VAL A  1 17  ? -15.654 -70.029  -34.582 1.00 30.37 ? 112 VAL A CG1 1 
ATOM   103  C CG2 . VAL A  1 17  ? -14.608 -71.897  -33.337 1.00 31.35 ? 112 VAL A CG2 1 
ATOM   104  N N   . SER A  1 18  ? -11.506 -71.370  -33.320 1.00 28.92 ? 113 SER A N   1 
ATOM   105  C CA  . SER A  1 18  ? -10.470 -72.152  -32.612 1.00 29.66 ? 113 SER A CA  1 
ATOM   106  C C   . SER A  1 18  ? -9.274  -71.318  -32.179 1.00 30.30 ? 113 SER A C   1 
ATOM   107  O O   . SER A  1 18  ? -8.439  -71.755  -31.420 1.00 29.09 ? 113 SER A O   1 
ATOM   108  C CB  . SER A  1 18  ? -9.953  -73.257  -33.528 1.00 29.73 ? 113 SER A CB  1 
ATOM   109  O OG  . SER A  1 18  ? -9.471  -72.684  -34.713 1.00 31.88 ? 113 SER A OG  1 
ATOM   110  N N   . GLU A  1 19  ? -9.199  -70.117  -32.714 1.00 33.58 ? 114 GLU A N   1 
ATOM   111  C CA  . GLU A  1 19  ? -8.174  -69.141  -32.390 1.00 36.46 ? 114 GLU A CA  1 
ATOM   112  C C   . GLU A  1 19  ? -8.443  -68.404  -31.068 1.00 34.44 ? 114 GLU A C   1 
ATOM   113  O O   . GLU A  1 19  ? -7.530  -67.828  -30.479 1.00 35.14 ? 114 GLU A O   1 
ATOM   114  C CB  . GLU A  1 19  ? -8.175  -68.132  -33.536 1.00 39.04 ? 114 GLU A CB  1 
ATOM   115  C CG  . GLU A  1 19  ? -6.978  -67.246  -33.661 1.00 42.83 ? 114 GLU A CG  1 
ATOM   116  C CD  . GLU A  1 19  ? -7.161  -66.197  -34.746 1.00 46.16 ? 114 GLU A CD  1 
ATOM   117  O OE1 . GLU A  1 19  ? -6.291  -65.299  -34.819 1.00 48.97 ? 114 GLU A OE1 1 
ATOM   118  O OE2 . GLU A  1 19  ? -8.153  -66.267  -35.523 1.00 44.81 ? 114 GLU A OE2 1 
ATOM   119  N N   . LEU A  1 20  ? -9.697  -68.401  -30.626 1.00 30.95 ? 115 LEU A N   1 
ATOM   120  C CA  . LEU A  1 20  ? -10.120 -67.585  -29.489 1.00 30.88 ? 115 LEU A CA  1 
ATOM   121  C C   . LEU A  1 20  ? -9.746  -68.170  -28.117 1.00 30.39 ? 115 LEU A C   1 
ATOM   122  O O   . LEU A  1 20  ? -9.916  -67.504  -27.105 1.00 28.36 ? 115 LEU A O   1 
ATOM   123  C CB  . LEU A  1 20  ? -11.634 -67.345  -29.544 1.00 32.35 ? 115 LEU A CB  1 
ATOM   124  C CG  . LEU A  1 20  ? -12.217 -66.128  -30.285 1.00 33.25 ? 115 LEU A CG  1 
ATOM   125  C CD1 . LEU A  1 20  ? -11.217 -65.417  -31.182 1.00 33.57 ? 115 LEU A CD1 1 
ATOM   126  C CD2 . LEU A  1 20  ? -13.470 -66.507  -31.053 1.00 33.94 ? 115 LEU A CD2 1 
ATOM   127  N N   . GLY A  1 21  ? -9.248  -69.401  -28.084 1.00 29.80 ? 116 GLY A N   1 
ATOM   128  C CA  . GLY A  1 21  ? -8.828  -70.019  -26.828 1.00 29.96 ? 116 GLY A CA  1 
ATOM   129  C C   . GLY A  1 21  ? -9.983  -70.350  -25.892 1.00 29.34 ? 116 GLY A C   1 
ATOM   130  O O   . GLY A  1 21  ? -9.789  -70.431  -24.674 1.00 30.46 ? 116 GLY A O   1 
ATOM   131  N N   . LEU A  1 22  ? -11.173 -70.554  -26.458 1.00 26.45 ? 117 LEU A N   1 
ATOM   132  C CA  . LEU A  1 22  ? -12.390 -70.838  -25.687 1.00 25.98 ? 117 LEU A CA  1 
ATOM   133  C C   . LEU A  1 22  ? -12.799 -72.322  -25.695 1.00 24.23 ? 117 LEU A C   1 
ATOM   134  O O   . LEU A  1 22  ? -13.877 -72.676  -25.231 1.00 24.01 ? 117 LEU A O   1 
ATOM   135  C CB  . LEU A  1 22  ? -13.545 -69.984  -26.222 1.00 26.28 ? 117 LEU A CB  1 
ATOM   136  C CG  . LEU A  1 22  ? -13.386 -68.465  -26.040 1.00 29.24 ? 117 LEU A CG  1 
ATOM   137  C CD1 . LEU A  1 22  ? -14.527 -67.752  -26.760 1.00 30.68 ? 117 LEU A CD1 1 
ATOM   138  C CD2 . LEU A  1 22  ? -13.348 -68.075  -24.559 1.00 28.99 ? 117 LEU A CD2 1 
ATOM   139  N N   . GLY A  1 23  ? -11.945 -73.184  -26.230 1.00 24.40 ? 118 GLY A N   1 
ATOM   140  C CA  . GLY A  1 23  ? -12.195 -74.614  -26.188 1.00 25.80 ? 118 GLY A CA  1 
ATOM   141  C C   . GLY A  1 23  ? -13.073 -75.170  -27.298 1.00 27.83 ? 118 GLY A C   1 
ATOM   142  O O   . GLY A  1 23  ? -13.507 -76.309  -27.228 1.00 29.16 ? 118 GLY A O   1 
ATOM   143  N N   . TYR A  1 24  ? -13.341 -74.384  -28.327 1.00 30.58 ? 119 TYR A N   1 
ATOM   144  C CA  . TYR A  1 24  ? -14.169 -74.868  -29.426 1.00 31.77 ? 119 TYR A CA  1 
ATOM   145  C C   . TYR A  1 24  ? -13.291 -75.400  -30.548 1.00 29.33 ? 119 TYR A C   1 
ATOM   146  O O   . TYR A  1 24  ? -12.506 -74.668  -31.144 1.00 30.77 ? 119 TYR A O   1 
ATOM   147  C CB  . TYR A  1 24  ? -15.073 -73.758  -29.927 1.00 33.76 ? 119 TYR A CB  1 
ATOM   148  C CG  . TYR A  1 24  ? -16.113 -73.316  -28.921 1.00 34.65 ? 119 TYR A CG  1 
ATOM   149  C CD1 . TYR A  1 24  ? -17.188 -74.156  -28.582 1.00 36.87 ? 119 TYR A CD1 1 
ATOM   150  C CD2 . TYR A  1 24  ? -16.037 -72.063  -28.318 1.00 34.44 ? 119 TYR A CD2 1 
ATOM   151  C CE1 . TYR A  1 24  ? -18.152 -73.754  -27.661 1.00 37.09 ? 119 TYR A CE1 1 
ATOM   152  C CE2 . TYR A  1 24  ? -16.989 -71.658  -27.393 1.00 36.67 ? 119 TYR A CE2 1 
ATOM   153  C CZ  . TYR A  1 24  ? -18.045 -72.507  -27.076 1.00 37.36 ? 119 TYR A CZ  1 
ATOM   154  O OH  . TYR A  1 24  ? -19.004 -72.113  -26.176 1.00 42.44 ? 119 TYR A OH  1 
ATOM   155  N N   . ALA A  1 25  ? -13.414 -76.685  -30.829 1.00 29.00 ? 120 ALA A N   1 
ATOM   156  C CA  . ALA A  1 25  ? -12.643 -77.303  -31.901 1.00 29.82 ? 120 ALA A CA  1 
ATOM   157  C C   . ALA A  1 25  ? -13.387 -77.136  -33.228 1.00 28.74 ? 120 ALA A C   1 
ATOM   158  O O   . ALA A  1 25  ? -13.906 -78.086  -33.771 1.00 27.87 ? 120 ALA A O   1 
ATOM   159  C CB  . ALA A  1 25  ? -12.392 -78.774  -31.597 1.00 30.04 ? 120 ALA A CB  1 
ATOM   160  N N   . SER A  1 26  ? -13.447 -75.904  -33.726 1.00 28.97 ? 121 SER A N   1 
ATOM   161  C CA  . SER A  1 26  ? -14.141 -75.597  -34.969 1.00 28.64 ? 121 SER A CA  1 
ATOM   162  C C   . SER A  1 26  ? -13.281 -74.680  -35.809 1.00 29.57 ? 121 SER A C   1 
ATOM   163  O O   . SER A  1 26  ? -12.723 -73.712  -35.312 1.00 33.09 ? 121 SER A O   1 
ATOM   164  C CB  . SER A  1 26  ? -15.480 -74.936  -34.685 1.00 26.31 ? 121 SER A CB  1 
ATOM   165  O OG  . SER A  1 26  ? -16.078 -74.483  -35.873 1.00 25.88 ? 121 SER A OG  1 
ATOM   166  N N   . ASP A  1 27  ? -13.175 -75.001  -37.090 1.00 31.15 ? 122 ASP A N   1 
ATOM   167  C CA  . ASP A  1 27  ? -12.438 -74.182  -38.050 1.00 31.47 ? 122 ASP A CA  1 
ATOM   168  C C   . ASP A  1 27  ? -13.337 -73.105  -38.643 1.00 28.76 ? 122 ASP A C   1 
ATOM   169  O O   . ASP A  1 27  ? -12.920 -72.401  -39.576 1.00 26.45 ? 122 ASP A O   1 
ATOM   170  C CB  . ASP A  1 27  ? -11.911 -75.044  -39.212 1.00 35.69 ? 122 ASP A CB  1 
ATOM   171  C CG  . ASP A  1 27  ? -10.824 -76.022  -38.794 1.00 40.10 ? 122 ASP A CG  1 
ATOM   172  O OD1 . ASP A  1 27  ? -10.143 -75.785  -37.768 1.00 41.75 ? 122 ASP A OD1 1 
ATOM   173  O OD2 . ASP A  1 27  ? -10.647 -77.023  -39.539 1.00 44.71 ? 122 ASP A OD2 1 
ATOM   174  N N   . GLU A  1 28  ? -14.573 -72.996  -38.155 1.00 24.53 ? 123 GLU A N   1 
ATOM   175  C CA  . GLU A  1 28  ? -15.459 -71.963  -38.651 1.00 23.67 ? 123 GLU A CA  1 
ATOM   176  C C   . GLU A  1 28  ? -14.899 -70.570  -38.341 1.00 23.78 ? 123 GLU A C   1 
ATOM   177  O O   . GLU A  1 28  ? -14.118 -70.364  -37.395 1.00 22.72 ? 123 GLU A O   1 
ATOM   178  C CB  . GLU A  1 28  ? -16.878 -72.097  -38.087 1.00 23.61 ? 123 GLU A CB  1 
ATOM   179  C CG  . GLU A  1 28  ? -17.709 -73.226  -38.704 1.00 23.68 ? 123 GLU A CG  1 
ATOM   180  C CD  . GLU A  1 28  ? -19.177 -72.893  -38.780 1.00 24.28 ? 123 GLU A CD  1 
ATOM   181  O OE1 . GLU A  1 28  ? -20.010 -73.844  -38.767 1.00 25.08 ? 123 GLU A OE1 1 
ATOM   182  O OE2 . GLU A  1 28  ? -19.513 -71.689  -38.859 1.00 22.28 ? 123 GLU A OE2 1 
ATOM   183  N N   . THR A  1 29  ? -15.311 -69.618  -39.160 1.00 24.06 ? 124 THR A N   1 
ATOM   184  C CA  . THR A  1 29  ? -14.957 -68.219  -38.993 1.00 23.63 ? 124 THR A CA  1 
ATOM   185  C C   . THR A  1 29  ? -16.150 -67.407  -38.450 1.00 22.21 ? 124 THR A C   1 
ATOM   186  O O   . THR A  1 29  ? -17.278 -67.610  -38.860 1.00 22.57 ? 124 THR A O   1 
ATOM   187  C CB  . THR A  1 29  ? -14.506 -67.663  -40.356 1.00 25.69 ? 124 THR A CB  1 
ATOM   188  O OG1 . THR A  1 29  ? -13.316 -68.345  -40.776 1.00 26.04 ? 124 THR A OG1 1 
ATOM   189  C CG2 . THR A  1 29  ? -14.217 -66.168  -40.288 1.00 27.19 ? 124 THR A CG2 1 
ATOM   190  N N   . VAL A  1 30  ? -15.896 -66.482  -37.534 1.00 21.03 ? 125 VAL A N   1 
ATOM   191  C CA  . VAL A  1 30  ? -16.915 -65.506  -37.161 1.00 21.36 ? 125 VAL A CA  1 
ATOM   192  C C   . VAL A  1 30  ? -16.403 -64.106  -37.405 1.00 20.74 ? 125 VAL A C   1 
ATOM   193  O O   . VAL A  1 30  ? -15.192 -63.873  -37.442 1.00 22.19 ? 125 VAL A O   1 
ATOM   194  C CB  . VAL A  1 30  ? -17.367 -65.633  -35.680 1.00 21.30 ? 125 VAL A CB  1 
ATOM   195  C CG1 . VAL A  1 30  ? -17.892 -67.031  -35.434 1.00 21.76 ? 125 VAL A CG1 1 
ATOM   196  C CG2 . VAL A  1 30  ? -16.243 -65.305  -34.726 1.00 21.28 ? 125 VAL A CG2 1 
ATOM   197  N N   . LEU A  1 31  ? -17.326 -63.174  -37.565 1.00 21.53 ? 126 LEU A N   1 
ATOM   198  C CA  . LEU A  1 31  ? -16.979 -61.743  -37.569 1.00 22.56 ? 126 LEU A CA  1 
ATOM   199  C C   . LEU A  1 31  ? -16.901 -61.285  -36.112 1.00 22.58 ? 126 LEU A C   1 
ATOM   200  O O   . LEU A  1 31  ? -17.920 -61.190  -35.444 1.00 23.95 ? 126 LEU A O   1 
ATOM   201  C CB  . LEU A  1 31  ? -18.034 -60.938  -38.322 1.00 23.56 ? 126 LEU A CB  1 
ATOM   202  C CG  . LEU A  1 31  ? -17.731 -59.465  -38.578 1.00 26.09 ? 126 LEU A CG  1 
ATOM   203  C CD1 . LEU A  1 31  ? -16.442 -59.288  -39.359 1.00 27.51 ? 126 LEU A CD1 1 
ATOM   204  C CD2 . LEU A  1 31  ? -18.881 -58.838  -39.334 1.00 28.42 ? 126 LEU A CD2 1 
ATOM   205  N N   . PHE A  1 32  ? -15.700 -61.041  -35.612 1.00 22.63 ? 127 PHE A N   1 
ATOM   206  C CA  . PHE A  1 32  ? -15.533 -60.650  -34.219 1.00 24.29 ? 127 PHE A CA  1 
ATOM   207  C C   . PHE A  1 32  ? -15.514 -59.140  -34.119 1.00 24.85 ? 127 PHE A C   1 
ATOM   208  O O   . PHE A  1 32  ? -14.635 -58.502  -34.696 1.00 25.89 ? 127 PHE A O   1 
ATOM   209  C CB  . PHE A  1 32  ? -14.264 -61.237  -33.615 1.00 24.15 ? 127 PHE A CB  1 
ATOM   210  C CG  . PHE A  1 32  ? -14.109 -60.949  -32.142 1.00 25.61 ? 127 PHE A CG  1 
ATOM   211  C CD1 . PHE A  1 32  ? -14.803 -61.683  -31.196 1.00 26.43 ? 127 PHE A CD1 1 
ATOM   212  C CD2 . PHE A  1 32  ? -13.273 -59.929  -31.707 1.00 25.75 ? 127 PHE A CD2 1 
ATOM   213  C CE1 . PHE A  1 32  ? -14.658 -61.412  -29.840 1.00 27.40 ? 127 PHE A CE1 1 
ATOM   214  C CE2 . PHE A  1 32  ? -13.131 -59.657  -30.359 1.00 26.17 ? 127 PHE A CE2 1 
ATOM   215  C CZ  . PHE A  1 32  ? -13.823 -60.387  -29.425 1.00 25.88 ? 127 PHE A CZ  1 
ATOM   216  N N   . ARG A  1 33  ? -16.484 -58.588  -33.390 1.00 26.07 ? 128 ARG A N   1 
ATOM   217  C CA  . ARG A  1 33  ? -16.612 -57.139  -33.192 1.00 27.72 ? 128 ARG A CA  1 
ATOM   218  C C   . ARG A  1 33  ? -16.243 -56.744  -31.758 1.00 27.98 ? 128 ARG A C   1 
ATOM   219  O O   . ARG A  1 33  ? -16.678 -57.385  -30.796 1.00 28.07 ? 128 ARG A O   1 
ATOM   220  C CB  . ARG A  1 33  ? -18.042 -56.673  -33.475 1.00 31.32 ? 128 ARG A CB  1 
ATOM   221  C CG  . ARG A  1 33  ? -18.457 -56.713  -34.935 1.00 35.84 ? 128 ARG A CG  1 
ATOM   222  C CD  . ARG A  1 33  ? -19.718 -55.884  -35.198 1.00 40.91 ? 128 ARG A CD  1 
ATOM   223  N NE  . ARG A  1 33  ? -19.935 -55.661  -36.636 1.00 45.09 ? 128 ARG A NE  1 
ATOM   224  C CZ  . ARG A  1 33  ? -20.909 -56.204  -37.381 1.00 52.64 ? 128 ARG A CZ  1 
ATOM   225  N NH1 . ARG A  1 33  ? -21.825 -57.017  -36.853 1.00 53.58 ? 128 ARG A NH1 1 
ATOM   226  N NH2 . ARG A  1 33  ? -20.983 -55.918  -38.683 1.00 54.67 ? 128 ARG A NH2 1 
ATOM   227  N N   . TYR A  1 34  ? -15.464 -55.675  -31.612 1.00 26.54 ? 129 TYR A N   1 
ATOM   228  C CA  . TYR A  1 34  ? -15.040 -55.233  -30.292 1.00 26.46 ? 129 TYR A CA  1 
ATOM   229  C C   . TYR A  1 34  ? -14.926 -53.721  -30.192 1.00 27.59 ? 129 TYR A C   1 
ATOM   230  O O   . TYR A  1 34  ? -15.036 -53.013  -31.200 1.00 24.90 ? 129 TYR A O   1 
ATOM   231  C CB  . TYR A  1 34  ? -13.709 -55.867  -29.950 1.00 27.37 ? 129 TYR A CB  1 
ATOM   232  C CG  . TYR A  1 34  ? -12.572 -55.473  -30.848 1.00 27.16 ? 129 TYR A CG  1 
ATOM   233  C CD1 . TYR A  1 34  ? -12.382 -56.095  -32.076 1.00 28.67 ? 129 TYR A CD1 1 
ATOM   234  C CD2 . TYR A  1 34  ? -11.651 -54.507  -30.447 1.00 27.75 ? 129 TYR A CD2 1 
ATOM   235  C CE1 . TYR A  1 34  ? -11.304 -55.761  -32.886 1.00 28.99 ? 129 TYR A CE1 1 
ATOM   236  C CE2 . TYR A  1 34  ? -10.580 -54.155  -31.250 1.00 27.10 ? 129 TYR A CE2 1 
ATOM   237  C CZ  . TYR A  1 34  ? -10.419 -54.779  -32.476 1.00 29.30 ? 129 TYR A CZ  1 
ATOM   238  O OH  . TYR A  1 34  ? -9.344  -54.455  -33.266 1.00 30.54 ? 129 TYR A OH  1 
ATOM   239  N N   . CYS A  1 35  ? -14.687 -53.239  -28.971 1.00 27.32 ? 130 CYS A N   1 
ATOM   240  C CA  . CYS A  1 35  ? -14.645 -51.790  -28.698 1.00 26.62 ? 130 CYS A CA  1 
ATOM   241  C C   . CYS A  1 35  ? -13.236 -51.330  -28.434 1.00 26.75 ? 130 CYS A C   1 
ATOM   242  O O   . CYS A  1 35  ? -12.547 -51.871  -27.564 1.00 26.36 ? 130 CYS A O   1 
ATOM   243  C CB  . CYS A  1 35  ? -15.523 -51.444  -27.503 1.00 25.78 ? 130 CYS A CB  1 
ATOM   244  S SG  . CYS A  1 35  ? -17.256 -51.827  -27.793 1.00 26.30 ? 130 CYS A SG  1 
ATOM   245  N N   . ALA A  1 36  ? -12.812 -50.320  -29.184 1.00 26.46 ? 131 ALA A N   1 
ATOM   246  C CA  . ALA A  1 36  ? -11.462 -49.781  -29.054 1.00 27.97 ? 131 ALA A CA  1 
ATOM   247  C C   . ALA A  1 36  ? -11.417 -48.297  -29.393 1.00 27.52 ? 131 ALA A C   1 
ATOM   248  O O   . ALA A  1 36  ? -12.299 -47.767  -30.067 1.00 26.95 ? 131 ALA A O   1 
ATOM   249  C CB  . ALA A  1 36  ? -10.493 -50.540  -29.951 1.00 27.63 ? 131 ALA A CB  1 
ATOM   250  N N   . GLY A  1 37  ? -10.351 -47.643  -28.950 1.00 30.33 ? 132 GLY A N   1 
ATOM   251  C CA  . GLY A  1 37  ? -10.131 -46.229  -29.257 1.00 31.97 ? 132 GLY A CA  1 
ATOM   252  C C   . GLY A  1 37  ? -10.038 -45.330  -28.038 1.00 32.63 ? 132 GLY A C   1 
ATOM   253  O O   . GLY A  1 37  ? -10.127 -45.793  -26.906 1.00 32.52 ? 132 GLY A O   1 
ATOM   254  N N   . ALA A  1 38  ? -9.876  -44.032  -28.294 1.00 34.00 ? 133 ALA A N   1 
ATOM   255  C CA  . ALA A  1 38  ? -9.712  -43.020  -27.245 1.00 32.95 ? 133 ALA A CA  1 
ATOM   256  C C   . ALA A  1 38  ? -11.023 -42.410  -26.808 1.00 31.05 ? 133 ALA A C   1 
ATOM   257  O O   . ALA A  1 38  ? -11.967 -42.300  -27.580 1.00 29.39 ? 133 ALA A O   1 
ATOM   258  C CB  . ALA A  1 38  ? -8.807  -41.913  -27.735 1.00 35.08 ? 133 ALA A CB  1 
ATOM   259  N N   . CYS A  1 39  ? -11.059 -42.005  -25.548 1.00 31.70 ? 134 CYS A N   1 
ATOM   260  C CA  . CYS A  1 39  ? -12.178 -41.276  -24.994 1.00 34.16 ? 134 CYS A CA  1 
ATOM   261  C C   . CYS A  1 39  ? -11.709 -39.829  -24.832 1.00 33.71 ? 134 CYS A C   1 
ATOM   262  O O   . CYS A  1 39  ? -11.003 -39.514  -23.892 1.00 34.09 ? 134 CYS A O   1 
ATOM   263  C CB  . CYS A  1 39  ? -12.602 -41.901  -23.665 1.00 34.01 ? 134 CYS A CB  1 
ATOM   264  S SG  . CYS A  1 39  ? -13.353 -43.542  -23.908 1.00 37.02 ? 134 CYS A SG  1 
ATOM   265  N N   . GLU A  1 40  ? -12.075 -38.983  -25.788 1.00 34.72 ? 135 GLU A N   1 
ATOM   266  C CA  . GLU A  1 40  ? -11.549 -37.610  -25.885 1.00 35.93 ? 135 GLU A CA  1 
ATOM   267  C C   . GLU A  1 40  ? -12.616 -36.551  -25.627 1.00 33.57 ? 135 GLU A C   1 
ATOM   268  O O   . GLU A  1 40  ? -12.313 -35.362  -25.668 1.00 37.17 ? 135 GLU A O   1 
ATOM   269  C CB  . GLU A  1 40  ? -10.920 -37.381  -27.276 1.00 40.37 ? 135 GLU A CB  1 
ATOM   270  C CG  . GLU A  1 40  ? -9.825  -38.387  -27.636 1.00 45.11 ? 135 GLU A CG  1 
ATOM   271  C CD  . GLU A  1 40  ? -9.397  -38.355  -29.099 1.00 50.76 ? 135 GLU A CD  1 
ATOM   272  O OE1 . GLU A  1 40  ? -8.189  -38.579  -29.340 1.00 56.47 ? 135 GLU A OE1 1 
ATOM   273  O OE2 . GLU A  1 40  ? -10.247 -38.137  -30.009 1.00 52.52 ? 135 GLU A OE2 1 
ATOM   274  N N   . ALA A  1 41  ? -13.852 -36.967  -25.361 1.00 29.53 ? 136 ALA A N   1 
ATOM   275  C CA  . ALA A  1 41  ? -14.907 -36.041  -24.977 1.00 28.89 ? 136 ALA A CA  1 
ATOM   276  C C   . ALA A  1 41  ? -14.512 -35.335  -23.682 1.00 27.82 ? 136 ALA A C   1 
ATOM   277  O O   . ALA A  1 41  ? -13.769 -35.891  -22.868 1.00 26.03 ? 136 ALA A O   1 
ATOM   278  C CB  . ALA A  1 41  ? -16.239 -36.763  -24.796 1.00 27.84 ? 136 ALA A CB  1 
ATOM   279  N N   . ALA A  1 42  ? -15.000 -34.102  -23.520 1.00 25.44 ? 137 ALA A N   1 
ATOM   280  C CA  . ALA A  1 42  ? -14.737 -33.301  -22.323 1.00 25.03 ? 137 ALA A CA  1 
ATOM   281  C C   . ALA A  1 42  ? -15.134 -34.072  -21.078 1.00 22.69 ? 137 ALA A C   1 
ATOM   282  O O   . ALA A  1 42  ? -16.146 -34.735  -21.077 1.00 22.92 ? 137 ALA A O   1 
ATOM   283  C CB  . ALA A  1 42  ? -15.532 -32.001  -22.375 1.00 25.56 ? 137 ALA A CB  1 
ATOM   284  N N   . ALA A  1 43  ? -14.342 -33.943  -20.027 1.00 22.27 ? 138 ALA A N   1 
ATOM   285  C CA  . ALA A  1 43  ? -14.556 -34.670  -18.797 1.00 23.26 ? 138 ALA A CA  1 
ATOM   286  C C   . ALA A  1 43  ? -15.913 -34.368  -18.174 1.00 22.88 ? 138 ALA A C   1 
ATOM   287  O O   . ALA A  1 43  ? -16.337 -33.253  -18.194 1.00 25.53 ? 138 ALA A O   1 
ATOM   288  C CB  . ALA A  1 43  ? -13.458 -34.339  -17.817 1.00 23.03 ? 138 ALA A CB  1 
ATOM   289  N N   . ARG A  1 44  ? -16.572 -35.370  -17.620 1.00 22.96 ? 139 ARG A N   1 
ATOM   290  C CA  . ARG A  1 44  ? -17.772 -35.164  -16.796 1.00 23.51 ? 139 ARG A CA  1 
ATOM   291  C C   . ARG A  1 44  ? -17.427 -34.375  -15.543 1.00 22.87 ? 139 ARG A C   1 
ATOM   292  O O   . ARG A  1 44  ? -16.304 -34.449  -15.071 1.00 21.62 ? 139 ARG A O   1 
ATOM   293  C CB  . ARG A  1 44  ? -18.277 -36.499  -16.281 1.00 25.21 ? 139 ARG A CB  1 
ATOM   294  C CG  . ARG A  1 44  ? -18.944 -37.386  -17.282 1.00 26.17 ? 139 ARG A CG  1 
ATOM   295  C CD  . ARG A  1 44  ? -19.351 -38.673  -16.610 1.00 26.01 ? 139 ARG A CD  1 
ATOM   296  N NE  . ARG A  1 44  ? -20.415 -39.321  -17.363 1.00 28.30 ? 139 ARG A NE  1 
ATOM   297  C CZ  . ARG A  1 44  ? -21.707 -39.013  -17.283 1.00 29.58 ? 139 ARG A CZ  1 
ATOM   298  N NH1 . ARG A  1 44  ? -22.137 -38.042  -16.489 1.00 28.14 ? 139 ARG A NH1 1 
ATOM   299  N NH2 . ARG A  1 44  ? -22.587 -39.694  -18.008 1.00 31.37 ? 139 ARG A NH2 1 
ATOM   300  N N   . VAL A  1 45  ? -18.405 -33.685  -14.960 1.00 21.48 ? 140 VAL A N   1 
ATOM   301  C CA  . VAL A  1 45  ? -18.160 -33.021  -13.675 1.00 22.22 ? 140 VAL A CA  1 
ATOM   302  C C   . VAL A  1 45  ? -17.811 -34.024  -12.568 1.00 20.61 ? 140 VAL A C   1 
ATOM   303  O O   . VAL A  1 45  ? -16.966 -33.755  -11.730 1.00 19.66 ? 140 VAL A O   1 
ATOM   304  C CB  . VAL A  1 45  ? -19.310 -32.073  -13.236 1.00 22.40 ? 140 VAL A CB  1 
ATOM   305  C CG1 . VAL A  1 45  ? -19.427 -30.939  -14.228 1.00 24.64 ? 140 VAL A CG1 1 
ATOM   306  C CG2 . VAL A  1 45  ? -20.640 -32.797  -13.099 1.00 22.81 ? 140 VAL A CG2 1 
ATOM   307  N N   . TYR A  1 46  ? -18.460 -35.184  -12.583 1.00 20.05 ? 141 TYR A N   1 
ATOM   308  C CA  . TYR A  1 46  ? -18.100 -36.289  -11.697 1.00 19.74 ? 141 TYR A CA  1 
ATOM   309  C C   . TYR A  1 46  ? -16.600 -36.585  -11.704 1.00 19.79 ? 141 TYR A C   1 
ATOM   310  O O   . TYR A  1 46  ? -15.943 -36.637  -10.655 1.00 19.02 ? 141 TYR A O   1 
ATOM   311  C CB  . TYR A  1 46  ? -18.871 -37.526  -12.118 1.00 20.31 ? 141 TYR A CB  1 
ATOM   312  C CG  . TYR A  1 46  ? -18.436 -38.797  -11.439 1.00 20.32 ? 141 TYR A CG  1 
ATOM   313  C CD1 . TYR A  1 46  ? -18.816 -39.089  -10.116 1.00 19.95 ? 141 TYR A CD1 1 
ATOM   314  C CD2 . TYR A  1 46  ? -17.665 -39.729  -12.127 1.00 19.66 ? 141 TYR A CD2 1 
ATOM   315  C CE1 . TYR A  1 46  ? -18.412 -40.280  -9.507  1.00 19.98 ? 141 TYR A CE1 1 
ATOM   316  C CE2 . TYR A  1 46  ? -17.259 -40.897  -11.530 1.00 20.36 ? 141 TYR A CE2 1 
ATOM   317  C CZ  . TYR A  1 46  ? -17.637 -41.181  -10.225 1.00 19.80 ? 141 TYR A CZ  1 
ATOM   318  O OH  . TYR A  1 46  ? -17.235 -42.372  -9.678  1.00 19.28 ? 141 TYR A OH  1 
ATOM   319  N N   . ASP A  1 47  ? -16.065 -36.767  -12.898 1.00 20.74 ? 142 ASP A N   1 
ATOM   320  C CA  . ASP A  1 47  ? -14.669 -37.125  -13.048 1.00 20.97 ? 142 ASP A CA  1 
ATOM   321  C C   . ASP A  1 47  ? -13.737 -35.991  -12.622 1.00 21.40 ? 142 ASP A C   1 
ATOM   322  O O   . ASP A  1 47  ? -12.696 -36.224  -12.009 1.00 20.05 ? 142 ASP A O   1 
ATOM   323  C CB  . ASP A  1 47  ? -14.402 -37.593  -14.469 1.00 20.88 ? 142 ASP A CB  1 
ATOM   324  C CG  . ASP A  1 47  ? -14.849 -39.037  -14.688 1.00 21.60 ? 142 ASP A CG  1 
ATOM   325  O OD1 . ASP A  1 47  ? -14.626 -39.865  -13.781 1.00 20.02 ? 142 ASP A OD1 1 
ATOM   326  O OD2 . ASP A  1 47  ? -15.408 -39.344  -15.768 1.00 21.43 ? 142 ASP A OD2 1 
ATOM   327  N N   . LEU A  1 48  ? -14.134 -34.765  -12.921 1.00 21.75 ? 143 LEU A N   1 
ATOM   328  C CA  . LEU A  1 48  ? -13.352 -33.611  -12.519 1.00 22.30 ? 143 LEU A CA  1 
ATOM   329  C C   . LEU A  1 48  ? -13.307 -33.525  -11.000 1.00 21.35 ? 143 LEU A C   1 
ATOM   330  O O   . LEU A  1 48  ? -12.253 -33.306  -10.420 1.00 20.98 ? 143 LEU A O   1 
ATOM   331  C CB  . LEU A  1 48  ? -13.943 -32.335  -13.123 1.00 24.19 ? 143 LEU A CB  1 
ATOM   332  C CG  . LEU A  1 48  ? -13.375 -31.740  -14.427 1.00 26.51 ? 143 LEU A CG  1 
ATOM   333  C CD1 . LEU A  1 48  ? -12.321 -32.569  -15.121 1.00 27.21 ? 143 LEU A CD1 1 
ATOM   334  C CD2 . LEU A  1 48  ? -14.496 -31.360  -15.381 1.00 27.14 ? 143 LEU A CD2 1 
ATOM   335  N N   . GLY A  1 49  ? -14.449 -33.724  -10.361 1.00 20.48 ? 144 GLY A N   1 
ATOM   336  C CA  . GLY A  1 49  ? -14.520 -33.708  -8.908  1.00 21.56 ? 144 GLY A CA  1 
ATOM   337  C C   . GLY A  1 49  ? -13.722 -34.820  -8.270  1.00 21.23 ? 144 GLY A C   1 
ATOM   338  O O   . GLY A  1 49  ? -13.060 -34.621  -7.252  1.00 23.10 ? 144 GLY A O   1 
ATOM   339  N N   . LEU A  1 50  ? -13.785 -35.998  -8.865  1.00 21.84 ? 145 LEU A N   1 
ATOM   340  C CA  . LEU A  1 50  ? -13.063 -37.146  -8.366  1.00 22.00 ? 145 LEU A CA  1 
ATOM   341  C C   . LEU A  1 50  ? -11.551 -36.940  -8.506  1.00 22.16 ? 145 LEU A C   1 
ATOM   342  O O   . LEU A  1 50  ? -10.808 -37.216  -7.575  1.00 21.85 ? 145 LEU A O   1 
ATOM   343  C CB  . LEU A  1 50  ? -13.521 -38.402  -9.125  1.00 23.55 ? 145 LEU A CB  1 
ATOM   344  C CG  . LEU A  1 50  ? -13.273 -39.794  -8.600  1.00 25.07 ? 145 LEU A CG  1 
ATOM   345  C CD1 . LEU A  1 50  ? -13.733 -39.959  -7.152  1.00 25.20 ? 145 LEU A CD1 1 
ATOM   346  C CD2 . LEU A  1 50  ? -13.979 -40.792  -9.522  1.00 26.09 ? 145 LEU A CD2 1 
ATOM   347  N N   . ARG A  1 51  ? -11.087 -36.446  -9.648  1.00 22.73 ? 146 ARG A N   1 
ATOM   348  C CA  . ARG A  1 51  ? -9.652  -36.147  -9.808  1.00 24.21 ? 146 ARG A CA  1 
ATOM   349  C C   . ARG A  1 51  ? -9.160  -35.178  -8.753  1.00 24.30 ? 146 ARG A C   1 
ATOM   350  O O   . ARG A  1 51  ? -8.102  -35.391  -8.150  1.00 23.62 ? 146 ARG A O   1 
ATOM   351  C CB  . ARG A  1 51  ? -9.351  -35.540  -11.171 1.00 26.97 ? 146 ARG A CB  1 
ATOM   352  C CG  . ARG A  1 51  ? -9.198  -36.571  -12.264 1.00 30.29 ? 146 ARG A CG  1 
ATOM   353  C CD  . ARG A  1 51  ? -9.248  -35.961  -13.660 1.00 32.45 ? 146 ARG A CD  1 
ATOM   354  N NE  . ARG A  1 51  ? -9.980  -36.824  -14.580 1.00 33.87 ? 146 ARG A NE  1 
ATOM   355  C CZ  . ARG A  1 51  ? -10.274 -36.524  -15.843 1.00 34.89 ? 146 ARG A CZ  1 
ATOM   356  N NH1 . ARG A  1 51  ? -9.896  -35.369  -16.376 1.00 35.25 ? 146 ARG A NH1 1 
ATOM   357  N NH2 . ARG A  1 51  ? -10.940 -37.401  -16.579 1.00 32.93 ? 146 ARG A NH2 1 
ATOM   358  N N   . ARG A  1 52  ? -9.926  -34.111  -8.530  1.00 21.63 ? 147 ARG A N   1 
ATOM   359  C CA  . ARG A  1 52  ? -9.546  -33.113  -7.552  1.00 21.40 ? 147 ARG A CA  1 
ATOM   360  C C   . ARG A  1 52  ? -9.459  -33.734  -6.155  1.00 22.00 ? 147 ARG A C   1 
ATOM   361  O O   . ARG A  1 52  ? -8.521  -33.461  -5.400  1.00 23.39 ? 147 ARG A O   1 
ATOM   362  C CB  . ARG A  1 52  ? -10.544 -31.939  -7.574  1.00 20.44 ? 147 ARG A CB  1 
ATOM   363  C CG  . ARG A  1 52  ? -10.412 -30.980  -6.402  1.00 20.67 ? 147 ARG A CG  1 
ATOM   364  C CD  . ARG A  1 52  ? -9.047  -30.302  -6.320  1.00 20.10 ? 147 ARG A CD  1 
ATOM   365  N NE  . ARG A  1 52  ? -8.880  -29.079  -7.123  1.00 20.02 ? 147 ARG A NE  1 
ATOM   366  C CZ  . ARG A  1 52  ? -9.280  -27.846  -6.764  1.00 20.46 ? 147 ARG A CZ  1 
ATOM   367  N NH1 . ARG A  1 52  ? -9.969  -27.619  -5.642  1.00 20.91 ? 147 ARG A NH1 1 
ATOM   368  N NH2 . ARG A  1 52  ? -8.982  -26.811  -7.533  1.00 20.70 ? 147 ARG A NH2 1 
ATOM   369  N N   . LEU A  1 53  ? -10.435 -34.561  -5.810  1.00 22.50 ? 148 LEU A N   1 
ATOM   370  C CA  . LEU A  1 53  ? -10.491 -35.143  -4.463  1.00 23.68 ? 148 LEU A CA  1 
ATOM   371  C C   . LEU A  1 53  ? -9.356  -36.143  -4.258  1.00 26.35 ? 148 LEU A C   1 
ATOM   372  O O   . LEU A  1 53  ? -8.770  -36.216  -3.183  1.00 25.53 ? 148 LEU A O   1 
ATOM   373  C CB  . LEU A  1 53  ? -11.822 -35.824  -4.223  1.00 23.10 ? 148 LEU A CB  1 
ATOM   374  C CG  . LEU A  1 53  ? -13.006 -34.898  -4.044  1.00 22.73 ? 148 LEU A CG  1 
ATOM   375  C CD1 . LEU A  1 53  ? -14.279 -35.698  -4.160  1.00 23.65 ? 148 LEU A CD1 1 
ATOM   376  C CD2 . LEU A  1 53  ? -12.922 -34.204  -2.685  1.00 24.31 ? 148 LEU A CD2 1 
ATOM   377  N N   . ARG A  1 54  ? -9.038  -36.899  -5.301  1.00 28.13 ? 149 ARG A N   1 
ATOM   378  C CA  . ARG A  1 54  ? -7.867  -37.772  -5.279  1.00 29.81 ? 149 ARG A CA  1 
ATOM   379  C C   . ARG A  1 54  ? -6.597  -36.958  -5.015  1.00 30.50 ? 149 ARG A C   1 
ATOM   380  O O   . ARG A  1 54  ? -5.844  -37.281  -4.111  1.00 28.41 ? 149 ARG A O   1 
ATOM   381  C CB  . ARG A  1 54  ? -7.750  -38.548  -6.588  1.00 31.68 ? 149 ARG A CB  1 
ATOM   382  C CG  . ARG A  1 54  ? -6.623  -39.579  -6.607  1.00 34.48 ? 149 ARG A CG  1 
ATOM   383  C CD  . ARG A  1 54  ? -6.155  -39.867  -8.023  1.00 35.35 ? 149 ARG A CD  1 
ATOM   384  N NE  . ARG A  1 54  ? -7.022  -40.801  -8.726  1.00 37.94 ? 149 ARG A NE  1 
ATOM   385  C CZ  . ARG A  1 54  ? -7.302  -40.777  -10.030 1.00 35.69 ? 149 ARG A CZ  1 
ATOM   386  N NH1 . ARG A  1 54  ? -6.848  -39.821  -10.830 1.00 34.32 ? 149 ARG A NH1 1 
ATOM   387  N NH2 . ARG A  1 54  ? -8.089  -41.715  -10.527 1.00 36.19 ? 149 ARG A NH2 1 
ATOM   388  N N   . GLN A  1 55  ? -6.390  -35.891  -5.783  1.00 34.29 ? 150 GLN A N   1 
ATOM   389  C CA  . GLN A  1 55  ? -5.203  -35.025  -5.665  1.00 35.38 ? 150 GLN A CA  1 
ATOM   390  C C   . GLN A  1 55  ? -5.095  -34.332  -4.318  1.00 36.57 ? 150 GLN A C   1 
ATOM   391  O O   . GLN A  1 55  ? -3.989  -34.027  -3.872  1.00 38.36 ? 150 GLN A O   1 
ATOM   392  C CB  . GLN A  1 55  ? -5.195  -33.948  -6.750  1.00 39.40 ? 150 GLN A CB  1 
ATOM   393  C CG  . GLN A  1 55  ? -5.049  -34.480  -8.174  1.00 45.46 ? 150 GLN A CG  1 
ATOM   394  C CD  . GLN A  1 55  ? -5.456  -33.477  -9.262  1.00 53.40 ? 150 GLN A CD  1 
ATOM   395  O OE1 . GLN A  1 55  ? -6.221  -32.535  -9.016  1.00 55.38 ? 150 GLN A OE1 1 
ATOM   396  N NE2 . GLN A  1 55  ? -4.945  -33.683  -10.479 1.00 55.88 ? 150 GLN A NE2 1 
ATOM   397  N N   . ARG A  1 56  ? -6.232  -34.068  -3.671  1.00 34.52 ? 151 ARG A N   1 
ATOM   398  C CA  . ARG A  1 56  ? -6.240  -33.428  -2.356  1.00 33.56 ? 151 ARG A CA  1 
ATOM   399  C C   . ARG A  1 56  ? -6.121  -34.474  -1.251  1.00 37.95 ? 151 ARG A C   1 
ATOM   400  O O   . ARG A  1 56  ? -6.362  -34.162  -0.076  1.00 35.80 ? 151 ARG A O   1 
ATOM   401  C CB  . ARG A  1 56  ? -7.511  -32.574  -2.175  1.00 31.17 ? 151 ARG A CB  1 
ATOM   402  C CG  . ARG A  1 56  ? -7.538  -31.313  -3.045  1.00 29.42 ? 151 ARG A CG  1 
ATOM   403  C CD  . ARG A  1 56  ? -6.800  -30.159  -2.400  1.00 26.71 ? 151 ARG A CD  1 
ATOM   404  N NE  . ARG A  1 56  ? -7.623  -29.627  -1.337  1.00 25.84 ? 151 ARG A NE  1 
ATOM   405  C CZ  . ARG A  1 56  ? -8.489  -28.630  -1.459  1.00 24.70 ? 151 ARG A CZ  1 
ATOM   406  N NH1 . ARG A  1 56  ? -9.204  -28.276  -0.403  1.00 24.70 ? 151 ARG A NH1 1 
ATOM   407  N NH2 . ARG A  1 56  ? -8.639  -27.978  -2.612  1.00 23.02 ? 151 ARG A NH2 1 
ATOM   408  N N   . ARG A  1 57  ? -5.758  -35.709  -1.638  1.00 40.98 ? 152 ARG A N   1 
ATOM   409  C CA  . ARG A  1 57  ? -5.603  -36.840  -0.717  1.00 44.44 ? 152 ARG A CA  1 
ATOM   410  C C   . ARG A  1 57  ? -6.837  -37.066  0.197   1.00 42.58 ? 152 ARG A C   1 
ATOM   411  O O   . ARG A  1 57  ? -6.715  -37.465  1.366   1.00 41.54 ? 152 ARG A O   1 
ATOM   412  C CB  . ARG A  1 57  ? -4.300  -36.659  0.088   1.00 48.81 ? 152 ARG A CB  1 
ATOM   413  C CG  . ARG A  1 57  ? -3.049  -37.171  -0.628  1.00 54.94 ? 152 ARG A CG  1 
ATOM   414  C CD  . ARG A  1 57  ? -2.777  -38.630  -0.245  1.00 62.49 ? 152 ARG A CD  1 
ATOM   415  N NE  . ARG A  1 57  ? -1.944  -39.364  -1.211  1.00 70.14 ? 152 ARG A NE  1 
ATOM   416  C CZ  . ARG A  1 57  ? -0.663  -39.720  -1.037  1.00 76.45 ? 152 ARG A CZ  1 
ATOM   417  N NH1 . ARG A  1 57  ? 0.002   -39.408  0.077   1.00 78.17 ? 152 ARG A NH1 1 
ATOM   418  N NH2 . ARG A  1 57  ? -0.031  -40.400  -1.997  1.00 76.18 ? 152 ARG A NH2 1 
ATOM   419  N N   . ARG A  1 58  ? -8.023  -36.816  -0.354  1.00 39.03 ? 153 ARG A N   1 
ATOM   420  C CA  . ARG A  1 58  ? -9.274  -36.972  0.373   1.00 38.45 ? 153 ARG A CA  1 
ATOM   421  C C   . ARG A  1 58  ? -9.889  -38.368  0.254   1.00 40.42 ? 153 ARG A C   1 
ATOM   422  O O   . ARG A  1 58  ? -10.835 -38.670  0.985   1.00 44.40 ? 153 ARG A O   1 
ATOM   423  C CB  . ARG A  1 58  ? -10.296 -35.941  -0.108  1.00 36.68 ? 153 ARG A CB  1 
ATOM   424  C CG  . ARG A  1 58  ? -9.945  -34.511  0.261   1.00 36.67 ? 153 ARG A CG  1 
ATOM   425  C CD  . ARG A  1 58  ? -10.352 -34.179  1.686   1.00 34.32 ? 153 ARG A CD  1 
ATOM   426  N NE  . ARG A  1 58  ? -11.722 -33.674  1.735   1.00 33.85 ? 153 ARG A NE  1 
ATOM   427  C CZ  . ARG A  1 58  ? -12.780 -34.301  2.238   1.00 30.83 ? 153 ARG A CZ  1 
ATOM   428  N NH1 . ARG A  1 58  ? -13.958 -33.693  2.194   1.00 27.81 ? 153 ARG A NH1 1 
ATOM   429  N NH2 . ARG A  1 58  ? -12.685 -35.510  2.777   1.00 30.05 ? 153 ARG A NH2 1 
ATOM   430  N N   . LEU A  1 59  ? -9.371  -39.209  -0.644  1.00 41.98 ? 154 LEU A N   1 
ATOM   431  C CA  . LEU A  1 59  ? -9.910  -40.572  -0.867  1.00 45.14 ? 154 LEU A CA  1 
ATOM   432  C C   . LEU A  1 59  ? -9.179  -41.652  -0.049  1.00 45.35 ? 154 LEU A C   1 
ATOM   433  O O   . LEU A  1 59  ? -8.196  -41.355  0.610   1.00 43.98 ? 154 LEU A O   1 
ATOM   434  C CB  . LEU A  1 59  ? -9.886  -40.903  -2.368  1.00 44.06 ? 154 LEU A CB  1 
ATOM   435  C CG  . LEU A  1 59  ? -11.062 -40.401  -3.223  1.00 44.16 ? 154 LEU A CG  1 
ATOM   436  C CD1 . LEU A  1 59  ? -11.940 -39.375  -2.529  1.00 45.21 ? 154 LEU A CD1 1 
ATOM   437  C CD2 . LEU A  1 59  ? -10.572 -39.861  -4.554  1.00 44.46 ? 154 LEU A CD2 1 
ATOM   438  N N   . ARG A  1 60  ? -9.671  -42.893  -0.116  1.00 53.29 ? 155 ARG A N   1 
ATOM   439  C CA  . ARG A  1 60  ? -9.325  -43.959  0.833   1.00 59.69 ? 155 ARG A CA  1 
ATOM   440  C C   . ARG A  1 60  ? -8.457  -45.117  0.297   1.00 63.68 ? 155 ARG A C   1 
ATOM   441  O O   . ARG A  1 60  ? -8.863  -46.281  0.381   1.00 71.94 ? 155 ARG A O   1 
ATOM   442  C CB  . ARG A  1 60  ? -10.647 -44.527  1.410   1.00 63.41 ? 155 ARG A CB  1 
ATOM   443  C CG  . ARG A  1 60  ? -10.564 -45.222  2.776   1.00 70.57 ? 155 ARG A CG  1 
ATOM   444  C CD  . ARG A  1 60  ? -9.778  -44.432  3.832   1.00 73.17 ? 155 ARG A CD  1 
ATOM   445  N NE  . ARG A  1 60  ? -9.236  -45.271  4.908   1.00 73.84 ? 155 ARG A NE  1 
ATOM   446  C CZ  . ARG A  1 60  ? -8.241  -46.157  4.770   1.00 73.57 ? 155 ARG A CZ  1 
ATOM   447  N NH1 . ARG A  1 60  ? -7.662  -46.377  3.593   1.00 68.33 ? 155 ARG A NH1 1 
ATOM   448  N NH2 . ARG A  1 60  ? -7.827  -46.852  5.823   1.00 74.91 ? 155 ARG A NH2 1 
ATOM   449  N N   . ARG A  1 61  ? -7.264  -44.824  -0.228  1.00 65.06 ? 156 ARG A N   1 
ATOM   450  C CA  . ARG A  1 61  ? -6.284  -45.882  -0.615  1.00 66.19 ? 156 ARG A CA  1 
ATOM   451  C C   . ARG A  1 61  ? -6.849  -47.041  -1.475  1.00 62.30 ? 156 ARG A C   1 
ATOM   452  O O   . ARG A  1 61  ? -6.339  -48.156  -1.436  1.00 69.09 ? 156 ARG A O   1 
ATOM   453  C CB  . ARG A  1 61  ? -5.614  -46.476  0.647   1.00 71.08 ? 156 ARG A CB  1 
ATOM   454  C CG  . ARG A  1 61  ? -4.365  -45.750  1.150   1.00 73.64 ? 156 ARG A CG  1 
ATOM   455  C CD  . ARG A  1 61  ? -4.399  -45.552  2.663   1.00 77.45 ? 156 ARG A CD  1 
ATOM   456  N NE  . ARG A  1 61  ? -5.405  -44.550  3.026   1.00 84.17 ? 156 ARG A NE  1 
ATOM   457  C CZ  . ARG A  1 61  ? -5.647  -44.104  4.257   1.00 86.89 ? 156 ARG A CZ  1 
ATOM   458  N NH1 . ARG A  1 61  ? -4.959  -44.568  5.295   1.00 89.20 ? 156 ARG A NH1 1 
ATOM   459  N NH2 . ARG A  1 61  ? -6.596  -43.189  4.450   1.00 87.11 ? 156 ARG A NH2 1 
ATOM   460  N N   . GLU A  1 62  ? -7.883  -46.770  -2.259  1.00 56.34 ? 157 GLU A N   1 
ATOM   461  C CA  . GLU A  1 62  ? -8.533  -47.781  -3.092  1.00 50.63 ? 157 GLU A CA  1 
ATOM   462  C C   . GLU A  1 62  ? -8.380  -47.356  -4.554  1.00 48.33 ? 157 GLU A C   1 
ATOM   463  O O   . GLU A  1 62  ? -8.182  -46.186  -4.846  1.00 47.30 ? 157 GLU A O   1 
ATOM   464  C CB  . GLU A  1 62  ? -10.013 -47.862  -2.709  1.00 46.82 ? 157 GLU A CB  1 
ATOM   465  C CG  . GLU A  1 62  ? -10.804 -48.987  -3.346  1.00 43.19 ? 157 GLU A CG  1 
ATOM   466  C CD  . GLU A  1 62  ? -12.233 -49.026  -2.846  1.00 38.95 ? 157 GLU A CD  1 
ATOM   467  O OE1 . GLU A  1 62  ? -12.740 -47.987  -2.374  1.00 36.27 ? 157 GLU A OE1 1 
ATOM   468  O OE2 . GLU A  1 62  ? -12.862 -50.095  -2.922  1.00 36.22 ? 157 GLU A OE2 1 
ATOM   469  N N   . ARG A  1 63  ? -8.463  -48.306  -5.473  1.00 46.27 ? 158 ARG A N   1 
ATOM   470  C CA  . ARG A  1 63  ? -8.389  -47.978  -6.897  1.00 44.42 ? 158 ARG A CA  1 
ATOM   471  C C   . ARG A  1 63  ? -9.689  -47.274  -7.329  1.00 38.69 ? 158 ARG A C   1 
ATOM   472  O O   . ARG A  1 63  ? -10.779 -47.844  -7.214  1.00 33.94 ? 158 ARG A O   1 
ATOM   473  C CB  . ARG A  1 63  ? -8.152  -49.245  -7.728  1.00 45.83 ? 158 ARG A CB  1 
ATOM   474  C CG  . ARG A  1 63  ? -7.252  -49.049  -8.941  1.00 47.76 ? 158 ARG A CG  1 
ATOM   475  C CD  . ARG A  1 63  ? -7.920  -48.144  -9.952  1.00 47.09 ? 158 ARG A CD  1 
ATOM   476  N NE  . ARG A  1 63  ? -7.349  -48.191  -11.302 1.00 45.28 ? 158 ARG A NE  1 
ATOM   477  C CZ  . ARG A  1 63  ? -7.178  -47.120  -12.077 1.00 44.65 ? 158 ARG A CZ  1 
ATOM   478  N NH1 . ARG A  1 63  ? -6.694  -47.259  -13.300 1.00 43.38 ? 158 ARG A NH1 1 
ATOM   479  N NH2 . ARG A  1 63  ? -7.481  -45.898  -11.629 1.00 43.27 ? 158 ARG A NH2 1 
ATOM   480  N N   . VAL A  1 64  ? -9.547  -46.031  -7.796  1.00 35.80 ? 159 VAL A N   1 
ATOM   481  C CA  . VAL A  1 64  ? -10.668 -45.198  -8.249  1.00 34.44 ? 159 VAL A CA  1 
ATOM   482  C C   . VAL A  1 64  ? -10.399 -44.744  -9.682  1.00 30.00 ? 159 VAL A C   1 
ATOM   483  O O   . VAL A  1 64  ? -9.348  -44.191  -9.970  1.00 27.72 ? 159 VAL A O   1 
ATOM   484  C CB  . VAL A  1 64  ? -10.914 -43.967  -7.327  1.00 37.06 ? 159 VAL A CB  1 
ATOM   485  C CG1 . VAL A  1 64  ? -11.084 -44.411  -5.881  1.00 38.56 ? 159 VAL A CG1 1 
ATOM   486  C CG2 . VAL A  1 64  ? -9.784  -42.949  -7.406  1.00 39.92 ? 159 VAL A CG2 1 
ATOM   487  N N   . ARG A  1 65  ? -11.347 -44.985  -10.575 1.00 27.55 ? 160 ARG A N   1 
ATOM   488  C CA  . ARG A  1 65  ? -11.227 -44.533  -11.967 1.00 27.67 ? 160 ARG A CA  1 
ATOM   489  C C   . ARG A  1 65  ? -11.914 -43.194  -12.154 1.00 26.54 ? 160 ARG A C   1 
ATOM   490  O O   . ARG A  1 65  ? -13.123 -43.086  -11.943 1.00 26.57 ? 160 ARG A O   1 
ATOM   491  C CB  . ARG A  1 65  ? -11.852 -45.553  -12.906 1.00 28.41 ? 160 ARG A CB  1 
ATOM   492  C CG  . ARG A  1 65  ? -11.029 -46.812  -13.005 1.00 29.51 ? 160 ARG A CG  1 
ATOM   493  C CD  . ARG A  1 65  ? -11.611 -47.812  -13.987 1.00 30.78 ? 160 ARG A CD  1 
ATOM   494  N NE  . ARG A  1 65  ? -10.691 -48.939  -14.132 1.00 31.73 ? 160 ARG A NE  1 
ATOM   495  C CZ  . ARG A  1 65  ? -9.571  -48.896  -14.841 1.00 32.05 ? 160 ARG A CZ  1 
ATOM   496  N NH1 . ARG A  1 65  ? -9.240  -47.807  -15.528 1.00 31.91 ? 160 ARG A NH1 1 
ATOM   497  N NH2 . ARG A  1 65  ? -8.786  -49.960  -14.891 1.00 33.72 ? 160 ARG A NH2 1 
ATOM   498  N N   . ALA A  1 66  ? -11.151 -42.185  -12.562 1.00 25.91 ? 161 ALA A N   1 
ATOM   499  C CA  . ALA A  1 66  ? -11.669 -40.820  -12.726 1.00 26.67 ? 161 ALA A CA  1 
ATOM   500  C C   . ALA A  1 66  ? -11.625 -40.408  -14.196 1.00 26.79 ? 161 ALA A C   1 
ATOM   501  O O   . ALA A  1 66  ? -11.443 -39.245  -14.537 1.00 26.77 ? 161 ALA A O   1 
ATOM   502  C CB  . ALA A  1 66  ? -10.879 -39.849  -11.870 1.00 27.76 ? 161 ALA A CB  1 
ATOM   503  N N   . GLN A  1 67  ? -11.852 -41.384  -15.054 1.00 25.70 ? 162 GLN A N   1 
ATOM   504  C CA  . GLN A  1 67  ? -11.676 -41.226  -16.480 1.00 27.62 ? 162 GLN A CA  1 
ATOM   505  C C   . GLN A  1 67  ? -12.451 -42.371  -17.119 1.00 26.41 ? 162 GLN A C   1 
ATOM   506  O O   . GLN A  1 67  ? -12.380 -43.494  -16.627 1.00 25.61 ? 162 GLN A O   1 
ATOM   507  C CB  . GLN A  1 67  ? -10.190 -41.360  -16.770 1.00 31.14 ? 162 GLN A CB  1 
ATOM   508  C CG  . GLN A  1 67  ? -9.853  -41.537  -18.215 1.00 33.91 ? 162 GLN A CG  1 
ATOM   509  C CD  . GLN A  1 67  ? -8.379  -41.461  -18.519 1.00 34.32 ? 162 GLN A CD  1 
ATOM   510  O OE1 . GLN A  1 67  ? -8.011  -41.329  -19.675 1.00 36.46 ? 162 GLN A OE1 1 
ATOM   511  N NE2 . GLN A  1 67  ? -7.531  -41.534  -17.500 1.00 35.66 ? 162 GLN A NE2 1 
ATOM   512  N N   . PRO A  1 68  ? -13.216 -42.094  -18.187 1.00 26.14 ? 163 PRO A N   1 
ATOM   513  C CA  . PRO A  1 68  ? -14.034 -43.150  -18.782 1.00 26.54 ? 163 PRO A CA  1 
ATOM   514  C C   . PRO A  1 68  ? -13.227 -44.264  -19.438 1.00 25.94 ? 163 PRO A C   1 
ATOM   515  O O   . PRO A  1 68  ? -12.069 -44.070  -19.779 1.00 24.97 ? 163 PRO A O   1 
ATOM   516  C CB  . PRO A  1 68  ? -14.868 -42.436  -19.844 1.00 26.72 ? 163 PRO A CB  1 
ATOM   517  C CG  . PRO A  1 68  ? -14.466 -41.007  -19.840 1.00 26.97 ? 163 PRO A CG  1 
ATOM   518  C CD  . PRO A  1 68  ? -13.503 -40.762  -18.735 1.00 26.87 ? 163 PRO A CD  1 
ATOM   519  N N   . CYS A  1 69  ? -13.865 -45.413  -19.623 1.00 24.53 ? 164 CYS A N   1 
ATOM   520  C CA  . CYS A  1 69  ? -13.256 -46.539  -20.327 1.00 23.42 ? 164 CYS A CA  1 
ATOM   521  C C   . CYS A  1 69  ? -14.063 -46.824  -21.591 1.00 22.71 ? 164 CYS A C   1 
ATOM   522  O O   . CYS A  1 69  ? -15.294 -46.822  -21.561 1.00 22.00 ? 164 CYS A O   1 
ATOM   523  C CB  . CYS A  1 69  ? -13.269 -47.767  -19.443 1.00 24.20 ? 164 CYS A CB  1 
ATOM   524  S SG  . CYS A  1 69  ? -12.161 -47.751  -18.002 1.00 25.64 ? 164 CYS A SG  1 
ATOM   525  N N   . CYS A  1 70  ? -13.372 -47.051  -22.700 1.00 22.25 ? 165 CYS A N   1 
ATOM   526  C CA  . CYS A  1 70  ? -14.026 -47.495  -23.931 1.00 23.26 ? 165 CYS A CA  1 
ATOM   527  C C   . CYS A  1 70  ? -14.368 -48.987  -23.785 1.00 22.02 ? 165 CYS A C   1 
ATOM   528  O O   . CYS A  1 70  ? -13.488 -49.845  -23.796 1.00 20.96 ? 165 CYS A O   1 
ATOM   529  C CB  . CYS A  1 70  ? -13.101 -47.284  -25.129 1.00 24.47 ? 165 CYS A CB  1 
ATOM   530  S SG  . CYS A  1 70  ? -13.827 -47.779  -26.713 1.00 26.72 ? 165 CYS A SG  1 
ATOM   531  N N   . ARG A  1 71  ? -15.646 -49.271  -23.630 1.00 21.42 ? 166 ARG A N   1 
ATOM   532  C CA  . ARG A  1 71  ? -16.135 -50.631  -23.392 1.00 21.48 ? 166 ARG A CA  1 
ATOM   533  C C   . ARG A  1 71  ? -17.464 -50.838  -24.083 1.00 22.53 ? 166 ARG A C   1 
ATOM   534  O O   . ARG A  1 71  ? -18.117 -49.868  -24.475 1.00 23.18 ? 166 ARG A O   1 
ATOM   535  C CB  . ARG A  1 71  ? -16.328 -50.878  -21.890 1.00 20.21 ? 166 ARG A CB  1 
ATOM   536  C CG  . ARG A  1 71  ? -15.041 -50.936  -21.109 1.00 20.12 ? 166 ARG A CG  1 
ATOM   537  C CD  . ARG A  1 71  ? -14.280 -52.229  -21.362 1.00 20.20 ? 166 ARG A CD  1 
ATOM   538  N NE  . ARG A  1 71  ? -14.994 -53.380  -20.806 1.00 19.56 ? 166 ARG A NE  1 
ATOM   539  C CZ  . ARG A  1 71  ? -14.672 -54.645  -21.039 1.00 18.89 ? 166 ARG A CZ  1 
ATOM   540  N NH1 . ARG A  1 71  ? -13.636 -54.943  -21.810 1.00 18.88 ? 166 ARG A NH1 1 
ATOM   541  N NH2 . ARG A  1 71  ? -15.382 -55.611  -20.489 1.00 18.25 ? 166 ARG A NH2 1 
ATOM   542  N N   . PRO A  1 72  ? -17.875 -52.105  -24.246 1.00 23.96 ? 167 PRO A N   1 
ATOM   543  C CA  . PRO A  1 72  ? -19.178 -52.349  -24.804 1.00 24.54 ? 167 PRO A CA  1 
ATOM   544  C C   . PRO A  1 72  ? -20.297 -51.970  -23.845 1.00 25.28 ? 167 PRO A C   1 
ATOM   545  O O   . PRO A  1 72  ? -20.182 -52.179  -22.642 1.00 25.10 ? 167 PRO A O   1 
ATOM   546  C CB  . PRO A  1 72  ? -19.198 -53.866  -25.048 1.00 24.26 ? 167 PRO A CB  1 
ATOM   547  C CG  . PRO A  1 72  ? -17.765 -54.299  -24.982 1.00 24.78 ? 167 PRO A CG  1 
ATOM   548  C CD  . PRO A  1 72  ? -17.121 -53.352  -24.030 1.00 24.02 ? 167 PRO A CD  1 
ATOM   549  N N   . THR A  1 73  ? -21.377 -51.448  -24.410 1.00 25.70 ? 168 THR A N   1 
ATOM   550  C CA  . THR A  1 73  ? -22.616 -51.205  -23.681 1.00 27.40 ? 168 THR A CA  1 
ATOM   551  C C   . THR A  1 73  ? -23.708 -52.168  -24.103 1.00 27.17 ? 168 THR A C   1 
ATOM   552  O O   . THR A  1 73  ? -24.770 -52.240  -23.476 1.00 28.04 ? 168 THR A O   1 
ATOM   553  C CB  . THR A  1 73  ? -23.102 -49.778  -23.941 1.00 27.13 ? 168 THR A CB  1 
ATOM   554  O OG1 . THR A  1 73  ? -23.127 -49.552  -25.353 1.00 26.44 ? 168 THR A OG1 1 
ATOM   555  C CG2 . THR A  1 73  ? -22.132 -48.806  -23.319 1.00 28.07 ? 168 THR A CG2 1 
ATOM   556  N N   . ALA A  1 74  ? -23.447 -52.910  -25.171 1.00 27.22 ? 169 ALA A N   1 
ATOM   557  C CA  . ALA A  1 74  ? -24.332 -53.973  -25.594 1.00 25.79 ? 169 ALA A CA  1 
ATOM   558  C C   . ALA A  1 74  ? -23.519 -55.021  -26.341 1.00 25.92 ? 169 ALA A C   1 
ATOM   559  O O   . ALA A  1 74  ? -22.442 -54.724  -26.915 1.00 24.26 ? 169 ALA A O   1 
ATOM   560  C CB  . ALA A  1 74  ? -25.439 -53.421  -26.471 1.00 26.99 ? 169 ALA A CB  1 
ATOM   561  N N   . TYR A  1 75  ? -24.042 -56.241  -26.326 1.00 24.93 ? 170 TYR A N   1 
ATOM   562  C CA  . TYR A  1 75  ? -23.342 -57.403  -26.880 1.00 25.88 ? 170 TYR A CA  1 
ATOM   563  C C   . TYR A  1 75  ? -24.162 -58.159  -27.931 1.00 26.17 ? 170 TYR A C   1 
ATOM   564  O O   . TYR A  1 75  ? -25.395 -58.109  -27.940 1.00 25.88 ? 170 TYR A O   1 
ATOM   565  C CB  . TYR A  1 75  ? -22.983 -58.348  -25.738 1.00 24.78 ? 170 TYR A CB  1 
ATOM   566  C CG  . TYR A  1 75  ? -21.879 -57.823  -24.860 1.00 24.04 ? 170 TYR A CG  1 
ATOM   567  C CD1 . TYR A  1 75  ? -20.541 -58.058  -25.180 1.00 24.07 ? 170 TYR A CD1 1 
ATOM   568  C CD2 . TYR A  1 75  ? -22.156 -57.059  -23.725 1.00 23.70 ? 170 TYR A CD2 1 
ATOM   569  C CE1 . TYR A  1 75  ? -19.518 -57.571  -24.380 1.00 23.32 ? 170 TYR A CE1 1 
ATOM   570  C CE2 . TYR A  1 75  ? -21.131 -56.567  -22.931 1.00 22.16 ? 170 TYR A CE2 1 
ATOM   571  C CZ  . TYR A  1 75  ? -19.824 -56.834  -23.263 1.00 22.08 ? 170 TYR A CZ  1 
ATOM   572  O OH  . TYR A  1 75  ? -18.795 -56.372  -22.487 1.00 23.49 ? 170 TYR A OH  1 
ATOM   573  N N   . GLU A  1 76  ? -23.454 -58.852  -28.818 1.00 25.84 ? 171 GLU A N   1 
ATOM   574  C CA  . GLU A  1 76  ? -24.070 -59.746  -29.777 1.00 25.68 ? 171 GLU A CA  1 
ATOM   575  C C   . GLU A  1 76  ? -25.004 -60.724  -29.077 1.00 25.72 ? 171 GLU A C   1 
ATOM   576  O O   . GLU A  1 76  ? -24.695 -61.251  -28.008 1.00 26.40 ? 171 GLU A O   1 
ATOM   577  C CB  . GLU A  1 76  ? -22.988 -60.501  -30.536 1.00 25.92 ? 171 GLU A CB  1 
ATOM   578  C CG  . GLU A  1 76  ? -23.445 -61.473  -31.597 1.00 25.44 ? 171 GLU A CG  1 
ATOM   579  C CD  . GLU A  1 76  ? -22.252 -62.151  -32.258 1.00 24.88 ? 171 GLU A CD  1 
ATOM   580  O OE1 . GLU A  1 76  ? -21.424 -62.769  -31.548 1.00 22.48 ? 171 GLU A OE1 1 
ATOM   581  O OE2 . GLU A  1 76  ? -22.135 -62.030  -33.486 1.00 23.84 ? 171 GLU A OE2 1 
ATOM   582  N N   . ASP A  1 77  ? -26.170 -60.907  -29.680 1.00 26.30 ? 172 ASP A N   1 
ATOM   583  C CA  . ASP A  1 77  ? -27.183 -61.819  -29.198 1.00 29.93 ? 172 ASP A CA  1 
ATOM   584  C C   . ASP A  1 77  ? -26.676 -63.278  -29.197 1.00 28.78 ? 172 ASP A C   1 
ATOM   585  O O   . ASP A  1 77  ? -26.606 -63.927  -28.144 1.00 25.95 ? 172 ASP A O   1 
ATOM   586  C CB  . ASP A  1 77  ? -28.407 -61.680  -30.093 1.00 35.93 ? 172 ASP A CB  1 
ATOM   587  C CG  . ASP A  1 77  ? -29.619 -62.349  -29.527 1.00 41.36 ? 172 ASP A CG  1 
ATOM   588  O OD1 . ASP A  1 77  ? -29.491 -63.071  -28.516 1.00 49.04 ? 172 ASP A OD1 1 
ATOM   589  O OD2 . ASP A  1 77  ? -30.706 -62.157  -30.104 1.00 48.30 ? 172 ASP A OD2 1 
ATOM   590  N N   . GLU A  1 78  ? -26.319 -63.774  -30.383 1.00 26.69 ? 173 GLU A N   1 
ATOM   591  C CA  . GLU A  1 78  ? -25.800 -65.139  -30.538 1.00 27.10 ? 173 GLU A CA  1 
ATOM   592  C C   . GLU A  1 78  ? -25.092 -65.324  -31.879 1.00 24.70 ? 173 GLU A C   1 
ATOM   593  O O   . GLU A  1 78  ? -25.349 -64.609  -32.841 1.00 22.61 ? 173 GLU A O   1 
ATOM   594  C CB  . GLU A  1 78  ? -26.921 -66.173  -30.401 1.00 27.59 ? 173 GLU A CB  1 
ATOM   595  C CG  . GLU A  1 78  ? -28.059 -65.973  -31.378 1.00 28.26 ? 173 GLU A CG  1 
ATOM   596  C CD  . GLU A  1 78  ? -29.052 -67.119  -31.360 1.00 30.40 ? 173 GLU A CD  1 
ATOM   597  O OE1 . GLU A  1 78  ? -28.828 -68.150  -32.038 1.00 31.30 ? 173 GLU A OE1 1 
ATOM   598  O OE2 . GLU A  1 78  ? -30.079 -66.979  -30.679 1.00 33.19 ? 173 GLU A OE2 1 
ATOM   599  N N   . VAL A  1 79  ? -24.181 -66.275  -31.921 1.00 24.81 ? 174 VAL A N   1 
ATOM   600  C CA  . VAL A  1 79  ? -23.610 -66.727  -33.186 1.00 25.19 ? 174 VAL A CA  1 
ATOM   601  C C   . VAL A  1 79  ? -23.417 -68.230  -33.050 1.00 25.39 ? 174 VAL A C   1 
ATOM   602  O O   . VAL A  1 79  ? -23.163 -68.717  -31.935 1.00 24.33 ? 174 VAL A O   1 
ATOM   603  C CB  . VAL A  1 79  ? -22.287 -66.000  -33.520 1.00 25.81 ? 174 VAL A CB  1 
ATOM   604  C CG1 . VAL A  1 79  ? -21.193 -66.310  -32.496 1.00 26.63 ? 174 VAL A CG1 1 
ATOM   605  C CG2 . VAL A  1 79  ? -21.816 -66.354  -34.922 1.00 25.99 ? 174 VAL A CG2 1 
ATOM   606  N N   . SER A  1 80  ? -23.561 -68.970  -34.149 1.00 24.02 ? 175 SER A N   1 
ATOM   607  C CA  . SER A  1 80  ? -23.404 -70.428  -34.083 1.00 23.77 ? 175 SER A CA  1 
ATOM   608  C C   . SER A  1 80  ? -22.376 -70.983  -35.056 1.00 23.54 ? 175 SER A C   1 
ATOM   609  O O   . SER A  1 80  ? -21.988 -70.322  -36.000 1.00 23.96 ? 175 SER A O   1 
ATOM   610  C CB  . SER A  1 80  ? -24.736 -71.116  -34.308 1.00 23.60 ? 175 SER A CB  1 
ATOM   611  O OG  . SER A  1 80  ? -25.661 -70.742  -33.314 1.00 24.93 ? 175 SER A OG  1 
ATOM   612  N N   . PHE A  1 81  ? -21.939 -72.215  -34.800 1.00 22.89 ? 176 PHE A N   1 
ATOM   613  C CA  . PHE A  1 81  ? -20.996 -72.895  -35.647 1.00 22.99 ? 176 PHE A CA  1 
ATOM   614  C C   . PHE A  1 81  ? -21.032 -74.391  -35.354 1.00 23.18 ? 176 PHE A C   1 
ATOM   615  O O   . PHE A  1 81  ? -21.498 -74.821  -34.286 1.00 21.79 ? 176 PHE A O   1 
ATOM   616  C CB  . PHE A  1 81  ? -19.574 -72.341  -35.460 1.00 23.96 ? 176 PHE A CB  1 
ATOM   617  C CG  . PHE A  1 81  ? -19.165 -72.199  -34.023 1.00 24.63 ? 176 PHE A CG  1 
ATOM   618  C CD1 . PHE A  1 81  ? -18.598 -73.259  -33.345 1.00 24.89 ? 176 PHE A CD1 1 
ATOM   619  C CD2 . PHE A  1 81  ? -19.357 -71.008  -33.350 1.00 25.28 ? 176 PHE A CD2 1 
ATOM   620  C CE1 . PHE A  1 81  ? -18.240 -73.150  -32.009 1.00 25.98 ? 176 PHE A CE1 1 
ATOM   621  C CE2 . PHE A  1 81  ? -19.003 -70.891  -32.015 1.00 25.84 ? 176 PHE A CE2 1 
ATOM   622  C CZ  . PHE A  1 81  ? -18.440 -71.963  -31.345 1.00 26.12 ? 176 PHE A CZ  1 
ATOM   623  N N   . LEU A  1 82  ? -20.533 -75.155  -36.314 1.00 23.05 ? 177 LEU A N   1 
ATOM   624  C CA  . LEU A  1 82  ? -20.418 -76.610  -36.219 1.00 22.87 ? 177 LEU A CA  1 
ATOM   625  C C   . LEU A  1 82  ? -18.968 -76.934  -35.960 1.00 23.21 ? 177 LEU A C   1 
ATOM   626  O O   . LEU A  1 82  ? -18.094 -76.413  -36.637 1.00 22.78 ? 177 LEU A O   1 
ATOM   627  C CB  . LEU A  1 82  ? -20.832 -77.260  -37.534 1.00 22.48 ? 177 LEU A CB  1 
ATOM   628  C CG  . LEU A  1 82  ? -20.828 -78.801  -37.589 1.00 22.96 ? 177 LEU A CG  1 
ATOM   629  C CD1 . LEU A  1 82  ? -22.044 -79.329  -36.838 1.00 22.78 ? 177 LEU A CD1 1 
ATOM   630  C CD2 . LEU A  1 82  ? -20.824 -79.315  -39.026 1.00 22.93 ? 177 LEU A CD2 1 
ATOM   631  N N   . ASP A  1 83  ? -18.704 -77.805  -34.996 1.00 24.51 ? 178 ASP A N   1 
ATOM   632  C CA  . ASP A  1 83  ? -17.320 -78.131  -34.637 1.00 26.73 ? 178 ASP A CA  1 
ATOM   633  C C   . ASP A  1 83  ? -16.855 -79.390  -35.378 1.00 28.57 ? 178 ASP A C   1 
ATOM   634  O O   . ASP A  1 83  ? -17.621 -79.982  -36.119 1.00 26.57 ? 178 ASP A O   1 
ATOM   635  C CB  . ASP A  1 83  ? -17.161 -78.237  -33.104 1.00 26.29 ? 178 ASP A CB  1 
ATOM   636  C CG  . ASP A  1 83  ? -17.746 -79.523  -32.516 1.00 27.42 ? 178 ASP A CG  1 
ATOM   637  O OD1 . ASP A  1 83  ? -18.098 -80.476  -33.252 1.00 27.06 ? 178 ASP A OD1 1 
ATOM   638  O OD2 . ASP A  1 83  ? -17.822 -79.589  -31.278 1.00 26.26 ? 178 ASP A OD2 1 
ATOM   639  N N   . ALA A  1 84  ? -15.594 -79.761  -35.183 1.00 31.59 ? 179 ALA A N   1 
ATOM   640  C CA  . ALA A  1 84  ? -14.962 -80.889  -35.871 1.00 34.30 ? 179 ALA A CA  1 
ATOM   641  C C   . ALA A  1 84  ? -15.558 -82.267  -35.550 1.00 35.71 ? 179 ALA A C   1 
ATOM   642  O O   . ALA A  1 84  ? -15.340 -83.213  -36.285 1.00 40.16 ? 179 ALA A O   1 
ATOM   643  C CB  . ALA A  1 84  ? -13.471 -80.897  -35.567 1.00 35.77 ? 179 ALA A CB  1 
ATOM   644  N N   . HIS A  1 85  ? -16.318 -82.379  -34.471 1.00 37.90 ? 180 HIS A N   1 
ATOM   645  C CA  . HIS A  1 85  ? -16.992 -83.628  -34.125 1.00 40.10 ? 180 HIS A CA  1 
ATOM   646  C C   . HIS A  1 85  ? -18.447 -83.561  -34.547 1.00 39.01 ? 180 HIS A C   1 
ATOM   647  O O   . HIS A  1 85  ? -19.287 -84.299  -34.046 1.00 37.73 ? 180 HIS A O   1 
ATOM   648  C CB  . HIS A  1 85  ? -16.852 -83.898  -32.619 1.00 42.48 ? 180 HIS A CB  1 
ATOM   649  C CG  . HIS A  1 85  ? -15.444 -83.750  -32.126 1.00 45.58 ? 180 HIS A CG  1 
ATOM   650  N ND1 . HIS A  1 85  ? -15.054 -82.742  -31.265 1.00 48.44 ? 180 HIS A ND1 1 
ATOM   651  C CD2 . HIS A  1 85  ? -14.319 -84.438  -32.434 1.00 46.62 ? 180 HIS A CD2 1 
ATOM   652  C CE1 . HIS A  1 85  ? -13.755 -82.834  -31.041 1.00 49.55 ? 180 HIS A CE1 1 
ATOM   653  N NE2 . HIS A  1 85  ? -13.285 -83.854  -31.740 1.00 49.74 ? 180 HIS A NE2 1 
ATOM   654  N N   . SER A  1 86  ? -18.748 -82.663  -35.480 1.00 38.52 ? 181 SER A N   1 
ATOM   655  C CA  . SER A  1 86  ? -20.092 -82.541  -36.017 1.00 37.12 ? 181 SER A CA  1 
ATOM   656  C C   . SER A  1 86  ? -21.128 -82.221  -34.939 1.00 35.85 ? 181 SER A C   1 
ATOM   657  O O   . SER A  1 86  ? -22.240 -82.731  -34.986 1.00 33.96 ? 181 SER A O   1 
ATOM   658  C CB  . SER A  1 86  ? -20.464 -83.831  -36.760 1.00 38.42 ? 181 SER A CB  1 
ATOM   659  O OG  . SER A  1 86  ? -21.663 -83.684  -37.480 1.00 40.13 ? 181 SER A OG  1 
ATOM   660  N N   . ARG A  1 87  ? -20.759 -81.376  -33.978 1.00 33.81 ? 182 ARG A N   1 
ATOM   661  C CA  . ARG A  1 87  ? -21.700 -80.857  -32.990 1.00 35.59 ? 182 ARG A CA  1 
ATOM   662  C C   . ARG A  1 87  ? -21.833 -79.346  -33.159 1.00 31.54 ? 182 ARG A C   1 
ATOM   663  O O   . ARG A  1 87  ? -20.846 -78.648  -33.385 1.00 25.72 ? 182 ARG A O   1 
ATOM   664  C CB  . ARG A  1 87  ? -21.246 -81.184  -31.549 1.00 41.06 ? 182 ARG A CB  1 
ATOM   665  C CG  . ARG A  1 87  ? -21.490 -82.632  -31.147 1.00 48.76 ? 182 ARG A CG  1 
ATOM   666  C CD  . ARG A  1 87  ? -21.615 -82.840  -29.637 1.00 56.77 ? 182 ARG A CD  1 
ATOM   667  N NE  . ARG A  1 87  ? -20.365 -83.305  -29.019 1.00 66.60 ? 182 ARG A NE  1 
ATOM   668  C CZ  . ARG A  1 87  ? -20.275 -83.922  -27.833 1.00 73.42 ? 182 ARG A CZ  1 
ATOM   669  N NH1 . ARG A  1 87  ? -21.364 -84.162  -27.100 1.00 75.76 ? 182 ARG A NH1 1 
ATOM   670  N NH2 . ARG A  1 87  ? -19.084 -84.307  -27.370 1.00 73.80 ? 182 ARG A NH2 1 
ATOM   671  N N   . TYR A  1 88  ? -23.061 -78.852  -33.042 1.00 29.01 ? 183 TYR A N   1 
ATOM   672  C CA  . TYR A  1 88  ? -23.314 -77.428  -33.166 1.00 28.31 ? 183 TYR A CA  1 
ATOM   673  C C   . TYR A  1 88  ? -23.151 -76.741  -31.830 1.00 29.10 ? 183 TYR A C   1 
ATOM   674  O O   . TYR A  1 88  ? -23.487 -77.318  -30.792 1.00 27.72 ? 183 TYR A O   1 
ATOM   675  C CB  . TYR A  1 88  ? -24.720 -77.159  -33.680 1.00 27.49 ? 183 TYR A CB  1 
ATOM   676  C CG  . TYR A  1 88  ? -24.855 -77.161  -35.195 1.00 26.30 ? 183 TYR A CG  1 
ATOM   677  C CD1 . TYR A  1 88  ? -24.291 -76.150  -35.972 1.00 25.48 ? 183 TYR A CD1 1 
ATOM   678  C CD2 . TYR A  1 88  ? -25.576 -78.162  -35.846 1.00 26.20 ? 183 TYR A CD2 1 
ATOM   679  C CE1 . TYR A  1 88  ? -24.433 -76.138  -37.358 1.00 25.15 ? 183 TYR A CE1 1 
ATOM   680  C CE2 . TYR A  1 88  ? -25.724 -78.157  -37.234 1.00 26.49 ? 183 TYR A CE2 1 
ATOM   681  C CZ  . TYR A  1 88  ? -25.159 -77.147  -37.983 1.00 25.32 ? 183 TYR A CZ  1 
ATOM   682  O OH  . TYR A  1 88  ? -25.322 -77.153  -39.358 1.00 25.79 ? 183 TYR A OH  1 
ATOM   683  N N   . HIS A  1 89  ? -22.654 -75.503  -31.881 1.00 28.55 ? 184 HIS A N   1 
ATOM   684  C CA  . HIS A  1 89  ? -22.554 -74.636  -30.713 1.00 29.24 ? 184 HIS A CA  1 
ATOM   685  C C   . HIS A  1 89  ? -23.149 -73.263  -31.004 1.00 28.25 ? 184 HIS A C   1 
ATOM   686  O O   . HIS A  1 89  ? -23.052 -72.754  -32.109 1.00 27.34 ? 184 HIS A O   1 
ATOM   687  C CB  . HIS A  1 89  ? -21.094 -74.499  -30.260 1.00 30.19 ? 184 HIS A CB  1 
ATOM   688  C CG  . HIS A  1 89  ? -20.428 -75.812  -29.992 1.00 31.29 ? 184 HIS A CG  1 
ATOM   689  N ND1 . HIS A  1 89  ? -20.548 -76.483  -28.791 1.00 31.31 ? 184 HIS A ND1 1 
ATOM   690  C CD2 . HIS A  1 89  ? -19.665 -76.596  -30.788 1.00 31.28 ? 184 HIS A CD2 1 
ATOM   691  C CE1 . HIS A  1 89  ? -19.877 -77.618  -28.859 1.00 31.99 ? 184 HIS A CE1 1 
ATOM   692  N NE2 . HIS A  1 89  ? -19.328 -77.708  -30.059 1.00 30.51 ? 184 HIS A NE2 1 
ATOM   693  N N   . THR A  1 90  ? -23.792 -72.690  -29.999 1.00 28.63 ? 185 THR A N   1 
ATOM   694  C CA  . THR A  1 90  ? -24.253 -71.320  -30.030 1.00 28.30 ? 185 THR A CA  1 
ATOM   695  C C   . THR A  1 90  ? -23.602 -70.573  -28.860 1.00 28.43 ? 185 THR A C   1 
ATOM   696  O O   . THR A  1 90  ? -23.678 -71.022  -27.718 1.00 28.46 ? 185 THR A O   1 
ATOM   697  C CB  . THR A  1 90  ? -25.785 -71.267  -29.922 1.00 28.09 ? 185 THR A CB  1 
ATOM   698  O OG1 . THR A  1 90  ? -26.361 -72.021  -31.000 1.00 27.84 ? 185 THR A OG1 1 
ATOM   699  C CG2 . THR A  1 90  ? -26.299 -69.815  -29.972 1.00 28.02 ? 185 THR A CG2 1 
ATOM   700  N N   . VAL A  1 91  ? -22.945 -69.457  -29.150 1.00 28.57 ? 186 VAL A N   1 
ATOM   701  C CA  . VAL A  1 91  ? -22.273 -68.648  -28.123 1.00 29.27 ? 186 VAL A CA  1 
ATOM   702  C C   . VAL A  1 91  ? -23.000 -67.307  -28.011 1.00 29.61 ? 186 VAL A C   1 
ATOM   703  O O   . VAL A  1 91  ? -23.314 -66.664  -29.025 1.00 28.57 ? 186 VAL A O   1 
ATOM   704  C CB  . VAL A  1 91  ? -20.778 -68.384  -28.444 1.00 29.84 ? 186 VAL A CB  1 
ATOM   705  C CG1 . VAL A  1 91  ? -20.110 -67.580  -27.326 1.00 29.21 ? 186 VAL A CG1 1 
ATOM   706  C CG2 . VAL A  1 91  ? -20.024 -69.687  -28.648 1.00 30.59 ? 186 VAL A CG2 1 
ATOM   707  N N   . HIS A  1 92  ? -23.264 -66.891  -26.775 1.00 28.97 ? 187 HIS A N   1 
ATOM   708  C CA  . HIS A  1 92  ? -23.962 -65.637  -26.522 1.00 29.28 ? 187 HIS A CA  1 
ATOM   709  C C   . HIS A  1 92  ? -22.990 -64.567  -26.061 1.00 27.06 ? 187 HIS A C   1 
ATOM   710  O O   . HIS A  1 92  ? -22.095 -64.840  -25.280 1.00 27.07 ? 187 HIS A O   1 
ATOM   711  C CB  . HIS A  1 92  ? -25.066 -65.844  -25.487 1.00 31.00 ? 187 HIS A CB  1 
ATOM   712  C CG  . HIS A  1 92  ? -26.092 -66.850  -25.906 1.00 32.82 ? 187 HIS A CG  1 
ATOM   713  N ND1 . HIS A  1 92  ? -25.974 -68.189  -25.615 1.00 34.83 ? 187 HIS A ND1 1 
ATOM   714  C CD2 . HIS A  1 92  ? -27.227 -66.722  -26.636 1.00 32.47 ? 187 HIS A CD2 1 
ATOM   715  C CE1 . HIS A  1 92  ? -27.004 -68.841  -26.123 1.00 33.89 ? 187 HIS A CE1 1 
ATOM   716  N NE2 . HIS A  1 92  ? -27.777 -67.973  -26.750 1.00 32.63 ? 187 HIS A NE2 1 
ATOM   717  N N   . GLU A  1 93  ? -23.174 -63.352  -26.570 1.00 26.90 ? 188 GLU A N   1 
ATOM   718  C CA  . GLU A  1 93  ? -22.371 -62.190  -26.178 1.00 26.78 ? 188 GLU A CA  1 
ATOM   719  C C   . GLU A  1 93  ? -20.886 -62.363  -26.476 1.00 24.99 ? 188 GLU A C   1 
ATOM   720  O O   . GLU A  1 93  ? -20.032 -61.876  -25.739 1.00 24.87 ? 188 GLU A O   1 
ATOM   721  C CB  . GLU A  1 93  ? -22.613 -61.858  -24.693 1.00 27.94 ? 188 GLU A CB  1 
ATOM   722  C CG  . GLU A  1 93  ? -24.093 -61.778  -24.342 1.00 28.20 ? 188 GLU A CG  1 
ATOM   723  C CD  . GLU A  1 93  ? -24.346 -61.194  -22.965 1.00 30.49 ? 188 GLU A CD  1 
ATOM   724  O OE1 . GLU A  1 93  ? -23.497 -61.347  -22.057 1.00 29.03 ? 188 GLU A OE1 1 
ATOM   725  O OE2 . GLU A  1 93  ? -25.415 -60.568  -22.799 1.00 33.29 ? 188 GLU A OE2 1 
ATOM   726  N N   . LEU A  1 94  ? -20.574 -63.043  -27.571 1.00 24.41 ? 189 LEU A N   1 
ATOM   727  C CA  . LEU A  1 94  ? -19.179 -63.181  -27.970 1.00 24.03 ? 189 LEU A CA  1 
ATOM   728  C C   . LEU A  1 94  ? -18.592 -61.864  -28.429 1.00 23.42 ? 189 LEU A C   1 
ATOM   729  O O   . LEU A  1 94  ? -17.484 -61.518  -28.032 1.00 22.98 ? 189 LEU A O   1 
ATOM   730  C CB  . LEU A  1 94  ? -19.000 -64.220  -29.062 1.00 23.95 ? 189 LEU A CB  1 
ATOM   731  C CG  . LEU A  1 94  ? -17.556 -64.474  -29.514 1.00 25.04 ? 189 LEU A CG  1 
ATOM   732  C CD1 . LEU A  1 94  ? -16.666 -64.804  -28.335 1.00 25.33 ? 189 LEU A CD1 1 
ATOM   733  C CD2 . LEU A  1 94  ? -17.511 -65.603  -30.542 1.00 25.94 ? 189 LEU A CD2 1 
ATOM   734  N N   . SER A  1 95  ? -19.338 -61.145  -29.263 1.00 22.91 ? 190 SER A N   1 
ATOM   735  C CA  . SER A  1 95  ? -18.899 -59.865  -29.815 1.00 22.85 ? 190 SER A CA  1 
ATOM   736  C C   . SER A  1 95  ? -19.596 -58.709  -29.108 1.00 22.46 ? 190 SER A C   1 
ATOM   737  O O   . SER A  1 95  ? -20.680 -58.873  -28.547 1.00 21.17 ? 190 SER A O   1 
ATOM   738  C CB  . SER A  1 95  ? -19.230 -59.798  -31.317 1.00 23.30 ? 190 SER A CB  1 
ATOM   739  O OG  . SER A  1 95  ? -18.264 -60.448  -32.124 1.00 22.98 ? 190 SER A OG  1 
ATOM   740  N N   . ALA A  1 96  ? -18.977 -57.538  -29.162 1.00 23.43 ? 191 ALA A N   1 
ATOM   741  C CA  . ALA A  1 96  ? -19.652 -56.294  -28.816 1.00 24.32 ? 191 ALA A CA  1 
ATOM   742  C C   . ALA A  1 96  ? -20.630 -55.928  -29.930 1.00 27.26 ? 191 ALA A C   1 
ATOM   743  O O   . ALA A  1 96  ? -20.394 -56.280  -31.096 1.00 26.13 ? 191 ALA A O   1 
ATOM   744  C CB  . ALA A  1 96  ? -18.636 -55.187  -28.642 1.00 24.47 ? 191 ALA A CB  1 
ATOM   745  N N   . ARG A  1 97  ? -21.721 -55.251  -29.560 1.00 28.68 ? 192 ARG A N   1 
ATOM   746  C CA  . ARG A  1 97  ? -22.703 -54.725  -30.503 1.00 31.21 ? 192 ARG A CA  1 
ATOM   747  C C   . ARG A  1 97  ? -22.739 -53.195  -30.481 1.00 31.31 ? 192 ARG A C   1 
ATOM   748  O O   . ARG A  1 97  ? -23.022 -52.575  -31.498 1.00 29.68 ? 192 ARG A O   1 
ATOM   749  C CB  . ARG A  1 97  ? -24.100 -55.280  -30.181 1.00 35.48 ? 192 ARG A CB  1 
ATOM   750  C CG  . ARG A  1 97  ? -25.204 -54.829  -31.135 1.00 40.12 ? 192 ARG A CG  1 
ATOM   751  C CD  . ARG A  1 97  ? -26.576 -54.831  -30.484 1.00 44.69 ? 192 ARG A CD  1 
ATOM   752  N NE  . ARG A  1 97  ? -27.035 -56.165  -30.137 1.00 49.00 ? 192 ARG A NE  1 
ATOM   753  C CZ  . ARG A  1 97  ? -27.875 -56.446  -29.133 1.00 58.18 ? 192 ARG A CZ  1 
ATOM   754  N NH1 . ARG A  1 97  ? -28.237 -57.710  -28.907 1.00 59.84 ? 192 ARG A NH1 1 
ATOM   755  N NH2 . ARG A  1 97  ? -28.351 -55.485  -28.338 1.00 57.20 ? 192 ARG A NH2 1 
ATOM   756  N N   . GLU A  1 98  ? -22.493 -52.587  -29.322 1.00 32.45 ? 193 GLU A N   1 
ATOM   757  C CA  . GLU A  1 98  ? -22.409 -51.128  -29.205 1.00 33.19 ? 193 GLU A CA  1 
ATOM   758  C C   . GLU A  1 98  ? -21.285 -50.770  -28.243 1.00 31.76 ? 193 GLU A C   1 
ATOM   759  O O   . GLU A  1 98  ? -21.010 -51.527  -27.299 1.00 30.51 ? 193 GLU A O   1 
ATOM   760  C CB  . GLU A  1 98  ? -23.735 -50.537  -28.702 1.00 37.61 ? 193 GLU A CB  1 
ATOM   761  C CG  . GLU A  1 98  ? -24.898 -50.682  -29.679 1.00 42.49 ? 193 GLU A CG  1 
ATOM   762  C CD  . GLU A  1 98  ? -26.248 -50.249  -29.117 1.00 47.80 ? 193 GLU A CD  1 
ATOM   763  O OE1 . GLU A  1 98  ? -26.316 -49.691  -27.995 1.00 53.90 ? 193 GLU A OE1 1 
ATOM   764  O OE2 . GLU A  1 98  ? -27.258 -50.457  -29.824 1.00 54.25 ? 193 GLU A OE2 1 
ATOM   765  N N   . CYS A  1 99  ? -20.646 -49.626  -28.489 1.00 29.79 ? 194 CYS A N   1 
ATOM   766  C CA  . CYS A  1 99  ? -19.534 -49.127  -27.671 1.00 28.74 ? 194 CYS A CA  1 
ATOM   767  C C   . CYS A  1 99  ? -19.830 -47.729  -27.107 1.00 29.06 ? 194 CYS A C   1 
ATOM   768  O O   . CYS A  1 99  ? -20.534 -46.924  -27.733 1.00 28.41 ? 194 CYS A O   1 
ATOM   769  C CB  . CYS A  1 99  ? -18.268 -49.030  -28.507 1.00 27.67 ? 194 CYS A CB  1 
ATOM   770  S SG  . CYS A  1 99  ? -17.812 -50.573  -29.318 1.00 31.30 ? 194 CYS A SG  1 
ATOM   771  N N   . ALA A  1 100 ? -19.270 -47.441  -25.939 1.00 27.51 ? 195 ALA A N   1 
ATOM   772  C CA  . ALA A  1 100 ? -19.282 -46.088  -25.402 1.00 28.23 ? 195 ALA A CA  1 
ATOM   773  C C   . ALA A  1 100 ? -18.153 -45.905  -24.408 1.00 26.86 ? 195 ALA A C   1 
ATOM   774  O O   . ALA A  1 100 ? -17.552 -46.879  -23.931 1.00 23.34 ? 195 ALA A O   1 
ATOM   775  C CB  . ALA A  1 100 ? -20.621 -45.771  -24.744 1.00 28.36 ? 195 ALA A CB  1 
ATOM   776  N N   . CYS A  1 101 ? -17.862 -44.638  -24.138 1.00 25.93 ? 196 CYS A N   1 
ATOM   777  C CA  . CYS A  1 101 ? -16.927 -44.258  -23.110 1.00 28.31 ? 196 CYS A CA  1 
ATOM   778  C C   . CYS A  1 101 ? -17.735 -44.191  -21.829 1.00 27.49 ? 196 CYS A C   1 
ATOM   779  O O   . CYS A  1 101 ? -18.530 -43.289  -21.643 1.00 27.08 ? 196 CYS A O   1 
ATOM   780  C CB  . CYS A  1 101 ? -16.268 -42.913  -23.433 1.00 30.60 ? 196 CYS A CB  1 
ATOM   781  S SG  . CYS A  1 101 ? -15.114 -43.071  -24.800 1.00 34.65 ? 196 CYS A SG  1 
ATOM   782  N N   . VAL A  1 102 ? -17.542 -45.174  -20.969 1.00 25.15 ? 197 VAL A N   1 
ATOM   783  C CA  . VAL A  1 102 ? -18.328 -45.304  -19.779 1.00 26.36 ? 197 VAL A CA  1 
ATOM   784  C C   . VAL A  1 102 ? -17.490 -44.839  -18.611 1.00 25.96 ? 197 VAL A C   1 
ATOM   785  O O   . VAL A  1 102 ? -17.971 -43.991  -17.862 1.00 26.05 ? 197 VAL A O   1 
ATOM   786  C CB  . VAL A  1 102 ? -18.757 -46.767  -19.571 1.00 26.57 ? 197 VAL A CB  1 
ATOM   787  C CG1 . VAL A  1 102 ? -19.612 -46.903  -18.330 1.00 26.57 ? 197 VAL A CG1 1 
ATOM   788  C CG2 . VAL A  1 102 ? -19.533 -47.240  -20.797 1.00 28.57 ? 197 VAL A CG2 1 
ATOM   789  O OXT . VAL A  1 102 ? -16.357 -45.316  -18.413 1.00 24.24 ? 197 VAL A OXT 1 
ATOM   790  N N   . ALA B  1 5   ? -9.966  -57.296  -0.765  1.00 59.74 ? 100 ALA B N   1 
ATOM   791  C CA  . ALA B  1 5   ? -10.269 -56.391  -1.920  1.00 56.30 ? 100 ALA B CA  1 
ATOM   792  C C   . ALA B  1 5   ? -11.768 -56.158  -2.017  1.00 50.06 ? 100 ALA B C   1 
ATOM   793  O O   . ALA B  1 5   ? -12.520 -57.035  -2.454  1.00 53.07 ? 100 ALA B O   1 
ATOM   794  C CB  . ALA B  1 5   ? -9.738  -56.974  -3.227  1.00 55.87 ? 100 ALA B CB  1 
ATOM   795  N N   . ARG B  1 6   ? -12.198 -54.970  -1.609  1.00 43.72 ? 101 ARG B N   1 
ATOM   796  C CA  . ARG B  1 6   ? -13.613 -54.627  -1.619  1.00 38.48 ? 101 ARG B CA  1 
ATOM   797  C C   . ARG B  1 6   ? -14.086 -54.568  -3.068  1.00 34.09 ? 101 ARG B C   1 
ATOM   798  O O   . ARG B  1 6   ? -13.391 -53.983  -3.900  1.00 30.89 ? 101 ARG B O   1 
ATOM   799  C CB  . ARG B  1 6   ? -13.817 -53.292  -0.925  1.00 39.00 ? 101 ARG B CB  1 
ATOM   800  C CG  . ARG B  1 6   ? -15.119 -53.207  -0.165  1.00 41.98 ? 101 ARG B CG  1 
ATOM   801  C CD  . ARG B  1 6   ? -15.178 -51.929  0.657   1.00 42.49 ? 101 ARG B CD  1 
ATOM   802  N NE  . ARG B  1 6   ? -16.548 -51.440  0.756   1.00 42.58 ? 101 ARG B NE  1 
ATOM   803  C CZ  . ARG B  1 6   ? -16.881 -50.202  1.107   1.00 42.12 ? 101 ARG B CZ  1 
ATOM   804  N NH1 . ARG B  1 6   ? -18.163 -49.865  1.157   1.00 43.20 ? 101 ARG B NH1 1 
ATOM   805  N NH2 . ARG B  1 6   ? -15.948 -49.300  1.410   1.00 39.82 ? 101 ARG B NH2 1 
ATOM   806  N N   . PRO B  1 7   ? -15.229 -55.211  -3.388  1.00 31.17 ? 102 PRO B N   1 
ATOM   807  C CA  . PRO B  1 7   ? -15.603 -55.206  -4.794  1.00 30.33 ? 102 PRO B CA  1 
ATOM   808  C C   . PRO B  1 7   ? -16.170 -53.867  -5.248  1.00 29.16 ? 102 PRO B C   1 
ATOM   809  O O   . PRO B  1 7   ? -16.611 -53.072  -4.430  1.00 26.25 ? 102 PRO B O   1 
ATOM   810  C CB  . PRO B  1 7   ? -16.700 -56.261  -4.860  1.00 31.72 ? 102 PRO B CB  1 
ATOM   811  C CG  . PRO B  1 7   ? -17.376 -56.145  -3.535  1.00 32.34 ? 102 PRO B CG  1 
ATOM   812  C CD  . PRO B  1 7   ? -16.217 -55.952  -2.578  1.00 31.07 ? 102 PRO B CD  1 
ATOM   813  N N   . CYS B  1 8   ? -16.163 -53.660  -6.557  1.00 28.27 ? 103 CYS B N   1 
ATOM   814  C CA  . CYS B  1 8   ? -16.676 -52.451  -7.175  1.00 28.09 ? 103 CYS B CA  1 
ATOM   815  C C   . CYS B  1 8   ? -18.028 -52.078  -6.618  1.00 27.85 ? 103 CYS B C   1 
ATOM   816  O O   . CYS B  1 8   ? -18.962 -52.852  -6.716  1.00 27.88 ? 103 CYS B O   1 
ATOM   817  C CB  . CYS B  1 8   ? -16.801 -52.636  -8.678  1.00 27.61 ? 103 CYS B CB  1 
ATOM   818  S SG  . CYS B  1 8   ? -17.543 -51.237  -9.545  1.00 28.04 ? 103 CYS B SG  1 
ATOM   819  N N   . GLY B  1 9   ? -18.127 -50.890  -6.036  1.00 26.76 ? 104 GLY B N   1 
ATOM   820  C CA  . GLY B  1 9   ? -19.416 -50.398  -5.535  1.00 27.91 ? 104 GLY B CA  1 
ATOM   821  C C   . GLY B  1 9   ? -19.417 -48.914  -5.181  1.00 26.54 ? 104 GLY B C   1 
ATOM   822  O O   . GLY B  1 9   ? -18.411 -48.238  -5.323  1.00 24.89 ? 104 GLY B O   1 
ATOM   823  N N   . LEU B  1 10  ? -20.559 -48.429  -4.696  1.00 27.77 ? 105 LEU B N   1 
ATOM   824  C CA  . LEU B  1 10  ? -20.688 -47.049  -4.232  1.00 28.51 ? 105 LEU B CA  1 
ATOM   825  C C   . LEU B  1 10  ? -19.843 -46.747  -3.006  1.00 28.38 ? 105 LEU B C   1 
ATOM   826  O O   . LEU B  1 10  ? -19.707 -47.580  -2.112  1.00 28.71 ? 105 LEU B O   1 
ATOM   827  C CB  . LEU B  1 10  ? -22.143 -46.731  -3.878  1.00 30.39 ? 105 LEU B CB  1 
ATOM   828  C CG  . LEU B  1 10  ? -23.097 -46.477  -5.045  1.00 31.60 ? 105 LEU B CG  1 
ATOM   829  C CD1 . LEU B  1 10  ? -24.540 -46.505  -4.558  1.00 32.48 ? 105 LEU B CD1 1 
ATOM   830  C CD2 . LEU B  1 10  ? -22.779 -45.151  -5.736  1.00 32.09 ? 105 LEU B CD2 1 
ATOM   831  N N   . ARG B  1 11  ? -19.286 -45.541  -2.977  1.00 26.61 ? 106 ARG B N   1 
ATOM   832  C CA  . ARG B  1 11  ? -18.612 -44.995  -1.807  1.00 26.62 ? 106 ARG B CA  1 
ATOM   833  C C   . ARG B  1 11  ? -19.112 -43.576  -1.606  1.00 26.69 ? 106 ARG B C   1 
ATOM   834  O O   . ARG B  1 11  ? -19.578 -42.941  -2.549  1.00 25.28 ? 106 ARG B O   1 
ATOM   835  C CB  . ARG B  1 11  ? -17.101 -44.951  -2.000  1.00 26.81 ? 106 ARG B CB  1 
ATOM   836  C CG  . ARG B  1 11  ? -16.477 -46.246  -2.511  1.00 27.29 ? 106 ARG B CG  1 
ATOM   837  C CD  . ARG B  1 11  ? -16.402 -47.317  -1.434  1.00 26.65 ? 106 ARG B CD  1 
ATOM   838  N NE  . ARG B  1 11  ? -15.718 -48.498  -1.969  1.00 25.89 ? 106 ARG B NE  1 
ATOM   839  C CZ  . ARG B  1 11  ? -16.320 -49.587  -2.434  1.00 24.74 ? 106 ARG B CZ  1 
ATOM   840  N NH1 . ARG B  1 11  ? -15.584 -50.576  -2.925  1.00 25.49 ? 106 ARG B NH1 1 
ATOM   841  N NH2 . ARG B  1 11  ? -17.635 -49.709  -2.416  1.00 24.21 ? 106 ARG B NH2 1 
ATOM   842  N N   . GLU B  1 12  ? -18.967 -43.087  -0.382  1.00 27.09 ? 107 GLU B N   1 
ATOM   843  C CA  . GLU B  1 12  ? -19.505 -41.784  0.042   1.00 29.67 ? 107 GLU B CA  1 
ATOM   844  C C   . GLU B  1 12  ? -18.458 -40.970  0.754   1.00 28.79 ? 107 GLU B C   1 
ATOM   845  O O   . GLU B  1 12  ? -17.680 -41.502  1.548   1.00 26.35 ? 107 GLU B O   1 
ATOM   846  C CB  . GLU B  1 12  ? -20.639 -41.960  1.055   1.00 30.93 ? 107 GLU B CB  1 
ATOM   847  C CG  . GLU B  1 12  ? -21.971 -42.258  0.425   1.00 33.96 ? 107 GLU B CG  1 
ATOM   848  C CD  . GLU B  1 12  ? -23.041 -42.533  1.450   1.00 33.91 ? 107 GLU B CD  1 
ATOM   849  O OE1 . GLU B  1 12  ? -24.115 -43.005  1.038   1.00 37.00 ? 107 GLU B OE1 1 
ATOM   850  O OE2 . GLU B  1 12  ? -22.807 -42.263  2.646   1.00 32.93 ? 107 GLU B OE2 1 
ATOM   851  N N   . LEU B  1 13  ? -18.532 -39.664  0.541   1.00 27.83 ? 108 LEU B N   1 
ATOM   852  C CA  . LEU B  1 13  ? -17.638 -38.719  1.158   1.00 28.77 ? 108 LEU B CA  1 
ATOM   853  C C   . LEU B  1 13  ? -18.401 -37.388  1.311   1.00 26.46 ? 108 LEU B C   1 
ATOM   854  O O   . LEU B  1 13  ? -19.060 -36.965  0.372   1.00 23.18 ? 108 LEU B O   1 
ATOM   855  C CB  . LEU B  1 13  ? -16.437 -38.517  0.224   1.00 32.06 ? 108 LEU B CB  1 
ATOM   856  C CG  . LEU B  1 13  ? -15.022 -38.429  0.770   1.00 35.61 ? 108 LEU B CG  1 
ATOM   857  C CD1 . LEU B  1 13  ? -14.262 -37.411  -0.044  1.00 36.32 ? 108 LEU B CD1 1 
ATOM   858  C CD2 . LEU B  1 13  ? -14.964 -38.072  2.245   1.00 38.98 ? 108 LEU B CD2 1 
ATOM   859  N N   . GLU B  1 14  ? -18.321 -36.742  2.479   1.00 25.20 ? 109 GLU B N   1 
ATOM   860  C CA  . GLU B  1 14  ? -18.872 -35.388  2.649   1.00 25.11 ? 109 GLU B CA  1 
ATOM   861  C C   . GLU B  1 14  ? -17.846 -34.421  2.145   1.00 23.92 ? 109 GLU B C   1 
ATOM   862  O O   . GLU B  1 14  ? -16.707 -34.505  2.558   1.00 23.36 ? 109 GLU B O   1 
ATOM   863  C CB  . GLU B  1 14  ? -19.154 -35.080  4.116   1.00 26.16 ? 109 GLU B CB  1 
ATOM   864  C CG  . GLU B  1 14  ? -20.214 -35.967  4.719   1.00 26.62 ? 109 GLU B CG  1 
ATOM   865  C CD  . GLU B  1 14  ? -20.509 -35.639  6.174   1.00 27.37 ? 109 GLU B CD  1 
ATOM   866  O OE1 . GLU B  1 14  ? -21.227 -36.447  6.783   1.00 29.33 ? 109 GLU B OE1 1 
ATOM   867  O OE2 . GLU B  1 14  ? -20.053 -34.598  6.695   1.00 26.26 ? 109 GLU B OE2 1 
ATOM   868  N N   . VAL B  1 15  ? -18.222 -33.535  1.223   1.00 23.79 ? 110 VAL B N   1 
ATOM   869  C CA  . VAL B  1 15  ? -17.277 -32.572  0.670   1.00 22.71 ? 110 VAL B CA  1 
ATOM   870  C C   . VAL B  1 15  ? -17.867 -31.165  0.637   1.00 23.06 ? 110 VAL B C   1 
ATOM   871  O O   . VAL B  1 15  ? -19.087 -30.980  0.541   1.00 22.51 ? 110 VAL B O   1 
ATOM   872  C CB  . VAL B  1 15  ? -16.807 -32.952  -0.748  1.00 24.50 ? 110 VAL B CB  1 
ATOM   873  C CG1 . VAL B  1 15  ? -16.237 -34.368  -0.772  1.00 25.92 ? 110 VAL B CG1 1 
ATOM   874  C CG2 . VAL B  1 15  ? -17.942 -32.834  -1.754  1.00 24.30 ? 110 VAL B CG2 1 
ATOM   875  N N   . ARG B  1 16  ? -16.980 -30.186  0.722   1.00 22.47 ? 111 ARG B N   1 
ATOM   876  C CA  . ARG B  1 16  ? -17.306 -28.788  0.449   1.00 23.07 ? 111 ARG B CA  1 
ATOM   877  C C   . ARG B  1 16  ? -17.349 -28.591  -1.052  1.00 21.29 ? 111 ARG B C   1 
ATOM   878  O O   . ARG B  1 16  ? -16.411 -28.979  -1.750  1.00 20.69 ? 111 ARG B O   1 
ATOM   879  C CB  . ARG B  1 16  ? -16.202 -27.870  0.947   1.00 25.72 ? 111 ARG B CB  1 
ATOM   880  C CG  . ARG B  1 16  ? -16.192 -27.389  2.390   1.00 30.43 ? 111 ARG B CG  1 
ATOM   881  C CD  . ARG B  1 16  ? -17.405 -27.651  3.233   1.00 32.51 ? 111 ARG B CD  1 
ATOM   882  N NE  . ARG B  1 16  ? -17.056 -27.373  4.634   1.00 36.98 ? 111 ARG B NE  1 
ATOM   883  C CZ  . ARG B  1 16  ? -16.849 -26.164  5.161   1.00 39.74 ? 111 ARG B CZ  1 
ATOM   884  N NH1 . ARG B  1 16  ? -16.529 -26.051  6.449   1.00 40.34 ? 111 ARG B NH1 1 
ATOM   885  N NH2 . ARG B  1 16  ? -16.960 -25.063  4.426   1.00 42.76 ? 111 ARG B NH2 1 
ATOM   886  N N   . VAL B  1 17  ? -18.385 -27.930  -1.551  1.00 20.06 ? 112 VAL B N   1 
ATOM   887  C CA  . VAL B  1 17  ? -18.508 -27.679  -2.970  1.00 20.72 ? 112 VAL B CA  1 
ATOM   888  C C   . VAL B  1 17  ? -17.290 -26.940  -3.539  1.00 19.86 ? 112 VAL B C   1 
ATOM   889  O O   . VAL B  1 17  ? -16.863 -27.200  -4.655  1.00 19.94 ? 112 VAL B O   1 
ATOM   890  C CB  . VAL B  1 17  ? -19.799 -26.892  -3.285  1.00 22.71 ? 112 VAL B CB  1 
ATOM   891  C CG1 . VAL B  1 17  ? -19.766 -26.358  -4.702  1.00 23.99 ? 112 VAL B CG1 1 
ATOM   892  C CG2 . VAL B  1 17  ? -21.012 -27.796  -3.110  1.00 22.90 ? 112 VAL B CG2 1 
ATOM   893  N N   . SER B  1 18  ? -16.747 -26.008  -2.771  1.00 20.23 ? 113 SER B N   1 
ATOM   894  C CA  . SER B  1 18  ? -15.574 -25.196  -3.189  1.00 20.10 ? 113 SER B CA  1 
ATOM   895  C C   . SER B  1 18  ? -14.308 -26.013  -3.397  1.00 21.04 ? 113 SER B C   1 
ATOM   896  O O   . SER B  1 18  ? -13.438 -25.636  -4.177  1.00 21.60 ? 113 SER B O   1 
ATOM   897  C CB  . SER B  1 18  ? -15.292 -24.185  -2.100  1.00 19.52 ? 113 SER B CB  1 
ATOM   898  O OG  . SER B  1 18  ? -15.134 -24.852  -0.876  1.00 18.10 ? 113 SER B OG  1 
ATOM   899  N N   . GLU B  1 19  ? -14.249 -27.133  -2.689  1.00 21.49 ? 114 GLU B N   1 
ATOM   900  C CA  . GLU B  1 19  ? -13.146 -28.083  -2.697  1.00 23.91 ? 114 GLU B CA  1 
ATOM   901  C C   . GLU B  1 19  ? -13.012 -28.823  -4.020  1.00 22.86 ? 114 GLU B C   1 
ATOM   902  O O   . GLU B  1 19  ? -11.938 -29.364  -4.323  1.00 21.21 ? 114 GLU B O   1 
ATOM   903  C CB  . GLU B  1 19  ? -13.465 -29.128  -1.620  1.00 27.11 ? 114 GLU B CB  1 
ATOM   904  C CG  . GLU B  1 19  ? -12.338 -29.964  -1.130  1.00 30.06 ? 114 GLU B CG  1 
ATOM   905  C CD  . GLU B  1 19  ? -12.796 -31.025  -0.152  1.00 29.01 ? 114 GLU B CD  1 
ATOM   906  O OE1 . GLU B  1 19  ? -11.961 -31.884  0.126   1.00 31.56 ? 114 GLU B OE1 1 
ATOM   907  O OE2 . GLU B  1 19  ? -13.946 -31.016  0.343   1.00 27.01 ? 114 GLU B OE2 1 
ATOM   908  N N   . LEU B  1 20  ? -14.112 -28.891  -4.777  1.00 21.08 ? 115 LEU B N   1 
ATOM   909  C CA  . LEU B  1 20  ? -14.132 -29.663  -6.020  1.00 21.34 ? 115 LEU B CA  1 
ATOM   910  C C   . LEU B  1 20  ? -13.450 -28.956  -7.201  1.00 20.16 ? 115 LEU B C   1 
ATOM   911  O O   . LEU B  1 20  ? -13.232 -29.562  -8.238  1.00 19.59 ? 115 LEU B O   1 
ATOM   912  C CB  . LEU B  1 20  ? -15.567 -30.017  -6.397  1.00 21.51 ? 115 LEU B CB  1 
ATOM   913  C CG  . LEU B  1 20  ? -16.347 -30.811  -5.348  1.00 21.88 ? 115 LEU B CG  1 
ATOM   914  C CD1 . LEU B  1 20  ? -17.763 -31.097  -5.805  1.00 22.45 ? 115 LEU B CD1 1 
ATOM   915  C CD2 . LEU B  1 20  ? -15.644 -32.101  -4.968  1.00 22.14 ? 115 LEU B CD2 1 
ATOM   916  N N   . GLY B  1 21  ? -13.146 -27.672  -7.055  1.00 19.74 ? 116 GLY B N   1 
ATOM   917  C CA  . GLY B  1 21  ? -12.391 -26.945  -8.084  1.00 20.24 ? 116 GLY B CA  1 
ATOM   918  C C   . GLY B  1 21  ? -13.199 -26.729  -9.361  1.00 20.56 ? 116 GLY B C   1 
ATOM   919  O O   . GLY B  1 21  ? -12.626 -26.651  -10.456 1.00 20.46 ? 116 GLY B O   1 
ATOM   920  N N   . LEU B  1 22  ? -14.519 -26.638  -9.210  1.00 19.41 ? 117 LEU B N   1 
ATOM   921  C CA  . LEU B  1 22  ? -15.420 -26.545  -10.338 1.00 21.00 ? 117 LEU B CA  1 
ATOM   922  C C   . LEU B  1 22  ? -15.896 -25.117  -10.594 1.00 21.75 ? 117 LEU B C   1 
ATOM   923  O O   . LEU B  1 22  ? -16.777 -24.908  -11.403 1.00 21.19 ? 117 LEU B O   1 
ATOM   924  C CB  . LEU B  1 22  ? -16.630 -27.457  -10.117 1.00 21.86 ? 117 LEU B CB  1 
ATOM   925  C CG  . LEU B  1 22  ? -16.359 -28.963  -10.178 1.00 22.62 ? 117 LEU B CG  1 
ATOM   926  C CD1 . LEU B  1 22  ? -17.622 -29.720  -9.749  1.00 22.98 ? 117 LEU B CD1 1 
ATOM   927  C CD2 . LEU B  1 22  ? -15.931 -29.389  -11.571 1.00 22.52 ? 117 LEU B CD2 1 
ATOM   928  N N   . GLY B  1 23  ? -15.292 -24.139  -9.921  1.00 22.33 ? 118 GLY B N   1 
ATOM   929  C CA  . GLY B  1 23  ? -15.649 -22.741  -10.122 1.00 23.81 ? 118 GLY B CA  1 
ATOM   930  C C   . GLY B  1 23  ? -16.782 -22.214  -9.257  1.00 24.13 ? 118 GLY B C   1 
ATOM   931  O O   . GLY B  1 23  ? -17.209 -21.078  -9.456  1.00 25.65 ? 118 GLY B O   1 
ATOM   932  N N   . TYR B  1 24  ? -17.259 -23.012  -8.298  1.00 23.54 ? 119 TYR B N   1 
ATOM   933  C CA  . TYR B  1 24  ? -18.314 -22.584  -7.390  1.00 24.19 ? 119 TYR B CA  1 
ATOM   934  C C   . TYR B  1 24  ? -17.737 -22.116  -6.076  1.00 22.84 ? 119 TYR B C   1 
ATOM   935  O O   . TYR B  1 24  ? -17.134 -22.898  -5.342  1.00 23.94 ? 119 TYR B O   1 
ATOM   936  C CB  . TYR B  1 24  ? -19.301 -23.719  -7.117  1.00 25.89 ? 119 TYR B CB  1 
ATOM   937  C CG  . TYR B  1 24  ? -19.994 -24.206  -8.359  1.00 26.59 ? 119 TYR B CG  1 
ATOM   938  C CD1 . TYR B  1 24  ? -20.945 -23.404  -9.009  1.00 27.86 ? 119 TYR B CD1 1 
ATOM   939  C CD2 . TYR B  1 24  ? -19.706 -25.460  -8.888  1.00 26.24 ? 119 TYR B CD2 1 
ATOM   940  C CE1 . TYR B  1 24  ? -21.575 -23.839  -10.164 1.00 28.86 ? 119 TYR B CE1 1 
ATOM   941  C CE2 . TYR B  1 24  ? -20.316 -25.898  -10.050 1.00 27.86 ? 119 TYR B CE2 1 
ATOM   942  C CZ  . TYR B  1 24  ? -21.247 -25.090  -10.685 1.00 29.17 ? 119 TYR B CZ  1 
ATOM   943  O OH  . TYR B  1 24  ? -21.877 -25.536  -11.826 1.00 29.94 ? 119 TYR B OH  1 
ATOM   944  N N   . ALA B  1 25  ? -17.929 -20.845  -5.780  1.00 21.24 ? 120 ALA B N   1 
ATOM   945  C CA  . ALA B  1 25  ? -17.471 -20.269  -4.529  1.00 21.89 ? 120 ALA B CA  1 
ATOM   946  C C   . ALA B  1 25  ? -18.543 -20.465  -3.469  1.00 20.34 ? 120 ALA B C   1 
ATOM   947  O O   . ALA B  1 25  ? -19.269 -19.540  -3.145  1.00 20.19 ? 120 ALA B O   1 
ATOM   948  C CB  . ALA B  1 25  ? -17.168 -18.782  -4.722  1.00 22.91 ? 120 ALA B CB  1 
ATOM   949  N N   . SER B  1 26  ? -18.676 -21.687  -2.972  1.00 21.09 ? 121 SER B N   1 
ATOM   950  C CA  . SER B  1 26  ? -19.685 -22.010  -1.967  1.00 21.20 ? 121 SER B CA  1 
ATOM   951  C C   . SER B  1 26  ? -19.088 -22.848  -0.865  1.00 22.03 ? 121 SER B C   1 
ATOM   952  O O   . SER B  1 26  ? -18.435 -23.872  -1.131  1.00 22.94 ? 121 SER B O   1 
ATOM   953  C CB  . SER B  1 26  ? -20.861 -22.742  -2.591  1.00 21.33 ? 121 SER B CB  1 
ATOM   954  O OG  . SER B  1 26  ? -21.788 -23.206  -1.595  1.00 19.74 ? 121 SER B OG  1 
ATOM   955  N N   . ASP B  1 27  ? -19.332 -22.432  0.375   1.00 21.49 ? 122 ASP B N   1 
ATOM   956  C CA  . ASP B  1 27  ? -18.935 -23.228  1.530   1.00 22.42 ? 122 ASP B CA  1 
ATOM   957  C C   . ASP B  1 27  ? -19.934 -24.355  1.866   1.00 21.12 ? 122 ASP B C   1 
ATOM   958  O O   . ASP B  1 27  ? -19.749 -25.034  2.872   1.00 20.14 ? 122 ASP B O   1 
ATOM   959  C CB  . ASP B  1 27  ? -18.770 -22.338  2.765   1.00 24.70 ? 122 ASP B CB  1 
ATOM   960  C CG  . ASP B  1 27  ? -17.678 -21.307  2.610   1.00 27.20 ? 122 ASP B CG  1 
ATOM   961  O OD1 . ASP B  1 27  ? -16.761 -21.484  1.787   1.00 28.24 ? 122 ASP B OD1 1 
ATOM   962  O OD2 . ASP B  1 27  ? -17.742 -20.297  3.340   1.00 33.49 ? 122 ASP B OD2 1 
ATOM   963  N N   . GLU B  1 28  ? -20.993 -24.534  1.060   1.00 19.81 ? 123 GLU B N   1 
ATOM   964  C CA  . GLU B  1 28  ? -21.943 -25.631  1.263   1.00 19.97 ? 123 GLU B CA  1 
ATOM   965  C C   . GLU B  1 28  ? -21.278 -27.014  1.161   1.00 20.93 ? 123 GLU B C   1 
ATOM   966  O O   . GLU B  1 28  ? -20.250 -27.177  0.483   1.00 21.36 ? 123 GLU B O   1 
ATOM   967  C CB  . GLU B  1 28  ? -23.114 -25.546  0.287   1.00 19.13 ? 123 GLU B CB  1 
ATOM   968  C CG  . GLU B  1 28  ? -24.124 -24.476  0.676   1.00 19.66 ? 123 GLU B CG  1 
ATOM   969  C CD  . GLU B  1 28  ? -25.584 -24.848  0.384   1.00 19.78 ? 123 GLU B CD  1 
ATOM   970  O OE1 . GLU B  1 28  ? -25.935 -26.053  0.379   1.00 18.12 ? 123 GLU B OE1 1 
ATOM   971  O OE2 . GLU B  1 28  ? -26.391 -23.915  0.157   1.00 18.52 ? 123 GLU B OE2 1 
ATOM   972  N N   . THR B  1 29  ? -21.843 -28.002  1.849   1.00 21.65 ? 124 THR B N   1 
ATOM   973  C CA  . THR B  1 29  ? -21.345 -29.374  1.693   1.00 23.02 ? 124 THR B CA  1 
ATOM   974  C C   . THR B  1 29  ? -22.360 -30.250  0.959   1.00 22.55 ? 124 THR B C   1 
ATOM   975  O O   . THR B  1 29  ? -23.577 -30.076  1.071   1.00 22.22 ? 124 THR B O   1 
ATOM   976  C CB  . THR B  1 29  ? -20.781 -30.055  2.997   1.00 24.80 ? 124 THR B CB  1 
ATOM   977  O OG1 . THR B  1 29  ? -21.460 -31.283  3.316   1.00 27.19 ? 124 THR B OG1 1 
ATOM   978  C CG2 . THR B  1 29  ? -20.733 -29.164  4.151   1.00 22.89 ? 124 THR B CG2 1 
ATOM   979  N N   . VAL B  1 30  ? -21.836 -31.160  0.150   1.00 22.13 ? 125 VAL B N   1 
ATOM   980  C CA  . VAL B  1 30  ? -22.664 -32.142  -0.509  1.00 21.91 ? 125 VAL B CA  1 
ATOM   981  C C   . VAL B  1 30  ? -22.144 -33.522  -0.170  1.00 21.96 ? 125 VAL B C   1 
ATOM   982  O O   . VAL B  1 30  ? -20.977 -33.680  0.176   1.00 22.03 ? 125 VAL B O   1 
ATOM   983  C CB  . VAL B  1 30  ? -22.666 -31.968  -2.038  1.00 21.66 ? 125 VAL B CB  1 
ATOM   984  C CG1 . VAL B  1 30  ? -23.186 -30.591  -2.408  1.00 21.44 ? 125 VAL B CG1 1 
ATOM   985  C CG2 . VAL B  1 30  ? -21.282 -32.206  -2.635  1.00 21.13 ? 125 VAL B CG2 1 
ATOM   986  N N   . LEU B  1 31  ? -23.018 -34.510  -0.289  1.00 21.89 ? 126 LEU B N   1 
ATOM   987  C CA  . LEU B  1 31  ? -22.624 -35.891  -0.137  0.50 23.33 ? 126 LEU B CA  1 
ATOM   988  C C   . LEU B  1 31  ? -22.132 -36.315  -1.496  1.00 23.05 ? 126 LEU B C   1 
ATOM   989  O O   . LEU B  1 31  ? -22.909 -36.385  -2.430  1.00 25.30 ? 126 LEU B O   1 
ATOM   990  C CB  . LEU B  1 31  ? -23.822 -36.722  0.281   1.00 24.98 ? 126 LEU B CB  1 
ATOM   991  C CG  . LEU B  1 31  ? -23.647 -38.056  1.012   1.00 27.71 ? 126 LEU B CG  1 
ATOM   992  C CD1 . LEU B  1 31  ? -23.984 -39.206  0.105   1.00 30.06 ? 126 LEU B CD1 1 
ATOM   993  C CD2 . LEU B  1 31  ? -22.280 -38.225  1.651   1.00 28.11 ? 126 LEU B CD2 1 
ATOM   994  N N   . PHE B  1 32  ? -20.832 -36.534  -1.634  1.00 22.78 ? 127 PHE B N   1 
ATOM   995  C CA  . PHE B  1 32  ? -20.268 -36.937  -2.906  1.00 23.07 ? 127 PHE B CA  1 
ATOM   996  C C   . PHE B  1 32  ? -20.186 -38.463  -2.960  1.00 23.85 ? 127 PHE B C   1 
ATOM   997  O O   . PHE B  1 32  ? -19.509 -39.072  -2.148  1.00 24.21 ? 127 PHE B O   1 
ATOM   998  C CB  . PHE B  1 32  ? -18.893 -36.292  -3.143  1.00 22.36 ? 127 PHE B CB  1 
ATOM   999  C CG  . PHE B  1 32  ? -18.323 -36.591  -4.498  1.00 22.99 ? 127 PHE B CG  1 
ATOM   1000 C CD1 . PHE B  1 32  ? -18.739 -35.887  -5.607  1.00 24.14 ? 127 PHE B CD1 1 
ATOM   1001 C CD2 . PHE B  1 32  ? -17.409 -37.628  -4.676  1.00 23.65 ? 127 PHE B CD2 1 
ATOM   1002 C CE1 . PHE B  1 32  ? -18.234 -36.178  -6.879  1.00 25.00 ? 127 PHE B CE1 1 
ATOM   1003 C CE2 . PHE B  1 32  ? -16.902 -37.917  -5.935  1.00 23.74 ? 127 PHE B CE2 1 
ATOM   1004 C CZ  . PHE B  1 32  ? -17.317 -37.198  -7.038  1.00 23.84 ? 127 PHE B CZ  1 
ATOM   1005 N N   . ARG B  1 33  ? -20.898 -39.070  -3.912  1.00 25.24 ? 128 ARG B N   1 
ATOM   1006 C CA  . ARG B  1 33  ? -20.898 -40.527  -4.088  1.00 25.35 ? 128 ARG B CA  1 
ATOM   1007 C C   . ARG B  1 33  ? -20.154 -40.907  -5.372  1.00 24.20 ? 128 ARG B C   1 
ATOM   1008 O O   . ARG B  1 33  ? -20.391 -40.321  -6.439  1.00 22.77 ? 128 ARG B O   1 
ATOM   1009 C CB  . ARG B  1 33  ? -22.320 -41.083  -4.169  1.00 28.78 ? 128 ARG B CB  1 
ATOM   1010 C CG  . ARG B  1 33  ? -23.119 -41.052  -2.882  1.00 33.08 ? 128 ARG B CG  1 
ATOM   1011 C CD  . ARG B  1 33  ? -24.374 -41.919  -2.984  1.00 36.05 ? 128 ARG B CD  1 
ATOM   1012 N NE  . ARG B  1 33  ? -24.963 -42.220  -1.674  1.00 39.78 ? 128 ARG B NE  1 
ATOM   1013 C CZ  . ARG B  1 33  ? -26.118 -41.728  -1.203  1.00 43.69 ? 128 ARG B CZ  1 
ATOM   1014 N NH1 . ARG B  1 33  ? -26.860 -40.887  -1.921  1.00 43.68 ? 128 ARG B NH1 1 
ATOM   1015 N NH2 . ARG B  1 33  ? -26.540 -42.073  0.017   1.00 44.50 ? 128 ARG B NH2 1 
ATOM   1016 N N   . TYR B  1 34  ? -19.284 -41.911  -5.280  1.00 22.87 ? 129 TYR B N   1 
ATOM   1017 C CA  . TYR B  1 34  ? -18.513 -42.360  -6.432  1.00 22.13 ? 129 TYR B CA  1 
ATOM   1018 C C   . TYR B  1 34  ? -18.326 -43.882  -6.483  1.00 22.70 ? 129 TYR B C   1 
ATOM   1019 O O   . TYR B  1 34  ? -18.712 -44.591  -5.560  1.00 23.09 ? 129 TYR B O   1 
ATOM   1020 C CB  . TYR B  1 34  ? -17.170 -41.667  -6.439  1.00 22.50 ? 129 TYR B CB  1 
ATOM   1021 C CG  . TYR B  1 34  ? -16.298 -42.003  -5.276  1.00 22.89 ? 129 TYR B CG  1 
ATOM   1022 C CD1 . TYR B  1 34  ? -16.438 -41.349  -4.068  1.00 23.60 ? 129 TYR B CD1 1 
ATOM   1023 C CD2 . TYR B  1 34  ? -15.306 -42.967  -5.393  1.00 24.43 ? 129 TYR B CD2 1 
ATOM   1024 C CE1 . TYR B  1 34  ? -15.618 -41.649  -2.988  1.00 24.40 ? 129 TYR B CE1 1 
ATOM   1025 C CE2 . TYR B  1 34  ? -14.493 -43.292  -4.319  1.00 24.92 ? 129 TYR B CE2 1 
ATOM   1026 C CZ  . TYR B  1 34  ? -14.649 -42.617  -3.128  1.00 24.95 ? 129 TYR B CZ  1 
ATOM   1027 O OH  . TYR B  1 34  ? -13.822 -42.924  -2.095  1.00 26.54 ? 129 TYR B OH  1 
ATOM   1028 N N   . CYS B  1 35  ? -17.770 -44.364  -7.591  1.00 21.74 ? 130 CYS B N   1 
ATOM   1029 C CA  . CYS B  1 35  ? -17.618 -45.794  -7.842  1.00 23.11 ? 130 CYS B CA  1 
ATOM   1030 C C   . CYS B  1 35  ? -16.156 -46.199  -7.731  1.00 23.16 ? 130 CYS B C   1 
ATOM   1031 O O   . CYS B  1 35  ? -15.311 -45.633  -8.410  1.00 21.18 ? 130 CYS B O   1 
ATOM   1032 C CB  . CYS B  1 35  ? -18.143 -46.147  -9.232  1.00 22.94 ? 130 CYS B CB  1 
ATOM   1033 S SG  . CYS B  1 35  ? -19.923 -45.885  -9.381  1.00 25.31 ? 130 CYS B SG  1 
ATOM   1034 N N   . ALA B  1 36  ? -15.889 -47.167  -6.856  1.00 23.71 ? 131 ALA B N   1 
ATOM   1035 C CA  . ALA B  1 36  ? -14.547 -47.689  -6.634  1.00 25.77 ? 131 ALA B CA  1 
ATOM   1036 C C   . ALA B  1 36  ? -14.588 -49.184  -6.268  1.00 25.07 ? 131 ALA B C   1 
ATOM   1037 O O   . ALA B  1 36  ? -15.627 -49.724  -5.895  1.00 24.73 ? 131 ALA B O   1 
ATOM   1038 C CB  . ALA B  1 36  ? -13.875 -46.899  -5.528  1.00 26.77 ? 131 ALA B CB  1 
ATOM   1039 N N   . GLY B  1 37  ? -13.441 -49.835  -6.372  1.00 27.13 ? 132 GLY B N   1 
ATOM   1040 C CA  . GLY B  1 37  ? -13.310 -51.250  -5.994  1.00 28.14 ? 132 GLY B CA  1 
ATOM   1041 C C   . GLY B  1 37  ? -12.881 -52.161  -7.128  1.00 28.87 ? 132 GLY B C   1 
ATOM   1042 O O   . GLY B  1 37  ? -12.685 -51.715  -8.253  1.00 28.60 ? 132 GLY B O   1 
ATOM   1043 N N   . ALA B  1 38  ? -12.756 -53.449  -6.814  1.00 29.98 ? 133 ALA B N   1 
ATOM   1044 C CA  . ALA B  1 38  ? -12.233 -54.449  -7.746  1.00 28.56 ? 133 ALA B CA  1 
ATOM   1045 C C   . ALA B  1 38  ? -13.330 -55.123  -8.571  1.00 28.23 ? 133 ALA B C   1 
ATOM   1046 O O   . ALA B  1 38  ? -14.466 -55.296  -8.127  1.00 25.16 ? 133 ALA B O   1 
ATOM   1047 C CB  . ALA B  1 38  ? -11.445 -55.499  -6.980  1.00 28.93 ? 133 ALA B CB  1 
ATOM   1048 N N   . CYS B  1 39  ? -12.966 -55.497  -9.788  1.00 29.07 ? 134 CYS B N   1 
ATOM   1049 C CA  . CYS B  1 39  ? -13.809 -56.306  -10.647 1.00 30.09 ? 134 CYS B CA  1 
ATOM   1050 C C   . CYS B  1 39  ? -13.181 -57.702  -10.725 1.00 32.63 ? 134 CYS B C   1 
ATOM   1051 O O   . CYS B  1 39  ? -12.247 -57.951  -11.487 1.00 33.14 ? 134 CYS B O   1 
ATOM   1052 C CB  . CYS B  1 39  ? -13.888 -55.665  -12.020 1.00 29.84 ? 134 CYS B CB  1 
ATOM   1053 S SG  . CYS B  1 39  ? -14.713 -54.053  -11.966 1.00 28.02 ? 134 CYS B SG  1 
ATOM   1054 N N   . GLU B  1 40  ? -13.693 -58.607  -9.910  1.00 34.40 ? 135 GLU B N   1 
ATOM   1055 C CA  . GLU B  1 40  ? -13.083 -59.922  -9.749  1.00 36.80 ? 135 GLU B CA  1 
ATOM   1056 C C   . GLU B  1 40  ? -13.968 -61.029  -10.315 1.00 31.23 ? 135 GLU B C   1 
ATOM   1057 O O   . GLU B  1 40  ? -13.627 -62.175  -10.214 1.00 32.09 ? 135 GLU B O   1 
ATOM   1058 C CB  . GLU B  1 40  ? -12.803 -60.171  -8.256  1.00 41.54 ? 135 GLU B CB  1 
ATOM   1059 C CG  . GLU B  1 40  ? -12.085 -59.026  -7.545  1.00 47.12 ? 135 GLU B CG  1 
ATOM   1060 C CD  . GLU B  1 40  ? -10.572 -59.210  -7.440  1.00 53.54 ? 135 GLU B CD  1 
ATOM   1061 O OE1 . GLU B  1 40  ? -9.904  -59.341  -8.501  1.00 56.20 ? 135 GLU B OE1 1 
ATOM   1062 O OE2 . GLU B  1 40  ? -10.053 -59.181  -6.289  1.00 55.90 ? 135 GLU B OE2 1 
ATOM   1063 N N   . ALA B  1 41  ? -15.099 -60.694  -10.921 1.00 29.31 ? 136 ALA B N   1 
ATOM   1064 C CA  . ALA B  1 41  ? -15.941 -61.704  -11.540 1.00 28.96 ? 136 ALA B CA  1 
ATOM   1065 C C   . ALA B  1 41  ? -15.152 -62.388  -12.648 1.00 27.29 ? 136 ALA B C   1 
ATOM   1066 O O   . ALA B  1 41  ? -14.227 -61.799  -13.196 1.00 25.01 ? 136 ALA B O   1 
ATOM   1067 C CB  . ALA B  1 41  ? -17.209 -61.088  -12.097 1.00 28.67 ? 136 ALA B CB  1 
ATOM   1068 N N   . ALA B  1 42  ? -15.499 -63.641  -12.932 1.00 25.39 ? 137 ALA B N   1 
ATOM   1069 C CA  . ALA B  1 42  ? -14.901 -64.374  -14.035 1.00 23.85 ? 137 ALA B CA  1 
ATOM   1070 C C   . ALA B  1 42  ? -15.049 -63.583  -15.324 1.00 23.37 ? 137 ALA B C   1 
ATOM   1071 O O   . ALA B  1 42  ? -16.083 -63.005  -15.585 1.00 21.89 ? 137 ALA B O   1 
ATOM   1072 C CB  . ALA B  1 42  ? -15.574 -65.725  -14.195 1.00 23.82 ? 137 ALA B CB  1 
ATOM   1073 N N   . ALA B  1 43  ? -14.015 -63.614  -16.145 1.00 23.88 ? 138 ALA B N   1 
ATOM   1074 C CA  . ALA B  1 43  ? -14.011 -62.914  -17.409 1.00 25.07 ? 138 ALA B CA  1 
ATOM   1075 C C   . ALA B  1 43  ? -15.144 -63.342  -18.345 1.00 24.64 ? 138 ALA B C   1 
ATOM   1076 O O   . ALA B  1 43  ? -15.460 -64.514  -18.447 1.00 26.68 ? 138 ALA B O   1 
ATOM   1077 C CB  . ALA B  1 43  ? -12.657 -63.094  -18.101 1.00 25.11 ? 138 ALA B CB  1 
ATOM   1078 N N   . ARG B  1 44  ? -15.752 -62.370  -19.007 1.00 24.62 ? 139 ARG B N   1 
ATOM   1079 C CA  . ARG B  1 44  ? -16.663 -62.614  -20.127 1.00 25.22 ? 139 ARG B CA  1 
ATOM   1080 C C   . ARG B  1 44  ? -15.986 -63.343  -21.268 1.00 23.38 ? 139 ARG B C   1 
ATOM   1081 O O   . ARG B  1 44  ? -14.797 -63.169  -21.496 1.00 22.64 ? 139 ARG B O   1 
ATOM   1082 C CB  . ARG B  1 44  ? -17.084 -61.281  -20.743 1.00 26.67 ? 139 ARG B CB  1 
ATOM   1083 C CG  . ARG B  1 44  ? -18.056 -60.464  -19.963 1.00 28.66 ? 139 ARG B CG  1 
ATOM   1084 C CD  . ARG B  1 44  ? -18.297 -59.166  -20.708 1.00 29.55 ? 139 ARG B CD  1 
ATOM   1085 N NE  . ARG B  1 44  ? -19.514 -58.543  -20.223 1.00 30.86 ? 139 ARG B NE  1 
ATOM   1086 C CZ  . ARG B  1 44  ? -20.736 -58.878  -20.606 1.00 30.41 ? 139 ARG B CZ  1 
ATOM   1087 N NH1 . ARG B  1 44  ? -20.936 -59.828  -21.497 1.00 29.99 ? 139 ARG B NH1 1 
ATOM   1088 N NH2 . ARG B  1 44  ? -21.769 -58.245  -20.084 1.00 32.65 ? 139 ARG B NH2 1 
ATOM   1089 N N   . VAL B  1 45  ? -16.761 -64.078  -22.056 1.00 22.88 ? 140 VAL B N   1 
ATOM   1090 C CA  . VAL B  1 45  ? -16.192 -64.701  -23.267 1.00 23.30 ? 140 VAL B CA  1 
ATOM   1091 C C   . VAL B  1 45  ? -15.636 -63.657  -24.236 1.00 21.94 ? 140 VAL B C   1 
ATOM   1092 O O   . VAL B  1 45  ? -14.596 -63.866  -24.830 1.00 21.42 ? 140 VAL B O   1 
ATOM   1093 C CB  . VAL B  1 45  ? -17.173 -65.660  -23.986 1.00 25.18 ? 140 VAL B CB  1 
ATOM   1094 C CG1 . VAL B  1 45  ? -17.501 -66.829  -23.071 1.00 25.94 ? 140 VAL B CG1 1 
ATOM   1095 C CG2 . VAL B  1 45  ? -18.444 -64.951  -24.436 1.00 24.98 ? 140 VAL B CG2 1 
ATOM   1096 N N   . TYR B  1 46  ? -16.307 -62.513  -24.351 1.00 21.61 ? 141 TYR B N   1 
ATOM   1097 C CA  . TYR B  1 46  ? -15.786 -61.385  -25.133 1.00 21.85 ? 141 TYR B CA  1 
ATOM   1098 C C   . TYR B  1 46  ? -14.380 -60.987  -24.737 1.00 21.46 ? 141 TYR B C   1 
ATOM   1099 O O   . TYR B  1 46  ? -13.484 -60.914  -25.575 1.00 22.02 ? 141 TYR B O   1 
ATOM   1100 C CB  . TYR B  1 46  ? -16.727 -60.188  -25.006 1.00 22.32 ? 141 TYR B CB  1 
ATOM   1101 C CG  . TYR B  1 46  ? -16.172 -58.881  -25.504 1.00 22.62 ? 141 TYR B CG  1 
ATOM   1102 C CD1 . TYR B  1 46  ? -16.190 -58.565  -26.854 1.00 23.44 ? 141 TYR B CD1 1 
ATOM   1103 C CD2 . TYR B  1 46  ? -15.641 -57.951  -24.623 1.00 22.76 ? 141 TYR B CD2 1 
ATOM   1104 C CE1 . TYR B  1 46  ? -15.685 -57.352  -27.313 1.00 24.20 ? 141 TYR B CE1 1 
ATOM   1105 C CE2 . TYR B  1 46  ? -15.142 -56.733  -25.067 1.00 23.58 ? 141 TYR B CE2 1 
ATOM   1106 C CZ  . TYR B  1 46  ? -15.172 -56.434  -26.415 1.00 24.01 ? 141 TYR B CZ  1 
ATOM   1107 O OH  . TYR B  1 46  ? -14.660 -55.230  -26.834 1.00 25.39 ? 141 TYR B OH  1 
ATOM   1108 N N   . ASP B  1 47  ? -14.184 -60.725  -23.454 1.00 23.20 ? 142 ASP B N   1 
ATOM   1109 C CA  . ASP B  1 47  ? -12.861 -60.343  -22.946 1.00 23.31 ? 142 ASP B CA  1 
ATOM   1110 C C   . ASP B  1 47  ? -11.818 -61.424  -23.094 1.00 24.16 ? 142 ASP B C   1 
ATOM   1111 O O   . ASP B  1 47  ? -10.670 -61.129  -23.398 1.00 25.59 ? 142 ASP B O   1 
ATOM   1112 C CB  . ASP B  1 47  ? -12.970 -59.890  -21.491 1.00 23.75 ? 142 ASP B CB  1 
ATOM   1113 C CG  . ASP B  1 47  ? -13.571 -58.518  -21.378 1.00 23.83 ? 142 ASP B CG  1 
ATOM   1114 O OD1 . ASP B  1 47  ? -13.238 -57.663  -22.236 1.00 23.88 ? 142 ASP B OD1 1 
ATOM   1115 O OD2 . ASP B  1 47  ? -14.385 -58.285  -20.465 1.00 23.82 ? 142 ASP B OD2 1 
ATOM   1116 N N   . LEU B  1 48  ? -12.203 -62.683  -22.900 1.00 25.43 ? 143 LEU B N   1 
ATOM   1117 C CA  . LEU B  1 48  ? -11.261 -63.785  -23.120 1.00 25.84 ? 143 LEU B CA  1 
ATOM   1118 C C   . LEU B  1 48  ? -10.834 -63.859  -24.591 1.00 24.53 ? 143 LEU B C   1 
ATOM   1119 O O   . LEU B  1 48  ? -9.647  -63.973  -24.901 1.00 22.89 ? 143 LEU B O   1 
ATOM   1120 C CB  . LEU B  1 48  ? -11.872 -65.107  -22.633 1.00 27.55 ? 143 LEU B CB  1 
ATOM   1121 C CG  . LEU B  1 48  ? -11.788 -65.265  -21.095 1.00 29.31 ? 143 LEU B CG  1 
ATOM   1122 C CD1 . LEU B  1 48  ? -12.746 -66.321  -20.594 1.00 29.95 ? 143 LEU B CD1 1 
ATOM   1123 C CD2 . LEU B  1 48  ? -10.374 -65.639  -20.678 1.00 30.60 ? 143 LEU B CD2 1 
ATOM   1124 N N   . GLY B  1 49  ? -11.796 -63.753  -25.503 1.00 23.91 ? 144 GLY B N   1 
ATOM   1125 C CA  . GLY B  1 49  ? -11.462 -63.742  -26.919 1.00 23.82 ? 144 GLY B CA  1 
ATOM   1126 C C   . GLY B  1 49  ? -10.578 -62.569  -27.269 1.00 25.24 ? 144 GLY B C   1 
ATOM   1127 O O   . GLY B  1 49  ? -9.589  -62.705  -27.994 1.00 24.28 ? 144 GLY B O   1 
ATOM   1128 N N   . LEU B  1 50  ? -10.943 -61.400  -26.756 1.00 26.96 ? 145 LEU B N   1 
ATOM   1129 C CA  . LEU B  1 50  ? -10.200 -60.179  -27.045 1.00 28.91 ? 145 LEU B CA  1 
ATOM   1130 C C   . LEU B  1 50  ? -8.762  -60.260  -26.517 1.00 31.79 ? 145 LEU B C   1 
ATOM   1131 O O   . LEU B  1 50  ? -7.822  -59.895  -27.221 1.00 31.86 ? 145 LEU B O   1 
ATOM   1132 C CB  . LEU B  1 50  ? -10.947 -58.980  -26.450 1.00 29.08 ? 145 LEU B CB  1 
ATOM   1133 C CG  . LEU B  1 50  ? -10.597 -57.578  -26.889 1.00 28.36 ? 145 LEU B CG  1 
ATOM   1134 C CD1 . LEU B  1 50  ? -10.706 -57.422  -28.394 1.00 28.53 ? 145 LEU B CD1 1 
ATOM   1135 C CD2 . LEU B  1 50  ? -11.533 -56.612  -26.172 1.00 28.55 ? 145 LEU B CD2 1 
ATOM   1136 N N   . ARG B  1 51  ? -8.582  -60.768  -25.299 1.00 34.24 ? 146 ARG B N   1 
ATOM   1137 C CA  . ARG B  1 51  ? -7.235  -60.962  -24.760 1.00 36.19 ? 146 ARG B CA  1 
ATOM   1138 C C   . ARG B  1 51  ? -6.411  -61.834  -25.670 1.00 35.05 ? 146 ARG B C   1 
ATOM   1139 O O   . ARG B  1 51  ? -5.256  -61.529  -25.963 1.00 36.18 ? 146 ARG B O   1 
ATOM   1140 C CB  . ARG B  1 51  ? -7.258  -61.621  -23.378 1.00 38.01 ? 146 ARG B CB  1 
ATOM   1141 C CG  . ARG B  1 51  ? -7.385  -60.646  -22.239 1.00 43.45 ? 146 ARG B CG  1 
ATOM   1142 C CD  . ARG B  1 51  ? -7.801  -61.330  -20.939 1.00 47.54 ? 146 ARG B CD  1 
ATOM   1143 N NE  . ARG B  1 51  ? -8.823  -60.555  -20.234 1.00 49.36 ? 146 ARG B NE  1 
ATOM   1144 C CZ  . ARG B  1 51  ? -9.419  -60.922  -19.102 1.00 51.34 ? 146 ARG B CZ  1 
ATOM   1145 N NH1 . ARG B  1 51  ? -9.113  -62.075  -18.508 1.00 50.07 ? 146 ARG B NH1 1 
ATOM   1146 N NH2 . ARG B  1 51  ? -10.332 -60.120  -18.559 1.00 52.16 ? 146 ARG B NH2 1 
ATOM   1147 N N   . ARG B  1 52  ? -6.985  -62.958  -26.072 1.00 34.18 ? 147 ARG B N   1 
ATOM   1148 C CA  . ARG B  1 52  ? -6.238  -63.910  -26.856 1.00 33.33 ? 147 ARG B CA  1 
ATOM   1149 C C   . ARG B  1 52  ? -5.815  -63.270  -28.173 1.00 32.04 ? 147 ARG B C   1 
ATOM   1150 O O   . ARG B  1 52  ? -4.658  -63.381  -28.577 1.00 29.94 ? 147 ARG B O   1 
ATOM   1151 C CB  . ARG B  1 52  ? -7.053  -65.180  -27.097 1.00 35.62 ? 147 ARG B CB  1 
ATOM   1152 C CG  . ARG B  1 52  ? -6.465  -66.108  -28.151 1.00 36.77 ? 147 ARG B CG  1 
ATOM   1153 C CD  . ARG B  1 52  ? -5.065  -66.595  -27.784 1.00 38.51 ? 147 ARG B CD  1 
ATOM   1154 N NE  . ARG B  1 52  ? -5.124  -67.834  -27.005 1.00 41.30 ? 147 ARG B NE  1 
ATOM   1155 C CZ  . ARG B  1 52  ? -5.269  -69.063  -27.526 1.00 41.71 ? 147 ARG B CZ  1 
ATOM   1156 N NH1 . ARG B  1 52  ? -5.367  -69.265  -28.849 1.00 39.94 ? 147 ARG B NH1 1 
ATOM   1157 N NH2 . ARG B  1 52  ? -5.325  -70.105  -26.712 1.00 39.49 ? 147 ARG B NH2 1 
ATOM   1158 N N   . LEU B  1 53  ? -6.744  -62.587  -28.829 1.00 30.37 ? 148 LEU B N   1 
ATOM   1159 C CA  . LEU B  1 53  ? -6.447  -61.930  -30.103 1.00 31.28 ? 148 LEU B CA  1 
ATOM   1160 C C   . LEU B  1 53  ? -5.377  -60.836  -29.973 1.00 34.66 ? 148 LEU B C   1 
ATOM   1161 O O   . LEU B  1 53  ? -4.478  -60.727  -30.819 1.00 31.32 ? 148 LEU B O   1 
ATOM   1162 C CB  . LEU B  1 53  ? -7.721  -61.334  -30.699 1.00 28.91 ? 148 LEU B CB  1 
ATOM   1163 C CG  . LEU B  1 53  ? -8.759  -62.347  -31.179 1.00 28.18 ? 148 LEU B CG  1 
ATOM   1164 C CD1 . LEU B  1 53  ? -10.117 -61.682  -31.423 1.00 26.72 ? 148 LEU B CD1 1 
ATOM   1165 C CD2 . LEU B  1 53  ? -8.261  -63.045  -32.437 1.00 29.05 ? 148 LEU B CD2 1 
ATOM   1166 N N   . ARG B  1 54  ? -5.492  -60.027  -28.919 1.00 37.91 ? 149 ARG B N   1 
ATOM   1167 C CA  . ARG B  1 54  ? -4.469  -59.035  -28.592 1.00 43.23 ? 149 ARG B CA  1 
ATOM   1168 C C   . ARG B  1 54  ? -3.100  -59.677  -28.458 1.00 44.14 ? 149 ARG B C   1 
ATOM   1169 O O   . ARG B  1 54  ? -2.147  -59.243  -29.096 1.00 47.74 ? 149 ARG B O   1 
ATOM   1170 C CB  . ARG B  1 54  ? -4.809  -58.304  -27.295 1.00 44.42 ? 149 ARG B CB  1 
ATOM   1171 C CG  . ARG B  1 54  ? -3.821  -57.192  -26.962 1.00 45.83 ? 149 ARG B CG  1 
ATOM   1172 C CD  . ARG B  1 54  ? -3.678  -57.010  -25.465 1.00 45.63 ? 149 ARG B CD  1 
ATOM   1173 N NE  . ARG B  1 54  ? -4.740  -56.162  -24.943 1.00 43.28 ? 149 ARG B NE  1 
ATOM   1174 C CZ  . ARG B  1 54  ? -5.288  -56.274  -23.738 1.00 40.25 ? 149 ARG B CZ  1 
ATOM   1175 N NH1 . ARG B  1 54  ? -4.926  -57.230  -22.893 1.00 39.00 ? 149 ARG B NH1 1 
ATOM   1176 N NH2 . ARG B  1 54  ? -6.235  -55.423  -23.385 1.00 41.13 ? 149 ARG B NH2 1 
ATOM   1177 N N   . GLN B  1 55  ? -3.016  -60.720  -27.642 1.00 49.49 ? 150 GLN B N   1 
ATOM   1178 C CA  . GLN B  1 55  ? -1.753  -61.438  -27.396 1.00 52.96 ? 150 GLN B CA  1 
ATOM   1179 C C   . GLN B  1 55  ? -1.137  -62.012  -28.672 1.00 54.63 ? 150 GLN B C   1 
ATOM   1180 O O   . GLN B  1 55  ? 0.080   -61.995  -28.839 1.00 58.15 ? 150 GLN B O   1 
ATOM   1181 C CB  . GLN B  1 55  ? -1.966  -62.547  -26.361 1.00 53.99 ? 150 GLN B CB  1 
ATOM   1182 C CG  . GLN B  1 55  ? -2.302  -61.993  -24.975 1.00 57.64 ? 150 GLN B CG  1 
ATOM   1183 C CD  . GLN B  1 55  ? -2.753  -63.024  -23.942 1.00 60.04 ? 150 GLN B CD  1 
ATOM   1184 O OE1 . GLN B  1 55  ? -2.605  -62.785  -22.739 1.00 64.02 ? 150 GLN B OE1 1 
ATOM   1185 N NE2 . GLN B  1 55  ? -3.321  -64.153  -24.388 1.00 59.27 ? 150 GLN B NE2 1 
ATOM   1186 N N   . ARG B  1 56  ? -1.984  -62.484  -29.582 1.00 56.36 ? 151 ARG B N   1 
ATOM   1187 C CA  . ARG B  1 56  ? -1.532  -63.042  -30.857 1.00 58.05 ? 151 ARG B CA  1 
ATOM   1188 C C   . ARG B  1 56  ? -1.237  -61.939  -31.897 1.00 56.19 ? 151 ARG B C   1 
ATOM   1189 O O   . ARG B  1 56  ? -1.097  -62.226  -33.082 1.00 55.94 ? 151 ARG B O   1 
ATOM   1190 C CB  . ARG B  1 56  ? -2.587  -64.026  -31.387 1.00 61.95 ? 151 ARG B CB  1 
ATOM   1191 C CG  . ARG B  1 56  ? -2.729  -65.294  -30.551 1.00 67.25 ? 151 ARG B CG  1 
ATOM   1192 C CD  . ARG B  1 56  ? -1.763  -66.391  -30.996 1.00 74.33 ? 151 ARG B CD  1 
ATOM   1193 N NE  . ARG B  1 56  ? -2.156  -66.972  -32.289 1.00 79.87 ? 151 ARG B NE  1 
ATOM   1194 C CZ  . ARG B  1 56  ? -3.015  -67.981  -32.458 1.00 82.68 ? 151 ARG B CZ  1 
ATOM   1195 N NH1 . ARG B  1 56  ? -3.595  -68.573  -31.416 1.00 82.46 ? 151 ARG B NH1 1 
ATOM   1196 N NH2 . ARG B  1 56  ? -3.293  -68.408  -33.687 1.00 83.57 ? 151 ARG B NH2 1 
ATOM   1197 N N   . ARG B  1 57  ? -1.124  -60.688  -31.432 1.00 56.07 ? 152 ARG B N   1 
ATOM   1198 C CA  . ARG B  1 57  ? -0.916  -59.491  -32.275 1.00 55.56 ? 152 ARG B CA  1 
ATOM   1199 C C   . ARG B  1 57  ? -1.855  -59.368  -33.497 1.00 53.53 ? 152 ARG B C   1 
ATOM   1200 O O   . ARG B  1 57  ? -1.456  -58.896  -34.563 1.00 52.82 ? 152 ARG B O   1 
ATOM   1201 C CB  . ARG B  1 57  ? 0.582   -59.318  -32.650 1.00 61.48 ? 152 ARG B CB  1 
ATOM   1202 C CG  . ARG B  1 57  ? 1.417   -60.596  -32.809 1.00 65.89 ? 152 ARG B CG  1 
ATOM   1203 C CD  . ARG B  1 57  ? 2.912   -60.331  -32.658 1.00 70.58 ? 152 ARG B CD  1 
ATOM   1204 N NE  . ARG B  1 57  ? 3.338   -60.456  -31.258 1.00 74.40 ? 152 ARG B NE  1 
ATOM   1205 C CZ  . ARG B  1 57  ? 3.732   -61.587  -30.668 1.00 75.21 ? 152 ARG B CZ  1 
ATOM   1206 N NH1 . ARG B  1 57  ? 3.783   -62.732  -31.344 1.00 76.36 ? 152 ARG B NH1 1 
ATOM   1207 N NH2 . ARG B  1 57  ? 4.084   -61.574  -29.385 1.00 75.41 ? 152 ARG B NH2 1 
ATOM   1208 N N   . ARG B  1 58  ? -3.115  -59.760  -33.310 1.00 50.51 ? 153 ARG B N   1 
ATOM   1209 C CA  . ARG B  1 58  ? -4.119  -59.754  -34.378 1.00 47.62 ? 153 ARG B CA  1 
ATOM   1210 C C   . ARG B  1 58  ? -4.923  -58.457  -34.447 1.00 48.80 ? 153 ARG B C   1 
ATOM   1211 O O   . ARG B  1 58  ? -5.707  -58.274  -35.378 1.00 46.72 ? 153 ARG B O   1 
ATOM   1212 C CB  . ARG B  1 58  ? -5.103  -60.917  -34.199 1.00 45.58 ? 153 ARG B CB  1 
ATOM   1213 C CG  . ARG B  1 58  ? -4.500  -62.291  -34.411 1.00 45.83 ? 153 ARG B CG  1 
ATOM   1214 C CD  . ARG B  1 58  ? -4.541  -62.709  -35.866 1.00 45.46 ? 153 ARG B CD  1 
ATOM   1215 N NE  . ARG B  1 58  ? -5.841  -63.277  -36.214 1.00 44.48 ? 153 ARG B NE  1 
ATOM   1216 C CZ  . ARG B  1 58  ? -6.746  -62.727  -37.023 1.00 41.84 ? 153 ARG B CZ  1 
ATOM   1217 N NH1 . ARG B  1 58  ? -7.885  -63.362  -37.238 1.00 40.42 ? 153 ARG B NH1 1 
ATOM   1218 N NH2 . ARG B  1 58  ? -6.530  -61.564  -37.635 1.00 42.71 ? 153 ARG B NH2 1 
ATOM   1219 N N   . LEU B  1 59  ? -4.747  -57.567  -33.474 1.00 48.24 ? 154 LEU B N   1 
ATOM   1220 C CA  . LEU B  1 59  ? -5.546  -56.343  -33.408 1.00 52.14 ? 154 LEU B CA  1 
ATOM   1221 C C   . LEU B  1 59  ? -4.815  -55.144  -33.998 1.00 57.36 ? 154 LEU B C   1 
ATOM   1222 O O   . LEU B  1 59  ? -3.594  -55.173  -34.160 1.00 61.16 ? 154 LEU B O   1 
ATOM   1223 C CB  . LEU B  1 59  ? -5.946  -56.053  -31.961 1.00 50.05 ? 154 LEU B CB  1 
ATOM   1224 C CG  . LEU B  1 59  ? -6.741  -57.178  -31.299 1.00 47.34 ? 154 LEU B CG  1 
ATOM   1225 C CD1 . LEU B  1 59  ? -7.189  -56.778  -29.909 1.00 50.73 ? 154 LEU B CD1 1 
ATOM   1226 C CD2 . LEU B  1 59  ? -7.950  -57.553  -32.129 1.00 48.32 ? 154 LEU B CD2 1 
ATOM   1227 N N   . ARG B  1 60  ? -5.567  -54.091  -34.320 1.00 58.47 ? 155 ARG B N   1 
ATOM   1228 C CA  . ARG B  1 60  ? -4.969  -52.898  -34.902 1.00 60.50 ? 155 ARG B CA  1 
ATOM   1229 C C   . ARG B  1 60  ? -4.442  -52.051  -33.753 1.00 61.78 ? 155 ARG B C   1 
ATOM   1230 O O   . ARG B  1 60  ? -5.132  -51.896  -32.741 1.00 60.80 ? 155 ARG B O   1 
ATOM   1231 C CB  . ARG B  1 60  ? -5.984  -52.099  -35.738 1.00 64.37 ? 155 ARG B CB  1 
ATOM   1232 C CG  . ARG B  1 60  ? -5.594  -51.829  -37.200 1.00 67.92 ? 155 ARG B CG  1 
ATOM   1233 C CD  . ARG B  1 60  ? -4.086  -51.687  -37.457 1.00 71.16 ? 155 ARG B CD  1 
ATOM   1234 N NE  . ARG B  1 60  ? -3.629  -50.304  -37.599 1.00 71.92 ? 155 ARG B NE  1 
ATOM   1235 C CZ  . ARG B  1 60  ? -2.354  -49.914  -37.568 1.00 71.83 ? 155 ARG B CZ  1 
ATOM   1236 N NH1 . ARG B  1 60  ? -1.368  -50.792  -37.386 1.00 69.91 ? 155 ARG B NH1 1 
ATOM   1237 N NH2 . ARG B  1 60  ? -2.062  -48.625  -37.714 1.00 73.06 ? 155 ARG B NH2 1 
ATOM   1238 N N   . ARG B  1 61  ? -3.226  -51.517  -33.894 1.00 60.47 ? 156 ARG B N   1 
ATOM   1239 C CA  . ARG B  1 61  ? -2.571  -50.820  -32.776 1.00 59.94 ? 156 ARG B CA  1 
ATOM   1240 C C   . ARG B  1 61  ? -3.409  -49.630  -32.312 1.00 54.76 ? 156 ARG B C   1 
ATOM   1241 O O   . ARG B  1 61  ? -3.672  -48.695  -33.066 1.00 56.45 ? 156 ARG B O   1 
ATOM   1242 C CB  . ARG B  1 61  ? -1.132  -50.402  -33.109 1.00 63.05 ? 156 ARG B CB  1 
ATOM   1243 C CG  . ARG B  1 61  ? -0.076  -51.354  -32.555 1.00 66.74 ? 156 ARG B CG  1 
ATOM   1244 C CD  . ARG B  1 61  ? 0.065   -51.220  -31.039 1.00 72.19 ? 156 ARG B CD  1 
ATOM   1245 N NE  . ARG B  1 61  ? 1.162   -52.035  -30.499 1.00 76.98 ? 156 ARG B NE  1 
ATOM   1246 C CZ  . ARG B  1 61  ? 1.448   -52.183  -29.202 1.00 77.07 ? 156 ARG B CZ  1 
ATOM   1247 N NH1 . ARG B  1 61  ? 0.727   -51.573  -28.263 1.00 75.90 ? 156 ARG B NH1 1 
ATOM   1248 N NH2 . ARG B  1 61  ? 2.469   -52.954  -28.840 1.00 77.25 ? 156 ARG B NH2 1 
ATOM   1249 N N   . GLU B  1 62  ? -3.830  -49.692  -31.056 1.00 48.80 ? 157 GLU B N   1 
ATOM   1250 C CA  . GLU B  1 62  ? -4.903  -48.856  -30.543 1.00 43.20 ? 157 GLU B CA  1 
ATOM   1251 C C   . GLU B  1 62  ? -5.128  -49.264  -29.100 1.00 40.57 ? 157 GLU B C   1 
ATOM   1252 O O   . GLU B  1 62  ? -4.727  -50.361  -28.703 1.00 37.15 ? 157 GLU B O   1 
ATOM   1253 C CB  . GLU B  1 62  ? -6.172  -49.138  -31.340 1.00 43.05 ? 157 GLU B CB  1 
ATOM   1254 C CG  . GLU B  1 62  ? -7.285  -48.152  -31.117 1.00 43.46 ? 157 GLU B CG  1 
ATOM   1255 C CD  . GLU B  1 62  ? -8.371  -48.271  -32.158 1.00 41.08 ? 157 GLU B CD  1 
ATOM   1256 O OE1 . GLU B  1 62  ? -8.911  -47.220  -32.541 1.00 40.84 ? 157 GLU B OE1 1 
ATOM   1257 O OE2 . GLU B  1 62  ? -8.677  -49.402  -32.606 1.00 40.44 ? 157 GLU B OE2 1 
ATOM   1258 N N   . ARG B  1 63  ? -5.774  -48.411  -28.311 1.00 37.41 ? 158 ARG B N   1 
ATOM   1259 C CA  . ARG B  1 63  ? -6.093  -48.794  -26.937 1.00 37.19 ? 158 ARG B CA  1 
ATOM   1260 C C   . ARG B  1 63  ? -7.287  -49.753  -26.962 1.00 34.71 ? 158 ARG B C   1 
ATOM   1261 O O   . ARG B  1 63  ? -8.362  -49.422  -27.461 1.00 35.21 ? 158 ARG B O   1 
ATOM   1262 C CB  . ARG B  1 63  ? -6.395  -47.588  -26.036 1.00 37.48 ? 158 ARG B CB  1 
ATOM   1263 C CG  . ARG B  1 63  ? -6.572  -47.944  -24.546 1.00 38.42 ? 158 ARG B CG  1 
ATOM   1264 C CD  . ARG B  1 63  ? -5.408  -48.739  -23.957 1.00 38.59 ? 158 ARG B CD  1 
ATOM   1265 N NE  . ARG B  1 63  ? -5.518  -48.896  -22.494 1.00 38.81 ? 158 ARG B NE  1 
ATOM   1266 C CZ  . ARG B  1 63  ? -5.805  -50.031  -21.847 1.00 39.22 ? 158 ARG B CZ  1 
ATOM   1267 N NH1 . ARG B  1 63  ? -5.886  -50.023  -20.522 1.00 41.25 ? 158 ARG B NH1 1 
ATOM   1268 N NH2 . ARG B  1 63  ? -6.004  -51.179  -22.492 1.00 37.61 ? 158 ARG B NH2 1 
ATOM   1269 N N   . VAL B  1 64  ? -7.067  -50.941  -26.418 1.00 33.46 ? 159 VAL B N   1 
ATOM   1270 C CA  . VAL B  1 64  ? -8.045  -52.016  -26.433 1.00 33.60 ? 159 VAL B CA  1 
ATOM   1271 C C   . VAL B  1 64  ? -8.217  -52.535  -25.010 1.00 31.60 ? 159 VAL B C   1 
ATOM   1272 O O   . VAL B  1 64  ? -7.288  -53.113  -24.457 1.00 32.58 ? 159 VAL B O   1 
ATOM   1273 C CB  . VAL B  1 64  ? -7.547  -53.146  -27.359 1.00 34.15 ? 159 VAL B CB  1 
ATOM   1274 C CG1 . VAL B  1 64  ? -8.386  -54.400  -27.193 1.00 35.10 ? 159 VAL B CG1 1 
ATOM   1275 C CG2 . VAL B  1 64  ? -7.563  -52.678  -28.816 1.00 33.28 ? 159 VAL B CG2 1 
ATOM   1276 N N   . ARG B  1 65  ? -9.395  -52.334  -24.423 1.00 30.13 ? 160 ARG B N   1 
ATOM   1277 C CA  . ARG B  1 65  ? -9.678  -52.801  -23.050 1.00 29.04 ? 160 ARG B CA  1 
ATOM   1278 C C   . ARG B  1 65  ? -10.336 -54.176  -23.044 1.00 28.57 ? 160 ARG B C   1 
ATOM   1279 O O   . ARG B  1 65  ? -11.439 -54.347  -23.560 1.00 26.68 ? 160 ARG B O   1 
ATOM   1280 C CB  . ARG B  1 65  ? -10.568 -51.809  -22.319 1.00 29.07 ? 160 ARG B CB  1 
ATOM   1281 C CG  . ARG B  1 65  ? -9.838  -50.524  -21.971 1.00 31.23 ? 160 ARG B CG  1 
ATOM   1282 C CD  . ARG B  1 65  ? -10.670 -49.536  -21.157 1.00 32.25 ? 160 ARG B CD  1 
ATOM   1283 N NE  . ARG B  1 65  ? -9.839  -48.393  -20.769 1.00 34.15 ? 160 ARG B NE  1 
ATOM   1284 C CZ  . ARG B  1 65  ? -8.935  -48.423  -19.789 1.00 34.63 ? 160 ARG B CZ  1 
ATOM   1285 N NH1 . ARG B  1 65  ? -8.745  -49.524  -19.057 1.00 35.81 ? 160 ARG B NH1 1 
ATOM   1286 N NH2 . ARG B  1 65  ? -8.204  -47.352  -19.535 1.00 34.75 ? 160 ARG B NH2 1 
ATOM   1287 N N   . ALA B  1 66  ? -9.648  -55.148  -22.449 1.00 29.02 ? 161 ALA B N   1 
ATOM   1288 C CA  . ALA B  1 66  ? -10.100 -56.537  -22.438 1.00 28.51 ? 161 ALA B CA  1 
ATOM   1289 C C   . ALA B  1 66  ? -10.373 -56.979  -21.008 1.00 29.05 ? 161 ALA B C   1 
ATOM   1290 O O   . ALA B  1 66  ? -10.169 -58.134  -20.654 1.00 27.06 ? 161 ALA B O   1 
ATOM   1291 C CB  . ALA B  1 66  ? -9.050  -57.431  -23.078 1.00 28.50 ? 161 ALA B CB  1 
ATOM   1292 N N   . GLN B  1 67  ? -10.891 -56.046  -20.219 1.00 29.12 ? 162 GLN B N   1 
ATOM   1293 C CA  . GLN B  1 67  ? -11.082 -56.213  -18.811 1.00 29.47 ? 162 GLN B CA  1 
ATOM   1294 C C   . GLN B  1 67  ? -12.049 -55.107  -18.400 1.00 27.86 ? 162 GLN B C   1 
ATOM   1295 O O   . GLN B  1 67  ? -11.951 -53.989  -18.904 1.00 25.39 ? 162 GLN B O   1 
ATOM   1296 C CB  . GLN B  1 67  ? -9.733  -56.030  -18.151 1.00 33.95 ? 162 GLN B CB  1 
ATOM   1297 C CG  . GLN B  1 67  ? -9.767  -55.854  -16.670 1.00 38.45 ? 162 GLN B CG  1 
ATOM   1298 C CD  . GLN B  1 67  ? -8.400  -55.910  -16.028 1.00 39.40 ? 162 GLN B CD  1 
ATOM   1299 O OE1 . GLN B  1 67  ? -8.306  -55.948  -14.812 1.00 46.74 ? 162 GLN B OE1 1 
ATOM   1300 N NE2 . GLN B  1 67  ? -7.338  -55.907  -16.826 1.00 41.52 ? 162 GLN B NE2 1 
ATOM   1301 N N   . PRO B  1 68  ? -13.014 -55.423  -17.519 1.00 25.72 ? 163 PRO B N   1 
ATOM   1302 C CA  . PRO B  1 68  ? -14.017 -54.418  -17.176 1.00 24.56 ? 163 PRO B CA  1 
ATOM   1303 C C   . PRO B  1 68  ? -13.461 -53.296  -16.322 1.00 24.17 ? 163 PRO B C   1 
ATOM   1304 O O   . PRO B  1 68  ? -12.414 -53.465  -15.680 1.00 23.59 ? 163 PRO B O   1 
ATOM   1305 C CB  . PRO B  1 68  ? -15.090 -55.187  -16.397 1.00 24.99 ? 163 PRO B CB  1 
ATOM   1306 C CG  . PRO B  1 68  ? -14.637 -56.602  -16.309 1.00 25.80 ? 163 PRO B CG  1 
ATOM   1307 C CD  . PRO B  1 68  ? -13.397 -56.786  -17.126 1.00 25.65 ? 163 PRO B CD  1 
ATOM   1308 N N   . CYS B  1 69  ? -14.187 -52.177  -16.316 1.00 23.03 ? 164 CYS B N   1 
ATOM   1309 C CA  . CYS B  1 69  ? -13.881 -51.031  -15.467 1.00 23.75 ? 164 CYS B CA  1 
ATOM   1310 C C   . CYS B  1 69  ? -14.998 -50.791  -14.458 1.00 23.01 ? 164 CYS B C   1 
ATOM   1311 O O   . CYS B  1 69  ? -16.172 -50.802  -14.817 1.00 24.15 ? 164 CYS B O   1 
ATOM   1312 C CB  . CYS B  1 69  ? -13.710 -49.777  -16.332 1.00 24.79 ? 164 CYS B CB  1 
ATOM   1313 S SG  . CYS B  1 69  ? -12.234 -49.737  -17.402 1.00 26.19 ? 164 CYS B SG  1 
ATOM   1314 N N   . CYS B  1 70  ? -14.627 -50.546  -13.203 1.00 22.74 ? 165 CYS B N   1 
ATOM   1315 C CA  . CYS B  1 70  ? -15.569 -50.099  -12.179 1.00 22.76 ? 165 CYS B CA  1 
ATOM   1316 C C   . CYS B  1 70  ? -15.925 -48.617  -12.404 1.00 21.76 ? 165 CYS B C   1 
ATOM   1317 O O   . CYS B  1 70  ? -15.117 -47.715  -12.147 1.00 20.45 ? 165 CYS B O   1 
ATOM   1318 C CB  . CYS B  1 70  ? -14.980 -50.275  -10.778 1.00 23.24 ? 165 CYS B CB  1 
ATOM   1319 S SG  . CYS B  1 70  ? -16.113 -49.794  -9.460  1.00 24.45 ? 165 CYS B SG  1 
ATOM   1320 N N   . ARG B  1 71  ? -17.132 -48.391  -12.897 1.00 21.14 ? 166 ARG B N   1 
ATOM   1321 C CA  . ARG B  1 71  ? -17.580 -47.069  -13.290 1.00 21.21 ? 166 ARG B CA  1 
ATOM   1322 C C   . ARG B  1 71  ? -19.045 -46.928  -12.983 1.00 21.57 ? 166 ARG B C   1 
ATOM   1323 O O   . ARG B  1 71  ? -19.748 -47.933  -12.811 1.00 22.28 ? 166 ARG B O   1 
ATOM   1324 C CB  . ARG B  1 71  ? -17.378 -46.837  -14.802 1.00 20.85 ? 166 ARG B CB  1 
ATOM   1325 C CG  . ARG B  1 71  ? -15.925 -46.712  -15.245 1.00 21.09 ? 166 ARG B CG  1 
ATOM   1326 C CD  . ARG B  1 71  ? -15.300 -45.386  -14.801 1.00 21.25 ? 166 ARG B CD  1 
ATOM   1327 N NE  . ARG B  1 71  ? -15.887 -44.258  -15.522 1.00 20.75 ? 166 ARG B NE  1 
ATOM   1328 C CZ  . ARG B  1 71  ? -15.713 -42.977  -15.216 1.00 20.95 ? 166 ARG B CZ  1 
ATOM   1329 N NH1 . ARG B  1 71  ? -14.953 -42.615  -14.183 1.00 20.35 ? 166 ARG B NH1 1 
ATOM   1330 N NH2 . ARG B  1 71  ? -16.296 -42.052  -15.963 1.00 20.55 ? 166 ARG B NH2 1 
ATOM   1331 N N   . PRO B  1 72  ? -19.528 -45.668  -12.930 1.00 22.49 ? 167 PRO B N   1 
ATOM   1332 C CA  . PRO B  1 72  ? -20.942 -45.453  -12.735 1.00 22.04 ? 167 PRO B CA  1 
ATOM   1333 C C   . PRO B  1 72  ? -21.757 -45.874  -13.961 1.00 22.41 ? 167 PRO B C   1 
ATOM   1334 O O   . PRO B  1 72  ? -21.302 -45.734  -15.088 1.00 20.86 ? 167 PRO B O   1 
ATOM   1335 C CB  . PRO B  1 72  ? -21.056 -43.935  -12.519 1.00 22.72 ? 167 PRO B CB  1 
ATOM   1336 C CG  . PRO B  1 72  ? -19.680 -43.459  -12.235 1.00 22.93 ? 167 PRO B CG  1 
ATOM   1337 C CD  . PRO B  1 72  ? -18.780 -44.400  -12.993 1.00 22.44 ? 167 PRO B CD  1 
ATOM   1338 N N   . THR B  1 73  ? -22.941 -46.402  -13.710 1.00 22.75 ? 168 THR B N   1 
ATOM   1339 C CA  . THR B  1 73  ? -23.895 -46.717  -14.763 1.00 25.64 ? 168 THR B CA  1 
ATOM   1340 C C   . THR B  1 73  ? -25.114 -45.818  -14.639 1.00 25.63 ? 168 THR B C   1 
ATOM   1341 O O   . THR B  1 73  ? -25.955 -45.794  -15.516 1.00 25.97 ? 168 THR B O   1 
ATOM   1342 C CB  . THR B  1 73  ? -24.361 -48.169  -14.645 1.00 27.02 ? 168 THR B CB  1 
ATOM   1343 O OG1 . THR B  1 73  ? -24.815 -48.407  -13.305 1.00 27.32 ? 168 THR B OG1 1 
ATOM   1344 C CG2 . THR B  1 73  ? -23.214 -49.085  -14.941 1.00 29.46 ? 168 THR B CG2 1 
ATOM   1345 N N   . ALA B  1 74  ? -25.221 -45.102  -13.522 1.00 25.89 ? 169 ALA B N   1 
ATOM   1346 C CA  . ALA B  1 74  ? -26.216 -44.051  -13.379 1.00 25.14 ? 169 ALA B CA  1 
ATOM   1347 C C   . ALA B  1 74  ? -25.647 -42.954  -12.493 1.00 24.98 ? 169 ALA B C   1 
ATOM   1348 O O   . ALA B  1 74  ? -24.788 -43.224  -11.656 1.00 22.85 ? 169 ALA B O   1 
ATOM   1349 C CB  . ALA B  1 74  ? -27.499 -44.614  -12.783 1.00 26.21 ? 169 ALA B CB  1 
ATOM   1350 N N   . TYR B  1 75  ? -26.156 -41.732  -12.677 1.00 24.22 ? 170 TYR B N   1 
ATOM   1351 C CA  . TYR B  1 75  ? -25.693 -40.551  -11.954 1.00 22.95 ? 170 TYR B CA  1 
ATOM   1352 C C   . TYR B  1 75  ? -26.805 -39.839  -11.179 1.00 23.70 ? 170 TYR B C   1 
ATOM   1353 O O   . TYR B  1 75  ? -27.989 -39.968  -11.489 1.00 23.16 ? 170 TYR B O   1 
ATOM   1354 C CB  . TYR B  1 75  ? -25.068 -39.575  -12.927 1.00 22.09 ? 170 TYR B CB  1 
ATOM   1355 C CG  . TYR B  1 75  ? -23.756 -40.065  -13.459 1.00 21.14 ? 170 TYR B CG  1 
ATOM   1356 C CD1 . TYR B  1 75  ? -22.570 -39.768  -12.794 1.00 20.05 ? 170 TYR B CD1 1 
ATOM   1357 C CD2 . TYR B  1 75  ? -23.692 -40.829  -14.624 1.00 19.90 ? 170 TYR B CD2 1 
ATOM   1358 C CE1 . TYR B  1 75  ? -21.355 -40.219  -13.271 1.00 20.00 ? 170 TYR B CE1 1 
ATOM   1359 C CE2 . TYR B  1 75  ? -22.479 -41.308  -15.095 1.00 19.08 ? 170 TYR B CE2 1 
ATOM   1360 C CZ  . TYR B  1 75  ? -21.311 -40.997  -14.426 1.00 19.21 ? 170 TYR B CZ  1 
ATOM   1361 O OH  . TYR B  1 75  ? -20.073 -41.428  -14.899 1.00 17.25 ? 170 TYR B OH  1 
ATOM   1362 N N   . GLU B  1 76  ? -26.396 -39.115  -10.138 1.00 23.23 ? 171 GLU B N   1 
ATOM   1363 C CA  . GLU B  1 76  ? -27.271 -38.227  -9.403  1.00 23.40 ? 171 GLU B CA  1 
ATOM   1364 C C   . GLU B  1 76  ? -27.994 -37.278  -10.369 1.00 22.88 ? 171 GLU B C   1 
ATOM   1365 O O   . GLU B  1 76  ? -27.426 -36.778  -11.328 1.00 22.25 ? 171 GLU B O   1 
ATOM   1366 C CB  . GLU B  1 76  ? -26.471 -37.437  -8.394  1.00 23.10 ? 171 GLU B CB  1 
ATOM   1367 C CG  . GLU B  1 76  ? -27.249 -36.463  -7.523  1.00 23.23 ? 171 GLU B CG  1 
ATOM   1368 C CD  . GLU B  1 76  ? -26.302 -35.692  -6.616  1.00 22.37 ? 171 GLU B CD  1 
ATOM   1369 O OE1 . GLU B  1 76  ? -25.383 -35.030  -7.145  1.00 22.28 ? 171 GLU B OE1 1 
ATOM   1370 O OE2 . GLU B  1 76  ? -26.445 -35.783  -5.387  1.00 21.70 ? 171 GLU B OE2 1 
ATOM   1371 N N   . ASP B  1 77  ? -29.273 -37.093  -10.099 1.00 23.71 ? 172 ASP B N   1 
ATOM   1372 C CA  . ASP B  1 77  ? -30.142 -36.234  -10.866 1.00 25.88 ? 172 ASP B CA  1 
ATOM   1373 C C   . ASP B  1 77  ? -29.657 -34.770  -10.763 1.00 23.36 ? 172 ASP B C   1 
ATOM   1374 O O   . ASP B  1 77  ? -29.237 -34.146  -11.752 1.00 21.52 ? 172 ASP B O   1 
ATOM   1375 C CB  . ASP B  1 77  ? -31.542 -36.404  -10.263 1.00 30.78 ? 172 ASP B CB  1 
ATOM   1376 C CG  . ASP B  1 77  ? -32.627 -36.139  -11.215 1.00 36.11 ? 172 ASP B CG  1 
ATOM   1377 O OD1 . ASP B  1 77  ? -32.583 -35.115  -11.930 1.00 42.04 ? 172 ASP B OD1 1 
ATOM   1378 O OD2 . ASP B  1 77  ? -33.560 -36.964  -11.219 1.00 45.21 ? 172 ASP B OD2 1 
ATOM   1379 N N   . GLU B  1 78  ? -29.661 -34.247  -9.545  1.00 21.10 ? 173 GLU B N   1 
ATOM   1380 C CA  . GLU B  1 78  ? -29.207 -32.878  -9.306  1.00 21.69 ? 173 GLU B CA  1 
ATOM   1381 C C   . GLU B  1 78  ? -28.927 -32.627  -7.830  1.00 19.97 ? 173 GLU B C   1 
ATOM   1382 O O   . GLU B  1 78  ? -29.419 -33.342  -6.961  1.00 19.34 ? 173 GLU B O   1 
ATOM   1383 C CB  . GLU B  1 78  ? -30.255 -31.870  -9.802  1.00 22.67 ? 173 GLU B CB  1 
ATOM   1384 C CG  . GLU B  1 78  ? -31.620 -31.997  -9.136  1.00 24.32 ? 173 GLU B CG  1 
ATOM   1385 C CD  . GLU B  1 78  ? -32.582 -30.924  -9.609  1.00 26.23 ? 173 GLU B CD  1 
ATOM   1386 O OE1 . GLU B  1 78  ? -33.207 -31.104  -10.664 1.00 27.33 ? 173 GLU B OE1 1 
ATOM   1387 O OE2 . GLU B  1 78  ? -32.689 -29.878  -8.948  1.00 26.77 ? 173 GLU B OE2 1 
ATOM   1388 N N   . VAL B  1 79  ? -28.130 -31.605  -7.551  1.00 18.80 ? 174 VAL B N   1 
ATOM   1389 C CA  . VAL B  1 79  ? -27.947 -31.129  -6.188  1.00 18.17 ? 174 VAL B CA  1 
ATOM   1390 C C   . VAL B  1 79  ? -27.734 -29.618  -6.275  1.00 17.98 ? 174 VAL B C   1 
ATOM   1391 O O   . VAL B  1 79  ? -27.232 -29.112  -7.264  1.00 17.55 ? 174 VAL B O   1 
ATOM   1392 C CB  . VAL B  1 79  ? -26.772 -31.826  -5.487  1.00 18.54 ? 174 VAL B CB  1 
ATOM   1393 C CG1 . VAL B  1 79  ? -25.445 -31.493  -6.166  1.00 18.80 ? 174 VAL B CG1 1 
ATOM   1394 C CG2 . VAL B  1 79  ? -26.743 -31.479  -4.002  1.00 18.36 ? 174 VAL B CG2 1 
ATOM   1395 N N   . SER B  1 80  ? -28.138 -28.887  -5.254  1.00 17.88 ? 175 SER B N   1 
ATOM   1396 C CA  . SER B  1 80  ? -28.084 -27.440  -5.352  1.00 16.96 ? 175 SER B CA  1 
ATOM   1397 C C   . SER B  1 80  ? -27.415 -26.843  -4.147  1.00 17.44 ? 175 SER B C   1 
ATOM   1398 O O   . SER B  1 80  ? -27.268 -27.494  -3.123  1.00 18.24 ? 175 SER B O   1 
ATOM   1399 C CB  . SER B  1 80  ? -29.499 -26.878  -5.529  1.00 16.68 ? 175 SER B CB  1 
ATOM   1400 O OG  . SER B  1 80  ? -30.003 -27.251  -6.802  1.00 17.13 ? 175 SER B OG  1 
ATOM   1401 N N   . PHE B  1 81  ? -27.027 -25.582  -4.277  1.00 17.02 ? 176 PHE B N   1 
ATOM   1402 C CA  . PHE B  1 81  ? -26.428 -24.872  -3.185  1.00 18.05 ? 176 PHE B CA  1 
ATOM   1403 C C   . PHE B  1 81  ? -26.402 -23.368  -3.461  1.00 17.74 ? 176 PHE B C   1 
ATOM   1404 O O   . PHE B  1 81  ? -26.492 -22.924  -4.611  1.00 16.61 ? 176 PHE B O   1 
ATOM   1405 C CB  . PHE B  1 81  ? -25.015 -25.385  -2.977  1.00 18.20 ? 176 PHE B CB  1 
ATOM   1406 C CG  . PHE B  1 81  ? -24.240 -25.494  -4.244  1.00 19.33 ? 176 PHE B CG  1 
ATOM   1407 C CD1 . PHE B  1 81  ? -23.587 -24.382  -4.776  1.00 20.08 ? 176 PHE B CD1 1 
ATOM   1408 C CD2 . PHE B  1 81  ? -24.161 -26.703  -4.926  1.00 20.18 ? 176 PHE B CD2 1 
ATOM   1409 C CE1 . PHE B  1 81  ? -22.860 -24.481  -5.954  1.00 19.63 ? 176 PHE B CE1 1 
ATOM   1410 C CE2 . PHE B  1 81  ? -23.441 -26.793  -6.104  1.00 20.57 ? 176 PHE B CE2 1 
ATOM   1411 C CZ  . PHE B  1 81  ? -22.789 -25.684  -6.607  1.00 20.17 ? 176 PHE B CZ  1 
ATOM   1412 N N   . LEU B  1 82  ? -26.280 -22.613  -2.382  1.00 19.29 ? 177 LEU B N   1 
ATOM   1413 C CA  . LEU B  1 82  ? -26.105 -21.160  -2.423  1.00 20.10 ? 177 LEU B CA  1 
ATOM   1414 C C   . LEU B  1 82  ? -24.611 -20.836  -2.317  1.00 20.87 ? 177 LEU B C   1 
ATOM   1415 O O   . LEU B  1 82  ? -23.919 -21.372  -1.454  1.00 20.98 ? 177 LEU B O   1 
ATOM   1416 C CB  . LEU B  1 82  ? -26.854 -20.507  -1.261  1.00 19.56 ? 177 LEU B CB  1 
ATOM   1417 C CG  . LEU B  1 82  ? -26.935 -18.972  -1.273  1.00 19.81 ? 177 LEU B CG  1 
ATOM   1418 C CD1 . LEU B  1 82  ? -27.936 -18.502  -2.308  1.00 19.42 ? 177 LEU B CD1 1 
ATOM   1419 C CD2 . LEU B  1 82  ? -27.315 -18.425  0.085   1.00 19.99 ? 177 LEU B CD2 1 
ATOM   1420 N N   . ASP B  1 83  ? -24.134 -19.943  -3.178  1.00 21.62 ? 178 ASP B N   1 
ATOM   1421 C CA  . ASP B  1 83  ? -22.737 -19.525  -3.142  1.00 21.81 ? 178 ASP B CA  1 
ATOM   1422 C C   . ASP B  1 83  ? -22.513 -18.253  -2.302  1.00 23.79 ? 178 ASP B C   1 
ATOM   1423 O O   . ASP B  1 83  ? -23.462 -17.708  -1.716  1.00 21.78 ? 178 ASP B O   1 
ATOM   1424 C CB  . ASP B  1 83  ? -22.169 -19.412  -4.566  1.00 21.38 ? 178 ASP B CB  1 
ATOM   1425 C CG  . ASP B  1 83  ? -22.542 -18.127  -5.279  1.00 20.48 ? 178 ASP B CG  1 
ATOM   1426 O OD1 . ASP B  1 83  ? -23.093 -17.162  -4.705  1.00 20.33 ? 178 ASP B OD1 1 
ATOM   1427 O OD2 . ASP B  1 83  ? -22.260 -18.096  -6.474  1.00 20.90 ? 178 ASP B OD2 1 
ATOM   1428 N N   . ALA B  1 84  ? -21.247 -17.828  -2.216  1.00 24.31 ? 179 ALA B N   1 
ATOM   1429 C CA  . ALA B  1 84  ? -20.833 -16.706  -1.353  1.00 25.72 ? 179 ALA B CA  1 
ATOM   1430 C C   . ALA B  1 84  ? -21.348 -15.353  -1.852  1.00 26.24 ? 179 ALA B C   1 
ATOM   1431 O O   . ALA B  1 84  ? -21.386 -14.411  -1.100  1.00 24.62 ? 179 ALA B O   1 
ATOM   1432 C CB  . ALA B  1 84  ? -19.300 -16.672  -1.213  1.00 26.63 ? 179 ALA B CB  1 
ATOM   1433 N N   . HIS B  1 85  ? -21.750 -15.264  -3.111  1.00 27.32 ? 180 HIS B N   1 
ATOM   1434 C CA  . HIS B  1 85  ? -22.351 -14.037  -3.632  1.00 31.25 ? 180 HIS B CA  1 
ATOM   1435 C C   . HIS B  1 85  ? -23.872 -14.112  -3.598  1.00 30.45 ? 180 HIS B C   1 
ATOM   1436 O O   . HIS B  1 85  ? -24.533 -13.372  -4.293  1.00 29.29 ? 180 HIS B O   1 
ATOM   1437 C CB  . HIS B  1 85  ? -21.880 -13.798  -5.070  1.00 33.91 ? 180 HIS B CB  1 
ATOM   1438 C CG  . HIS B  1 85  ? -20.408 -13.974  -5.244  1.00 40.23 ? 180 HIS B CG  1 
ATOM   1439 N ND1 . HIS B  1 85  ? -19.495 -13.000  -4.893  1.00 42.21 ? 180 HIS B ND1 1 
ATOM   1440 C CD2 . HIS B  1 85  ? -19.687 -15.026  -5.700  1.00 42.70 ? 180 HIS B CD2 1 
ATOM   1441 C CE1 . HIS B  1 85  ? -18.275 -13.443  -5.136  1.00 44.58 ? 180 HIS B CE1 1 
ATOM   1442 N NE2 . HIS B  1 85  ? -18.363 -14.669  -5.625  1.00 45.65 ? 180 HIS B NE2 1 
ATOM   1443 N N   . SER B  1 86  ? -24.419 -15.039  -2.817  1.00 31.53 ? 181 SER B N   1 
ATOM   1444 C CA  . SER B  1 86  ? -25.864 -15.208  -2.690  1.00 31.71 ? 181 SER B CA  1 
ATOM   1445 C C   . SER B  1 86  ? -26.574 -15.580  -3.992  1.00 31.04 ? 181 SER B C   1 
ATOM   1446 O O   . SER B  1 86  ? -27.701 -15.156  -4.226  1.00 31.97 ? 181 SER B O   1 
ATOM   1447 C CB  . SER B  1 86  ? -26.482 -13.939  -2.096  1.00 32.71 ? 181 SER B CB  1 
ATOM   1448 O OG  . SER B  1 86  ? -27.798 -14.215  -1.695  1.00 37.38 ? 181 SER B OG  1 
ATOM   1449 N N   . ARG B  1 87  ? -25.923 -16.369  -4.833  1.00 28.76 ? 182 ARG B N   1 
ATOM   1450 C CA  . ARG B  1 87  ? -26.545 -16.927  -6.021  1.00 28.96 ? 182 ARG B CA  1 
ATOM   1451 C C   . ARG B  1 87  ? -26.637 -18.444  -5.870  1.00 24.94 ? 182 ARG B C   1 
ATOM   1452 O O   . ARG B  1 87  ? -25.697 -19.088  -5.390  1.00 23.20 ? 182 ARG B O   1 
ATOM   1453 C CB  . ARG B  1 87  ? -25.742 -16.602  -7.273  1.00 34.84 ? 182 ARG B CB  1 
ATOM   1454 C CG  . ARG B  1 87  ? -25.801 -15.141  -7.698  1.00 43.48 ? 182 ARG B CG  1 
ATOM   1455 C CD  . ARG B  1 87  ? -24.887 -14.852  -8.893  1.00 50.77 ? 182 ARG B CD  1 
ATOM   1456 N NE  . ARG B  1 87  ? -25.605 -14.865  -10.172 1.00 57.23 ? 182 ARG B NE  1 
ATOM   1457 C CZ  . ARG B  1 87  ? -25.398 -15.710  -11.186 1.00 63.67 ? 182 ARG B CZ  1 
ATOM   1458 N NH1 . ARG B  1 87  ? -24.473 -16.669  -11.126 1.00 66.99 ? 182 ARG B NH1 1 
ATOM   1459 N NH2 . ARG B  1 87  ? -26.133 -15.585  -12.293 1.00 66.76 ? 182 ARG B NH2 1 
ATOM   1460 N N   . TYR B  1 88  ? -27.767 -19.003  -6.290  1.00 21.91 ? 183 TYR B N   1 
ATOM   1461 C CA  . TYR B  1 88  ? -28.000 -20.453  -6.232  1.00 20.97 ? 183 TYR B CA  1 
ATOM   1462 C C   . TYR B  1 88  ? -27.467 -21.122  -7.476  1.00 19.84 ? 183 TYR B C   1 
ATOM   1463 O O   . TYR B  1 88  ? -27.502 -20.537  -8.542  1.00 20.73 ? 183 TYR B O   1 
ATOM   1464 C CB  . TYR B  1 88  ? -29.497 -20.776  -6.129  1.00 20.54 ? 183 TYR B CB  1 
ATOM   1465 C CG  . TYR B  1 88  ? -30.056 -20.771  -4.737  1.00 19.33 ? 183 TYR B CG  1 
ATOM   1466 C CD1 . TYR B  1 88  ? -29.773 -21.792  -3.858  1.00 19.72 ? 183 TYR B CD1 1 
ATOM   1467 C CD2 . TYR B  1 88  ? -30.907 -19.750  -4.307  1.00 19.32 ? 183 TYR B CD2 1 
ATOM   1468 C CE1 . TYR B  1 88  ? -30.303 -21.808  -2.579  1.00 18.89 ? 183 TYR B CE1 1 
ATOM   1469 C CE2 . TYR B  1 88  ? -31.436 -19.760  -3.042  1.00 19.01 ? 183 TYR B CE2 1 
ATOM   1470 C CZ  . TYR B  1 88  ? -31.136 -20.789  -2.185  1.00 18.40 ? 183 TYR B CZ  1 
ATOM   1471 O OH  . TYR B  1 88  ? -31.656 -20.772  -0.915  1.00 19.73 ? 183 TYR B OH  1 
ATOM   1472 N N   . HIS B  1 89  ? -26.996 -22.361  -7.328  1.00 19.82 ? 184 HIS B N   1 
ATOM   1473 C CA  . HIS B  1 89  ? -26.573 -23.183  -8.440  1.00 19.28 ? 184 HIS B CA  1 
ATOM   1474 C C   . HIS B  1 89  ? -27.164 -24.567  -8.302  1.00 18.39 ? 184 HIS B C   1 
ATOM   1475 O O   . HIS B  1 89  ? -27.410 -25.034  -7.206  1.00 19.88 ? 184 HIS B O   1 
ATOM   1476 C CB  . HIS B  1 89  ? -25.030 -23.274  -8.497  1.00 20.26 ? 184 HIS B CB  1 
ATOM   1477 C CG  . HIS B  1 89  ? -24.355 -21.946  -8.545  1.00 20.76 ? 184 HIS B CG  1 
ATOM   1478 N ND1 . HIS B  1 89  ? -24.154 -21.255  -9.726  1.00 22.58 ? 184 HIS B ND1 1 
ATOM   1479 C CD2 . HIS B  1 89  ? -23.904 -21.142  -7.557  1.00 21.48 ? 184 HIS B CD2 1 
ATOM   1480 C CE1 . HIS B  1 89  ? -23.584 -20.092  -9.463  1.00 22.23 ? 184 HIS B CE1 1 
ATOM   1481 N NE2 . HIS B  1 89  ? -23.429 -19.995  -8.150  1.00 22.13 ? 184 HIS B NE2 1 
ATOM   1482 N N   . THR B  1 90  ? -27.415 -25.204  -9.431  1.00 18.21 ? 185 THR B N   1 
ATOM   1483 C CA  . THR B  1 90  ? -27.833 -26.593  -9.487  1.00 19.82 ? 185 THR B CA  1 
ATOM   1484 C C   . THR B  1 90  ? -26.869 -27.335  -10.421 1.00 20.68 ? 185 THR B C   1 
ATOM   1485 O O   . THR B  1 90  ? -26.637 -26.883  -11.563 1.00 20.09 ? 185 THR B O   1 
ATOM   1486 C CB  . THR B  1 90  ? -29.260 -26.744  -10.032 1.00 20.07 ? 185 THR B CB  1 
ATOM   1487 O OG1 . THR B  1 90  ? -30.169 -25.999  -9.213  1.00 20.74 ? 185 THR B OG1 1 
ATOM   1488 C CG2 . THR B  1 90  ? -29.686 -28.230  -10.079 1.00 19.58 ? 185 THR B CG2 1 
ATOM   1489 N N   . VAL B  1 91  ? -26.314 -28.454  -9.932  1.00 20.35 ? 186 VAL B N   1 
ATOM   1490 C CA  . VAL B  1 91  ? -25.354 -29.253  -10.700 1.00 21.14 ? 186 VAL B CA  1 
ATOM   1491 C C   . VAL B  1 91  ? -25.963 -30.619  -10.962 1.00 20.60 ? 186 VAL B C   1 
ATOM   1492 O O   . VAL B  1 91  ? -26.508 -31.224  -10.054 1.00 19.18 ? 186 VAL B O   1 
ATOM   1493 C CB  . VAL B  1 91  ? -23.993 -29.434  -9.996  1.00 21.59 ? 186 VAL B CB  1 
ATOM   1494 C CG1 . VAL B  1 91  ? -23.012 -30.165  -10.913 1.00 22.14 ? 186 VAL B CG1 1 
ATOM   1495 C CG2 . VAL B  1 91  ? -23.403 -28.094  -9.595  1.00 22.84 ? 186 VAL B CG2 1 
ATOM   1496 N N   . HIS B  1 92  ? -25.874 -31.063  -12.217 1.00 21.08 ? 187 HIS B N   1 
ATOM   1497 C CA  . HIS B  1 92  ? -26.408 -32.343  -12.649 1.00 21.59 ? 187 HIS B CA  1 
ATOM   1498 C C   . HIS B  1 92  ? -25.312 -33.395  -12.785 1.00 20.91 ? 187 HIS B C   1 
ATOM   1499 O O   . HIS B  1 92  ? -24.214 -33.096  -13.253 1.00 19.57 ? 187 HIS B O   1 
ATOM   1500 C CB  . HIS B  1 92  ? -27.135 -32.168  -13.976 1.00 22.84 ? 187 HIS B CB  1 
ATOM   1501 C CG  . HIS B  1 92  ? -28.264 -31.198  -13.893 1.00 25.73 ? 187 HIS B CG  1 
ATOM   1502 N ND1 . HIS B  1 92  ? -28.112 -29.860  -14.191 1.00 29.14 ? 187 HIS B ND1 1 
ATOM   1503 C CD2 . HIS B  1 92  ? -29.546 -31.350  -13.480 1.00 26.17 ? 187 HIS B CD2 1 
ATOM   1504 C CE1 . HIS B  1 92  ? -29.262 -29.236  -13.996 1.00 28.34 ? 187 HIS B CE1 1 
ATOM   1505 N NE2 . HIS B  1 92  ? -30.145 -30.119  -13.566 1.00 28.15 ? 187 HIS B NE2 1 
ATOM   1506 N N   . GLU B  1 93  ? -25.620 -34.612  -12.344 1.00 20.56 ? 188 GLU B N   1 
ATOM   1507 C CA  . GLU B  1 93  ? -24.740 -35.759  -12.486 1.00 21.02 ? 188 GLU B CA  1 
ATOM   1508 C C   . GLU B  1 93  ? -23.399 -35.543  -11.797 1.00 20.76 ? 188 GLU B C   1 
ATOM   1509 O O   . GLU B  1 93  ? -22.359 -35.989  -12.278 1.00 20.69 ? 188 GLU B O   1 
ATOM   1510 C CB  . GLU B  1 93  ? -24.572 -36.108  -13.973 1.00 22.52 ? 188 GLU B CB  1 
ATOM   1511 C CG  . GLU B  1 93  ? -25.911 -36.336  -14.650 1.00 22.88 ? 188 GLU B CG  1 
ATOM   1512 C CD  . GLU B  1 93  ? -25.795 -37.073  -15.965 1.00 25.16 ? 188 GLU B CD  1 
ATOM   1513 O OE1 . GLU B  1 93  ? -24.828 -36.854  -16.723 1.00 26.40 ? 188 GLU B OE1 1 
ATOM   1514 O OE2 . GLU B  1 93  ? -26.680 -37.900  -16.237 1.00 28.75 ? 188 GLU B OE2 1 
ATOM   1515 N N   . LEU B  1 94  ? -23.426 -34.856  -10.656 1.00 21.11 ? 189 LEU B N   1 
ATOM   1516 C CA  . LEU B  1 94  ? -22.184 -34.632  -9.906  1.00 21.55 ? 189 LEU B CA  1 
ATOM   1517 C C   . LEU B  1 94  ? -21.663 -35.931  -9.296  1.00 21.08 ? 189 LEU B C   1 
ATOM   1518 O O   . LEU B  1 94  ? -20.486 -36.229  -9.400  1.00 21.14 ? 189 LEU B O   1 
ATOM   1519 C CB  . LEU B  1 94  ? -22.365 -33.569  -8.819  1.00 21.10 ? 189 LEU B CB  1 
ATOM   1520 C CG  . LEU B  1 94  ? -21.085 -33.234  -8.037  1.00 21.22 ? 189 LEU B CG  1 
ATOM   1521 C CD1 . LEU B  1 94  ? -19.894 -32.873  -8.910  1.00 21.81 ? 189 LEU B CD1 1 
ATOM   1522 C CD2 . LEU B  1 94  ? -21.378 -32.090  -7.091  1.00 21.85 ? 189 LEU B CD2 1 
ATOM   1523 N N   . SER B  1 95  ? -22.554 -36.666  -8.646  1.00 20.26 ? 190 SER B N   1 
ATOM   1524 C CA  . SER B  1 95  ? -22.244 -37.921  -7.980  1.00 20.57 ? 190 SER B CA  1 
ATOM   1525 C C   . SER B  1 95  ? -22.729 -39.105  -8.792  1.00 21.71 ? 190 SER B C   1 
ATOM   1526 O O   . SER B  1 95  ? -23.670 -38.985  -9.572  1.00 22.58 ? 190 SER B O   1 
ATOM   1527 C CB  . SER B  1 95  ? -22.947 -37.981  -6.630  1.00 20.53 ? 190 SER B CB  1 
ATOM   1528 O OG  . SER B  1 95  ? -22.231 -37.283  -5.635  1.00 20.80 ? 190 SER B OG  1 
ATOM   1529 N N   . ALA B  1 96  ? -22.096 -40.255  -8.584  1.00 22.88 ? 191 ALA B N   1 
ATOM   1530 C CA  . ALA B  1 96  ? -22.624 -41.528  -9.081  1.00 23.24 ? 191 ALA B CA  1 
ATOM   1531 C C   . ALA B  1 96  ? -23.870 -41.942  -8.296  1.00 24.32 ? 191 ALA B C   1 
ATOM   1532 O O   . ALA B  1 96  ? -23.972 -41.672  -7.094  1.00 23.60 ? 191 ALA B O   1 
ATOM   1533 C CB  . ALA B  1 96  ? -21.564 -42.603  -8.962  1.00 23.51 ? 191 ALA B CB  1 
ATOM   1534 N N   . ARG B  1 97  ? -24.806 -42.613  -8.965  1.00 25.41 ? 192 ARG B N   1 
ATOM   1535 C CA  . ARG B  1 97  ? -25.968 -43.201  -8.283  1.00 27.66 ? 192 ARG B CA  1 
ATOM   1536 C C   . ARG B  1 97  ? -25.931 -44.728  -8.287  1.00 28.00 ? 192 ARG B C   1 
ATOM   1537 O O   . ARG B  1 97  ? -26.462 -45.336  -7.385  1.00 27.13 ? 192 ARG B O   1 
ATOM   1538 C CB  . ARG B  1 97  ? -27.285 -42.706  -8.889  1.00 30.46 ? 192 ARG B CB  1 
ATOM   1539 C CG  . ARG B  1 97  ? -28.518 -43.272  -8.195  1.00 34.92 ? 192 ARG B CG  1 
ATOM   1540 C CD  . ARG B  1 97  ? -29.808 -42.510  -8.476  1.00 37.80 ? 192 ARG B CD  1 
ATOM   1541 N NE  . ARG B  1 97  ? -29.946 -42.165  -9.885  1.00 40.10 ? 192 ARG B NE  1 
ATOM   1542 C CZ  . ARG B  1 97  ? -30.399 -42.975  -10.841 1.00 43.64 ? 192 ARG B CZ  1 
ATOM   1543 N NH1 . ARG B  1 97  ? -30.472 -42.530  -12.098 1.00 43.54 ? 192 ARG B NH1 1 
ATOM   1544 N NH2 . ARG B  1 97  ? -30.761 -44.225  -10.566 1.00 44.92 ? 192 ARG B NH2 1 
ATOM   1545 N N   . GLU B  1 98  ? -25.335 -45.336  -9.316  1.00 29.93 ? 193 GLU B N   1 
ATOM   1546 C CA  . GLU B  1 98  ? -25.146 -46.793  -9.383  1.00 30.96 ? 193 GLU B CA  1 
ATOM   1547 C C   . GLU B  1 98  ? -23.775 -47.085  -9.987  1.00 29.32 ? 193 GLU B C   1 
ATOM   1548 O O   . GLU B  1 98  ? -23.268 -46.287  -10.786 1.00 26.67 ? 193 GLU B O   1 
ATOM   1549 C CB  . GLU B  1 98  ? -26.259 -47.458  -10.226 1.00 35.35 ? 193 GLU B CB  1 
ATOM   1550 C CG  . GLU B  1 98  ? -27.653 -47.382  -9.594  1.00 39.66 ? 193 GLU B CG  1 
ATOM   1551 C CD  . GLU B  1 98  ? -28.800 -47.867  -10.498 1.00 47.50 ? 193 GLU B CD  1 
ATOM   1552 O OE1 . GLU B  1 98  ? -28.559 -48.534  -11.539 1.00 48.23 ? 193 GLU B OE1 1 
ATOM   1553 O OE2 . GLU B  1 98  ? -29.977 -47.571  -10.158 1.00 52.19 ? 193 GLU B OE2 1 
ATOM   1554 N N   . CYS B  1 99  ? -23.194 -48.225  -9.607  1.00 27.29 ? 194 CYS B N   1 
ATOM   1555 C CA  . CYS B  1 99  ? -21.881 -48.666  -10.083 1.00 27.34 ? 194 CYS B CA  1 
ATOM   1556 C C   . CYS B  1 99  ? -21.928 -50.093  -10.658 1.00 28.52 ? 194 CYS B C   1 
ATOM   1557 O O   . CYS B  1 99  ? -22.664 -50.947  -10.165 1.00 27.84 ? 194 CYS B O   1 
ATOM   1558 C CB  . CYS B  1 99  ? -20.879 -48.683  -8.928  1.00 27.10 ? 194 CYS B CB  1 
ATOM   1559 S SG  . CYS B  1 99  ? -20.709 -47.132  -8.017  1.00 28.54 ? 194 CYS B SG  1 
ATOM   1560 N N   . ALA B  1 100 ? -21.122 -50.352  -11.676 1.00 26.84 ? 195 ALA B N   1 
ATOM   1561 C CA  . ALA B  1 100 ? -20.928 -51.717  -12.142 1.00 26.83 ? 195 ALA B CA  1 
ATOM   1562 C C   . ALA B  1 100 ? -19.547 -51.860  -12.767 1.00 26.42 ? 195 ALA B C   1 
ATOM   1563 O O   . ALA B  1 100 ? -18.877 -50.863  -13.054 1.00 24.54 ? 195 ALA B O   1 
ATOM   1564 C CB  . ALA B  1 100 ? -22.012 -52.100  -13.133 1.00 27.52 ? 195 ALA B CB  1 
ATOM   1565 N N   . CYS B  1 101 ? -19.133 -53.111  -12.938 1.00 25.79 ? 196 CYS B N   1 
ATOM   1566 C CA  . CYS B  1 101 ? -17.953 -53.455  -13.703 1.00 26.96 ? 196 CYS B CA  1 
ATOM   1567 C C   . CYS B  1 101 ? -18.408 -53.578  -15.146 1.00 27.44 ? 196 CYS B C   1 
ATOM   1568 O O   . CYS B  1 101 ? -19.147 -54.492  -15.496 1.00 26.57 ? 196 CYS B O   1 
ATOM   1569 C CB  . CYS B  1 101 ? -17.358 -54.768  -13.187 1.00 28.49 ? 196 CYS B CB  1 
ATOM   1570 S SG  . CYS B  1 101 ? -16.616 -54.582  -11.542 1.00 29.00 ? 196 CYS B SG  1 
ATOM   1571 N N   . VAL B  1 102 ? -18.007 -52.621  -15.965 1.00 25.66 ? 197 VAL B N   1 
ATOM   1572 C CA  . VAL B  1 102 ? -18.506 -52.525  -17.325 1.00 27.06 ? 197 VAL B CA  1 
ATOM   1573 C C   . VAL B  1 102 ? -17.358 -52.892  -18.238 1.00 26.55 ? 197 VAL B C   1 
ATOM   1574 O O   . VAL B  1 102 ? -17.485 -53.801  -19.047 1.00 27.56 ? 197 VAL B O   1 
ATOM   1575 C CB  . VAL B  1 102 ? -19.005 -51.091  -17.670 1.00 28.18 ? 197 VAL B CB  1 
ATOM   1576 C CG1 . VAL B  1 102 ? -19.526 -51.016  -19.096 1.00 27.75 ? 197 VAL B CG1 1 
ATOM   1577 C CG2 . VAL B  1 102 ? -20.098 -50.642  -16.697 1.00 29.06 ? 197 VAL B CG2 1 
ATOM   1578 O OXT . VAL B  1 102 ? -16.293 -52.287  -18.167 1.00 25.19 ? 197 VAL B OXT 1 
ATOM   1579 N N   . ASN C  2 13  ? -12.509 -76.699  -47.059 1.00 39.00 ? 159 ASN C N   1 
ATOM   1580 C CA  . ASN C  2 13  ? -13.519 -77.273  -47.994 1.00 36.85 ? 159 ASN C CA  1 
ATOM   1581 C C   . ASN C  2 13  ? -14.604 -76.252  -48.360 1.00 35.87 ? 159 ASN C C   1 
ATOM   1582 O O   . ASN C  2 13  ? -14.742 -75.221  -47.697 1.00 33.62 ? 159 ASN C O   1 
ATOM   1583 C CB  . ASN C  2 13  ? -14.118 -78.561  -47.402 1.00 37.40 ? 159 ASN C CB  1 
ATOM   1584 C CG  . ASN C  2 13  ? -15.020 -78.311  -46.198 1.00 35.96 ? 159 ASN C CG  1 
ATOM   1585 O OD1 . ASN C  2 13  ? -16.041 -77.646  -46.322 1.00 36.73 ? 159 ASN C OD1 1 
ATOM   1586 N ND2 . ASN C  2 13  ? -14.666 -78.874  -45.035 1.00 34.04 ? 159 ASN C ND2 1 
ATOM   1587 N N   . HIS C  2 14  ? -15.373 -76.537  -49.414 1.00 34.56 ? 160 HIS C N   1 
ATOM   1588 C CA  . HIS C  2 14  ? -16.379 -75.595  -49.900 1.00 32.24 ? 160 HIS C CA  1 
ATOM   1589 C C   . HIS C  2 14  ? -17.522 -75.352  -48.918 1.00 28.64 ? 160 HIS C C   1 
ATOM   1590 O O   . HIS C  2 14  ? -18.133 -74.294  -48.926 1.00 26.54 ? 160 HIS C O   1 
ATOM   1591 C CB  . HIS C  2 14  ? -16.962 -76.076  -51.219 1.00 34.13 ? 160 HIS C CB  1 
ATOM   1592 C CG  . HIS C  2 14  ? -15.999 -76.020  -52.359 1.00 38.78 ? 160 HIS C CG  1 
ATOM   1593 N ND1 . HIS C  2 14  ? -15.231 -74.906  -52.635 1.00 42.31 ? 160 HIS C ND1 1 
ATOM   1594 C CD2 . HIS C  2 14  ? -15.688 -76.933  -53.307 1.00 39.55 ? 160 HIS C CD2 1 
ATOM   1595 C CE1 . HIS C  2 14  ? -14.479 -75.145  -53.693 1.00 40.00 ? 160 HIS C CE1 1 
ATOM   1596 N NE2 . HIS C  2 14  ? -14.745 -76.364  -54.123 1.00 39.61 ? 160 HIS C NE2 1 
ATOM   1597 N N   . CYS C  2 15  ? -17.834 -76.348  -48.108 1.00 27.63 ? 161 CYS C N   1 
ATOM   1598 C CA  . CYS C  2 15  ? -18.888 -76.210  -47.108 1.00 28.34 ? 161 CYS C CA  1 
ATOM   1599 C C   . CYS C  2 15  ? -18.446 -75.306  -45.941 1.00 27.79 ? 161 CYS C C   1 
ATOM   1600 O O   . CYS C  2 15  ? -19.247 -74.541  -45.430 1.00 25.50 ? 161 CYS C O   1 
ATOM   1601 C CB  . CYS C  2 15  ? -19.343 -77.586  -46.602 1.00 28.30 ? 161 CYS C CB  1 
ATOM   1602 S SG  . CYS C  2 15  ? -20.028 -78.616  -47.936 1.00 30.85 ? 161 CYS C SG  1 
ATOM   1603 N N   . LEU C  2 16  ? -17.172 -75.384  -45.560 1.00 27.70 ? 162 LEU C N   1 
ATOM   1604 C CA  . LEU C  2 16  ? -16.612 -74.489  -44.549 1.00 29.80 ? 162 LEU C CA  1 
ATOM   1605 C C   . LEU C  2 16  ? -16.538 -73.064  -45.081 1.00 27.96 ? 162 LEU C C   1 
ATOM   1606 O O   . LEU C  2 16  ? -16.871 -72.128  -44.368 1.00 26.24 ? 162 LEU C O   1 
ATOM   1607 C CB  . LEU C  2 16  ? -15.235 -74.969  -44.111 1.00 32.76 ? 162 LEU C CB  1 
ATOM   1608 C CG  . LEU C  2 16  ? -14.665 -74.351  -42.826 1.00 36.23 ? 162 LEU C CG  1 
ATOM   1609 C CD1 . LEU C  2 16  ? -15.507 -74.696  -41.609 1.00 36.15 ? 162 LEU C CD1 1 
ATOM   1610 C CD2 . LEU C  2 16  ? -13.224 -74.798  -42.613 1.00 37.27 ? 162 LEU C CD2 1 
ATOM   1611 N N   . ASP C  2 17  ? -16.159 -72.912  -46.353 1.00 28.01 ? 163 ASP C N   1 
ATOM   1612 C CA  . ASP C  2 17  ? -16.200 -71.603  -47.024 1.00 28.42 ? 163 ASP C CA  1 
ATOM   1613 C C   . ASP C  2 17  ? -17.623 -71.009  -47.005 1.00 27.36 ? 163 ASP C C   1 
ATOM   1614 O O   . ASP C  2 17  ? -17.799 -69.834  -46.737 1.00 25.54 ? 163 ASP C O   1 
ATOM   1615 C CB  . ASP C  2 17  ? -15.751 -71.697  -48.486 1.00 30.81 ? 163 ASP C CB  1 
ATOM   1616 C CG  . ASP C  2 17  ? -14.286 -72.070  -48.651 1.00 32.42 ? 163 ASP C CG  1 
ATOM   1617 O OD1 . ASP C  2 17  ? -13.486 -71.864  -47.725 1.00 36.29 ? 163 ASP C OD1 1 
ATOM   1618 O OD2 . ASP C  2 17  ? -13.941 -72.563  -49.745 1.00 35.60 ? 163 ASP C OD2 1 
ATOM   1619 N N   . ALA C  2 18  ? -18.628 -71.833  -47.307 1.00 25.39 ? 164 ALA C N   1 
ATOM   1620 C CA  . ALA C  2 18  ? -20.025 -71.403  -47.272 1.00 23.99 ? 164 ALA C CA  1 
ATOM   1621 C C   . ALA C  2 18  ? -20.493 -70.924  -45.882 1.00 24.43 ? 164 ALA C C   1 
ATOM   1622 O O   . ALA C  2 18  ? -21.226 -69.932  -45.769 1.00 24.09 ? 164 ALA C O   1 
ATOM   1623 C CB  . ALA C  2 18  ? -20.929 -72.527  -47.752 1.00 23.66 ? 164 ALA C CB  1 
ATOM   1624 N N   . ALA C  2 19  ? -20.114 -71.646  -44.831 1.00 23.87 ? 165 ALA C N   1 
ATOM   1625 C CA  . ALA C  2 19  ? -20.482 -71.226  -43.477 1.00 23.93 ? 165 ALA C CA  1 
ATOM   1626 C C   . ALA C  2 19  ? -19.851 -69.871  -43.147 1.00 22.68 ? 165 ALA C C   1 
ATOM   1627 O O   . ALA C  2 19  ? -20.505 -69.013  -42.564 1.00 22.42 ? 165 ALA C O   1 
ATOM   1628 C CB  . ALA C  2 19  ? -20.067 -72.271  -42.458 1.00 24.42 ? 165 ALA C CB  1 
ATOM   1629 N N   . LYS C  2 20  ? -18.594 -69.695  -43.548 1.00 23.81 ? 166 LYS C N   1 
ATOM   1630 C CA  . LYS C  2 20  ? -17.856 -68.437  -43.393 1.00 25.35 ? 166 LYS C CA  1 
ATOM   1631 C C   . LYS C  2 20  ? -18.562 -67.255  -44.057 1.00 25.46 ? 166 LYS C C   1 
ATOM   1632 O O   . LYS C  2 20  ? -18.867 -66.264  -43.389 1.00 27.22 ? 166 LYS C O   1 
ATOM   1633 C CB  . LYS C  2 20  ? -16.424 -68.594  -43.953 1.00 27.62 ? 166 LYS C CB  1 
ATOM   1634 C CG  . LYS C  2 20  ? -15.638 -67.296  -43.999 1.00 30.20 ? 166 LYS C CG  1 
ATOM   1635 C CD  . LYS C  2 20  ? -14.188 -67.504  -44.391 1.00 31.59 ? 166 LYS C CD  1 
ATOM   1636 C CE  . LYS C  2 20  ? -13.506 -66.147  -44.508 1.00 36.22 ? 166 LYS C CE  1 
ATOM   1637 N NZ  . LYS C  2 20  ? -12.133 -66.230  -45.094 1.00 38.95 ? 166 LYS C NZ  1 
ATOM   1638 N N   . ALA C  2 21  ? -18.859 -67.364  -45.355 1.00 24.20 ? 167 ALA C N   1 
ATOM   1639 C CA  . ALA C  2 21  ? -19.622 -66.323  -46.042 1.00 23.37 ? 167 ALA C CA  1 
ATOM   1640 C C   . ALA C  2 21  ? -20.958 -66.017  -45.330 1.00 23.35 ? 167 ALA C C   1 
ATOM   1641 O O   . ALA C  2 21  ? -21.363 -64.860  -45.221 1.00 23.50 ? 167 ALA C O   1 
ATOM   1642 C CB  . ALA C  2 21  ? -19.864 -66.710  -47.505 1.00 22.52 ? 167 ALA C CB  1 
ATOM   1643 N N   . CYS C  2 22  ? -21.641 -67.038  -44.829 1.00 23.02 ? 168 CYS C N   1 
ATOM   1644 C CA  . CYS C  2 22  ? -22.887 -66.803  -44.102 1.00 23.22 ? 168 CYS C CA  1 
ATOM   1645 C C   . CYS C  2 22  ? -22.630 -66.021  -42.809 1.00 23.60 ? 168 CYS C C   1 
ATOM   1646 O O   . CYS C  2 22  ? -23.248 -64.979  -42.569 1.00 22.87 ? 168 CYS C O   1 
ATOM   1647 C CB  . CYS C  2 22  ? -23.600 -68.117  -43.782 1.00 23.89 ? 168 CYS C CB  1 
ATOM   1648 S SG  . CYS C  2 22  ? -25.144 -67.858  -42.881 1.00 28.18 ? 168 CYS C SG  1 
ATOM   1649 N N   . ASN C  2 23  ? -21.706 -66.515  -41.991 1.00 23.41 ? 169 ASN C N   1 
ATOM   1650 C CA  . ASN C  2 23  ? -21.430 -65.887  -40.687 1.00 23.70 ? 169 ASN C CA  1 
ATOM   1651 C C   . ASN C  2 23  ? -20.911 -64.432  -40.836 1.00 25.80 ? 169 ASN C C   1 
ATOM   1652 O O   . ASN C  2 23  ? -21.163 -63.589  -39.969 1.00 26.10 ? 169 ASN C O   1 
ATOM   1653 C CB  . ASN C  2 23  ? -20.456 -66.737  -39.859 1.00 22.76 ? 169 ASN C CB  1 
ATOM   1654 C CG  . ASN C  2 23  ? -21.149 -67.780  -38.987 1.00 22.79 ? 169 ASN C CG  1 
ATOM   1655 O OD1 . ASN C  2 23  ? -22.378 -67.988  -39.051 1.00 22.35 ? 169 ASN C OD1 1 
ATOM   1656 N ND2 . ASN C  2 23  ? -20.358 -68.437  -38.140 1.00 22.15 ? 169 ASN C ND2 1 
ATOM   1657 N N   . LEU C  2 24  ? -20.221 -64.148  -41.943 1.00 27.04 ? 170 LEU C N   1 
ATOM   1658 C CA  . LEU C  2 24  ? -19.738 -62.793  -42.247 1.00 28.67 ? 170 LEU C CA  1 
ATOM   1659 C C   . LEU C  2 24  ? -20.817 -61.835  -42.772 1.00 28.91 ? 170 LEU C C   1 
ATOM   1660 O O   . LEU C  2 24  ? -20.553 -60.641  -42.949 1.00 29.96 ? 170 LEU C O   1 
ATOM   1661 C CB  . LEU C  2 24  ? -18.565 -62.852  -43.229 1.00 29.81 ? 170 LEU C CB  1 
ATOM   1662 C CG  . LEU C  2 24  ? -17.147 -62.916  -42.661 1.00 31.95 ? 170 LEU C CG  1 
ATOM   1663 C CD1 . LEU C  2 24  ? -17.076 -63.688  -41.366 1.00 34.38 ? 170 LEU C CD1 1 
ATOM   1664 C CD2 . LEU C  2 24  ? -16.188 -63.501  -43.693 1.00 33.71 ? 170 LEU C CD2 1 
ATOM   1665 N N   . ASN C  2 25  ? -22.015 -62.359  -43.007 1.00 27.64 ? 171 ASN C N   1 
ATOM   1666 C CA  . ASN C  2 25  ? -23.172 -61.574  -43.409 1.00 28.80 ? 171 ASN C CA  1 
ATOM   1667 C C   . ASN C  2 25  ? -24.158 -61.505  -42.245 1.00 29.02 ? 171 ASN C C   1 
ATOM   1668 O O   . ASN C  2 25  ? -24.644 -62.526  -41.785 1.00 26.49 ? 171 ASN C O   1 
ATOM   1669 C CB  . ASN C  2 25  ? -23.838 -62.220  -44.634 1.00 28.29 ? 171 ASN C CB  1 
ATOM   1670 C CG  . ASN C  2 25  ? -25.066 -61.472  -45.096 1.00 29.39 ? 171 ASN C CG  1 
ATOM   1671 O OD1 . ASN C  2 25  ? -26.193 -61.784  -44.702 1.00 29.18 ? 171 ASN C OD1 1 
ATOM   1672 N ND2 . ASN C  2 25  ? -24.859 -60.478  -45.940 1.00 30.73 ? 171 ASN C ND2 1 
ATOM   1673 N N   . ASP C  2 26  ? -24.458 -60.292  -41.788 1.00 32.28 ? 172 ASP C N   1 
ATOM   1674 C CA  . ASP C  2 26  ? -25.265 -60.084  -40.580 1.00 33.52 ? 172 ASP C CA  1 
ATOM   1675 C C   . ASP C  2 26  ? -26.598 -60.797  -40.573 1.00 30.56 ? 172 ASP C C   1 
ATOM   1676 O O   . ASP C  2 26  ? -26.946 -61.458  -39.605 1.00 29.72 ? 172 ASP C O   1 
ATOM   1677 C CB  . ASP C  2 26  ? -25.496 -58.586  -40.333 1.00 38.80 ? 172 ASP C CB  1 
ATOM   1678 C CG  . ASP C  2 26  ? -24.774 -58.096  -39.102 1.00 45.50 ? 172 ASP C CG  1 
ATOM   1679 O OD1 . ASP C  2 26  ? -25.374 -58.240  -38.003 1.00 52.11 ? 172 ASP C OD1 1 
ATOM   1680 O OD2 . ASP C  2 26  ? -23.608 -57.624  -39.222 1.00 46.56 ? 172 ASP C OD2 1 
ATOM   1681 N N   . ASN C  2 27  ? -27.348 -60.646  -41.654 1.00 28.91 ? 173 ASN C N   1 
ATOM   1682 C CA  . ASN C  2 27  ? -28.648 -61.299  -41.786 1.00 29.28 ? 173 ASN C CA  1 
ATOM   1683 C C   . ASN C  2 27  ? -28.519 -62.835  -41.797 1.00 26.84 ? 173 ASN C C   1 
ATOM   1684 O O   . ASN C  2 27  ? -29.232 -63.516  -41.058 1.00 25.48 ? 173 ASN C O   1 
ATOM   1685 C CB  . ASN C  2 27  ? -29.341 -60.798  -43.060 1.00 29.11 ? 173 ASN C CB  1 
ATOM   1686 C CG  . ASN C  2 27  ? -30.717 -61.418  -43.281 1.00 29.28 ? 173 ASN C CG  1 
ATOM   1687 O OD1 . ASN C  2 27  ? -31.575 -61.381  -42.414 1.00 31.34 ? 173 ASN C OD1 1 
ATOM   1688 N ND2 . ASN C  2 27  ? -30.933 -61.972  -44.462 1.00 30.16 ? 173 ASN C ND2 1 
ATOM   1689 N N   . CYS C  2 28  ? -27.607 -63.362  -42.614 1.00 25.84 ? 174 CYS C N   1 
ATOM   1690 C CA  . CYS C  2 28  ? -27.432 -64.822  -42.726 1.00 26.70 ? 174 CYS C CA  1 
ATOM   1691 C C   . CYS C  2 28  ? -27.006 -65.376  -41.377 1.00 26.52 ? 174 CYS C C   1 
ATOM   1692 O O   . CYS C  2 28  ? -27.590 -66.327  -40.876 1.00 26.00 ? 174 CYS C O   1 
ATOM   1693 C CB  . CYS C  2 28  ? -26.403 -65.208  -43.798 1.00 26.65 ? 174 CYS C CB  1 
ATOM   1694 S SG  . CYS C  2 28  ? -26.352 -66.989  -44.249 1.00 26.24 ? 174 CYS C SG  1 
ATOM   1695 N N   . LYS C  2 29  ? -26.011 -64.753  -40.765 1.00 28.03 ? 175 LYS C N   1 
ATOM   1696 C CA  . LYS C  2 29  ? -25.524 -65.264  -39.498 1.00 29.88 ? 175 LYS C CA  1 
ATOM   1697 C C   . LYS C  2 29  ? -26.609 -65.278  -38.399 1.00 28.97 ? 175 LYS C C   1 
ATOM   1698 O O   . LYS C  2 29  ? -26.684 -66.229  -37.626 1.00 27.25 ? 175 LYS C O   1 
ATOM   1699 C CB  . LYS C  2 29  ? -24.229 -64.560  -39.100 1.00 33.22 ? 175 LYS C CB  1 
ATOM   1700 C CG  . LYS C  2 29  ? -24.337 -63.370  -38.189 1.00 36.58 ? 175 LYS C CG  1 
ATOM   1701 C CD  . LYS C  2 29  ? -23.822 -63.722  -36.796 1.00 35.72 ? 175 LYS C CD  1 
ATOM   1702 C CE  . LYS C  2 29  ? -24.604 -62.975  -35.737 1.00 35.25 ? 175 LYS C CE  1 
ATOM   1703 N NZ  . LYS C  2 29  ? -24.120 -61.593  -35.541 1.00 36.99 ? 175 LYS C NZ  1 
ATOM   1704 N N   . LYS C  2 30  ? -27.480 -64.269  -38.370 1.00 27.32 ? 176 LYS C N   1 
ATOM   1705 C CA  . LYS C  2 30  ? -28.556 -64.228  -37.382 1.00 28.44 ? 176 LYS C CA  1 
ATOM   1706 C C   . LYS C  2 30  ? -29.568 -65.326  -37.631 1.00 26.46 ? 176 LYS C C   1 
ATOM   1707 O O   . LYS C  2 30  ? -30.001 -65.991  -36.695 1.00 24.26 ? 176 LYS C O   1 
ATOM   1708 C CB  . LYS C  2 30  ? -29.302 -62.880  -37.387 1.00 31.70 ? 176 LYS C CB  1 
ATOM   1709 C CG  . LYS C  2 30  ? -28.526 -61.731  -36.761 1.00 35.72 ? 176 LYS C CG  1 
ATOM   1710 C CD  . LYS C  2 30  ? -29.120 -60.357  -37.078 1.00 39.14 ? 176 LYS C CD  1 
ATOM   1711 C CE  . LYS C  2 30  ? -28.402 -59.282  -36.271 1.00 41.97 ? 176 LYS C CE  1 
ATOM   1712 N NZ  . LYS C  2 30  ? -28.440 -57.921  -36.879 1.00 45.07 ? 176 LYS C NZ  1 
ATOM   1713 N N   . LEU C  2 31  ? -29.989 -65.483  -38.883 1.00 25.78 ? 177 LEU C N   1 
ATOM   1714 C CA  . LEU C  2 31  ? -31.044 -66.448  -39.196 1.00 25.86 ? 177 LEU C CA  1 
ATOM   1715 C C   . LEU C  2 31  ? -30.500 -67.878  -39.157 1.00 25.62 ? 177 LEU C C   1 
ATOM   1716 O O   . LEU C  2 31  ? -31.237 -68.815  -38.838 1.00 26.01 ? 177 LEU C O   1 
ATOM   1717 C CB  . LEU C  2 31  ? -31.712 -66.136  -40.537 1.00 27.77 ? 177 LEU C CB  1 
ATOM   1718 C CG  . LEU C  2 31  ? -32.884 -65.152  -40.506 1.00 28.42 ? 177 LEU C CG  1 
ATOM   1719 C CD1 . LEU C  2 31  ? -32.501 -63.837  -39.872 1.00 30.76 ? 177 LEU C CD1 1 
ATOM   1720 C CD2 . LEU C  2 31  ? -33.368 -64.890  -41.918 1.00 30.21 ? 177 LEU C CD2 1 
ATOM   1721 N N   . ARG C  2 32  ? -29.214 -68.031  -39.455 1.00 23.99 ? 178 ARG C N   1 
ATOM   1722 C CA  . ARG C  2 32  ? -28.538 -69.315  -39.301 1.00 24.18 ? 178 ARG C CA  1 
ATOM   1723 C C   . ARG C  2 32  ? -28.446 -69.671  -37.827 1.00 24.86 ? 178 ARG C C   1 
ATOM   1724 O O   . ARG C  2 32  ? -28.831 -70.762  -37.433 1.00 23.58 ? 178 ARG C O   1 
ATOM   1725 C CB  . ARG C  2 32  ? -27.134 -69.278  -39.906 1.00 23.76 ? 178 ARG C CB  1 
ATOM   1726 C CG  . ARG C  2 32  ? -26.430 -70.624  -39.879 1.00 24.47 ? 178 ARG C CG  1 
ATOM   1727 C CD  . ARG C  2 32  ? -24.943 -70.487  -40.099 1.00 24.50 ? 178 ARG C CD  1 
ATOM   1728 N NE  . ARG C  2 32  ? -24.309 -71.794  -40.099 1.00 25.23 ? 178 ARG C NE  1 
ATOM   1729 C CZ  . ARG C  2 32  ? -23.069 -72.044  -39.706 1.00 26.81 ? 178 ARG C CZ  1 
ATOM   1730 N NH1 . ARG C  2 32  ? -22.264 -71.062  -39.255 1.00 26.84 ? 178 ARG C NH1 1 
ATOM   1731 N NH2 . ARG C  2 32  ? -22.619 -73.294  -39.773 1.00 26.87 ? 178 ARG C NH2 1 
ATOM   1732 N N   . SER C  2 33  ? -27.920 -68.766  -37.005 1.00 25.31 ? 179 SER C N   1 
ATOM   1733 C CA  . SER C  2 33  ? -27.817 -69.056  -35.569 1.00 26.09 ? 179 SER C CA  1 
ATOM   1734 C C   . SER C  2 33  ? -29.198 -69.341  -34.967 1.00 26.06 ? 179 SER C C   1 
ATOM   1735 O O   . SER C  2 33  ? -29.350 -70.227  -34.130 1.00 26.47 ? 179 SER C O   1 
ATOM   1736 C CB  . SER C  2 33  ? -27.126 -67.923  -34.789 1.00 26.31 ? 179 SER C CB  1 
ATOM   1737 O OG  . SER C  2 33  ? -26.844 -68.341  -33.443 1.00 26.97 ? 179 SER C OG  1 
ATOM   1738 N N   . SER C  2 34  ? -30.210 -68.613  -35.409 1.00 26.57 ? 180 SER C N   1 
ATOM   1739 C CA  . SER C  2 34  ? -31.539 -68.812  -34.856 1.00 27.56 ? 180 SER C CA  1 
ATOM   1740 C C   . SER C  2 34  ? -32.035 -70.241  -35.110 1.00 27.73 ? 180 SER C C   1 
ATOM   1741 O O   . SER C  2 34  ? -32.520 -70.895  -34.186 1.00 26.95 ? 180 SER C O   1 
ATOM   1742 C CB  . SER C  2 34  ? -32.529 -67.790  -35.401 1.00 29.07 ? 180 SER C CB  1 
ATOM   1743 O OG  . SER C  2 34  ? -33.847 -68.175  -35.038 1.00 31.53 ? 180 SER C OG  1 
ATOM   1744 N N   . TYR C  2 35  ? -31.889 -70.758  -36.335 1.00 25.82 ? 181 TYR C N   1 
ATOM   1745 C CA  . TYR C  2 35  ? -32.406 -72.109  -36.580 1.00 24.16 ? 181 TYR C CA  1 
ATOM   1746 C C   . TYR C  2 35  ? -31.522 -73.119  -35.857 1.00 23.61 ? 181 TYR C C   1 
ATOM   1747 O O   . TYR C  2 35  ? -32.033 -74.077  -35.294 1.00 23.91 ? 181 TYR C O   1 
ATOM   1748 C CB  . TYR C  2 35  ? -32.659 -72.422  -38.085 1.00 23.42 ? 181 TYR C CB  1 
ATOM   1749 C CG  . TYR C  2 35  ? -31.494 -72.912  -38.914 1.00 23.12 ? 181 TYR C CG  1 
ATOM   1750 C CD1 . TYR C  2 35  ? -30.988 -74.204  -38.772 1.00 23.16 ? 181 TYR C CD1 1 
ATOM   1751 C CD2 . TYR C  2 35  ? -30.949 -72.112  -39.894 1.00 22.39 ? 181 TYR C CD2 1 
ATOM   1752 C CE1 . TYR C  2 35  ? -29.929 -74.647  -39.561 1.00 22.91 ? 181 TYR C CE1 1 
ATOM   1753 C CE2 . TYR C  2 35  ? -29.895 -72.546  -40.683 1.00 22.86 ? 181 TYR C CE2 1 
ATOM   1754 C CZ  . TYR C  2 35  ? -29.389 -73.805  -40.510 1.00 21.68 ? 181 TYR C CZ  1 
ATOM   1755 O OH  . TYR C  2 35  ? -28.360 -74.194  -41.302 1.00 21.93 ? 181 TYR C OH  1 
ATOM   1756 N N   . ILE C  2 36  ? -30.211 -72.875  -35.810 1.00 23.33 ? 182 ILE C N   1 
ATOM   1757 C CA  . ILE C  2 36  ? -29.299 -73.768  -35.083 1.00 23.16 ? 182 ILE C CA  1 
ATOM   1758 C C   . ILE C  2 36  ? -29.636 -73.810  -33.591 1.00 24.88 ? 182 ILE C C   1 
ATOM   1759 O O   . ILE C  2 36  ? -29.771 -74.894  -33.027 1.00 27.66 ? 182 ILE C O   1 
ATOM   1760 C CB  . ILE C  2 36  ? -27.818 -73.401  -35.286 1.00 22.75 ? 182 ILE C CB  1 
ATOM   1761 C CG1 . ILE C  2 36  ? -27.400 -73.708  -36.724 1.00 23.17 ? 182 ILE C CG1 1 
ATOM   1762 C CG2 . ILE C  2 36  ? -26.910 -74.161  -34.315 1.00 22.83 ? 182 ILE C CG2 1 
ATOM   1763 C CD1 . ILE C  2 36  ? -26.049 -73.152  -37.129 1.00 23.28 ? 182 ILE C CD1 1 
ATOM   1764 N N   . SER C  2 37  ? -29.806 -72.661  -32.951 1.00 25.16 ? 183 SER C N   1 
ATOM   1765 C CA  . SER C  2 37  ? -30.061 -72.667  -31.509 1.00 26.67 ? 183 SER C CA  1 
ATOM   1766 C C   . SER C  2 37  ? -31.429 -73.272  -31.183 1.00 26.77 ? 183 SER C C   1 
ATOM   1767 O O   . SER C  2 37  ? -31.540 -74.027  -30.227 1.00 26.91 ? 183 SER C O   1 
ATOM   1768 C CB  . SER C  2 37  ? -29.886 -71.279  -30.891 1.00 27.12 ? 183 SER C CB  1 
ATOM   1769 O OG  . SER C  2 37  ? -30.717 -70.336  -31.526 1.00 28.54 ? 183 SER C OG  1 
ATOM   1770 N N   . ILE C  2 38  ? -32.447 -73.004  -31.998 1.00 28.30 ? 184 ILE C N   1 
ATOM   1771 C CA  . ILE C  2 38  ? -33.758 -73.646  -31.806 1.00 30.15 ? 184 ILE C CA  1 
ATOM   1772 C C   . ILE C  2 38  ? -33.692 -75.152  -32.092 1.00 30.47 ? 184 ILE C C   1 
ATOM   1773 O O   . ILE C  2 38  ? -34.093 -75.955  -31.268 1.00 32.22 ? 184 ILE C O   1 
ATOM   1774 C CB  . ILE C  2 38  ? -34.866 -73.009  -32.681 1.00 32.40 ? 184 ILE C CB  1 
ATOM   1775 C CG1 . ILE C  2 38  ? -35.143 -71.570  -32.240 1.00 33.81 ? 184 ILE C CG1 1 
ATOM   1776 C CG2 . ILE C  2 38  ? -36.159 -73.829  -32.601 1.00 33.68 ? 184 ILE C CG2 1 
ATOM   1777 C CD1 . ILE C  2 38  ? -35.911 -70.752  -33.256 1.00 35.66 ? 184 ILE C CD1 1 
ATOM   1778 N N   . CYS C  2 39  ? -33.179 -75.537  -33.255 1.00 30.03 ? 185 CYS C N   1 
ATOM   1779 C CA  . CYS C  2 39  ? -33.153 -76.948  -33.628 1.00 29.82 ? 185 CYS C CA  1 
ATOM   1780 C C   . CYS C  2 39  ? -32.265 -77.801  -32.719 1.00 29.53 ? 185 CYS C C   1 
ATOM   1781 O O   . CYS C  2 39  ? -32.513 -78.990  -32.567 1.00 31.05 ? 185 CYS C O   1 
ATOM   1782 C CB  . CYS C  2 39  ? -32.691 -77.127  -35.079 1.00 29.84 ? 185 CYS C CB  1 
ATOM   1783 S SG  . CYS C  2 39  ? -33.767 -76.397  -36.313 1.00 28.29 ? 185 CYS C SG  1 
ATOM   1784 N N   . ASN C  2 40  ? -31.228 -77.203  -32.137 1.00 28.00 ? 186 ASN C N   1 
ATOM   1785 C CA  . ASN C  2 40  ? -30.276 -77.944  -31.317 1.00 28.05 ? 186 ASN C CA  1 
ATOM   1786 C C   . ASN C  2 40  ? -30.720 -78.096  -29.864 1.00 29.94 ? 186 ASN C C   1 
ATOM   1787 O O   . ASN C  2 40  ? -30.113 -78.853  -29.129 1.00 30.10 ? 186 ASN C O   1 
ATOM   1788 C CB  . ASN C  2 40  ? -28.913 -77.241  -31.358 1.00 26.36 ? 186 ASN C CB  1 
ATOM   1789 C CG  . ASN C  2 40  ? -27.753 -78.149  -31.010 1.00 25.18 ? 186 ASN C CG  1 
ATOM   1790 O OD1 . ASN C  2 40  ? -27.767 -79.335  -31.299 1.00 25.43 ? 186 ASN C OD1 1 
ATOM   1791 N ND2 . ASN C  2 40  ? -26.701 -77.567  -30.445 1.00 25.24 ? 186 ASN C ND2 1 
ATOM   1792 N N   . ARG C  2 41  ? -31.761 -77.377  -29.454 1.00 35.03 ? 187 ARG C N   1 
ATOM   1793 C CA  . ARG C  2 41  ? -32.180 -77.315  -28.040 1.00 41.81 ? 187 ARG C CA  1 
ATOM   1794 C C   . ARG C  2 41  ? -33.037 -78.516  -27.622 1.00 42.77 ? 187 ARG C C   1 
ATOM   1795 O O   . ARG C  2 41  ? -34.174 -78.643  -28.073 1.00 41.21 ? 187 ARG C O   1 
ATOM   1796 C CB  . ARG C  2 41  ? -32.959 -76.010  -27.785 1.00 45.79 ? 187 ARG C CB  1 
ATOM   1797 C CG  . ARG C  2 41  ? -33.662 -75.935  -26.430 1.00 53.58 ? 187 ARG C CG  1 
ATOM   1798 C CD  . ARG C  2 41  ? -34.234 -74.550  -26.114 1.00 58.56 ? 187 ARG C CD  1 
ATOM   1799 N NE  . ARG C  2 41  ? -33.929 -74.147  -24.735 1.00 66.92 ? 187 ARG C NE  1 
ATOM   1800 C CZ  . ARG C  2 41  ? -32.802 -73.540  -24.343 1.00 73.93 ? 187 ARG C CZ  1 
ATOM   1801 N NH1 . ARG C  2 41  ? -31.845 -73.230  -25.220 1.00 74.96 ? 187 ARG C NH1 1 
ATOM   1802 N NH2 . ARG C  2 41  ? -32.626 -73.231  -23.058 1.00 75.91 ? 187 ARG C NH2 1 
ATOM   1803 N N   . GLU C  2 42  ? -32.494 -79.370  -26.754 1.00 47.35 ? 188 GLU C N   1 
ATOM   1804 C CA  . GLU C  2 42  ? -33.220 -80.543  -26.225 1.00 51.58 ? 188 GLU C CA  1 
ATOM   1805 C C   . GLU C  2 42  ? -34.336 -80.146  -25.272 1.00 51.29 ? 188 GLU C C   1 
ATOM   1806 O O   . GLU C  2 42  ? -34.143 -79.298  -24.415 1.00 51.06 ? 188 GLU C O   1 
ATOM   1807 C CB  . GLU C  2 42  ? -32.283 -81.509  -25.487 1.00 54.68 ? 188 GLU C CB  1 
ATOM   1808 C CG  . GLU C  2 42  ? -31.777 -82.671  -26.330 1.00 59.64 ? 188 GLU C CG  1 
ATOM   1809 C CD  . GLU C  2 42  ? -31.332 -83.871  -25.499 1.00 63.22 ? 188 GLU C CD  1 
ATOM   1810 O OE1 . GLU C  2 42  ? -30.247 -84.424  -25.774 1.00 68.66 ? 188 GLU C OE1 1 
ATOM   1811 O OE2 . GLU C  2 42  ? -32.071 -84.276  -24.577 1.00 67.46 ? 188 GLU C OE2 1 
ATOM   1812 N N   . ILE C  2 43  ? -35.497 -80.772  -25.425 1.00 53.17 ? 189 ILE C N   1 
ATOM   1813 C CA  . ILE C  2 43  ? -36.652 -80.494  -24.564 1.00 56.76 ? 189 ILE C CA  1 
ATOM   1814 C C   . ILE C  2 43  ? -36.667 -81.442  -23.364 1.00 58.82 ? 189 ILE C C   1 
ATOM   1815 O O   . ILE C  2 43  ? -36.908 -81.015  -22.235 1.00 62.06 ? 189 ILE C O   1 
ATOM   1816 C CB  . ILE C  2 43  ? -37.984 -80.626  -25.335 1.00 54.27 ? 189 ILE C CB  1 
ATOM   1817 C CG1 . ILE C  2 43  ? -37.970 -79.761  -26.605 1.00 55.05 ? 189 ILE C CG1 1 
ATOM   1818 C CG2 . ILE C  2 43  ? -39.168 -80.250  -24.454 1.00 53.23 ? 189 ILE C CG2 1 
ATOM   1819 C CD1 . ILE C  2 43  ? -37.710 -78.280  -26.392 1.00 52.73 ? 189 ILE C CD1 1 
ATOM   1820 N N   . SER C  2 44  ? -36.424 -82.723  -23.622 1.00 59.66 ? 190 SER C N   1 
ATOM   1821 C CA  . SER C  2 44  ? -36.397 -83.747  -22.575 1.00 64.06 ? 190 SER C CA  1 
ATOM   1822 C C   . SER C  2 44  ? -35.602 -84.950  -23.088 1.00 65.84 ? 190 SER C C   1 
ATOM   1823 O O   . SER C  2 44  ? -35.294 -85.028  -24.281 1.00 60.59 ? 190 SER C O   1 
ATOM   1824 C CB  . SER C  2 44  ? -37.829 -84.157  -22.185 1.00 62.85 ? 190 SER C CB  1 
ATOM   1825 O OG  . SER C  2 44  ? -38.424 -84.992  -23.163 1.00 60.86 ? 190 SER C OG  1 
ATOM   1826 N N   . PRO C  2 45  ? -35.266 -85.898  -22.197 1.00 71.05 ? 191 PRO C N   1 
ATOM   1827 C CA  . PRO C  2 45  ? -34.526 -87.069  -22.692 1.00 72.13 ? 191 PRO C CA  1 
ATOM   1828 C C   . PRO C  2 45  ? -35.217 -87.790  -23.853 1.00 69.88 ? 191 PRO C C   1 
ATOM   1829 O O   . PRO C  2 45  ? -34.550 -88.466  -24.634 1.00 68.25 ? 191 PRO C O   1 
ATOM   1830 C CB  . PRO C  2 45  ? -34.439 -88.001  -21.471 1.00 72.18 ? 191 PRO C CB  1 
ATOM   1831 C CG  . PRO C  2 45  ? -34.914 -87.224  -20.294 1.00 73.20 ? 191 PRO C CG  1 
ATOM   1832 C CD  . PRO C  2 45  ? -35.379 -85.867  -20.728 1.00 71.51 ? 191 PRO C CD  1 
ATOM   1833 N N   . THR C  2 46  ? -36.536 -87.646  -23.950 1.00 67.87 ? 192 THR C N   1 
ATOM   1834 C CA  . THR C  2 46  ? -37.331 -88.350  -24.947 1.00 68.96 ? 192 THR C CA  1 
ATOM   1835 C C   . THR C  2 46  ? -37.709 -87.468  -26.158 1.00 68.60 ? 192 THR C C   1 
ATOM   1836 O O   . THR C  2 46  ? -38.165 -87.983  -27.183 1.00 68.50 ? 192 THR C O   1 
ATOM   1837 C CB  . THR C  2 46  ? -38.598 -88.932  -24.279 1.00 71.29 ? 192 THR C CB  1 
ATOM   1838 O OG1 . THR C  2 46  ? -39.421 -87.870  -23.782 1.00 70.83 ? 192 THR C OG1 1 
ATOM   1839 C CG2 . THR C  2 46  ? -38.214 -89.849  -23.113 1.00 71.76 ? 192 THR C CG2 1 
ATOM   1840 N N   . GLU C  2 47  ? -37.507 -86.151  -26.045 1.00 64.44 ? 193 GLU C N   1 
ATOM   1841 C CA  . GLU C  2 47  ? -37.857 -85.205  -27.112 1.00 58.37 ? 193 GLU C CA  1 
ATOM   1842 C C   . GLU C  2 47  ? -36.643 -84.369  -27.496 1.00 53.03 ? 193 GLU C C   1 
ATOM   1843 O O   . GLU C  2 47  ? -36.297 -83.417  -26.808 1.00 46.95 ? 193 GLU C O   1 
ATOM   1844 C CB  . GLU C  2 47  ? -38.994 -84.288  -26.660 1.00 59.23 ? 193 GLU C CB  1 
ATOM   1845 C CG  . GLU C  2 47  ? -39.397 -83.257  -27.702 1.00 60.48 ? 193 GLU C CG  1 
ATOM   1846 C CD  . GLU C  2 47  ? -40.849 -82.847  -27.602 1.00 61.44 ? 193 GLU C CD  1 
ATOM   1847 O OE1 . GLU C  2 47  ? -41.627 -83.598  -26.984 1.00 64.93 ? 193 GLU C OE1 1 
ATOM   1848 O OE2 . GLU C  2 47  ? -41.218 -81.788  -28.157 1.00 60.76 ? 193 GLU C OE2 1 
ATOM   1849 N N   . ARG C  2 48  ? -36.007 -84.710  -28.608 1.00 50.03 ? 194 ARG C N   1 
ATOM   1850 C CA  . ARG C  2 48  ? -34.688 -84.152  -28.887 1.00 48.11 ? 194 ARG C CA  1 
ATOM   1851 C C   . ARG C  2 48  ? -34.750 -82.669  -29.326 1.00 42.72 ? 194 ARG C C   1 
ATOM   1852 O O   . ARG C  2 48  ? -33.750 -81.965  -29.236 1.00 41.60 ? 194 ARG C O   1 
ATOM   1853 C CB  . ARG C  2 48  ? -33.874 -85.081  -29.815 1.00 50.89 ? 194 ARG C CB  1 
ATOM   1854 C CG  . ARG C  2 48  ? -33.913 -84.803  -31.306 1.00 53.07 ? 194 ARG C CG  1 
ATOM   1855 C CD  . ARG C  2 48  ? -32.925 -83.710  -31.685 1.00 54.04 ? 194 ARG C CD  1 
ATOM   1856 N NE  . ARG C  2 48  ? -31.531 -84.007  -31.339 1.00 56.13 ? 194 ARG C NE  1 
ATOM   1857 C CZ  . ARG C  2 48  ? -30.640 -83.121  -30.873 1.00 59.23 ? 194 ARG C CZ  1 
ATOM   1858 N NH1 . ARG C  2 48  ? -30.965 -81.838  -30.627 1.00 57.74 ? 194 ARG C NH1 1 
ATOM   1859 N NH2 . ARG C  2 48  ? -29.402 -83.531  -30.631 1.00 60.54 ? 194 ARG C NH2 1 
ATOM   1860 N N   . CYS C  2 49  ? -35.919 -82.186  -29.746 1.00 39.65 ? 195 CYS C N   1 
ATOM   1861 C CA  . CYS C  2 49  ? -36.099 -80.756  -30.011 1.00 37.94 ? 195 CYS C CA  1 
ATOM   1862 C C   . CYS C  2 49  ? -37.557 -80.416  -30.184 1.00 36.33 ? 195 CYS C C   1 
ATOM   1863 O O   . CYS C  2 49  ? -38.389 -81.308  -30.302 1.00 39.08 ? 195 CYS C O   1 
ATOM   1864 C CB  . CYS C  2 49  ? -35.370 -80.348  -31.291 1.00 36.84 ? 195 CYS C CB  1 
ATOM   1865 S SG  . CYS C  2 49  ? -36.122 -81.134  -32.714 1.00 36.93 ? 195 CYS C SG  1 
ATOM   1866 N N   . ASN C  2 50  ? -37.862 -79.125  -30.211 1.00 35.87 ? 196 ASN C N   1 
ATOM   1867 C CA  . ASN C  2 50  ? -39.164 -78.660  -30.676 1.00 38.95 ? 196 ASN C CA  1 
ATOM   1868 C C   . ASN C  2 50  ? -39.134 -78.639  -32.217 1.00 41.81 ? 196 ASN C C   1 
ATOM   1869 O O   . ASN C  2 50  ? -38.597 -77.721  -32.844 1.00 42.33 ? 196 ASN C O   1 
ATOM   1870 C CB  . ASN C  2 50  ? -39.498 -77.279  -30.090 1.00 38.98 ? 196 ASN C CB  1 
ATOM   1871 C CG  . ASN C  2 50  ? -40.912 -76.827  -30.407 1.00 42.27 ? 196 ASN C CG  1 
ATOM   1872 O OD1 . ASN C  2 50  ? -41.513 -77.264  -31.381 1.00 43.72 ? 196 ASN C OD1 1 
ATOM   1873 N ND2 . ASN C  2 50  ? -41.443 -75.930  -29.594 1.00 45.80 ? 196 ASN C ND2 1 
ATOM   1874 N N   . ARG C  2 51  ? -39.709 -79.670  -32.818 1.00 44.38 ? 197 ARG C N   1 
ATOM   1875 C CA  . ARG C  2 51  ? -39.643 -79.848  -34.263 1.00 45.73 ? 197 ARG C CA  1 
ATOM   1876 C C   . ARG C  2 51  ? -40.359 -78.746  -35.026 1.00 44.26 ? 197 ARG C C   1 
ATOM   1877 O O   . ARG C  2 51  ? -39.819 -78.199  -35.993 1.00 42.81 ? 197 ARG C O   1 
ATOM   1878 C CB  . ARG C  2 51  ? -40.229 -81.197  -34.660 1.00 47.79 ? 197 ARG C CB  1 
ATOM   1879 C CG  . ARG C  2 51  ? -39.934 -81.562  -36.099 1.00 52.07 ? 197 ARG C CG  1 
ATOM   1880 C CD  . ARG C  2 51  ? -40.597 -82.855  -36.529 1.00 56.15 ? 197 ARG C CD  1 
ATOM   1881 N NE  . ARG C  2 51  ? -39.645 -83.595  -37.346 1.00 63.07 ? 197 ARG C NE  1 
ATOM   1882 C CZ  . ARG C  2 51  ? -39.049 -84.741  -37.009 1.00 68.48 ? 197 ARG C CZ  1 
ATOM   1883 N NH1 . ARG C  2 51  ? -39.336 -85.380  -35.870 1.00 70.51 ? 197 ARG C NH1 1 
ATOM   1884 N NH2 . ARG C  2 51  ? -38.171 -85.273  -37.849 1.00 69.57 ? 197 ARG C NH2 1 
ATOM   1885 N N   . ARG C  2 52  ? -41.574 -78.428  -34.595 1.00 41.95 ? 198 ARG C N   1 
ATOM   1886 C CA  . ARG C  2 52  ? -42.377 -77.415  -35.268 1.00 42.72 ? 198 ARG C CA  1 
ATOM   1887 C C   . ARG C  2 52  ? -41.586 -76.113  -35.346 1.00 39.16 ? 198 ARG C C   1 
ATOM   1888 O O   . ARG C  2 52  ? -41.526 -75.468  -36.386 1.00 36.83 ? 198 ARG C O   1 
ATOM   1889 C CB  . ARG C  2 52  ? -43.711 -77.188  -34.532 1.00 47.62 ? 198 ARG C CB  1 
ATOM   1890 C CG  . ARG C  2 52  ? -44.707 -76.283  -35.270 1.00 54.08 ? 198 ARG C CG  1 
ATOM   1891 C CD  . ARG C  2 52  ? -45.484 -75.386  -34.310 1.00 61.62 ? 198 ARG C CD  1 
ATOM   1892 N NE  . ARG C  2 52  ? -44.598 -74.395  -33.686 1.00 70.52 ? 198 ARG C NE  1 
ATOM   1893 C CZ  . ARG C  2 52  ? -44.979 -73.435  -32.845 1.00 74.19 ? 198 ARG C CZ  1 
ATOM   1894 N NH1 . ARG C  2 52  ? -46.252 -73.310  -32.493 1.00 80.09 ? 198 ARG C NH1 1 
ATOM   1895 N NH2 . ARG C  2 52  ? -44.077 -72.592  -32.354 1.00 76.19 ? 198 ARG C NH2 1 
ATOM   1896 N N   . LYS C  2 53  ? -40.974 -75.750  -34.229 1.00 36.62 ? 199 LYS C N   1 
ATOM   1897 C CA  . LYS C  2 53  ? -40.274 -74.477  -34.096 1.00 37.81 ? 199 LYS C CA  1 
ATOM   1898 C C   . LYS C  2 53  ? -38.994 -74.475  -34.937 1.00 33.86 ? 199 LYS C C   1 
ATOM   1899 O O   . LYS C  2 53  ? -38.644 -73.481  -35.525 1.00 33.26 ? 199 LYS C O   1 
ATOM   1900 C CB  . LYS C  2 53  ? -39.963 -74.211  -32.618 1.00 40.39 ? 199 LYS C CB  1 
ATOM   1901 C CG  . LYS C  2 53  ? -40.060 -72.749  -32.229 1.00 45.72 ? 199 LYS C CG  1 
ATOM   1902 C CD  . LYS C  2 53  ? -39.658 -72.518  -30.778 1.00 49.53 ? 199 LYS C CD  1 
ATOM   1903 C CE  . LYS C  2 53  ? -39.373 -71.044  -30.527 1.00 52.75 ? 199 LYS C CE  1 
ATOM   1904 N NZ  . LYS C  2 53  ? -39.015 -70.795  -29.106 1.00 55.81 ? 199 LYS C NZ  1 
ATOM   1905 N N   . CYS C  2 54  ? -38.317 -75.613  -34.978 1.00 32.21 ? 200 CYS C N   1 
ATOM   1906 C CA  . CYS C  2 54  ? -37.150 -75.820  -35.821 1.00 31.83 ? 200 CYS C CA  1 
ATOM   1907 C C   . CYS C  2 54  ? -37.485 -75.669  -37.306 1.00 30.95 ? 200 CYS C C   1 
ATOM   1908 O O   . CYS C  2 54  ? -36.798 -74.962  -38.051 1.00 27.72 ? 200 CYS C O   1 
ATOM   1909 C CB  . CYS C  2 54  ? -36.600 -77.219  -35.552 1.00 32.60 ? 200 CYS C CB  1 
ATOM   1910 S SG  . CYS C  2 54  ? -35.281 -77.753  -36.658 1.00 34.61 ? 200 CYS C SG  1 
ATOM   1911 N N   . HIS C  2 55  ? -38.553 -76.338  -37.726 1.00 32.35 ? 201 HIS C N   1 
ATOM   1912 C CA  . HIS C  2 55  ? -39.016 -76.267  -39.112 1.00 30.96 ? 201 HIS C CA  1 
ATOM   1913 C C   . HIS C  2 55  ? -39.362 -74.848  -39.511 1.00 31.99 ? 201 HIS C C   1 
ATOM   1914 O O   . HIS C  2 55  ? -38.963 -74.388  -40.583 1.00 31.98 ? 201 HIS C O   1 
ATOM   1915 C CB  . HIS C  2 55  ? -40.203 -77.197  -39.326 1.00 30.51 ? 201 HIS C CB  1 
ATOM   1916 C CG  . HIS C  2 55  ? -39.808 -78.600  -39.669 1.00 29.82 ? 201 HIS C CG  1 
ATOM   1917 N ND1 . HIS C  2 55  ? -40.656 -79.480  -40.305 1.00 30.47 ? 201 HIS C ND1 1 
ATOM   1918 C CD2 . HIS C  2 55  ? -38.643 -79.264  -39.490 1.00 29.75 ? 201 HIS C CD2 1 
ATOM   1919 C CE1 . HIS C  2 55  ? -40.030 -80.627  -40.501 1.00 30.77 ? 201 HIS C CE1 1 
ATOM   1920 N NE2 . HIS C  2 55  ? -38.808 -80.524  -40.012 1.00 30.55 ? 201 HIS C NE2 1 
ATOM   1921 N N   . LYS C  2 56  ? -40.070 -74.138  -38.634 1.00 33.84 ? 202 LYS C N   1 
ATOM   1922 C CA  . LYS C  2 56  ? -40.382 -72.725  -38.868 1.00 33.55 ? 202 LYS C CA  1 
ATOM   1923 C C   . LYS C  2 56  ? -39.111 -71.904  -39.051 1.00 29.53 ? 202 LYS C C   1 
ATOM   1924 O O   . LYS C  2 56  ? -39.009 -71.109  -39.976 1.00 28.98 ? 202 LYS C O   1 
ATOM   1925 C CB  . LYS C  2 56  ? -41.207 -72.168  -37.712 1.00 36.63 ? 202 LYS C CB  1 
ATOM   1926 C CG  . LYS C  2 56  ? -41.827 -70.785  -37.940 1.00 38.89 ? 202 LYS C CG  1 
ATOM   1927 C CD  . LYS C  2 56  ? -42.729 -70.416  -36.754 1.00 41.43 ? 202 LYS C CD  1 
ATOM   1928 C CE  . LYS C  2 56  ? -43.783 -69.387  -37.096 1.00 43.80 ? 202 LYS C CE  1 
ATOM   1929 N NZ  . LYS C  2 56  ? -43.124 -68.101  -37.435 1.00 46.40 ? 202 LYS C NZ  1 
ATOM   1930 N N   . ALA C  2 57  ? -38.125 -72.118  -38.188 1.00 27.98 ? 203 ALA C N   1 
ATOM   1931 C CA  . ALA C  2 57  ? -36.877 -71.363  -38.284 1.00 27.33 ? 203 ALA C CA  1 
ATOM   1932 C C   . ALA C  2 57  ? -36.077 -71.703  -39.569 1.00 27.03 ? 203 ALA C C   1 
ATOM   1933 O O   . ALA C  2 57  ? -35.428 -70.828  -40.156 1.00 25.94 ? 203 ALA C O   1 
ATOM   1934 C CB  . ALA C  2 57  ? -36.037 -71.593  -37.047 1.00 27.47 ? 203 ALA C CB  1 
ATOM   1935 N N   . LEU C  2 58  ? -36.146 -72.967  -39.996 1.00 25.99 ? 204 LEU C N   1 
ATOM   1936 C CA  . LEU C  2 58  ? -35.559 -73.406  -41.266 1.00 26.27 ? 204 LEU C CA  1 
ATOM   1937 C C   . LEU C  2 58  ? -36.229 -72.726  -42.464 1.00 26.60 ? 204 LEU C C   1 
ATOM   1938 O O   . LEU C  2 58  ? -35.550 -72.178  -43.333 1.00 24.45 ? 204 LEU C O   1 
ATOM   1939 C CB  . LEU C  2 58  ? -35.626 -74.941  -41.403 1.00 26.19 ? 204 LEU C CB  1 
ATOM   1940 C CG  . LEU C  2 58  ? -34.521 -75.715  -40.656 1.00 25.80 ? 204 LEU C CG  1 
ATOM   1941 C CD1 . LEU C  2 58  ? -34.866 -77.192  -40.496 1.00 27.39 ? 204 LEU C CD1 1 
ATOM   1942 C CD2 . LEU C  2 58  ? -33.161 -75.571  -41.331 1.00 25.37 ? 204 LEU C CD2 1 
ATOM   1943 N N   . ARG C  2 59  ? -37.562 -72.721  -42.480 1.00 28.65 ? 205 ARG C N   1 
ATOM   1944 C CA  . ARG C  2 59  ? -38.310 -72.047  -43.544 1.00 29.99 ? 205 ARG C CA  1 
ATOM   1945 C C   . ARG C  2 59  ? -37.910 -70.572  -43.631 1.00 30.46 ? 205 ARG C C   1 
ATOM   1946 O O   . ARG C  2 59  ? -37.662 -70.029  -44.726 1.00 30.73 ? 205 ARG C O   1 
ATOM   1947 C CB  . ARG C  2 59  ? -39.812 -72.192  -43.304 1.00 31.96 ? 205 ARG C CB  1 
ATOM   1948 C CG  . ARG C  2 59  ? -40.331 -73.603  -43.530 1.00 33.71 ? 205 ARG C CG  1 
ATOM   1949 C CD  . ARG C  2 59  ? -41.855 -73.693  -43.653 1.00 33.29 ? 205 ARG C CD  1 
ATOM   1950 N NE  . ARG C  2 59  ? -42.566 -73.036  -42.553 1.00 33.03 ? 205 ARG C NE  1 
ATOM   1951 C CZ  . ARG C  2 59  ? -42.894 -73.599  -41.393 1.00 33.76 ? 205 ARG C CZ  1 
ATOM   1952 N NH1 . ARG C  2 59  ? -43.541 -72.883  -40.479 1.00 36.08 ? 205 ARG C NH1 1 
ATOM   1953 N NH2 . ARG C  2 59  ? -42.588 -74.856  -41.126 1.00 32.78 ? 205 ARG C NH2 1 
ATOM   1954 N N   . GLN C  2 60  ? -37.798 -69.940  -42.471 1.00 30.39 ? 206 GLN C N   1 
ATOM   1955 C CA  . GLN C  2 60  ? -37.391 -68.528  -42.397 1.00 31.30 ? 206 GLN C CA  1 
ATOM   1956 C C   . GLN C  2 60  ? -36.000 -68.290  -42.937 1.00 28.76 ? 206 GLN C C   1 
ATOM   1957 O O   . GLN C  2 60  ? -35.752 -67.286  -43.609 1.00 28.10 ? 206 GLN C O   1 
ATOM   1958 C CB  . GLN C  2 60  ? -37.496 -68.001  -40.966 1.00 34.15 ? 206 GLN C CB  1 
ATOM   1959 C CG  . GLN C  2 60  ? -38.928 -67.631  -40.598 1.00 38.47 ? 206 GLN C CG  1 
ATOM   1960 C CD  . GLN C  2 60  ? -39.153 -67.291  -39.128 1.00 42.93 ? 206 GLN C CD  1 
ATOM   1961 O OE1 . GLN C  2 60  ? -40.199 -66.749  -38.776 1.00 48.37 ? 206 GLN C OE1 1 
ATOM   1962 N NE2 . GLN C  2 60  ? -38.199 -67.619  -38.263 1.00 44.88 ? 206 GLN C NE2 1 
ATOM   1963 N N   . PHE C  2 61  ? -35.099 -69.220  -42.678 1.00 27.44 ? 207 PHE C N   1 
ATOM   1964 C CA  . PHE C  2 61  ? -33.726 -69.085  -43.149 1.00 27.34 ? 207 PHE C CA  1 
ATOM   1965 C C   . PHE C  2 61  ? -33.704 -69.124  -44.674 1.00 26.20 ? 207 PHE C C   1 
ATOM   1966 O O   . PHE C  2 61  ? -33.137 -68.235  -45.312 1.00 25.07 ? 207 PHE C O   1 
ATOM   1967 C CB  . PHE C  2 61  ? -32.857 -70.200  -42.547 1.00 27.30 ? 207 PHE C CB  1 
ATOM   1968 C CG  . PHE C  2 61  ? -31.436 -70.210  -43.032 1.00 26.23 ? 207 PHE C CG  1 
ATOM   1969 C CD1 . PHE C  2 61  ? -30.543 -69.232  -42.636 1.00 26.30 ? 207 PHE C CD1 1 
ATOM   1970 C CD2 . PHE C  2 61  ? -30.992 -71.209  -43.879 1.00 27.03 ? 207 PHE C CD2 1 
ATOM   1971 C CE1 . PHE C  2 61  ? -29.238 -69.254  -43.067 1.00 27.12 ? 207 PHE C CE1 1 
ATOM   1972 C CE2 . PHE C  2 61  ? -29.681 -71.236  -44.321 1.00 26.86 ? 207 PHE C CE2 1 
ATOM   1973 C CZ  . PHE C  2 61  ? -28.804 -70.256  -43.915 1.00 27.22 ? 207 PHE C CZ  1 
ATOM   1974 N N   . PHE C  2 62  ? -34.350 -70.131  -45.256 1.00 26.41 ? 208 PHE C N   1 
ATOM   1975 C CA  . PHE C  2 62  ? -34.349 -70.289  -46.718 1.00 27.64 ? 208 PHE C CA  1 
ATOM   1976 C C   . PHE C  2 62  ? -35.188 -69.241  -47.442 1.00 30.38 ? 208 PHE C C   1 
ATOM   1977 O O   . PHE C  2 62  ? -34.873 -68.897  -48.576 1.00 31.03 ? 208 PHE C O   1 
ATOM   1978 C CB  . PHE C  2 62  ? -34.749 -71.714  -47.123 1.00 28.01 ? 208 PHE C CB  1 
ATOM   1979 C CG  . PHE C  2 62  ? -33.688 -72.719  -46.822 1.00 27.46 ? 208 PHE C CG  1 
ATOM   1980 C CD1 . PHE C  2 62  ? -32.579 -72.813  -47.634 1.00 28.85 ? 208 PHE C CD1 1 
ATOM   1981 C CD2 . PHE C  2 62  ? -33.773 -73.535  -45.712 1.00 28.12 ? 208 PHE C CD2 1 
ATOM   1982 C CE1 . PHE C  2 62  ? -31.571 -73.719  -47.360 1.00 28.81 ? 208 PHE C CE1 1 
ATOM   1983 C CE2 . PHE C  2 62  ? -32.765 -74.440  -45.419 1.00 28.43 ? 208 PHE C CE2 1 
ATOM   1984 C CZ  . PHE C  2 62  ? -31.667 -74.534  -46.248 1.00 28.73 ? 208 PHE C CZ  1 
ATOM   1985 N N   . ASP C  2 63  ? -36.219 -68.714  -46.782 1.00 31.82 ? 209 ASP C N   1 
ATOM   1986 C CA  . ASP C  2 63  ? -37.057 -67.663  -47.369 1.00 34.11 ? 209 ASP C CA  1 
ATOM   1987 C C   . ASP C  2 63  ? -36.424 -66.281  -47.287 1.00 33.87 ? 209 ASP C C   1 
ATOM   1988 O O   . ASP C  2 63  ? -36.546 -65.498  -48.210 1.00 33.25 ? 209 ASP C O   1 
ATOM   1989 C CB  . ASP C  2 63  ? -38.432 -67.598  -46.685 1.00 36.76 ? 209 ASP C CB  1 
ATOM   1990 C CG  . ASP C  2 63  ? -39.303 -68.801  -46.999 1.00 39.94 ? 209 ASP C CG  1 
ATOM   1991 O OD1 . ASP C  2 63  ? -39.036 -69.521  -47.997 1.00 42.89 ? 209 ASP C OD1 1 
ATOM   1992 O OD2 . ASP C  2 63  ? -40.271 -69.029  -46.239 1.00 44.09 ? 209 ASP C OD2 1 
ATOM   1993 N N   . ARG C  2 64  ? -35.750 -65.976  -46.187 1.00 35.04 ? 210 ARG C N   1 
ATOM   1994 C CA  . ARG C  2 64  ? -35.297 -64.611  -45.930 1.00 35.71 ? 210 ARG C CA  1 
ATOM   1995 C C   . ARG C  2 64  ? -33.800 -64.390  -46.089 1.00 33.14 ? 210 ARG C C   1 
ATOM   1996 O O   . ARG C  2 64  ? -33.325 -63.285  -45.872 1.00 29.64 ? 210 ARG C O   1 
ATOM   1997 C CB  . ARG C  2 64  ? -35.702 -64.182  -44.523 1.00 40.24 ? 210 ARG C CB  1 
ATOM   1998 C CG  . ARG C  2 64  ? -37.172 -64.392  -44.193 1.00 45.01 ? 210 ARG C CG  1 
ATOM   1999 C CD  . ARG C  2 64  ? -37.645 -63.349  -43.203 1.00 52.24 ? 210 ARG C CD  1 
ATOM   2000 N NE  . ARG C  2 64  ? -38.755 -63.795  -42.354 1.00 57.16 ? 210 ARG C NE  1 
ATOM   2001 C CZ  . ARG C  2 64  ? -38.686 -63.982  -41.033 1.00 60.56 ? 210 ARG C CZ  1 
ATOM   2002 N NH1 . ARG C  2 64  ? -39.770 -64.370  -40.369 1.00 62.55 ? 210 ARG C NH1 1 
ATOM   2003 N NH2 . ARG C  2 64  ? -37.548 -63.789  -40.365 1.00 60.22 ? 210 ARG C NH2 1 
ATOM   2004 N N   . VAL C  2 65  ? -33.049 -65.425  -46.440 1.00 30.73 ? 211 VAL C N   1 
ATOM   2005 C CA  . VAL C  2 65  ? -31.637 -65.241  -46.749 1.00 31.07 ? 211 VAL C CA  1 
ATOM   2006 C C   . VAL C  2 65  ? -31.469 -65.530  -48.225 1.00 31.36 ? 211 VAL C C   1 
ATOM   2007 O O   . VAL C  2 65  ? -32.005 -66.516  -48.710 1.00 34.44 ? 211 VAL C O   1 
ATOM   2008 C CB  . VAL C  2 65  ? -30.746 -66.186  -45.934 1.00 30.51 ? 211 VAL C CB  1 
ATOM   2009 C CG1 . VAL C  2 65  ? -29.285 -66.046  -46.352 1.00 30.96 ? 211 VAL C CG1 1 
ATOM   2010 C CG2 . VAL C  2 65  ? -30.905 -65.902  -44.456 1.00 30.86 ? 211 VAL C CG2 1 
ATOM   2011 N N   . PRO C  2 66  ? -30.713 -64.691  -48.950 1.00 31.31 ? 212 PRO C N   1 
ATOM   2012 C CA  . PRO C  2 66  ? -30.615 -64.958  -50.402 1.00 29.53 ? 212 PRO C CA  1 
ATOM   2013 C C   . PRO C  2 66  ? -29.957 -66.303  -50.729 1.00 28.86 ? 212 PRO C C   1 
ATOM   2014 O O   . PRO C  2 66  ? -29.123 -66.792  -49.966 1.00 27.68 ? 212 PRO C O   1 
ATOM   2015 C CB  . PRO C  2 66  ? -29.794 -63.798  -50.945 1.00 30.51 ? 212 PRO C CB  1 
ATOM   2016 C CG  . PRO C  2 66  ? -29.381 -62.960  -49.775 1.00 32.75 ? 212 PRO C CG  1 
ATOM   2017 C CD  . PRO C  2 66  ? -30.046 -63.448  -48.530 1.00 32.42 ? 212 PRO C CD  1 
ATOM   2018 N N   . SER C  2 67  ? -30.345 -66.879  -51.862 1.00 26.17 ? 213 SER C N   1 
ATOM   2019 C CA  . SER C  2 67  ? -29.881 -68.169  -52.280 1.00 25.83 ? 213 SER C CA  1 
ATOM   2020 C C   . SER C  2 67  ? -28.377 -68.190  -52.474 1.00 25.74 ? 213 SER C C   1 
ATOM   2021 O O   . SER C  2 67  ? -27.767 -69.227  -52.306 1.00 24.85 ? 213 SER C O   1 
ATOM   2022 C CB  . SER C  2 67  ? -30.580 -68.583  -53.577 1.00 28.25 ? 213 SER C CB  1 
ATOM   2023 O OG  . SER C  2 67  ? -30.305 -67.653  -54.619 1.00 29.41 ? 213 SER C OG  1 
ATOM   2024 N N   . GLU C  2 68  ? -27.761 -67.052  -52.799 1.00 27.33 ? 214 GLU C N   1 
ATOM   2025 C CA  . GLU C  2 68  ? -26.292 -66.995  -52.894 1.00 28.65 ? 214 GLU C CA  1 
ATOM   2026 C C   . GLU C  2 68  ? -25.604 -67.513  -51.629 1.00 27.21 ? 214 GLU C C   1 
ATOM   2027 O O   . GLU C  2 68  ? -24.560 -68.127  -51.714 1.00 26.76 ? 214 GLU C O   1 
ATOM   2028 C CB  . GLU C  2 68  ? -25.775 -65.585  -53.266 1.00 32.67 ? 214 GLU C CB  1 
ATOM   2029 C CG  . GLU C  2 68  ? -25.707 -64.573  -52.132 1.00 36.39 ? 214 GLU C CG  1 
ATOM   2030 C CD  . GLU C  2 68  ? -25.103 -63.234  -52.568 1.00 40.23 ? 214 GLU C CD  1 
ATOM   2031 O OE1 . GLU C  2 68  ? -23.869 -63.166  -52.751 1.00 41.55 ? 214 GLU C OE1 1 
ATOM   2032 O OE2 . GLU C  2 68  ? -25.858 -62.246  -52.712 1.00 39.81 ? 214 GLU C OE2 1 
ATOM   2033 N N   . TYR C  2 69  ? -26.199 -67.293  -50.459 1.00 26.74 ? 215 TYR C N   1 
ATOM   2034 C CA  . TYR C  2 69  ? -25.638 -67.866  -49.221 1.00 27.40 ? 215 TYR C CA  1 
ATOM   2035 C C   . TYR C  2 69  ? -26.154 -69.264  -48.927 1.00 26.23 ? 215 TYR C C   1 
ATOM   2036 O O   . TYR C  2 69  ? -25.434 -70.144  -48.481 1.00 24.56 ? 215 TYR C O   1 
ATOM   2037 C CB  . TYR C  2 69  ? -25.970 -66.976  -48.037 1.00 27.41 ? 215 TYR C CB  1 
ATOM   2038 C CG  . TYR C  2 69  ? -25.349 -65.619  -48.167 1.00 28.34 ? 215 TYR C CG  1 
ATOM   2039 C CD1 . TYR C  2 69  ? -23.966 -65.451  -48.053 1.00 29.04 ? 215 TYR C CD1 1 
ATOM   2040 C CD2 . TYR C  2 69  ? -26.127 -64.509  -48.413 1.00 28.35 ? 215 TYR C CD2 1 
ATOM   2041 C CE1 . TYR C  2 69  ? -23.393 -64.205  -48.164 1.00 29.38 ? 215 TYR C CE1 1 
ATOM   2042 C CE2 . TYR C  2 69  ? -25.556 -63.262  -48.524 1.00 29.45 ? 215 TYR C CE2 1 
ATOM   2043 C CZ  . TYR C  2 69  ? -24.195 -63.127  -48.403 1.00 28.82 ? 215 TYR C CZ  1 
ATOM   2044 O OH  . TYR C  2 69  ? -23.639 -61.897  -48.521 1.00 33.25 ? 215 TYR C OH  1 
ATOM   2045 N N   . THR C  2 70  ? -27.424 -69.430  -49.201 1.00 26.83 ? 216 THR C N   1 
ATOM   2046 C CA  . THR C  2 70  ? -28.207 -70.550  -48.721 1.00 28.76 ? 216 THR C CA  1 
ATOM   2047 C C   . THR C  2 70  ? -27.921 -71.839  -49.529 1.00 27.77 ? 216 THR C C   1 
ATOM   2048 O O   . THR C  2 70  ? -27.707 -72.903  -48.952 1.00 26.78 ? 216 THR C O   1 
ATOM   2049 C CB  . THR C  2 70  ? -29.672 -70.077  -48.748 1.00 29.92 ? 216 THR C CB  1 
ATOM   2050 O OG1 . THR C  2 70  ? -30.135 -69.882  -47.410 1.00 35.33 ? 216 THR C OG1 1 
ATOM   2051 C CG2 . THR C  2 70  ? -30.529 -70.969  -49.446 1.00 30.48 ? 216 THR C CG2 1 
ATOM   2052 N N   . TYR C  2 71  ? -27.861 -71.706  -50.850 1.00 25.98 ? 217 TYR C N   1 
ATOM   2053 C CA  . TYR C  2 71  ? -27.592 -72.822  -51.769 1.00 26.72 ? 217 TYR C CA  1 
ATOM   2054 C C   . TYR C  2 71  ? -26.133 -73.231  -51.682 1.00 25.75 ? 217 TYR C C   1 
ATOM   2055 O O   . TYR C  2 71  ? -25.780 -74.384  -51.845 1.00 22.87 ? 217 TYR C O   1 
ATOM   2056 C CB  . TYR C  2 71  ? -27.920 -72.415  -53.219 1.00 26.20 ? 217 TYR C CB  1 
ATOM   2057 C CG  . TYR C  2 71  ? -29.388 -72.204  -53.532 1.00 27.14 ? 217 TYR C CG  1 
ATOM   2058 C CD1 . TYR C  2 71  ? -30.355 -72.145  -52.528 1.00 28.22 ? 217 TYR C CD1 1 
ATOM   2059 C CD2 . TYR C  2 71  ? -29.815 -72.031  -54.848 1.00 29.18 ? 217 TYR C CD2 1 
ATOM   2060 C CE1 . TYR C  2 71  ? -31.693 -71.927  -52.830 1.00 29.45 ? 217 TYR C CE1 1 
ATOM   2061 C CE2 . TYR C  2 71  ? -31.149 -71.820  -55.154 1.00 28.91 ? 217 TYR C CE2 1 
ATOM   2062 C CZ  . TYR C  2 71  ? -32.076 -71.766  -54.149 1.00 30.58 ? 217 TYR C CZ  1 
ATOM   2063 O OH  . TYR C  2 71  ? -33.402 -71.546  -54.469 1.00 35.51 ? 217 TYR C OH  1 
ATOM   2064 N N   . ARG C  2 72  ? -25.285 -72.268  -51.368 1.00 27.62 ? 218 ARG C N   1 
ATOM   2065 C CA  . ARG C  2 72  ? -23.873 -72.556  -51.191 1.00 28.83 ? 218 ARG C CA  1 
ATOM   2066 C C   . ARG C  2 72  ? -23.629 -73.489  -50.002 1.00 26.01 ? 218 ARG C C   1 
ATOM   2067 O O   . ARG C  2 72  ? -22.790 -74.378  -50.060 1.00 22.37 ? 218 ARG C O   1 
ATOM   2068 C CB  . ARG C  2 72  ? -23.111 -71.258  -51.034 1.00 31.88 ? 218 ARG C CB  1 
ATOM   2069 C CG  . ARG C  2 72  ? -21.745 -71.309  -51.646 1.00 36.58 ? 218 ARG C CG  1 
ATOM   2070 C CD  . ARG C  2 72  ? -21.027 -70.005  -51.389 1.00 38.78 ? 218 ARG C CD  1 
ATOM   2071 N NE  . ARG C  2 72  ? -19.595 -70.197  -51.158 1.00 39.56 ? 218 ARG C NE  1 
ATOM   2072 C CZ  . ARG C  2 72  ? -18.761 -69.216  -50.828 1.00 42.68 ? 218 ARG C CZ  1 
ATOM   2073 N NH1 . ARG C  2 72  ? -19.214 -67.975  -50.668 1.00 43.90 ? 218 ARG C NH1 1 
ATOM   2074 N NH2 . ARG C  2 72  ? -17.472 -69.468  -50.660 1.00 44.11 ? 218 ARG C NH2 1 
ATOM   2075 N N   . MET C  2 73  ? -24.381 -73.289  -48.929 1.00 25.37 ? 219 MET C N   1 
ATOM   2076 C CA  . MET C  2 73  ? -24.284 -74.176  -47.778 1.00 24.89 ? 219 MET C CA  1 
ATOM   2077 C C   . MET C  2 73  ? -24.929 -75.553  -48.065 1.00 25.11 ? 219 MET C C   1 
ATOM   2078 O O   . MET C  2 73  ? -24.375 -76.601  -47.691 1.00 23.33 ? 219 MET C O   1 
ATOM   2079 C CB  . MET C  2 73  ? -24.932 -73.521  -46.570 1.00 25.01 ? 219 MET C CB  1 
ATOM   2080 C CG  . MET C  2 73  ? -24.179 -72.291  -46.092 1.00 27.28 ? 219 MET C CG  1 
ATOM   2081 S SD  . MET C  2 73  ? -25.126 -71.384  -44.860 1.00 30.35 ? 219 MET C SD  1 
ATOM   2082 C CE  . MET C  2 73  ? -25.100 -72.552  -43.515 1.00 29.68 ? 219 MET C CE  1 
ATOM   2083 N N   . LEU C  2 74  ? -26.083 -75.546  -48.739 1.00 23.80 ? 220 LEU C N   1 
ATOM   2084 C CA  . LEU C  2 74  ? -26.874 -76.774  -48.925 1.00 23.41 ? 220 LEU C CA  1 
ATOM   2085 C C   . LEU C  2 74  ? -26.269 -77.708  -49.974 1.00 22.16 ? 220 LEU C C   1 
ATOM   2086 O O   . LEU C  2 74  ? -26.307 -78.931  -49.835 1.00 20.72 ? 220 LEU C O   1 
ATOM   2087 C CB  . LEU C  2 74  ? -28.306 -76.391  -49.319 1.00 24.87 ? 220 LEU C CB  1 
ATOM   2088 C CG  . LEU C  2 74  ? -29.407 -77.396  -49.089 1.00 26.19 ? 220 LEU C CG  1 
ATOM   2089 C CD1 . LEU C  2 74  ? -29.387 -77.804  -47.624 1.00 27.73 ? 220 LEU C CD1 1 
ATOM   2090 C CD2 . LEU C  2 74  ? -30.748 -76.778  -49.476 1.00 27.74 ? 220 LEU C CD2 1 
ATOM   2091 N N   . PHE C  2 75  ? -25.655 -77.116  -50.994 1.00 21.22 ? 221 PHE C N   1 
ATOM   2092 C CA  . PHE C  2 75  ? -25.198 -77.860  -52.153 1.00 21.08 ? 221 PHE C CA  1 
ATOM   2093 C C   . PHE C  2 75  ? -23.678 -77.773  -52.385 1.00 23.13 ? 221 PHE C C   1 
ATOM   2094 O O   . PHE C  2 75  ? -23.200 -78.076  -53.475 1.00 24.00 ? 221 PHE C O   1 
ATOM   2095 C CB  . PHE C  2 75  ? -25.957 -77.370  -53.388 1.00 19.52 ? 221 PHE C CB  1 
ATOM   2096 C CG  . PHE C  2 75  ? -27.468 -77.383  -53.230 1.00 19.55 ? 221 PHE C CG  1 
ATOM   2097 C CD1 . PHE C  2 75  ? -28.135 -78.541  -52.923 1.00 19.40 ? 221 PHE C CD1 1 
ATOM   2098 C CD2 . PHE C  2 75  ? -28.215 -76.230  -53.425 1.00 19.85 ? 221 PHE C CD2 1 
ATOM   2099 C CE1 . PHE C  2 75  ? -29.516 -78.562  -52.798 1.00 20.00 ? 221 PHE C CE1 1 
ATOM   2100 C CE2 . PHE C  2 75  ? -29.586 -76.242  -53.286 1.00 19.51 ? 221 PHE C CE2 1 
ATOM   2101 C CZ  . PHE C  2 75  ? -30.240 -77.420  -52.983 1.00 19.50 ? 221 PHE C CZ  1 
ATOM   2102 N N   . CYS C  2 76  ? -22.908 -77.394  -51.371 1.00 25.39 ? 222 CYS C N   1 
ATOM   2103 C CA  . CYS C  2 76  ? -21.456 -77.304  -51.522 1.00 26.57 ? 222 CYS C CA  1 
ATOM   2104 C C   . CYS C  2 76  ? -20.832 -78.658  -51.920 1.00 28.47 ? 222 CYS C C   1 
ATOM   2105 O O   . CYS C  2 76  ? -21.211 -79.686  -51.371 1.00 27.01 ? 222 CYS C O   1 
ATOM   2106 C CB  . CYS C  2 76  ? -20.800 -76.805  -50.229 1.00 27.51 ? 222 CYS C CB  1 
ATOM   2107 S SG  . CYS C  2 76  ? -21.505 -77.500  -48.708 1.00 30.05 ? 222 CYS C SG  1 
ATOM   2108 N N   . SER C  2 77  ? -19.903 -78.620  -52.884 1.00 28.15 ? 223 SER C N   1 
ATOM   2109 C CA  . SER C  2 77  ? -19.034 -79.750  -53.264 1.00 31.16 ? 223 SER C CA  1 
ATOM   2110 C C   . SER C  2 77  ? -18.148 -80.257  -52.143 1.00 30.30 ? 223 SER C C   1 
ATOM   2111 O O   . SER C  2 77  ? -17.574 -79.466  -51.413 1.00 27.75 ? 223 SER C O   1 
ATOM   2112 C CB  . SER C  2 77  ? -18.039 -79.296  -54.351 1.00 33.18 ? 223 SER C CB  1 
ATOM   2113 O OG  . SER C  2 77  ? -18.599 -79.364  -55.625 1.00 39.19 ? 223 SER C OG  1 
ATOM   2114 N N   . CYS C  2 78  ? -17.949 -81.571  -52.084 1.00 29.99 ? 224 CYS C N   1 
ATOM   2115 C CA  . CYS C  2 78  ? -17.081 -82.189  -51.087 1.00 31.20 ? 224 CYS C CA  1 
ATOM   2116 C C   . CYS C  2 78  ? -16.219 -83.287  -51.685 1.00 32.03 ? 224 CYS C C   1 
ATOM   2117 O O   . CYS C  2 78  ? -16.687 -84.052  -52.526 1.00 32.53 ? 224 CYS C O   1 
ATOM   2118 C CB  . CYS C  2 78  ? -17.917 -82.824  -49.974 1.00 31.46 ? 224 CYS C CB  1 
ATOM   2119 S SG  . CYS C  2 78  ? -18.750 -81.657  -48.894 1.00 31.70 ? 224 CYS C SG  1 
ATOM   2120 N N   . GLN C  2 79  ? -14.980 -83.382  -51.212 1.00 34.06 ? 225 GLN C N   1 
ATOM   2121 C CA  . GLN C  2 79  ? -14.087 -84.489  -51.552 1.00 38.06 ? 225 GLN C CA  1 
ATOM   2122 C C   . GLN C  2 79  ? -13.886 -85.448  -50.387 1.00 39.03 ? 225 GLN C C   1 
ATOM   2123 O O   . GLN C  2 79  ? -13.372 -86.542  -50.586 1.00 42.42 ? 225 GLN C O   1 
ATOM   2124 C CB  . GLN C  2 79  ? -12.716 -83.974  -51.989 1.00 40.94 ? 225 GLN C CB  1 
ATOM   2125 C CG  . GLN C  2 79  ? -12.707 -83.210  -53.303 1.00 44.02 ? 225 GLN C CG  1 
ATOM   2126 C CD  . GLN C  2 79  ? -11.374 -82.510  -53.544 1.00 49.70 ? 225 GLN C CD  1 
ATOM   2127 O OE1 . GLN C  2 79  ? -10.340 -83.164  -53.712 1.00 50.24 ? 225 GLN C OE1 1 
ATOM   2128 N NE2 . GLN C  2 79  ? -11.387 -81.174  -53.540 1.00 52.48 ? 225 GLN C NE2 1 
ATOM   2129 N N   . ASP C  2 80  ? -14.274 -85.063  -49.176 1.00 36.15 ? 226 ASP C N   1 
ATOM   2130 C CA  . ASP C  2 80  ? -14.028 -85.915  -48.022 1.00 36.68 ? 226 ASP C CA  1 
ATOM   2131 C C   . ASP C  2 80  ? -15.190 -85.957  -47.061 1.00 36.52 ? 226 ASP C C   1 
ATOM   2132 O O   . ASP C  2 80  ? -16.171 -85.216  -47.195 1.00 36.39 ? 226 ASP C O   1 
ATOM   2133 C CB  . ASP C  2 80  ? -12.725 -85.508  -47.296 1.00 40.00 ? 226 ASP C CB  1 
ATOM   2134 C CG  . ASP C  2 80  ? -12.773 -84.095  -46.684 1.00 40.65 ? 226 ASP C CG  1 
ATOM   2135 O OD1 . ASP C  2 80  ? -13.839 -83.632  -46.223 1.00 40.18 ? 226 ASP C OD1 1 
ATOM   2136 O OD2 . ASP C  2 80  ? -11.700 -83.456  -46.634 1.00 44.04 ? 226 ASP C OD2 1 
ATOM   2137 N N   . GLN C  2 81  ? -15.056 -86.826  -46.071 1.00 38.10 ? 227 GLN C N   1 
ATOM   2138 C CA  . GLN C  2 81  ? -16.122 -87.091  -45.127 1.00 39.36 ? 227 GLN C CA  1 
ATOM   2139 C C   . GLN C  2 81  ? -16.400 -85.909  -44.201 1.00 37.01 ? 227 GLN C C   1 
ATOM   2140 O O   . GLN C  2 81  ? -17.548 -85.682  -43.825 1.00 38.31 ? 227 GLN C O   1 
ATOM   2141 C CB  . GLN C  2 81  ? -15.789 -88.316  -44.284 1.00 42.72 ? 227 GLN C CB  1 
ATOM   2142 C CG  . GLN C  2 81  ? -17.028 -89.060  -43.814 1.00 47.70 ? 227 GLN C CG  1 
ATOM   2143 C CD  . GLN C  2 81  ? -17.482 -90.157  -44.770 1.00 53.06 ? 227 GLN C CD  1 
ATOM   2144 O OE1 . GLN C  2 81  ? -18.257 -91.026  -44.383 1.00 57.34 ? 227 GLN C OE1 1 
ATOM   2145 N NE2 . GLN C  2 81  ? -17.002 -90.131  -46.018 1.00 56.38 ? 227 GLN C NE2 1 
ATOM   2146 N N   . ALA C  2 82  ? -15.363 -85.168  -43.827 1.00 33.77 ? 228 ALA C N   1 
ATOM   2147 C CA  . ALA C  2 82  ? -15.540 -84.010  -42.948 1.00 33.40 ? 228 ALA C CA  1 
ATOM   2148 C C   . ALA C  2 82  ? -16.476 -82.990  -43.607 1.00 31.04 ? 228 ALA C C   1 
ATOM   2149 O O   . ALA C  2 82  ? -17.409 -82.495  -42.986 1.00 28.48 ? 228 ALA C O   1 
ATOM   2150 C CB  . ALA C  2 82  ? -14.197 -83.369  -42.635 1.00 32.62 ? 228 ALA C CB  1 
ATOM   2151 N N   . CYS C  2 83  ? -16.193 -82.683  -44.870 1.00 30.25 ? 229 CYS C N   1 
ATOM   2152 C CA  . CYS C  2 83  ? -17.022 -81.782  -45.675 1.00 29.68 ? 229 CYS C CA  1 
ATOM   2153 C C   . CYS C  2 83  ? -18.455 -82.314  -45.834 1.00 27.35 ? 229 CYS C C   1 
ATOM   2154 O O   . CYS C  2 83  ? -19.415 -81.577  -45.654 1.00 27.03 ? 229 CYS C O   1 
ATOM   2155 C CB  . CYS C  2 83  ? -16.360 -81.558  -47.044 1.00 31.18 ? 229 CYS C CB  1 
ATOM   2156 S SG  . CYS C  2 83  ? -17.212 -80.452  -48.202 1.00 30.18 ? 229 CYS C SG  1 
ATOM   2157 N N   . ALA C  2 84  ? -18.595 -83.597  -46.134 1.00 25.59 ? 230 ALA C N   1 
ATOM   2158 C CA  . ALA C  2 84  ? -19.906 -84.158  -46.419 1.00 25.05 ? 230 ALA C CA  1 
ATOM   2159 C C   . ALA C  2 84  ? -20.763 -84.255  -45.164 1.00 24.22 ? 230 ALA C C   1 
ATOM   2160 O O   . ALA C  2 84  ? -21.988 -84.131  -45.228 1.00 23.04 ? 230 ALA C O   1 
ATOM   2161 C CB  . ALA C  2 84  ? -19.765 -85.521  -47.076 1.00 26.06 ? 230 ALA C CB  1 
ATOM   2162 N N   . GLU C  2 85  ? -20.123 -84.491  -44.021 1.00 23.98 ? 231 GLU C N   1 
ATOM   2163 C CA  . GLU C  2 85  ? -20.840 -84.530  -42.765 1.00 23.48 ? 231 GLU C CA  1 
ATOM   2164 C C   . GLU C  2 85  ? -21.328 -83.106  -42.413 1.00 22.20 ? 231 GLU C C   1 
ATOM   2165 O O   . GLU C  2 85  ? -22.465 -82.915  -41.944 1.00 20.98 ? 231 GLU C O   1 
ATOM   2166 C CB  . GLU C  2 85  ? -19.944 -85.106  -41.673 1.00 24.65 ? 231 GLU C CB  1 
ATOM   2167 C CG  . GLU C  2 85  ? -20.564 -85.115  -40.288 1.00 25.49 ? 231 GLU C CG  1 
ATOM   2168 C CD  . GLU C  2 85  ? -21.854 -85.928  -40.192 1.00 27.64 ? 231 GLU C CD  1 
ATOM   2169 O OE1 . GLU C  2 85  ? -22.203 -86.642  -41.143 1.00 27.28 ? 231 GLU C OE1 1 
ATOM   2170 O OE2 . GLU C  2 85  ? -22.541 -85.849  -39.150 1.00 29.69 ? 231 GLU C OE2 1 
ATOM   2171 N N   . ARG C  2 86  ? -20.490 -82.116  -42.682 1.00 21.48 ? 232 ARG C N   1 
ATOM   2172 C CA  . ARG C  2 86  ? -20.901 -80.715  -42.516 1.00 21.69 ? 232 ARG C CA  1 
ATOM   2173 C C   . ARG C  2 86  ? -22.137 -80.399  -43.353 1.00 20.86 ? 232 ARG C C   1 
ATOM   2174 O O   . ARG C  2 86  ? -23.134 -79.882  -42.834 1.00 20.58 ? 232 ARG C O   1 
ATOM   2175 C CB  . ARG C  2 86  ? -19.757 -79.755  -42.859 1.00 22.05 ? 232 ARG C CB  1 
ATOM   2176 C CG  . ARG C  2 86  ? -20.175 -78.284  -42.843 1.00 22.50 ? 232 ARG C CG  1 
ATOM   2177 C CD  . ARG C  2 86  ? -18.982 -77.360  -42.966 1.00 22.52 ? 232 ARG C CD  1 
ATOM   2178 N NE  . ARG C  2 86  ? -18.175 -77.331  -41.752 1.00 24.92 ? 232 ARG C NE  1 
ATOM   2179 C CZ  . ARG C  2 86  ? -18.407 -76.545  -40.702 1.00 24.90 ? 232 ARG C CZ  1 
ATOM   2180 N NH1 . ARG C  2 86  ? -19.453 -75.729  -40.669 1.00 24.95 ? 232 ARG C NH1 1 
ATOM   2181 N NH2 . ARG C  2 86  ? -17.600 -76.592  -39.663 1.00 24.34 ? 232 ARG C NH2 1 
ATOM   2182 N N   . ARG C  2 87  ? -22.066 -80.739  -44.637 1.00 20.62 ? 233 ARG C N   1 
ATOM   2183 C CA  . ARG C  2 87  ? -23.194 -80.594  -45.548 1.00 21.11 ? 233 ARG C CA  1 
ATOM   2184 C C   . ARG C  2 87  ? -24.463 -81.278  -45.044 1.00 21.17 ? 233 ARG C C   1 
ATOM   2185 O O   . ARG C  2 87  ? -25.536 -80.655  -45.000 1.00 20.80 ? 233 ARG C O   1 
ATOM   2186 C CB  . ARG C  2 87  ? -22.827 -81.141  -46.924 1.00 22.23 ? 233 ARG C CB  1 
ATOM   2187 C CG  . ARG C  2 87  ? -23.881 -80.844  -47.986 1.00 22.78 ? 233 ARG C CG  1 
ATOM   2188 C CD  . ARG C  2 87  ? -23.373 -81.218  -49.350 1.00 23.35 ? 233 ARG C CD  1 
ATOM   2189 N NE  . ARG C  2 87  ? -22.963 -82.617  -49.356 1.00 24.25 ? 233 ARG C NE  1 
ATOM   2190 C CZ  . ARG C  2 87  ? -22.110 -83.163  -50.215 1.00 24.65 ? 233 ARG C CZ  1 
ATOM   2191 N NH1 . ARG C  2 87  ? -21.564 -82.445  -51.182 1.00 25.12 ? 233 ARG C NH1 1 
ATOM   2192 N NH2 . ARG C  2 87  ? -21.823 -84.456  -50.110 1.00 25.26 ? 233 ARG C NH2 1 
ATOM   2193 N N   . ARG C  2 88  ? -24.325 -82.540  -44.636 1.00 21.42 ? 234 ARG C N   1 
ATOM   2194 C CA  . ARG C  2 88  ? -25.447 -83.310  -44.069 1.00 23.25 ? 234 ARG C CA  1 
ATOM   2195 C C   . ARG C  2 88  ? -26.058 -82.598  -42.860 1.00 22.36 ? 234 ARG C C   1 
ATOM   2196 O O   . ARG C  2 88  ? -27.258 -82.684  -42.612 1.00 22.19 ? 234 ARG C O   1 
ATOM   2197 C CB  . ARG C  2 88  ? -24.987 -84.721  -43.654 1.00 23.37 ? 234 ARG C CB  1 
ATOM   2198 C CG  . ARG C  2 88  ? -26.138 -85.691  -43.383 1.00 24.54 ? 234 ARG C CG  1 
ATOM   2199 C CD  . ARG C  2 88  ? -25.642 -87.009  -42.801 1.00 25.14 ? 234 ARG C CD  1 
ATOM   2200 N NE  . ARG C  2 88  ? -25.157 -86.823  -41.443 1.00 26.88 ? 234 ARG C NE  1 
ATOM   2201 C CZ  . ARG C  2 88  ? -25.934 -86.769  -40.358 1.00 28.64 ? 234 ARG C CZ  1 
ATOM   2202 N NH1 . ARG C  2 88  ? -25.385 -86.556  -39.164 1.00 31.33 ? 234 ARG C NH1 1 
ATOM   2203 N NH2 . ARG C  2 88  ? -27.247 -86.911  -40.441 1.00 28.20 ? 234 ARG C NH2 1 
ATOM   2204 N N   . GLN C  2 89  ? -25.222 -81.881  -42.119 1.00 23.53 ? 235 GLN C N   1 
ATOM   2205 C CA  . GLN C  2 89  ? -25.642 -81.239  -40.869 1.00 23.84 ? 235 GLN C CA  1 
ATOM   2206 C C   . GLN C  2 89  ? -26.282 -79.867  -41.044 1.00 23.61 ? 235 GLN C C   1 
ATOM   2207 O O   . GLN C  2 89  ? -26.804 -79.312  -40.072 1.00 23.54 ? 235 GLN C O   1 
ATOM   2208 C CB  . GLN C  2 89  ? -24.447 -81.126  -39.911 1.00 24.32 ? 235 GLN C CB  1 
ATOM   2209 C CG  . GLN C  2 89  ? -24.158 -82.402  -39.154 1.00 25.28 ? 235 GLN C CG  1 
ATOM   2210 C CD  . GLN C  2 89  ? -25.073 -82.596  -37.947 1.00 26.87 ? 235 GLN C CD  1 
ATOM   2211 O OE1 . GLN C  2 89  ? -26.290 -82.489  -38.018 1.00 26.51 ? 235 GLN C OE1 1 
ATOM   2212 N NE2 . GLN C  2 89  ? -24.469 -82.865  -36.828 1.00 30.33 ? 235 GLN C NE2 1 
ATOM   2213 N N   . THR C  2 90  ? -26.281 -79.335  -42.269 1.00 22.81 ? 236 THR C N   1 
ATOM   2214 C CA  . THR C  2 90  ? -26.829 -78.009  -42.549 1.00 22.97 ? 236 THR C CA  1 
ATOM   2215 C C   . THR C  2 90  ? -28.208 -77.781  -41.932 1.00 23.83 ? 236 THR C C   1 
ATOM   2216 O O   . THR C  2 90  ? -28.414 -76.751  -41.293 1.00 24.81 ? 236 THR C O   1 
ATOM   2217 C CB  . THR C  2 90  ? -26.893 -77.714  -44.074 1.00 22.37 ? 236 THR C CB  1 
ATOM   2218 O OG1 . THR C  2 90  ? -25.623 -77.989  -44.675 1.00 21.48 ? 236 THR C OG1 1 
ATOM   2219 C CG2 . THR C  2 90  ? -27.204 -76.263  -44.323 1.00 24.07 ? 236 THR C CG2 1 
ATOM   2220 N N   . ILE C  2 91  ? -29.139 -78.725  -42.107 1.00 22.80 ? 237 ILE C N   1 
ATOM   2221 C CA  . ILE C  2 91  ? -30.496 -78.574  -41.575 1.00 23.31 ? 237 ILE C CA  1 
ATOM   2222 C C   . ILE C  2 91  ? -30.658 -79.115  -40.138 1.00 23.17 ? 237 ILE C C   1 
ATOM   2223 O O   . ILE C  2 91  ? -31.772 -79.168  -39.602 1.00 23.15 ? 237 ILE C O   1 
ATOM   2224 C CB  . ILE C  2 91  ? -31.549 -79.242  -42.496 1.00 23.51 ? 237 ILE C CB  1 
ATOM   2225 C CG1 . ILE C  2 91  ? -31.450 -80.778  -42.462 1.00 24.53 ? 237 ILE C CG1 1 
ATOM   2226 C CG2 . ILE C  2 91  ? -31.406 -78.726  -43.920 1.00 24.27 ? 237 ILE C CG2 1 
ATOM   2227 C CD1 . ILE C  2 91  ? -32.583 -81.477  -43.206 1.00 25.11 ? 237 ILE C CD1 1 
ATOM   2228 N N   . LEU C  2 92  ? -29.559 -79.510  -39.522 1.00 24.16 ? 238 LEU C N   1 
ATOM   2229 C CA  . LEU C  2 92  ? -29.586 -80.119  -38.200 1.00 25.63 ? 238 LEU C CA  1 
ATOM   2230 C C   . LEU C  2 92  ? -30.596 -81.285  -38.205 1.00 26.88 ? 238 LEU C C   1 
ATOM   2231 O O   . LEU C  2 92  ? -31.624 -81.276  -37.498 1.00 25.15 ? 238 LEU C O   1 
ATOM   2232 C CB  . LEU C  2 92  ? -29.858 -79.060  -37.116 1.00 26.91 ? 238 LEU C CB  1 
ATOM   2233 C CG  . LEU C  2 92  ? -29.152 -79.341  -35.777 1.00 27.79 ? 238 LEU C CG  1 
ATOM   2234 C CD1 . LEU C  2 92  ? -28.936 -78.081  -34.954 1.00 28.06 ? 238 LEU C CD1 1 
ATOM   2235 C CD2 . LEU C  2 92  ? -29.908 -80.379  -34.963 1.00 28.88 ? 238 LEU C CD2 1 
ATOM   2236 N N   . PRO C  2 93  ? -30.303 -82.309  -39.022 1.00 27.24 ? 239 PRO C N   1 
ATOM   2237 C CA  . PRO C  2 93  ? -31.247 -83.408  -39.262 1.00 27.66 ? 239 PRO C CA  1 
ATOM   2238 C C   . PRO C  2 93  ? -31.682 -84.221  -38.038 1.00 29.52 ? 239 PRO C C   1 
ATOM   2239 O O   . PRO C  2 93  ? -32.768 -84.794  -38.076 1.00 31.14 ? 239 PRO C O   1 
ATOM   2240 C CB  . PRO C  2 93  ? -30.496 -84.308  -40.252 1.00 26.91 ? 239 PRO C CB  1 
ATOM   2241 C CG  . PRO C  2 93  ? -29.053 -83.944  -40.092 1.00 27.09 ? 239 PRO C CG  1 
ATOM   2242 C CD  . PRO C  2 93  ? -29.066 -82.472  -39.805 1.00 26.63 ? 239 PRO C CD  1 
ATOM   2243 N N   . SER C  2 94  ? -30.857 -84.318  -36.991 1.00 30.88 ? 240 SER C N   1 
ATOM   2244 C CA  . SER C  2 94  ? -31.254 -85.089  -35.808 1.00 32.16 ? 240 SER C CA  1 
ATOM   2245 C C   . SER C  2 94  ? -32.526 -84.509  -35.213 1.00 30.43 ? 240 SER C C   1 
ATOM   2246 O O   . SER C  2 94  ? -33.275 -85.231  -34.570 1.00 30.23 ? 240 SER C O   1 
ATOM   2247 C CB  . SER C  2 94  ? -30.161 -85.186  -34.737 1.00 33.68 ? 240 SER C CB  1 
ATOM   2248 O OG  . SER C  2 94  ? -29.288 -84.084  -34.781 1.00 40.81 ? 240 SER C OG  1 
ATOM   2249 N N   . CYS C  2 95  ? -32.778 -83.221  -35.453 1.00 28.35 ? 241 CYS C N   1 
ATOM   2250 C CA  . CYS C  2 95  ? -34.046 -82.600  -35.068 1.00 29.03 ? 241 CYS C CA  1 
ATOM   2251 C C   . CYS C  2 95  ? -35.077 -82.516  -36.196 1.00 27.77 ? 241 CYS C C   1 
ATOM   2252 O O   . CYS C  2 95  ? -36.255 -82.837  -36.014 1.00 27.50 ? 241 CYS C O   1 
ATOM   2253 C CB  . CYS C  2 95  ? -33.773 -81.198  -34.525 1.00 30.48 ? 241 CYS C CB  1 
ATOM   2254 S SG  . CYS C  2 95  ? -35.260 -80.226  -34.297 1.00 32.79 ? 241 CYS C SG  1 
ATOM   2255 N N   . SER C  2 96  ? -34.640 -82.044  -37.352 1.00 27.01 ? 242 SER C N   1 
ATOM   2256 C CA  . SER C  2 96  ? -35.558 -81.627  -38.405 1.00 27.10 ? 242 SER C CA  1 
ATOM   2257 C C   . SER C  2 96  ? -35.958 -82.707  -39.403 1.00 26.65 ? 242 SER C C   1 
ATOM   2258 O O   . SER C  2 96  ? -36.895 -82.505  -40.170 1.00 27.50 ? 242 SER C O   1 
ATOM   2259 C CB  . SER C  2 96  ? -34.920 -80.491  -39.191 1.00 26.95 ? 242 SER C CB  1 
ATOM   2260 O OG  . SER C  2 96  ? -33.804 -80.968  -39.920 1.00 27.88 ? 242 SER C OG  1 
ATOM   2261 N N   . TYR C  2 97  ? -35.240 -83.825  -39.401 1.00 26.75 ? 243 TYR C N   1 
ATOM   2262 C CA  . TYR C  2 97  ? -35.309 -84.810  -40.479 1.00 28.02 ? 243 TYR C CA  1 
ATOM   2263 C C   . TYR C  2 97  ? -35.633 -86.183  -39.916 1.00 28.20 ? 243 TYR C C   1 
ATOM   2264 O O   . TYR C  2 97  ? -36.642 -86.775  -40.262 1.00 29.27 ? 243 TYR C O   1 
ATOM   2265 C CB  . TYR C  2 97  ? -33.956 -84.846  -41.227 1.00 26.94 ? 243 TYR C CB  1 
ATOM   2266 C CG  . TYR C  2 97  ? -33.848 -85.850  -42.366 1.00 26.37 ? 243 TYR C CG  1 
ATOM   2267 C CD1 . TYR C  2 97  ? -34.693 -85.783  -43.464 1.00 26.81 ? 243 TYR C CD1 1 
ATOM   2268 C CD2 . TYR C  2 97  ? -32.853 -86.828  -42.368 1.00 27.70 ? 243 TYR C CD2 1 
ATOM   2269 C CE1 . TYR C  2 97  ? -34.578 -86.680  -44.516 1.00 26.90 ? 243 TYR C CE1 1 
ATOM   2270 C CE2 . TYR C  2 97  ? -32.722 -87.729  -43.412 1.00 25.43 ? 243 TYR C CE2 1 
ATOM   2271 C CZ  . TYR C  2 97  ? -33.586 -87.656  -44.483 1.00 26.30 ? 243 TYR C CZ  1 
ATOM   2272 O OH  . TYR C  2 97  ? -33.445 -88.543  -45.519 1.00 24.49 ? 243 TYR C OH  1 
ATOM   2273 N N   . GLU C  2 98  ? -34.768 -86.669  -39.036 1.00 30.53 ? 244 GLU C N   1 
ATOM   2274 C CA  . GLU C  2 98  ? -34.935 -87.971  -38.417 1.00 33.63 ? 244 GLU C CA  1 
ATOM   2275 C C   . GLU C  2 98  ? -36.061 -87.993  -37.433 1.00 36.71 ? 244 GLU C C   1 
ATOM   2276 O O   . GLU C  2 98  ? -36.489 -86.971  -36.894 1.00 36.73 ? 244 GLU C O   1 
ATOM   2277 C CB  . GLU C  2 98  ? -33.690 -88.393  -37.667 1.00 33.49 ? 244 GLU C CB  1 
ATOM   2278 C CG  . GLU C  2 98  ? -32.522 -88.666  -38.560 1.00 33.56 ? 244 GLU C CG  1 
ATOM   2279 C CD  . GLU C  2 98  ? -31.258 -88.833  -37.782 1.00 35.74 ? 244 GLU C CD  1 
ATOM   2280 O OE1 . GLU C  2 98  ? -30.202 -88.996  -38.423 1.00 35.20 ? 244 GLU C OE1 1 
ATOM   2281 O OE2 . GLU C  2 98  ? -31.320 -88.788  -36.529 1.00 38.49 ? 244 GLU C OE2 1 
ATOM   2282 N N   . ASP C  2 99  ? -36.525 -89.199  -37.191 1.00 42.38 ? 245 ASP C N   1 
ATOM   2283 C CA  . ASP C  2 99  ? -37.656 -89.396  -36.341 1.00 46.59 ? 245 ASP C CA  1 
ATOM   2284 C C   . ASP C  2 99  ? -37.688 -90.837  -35.902 1.00 46.55 ? 245 ASP C C   1 
ATOM   2285 O O   . ASP C  2 99  ? -37.193 -91.738  -36.586 1.00 40.97 ? 245 ASP C O   1 
ATOM   2286 C CB  . ASP C  2 99  ? -38.954 -89.019  -37.061 1.00 50.40 ? 245 ASP C CB  1 
ATOM   2287 C CG  . ASP C  2 99  ? -40.008 -88.498  -36.112 1.00 55.77 ? 245 ASP C CG  1 
ATOM   2288 O OD1 . ASP C  2 99  ? -40.099 -89.017  -34.974 1.00 57.91 ? 245 ASP C OD1 1 
ATOM   2289 O OD2 . ASP C  2 99  ? -40.732 -87.553  -36.496 1.00 58.47 ? 245 ASP C OD2 1 
ATOM   2290 N N   . LYS C  2 100 ? -38.306 -91.020  -34.746 1.00 46.45 ? 246 LYS C N   1 
ATOM   2291 C CA  . LYS C  2 100 ? -38.398 -92.301  -34.094 1.00 44.47 ? 246 LYS C CA  1 
ATOM   2292 C C   . LYS C  2 100 ? -39.176 -93.249  -34.996 1.00 47.08 ? 246 LYS C C   1 
ATOM   2293 O O   . LYS C  2 100 ? -38.854 -94.430  -35.076 1.00 49.21 ? 246 LYS C O   1 
ATOM   2294 C CB  . LYS C  2 100 ? -39.067 -92.100  -32.726 1.00 40.49 ? 246 LYS C CB  1 
ATOM   2295 C CG  . LYS C  2 100 ? -38.517 -90.843  -32.001 1.00 38.60 ? 246 LYS C CG  1 
ATOM   2296 C CD  . LYS C  2 100 ? -38.671 -90.854  -30.471 1.00 37.25 ? 246 LYS C CD  1 
ATOM   2297 C CE  . LYS C  2 100 ? -37.841 -91.945  -29.782 1.00 35.67 ? 246 LYS C CE  1 
ATOM   2298 N NZ  . LYS C  2 100 ? -36.387 -91.593  -29.773 1.00 36.37 ? 246 LYS C NZ  1 
ATOM   2299 N N   . GLU C  2 101 ? -40.166 -92.709  -35.710 1.00 47.47 ? 247 GLU C N   1 
ATOM   2300 C CA  . GLU C  2 101 ? -40.944 -93.496  -36.661 1.00 46.43 ? 247 GLU C CA  1 
ATOM   2301 C C   . GLU C  2 101 ? -40.760 -93.060  -38.110 1.00 48.21 ? 247 GLU C C   1 
ATOM   2302 O O   . GLU C  2 101 ? -40.999 -91.906  -38.457 1.00 55.40 ? 247 GLU C O   1 
ATOM   2303 C CB  . GLU C  2 101 ? -42.430 -93.462  -36.268 1.00 40.49 ? 247 GLU C CB  1 
ATOM   2304 C CG  . GLU C  2 101 ? -42.714 -94.264  -34.995 1.00 37.95 ? 247 GLU C CG  1 
ATOM   2305 C CD  . GLU C  2 101 ? -42.160 -95.677  -35.071 1.00 37.66 ? 247 GLU C CD  1 
ATOM   2306 O OE1 . GLU C  2 101 ? -42.775 -96.563  -35.722 1.00 37.54 ? 247 GLU C OE1 1 
ATOM   2307 O OE2 . GLU C  2 101 ? -41.082 -95.918  -34.491 1.00 38.01 ? 247 GLU C OE2 1 
ATOM   2308 N N   . LYS C  2 102 ? -40.340 -94.006  -38.943 1.00 48.43 ? 248 LYS C N   1 
ATOM   2309 C CA  . LYS C  2 102 ? -40.146 -93.770  -40.359 1.00 47.16 ? 248 LYS C CA  1 
ATOM   2310 C C   . LYS C  2 102 ? -41.395 -94.163  -41.148 1.00 45.35 ? 248 LYS C C   1 
ATOM   2311 O O   . LYS C  2 102 ? -41.622 -95.333  -41.388 1.00 45.17 ? 248 LYS C O   1 
ATOM   2312 C CB  . LYS C  2 102 ? -38.952 -94.580  -40.847 1.00 49.35 ? 248 LYS C CB  1 
ATOM   2313 C CG  . LYS C  2 102 ? -38.059 -93.802  -41.794 1.00 50.91 ? 248 LYS C CG  1 
ATOM   2314 C CD  . LYS C  2 102 ? -37.312 -94.720  -42.739 1.00 49.92 ? 248 LYS C CD  1 
ATOM   2315 C CE  . LYS C  2 102 ? -35.824 -94.740  -42.461 1.00 50.02 ? 248 LYS C CE  1 
ATOM   2316 N NZ  . LYS C  2 102 ? -35.155 -93.783  -43.376 1.00 53.71 ? 248 LYS C NZ  1 
ATOM   2317 N N   . PRO C  2 103 ? -42.210 -93.182  -41.563 1.00 43.76 ? 249 PRO C N   1 
ATOM   2318 C CA  . PRO C  2 103 ? -43.465 -93.518  -42.236 1.00 42.14 ? 249 PRO C CA  1 
ATOM   2319 C C   . PRO C  2 103 ? -43.298 -94.139  -43.625 1.00 43.92 ? 249 PRO C C   1 
ATOM   2320 O O   . PRO C  2 103 ? -42.193 -94.168  -44.180 1.00 41.63 ? 249 PRO C O   1 
ATOM   2321 C CB  . PRO C  2 103 ? -44.176 -92.167  -42.352 1.00 42.98 ? 249 PRO C CB  1 
ATOM   2322 C CG  . PRO C  2 103 ? -43.077 -91.157  -42.348 1.00 43.07 ? 249 PRO C CG  1 
ATOM   2323 C CD  . PRO C  2 103 ? -42.019 -91.723  -41.443 1.00 43.16 ? 249 PRO C CD  1 
ATOM   2324 N N   . ASN C  2 104 ? -44.401 -94.661  -44.156 1.00 41.92 ? 250 ASN C N   1 
ATOM   2325 C CA  . ASN C  2 104 ? -44.465 -95.075  -45.548 1.00 42.09 ? 250 ASN C CA  1 
ATOM   2326 C C   . ASN C  2 104 ? -44.493 -93.812  -46.401 1.00 41.46 ? 250 ASN C C   1 
ATOM   2327 O O   . ASN C  2 104 ? -45.201 -92.867  -46.067 1.00 38.67 ? 250 ASN C O   1 
ATOM   2328 C CB  . ASN C  2 104 ? -45.717 -95.911  -45.823 1.00 40.19 ? 250 ASN C CB  1 
ATOM   2329 C CG  . ASN C  2 104 ? -45.755 -96.438  -47.248 1.00 40.09 ? 250 ASN C CG  1 
ATOM   2330 O OD1 . ASN C  2 104 ? -46.422 -95.877  -48.105 1.00 40.27 ? 250 ASN C OD1 1 
ATOM   2331 N ND2 . ASN C  2 104 ? -45.002 -97.492  -47.510 1.00 40.36 ? 250 ASN C ND2 1 
ATOM   2332 N N   . CYS C  2 105 ? -43.729 -93.789  -47.493 1.00 42.19 ? 251 CYS C N   1 
ATOM   2333 C CA  . CYS C  2 105 ? -43.617 -92.565  -48.303 1.00 41.93 ? 251 CYS C CA  1 
ATOM   2334 C C   . CYS C  2 105 ? -44.958 -92.069  -48.852 1.00 42.58 ? 251 CYS C C   1 
ATOM   2335 O O   . CYS C  2 105 ? -45.161 -90.860  -48.972 1.00 39.75 ? 251 CYS C O   1 
ATOM   2336 C CB  . CYS C  2 105 ? -42.608 -92.730  -49.446 1.00 40.90 ? 251 CYS C CB  1 
ATOM   2337 S SG  . CYS C  2 105 ? -40.884 -92.924  -48.917 1.00 43.68 ? 251 CYS C SG  1 
ATOM   2338 N N   . LEU C  2 106 ? -45.875 -92.980  -49.174 1.00 43.66 ? 252 LEU C N   1 
ATOM   2339 C CA  . LEU C  2 106 ? -47.192 -92.561  -49.667 1.00 43.61 ? 252 LEU C CA  1 
ATOM   2340 C C   . LEU C  2 106 ? -48.056 -91.960  -48.552 1.00 41.74 ? 252 LEU C C   1 
ATOM   2341 O O   . LEU C  2 106 ? -48.745 -90.965  -48.770 1.00 41.03 ? 252 LEU C O   1 
ATOM   2342 C CB  . LEU C  2 106 ? -47.907 -93.706  -50.394 1.00 47.38 ? 252 LEU C CB  1 
ATOM   2343 C CG  . LEU C  2 106 ? -47.211 -94.159  -51.692 1.00 50.10 ? 252 LEU C CG  1 
ATOM   2344 C CD1 . LEU C  2 106 ? -47.901 -95.379  -52.276 1.00 49.30 ? 252 LEU C CD1 1 
ATOM   2345 C CD2 . LEU C  2 106 ? -47.137 -93.044  -52.739 1.00 49.87 ? 252 LEU C CD2 1 
ATOM   2346 N N   . ASP C  2 107 ? -47.989 -92.522  -47.350 1.00 40.82 ? 253 ASP C N   1 
ATOM   2347 C CA  . ASP C  2 107 ? -48.664 -91.902  -46.203 1.00 41.99 ? 253 ASP C CA  1 
ATOM   2348 C C   . ASP C  2 107 ? -48.115 -90.483  -45.988 1.00 41.72 ? 253 ASP C C   1 
ATOM   2349 O O   . ASP C  2 107 ? -48.881 -89.523  -45.865 1.00 41.98 ? 253 ASP C O   1 
ATOM   2350 C CB  . ASP C  2 107 ? -48.517 -92.751  -44.925 1.00 43.24 ? 253 ASP C CB  1 
ATOM   2351 C CG  . ASP C  2 107 ? -49.170 -94.141  -45.049 1.00 46.16 ? 253 ASP C CG  1 
ATOM   2352 O OD1 . ASP C  2 107 ? -50.050 -94.322  -45.914 1.00 47.52 ? 253 ASP C OD1 1 
ATOM   2353 O OD2 . ASP C  2 107 ? -48.787 -95.061  -44.290 1.00 45.55 ? 253 ASP C OD2 1 
ATOM   2354 N N   . LEU C  2 108 ? -46.790 -90.346  -45.980 1.00 39.93 ? 254 LEU C N   1 
ATOM   2355 C CA  . LEU C  2 108 ? -46.169 -89.026  -45.813 1.00 38.26 ? 254 LEU C CA  1 
ATOM   2356 C C   . LEU C  2 108 ? -46.606 -88.051  -46.913 1.00 37.87 ? 254 LEU C C   1 
ATOM   2357 O O   . LEU C  2 108 ? -46.915 -86.892  -46.640 1.00 36.96 ? 254 LEU C O   1 
ATOM   2358 C CB  . LEU C  2 108 ? -44.639 -89.147  -45.788 1.00 37.59 ? 254 LEU C CB  1 
ATOM   2359 C CG  . LEU C  2 108 ? -43.878 -87.867  -45.411 1.00 38.36 ? 254 LEU C CG  1 
ATOM   2360 C CD1 . LEU C  2 108 ? -44.214 -87.431  -43.990 1.00 37.99 ? 254 LEU C CD1 1 
ATOM   2361 C CD2 . LEU C  2 108 ? -42.379 -88.080  -45.558 1.00 38.60 ? 254 LEU C CD2 1 
ATOM   2362 N N   . ARG C  2 109 ? -46.615 -88.518  -48.163 1.00 38.93 ? 255 ARG C N   1 
ATOM   2363 C CA  . ARG C  2 109 ? -47.114 -87.721  -49.281 1.00 38.81 ? 255 ARG C CA  1 
ATOM   2364 C C   . ARG C  2 109 ? -48.545 -87.254  -49.006 1.00 39.48 ? 255 ARG C C   1 
ATOM   2365 O O   . ARG C  2 109 ? -48.894 -86.089  -49.248 1.00 37.46 ? 255 ARG C O   1 
ATOM   2366 C CB  . ARG C  2 109 ? -47.086 -88.543  -50.563 1.00 39.26 ? 255 ARG C CB  1 
ATOM   2367 C CG  . ARG C  2 109 ? -47.594 -87.818  -51.805 1.00 41.47 ? 255 ARG C CG  1 
ATOM   2368 C CD  . ARG C  2 109 ? -47.763 -88.813  -52.944 1.00 42.89 ? 255 ARG C CD  1 
ATOM   2369 N NE  . ARG C  2 109 ? -48.536 -88.300  -54.075 1.00 48.76 ? 255 ARG C NE  1 
ATOM   2370 C CZ  . ARG C  2 109 ? -49.866 -88.172  -54.103 1.00 51.15 ? 255 ARG C CZ  1 
ATOM   2371 N NH1 . ARG C  2 109 ? -50.613 -88.493  -53.046 1.00 55.70 ? 255 ARG C NH1 1 
ATOM   2372 N NH2 . ARG C  2 109 ? -50.457 -87.693  -55.190 1.00 47.96 ? 255 ARG C NH2 1 
ATOM   2373 N N   . GLY C  2 110 ? -49.370 -88.162  -48.495 1.00 39.59 ? 256 GLY C N   1 
ATOM   2374 C CA  . GLY C  2 110 ? -50.727 -87.801  -48.078 1.00 40.28 ? 256 GLY C CA  1 
ATOM   2375 C C   . GLY C  2 110 ? -50.744 -86.697  -47.032 1.00 40.65 ? 256 GLY C C   1 
ATOM   2376 O O   . GLY C  2 110 ? -51.455 -85.708  -47.188 1.00 38.96 ? 256 GLY C O   1 
ATOM   2377 N N   . VAL C  2 111 ? -49.948 -86.861  -45.974 1.00 40.72 ? 257 VAL C N   1 
ATOM   2378 C CA  . VAL C  2 111 ? -49.847 -85.837  -44.934 1.00 41.81 ? 257 VAL C CA  1 
ATOM   2379 C C   . VAL C  2 111 ? -49.436 -84.513  -45.571 1.00 41.25 ? 257 VAL C C   1 
ATOM   2380 O O   . VAL C  2 111 ? -50.067 -83.482  -45.338 1.00 41.80 ? 257 VAL C O   1 
ATOM   2381 C CB  . VAL C  2 111 ? -48.841 -86.212  -43.807 1.00 41.92 ? 257 VAL C CB  1 
ATOM   2382 C CG1 . VAL C  2 111 ? -48.735 -85.097  -42.782 1.00 42.15 ? 257 VAL C CG1 1 
ATOM   2383 C CG2 . VAL C  2 111 ? -49.254 -87.490  -43.093 1.00 41.91 ? 257 VAL C CG2 1 
ATOM   2384 N N   . CYS C  2 112 ? -48.380 -84.548  -46.379 1.00 40.44 ? 258 CYS C N   1 
ATOM   2385 C CA  . CYS C  2 112 ? -47.886 -83.341  -47.039 1.00 41.58 ? 258 CYS C CA  1 
ATOM   2386 C C   . CYS C  2 112 ? -49.001 -82.652  -47.839 1.00 42.41 ? 258 CYS C C   1 
ATOM   2387 O O   . CYS C  2 112 ? -49.141 -81.432  -47.816 1.00 37.96 ? 258 CYS C O   1 
ATOM   2388 C CB  . CYS C  2 112 ? -46.702 -83.670  -47.967 1.00 39.21 ? 258 CYS C CB  1 
ATOM   2389 S SG  . CYS C  2 112 ? -46.195 -82.273  -48.996 1.00 39.07 ? 258 CYS C SG  1 
ATOM   2390 N N   . ARG C  2 113 ? -49.798 -83.449  -48.535 1.00 46.49 ? 259 ARG C N   1 
ATOM   2391 C CA  . ARG C  2 113 ? -50.827 -82.899  -49.410 1.00 50.74 ? 259 ARG C CA  1 
ATOM   2392 C C   . ARG C  2 113 ? -52.031 -82.272  -48.691 1.00 51.14 ? 259 ARG C C   1 
ATOM   2393 O O   . ARG C  2 113 ? -52.791 -81.553  -49.326 1.00 49.78 ? 259 ARG C O   1 
ATOM   2394 C CB  . ARG C  2 113 ? -51.283 -83.957  -50.405 1.00 53.14 ? 259 ARG C CB  1 
ATOM   2395 C CG  . ARG C  2 113 ? -50.279 -84.173  -51.513 1.00 56.98 ? 259 ARG C CG  1 
ATOM   2396 C CD  . ARG C  2 113 ? -50.784 -85.180  -52.524 1.00 62.42 ? 259 ARG C CD  1 
ATOM   2397 N NE  . ARG C  2 113 ? -50.047 -85.092  -53.786 1.00 67.06 ? 259 ARG C NE  1 
ATOM   2398 C CZ  . ARG C  2 113 ? -50.401 -84.348  -54.834 1.00 70.83 ? 259 ARG C CZ  1 
ATOM   2399 N NH1 . ARG C  2 113 ? -51.498 -83.590  -54.806 1.00 73.88 ? 259 ARG C NH1 1 
ATOM   2400 N NH2 . ARG C  2 113 ? -49.646 -84.360  -55.930 1.00 73.10 ? 259 ARG C NH2 1 
ATOM   2401 N N   . THR C  2 114 ? -52.198 -82.521  -47.388 1.00 50.97 ? 260 THR C N   1 
ATOM   2402 C CA  . THR C  2 114 ? -53.229 -81.827  -46.605 1.00 49.44 ? 260 THR C CA  1 
ATOM   2403 C C   . THR C  2 114 ? -52.800 -80.411  -46.280 1.00 50.44 ? 260 THR C C   1 
ATOM   2404 O O   . THR C  2 114 ? -53.640 -79.566  -46.001 1.00 50.59 ? 260 THR C O   1 
ATOM   2405 C CB  . THR C  2 114 ? -53.537 -82.523  -45.270 1.00 49.99 ? 260 THR C CB  1 
ATOM   2406 O OG1 . THR C  2 114 ? -52.374 -82.490  -44.431 1.00 51.19 ? 260 THR C OG1 1 
ATOM   2407 C CG2 . THR C  2 114 ? -53.970 -83.965  -45.493 1.00 48.92 ? 260 THR C CG2 1 
ATOM   2408 N N   . ASP C  2 115 ? -51.494 -80.157  -46.287 1.00 51.85 ? 261 ASP C N   1 
ATOM   2409 C CA  . ASP C  2 115 ? -50.974 -78.809  -46.083 1.00 51.22 ? 261 ASP C CA  1 
ATOM   2410 C C   . ASP C  2 115 ? -50.894 -78.097  -47.433 1.00 51.55 ? 261 ASP C C   1 
ATOM   2411 O O   . ASP C  2 115 ? -50.239 -78.567  -48.363 1.00 46.65 ? 261 ASP C O   1 
ATOM   2412 C CB  . ASP C  2 115 ? -49.605 -78.852  -45.395 1.00 52.94 ? 261 ASP C CB  1 
ATOM   2413 C CG  . ASP C  2 115 ? -49.095 -77.465  -45.005 1.00 54.23 ? 261 ASP C CG  1 
ATOM   2414 O OD1 . ASP C  2 115 ? -48.748 -76.666  -45.896 1.00 57.59 ? 261 ASP C OD1 1 
ATOM   2415 O OD2 . ASP C  2 115 ? -49.025 -77.173  -43.795 1.00 61.12 ? 261 ASP C OD2 1 
ATOM   2416 N N   . HIS C  2 116 ? -51.579 -76.962  -47.519 1.00 54.71 ? 262 HIS C N   1 
ATOM   2417 C CA  . HIS C  2 116 ? -51.644 -76.161  -48.732 1.00 58.19 ? 262 HIS C CA  1 
ATOM   2418 C C   . HIS C  2 116 ? -50.258 -75.893  -49.320 1.00 52.00 ? 262 HIS C C   1 
ATOM   2419 O O   . HIS C  2 116 ? -50.065 -76.033  -50.533 1.00 48.22 ? 262 HIS C O   1 
ATOM   2420 C CB  . HIS C  2 116 ? -52.372 -74.834  -48.430 1.00 65.11 ? 262 HIS C CB  1 
ATOM   2421 C CG  . HIS C  2 116 ? -52.232 -73.794  -49.502 1.00 74.92 ? 262 HIS C CG  1 
ATOM   2422 N ND1 . HIS C  2 116 ? -51.397 -72.702  -49.376 1.00 78.71 ? 262 HIS C ND1 1 
ATOM   2423 C CD2 . HIS C  2 116 ? -52.822 -73.678  -50.718 1.00 81.19 ? 262 HIS C CD2 1 
ATOM   2424 C CE1 . HIS C  2 116 ? -51.476 -71.961  -50.468 1.00 83.96 ? 262 HIS C CE1 1 
ATOM   2425 N NE2 . HIS C  2 116 ? -52.333 -72.531  -51.298 1.00 85.92 ? 262 HIS C NE2 1 
ATOM   2426 N N   . LEU C  2 117 ? -49.305 -75.520  -48.459 1.00 47.86 ? 263 LEU C N   1 
ATOM   2427 C CA  . LEU C  2 117 ? -47.988 -75.058  -48.914 1.00 45.36 ? 263 LEU C CA  1 
ATOM   2428 C C   . LEU C  2 117 ? -47.070 -76.231  -49.232 1.00 39.92 ? 263 LEU C C   1 
ATOM   2429 O O   . LEU C  2 117 ? -46.391 -76.209  -50.237 1.00 39.54 ? 263 LEU C O   1 
ATOM   2430 C CB  . LEU C  2 117 ? -47.325 -74.139  -47.890 1.00 44.86 ? 263 LEU C CB  1 
ATOM   2431 C CG  . LEU C  2 117 ? -46.872 -72.778  -48.417 1.00 47.78 ? 263 LEU C CG  1 
ATOM   2432 C CD1 . LEU C  2 117 ? -46.021 -72.083  -47.356 1.00 49.07 ? 263 LEU C CD1 1 
ATOM   2433 C CD2 . LEU C  2 117 ? -46.125 -72.843  -49.739 1.00 48.15 ? 263 LEU C CD2 1 
ATOM   2434 N N   . CYS C  2 118 ? -47.064 -77.253  -48.386 1.00 38.88 ? 264 CYS C N   1 
ATOM   2435 C CA  . CYS C  2 118 ? -46.344 -78.495  -48.691 1.00 39.11 ? 264 CYS C CA  1 
ATOM   2436 C C   . CYS C  2 118 ? -46.798 -79.063  -50.038 1.00 39.88 ? 264 CYS C C   1 
ATOM   2437 O O   . CYS C  2 118 ? -45.967 -79.477  -50.853 1.00 39.18 ? 264 CYS C O   1 
ATOM   2438 C CB  . CYS C  2 118 ? -46.549 -79.547  -47.598 1.00 37.69 ? 264 CYS C CB  1 
ATOM   2439 S SG  . CYS C  2 118 ? -45.393 -80.953  -47.656 1.00 39.13 ? 264 CYS C SG  1 
ATOM   2440 N N   . ARG C  2 119 ? -48.113 -79.070  -50.267 1.00 39.64 ? 265 ARG C N   1 
ATOM   2441 C CA  . ARG C  2 119 ? -48.691 -79.638  -51.494 1.00 40.58 ? 265 ARG C CA  1 
ATOM   2442 C C   . ARG C  2 119 ? -48.143 -78.916  -52.710 1.00 36.21 ? 265 ARG C C   1 
ATOM   2443 O O   . ARG C  2 119 ? -47.720 -79.547  -53.662 1.00 36.34 ? 265 ARG C O   1 
ATOM   2444 C CB  . ARG C  2 119 ? -50.226 -79.539  -51.488 1.00 44.49 ? 265 ARG C CB  1 
ATOM   2445 C CG  . ARG C  2 119 ? -50.902 -80.079  -52.747 1.00 48.97 ? 265 ARG C CG  1 
ATOM   2446 C CD  . ARG C  2 119 ? -52.353 -80.515  -52.517 1.00 55.82 ? 265 ARG C CD  1 
ATOM   2447 N NE  . ARG C  2 119 ? -53.341 -79.443  -52.659 1.00 61.22 ? 265 ARG C NE  1 
ATOM   2448 C CZ  . ARG C  2 119 ? -53.974 -79.107  -53.791 1.00 68.93 ? 265 ARG C CZ  1 
ATOM   2449 N NH1 . ARG C  2 119 ? -53.725 -79.739  -54.941 1.00 72.41 ? 265 ARG C NH1 1 
ATOM   2450 N NH2 . ARG C  2 119 ? -54.864 -78.112  -53.779 1.00 68.91 ? 265 ARG C NH2 1 
ATOM   2451 N N   . SER C  2 120 ? -48.179 -77.592  -52.649 1.00 32.18 ? 266 SER C N   1 
ATOM   2452 C CA  . SER C  2 120 ? -47.643 -76.710  -53.671 1.00 33.01 ? 266 SER C CA  1 
ATOM   2453 C C   . SER C  2 120 ? -46.096 -76.815  -53.857 1.00 31.18 ? 266 SER C C   1 
ATOM   2454 O O   . SER C  2 120 ? -45.602 -76.821  -54.978 1.00 30.05 ? 266 SER C O   1 
ATOM   2455 C CB  . SER C  2 120 ? -48.029 -75.276  -53.308 1.00 34.39 ? 266 SER C CB  1 
ATOM   2456 O OG  . SER C  2 120 ? -47.416 -74.336  -54.170 1.00 42.75 ? 266 SER C OG  1 
ATOM   2457 N N   . ARG C  2 121 ? -45.352 -76.866  -52.760 1.00 28.44 ? 267 ARG C N   1 
ATOM   2458 C CA  . ARG C  2 121 ? -43.889 -77.004  -52.830 1.00 29.52 ? 267 ARG C CA  1 
ATOM   2459 C C   . ARG C  2 121 ? -43.475 -78.358  -53.424 1.00 28.12 ? 267 ARG C C   1 
ATOM   2460 O O   . ARG C  2 121 ? -42.572 -78.425  -54.249 1.00 27.43 ? 267 ARG C O   1 
ATOM   2461 C CB  . ARG C  2 121 ? -43.257 -76.818  -51.448 1.00 29.43 ? 267 ARG C CB  1 
ATOM   2462 C CG  . ARG C  2 121 ? -43.398 -75.405  -50.885 1.00 30.20 ? 267 ARG C CG  1 
ATOM   2463 C CD  . ARG C  2 121 ? -42.622 -74.369  -51.688 1.00 30.80 ? 267 ARG C CD  1 
ATOM   2464 N NE  . ARG C  2 121 ? -42.817 -73.022  -51.155 1.00 32.79 ? 267 ARG C NE  1 
ATOM   2465 C CZ  . ARG C  2 121 ? -42.203 -72.518  -50.084 1.00 33.52 ? 267 ARG C CZ  1 
ATOM   2466 N NH1 . ARG C  2 121 ? -41.323 -73.229  -49.390 1.00 33.42 ? 267 ARG C NH1 1 
ATOM   2467 N NH2 . ARG C  2 121 ? -42.451 -71.272  -49.717 1.00 35.51 ? 267 ARG C NH2 1 
ATOM   2468 N N   . LEU C  2 122 ? -44.155 -79.424  -53.018 1.00 27.11 ? 268 LEU C N   1 
ATOM   2469 C CA  . LEU C  2 122 ? -43.945 -80.730  -53.614 1.00 28.38 ? 268 LEU C CA  1 
ATOM   2470 C C   . LEU C  2 122 ? -44.233 -80.700  -55.114 1.00 29.22 ? 268 LEU C C   1 
ATOM   2471 O O   . LEU C  2 122 ? -43.455 -81.227  -55.907 1.00 27.91 ? 268 LEU C O   1 
ATOM   2472 C CB  . LEU C  2 122 ? -44.807 -81.801  -52.925 1.00 29.48 ? 268 LEU C CB  1 
ATOM   2473 C CG  . LEU C  2 122 ? -44.667 -83.252  -53.424 1.00 29.62 ? 268 LEU C CG  1 
ATOM   2474 C CD1 . LEU C  2 122 ? -43.231 -83.751  -53.323 1.00 29.66 ? 268 LEU C CD1 1 
ATOM   2475 C CD2 . LEU C  2 122 ? -45.575 -84.178  -52.628 1.00 29.06 ? 268 LEU C CD2 1 
ATOM   2476 N N   . ALA C  2 123 ? -45.330 -80.063  -55.509 1.00 28.88 ? 269 ALA C N   1 
ATOM   2477 C CA  . ALA C  2 123 ? -45.680 -79.985  -56.923 1.00 29.78 ? 269 ALA C CA  1 
ATOM   2478 C C   . ALA C  2 123 ? -44.639 -79.186  -57.719 1.00 29.50 ? 269 ALA C C   1 
ATOM   2479 O O   . ALA C  2 123 ? -44.335 -79.531  -58.862 1.00 29.13 ? 269 ALA C O   1 
ATOM   2480 C CB  . ALA C  2 123 ? -47.074 -79.407  -57.104 1.00 29.80 ? 269 ALA C CB  1 
ATOM   2481 N N   . ASP C  2 124 ? -44.103 -78.122  -57.124 1.00 30.08 ? 270 ASP C N   1 
ATOM   2482 C CA  . ASP C  2 124 ? -42.986 -77.386  -57.727 1.00 30.15 ? 270 ASP C CA  1 
ATOM   2483 C C   . ASP C  2 124 ? -41.763 -78.291  -57.934 1.00 27.47 ? 270 ASP C C   1 
ATOM   2484 O O   . ASP C  2 124 ? -41.167 -78.281  -58.996 1.00 26.23 ? 270 ASP C O   1 
ATOM   2485 C CB  . ASP C  2 124 ? -42.573 -76.184  -56.867 1.00 33.40 ? 270 ASP C CB  1 
ATOM   2486 C CG  . ASP C  2 124 ? -43.578 -75.037  -56.911 1.00 35.87 ? 270 ASP C CG  1 
ATOM   2487 O OD1 . ASP C  2 124 ? -44.433 -75.002  -57.816 1.00 38.68 ? 270 ASP C OD1 1 
ATOM   2488 O OD2 . ASP C  2 124 ? -43.507 -74.148  -56.025 1.00 38.75 ? 270 ASP C OD2 1 
ATOM   2489 N N   . PHE C  2 125 ? -41.426 -79.075  -56.916 1.00 26.28 ? 271 PHE C N   1 
ATOM   2490 C CA  . PHE C  2 125 ? -40.308 -80.000  -56.970 1.00 26.63 ? 271 PHE C CA  1 
ATOM   2491 C C   . PHE C  2 125 ? -40.487 -81.013  -58.095 1.00 27.45 ? 271 PHE C C   1 
ATOM   2492 O O   . PHE C  2 125 ? -39.554 -81.273  -58.859 1.00 25.26 ? 271 PHE C O   1 
ATOM   2493 C CB  . PHE C  2 125 ? -40.154 -80.719  -55.628 1.00 26.88 ? 271 PHE C CB  1 
ATOM   2494 C CG  . PHE C  2 125 ? -39.158 -81.839  -55.657 1.00 27.23 ? 271 PHE C CG  1 
ATOM   2495 C CD1 . PHE C  2 125 ? -37.804 -81.573  -55.730 1.00 27.19 ? 271 PHE C CD1 1 
ATOM   2496 C CD2 . PHE C  2 125 ? -39.576 -83.156  -55.636 1.00 26.93 ? 271 PHE C CD2 1 
ATOM   2497 C CE1 . PHE C  2 125 ? -36.882 -82.602  -55.771 1.00 28.61 ? 271 PHE C CE1 1 
ATOM   2498 C CE2 . PHE C  2 125 ? -38.656 -84.183  -55.669 1.00 27.94 ? 271 PHE C CE2 1 
ATOM   2499 C CZ  . PHE C  2 125 ? -37.306 -83.909  -55.738 1.00 27.86 ? 271 PHE C CZ  1 
ATOM   2500 N N   . HIS C  2 126 ? -41.692 -81.561  -58.200 1.00 26.39 ? 272 HIS C N   1 
ATOM   2501 C CA  . HIS C  2 126 ? -42.009 -82.510  -59.255 1.00 27.68 ? 272 HIS C CA  1 
ATOM   2502 C C   . HIS C  2 126 ? -41.839 -81.871  -60.608 1.00 25.86 ? 272 HIS C C   1 
ATOM   2503 O O   . HIS C  2 126 ? -41.190 -82.443  -61.487 1.00 24.74 ? 272 HIS C O   1 
ATOM   2504 C CB  . HIS C  2 126 ? -43.432 -83.077  -59.087 1.00 29.59 ? 272 HIS C CB  1 
ATOM   2505 C CG  . HIS C  2 126 ? -43.528 -84.127  -58.021 1.00 31.27 ? 272 HIS C CG  1 
ATOM   2506 N ND1 . HIS C  2 126 ? -44.604 -84.232  -57.164 1.00 31.97 ? 272 HIS C ND1 1 
ATOM   2507 C CD2 . HIS C  2 126 ? -42.666 -85.110  -57.666 1.00 30.85 ? 272 HIS C CD2 1 
ATOM   2508 C CE1 . HIS C  2 126 ? -44.407 -85.244  -56.336 1.00 32.24 ? 272 HIS C CE1 1 
ATOM   2509 N NE2 . HIS C  2 126 ? -43.236 -85.790  -56.617 1.00 32.25 ? 272 HIS C NE2 1 
ATOM   2510 N N   . ALA C  2 127 ? -42.386 -80.665  -60.768 1.00 25.79 ? 273 ALA C N   1 
ATOM   2511 C CA  . ALA C  2 127 ? -42.360 -79.978  -62.055 1.00 24.76 ? 273 ALA C CA  1 
ATOM   2512 C C   . ALA C  2 127 ? -40.952 -79.570  -62.484 1.00 25.11 ? 273 ALA C C   1 
ATOM   2513 O O   . ALA C  2 127 ? -40.582 -79.685  -63.658 1.00 25.44 ? 273 ALA C O   1 
ATOM   2514 C CB  . ALA C  2 127 ? -43.257 -78.760  -62.015 1.00 25.37 ? 273 ALA C CB  1 
ATOM   2515 N N   . ASN C  2 128 ? -40.167 -79.100  -61.534 1.00 25.00 ? 274 ASN C N   1 
ATOM   2516 C CA  . ASN C  2 128 ? -38.833 -78.581  -61.840 1.00 24.31 ? 274 ASN C CA  1 
ATOM   2517 C C   . ASN C  2 128 ? -37.713 -79.619  -61.789 1.00 23.48 ? 274 ASN C C   1 
ATOM   2518 O O   . ASN C  2 128 ? -36.700 -79.453  -62.468 1.00 23.94 ? 274 ASN C O   1 
ATOM   2519 C CB  . ASN C  2 128 ? -38.546 -77.410  -60.905 1.00 25.59 ? 274 ASN C CB  1 
ATOM   2520 C CG  . ASN C  2 128 ? -39.499 -76.243  -61.139 1.00 27.54 ? 274 ASN C CG  1 
ATOM   2521 O OD1 . ASN C  2 128 ? -39.878 -75.975  -62.274 1.00 27.63 ? 274 ASN C OD1 1 
ATOM   2522 N ND2 . ASN C  2 128 ? -39.881 -75.547  -60.073 1.00 27.65 ? 274 ASN C ND2 1 
ATOM   2523 N N   . CYS C  2 129 ? -37.882 -80.680  -60.993 1.00 22.83 ? 275 CYS C N   1 
ATOM   2524 C CA  . CYS C  2 129 ? -36.815 -81.665  -60.775 1.00 21.91 ? 275 CYS C CA  1 
ATOM   2525 C C   . CYS C  2 129 ? -37.042 -83.036  -61.385 1.00 21.17 ? 275 CYS C C   1 
ATOM   2526 O O   . CYS C  2 129 ? -36.068 -83.782  -61.546 1.00 19.45 ? 275 CYS C O   1 
ATOM   2527 C CB  . CYS C  2 129 ? -36.536 -81.877  -59.275 1.00 21.85 ? 275 CYS C CB  1 
ATOM   2528 S SG  . CYS C  2 129 ? -35.807 -80.466  -58.407 1.00 23.06 ? 275 CYS C SG  1 
ATOM   2529 N N   . ARG C  2 130 ? -38.287 -83.423  -61.669 1.00 21.09 ? 276 ARG C N   1 
ATOM   2530 C CA  . ARG C  2 130 ? -38.499 -84.719  -62.315 1.00 23.29 ? 276 ARG C CA  1 
ATOM   2531 C C   . ARG C  2 130 ? -37.670 -84.746  -63.602 1.00 22.39 ? 276 ARG C C   1 
ATOM   2532 O O   . ARG C  2 130 ? -37.661 -83.766  -64.351 1.00 19.90 ? 276 ARG C O   1 
ATOM   2533 C CB  . ARG C  2 130 ? -39.968 -85.013  -62.644 1.00 25.80 ? 276 ARG C CB  1 
ATOM   2534 C CG  . ARG C  2 130 ? -40.743 -85.647  -61.514 1.00 29.17 ? 276 ARG C CG  1 
ATOM   2535 C CD  . ARG C  2 130 ? -42.199 -85.842  -61.891 1.00 31.41 ? 276 ARG C CD  1 
ATOM   2536 N NE  . ARG C  2 130 ? -42.951 -86.530  -60.835 1.00 34.12 ? 276 ARG C NE  1 
ATOM   2537 C CZ  . ARG C  2 130 ? -44.253 -86.353  -60.580 1.00 35.69 ? 276 ARG C CZ  1 
ATOM   2538 N NH1 . ARG C  2 130 ? -44.988 -85.495  -61.295 1.00 36.68 ? 276 ARG C NH1 1 
ATOM   2539 N NH2 . ARG C  2 130 ? -44.824 -87.020  -59.584 1.00 34.66 ? 276 ARG C NH2 1 
ATOM   2540 N N   . ALA C  2 131 ? -36.992 -85.877  -63.813 1.00 21.09 ? 277 ALA C N   1 
ATOM   2541 C CA  . ALA C  2 131 ? -36.016 -86.063  -64.877 1.00 22.09 ? 277 ALA C CA  1 
ATOM   2542 C C   . ALA C  2 131 ? -36.661 -86.099  -66.245 1.00 21.46 ? 277 ALA C C   1 
ATOM   2543 O O   . ALA C  2 131 ? -37.716 -86.685  -66.402 1.00 22.93 ? 277 ALA C O   1 
ATOM   2544 C CB  . ALA C  2 131 ? -35.256 -87.357  -64.650 1.00 22.60 ? 277 ALA C CB  1 
ATOM   2545 N N   . SER C  2 132 ? -36.009 -85.477  -67.227 1.00 20.92 ? 278 SER C N   1 
ATOM   2546 C CA  . SER C  2 132 ? -36.333 -85.625  -68.633 1.00 20.63 ? 278 SER C CA  1 
ATOM   2547 C C   . SER C  2 132 ? -35.293 -86.522  -69.276 1.00 21.86 ? 278 SER C C   1 
ATOM   2548 O O   . SER C  2 132 ? -34.101 -86.456  -68.935 1.00 20.76 ? 278 SER C O   1 
ATOM   2549 C CB  . SER C  2 132 ? -36.331 -84.258  -69.336 1.00 20.98 ? 278 SER C CB  1 
ATOM   2550 O OG  . SER C  2 132 ? -36.299 -84.413  -70.747 1.00 21.08 ? 278 SER C OG  1 
ATOM   2551 N N   . TYR C  2 133 ? -35.742 -87.363  -70.209 1.00 22.77 ? 279 TYR C N   1 
ATOM   2552 C CA  . TYR C  2 133 ? -34.860 -88.264  -70.945 1.00 23.35 ? 279 TYR C CA  1 
ATOM   2553 C C   . TYR C  2 133 ? -34.298 -87.595  -72.187 1.00 21.42 ? 279 TYR C C   1 
ATOM   2554 O O   . TYR C  2 133 ? -33.565 -88.229  -72.932 1.00 18.83 ? 279 TYR C O   1 
ATOM   2555 C CB  . TYR C  2 133 ? -35.600 -89.544  -71.373 1.00 26.78 ? 279 TYR C CB  1 
ATOM   2556 C CG  . TYR C  2 133 ? -36.344 -90.237  -70.249 1.00 31.95 ? 279 TYR C CG  1 
ATOM   2557 C CD1 . TYR C  2 133 ? -35.794 -90.334  -68.968 1.00 36.24 ? 279 TYR C CD1 1 
ATOM   2558 C CD2 . TYR C  2 133 ? -37.602 -90.789  -70.459 1.00 35.25 ? 279 TYR C CD2 1 
ATOM   2559 C CE1 . TYR C  2 133 ? -36.491 -90.951  -67.929 1.00 38.65 ? 279 TYR C CE1 1 
ATOM   2560 C CE2 . TYR C  2 133 ? -38.291 -91.426  -69.428 1.00 38.93 ? 279 TYR C CE2 1 
ATOM   2561 C CZ  . TYR C  2 133 ? -37.727 -91.500  -68.172 1.00 39.50 ? 279 TYR C CZ  1 
ATOM   2562 O OH  . TYR C  2 133 ? -38.408 -92.126  -67.158 1.00 49.45 ? 279 TYR C OH  1 
ATOM   2563 N N   . GLN C  2 134 ? -34.618 -86.312  -72.387 1.00 21.04 ? 280 GLN C N   1 
ATOM   2564 C CA  . GLN C  2 134 ? -34.328 -85.601  -73.647 1.00 20.69 ? 280 GLN C CA  1 
ATOM   2565 C C   . GLN C  2 134 ? -33.248 -84.513  -73.549 1.00 20.14 ? 280 GLN C C   1 
ATOM   2566 O O   . GLN C  2 134 ? -32.814 -83.993  -74.575 1.00 20.12 ? 280 GLN C O   1 
ATOM   2567 C CB  . GLN C  2 134 ? -35.631 -84.967  -74.177 1.00 21.60 ? 280 GLN C CB  1 
ATOM   2568 C CG  . GLN C  2 134 ? -36.727 -85.966  -74.507 1.00 22.48 ? 280 GLN C CG  1 
ATOM   2569 C CD  . GLN C  2 134 ? -36.288 -86.984  -75.547 1.00 26.00 ? 280 GLN C CD  1 
ATOM   2570 O OE1 . GLN C  2 134 ? -35.476 -86.682  -76.428 1.00 27.62 ? 280 GLN C OE1 1 
ATOM   2571 N NE2 . GLN C  2 134 ? -36.817 -88.201  -75.454 1.00 28.59 ? 280 GLN C NE2 1 
ATOM   2572 N N   . THR C  2 135 ? -32.826 -84.151  -72.339 1.00 19.26 ? 281 THR C N   1 
ATOM   2573 C CA  . THR C  2 135 ? -31.903 -83.005  -72.164 1.00 19.11 ? 281 THR C CA  1 
ATOM   2574 C C   . THR C  2 135 ? -30.523 -83.473  -71.704 1.00 19.70 ? 281 THR C C   1 
ATOM   2575 O O   . THR C  2 135 ? -30.395 -84.517  -71.083 1.00 19.29 ? 281 THR C O   1 
ATOM   2576 C CB  . THR C  2 135 ? -32.454 -81.972  -71.175 1.00 17.90 ? 281 THR C CB  1 
ATOM   2577 O OG1 . THR C  2 135 ? -32.446 -82.507  -69.827 1.00 17.46 ? 281 THR C OG1 1 
ATOM   2578 C CG2 . THR C  2 135 ? -33.878 -81.530  -71.577 1.00 18.38 ? 281 THR C CG2 1 
ATOM   2579 N N   . VAL C  2 136 ? -29.499 -82.686  -71.997 1.00 21.23 ? 282 VAL C N   1 
ATOM   2580 C CA  . VAL C  2 136 ? -28.140 -83.072  -71.630 1.00 21.21 ? 282 VAL C CA  1 
ATOM   2581 C C   . VAL C  2 136 ? -27.962 -83.203  -70.100 1.00 20.44 ? 282 VAL C C   1 
ATOM   2582 O O   . VAL C  2 136 ? -27.151 -83.991  -69.645 1.00 21.03 ? 282 VAL C O   1 
ATOM   2583 C CB  . VAL C  2 136 ? -27.061 -82.134  -72.226 1.00 23.27 ? 282 VAL C CB  1 
ATOM   2584 C CG1 . VAL C  2 136 ? -27.140 -82.090  -73.745 1.00 24.21 ? 282 VAL C CG1 1 
ATOM   2585 C CG2 . VAL C  2 136 ? -27.146 -80.736  -71.660 1.00 25.69 ? 282 VAL C CG2 1 
ATOM   2586 N N   . THR C  2 137 ? -28.733 -82.449  -69.336 1.00 18.91 ? 283 THR C N   1 
ATOM   2587 C CA  . THR C  2 137 ? -28.646 -82.428  -67.878 1.00 19.31 ? 283 THR C CA  1 
ATOM   2588 C C   . THR C  2 137 ? -29.627 -83.351  -67.166 1.00 19.03 ? 283 THR C C   1 
ATOM   2589 O O   . THR C  2 137 ? -29.573 -83.487  -65.953 1.00 19.82 ? 283 THR C O   1 
ATOM   2590 C CB  . THR C  2 137 ? -28.968 -81.017  -67.359 1.00 19.26 ? 283 THR C CB  1 
ATOM   2591 O OG1 . THR C  2 137 ? -30.325 -80.688  -67.682 1.00 18.64 ? 283 THR C OG1 1 
ATOM   2592 C CG2 . THR C  2 137 ? -28.015 -80.015  -67.941 1.00 19.91 ? 283 THR C CG2 1 
ATOM   2593 N N   . SER C  2 138 ? -30.543 -83.940  -67.937 1.00 19.53 ? 284 SER C N   1 
ATOM   2594 C CA  . SER C  2 138 ? -31.739 -84.628  -67.434 1.00 18.32 ? 284 SER C CA  1 
ATOM   2595 C C   . SER C  2 138 ? -32.727 -83.730  -66.709 1.00 18.58 ? 284 SER C C   1 
ATOM   2596 O O   . SER C  2 138 ? -33.743 -84.234  -66.234 1.00 18.75 ? 284 SER C O   1 
ATOM   2597 C CB  . SER C  2 138 ? -31.390 -85.855  -66.589 1.00 18.52 ? 284 SER C CB  1 
ATOM   2598 O OG  . SER C  2 138 ? -30.600 -86.782  -67.341 1.00 17.80 ? 284 SER C OG  1 
ATOM   2599 N N   . CYS C  2 139 ? -32.487 -82.413  -66.653 1.00 18.46 ? 285 CYS C N   1 
ATOM   2600 C CA  . CYS C  2 139 ? -33.481 -81.493  -66.112 1.00 18.89 ? 285 CYS C CA  1 
ATOM   2601 C C   . CYS C  2 139 ? -34.243 -80.847  -67.240 1.00 19.99 ? 285 CYS C C   1 
ATOM   2602 O O   . CYS C  2 139 ? -33.700 -80.656  -68.323 1.00 19.57 ? 285 CYS C O   1 
ATOM   2603 C CB  . CYS C  2 139 ? -32.856 -80.391  -65.249 1.00 19.92 ? 285 CYS C CB  1 
ATOM   2604 S SG  . CYS C  2 139 ? -31.981 -81.033  -63.806 1.00 20.17 ? 285 CYS C SG  1 
ATOM   2605 N N   . PRO C  2 140 ? -35.526 -80.498  -66.988 1.00 20.73 ? 286 PRO C N   1 
ATOM   2606 C CA  . PRO C  2 140 ? -36.290 -79.806  -67.999 1.00 21.18 ? 286 PRO C CA  1 
ATOM   2607 C C   . PRO C  2 140 ? -35.639 -78.461  -68.326 1.00 21.01 ? 286 PRO C C   1 
ATOM   2608 O O   . PRO C  2 140 ? -35.233 -77.747  -67.419 1.00 19.63 ? 286 PRO C O   1 
ATOM   2609 C CB  . PRO C  2 140 ? -37.683 -79.612  -67.356 1.00 21.73 ? 286 PRO C CB  1 
ATOM   2610 C CG  . PRO C  2 140 ? -37.489 -79.820  -65.895 1.00 22.06 ? 286 PRO C CG  1 
ATOM   2611 C CD  . PRO C  2 140 ? -36.263 -80.678  -65.728 1.00 21.51 ? 286 PRO C CD  1 
ATOM   2612 N N   . ALA C  2 141 ? -35.531 -78.164  -69.620 1.00 20.76 ? 287 ALA C N   1 
ATOM   2613 C CA  . ALA C  2 141 ? -34.918 -76.943  -70.125 1.00 22.10 ? 287 ALA C CA  1 
ATOM   2614 C C   . ALA C  2 141 ? -33.515 -76.737  -69.602 1.00 21.94 ? 287 ALA C C   1 
ATOM   2615 O O   . ALA C  2 141 ? -33.011 -75.631  -69.639 1.00 22.37 ? 287 ALA C O   1 
ATOM   2616 C CB  . ALA C  2 141 ? -35.788 -75.724  -69.813 1.00 22.96 ? 287 ALA C CB  1 
ATOM   2617 N N   . ASP C  2 142 ? -32.875 -77.805  -69.134 1.00 22.07 ? 288 ASP C N   1 
ATOM   2618 C CA  . ASP C  2 142 ? -31.541 -77.721  -68.510 1.00 22.12 ? 288 ASP C CA  1 
ATOM   2619 C C   . ASP C  2 142 ? -31.496 -76.699  -67.402 1.00 21.23 ? 288 ASP C C   1 
ATOM   2620 O O   . ASP C  2 142 ? -30.482 -76.044  -67.192 1.00 21.81 ? 288 ASP C O   1 
ATOM   2621 C CB  . ASP C  2 142 ? -30.464 -77.447  -69.574 1.00 22.13 ? 288 ASP C CB  1 
ATOM   2622 C CG  . ASP C  2 142 ? -30.291 -78.610  -70.508 1.00 22.84 ? 288 ASP C CG  1 
ATOM   2623 O OD1 . ASP C  2 142 ? -30.474 -79.756  -70.031 1.00 22.67 ? 288 ASP C OD1 1 
ATOM   2624 O OD2 . ASP C  2 142 ? -30.002 -78.396  -71.708 1.00 22.39 ? 288 ASP C OD2 1 
ATOM   2625 N N   . ASN C  2 143 ? -32.603 -76.566  -66.681 1.00 20.72 ? 289 ASN C N   1 
ATOM   2626 C CA  . ASN C  2 143 ? -32.726 -75.533  -65.670 1.00 21.46 ? 289 ASN C CA  1 
ATOM   2627 C C   . ASN C  2 143 ? -32.427 -76.102  -64.281 1.00 22.18 ? 289 ASN C C   1 
ATOM   2628 O O   . ASN C  2 143 ? -33.336 -76.485  -63.524 1.00 21.34 ? 289 ASN C O   1 
ATOM   2629 C CB  . ASN C  2 143 ? -34.113 -74.885  -65.712 1.00 21.94 ? 289 ASN C CB  1 
ATOM   2630 C CG  . ASN C  2 143 ? -34.200 -73.648  -64.844 1.00 22.75 ? 289 ASN C CG  1 
ATOM   2631 O OD1 . ASN C  2 143 ? -33.369 -73.418  -63.982 1.00 22.34 ? 289 ASN C OD1 1 
ATOM   2632 N ND2 . ASN C  2 143 ? -35.224 -72.859  -65.062 1.00 24.77 ? 289 ASN C ND2 1 
ATOM   2633 N N   . TYR C  2 144 ? -31.137 -76.164  -63.977 1.00 21.62 ? 290 TYR C N   1 
ATOM   2634 C CA  . TYR C  2 144 ? -30.643 -76.548  -62.656 1.00 22.43 ? 290 TYR C CA  1 
ATOM   2635 C C   . TYR C  2 144 ? -31.194 -75.679  -61.529 1.00 23.35 ? 290 TYR C C   1 
ATOM   2636 O O   . TYR C  2 144 ? -31.679 -76.214  -60.519 1.00 22.24 ? 290 TYR C O   1 
ATOM   2637 C CB  . TYR C  2 144 ? -29.107 -76.466  -62.625 1.00 21.87 ? 290 TYR C CB  1 
ATOM   2638 C CG  . TYR C  2 144 ? -28.361 -77.575  -63.349 1.00 20.50 ? 290 TYR C CG  1 
ATOM   2639 C CD1 . TYR C  2 144 ? -28.869 -78.864  -63.400 1.00 20.23 ? 290 TYR C CD1 1 
ATOM   2640 C CD2 . TYR C  2 144 ? -27.108 -77.346  -63.928 1.00 20.08 ? 290 TYR C CD2 1 
ATOM   2641 C CE1 . TYR C  2 144 ? -28.188 -79.886  -64.021 1.00 19.97 ? 290 TYR C CE1 1 
ATOM   2642 C CE2 . TYR C  2 144 ? -26.405 -78.380  -64.539 1.00 19.25 ? 290 TYR C CE2 1 
ATOM   2643 C CZ  . TYR C  2 144 ? -26.957 -79.654  -64.576 1.00 19.60 ? 290 TYR C CZ  1 
ATOM   2644 O OH  . TYR C  2 144 ? -26.317 -80.725  -65.192 1.00 18.64 ? 290 TYR C OH  1 
ATOM   2645 N N   . GLN C  2 145 ? -31.118 -74.350  -61.697 1.00 24.98 ? 291 GLN C N   1 
ATOM   2646 C CA  . GLN C  2 145 ? -31.517 -73.406  -60.630 1.00 26.34 ? 291 GLN C CA  1 
ATOM   2647 C C   . GLN C  2 145 ? -32.942 -73.605  -60.104 1.00 24.04 ? 291 GLN C C   1 
ATOM   2648 O O   . GLN C  2 145 ? -33.156 -73.633  -58.887 1.00 23.23 ? 291 GLN C O   1 
ATOM   2649 C CB  . GLN C  2 145 ? -31.336 -71.933  -61.056 1.00 30.28 ? 291 GLN C CB  1 
ATOM   2650 C CG  . GLN C  2 145 ? -29.972 -71.345  -60.725 1.00 36.95 ? 291 GLN C CG  1 
ATOM   2651 C CD  . GLN C  2 145 ? -29.725 -71.183  -59.212 1.00 42.99 ? 291 GLN C CD  1 
ATOM   2652 O OE1 . GLN C  2 145 ? -30.411 -70.405  -58.530 1.00 48.13 ? 291 GLN C OE1 1 
ATOM   2653 N NE2 . GLN C  2 145 ? -28.732 -71.918  -58.683 1.00 43.77 ? 291 GLN C NE2 1 
ATOM   2654 N N   . ALA C  2 146 ? -33.910 -73.726  -61.007 1.00 22.25 ? 292 ALA C N   1 
ATOM   2655 C CA  . ALA C  2 146 ? -35.309 -73.951  -60.605 1.00 22.13 ? 292 ALA C CA  1 
ATOM   2656 C C   . ALA C  2 146 ? -35.540 -75.270  -59.859 1.00 21.44 ? 292 ALA C C   1 
ATOM   2657 O O   . ALA C  2 146 ? -36.384 -75.345  -58.951 1.00 21.39 ? 292 ALA C O   1 
ATOM   2658 C CB  . ALA C  2 146 ? -36.213 -73.885  -61.822 1.00 22.26 ? 292 ALA C CB  1 
ATOM   2659 N N   . CYS C  2 147 ? -34.802 -76.309  -60.237 1.00 20.75 ? 293 CYS C N   1 
ATOM   2660 C CA  . CYS C  2 147 ? -34.857 -77.548  -59.471 1.00 21.60 ? 293 CYS C CA  1 
ATOM   2661 C C   . CYS C  2 147 ? -34.276 -77.339  -58.061 1.00 20.90 ? 293 CYS C C   1 
ATOM   2662 O O   . CYS C  2 147 ? -34.873 -77.760  -57.065 1.00 19.45 ? 293 CYS C O   1 
ATOM   2663 C CB  . CYS C  2 147 ? -34.121 -78.680  -60.196 1.00 21.19 ? 293 CYS C CB  1 
ATOM   2664 S SG  . CYS C  2 147 ? -33.954 -80.201  -59.223 1.00 22.28 ? 293 CYS C SG  1 
ATOM   2665 N N   . LEU C  2 148 ? -33.107 -76.702  -57.977 1.00 21.13 ? 294 LEU C N   1 
ATOM   2666 C CA  . LEU C  2 148 ? -32.450 -76.551  -56.683 1.00 22.25 ? 294 LEU C CA  1 
ATOM   2667 C C   . LEU C  2 148 ? -33.336 -75.745  -55.730 1.00 22.59 ? 294 LEU C C   1 
ATOM   2668 O O   . LEU C  2 148 ? -33.482 -76.085  -54.559 1.00 22.89 ? 294 LEU C O   1 
ATOM   2669 C CB  . LEU C  2 148 ? -31.086 -75.887  -56.834 1.00 22.56 ? 294 LEU C CB  1 
ATOM   2670 C CG  . LEU C  2 148 ? -29.991 -76.680  -57.524 1.00 22.18 ? 294 LEU C CG  1 
ATOM   2671 C CD1 . LEU C  2 148 ? -28.681 -75.927  -57.451 1.00 22.92 ? 294 LEU C CD1 1 
ATOM   2672 C CD2 . LEU C  2 148 ? -29.830 -78.066  -56.925 1.00 23.86 ? 294 LEU C CD2 1 
ATOM   2673 N N   . GLY C  2 149 ? -33.949 -74.694  -56.259 1.00 24.07 ? 295 GLY C N   1 
ATOM   2674 C CA  . GLY C  2 149 ? -34.862 -73.878  -55.488 1.00 23.81 ? 295 GLY C CA  1 
ATOM   2675 C C   . GLY C  2 149 ? -36.066 -74.645  -54.998 1.00 24.90 ? 295 GLY C C   1 
ATOM   2676 O O   . GLY C  2 149 ? -36.495 -74.462  -53.849 1.00 24.69 ? 295 GLY C O   1 
ATOM   2677 N N   . SER C  2 150 ? -36.614 -75.507  -55.853 1.00 24.93 ? 296 SER C N   1 
ATOM   2678 C CA  . SER C  2 150 ? -37.765 -76.318  -55.458 1.00 25.02 ? 296 SER C CA  1 
ATOM   2679 C C   . SER C  2 150 ? -37.382 -77.368  -54.449 1.00 24.83 ? 296 SER C C   1 
ATOM   2680 O O   . SER C  2 150 ? -38.198 -77.720  -53.588 1.00 25.44 ? 296 SER C O   1 
ATOM   2681 C CB  . SER C  2 150 ? -38.406 -76.983  -56.667 1.00 25.97 ? 296 SER C CB  1 
ATOM   2682 O OG  . SER C  2 150 ? -38.884 -75.996  -57.561 1.00 28.25 ? 296 SER C OG  1 
ATOM   2683 N N   . TYR C  2 151 ? -36.162 -77.900  -54.549 1.00 23.69 ? 297 TYR C N   1 
ATOM   2684 C CA  . TYR C  2 151 ? -35.676 -78.829  -53.523 1.00 22.69 ? 297 TYR C CA  1 
ATOM   2685 C C   . TYR C  2 151 ? -35.590 -78.102  -52.199 1.00 22.88 ? 297 TYR C C   1 
ATOM   2686 O O   . TYR C  2 151 ? -36.130 -78.581  -51.208 1.00 22.64 ? 297 TYR C O   1 
ATOM   2687 C CB  . TYR C  2 151 ? -34.302 -79.416  -53.872 1.00 23.15 ? 297 TYR C CB  1 
ATOM   2688 C CG  . TYR C  2 151 ? -33.698 -80.314  -52.799 1.00 22.60 ? 297 TYR C CG  1 
ATOM   2689 C CD1 . TYR C  2 151 ? -32.886 -79.802  -51.808 1.00 21.80 ? 297 TYR C CD1 1 
ATOM   2690 C CD2 . TYR C  2 151 ? -33.945 -81.682  -52.795 1.00 24.01 ? 297 TYR C CD2 1 
ATOM   2691 C CE1 . TYR C  2 151 ? -32.317 -80.626  -50.844 1.00 23.47 ? 297 TYR C CE1 1 
ATOM   2692 C CE2 . TYR C  2 151 ? -33.381 -82.518  -51.836 1.00 24.91 ? 297 TYR C CE2 1 
ATOM   2693 C CZ  . TYR C  2 151 ? -32.567 -81.992  -50.858 1.00 23.79 ? 297 TYR C CZ  1 
ATOM   2694 O OH  . TYR C  2 151 ? -32.028 -82.846  -49.905 1.00 24.73 ? 297 TYR C OH  1 
ATOM   2695 N N   . ALA C  2 152 ? -34.911 -76.947  -52.185 1.00 24.10 ? 298 ALA C N   1 
ATOM   2696 C CA  . ALA C  2 152 ? -34.735 -76.172  -50.952 1.00 25.17 ? 298 ALA C CA  1 
ATOM   2697 C C   . ALA C  2 152 ? -36.086 -75.742  -50.365 1.00 25.52 ? 298 ALA C C   1 
ATOM   2698 O O   . ALA C  2 152 ? -36.258 -75.654  -49.130 1.00 25.12 ? 298 ALA C O   1 
ATOM   2699 C CB  . ALA C  2 152 ? -33.839 -74.952  -51.199 1.00 25.40 ? 298 ALA C CB  1 
ATOM   2700 N N   . GLY C  2 153 ? -37.046 -75.481  -51.246 1.00 25.55 ? 299 GLY C N   1 
ATOM   2701 C CA  . GLY C  2 153 ? -38.398 -75.111  -50.835 1.00 25.23 ? 299 GLY C CA  1 
ATOM   2702 C C   . GLY C  2 153 ? -39.193 -76.155  -50.073 1.00 26.07 ? 299 GLY C C   1 
ATOM   2703 O O   . GLY C  2 153 ? -40.257 -75.827  -49.534 1.00 28.35 ? 299 GLY C O   1 
ATOM   2704 N N   . MET C  2 154 ? -38.701 -77.397  -50.000 1.00 25.47 ? 300 MET C N   1 
ATOM   2705 C CA  . MET C  2 154 ? -39.381 -78.427  -49.224 1.00 26.11 ? 300 MET C CA  1 
ATOM   2706 C C   . MET C  2 154 ? -38.843 -78.608  -47.798 1.00 26.18 ? 300 MET C C   1 
ATOM   2707 O O   . MET C  2 154 ? -39.448 -79.321  -46.995 1.00 25.55 ? 300 MET C O   1 
ATOM   2708 C CB  . MET C  2 154 ? -39.353 -79.748  -49.969 1.00 28.00 ? 300 MET C CB  1 
ATOM   2709 C CG  . MET C  2 154 ? -40.444 -79.851  -51.040 1.00 29.82 ? 300 MET C CG  1 
ATOM   2710 S SD  . MET C  2 154 ? -40.379 -81.455  -51.817 1.00 36.17 ? 300 MET C SD  1 
ATOM   2711 C CE  . MET C  2 154 ? -38.670 -81.460  -52.409 1.00 34.35 ? 300 MET C CE  1 
ATOM   2712 N N   . ILE C  2 155 ? -37.738 -77.938  -47.479 1.00 25.93 ? 301 ILE C N   1 
ATOM   2713 C CA  . ILE C  2 155 ? -37.135 -78.030  -46.155 1.00 25.79 ? 301 ILE C CA  1 
ATOM   2714 C C   . ILE C  2 155 ? -37.956 -77.235  -45.135 1.00 27.28 ? 301 ILE C C   1 
ATOM   2715 O O   . ILE C  2 155 ? -38.297 -76.082  -45.370 1.00 29.36 ? 301 ILE C O   1 
ATOM   2716 C CB  . ILE C  2 155 ? -35.683 -77.521  -46.191 1.00 25.69 ? 301 ILE C CB  1 
ATOM   2717 C CG1 . ILE C  2 155 ? -34.854 -78.406  -47.140 1.00 23.47 ? 301 ILE C CG1 1 
ATOM   2718 C CG2 . ILE C  2 155 ? -35.099 -77.502  -44.786 1.00 25.08 ? 301 ILE C CG2 1 
ATOM   2719 C CD1 . ILE C  2 155 ? -33.527 -77.825  -47.543 1.00 23.64 ? 301 ILE C CD1 1 
ATOM   2720 N N   . GLY C  2 156 ? -38.268 -77.867  -44.004 1.00 29.43 ? 302 GLY C N   1 
ATOM   2721 C CA  . GLY C  2 156 ? -39.144 -77.277  -42.988 1.00 30.15 ? 302 GLY C CA  1 
ATOM   2722 C C   . GLY C  2 156 ? -40.625 -77.603  -43.162 1.00 31.86 ? 302 GLY C C   1 
ATOM   2723 O O   . GLY C  2 156 ? -41.475 -76.960  -42.551 1.00 32.02 ? 302 GLY C O   1 
ATOM   2724 N N   . PHE C  2 157 ? -40.922 -78.591  -44.013 1.00 33.40 ? 303 PHE C N   1 
ATOM   2725 C CA  . PHE C  2 157 ? -42.266 -79.136  -44.227 1.00 32.83 ? 303 PHE C CA  1 
ATOM   2726 C C   . PHE C  2 157 ? -42.229 -80.620  -43.898 1.00 33.14 ? 303 PHE C C   1 
ATOM   2727 O O   . PHE C  2 157 ? -41.165 -81.163  -43.597 1.00 34.49 ? 303 PHE C O   1 
ATOM   2728 C CB  . PHE C  2 157 ? -42.717 -78.942  -45.682 1.00 33.30 ? 303 PHE C CB  1 
ATOM   2729 C CG  . PHE C  2 157 ? -42.951 -77.514  -46.046 1.00 34.68 ? 303 PHE C CG  1 
ATOM   2730 C CD1 . PHE C  2 157 ? -44.203 -76.933  -45.860 1.00 35.37 ? 303 PHE C CD1 1 
ATOM   2731 C CD2 . PHE C  2 157 ? -41.922 -76.730  -46.539 1.00 33.79 ? 303 PHE C CD2 1 
ATOM   2732 C CE1 . PHE C  2 157 ? -44.423 -75.604  -46.179 1.00 34.37 ? 303 PHE C CE1 1 
ATOM   2733 C CE2 . PHE C  2 157 ? -42.138 -75.398  -46.853 1.00 34.14 ? 303 PHE C CE2 1 
ATOM   2734 C CZ  . PHE C  2 157 ? -43.391 -74.837  -46.679 1.00 33.76 ? 303 PHE C CZ  1 
ATOM   2735 N N   . ASP C  2 158 ? -43.390 -81.272  -43.952 1.00 34.98 ? 304 ASP C N   1 
ATOM   2736 C CA  . ASP C  2 158 ? -43.505 -82.712  -43.678 1.00 35.76 ? 304 ASP C CA  1 
ATOM   2737 C C   . ASP C  2 158 ? -42.598 -83.541  -44.602 1.00 35.74 ? 304 ASP C C   1 
ATOM   2738 O O   . ASP C  2 158 ? -42.109 -84.599  -44.221 1.00 32.98 ? 304 ASP C O   1 
ATOM   2739 C CB  . ASP C  2 158 ? -44.955 -83.169  -43.862 1.00 39.16 ? 304 ASP C CB  1 
ATOM   2740 C CG  . ASP C  2 158 ? -45.905 -82.586  -42.816 1.00 39.65 ? 304 ASP C CG  1 
ATOM   2741 O OD1 . ASP C  2 158 ? -45.595 -82.656  -41.623 1.00 41.16 ? 304 ASP C OD1 1 
ATOM   2742 O OD2 . ASP C  2 158 ? -46.965 -82.066  -43.200 1.00 42.73 ? 304 ASP C OD2 1 
ATOM   2743 N N   . MET C  2 159 ? -42.376 -83.039  -45.815 1.00 35.15 ? 305 MET C N   1 
ATOM   2744 C CA  . MET C  2 159 ? -41.590 -83.727  -46.830 1.00 36.61 ? 305 MET C CA  1 
ATOM   2745 C C   . MET C  2 159 ? -40.109 -83.293  -46.844 1.00 34.36 ? 305 MET C C   1 
ATOM   2746 O O   . MET C  2 159 ? -39.463 -83.361  -47.891 1.00 36.15 ? 305 MET C O   1 
ATOM   2747 C CB  . MET C  2 159 ? -42.243 -83.439  -48.195 1.00 40.51 ? 305 MET C CB  1 
ATOM   2748 C CG  . MET C  2 159 ? -41.846 -84.345  -49.351 1.00 42.70 ? 305 MET C CG  1 
ATOM   2749 S SD  . MET C  2 159 ? -42.134 -86.097  -49.054 1.00 46.44 ? 305 MET C SD  1 
ATOM   2750 C CE  . MET C  2 159 ? -43.916 -86.118  -48.956 1.00 44.27 ? 305 MET C CE  1 
ATOM   2751 N N   . THR C  2 160 ? -39.565 -82.866  -45.702 1.00 30.16 ? 306 THR C N   1 
ATOM   2752 C CA  . THR C  2 160 ? -38.194 -82.330  -45.634 1.00 28.15 ? 306 THR C CA  1 
ATOM   2753 C C   . THR C  2 160 ? -37.194 -83.346  -46.150 1.00 26.21 ? 306 THR C C   1 
ATOM   2754 O O   . THR C  2 160 ? -37.094 -84.435  -45.609 1.00 26.44 ? 306 THR C O   1 
ATOM   2755 C CB  . THR C  2 160 ? -37.802 -81.944  -44.186 1.00 28.76 ? 306 THR C CB  1 
ATOM   2756 O OG1 . THR C  2 160 ? -38.554 -80.788  -43.785 1.00 29.42 ? 306 THR C OG1 1 
ATOM   2757 C CG2 . THR C  2 160 ? -36.313 -81.635  -44.079 1.00 28.22 ? 306 THR C CG2 1 
ATOM   2758 N N   . PRO C  2 161 ? -36.467 -83.005  -47.216 1.00 23.65 ? 307 PRO C N   1 
ATOM   2759 C CA  . PRO C  2 161 ? -35.443 -83.928  -47.697 1.00 22.83 ? 307 PRO C CA  1 
ATOM   2760 C C   . PRO C  2 161 ? -34.067 -83.666  -47.087 1.00 22.42 ? 307 PRO C C   1 
ATOM   2761 O O   . PRO C  2 161 ? -33.789 -82.532  -46.696 1.00 19.29 ? 307 PRO C O   1 
ATOM   2762 C CB  . PRO C  2 161 ? -35.416 -83.637  -49.196 1.00 22.99 ? 307 PRO C CB  1 
ATOM   2763 C CG  . PRO C  2 161 ? -35.722 -82.195  -49.289 1.00 23.14 ? 307 PRO C CG  1 
ATOM   2764 C CD  . PRO C  2 161 ? -36.606 -81.845  -48.106 1.00 23.36 ? 307 PRO C CD  1 
ATOM   2765 N N   . ASN C  2 162 ? -33.223 -84.701  -47.004 1.00 21.68 ? 308 ASN C N   1 
ATOM   2766 C CA  . ASN C  2 162 ? -31.813 -84.506  -46.690 1.00 21.84 ? 308 ASN C CA  1 
ATOM   2767 C C   . ASN C  2 162 ? -30.899 -85.558  -47.292 1.00 21.87 ? 308 ASN C C   1 
ATOM   2768 O O   . ASN C  2 162 ? -31.345 -86.659  -47.699 1.00 21.54 ? 308 ASN C O   1 
ATOM   2769 C CB  . ASN C  2 162 ? -31.575 -84.454  -45.171 1.00 22.56 ? 308 ASN C CB  1 
ATOM   2770 C CG  . ASN C  2 162 ? -30.315 -83.670  -44.799 1.00 23.11 ? 308 ASN C CG  1 
ATOM   2771 O OD1 . ASN C  2 162 ? -29.978 -82.669  -45.443 1.00 22.22 ? 308 ASN C OD1 1 
ATOM   2772 N ND2 . ASN C  2 162 ? -29.612 -84.122  -43.755 1.00 24.59 ? 308 ASN C ND2 1 
ATOM   2773 N N   . TYR C  2 163 ? -29.618 -85.195  -47.342 1.00 21.34 ? 309 TYR C N   1 
ATOM   2774 C CA  . TYR C  2 163 ? -28.535 -86.144  -47.539 1.00 21.73 ? 309 TYR C CA  1 
ATOM   2775 C C   . TYR C  2 163 ? -28.685 -87.258  -46.508 1.00 23.90 ? 309 TYR C C   1 
ATOM   2776 O O   . TYR C  2 163 ? -28.871 -87.002  -45.306 1.00 23.42 ? 309 TYR C O   1 
ATOM   2777 C CB  . TYR C  2 163 ? -27.168 -85.462  -47.404 1.00 21.08 ? 309 TYR C CB  1 
ATOM   2778 C CG  . TYR C  2 163 ? -26.990 -84.326  -48.375 1.00 21.61 ? 309 TYR C CG  1 
ATOM   2779 C CD1 . TYR C  2 163 ? -26.538 -84.555  -49.668 1.00 21.26 ? 309 TYR C CD1 1 
ATOM   2780 C CD2 . TYR C  2 163 ? -27.284 -83.010  -48.011 1.00 21.52 ? 309 TYR C CD2 1 
ATOM   2781 C CE1 . TYR C  2 163 ? -26.386 -83.510  -50.571 1.00 21.29 ? 309 TYR C CE1 1 
ATOM   2782 C CE2 . TYR C  2 163 ? -27.154 -81.978  -48.913 1.00 20.58 ? 309 TYR C CE2 1 
ATOM   2783 C CZ  . TYR C  2 163 ? -26.700 -82.227  -50.185 1.00 20.61 ? 309 TYR C CZ  1 
ATOM   2784 O OH  . TYR C  2 163 ? -26.556 -81.184  -51.080 1.00 20.25 ? 309 TYR C OH  1 
ATOM   2785 N N   . VAL C  2 164 ? -28.634 -88.498  -46.985 1.00 24.28 ? 310 VAL C N   1 
ATOM   2786 C CA  . VAL C  2 164 ? -28.923 -89.636  -46.119 1.00 25.51 ? 310 VAL C CA  1 
ATOM   2787 C C   . VAL C  2 164 ? -27.691 -90.042  -45.331 1.00 24.95 ? 310 VAL C C   1 
ATOM   2788 O O   . VAL C  2 164 ? -27.832 -90.666  -44.317 1.00 27.50 ? 310 VAL C O   1 
ATOM   2789 C CB  . VAL C  2 164 ? -29.494 -90.874  -46.882 1.00 24.68 ? 310 VAL C CB  1 
ATOM   2790 C CG1 . VAL C  2 164 ? -30.779 -90.520  -47.627 1.00 24.62 ? 310 VAL C CG1 1 
ATOM   2791 C CG2 . VAL C  2 164 ? -28.468 -91.479  -47.826 1.00 25.06 ? 310 VAL C CG2 1 
ATOM   2792 N N   . ASP C  2 165 ? -26.497 -89.695  -45.804 1.00 26.19 ? 311 ASP C N   1 
ATOM   2793 C CA  . ASP C  2 165 ? -25.261 -90.046  -45.111 1.00 27.12 ? 311 ASP C CA  1 
ATOM   2794 C C   . ASP C  2 165 ? -24.150 -89.039  -45.449 1.00 28.62 ? 311 ASP C C   1 
ATOM   2795 O O   . ASP C  2 165 ? -24.433 -87.975  -46.026 1.00 28.01 ? 311 ASP C O   1 
ATOM   2796 C CB  . ASP C  2 165 ? -24.876 -91.484  -45.460 1.00 27.42 ? 311 ASP C CB  1 
ATOM   2797 C CG  . ASP C  2 165 ? -24.561 -91.674  -46.943 1.00 27.30 ? 311 ASP C CG  1 
ATOM   2798 O OD1 . ASP C  2 165 ? -24.189 -90.712  -47.647 1.00 26.42 ? 311 ASP C OD1 1 
ATOM   2799 O OD2 . ASP C  2 165 ? -24.672 -92.815  -47.407 1.00 28.43 ? 311 ASP C OD2 1 
ATOM   2800 N N   . SER C  2 166 ? -22.905 -89.356  -45.092 1.00 28.52 ? 312 SER C N   1 
ATOM   2801 C CA  . SER C  2 166 ? -21.781 -88.455  -45.347 1.00 31.07 ? 312 SER C CA  1 
ATOM   2802 C C   . SER C  2 166 ? -20.901 -88.891  -46.511 1.00 31.73 ? 312 SER C C   1 
ATOM   2803 O O   . SER C  2 166 ? -19.706 -88.605  -46.543 1.00 31.26 ? 312 SER C O   1 
ATOM   2804 C CB  . SER C  2 166 ? -20.938 -88.269  -44.082 1.00 33.35 ? 312 SER C CB  1 
ATOM   2805 O OG  . SER C  2 166 ? -20.440 -89.502  -43.618 1.00 35.08 ? 312 SER C OG  1 
ATOM   2806 N N   . SER C  2 167 ? -21.499 -89.552  -47.490 1.00 32.47 ? 313 SER C N   1 
ATOM   2807 C CA  . SER C  2 167 ? -20.794 -89.875  -48.710 1.00 34.79 ? 313 SER C CA  1 
ATOM   2808 C C   . SER C  2 167 ? -20.421 -88.569  -49.413 1.00 33.66 ? 313 SER C C   1 
ATOM   2809 O O   . SER C  2 167 ? -21.279 -87.730  -49.631 1.00 34.23 ? 313 SER C O   1 
ATOM   2810 C CB  . SER C  2 167 ? -21.668 -90.760  -49.610 1.00 37.11 ? 313 SER C CB  1 
ATOM   2811 O OG  . SER C  2 167 ? -21.035 -90.955  -50.868 1.00 44.25 ? 313 SER C OG  1 
ATOM   2812 N N   . PRO C  2 168 ? -19.137 -88.381  -49.748 1.00 35.01 ? 314 PRO C N   1 
ATOM   2813 C CA  . PRO C  2 168 ? -18.735 -87.101  -50.340 1.00 36.12 ? 314 PRO C CA  1 
ATOM   2814 C C   . PRO C  2 168 ? -19.248 -86.835  -51.748 1.00 36.09 ? 314 PRO C C   1 
ATOM   2815 O O   . PRO C  2 168 ? -19.783 -85.752  -52.007 1.00 36.95 ? 314 PRO C O   1 
ATOM   2816 C CB  . PRO C  2 168 ? -17.201 -87.131  -50.317 1.00 37.67 ? 314 PRO C CB  1 
ATOM   2817 C CG  . PRO C  2 168 ? -16.796 -88.450  -49.773 1.00 37.20 ? 314 PRO C CG  1 
ATOM   2818 C CD  . PRO C  2 168 ? -17.997 -89.203  -49.309 1.00 36.03 ? 314 PRO C CD  1 
ATOM   2819 N N   . THR C  2 169 ? -19.075 -87.789  -52.653 1.00 34.07 ? 315 THR C N   1 
ATOM   2820 C CA  . THR C  2 169 ? -19.526 -87.605  -54.045 1.00 35.02 ? 315 THR C CA  1 
ATOM   2821 C C   . THR C  2 169 ? -20.720 -88.479  -54.410 1.00 33.25 ? 315 THR C C   1 
ATOM   2822 O O   . THR C  2 169 ? -21.494 -88.127  -55.280 1.00 33.11 ? 315 THR C O   1 
ATOM   2823 C CB  . THR C  2 169 ? -18.398 -87.881  -55.044 1.00 35.11 ? 315 THR C CB  1 
ATOM   2824 O OG1 . THR C  2 169 ? -17.958 -89.234  -54.886 1.00 39.58 ? 315 THR C OG1 1 
ATOM   2825 C CG2 . THR C  2 169 ? -17.227 -86.925  -54.799 1.00 35.57 ? 315 THR C CG2 1 
ATOM   2826 N N   . GLY C  2 170 ? -20.859 -89.625  -53.756 1.00 32.14 ? 316 GLY C N   1 
ATOM   2827 C CA  . GLY C  2 170 ? -22.037 -90.449  -53.925 1.00 30.80 ? 316 GLY C CA  1 
ATOM   2828 C C   . GLY C  2 170 ? -23.234 -89.902  -53.176 1.00 30.44 ? 316 GLY C C   1 
ATOM   2829 O O   . GLY C  2 170 ? -23.695 -90.502  -52.223 1.00 30.97 ? 316 GLY C O   1 
ATOM   2830 N N   . ILE C  2 171 ? -23.747 -88.765  -53.629 1.00 30.08 ? 317 ILE C N   1 
ATOM   2831 C CA  . ILE C  2 171 ? -24.827 -88.066  -52.948 1.00 27.69 ? 317 ILE C CA  1 
ATOM   2832 C C   . ILE C  2 171 ? -26.128 -88.830  -53.135 1.00 27.90 ? 317 ILE C C   1 
ATOM   2833 O O   . ILE C  2 171 ? -26.496 -89.178  -54.264 1.00 29.85 ? 317 ILE C O   1 
ATOM   2834 C CB  . ILE C  2 171 ? -24.990 -86.629  -53.498 1.00 29.20 ? 317 ILE C CB  1 
ATOM   2835 C CG1 . ILE C  2 171 ? -23.917 -85.722  -52.872 1.00 29.93 ? 317 ILE C CG1 1 
ATOM   2836 C CG2 . ILE C  2 171 ? -26.401 -86.085  -53.229 1.00 29.49 ? 317 ILE C CG2 1 
ATOM   2837 C CD1 . ILE C  2 171 ? -23.649 -84.423  -53.602 1.00 29.65 ? 317 ILE C CD1 1 
ATOM   2838 N N   . VAL C  2 172 ? -26.805 -89.108  -52.025 1.00 25.01 ? 318 VAL C N   1 
ATOM   2839 C CA  . VAL C  2 172 ? -28.157 -89.622  -52.060 1.00 23.60 ? 318 VAL C CA  1 
ATOM   2840 C C   . VAL C  2 172 ? -28.992 -88.770  -51.135 1.00 21.89 ? 318 VAL C C   1 
ATOM   2841 O O   . VAL C  2 172 ? -28.654 -88.619  -49.962 1.00 20.23 ? 318 VAL C O   1 
ATOM   2842 C CB  . VAL C  2 172 ? -28.235 -91.084  -51.594 1.00 24.32 ? 318 VAL C CB  1 
ATOM   2843 C CG1 . VAL C  2 172 ? -29.688 -91.577  -51.654 1.00 24.67 ? 318 VAL C CG1 1 
ATOM   2844 C CG2 . VAL C  2 172 ? -27.341 -91.972  -52.445 1.00 23.97 ? 318 VAL C CG2 1 
ATOM   2845 N N   . VAL C  2 173 ? -30.070 -88.201  -51.676 1.00 21.77 ? 319 VAL C N   1 
ATOM   2846 C CA  . VAL C  2 173 ? -31.033 -87.443  -50.864 1.00 22.34 ? 319 VAL C CA  1 
ATOM   2847 C C   . VAL C  2 173 ? -32.372 -88.138  -50.856 1.00 22.46 ? 319 VAL C C   1 
ATOM   2848 O O   . VAL C  2 173 ? -32.706 -88.865  -51.796 1.00 25.22 ? 319 VAL C O   1 
ATOM   2849 C CB  . VAL C  2 173 ? -31.183 -85.972  -51.313 1.00 21.23 ? 319 VAL C CB  1 
ATOM   2850 C CG1 . VAL C  2 173 ? -29.866 -85.263  -51.135 1.00 21.33 ? 319 VAL C CG1 1 
ATOM   2851 C CG2 . VAL C  2 173 ? -31.635 -85.855  -52.768 1.00 20.05 ? 319 VAL C CG2 1 
ATOM   2852 N N   . SER C  2 174 ? -33.119 -87.915  -49.783 1.00 22.41 ? 320 SER C N   1 
ATOM   2853 C CA  . SER C  2 174 ? -34.400 -88.550  -49.560 1.00 23.14 ? 320 SER C CA  1 
ATOM   2854 C C   . SER C  2 174 ? -35.207 -87.872  -48.456 1.00 25.31 ? 320 SER C C   1 
ATOM   2855 O O   . SER C  2 174 ? -34.644 -87.312  -47.529 1.00 24.71 ? 320 SER C O   1 
ATOM   2856 C CB  . SER C  2 174 ? -34.186 -90.012  -49.156 1.00 24.15 ? 320 SER C CB  1 
ATOM   2857 O OG  . SER C  2 174 ? -35.430 -90.608  -48.854 1.00 23.94 ? 320 SER C OG  1 
ATOM   2858 N N   . PRO C  2 175 ? -36.546 -87.938  -48.543 1.00 27.38 ? 321 PRO C N   1 
ATOM   2859 C CA  . PRO C  2 175 ? -37.325 -87.567  -47.381 1.00 28.14 ? 321 PRO C CA  1 
ATOM   2860 C C   . PRO C  2 175 ? -37.190 -88.664  -46.344 1.00 29.00 ? 321 PRO C C   1 
ATOM   2861 O O   . PRO C  2 175 ? -36.642 -89.715  -46.661 1.00 29.46 ? 321 PRO C O   1 
ATOM   2862 C CB  . PRO C  2 175 ? -38.763 -87.477  -47.913 1.00 28.42 ? 321 PRO C CB  1 
ATOM   2863 C CG  . PRO C  2 175 ? -38.754 -88.006  -49.300 1.00 28.31 ? 321 PRO C CG  1 
ATOM   2864 C CD  . PRO C  2 175 ? -37.371 -88.391  -49.677 1.00 27.52 ? 321 PRO C CD  1 
ATOM   2865 N N   . TRP C  2 176 ? -37.651 -88.423  -45.115 1.00 30.77 ? 322 TRP C N   1 
ATOM   2866 C CA  . TRP C  2 176 ? -37.614 -89.463  -44.074 1.00 30.93 ? 322 TRP C CA  1 
ATOM   2867 C C   . TRP C  2 176 ? -38.862 -90.352  -44.225 1.00 32.42 ? 322 TRP C C   1 
ATOM   2868 O O   . TRP C  2 176 ? -39.926 -90.085  -43.658 1.00 30.92 ? 322 TRP C O   1 
ATOM   2869 C CB  . TRP C  2 176 ? -37.498 -88.832  -42.682 1.00 32.80 ? 322 TRP C CB  1 
ATOM   2870 C CG  . TRP C  2 176 ? -37.247 -89.803  -41.547 1.00 33.10 ? 322 TRP C CG  1 
ATOM   2871 C CD1 . TRP C  2 176 ? -38.172 -90.257  -40.646 1.00 33.27 ? 322 TRP C CD1 1 
ATOM   2872 C CD2 . TRP C  2 176 ? -36.004 -90.420  -41.191 1.00 33.68 ? 322 TRP C CD2 1 
ATOM   2873 N NE1 . TRP C  2 176 ? -37.583 -91.108  -39.750 1.00 34.00 ? 322 TRP C NE1 1 
ATOM   2874 C CE2 . TRP C  2 176 ? -36.253 -91.229  -40.057 1.00 34.92 ? 322 TRP C CE2 1 
ATOM   2875 C CE3 . TRP C  2 176 ? -34.705 -90.368  -41.713 1.00 35.86 ? 322 TRP C CE3 1 
ATOM   2876 C CZ2 . TRP C  2 176 ? -35.251 -91.994  -39.440 1.00 35.67 ? 322 TRP C CZ2 1 
ATOM   2877 C CZ3 . TRP C  2 176 ? -33.702 -91.120  -41.093 1.00 36.47 ? 322 TRP C CZ3 1 
ATOM   2878 C CH2 . TRP C  2 176 ? -33.988 -91.929  -39.966 1.00 36.87 ? 322 TRP C CH2 1 
ATOM   2879 N N   . CYS C  2 177 ? -38.725 -91.378  -45.056 1.00 33.09 ? 323 CYS C N   1 
ATOM   2880 C CA  . CYS C  2 177 ? -39.774 -92.361  -45.263 1.00 35.60 ? 323 CYS C CA  1 
ATOM   2881 C C   . CYS C  2 177 ? -39.202 -93.576  -45.976 1.00 37.69 ? 323 CYS C C   1 
ATOM   2882 O O   . CYS C  2 177 ? -38.087 -93.527  -46.496 1.00 35.31 ? 323 CYS C O   1 
ATOM   2883 C CB  . CYS C  2 177 ? -40.935 -91.783  -46.073 1.00 37.36 ? 323 CYS C CB  1 
ATOM   2884 S SG  . CYS C  2 177 ? -40.514 -91.264  -47.754 1.00 39.08 ? 323 CYS C SG  1 
ATOM   2885 N N   . SER C  2 178 ? -39.944 -94.683  -45.958 1.00 41.09 ? 324 SER C N   1 
ATOM   2886 C CA  . SER C  2 178 ? -39.581 -95.856  -46.766 1.00 43.63 ? 324 SER C CA  1 
ATOM   2887 C C   . SER C  2 178 ? -40.810 -96.408  -47.466 1.00 43.12 ? 324 SER C C   1 
ATOM   2888 O O   . SER C  2 178 ? -41.942 -95.960  -47.220 1.00 40.72 ? 324 SER C O   1 
ATOM   2889 C CB  . SER C  2 178 ? -38.878 -96.946  -45.935 1.00 45.36 ? 324 SER C CB  1 
ATOM   2890 O OG  . SER C  2 178 ? -39.790 -97.735  -45.202 1.00 46.14 ? 324 SER C OG  1 
ATOM   2891 N N   . CYS C  2 179 ? -40.566 -97.362  -48.355 1.00 44.90 ? 325 CYS C N   1 
ATOM   2892 C CA  . CYS C  2 179 ? -41.634 -97.995  -49.115 1.00 50.11 ? 325 CYS C CA  1 
ATOM   2893 C C   . CYS C  2 179 ? -42.029 -99.393  -48.584 1.00 55.01 ? 325 CYS C C   1 
ATOM   2894 O O   . CYS C  2 179 ? -42.806 -100.118 -49.227 1.00 56.27 ? 325 CYS C O   1 
ATOM   2895 C CB  . CYS C  2 179 ? -41.269 -98.014  -50.607 1.00 48.31 ? 325 CYS C CB  1 
ATOM   2896 S SG  . CYS C  2 179 ? -41.578 -96.422  -51.408 1.00 45.56 ? 325 CYS C SG  1 
ATOM   2897 N N   . ARG C  2 180 ? -41.527 -99.744  -47.400 1.00 57.22 ? 326 ARG C N   1 
ATOM   2898 C CA  . ARG C  2 180 ? -42.005 -100.920 -46.677 1.00 61.38 ? 326 ARG C CA  1 
ATOM   2899 C C   . ARG C  2 180 ? -43.421 -100.655 -46.163 1.00 61.46 ? 326 ARG C C   1 
ATOM   2900 O O   . ARG C  2 180 ? -43.747 -99.531  -45.785 1.00 61.04 ? 326 ARG C O   1 
ATOM   2901 C CB  . ARG C  2 180 ? -41.070 -101.261 -45.513 1.00 63.63 ? 326 ARG C CB  1 
ATOM   2902 C CG  . ARG C  2 180 ? -39.641 -101.555 -45.941 1.00 66.83 ? 326 ARG C CG  1 
ATOM   2903 C CD  . ARG C  2 180 ? -38.638 -101.080 -44.904 1.00 72.51 ? 326 ARG C CD  1 
ATOM   2904 N NE  . ARG C  2 180 ? -38.571 -101.979 -43.751 1.00 78.37 ? 326 ARG C NE  1 
ATOM   2905 C CZ  . ARG C  2 180 ? -38.127 -101.645 -42.538 1.00 81.64 ? 326 ARG C CZ  1 
ATOM   2906 N NH1 . ARG C  2 180 ? -37.703 -100.408 -42.271 1.00 84.88 ? 326 ARG C NH1 1 
ATOM   2907 N NH2 . ARG C  2 180 ? -38.114 -102.559 -41.575 1.00 79.65 ? 326 ARG C NH2 1 
ATOM   2908 N N   . GLY C  2 181 ? -44.256 -101.694 -46.163 1.00 63.50 ? 327 GLY C N   1 
ATOM   2909 C CA  . GLY C  2 181 ? -45.657 -101.576 -45.743 1.00 62.61 ? 327 GLY C CA  1 
ATOM   2910 C C   . GLY C  2 181 ? -46.535 -100.880 -46.771 1.00 64.71 ? 327 GLY C C   1 
ATOM   2911 O O   . GLY C  2 181 ? -47.551 -100.263 -46.423 1.00 62.69 ? 327 GLY C O   1 
ATOM   2912 N N   . SER C  2 182 ? -46.142 -100.975 -48.041 1.00 66.45 ? 328 SER C N   1 
ATOM   2913 C CA  . SER C  2 182 ? -46.917 -100.393 -49.143 1.00 71.49 ? 328 SER C CA  1 
ATOM   2914 C C   . SER C  2 182 ? -48.073 -101.301 -49.608 1.00 74.20 ? 328 SER C C   1 
ATOM   2915 O O   . SER C  2 182 ? -49.006 -100.833 -50.273 1.00 73.13 ? 328 SER C O   1 
ATOM   2916 C CB  . SER C  2 182 ? -45.999 -100.065 -50.331 1.00 70.87 ? 328 SER C CB  1 
ATOM   2917 O OG  . SER C  2 182 ? -45.152 -98.967  -50.039 1.00 66.46 ? 328 SER C OG  1 
ATOM   2918 N N   . GLY C  2 183 ? -48.009 -102.589 -49.260 1.00 74.68 ? 329 GLY C N   1 
ATOM   2919 C CA  . GLY C  2 183 ? -49.008 -103.558 -49.700 1.00 74.85 ? 329 GLY C CA  1 
ATOM   2920 C C   . GLY C  2 183 ? -48.995 -103.712 -51.212 1.00 76.88 ? 329 GLY C C   1 
ATOM   2921 O O   . GLY C  2 183 ? -47.981 -104.095 -51.799 1.00 77.49 ? 329 GLY C O   1 
ATOM   2922 N N   . ASN C  2 184 ? -50.124 -103.390 -51.839 1.00 77.48 ? 330 ASN C N   1 
ATOM   2923 C CA  . ASN C  2 184 ? -50.269 -103.474 -53.296 1.00 77.40 ? 330 ASN C CA  1 
ATOM   2924 C C   . ASN C  2 184 ? -49.787 -102.217 -54.026 1.00 77.50 ? 330 ASN C C   1 
ATOM   2925 O O   . ASN C  2 184 ? -49.799 -102.178 -55.255 1.00 79.46 ? 330 ASN C O   1 
ATOM   2926 C CB  . ASN C  2 184 ? -51.735 -103.725 -53.662 1.00 76.31 ? 330 ASN C CB  1 
ATOM   2927 C CG  . ASN C  2 184 ? -52.648 -102.587 -53.220 1.00 76.99 ? 330 ASN C CG  1 
ATOM   2928 O OD1 . ASN C  2 184 ? -52.647 -102.200 -52.052 1.00 75.68 ? 330 ASN C OD1 1 
ATOM   2929 N ND2 . ASN C  2 184 ? -53.424 -102.044 -54.149 1.00 78.95 ? 330 ASN C ND2 1 
ATOM   2930 N N   . MET C  2 185 ? -49.375 -101.193 -53.274 1.00 75.02 ? 331 MET C N   1 
ATOM   2931 C CA  . MET C  2 185 ? -49.007 -99.892  -53.840 1.00 70.38 ? 331 MET C CA  1 
ATOM   2932 C C   . MET C  2 185 ? -47.494 -99.697  -53.855 1.00 67.15 ? 331 MET C C   1 
ATOM   2933 O O   . MET C  2 185 ? -47.010 -98.567  -53.899 1.00 64.65 ? 331 MET C O   1 
ATOM   2934 C CB  . MET C  2 185 ? -49.651 -98.777  -53.010 1.00 71.48 ? 331 MET C CB  1 
ATOM   2935 C CG  . MET C  2 185 ? -51.170 -98.820  -52.974 1.00 72.47 ? 331 MET C CG  1 
ATOM   2936 S SD  . MET C  2 185 ? -51.903 -98.147  -54.473 1.00 76.61 ? 331 MET C SD  1 
ATOM   2937 C CE  . MET C  2 185 ? -51.685 -96.383  -54.223 1.00 74.41 ? 331 MET C CE  1 
ATOM   2938 N N   . GLU C  2 186 ? -46.753 -100.801 -53.821 1.00 64.64 ? 332 GLU C N   1 
ATOM   2939 C CA  . GLU C  2 186 ? -45.299 -100.767 -53.715 1.00 64.59 ? 332 GLU C CA  1 
ATOM   2940 C C   . GLU C  2 186 ? -44.617 -100.101 -54.912 1.00 62.46 ? 332 GLU C C   1 
ATOM   2941 O O   . GLU C  2 186 ? -43.624 -99.397  -54.747 1.00 62.40 ? 332 GLU C O   1 
ATOM   2942 C CB  . GLU C  2 186 ? -44.756 -102.188 -53.531 1.00 66.89 ? 332 GLU C CB  1 
ATOM   2943 C CG  . GLU C  2 186 ? -43.244 -102.295 -53.638 1.00 70.00 ? 332 GLU C CG  1 
ATOM   2944 C CD  . GLU C  2 186 ? -42.678 -103.392 -52.771 1.00 73.65 ? 332 GLU C CD  1 
ATOM   2945 O OE1 . GLU C  2 186 ? -42.349 -104.473 -53.302 1.00 76.91 ? 332 GLU C OE1 1 
ATOM   2946 O OE2 . GLU C  2 186 ? -42.572 -103.169 -51.550 1.00 79.23 ? 332 GLU C OE2 1 
ATOM   2947 N N   . GLU C  2 187 ? -45.136 -100.332 -56.111 1.00 60.42 ? 333 GLU C N   1 
ATOM   2948 C CA  . GLU C  2 187 ? -44.540 -99.747  -57.307 1.00 61.85 ? 333 GLU C CA  1 
ATOM   2949 C C   . GLU C  2 187 ? -44.755 -98.242  -57.291 1.00 58.50 ? 333 GLU C C   1 
ATOM   2950 O O   . GLU C  2 187 ? -43.835 -97.475  -57.548 1.00 54.78 ? 333 GLU C O   1 
ATOM   2951 C CB  . GLU C  2 187 ? -45.130 -100.358 -58.586 1.00 65.98 ? 333 GLU C CB  1 
ATOM   2952 C CG  . GLU C  2 187 ? -44.137 -100.472 -59.742 1.00 70.41 ? 333 GLU C CG  1 
ATOM   2953 C CD  . GLU C  2 187 ? -43.657 -99.122  -60.283 1.00 76.14 ? 333 GLU C CD  1 
ATOM   2954 O OE1 . GLU C  2 187 ? -42.473 -98.769  -60.049 1.00 77.88 ? 333 GLU C OE1 1 
ATOM   2955 O OE2 . GLU C  2 187 ? -44.458 -98.405  -60.937 1.00 73.68 ? 333 GLU C OE2 1 
ATOM   2956 N N   . GLU C  2 188 ? -45.980 -97.835  -56.988 1.00 55.40 ? 334 GLU C N   1 
ATOM   2957 C CA  . GLU C  2 188 ? -46.337 -96.425  -56.900 1.00 56.43 ? 334 GLU C CA  1 
ATOM   2958 C C   . GLU C  2 188 ? -45.452 -95.682  -55.889 1.00 53.30 ? 334 GLU C C   1 
ATOM   2959 O O   . GLU C  2 188 ? -45.016 -94.559  -56.155 1.00 48.33 ? 334 GLU C O   1 
ATOM   2960 C CB  . GLU C  2 188 ? -47.820 -96.302  -56.523 1.00 61.45 ? 334 GLU C CB  1 
ATOM   2961 C CG  . GLU C  2 188 ? -48.321 -94.913  -56.155 1.00 68.99 ? 334 GLU C CG  1 
ATOM   2962 C CD  . GLU C  2 188 ? -48.677 -94.080  -57.367 1.00 72.76 ? 334 GLU C CD  1 
ATOM   2963 O OE1 . GLU C  2 188 ? -49.713 -93.378  -57.315 1.00 75.99 ? 334 GLU C OE1 1 
ATOM   2964 O OE2 . GLU C  2 188 ? -47.929 -94.138  -58.369 1.00 78.58 ? 334 GLU C OE2 1 
ATOM   2965 N N   . CYS C  2 189 ? -45.200 -96.315  -54.741 1.00 50.50 ? 335 CYS C N   1 
ATOM   2966 C CA  . CYS C  2 189 ? -44.409 -95.724  -53.660 1.00 47.66 ? 335 CYS C CA  1 
ATOM   2967 C C   . CYS C  2 189 ? -42.976 -95.525  -54.110 1.00 47.34 ? 335 CYS C C   1 
ATOM   2968 O O   . CYS C  2 189 ? -42.429 -94.437  -53.988 1.00 47.96 ? 335 CYS C O   1 
ATOM   2969 C CB  . CYS C  2 189 ? -44.448 -96.619  -52.420 1.00 47.49 ? 335 CYS C CB  1 
ATOM   2970 S SG  . CYS C  2 189 ? -43.533 -96.010  -50.974 1.00 48.78 ? 335 CYS C SG  1 
ATOM   2971 N N   . GLU C  2 190 ? -42.372 -96.580  -54.636 1.00 48.45 ? 336 GLU C N   1 
ATOM   2972 C CA  . GLU C  2 190 ? -40.990 -96.523  -55.104 1.00 50.47 ? 336 GLU C CA  1 
ATOM   2973 C C   . GLU C  2 190 ? -40.780 -95.541  -56.261 1.00 48.17 ? 336 GLU C C   1 
ATOM   2974 O O   . GLU C  2 190 ? -39.730 -94.918  -56.349 1.00 48.12 ? 336 GLU C O   1 
ATOM   2975 C CB  . GLU C  2 190 ? -40.488 -97.917  -55.480 1.00 53.72 ? 336 GLU C CB  1 
ATOM   2976 C CG  . GLU C  2 190 ? -40.250 -98.792  -54.255 1.00 59.36 ? 336 GLU C CG  1 
ATOM   2977 C CD  . GLU C  2 190 ? -39.948 -100.244 -54.590 1.00 64.63 ? 336 GLU C CD  1 
ATOM   2978 O OE1 . GLU C  2 190 ? -40.290 -101.118 -53.763 1.00 70.36 ? 336 GLU C OE1 1 
ATOM   2979 O OE2 . GLU C  2 190 ? -39.371 -100.517 -55.667 1.00 66.13 ? 336 GLU C OE2 1 
ATOM   2980 N N   . LYS C  2 191 ? -41.767 -95.392  -57.135 1.00 45.27 ? 337 LYS C N   1 
ATOM   2981 C CA  . LYS C  2 191 ? -41.671 -94.406  -58.210 1.00 45.32 ? 337 LYS C CA  1 
ATOM   2982 C C   . LYS C  2 191 ? -41.662 -92.998  -57.637 1.00 42.11 ? 337 LYS C C   1 
ATOM   2983 O O   . LYS C  2 191 ? -40.919 -92.137  -58.115 1.00 40.20 ? 337 LYS C O   1 
ATOM   2984 C CB  . LYS C  2 191 ? -42.830 -94.529  -59.193 1.00 47.94 ? 337 LYS C CB  1 
ATOM   2985 C CG  . LYS C  2 191 ? -42.733 -93.583  -60.395 1.00 51.40 ? 337 LYS C CG  1 
ATOM   2986 C CD  . LYS C  2 191 ? -44.095 -93.111  -60.895 1.00 53.75 ? 337 LYS C CD  1 
ATOM   2987 C CE  . LYS C  2 191 ? -44.741 -92.134  -59.908 1.00 56.19 ? 337 LYS C CE  1 
ATOM   2988 N NZ  . LYS C  2 191 ? -45.811 -91.298  -60.519 1.00 57.88 ? 337 LYS C NZ  1 
ATOM   2989 N N   . PHE C  2 192 ? -42.507 -92.767  -56.634 1.00 37.80 ? 338 PHE C N   1 
ATOM   2990 C CA  . PHE C  2 192 ? -42.567 -91.477  -55.955 1.00 36.01 ? 338 PHE C CA  1 
ATOM   2991 C C   . PHE C  2 192 ? -41.227 -91.186  -55.288 1.00 34.08 ? 338 PHE C C   1 
ATOM   2992 O O   . PHE C  2 192 ? -40.678 -90.101  -55.440 1.00 33.57 ? 338 PHE C O   1 
ATOM   2993 C CB  . PHE C  2 192 ? -43.685 -91.448  -54.907 1.00 35.23 ? 338 PHE C CB  1 
ATOM   2994 C CG  . PHE C  2 192 ? -43.591 -90.284  -53.963 1.00 33.30 ? 338 PHE C CG  1 
ATOM   2995 C CD1 . PHE C  2 192 ? -44.079 -89.049  -54.328 1.00 32.32 ? 338 PHE C CD1 1 
ATOM   2996 C CD2 . PHE C  2 192 ? -42.992 -90.427  -52.714 1.00 34.06 ? 338 PHE C CD2 1 
ATOM   2997 C CE1 . PHE C  2 192 ? -43.982 -87.963  -53.473 1.00 33.15 ? 338 PHE C CE1 1 
ATOM   2998 C CE2 . PHE C  2 192 ? -42.895 -89.347  -51.850 1.00 35.35 ? 338 PHE C CE2 1 
ATOM   2999 C CZ  . PHE C  2 192 ? -43.387 -88.109  -52.234 1.00 33.86 ? 338 PHE C CZ  1 
ATOM   3000 N N   . LEU C  2 193 ? -40.713 -92.170  -54.560 1.00 34.94 ? 339 LEU C N   1 
ATOM   3001 C CA  . LEU C  2 193 ? -39.476 -92.001  -53.808 1.00 34.41 ? 339 LEU C CA  1 
ATOM   3002 C C   . LEU C  2 193 ? -38.289 -91.762  -54.730 1.00 33.89 ? 339 LEU C C   1 
ATOM   3003 O O   . LEU C  2 193 ? -37.395 -90.985  -54.392 1.00 32.48 ? 339 LEU C O   1 
ATOM   3004 C CB  . LEU C  2 193 ? -39.219 -93.210  -52.905 1.00 33.57 ? 339 LEU C CB  1 
ATOM   3005 C CG  . LEU C  2 193 ? -37.932 -93.192  -52.076 1.00 33.19 ? 339 LEU C CG  1 
ATOM   3006 C CD1 . LEU C  2 193 ? -37.870 -91.939  -51.221 1.00 32.12 ? 339 LEU C CD1 1 
ATOM   3007 C CD2 . LEU C  2 193 ? -37.811 -94.443  -51.212 1.00 33.79 ? 339 LEU C CD2 1 
ATOM   3008 N N   . ARG C  2 194 ? -38.286 -92.408  -55.898 1.00 34.40 ? 340 ARG C N   1 
ATOM   3009 C CA  . ARG C  2 194 ? -37.156 -92.284  -56.845 1.00 34.06 ? 340 ARG C CA  1 
ATOM   3010 C C   . ARG C  2 194 ? -36.960 -90.875  -57.406 1.00 31.82 ? 340 ARG C C   1 
ATOM   3011 O O   . ARG C  2 194 ? -35.870 -90.548  -57.876 1.00 31.41 ? 340 ARG C O   1 
ATOM   3012 C CB  . ARG C  2 194 ? -37.252 -93.298  -57.999 1.00 36.22 ? 340 ARG C CB  1 
ATOM   3013 C CG  . ARG C  2 194 ? -36.784 -94.700  -57.621 1.00 38.38 ? 340 ARG C CG  1 
ATOM   3014 C CD  . ARG C  2 194 ? -36.548 -95.565  -58.849 1.00 41.22 ? 340 ARG C CD  1 
ATOM   3015 N NE  . ARG C  2 194 ? -37.770 -95.727  -59.639 1.00 42.94 ? 340 ARG C NE  1 
ATOM   3016 C CZ  . ARG C  2 194 ? -38.700 -96.660  -59.429 1.00 44.87 ? 340 ARG C CZ  1 
ATOM   3017 N NH1 . ARG C  2 194 ? -38.568 -97.551  -58.443 1.00 45.47 ? 340 ARG C NH1 1 
ATOM   3018 N NH2 . ARG C  2 194 ? -39.774 -96.700  -60.215 1.00 45.26 ? 340 ARG C NH2 1 
ATOM   3019 N N   . ASP C  2 195 ? -37.985 -90.034  -57.351 1.00 30.47 ? 341 ASP C N   1 
ATOM   3020 C CA  . ASP C  2 195 ? -37.825 -88.647  -57.789 1.00 30.02 ? 341 ASP C CA  1 
ATOM   3021 C C   . ASP C  2 195 ? -36.859 -87.882  -56.884 1.00 30.12 ? 341 ASP C C   1 
ATOM   3022 O O   . ASP C  2 195 ? -36.296 -86.842  -57.295 1.00 27.59 ? 341 ASP C O   1 
ATOM   3023 C CB  . ASP C  2 195 ? -39.172 -87.930  -57.831 1.00 30.91 ? 341 ASP C CB  1 
ATOM   3024 C CG  . ASP C  2 195 ? -40.023 -88.348  -59.012 1.00 31.46 ? 341 ASP C CG  1 
ATOM   3025 O OD1 . ASP C  2 195 ? -39.456 -88.725  -60.048 1.00 31.46 ? 341 ASP C OD1 1 
ATOM   3026 O OD2 . ASP C  2 195 ? -41.264 -88.288  -58.904 1.00 34.82 ? 341 ASP C OD2 1 
ATOM   3027 N N   . PHE C  2 196 ? -36.712 -88.375  -55.647 1.00 28.91 ? 342 PHE C N   1 
ATOM   3028 C CA  . PHE C  2 196 ? -35.700 -87.891  -54.709 1.00 28.02 ? 342 PHE C CA  1 
ATOM   3029 C C   . PHE C  2 196 ? -34.416 -88.697  -54.825 1.00 28.31 ? 342 PHE C C   1 
ATOM   3030 O O   . PHE C  2 196 ? -33.351 -88.155  -55.080 1.00 27.36 ? 342 PHE C O   1 
ATOM   3031 C CB  . PHE C  2 196 ? -36.208 -87.977  -53.270 1.00 27.79 ? 342 PHE C CB  1 
ATOM   3032 C CG  . PHE C  2 196 ? -37.347 -87.063  -52.981 1.00 28.55 ? 342 PHE C CG  1 
ATOM   3033 C CD1 . PHE C  2 196 ? -38.653 -87.460  -53.241 1.00 28.77 ? 342 PHE C CD1 1 
ATOM   3034 C CD2 . PHE C  2 196 ? -37.123 -85.802  -52.452 1.00 30.01 ? 342 PHE C CD2 1 
ATOM   3035 C CE1 . PHE C  2 196 ? -39.719 -86.618  -52.987 1.00 29.14 ? 342 PHE C CE1 1 
ATOM   3036 C CE2 . PHE C  2 196 ? -38.182 -84.957  -52.188 1.00 30.82 ? 342 PHE C CE2 1 
ATOM   3037 C CZ  . PHE C  2 196 ? -39.487 -85.366  -52.452 1.00 30.14 ? 342 PHE C CZ  1 
ATOM   3038 N N   . THR C  2 197 ? -34.537 -90.008  -54.657 1.00 28.87 ? 343 THR C N   1 
ATOM   3039 C CA  . THR C  2 197 ? -33.394 -90.874  -54.429 1.00 29.09 ? 343 THR C CA  1 
ATOM   3040 C C   . THR C  2 197 ? -32.608 -91.274  -55.661 1.00 29.86 ? 343 THR C C   1 
ATOM   3041 O O   . THR C  2 197 ? -31.421 -91.598  -55.534 1.00 31.45 ? 343 THR C O   1 
ATOM   3042 C CB  . THR C  2 197 ? -33.837 -92.187  -53.743 1.00 30.68 ? 343 THR C CB  1 
ATOM   3043 O OG1 . THR C  2 197 ? -34.874 -92.800  -54.515 1.00 31.39 ? 343 THR C OG1 1 
ATOM   3044 C CG2 . THR C  2 197 ? -34.362 -91.916  -52.333 1.00 29.79 ? 343 THR C CG2 1 
ATOM   3045 N N   . GLU C  2 198 ? -33.255 -91.306  -56.831 1.00 29.82 ? 344 GLU C N   1 
ATOM   3046 C CA  . GLU C  2 198 ? -32.631 -91.838  -58.044 1.00 30.04 ? 344 GLU C CA  1 
ATOM   3047 C C   . GLU C  2 198 ? -33.004 -90.973  -59.237 1.00 28.60 ? 344 GLU C C   1 
ATOM   3048 O O   . GLU C  2 198 ? -33.548 -91.443  -60.222 1.00 28.67 ? 344 GLU C O   1 
ATOM   3049 C CB  . GLU C  2 198 ? -33.056 -93.301  -58.277 1.00 33.44 ? 344 GLU C CB  1 
ATOM   3050 C CG  . GLU C  2 198 ? -32.696 -94.232  -57.127 1.00 36.22 ? 344 GLU C CG  1 
ATOM   3051 C CD  . GLU C  2 198 ? -33.022 -95.694  -57.383 1.00 37.51 ? 344 GLU C CD  1 
ATOM   3052 O OE1 . GLU C  2 198 ? -33.177 -96.431  -56.388 1.00 40.22 ? 344 GLU C OE1 1 
ATOM   3053 O OE2 . GLU C  2 198 ? -33.120 -96.111  -58.557 1.00 41.31 ? 344 GLU C OE2 1 
ATOM   3054 N N   . ASN C  2 199 ? -32.703 -89.690  -59.129 1.00 26.10 ? 345 ASN C N   1 
ATOM   3055 C CA  . ASN C  2 199 ? -33.122 -88.706  -60.099 1.00 23.71 ? 345 ASN C CA  1 
ATOM   3056 C C   . ASN C  2 199 ? -31.876 -88.036  -60.690 1.00 22.57 ? 345 ASN C C   1 
ATOM   3057 O O   . ASN C  2 199 ? -31.196 -87.289  -60.009 1.00 22.92 ? 345 ASN C O   1 
ATOM   3058 C CB  . ASN C  2 199 ? -34.007 -87.692  -59.395 1.00 24.07 ? 345 ASN C CB  1 
ATOM   3059 C CG  . ASN C  2 199 ? -34.497 -86.585  -60.298 1.00 24.50 ? 345 ASN C CG  1 
ATOM   3060 O OD1 . ASN C  2 199 ? -33.979 -86.365  -61.393 1.00 25.54 ? 345 ASN C OD1 1 
ATOM   3061 N ND2 . ASN C  2 199 ? -35.505 -85.854  -59.826 1.00 26.10 ? 345 ASN C ND2 1 
ATOM   3062 N N   . PRO C  2 200 ? -31.581 -88.303  -61.963 1.00 20.48 ? 346 PRO C N   1 
ATOM   3063 C CA  . PRO C  2 200 ? -30.375 -87.777  -62.567 1.00 19.82 ? 346 PRO C CA  1 
ATOM   3064 C C   . PRO C  2 200 ? -30.413 -86.267  -62.711 1.00 18.91 ? 346 PRO C C   1 
ATOM   3065 O O   . PRO C  2 200 ? -29.347 -85.648  -62.779 1.00 18.10 ? 346 PRO C O   1 
ATOM   3066 C CB  . PRO C  2 200 ? -30.343 -88.438  -63.940 1.00 20.94 ? 346 PRO C CB  1 
ATOM   3067 C CG  . PRO C  2 200 ? -31.766 -88.823  -64.215 1.00 22.07 ? 346 PRO C CG  1 
ATOM   3068 C CD  . PRO C  2 200 ? -32.323 -89.177  -62.875 1.00 21.50 ? 346 PRO C CD  1 
ATOM   3069 N N   . CYS C  2 201 ? -31.607 -85.674  -62.764 1.00 18.08 ? 347 CYS C N   1 
ATOM   3070 C CA  . CYS C  2 201 ? -31.718 -84.217  -62.812 1.00 18.39 ? 347 CYS C CA  1 
ATOM   3071 C C   . CYS C  2 201 ? -31.226 -83.614  -61.515 1.00 19.09 ? 347 CYS C C   1 
ATOM   3072 O O   . CYS C  2 201 ? -30.384 -82.694  -61.529 1.00 18.02 ? 347 CYS C O   1 
ATOM   3073 C CB  . CYS C  2 201 ? -33.156 -83.748  -63.051 1.00 19.12 ? 347 CYS C CB  1 
ATOM   3074 S SG  . CYS C  2 201 ? -33.420 -81.986  -62.751 1.00 18.46 ? 347 CYS C SG  1 
ATOM   3075 N N   . LEU C  2 202 ? -31.767 -84.122  -60.409 1.00 18.64 ? 348 LEU C N   1 
ATOM   3076 C CA  . LEU C  2 202 ? -31.412 -83.630  -59.094 1.00 19.02 ? 348 LEU C CA  1 
ATOM   3077 C C   . LEU C  2 202 ? -29.923 -83.875  -58.800 1.00 20.10 ? 348 LEU C C   1 
ATOM   3078 O O   . LEU C  2 202 ? -29.213 -82.971  -58.330 1.00 21.79 ? 348 LEU C O   1 
ATOM   3079 C CB  . LEU C  2 202 ? -32.282 -84.283  -58.032 1.00 18.89 ? 348 LEU C CB  1 
ATOM   3080 C CG  . LEU C  2 202 ? -32.100 -83.819  -56.586 1.00 19.26 ? 348 LEU C CG  1 
ATOM   3081 C CD1 . LEU C  2 202 ? -32.239 -82.307  -56.392 1.00 19.02 ? 348 LEU C CD1 1 
ATOM   3082 C CD2 . LEU C  2 202 ? -33.105 -84.542  -55.712 1.00 19.40 ? 348 LEU C CD2 1 
ATOM   3083 N N   . ARG C  2 203 ? -29.462 -85.085  -59.091 1.00 20.70 ? 349 ARG C N   1 
ATOM   3084 C CA  . ARG C  2 203 ? -28.021 -85.434  -58.997 1.00 21.21 ? 349 ARG C CA  1 
ATOM   3085 C C   . ARG C  2 203 ? -27.147 -84.414  -59.713 1.00 20.13 ? 349 ARG C C   1 
ATOM   3086 O O   . ARG C  2 203 ? -26.190 -83.895  -59.156 1.00 17.34 ? 349 ARG C O   1 
ATOM   3087 C CB  . ARG C  2 203 ? -27.778 -86.830  -59.597 1.00 22.44 ? 349 ARG C CB  1 
ATOM   3088 C CG  . ARG C  2 203 ? -26.317 -87.231  -59.731 1.00 24.09 ? 349 ARG C CG  1 
ATOM   3089 C CD  . ARG C  2 203 ? -26.139 -88.361  -60.742 1.00 25.77 ? 349 ARG C CD  1 
ATOM   3090 N NE  . ARG C  2 203 ? -24.742 -88.814  -60.807 1.00 26.76 ? 349 ARG C NE  1 
ATOM   3091 C CZ  . ARG C  2 203 ? -23.808 -88.316  -61.604 1.00 26.79 ? 349 ARG C CZ  1 
ATOM   3092 N NH1 . ARG C  2 203 ? -22.581 -88.798  -61.563 1.00 28.52 ? 349 ARG C NH1 1 
ATOM   3093 N NH2 . ARG C  2 203 ? -24.081 -87.348  -62.449 1.00 28.71 ? 349 ARG C NH2 1 
ATOM   3094 N N   . ASN C  2 204 ? -27.471 -84.146  -60.970 1.00 20.01 ? 350 ASN C N   1 
ATOM   3095 C CA  . ASN C  2 204 ? -26.661 -83.262  -61.792 1.00 19.60 ? 350 ASN C CA  1 
ATOM   3096 C C   . ASN C  2 204 ? -26.747 -81.819  -61.350 1.00 19.75 ? 350 ASN C C   1 
ATOM   3097 O O   . ASN C  2 204 ? -25.763 -81.089  -61.380 1.00 20.23 ? 350 ASN C O   1 
ATOM   3098 C CB  . ASN C  2 204 ? -27.084 -83.364  -63.261 1.00 20.16 ? 350 ASN C CB  1 
ATOM   3099 C CG  . ASN C  2 204 ? -26.723 -84.694  -63.865 1.00 20.01 ? 350 ASN C CG  1 
ATOM   3100 O OD1 . ASN C  2 204 ? -25.970 -85.465  -63.275 1.00 21.36 ? 350 ASN C OD1 1 
ATOM   3101 N ND2 . ASN C  2 204 ? -27.247 -84.973  -65.031 1.00 19.86 ? 350 ASN C ND2 1 
ATOM   3102 N N   . ALA C  2 205 ? -27.930 -81.394  -60.935 1.00 19.97 ? 351 ALA C N   1 
ATOM   3103 C CA  . ALA C  2 205 ? -28.095 -80.043  -60.450 1.00 19.71 ? 351 ALA C CA  1 
ATOM   3104 C C   . ALA C  2 205 ? -27.229 -79.773  -59.223 1.00 20.26 ? 351 ALA C C   1 
ATOM   3105 O O   . ALA C  2 205 ? -26.564 -78.744  -59.146 1.00 19.91 ? 351 ALA C O   1 
ATOM   3106 C CB  . ALA C  2 205 ? -29.556 -79.791  -60.124 1.00 20.82 ? 351 ALA C CB  1 
ATOM   3107 N N   . ILE C  2 206 ? -27.277 -80.679  -58.252 1.00 20.67 ? 352 ILE C N   1 
ATOM   3108 C CA  . ILE C  2 206 ? -26.513 -80.526  -57.027 1.00 21.79 ? 352 ILE C CA  1 
ATOM   3109 C C   . ILE C  2 206 ? -25.011 -80.565  -57.341 1.00 24.08 ? 352 ILE C C   1 
ATOM   3110 O O   . ILE C  2 206 ? -24.256 -79.729  -56.852 1.00 22.58 ? 352 ILE C O   1 
ATOM   3111 C CB  . ILE C  2 206 ? -26.863 -81.592  -55.980 1.00 21.18 ? 352 ILE C CB  1 
ATOM   3112 C CG1 . ILE C  2 206 ? -28.273 -81.366  -55.456 1.00 19.91 ? 352 ILE C CG1 1 
ATOM   3113 C CG2 . ILE C  2 206 ? -25.865 -81.559  -54.823 1.00 21.61 ? 352 ILE C CG2 1 
ATOM   3114 C CD1 . ILE C  2 206 ? -28.793 -82.483  -54.588 1.00 19.74 ? 352 ILE C CD1 1 
ATOM   3115 N N   . GLN C  2 207 ? -24.604 -81.498  -58.193 1.00 26.84 ? 353 GLN C N   1 
ATOM   3116 C CA  . GLN C  2 207 ? -23.195 -81.618  -58.575 1.00 31.17 ? 353 GLN C CA  1 
ATOM   3117 C C   . GLN C  2 207 ? -22.685 -80.418  -59.327 1.00 29.62 ? 353 GLN C C   1 
ATOM   3118 O O   . GLN C  2 207 ? -21.565 -79.989  -59.112 1.00 29.88 ? 353 GLN C O   1 
ATOM   3119 C CB  . GLN C  2 207 ? -22.939 -82.849  -59.441 1.00 34.10 ? 353 GLN C CB  1 
ATOM   3120 C CG  . GLN C  2 207 ? -22.700 -84.118  -58.656 1.00 38.41 ? 353 GLN C CG  1 
ATOM   3121 C CD  . GLN C  2 207 ? -22.022 -85.230  -59.455 1.00 43.43 ? 353 GLN C CD  1 
ATOM   3122 O OE1 . GLN C  2 207 ? -21.959 -86.362  -58.979 1.00 46.62 ? 353 GLN C OE1 1 
ATOM   3123 N NE2 . GLN C  2 207 ? -21.520 -84.926  -60.667 1.00 44.77 ? 353 GLN C NE2 1 
ATOM   3124 N N   . ALA C  2 208 ? -23.494 -79.888  -60.230 1.00 28.69 ? 354 ALA C N   1 
ATOM   3125 C CA  . ALA C  2 208 ? -23.059 -78.758  -61.026 1.00 28.63 ? 354 ALA C CA  1 
ATOM   3126 C C   . ALA C  2 208 ? -22.969 -77.486  -60.190 1.00 28.96 ? 354 ALA C C   1 
ATOM   3127 O O   . ALA C  2 208 ? -22.269 -76.545  -60.561 1.00 29.35 ? 354 ALA C O   1 
ATOM   3128 C CB  . ALA C  2 208 ? -23.970 -78.556  -62.221 1.00 27.65 ? 354 ALA C CB  1 
ATOM   3129 N N   . PHE C  2 209 ? -23.663 -77.434  -59.065 1.00 29.22 ? 355 PHE C N   1 
ATOM   3130 C CA  . PHE C  2 209 ? -23.637 -76.217  -58.276 1.00 31.50 ? 355 PHE C CA  1 
ATOM   3131 C C   . PHE C  2 209 ? -22.246 -75.912  -57.724 1.00 32.89 ? 355 PHE C C   1 
ATOM   3132 O O   . PHE C  2 209 ? -21.808 -74.782  -57.758 1.00 33.41 ? 355 PHE C O   1 
ATOM   3133 C CB  . PHE C  2 209 ? -24.645 -76.250  -57.144 1.00 31.31 ? 355 PHE C CB  1 
ATOM   3134 C CG  . PHE C  2 209 ? -24.708 -74.965  -56.386 1.00 32.19 ? 355 PHE C CG  1 
ATOM   3135 C CD1 . PHE C  2 209 ? -23.834 -74.731  -55.339 1.00 31.61 ? 355 PHE C CD1 1 
ATOM   3136 C CD2 . PHE C  2 209 ? -25.611 -73.964  -56.747 1.00 31.84 ? 355 PHE C CD2 1 
ATOM   3137 C CE1 . PHE C  2 209 ? -23.866 -73.535  -54.648 1.00 31.32 ? 355 PHE C CE1 1 
ATOM   3138 C CE2 . PHE C  2 209 ? -25.654 -72.768  -56.048 1.00 32.30 ? 355 PHE C CE2 1 
ATOM   3139 C CZ  . PHE C  2 209 ? -24.779 -72.559  -54.991 1.00 31.73 ? 355 PHE C CZ  1 
ATOM   3140 N N   . GLY C  2 210 ? -21.563 -76.923  -57.218 1.00 39.64 ? 356 GLY C N   1 
ATOM   3141 C CA  . GLY C  2 210 ? -20.206 -76.740  -56.688 1.00 45.29 ? 356 GLY C CA  1 
ATOM   3142 C C   . GLY C  2 210 ? -19.113 -76.905  -57.726 1.00 45.47 ? 356 GLY C C   1 
ATOM   3143 O O   . GLY C  2 210 ? -19.357 -77.392  -58.832 1.00 50.44 ? 356 GLY C O   1 
ATOM   3144 N N   . ASN D  2 13  ? -21.766 -20.765  10.168  1.00 36.35 ? 159 ASN D N   1 
ATOM   3145 C CA  . ASN D  2 13  ? -23.007 -20.221  10.793  1.00 32.97 ? 159 ASN D CA  1 
ATOM   3146 C C   . ASN D  2 13  ? -24.132 -21.277  10.842  1.00 31.32 ? 159 ASN D C   1 
ATOM   3147 O O   . ASN D  2 13  ? -24.047 -22.343  10.204  1.00 30.26 ? 159 ASN D O   1 
ATOM   3148 C CB  . ASN D  2 13  ? -23.437 -18.948  10.058  1.00 33.59 ? 159 ASN D CB  1 
ATOM   3149 C CG  . ASN D  2 13  ? -23.919 -19.214  8.619   1.00 31.79 ? 159 ASN D CG  1 
ATOM   3150 O OD1 . ASN D  2 13  ? -24.942 -19.866  8.406   1.00 30.62 ? 159 ASN D OD1 1 
ATOM   3151 N ND2 . ASN D  2 13  ? -23.202 -18.682  7.639   1.00 29.77 ? 159 ASN D ND2 1 
ATOM   3152 N N   . HIS D  2 14  ? -25.171 -21.003  11.623  1.00 30.23 ? 160 HIS D N   1 
ATOM   3153 C CA  . HIS D  2 14  ? -26.222 -21.991  11.826  1.00 29.82 ? 160 HIS D CA  1 
ATOM   3154 C C   . HIS D  2 14  ? -27.005 -22.273  10.533  1.00 26.70 ? 160 HIS D C   1 
ATOM   3155 O O   . HIS D  2 14  ? -27.569 -23.343  10.357  1.00 26.65 ? 160 HIS D O   1 
ATOM   3156 C CB  . HIS D  2 14  ? -27.180 -21.549  12.939  1.00 32.02 ? 160 HIS D CB  1 
ATOM   3157 C CG  . HIS D  2 14  ? -26.565 -21.556  14.302  1.00 35.94 ? 160 HIS D CG  1 
ATOM   3158 N ND1 . HIS D  2 14  ? -25.905 -22.651  14.816  1.00 38.79 ? 160 HIS D ND1 1 
ATOM   3159 C CD2 . HIS D  2 14  ? -26.514 -20.606  15.264  1.00 37.86 ? 160 HIS D CD2 1 
ATOM   3160 C CE1 . HIS D  2 14  ? -25.466 -22.375  16.031  1.00 38.09 ? 160 HIS D CE1 1 
ATOM   3161 N NE2 . HIS D  2 14  ? -25.826 -21.140  16.327  1.00 39.58 ? 160 HIS D NE2 1 
ATOM   3162 N N   . CYS D  2 15  ? -27.056 -21.300  9.646   1.00 24.83 ? 161 CYS D N   1 
ATOM   3163 C CA  . CYS D  2 15  ? -27.808 -21.450  8.399   1.00 24.62 ? 161 CYS D CA  1 
ATOM   3164 C C   . CYS D  2 15  ? -27.054 -22.336  7.412   1.00 23.57 ? 161 CYS D C   1 
ATOM   3165 O O   . CYS D  2 15  ? -27.658 -23.158  6.742   1.00 23.48 ? 161 CYS D O   1 
ATOM   3166 C CB  . CYS D  2 15  ? -28.133 -20.085  7.807   1.00 23.83 ? 161 CYS D CB  1 
ATOM   3167 S SG  . CYS D  2 15  ? -29.236 -19.131  8.870   1.00 25.80 ? 161 CYS D SG  1 
ATOM   3168 N N   . LEU D  2 16  ? -25.732 -22.182  7.360   1.00 23.26 ? 162 LEU D N   1 
ATOM   3169 C CA  . LEU D  2 16  ? -24.872 -23.093  6.601   1.00 23.60 ? 162 LEU D CA  1 
ATOM   3170 C C   . LEU D  2 16  ? -24.955 -24.526  7.134   1.00 23.17 ? 162 LEU D C   1 
ATOM   3171 O O   . LEU D  2 16  ? -25.003 -25.483  6.349   1.00 23.80 ? 162 LEU D O   1 
ATOM   3172 C CB  . LEU D  2 16  ? -23.430 -22.605  6.650   1.00 24.48 ? 162 LEU D CB  1 
ATOM   3173 C CG  . LEU D  2 16  ? -22.457 -23.258  5.663   1.00 25.87 ? 162 LEU D CG  1 
ATOM   3174 C CD1 . LEU D  2 16  ? -22.876 -23.034  4.218   1.00 25.16 ? 162 LEU D CD1 1 
ATOM   3175 C CD2 . LEU D  2 16  ? -21.048 -22.718  5.918   1.00 26.84 ? 162 LEU D CD2 1 
ATOM   3176 N N   . ASP D  2 17  ? -24.968 -24.674  8.463   1.00 23.25 ? 163 ASP D N   1 
ATOM   3177 C CA  . ASP D  2 17  ? -25.103 -25.982  9.110   1.00 22.35 ? 163 ASP D CA  1 
ATOM   3178 C C   . ASP D  2 17  ? -26.424 -26.657  8.728   1.00 22.14 ? 163 ASP D C   1 
ATOM   3179 O O   . ASP D  2 17  ? -26.479 -27.866  8.530   1.00 20.89 ? 163 ASP D O   1 
ATOM   3180 C CB  . ASP D  2 17  ? -25.101 -25.850  10.634  1.00 24.27 ? 163 ASP D CB  1 
ATOM   3181 C CG  . ASP D  2 17  ? -23.782 -25.363  11.211  1.00 25.27 ? 163 ASP D CG  1 
ATOM   3182 O OD1 . ASP D  2 17  ? -22.734 -25.561  10.599  1.00 26.47 ? 163 ASP D OD1 1 
ATOM   3183 O OD2 . ASP D  2 17  ? -23.815 -24.800  12.329  1.00 28.66 ? 163 ASP D OD2 1 
ATOM   3184 N N   . ALA D  2 18  ? -27.490 -25.864  8.680   1.00 21.73 ? 164 ALA D N   1 
ATOM   3185 C CA  . ALA D  2 18  ? -28.826 -26.325  8.287   1.00 21.34 ? 164 ALA D CA  1 
ATOM   3186 C C   . ALA D  2 18  ? -28.879 -26.817  6.839   1.00 21.71 ? 164 ALA D C   1 
ATOM   3187 O O   . ALA D  2 18  ? -29.509 -27.840  6.555   1.00 24.11 ? 164 ALA D O   1 
ATOM   3188 C CB  . ALA D  2 18  ? -29.836 -25.205  8.489   1.00 21.07 ? 164 ALA D CB  1 
ATOM   3189 N N   . ALA D  2 19  ? -28.222 -26.092  5.935   1.00 20.06 ? 165 ALA D N   1 
ATOM   3190 C CA  . ALA D  2 19  ? -28.142 -26.509  4.538   1.00 19.54 ? 165 ALA D CA  1 
ATOM   3191 C C   . ALA D  2 19  ? -27.389 -27.836  4.424   1.00 19.34 ? 165 ALA D C   1 
ATOM   3192 O O   . ALA D  2 19  ? -27.791 -28.694  3.657   1.00 17.70 ? 165 ALA D O   1 
ATOM   3193 C CB  . ALA D  2 19  ? -27.460 -25.453  3.690   1.00 18.98 ? 165 ALA D CB  1 
ATOM   3194 N N   . LYS D  2 20  ? -26.310 -27.971  5.198   1.00 20.17 ? 166 LYS D N   1 
ATOM   3195 C CA  . LYS D  2 20  ? -25.526 -29.200  5.255   1.00 21.46 ? 166 LYS D CA  1 
ATOM   3196 C C   . LYS D  2 20  ? -26.361 -30.400  5.674   1.00 20.19 ? 166 LYS D C   1 
ATOM   3197 O O   . LYS D  2 20  ? -26.368 -31.390  4.992   1.00 20.77 ? 166 LYS D O   1 
ATOM   3198 C CB  . LYS D  2 20  ? -24.347 -29.038  6.220   1.00 22.83 ? 166 LYS D CB  1 
ATOM   3199 C CG  . LYS D  2 20  ? -23.552 -30.314  6.447   1.00 24.46 ? 166 LYS D CG  1 
ATOM   3200 C CD  . LYS D  2 20  ? -22.296 -30.068  7.270   1.00 26.76 ? 166 LYS D CD  1 
ATOM   3201 C CE  . LYS D  2 20  ? -21.630 -31.393  7.598   1.00 29.47 ? 166 LYS D CE  1 
ATOM   3202 N NZ  . LYS D  2 20  ? -20.524 -31.197  8.566   1.00 33.25 ? 166 LYS D NZ  1 
ATOM   3203 N N   . ALA D  2 21  ? -27.052 -30.311  6.804   1.00 20.23 ? 167 ALA D N   1 
ATOM   3204 C CA  . ALA D  2 21  ? -27.924 -31.380  7.238   1.00 21.19 ? 167 ALA D CA  1 
ATOM   3205 C C   . ALA D  2 21  ? -28.929 -31.752  6.153   1.00 21.27 ? 167 ALA D C   1 
ATOM   3206 O O   . ALA D  2 21  ? -29.194 -32.931  5.932   1.00 20.20 ? 167 ALA D O   1 
ATOM   3207 C CB  . ALA D  2 21  ? -28.663 -30.984  8.515   1.00 22.05 ? 167 ALA D CB  1 
ATOM   3208 N N   . CYS D  2 22  ? -29.483 -30.749  5.475   1.00 20.25 ? 168 CYS D N   1 
ATOM   3209 C CA  . CYS D  2 22  ? -30.449 -31.025  4.420   1.00 21.40 ? 168 CYS D CA  1 
ATOM   3210 C C   . CYS D  2 22  ? -29.798 -31.793  3.295   1.00 21.69 ? 168 CYS D C   1 
ATOM   3211 O O   . CYS D  2 22  ? -30.266 -32.869  2.926   1.00 21.21 ? 168 CYS D O   1 
ATOM   3212 C CB  . CYS D  2 22  ? -31.086 -29.744  3.873   1.00 21.72 ? 168 CYS D CB  1 
ATOM   3213 S SG  . CYS D  2 22  ? -32.250 -30.063  2.537   1.00 22.99 ? 168 CYS D SG  1 
ATOM   3214 N N   . ASN D  2 23  ? -28.707 -31.250  2.757   1.00 21.21 ? 169 ASN D N   1 
ATOM   3215 C CA  . ASN D  2 23  ? -28.039 -31.888  1.628   1.00 20.58 ? 169 ASN D CA  1 
ATOM   3216 C C   . ASN D  2 23  ? -27.545 -33.322  1.929   1.00 20.32 ? 169 ASN D C   1 
ATOM   3217 O O   . ASN D  2 23  ? -27.496 -34.157  1.020   1.00 19.09 ? 169 ASN D O   1 
ATOM   3218 C CB  . ASN D  2 23  ? -26.888 -31.008  1.096   1.00 20.35 ? 169 ASN D CB  1 
ATOM   3219 C CG  . ASN D  2 23  ? -27.351 -29.976  0.060   1.00 19.80 ? 169 ASN D CG  1 
ATOM   3220 O OD1 . ASN D  2 23  ? -28.538 -29.814  -0.214  1.00 19.25 ? 169 ASN D OD1 1 
ATOM   3221 N ND2 . ASN D  2 23  ? -26.410 -29.275  -0.509  1.00 20.00 ? 169 ASN D ND2 1 
ATOM   3222 N N   . LEU D  2 24  ? -27.191 -33.592  3.184   1.00 20.50 ? 170 LEU D N   1 
ATOM   3223 C CA  . LEU D  2 24  ? -26.751 -34.936  3.608   1.00 21.62 ? 170 LEU D CA  1 
ATOM   3224 C C   . LEU D  2 24  ? -27.894 -35.921  3.889   1.00 22.70 ? 170 LEU D C   1 
ATOM   3225 O O   . LEU D  2 24  ? -27.648 -37.072  4.212   1.00 24.01 ? 170 LEU D O   1 
ATOM   3226 C CB  . LEU D  2 24  ? -25.847 -34.842  4.835   1.00 22.15 ? 170 LEU D CB  1 
ATOM   3227 C CG  . LEU D  2 24  ? -24.529 -34.122  4.584   1.00 22.78 ? 170 LEU D CG  1 
ATOM   3228 C CD1 . LEU D  2 24  ? -23.700 -34.118  5.858   1.00 24.70 ? 170 LEU D CD1 1 
ATOM   3229 C CD2 . LEU D  2 24  ? -23.747 -34.766  3.459   1.00 23.19 ? 170 LEU D CD2 1 
ATOM   3230 N N   . ASN D  2 25  ? -29.134 -35.458  3.789   1.00 22.11 ? 171 ASN D N   1 
ATOM   3231 C CA  . ASN D  2 25  ? -30.311 -36.309  3.839   1.00 22.35 ? 171 ASN D CA  1 
ATOM   3232 C C   . ASN D  2 25  ? -30.866 -36.414  2.413   1.00 23.45 ? 171 ASN D C   1 
ATOM   3233 O O   . ASN D  2 25  ? -31.171 -35.388  1.804   1.00 22.33 ? 171 ASN D O   1 
ATOM   3234 C CB  . ASN D  2 25  ? -31.347 -35.678  4.748   1.00 22.72 ? 171 ASN D CB  1 
ATOM   3235 C CG  . ASN D  2 25  ? -32.622 -36.487  4.814   1.00 23.53 ? 171 ASN D CG  1 
ATOM   3236 O OD1 . ASN D  2 25  ? -33.574 -36.222  4.093   1.00 22.86 ? 171 ASN D OD1 1 
ATOM   3237 N ND2 . ASN D  2 25  ? -32.636 -37.498  5.670   1.00 24.38 ? 171 ASN D ND2 1 
ATOM   3238 N N   A ASP D  2 26  ? -30.992 -37.639  1.892   0.50 23.22 ? 172 ASP D N   1 
ATOM   3239 N N   B ASP D  2 26  ? -30.996 -37.629  1.876   0.50 22.74 ? 172 ASP D N   1 
ATOM   3240 C CA  A ASP D  2 26  ? -31.386 -37.852  0.497   0.50 23.76 ? 172 ASP D CA  1 
ATOM   3241 C CA  B ASP D  2 26  ? -31.353 -37.771  0.467   0.50 22.99 ? 172 ASP D CA  1 
ATOM   3242 C C   A ASP D  2 26  ? -32.681 -37.145  0.105   0.50 22.52 ? 172 ASP D C   1 
ATOM   3243 C C   B ASP D  2 26  ? -32.677 -37.093  0.112   0.50 22.11 ? 172 ASP D C   1 
ATOM   3244 O O   A ASP D  2 26  ? -32.762 -36.516  -0.946  0.50 21.58 ? 172 ASP D O   1 
ATOM   3245 O O   B ASP D  2 26  ? -32.774 -36.420  -0.911  0.50 21.25 ? 172 ASP D O   1 
ATOM   3246 C CB  A ASP D  2 26  ? -31.512 -39.347  0.191   0.50 24.82 ? 172 ASP D CB  1 
ATOM   3247 C CB  B ASP D  2 26  ? -31.407 -39.235  0.041   0.50 23.55 ? 172 ASP D CB  1 
ATOM   3248 C CG  A ASP D  2 26  ? -30.377 -39.855  -0.674  0.50 26.20 ? 172 ASP D CG  1 
ATOM   3249 C CG  B ASP D  2 26  ? -31.765 -39.388  -1.426  0.50 24.33 ? 172 ASP D CG  1 
ATOM   3250 O OD1 A ASP D  2 26  ? -29.294 -40.143  -0.121  0.50 26.31 ? 172 ASP D OD1 1 
ATOM   3251 O OD1 B ASP D  2 26  ? -31.012 -38.893  -2.312  0.50 25.17 ? 172 ASP D OD1 1 
ATOM   3252 O OD2 A ASP D  2 26  ? -30.560 -39.943  -1.916  0.50 28.50 ? 172 ASP D OD2 1 
ATOM   3253 O OD2 B ASP D  2 26  ? -32.814 -39.991  -1.705  0.50 24.38 ? 172 ASP D OD2 1 
ATOM   3254 N N   . ASN D  2 27  ? -33.691 -37.271  0.954   1.00 21.90 ? 173 ASN D N   1 
ATOM   3255 C CA  . ASN D  2 27  ? -35.010 -36.738  0.666   1.00 21.42 ? 173 ASN D CA  1 
ATOM   3256 C C   . ASN D  2 27  ? -34.990 -35.212  0.714   1.00 20.91 ? 173 ASN D C   1 
ATOM   3257 O O   . ASN D  2 27  ? -35.489 -34.555  -0.186  1.00 22.65 ? 173 ASN D O   1 
ATOM   3258 C CB  . ASN D  2 27  ? -36.024 -37.309  1.653   1.00 22.15 ? 173 ASN D CB  1 
ATOM   3259 C CG  . ASN D  2 27  ? -37.419 -36.730  1.467   1.00 22.99 ? 173 ASN D CG  1 
ATOM   3260 O OD1 . ASN D  2 27  ? -38.016 -36.860  0.398   1.00 21.61 ? 173 ASN D OD1 1 
ATOM   3261 N ND2 . ASN D  2 27  ? -37.945 -36.088  2.517   1.00 23.55 ? 173 ASN D ND2 1 
ATOM   3262 N N   . CYS D  2 28  ? -34.384 -34.649  1.745   1.00 20.67 ? 174 CYS D N   1 
ATOM   3263 C CA  . CYS D  2 28  ? -34.283 -33.195  1.847   1.00 20.86 ? 174 CYS D CA  1 
ATOM   3264 C C   . CYS D  2 28  ? -33.491 -32.613  0.658   1.00 20.69 ? 174 CYS D C   1 
ATOM   3265 O O   . CYS D  2 28  ? -33.909 -31.639  0.018   1.00 19.59 ? 174 CYS D O   1 
ATOM   3266 C CB  . CYS D  2 28  ? -33.636 -32.786  3.179   1.00 20.35 ? 174 CYS D CB  1 
ATOM   3267 S SG  . CYS D  2 28  ? -33.785 -31.010  3.535   1.00 21.02 ? 174 CYS D SG  1 
ATOM   3268 N N   . LYS D  2 29  ? -32.360 -33.233  0.361   1.00 19.69 ? 175 LYS D N   1 
ATOM   3269 C CA  . LYS D  2 29  ? -31.510 -32.785  -0.711  1.00 21.42 ? 175 LYS D CA  1 
ATOM   3270 C C   . LYS D  2 29  ? -32.243 -32.753  -2.035  1.00 20.68 ? 175 LYS D C   1 
ATOM   3271 O O   . LYS D  2 29  ? -32.062 -31.825  -2.808  1.00 19.94 ? 175 LYS D O   1 
ATOM   3272 C CB  . LYS D  2 29  ? -30.286 -33.686  -0.826  1.00 21.81 ? 175 LYS D CB  1 
ATOM   3273 C CG  . LYS D  2 29  ? -29.285 -33.288  -1.906  1.00 23.97 ? 175 LYS D CG  1 
ATOM   3274 C CD  . LYS D  2 29  ? -28.623 -34.510  -2.527  1.00 25.16 ? 175 LYS D CD  1 
ATOM   3275 C CE  . LYS D  2 29  ? -29.440 -35.061  -3.688  1.00 26.75 ? 175 LYS D CE  1 
ATOM   3276 N NZ  . LYS D  2 29  ? -28.893 -36.404  -3.992  1.00 29.10 ? 175 LYS D NZ  1 
ATOM   3277 N N   . LYS D  2 30  ? -33.051 -33.771  -2.295  1.00 21.64 ? 176 LYS D N   1 
ATOM   3278 C CA  . LYS D  2 30  ? -33.771 -33.883  -3.568  1.00 22.88 ? 176 LYS D CA  1 
ATOM   3279 C C   . LYS D  2 30  ? -34.825 -32.802  -3.656  1.00 21.11 ? 176 LYS D C   1 
ATOM   3280 O O   . LYS D  2 30  ? -34.928 -32.126  -4.665  1.00 20.30 ? 176 LYS D O   1 
ATOM   3281 C CB  . LYS D  2 30  ? -34.460 -35.252  -3.739  1.00 24.57 ? 176 LYS D CB  1 
ATOM   3282 C CG  . LYS D  2 30  ? -33.513 -36.360  -4.119  1.00 28.65 ? 176 LYS D CG  1 
ATOM   3283 C CD  . LYS D  2 30  ? -34.152 -37.751  -4.040  1.00 31.64 ? 176 LYS D CD  1 
ATOM   3284 C CE  . LYS D  2 30  ? -33.173 -38.811  -4.563  1.00 34.42 ? 176 LYS D CE  1 
ATOM   3285 N NZ  . LYS D  2 30  ? -33.311 -40.177  -3.998  1.00 35.08 ? 176 LYS D NZ  1 
ATOM   3286 N N   . LEU D  2 31  ? -35.606 -32.662  -2.593  1.00 20.29 ? 177 LEU D N   1 
ATOM   3287 C CA  . LEU D  2 31  ? -36.737 -31.750  -2.591  1.00 20.46 ? 177 LEU D CA  1 
ATOM   3288 C C   . LEU D  2 31  ? -36.267 -30.297  -2.501  1.00 19.68 ? 177 LEU D C   1 
ATOM   3289 O O   . LEU D  2 31  ? -36.909 -29.384  -3.041  1.00 18.21 ? 177 LEU D O   1 
ATOM   3290 C CB  . LEU D  2 31  ? -37.707 -32.108  -1.464  1.00 21.88 ? 177 LEU D CB  1 
ATOM   3291 C CG  . LEU D  2 31  ? -38.760 -33.158  -1.841  1.00 25.24 ? 177 LEU D CG  1 
ATOM   3292 C CD1 . LEU D  2 31  ? -38.141 -34.424  -2.378  1.00 28.91 ? 177 LEU D CD1 1 
ATOM   3293 C CD2 . LEU D  2 31  ? -39.652 -33.503  -0.659  1.00 25.91 ? 177 LEU D CD2 1 
ATOM   3294 N N   . ARG D  2 32  ? -35.130 -30.086  -1.833  1.00 18.98 ? 178 ARG D N   1 
ATOM   3295 C CA  . ARG D  2 32  ? -34.464 -28.782  -1.849  1.00 18.26 ? 178 ARG D CA  1 
ATOM   3296 C C   . ARG D  2 32  ? -33.989 -28.406  -3.256  1.00 18.22 ? 178 ARG D C   1 
ATOM   3297 O O   . ARG D  2 32  ? -34.252 -27.297  -3.718  1.00 18.48 ? 178 ARG D O   1 
ATOM   3298 C CB  . ARG D  2 32  ? -33.272 -28.727  -0.889  1.00 18.44 ? 178 ARG D CB  1 
ATOM   3299 C CG  . ARG D  2 32  ? -32.662 -27.336  -0.760  1.00 18.60 ? 178 ARG D CG  1 
ATOM   3300 C CD  . ARG D  2 32  ? -31.342 -27.396  -0.015  1.00 18.65 ? 178 ARG D CD  1 
ATOM   3301 N NE  . ARG D  2 32  ? -30.761 -26.071  0.209   1.00 18.05 ? 178 ARG D NE  1 
ATOM   3302 C CZ  . ARG D  2 32  ? -29.458 -25.795  0.205   1.00 17.64 ? 178 ARG D CZ  1 
ATOM   3303 N NH1 . ARG D  2 32  ? -28.549 -26.740  -0.048  1.00 17.80 ? 178 ARG D NH1 1 
ATOM   3304 N NH2 . ARG D  2 32  ? -29.061 -24.553  0.415   1.00 17.29 ? 178 ARG D NH2 1 
ATOM   3305 N N   . SER D  2 33  ? -33.238 -29.285  -3.900  1.00 17.30 ? 179 SER D N   1 
ATOM   3306 C CA  . SER D  2 33  ? -32.729 -28.999  -5.236  1.00 18.29 ? 179 SER D CA  1 
ATOM   3307 C C   . SER D  2 33  ? -33.861 -28.774  -6.208  1.00 18.36 ? 179 SER D C   1 
ATOM   3308 O O   . SER D  2 33  ? -33.797 -27.900  -7.077  1.00 17.90 ? 179 SER D O   1 
ATOM   3309 C CB  . SER D  2 33  ? -31.835 -30.122  -5.766  1.00 18.39 ? 179 SER D CB  1 
ATOM   3310 O OG  . SER D  2 33  ? -31.162 -29.662  -6.916  1.00 19.83 ? 179 SER D OG  1 
ATOM   3311 N N   . SER D  2 34  ? -34.925 -29.538  -6.051  1.00 18.61 ? 180 SER D N   1 
ATOM   3312 C CA  . SER D  2 34  ? -36.048 -29.379  -6.962  1.00 19.87 ? 180 SER D CA  1 
ATOM   3313 C C   . SER D  2 34  ? -36.648 -27.965  -6.907  1.00 19.21 ? 180 SER D C   1 
ATOM   3314 O O   . SER D  2 34  ? -36.831 -27.340  -7.949  1.00 17.74 ? 180 SER D O   1 
ATOM   3315 C CB  . SER D  2 34  ? -37.109 -30.432  -6.701  1.00 21.76 ? 180 SER D CB  1 
ATOM   3316 O OG  . SER D  2 34  ? -38.254 -30.083  -7.423  1.00 25.11 ? 180 SER D OG  1 
ATOM   3317 N N   . TYR D  2 35  ? -36.924 -27.440  -5.706  1.00 18.63 ? 181 TYR D N   1 
ATOM   3318 C CA  . TYR D  2 35  ? -37.468 -26.078  -5.616  1.00 18.80 ? 181 TYR D CA  1 
ATOM   3319 C C   . TYR D  2 35  ? -36.417 -25.057  -6.036  1.00 19.49 ? 181 TYR D C   1 
ATOM   3320 O O   . TYR D  2 35  ? -36.738 -24.095  -6.722  1.00 17.88 ? 181 TYR D O   1 
ATOM   3321 C CB  . TYR D  2 35  ? -38.115 -25.766  -4.255  1.00 18.28 ? 181 TYR D CB  1 
ATOM   3322 C CG  . TYR D  2 35  ? -37.267 -25.251  -3.115  1.00 16.88 ? 181 TYR D CG  1 
ATOM   3323 C CD1 . TYR D  2 35  ? -36.802 -23.950  -3.093  1.00 16.23 ? 181 TYR D CD1 1 
ATOM   3324 C CD2 . TYR D  2 35  ? -37.036 -26.038  -2.004  1.00 16.77 ? 181 TYR D CD2 1 
ATOM   3325 C CE1 . TYR D  2 35  ? -36.050 -23.478  -2.032  1.00 15.97 ? 181 TYR D CE1 1 
ATOM   3326 C CE2 . TYR D  2 35  ? -36.312 -25.571  -0.921  1.00 16.24 ? 181 TYR D CE2 1 
ATOM   3327 C CZ  . TYR D  2 35  ? -35.823 -24.277  -0.937  1.00 16.23 ? 181 TYR D CZ  1 
ATOM   3328 O OH  . TYR D  2 35  ? -35.108 -23.829  0.143   1.00 14.94 ? 181 TYR D OH  1 
ATOM   3329 N N   . ILE D  2 36  ? -35.144 -25.315  -5.718  1.00 19.58 ? 182 ILE D N   1 
ATOM   3330 C CA  . ILE D  2 36  ? -34.099 -24.378  -6.130  1.00 18.92 ? 182 ILE D CA  1 
ATOM   3331 C C   . ILE D  2 36  ? -34.004 -24.292  -7.645  1.00 19.18 ? 182 ILE D C   1 
ATOM   3332 O O   . ILE D  2 36  ? -33.986 -23.189  -8.203  1.00 18.91 ? 182 ILE D O   1 
ATOM   3333 C CB  . ILE D  2 36  ? -32.734 -24.694  -5.501  1.00 18.58 ? 182 ILE D CB  1 
ATOM   3334 C CG1 . ILE D  2 36  ? -32.805 -24.393  -4.002  1.00 18.67 ? 182 ILE D CG1 1 
ATOM   3335 C CG2 . ILE D  2 36  ? -31.653 -23.843  -6.147  1.00 18.50 ? 182 ILE D CG2 1 
ATOM   3336 C CD1 . ILE D  2 36  ? -31.635 -24.915  -3.209  1.00 18.98 ? 182 ILE D CD1 1 
ATOM   3337 N N   . SER D  2 37  ? -33.971 -25.431  -8.321  1.00 19.36 ? 183 SER D N   1 
ATOM   3338 C CA  . SER D  2 37  ? -33.766 -25.421  -9.767  1.00 20.16 ? 183 SER D CA  1 
ATOM   3339 C C   . SER D  2 37  ? -34.981 -24.873  -10.514 1.00 19.23 ? 183 SER D C   1 
ATOM   3340 O O   . SER D  2 37  ? -34.823 -24.174  -11.489 1.00 19.21 ? 183 SER D O   1 
ATOM   3341 C CB  . SER D  2 37  ? -33.364 -26.805  -10.305 1.00 21.25 ? 183 SER D CB  1 
ATOM   3342 O OG  . SER D  2 37  ? -34.308 -27.775  -9.959  1.00 22.03 ? 183 SER D OG  1 
ATOM   3343 N N   . ILE D  2 38  ? -36.185 -25.161  -10.039 1.00 19.16 ? 184 ILE D N   1 
ATOM   3344 C CA  . ILE D  2 38  ? -37.387 -24.565  -10.631 1.00 18.85 ? 184 ILE D CA  1 
ATOM   3345 C C   . ILE D  2 38  ? -37.423 -23.065  -10.354 1.00 18.76 ? 184 ILE D C   1 
ATOM   3346 O O   . ILE D  2 38  ? -37.561 -22.263  -11.274 1.00 17.23 ? 184 ILE D O   1 
ATOM   3347 C CB  . ILE D  2 38  ? -38.677 -25.220  -10.086 1.00 20.30 ? 184 ILE D CB  1 
ATOM   3348 C CG1 . ILE D  2 38  ? -38.769 -26.661  -10.586 1.00 21.59 ? 184 ILE D CG1 1 
ATOM   3349 C CG2 . ILE D  2 38  ? -39.914 -24.426  -10.522 1.00 20.05 ? 184 ILE D CG2 1 
ATOM   3350 C CD1 . ILE D  2 38  ? -39.777 -27.522  -9.838  1.00 23.00 ? 184 ILE D CD1 1 
ATOM   3351 N N   . CYS D  2 39  ? -37.274 -22.678  -9.089  1.00 18.95 ? 185 CYS D N   1 
ATOM   3352 C CA  . CYS D  2 39  ? -37.429 -21.271  -8.711  1.00 19.65 ? 185 CYS D CA  1 
ATOM   3353 C C   . CYS D  2 39  ? -36.340 -20.370  -9.284  1.00 19.83 ? 185 CYS D C   1 
ATOM   3354 O O   . CYS D  2 39  ? -36.577 -19.187  -9.458  1.00 20.70 ? 185 CYS D O   1 
ATOM   3355 C CB  . CYS D  2 39  ? -37.465 -21.098  -7.180  1.00 20.34 ? 185 CYS D CB  1 
ATOM   3356 S SG  . CYS D  2 39  ? -38.866 -21.877  -6.352  1.00 21.61 ? 185 CYS D SG  1 
ATOM   3357 N N   . ASN D  2 40  ? -35.143 -20.918  -9.516  1.00 20.35 ? 186 ASN D N   1 
ATOM   3358 C CA  . ASN D  2 40  ? -33.996 -20.172  -10.039 1.00 21.18 ? 186 ASN D CA  1 
ATOM   3359 C C   . ASN D  2 40  ? -33.963 -20.066  -11.575 1.00 22.84 ? 186 ASN D C   1 
ATOM   3360 O O   . ASN D  2 40  ? -33.149 -19.330  -12.119 1.00 23.01 ? 186 ASN D O   1 
ATOM   3361 C CB  . ASN D  2 40  ? -32.701 -20.850  -9.568  1.00 20.78 ? 186 ASN D CB  1 
ATOM   3362 C CG  . ASN D  2 40  ? -31.496 -19.921  -9.569  1.00 21.22 ? 186 ASN D CG  1 
ATOM   3363 O OD1 . ASN D  2 40  ? -31.609 -18.725  -9.333  1.00 21.69 ? 186 ASN D OD1 1 
ATOM   3364 N ND2 . ASN D  2 40  ? -30.320 -20.495  -9.759  1.00 20.87 ? 186 ASN D ND2 1 
ATOM   3365 N N   . ARG D  2 41  ? -34.817 -20.805  -12.267 1.00 24.48 ? 187 ARG D N   1 
ATOM   3366 C CA  . ARG D  2 41  ? -34.794 -20.847  -13.739 1.00 29.47 ? 187 ARG D CA  1 
ATOM   3367 C C   . ARG D  2 41  ? -35.522 -19.651  -14.367 1.00 29.13 ? 187 ARG D C   1 
ATOM   3368 O O   . ARG D  2 41  ? -36.742 -19.562  -14.290 1.00 29.75 ? 187 ARG D O   1 
ATOM   3369 C CB  . ARG D  2 41  ? -35.418 -22.158  -14.253 1.00 31.69 ? 187 ARG D CB  1 
ATOM   3370 C CG  . ARG D  2 41  ? -35.676 -22.187  -15.762 1.00 36.11 ? 187 ARG D CG  1 
ATOM   3371 C CD  . ARG D  2 41  ? -36.055 -23.565  -16.275 1.00 39.58 ? 187 ARG D CD  1 
ATOM   3372 N NE  . ARG D  2 41  ? -34.860 -24.393  -16.428 1.00 47.06 ? 187 ARG D NE  1 
ATOM   3373 C CZ  . ARG D  2 41  ? -34.450 -25.354  -15.588 1.00 50.32 ? 187 ARG D CZ  1 
ATOM   3374 N NH1 . ARG D  2 41  ? -35.141 -25.677  -14.488 1.00 49.95 ? 187 ARG D NH1 1 
ATOM   3375 N NH2 . ARG D  2 41  ? -33.325 -26.011  -15.864 1.00 52.94 ? 187 ARG D NH2 1 
ATOM   3376 N N   . GLU D  2 42  ? -34.770 -18.762  -14.998 1.00 31.18 ? 188 GLU D N   1 
ATOM   3377 C CA  . GLU D  2 42  ? -35.336 -17.624  -15.729 1.00 36.05 ? 188 GLU D CA  1 
ATOM   3378 C C   . GLU D  2 42  ? -36.081 -18.035  -17.001 1.00 36.40 ? 188 GLU D C   1 
ATOM   3379 O O   . GLU D  2 42  ? -35.609 -18.874  -17.754 1.00 36.83 ? 188 GLU D O   1 
ATOM   3380 C CB  . GLU D  2 42  ? -34.244 -16.637  -16.113 1.00 39.87 ? 188 GLU D CB  1 
ATOM   3381 C CG  . GLU D  2 42  ? -34.049 -15.523  -15.114 1.00 44.58 ? 188 GLU D CG  1 
ATOM   3382 C CD  . GLU D  2 42  ? -33.195 -14.394  -15.667 1.00 48.99 ? 188 GLU D CD  1 
ATOM   3383 O OE1 . GLU D  2 42  ? -32.294 -13.938  -14.928 1.00 50.80 ? 188 GLU D OE1 1 
ATOM   3384 O OE2 . GLU D  2 42  ? -33.425 -13.971  -16.829 1.00 48.73 ? 188 GLU D OE2 1 
ATOM   3385 N N   . ILE D  2 43  ? -37.242 -17.428  -17.233 1.00 38.07 ? 189 ILE D N   1 
ATOM   3386 C CA  . ILE D  2 43  ? -38.069 -17.734  -18.421 1.00 39.24 ? 189 ILE D CA  1 
ATOM   3387 C C   . ILE D  2 43  ? -37.742 -16.800  -19.596 1.00 37.81 ? 189 ILE D C   1 
ATOM   3388 O O   . ILE D  2 43  ? -37.647 -17.238  -20.732 1.00 38.34 ? 189 ILE D O   1 
ATOM   3389 C CB  . ILE D  2 43  ? -39.584 -17.619  -18.100 1.00 39.14 ? 189 ILE D CB  1 
ATOM   3390 C CG1 . ILE D  2 43  ? -39.961 -18.486  -16.892 1.00 38.94 ? 189 ILE D CG1 1 
ATOM   3391 C CG2 . ILE D  2 43  ? -40.422 -18.006  -19.309 1.00 39.81 ? 189 ILE D CG2 1 
ATOM   3392 C CD1 . ILE D  2 43  ? -39.596 -19.958  -17.011 1.00 38.78 ? 189 ILE D CD1 1 
ATOM   3393 N N   . SER D  2 44  ? -37.601 -15.516  -19.302 1.00 38.36 ? 190 SER D N   1 
ATOM   3394 C CA  . SER D  2 44  ? -37.310 -14.502  -20.302 1.00 40.59 ? 190 SER D CA  1 
ATOM   3395 C C   . SER D  2 44  ? -36.756 -13.284  -19.556 1.00 44.40 ? 190 SER D C   1 
ATOM   3396 O O   . SER D  2 44  ? -36.779 -13.260  -18.312 1.00 40.88 ? 190 SER D O   1 
ATOM   3397 C CB  . SER D  2 44  ? -38.594 -14.123  -21.048 1.00 41.17 ? 190 SER D CB  1 
ATOM   3398 O OG  . SER D  2 44  ? -39.390 -13.259  -20.245 1.00 42.41 ? 190 SER D OG  1 
ATOM   3399 N N   . PRO D  2 45  ? -36.268 -12.264  -20.294 1.00 46.93 ? 191 PRO D N   1 
ATOM   3400 C CA  . PRO D  2 45  ? -35.742 -11.075  -19.601 1.00 48.26 ? 191 PRO D CA  1 
ATOM   3401 C C   . PRO D  2 45  ? -36.782 -10.355  -18.734 1.00 49.94 ? 191 PRO D C   1 
ATOM   3402 O O   . PRO D  2 45  ? -36.412 -9.632   -17.817 1.00 52.17 ? 191 PRO D O   1 
ATOM   3403 C CB  . PRO D  2 45  ? -35.271 -10.149  -20.734 1.00 49.22 ? 191 PRO D CB  1 
ATOM   3404 C CG  . PRO D  2 45  ? -35.402 -10.907  -22.010 1.00 50.52 ? 191 PRO D CG  1 
ATOM   3405 C CD  . PRO D  2 45  ? -35.973 -12.268  -21.740 1.00 48.91 ? 191 PRO D CD  1 
ATOM   3406 N N   . THR D  2 46  ? -38.062 -10.561  -19.026 1.00 51.92 ? 192 THR D N   1 
ATOM   3407 C CA  . THR D  2 46  ? -39.157 -9.914   -18.303 1.00 52.23 ? 192 THR D CA  1 
ATOM   3408 C C   . THR D  2 46  ? -39.818 -10.821  -17.256 1.00 51.41 ? 192 THR D C   1 
ATOM   3409 O O   . THR D  2 46  ? -40.614 -10.342  -16.444 1.00 53.66 ? 192 THR D O   1 
ATOM   3410 C CB  . THR D  2 46  ? -40.242 -9.468   -19.300 1.00 54.12 ? 192 THR D CB  1 
ATOM   3411 O OG1 . THR D  2 46  ? -39.633 -9.158   -20.560 1.00 55.30 ? 192 THR D OG1 1 
ATOM   3412 C CG2 . THR D  2 46  ? -40.986 -8.247   -18.792 1.00 57.15 ? 192 THR D CG2 1 
ATOM   3413 N N   . GLU D  2 47  ? -39.499 -12.116  -17.272 1.00 47.15 ? 193 GLU D N   1 
ATOM   3414 C CA  . GLU D  2 47  ? -40.106 -13.077  -16.347 1.00 44.22 ? 193 GLU D CA  1 
ATOM   3415 C C   . GLU D  2 47  ? -39.027 -13.882  -15.609 1.00 37.13 ? 193 GLU D C   1 
ATOM   3416 O O   . GLU D  2 47  ? -38.418 -14.775  -16.177 1.00 34.01 ? 193 GLU D O   1 
ATOM   3417 C CB  . GLU D  2 47  ? -41.073 -14.001  -17.103 1.00 47.30 ? 193 GLU D CB  1 
ATOM   3418 C CG  . GLU D  2 47  ? -41.756 -15.030  -16.204 1.00 52.95 ? 193 GLU D CG  1 
ATOM   3419 C CD  . GLU D  2 47  ? -43.133 -15.465  -16.682 1.00 57.46 ? 193 GLU D CD  1 
ATOM   3420 O OE1 . GLU D  2 47  ? -43.892 -14.622  -17.212 1.00 63.12 ? 193 GLU D OE1 1 
ATOM   3421 O OE2 . GLU D  2 47  ? -43.469 -16.657  -16.501 1.00 56.86 ? 193 GLU D OE2 1 
ATOM   3422 N N   . ARG D  2 48  ? -38.819 -13.548  -14.340 1.00 33.34 ? 194 ARG D N   1 
ATOM   3423 C CA  . ARG D  2 48  ? -37.747 -14.115  -13.511 1.00 34.14 ? 194 ARG D CA  1 
ATOM   3424 C C   . ARG D  2 48  ? -37.846 -15.643  -13.328 1.00 32.22 ? 194 ARG D C   1 
ATOM   3425 O O   . ARG D  2 48  ? -36.817 -16.326  -13.198 1.00 31.51 ? 194 ARG D O   1 
ATOM   3426 C CB  . ARG D  2 48  ? -37.713 -13.419  -12.134 1.00 34.81 ? 194 ARG D CB  1 
ATOM   3427 C CG  . ARG D  2 48  ? -36.686 -13.963  -11.122 1.00 37.44 ? 194 ARG D CG  1 
ATOM   3428 C CD  . ARG D  2 48  ? -35.263 -13.921  -11.677 1.00 39.99 ? 194 ARG D CD  1 
ATOM   3429 N NE  . ARG D  2 48  ? -34.233 -14.557  -10.846 1.00 40.90 ? 194 ARG D NE  1 
ATOM   3430 C CZ  . ARG D  2 48  ? -34.049 -15.877  -10.698 1.00 41.78 ? 194 ARG D CZ  1 
ATOM   3431 N NH1 . ARG D  2 48  ? -34.882 -16.772  -11.253 1.00 39.39 ? 194 ARG D NH1 1 
ATOM   3432 N NH2 . ARG D  2 48  ? -33.035 -16.308  -9.947  1.00 39.72 ? 194 ARG D NH2 1 
ATOM   3433 N N   . CYS D  2 49  ? -39.074 -16.165  -13.304 1.00 28.22 ? 195 CYS D N   1 
ATOM   3434 C CA  . CYS D  2 49  ? -39.298 -17.593  -13.114 1.00 26.72 ? 195 CYS D CA  1 
ATOM   3435 C C   . CYS D  2 49  ? -40.739 -17.957  -13.407 1.00 25.09 ? 195 CYS D C   1 
ATOM   3436 O O   . CYS D  2 49  ? -41.587 -17.090  -13.566 1.00 25.76 ? 195 CYS D O   1 
ATOM   3437 C CB  . CYS D  2 49  ? -38.986 -18.006  -11.667 1.00 25.72 ? 195 CYS D CB  1 
ATOM   3438 S SG  . CYS D  2 49  ? -40.142 -17.215  -10.557 1.00 25.45 ? 195 CYS D SG  1 
ATOM   3439 N N   . ASN D  2 50  ? -41.005 -19.254  -13.462 1.00 24.45 ? 196 ASN D N   1 
ATOM   3440 C CA  . ASN D  2 50  ? -42.385 -19.769  -13.425 1.00 23.59 ? 196 ASN D CA  1 
ATOM   3441 C C   . ASN D  2 50  ? -42.820 -19.808  -11.964 1.00 24.19 ? 196 ASN D C   1 
ATOM   3442 O O   . ASN D  2 50  ? -42.498 -20.744  -11.233 1.00 24.21 ? 196 ASN D O   1 
ATOM   3443 C CB  . ASN D  2 50  ? -42.422 -21.156  -14.040 1.00 23.67 ? 196 ASN D CB  1 
ATOM   3444 C CG  . ASN D  2 50  ? -43.826 -21.727  -14.162 1.00 24.45 ? 196 ASN D CG  1 
ATOM   3445 O OD1 . ASN D  2 50  ? -44.742 -21.387  -13.413 1.00 24.58 ? 196 ASN D OD1 1 
ATOM   3446 N ND2 . ASN D  2 50  ? -43.987 -22.630  -15.112 1.00 25.30 ? 196 ASN D ND2 1 
ATOM   3447 N N   . ARG D  2 51  ? -43.542 -18.780  -11.540 1.00 24.02 ? 197 ARG D N   1 
ATOM   3448 C CA  . ARG D  2 51  ? -43.870 -18.600  -10.131 1.00 25.07 ? 197 ARG D CA  1 
ATOM   3449 C C   . ARG D  2 51  ? -44.767 -19.706  -9.576  1.00 23.53 ? 197 ARG D C   1 
ATOM   3450 O O   . ARG D  2 51  ? -44.592 -20.176  -8.448  1.00 20.10 ? 197 ARG D O   1 
ATOM   3451 C CB  . ARG D  2 51  ? -44.568 -17.254  -9.954  1.00 28.14 ? 197 ARG D CB  1 
ATOM   3452 C CG  . ARG D  2 51  ? -44.682 -16.794  -8.508  1.00 32.12 ? 197 ARG D CG  1 
ATOM   3453 C CD  . ARG D  2 51  ? -45.274 -15.404  -8.469  1.00 35.43 ? 197 ARG D CD  1 
ATOM   3454 N NE  . ARG D  2 51  ? -45.763 -15.061  -7.145  1.00 37.99 ? 197 ARG D NE  1 
ATOM   3455 C CZ  . ARG D  2 51  ? -45.125 -14.288  -6.278  1.00 41.50 ? 197 ARG D CZ  1 
ATOM   3456 N NH1 . ARG D  2 51  ? -45.690 -14.055  -5.094  1.00 43.28 ? 197 ARG D NH1 1 
ATOM   3457 N NH2 . ARG D  2 51  ? -43.935 -13.740  -6.583  1.00 42.78 ? 197 ARG D NH2 1 
ATOM   3458 N N   . ARG D  2 52  ? -45.752 -20.091  -10.370 1.00 23.25 ? 198 ARG D N   1 
ATOM   3459 C CA  . ARG D  2 52  ? -46.723 -21.098  -9.955  1.00 23.60 ? 198 ARG D CA  1 
ATOM   3460 C C   . ARG D  2 52  ? -46.048 -22.444  -9.666  1.00 22.78 ? 198 ARG D C   1 
ATOM   3461 O O   . ARG D  2 52  ? -46.321 -23.114  -8.660  1.00 24.32 ? 198 ARG D O   1 
ATOM   3462 C CB  . ARG D  2 52  ? -47.776 -21.256  -11.050 1.00 25.51 ? 198 ARG D CB  1 
ATOM   3463 C CG  . ARG D  2 52  ? -49.124 -21.620  -10.497 1.00 27.40 ? 198 ARG D CG  1 
ATOM   3464 C CD  . ARG D  2 52  ? -50.224 -21.644  -11.539 1.00 27.71 ? 198 ARG D CD  1 
ATOM   3465 N NE  . ARG D  2 52  ? -51.343 -22.446  -11.046 1.00 28.57 ? 198 ARG D NE  1 
ATOM   3466 C CZ  . ARG D  2 52  ? -52.454 -22.711  -11.722 1.00 28.36 ? 198 ARG D CZ  1 
ATOM   3467 N NH1 . ARG D  2 52  ? -52.631 -22.218  -12.934 1.00 28.32 ? 198 ARG D NH1 1 
ATOM   3468 N NH2 . ARG D  2 52  ? -53.393 -23.469  -11.164 1.00 29.08 ? 198 ARG D NH2 1 
ATOM   3469 N N   . LYS D  2 53  ? -45.120 -22.791  -10.539 1.00 22.39 ? 199 LYS D N   1 
ATOM   3470 C CA  . LYS D  2 53  ? -44.356 -24.014  -10.421 1.00 22.68 ? 199 LYS D CA  1 
ATOM   3471 C C   . LYS D  2 53  ? -43.387 -23.932  -9.229  1.00 20.40 ? 199 LYS D C   1 
ATOM   3472 O O   . LYS D  2 53  ? -43.241 -24.881  -8.490  1.00 18.96 ? 199 LYS D O   1 
ATOM   3473 C CB  . LYS D  2 53  ? -43.596 -24.246  -11.724 1.00 24.93 ? 199 LYS D CB  1 
ATOM   3474 C CG  . LYS D  2 53  ? -43.380 -25.698  -12.041 1.00 27.84 ? 199 LYS D CG  1 
ATOM   3475 C CD  . LYS D  2 53  ? -42.497 -25.874  -13.267 1.00 30.58 ? 199 LYS D CD  1 
ATOM   3476 C CE  . LYS D  2 53  ? -42.126 -27.339  -13.395 1.00 32.89 ? 199 LYS D CE  1 
ATOM   3477 N NZ  . LYS D  2 53  ? -41.381 -27.583  -14.652 1.00 36.94 ? 199 LYS D NZ  1 
ATOM   3478 N N   . CYS D  2 54  ? -42.750 -22.783  -9.055  1.00 19.08 ? 200 CYS D N   1 
ATOM   3479 C CA  . CYS D  2 54  ? -41.864 -22.538  -7.929  1.00 19.61 ? 200 CYS D CA  1 
ATOM   3480 C C   . CYS D  2 54  ? -42.584 -22.686  -6.586  1.00 19.31 ? 200 CYS D C   1 
ATOM   3481 O O   . CYS D  2 54  ? -42.115 -23.373  -5.687  1.00 19.58 ? 200 CYS D O   1 
ATOM   3482 C CB  . CYS D  2 54  ? -41.248 -21.135  -8.074  1.00 20.21 ? 200 CYS D CB  1 
ATOM   3483 S SG  . CYS D  2 54  ? -40.415 -20.529  -6.589  1.00 21.87 ? 200 CYS D SG  1 
ATOM   3484 N N   . HIS D  2 55  ? -43.740 -22.043  -6.469  1.00 18.84 ? 201 HIS D N   1 
ATOM   3485 C CA  . HIS D  2 55  ? -44.576 -22.164  -5.273  1.00 19.17 ? 201 HIS D CA  1 
ATOM   3486 C C   . HIS D  2 55  ? -44.988 -23.590  -4.957  1.00 18.69 ? 201 HIS D C   1 
ATOM   3487 O O   . HIS D  2 55  ? -44.899 -24.033  -3.805  1.00 17.43 ? 201 HIS D O   1 
ATOM   3488 C CB  . HIS D  2 55  ? -45.807 -21.263  -5.401  1.00 19.95 ? 201 HIS D CB  1 
ATOM   3489 C CG  . HIS D  2 55  ? -45.567 -19.861  -4.939  1.00 21.24 ? 201 HIS D CG  1 
ATOM   3490 N ND1 . HIS D  2 55  ? -46.576 -19.047  -4.467  1.00 22.70 ? 201 HIS D ND1 1 
ATOM   3491 C CD2 . HIS D  2 55  ? -44.429 -19.139  -4.836  1.00 21.82 ? 201 HIS D CD2 1 
ATOM   3492 C CE1 . HIS D  2 55  ? -46.076 -17.878  -4.119  1.00 22.17 ? 201 HIS D CE1 1 
ATOM   3493 N NE2 . HIS D  2 55  ? -44.775 -17.905  -4.339  1.00 22.69 ? 201 HIS D NE2 1 
ATOM   3494 N N   . LYS D  2 56  ? -45.416 -24.322  -5.981  1.00 19.23 ? 202 LYS D N   1 
ATOM   3495 C CA  . LYS D  2 56  ? -45.741 -25.744  -5.821  1.00 19.58 ? 202 LYS D CA  1 
ATOM   3496 C C   . LYS D  2 56  ? -44.552 -26.522  -5.257  1.00 18.37 ? 202 LYS D C   1 
ATOM   3497 O O   . LYS D  2 56  ? -44.718 -27.322  -4.335  1.00 18.05 ? 202 LYS D O   1 
ATOM   3498 C CB  . LYS D  2 56  ? -46.173 -26.347  -7.155  1.00 22.00 ? 202 LYS D CB  1 
ATOM   3499 C CG  . LYS D  2 56  ? -46.724 -27.761  -7.106  1.00 24.35 ? 202 LYS D CG  1 
ATOM   3500 C CD  . LYS D  2 56  ? -47.129 -28.126  -8.531  1.00 27.84 ? 202 LYS D CD  1 
ATOM   3501 C CE  . LYS D  2 56  ? -47.348 -29.608  -8.722  1.00 31.03 ? 202 LYS D CE  1 
ATOM   3502 N NZ  . LYS D  2 56  ? -48.185 -30.181  -7.629  1.00 34.07 ? 202 LYS D NZ  1 
ATOM   3503 N N   . ALA D  2 57  ? -43.360 -26.295  -5.799  1.00 17.52 ? 203 ALA D N   1 
ATOM   3504 C CA  . ALA D  2 57  ? -42.168 -27.004  -5.308  1.00 17.35 ? 203 ALA D CA  1 
ATOM   3505 C C   . ALA D  2 57  ? -41.803 -26.633  -3.854  1.00 17.38 ? 203 ALA D C   1 
ATOM   3506 O O   . ALA D  2 57  ? -41.357 -27.475  -3.077  1.00 16.04 ? 203 ALA D O   1 
ATOM   3507 C CB  . ALA D  2 57  ? -40.990 -26.760  -6.234  1.00 16.97 ? 203 ALA D CB  1 
ATOM   3508 N N   . LEU D  2 58  ? -41.971 -25.364  -3.508  1.00 18.02 ? 204 LEU D N   1 
ATOM   3509 C CA  . LEU D  2 58  ? -41.797 -24.906  -2.123  1.00 19.31 ? 204 LEU D CA  1 
ATOM   3510 C C   . LEU D  2 58  ? -42.756 -25.634  -1.170  1.00 18.95 ? 204 LEU D C   1 
ATOM   3511 O O   . LEU D  2 58  ? -42.356 -26.126  -0.114  1.00 17.61 ? 204 LEU D O   1 
ATOM   3512 C CB  . LEU D  2 58  ? -42.039 -23.377  -2.036  1.00 20.29 ? 204 LEU D CB  1 
ATOM   3513 C CG  . LEU D  2 58  ? -40.893 -22.350  -1.974  1.00 22.01 ? 204 LEU D CG  1 
ATOM   3514 C CD1 . LEU D  2 58  ? -39.523 -22.945  -1.987  1.00 23.07 ? 204 LEU D CD1 1 
ATOM   3515 C CD2 . LEU D  2 58  ? -41.022 -21.234  -3.010  1.00 23.63 ? 204 LEU D CD2 1 
ATOM   3516 N N   . ARG D  2 59  ? -44.031 -25.682  -1.552  1.00 19.45 ? 205 ARG D N   1 
ATOM   3517 C CA  . ARG D  2 59  ? -45.050 -26.346  -0.758  1.00 18.98 ? 205 ARG D CA  1 
ATOM   3518 C C   . ARG D  2 59  ? -44.674 -27.798  -0.492  1.00 19.64 ? 205 ARG D C   1 
ATOM   3519 O O   . ARG D  2 59  ? -44.716 -28.263  0.648   1.00 19.14 ? 205 ARG D O   1 
ATOM   3520 C CB  . ARG D  2 59  ? -46.404 -26.259  -1.457  1.00 18.83 ? 205 ARG D CB  1 
ATOM   3521 C CG  . ARG D  2 59  ? -47.007 -24.873  -1.400  1.00 19.15 ? 205 ARG D CG  1 
ATOM   3522 C CD  . ARG D  2 59  ? -48.512 -24.861  -1.689  1.00 18.91 ? 205 ARG D CD  1 
ATOM   3523 N NE  . ARG D  2 59  ? -48.844 -25.553  -2.920  1.00 18.54 ? 205 ARG D NE  1 
ATOM   3524 C CZ  . ARG D  2 59  ? -48.880 -25.002  -4.126  1.00 17.95 ? 205 ARG D CZ  1 
ATOM   3525 N NH1 . ARG D  2 59  ? -49.187 -25.754  -5.175  1.00 19.52 ? 205 ARG D NH1 1 
ATOM   3526 N NH2 . ARG D  2 59  ? -48.579 -23.733  -4.307  1.00 18.66 ? 205 ARG D NH2 1 
ATOM   3527 N N   . GLN D  2 60  ? -44.271 -28.488  -1.551  1.00 20.61 ? 206 GLN D N   1 
ATOM   3528 C CA  . GLN D  2 60  ? -43.841 -29.874  -1.466  1.00 21.71 ? 206 GLN D CA  1 
ATOM   3529 C C   . GLN D  2 60  ? -42.666 -30.082  -0.526  1.00 19.99 ? 206 GLN D C   1 
ATOM   3530 O O   . GLN D  2 60  ? -42.613 -31.087  0.193   1.00 18.74 ? 206 GLN D O   1 
ATOM   3531 C CB  . GLN D  2 60  ? -43.476 -30.415  -2.853  1.00 24.63 ? 206 GLN D CB  1 
ATOM   3532 C CG  . GLN D  2 60  ? -44.709 -30.784  -3.657  1.00 28.39 ? 206 GLN D CG  1 
ATOM   3533 C CD  . GLN D  2 60  ? -44.423 -30.996  -5.125  1.00 32.39 ? 206 GLN D CD  1 
ATOM   3534 O OE1 . GLN D  2 60  ? -43.323 -30.710  -5.607  1.00 36.15 ? 206 GLN D OE1 1 
ATOM   3535 N NE2 . GLN D  2 60  ? -45.423 -31.473  -5.855  1.00 33.21 ? 206 GLN D NE2 1 
ATOM   3536 N N   . PHE D  2 61  ? -41.720 -29.154  -0.560  1.00 18.48 ? 207 PHE D N   1 
ATOM   3537 C CA  . PHE D  2 61  ? -40.557 -29.209  0.314   1.00 18.03 ? 207 PHE D CA  1 
ATOM   3538 C C   . PHE D  2 61  ? -40.987 -29.136  1.773   1.00 18.40 ? 207 PHE D C   1 
ATOM   3539 O O   . PHE D  2 61  ? -40.620 -29.984  2.582   1.00 18.97 ? 207 PHE D O   1 
ATOM   3540 C CB  . PHE D  2 61  ? -39.590 -28.064  -0.032  1.00 18.73 ? 207 PHE D CB  1 
ATOM   3541 C CG  . PHE D  2 61  ? -38.394 -27.981  0.863   1.00 17.53 ? 207 PHE D CG  1 
ATOM   3542 C CD1 . PHE D  2 61  ? -37.373 -28.889  0.732   1.00 17.80 ? 207 PHE D CD1 1 
ATOM   3543 C CD2 . PHE D  2 61  ? -38.286 -26.988  1.818   1.00 17.93 ? 207 PHE D CD2 1 
ATOM   3544 C CE1 . PHE D  2 61  ? -36.268 -28.830  1.552   1.00 18.04 ? 207 PHE D CE1 1 
ATOM   3545 C CE2 . PHE D  2 61  ? -37.159 -26.911  2.644   1.00 18.11 ? 207 PHE D CE2 1 
ATOM   3546 C CZ  . PHE D  2 61  ? -36.150 -27.839  2.501   1.00 18.03 ? 207 PHE D CZ  1 
ATOM   3547 N N   . PHE D  2 62  ? -41.793 -28.134  2.109   1.00 19.54 ? 208 PHE D N   1 
ATOM   3548 C CA  . PHE D  2 62  ? -42.231 -27.972  3.495   1.00 20.36 ? 208 PHE D CA  1 
ATOM   3549 C C   . PHE D  2 62  ? -43.237 -29.015  3.938   1.00 22.00 ? 208 PHE D C   1 
ATOM   3550 O O   . PHE D  2 62  ? -43.290 -29.329  5.135   1.00 20.35 ? 208 PHE D O   1 
ATOM   3551 C CB  . PHE D  2 62  ? -42.743 -26.559  3.756   1.00 19.73 ? 208 PHE D CB  1 
ATOM   3552 C CG  . PHE D  2 62  ? -41.644 -25.538  3.784   1.00 20.21 ? 208 PHE D CG  1 
ATOM   3553 C CD1 . PHE D  2 62  ? -40.867 -25.379  4.914   1.00 20.35 ? 208 PHE D CD1 1 
ATOM   3554 C CD2 . PHE D  2 62  ? -41.366 -24.766  2.677   1.00 19.93 ? 208 PHE D CD2 1 
ATOM   3555 C CE1 . PHE D  2 62  ? -39.830 -24.461  4.945   1.00 20.45 ? 208 PHE D CE1 1 
ATOM   3556 C CE2 . PHE D  2 62  ? -40.338 -23.846  2.692   1.00 20.55 ? 208 PHE D CE2 1 
ATOM   3557 C CZ  . PHE D  2 62  ? -39.566 -23.687  3.832   1.00 20.60 ? 208 PHE D CZ  1 
ATOM   3558 N N   . ASP D  2 63  ? -43.993 -29.582  2.986   1.00 23.40 ? 209 ASP D N   1 
ATOM   3559 C CA  . ASP D  2 63  ? -44.948 -30.671  3.290   1.00 25.38 ? 209 ASP D CA  1 
ATOM   3560 C C   . ASP D  2 63  ? -44.276 -32.026  3.441   1.00 25.38 ? 209 ASP D C   1 
ATOM   3561 O O   . ASP D  2 63  ? -44.667 -32.809  4.294   1.00 24.16 ? 209 ASP D O   1 
ATOM   3562 C CB  . ASP D  2 63  ? -46.030 -30.791  2.201   1.00 28.63 ? 209 ASP D CB  1 
ATOM   3563 C CG  . ASP D  2 63  ? -47.112 -29.717  2.311   1.00 32.35 ? 209 ASP D CG  1 
ATOM   3564 O OD1 . ASP D  2 63  ? -47.225 -29.050  3.376   1.00 32.50 ? 209 ASP D OD1 1 
ATOM   3565 O OD2 . ASP D  2 63  ? -47.852 -29.530  1.313   1.00 35.00 ? 209 ASP D OD2 1 
ATOM   3566 N N   . ARG D  2 64  ? -43.280 -32.315  2.610   1.00 24.47 ? 210 ARG D N   1 
ATOM   3567 C CA  . ARG D  2 64  ? -42.731 -33.678  2.533   1.00 26.28 ? 210 ARG D CA  1 
ATOM   3568 C C   . ARG D  2 64  ? -41.353 -33.858  3.183   1.00 25.01 ? 210 ARG D C   1 
ATOM   3569 O O   . ARG D  2 64  ? -40.834 -34.957  3.187   1.00 24.66 ? 210 ARG D O   1 
ATOM   3570 C CB  . ARG D  2 64  ? -42.714 -34.152  1.080   1.00 29.35 ? 210 ARG D CB  1 
ATOM   3571 C CG  . ARG D  2 64  ? -44.073 -34.026  0.393   1.00 33.86 ? 210 ARG D CG  1 
ATOM   3572 C CD  . ARG D  2 64  ? -44.336 -35.060  -0.698  1.00 40.00 ? 210 ARG D CD  1 
ATOM   3573 N NE  . ARG D  2 64  ? -44.005 -34.587  -2.048  1.00 46.28 ? 210 ARG D NE  1 
ATOM   3574 C CZ  . ARG D  2 64  ? -42.989 -35.026  -2.815  1.00 50.35 ? 210 ARG D CZ  1 
ATOM   3575 N NH1 . ARG D  2 64  ? -42.812 -34.496  -4.022  1.00 50.69 ? 210 ARG D NH1 1 
ATOM   3576 N NH2 . ARG D  2 64  ? -42.151 -35.991  -2.415  1.00 49.95 ? 210 ARG D NH2 1 
ATOM   3577 N N   . VAL D  2 65  ? -40.762 -32.787  3.723   1.00 23.65 ? 211 VAL D N   1 
ATOM   3578 C CA  . VAL D  2 65  ? -39.499 -32.902  4.470   1.00 22.93 ? 211 VAL D CA  1 
ATOM   3579 C C   . VAL D  2 65  ? -39.793 -32.589  5.926   1.00 23.16 ? 211 VAL D C   1 
ATOM   3580 O O   . VAL D  2 65  ? -40.429 -31.576  6.216   1.00 22.10 ? 211 VAL D O   1 
ATOM   3581 C CB  . VAL D  2 65  ? -38.414 -31.949  3.930   1.00 22.18 ? 211 VAL D CB  1 
ATOM   3582 C CG1 . VAL D  2 65  ? -37.122 -32.049  4.740   1.00 22.72 ? 211 VAL D CG1 1 
ATOM   3583 C CG2 . VAL D  2 65  ? -38.135 -32.242  2.462   1.00 23.09 ? 211 VAL D CG2 1 
ATOM   3584 N N   . PRO D  2 66  ? -39.307 -33.434  6.860   1.00 24.22 ? 212 PRO D N   1 
ATOM   3585 C CA  . PRO D  2 66  ? -39.583 -33.128  8.279   1.00 25.85 ? 212 PRO D CA  1 
ATOM   3586 C C   . PRO D  2 66  ? -39.081 -31.768  8.769   1.00 25.87 ? 212 PRO D C   1 
ATOM   3587 O O   . PRO D  2 66  ? -38.087 -31.231  8.270   1.00 24.74 ? 212 PRO D O   1 
ATOM   3588 C CB  . PRO D  2 66  ? -38.901 -34.261  9.060   1.00 25.92 ? 212 PRO D CB  1 
ATOM   3589 C CG  . PRO D  2 66  ? -38.172 -35.092  8.065   1.00 26.11 ? 212 PRO D CG  1 
ATOM   3590 C CD  . PRO D  2 66  ? -38.551 -34.678  6.676   1.00 24.35 ? 212 PRO D CD  1 
ATOM   3591 N N   . SER D  2 67  ? -39.793 -31.249  9.761   1.00 27.95 ? 213 SER D N   1 
ATOM   3592 C CA  . SER D  2 67  ? -39.511 -29.971  10.403  1.00 29.42 ? 213 SER D CA  1 
ATOM   3593 C C   . SER D  2 67  ? -38.095 -29.888  10.917  1.00 28.90 ? 213 SER D C   1 
ATOM   3594 O O   . SER D  2 67  ? -37.526 -28.810  10.935  1.00 27.96 ? 213 SER D O   1 
ATOM   3595 C CB  . SER D  2 67  ? -40.416 -29.759  11.618  1.00 31.68 ? 213 SER D CB  1 
ATOM   3596 O OG  . SER D  2 67  ? -41.677 -30.348  11.445  1.00 37.30 ? 213 SER D OG  1 
ATOM   3597 N N   . GLU D  2 68  ? -37.529 -31.010  11.353  1.00 28.23 ? 214 GLU D N   1 
ATOM   3598 C CA  . GLU D  2 68  ? -36.155 -30.988  11.862  1.00 29.92 ? 214 GLU D CA  1 
ATOM   3599 C C   . GLU D  2 68  ? -35.173 -30.399  10.840  1.00 27.09 ? 214 GLU D C   1 
ATOM   3600 O O   . GLU D  2 68  ? -34.232 -29.706  11.218  1.00 26.56 ? 214 GLU D O   1 
ATOM   3601 C CB  . GLU D  2 68  ? -35.688 -32.368  12.374  1.00 32.96 ? 214 GLU D CB  1 
ATOM   3602 C CG  . GLU D  2 68  ? -35.278 -33.359  11.300  1.00 37.66 ? 214 GLU D CG  1 
ATOM   3603 C CD  . GLU D  2 68  ? -34.756 -34.682  11.862  1.00 41.88 ? 214 GLU D CD  1 
ATOM   3604 O OE1 . GLU D  2 68  ? -33.650 -34.697  12.446  1.00 42.64 ? 214 GLU D OE1 1 
ATOM   3605 O OE2 . GLU D  2 68  ? -35.444 -35.711  11.688  1.00 43.49 ? 214 GLU D OE2 1 
ATOM   3606 N N   . TYR D  2 69  ? -35.390 -30.648  9.551   1.00 24.17 ? 215 TYR D N   1 
ATOM   3607 C CA  . TYR D  2 69  ? -34.549 -30.032  8.517   1.00 23.59 ? 215 TYR D CA  1 
ATOM   3608 C C   . TYR D  2 69  ? -35.055 -28.663  8.121   1.00 22.12 ? 215 TYR D C   1 
ATOM   3609 O O   . TYR D  2 69  ? -34.313 -27.696  7.985   1.00 20.29 ? 215 TYR D O   1 
ATOM   3610 C CB  . TYR D  2 69  ? -34.493 -30.927  7.280   1.00 24.56 ? 215 TYR D CB  1 
ATOM   3611 C CG  . TYR D  2 69  ? -33.911 -32.283  7.603   1.00 25.95 ? 215 TYR D CG  1 
ATOM   3612 C CD1 . TYR D  2 69  ? -32.574 -32.420  7.905   1.00 26.44 ? 215 TYR D CD1 1 
ATOM   3613 C CD2 . TYR D  2 69  ? -34.711 -33.419  7.653   1.00 28.69 ? 215 TYR D CD2 1 
ATOM   3614 C CE1 . TYR D  2 69  ? -32.034 -33.653  8.224   1.00 26.89 ? 215 TYR D CE1 1 
ATOM   3615 C CE2 . TYR D  2 69  ? -34.173 -34.656  7.966   1.00 28.11 ? 215 TYR D CE2 1 
ATOM   3616 C CZ  . TYR D  2 69  ? -32.831 -34.753  8.239   1.00 27.65 ? 215 TYR D CZ  1 
ATOM   3617 O OH  . TYR D  2 69  ? -32.299 -35.968  8.554   1.00 29.93 ? 215 TYR D OH  1 
ATOM   3618 N N   . THR D  2 70  ? -36.355 -28.601  7.953   1.00 22.40 ? 216 THR D N   1 
ATOM   3619 C CA  . THR D  2 70  ? -37.028 -27.481  7.319   1.00 23.32 ? 216 THR D CA  1 
ATOM   3620 C C   . THR D  2 70  ? -37.001 -26.203  8.193   1.00 23.38 ? 216 THR D C   1 
ATOM   3621 O O   . THR D  2 70  ? -36.652 -25.117  7.709   1.00 22.83 ? 216 THR D O   1 
ATOM   3622 C CB  . THR D  2 70  ? -38.433 -28.016  6.921   1.00 24.15 ? 216 THR D CB  1 
ATOM   3623 O OG1 . THR D  2 70  ? -38.475 -28.301  5.505   1.00 26.03 ? 216 THR D OG1 1 
ATOM   3624 C CG2 . THR D  2 70  ? -39.476 -27.166  7.327   1.00 23.65 ? 216 THR D CG2 1 
ATOM   3625 N N   . TYR D  2 71  ? -37.316 -26.344  9.479   1.00 22.99 ? 217 TYR D N   1 
ATOM   3626 C CA  . TYR D  2 71  ? -37.370 -25.198  10.403  1.00 24.38 ? 217 TYR D CA  1 
ATOM   3627 C C   . TYR D  2 71  ? -35.962 -24.694  10.688  1.00 23.63 ? 217 TYR D C   1 
ATOM   3628 O O   . TYR D  2 71  ? -35.723 -23.510  10.878  1.00 22.56 ? 217 TYR D O   1 
ATOM   3629 C CB  . TYR D  2 71  ? -38.060 -25.587  11.724  1.00 24.93 ? 217 TYR D CB  1 
ATOM   3630 C CG  . TYR D  2 71  ? -39.559 -25.870  11.619  1.00 27.02 ? 217 TYR D CG  1 
ATOM   3631 C CD1 . TYR D  2 71  ? -40.177 -26.026  10.391  1.00 28.31 ? 217 TYR D CD1 1 
ATOM   3632 C CD2 . TYR D  2 71  ? -40.335 -26.029  12.751  1.00 29.69 ? 217 TYR D CD2 1 
ATOM   3633 C CE1 . TYR D  2 71  ? -41.518 -26.311  10.289  1.00 30.48 ? 217 TYR D CE1 1 
ATOM   3634 C CE2 . TYR D  2 71  ? -41.689 -26.324  12.656  1.00 30.39 ? 217 TYR D CE2 1 
ATOM   3635 C CZ  . TYR D  2 71  ? -42.267 -26.454  11.420  1.00 30.52 ? 217 TYR D CZ  1 
ATOM   3636 O OH  . TYR D  2 71  ? -43.600 -26.760  11.275  1.00 37.74 ? 217 TYR D OH  1 
ATOM   3637 N N   . ARG D  2 72  ? -35.026 -25.622  10.701  1.00 23.86 ? 218 ARG D N   1 
ATOM   3638 C CA  . ARG D  2 72  ? -33.647 -25.281  10.946  1.00 26.13 ? 218 ARG D CA  1 
ATOM   3639 C C   . ARG D  2 72  ? -33.114 -24.363  9.860   1.00 23.13 ? 218 ARG D C   1 
ATOM   3640 O O   . ARG D  2 72  ? -32.348 -23.481  10.151  1.00 21.72 ? 218 ARG D O   1 
ATOM   3641 C CB  . ARG D  2 72  ? -32.818 -26.554  11.039  1.00 29.73 ? 218 ARG D CB  1 
ATOM   3642 C CG  . ARG D  2 72  ? -31.671 -26.458  12.004  1.00 36.50 ? 218 ARG D CG  1 
ATOM   3643 C CD  . ARG D  2 72  ? -30.889 -27.761  12.009  1.00 41.48 ? 218 ARG D CD  1 
ATOM   3644 N NE  . ARG D  2 72  ? -29.453 -27.542  12.169  1.00 45.14 ? 218 ARG D NE  1 
ATOM   3645 C CZ  . ARG D  2 72  ? -28.527 -28.491  12.040  1.00 46.50 ? 218 ARG D CZ  1 
ATOM   3646 N NH1 . ARG D  2 72  ? -28.873 -29.743  11.749  1.00 47.26 ? 218 ARG D NH1 1 
ATOM   3647 N NH2 . ARG D  2 72  ? -27.249 -28.181  12.211  1.00 47.75 ? 218 ARG D NH2 1 
ATOM   3648 N N   . MET D  2 73  ? -33.541 -24.567  8.611   1.00 22.26 ? 219 MET D N   1 
ATOM   3649 C CA  . MET D  2 73  ? -33.121 -23.702  7.510   1.00 21.54 ? 219 MET D CA  1 
ATOM   3650 C C   . MET D  2 73  ? -33.810 -22.335  7.564   1.00 21.19 ? 219 MET D C   1 
ATOM   3651 O O   . MET D  2 73  ? -33.190 -21.307  7.350   1.00 20.71 ? 219 MET D O   1 
ATOM   3652 C CB  . MET D  2 73  ? -33.391 -24.387  6.178   1.00 21.90 ? 219 MET D CB  1 
ATOM   3653 C CG  . MET D  2 73  ? -32.422 -25.545  5.913   1.00 23.14 ? 219 MET D CG  1 
ATOM   3654 S SD  . MET D  2 73  ? -33.025 -26.545  4.559   1.00 27.39 ? 219 MET D SD  1 
ATOM   3655 C CE  . MET D  2 73  ? -32.635 -25.454  3.185   1.00 26.49 ? 219 MET D CE  1 
ATOM   3656 N N   . LEU D  2 74  ? -35.096 -22.344  7.889   1.00 20.70 ? 220 LEU D N   1 
ATOM   3657 C CA  . LEU D  2 74  ? -35.934 -21.151  7.850   1.00 21.29 ? 220 LEU D CA  1 
ATOM   3658 C C   . LEU D  2 74  ? -35.703 -20.229  9.030   1.00 20.25 ? 220 LEU D C   1 
ATOM   3659 O O   . LEU D  2 74  ? -35.752 -19.008  8.885   1.00 19.40 ? 220 LEU D O   1 
ATOM   3660 C CB  . LEU D  2 74  ? -37.411 -21.590  7.827   1.00 22.97 ? 220 LEU D CB  1 
ATOM   3661 C CG  . LEU D  2 74  ? -38.449 -20.698  7.187   1.00 24.03 ? 220 LEU D CG  1 
ATOM   3662 C CD1 . LEU D  2 74  ? -38.062 -20.319  5.772   1.00 25.32 ? 220 LEU D CD1 1 
ATOM   3663 C CD2 . LEU D  2 74  ? -39.778 -21.436  7.199   1.00 24.28 ? 220 LEU D CD2 1 
ATOM   3664 N N   . PHE D  2 75  ? -35.432 -20.808  10.195  1.00 20.66 ? 221 PHE D N   1 
ATOM   3665 C CA  . PHE D  2 75  ? -35.330 -20.040  11.439  1.00 21.16 ? 221 PHE D CA  1 
ATOM   3666 C C   . PHE D  2 75  ? -33.962 -20.058  12.112  1.00 23.17 ? 221 PHE D C   1 
ATOM   3667 O O   . PHE D  2 75  ? -33.857 -19.745  13.303  1.00 25.10 ? 221 PHE D O   1 
ATOM   3668 C CB  . PHE D  2 75  ? -36.367 -20.565  12.420  1.00 20.67 ? 221 PHE D CB  1 
ATOM   3669 C CG  . PHE D  2 75  ? -37.775 -20.582  11.866  1.00 21.44 ? 221 PHE D CG  1 
ATOM   3670 C CD1 . PHE D  2 75  ? -38.381 -19.418  11.410  1.00 21.69 ? 221 PHE D CD1 1 
ATOM   3671 C CD2 . PHE D  2 75  ? -38.508 -21.766  11.823  1.00 22.77 ? 221 PHE D CD2 1 
ATOM   3672 C CE1 . PHE D  2 75  ? -39.686 -19.427  10.937  1.00 21.24 ? 221 PHE D CE1 1 
ATOM   3673 C CE2 . PHE D  2 75  ? -39.813 -21.781  11.329  1.00 21.73 ? 221 PHE D CE2 1 
ATOM   3674 C CZ  . PHE D  2 75  ? -40.396 -20.614  10.888  1.00 21.34 ? 221 PHE D CZ  1 
ATOM   3675 N N   . CYS D  2 76  ? -32.921 -20.421  11.370  1.00 22.91 ? 222 CYS D N   1 
ATOM   3676 C CA  . CYS D  2 76  ? -31.568 -20.479  11.921  1.00 23.53 ? 222 CYS D CA  1 
ATOM   3677 C C   . CYS D  2 76  ? -31.128 -19.100  12.447  1.00 24.31 ? 222 CYS D C   1 
ATOM   3678 O O   . CYS D  2 76  ? -31.390 -18.084  11.814  1.00 22.63 ? 222 CYS D O   1 
ATOM   3679 C CB  . CYS D  2 76  ? -30.576 -20.981  10.874  1.00 23.46 ? 222 CYS D CB  1 
ATOM   3680 S SG  . CYS D  2 76  ? -30.827 -20.335  9.197   1.00 25.23 ? 222 CYS D SG  1 
ATOM   3681 N N   . SER D  2 77  ? -30.492 -19.109  13.618  1.00 25.13 ? 223 SER D N   1 
ATOM   3682 C CA  . SER D  2 77  ? -29.841 -17.950  14.237  1.00 28.75 ? 223 SER D CA  1 
ATOM   3683 C C   . SER D  2 77  ? -28.716 -17.423  13.397  1.00 27.86 ? 223 SER D C   1 
ATOM   3684 O O   . SER D  2 77  ? -27.941 -18.216  12.909  1.00 27.24 ? 223 SER D O   1 
ATOM   3685 C CB  . SER D  2 77  ? -29.144 -18.380  15.535  1.00 30.15 ? 223 SER D CB  1 
ATOM   3686 O OG  . SER D  2 77  ? -29.979 -18.265  16.637  1.00 35.34 ? 223 SER D OG  1 
ATOM   3687 N N   . CYS D  2 78  ? -28.584 -16.098  13.309  1.00 27.15 ? 224 CYS D N   1 
ATOM   3688 C CA  . CYS D  2 78  ? -27.446 -15.459  12.632  1.00 28.79 ? 224 CYS D CA  1 
ATOM   3689 C C   . CYS D  2 78  ? -26.814 -14.362  13.487  1.00 30.30 ? 224 CYS D C   1 
ATOM   3690 O O   . CYS D  2 78  ? -27.506 -13.690  14.240  1.00 29.67 ? 224 CYS D O   1 
ATOM   3691 C CB  . CYS D  2 78  ? -27.891 -14.841  11.311  1.00 28.67 ? 224 CYS D CB  1 
ATOM   3692 S SG  . CYS D  2 78  ? -28.388 -16.069  10.084  1.00 29.47 ? 224 CYS D SG  1 
ATOM   3693 N N   . GLN D  2 79  ? -25.498 -14.209  13.360  1.00 34.04 ? 225 GLN D N   1 
ATOM   3694 C CA  . GLN D  2 79  ? -24.758 -13.094  13.956  1.00 37.21 ? 225 GLN D CA  1 
ATOM   3695 C C   . GLN D  2 79  ? -24.250 -12.106  12.911  1.00 35.54 ? 225 GLN D C   1 
ATOM   3696 O O   . GLN D  2 79  ? -23.835 -11.018  13.271  1.00 34.32 ? 225 GLN D O   1 
ATOM   3697 C CB  . GLN D  2 79  ? -23.547 -13.599  14.732  1.00 40.50 ? 225 GLN D CB  1 
ATOM   3698 C CG  . GLN D  2 79  ? -23.866 -14.316  16.026  1.00 47.75 ? 225 GLN D CG  1 
ATOM   3699 C CD  . GLN D  2 79  ? -22.629 -14.981  16.609  1.00 54.75 ? 225 GLN D CD  1 
ATOM   3700 O OE1 . GLN D  2 79  ? -21.677 -14.310  17.014  1.00 58.98 ? 225 GLN D OE1 1 
ATOM   3701 N NE2 . GLN D  2 79  ? -22.624 -16.308  16.631  1.00 59.20 ? 225 GLN D NE2 1 
ATOM   3702 N N   . ASP D  2 80  ? -24.256 -12.484  11.633  1.00 34.00 ? 226 ASP D N   1 
ATOM   3703 C CA  . ASP D  2 80  ? -23.729 -11.620  10.579  1.00 33.77 ? 226 ASP D CA  1 
ATOM   3704 C C   . ASP D  2 80  ? -24.601 -11.640  9.334   1.00 34.51 ? 226 ASP D C   1 
ATOM   3705 O O   . ASP D  2 80  ? -25.583 -12.377  9.268   1.00 32.62 ? 226 ASP D O   1 
ATOM   3706 C CB  . ASP D  2 80  ? -22.281 -11.998  10.233  1.00 35.15 ? 226 ASP D CB  1 
ATOM   3707 C CG  . ASP D  2 80  ? -22.142 -13.420  9.721   1.00 35.62 ? 226 ASP D CG  1 
ATOM   3708 O OD1 . ASP D  2 80  ? -22.978 -13.894  8.920   1.00 33.89 ? 226 ASP D OD1 1 
ATOM   3709 O OD2 . ASP D  2 80  ? -21.162 -14.070  10.106  1.00 38.45 ? 226 ASP D OD2 1 
ATOM   3710 N N   . GLN D  2 81  ? -24.215 -10.811  8.367   1.00 35.64 ? 227 GLN D N   1 
ATOM   3711 C CA  . GLN D  2 81  ? -24.949 -10.571  7.132   1.00 36.91 ? 227 GLN D CA  1 
ATOM   3712 C C   . GLN D  2 81  ? -24.938 -11.771  6.217   1.00 34.10 ? 227 GLN D C   1 
ATOM   3713 O O   . GLN D  2 81  ? -25.904 -12.030  5.522   1.00 30.62 ? 227 GLN D O   1 
ATOM   3714 C CB  . GLN D  2 81  ? -24.304 -9.412   6.362   1.00 43.65 ? 227 GLN D CB  1 
ATOM   3715 C CG  . GLN D  2 81  ? -25.275 -8.617   5.513   1.00 49.81 ? 227 GLN D CG  1 
ATOM   3716 C CD  . GLN D  2 81  ? -26.037 -7.606   6.345   1.00 57.11 ? 227 GLN D CD  1 
ATOM   3717 O OE1 . GLN D  2 81  ? -25.973 -7.631   7.579   1.00 62.50 ? 227 GLN D OE1 1 
ATOM   3718 N NE2 . GLN D  2 81  ? -26.757 -6.704   5.680   1.00 61.65 ? 227 GLN D NE2 1 
ATOM   3719 N N   . ALA D  2 82  ? -23.810 -12.464  6.178   1.00 30.48 ? 228 ALA D N   1 
ATOM   3720 C CA  . ALA D  2 82  ? -23.658 -13.603  5.309   1.00 30.60 ? 228 ALA D CA  1 
ATOM   3721 C C   . ALA D  2 82  ? -24.703 -14.647  5.666   1.00 28.42 ? 228 ALA D C   1 
ATOM   3722 O O   . ALA D  2 82  ? -25.372 -15.190  4.780   1.00 28.79 ? 228 ALA D O   1 
ATOM   3723 C CB  . ALA D  2 82  ? -22.258 -14.187  5.435   1.00 29.66 ? 228 ALA D CB  1 
ATOM   3724 N N   . CYS D  2 83  ? -24.820 -14.916  6.963   1.00 25.39 ? 229 CYS D N   1 
ATOM   3725 C CA  . CYS D  2 83  ? -25.789 -15.868  7.493   1.00 25.88 ? 229 CYS D CA  1 
ATOM   3726 C C   . CYS D  2 83  ? -27.223 -15.387  7.257   1.00 25.43 ? 229 CYS D C   1 
ATOM   3727 O O   . CYS D  2 83  ? -28.079 -16.175  6.879   1.00 23.64 ? 229 CYS D O   1 
ATOM   3728 C CB  . CYS D  2 83  ? -25.549 -16.082  8.997   1.00 26.15 ? 229 CYS D CB  1 
ATOM   3729 S SG  . CYS D  2 83  ? -26.684 -17.205  9.840   1.00 27.89 ? 229 CYS D SG  1 
ATOM   3730 N N   . ALA D  2 84  ? -27.478 -14.092  7.469   1.00 23.92 ? 230 ALA D N   1 
ATOM   3731 C CA  . ALA D  2 84  ? -28.838 -13.573  7.375   1.00 23.55 ? 230 ALA D CA  1 
ATOM   3732 C C   . ALA D  2 84  ? -29.313 -13.527  5.946   1.00 22.18 ? 230 ALA D C   1 
ATOM   3733 O O   . ALA D  2 84  ? -30.482 -13.661  5.690   1.00 21.74 ? 230 ALA D O   1 
ATOM   3734 C CB  . ALA D  2 84  ? -28.924 -12.196  7.998   1.00 24.80 ? 230 ALA D CB  1 
ATOM   3735 N N   . GLU D  2 85  ? -28.387 -13.326  5.018   1.00 22.26 ? 231 GLU D N   1 
ATOM   3736 C CA  . GLU D  2 85  ? -28.699 -13.294  3.604   1.00 21.90 ? 231 GLU D CA  1 
ATOM   3737 C C   . GLU D  2 85  ? -29.044 -14.720  3.134   1.00 22.22 ? 231 GLU D C   1 
ATOM   3738 O O   . GLU D  2 85  ? -29.986 -14.921  2.345   1.00 21.47 ? 231 GLU D O   1 
ATOM   3739 C CB  . GLU D  2 85  ? -27.514 -12.700  2.831   1.00 22.29 ? 231 GLU D CB  1 
ATOM   3740 C CG  . GLU D  2 85  ? -27.650 -12.690  1.317   1.00 23.75 ? 231 GLU D CG  1 
ATOM   3741 C CD  . GLU D  2 85  ? -28.881 -11.955  0.814   1.00 24.80 ? 231 GLU D CD  1 
ATOM   3742 O OE1 . GLU D  2 85  ? -29.569 -11.269  1.601   1.00 26.24 ? 231 GLU D OE1 1 
ATOM   3743 O OE2 . GLU D  2 85  ? -29.164 -12.061  -0.394  1.00 26.83 ? 231 GLU D OE2 1 
ATOM   3744 N N   . ARG D  2 86  ? -28.293 -15.698  3.637   1.00 21.02 ? 232 ARG D N   1 
ATOM   3745 C CA  . ARG D  2 86  ? -28.559 -17.093  3.350   1.00 20.20 ? 232 ARG D CA  1 
ATOM   3746 C C   . ARG D  2 86  ? -29.969 -17.459  3.815   1.00 20.05 ? 232 ARG D C   1 
ATOM   3747 O O   . ARG D  2 86  ? -30.749 -18.048  3.057   1.00 18.90 ? 232 ARG D O   1 
ATOM   3748 C CB  . ARG D  2 86  ? -27.520 -17.989  4.035   1.00 20.99 ? 232 ARG D CB  1 
ATOM   3749 C CG  . ARG D  2 86  ? -27.841 -19.474  3.963   1.00 21.47 ? 232 ARG D CG  1 
ATOM   3750 C CD  . ARG D  2 86  ? -26.677 -20.329  4.424   1.00 21.23 ? 232 ARG D CD  1 
ATOM   3751 N NE  . ARG D  2 86  ? -25.564 -20.338  3.483   1.00 21.06 ? 232 ARG D NE  1 
ATOM   3752 C CZ  . ARG D  2 86  ? -25.463 -21.126  2.418   1.00 22.65 ? 232 ARG D CZ  1 
ATOM   3753 N NH1 . ARG D  2 86  ? -26.423 -21.974  2.086   1.00 24.90 ? 232 ARG D NH1 1 
ATOM   3754 N NH2 . ARG D  2 86  ? -24.390 -21.075  1.659   1.00 23.24 ? 232 ARG D NH2 1 
ATOM   3755 N N   . ARG D  2 87  ? -30.280 -17.116  5.059   1.00 19.40 ? 233 ARG D N   1 
ATOM   3756 C CA  . ARG D  2 87  ? -31.624 -17.305  5.599   1.00 19.82 ? 233 ARG D CA  1 
ATOM   3757 C C   . ARG D  2 87  ? -32.714 -16.658  4.731   1.00 19.74 ? 233 ARG D C   1 
ATOM   3758 O O   . ARG D  2 87  ? -33.709 -17.298  4.417   1.00 18.73 ? 233 ARG D O   1 
ATOM   3759 C CB  . ARG D  2 87  ? -31.699 -16.753  7.009   1.00 20.69 ? 233 ARG D CB  1 
ATOM   3760 C CG  . ARG D  2 87  ? -32.982 -17.085  7.743   1.00 22.37 ? 233 ARG D CG  1 
ATOM   3761 C CD  . ARG D  2 87  ? -32.909 -16.668  9.214   1.00 23.22 ? 233 ARG D CD  1 
ATOM   3762 N NE  . ARG D  2 87  ? -32.569 -15.249  9.311   1.00 24.54 ? 233 ARG D NE  1 
ATOM   3763 C CZ  . ARG D  2 87  ? -32.014 -14.667  10.365  1.00 25.49 ? 233 ARG D CZ  1 
ATOM   3764 N NH1 . ARG D  2 87  ? -31.750 -15.363  11.457  1.00 26.23 ? 233 ARG D NH1 1 
ATOM   3765 N NH2 . ARG D  2 87  ? -31.747 -13.365  10.328  1.00 26.47 ? 233 ARG D NH2 1 
ATOM   3766 N N   . ARG D  2 88  ? -32.508 -15.394  4.362   1.00 19.77 ? 234 ARG D N   1 
ATOM   3767 C CA  . ARG D  2 88  ? -33.430 -14.670  3.509   1.00 21.42 ? 234 ARG D CA  1 
ATOM   3768 C C   . ARG D  2 88  ? -33.626 -15.374  2.164   1.00 20.83 ? 234 ARG D C   1 
ATOM   3769 O O   . ARG D  2 88  ? -34.711 -15.338  1.589   1.00 22.05 ? 234 ARG D O   1 
ATOM   3770 C CB  . ARG D  2 88  ? -32.933 -13.238  3.270   1.00 21.67 ? 234 ARG D CB  1 
ATOM   3771 C CG  . ARG D  2 88  ? -33.989 -12.318  2.648   1.00 22.79 ? 234 ARG D CG  1 
ATOM   3772 C CD  . ARG D  2 88  ? -33.372 -10.983  2.238   1.00 24.14 ? 234 ARG D CD  1 
ATOM   3773 N NE  . ARG D  2 88  ? -32.489 -11.141  1.093   1.00 24.53 ? 234 ARG D NE  1 
ATOM   3774 C CZ  . ARG D  2 88  ? -32.906 -11.231  -0.162  1.00 27.17 ? 234 ARG D CZ  1 
ATOM   3775 N NH1 . ARG D  2 88  ? -32.022 -11.414  -1.142  1.00 29.21 ? 234 ARG D NH1 1 
ATOM   3776 N NH2 . ARG D  2 88  ? -34.207 -11.171  -0.442  1.00 27.96 ? 234 ARG D NH2 1 
ATOM   3777 N N   . GLN D  2 89  ? -32.572 -16.017  1.683   1.00 20.18 ? 235 GLN D N   1 
ATOM   3778 C CA  . GLN D  2 89  ? -32.584 -16.689  0.396   1.00 20.69 ? 235 GLN D CA  1 
ATOM   3779 C C   . GLN D  2 89  ? -33.179 -18.088  0.425   1.00 19.41 ? 235 GLN D C   1 
ATOM   3780 O O   . GLN D  2 89  ? -33.357 -18.695  -0.628  1.00 18.96 ? 235 GLN D O   1 
ATOM   3781 C CB  . GLN D  2 89  ? -31.165 -16.739  -0.179  1.00 21.99 ? 235 GLN D CB  1 
ATOM   3782 C CG  . GLN D  2 89  ? -30.737 -15.446  -0.829  1.00 23.29 ? 235 GLN D CG  1 
ATOM   3783 C CD  . GLN D  2 89  ? -31.296 -15.277  -2.234  1.00 25.76 ? 235 GLN D CD  1 
ATOM   3784 O OE1 . GLN D  2 89  ? -32.492 -15.363  -2.456  1.00 28.12 ? 235 GLN D OE1 1 
ATOM   3785 N NE2 . GLN D  2 89  ? -30.420 -15.057  -3.193  1.00 27.23 ? 235 GLN D NE2 1 
ATOM   3786 N N   . THR D  2 90  ? -33.513 -18.595  1.603   1.00 19.69 ? 236 THR D N   1 
ATOM   3787 C CA  . THR D  2 90  ? -34.075 -19.949  1.723   1.00 20.30 ? 236 THR D CA  1 
ATOM   3788 C C   . THR D  2 90  ? -35.194 -20.221  0.701   1.00 20.05 ? 236 THR D C   1 
ATOM   3789 O O   . THR D  2 90  ? -35.154 -21.226  -0.014  1.00 18.64 ? 236 THR D O   1 
ATOM   3790 C CB  . THR D  2 90  ? -34.584 -20.227  3.140   1.00 20.90 ? 236 THR D CB  1 
ATOM   3791 O OG1 . THR D  2 90  ? -33.548 -19.914  4.074   1.00 21.71 ? 236 THR D OG1 1 
ATOM   3792 C CG2 . THR D  2 90  ? -34.977 -21.708  3.314   1.00 21.67 ? 236 THR D CG2 1 
ATOM   3793 N N   . ILE D  2 91  ? -36.144 -19.297  0.576   1.00 19.45 ? 237 ILE D N   1 
ATOM   3794 C CA  . ILE D  2 91  ? -37.294 -19.518  -0.324  1.00 19.86 ? 237 ILE D CA  1 
ATOM   3795 C C   . ILE D  2 91  ? -37.048 -19.037  -1.739  1.00 20.42 ? 237 ILE D C   1 
ATOM   3796 O O   . ILE D  2 91  ? -37.962 -19.042  -2.545  1.00 21.71 ? 237 ILE D O   1 
ATOM   3797 C CB  . ILE D  2 91  ? -38.597 -18.892  0.225   1.00 20.06 ? 237 ILE D CB  1 
ATOM   3798 C CG1 . ILE D  2 91  ? -38.541 -17.352  0.210   1.00 19.72 ? 237 ILE D CG1 1 
ATOM   3799 C CG2 . ILE D  2 91  ? -38.841 -19.413  1.629   1.00 21.02 ? 237 ILE D CG2 1 
ATOM   3800 C CD1 . ILE D  2 91  ? -39.857 -16.665  0.555   1.00 20.94 ? 237 ILE D CD1 1 
ATOM   3801 N N   . LEU D  2 92  ? -35.816 -18.620  -2.038  1.00 20.76 ? 238 LEU D N   1 
ATOM   3802 C CA  . LEU D  2 92  ? -35.482 -17.984  -3.300  1.00 20.93 ? 238 LEU D CA  1 
ATOM   3803 C C   . LEU D  2 92  ? -36.465 -16.837  -3.615  1.00 21.52 ? 238 LEU D C   1 
ATOM   3804 O O   . LEU D  2 92  ? -37.200 -16.866  -4.619  1.00 21.05 ? 238 LEU D O   1 
ATOM   3805 C CB  . LEU D  2 92  ? -35.390 -19.037  -4.408  1.00 22.09 ? 238 LEU D CB  1 
ATOM   3806 C CG  . LEU D  2 92  ? -34.326 -18.755  -5.480  1.00 22.95 ? 238 LEU D CG  1 
ATOM   3807 C CD1 . LEU D  2 92  ? -33.883 -20.020  -6.194  1.00 23.52 ? 238 LEU D CD1 1 
ATOM   3808 C CD2 . LEU D  2 92  ? -34.833 -17.748  -6.504  1.00 23.64 ? 238 LEU D CD2 1 
ATOM   3809 N N   . PRO D  2 93  ? -36.470 -15.804  -2.755  1.00 21.13 ? 239 PRO D N   1 
ATOM   3810 C CA  . PRO D  2 93  ? -37.445 -14.718  -2.829  1.00 21.83 ? 239 PRO D CA  1 
ATOM   3811 C C   . PRO D  2 93  ? -37.535 -13.905  -4.119  1.00 22.14 ? 239 PRO D C   1 
ATOM   3812 O O   . PRO D  2 93  ? -38.596 -13.321  -4.368  1.00 21.24 ? 239 PRO D O   1 
ATOM   3813 C CB  . PRO D  2 93  ? -37.053 -13.795  -1.670  1.00 21.31 ? 239 PRO D CB  1 
ATOM   3814 C CG  . PRO D  2 93  ? -35.659 -14.156  -1.351  1.00 21.11 ? 239 PRO D CG  1 
ATOM   3815 C CD  . PRO D  2 93  ? -35.574 -15.626  -1.607  1.00 21.34 ? 239 PRO D CD  1 
ATOM   3816 N N   . SER D  2 94  ? -36.481 -13.837  -4.922  1.00 20.86 ? 240 SER D N   1 
ATOM   3817 C CA  . SER D  2 94  ? -36.575 -13.051  -6.149  1.00 23.72 ? 240 SER D CA  1 
ATOM   3818 C C   . SER D  2 94  ? -37.571 -13.690  -7.103  1.00 22.77 ? 240 SER D C   1 
ATOM   3819 O O   . SER D  2 94  ? -38.101 -13.031  -7.978  1.00 23.01 ? 240 SER D O   1 
ATOM   3820 C CB  . SER D  2 94  ? -35.223 -12.914  -6.836  1.00 25.25 ? 240 SER D CB  1 
ATOM   3821 O OG  . SER D  2 94  ? -34.778 -14.183  -7.242  1.00 29.51 ? 240 SER D OG  1 
ATOM   3822 N N   . CYS D  2 95  ? -37.808 -14.986  -6.948  1.00 22.55 ? 241 CYS D N   1 
ATOM   3823 C CA  . CYS D  2 95  ? -38.885 -15.644  -7.656  1.00 21.48 ? 241 CYS D CA  1 
ATOM   3824 C C   . CYS D  2 95  ? -40.192 -15.727  -6.870  1.00 21.61 ? 241 CYS D C   1 
ATOM   3825 O O   . CYS D  2 95  ? -41.254 -15.391  -7.389  1.00 21.25 ? 241 CYS D O   1 
ATOM   3826 C CB  . CYS D  2 95  ? -38.459 -17.046  -8.054  1.00 23.20 ? 241 CYS D CB  1 
ATOM   3827 S SG  . CYS D  2 95  ? -39.825 -18.017  -8.733  1.00 23.36 ? 241 CYS D SG  1 
ATOM   3828 N N   . SER D  2 96  ? -40.110 -16.212  -5.630  1.00 22.16 ? 242 SER D N   1 
ATOM   3829 C CA  . SER D  2 96  ? -41.274 -16.685  -4.903  1.00 22.12 ? 242 SER D CA  1 
ATOM   3830 C C   . SER D  2 96  ? -41.996 -15.611  -4.075  1.00 23.95 ? 242 SER D C   1 
ATOM   3831 O O   . SER D  2 96  ? -43.134 -15.814  -3.635  1.00 23.28 ? 242 SER D O   1 
ATOM   3832 C CB  . SER D  2 96  ? -40.856 -17.819  -3.985  1.00 22.87 ? 242 SER D CB  1 
ATOM   3833 O OG  . SER D  2 96  ? -40.050 -17.390  -2.904  1.00 23.64 ? 242 SER D OG  1 
ATOM   3834 N N   . TYR D  2 97  ? -41.342 -14.475  -3.879  1.00 24.02 ? 243 TYR D N   1 
ATOM   3835 C CA  . TYR D  2 97  ? -41.750 -13.505  -2.869  1.00 25.00 ? 243 TYR D CA  1 
ATOM   3836 C C   . TYR D  2 97  ? -41.921 -12.140  -3.506  1.00 26.58 ? 243 TYR D C   1 
ATOM   3837 O O   . TYR D  2 97  ? -42.999 -11.577  -3.466  1.00 25.84 ? 243 TYR D O   1 
ATOM   3838 C CB  . TYR D  2 97  ? -40.691 -13.459  -1.766  1.00 24.41 ? 243 TYR D CB  1 
ATOM   3839 C CG  . TYR D  2 97  ? -40.964 -12.446  -0.672  1.00 24.07 ? 243 TYR D CG  1 
ATOM   3840 C CD1 . TYR D  2 97  ? -42.094 -12.558  0.130   1.00 23.19 ? 243 TYR D CD1 1 
ATOM   3841 C CD2 . TYR D  2 97  ? -40.085 -11.388  -0.434  1.00 23.74 ? 243 TYR D CD2 1 
ATOM   3842 C CE1 . TYR D  2 97  ? -42.358 -11.645  1.125   1.00 23.51 ? 243 TYR D CE1 1 
ATOM   3843 C CE2 . TYR D  2 97  ? -40.322 -10.478  0.589   1.00 23.66 ? 243 TYR D CE2 1 
ATOM   3844 C CZ  . TYR D  2 97  ? -41.470 -10.605  1.352   1.00 23.98 ? 243 TYR D CZ  1 
ATOM   3845 O OH  . TYR D  2 97  ? -41.746 -9.715   2.355   1.00 24.21 ? 243 TYR D OH  1 
ATOM   3846 N N   . GLU D  2 98  ? -40.847 -11.623  -4.098  1.00 29.09 ? 244 GLU D N   1 
ATOM   3847 C CA  . GLU D  2 98  ? -40.873 -10.332  -4.773  1.00 33.75 ? 244 GLU D CA  1 
ATOM   3848 C C   . GLU D  2 98  ? -41.672 -10.373  -6.058  1.00 37.84 ? 244 GLU D C   1 
ATOM   3849 O O   . GLU D  2 98  ? -41.865 -11.414  -6.666  1.00 39.58 ? 244 GLU D O   1 
ATOM   3850 C CB  . GLU D  2 98  ? -39.468 -9.858   -5.110  1.00 35.30 ? 244 GLU D CB  1 
ATOM   3851 C CG  . GLU D  2 98  ? -38.633 -9.514   -3.893  1.00 38.09 ? 244 GLU D CG  1 
ATOM   3852 C CD  . GLU D  2 98  ? -37.206 -9.139   -4.246  1.00 39.95 ? 244 GLU D CD  1 
ATOM   3853 O OE1 . GLU D  2 98  ? -36.468 -8.742   -3.326  1.00 36.54 ? 244 GLU D OE1 1 
ATOM   3854 O OE2 . GLU D  2 98  ? -36.831 -9.258   -5.436  1.00 39.63 ? 244 GLU D OE2 1 
ATOM   3855 N N   . ASP D  2 99  ? -42.138 -9.203   -6.451  1.00 45.15 ? 245 ASP D N   1 
ATOM   3856 C CA  . ASP D  2 99  ? -42.863 -9.027   -7.688  1.00 48.19 ? 245 ASP D CA  1 
ATOM   3857 C C   . ASP D  2 99  ? -42.807 -7.547   -8.033  1.00 47.48 ? 245 ASP D C   1 
ATOM   3858 O O   . ASP D  2 99  ? -42.658 -6.687   -7.149  1.00 44.69 ? 245 ASP D O   1 
ATOM   3859 C CB  . ASP D  2 99  ? -44.308 -9.501   -7.545  1.00 52.44 ? 245 ASP D CB  1 
ATOM   3860 C CG  . ASP D  2 99  ? -44.892 -9.985   -8.859  1.00 58.48 ? 245 ASP D CG  1 
ATOM   3861 O OD1 . ASP D  2 99  ? -44.561 -9.375   -9.912  1.00 62.14 ? 245 ASP D OD1 1 
ATOM   3862 O OD2 . ASP D  2 99  ? -45.670 -10.980  -8.835  1.00 60.58 ? 245 ASP D OD2 1 
ATOM   3863 N N   . LYS D  2 100 ? -42.925 -7.259   -9.324  1.00 48.14 ? 246 LYS D N   1 
ATOM   3864 C CA  . LYS D  2 100 ? -42.884 -5.866   -9.818  1.00 45.30 ? 246 LYS D CA  1 
ATOM   3865 C C   . LYS D  2 100 ? -44.105 -5.108   -9.280  1.00 46.74 ? 246 LYS D C   1 
ATOM   3866 O O   . LYS D  2 100 ? -44.042 -3.927   -8.963  1.00 52.21 ? 246 LYS D O   1 
ATOM   3867 C CB  . LYS D  2 100 ? -42.864 -5.823   -11.353 1.00 38.39 ? 246 LYS D CB  1 
ATOM   3868 C CG  . LYS D  2 100 ? -42.299 -7.079   -12.012 1.00 37.99 ? 246 LYS D CG  1 
ATOM   3869 C CD  . LYS D  2 100 ? -41.765 -6.811   -13.425 1.00 35.83 ? 246 LYS D CD  1 
ATOM   3870 C CE  . LYS D  2 100 ? -41.441 -8.121   -14.135 1.00 34.49 ? 246 LYS D CE  1 
ATOM   3871 N NZ  . LYS D  2 100 ? -42.158 -8.135   -15.444 1.00 34.20 ? 246 LYS D NZ  1 
ATOM   3872 N N   . GLU D  2 101 ? -45.206 -5.833   -9.156  1.00 46.61 ? 247 GLU D N   1 
ATOM   3873 C CA  . GLU D  2 101 ? -46.433 -5.316   -8.553  1.00 45.00 ? 247 GLU D CA  1 
ATOM   3874 C C   . GLU D  2 101 ? -46.429 -5.625   -7.063  1.00 45.56 ? 247 GLU D C   1 
ATOM   3875 O O   . GLU D  2 101 ? -46.294 -6.782   -6.674  1.00 51.89 ? 247 GLU D O   1 
ATOM   3876 C CB  . GLU D  2 101 ? -47.646 -5.988   -9.201  1.00 39.27 ? 247 GLU D CB  1 
ATOM   3877 C CG  . GLU D  2 101 ? -47.347 -7.403   -9.711  1.00 38.76 ? 247 GLU D CG  1 
ATOM   3878 C CD  . GLU D  2 101 ? -48.579 -8.127   -10.196 1.00 38.38 ? 247 GLU D CD  1 
ATOM   3879 O OE1 . GLU D  2 101 ? -49.515 -7.420   -10.674 1.00 38.31 ? 247 GLU D OE1 1 
ATOM   3880 O OE2 . GLU D  2 101 ? -48.603 -9.398   -10.114 1.00 36.37 ? 247 GLU D OE2 1 
ATOM   3881 N N   . LYS D  2 102 ? -46.569 -4.598   -6.234  1.00 42.43 ? 248 LYS D N   1 
ATOM   3882 C CA  . LYS D  2 102 ? -46.747 -4.801   -4.818  1.00 42.90 ? 248 LYS D CA  1 
ATOM   3883 C C   . LYS D  2 102 ? -48.201 -4.553   -4.427  1.00 39.43 ? 248 LYS D C   1 
ATOM   3884 O O   . LYS D  2 102 ? -48.613 -3.407   -4.291  1.00 39.54 ? 248 LYS D O   1 
ATOM   3885 C CB  . LYS D  2 102 ? -45.842 -3.872   -4.031  1.00 46.19 ? 248 LYS D CB  1 
ATOM   3886 C CG  . LYS D  2 102 ? -45.105 -4.562   -2.905  1.00 48.69 ? 248 LYS D CG  1 
ATOM   3887 C CD  . LYS D  2 102 ? -44.861 -3.616   -1.741  1.00 51.33 ? 248 LYS D CD  1 
ATOM   3888 C CE  . LYS D  2 102 ? -43.434 -3.702   -1.218  1.00 52.57 ? 248 LYS D CE  1 
ATOM   3889 N NZ  . LYS D  2 102 ? -43.369 -4.409   0.084   1.00 55.56 ? 248 LYS D NZ  1 
ATOM   3890 N N   . PRO D  2 103 ? -48.972 -5.631   -4.201  1.00 33.49 ? 249 PRO D N   1 
ATOM   3891 C CA  . PRO D  2 103 ? -50.399 -5.451   -4.009  1.00 31.21 ? 249 PRO D CA  1 
ATOM   3892 C C   . PRO D  2 103 ? -50.749 -4.871   -2.664  1.00 30.60 ? 249 PRO D C   1 
ATOM   3893 O O   . PRO D  2 103 ? -49.908 -4.797   -1.776  1.00 30.19 ? 249 PRO D O   1 
ATOM   3894 C CB  . PRO D  2 103 ? -50.952 -6.876   -4.137  1.00 30.47 ? 249 PRO D CB  1 
ATOM   3895 C CG  . PRO D  2 103 ? -49.814 -7.746   -3.735  1.00 30.39 ? 249 PRO D CG  1 
ATOM   3896 C CD  . PRO D  2 103 ? -48.590 -7.053   -4.229  1.00 31.03 ? 249 PRO D CD  1 
ATOM   3897 N N   . ASN D  2 104 ? -51.995 -4.436   -2.532  1.00 29.38 ? 250 ASN D N   1 
ATOM   3898 C CA  . ASN D  2 104 ? -52.524 -4.032   -1.251  1.00 28.40 ? 250 ASN D CA  1 
ATOM   3899 C C   . ASN D  2 104 ? -52.702 -5.301   -0.448  1.00 28.50 ? 250 ASN D C   1 
ATOM   3900 O O   . ASN D  2 104 ? -53.204 -6.288   -0.982  1.00 28.05 ? 250 ASN D O   1 
ATOM   3901 C CB  . ASN D  2 104 ? -53.872 -3.331   -1.426  1.00 28.49 ? 250 ASN D CB  1 
ATOM   3902 C CG  . ASN D  2 104 ? -54.449 -2.845   -0.122  1.00 28.88 ? 250 ASN D CG  1 
ATOM   3903 O OD1 . ASN D  2 104 ? -54.179 -1.717   0.326   1.00 32.51 ? 250 ASN D OD1 1 
ATOM   3904 N ND2 . ASN D  2 104 ? -55.261 -3.669   0.493   1.00 27.19 ? 250 ASN D ND2 1 
ATOM   3905 N N   . CYS D  2 105 ? -52.319 -5.272   0.827   1.00 28.11 ? 251 CYS D N   1 
ATOM   3906 C CA  . CYS D  2 105 ? -52.379 -6.472   1.662   1.00 29.17 ? 251 CYS D CA  1 
ATOM   3907 C C   . CYS D  2 105 ? -53.777 -7.091   1.754   1.00 29.28 ? 251 CYS D C   1 
ATOM   3908 O O   . CYS D  2 105 ? -53.903 -8.312   1.810   1.00 26.86 ? 251 CYS D O   1 
ATOM   3909 C CB  . CYS D  2 105 ? -51.835 -6.205   3.060   1.00 29.79 ? 251 CYS D CB  1 
ATOM   3910 S SG  . CYS D  2 105 ? -50.075 -5.795   3.068   1.00 31.35 ? 251 CYS D SG  1 
ATOM   3911 N N   . LEU D  2 106 ? -54.818 -6.269   1.791   1.00 28.31 ? 252 LEU D N   1 
ATOM   3912 C CA  . LEU D  2 106 ? -56.179 -6.811   1.844   1.00 28.90 ? 252 LEU D CA  1 
ATOM   3913 C C   . LEU D  2 106 ? -56.613 -7.446   0.530   1.00 25.96 ? 252 LEU D C   1 
ATOM   3914 O O   . LEU D  2 106 ? -57.330 -8.437   0.558   1.00 27.26 ? 252 LEU D O   1 
ATOM   3915 C CB  . LEU D  2 106 ? -57.191 -5.774   2.322   1.00 30.92 ? 252 LEU D CB  1 
ATOM   3916 C CG  . LEU D  2 106 ? -56.955 -5.283   3.745   1.00 34.00 ? 252 LEU D CG  1 
ATOM   3917 C CD1 . LEU D  2 106 ? -57.958 -4.189   4.074   1.00 36.75 ? 252 LEU D CD1 1 
ATOM   3918 C CD2 . LEU D  2 106 ? -57.074 -6.396   4.770   1.00 35.50 ? 252 LEU D CD2 1 
ATOM   3919 N N   . ASP D  2 107 ? -56.143 -6.928   -0.598  1.00 24.95 ? 253 ASP D N   1 
ATOM   3920 C CA  . ASP D  2 107 ? -56.394 -7.570   -1.896  1.00 26.64 ? 253 ASP D CA  1 
ATOM   3921 C C   . ASP D  2 107 ? -55.662 -8.916   -1.940  1.00 25.75 ? 253 ASP D C   1 
ATOM   3922 O O   . ASP D  2 107 ? -56.210 -9.924   -2.372  1.00 25.32 ? 253 ASP D O   1 
ATOM   3923 C CB  . ASP D  2 107 ? -55.932 -6.682   -3.066  1.00 27.79 ? 253 ASP D CB  1 
ATOM   3924 C CG  . ASP D  2 107 ? -56.764 -5.389   -3.214  1.00 29.08 ? 253 ASP D CG  1 
ATOM   3925 O OD1 . ASP D  2 107 ? -57.865 -5.260   -2.648  1.00 29.68 ? 253 ASP D OD1 1 
ATOM   3926 O OD2 . ASP D  2 107 ? -56.296 -4.487   -3.913  1.00 33.15 ? 253 ASP D OD2 1 
ATOM   3927 N N   . LEU D  2 108 ? -54.421 -8.930   -1.468  1.00 25.17 ? 254 LEU D N   1 
ATOM   3928 C CA  . LEU D  2 108 ? -53.656 -10.164  -1.419  1.00 24.65 ? 254 LEU D CA  1 
ATOM   3929 C C   . LEU D  2 108 ? -54.332 -11.177  -0.502  1.00 25.12 ? 254 LEU D C   1 
ATOM   3930 O O   . LEU D  2 108 ? -54.430 -12.361  -0.844  1.00 24.43 ? 254 LEU D O   1 
ATOM   3931 C CB  . LEU D  2 108 ? -52.218 -9.907   -0.967  1.00 24.03 ? 254 LEU D CB  1 
ATOM   3932 C CG  . LEU D  2 108 ? -51.314 -11.140  -1.058  1.00 24.02 ? 254 LEU D CG  1 
ATOM   3933 C CD1 . LEU D  2 108 ? -51.163 -11.582  -2.507  1.00 23.90 ? 254 LEU D CD1 1 
ATOM   3934 C CD2 . LEU D  2 108 ? -49.958 -10.829  -0.446  1.00 24.13 ? 254 LEU D CD2 1 
ATOM   3935 N N   . ARG D  2 109 ? -54.815 -10.719  0.649   1.00 25.26 ? 255 ARG D N   1 
ATOM   3936 C CA  . ARG D  2 109 ? -55.574 -11.599  1.542   1.00 27.16 ? 255 ARG D CA  1 
ATOM   3937 C C   . ARG D  2 109 ? -56.801 -12.197  0.841   1.00 26.68 ? 255 ARG D C   1 
ATOM   3938 O O   . ARG D  2 109 ? -57.124 -13.364  1.038   1.00 26.55 ? 255 ARG D O   1 
ATOM   3939 C CB  . ARG D  2 109 ? -56.015 -10.865  2.797   1.00 27.96 ? 255 ARG D CB  1 
ATOM   3940 C CG  . ARG D  2 109 ? -56.715 -11.764  3.796   1.00 29.76 ? 255 ARG D CG  1 
ATOM   3941 C CD  . ARG D  2 109 ? -57.159 -10.988  5.020   1.00 33.32 ? 255 ARG D CD  1 
ATOM   3942 N NE  . ARG D  2 109 ? -58.283 -10.107  4.724   1.00 36.16 ? 255 ARG D NE  1 
ATOM   3943 C CZ  . ARG D  2 109 ? -58.847 -9.287   5.608   1.00 39.68 ? 255 ARG D CZ  1 
ATOM   3944 N NH1 . ARG D  2 109 ? -58.401 -9.220   6.866   1.00 40.60 ? 255 ARG D NH1 1 
ATOM   3945 N NH2 . ARG D  2 109 ? -59.853 -8.516   5.230   1.00 39.12 ? 255 ARG D NH2 1 
ATOM   3946 N N   . GLY D  2 110 ? -57.476 -11.391  0.031   1.00 27.02 ? 256 GLY D N   1 
ATOM   3947 C CA  . GLY D  2 110 ? -58.594 -11.880  -0.790  1.00 26.91 ? 256 GLY D CA  1 
ATOM   3948 C C   . GLY D  2 110 ? -58.171 -13.007  -1.729  1.00 25.05 ? 256 GLY D C   1 
ATOM   3949 O O   . GLY D  2 110 ? -58.816 -14.053  -1.774  1.00 25.27 ? 256 GLY D O   1 
ATOM   3950 N N   . VAL D  2 111 ? -57.086 -12.790  -2.463  1.00 24.07 ? 257 VAL D N   1 
ATOM   3951 C CA  . VAL D  2 111 ? -56.527 -13.806  -3.375  1.00 23.86 ? 257 VAL D CA  1 
ATOM   3952 C C   . VAL D  2 111 ? -56.194 -15.089  -2.618  1.00 22.82 ? 257 VAL D C   1 
ATOM   3953 O O   . VAL D  2 111 ? -56.616 -16.156  -3.021  1.00 22.46 ? 257 VAL D O   1 
ATOM   3954 C CB  . VAL D  2 111 ? -55.274 -13.286  -4.131  1.00 24.29 ? 257 VAL D CB  1 
ATOM   3955 C CG1 . VAL D  2 111 ? -54.653 -14.369  -5.007  1.00 23.65 ? 257 VAL D CG1 1 
ATOM   3956 C CG2 . VAL D  2 111 ? -55.626 -12.071  -4.980  1.00 24.98 ? 257 VAL D CG2 1 
ATOM   3957 N N   . CYS D  2 112 ? -55.469 -14.982  -1.506  1.00 23.18 ? 258 CYS D N   1 
ATOM   3958 C CA  . CYS D  2 112 ? -55.241 -16.127  -0.607  1.00 22.61 ? 258 CYS D CA  1 
ATOM   3959 C C   . CYS D  2 112 ? -56.530 -16.841  -0.218  1.00 23.26 ? 258 CYS D C   1 
ATOM   3960 O O   . CYS D  2 112 ? -56.610 -18.072  -0.271  1.00 23.34 ? 258 CYS D O   1 
ATOM   3961 C CB  . CYS D  2 112 ? -54.515 -15.689  0.678   1.00 23.11 ? 258 CYS D CB  1 
ATOM   3962 S SG  . CYS D  2 112 ? -54.365 -16.987  1.927   1.00 22.96 ? 258 CYS D SG  1 
ATOM   3963 N N   . ARG D  2 113 ? -57.541 -16.080  0.176   1.00 22.77 ? 259 ARG D N   1 
ATOM   3964 C CA  . ARG D  2 113 ? -58.775 -16.686  0.659   1.00 23.87 ? 259 ARG D CA  1 
ATOM   3965 C C   . ARG D  2 113 ? -59.616 -17.393  -0.415  1.00 22.29 ? 259 ARG D C   1 
ATOM   3966 O O   . ARG D  2 113 ? -60.510 -18.139  -0.064  1.00 22.66 ? 259 ARG D O   1 
ATOM   3967 C CB  . ARG D  2 113 ? -59.617 -15.652  1.419   1.00 26.40 ? 259 ARG D CB  1 
ATOM   3968 C CG  . ARG D  2 113 ? -59.036 -15.347  2.775   1.00 27.54 ? 259 ARG D CG  1 
ATOM   3969 C CD  . ARG D  2 113 ? -59.914 -14.453  3.624   1.00 30.36 ? 259 ARG D CD  1 
ATOM   3970 N NE  . ARG D  2 113 ? -59.407 -14.490  5.006   1.00 33.42 ? 259 ARG D NE  1 
ATOM   3971 C CZ  . ARG D  2 113 ? -59.584 -13.539  5.927   1.00 36.03 ? 259 ARG D CZ  1 
ATOM   3972 N NH1 . ARG D  2 113 ? -59.049 -13.711  7.140   1.00 38.13 ? 259 ARG D NH1 1 
ATOM   3973 N NH2 . ARG D  2 113 ? -60.269 -12.425  5.656   1.00 33.84 ? 259 ARG D NH2 1 
ATOM   3974 N N   . THR D  2 114 ? -59.316 -17.216  -1.706  1.00 21.17 ? 260 THR D N   1 
ATOM   3975 C CA  . THR D  2 114 ? -59.966 -18.048  -2.730  1.00 20.63 ? 260 THR D CA  1 
ATOM   3976 C C   . THR D  2 114 ? -59.419 -19.479  -2.751  1.00 20.94 ? 260 THR D C   1 
ATOM   3977 O O   . THR D  2 114 ? -60.055 -20.387  -3.301  1.00 20.46 ? 260 THR D O   1 
ATOM   3978 C CB  . THR D  2 114 ? -59.814 -17.479  -4.143  1.00 20.80 ? 260 THR D CB  1 
ATOM   3979 O OG1 . THR D  2 114 ? -58.429 -17.493  -4.524  1.00 20.21 ? 260 THR D OG1 1 
ATOM   3980 C CG2 . THR D  2 114 ? -60.366 -16.070  -4.219  1.00 21.81 ? 260 THR D CG2 1 
ATOM   3981 N N   . ASP D  2 115 ? -58.230 -19.673  -2.182  1.00 20.79 ? 261 ASP D N   1 
ATOM   3982 C CA  . ASP D  2 115 ? -57.578 -20.985  -2.165  1.00 21.04 ? 261 ASP D CA  1 
ATOM   3983 C C   . ASP D  2 115 ? -57.891 -21.662  -0.835  1.00 21.47 ? 261 ASP D C   1 
ATOM   3984 O O   . ASP D  2 115 ? -57.570 -21.129  0.236   1.00 21.61 ? 261 ASP D O   1 
ATOM   3985 C CB  . ASP D  2 115 ? -56.061 -20.815  -2.399  1.00 21.12 ? 261 ASP D CB  1 
ATOM   3986 C CG  . ASP D  2 115 ? -55.301 -22.130  -2.434  1.00 20.33 ? 261 ASP D CG  1 
ATOM   3987 O OD1 . ASP D  2 115 ? -55.288 -22.845  -1.402  1.00 19.61 ? 261 ASP D OD1 1 
ATOM   3988 O OD2 . ASP D  2 115 ? -54.691 -22.434  -3.494  1.00 20.80 ? 261 ASP D OD2 1 
ATOM   3989 N N   . HIS D  2 116 ? -58.561 -22.807  -0.902  1.00 21.88 ? 262 HIS D N   1 
ATOM   3990 C CA  . HIS D  2 116 ? -58.980 -23.546  0.308   1.00 24.70 ? 262 HIS D CA  1 
ATOM   3991 C C   . HIS D  2 116 ? -57.851 -23.730  1.333   1.00 24.02 ? 262 HIS D C   1 
ATOM   3992 O O   . HIS D  2 116 ? -58.032 -23.516  2.535   1.00 21.79 ? 262 HIS D O   1 
ATOM   3993 C CB  . HIS D  2 116 ? -59.532 -24.915  -0.086  1.00 26.59 ? 262 HIS D CB  1 
ATOM   3994 C CG  . HIS D  2 116 ? -59.709 -25.856  1.061   1.00 28.45 ? 262 HIS D CG  1 
ATOM   3995 N ND1 . HIS D  2 116 ? -60.846 -25.869  1.843   1.00 29.46 ? 262 HIS D ND1 1 
ATOM   3996 C CD2 . HIS D  2 116 ? -58.905 -26.835  1.547   1.00 29.45 ? 262 HIS D CD2 1 
ATOM   3997 C CE1 . HIS D  2 116 ? -60.729 -26.806  2.770   1.00 29.25 ? 262 HIS D CE1 1 
ATOM   3998 N NE2 . HIS D  2 116 ? -59.560 -27.403  2.616   1.00 29.76 ? 262 HIS D NE2 1 
ATOM   3999 N N   . LEU D  2 117 ? -56.680 -24.104  0.838   1.00 24.84 ? 263 LEU D N   1 
ATOM   4000 C CA  . LEU D  2 117 ? -55.549 -24.367  1.717   1.00 25.07 ? 263 LEU D CA  1 
ATOM   4001 C C   . LEU D  2 117 ? -54.903 -23.072  2.234   1.00 22.88 ? 263 LEU D C   1 
ATOM   4002 O O   . LEU D  2 117 ? -54.589 -22.971  3.426   1.00 23.26 ? 263 LEU D O   1 
ATOM   4003 C CB  . LEU D  2 117 ? -54.512 -25.242  1.034   1.00 26.99 ? 263 LEU D CB  1 
ATOM   4004 C CG  . LEU D  2 117 ? -54.222 -26.568  1.738   1.00 29.82 ? 263 LEU D CG  1 
ATOM   4005 C CD1 . LEU D  2 117 ? -53.046 -27.242  1.043   1.00 30.15 ? 263 LEU D CD1 1 
ATOM   4006 C CD2 . LEU D  2 117 ? -53.948 -26.415  3.225   1.00 29.56 ? 263 LEU D CD2 1 
ATOM   4007 N N   . CYS D  2 118 ? -54.725 -22.075  1.379   1.00 21.53 ? 264 CYS D N   1 
ATOM   4008 C CA  . CYS D  2 118 ? -54.170 -20.797  1.849   1.00 21.67 ? 264 CYS D CA  1 
ATOM   4009 C C   . CYS D  2 118 ? -55.060 -20.221  2.934   1.00 22.78 ? 264 CYS D C   1 
ATOM   4010 O O   . CYS D  2 118 ? -54.571 -19.731  3.950   1.00 22.87 ? 264 CYS D O   1 
ATOM   4011 C CB  . CYS D  2 118 ? -54.014 -19.796  0.708   1.00 22.23 ? 264 CYS D CB  1 
ATOM   4012 S SG  . CYS D  2 118 ? -53.016 -18.310  1.050   1.00 23.55 ? 264 CYS D SG  1 
ATOM   4013 N N   . ARG D  2 119 ? -56.371 -20.293  2.722   1.00 22.69 ? 265 ARG D N   1 
ATOM   4014 C CA  . ARG D  2 119 ? -57.336 -19.721  3.656   1.00 23.14 ? 265 ARG D CA  1 
ATOM   4015 C C   . ARG D  2 119 ? -57.203 -20.348  5.039   1.00 23.73 ? 265 ARG D C   1 
ATOM   4016 O O   . ARG D  2 119 ? -57.185 -19.666  6.055   1.00 24.27 ? 265 ARG D O   1 
ATOM   4017 C CB  . ARG D  2 119 ? -58.751 -19.923  3.120   1.00 24.79 ? 265 ARG D CB  1 
ATOM   4018 C CG  . ARG D  2 119 ? -59.817 -19.234  3.960   1.00 27.26 ? 265 ARG D CG  1 
ATOM   4019 C CD  . ARG D  2 119 ? -61.132 -19.129  3.203   1.00 29.47 ? 265 ARG D CD  1 
ATOM   4020 N NE  . ARG D  2 119 ? -61.638 -20.474  2.966   1.00 30.99 ? 265 ARG D NE  1 
ATOM   4021 C CZ  . ARG D  2 119 ? -61.794 -21.066  1.772   1.00 30.06 ? 265 ARG D CZ  1 
ATOM   4022 N NH1 . ARG D  2 119 ? -61.534 -20.441  0.618   1.00 32.06 ? 265 ARG D NH1 1 
ATOM   4023 N NH2 . ARG D  2 119 ? -62.247 -22.311  1.742   1.00 28.25 ? 265 ARG D NH2 1 
ATOM   4024 N N   . SER D  2 120 ? -57.099 -21.661  5.043   1.00 22.44 ? 266 SER D N   1 
ATOM   4025 C CA  . SER D  2 120 ? -56.893 -22.442  6.227   1.00 23.80 ? 266 SER D CA  1 
ATOM   4026 C C   . SER D  2 120 ? -55.493 -22.231  6.876   1.00 23.61 ? 266 SER D C   1 
ATOM   4027 O O   . SER D  2 120 ? -55.371 -22.111  8.091   1.00 22.53 ? 266 SER D O   1 
ATOM   4028 C CB  . SER D  2 120 ? -57.090 -23.903  5.827   1.00 24.25 ? 266 SER D CB  1 
ATOM   4029 O OG  . SER D  2 120 ? -56.708 -24.746  6.870   1.00 27.64 ? 266 SER D OG  1 
ATOM   4030 N N   . ARG D  2 121 ? -54.446 -22.188  6.060   1.00 24.06 ? 267 ARG D N   1 
ATOM   4031 C CA  . ARG D  2 121 ? -53.093 -21.925  6.569   1.00 24.13 ? 267 ARG D CA  1 
ATOM   4032 C C   . ARG D  2 121 ? -52.976 -20.522  7.173   1.00 23.98 ? 267 ARG D C   1 
ATOM   4033 O O   . ARG D  2 121 ? -52.370 -20.346  8.212   1.00 23.80 ? 267 ARG D O   1 
ATOM   4034 C CB  . ARG D  2 121 ? -52.042 -22.117  5.470   1.00 24.31 ? 267 ARG D CB  1 
ATOM   4035 C CG  . ARG D  2 121 ? -51.926 -23.546  4.959   1.00 25.28 ? 267 ARG D CG  1 
ATOM   4036 C CD  . ARG D  2 121 ? -51.364 -24.479  6.012   1.00 26.25 ? 267 ARG D CD  1 
ATOM   4037 N NE  . ARG D  2 121 ? -51.282 -25.872  5.569   1.00 26.70 ? 267 ARG D NE  1 
ATOM   4038 C CZ  . ARG D  2 121 ? -50.351 -26.378  4.767   1.00 27.93 ? 267 ARG D CZ  1 
ATOM   4039 N NH1 . ARG D  2 121 ? -49.400 -25.622  4.236   1.00 28.73 ? 267 ARG D NH1 1 
ATOM   4040 N NH2 . ARG D  2 121 ? -50.382 -27.667  4.473   1.00 30.83 ? 267 ARG D NH2 1 
ATOM   4041 N N   . LEU D  2 122 ? -53.545 -19.526  6.515   1.00 23.97 ? 268 LEU D N   1 
ATOM   4042 C CA  . LEU D  2 122 ? -53.575 -18.175  7.074   1.00 25.51 ? 268 LEU D CA  1 
ATOM   4043 C C   . LEU D  2 122 ? -54.337 -18.135  8.408   1.00 27.31 ? 268 LEU D C   1 
ATOM   4044 O O   . LEU D  2 122 ? -53.873 -17.522  9.380   1.00 25.83 ? 268 LEU D O   1 
ATOM   4045 C CB  . LEU D  2 122 ? -54.209 -17.209  6.079   1.00 25.75 ? 268 LEU D CB  1 
ATOM   4046 C CG  . LEU D  2 122 ? -54.328 -15.738  6.476   1.00 26.19 ? 268 LEU D CG  1 
ATOM   4047 C CD1 . LEU D  2 122 ? -52.965 -15.151  6.817   1.00 26.32 ? 268 LEU D CD1 1 
ATOM   4048 C CD2 . LEU D  2 122 ? -54.978 -14.940  5.349   1.00 24.88 ? 268 LEU D CD2 1 
ATOM   4049 N N   . ALA D  2 123 ? -55.498 -18.795  8.457   1.00 26.17 ? 269 ALA D N   1 
ATOM   4050 C CA  . ALA D  2 123 ? -56.261 -18.884  9.696   1.00 27.70 ? 269 ALA D CA  1 
ATOM   4051 C C   . ALA D  2 123 ? -55.456 -19.552  10.814  1.00 27.37 ? 269 ALA D C   1 
ATOM   4052 O O   . ALA D  2 123 ? -55.535 -19.125  11.966  1.00 30.30 ? 269 ALA D O   1 
ATOM   4053 C CB  . ALA D  2 123 ? -57.580 -19.634  9.480   1.00 27.66 ? 269 ALA D CB  1 
ATOM   4054 N N   . ASP D  2 124 ? -54.708 -20.606  10.486  1.00 26.84 ? 270 ASP D N   1 
ATOM   4055 C CA  . ASP D  2 124 ? -53.836 -21.262  11.468  1.00 27.12 ? 270 ASP D CA  1 
ATOM   4056 C C   . ASP D  2 124 ? -52.787 -20.279  11.990  1.00 28.52 ? 270 ASP D C   1 
ATOM   4057 O O   . ASP D  2 124 ? -52.540 -20.197  13.184  1.00 29.41 ? 270 ASP D O   1 
ATOM   4058 C CB  . ASP D  2 124 ? -53.096 -22.465  10.867  1.00 27.40 ? 270 ASP D CB  1 
ATOM   4059 C CG  . ASP D  2 124 ? -53.984 -23.656  10.636  1.00 27.92 ? 270 ASP D CG  1 
ATOM   4060 O OD1 . ASP D  2 124 ? -55.139 -23.651  11.085  1.00 28.56 ? 270 ASP D OD1 1 
ATOM   4061 O OD2 . ASP D  2 124 ? -53.518 -24.607  9.985   1.00 29.39 ? 270 ASP D OD2 1 
ATOM   4062 N N   . PHE D  2 125 ? -52.160 -19.550  11.081  1.00 27.17 ? 271 PHE D N   1 
ATOM   4063 C CA  . PHE D  2 125 ? -51.164 -18.548  11.450  1.00 28.33 ? 271 PHE D CA  1 
ATOM   4064 C C   . PHE D  2 125 ? -51.732 -17.461  12.371  1.00 30.44 ? 271 PHE D C   1 
ATOM   4065 O O   . PHE D  2 125 ? -51.115 -17.126  13.380  1.00 28.13 ? 271 PHE D O   1 
ATOM   4066 C CB  . PHE D  2 125 ? -50.593 -17.887  10.200  1.00 27.77 ? 271 PHE D CB  1 
ATOM   4067 C CG  . PHE D  2 125 ? -49.725 -16.702  10.489  1.00 28.41 ? 271 PHE D CG  1 
ATOM   4068 C CD1 . PHE D  2 125 ? -48.495 -16.874  11.104  1.00 29.51 ? 271 PHE D CD1 1 
ATOM   4069 C CD2 . PHE D  2 125 ? -50.126 -15.427  10.148  1.00 28.92 ? 271 PHE D CD2 1 
ATOM   4070 C CE1 . PHE D  2 125 ? -47.670 -15.797  11.356  1.00 30.30 ? 271 PHE D CE1 1 
ATOM   4071 C CE2 . PHE D  2 125 ? -49.318 -14.334  10.414  1.00 29.29 ? 271 PHE D CE2 1 
ATOM   4072 C CZ  . PHE D  2 125 ? -48.082 -14.522  11.008  1.00 30.19 ? 271 PHE D CZ  1 
ATOM   4073 N N   A HIS D  2 126 ? -52.891 -16.913  12.011  0.50 31.06 ? 272 HIS D N   1 
ATOM   4074 N N   B HIS D  2 126 ? -52.886 -16.908  12.000  0.50 29.84 ? 272 HIS D N   1 
ATOM   4075 C CA  A HIS D  2 126 ? -53.544 -15.886  12.821  0.50 32.80 ? 272 HIS D CA  1 
ATOM   4076 C CA  B HIS D  2 126 ? -53.553 -15.891  12.812  0.50 30.63 ? 272 HIS D CA  1 
ATOM   4077 C C   A HIS D  2 126 ? -53.848 -16.422  14.221  0.50 33.01 ? 272 HIS D C   1 
ATOM   4078 C C   B HIS D  2 126 ? -53.869 -16.415  14.213  0.50 31.77 ? 272 HIS D C   1 
ATOM   4079 O O   A HIS D  2 126 ? -53.649 -15.726  15.208  0.50 36.76 ? 272 HIS D O   1 
ATOM   4080 O O   B HIS D  2 126 ? -53.724 -15.694  15.191  0.50 35.80 ? 272 HIS D O   1 
ATOM   4081 C CB  A HIS D  2 126 ? -54.823 -15.388  12.129  0.50 33.61 ? 272 HIS D CB  1 
ATOM   4082 C CB  B HIS D  2 126 ? -54.844 -15.402  12.138  0.50 29.77 ? 272 HIS D CB  1 
ATOM   4083 C CG  A HIS D  2 126 ? -55.519 -14.271  12.851  0.50 34.33 ? 272 HIS D CG  1 
ATOM   4084 C CG  B HIS D  2 126 ? -54.625 -14.398  11.048  0.50 28.70 ? 272 HIS D CG  1 
ATOM   4085 N ND1 A HIS D  2 126 ? -55.219 -12.943  12.638  0.50 35.59 ? 272 HIS D ND1 1 
ATOM   4086 N ND1 B HIS D  2 126 ? -55.523 -14.215  10.018  0.50 27.72 ? 272 HIS D ND1 1 
ATOM   4087 C CD2 A HIS D  2 126 ? -56.513 -14.288  13.771  0.50 34.43 ? 272 HIS D CD2 1 
ATOM   4088 C CD2 B HIS D  2 126 ? -53.613 -13.527  10.822  0.50 28.22 ? 272 HIS D CD2 1 
ATOM   4089 C CE1 A HIS D  2 126 ? -55.994 -12.191  13.400  0.50 35.64 ? 272 HIS D CE1 1 
ATOM   4090 C CE1 B HIS D  2 126 ? -55.082 -13.268  9.212   0.50 27.40 ? 272 HIS D CE1 1 
ATOM   4091 N NE2 A HIS D  2 126 ? -56.785 -12.984  14.100  0.50 34.65 ? 272 HIS D NE2 1 
ATOM   4092 N NE2 B HIS D  2 126 ? -53.921 -12.837  9.675   0.50 27.55 ? 272 HIS D NE2 1 
ATOM   4093 N N   . ALA D  2 127 ? -54.293 -17.670  14.315  1.00 33.69 ? 273 ALA D N   1 
ATOM   4094 C CA  . ALA D  2 127 ? -54.622 -18.259  15.613  1.00 32.01 ? 273 ALA D CA  1 
ATOM   4095 C C   . ALA D  2 127 ? -53.382 -18.643  16.420  1.00 33.50 ? 273 ALA D C   1 
ATOM   4096 O O   . ALA D  2 127 ? -53.305 -18.359  17.602  1.00 33.61 ? 273 ALA D O   1 
ATOM   4097 C CB  . ALA D  2 127 ? -55.510 -19.471  15.427  1.00 33.51 ? 273 ALA D CB  1 
ATOM   4098 N N   . ASN D  2 128 ? -52.419 -19.306  15.790  1.00 32.92 ? 274 ASN D N   1 
ATOM   4099 C CA  . ASN D  2 128 ? -51.290 -19.859  16.512  1.00 31.71 ? 274 ASN D CA  1 
ATOM   4100 C C   . ASN D  2 128 ? -50.181 -18.853  16.826  1.00 31.38 ? 274 ASN D C   1 
ATOM   4101 O O   . ASN D  2 128 ? -49.423 -19.042  17.766  1.00 31.06 ? 274 ASN D O   1 
ATOM   4102 C CB  . ASN D  2 128 ? -50.736 -21.064  15.762  1.00 33.53 ? 274 ASN D CB  1 
ATOM   4103 C CG  . ASN D  2 128 ? -51.748 -22.187  15.661  1.00 34.25 ? 274 ASN D CG  1 
ATOM   4104 O OD1 . ASN D  2 128 ? -52.737 -22.188  16.370  1.00 36.89 ? 274 ASN D OD1 1 
ATOM   4105 N ND2 . ASN D  2 128 ? -51.515 -23.128  14.767  1.00 33.49 ? 274 ASN D ND2 1 
ATOM   4106 N N   . CYS D  2 129 ? -50.083 -17.789  16.042  1.00 31.18 ? 275 CYS D N   1 
ATOM   4107 C CA  . CYS D  2 129 ? -49.090 -16.753  16.300  1.00 30.18 ? 275 CYS D CA  1 
ATOM   4108 C C   . CYS D  2 129 ? -49.683 -15.488  16.932  1.00 32.02 ? 275 CYS D C   1 
ATOM   4109 O O   . CYS D  2 129 ? -49.014 -14.478  17.022  1.00 32.08 ? 275 CYS D O   1 
ATOM   4110 C CB  . CYS D  2 129 ? -48.343 -16.411  15.016  1.00 27.95 ? 275 CYS D CB  1 
ATOM   4111 S SG  . CYS D  2 129 ? -47.372 -17.786  14.380  1.00 25.49 ? 275 CYS D SG  1 
ATOM   4112 N N   . ARG D  2 130 ? -50.933 -15.558  17.377  1.00 36.04 ? 276 ARG D N   1 
ATOM   4113 C CA  . ARG D  2 130 ? -51.615 -14.438  17.989  1.00 37.65 ? 276 ARG D CA  1 
ATOM   4114 C C   . ARG D  2 130 ? -50.873 -13.961  19.228  1.00 37.08 ? 276 ARG D C   1 
ATOM   4115 O O   . ARG D  2 130 ? -50.592 -14.741  20.122  1.00 36.16 ? 276 ARG D O   1 
ATOM   4116 C CB  . ARG D  2 130 ? -53.036 -14.834  18.402  1.00 42.09 ? 276 ARG D CB  1 
ATOM   4117 C CG  . ARG D  2 130 ? -53.951 -13.634  18.601  1.00 46.78 ? 276 ARG D CG  1 
ATOM   4118 C CD  . ARG D  2 130 ? -55.200 -13.975  19.400  1.00 50.25 ? 276 ARG D CD  1 
ATOM   4119 N NE  . ARG D  2 130 ? -55.832 -12.747  19.894  1.00 55.65 ? 276 ARG D NE  1 
ATOM   4120 C CZ  . ARG D  2 130 ? -56.659 -11.962  19.193  1.00 61.56 ? 276 ARG D CZ  1 
ATOM   4121 N NH1 . ARG D  2 130 ? -57.002 -12.253  17.935  1.00 61.52 ? 276 ARG D NH1 1 
ATOM   4122 N NH2 . ARG D  2 130 ? -57.159 -10.865  19.760  1.00 65.13 ? 276 ARG D NH2 1 
ATOM   4123 N N   . ALA D  2 131 ? -50.565 -12.677  19.271  1.00 39.08 ? 277 ALA D N   1 
ATOM   4124 C CA  . ALA D  2 131 ? -49.849 -12.103  20.394  1.00 42.88 ? 277 ALA D CA  1 
ATOM   4125 C C   . ALA D  2 131 ? -50.759 -12.032  21.614  1.00 49.02 ? 277 ALA D C   1 
ATOM   4126 O O   . ALA D  2 131 ? -51.885 -11.548  21.522  1.00 52.20 ? 277 ALA D O   1 
ATOM   4127 C CB  . ALA D  2 131 ? -49.327 -10.723  20.041  1.00 41.47 ? 277 ALA D CB  1 
ATOM   4128 N N   . SER D  2 132 ? -50.268 -12.546  22.739  1.00 54.06 ? 278 SER D N   1 
ATOM   4129 C CA  . SER D  2 132 ? -50.973 -12.507  24.012  1.00 58.58 ? 278 SER D CA  1 
ATOM   4130 C C   . SER D  2 132 ? -50.277 -11.520  24.941  1.00 63.81 ? 278 SER D C   1 
ATOM   4131 O O   . SER D  2 132 ? -49.051 -11.485  25.013  1.00 67.06 ? 278 SER D O   1 
ATOM   4132 C CB  . SER D  2 132 ? -50.977 -13.892  24.649  1.00 60.11 ? 278 SER D CB  1 
ATOM   4133 O OG  . SER D  2 132 ? -51.308 -13.819  26.024  1.00 64.73 ? 278 SER D OG  1 
ATOM   4134 N N   . TYR D  2 133 ? -51.058 -10.720  25.658  1.00 66.86 ? 279 TYR D N   1 
ATOM   4135 C CA  . TYR D  2 133 ? -50.507 -9.803   26.652  1.00 66.89 ? 279 TYR D CA  1 
ATOM   4136 C C   . TYR D  2 133 ? -50.478 -10.451  28.030  1.00 62.95 ? 279 TYR D C   1 
ATOM   4137 O O   . TYR D  2 133 ? -50.220 -9.767   29.019  1.00 64.64 ? 279 TYR D O   1 
ATOM   4138 C CB  . TYR D  2 133 ? -51.328 -8.505   26.707  1.00 72.28 ? 279 TYR D CB  1 
ATOM   4139 C CG  . TYR D  2 133 ? -51.242 -7.614   25.475  1.00 78.96 ? 279 TYR D CG  1 
ATOM   4140 C CD1 . TYR D  2 133 ? -50.185 -7.720   24.559  1.00 81.06 ? 279 TYR D CD1 1 
ATOM   4141 C CD2 . TYR D  2 133 ? -52.210 -6.631   25.246  1.00 82.97 ? 279 TYR D CD2 1 
ATOM   4142 C CE1 . TYR D  2 133 ? -50.115 -6.893   23.447  1.00 82.94 ? 279 TYR D CE1 1 
ATOM   4143 C CE2 . TYR D  2 133 ? -52.144 -5.797   24.139  1.00 83.98 ? 279 TYR D CE2 1 
ATOM   4144 C CZ  . TYR D  2 133 ? -51.097 -5.929   23.244  1.00 84.85 ? 279 TYR D CZ  1 
ATOM   4145 O OH  . TYR D  2 133 ? -51.032 -5.101   22.145  1.00 83.26 ? 279 TYR D OH  1 
ATOM   4146 N N   . GLN D  2 134 ? -50.729 -11.762  28.083  1.00 59.31 ? 280 GLN D N   1 
ATOM   4147 C CA  . GLN D  2 134 ? -50.917 -12.493  29.333  1.00 58.90 ? 280 GLN D CA  1 
ATOM   4148 C C   . GLN D  2 134 ? -49.930 -13.638  29.540  1.00 57.36 ? 280 GLN D C   1 
ATOM   4149 O O   . GLN D  2 134 ? -49.861 -14.212  30.626  1.00 58.29 ? 280 GLN D O   1 
ATOM   4150 C CB  . GLN D  2 134 ? -52.334 -13.087  29.368  1.00 63.89 ? 280 GLN D CB  1 
ATOM   4151 C CG  . GLN D  2 134 ? -53.469 -12.072  29.439  1.00 66.96 ? 280 GLN D CG  1 
ATOM   4152 C CD  . GLN D  2 134 ? -53.720 -11.538  30.848  1.00 72.44 ? 280 GLN D CD  1 
ATOM   4153 O OE1 . GLN D  2 134 ? -53.473 -12.222  31.847  1.00 73.21 ? 280 GLN D OE1 1 
ATOM   4154 N NE2 . GLN D  2 134 ? -54.229 -10.312  30.932  1.00 74.08 ? 280 GLN D NE2 1 
ATOM   4155 N N   . THR D  2 135 ? -49.175 -13.991  28.509  1.00 52.50 ? 281 THR D N   1 
ATOM   4156 C CA  . THR D  2 135 ? -48.360 -15.194  28.558  1.00 49.32 ? 281 THR D CA  1 
ATOM   4157 C C   . THR D  2 135 ? -46.889 -14.769  28.554  1.00 47.66 ? 281 THR D C   1 
ATOM   4158 O O   . THR D  2 135 ? -46.564 -13.686  28.098  1.00 45.46 ? 281 THR D O   1 
ATOM   4159 C CB  . THR D  2 135 ? -48.719 -16.119  27.371  1.00 49.00 ? 281 THR D CB  1 
ATOM   4160 O OG1 . THR D  2 135 ? -48.330 -17.464  27.656  1.00 51.72 ? 281 THR D OG1 1 
ATOM   4161 C CG2 . THR D  2 135 ? -48.050 -15.674  26.108  1.00 47.07 ? 281 THR D CG2 1 
ATOM   4162 N N   . VAL D  2 136 ? -46.004 -15.602  29.080  1.00 48.38 ? 282 VAL D N   1 
ATOM   4163 C CA  . VAL D  2 136 ? -44.585 -15.221  29.182  1.00 49.71 ? 282 VAL D CA  1 
ATOM   4164 C C   . VAL D  2 136 ? -43.922 -15.020  27.787  1.00 48.31 ? 282 VAL D C   1 
ATOM   4165 O O   . VAL D  2 136 ? -43.111 -14.105  27.577  1.00 47.00 ? 282 VAL D O   1 
ATOM   4166 C CB  . VAL D  2 136 ? -43.828 -16.212  30.104  1.00 51.81 ? 282 VAL D CB  1 
ATOM   4167 C CG1 . VAL D  2 136 ? -43.784 -17.624  29.527  1.00 52.68 ? 282 VAL D CG1 1 
ATOM   4168 C CG2 . VAL D  2 136 ? -42.430 -15.717  30.404  1.00 54.43 ? 282 VAL D CG2 1 
ATOM   4169 N N   . THR D  2 137 ? -44.335 -15.831  26.818  1.00 47.97 ? 283 THR D N   1 
ATOM   4170 C CA  . THR D  2 137 ? -43.775 -15.794  25.455  1.00 44.03 ? 283 THR D CA  1 
ATOM   4171 C C   . THR D  2 137 ? -44.466 -14.831  24.499  1.00 42.65 ? 283 THR D C   1 
ATOM   4172 O O   . THR D  2 137 ? -43.958 -14.569  23.409  1.00 42.57 ? 283 THR D O   1 
ATOM   4173 C CB  . THR D  2 137 ? -43.854 -17.181  24.826  1.00 44.39 ? 283 THR D CB  1 
ATOM   4174 O OG1 . THR D  2 137 ? -45.226 -17.590  24.732  1.00 45.01 ? 283 THR D OG1 1 
ATOM   4175 C CG2 . THR D  2 137 ? -43.111 -18.174  25.669  1.00 44.52 ? 283 THR D CG2 1 
ATOM   4176 N N   . SER D  2 138 ? -45.584 -14.258  24.937  1.00 43.45 ? 284 SER D N   1 
ATOM   4177 C CA  . SER D  2 138 ? -46.571 -13.610  24.066  1.00 42.09 ? 284 SER D CA  1 
ATOM   4178 C C   . SER D  2 138 ? -47.299 -14.571  23.091  1.00 38.36 ? 284 SER D C   1 
ATOM   4179 O O   . SER D  2 138 ? -48.122 -14.117  22.308  1.00 37.64 ? 284 SER D O   1 
ATOM   4180 C CB  . SER D  2 138 ? -45.976 -12.410  23.326  1.00 43.88 ? 284 SER D CB  1 
ATOM   4181 O OG  . SER D  2 138 ? -45.483 -11.447  24.241  1.00 47.11 ? 284 SER D OG  1 
ATOM   4182 N N   . CYS D  2 139 ? -47.045 -15.881  23.166  1.00 37.88 ? 285 CYS D N   1 
ATOM   4183 C CA  . CYS D  2 139 ? -47.768 -16.858  22.338  1.00 38.18 ? 285 CYS D CA  1 
ATOM   4184 C C   . CYS D  2 139 ? -48.835 -17.606  23.129  1.00 41.27 ? 285 CYS D C   1 
ATOM   4185 O O   . CYS D  2 139 ? -48.658 -17.866  24.321  1.00 40.38 ? 285 CYS D O   1 
ATOM   4186 C CB  . CYS D  2 139 ? -46.822 -17.887  21.721  1.00 36.96 ? 285 CYS D CB  1 
ATOM   4187 S SG  . CYS D  2 139 ? -45.578 -17.189  20.624  1.00 35.84 ? 285 CYS D SG  1 
ATOM   4188 N N   . PRO D  2 140 ? -49.943 -17.992  22.456  1.00 42.85 ? 286 PRO D N   1 
ATOM   4189 C CA  . PRO D  2 140 ? -50.985 -18.752  23.139  1.00 41.75 ? 286 PRO D CA  1 
ATOM   4190 C C   . PRO D  2 140 ? -50.464 -20.078  23.636  1.00 42.91 ? 286 PRO D C   1 
ATOM   4191 O O   . PRO D  2 140 ? -49.838 -20.822  22.878  1.00 42.52 ? 286 PRO D O   1 
ATOM   4192 C CB  . PRO D  2 140 ? -52.053 -18.979  22.063  1.00 42.96 ? 286 PRO D CB  1 
ATOM   4193 C CG  . PRO D  2 140 ? -51.418 -18.662  20.764  1.00 43.16 ? 286 PRO D CG  1 
ATOM   4194 C CD  . PRO D  2 140 ? -50.259 -17.755  21.036  1.00 43.45 ? 286 PRO D CD  1 
ATOM   4195 N N   . ALA D  2 141 ? -50.727 -20.354  24.913  1.00 43.24 ? 287 ALA D N   1 
ATOM   4196 C CA  . ALA D  2 141 ? -50.253 -21.548  25.597  1.00 42.17 ? 287 ALA D CA  1 
ATOM   4197 C C   . ALA D  2 141 ? -48.741 -21.691  25.588  1.00 41.17 ? 287 ALA D C   1 
ATOM   4198 O O   . ALA D  2 141 ? -48.238 -22.790  25.796  1.00 44.96 ? 287 ALA D O   1 
ATOM   4199 C CB  . ALA D  2 141 ? -50.893 -22.789  24.998  1.00 42.91 ? 287 ALA D CB  1 
ATOM   4200 N N   . ASP D  2 142 ? -48.032 -20.589  25.372  1.00 40.36 ? 288 ASP D N   1 
ATOM   4201 C CA  . ASP D  2 142 ? -46.575 -20.599  25.212  1.00 43.31 ? 288 ASP D CA  1 
ATOM   4202 C C   . ASP D  2 142 ? -46.096 -21.621  24.193  1.00 41.09 ? 288 ASP D C   1 
ATOM   4203 O O   . ASP D  2 142 ? -45.017 -22.193  24.333  1.00 42.15 ? 288 ASP D O   1 
ATOM   4204 C CB  . ASP D  2 142 ? -45.890 -20.815  26.568  1.00 45.07 ? 288 ASP D CB  1 
ATOM   4205 C CG  . ASP D  2 142 ? -46.172 -19.687  27.545  1.00 46.09 ? 288 ASP D CG  1 
ATOM   4206 O OD1 . ASP D  2 142 ? -46.176 -18.504  27.140  1.00 49.31 ? 288 ASP D OD1 1 
ATOM   4207 O OD2 . ASP D  2 142 ? -46.391 -19.985  28.728  1.00 49.94 ? 288 ASP D OD2 1 
ATOM   4208 N N   . ASN D  2 143 ? -46.895 -21.826  23.150  1.00 39.05 ? 289 ASN D N   1 
ATOM   4209 C CA  . ASN D  2 143 ? -46.594 -22.845  22.161  1.00 36.06 ? 289 ASN D CA  1 
ATOM   4210 C C   . ASN D  2 143 ? -45.885 -22.219  20.966  1.00 34.05 ? 289 ASN D C   1 
ATOM   4211 O O   . ASN D  2 143 ? -46.519 -21.789  20.005  1.00 33.33 ? 289 ASN D O   1 
ATOM   4212 C CB  . ASN D  2 143 ? -47.867 -23.559  21.732  1.00 34.20 ? 289 ASN D CB  1 
ATOM   4213 C CG  . ASN D  2 143 ? -47.589 -24.753  20.846  1.00 34.98 ? 289 ASN D CG  1 
ATOM   4214 O OD1 . ASN D  2 143 ? -46.503 -24.896  20.273  1.00 35.28 ? 289 ASN D OD1 1 
ATOM   4215 N ND2 . ASN D  2 143 ? -48.564 -25.622  20.732  1.00 34.24 ? 289 ASN D ND2 1 
ATOM   4216 N N   . TYR D  2 144 ? -44.565 -22.141  21.059  1.00 32.38 ? 290 TYR D N   1 
ATOM   4217 C CA  . TYR D  2 144 ? -43.759 -21.614  19.974  1.00 32.14 ? 290 TYR D CA  1 
ATOM   4218 C C   . TYR D  2 144 ? -43.888 -22.463  18.707  1.00 32.06 ? 290 TYR D C   1 
ATOM   4219 O O   . TYR D  2 144 ? -44.071 -21.911  17.614  1.00 29.87 ? 290 TYR D O   1 
ATOM   4220 C CB  . TYR D  2 144 ? -42.285 -21.560  20.377  1.00 33.23 ? 290 TYR D CB  1 
ATOM   4221 C CG  . TYR D  2 144 ? -41.878 -20.393  21.265  1.00 33.10 ? 290 TYR D CG  1 
ATOM   4222 C CD1 . TYR D  2 144 ? -42.426 -19.122  21.099  1.00 32.94 ? 290 TYR D CD1 1 
ATOM   4223 C CD2 . TYR D  2 144 ? -40.889 -20.556  22.238  1.00 33.08 ? 290 TYR D CD2 1 
ATOM   4224 C CE1 . TYR D  2 144 ? -42.018 -18.051  21.885  1.00 32.33 ? 290 TYR D CE1 1 
ATOM   4225 C CE2 . TYR D  2 144 ? -40.480 -19.494  23.036  1.00 33.79 ? 290 TYR D CE2 1 
ATOM   4226 C CZ  . TYR D  2 144 ? -41.050 -18.247  22.856  1.00 32.22 ? 290 TYR D CZ  1 
ATOM   4227 O OH  . TYR D  2 144 ? -40.654 -17.205  23.638  1.00 31.21 ? 290 TYR D OH  1 
ATOM   4228 N N   . GLN D  2 145 ? -43.781 -23.786  18.860  1.00 32.39 ? 291 GLN D N   1 
ATOM   4229 C CA  . GLN D  2 145 ? -43.732 -24.716  17.712  1.00 36.02 ? 291 GLN D CA  1 
ATOM   4230 C C   . GLN D  2 145 ? -44.926 -24.569  16.767  1.00 32.27 ? 291 GLN D C   1 
ATOM   4231 O O   . GLN D  2 145 ? -44.749 -24.533  15.561  1.00 32.81 ? 291 GLN D O   1 
ATOM   4232 C CB  . GLN D  2 145 ? -43.606 -26.187  18.160  1.00 39.86 ? 291 GLN D CB  1 
ATOM   4233 C CG  . GLN D  2 145 ? -42.168 -26.673  18.338  1.00 46.19 ? 291 GLN D CG  1 
ATOM   4234 C CD  . GLN D  2 145 ? -41.416 -26.855  17.017  1.00 52.12 ? 291 GLN D CD  1 
ATOM   4235 O OE1 . GLN D  2 145 ? -41.724 -27.762  16.230  1.00 55.71 ? 291 GLN D OE1 1 
ATOM   4236 N NE2 . GLN D  2 145 ? -40.408 -26.005  16.777  1.00 53.88 ? 291 GLN D NE2 1 
ATOM   4237 N N   . ALA D  2 146 ? -46.127 -24.468  17.320  1.00 30.93 ? 292 ALA D N   1 
ATOM   4238 C CA  . ALA D  2 146 ? -47.352 -24.323  16.510  1.00 31.86 ? 292 ALA D CA  1 
ATOM   4239 C C   . ALA D  2 146 ? -47.381 -23.008  15.730  1.00 30.43 ? 292 ALA D C   1 
ATOM   4240 O O   . ALA D  2 146 ? -47.874 -22.961  14.585  1.00 26.27 ? 292 ALA D O   1 
ATOM   4241 C CB  . ALA D  2 146 ? -48.599 -24.447  17.382  1.00 32.20 ? 292 ALA D CB  1 
ATOM   4242 N N   . CYS D  2 147 ? -46.832 -21.945  16.333  1.00 28.70 ? 293 CYS D N   1 
ATOM   4243 C CA  . CYS D  2 147 ? -46.658 -20.684  15.611  1.00 26.72 ? 293 CYS D CA  1 
ATOM   4244 C C   . CYS D  2 147 ? -45.637 -20.801  14.456  1.00 25.01 ? 293 CYS D C   1 
ATOM   4245 O O   . CYS D  2 147 ? -45.899 -20.348  13.349  1.00 22.40 ? 293 CYS D O   1 
ATOM   4246 C CB  . CYS D  2 147 ? -46.235 -19.553  16.549  1.00 26.14 ? 293 CYS D CB  1 
ATOM   4247 S SG  . CYS D  2 147 ? -45.820 -18.009  15.691  1.00 26.80 ? 293 CYS D SG  1 
ATOM   4248 N N   . LEU D  2 148 ? -44.472 -21.372  14.733  1.00 23.43 ? 294 LEU D N   1 
ATOM   4249 C CA  . LEU D  2 148 ? -43.463 -21.548  13.688  1.00 24.87 ? 294 LEU D CA  1 
ATOM   4250 C C   . LEU D  2 148 ? -44.020 -22.388  12.526  1.00 23.12 ? 294 LEU D C   1 
ATOM   4251 O O   . LEU D  2 148 ? -43.830 -22.049  11.370  1.00 21.63 ? 294 LEU D O   1 
ATOM   4252 C CB  . LEU D  2 148 ? -42.184 -22.209  14.249  1.00 25.83 ? 294 LEU D CB  1 
ATOM   4253 C CG  . LEU D  2 148 ? -40.936 -21.381  14.645  1.00 26.72 ? 294 LEU D CG  1 
ATOM   4254 C CD1 . LEU D  2 148 ? -41.206 -19.911  14.881  1.00 25.66 ? 294 LEU D CD1 1 
ATOM   4255 C CD2 . LEU D  2 148 ? -40.198 -21.981  15.835  1.00 26.87 ? 294 LEU D CD2 1 
ATOM   4256 N N   . GLY D  2 149 ? -44.709 -23.473  12.851  1.00 23.55 ? 295 GLY D N   1 
ATOM   4257 C CA  . GLY D  2 149 ? -45.297 -24.357  11.828  1.00 23.63 ? 295 GLY D CA  1 
ATOM   4258 C C   . GLY D  2 149 ? -46.333 -23.646  10.992  1.00 23.02 ? 295 GLY D C   1 
ATOM   4259 O O   . GLY D  2 149 ? -46.409 -23.844  9.786   1.00 23.10 ? 295 GLY D O   1 
ATOM   4260 N N   . SER D  2 150 ? -47.130 -22.804  11.632  1.00 24.38 ? 296 SER D N   1 
ATOM   4261 C CA  . SER D  2 150 ? -48.126 -22.030  10.922  1.00 24.53 ? 296 SER D CA  1 
ATOM   4262 C C   . SER D  2 150 ? -47.478 -20.978  10.032  1.00 23.86 ? 296 SER D C   1 
ATOM   4263 O O   . SER D  2 150 ? -47.966 -20.709  8.927   1.00 22.92 ? 296 SER D O   1 
ATOM   4264 C CB  . SER D  2 150 ? -49.085 -21.387  11.892  1.00 27.12 ? 296 SER D CB  1 
ATOM   4265 O OG  . SER D  2 150 ? -49.809 -22.409  12.564  1.00 33.32 ? 296 SER D OG  1 
ATOM   4266 N N   . TYR D  2 151 ? -46.369 -20.401  10.481  1.00 22.07 ? 297 TYR D N   1 
ATOM   4267 C CA  . TYR D  2 151 ? -45.614 -19.498  9.611   1.00 21.95 ? 297 TYR D CA  1 
ATOM   4268 C C   . TYR D  2 151 ? -45.123 -20.257  8.382   1.00 21.37 ? 297 TYR D C   1 
ATOM   4269 O O   . TYR D  2 151 ? -45.367 -19.821  7.249   1.00 21.55 ? 297 TYR D O   1 
ATOM   4270 C CB  . TYR D  2 151 ? -44.439 -18.841  10.347  1.00 22.13 ? 297 TYR D CB  1 
ATOM   4271 C CG  . TYR D  2 151 ? -43.592 -17.939  9.482   1.00 21.00 ? 297 TYR D CG  1 
ATOM   4272 C CD1 . TYR D  2 151 ? -42.502 -18.439  8.771   1.00 21.24 ? 297 TYR D CD1 1 
ATOM   4273 C CD2 . TYR D  2 151 ? -43.877 -16.599  9.373   1.00 20.75 ? 297 TYR D CD2 1 
ATOM   4274 C CE1 . TYR D  2 151 ? -41.716 -17.612  7.979   1.00 21.47 ? 297 TYR D CE1 1 
ATOM   4275 C CE2 . TYR D  2 151 ? -43.105 -15.769  8.594   1.00 21.61 ? 297 TYR D CE2 1 
ATOM   4276 C CZ  . TYR D  2 151 ? -42.024 -16.268  7.901   1.00 21.68 ? 297 TYR D CZ  1 
ATOM   4277 O OH  . TYR D  2 151 ? -41.293 -15.423  7.114   1.00 21.83 ? 297 TYR D OH  1 
ATOM   4278 N N   . ALA D  2 152 ? -44.454 -21.393  8.598   1.00 21.40 ? 298 ALA D N   1 
ATOM   4279 C CA  . ALA D  2 152 ? -43.869 -22.170  7.492   1.00 21.32 ? 298 ALA D CA  1 
ATOM   4280 C C   . ALA D  2 152 ? -44.929 -22.679  6.522   1.00 21.95 ? 298 ALA D C   1 
ATOM   4281 O O   . ALA D  2 152 ? -44.695 -22.758  5.317   1.00 20.86 ? 298 ALA D O   1 
ATOM   4282 C CB  . ALA D  2 152 ? -43.054 -23.340  8.014   1.00 22.14 ? 298 ALA D CB  1 
ATOM   4283 N N   . GLY D  2 153 ? -46.099 -23.010  7.060   1.00 21.93 ? 299 GLY D N   1 
ATOM   4284 C CA  . GLY D  2 153 ? -47.196 -23.500  6.260   1.00 21.96 ? 299 GLY D CA  1 
ATOM   4285 C C   . GLY D  2 153 ? -47.807 -22.510  5.280   1.00 21.60 ? 299 GLY D C   1 
ATOM   4286 O O   . GLY D  2 153 ? -48.664 -22.904  4.495   1.00 20.77 ? 299 GLY D O   1 
ATOM   4287 N N   . MET D  2 154 ? -47.389 -21.240  5.314   1.00 22.10 ? 300 MET D N   1 
ATOM   4288 C CA  . MET D  2 154 ? -47.864 -20.241  4.331   1.00 22.14 ? 300 MET D CA  1 
ATOM   4289 C C   . MET D  2 154 ? -46.957 -20.073  3.116   1.00 20.90 ? 300 MET D C   1 
ATOM   4290 O O   . MET D  2 154 ? -47.355 -19.472  2.094   1.00 21.16 ? 300 MET D O   1 
ATOM   4291 C CB  . MET D  2 154 ? -48.097 -18.901  5.028   1.00 24.31 ? 300 MET D CB  1 
ATOM   4292 C CG  . MET D  2 154 ? -49.427 -18.869  5.782   1.00 25.93 ? 300 MET D CG  1 
ATOM   4293 S SD  . MET D  2 154 ? -49.685 -17.261  6.529   1.00 30.59 ? 300 MET D SD  1 
ATOM   4294 C CE  . MET D  2 154 ? -48.204 -17.076  7.517   1.00 31.23 ? 300 MET D CE  1 
ATOM   4295 N N   . ILE D  2 155 ? -45.761 -20.635  3.194   1.00 20.22 ? 301 ILE D N   1 
ATOM   4296 C CA  . ILE D  2 155 ? -44.776 -20.518  2.104   1.00 20.09 ? 301 ILE D CA  1 
ATOM   4297 C C   . ILE D  2 155 ? -45.206 -21.346  0.883   1.00 19.91 ? 301 ILE D C   1 
ATOM   4298 O O   . ILE D  2 155 ? -45.538 -22.528  1.007   1.00 18.58 ? 301 ILE D O   1 
ATOM   4299 C CB  . ILE D  2 155 ? -43.388 -20.935  2.609   1.00 20.10 ? 301 ILE D CB  1 
ATOM   4300 C CG1 . ILE D  2 155 ? -42.941 -19.926  3.692   1.00 20.05 ? 301 ILE D CG1 1 
ATOM   4301 C CG2 . ILE D  2 155 ? -42.397 -20.953  1.468   1.00 20.78 ? 301 ILE D CG2 1 
ATOM   4302 C CD1 . ILE D  2 155 ? -41.815 -20.383  4.570   1.00 19.46 ? 301 ILE D CD1 1 
ATOM   4303 N N   . GLY D  2 156 ? -45.217 -20.707  -0.283  1.00 19.94 ? 302 GLY D N   1 
ATOM   4304 C CA  . GLY D  2 156 ? -45.688 -21.322  -1.514  1.00 20.00 ? 302 GLY D CA  1 
ATOM   4305 C C   . GLY D  2 156 ? -47.160 -21.068  -1.830  1.00 21.25 ? 302 GLY D C   1 
ATOM   4306 O O   . GLY D  2 156 ? -47.703 -21.665  -2.752  1.00 19.92 ? 302 GLY D O   1 
ATOM   4307 N N   . PHE D  2 157 ? -47.816 -20.207  -1.054  1.00 21.83 ? 303 PHE D N   1 
ATOM   4308 C CA  . PHE D  2 157 ? -49.210 -19.835  -1.309  1.00 21.47 ? 303 PHE D CA  1 
ATOM   4309 C C   . PHE D  2 157 ? -49.180 -18.369  -1.631  1.00 22.86 ? 303 PHE D C   1 
ATOM   4310 O O   . PHE D  2 157 ? -48.105 -17.767  -1.629  1.00 21.62 ? 303 PHE D O   1 
ATOM   4311 C CB  . PHE D  2 157 ? -50.073 -20.086  -0.096  1.00 21.03 ? 303 PHE D CB  1 
ATOM   4312 C CG  . PHE D  2 157 ? -50.278 -21.547  0.227   1.00 21.25 ? 303 PHE D CG  1 
ATOM   4313 C CD1 . PHE D  2 157 ? -51.302 -22.269  -0.369  1.00 21.40 ? 303 PHE D CD1 1 
ATOM   4314 C CD2 . PHE D  2 157 ? -49.477 -22.181  1.156   1.00 21.13 ? 303 PHE D CD2 1 
ATOM   4315 C CE1 . PHE D  2 157 ? -51.496 -23.600  -0.067  1.00 21.94 ? 303 PHE D CE1 1 
ATOM   4316 C CE2 . PHE D  2 157 ? -49.673 -23.498  1.479   1.00 22.01 ? 303 PHE D CE2 1 
ATOM   4317 C CZ  . PHE D  2 157 ? -50.682 -24.217  0.875   1.00 22.51 ? 303 PHE D CZ  1 
ATOM   4318 N N   . ASP D  2 158 ? -50.339 -17.786  -1.927  1.00 24.53 ? 304 ASP D N   1 
ATOM   4319 C CA  . ASP D  2 158 ? -50.415 -16.336  -2.158  1.00 25.96 ? 304 ASP D CA  1 
ATOM   4320 C C   . ASP D  2 158 ? -50.524 -15.559  -0.854  1.00 27.32 ? 304 ASP D C   1 
ATOM   4321 O O   . ASP D  2 158 ? -51.409 -14.729  -0.680  1.00 37.76 ? 304 ASP D O   1 
ATOM   4322 C CB  . ASP D  2 158 ? -51.612 -15.996  -3.030  1.00 25.96 ? 304 ASP D CB  1 
ATOM   4323 C CG  . ASP D  2 158 ? -51.502 -16.565  -4.415  1.00 24.74 ? 304 ASP D CG  1 
ATOM   4324 O OD1 . ASP D  2 158 ? -50.427 -16.469  -5.008  1.00 26.28 ? 304 ASP D OD1 1 
ATOM   4325 O OD2 . ASP D  2 158 ? -52.485 -17.107  -4.911  1.00 23.70 ? 304 ASP D OD2 1 
ATOM   4326 N N   . MET D  2 159 ? -49.685 -15.893  0.093   1.00 26.95 ? 305 MET D N   1 
ATOM   4327 C CA  . MET D  2 159 ? -49.471 -15.080  1.260   1.00 26.53 ? 305 MET D CA  1 
ATOM   4328 C C   . MET D  2 159 ? -48.070 -15.445  1.733   1.00 23.95 ? 305 MET D C   1 
ATOM   4329 O O   . MET D  2 159 ? -47.826 -15.573  2.913   1.00 25.35 ? 305 MET D O   1 
ATOM   4330 C CB  . MET D  2 159 ? -50.510 -15.415  2.328   1.00 27.75 ? 305 MET D CB  1 
ATOM   4331 C CG  . MET D  2 159 ? -50.519 -14.478  3.522   1.00 29.79 ? 305 MET D CG  1 
ATOM   4332 S SD  . MET D  2 159 ? -50.731 -12.738  3.096   1.00 31.76 ? 305 MET D SD  1 
ATOM   4333 C CE  . MET D  2 159 ? -52.380 -12.793  2.402   1.00 32.06 ? 305 MET D CE  1 
ATOM   4334 N N   . THR D  2 160 ? -47.150 -15.644  0.803   1.00 22.01 ? 306 THR D N   1 
ATOM   4335 C CA  . THR D  2 160 ? -45.838 -16.149  1.186   1.00 21.66 ? 306 THR D CA  1 
ATOM   4336 C C   . THR D  2 160 ? -45.129 -15.053  1.974   1.00 20.01 ? 306 THR D C   1 
ATOM   4337 O O   . THR D  2 160 ? -44.908 -13.985  1.447   1.00 20.81 ? 306 THR D O   1 
ATOM   4338 C CB  . THR D  2 160 ? -45.034 -16.594  -0.041  1.00 22.29 ? 306 THR D CB  1 
ATOM   4339 O OG1 . THR D  2 160 ? -45.613 -17.798  -0.580  1.00 22.68 ? 306 THR D OG1 1 
ATOM   4340 C CG2 . THR D  2 160 ? -43.556 -16.820  0.326   1.00 22.34 ? 306 THR D CG2 1 
ATOM   4341 N N   . PRO D  2 161 ? -44.810 -15.303  3.253   1.00 20.26 ? 307 PRO D N   1 
ATOM   4342 C CA  . PRO D  2 161 ? -44.028 -14.337  4.024   1.00 20.42 ? 307 PRO D CA  1 
ATOM   4343 C C   . PRO D  2 161 ? -42.531 -14.567  3.847   1.00 20.22 ? 307 PRO D C   1 
ATOM   4344 O O   . PRO D  2 161 ? -42.117 -15.689  3.544   1.00 20.24 ? 307 PRO D O   1 
ATOM   4345 C CB  . PRO D  2 161 ? -44.416 -14.671  5.457   1.00 21.16 ? 307 PRO D CB  1 
ATOM   4346 C CG  . PRO D  2 161 ? -44.599 -16.157  5.429   1.00 21.92 ? 307 PRO D CG  1 
ATOM   4347 C CD  . PRO D  2 161 ? -45.033 -16.538  4.028   1.00 20.82 ? 307 PRO D CD  1 
ATOM   4348 N N   . ASN D  2 162 ? -41.728 -13.520  4.016   1.00 19.45 ? 308 ASN D N   1 
ATOM   4349 C CA  . ASN D  2 162 ? -40.269 -13.665  4.107   1.00 19.51 ? 308 ASN D CA  1 
ATOM   4350 C C   . ASN D  2 162 ? -39.589 -12.563  4.926   1.00 20.43 ? 308 ASN D C   1 
ATOM   4351 O O   . ASN D  2 162 ? -40.129 -11.454  5.115   1.00 19.96 ? 308 ASN D O   1 
ATOM   4352 C CB  . ASN D  2 162 ? -39.615 -13.732  2.722   1.00 18.73 ? 308 ASN D CB  1 
ATOM   4353 C CG  . ASN D  2 162 ? -38.261 -14.448  2.750   1.00 18.92 ? 308 ASN D CG  1 
ATOM   4354 O OD1 . ASN D  2 162 ? -38.076 -15.401  3.493   1.00 19.14 ? 308 ASN D OD1 1 
ATOM   4355 N ND2 . ASN D  2 162 ? -37.323 -13.998  1.935   1.00 18.77 ? 308 ASN D ND2 1 
ATOM   4356 N N   . TYR D  2 163 ? -38.392 -12.899  5.399   1.00 20.81 ? 309 TYR D N   1 
ATOM   4357 C CA  . TYR D  2 163 ? -37.447 -11.918  5.897   1.00 21.51 ? 309 TYR D CA  1 
ATOM   4358 C C   . TYR D  2 163 ? -37.344 -10.810  4.872   1.00 22.01 ? 309 TYR D C   1 
ATOM   4359 O O   . TYR D  2 163 ? -37.178 -11.050  3.690   1.00 24.03 ? 309 TYR D O   1 
ATOM   4360 C CB  . TYR D  2 163 ? -36.073 -12.550  6.186   1.00 21.29 ? 309 TYR D CB  1 
ATOM   4361 C CG  . TYR D  2 163 ? -36.166 -13.669  7.195   1.00 20.53 ? 309 TYR D CG  1 
ATOM   4362 C CD1 . TYR D  2 163 ? -36.168 -13.398  8.548   1.00 20.54 ? 309 TYR D CD1 1 
ATOM   4363 C CD2 . TYR D  2 163 ? -36.286 -14.996  6.789   1.00 20.11 ? 309 TYR D CD2 1 
ATOM   4364 C CE1 . TYR D  2 163 ? -36.268 -14.410  9.485   1.00 21.06 ? 309 TYR D CE1 1 
ATOM   4365 C CE2 . TYR D  2 163 ? -36.386 -16.022  7.717   1.00 20.40 ? 309 TYR D CE2 1 
ATOM   4366 C CZ  . TYR D  2 163 ? -36.390 -15.718  9.061   1.00 20.56 ? 309 TYR D CZ  1 
ATOM   4367 O OH  . TYR D  2 163 ? -36.480 -16.706  9.995   1.00 20.88 ? 309 TYR D OH  1 
ATOM   4368 N N   . VAL D  2 164 ? -37.503 -9.590   5.358   1.00 23.31 ? 310 VAL D N   1 
ATOM   4369 C CA  . VAL D  2 164 ? -37.568 -8.403   4.533   1.00 24.55 ? 310 VAL D CA  1 
ATOM   4370 C C   . VAL D  2 164 ? -36.170 -7.959   4.058   1.00 24.07 ? 310 VAL D C   1 
ATOM   4371 O O   . VAL D  2 164 ? -36.035 -7.369   2.983   1.00 25.69 ? 310 VAL D O   1 
ATOM   4372 C CB  . VAL D  2 164 ? -38.367 -7.331   5.316   1.00 26.70 ? 310 VAL D CB  1 
ATOM   4373 C CG1 . VAL D  2 164 ? -37.825 -5.931   5.120   1.00 29.44 ? 310 VAL D CG1 1 
ATOM   4374 C CG2 . VAL D  2 164 ? -39.852 -7.444   4.998   1.00 26.35 ? 310 VAL D CG2 1 
ATOM   4375 N N   . ASP D  2 165 ? -35.132 -8.295   4.812   1.00 23.98 ? 311 ASP D N   1 
ATOM   4376 C CA  . ASP D  2 165 ? -33.760 -7.930   4.448   1.00 23.85 ? 311 ASP D CA  1 
ATOM   4377 C C   . ASP D  2 165 ? -32.758 -8.844   5.153   1.00 24.42 ? 311 ASP D C   1 
ATOM   4378 O O   . ASP D  2 165 ? -33.164 -9.837   5.760   1.00 23.30 ? 311 ASP D O   1 
ATOM   4379 C CB  . ASP D  2 165 ? -33.513 -6.468   4.810   1.00 24.60 ? 311 ASP D CB  1 
ATOM   4380 C CG  . ASP D  2 165 ? -33.617 -6.204   6.293   1.00 25.50 ? 311 ASP D CG  1 
ATOM   4381 O OD1 . ASP D  2 165 ? -33.505 -7.135   7.131   1.00 26.27 ? 311 ASP D OD1 1 
ATOM   4382 O OD2 . ASP D  2 165 ? -33.802 -5.027   6.620   1.00 29.34 ? 311 ASP D OD2 1 
ATOM   4383 N N   . SER D  2 166 ? -31.461 -8.528   5.077   1.00 24.75 ? 312 SER D N   1 
ATOM   4384 C CA  . SER D  2 166 ? -30.438 -9.356   5.709   1.00 25.93 ? 312 SER D CA  1 
ATOM   4385 C C   . SER D  2 166 ? -29.957 -8.862   7.069   1.00 27.62 ? 312 SER D C   1 
ATOM   4386 O O   . SER D  2 166 ? -28.803 -9.071   7.447   1.00 28.16 ? 312 SER D O   1 
ATOM   4387 C CB  . SER D  2 166 ? -29.242 -9.527   4.775   1.00 28.16 ? 312 SER D CB  1 
ATOM   4388 O OG  . SER D  2 166 ? -28.619 -8.291   4.482   1.00 31.06 ? 312 SER D OG  1 
ATOM   4389 N N   . SER D  2 167 ? -30.832 -8.211   7.811   1.00 29.44 ? 313 SER D N   1 
ATOM   4390 C CA  . SER D  2 167 ? -30.538 -7.899   9.191   1.00 32.54 ? 313 SER D CA  1 
ATOM   4391 C C   . SER D  2 167 ? -30.341 -9.212   9.975   1.00 32.03 ? 313 SER D C   1 
ATOM   4392 O O   . SER D  2 167 ? -31.223 -10.051  9.982   1.00 34.90 ? 313 SER D O   1 
ATOM   4393 C CB  . SER D  2 167 ? -31.675 -7.085   9.791   1.00 35.12 ? 313 SER D CB  1 
ATOM   4394 O OG  . SER D  2 167 ? -31.468 -6.954   11.189  1.00 41.68 ? 313 SER D OG  1 
ATOM   4395 N N   . PRO D  2 168 ? -29.184 -9.388   10.642  1.00 31.75 ? 314 PRO D N   1 
ATOM   4396 C CA  . PRO D  2 168 ? -28.926 -10.636  11.384  1.00 31.81 ? 314 PRO D CA  1 
ATOM   4397 C C   . PRO D  2 168 ? -29.824 -10.939  12.607  1.00 33.74 ? 314 PRO D C   1 
ATOM   4398 O O   . PRO D  2 168 ? -30.351 -12.050  12.724  1.00 31.34 ? 314 PRO D O   1 
ATOM   4399 C CB  . PRO D  2 168 ? -27.455 -10.528  11.809  1.00 31.86 ? 314 PRO D CB  1 
ATOM   4400 C CG  . PRO D  2 168 ? -26.975 -9.196   11.414  1.00 31.53 ? 314 PRO D CG  1 
ATOM   4401 C CD  . PRO D  2 168 ? -28.020 -8.485   10.604  1.00 31.94 ? 314 PRO D CD  1 
ATOM   4402 N N   . THR D  2 169 ? -29.991 -9.969   13.497  1.00 33.64 ? 315 THR D N   1 
ATOM   4403 C CA  . THR D  2 169 ? -30.826 -10.138  14.682  1.00 35.44 ? 315 THR D CA  1 
ATOM   4404 C C   . THR D  2 169 ? -32.102 -9.296   14.641  1.00 34.68 ? 315 THR D C   1 
ATOM   4405 O O   . THR D  2 169 ? -33.085 -9.647   15.265  1.00 33.38 ? 315 THR D O   1 
ATOM   4406 C CB  . THR D  2 169 ? -30.050 -9.745   15.952  1.00 38.24 ? 315 THR D CB  1 
ATOM   4407 O OG1 . THR D  2 169 ? -29.593 -8.392   15.822  1.00 41.34 ? 315 THR D OG1 1 
ATOM   4408 C CG2 . THR D  2 169 ? -28.850 -10.679  16.159  1.00 39.52 ? 315 THR D CG2 1 
ATOM   4409 N N   . GLY D  2 170 ? -32.075 -8.173   13.933  1.00 34.38 ? 316 GLY D N   1 
ATOM   4410 C CA  . GLY D  2 170 ? -33.263 -7.345   13.780  1.00 35.92 ? 316 GLY D CA  1 
ATOM   4411 C C   . GLY D  2 170 ? -34.219 -7.917   12.746  1.00 33.51 ? 316 GLY D C   1 
ATOM   4412 O O   . GLY D  2 170 ? -34.415 -7.329   11.684  1.00 33.22 ? 316 GLY D O   1 
ATOM   4413 N N   . ILE D  2 171 ? -34.814 -9.061   13.069  1.00 32.00 ? 317 ILE D N   1 
ATOM   4414 C CA  . ILE D  2 171 ? -35.697 -9.791   12.141  1.00 31.72 ? 317 ILE D CA  1 
ATOM   4415 C C   . ILE D  2 171 ? -37.006 -9.061   11.891  1.00 27.56 ? 317 ILE D C   1 
ATOM   4416 O O   . ILE D  2 171 ? -37.715 -8.725   12.832  1.00 27.06 ? 317 ILE D O   1 
ATOM   4417 C CB  . ILE D  2 171 ? -36.073 -11.181  12.713  1.00 32.36 ? 317 ILE D CB  1 
ATOM   4418 C CG1 . ILE D  2 171 ? -34.842 -12.079  12.812  1.00 35.53 ? 317 ILE D CG1 1 
ATOM   4419 C CG2 . ILE D  2 171 ? -37.155 -11.847  11.880  1.00 33.16 ? 317 ILE D CG2 1 
ATOM   4420 C CD1 . ILE D  2 171 ? -33.812 -11.844  11.736  1.00 36.71 ? 317 ILE D CD1 1 
ATOM   4421 N N   . VAL D  2 172 ? -37.318 -8.831   10.623  1.00 25.59 ? 318 VAL D N   1 
ATOM   4422 C CA  . VAL D  2 172 ? -38.650 -8.373   10.220  1.00 24.79 ? 318 VAL D CA  1 
ATOM   4423 C C   . VAL D  2 172 ? -39.140 -9.262   9.079   1.00 23.74 ? 318 VAL D C   1 
ATOM   4424 O O   . VAL D  2 172 ? -38.476 -9.366   8.063   1.00 21.90 ? 318 VAL D O   1 
ATOM   4425 C CB  . VAL D  2 172 ? -38.664 -6.909   9.746   1.00 24.49 ? 318 VAL D CB  1 
ATOM   4426 C CG1 . VAL D  2 172 ? -40.071 -6.489   9.310   1.00 24.38 ? 318 VAL D CG1 1 
ATOM   4427 C CG2 . VAL D  2 172 ? -38.175 -5.992   10.858  1.00 24.78 ? 318 VAL D CG2 1 
ATOM   4428 N N   . VAL D  2 173 ? -40.302 -9.893   9.270   1.00 23.58 ? 319 VAL D N   1 
ATOM   4429 C CA  . VAL D  2 173 ? -40.932 -10.702  8.228   1.00 23.05 ? 319 VAL D CA  1 
ATOM   4430 C C   . VAL D  2 173 ? -42.242 -10.054  7.769   1.00 23.36 ? 319 VAL D C   1 
ATOM   4431 O O   . VAL D  2 173 ? -42.906 -9.341   8.517   1.00 23.80 ? 319 VAL D O   1 
ATOM   4432 C CB  . VAL D  2 173 ? -41.156 -12.175  8.678   1.00 21.90 ? 319 VAL D CB  1 
ATOM   4433 C CG1 . VAL D  2 173 ? -39.822 -12.868  8.930   1.00 21.25 ? 319 VAL D CG1 1 
ATOM   4434 C CG2 . VAL D  2 173 ? -42.035 -12.280  9.920   1.00 21.71 ? 319 VAL D CG2 1 
ATOM   4435 N N   . SER D  2 174 ? -42.588 -10.291  6.513   1.00 23.56 ? 320 SER D N   1 
ATOM   4436 C CA  . SER D  2 174 ? -43.772 -9.714   5.915   1.00 23.11 ? 320 SER D CA  1 
ATOM   4437 C C   . SER D  2 174 ? -44.157 -10.461  4.644   1.00 22.98 ? 320 SER D C   1 
ATOM   4438 O O   . SER D  2 174 ? -43.287 -10.981  3.956   1.00 22.56 ? 320 SER D O   1 
ATOM   4439 C CB  . SER D  2 174 ? -43.497 -8.250   5.557   1.00 22.98 ? 320 SER D CB  1 
ATOM   4440 O OG  . SER D  2 174 ? -44.569 -7.655   4.835   1.00 23.54 ? 320 SER D OG  1 
ATOM   4441 N N   . PRO D  2 175 ? -45.458 -10.460  4.299   1.00 23.73 ? 321 PRO D N   1 
ATOM   4442 C CA  . PRO D  2 175 ? -45.828 -10.790  2.930   1.00 23.15 ? 321 PRO D CA  1 
ATOM   4443 C C   . PRO D  2 175 ? -45.429 -9.671   2.002   1.00 23.90 ? 321 PRO D C   1 
ATOM   4444 O O   . PRO D  2 175 ? -45.112 -8.580   2.460   1.00 23.67 ? 321 PRO D O   1 
ATOM   4445 C CB  . PRO D  2 175 ? -47.357 -10.952  2.980   1.00 24.31 ? 321 PRO D CB  1 
ATOM   4446 C CG  . PRO D  2 175 ? -47.806 -10.511  4.314   1.00 23.96 ? 321 PRO D CG  1 
ATOM   4447 C CD  . PRO D  2 175 ? -46.615 -10.074  5.121   1.00 23.81 ? 321 PRO D CD  1 
ATOM   4448 N N   . TRP D  2 176 ? -45.392 -9.941   0.709   1.00 24.77 ? 322 TRP D N   1 
ATOM   4449 C CA  . TRP D  2 176 ? -45.065 -8.915   -0.264  1.00 27.20 ? 322 TRP D CA  1 
ATOM   4450 C C   . TRP D  2 176 ? -46.346 -8.157   -0.599  1.00 28.71 ? 322 TRP D C   1 
ATOM   4451 O O   . TRP D  2 176 ? -47.092 -8.525   -1.501  1.00 26.45 ? 322 TRP D O   1 
ATOM   4452 C CB  . TRP D  2 176 ? -44.455 -9.543   -1.503  1.00 28.48 ? 322 TRP D CB  1 
ATOM   4453 C CG  . TRP D  2 176 ? -43.976 -8.574   -2.520  1.00 30.22 ? 322 TRP D CG  1 
ATOM   4454 C CD1 . TRP D  2 176 ? -44.607 -8.214   -3.675  1.00 30.84 ? 322 TRP D CD1 1 
ATOM   4455 C CD2 . TRP D  2 176 ? -42.736 -7.863   -2.505  1.00 31.44 ? 322 TRP D CD2 1 
ATOM   4456 N NE1 . TRP D  2 176 ? -43.849 -7.303   -4.366  1.00 31.89 ? 322 TRP D NE1 1 
ATOM   4457 C CE2 . TRP D  2 176 ? -42.690 -7.077   -3.675  1.00 31.09 ? 322 TRP D CE2 1 
ATOM   4458 C CE3 . TRP D  2 176 ? -41.665 -7.813   -1.619  1.00 31.19 ? 322 TRP D CE3 1 
ATOM   4459 C CZ2 . TRP D  2 176 ? -41.614 -6.243   -3.975  1.00 32.62 ? 322 TRP D CZ2 1 
ATOM   4460 C CZ3 . TRP D  2 176 ? -40.598 -6.983   -1.916  1.00 32.84 ? 322 TRP D CZ3 1 
ATOM   4461 C CH2 . TRP D  2 176 ? -40.578 -6.209   -3.083  1.00 32.12 ? 322 TRP D CH2 1 
ATOM   4462 N N   . CYS D  2 177 ? -46.601 -7.123   0.192   1.00 29.66 ? 323 CYS D N   1 
ATOM   4463 C CA  . CYS D  2 177 ? -47.761 -6.264   0.022   1.00 31.32 ? 323 CYS D CA  1 
ATOM   4464 C C   . CYS D  2 177 ? -47.581 -4.990   0.846   1.00 33.61 ? 323 CYS D C   1 
ATOM   4465 O O   . CYS D  2 177 ? -46.747 -4.948   1.748   1.00 31.20 ? 323 CYS D O   1 
ATOM   4466 C CB  . CYS D  2 177 ? -49.044 -6.986   0.465   1.00 29.80 ? 323 CYS D CB  1 
ATOM   4467 S SG  . CYS D  2 177 ? -49.176 -7.448   2.210   1.00 31.42 ? 323 CYS D SG  1 
ATOM   4468 N N   . SER D  2 178 ? -48.366 -3.959   0.549   1.00 34.45 ? 324 SER D N   1 
ATOM   4469 C CA  . SER D  2 178 ? -48.390 -2.771   1.409   1.00 36.74 ? 324 SER D CA  1 
ATOM   4470 C C   . SER D  2 178 ? -49.820 -2.339   1.655   1.00 36.15 ? 324 SER D C   1 
ATOM   4471 O O   . SER D  2 178 ? -50.750 -2.854   1.043   1.00 36.02 ? 324 SER D O   1 
ATOM   4472 C CB  . SER D  2 178 ? -47.568 -1.616   0.812   1.00 37.63 ? 324 SER D CB  1 
ATOM   4473 O OG  . SER D  2 178 ? -48.264 -0.938   -0.216  1.00 38.04 ? 324 SER D OG  1 
ATOM   4474 N N   . CYS D  2 179 ? -49.987 -1.393   2.564   1.00 39.12 ? 325 CYS D N   1 
ATOM   4475 C CA  . CYS D  2 179 ? -51.309 -0.900   2.906   1.00 41.22 ? 325 CYS D CA  1 
ATOM   4476 C C   . CYS D  2 179 ? -51.645 0.443    2.240   1.00 44.30 ? 325 CYS D C   1 
ATOM   4477 O O   . CYS D  2 179 ? -52.663 1.059    2.552   1.00 46.38 ? 325 CYS D O   1 
ATOM   4478 C CB  . CYS D  2 179 ? -51.467 -0.859   4.419   1.00 39.90 ? 325 CYS D CB  1 
ATOM   4479 S SG  . CYS D  2 179 ? -51.810 -2.490   5.114   1.00 38.18 ? 325 CYS D SG  1 
ATOM   4480 N N   . ARG D  2 180 ? -50.823 0.854    1.280   1.00 45.79 ? 326 ARG D N   1 
ATOM   4481 C CA  . ARG D  2 180 ? -51.149 1.992    0.431   1.00 48.54 ? 326 ARG D CA  1 
ATOM   4482 C C   . ARG D  2 180 ? -52.278 1.605    -0.521  1.00 48.10 ? 326 ARG D C   1 
ATOM   4483 O O   . ARG D  2 180 ? -52.369 0.454    -0.962  1.00 48.57 ? 326 ARG D O   1 
ATOM   4484 C CB  . ARG D  2 180 ? -49.913 2.461    -0.348  1.00 53.79 ? 326 ARG D CB  1 
ATOM   4485 C CG  . ARG D  2 180 ? -48.686 2.658    0.540   1.00 61.10 ? 326 ARG D CG  1 
ATOM   4486 C CD  . ARG D  2 180 ? -47.757 3.771    0.075   1.00 67.56 ? 326 ARG D CD  1 
ATOM   4487 N NE  . ARG D  2 180 ? -47.164 3.508    -1.234  1.00 73.06 ? 326 ARG D NE  1 
ATOM   4488 C CZ  . ARG D  2 180 ? -46.181 2.638    -1.475  1.00 80.46 ? 326 ARG D CZ  1 
ATOM   4489 N NH1 . ARG D  2 180 ? -45.651 1.896    -0.500  1.00 81.74 ? 326 ARG D NH1 1 
ATOM   4490 N NH2 . ARG D  2 180 ? -45.728 2.500    -2.716  1.00 84.28 ? 326 ARG D NH2 1 
ATOM   4491 N N   . GLY D  2 181 ? -53.140 2.572    -0.829  1.00 48.91 ? 327 GLY D N   1 
ATOM   4492 C CA  . GLY D  2 181 ? -54.313 2.342    -1.673  1.00 44.76 ? 327 GLY D CA  1 
ATOM   4493 C C   . GLY D  2 181 ? -55.426 1.602    -0.957  1.00 44.22 ? 327 GLY D C   1 
ATOM   4494 O O   . GLY D  2 181 ? -56.256 0.970    -1.601  1.00 48.17 ? 327 GLY D O   1 
ATOM   4495 N N   . SER D  2 182 ? -55.460 1.684    0.371   1.00 44.12 ? 328 SER D N   1 
ATOM   4496 C CA  . SER D  2 182 ? -56.482 0.992    1.166   1.00 45.74 ? 328 SER D CA  1 
ATOM   4497 C C   . SER D  2 182 ? -57.816 1.736    1.216   1.00 46.12 ? 328 SER D C   1 
ATOM   4498 O O   . SER D  2 182 ? -58.828 1.146    1.598   1.00 41.94 ? 328 SER D O   1 
ATOM   4499 C CB  . SER D  2 182 ? -55.995 0.762    2.605   1.00 46.43 ? 328 SER D CB  1 
ATOM   4500 O OG  . SER D  2 182 ? -54.992 -0.227   2.670   1.00 46.68 ? 328 SER D OG  1 
ATOM   4501 N N   . GLY D  2 183 ? -57.804 3.026    0.859   1.00 50.14 ? 329 GLY D N   1 
ATOM   4502 C CA  . GLY D  2 183 ? -58.985 3.885    0.965   1.00 49.30 ? 329 GLY D CA  1 
ATOM   4503 C C   . GLY D  2 183 ? -59.428 4.021    2.413   1.00 51.73 ? 329 GLY D C   1 
ATOM   4504 O O   . GLY D  2 183 ? -58.653 4.428    3.276   1.00 54.31 ? 329 GLY D O   1 
ATOM   4505 N N   . ASN D  2 184 ? -60.669 3.645    2.689   1.00 52.71 ? 330 ASN D N   1 
ATOM   4506 C CA  . ASN D  2 184 ? -61.211 3.749    4.040   1.00 56.47 ? 330 ASN D CA  1 
ATOM   4507 C C   . ASN D  2 184 ? -60.948 2.510    4.899   1.00 56.36 ? 330 ASN D C   1 
ATOM   4508 O O   . ASN D  2 184 ? -61.372 2.463    6.055   1.00 52.31 ? 330 ASN D O   1 
ATOM   4509 C CB  . ASN D  2 184 ? -62.717 4.036    3.986   1.00 60.97 ? 330 ASN D CB  1 
ATOM   4510 C CG  . ASN D  2 184 ? -63.490 2.958    3.252   1.00 65.02 ? 330 ASN D CG  1 
ATOM   4511 O OD1 . ASN D  2 184 ? -62.996 2.378    2.284   1.00 68.73 ? 330 ASN D OD1 1 
ATOM   4512 N ND2 . ASN D  2 184 ? -64.711 2.690    3.700   1.00 67.91 ? 330 ASN D ND2 1 
ATOM   4513 N N   . MET D  2 185 ? -60.254 1.509    4.351   1.00 56.11 ? 331 MET D N   1 
ATOM   4514 C CA  . MET D  2 185 ? -59.938 0.295    5.115   1.00 55.56 ? 331 MET D CA  1 
ATOM   4515 C C   . MET D  2 185 ? -58.470 0.238    5.541   1.00 53.23 ? 331 MET D C   1 
ATOM   4516 O O   . MET D  2 185 ? -57.935 -0.835   5.796   1.00 49.35 ? 331 MET D O   1 
ATOM   4517 C CB  . MET D  2 185 ? -60.330 -0.949   4.320   1.00 58.35 ? 331 MET D CB  1 
ATOM   4518 C CG  . MET D  2 185 ? -61.768 -1.372   4.566   1.00 61.19 ? 331 MET D CG  1 
ATOM   4519 S SD  . MET D  2 185 ? -62.426 -2.310   3.176   1.00 71.47 ? 331 MET D SD  1 
ATOM   4520 C CE  . MET D  2 185 ? -61.593 -3.887   3.377   1.00 69.53 ? 331 MET D CE  1 
ATOM   4521 N N   . GLU D  2 186 ? -57.843 1.404    5.659   1.00 50.23 ? 332 GLU D N   1 
ATOM   4522 C CA  . GLU D  2 186 ? -56.429 1.489    5.985   1.00 50.92 ? 332 GLU D CA  1 
ATOM   4523 C C   . GLU D  2 186 ? -56.095 0.902    7.360   1.00 47.47 ? 332 GLU D C   1 
ATOM   4524 O O   . GLU D  2 186 ? -55.066 0.240    7.502   1.00 41.69 ? 332 GLU D O   1 
ATOM   4525 C CB  . GLU D  2 186 ? -55.939 2.934    5.893   1.00 54.00 ? 332 GLU D CB  1 
ATOM   4526 C CG  . GLU D  2 186 ? -54.427 3.065    5.835   1.00 56.91 ? 332 GLU D CG  1 
ATOM   4527 C CD  . GLU D  2 186 ? -53.955 4.480    6.098   1.00 59.17 ? 332 GLU D CD  1 
ATOM   4528 O OE1 . GLU D  2 186 ? -53.317 4.712    7.152   1.00 60.50 ? 332 GLU D OE1 1 
ATOM   4529 O OE2 . GLU D  2 186 ? -54.232 5.358    5.254   1.00 60.47 ? 332 GLU D OE2 1 
ATOM   4530 N N   . GLU D  2 187 ? -56.951 1.132    8.357   1.00 44.08 ? 333 GLU D N   1 
ATOM   4531 C CA  . GLU D  2 187 ? -56.694 0.618    9.705   1.00 46.53 ? 333 GLU D CA  1 
ATOM   4532 C C   . GLU D  2 187 ? -56.771 -0.903   9.704   1.00 42.73 ? 333 GLU D C   1 
ATOM   4533 O O   . GLU D  2 187 ? -55.953 -1.570   10.332  1.00 37.12 ? 333 GLU D O   1 
ATOM   4534 C CB  . GLU D  2 187 ? -57.677 1.187    10.743  1.00 50.51 ? 333 GLU D CB  1 
ATOM   4535 C CG  . GLU D  2 187 ? -57.062 1.468    12.120  1.00 56.32 ? 333 GLU D CG  1 
ATOM   4536 C CD  . GLU D  2 187 ? -56.565 0.231    12.874  1.00 61.47 ? 333 GLU D CD  1 
ATOM   4537 O OE1 . GLU D  2 187 ? -55.328 0.087    13.044  1.00 62.69 ? 333 GLU D OE1 1 
ATOM   4538 O OE2 . GLU D  2 187 ? -57.398 -0.597   13.312  1.00 66.20 ? 333 GLU D OE2 1 
ATOM   4539 N N   . GLU D  2 188 ? -57.775 -1.432   9.009   1.00 42.47 ? 334 GLU D N   1 
ATOM   4540 C CA  . GLU D  2 188 ? -57.980 -2.872   8.891   1.00 42.46 ? 334 GLU D CA  1 
ATOM   4541 C C   . GLU D  2 188 ? -56.769 -3.533   8.227   1.00 38.98 ? 334 GLU D C   1 
ATOM   4542 O O   . GLU D  2 188 ? -56.307 -4.564   8.686   1.00 37.97 ? 334 GLU D O   1 
ATOM   4543 C CB  . GLU D  2 188 ? -59.259 -3.144   8.098   1.00 47.60 ? 334 GLU D CB  1 
ATOM   4544 C CG  . GLU D  2 188 ? -59.464 -4.576   7.616   1.00 56.84 ? 334 GLU D CG  1 
ATOM   4545 C CD  . GLU D  2 188 ? -60.070 -5.501   8.655   1.00 63.15 ? 334 GLU D CD  1 
ATOM   4546 O OE1 . GLU D  2 188 ? -60.770 -6.460   8.247   1.00 65.22 ? 334 GLU D OE1 1 
ATOM   4547 O OE2 . GLU D  2 188 ? -59.847 -5.273   9.868   1.00 70.77 ? 334 GLU D OE2 1 
ATOM   4548 N N   . CYS D  2 189 ? -56.268 -2.924   7.158   1.00 36.00 ? 335 CYS D N   1 
ATOM   4549 C CA  . CYS D  2 189 ? -55.122 -3.442   6.421   1.00 37.83 ? 335 CYS D CA  1 
ATOM   4550 C C   . CYS D  2 189 ? -53.863 -3.490   7.290   1.00 38.71 ? 335 CYS D C   1 
ATOM   4551 O O   . CYS D  2 189 ? -53.176 -4.508   7.327   1.00 37.90 ? 335 CYS D O   1 
ATOM   4552 C CB  . CYS D  2 189 ? -54.863 -2.586   5.191   1.00 35.30 ? 335 CYS D CB  1 
ATOM   4553 S SG  . CYS D  2 189 ? -53.509 -3.131   4.137   1.00 37.36 ? 335 CYS D SG  1 
ATOM   4554 N N   . GLU D  2 190 ? -53.579 -2.395   7.996   1.00 38.32 ? 336 GLU D N   1 
ATOM   4555 C CA  . GLU D  2 190 ? -52.373 -2.287   8.813   1.00 37.53 ? 336 GLU D CA  1 
ATOM   4556 C C   . GLU D  2 190 ? -52.414 -3.236   9.999   1.00 34.92 ? 336 GLU D C   1 
ATOM   4557 O O   . GLU D  2 190 ? -51.384 -3.766   10.393  1.00 37.22 ? 336 GLU D O   1 
ATOM   4558 C CB  . GLU D  2 190 ? -52.150 -0.835   9.282   1.00 39.96 ? 336 GLU D CB  1 
ATOM   4559 C CG  . GLU D  2 190 ? -52.001 0.178    8.141   1.00 43.58 ? 336 GLU D CG  1 
ATOM   4560 C CD  . GLU D  2 190 ? -50.581 0.338    7.577   1.00 47.95 ? 336 GLU D CD  1 
ATOM   4561 O OE1 . GLU D  2 190 ? -49.659 -0.459   7.890   1.00 47.82 ? 336 GLU D OE1 1 
ATOM   4562 O OE2 . GLU D  2 190 ? -50.392 1.288    6.777   1.00 56.26 ? 336 GLU D OE2 1 
ATOM   4563 N N   . LYS D  2 191 ? -53.593 -3.470   10.562  1.00 31.76 ? 337 LYS D N   1 
ATOM   4564 C CA  . LYS D  2 191 ? -53.728 -4.422   11.654  1.00 33.89 ? 337 LYS D CA  1 
ATOM   4565 C C   . LYS D  2 191 ? -53.430 -5.835   11.137  1.00 32.81 ? 337 LYS D C   1 
ATOM   4566 O O   . LYS D  2 191 ? -52.790 -6.648   11.815  1.00 31.57 ? 337 LYS D O   1 
ATOM   4567 C CB  . LYS D  2 191 ? -55.140 -4.352   12.259  1.00 37.67 ? 337 LYS D CB  1 
ATOM   4568 C CG  . LYS D  2 191 ? -55.357 -5.220   13.493  1.00 41.36 ? 337 LYS D CG  1 
ATOM   4569 C CD  . LYS D  2 191 ? -56.832 -5.336   13.872  1.00 46.88 ? 337 LYS D CD  1 
ATOM   4570 C CE  . LYS D  2 191 ? -57.559 -6.408   13.064  1.00 51.69 ? 337 LYS D CE  1 
ATOM   4571 N NZ  . LYS D  2 191 ? -58.926 -6.724   13.585  1.00 55.54 ? 337 LYS D NZ  1 
ATOM   4572 N N   . PHE D  2 192 ? -53.902 -6.127   9.930   1.00 31.18 ? 338 PHE D N   1 
ATOM   4573 C CA  . PHE D  2 192 ? -53.646 -7.425   9.310   1.00 29.53 ? 338 PHE D CA  1 
ATOM   4574 C C   . PHE D  2 192 ? -52.151 -7.578   9.103   1.00 26.87 ? 338 PHE D C   1 
ATOM   4575 O O   . PHE D  2 192 ? -51.563 -8.571   9.493   1.00 25.36 ? 338 PHE D O   1 
ATOM   4576 C CB  . PHE D  2 192 ? -54.387 -7.554   7.977   1.00 30.24 ? 338 PHE D CB  1 
ATOM   4577 C CG  . PHE D  2 192 ? -53.936 -8.721   7.132   1.00 30.86 ? 338 PHE D CG  1 
ATOM   4578 C CD1 . PHE D  2 192 ? -54.317 -10.014  7.448   1.00 31.83 ? 338 PHE D CD1 1 
ATOM   4579 C CD2 . PHE D  2 192 ? -53.132 -8.522   6.032   1.00 31.47 ? 338 PHE D CD2 1 
ATOM   4580 C CE1 . PHE D  2 192 ? -53.904 -11.085  6.670   1.00 32.81 ? 338 PHE D CE1 1 
ATOM   4581 C CE2 . PHE D  2 192 ? -52.714 -9.587   5.254   1.00 33.08 ? 338 PHE D CE2 1 
ATOM   4582 C CZ  . PHE D  2 192 ? -53.106 -10.872  5.571   1.00 32.19 ? 338 PHE D CZ  1 
ATOM   4583 N N   . LEU D  2 193 ? -51.546 -6.574   8.506   1.00 25.55 ? 339 LEU D N   1 
ATOM   4584 C CA  . LEU D  2 193 ? -50.134 -6.628   8.212   1.00 27.10 ? 339 LEU D CA  1 
ATOM   4585 C C   . LEU D  2 193 ? -49.281 -6.818   9.476   1.00 29.74 ? 339 LEU D C   1 
ATOM   4586 O O   . LEU D  2 193 ? -48.289 -7.562   9.442   1.00 30.38 ? 339 LEU D O   1 
ATOM   4587 C CB  . LEU D  2 193 ? -49.717 -5.389   7.443   1.00 25.87 ? 339 LEU D CB  1 
ATOM   4588 C CG  . LEU D  2 193 ? -48.245 -5.291   7.062   1.00 26.59 ? 339 LEU D CG  1 
ATOM   4589 C CD1 . LEU D  2 193 ? -47.769 -6.507   6.277   1.00 26.41 ? 339 LEU D CD1 1 
ATOM   4590 C CD2 . LEU D  2 193 ? -48.024 -4.025   6.261   1.00 27.07 ? 339 LEU D CD2 1 
ATOM   4591 N N   . ARG D  2 194 ? -49.698 -6.202   10.587  1.00 30.35 ? 340 ARG D N   1 
ATOM   4592 C CA  . ARG D  2 194 ? -48.961 -6.272   11.849  1.00 30.65 ? 340 ARG D CA  1 
ATOM   4593 C C   . ARG D  2 194 ? -48.925 -7.649   12.482  1.00 29.35 ? 340 ARG D C   1 
ATOM   4594 O O   . ARG D  2 194 ? -48.065 -7.911   13.312  1.00 27.49 ? 340 ARG D O   1 
ATOM   4595 C CB  . ARG D  2 194 ? -49.481 -5.235   12.861  1.00 31.67 ? 340 ARG D CB  1 
ATOM   4596 C CG  . ARG D  2 194 ? -48.959 -3.825   12.621  1.00 33.07 ? 340 ARG D CG  1 
ATOM   4597 C CD  . ARG D  2 194 ? -49.192 -2.925   13.841  1.00 35.36 ? 340 ARG D CD  1 
ATOM   4598 N NE  . ARG D  2 194 ? -50.616 -2.793   14.184  1.00 36.07 ? 340 ARG D NE  1 
ATOM   4599 C CZ  . ARG D  2 194 ? -51.453 -1.891   13.662  1.00 36.52 ? 340 ARG D CZ  1 
ATOM   4600 N NH1 . ARG D  2 194 ? -51.034 -1.008   12.761  1.00 37.07 ? 340 ARG D NH1 1 
ATOM   4601 N NH2 . ARG D  2 194 ? -52.725 -1.872   14.046  1.00 35.68 ? 340 ARG D NH2 1 
ATOM   4602 N N   . ASP D  2 195 ? -49.833 -8.540   12.093  1.00 30.09 ? 341 ASP D N   1 
ATOM   4603 C CA  . ASP D  2 195 ? -49.747 -9.951   12.509  1.00 29.93 ? 341 ASP D CA  1 
ATOM   4604 C C   . ASP D  2 195 ? -48.446 -10.618  12.048  1.00 26.77 ? 341 ASP D C   1 
ATOM   4605 O O   . ASP D  2 195 ? -47.968 -11.580  12.669  1.00 25.88 ? 341 ASP D O   1 
ATOM   4606 C CB  . ASP D  2 195 ? -50.914 -10.761  11.950  1.00 34.27 ? 341 ASP D CB  1 
ATOM   4607 C CG  . ASP D  2 195 ? -52.188 -10.600  12.751  1.00 39.33 ? 341 ASP D CG  1 
ATOM   4608 O OD1 . ASP D  2 195 ? -52.130 -10.170  13.928  1.00 41.57 ? 341 ASP D OD1 1 
ATOM   4609 O OD2 . ASP D  2 195 ? -53.257 -10.937  12.195  1.00 44.32 ? 341 ASP D OD2 1 
ATOM   4610 N N   . PHE D  2 196 ? -47.929 -10.131  10.925  1.00 25.36 ? 342 PHE D N   1 
ATOM   4611 C CA  . PHE D  2 196 ? -46.648 -10.550  10.392  1.00 26.05 ? 342 PHE D CA  1 
ATOM   4612 C C   . PHE D  2 196 ? -45.518 -9.678   10.922  1.00 26.72 ? 342 PHE D C   1 
ATOM   4613 O O   . PHE D  2 196 ? -44.581 -10.173  11.548  1.00 26.03 ? 342 PHE D O   1 
ATOM   4614 C CB  . PHE D  2 196 ? -46.681 -10.443  8.869   1.00 26.26 ? 342 PHE D CB  1 
ATOM   4615 C CG  . PHE D  2 196 ? -47.615 -11.418  8.216   1.00 28.33 ? 342 PHE D CG  1 
ATOM   4616 C CD1 . PHE D  2 196 ? -47.167 -12.682  7.862   1.00 29.55 ? 342 PHE D CD1 1 
ATOM   4617 C CD2 . PHE D  2 196 ? -48.941 -11.083  7.974   1.00 28.81 ? 342 PHE D CD2 1 
ATOM   4618 C CE1 . PHE D  2 196 ? -48.017 -13.586  7.249   1.00 31.50 ? 342 PHE D CE1 1 
ATOM   4619 C CE2 . PHE D  2 196 ? -49.799 -11.980  7.374   1.00 30.55 ? 342 PHE D CE2 1 
ATOM   4620 C CZ  . PHE D  2 196 ? -49.338 -13.240  7.005   1.00 31.46 ? 342 PHE D CZ  1 
ATOM   4621 N N   . THR D  2 197 ? -45.640 -8.371   10.674  1.00 27.32 ? 343 THR D N   1 
ATOM   4622 C CA  . THR D  2 197 ? -44.530 -7.440   10.817  1.00 27.85 ? 343 THR D CA  1 
ATOM   4623 C C   . THR D  2 197 ? -44.204 -7.056   12.254  1.00 28.77 ? 343 THR D C   1 
ATOM   4624 O O   . THR D  2 197 ? -43.052 -6.811   12.542  1.00 28.46 ? 343 THR D O   1 
ATOM   4625 C CB  . THR D  2 197 ? -44.763 -6.141   10.026  1.00 27.18 ? 343 THR D CB  1 
ATOM   4626 O OG1 . THR D  2 197 ? -45.999 -5.553   10.431  1.00 27.44 ? 343 THR D OG1 1 
ATOM   4627 C CG2 . THR D  2 197 ? -44.801 -6.407   8.546   1.00 26.72 ? 343 THR D CG2 1 
ATOM   4628 N N   . GLU D  2 198 ? -45.200 -7.016   13.138  1.00 29.95 ? 344 GLU D N   1 
ATOM   4629 C CA  . GLU D  2 198 ? -45.028 -6.461   14.477  1.00 32.65 ? 344 GLU D CA  1 
ATOM   4630 C C   . GLU D  2 198 ? -45.767 -7.336   15.451  1.00 32.38 ? 344 GLU D C   1 
ATOM   4631 O O   . GLU D  2 198 ? -46.748 -6.929   16.071  1.00 35.22 ? 344 GLU D O   1 
ATOM   4632 C CB  . GLU D  2 198 ? -45.553 -5.015   14.546  1.00 35.47 ? 344 GLU D CB  1 
ATOM   4633 C CG  . GLU D  2 198 ? -44.885 -4.068   13.563  1.00 36.44 ? 344 GLU D CG  1 
ATOM   4634 C CD  . GLU D  2 198 ? -45.343 -2.626   13.725  1.00 40.89 ? 344 GLU D CD  1 
ATOM   4635 O OE1 . GLU D  2 198 ? -45.253 -1.861   12.737  1.00 41.02 ? 344 GLU D OE1 1 
ATOM   4636 O OE2 . GLU D  2 198 ? -45.799 -2.259   14.835  1.00 42.35 ? 344 GLU D OE2 1 
ATOM   4637 N N   . ASN D  2 199 ? -45.296 -8.568   15.556  1.00 33.05 ? 345 ASN D N   1 
ATOM   4638 C CA  . ASN D  2 199 ? -45.924 -9.581   16.380  1.00 33.61 ? 345 ASN D CA  1 
ATOM   4639 C C   . ASN D  2 199 ? -44.888 -10.146  17.351  1.00 35.58 ? 345 ASN D C   1 
ATOM   4640 O O   . ASN D  2 199 ? -43.971 -10.877  16.932  1.00 33.91 ? 345 ASN D O   1 
ATOM   4641 C CB  . ASN D  2 199 ? -46.463 -10.668  15.461  1.00 34.31 ? 345 ASN D CB  1 
ATOM   4642 C CG  . ASN D  2 199 ? -47.154 -11.790  16.200  1.00 34.48 ? 345 ASN D CG  1 
ATOM   4643 O OD1 . ASN D  2 199 ? -46.924 -12.035  17.381  1.00 37.06 ? 345 ASN D OD1 1 
ATOM   4644 N ND2 . ASN D  2 199 ? -47.992 -12.507  15.484  1.00 34.96 ? 345 ASN D ND2 1 
ATOM   4645 N N   . PRO D  2 200 ? -45.021 -9.818   18.651  1.00 37.72 ? 346 PRO D N   1 
ATOM   4646 C CA  . PRO D  2 200 ? -44.055 -10.301  19.631  1.00 36.14 ? 346 PRO D CA  1 
ATOM   4647 C C   . PRO D  2 200 ? -44.040 -11.815  19.791  1.00 33.81 ? 346 PRO D C   1 
ATOM   4648 O O   . PRO D  2 200 ? -42.996 -12.360  20.143  1.00 34.20 ? 346 PRO D O   1 
ATOM   4649 C CB  . PRO D  2 200 ? -44.508 -9.628   20.937  1.00 39.06 ? 346 PRO D CB  1 
ATOM   4650 C CG  . PRO D  2 200 ? -45.961 -9.375   20.747  1.00 40.67 ? 346 PRO D CG  1 
ATOM   4651 C CD  . PRO D  2 200 ? -46.075 -9.006   19.288  1.00 40.84 ? 346 PRO D CD  1 
ATOM   4652 N N   . CYS D  2 201 ? -45.168 -12.493  19.558  1.00 31.30 ? 347 CYS D N   1 
ATOM   4653 C CA  . CYS D  2 201 ? -45.183 -13.960  19.621  1.00 30.14 ? 347 CYS D CA  1 
ATOM   4654 C C   . CYS D  2 201 ? -44.303 -14.560  18.535  1.00 27.90 ? 347 CYS D C   1 
ATOM   4655 O O   . CYS D  2 201 ? -43.472 -15.427  18.808  1.00 27.43 ? 347 CYS D O   1 
ATOM   4656 C CB  . CYS D  2 201 ? -46.581 -14.518  19.473  1.00 30.93 ? 347 CYS D CB  1 
ATOM   4657 S SG  . CYS D  2 201 ? -46.642 -16.286  19.153  1.00 32.27 ? 347 CYS D SG  1 
ATOM   4658 N N   . LEU D  2 202 ? -44.501 -14.106  17.305  1.00 26.00 ? 348 LEU D N   1 
ATOM   4659 C CA  . LEU D  2 202 ? -43.692 -14.578  16.191  1.00 25.51 ? 348 LEU D CA  1 
ATOM   4660 C C   . LEU D  2 202 ? -42.223 -14.230  16.409  1.00 25.32 ? 348 LEU D C   1 
ATOM   4661 O O   . LEU D  2 202 ? -41.357 -15.084  16.234  1.00 24.97 ? 348 LEU D O   1 
ATOM   4662 C CB  . LEU D  2 202 ? -44.182 -13.986  14.868  1.00 25.17 ? 348 LEU D CB  1 
ATOM   4663 C CG  . LEU D  2 202 ? -43.499 -14.419  13.567  1.00 24.66 ? 348 LEU D CG  1 
ATOM   4664 C CD1 . LEU D  2 202 ? -43.475 -15.938  13.434  1.00 25.61 ? 348 LEU D CD1 1 
ATOM   4665 C CD2 . LEU D  2 202 ? -44.182 -13.805  12.352  1.00 24.44 ? 348 LEU D CD2 1 
ATOM   4666 N N   . ARG D  2 203 ? -41.954 -12.974  16.759  1.00 25.75 ? 349 ARG D N   1 
ATOM   4667 C CA  . ARG D  2 203 ? -40.604 -12.540  17.082  1.00 26.95 ? 349 ARG D CA  1 
ATOM   4668 C C   . ARG D  2 203 ? -39.926 -13.486  18.069  1.00 25.48 ? 349 ARG D C   1 
ATOM   4669 O O   . ARG D  2 203 ? -38.805 -13.948  17.839  1.00 26.12 ? 349 ARG D O   1 
ATOM   4670 C CB  . ARG D  2 203 ? -40.630 -11.135  17.674  1.00 29.05 ? 349 ARG D CB  1 
ATOM   4671 C CG  . ARG D  2 203 ? -39.266 -10.632  18.140  1.00 30.44 ? 349 ARG D CG  1 
ATOM   4672 C CD  . ARG D  2 203 ? -39.382 -9.495   19.140  1.00 32.66 ? 349 ARG D CD  1 
ATOM   4673 N NE  . ARG D  2 203 ? -38.039 -9.016   19.488  1.00 36.47 ? 349 ARG D NE  1 
ATOM   4674 C CZ  . ARG D  2 203 ? -37.265 -9.493   20.473  1.00 36.21 ? 349 ARG D CZ  1 
ATOM   4675 N NH1 . ARG D  2 203 ? -37.680 -10.466  21.274  1.00 36.89 ? 349 ARG D NH1 1 
ATOM   4676 N NH2 . ARG D  2 203 ? -36.054 -8.977   20.663  1.00 35.65 ? 349 ARG D NH2 1 
ATOM   4677 N N   . ASN D  2 204 ? -40.609 -13.768  19.169  1.00 25.19 ? 350 ASN D N   1 
ATOM   4678 C CA  . ASN D  2 204 ? -40.038 -14.587  20.213  1.00 26.04 ? 350 ASN D CA  1 
ATOM   4679 C C   . ASN D  2 204 ? -39.893 -16.042  19.785  1.00 27.63 ? 350 ASN D C   1 
ATOM   4680 O O   . ASN D  2 204 ? -38.914 -16.697  20.141  1.00 27.17 ? 350 ASN D O   1 
ATOM   4681 C CB  . ASN D  2 204 ? -40.877 -14.509  21.479  1.00 26.62 ? 350 ASN D CB  1 
ATOM   4682 C CG  . ASN D  2 204 ? -40.835 -13.135  22.123  1.00 27.22 ? 350 ASN D CG  1 
ATOM   4683 O OD1 . ASN D  2 204 ? -39.996 -12.292  21.778  1.00 27.15 ? 350 ASN D OD1 1 
ATOM   4684 N ND2 . ASN D  2 204 ? -41.753 -12.897  23.047  1.00 25.83 ? 350 ASN D ND2 1 
ATOM   4685 N N   . ALA D  2 205 ? -40.875 -16.555  19.047  1.00 27.44 ? 351 ALA D N   1 
ATOM   4686 C CA  . ALA D  2 205 ? -40.797 -17.920  18.558  1.00 27.30 ? 351 ALA D CA  1 
ATOM   4687 C C   . ALA D  2 205 ? -39.574 -18.112  17.655  1.00 27.11 ? 351 ALA D C   1 
ATOM   4688 O O   . ALA D  2 205 ? -38.864 -19.090  17.803  1.00 28.01 ? 351 ALA D O   1 
ATOM   4689 C CB  . ALA D  2 205 ? -42.069 -18.306  17.831  1.00 26.85 ? 351 ALA D CB  1 
ATOM   4690 N N   . ILE D  2 206 ? -39.335 -17.186  16.732  1.00 26.53 ? 352 ILE D N   1 
ATOM   4691 C CA  . ILE D  2 206 ? -38.205 -17.316  15.824  1.00 29.16 ? 352 ILE D CA  1 
ATOM   4692 C C   . ILE D  2 206 ? -36.887 -17.204  16.599  1.00 32.05 ? 352 ILE D C   1 
ATOM   4693 O O   . ILE D  2 206 ? -35.960 -17.985  16.395  1.00 33.06 ? 352 ILE D O   1 
ATOM   4694 C CB  . ILE D  2 206 ? -38.260 -16.277  14.685  1.00 28.11 ? 352 ILE D CB  1 
ATOM   4695 C CG1 . ILE D  2 206 ? -39.458 -16.564  13.759  1.00 26.92 ? 352 ILE D CG1 1 
ATOM   4696 C CG2 . ILE D  2 206 ? -36.951 -16.289  13.904  1.00 28.29 ? 352 ILE D CG2 1 
ATOM   4697 C CD1 . ILE D  2 206 ? -39.764 -15.478  12.750  1.00 26.80 ? 352 ILE D CD1 1 
ATOM   4698 N N   . GLN D  2 207 ? -36.817 -16.232  17.499  1.00 36.60 ? 353 GLN D N   1 
ATOM   4699 C CA  . GLN D  2 207 ? -35.624 -16.038  18.311  1.00 40.29 ? 353 GLN D CA  1 
ATOM   4700 C C   . GLN D  2 207 ? -35.315 -17.212  19.218  1.00 37.64 ? 353 GLN D C   1 
ATOM   4701 O O   . GLN D  2 207 ? -34.156 -17.572  19.393  1.00 36.21 ? 353 GLN D O   1 
ATOM   4702 C CB  . GLN D  2 207 ? -35.756 -14.801  19.170  1.00 42.84 ? 353 GLN D CB  1 
ATOM   4703 C CG  . GLN D  2 207 ? -35.392 -13.535  18.434  1.00 48.41 ? 353 GLN D CG  1 
ATOM   4704 C CD  . GLN D  2 207 ? -35.045 -12.376  19.351  1.00 54.06 ? 353 GLN D CD  1 
ATOM   4705 O OE1 . GLN D  2 207 ? -34.981 -11.236  18.888  1.00 59.39 ? 353 GLN D OE1 1 
ATOM   4706 N NE2 . GLN D  2 207 ? -34.806 -12.649  20.646  1.00 55.24 ? 353 GLN D NE2 1 
ATOM   4707 N N   . ALA D  2 208 ? -36.352 -17.806  19.796  1.00 36.19 ? 354 ALA D N   1 
ATOM   4708 C CA  . ALA D  2 208 ? -36.164 -18.939  20.685  1.00 35.33 ? 354 ALA D CA  1 
ATOM   4709 C C   . ALA D  2 208 ? -35.710 -20.200  19.948  1.00 35.55 ? 354 ALA D C   1 
ATOM   4710 O O   . ALA D  2 208 ? -35.119 -21.084  20.559  1.00 35.58 ? 354 ALA D O   1 
ATOM   4711 C CB  . ALA D  2 208 ? -37.422 -19.210  21.476  1.00 35.69 ? 354 ALA D CB  1 
ATOM   4712 N N   . PHE D  2 209 ? -35.973 -20.302  18.647  1.00 34.37 ? 355 PHE D N   1 
ATOM   4713 C CA  . PHE D  2 209 ? -35.595 -21.503  17.916  1.00 34.48 ? 355 PHE D CA  1 
ATOM   4714 C C   . PHE D  2 209 ? -34.078 -21.728  17.874  1.00 36.69 ? 355 PHE D C   1 
ATOM   4715 O O   . PHE D  2 209 ? -33.625 -22.852  18.045  1.00 32.31 ? 355 PHE D O   1 
ATOM   4716 C CB  . PHE D  2 209 ? -36.141 -21.483  16.486  1.00 35.45 ? 355 PHE D CB  1 
ATOM   4717 C CG  . PHE D  2 209 ? -35.897 -22.762  15.740  1.00 34.45 ? 355 PHE D CG  1 
ATOM   4718 C CD1 . PHE D  2 209 ? -34.729 -22.950  15.025  1.00 33.15 ? 355 PHE D CD1 1 
ATOM   4719 C CD2 . PHE D  2 209 ? -36.822 -23.792  15.798  1.00 34.56 ? 355 PHE D CD2 1 
ATOM   4720 C CE1 . PHE D  2 209 ? -34.509 -24.138  14.348  1.00 35.14 ? 355 PHE D CE1 1 
ATOM   4721 C CE2 . PHE D  2 209 ? -36.606 -24.985  15.136  1.00 34.28 ? 355 PHE D CE2 1 
ATOM   4722 C CZ  . PHE D  2 209 ? -35.449 -25.156  14.402  1.00 33.81 ? 355 PHE D CZ  1 
ATOM   4723 N N   . GLY D  2 210 ? -33.305 -20.670  17.629  1.00 41.99 ? 356 GLY D N   1 
ATOM   4724 C CA  . GLY D  2 210 ? -31.836 -20.790  17.503  1.00 45.61 ? 356 GLY D CA  1 
ATOM   4725 C C   . GLY D  2 210 ? -31.452 -21.125  16.059  1.00 49.57 ? 356 GLY D C   1 
ATOM   4726 O O   . GLY D  2 210 ? -30.467 -21.830  15.770  1.00 50.49 ? 356 GLY D O   1 
HETATM 4727 S S   . SO4 E  3 .   ? -5.881  -48.662  -16.970 1.00 44.52 ? 201 SO4 A S   1 
HETATM 4728 O O1  . SO4 E  3 .   ? -6.751  -49.845  -17.096 1.00 43.10 ? 201 SO4 A O1  1 
HETATM 4729 O O2  . SO4 E  3 .   ? -5.022  -48.520  -18.165 1.00 45.67 ? 201 SO4 A O2  1 
HETATM 4730 O O3  . SO4 E  3 .   ? -5.115  -48.732  -15.718 1.00 43.67 ? 201 SO4 A O3  1 
HETATM 4731 O O4  . SO4 E  3 .   ? -6.758  -47.480  -16.907 1.00 47.48 ? 201 SO4 A O4  1 
HETATM 4732 S S   . SO4 F  3 .   ? -7.647  -43.012  -13.750 1.00 35.89 ? 202 SO4 A S   1 
HETATM 4733 O O1  . SO4 F  3 .   ? -8.448  -44.102  -14.333 1.00 40.51 ? 202 SO4 A O1  1 
HETATM 4734 O O2  . SO4 F  3 .   ? -6.852  -42.417  -14.812 1.00 37.51 ? 202 SO4 A O2  1 
HETATM 4735 O O3  . SO4 F  3 .   ? -6.789  -43.504  -12.672 1.00 40.80 ? 202 SO4 A O3  1 
HETATM 4736 O O4  . SO4 F  3 .   ? -8.551  -42.026  -13.146 1.00 36.55 ? 202 SO4 A O4  1 
HETATM 4737 S S   . SO4 G  3 .   ? -12.520 -51.350  -38.436 1.00 55.83 ? 203 SO4 A S   1 
HETATM 4738 O O1  . SO4 G  3 .   ? -12.274 -51.422  -39.890 1.00 61.62 ? 203 SO4 A O1  1 
HETATM 4739 O O2  . SO4 G  3 .   ? -13.111 -50.039  -38.107 1.00 57.73 ? 203 SO4 A O2  1 
HETATM 4740 O O3  . SO4 G  3 .   ? -11.230 -51.555  -37.735 1.00 56.95 ? 203 SO4 A O3  1 
HETATM 4741 O O4  . SO4 G  3 .   ? -13.497 -52.389  -38.052 1.00 60.02 ? 203 SO4 A O4  1 
HETATM 4742 S S   . SO4 H  3 .   ? -6.648  -54.083  -20.138 1.00 36.11 ? 201 SO4 B S   1 
HETATM 4743 O O1  . SO4 H  3 .   ? -7.391  -55.269  -20.572 1.00 38.48 ? 201 SO4 B O1  1 
HETATM 4744 O O2  . SO4 H  3 .   ? -5.616  -53.719  -21.118 1.00 38.76 ? 201 SO4 B O2  1 
HETATM 4745 O O3  . SO4 H  3 .   ? -6.086  -54.385  -18.823 1.00 39.32 ? 201 SO4 B O3  1 
HETATM 4746 O O4  . SO4 H  3 .   ? -7.542  -52.922  -20.057 1.00 39.72 ? 201 SO4 B O4  1 
HETATM 4747 S S   . SO4 I  3 .   ? -11.664 -25.166  -0.292  1.00 27.89 ? 202 SO4 B S   1 
HETATM 4748 O O1  . SO4 I  3 .   ? -10.658 -25.972  -1.029  1.00 29.02 ? 202 SO4 B O1  1 
HETATM 4749 O O2  . SO4 I  3 .   ? -12.079 -24.000  -1.092  1.00 28.99 ? 202 SO4 B O2  1 
HETATM 4750 O O3  . SO4 I  3 .   ? -11.040 -24.631  0.937   1.00 27.82 ? 202 SO4 B O3  1 
HETATM 4751 O O4  . SO4 I  3 .   ? -12.829 -25.973  0.055   1.00 26.36 ? 202 SO4 B O4  1 
HETATM 4752 S S   . SO4 J  3 .   ? -18.055 -46.134  2.153   1.00 59.00 ? 203 SO4 B S   1 
HETATM 4753 O O1  . SO4 J  3 .   ? -19.259 -46.945  1.822   1.00 58.19 ? 203 SO4 B O1  1 
HETATM 4754 O O2  . SO4 J  3 .   ? -18.031 -44.874  1.384   1.00 56.71 ? 203 SO4 B O2  1 
HETATM 4755 O O3  . SO4 J  3 .   ? -18.061 -45.786  3.594   1.00 64.17 ? 203 SO4 B O3  1 
HETATM 4756 O O4  . SO4 J  3 .   ? -16.830 -46.897  1.839   1.00 59.69 ? 203 SO4 B O4  1 
HETATM 4757 S S   . SO4 K  3 .   ? -18.778 -54.244  0.441   1.00 79.92 ? 204 SO4 B S   1 
HETATM 4758 O O1  . SO4 K  3 .   ? -20.188 -54.627  0.188   1.00 78.60 ? 204 SO4 B O1  1 
HETATM 4759 O O2  . SO4 K  3 .   ? -18.272 -53.388  -0.648  1.00 82.70 ? 204 SO4 B O2  1 
HETATM 4760 O O3  . SO4 K  3 .   ? -18.672 -53.462  1.692   1.00 86.21 ? 204 SO4 B O3  1 
HETATM 4761 O O4  . SO4 K  3 .   ? -17.942 -55.459  0.539   1.00 83.95 ? 204 SO4 B O4  1 
HETATM 4762 S S   . SO4 L  3 .   ? -2.197  -59.516  -21.471 0.50 43.89 ? 205 SO4 B S   1 
HETATM 4763 O O1  . SO4 L  3 .   ? -1.181  -59.346  -22.530 0.50 43.11 ? 205 SO4 B O1  1 
HETATM 4764 O O2  . SO4 L  3 .   ? -3.497  -59.785  -22.117 0.50 42.78 ? 205 SO4 B O2  1 
HETATM 4765 O O3  . SO4 L  3 .   ? -1.856  -60.658  -20.590 0.50 43.45 ? 205 SO4 B O3  1 
HETATM 4766 O O4  . SO4 L  3 .   ? -2.233  -58.272  -20.673 0.50 44.68 ? 205 SO4 B O4  1 
HETATM 4767 C C1  . GOL M  4 .   ? -31.135 -37.446  -6.477  1.00 43.95 ? 206 GOL B C1  1 
HETATM 4768 O O1  . GOL M  4 .   ? -30.751 -36.446  -7.437  1.00 45.21 ? 206 GOL B O1  1 
HETATM 4769 C C2  . GOL M  4 .   ? -30.858 -38.877  -6.933  1.00 41.91 ? 206 GOL B C2  1 
HETATM 4770 O O2  . GOL M  4 .   ? -30.318 -38.797  -8.235  1.00 40.37 ? 206 GOL B O2  1 
HETATM 4771 C C3  . GOL M  4 .   ? -29.954 -39.673  -5.969  1.00 45.24 ? 206 GOL B C3  1 
HETATM 4772 O O3  . GOL M  4 .   ? -28.580 -39.784  -6.385  1.00 44.35 ? 206 GOL B O3  1 
HETATM 4773 S S   . SO4 N  3 .   ? -40.996 -84.795  -69.806 1.00 42.91 ? 401 SO4 C S   1 
HETATM 4774 O O1  . SO4 N  3 .   ? -40.300 -84.780  -71.131 1.00 36.29 ? 401 SO4 C O1  1 
HETATM 4775 O O2  . SO4 N  3 .   ? -42.241 -85.625  -69.726 1.00 34.55 ? 401 SO4 C O2  1 
HETATM 4776 O O3  . SO4 N  3 .   ? -40.054 -85.364  -68.803 1.00 40.94 ? 401 SO4 C O3  1 
HETATM 4777 O O4  . SO4 N  3 .   ? -41.306 -83.374  -69.484 1.00 36.85 ? 401 SO4 C O4  1 
HETATM 4778 S S   . SO4 O  3 .   ? -32.867 -65.193  -53.802 1.00 66.06 ? 402 SO4 C S   1 
HETATM 4779 O O1  . SO4 O  3 .   ? -31.534 -64.676  -54.169 1.00 62.79 ? 402 SO4 C O1  1 
HETATM 4780 O O2  . SO4 O  3 .   ? -33.725 -65.228  -55.005 1.00 71.76 ? 402 SO4 C O2  1 
HETATM 4781 O O3  . SO4 O  3 .   ? -33.489 -64.322  -52.773 1.00 72.77 ? 402 SO4 C O3  1 
HETATM 4782 O O4  . SO4 O  3 .   ? -32.759 -66.549  -53.232 1.00 70.36 ? 402 SO4 C O4  1 
HETATM 4783 S S   . SO4 P  3 .   ? -44.731 -70.104  -52.418 1.00 75.36 ? 403 SO4 C S   1 
HETATM 4784 O O1  . SO4 P  3 .   ? -43.684 -69.259  -53.036 1.00 74.94 ? 403 SO4 C O1  1 
HETATM 4785 O O2  . SO4 P  3 .   ? -46.046 -69.790  -53.029 1.00 73.30 ? 403 SO4 C O2  1 
HETATM 4786 O O3  . SO4 P  3 .   ? -44.805 -69.848  -50.958 1.00 78.95 ? 403 SO4 C O3  1 
HETATM 4787 O O4  . SO4 P  3 .   ? -44.388 -71.525  -52.645 1.00 77.79 ? 403 SO4 C O4  1 
HETATM 4788 S S   . SO4 Q  3 .   ? -48.310 -86.361  -60.824 1.00 58.54 ? 404 SO4 C S   1 
HETATM 4789 O O1  . SO4 Q  3 .   ? -47.672 -85.025  -60.871 1.00 58.42 ? 404 SO4 C O1  1 
HETATM 4790 O O2  . SO4 Q  3 .   ? -47.879 -87.118  -62.029 1.00 62.10 ? 404 SO4 C O2  1 
HETATM 4791 O O3  . SO4 Q  3 .   ? -47.875 -87.053  -59.578 1.00 54.62 ? 404 SO4 C O3  1 
HETATM 4792 O O4  . SO4 Q  3 .   ? -49.782 -86.197  -60.858 1.00 56.22 ? 404 SO4 C O4  1 
HETATM 4793 S S   . SO4 R  3 .   ? -45.058 -75.292  -29.373 0.50 50.03 ? 405 SO4 C S   1 
HETATM 4794 O O1  . SO4 R  3 .   ? -44.124 -75.450  -30.509 0.50 48.20 ? 405 SO4 C O1  1 
HETATM 4795 O O2  . SO4 R  3 .   ? -45.957 -74.150  -29.641 0.50 50.54 ? 405 SO4 C O2  1 
HETATM 4796 O O3  . SO4 R  3 .   ? -45.837 -76.538  -29.215 0.50 47.90 ? 405 SO4 C O3  1 
HETATM 4797 O O4  . SO4 R  3 .   ? -44.321 -75.017  -28.119 0.50 49.48 ? 405 SO4 C O4  1 
HETATM 4798 S S   . SO4 S  3 .   ? -23.583 -57.079  -43.733 1.00 69.97 ? 406 SO4 C S   1 
HETATM 4799 O O1  . SO4 S  3 .   ? -23.228 -56.652  -45.112 1.00 70.06 ? 406 SO4 C O1  1 
HETATM 4800 O O2  . SO4 S  3 .   ? -25.001 -57.485  -43.661 1.00 70.71 ? 406 SO4 C O2  1 
HETATM 4801 O O3  . SO4 S  3 .   ? -22.727 -58.230  -43.377 1.00 69.06 ? 406 SO4 C O3  1 
HETATM 4802 O O4  . SO4 S  3 .   ? -23.375 -55.975  -42.765 1.00 70.94 ? 406 SO4 C O4  1 
HETATM 4803 S S   . SO4 T  3 .   ? -12.423 -89.569  -46.233 1.00 87.97 ? 407 SO4 C S   1 
HETATM 4804 O O1  . SO4 T  3 .   ? -11.399 -89.541  -47.303 1.00 84.31 ? 407 SO4 C O1  1 
HETATM 4805 O O2  . SO4 T  3 .   ? -13.612 -88.828  -46.707 1.00 86.02 ? 407 SO4 C O2  1 
HETATM 4806 O O3  . SO4 T  3 .   ? -12.808 -90.964  -45.907 1.00 86.32 ? 407 SO4 C O3  1 
HETATM 4807 O O4  . SO4 T  3 .   ? -11.874 -88.933  -45.012 1.00 88.94 ? 407 SO4 C O4  1 
HETATM 4808 C C1  . GOL U  4 .   ? -26.716 -60.336  -33.078 1.00 47.16 ? 408 GOL C C1  1 
HETATM 4809 O O1  . GOL U  4 .   ? -26.434 -60.827  -34.393 1.00 47.36 ? 408 GOL C O1  1 
HETATM 4810 C C2  . GOL U  4 .   ? -26.814 -58.816  -33.114 1.00 46.96 ? 408 GOL C C2  1 
HETATM 4811 O O2  . GOL U  4 .   ? -27.850 -58.407  -32.204 1.00 50.93 ? 408 GOL C O2  1 
HETATM 4812 C C3  . GOL U  4 .   ? -25.525 -58.099  -32.734 1.00 46.31 ? 408 GOL C C3  1 
HETATM 4813 O O3  . GOL U  4 .   ? -24.408 -58.308  -33.612 1.00 47.53 ? 408 GOL C O3  1 
HETATM 4814 S S   . SO4 V  3 .   ? -30.535 -40.757  3.939   1.00 60.15 ? 401 SO4 D S   1 
HETATM 4815 O O1  . SO4 V  3 .   ? -29.804 -39.720  3.181   1.00 59.73 ? 401 SO4 D O1  1 
HETATM 4816 O O2  . SO4 V  3 .   ? -31.892 -40.862  3.370   1.00 62.91 ? 401 SO4 D O2  1 
HETATM 4817 O O3  . SO4 V  3 .   ? -29.876 -42.076  3.815   1.00 63.45 ? 401 SO4 D O3  1 
HETATM 4818 O O4  . SO4 V  3 .   ? -30.575 -40.402  5.379   1.00 60.81 ? 401 SO4 D O4  1 
HETATM 4819 S S   . SO4 W  3 .   ? -21.887 -8.044   9.479   1.00 75.34 ? 402 SO4 D S   1 
HETATM 4820 O O1  . SO4 W  3 .   ? -23.258 -7.531   9.248   1.00 69.73 ? 402 SO4 D O1  1 
HETATM 4821 O O2  . SO4 W  3 .   ? -21.508 -8.959   8.379   1.00 70.05 ? 402 SO4 D O2  1 
HETATM 4822 O O3  . SO4 W  3 .   ? -21.874 -8.760   10.777  1.00 75.29 ? 402 SO4 D O3  1 
HETATM 4823 O O4  . SO4 W  3 .   ? -20.901 -6.934   9.529   1.00 75.13 ? 402 SO4 D O4  1 
HETATM 4824 S S   . SO4 X  3 .   ? -53.192 -28.666  6.800   1.00 65.61 ? 403 SO4 D S   1 
HETATM 4825 O O1  . SO4 X  3 .   ? -52.507 -29.332  5.660   1.00 63.12 ? 403 SO4 D O1  1 
HETATM 4826 O O2  . SO4 X  3 .   ? -54.665 -28.697  6.617   1.00 65.42 ? 403 SO4 D O2  1 
HETATM 4827 O O3  . SO4 X  3 .   ? -52.832 -29.363  8.059   1.00 68.70 ? 403 SO4 D O3  1 
HETATM 4828 O O4  . SO4 X  3 .   ? -52.759 -27.254  6.895   1.00 62.98 ? 403 SO4 D O4  1 
HETATM 4829 S S   . SO4 Y  3 .   ? -32.206 -11.132  -4.986  0.50 42.52 ? 404 SO4 D S   1 
HETATM 4830 O O1  . SO4 Y  3 .   ? -31.505 -11.917  -6.033  0.50 41.77 ? 404 SO4 D O1  1 
HETATM 4831 O O2  . SO4 Y  3 .   ? -33.355 -10.440  -5.615  0.50 42.58 ? 404 SO4 D O2  1 
HETATM 4832 O O3  . SO4 Y  3 .   ? -32.654 -12.040  -3.903  0.50 39.05 ? 404 SO4 D O3  1 
HETATM 4833 O O4  . SO4 Y  3 .   ? -31.315 -10.106  -4.404  0.50 42.17 ? 404 SO4 D O4  1 
HETATM 4834 O O   . HOH Z  5 .   ? -20.259 -62.800  -34.937 1.00 23.80 ? 301 HOH A O   1 
HETATM 4835 O O   . HOH Z  5 .   ? -13.639 -70.686  -41.650 1.00 25.28 ? 302 HOH A O   1 
HETATM 4836 O O   . HOH Z  5 .   ? -19.028 -62.947  -32.385 1.00 25.27 ? 303 HOH A O   1 
HETATM 4837 O O   . HOH Z  5 .   ? -27.526 -63.415  -25.795 1.00 39.68 ? 304 HOH A O   1 
HETATM 4838 O O   . HOH Z  5 .   ? -20.207 -43.567  -16.629 1.00 21.80 ? 305 HOH A O   1 
HETATM 4839 O O   . HOH Z  5 .   ? -22.506 -63.925  -29.452 1.00 21.14 ? 306 HOH A O   1 
HETATM 4840 O O   . HOH Z  5 .   ? -13.721 -38.411  -22.100 1.00 30.30 ? 307 HOH A O   1 
HETATM 4841 O O   . HOH Z  5 .   ? -26.939 -74.398  -29.935 1.00 26.06 ? 308 HOH A O   1 
HETATM 4842 O O   . HOH Z  5 .   ? -15.535 -44.101  -10.802 1.00 18.70 ? 309 HOH A O   1 
HETATM 4843 O O   . HOH Z  5 .   ? -19.846 -64.073  -37.470 1.00 20.68 ? 310 HOH A O   1 
HETATM 4844 O O   . HOH Z  5 .   ? -10.394 -45.170  -15.936 1.00 26.38 ? 311 HOH A O   1 
HETATM 4845 O O   . HOH Z  5 .   ? -11.376 -50.584  -25.504 1.00 20.58 ? 312 HOH A O   1 
HETATM 4846 O O   . HOH Z  5 .   ? -15.201 -37.766  -17.948 1.00 21.80 ? 313 HOH A O   1 
HETATM 4847 O O   . HOH Z  5 .   ? -19.387 -54.157  -20.985 1.00 27.97 ? 314 HOH A O   1 
HETATM 4848 O O   . HOH Z  5 .   ? -19.378 -61.651  -23.109 1.00 22.40 ? 315 HOH A O   1 
HETATM 4849 O O   . HOH Z  5 .   ? -21.376 -48.163  -30.663 1.00 38.19 ? 316 HOH A O   1 
HETATM 4850 O O   . HOH Z  5 .   ? -11.837 -71.447  -29.136 1.00 38.25 ? 317 HOH A O   1 
HETATM 4851 O O   . HOH Z  5 .   ? -14.343 -45.181  -33.948 1.00 40.17 ? 318 HOH A O   1 
HETATM 4852 O O   . HOH Z  5 .   ? -9.971  -34.788  -24.324 1.00 36.38 ? 319 HOH A O   1 
HETATM 4853 O O   . HOH Z  5 .   ? -26.209 -56.701  -24.663 1.00 27.82 ? 320 HOH A O   1 
HETATM 4854 O O   . HOH Z  5 .   ? -16.677 -33.237  -25.551 1.00 29.03 ? 321 HOH A O   1 
HETATM 4855 O O   . HOH Z  5 .   ? -21.740 -65.781  -22.696 1.00 34.37 ? 322 HOH A O   1 
HETATM 4856 O O   . HOH Z  5 .   ? -25.350 -80.359  -32.584 1.00 28.84 ? 323 HOH A O   1 
HETATM 4857 O O   . HOH Z  5 .   ? -10.699 -41.809  -20.705 1.00 29.56 ? 324 HOH A O   1 
HETATM 4858 O O   . HOH Z  5 .   ? -8.175  -28.929  -9.867  1.00 27.69 ? 325 HOH A O   1 
HETATM 4859 O O   . HOH Z  5 .   ? -18.587 -41.363  -18.751 1.00 30.82 ? 326 HOH A O   1 
HETATM 4860 O O   . HOH Z  5 .   ? -10.420 -29.799  1.666   1.00 37.40 ? 327 HOH A O   1 
HETATM 4861 O O   . HOH Z  5 .   ? -24.707 -74.296  -27.837 1.00 29.17 ? 328 HOH A O   1 
HETATM 4862 O O   . HOH Z  5 .   ? -10.260 -31.543  -11.438 1.00 29.89 ? 329 HOH A O   1 
HETATM 4863 O O   . HOH Z  5 .   ? -6.186  -37.104  -9.411  1.00 38.31 ? 330 HOH A O   1 
HETATM 4864 O O   . HOH Z  5 .   ? -23.022 -68.572  -24.459 1.00 33.14 ? 331 HOH A O   1 
HETATM 4865 O O   . HOH Z  5 .   ? -20.814 -33.510  -16.543 1.00 28.51 ? 332 HOH A O   1 
HETATM 4866 O O   . HOH Z  5 .   ? -9.778  -48.147  -25.196 1.00 28.26 ? 333 HOH A O   1 
HETATM 4867 O O   . HOH Z  5 .   ? -13.068 -43.685  -36.742 1.00 49.22 ? 334 HOH A O   1 
HETATM 4868 O O   . HOH Z  5 .   ? -14.229 -77.729  -37.655 1.00 31.67 ? 335 HOH A O   1 
HETATM 4869 O O   . HOH Z  5 .   ? -12.778 -37.700  -18.924 1.00 34.11 ? 336 HOH A O   1 
HETATM 4870 O O   . HOH Z  5 .   ? -4.081  -38.595  -10.702 1.00 46.94 ? 337 HOH A O   1 
HETATM 4871 O O   . HOH Z  5 .   ? -10.624 -59.095  -40.944 1.00 48.68 ? 338 HOH A O   1 
HETATM 4872 O O   . HOH Z  5 .   ? -19.110 -47.408  -33.006 1.00 36.82 ? 339 HOH A O   1 
HETATM 4873 O O   . HOH Z  5 .   ? -6.684  -40.038  -1.888  1.00 41.63 ? 340 HOH A O   1 
HETATM 4874 O O   . HOH Z  5 .   ? -19.284 -56.356  -41.565 1.00 41.14 ? 341 HOH A O   1 
HETATM 4875 O O   . HOH Z  5 .   ? -15.269 -40.409  -27.438 1.00 32.26 ? 342 HOH A O   1 
HETATM 4876 O O   . HOH Z  5 .   ? -20.826 -34.296  -19.300 1.00 36.05 ? 343 HOH A O   1 
HETATM 4877 O O   . HOH AA 5 .   ? -31.767 -34.474  -6.726  1.00 38.27 ? 301 HOH B O   1 
HETATM 4878 O O   . HOH AA 5 .   ? -18.496 -52.398  -2.751  1.00 34.20 ? 302 HOH B O   1 
HETATM 4879 O O   . HOH AA 5 .   ? -15.019 -19.879  1.805   1.00 35.24 ? 303 HOH B O   1 
HETATM 4880 O O   . HOH AA 5 .   ? -14.680 -59.865  -18.521 1.00 24.77 ? 304 HOH B O   1 
HETATM 4881 O O   . HOH AA 5 .   ? -25.052 -34.926  -3.412  1.00 19.03 ? 305 HOH B O   1 
HETATM 4882 O O   . HOH AA 5 .   ? -21.581 -54.631  -16.379 1.00 38.40 ? 306 HOH B O   1 
HETATM 4883 O O   . HOH AA 5 .   ? -23.283 -32.388  -15.575 1.00 25.81 ? 307 HOH B O   1 
HETATM 4884 O O   . HOH AA 5 .   ? -29.404 -34.886  -14.242 1.00 27.23 ? 308 HOH B O   1 
HETATM 4885 O O   . HOH AA 5 .   ? -25.793 -33.920  -9.468  1.00 15.99 ? 309 HOH B O   1 
HETATM 4886 O O   . HOH AA 5 .   ? -19.030 -55.137  -7.970  1.00 39.99 ? 310 HOH B O   1 
HETATM 4887 O O   . HOH AA 5 .   ? -10.571 -25.450  -3.610  1.00 17.78 ? 311 HOH B O   1 
HETATM 4888 O O   . HOH AA 5 .   ? -20.892 -36.167  -14.480 1.00 18.90 ? 312 HOH B O   1 
HETATM 4889 O O   . HOH AA 5 .   ? -23.868 -17.587  0.907   1.00 42.09 ? 313 HOH B O   1 
HETATM 4890 O O   . HOH AA 5 .   ? -22.049 -55.818  -19.014 1.00 55.78 ? 314 HOH B O   1 
HETATM 4891 O O   . HOH AA 5 .   ? -13.049 -21.552  -0.570  1.00 28.40 ? 315 HOH B O   1 
HETATM 4892 O O   . HOH AA 5 .   ? -13.449 -53.417  -25.259 1.00 24.00 ? 316 HOH B O   1 
HETATM 4893 O O   . HOH AA 5 .   ? -13.551 -46.805  -10.082 1.00 19.68 ? 317 HOH B O   1 
HETATM 4894 O O   . HOH AA 5 .   ? -14.180 -59.185  -13.922 1.00 38.53 ? 318 HOH B O   1 
HETATM 4895 O O   . HOH AA 5 .   ? -17.559 -64.693  -11.507 1.00 33.05 ? 319 HOH B O   1 
HETATM 4896 O O   . HOH AA 5 .   ? -16.018 -25.664  -6.732  1.00 24.27 ? 320 HOH B O   1 
HETATM 4897 O O   . HOH AA 5 .   ? -9.903  -22.574  -1.886  1.00 27.42 ? 321 HOH B O   1 
HETATM 4898 O O   . HOH AA 5 .   ? -12.108 -50.543  -12.170 1.00 30.18 ? 322 HOH B O   1 
HETATM 4899 O O   . HOH AA 5 .   ? -12.030 -29.489  -10.685 1.00 28.09 ? 323 HOH B O   1 
HETATM 4900 O O   . HOH AA 5 .   ? -23.218 -34.736  -5.497  1.00 18.62 ? 324 HOH B O   1 
HETATM 4901 O O   . HOH AA 5 .   ? -21.010 -26.692  4.687   1.00 17.81 ? 325 HOH B O   1 
HETATM 4902 O O   . HOH AA 5 .   ? -18.284 -56.404  -18.566 1.00 31.66 ? 326 HOH B O   1 
HETATM 4903 O O   . HOH AA 5 .   ? -4.503  -61.504  -20.185 1.00 52.50 ? 327 HOH B O   1 
HETATM 4904 O O   . HOH AA 5 .   ? -12.489 -59.761  -16.842 1.00 29.04 ? 328 HOH B O   1 
HETATM 4905 O O   . HOH AA 5 .   ? -9.913  -52.085  -18.788 1.00 21.73 ? 329 HOH B O   1 
HETATM 4906 O O   . HOH AA 5 .   ? -14.497 -67.029  -17.683 1.00 30.43 ? 330 HOH B O   1 
HETATM 4907 O O   . HOH AA 5 .   ? -25.578 -33.618  -1.028  1.00 21.74 ? 331 HOH B O   1 
HETATM 4908 O O   . HOH AA 5 .   ? -24.831 -27.838  2.256   1.00 20.22 ? 332 HOH B O   1 
HETATM 4909 O O   . HOH AA 5 .   ? -11.135 -55.554  -14.288 1.00 39.22 ? 333 HOH B O   1 
HETATM 4910 O O   . HOH AA 5 .   ? -10.516 -46.763  -22.969 1.00 28.14 ? 334 HOH B O   1 
HETATM 4911 O O   . HOH AA 5 .   ? -19.785 -19.317  -7.263  1.00 29.62 ? 335 HOH B O   1 
HETATM 4912 O O   . HOH AA 5 .   ? -9.833  -55.196  1.128   1.00 54.40 ? 336 HOH B O   1 
HETATM 4913 O O   . HOH AA 5 .   ? -20.566 -19.891  0.602   1.00 22.57 ? 337 HOH B O   1 
HETATM 4914 O O   . HOH AA 5 .   ? -25.896 -40.024  -5.502  1.00 35.82 ? 338 HOH B O   1 
HETATM 4915 O O   . HOH AA 5 .   ? -25.430 -39.897  -17.841 1.00 38.22 ? 339 HOH B O   1 
HETATM 4916 O O   . HOH AA 5 .   ? -28.058 -41.443  -14.786 1.00 26.04 ? 340 HOH B O   1 
HETATM 4917 O O   . HOH AA 5 .   ? -30.300 -23.452  -10.505 1.00 19.55 ? 341 HOH B O   1 
HETATM 4918 O O   . HOH AA 5 .   ? -28.135 -25.864  -13.793 1.00 37.52 ? 342 HOH B O   1 
HETATM 4919 O O   . HOH AA 5 .   ? -21.410 -34.846  9.217   1.00 42.18 ? 343 HOH B O   1 
HETATM 4920 O O   . HOH AA 5 .   ? -12.482 -27.608  2.400   1.00 23.58 ? 344 HOH B O   1 
HETATM 4921 O O   . HOH AA 5 .   ? -19.461 -64.551  -21.163 1.00 39.82 ? 345 HOH B O   1 
HETATM 4922 O O   . HOH AA 5 .   ? -24.814 -22.675  -12.204 1.00 40.83 ? 346 HOH B O   1 
HETATM 4923 O O   . HOH AA 5 .   ? -27.602 -48.018  -14.276 1.00 45.03 ? 347 HOH B O   1 
HETATM 4924 O O   . HOH AA 5 .   ? -15.817 -20.720  -0.897  1.00 38.98 ? 348 HOH B O   1 
HETATM 4925 O O   . HOH AA 5 .   ? -27.619 -23.411  -11.771 1.00 21.92 ? 349 HOH B O   1 
HETATM 4926 O O   . HOH AA 5 .   ? -24.393 -49.589  -7.274  1.00 34.83 ? 350 HOH B O   1 
HETATM 4927 O O   . HOH AA 5 .   ? -20.535 -55.425  -11.682 1.00 33.73 ? 351 HOH B O   1 
HETATM 4928 O O   . HOH AA 5 .   ? -16.295 -58.063  -11.769 1.00 45.68 ? 352 HOH B O   1 
HETATM 4929 O O   . HOH AA 5 .   ? -11.469 -65.133  -15.550 1.00 41.49 ? 353 HOH B O   1 
HETATM 4930 O O   . HOH AA 5 .   ? -11.821 -49.232  -9.750  1.00 26.73 ? 354 HOH B O   1 
HETATM 4931 O O   . HOH AA 5 .   ? -22.826 -50.444  -4.684  1.00 38.05 ? 355 HOH B O   1 
HETATM 4932 O O   . HOH AA 5 .   ? -24.764 -29.302  -14.470 1.00 32.64 ? 356 HOH B O   1 
HETATM 4933 O O   . HOH AA 5 .   ? -10.300 -54.361  -10.958 1.00 46.28 ? 357 HOH B O   1 
HETATM 4934 O O   . HOH AA 5 .   ? -17.490 -38.376  5.047   1.00 30.75 ? 358 HOH B O   1 
HETATM 4935 O O   . HOH AA 5 .   ? -17.221 -56.891  -8.703  1.00 53.31 ? 359 HOH B O   1 
HETATM 4936 O O   . HOH AA 5 .   ? -10.649 -52.608  -12.979 1.00 46.54 ? 360 HOH B O   1 
HETATM 4937 O O   . HOH AA 5 .   ? -20.008 -26.496  7.207   1.00 32.38 ? 361 HOH B O   1 
HETATM 4938 O O   . HOH AA 5 .   ? -8.745  -65.312  -16.908 1.00 44.02 ? 362 HOH B O   1 
HETATM 4939 O O   . HOH AA 5 .   ? -28.928 -33.659  -16.518 1.00 39.05 ? 363 HOH B O   1 
HETATM 4940 O O   . HOH BA 5 .   ? -27.995 -83.367  -36.733 1.00 28.30 ? 501 HOH C O   1 
HETATM 4941 O O   . HOH BA 5 .   ? -28.967 -87.058  -38.145 1.00 40.22 ? 502 HOH C O   1 
HETATM 4942 O O   . HOH BA 5 .   ? -27.080 -58.665  -43.728 1.00 31.92 ? 503 HOH C O   1 
HETATM 4943 O O   . HOH BA 5 .   ? -48.311 -81.688  -54.643 1.00 36.77 ? 504 HOH C O   1 
HETATM 4944 O O   . HOH BA 5 .   ? -23.621 -87.040  -49.026 1.00 31.66 ? 505 HOH C O   1 
HETATM 4945 O O   . HOH BA 5 .   ? -31.333 -87.930  -56.600 1.00 29.21 ? 506 HOH C O   1 
HETATM 4946 O O   . HOH BA 5 .   ? -22.862 -83.899  -62.580 1.00 41.64 ? 507 HOH C O   1 
HETATM 4947 O O   . HOH BA 5 .   ? -43.112 -75.396  -38.387 1.00 34.71 ? 508 HOH C O   1 
HETATM 4948 O O   . HOH BA 5 .   ? -18.659 -72.584  -51.130 1.00 29.39 ? 509 HOH C O   1 
HETATM 4949 O O   . HOH BA 5 .   ? -27.533 -73.697  -60.093 1.00 35.20 ? 510 HOH C O   1 
HETATM 4950 O O   . HOH BA 5 .   ? -29.402 -74.458  -28.815 1.00 29.64 ? 511 HOH C O   1 
HETATM 4951 O O   . HOH BA 5 .   ? -41.482 -79.224  -27.790 1.00 40.61 ? 512 HOH C O   1 
HETATM 4952 O O   . HOH BA 5 .   ? -35.923 -77.175  -63.481 1.00 24.87 ? 513 HOH C O   1 
HETATM 4953 O O   . HOH BA 5 .   ? -23.876 -80.046  -65.827 1.00 29.03 ? 514 HOH C O   1 
HETATM 4954 O O   . HOH BA 5 .   ? -10.472 -75.445  -46.007 1.00 41.24 ? 515 HOH C O   1 
HETATM 4955 O O   . HOH BA 5 .   ? -34.720 -95.391  -54.212 1.00 32.89 ? 516 HOH C O   1 
HETATM 4956 O O   . HOH BA 5 .   ? -39.868 -81.573  -70.722 1.00 32.20 ? 517 HOH C O   1 
HETATM 4957 O O   . HOH BA 5 .   ? -21.671 -58.344  -40.841 1.00 37.14 ? 518 HOH C O   1 
HETATM 4958 O O   . HOH BA 5 .   ? -32.436 -68.891  -49.751 1.00 25.77 ? 519 HOH C O   1 
HETATM 4959 O O   . HOH BA 5 .   ? -20.196 -62.816  -46.417 1.00 28.38 ? 520 HOH C O   1 
HETATM 4960 O O   . HOH BA 5 .   ? -40.612 -76.651  -53.542 1.00 27.34 ? 521 HOH C O   1 
HETATM 4961 O O   . HOH BA 5 .   ? -37.634 -74.262  -47.184 1.00 31.78 ? 522 HOH C O   1 
HETATM 4962 O O   . HOH BA 5 .   ? -28.894 -76.112  -72.509 1.00 35.32 ? 523 HOH C O   1 
HETATM 4963 O O   . HOH BA 5 .   ? -38.149 -83.764  -31.330 1.00 34.78 ? 524 HOH C O   1 
HETATM 4964 O O   . HOH BA 5 .   ? -22.021 -79.795  -55.385 1.00 32.35 ? 525 HOH C O   1 
HETATM 4965 O O   . HOH BA 5 .   ? -19.255 -76.256  -53.958 1.00 48.67 ? 526 HOH C O   1 
HETATM 4966 O O   . HOH BA 5 .   ? -28.522 -62.006  -46.020 1.00 32.90 ? 527 HOH C O   1 
HETATM 4967 O O   . HOH BA 5 .   ? -21.814 -60.998  -39.654 1.00 26.93 ? 528 HOH C O   1 
HETATM 4968 O O   . HOH BA 5 .   ? -22.990 -76.950  -45.409 1.00 25.39 ? 529 HOH C O   1 
HETATM 4969 O O   . HOH BA 5 .   ? -43.296 -79.439  -40.863 1.00 36.71 ? 530 HOH C O   1 
HETATM 4970 O O   . HOH BA 5 .   ? -33.979 -68.775  -39.154 1.00 25.35 ? 531 HOH C O   1 
HETATM 4971 O O   . HOH BA 5 .   ? -13.035 -86.544  -43.741 1.00 48.37 ? 532 HOH C O   1 
HETATM 4972 O O   . HOH BA 5 .   ? -16.385 -71.292  -41.841 1.00 24.17 ? 533 HOH C O   1 
HETATM 4973 O O   . HOH BA 5 .   ? -32.368 -87.920  -34.190 1.00 47.10 ? 534 HOH C O   1 
HETATM 4974 O O   . HOH BA 5 .   ? -36.634 -72.162  -52.410 1.00 45.26 ? 535 HOH C O   1 
HETATM 4975 O O   . HOH BA 5 .   ? -14.928 -78.997  -50.935 1.00 28.52 ? 536 HOH C O   1 
HETATM 4976 O O   . HOH BA 5 .   ? -28.798 -64.784  -54.061 1.00 34.86 ? 537 HOH C O   1 
HETATM 4977 O O   . HOH BA 5 .   ? -30.260 -90.956  -43.079 1.00 30.88 ? 538 HOH C O   1 
HETATM 4978 O O   . HOH BA 5 .   ? -18.155 -59.308  -43.035 1.00 41.40 ? 539 HOH C O   1 
HETATM 4979 O O   . HOH BA 5 .   ? -45.986 -80.828  -60.643 1.00 30.62 ? 540 HOH C O   1 
HETATM 4980 O O   . HOH BA 5 .   ? -35.647 -61.825  -40.705 1.00 37.44 ? 541 HOH C O   1 
HETATM 4981 O O   . HOH BA 5 .   ? -30.503 -88.943  -41.166 1.00 30.79 ? 542 HOH C O   1 
HETATM 4982 O O   . HOH BA 5 .   ? -28.472 -80.557  -44.487 1.00 20.39 ? 543 HOH C O   1 
HETATM 4983 O O   . HOH BA 5 .   ? -23.561 -84.608  -47.525 1.00 22.14 ? 544 HOH C O   1 
HETATM 4984 O O   . HOH BA 5 .   ? -19.914 -83.339  -53.367 1.00 25.15 ? 545 HOH C O   1 
HETATM 4985 O O   . HOH BA 5 .   ? -31.480 -81.029  -47.104 1.00 22.29 ? 546 HOH C O   1 
HETATM 4986 O O   . HOH BA 5 .   ? -23.229 -77.464  -41.474 1.00 28.97 ? 547 HOH C O   1 
HETATM 4987 O O   . HOH BA 5 .   ? -29.211 -86.754  -42.557 1.00 26.70 ? 548 HOH C O   1 
HETATM 4988 O O   . HOH BA 5 .   ? -21.718 -57.666  -33.236 1.00 37.55 ? 549 HOH C O   1 
HETATM 4989 O O   . HOH BA 5 .   ? -48.524 -98.894  -57.431 1.00 40.27 ? 550 HOH C O   1 
HETATM 4990 O O   . HOH BA 5 .   ? -21.835 -75.361  -42.092 1.00 28.78 ? 551 HOH C O   1 
HETATM 4991 O O   . HOH BA 5 .   ? -39.430 -88.054  -68.339 1.00 23.51 ? 552 HOH C O   1 
HETATM 4992 O O   . HOH BA 5 .   ? -39.152 -86.122  -44.559 1.00 27.52 ? 553 HOH C O   1 
HETATM 4993 O O   . HOH BA 5 .   ? -15.804 -72.206  -52.119 1.00 40.55 ? 554 HOH C O   1 
HETATM 4994 O O   . HOH BA 5 .   ? -45.752 -79.849  -44.514 1.00 38.07 ? 555 HOH C O   1 
HETATM 4995 O O   . HOH BA 5 .   ? -32.772 -68.951  -30.181 1.00 41.59 ? 556 HOH C O   1 
HETATM 4996 O O   . HOH BA 5 .   ? -21.960 -74.702  -44.640 1.00 28.79 ? 557 HOH C O   1 
HETATM 4997 O O   . HOH BA 5 .   ? -25.443 -90.823  -58.918 1.00 31.69 ? 558 HOH C O   1 
HETATM 4998 O O   . HOH BA 5 .   ? -25.571 -74.271  -40.732 1.00 23.59 ? 559 HOH C O   1 
HETATM 4999 O O   . HOH BA 5 .   ? -22.786 -69.167  -48.063 1.00 24.78 ? 560 HOH C O   1 
HETATM 5000 O O   . HOH BA 5 .   ? -40.966 -74.184  -54.702 1.00 29.48 ? 561 HOH C O   1 
HETATM 5001 O O   . HOH BA 5 .   ? -22.003 -67.345  -50.383 1.00 42.38 ? 562 HOH C O   1 
HETATM 5002 O O   . HOH BA 5 .   ? -47.297 -82.618  -59.344 1.00 34.25 ? 563 HOH C O   1 
HETATM 5003 O O   . HOH BA 5 .   ? -24.356 -68.020  -36.957 1.00 21.04 ? 564 HOH C O   1 
HETATM 5004 O O   . HOH BA 5 .   ? -37.322 -88.245  -61.950 1.00 20.47 ? 565 HOH C O   1 
HETATM 5005 O O   . HOH BA 5 .   ? -37.533 -72.836  -58.055 1.00 34.80 ? 566 HOH C O   1 
HETATM 5006 O O   . HOH BA 5 .   ? -38.552 -87.296  -70.937 1.00 23.97 ? 567 HOH C O   1 
HETATM 5007 O O   . HOH BA 5 .   ? -14.011 -81.541  -49.171 1.00 43.87 ? 568 HOH C O   1 
HETATM 5008 O O   . HOH BA 5 .   ? -36.799 -79.645  -71.794 1.00 20.67 ? 569 HOH C O   1 
HETATM 5009 O O   . HOH BA 5 .   ? -30.325 -88.709  -54.551 1.00 21.99 ? 570 HOH C O   1 
HETATM 5010 O O   . HOH BA 5 .   ? -26.602 -76.081  -60.370 1.00 33.58 ? 571 HOH C O   1 
HETATM 5011 O O   . HOH BA 5 .   ? -25.840 -88.689  -49.059 1.00 23.46 ? 572 HOH C O   1 
HETATM 5012 O O   . HOH BA 5 .   ? -26.686 -83.630  -33.429 1.00 46.93 ? 573 HOH C O   1 
HETATM 5013 O O   . HOH BA 5 .   ? -16.307 -79.556  -42.385 1.00 28.93 ? 574 HOH C O   1 
HETATM 5014 O O   . HOH BA 5 .   ? -41.410 -81.626  -31.328 1.00 31.87 ? 575 HOH C O   1 
HETATM 5015 O O   . HOH BA 5 .   ? -40.865 -68.375  -43.371 1.00 43.69 ? 576 HOH C O   1 
HETATM 5016 O O   . HOH BA 5 .   ? -18.083 -91.048  -52.498 1.00 41.41 ? 577 HOH C O   1 
HETATM 5017 O O   . HOH BA 5 .   ? -15.508 -67.207  -51.001 1.00 46.94 ? 578 HOH C O   1 
HETATM 5018 O O   . HOH BA 5 .   ? -45.729 -76.442  -60.212 1.00 39.13 ? 579 HOH C O   1 
HETATM 5019 O O   . HOH BA 5 .   ? -20.651 -74.094  -52.335 1.00 34.77 ? 580 HOH C O   1 
HETATM 5020 O O   . HOH BA 5 .   ? -13.888 -87.771  -53.440 1.00 42.56 ? 581 HOH C O   1 
HETATM 5021 O O   . HOH BA 5 .   ? -36.004 -89.328  -78.298 1.00 25.87 ? 582 HOH C O   1 
HETATM 5022 O O   . HOH BA 5 .   ? -21.886 -59.421  -46.226 1.00 40.81 ? 583 HOH C O   1 
HETATM 5023 O O   . HOH BA 5 .   ? -37.833 -75.879  -64.702 1.00 28.34 ? 584 HOH C O   1 
HETATM 5024 O O   . HOH BA 5 .   ? -35.666 -90.093  -62.254 1.00 43.76 ? 585 HOH C O   1 
HETATM 5025 O O   . HOH BA 5 .   ? -28.968 -89.189  -56.423 1.00 37.16 ? 586 HOH C O   1 
HETATM 5026 O O   . HOH BA 5 .   ? -24.700 -74.863  -62.134 1.00 31.45 ? 587 HOH C O   1 
HETATM 5027 O O   . HOH BA 5 .   ? -50.675 -80.864  -56.595 1.00 36.29 ? 588 HOH C O   1 
HETATM 5028 O O   . HOH BA 5 .   ? -46.380 -75.135  -43.317 1.00 42.02 ? 589 HOH C O   1 
HETATM 5029 O O   . HOH BA 5 .   ? -39.301 -88.658  -73.218 1.00 27.47 ? 590 HOH C O   1 
HETATM 5030 O O   . HOH BA 5 .   ? -23.728 -89.467  -57.644 1.00 33.06 ? 591 HOH C O   1 
HETATM 5031 O O   . HOH BA 5 .   ? -42.908 -69.624  -41.501 1.00 45.57 ? 592 HOH C O   1 
HETATM 5032 O O   . HOH BA 5 .   ? -26.685 -86.566  -35.905 1.00 46.78 ? 593 HOH C O   1 
HETATM 5033 O O   . HOH BA 5 .   ? -45.288 -77.454  -42.285 1.00 39.37 ? 594 HOH C O   1 
HETATM 5034 O O   . HOH BA 5 .   ? -44.562 -75.076  -62.120 1.00 38.38 ? 595 HOH C O   1 
HETATM 5035 O O   . HOH CA 5 .   ? -46.304 -12.054  27.267  1.00 35.63 ? 501 HOH D O   1 
HETATM 5036 O O   . HOH CA 5 .   ? -49.094 -27.584  1.209   1.00 27.74 ? 502 HOH D O   1 
HETATM 5037 O O   . HOH CA 5 .   ? -42.840 -29.934  -7.848  1.00 36.98 ? 503 HOH D O   1 
HETATM 5038 O O   . HOH CA 5 .   ? -28.476 -24.915  11.979  1.00 29.45 ? 504 HOH D O   1 
HETATM 5039 O O   . HOH CA 5 .   ? -33.715 -14.720  -4.475  1.00 28.09 ? 505 HOH D O   1 
HETATM 5040 O O   . HOH CA 5 .   ? -54.361 -25.271  7.358   1.00 37.17 ? 506 HOH D O   1 
HETATM 5041 O O   . HOH CA 5 .   ? -33.986 -39.597  3.023   1.00 26.38 ? 507 HOH D O   1 
HETATM 5042 O O   . HOH CA 5 .   ? -33.682 -18.003  15.404  1.00 33.53 ? 508 HOH D O   1 
HETATM 5043 O O   . HOH CA 5 .   ? -35.266 -39.732  -1.095  1.00 45.24 ? 509 HOH D O   1 
HETATM 5044 O O   . HOH CA 5 .   ? -46.710 -26.796  2.321   1.00 26.48 ? 510 HOH D O   1 
HETATM 5045 O O   . HOH CA 5 .   ? -38.387 -17.235  24.819  1.00 35.71 ? 511 HOH D O   1 
HETATM 5046 O O   . HOH CA 5 .   ? -41.539 -29.142  7.008   1.00 27.98 ? 512 HOH D O   1 
HETATM 5047 O O   . HOH CA 5 .   ? -43.731 -12.252  -16.228 1.00 38.83 ? 513 HOH D O   1 
HETATM 5048 O O   . HOH CA 5 .   ? -37.354 -37.839  -1.899  1.00 36.30 ? 514 HOH D O   1 
HETATM 5049 O O   . HOH CA 5 .   ? -55.119 -21.907  -5.995  1.00 19.39 ? 515 HOH D O   1 
HETATM 5050 O O   . HOH CA 5 .   ? -47.352 -10.285  -3.399  1.00 22.85 ? 516 HOH D O   1 
HETATM 5051 O O   . HOH CA 5 .   ? -54.730 -18.076  -3.993  1.00 25.72 ? 517 HOH D O   1 
HETATM 5052 O O   . HOH CA 5 .   ? -57.269 -6.719   9.807   1.00 41.48 ? 518 HOH D O   1 
HETATM 5053 O O   . HOH CA 5 .   ? -41.930 -14.297  -9.668  1.00 29.27 ? 519 HOH D O   1 
HETATM 5054 O O   . HOH CA 5 .   ? -40.559 -37.361  0.008   1.00 31.35 ? 520 HOH D O   1 
HETATM 5055 O O   . HOH CA 5 .   ? -37.403 -9.101   -0.892  1.00 27.92 ? 521 HOH D O   1 
HETATM 5056 O O   . HOH CA 5 .   ? -59.190 -9.542   2.057   1.00 43.92 ? 522 HOH D O   1 
HETATM 5057 O O   . HOH CA 5 .   ? -50.161 -22.027  8.305   1.00 20.89 ? 523 HOH D O   1 
HETATM 5058 O O   . HOH CA 5 .   ? -40.697 -30.769  -5.882  1.00 28.46 ? 524 HOH D O   1 
HETATM 5059 O O   . HOH CA 5 .   ? -36.110 -35.929  4.771   1.00 26.14 ? 525 HOH D O   1 
HETATM 5060 O O   . HOH CA 5 .   ? -33.359 -10.786  8.608   1.00 30.08 ? 526 HOH D O   1 
HETATM 5061 O O   . HOH CA 5 .   ? -31.298 -20.787  5.574   1.00 23.34 ? 527 HOH D O   1 
HETATM 5062 O O   . HOH CA 5 .   ? -25.313 -18.506  13.065  1.00 31.04 ? 528 HOH D O   1 
HETATM 5063 O O   . HOH CA 5 .   ? -33.966 -37.923  9.204   1.00 39.88 ? 529 HOH D O   1 
HETATM 5064 O O   . HOH CA 5 .   ? -46.760 -27.800  5.675   1.00 50.31 ? 530 HOH D O   1 
HETATM 5065 O O   . HOH CA 5 .   ? -24.100 -15.992  11.966  1.00 36.01 ? 531 HOH D O   1 
HETATM 5066 O O   . HOH CA 5 .   ? -57.658 -17.891  12.991  1.00 34.25 ? 532 HOH D O   1 
HETATM 5067 O O   . HOH CA 5 .   ? -32.609 -13.158  7.210   1.00 21.62 ? 533 HOH D O   1 
HETATM 5068 O O   . HOH CA 5 .   ? -53.805 -14.491  26.663  1.00 41.04 ? 534 HOH D O   1 
HETATM 5069 O O   . HOH CA 5 .   ? -23.661 -26.253  4.180   1.00 21.62 ? 535 HOH D O   1 
HETATM 5070 O O   . HOH CA 5 .   ? -46.294 -12.363  -0.155  1.00 30.64 ? 536 HOH D O   1 
HETATM 5071 O O   . HOH CA 5 .   ? -32.287 -23.772  -12.223 1.00 28.53 ? 537 HOH D O   1 
HETATM 5072 O O   . HOH CA 5 .   ? -25.119 -29.696  9.925   1.00 35.11 ? 538 HOH D O   1 
HETATM 5073 O O   . HOH CA 5 .   ? -24.509 -17.984  15.742  1.00 44.17 ? 539 HOH D O   1 
HETATM 5074 O O   . HOH CA 5 .   ? -27.723 -36.769  0.491   1.00 22.64 ? 540 HOH D O   1 
HETATM 5075 O O   . HOH CA 5 .   ? -32.449 -23.603  0.348   1.00 17.06 ? 541 HOH D O   1 
HETATM 5076 O O   . HOH CA 5 .   ? -57.922 -17.113  6.377   1.00 23.04 ? 542 HOH D O   1 
HETATM 5077 O O   . HOH CA 5 .   ? -62.579 -20.142  -4.164  1.00 17.60 ? 543 HOH D O   1 
HETATM 5078 O O   . HOH CA 5 .   ? -47.161 -21.161  -14.546 1.00 24.57 ? 544 HOH D O   1 
HETATM 5079 O O   . HOH CA 5 .   ? -42.736 -32.704  10.722  1.00 29.26 ? 545 HOH D O   1 
HETATM 5080 O O   . HOH CA 5 .   ? -49.471 -8.042   15.593  1.00 42.87 ? 546 HOH D O   1 
HETATM 5081 O O   . HOH CA 5 .   ? -21.234 -11.192  6.910   1.00 36.38 ? 547 HOH D O   1 
HETATM 5082 O O   . HOH CA 5 .   ? -34.413 -33.052  -7.144  1.00 36.18 ? 548 HOH D O   1 
HETATM 5083 O O   . HOH CA 5 .   ? -45.578 -24.394  2.953   1.00 19.44 ? 549 HOH D O   1 
HETATM 5084 O O   . HOH CA 5 .   ? -28.571 -34.913  7.652   1.00 27.69 ? 550 HOH D O   1 
HETATM 5085 O O   . HOH CA 5 .   ? -39.665 -29.516  -3.627  1.00 17.03 ? 551 HOH D O   1 
HETATM 5086 O O   . HOH CA 5 .   ? -41.890 -14.623  -12.489 1.00 35.50 ? 552 HOH D O   1 
HETATM 5087 O O   . HOH CA 5 .   ? -30.513 -20.318  1.597   1.00 22.14 ? 553 HOH D O   1 
HETATM 5088 O O   . HOH CA 5 .   ? -31.582 -28.704  8.072   1.00 24.18 ? 554 HOH D O   1 
HETATM 5089 O O   . HOH CA 5 .   ? -26.551 -25.245  14.348  1.00 52.46 ? 555 HOH D O   1 
HETATM 5090 O O   . HOH CA 5 .   ? -39.872 -17.123  4.616   1.00 20.69 ? 556 HOH D O   1 
HETATM 5091 O O   . HOH CA 5 .   ? -28.994 -6.571   13.863  1.00 50.29 ? 557 HOH D O   1 
HETATM 5092 O O   . HOH CA 5 .   ? -29.085 -22.360  2.617   1.00 22.80 ? 558 HOH D O   1 
HETATM 5093 O O   . HOH CA 5 .   ? -48.566 -23.001  -7.062  1.00 23.21 ? 559 HOH D O   1 
HETATM 5094 O O   . HOH CA 5 .   ? -44.300 -4.916   5.076   1.00 34.12 ? 560 HOH D O   1 
HETATM 5095 O O   . HOH CA 5 .   ? -49.171 -21.369  19.236  1.00 31.03 ? 561 HOH D O   1 
HETATM 5096 O O   . HOH CA 5 .   ? -43.483 -27.587  -9.013  1.00 29.10 ? 562 HOH D O   1 
HETATM 5097 O O   . HOH CA 5 .   ? -29.945 -8.547   1.244   1.00 31.35 ? 563 HOH D O   1 
HETATM 5098 O O   . HOH CA 5 .   ? -36.125 -17.413  3.054   1.00 22.32 ? 564 HOH D O   1 
HETATM 5099 O O   . HOH CA 5 .   ? -30.785 -14.418  14.125  1.00 22.51 ? 565 HOH D O   1 
HETATM 5100 O O   . HOH CA 5 .   ? -36.874 -11.173  0.921   1.00 20.53 ? 566 HOH D O   1 
HETATM 5101 O O   . HOH CA 5 .   ? -29.527 -5.214   12.186  1.00 44.53 ? 567 HOH D O   1 
HETATM 5102 O O   . HOH CA 5 .   ? -38.876 -21.205  -13.538 1.00 23.57 ? 568 HOH D O   1 
HETATM 5103 O O   . HOH CA 5 .   ? -50.770 -24.333  9.526   1.00 23.62 ? 569 HOH D O   1 
HETATM 5104 O O   . HOH CA 5 .   ? -29.900 -23.196  5.045   1.00 26.85 ? 570 HOH D O   1 
HETATM 5105 O O   . HOH CA 5 .   ? -29.688 -29.820  -2.785  1.00 21.80 ? 571 HOH D O   1 
HETATM 5106 O O   . HOH CA 5 .   ? -29.957 -17.432  -7.451  1.00 21.38 ? 572 HOH D O   1 
HETATM 5107 O O   . HOH CA 5 .   ? -22.445 -19.169  2.419   1.00 31.97 ? 573 HOH D O   1 
HETATM 5108 O O   . HOH CA 5 .   ? -41.728 -23.341  -16.659 1.00 35.50 ? 574 HOH D O   1 
HETATM 5109 O O   . HOH CA 5 .   ? -43.049 -32.508  6.750   1.00 43.55 ? 575 HOH D O   1 
HETATM 5110 O O   . HOH CA 5 .   ? -57.424 -15.809  8.648   1.00 35.93 ? 576 HOH D O   1 
HETATM 5111 O O   . HOH CA 5 .   ? -37.958 -7.190   0.906   1.00 33.58 ? 577 HOH D O   1 
HETATM 5112 O O   . HOH CA 5 .   ? -24.830 -15.232  1.990   1.00 32.96 ? 578 HOH D O   1 
HETATM 5113 O O   . HOH CA 5 .   ? -52.261 -23.842  -3.934  1.00 24.31 ? 579 HOH D O   1 
HETATM 5114 O O   . HOH CA 5 .   ? -61.584 -14.307  -1.152  1.00 28.72 ? 580 HOH D O   1 
HETATM 5115 O O   . HOH CA 5 .   ? -48.678 -14.324  -4.314  1.00 35.68 ? 581 HOH D O   1 
HETATM 5116 O O   . HOH CA 5 .   ? -42.834 -9.919   13.794  1.00 32.91 ? 582 HOH D O   1 
HETATM 5117 O O   . HOH CA 5 .   ? -31.428 -33.215  11.430  1.00 42.45 ? 583 HOH D O   1 
HETATM 5118 O O   . HOH CA 5 .   ? -31.953 -19.251  -15.317 1.00 30.99 ? 584 HOH D O   1 
HETATM 5119 O O   . HOH CA 5 .   ? -24.106 -18.203  4.772   1.00 28.10 ? 585 HOH D O   1 
HETATM 5120 O O   . HOH CA 5 .   ? -38.776 -33.487  12.257  1.00 28.09 ? 586 HOH D O   1 
HETATM 5121 O O   . HOH CA 5 .   ? -35.500 -9.117   8.356   1.00 30.15 ? 587 HOH D O   1 
HETATM 5122 O O   . HOH CA 5 .   ? -44.653 -16.920  -13.540 1.00 22.04 ? 588 HOH D O   1 
HETATM 5123 O O   . HOH CA 5 .   ? -52.562 -19.662  -2.455  1.00 20.83 ? 589 HOH D O   1 
HETATM 5124 O O   . HOH CA 5 .   ? -47.233 -30.034  -1.540  1.00 37.30 ? 590 HOH D O   1 
HETATM 5125 O O   . HOH CA 5 .   ? -37.579 -15.536  22.536  1.00 43.68 ? 591 HOH D O   1 
HETATM 5126 O O   . HOH CA 5 .   ? -43.495 -19.628  -16.803 1.00 28.56 ? 592 HOH D O   1 
HETATM 5127 O O   . HOH CA 5 .   ? -49.434 -26.505  7.828   1.00 47.79 ? 593 HOH D O   1 
HETATM 5128 O O   . HOH CA 5 .   ? -50.234 -27.766  -1.416  1.00 30.72 ? 594 HOH D O   1 
HETATM 5129 O O   . HOH CA 5 .   ? -41.420 -9.335   12.081  1.00 24.37 ? 595 HOH D O   1 
HETATM 5130 O O   . HOH CA 5 .   ? -42.998 -24.914  21.636  1.00 40.49 ? 596 HOH D O   1 
HETATM 5131 O O   . HOH CA 5 .   ? -46.727 -18.513  -12.868 1.00 23.44 ? 597 HOH D O   1 
HETATM 5132 O O   . HOH CA 5 .   ? -40.523 -8.772   14.429  1.00 37.87 ? 598 HOH D O   1 
HETATM 5133 O O   . HOH CA 5 .   ? -31.141 -26.305  -13.376 1.00 43.90 ? 599 HOH D O   1 
HETATM 5134 O O   . HOH CA 5 .   ? -48.088 -16.930  -8.620  1.00 47.82 ? 600 HOH D O   1 
HETATM 5135 O O   . HOH CA 5 .   ? -49.650 -28.916  -4.226  1.00 33.73 ? 601 HOH D O   1 
HETATM 5136 O O   . HOH CA 5 .   ? -56.241 -9.571   11.479  1.00 49.31 ? 602 HOH D O   1 
HETATM 5137 O O   . HOH CA 5 .   ? -35.783 -8.360   16.953  1.00 40.49 ? 603 HOH D O   1 
HETATM 5138 O O   . HOH CA 5 .   ? -51.501 -22.506  19.604  1.00 40.47 ? 604 HOH D O   1 
HETATM 5139 O O   . HOH CA 5 .   ? -26.729 -16.847  16.584  1.00 35.13 ? 605 HOH D O   1 
HETATM 5140 O O   . HOH CA 5 .   ? -25.293 -32.493  9.102   1.00 41.87 ? 606 HOH D O   1 
HETATM 5141 O O   . HOH CA 5 .   ? -51.314 -21.195  -4.150  1.00 20.21 ? 607 HOH D O   1 
HETATM 5142 O O   . HOH CA 5 .   ? -60.201 -30.945  3.263   1.00 46.02 ? 608 HOH D O   1 
HETATM 5143 O O   . HOH CA 5 .   ? -42.518 -35.227  6.631   1.00 45.40 ? 609 HOH D O   1 
HETATM 5144 O O   . HOH CA 5 .   ? -52.428 -26.368  -2.611  1.00 21.86 ? 610 HOH D O   1 
HETATM 5145 O O   . HOH CA 5 .   ? -49.172 -20.169  -6.894  1.00 36.91 ? 611 HOH D O   1 
HETATM 5146 O O   . HOH CA 5 .   ? -63.392 -26.200  4.655   1.00 45.47 ? 612 HOH D O   1 
HETATM 5147 O O   . HOH CA 5 .   ? -63.977 -19.572  -2.232  1.00 29.39 ? 613 HOH D O   1 
HETATM 5148 O O   . HOH CA 5 .   ? -42.699 -20.987  -18.670 1.00 32.68 ? 614 HOH D O   1 
HETATM 5149 O O   . HOH CA 5 .   ? -48.627 -17.473  -11.828 1.00 35.71 ? 615 HOH D O   1 
HETATM 5150 O O   . HOH CA 5 .   ? -58.958 -16.487  10.756  1.00 41.55 ? 616 HOH D O   1 
HETATM 5151 O O   . HOH CA 5 .   ? -39.159 -23.284  -15.405 1.00 30.60 ? 617 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   96  ?   ?   ?   A . n 
A 1 2   ARG 2   97  ?   ?   ?   A . n 
A 1 3   LEU 3   98  ?   ?   ?   A . n 
A 1 4   GLY 4   99  ?   ?   ?   A . n 
A 1 5   ALA 5   100 100 ALA ALA A . n 
A 1 6   ARG 6   101 101 ARG ARG A . n 
A 1 7   PRO 7   102 102 PRO PRO A . n 
A 1 8   CYS 8   103 103 CYS CYS A . n 
A 1 9   GLY 9   104 104 GLY GLY A . n 
A 1 10  LEU 10  105 105 LEU LEU A . n 
A 1 11  ARG 11  106 106 ARG ARG A . n 
A 1 12  GLU 12  107 107 GLU GLU A . n 
A 1 13  LEU 13  108 108 LEU LEU A . n 
A 1 14  GLU 14  109 109 GLU GLU A . n 
A 1 15  VAL 15  110 110 VAL VAL A . n 
A 1 16  ARG 16  111 111 ARG ARG A . n 
A 1 17  VAL 17  112 112 VAL VAL A . n 
A 1 18  SER 18  113 113 SER SER A . n 
A 1 19  GLU 19  114 114 GLU GLU A . n 
A 1 20  LEU 20  115 115 LEU LEU A . n 
A 1 21  GLY 21  116 116 GLY GLY A . n 
A 1 22  LEU 22  117 117 LEU LEU A . n 
A 1 23  GLY 23  118 118 GLY GLY A . n 
A 1 24  TYR 24  119 119 TYR TYR A . n 
A 1 25  ALA 25  120 120 ALA ALA A . n 
A 1 26  SER 26  121 121 SER SER A . n 
A 1 27  ASP 27  122 122 ASP ASP A . n 
A 1 28  GLU 28  123 123 GLU GLU A . n 
A 1 29  THR 29  124 124 THR THR A . n 
A 1 30  VAL 30  125 125 VAL VAL A . n 
A 1 31  LEU 31  126 126 LEU LEU A . n 
A 1 32  PHE 32  127 127 PHE PHE A . n 
A 1 33  ARG 33  128 128 ARG ARG A . n 
A 1 34  TYR 34  129 129 TYR TYR A . n 
A 1 35  CYS 35  130 130 CYS CYS A . n 
A 1 36  ALA 36  131 131 ALA ALA A . n 
A 1 37  GLY 37  132 132 GLY GLY A . n 
A 1 38  ALA 38  133 133 ALA ALA A . n 
A 1 39  CYS 39  134 134 CYS CYS A . n 
A 1 40  GLU 40  135 135 GLU GLU A . n 
A 1 41  ALA 41  136 136 ALA ALA A . n 
A 1 42  ALA 42  137 137 ALA ALA A . n 
A 1 43  ALA 43  138 138 ALA ALA A . n 
A 1 44  ARG 44  139 139 ARG ARG A . n 
A 1 45  VAL 45  140 140 VAL VAL A . n 
A 1 46  TYR 46  141 141 TYR TYR A . n 
A 1 47  ASP 47  142 142 ASP ASP A . n 
A 1 48  LEU 48  143 143 LEU LEU A . n 
A 1 49  GLY 49  144 144 GLY GLY A . n 
A 1 50  LEU 50  145 145 LEU LEU A . n 
A 1 51  ARG 51  146 146 ARG ARG A . n 
A 1 52  ARG 52  147 147 ARG ARG A . n 
A 1 53  LEU 53  148 148 LEU LEU A . n 
A 1 54  ARG 54  149 149 ARG ARG A . n 
A 1 55  GLN 55  150 150 GLN GLN A . n 
A 1 56  ARG 56  151 151 ARG ARG A . n 
A 1 57  ARG 57  152 152 ARG ARG A . n 
A 1 58  ARG 58  153 153 ARG ARG A . n 
A 1 59  LEU 59  154 154 LEU LEU A . n 
A 1 60  ARG 60  155 155 ARG ARG A . n 
A 1 61  ARG 61  156 156 ARG ARG A . n 
A 1 62  GLU 62  157 157 GLU GLU A . n 
A 1 63  ARG 63  158 158 ARG ARG A . n 
A 1 64  VAL 64  159 159 VAL VAL A . n 
A 1 65  ARG 65  160 160 ARG ARG A . n 
A 1 66  ALA 66  161 161 ALA ALA A . n 
A 1 67  GLN 67  162 162 GLN GLN A . n 
A 1 68  PRO 68  163 163 PRO PRO A . n 
A 1 69  CYS 69  164 164 CYS CYS A . n 
A 1 70  CYS 70  165 165 CYS CYS A . n 
A 1 71  ARG 71  166 166 ARG ARG A . n 
A 1 72  PRO 72  167 167 PRO PRO A . n 
A 1 73  THR 73  168 168 THR THR A . n 
A 1 74  ALA 74  169 169 ALA ALA A . n 
A 1 75  TYR 75  170 170 TYR TYR A . n 
A 1 76  GLU 76  171 171 GLU GLU A . n 
A 1 77  ASP 77  172 172 ASP ASP A . n 
A 1 78  GLU 78  173 173 GLU GLU A . n 
A 1 79  VAL 79  174 174 VAL VAL A . n 
A 1 80  SER 80  175 175 SER SER A . n 
A 1 81  PHE 81  176 176 PHE PHE A . n 
A 1 82  LEU 82  177 177 LEU LEU A . n 
A 1 83  ASP 83  178 178 ASP ASP A . n 
A 1 84  ALA 84  179 179 ALA ALA A . n 
A 1 85  HIS 85  180 180 HIS HIS A . n 
A 1 86  SER 86  181 181 SER SER A . n 
A 1 87  ARG 87  182 182 ARG ARG A . n 
A 1 88  TYR 88  183 183 TYR TYR A . n 
A 1 89  HIS 89  184 184 HIS HIS A . n 
A 1 90  THR 90  185 185 THR THR A . n 
A 1 91  VAL 91  186 186 VAL VAL A . n 
A 1 92  HIS 92  187 187 HIS HIS A . n 
A 1 93  GLU 93  188 188 GLU GLU A . n 
A 1 94  LEU 94  189 189 LEU LEU A . n 
A 1 95  SER 95  190 190 SER SER A . n 
A 1 96  ALA 96  191 191 ALA ALA A . n 
A 1 97  ARG 97  192 192 ARG ARG A . n 
A 1 98  GLU 98  193 193 GLU GLU A . n 
A 1 99  CYS 99  194 194 CYS CYS A . n 
A 1 100 ALA 100 195 195 ALA ALA A . n 
A 1 101 CYS 101 196 196 CYS CYS A . n 
A 1 102 VAL 102 197 197 VAL VAL A . n 
B 1 1   ALA 1   96  ?   ?   ?   B . n 
B 1 2   ARG 2   97  ?   ?   ?   B . n 
B 1 3   LEU 3   98  ?   ?   ?   B . n 
B 1 4   GLY 4   99  ?   ?   ?   B . n 
B 1 5   ALA 5   100 100 ALA ALA B . n 
B 1 6   ARG 6   101 101 ARG ARG B . n 
B 1 7   PRO 7   102 102 PRO PRO B . n 
B 1 8   CYS 8   103 103 CYS CYS B . n 
B 1 9   GLY 9   104 104 GLY GLY B . n 
B 1 10  LEU 10  105 105 LEU LEU B . n 
B 1 11  ARG 11  106 106 ARG ARG B . n 
B 1 12  GLU 12  107 107 GLU GLU B . n 
B 1 13  LEU 13  108 108 LEU LEU B . n 
B 1 14  GLU 14  109 109 GLU GLU B . n 
B 1 15  VAL 15  110 110 VAL VAL B . n 
B 1 16  ARG 16  111 111 ARG ARG B . n 
B 1 17  VAL 17  112 112 VAL VAL B . n 
B 1 18  SER 18  113 113 SER SER B . n 
B 1 19  GLU 19  114 114 GLU GLU B . n 
B 1 20  LEU 20  115 115 LEU LEU B . n 
B 1 21  GLY 21  116 116 GLY GLY B . n 
B 1 22  LEU 22  117 117 LEU LEU B . n 
B 1 23  GLY 23  118 118 GLY GLY B . n 
B 1 24  TYR 24  119 119 TYR TYR B . n 
B 1 25  ALA 25  120 120 ALA ALA B . n 
B 1 26  SER 26  121 121 SER SER B . n 
B 1 27  ASP 27  122 122 ASP ASP B . n 
B 1 28  GLU 28  123 123 GLU GLU B . n 
B 1 29  THR 29  124 124 THR THR B . n 
B 1 30  VAL 30  125 125 VAL VAL B . n 
B 1 31  LEU 31  126 126 LEU LEU B . n 
B 1 32  PHE 32  127 127 PHE PHE B . n 
B 1 33  ARG 33  128 128 ARG ARG B . n 
B 1 34  TYR 34  129 129 TYR TYR B . n 
B 1 35  CYS 35  130 130 CYS CYS B . n 
B 1 36  ALA 36  131 131 ALA ALA B . n 
B 1 37  GLY 37  132 132 GLY GLY B . n 
B 1 38  ALA 38  133 133 ALA ALA B . n 
B 1 39  CYS 39  134 134 CYS CYS B . n 
B 1 40  GLU 40  135 135 GLU GLU B . n 
B 1 41  ALA 41  136 136 ALA ALA B . n 
B 1 42  ALA 42  137 137 ALA ALA B . n 
B 1 43  ALA 43  138 138 ALA ALA B . n 
B 1 44  ARG 44  139 139 ARG ARG B . n 
B 1 45  VAL 45  140 140 VAL VAL B . n 
B 1 46  TYR 46  141 141 TYR TYR B . n 
B 1 47  ASP 47  142 142 ASP ASP B . n 
B 1 48  LEU 48  143 143 LEU LEU B . n 
B 1 49  GLY 49  144 144 GLY GLY B . n 
B 1 50  LEU 50  145 145 LEU LEU B . n 
B 1 51  ARG 51  146 146 ARG ARG B . n 
B 1 52  ARG 52  147 147 ARG ARG B . n 
B 1 53  LEU 53  148 148 LEU LEU B . n 
B 1 54  ARG 54  149 149 ARG ARG B . n 
B 1 55  GLN 55  150 150 GLN GLN B . n 
B 1 56  ARG 56  151 151 ARG ARG B . n 
B 1 57  ARG 57  152 152 ARG ARG B . n 
B 1 58  ARG 58  153 153 ARG ARG B . n 
B 1 59  LEU 59  154 154 LEU LEU B . n 
B 1 60  ARG 60  155 155 ARG ARG B . n 
B 1 61  ARG 61  156 156 ARG ARG B . n 
B 1 62  GLU 62  157 157 GLU GLU B . n 
B 1 63  ARG 63  158 158 ARG ARG B . n 
B 1 64  VAL 64  159 159 VAL VAL B . n 
B 1 65  ARG 65  160 160 ARG ARG B . n 
B 1 66  ALA 66  161 161 ALA ALA B . n 
B 1 67  GLN 67  162 162 GLN GLN B . n 
B 1 68  PRO 68  163 163 PRO PRO B . n 
B 1 69  CYS 69  164 164 CYS CYS B . n 
B 1 70  CYS 70  165 165 CYS CYS B . n 
B 1 71  ARG 71  166 166 ARG ARG B . n 
B 1 72  PRO 72  167 167 PRO PRO B . n 
B 1 73  THR 73  168 168 THR THR B . n 
B 1 74  ALA 74  169 169 ALA ALA B . n 
B 1 75  TYR 75  170 170 TYR TYR B . n 
B 1 76  GLU 76  171 171 GLU GLU B . n 
B 1 77  ASP 77  172 172 ASP ASP B . n 
B 1 78  GLU 78  173 173 GLU GLU B . n 
B 1 79  VAL 79  174 174 VAL VAL B . n 
B 1 80  SER 80  175 175 SER SER B . n 
B 1 81  PHE 81  176 176 PHE PHE B . n 
B 1 82  LEU 82  177 177 LEU LEU B . n 
B 1 83  ASP 83  178 178 ASP ASP B . n 
B 1 84  ALA 84  179 179 ALA ALA B . n 
B 1 85  HIS 85  180 180 HIS HIS B . n 
B 1 86  SER 86  181 181 SER SER B . n 
B 1 87  ARG 87  182 182 ARG ARG B . n 
B 1 88  TYR 88  183 183 TYR TYR B . n 
B 1 89  HIS 89  184 184 HIS HIS B . n 
B 1 90  THR 90  185 185 THR THR B . n 
B 1 91  VAL 91  186 186 VAL VAL B . n 
B 1 92  HIS 92  187 187 HIS HIS B . n 
B 1 93  GLU 93  188 188 GLU GLU B . n 
B 1 94  LEU 94  189 189 LEU LEU B . n 
B 1 95  SER 95  190 190 SER SER B . n 
B 1 96  ALA 96  191 191 ALA ALA B . n 
B 1 97  ARG 97  192 192 ARG ARG B . n 
B 1 98  GLU 98  193 193 GLU GLU B . n 
B 1 99  CYS 99  194 194 CYS CYS B . n 
B 1 100 ALA 100 195 195 ALA ALA B . n 
B 1 101 CYS 101 196 196 CYS CYS B . n 
B 1 102 VAL 102 197 197 VAL VAL B . n 
C 2 1   GLY 1   147 ?   ?   ?   C . n 
C 2 2   THR 2   148 ?   ?   ?   C . n 
C 2 3   GLY 3   149 ?   ?   ?   C . n 
C 2 4   ALA 4   150 ?   ?   ?   C . n 
C 2 5   ASP 5   151 ?   ?   ?   C . n 
C 2 6   PRO 6   152 ?   ?   ?   C . n 
C 2 7   VAL 7   153 ?   ?   ?   C . n 
C 2 8   VAL 8   154 ?   ?   ?   C . n 
C 2 9   SER 9   155 ?   ?   ?   C . n 
C 2 10  ALA 10  156 ?   ?   ?   C . n 
C 2 11  LYS 11  157 ?   ?   ?   C . n 
C 2 12  SER 12  158 ?   ?   ?   C . n 
C 2 13  ASN 13  159 159 ASN ASN C . n 
C 2 14  HIS 14  160 160 HIS HIS C . n 
C 2 15  CYS 15  161 161 CYS CYS C . n 
C 2 16  LEU 16  162 162 LEU LEU C . n 
C 2 17  ASP 17  163 163 ASP ASP C . n 
C 2 18  ALA 18  164 164 ALA ALA C . n 
C 2 19  ALA 19  165 165 ALA ALA C . n 
C 2 20  LYS 20  166 166 LYS LYS C . n 
C 2 21  ALA 21  167 167 ALA ALA C . n 
C 2 22  CYS 22  168 168 CYS CYS C . n 
C 2 23  ASN 23  169 169 ASN ASN C . n 
C 2 24  LEU 24  170 170 LEU LEU C . n 
C 2 25  ASN 25  171 171 ASN ASN C . n 
C 2 26  ASP 26  172 172 ASP ASP C . n 
C 2 27  ASN 27  173 173 ASN ASN C . n 
C 2 28  CYS 28  174 174 CYS CYS C . n 
C 2 29  LYS 29  175 175 LYS LYS C . n 
C 2 30  LYS 30  176 176 LYS LYS C . n 
C 2 31  LEU 31  177 177 LEU LEU C . n 
C 2 32  ARG 32  178 178 ARG ARG C . n 
C 2 33  SER 33  179 179 SER SER C . n 
C 2 34  SER 34  180 180 SER SER C . n 
C 2 35  TYR 35  181 181 TYR TYR C . n 
C 2 36  ILE 36  182 182 ILE ILE C . n 
C 2 37  SER 37  183 183 SER SER C . n 
C 2 38  ILE 38  184 184 ILE ILE C . n 
C 2 39  CYS 39  185 185 CYS CYS C . n 
C 2 40  ASN 40  186 186 ASN ASN C . n 
C 2 41  ARG 41  187 187 ARG ARG C . n 
C 2 42  GLU 42  188 188 GLU GLU C . n 
C 2 43  ILE 43  189 189 ILE ILE C . n 
C 2 44  SER 44  190 190 SER SER C . n 
C 2 45  PRO 45  191 191 PRO PRO C . n 
C 2 46  THR 46  192 192 THR THR C . n 
C 2 47  GLU 47  193 193 GLU GLU C . n 
C 2 48  ARG 48  194 194 ARG ARG C . n 
C 2 49  CYS 49  195 195 CYS CYS C . n 
C 2 50  ASN 50  196 196 ASN ASN C . n 
C 2 51  ARG 51  197 197 ARG ARG C . n 
C 2 52  ARG 52  198 198 ARG ARG C . n 
C 2 53  LYS 53  199 199 LYS LYS C . n 
C 2 54  CYS 54  200 200 CYS CYS C . n 
C 2 55  HIS 55  201 201 HIS HIS C . n 
C 2 56  LYS 56  202 202 LYS LYS C . n 
C 2 57  ALA 57  203 203 ALA ALA C . n 
C 2 58  LEU 58  204 204 LEU LEU C . n 
C 2 59  ARG 59  205 205 ARG ARG C . n 
C 2 60  GLN 60  206 206 GLN GLN C . n 
C 2 61  PHE 61  207 207 PHE PHE C . n 
C 2 62  PHE 62  208 208 PHE PHE C . n 
C 2 63  ASP 63  209 209 ASP ASP C . n 
C 2 64  ARG 64  210 210 ARG ARG C . n 
C 2 65  VAL 65  211 211 VAL VAL C . n 
C 2 66  PRO 66  212 212 PRO PRO C . n 
C 2 67  SER 67  213 213 SER SER C . n 
C 2 68  GLU 68  214 214 GLU GLU C . n 
C 2 69  TYR 69  215 215 TYR TYR C . n 
C 2 70  THR 70  216 216 THR THR C . n 
C 2 71  TYR 71  217 217 TYR TYR C . n 
C 2 72  ARG 72  218 218 ARG ARG C . n 
C 2 73  MET 73  219 219 MET MET C . n 
C 2 74  LEU 74  220 220 LEU LEU C . n 
C 2 75  PHE 75  221 221 PHE PHE C . n 
C 2 76  CYS 76  222 222 CYS CYS C . n 
C 2 77  SER 77  223 223 SER SER C . n 
C 2 78  CYS 78  224 224 CYS CYS C . n 
C 2 79  GLN 79  225 225 GLN GLN C . n 
C 2 80  ASP 80  226 226 ASP ASP C . n 
C 2 81  GLN 81  227 227 GLN GLN C . n 
C 2 82  ALA 82  228 228 ALA ALA C . n 
C 2 83  CYS 83  229 229 CYS CYS C . n 
C 2 84  ALA 84  230 230 ALA ALA C . n 
C 2 85  GLU 85  231 231 GLU GLU C . n 
C 2 86  ARG 86  232 232 ARG ARG C . n 
C 2 87  ARG 87  233 233 ARG ARG C . n 
C 2 88  ARG 88  234 234 ARG ARG C . n 
C 2 89  GLN 89  235 235 GLN GLN C . n 
C 2 90  THR 90  236 236 THR THR C . n 
C 2 91  ILE 91  237 237 ILE ILE C . n 
C 2 92  LEU 92  238 238 LEU LEU C . n 
C 2 93  PRO 93  239 239 PRO PRO C . n 
C 2 94  SER 94  240 240 SER SER C . n 
C 2 95  CYS 95  241 241 CYS CYS C . n 
C 2 96  SER 96  242 242 SER SER C . n 
C 2 97  TYR 97  243 243 TYR TYR C . n 
C 2 98  GLU 98  244 244 GLU GLU C . n 
C 2 99  ASP 99  245 245 ASP ASP C . n 
C 2 100 LYS 100 246 246 LYS LYS C . n 
C 2 101 GLU 101 247 247 GLU GLU C . n 
C 2 102 LYS 102 248 248 LYS LYS C . n 
C 2 103 PRO 103 249 249 PRO PRO C . n 
C 2 104 ASN 104 250 250 ASN ASN C . n 
C 2 105 CYS 105 251 251 CYS CYS C . n 
C 2 106 LEU 106 252 252 LEU LEU C . n 
C 2 107 ASP 107 253 253 ASP ASP C . n 
C 2 108 LEU 108 254 254 LEU LEU C . n 
C 2 109 ARG 109 255 255 ARG ARG C . n 
C 2 110 GLY 110 256 256 GLY GLY C . n 
C 2 111 VAL 111 257 257 VAL VAL C . n 
C 2 112 CYS 112 258 258 CYS CYS C . n 
C 2 113 ARG 113 259 259 ARG ARG C . n 
C 2 114 THR 114 260 260 THR THR C . n 
C 2 115 ASP 115 261 261 ASP ASP C . n 
C 2 116 HIS 116 262 262 HIS HIS C . n 
C 2 117 LEU 117 263 263 LEU LEU C . n 
C 2 118 CYS 118 264 264 CYS CYS C . n 
C 2 119 ARG 119 265 265 ARG ARG C . n 
C 2 120 SER 120 266 266 SER SER C . n 
C 2 121 ARG 121 267 267 ARG ARG C . n 
C 2 122 LEU 122 268 268 LEU LEU C . n 
C 2 123 ALA 123 269 269 ALA ALA C . n 
C 2 124 ASP 124 270 270 ASP ASP C . n 
C 2 125 PHE 125 271 271 PHE PHE C . n 
C 2 126 HIS 126 272 272 HIS HIS C . n 
C 2 127 ALA 127 273 273 ALA ALA C . n 
C 2 128 ASN 128 274 274 ASN ASN C . n 
C 2 129 CYS 129 275 275 CYS CYS C . n 
C 2 130 ARG 130 276 276 ARG ARG C . n 
C 2 131 ALA 131 277 277 ALA ALA C . n 
C 2 132 SER 132 278 278 SER SER C . n 
C 2 133 TYR 133 279 279 TYR TYR C . n 
C 2 134 GLN 134 280 280 GLN GLN C . n 
C 2 135 THR 135 281 281 THR THR C . n 
C 2 136 VAL 136 282 282 VAL VAL C . n 
C 2 137 THR 137 283 283 THR THR C . n 
C 2 138 SER 138 284 284 SER SER C . n 
C 2 139 CYS 139 285 285 CYS CYS C . n 
C 2 140 PRO 140 286 286 PRO PRO C . n 
C 2 141 ALA 141 287 287 ALA ALA C . n 
C 2 142 ASP 142 288 288 ASP ASP C . n 
C 2 143 ASN 143 289 289 ASN ASN C . n 
C 2 144 TYR 144 290 290 TYR TYR C . n 
C 2 145 GLN 145 291 291 GLN GLN C . n 
C 2 146 ALA 146 292 292 ALA ALA C . n 
C 2 147 CYS 147 293 293 CYS CYS C . n 
C 2 148 LEU 148 294 294 LEU LEU C . n 
C 2 149 GLY 149 295 295 GLY GLY C . n 
C 2 150 SER 150 296 296 SER SER C . n 
C 2 151 TYR 151 297 297 TYR TYR C . n 
C 2 152 ALA 152 298 298 ALA ALA C . n 
C 2 153 GLY 153 299 299 GLY GLY C . n 
C 2 154 MET 154 300 300 MET MET C . n 
C 2 155 ILE 155 301 301 ILE ILE C . n 
C 2 156 GLY 156 302 302 GLY GLY C . n 
C 2 157 PHE 157 303 303 PHE PHE C . n 
C 2 158 ASP 158 304 304 ASP ASP C . n 
C 2 159 MET 159 305 305 MET MET C . n 
C 2 160 THR 160 306 306 THR THR C . n 
C 2 161 PRO 161 307 307 PRO PRO C . n 
C 2 162 ASN 162 308 308 ASN ASN C . n 
C 2 163 TYR 163 309 309 TYR TYR C . n 
C 2 164 VAL 164 310 310 VAL VAL C . n 
C 2 165 ASP 165 311 311 ASP ASP C . n 
C 2 166 SER 166 312 312 SER SER C . n 
C 2 167 SER 167 313 313 SER SER C . n 
C 2 168 PRO 168 314 314 PRO PRO C . n 
C 2 169 THR 169 315 315 THR THR C . n 
C 2 170 GLY 170 316 316 GLY GLY C . n 
C 2 171 ILE 171 317 317 ILE ILE C . n 
C 2 172 VAL 172 318 318 VAL VAL C . n 
C 2 173 VAL 173 319 319 VAL VAL C . n 
C 2 174 SER 174 320 320 SER SER C . n 
C 2 175 PRO 175 321 321 PRO PRO C . n 
C 2 176 TRP 176 322 322 TRP TRP C . n 
C 2 177 CYS 177 323 323 CYS CYS C . n 
C 2 178 SER 178 324 324 SER SER C . n 
C 2 179 CYS 179 325 325 CYS CYS C . n 
C 2 180 ARG 180 326 326 ARG ARG C . n 
C 2 181 GLY 181 327 327 GLY GLY C . n 
C 2 182 SER 182 328 328 SER SER C . n 
C 2 183 GLY 183 329 329 GLY GLY C . n 
C 2 184 ASN 184 330 330 ASN ASN C . n 
C 2 185 MET 185 331 331 MET MET C . n 
C 2 186 GLU 186 332 332 GLU GLU C . n 
C 2 187 GLU 187 333 333 GLU GLU C . n 
C 2 188 GLU 188 334 334 GLU GLU C . n 
C 2 189 CYS 189 335 335 CYS CYS C . n 
C 2 190 GLU 190 336 336 GLU GLU C . n 
C 2 191 LYS 191 337 337 LYS LYS C . n 
C 2 192 PHE 192 338 338 PHE PHE C . n 
C 2 193 LEU 193 339 339 LEU LEU C . n 
C 2 194 ARG 194 340 340 ARG ARG C . n 
C 2 195 ASP 195 341 341 ASP ASP C . n 
C 2 196 PHE 196 342 342 PHE PHE C . n 
C 2 197 THR 197 343 343 THR THR C . n 
C 2 198 GLU 198 344 344 GLU GLU C . n 
C 2 199 ASN 199 345 345 ASN ASN C . n 
C 2 200 PRO 200 346 346 PRO PRO C . n 
C 2 201 CYS 201 347 347 CYS CYS C . n 
C 2 202 LEU 202 348 348 LEU LEU C . n 
C 2 203 ARG 203 349 349 ARG ARG C . n 
C 2 204 ASN 204 350 350 ASN ASN C . n 
C 2 205 ALA 205 351 351 ALA ALA C . n 
C 2 206 ILE 206 352 352 ILE ILE C . n 
C 2 207 GLN 207 353 353 GLN GLN C . n 
C 2 208 ALA 208 354 354 ALA ALA C . n 
C 2 209 PHE 209 355 355 PHE PHE C . n 
C 2 210 GLY 210 356 356 GLY GLY C . n 
C 2 211 ASN 211 357 ?   ?   ?   C . n 
C 2 212 GLY 212 358 ?   ?   ?   C . n 
C 2 213 THR 213 359 ?   ?   ?   C . n 
C 2 214 ASP 214 360 ?   ?   ?   C . n 
C 2 215 VAL 215 361 ?   ?   ?   C . n 
C 2 216 ASN 216 362 ?   ?   ?   C . n 
D 2 1   GLY 1   147 ?   ?   ?   D . n 
D 2 2   THR 2   148 ?   ?   ?   D . n 
D 2 3   GLY 3   149 ?   ?   ?   D . n 
D 2 4   ALA 4   150 ?   ?   ?   D . n 
D 2 5   ASP 5   151 ?   ?   ?   D . n 
D 2 6   PRO 6   152 ?   ?   ?   D . n 
D 2 7   VAL 7   153 ?   ?   ?   D . n 
D 2 8   VAL 8   154 ?   ?   ?   D . n 
D 2 9   SER 9   155 ?   ?   ?   D . n 
D 2 10  ALA 10  156 ?   ?   ?   D . n 
D 2 11  LYS 11  157 ?   ?   ?   D . n 
D 2 12  SER 12  158 ?   ?   ?   D . n 
D 2 13  ASN 13  159 159 ASN ASN D . n 
D 2 14  HIS 14  160 160 HIS HIS D . n 
D 2 15  CYS 15  161 161 CYS CYS D . n 
D 2 16  LEU 16  162 162 LEU LEU D . n 
D 2 17  ASP 17  163 163 ASP ASP D . n 
D 2 18  ALA 18  164 164 ALA ALA D . n 
D 2 19  ALA 19  165 165 ALA ALA D . n 
D 2 20  LYS 20  166 166 LYS LYS D . n 
D 2 21  ALA 21  167 167 ALA ALA D . n 
D 2 22  CYS 22  168 168 CYS CYS D . n 
D 2 23  ASN 23  169 169 ASN ASN D . n 
D 2 24  LEU 24  170 170 LEU LEU D . n 
D 2 25  ASN 25  171 171 ASN ASN D . n 
D 2 26  ASP 26  172 172 ASP ASP D . n 
D 2 27  ASN 27  173 173 ASN ASN D . n 
D 2 28  CYS 28  174 174 CYS CYS D . n 
D 2 29  LYS 29  175 175 LYS LYS D . n 
D 2 30  LYS 30  176 176 LYS LYS D . n 
D 2 31  LEU 31  177 177 LEU LEU D . n 
D 2 32  ARG 32  178 178 ARG ARG D . n 
D 2 33  SER 33  179 179 SER SER D . n 
D 2 34  SER 34  180 180 SER SER D . n 
D 2 35  TYR 35  181 181 TYR TYR D . n 
D 2 36  ILE 36  182 182 ILE ILE D . n 
D 2 37  SER 37  183 183 SER SER D . n 
D 2 38  ILE 38  184 184 ILE ILE D . n 
D 2 39  CYS 39  185 185 CYS CYS D . n 
D 2 40  ASN 40  186 186 ASN ASN D . n 
D 2 41  ARG 41  187 187 ARG ARG D . n 
D 2 42  GLU 42  188 188 GLU GLU D . n 
D 2 43  ILE 43  189 189 ILE ILE D . n 
D 2 44  SER 44  190 190 SER SER D . n 
D 2 45  PRO 45  191 191 PRO PRO D . n 
D 2 46  THR 46  192 192 THR THR D . n 
D 2 47  GLU 47  193 193 GLU GLU D . n 
D 2 48  ARG 48  194 194 ARG ARG D . n 
D 2 49  CYS 49  195 195 CYS CYS D . n 
D 2 50  ASN 50  196 196 ASN ASN D . n 
D 2 51  ARG 51  197 197 ARG ARG D . n 
D 2 52  ARG 52  198 198 ARG ARG D . n 
D 2 53  LYS 53  199 199 LYS LYS D . n 
D 2 54  CYS 54  200 200 CYS CYS D . n 
D 2 55  HIS 55  201 201 HIS HIS D . n 
D 2 56  LYS 56  202 202 LYS LYS D . n 
D 2 57  ALA 57  203 203 ALA ALA D . n 
D 2 58  LEU 58  204 204 LEU LEU D . n 
D 2 59  ARG 59  205 205 ARG ARG D . n 
D 2 60  GLN 60  206 206 GLN GLN D . n 
D 2 61  PHE 61  207 207 PHE PHE D . n 
D 2 62  PHE 62  208 208 PHE PHE D . n 
D 2 63  ASP 63  209 209 ASP ASP D . n 
D 2 64  ARG 64  210 210 ARG ARG D . n 
D 2 65  VAL 65  211 211 VAL VAL D . n 
D 2 66  PRO 66  212 212 PRO PRO D . n 
D 2 67  SER 67  213 213 SER SER D . n 
D 2 68  GLU 68  214 214 GLU GLU D . n 
D 2 69  TYR 69  215 215 TYR TYR D . n 
D 2 70  THR 70  216 216 THR THR D . n 
D 2 71  TYR 71  217 217 TYR TYR D . n 
D 2 72  ARG 72  218 218 ARG ARG D . n 
D 2 73  MET 73  219 219 MET MET D . n 
D 2 74  LEU 74  220 220 LEU LEU D . n 
D 2 75  PHE 75  221 221 PHE PHE D . n 
D 2 76  CYS 76  222 222 CYS CYS D . n 
D 2 77  SER 77  223 223 SER SER D . n 
D 2 78  CYS 78  224 224 CYS CYS D . n 
D 2 79  GLN 79  225 225 GLN GLN D . n 
D 2 80  ASP 80  226 226 ASP ASP D . n 
D 2 81  GLN 81  227 227 GLN GLN D . n 
D 2 82  ALA 82  228 228 ALA ALA D . n 
D 2 83  CYS 83  229 229 CYS CYS D . n 
D 2 84  ALA 84  230 230 ALA ALA D . n 
D 2 85  GLU 85  231 231 GLU GLU D . n 
D 2 86  ARG 86  232 232 ARG ARG D . n 
D 2 87  ARG 87  233 233 ARG ARG D . n 
D 2 88  ARG 88  234 234 ARG ARG D . n 
D 2 89  GLN 89  235 235 GLN GLN D . n 
D 2 90  THR 90  236 236 THR THR D . n 
D 2 91  ILE 91  237 237 ILE ILE D . n 
D 2 92  LEU 92  238 238 LEU LEU D . n 
D 2 93  PRO 93  239 239 PRO PRO D . n 
D 2 94  SER 94  240 240 SER SER D . n 
D 2 95  CYS 95  241 241 CYS CYS D . n 
D 2 96  SER 96  242 242 SER SER D . n 
D 2 97  TYR 97  243 243 TYR TYR D . n 
D 2 98  GLU 98  244 244 GLU GLU D . n 
D 2 99  ASP 99  245 245 ASP ASP D . n 
D 2 100 LYS 100 246 246 LYS LYS D . n 
D 2 101 GLU 101 247 247 GLU GLU D . n 
D 2 102 LYS 102 248 248 LYS LYS D . n 
D 2 103 PRO 103 249 249 PRO PRO D . n 
D 2 104 ASN 104 250 250 ASN ASN D . n 
D 2 105 CYS 105 251 251 CYS CYS D . n 
D 2 106 LEU 106 252 252 LEU LEU D . n 
D 2 107 ASP 107 253 253 ASP ASP D . n 
D 2 108 LEU 108 254 254 LEU LEU D . n 
D 2 109 ARG 109 255 255 ARG ARG D . n 
D 2 110 GLY 110 256 256 GLY GLY D . n 
D 2 111 VAL 111 257 257 VAL VAL D . n 
D 2 112 CYS 112 258 258 CYS CYS D . n 
D 2 113 ARG 113 259 259 ARG ARG D . n 
D 2 114 THR 114 260 260 THR THR D . n 
D 2 115 ASP 115 261 261 ASP ASP D . n 
D 2 116 HIS 116 262 262 HIS HIS D . n 
D 2 117 LEU 117 263 263 LEU LEU D . n 
D 2 118 CYS 118 264 264 CYS CYS D . n 
D 2 119 ARG 119 265 265 ARG ARG D . n 
D 2 120 SER 120 266 266 SER SER D . n 
D 2 121 ARG 121 267 267 ARG ARG D . n 
D 2 122 LEU 122 268 268 LEU LEU D . n 
D 2 123 ALA 123 269 269 ALA ALA D . n 
D 2 124 ASP 124 270 270 ASP ASP D . n 
D 2 125 PHE 125 271 271 PHE PHE D . n 
D 2 126 HIS 126 272 272 HIS HIS D . n 
D 2 127 ALA 127 273 273 ALA ALA D . n 
D 2 128 ASN 128 274 274 ASN ASN D . n 
D 2 129 CYS 129 275 275 CYS CYS D . n 
D 2 130 ARG 130 276 276 ARG ARG D . n 
D 2 131 ALA 131 277 277 ALA ALA D . n 
D 2 132 SER 132 278 278 SER SER D . n 
D 2 133 TYR 133 279 279 TYR TYR D . n 
D 2 134 GLN 134 280 280 GLN GLN D . n 
D 2 135 THR 135 281 281 THR THR D . n 
D 2 136 VAL 136 282 282 VAL VAL D . n 
D 2 137 THR 137 283 283 THR THR D . n 
D 2 138 SER 138 284 284 SER SER D . n 
D 2 139 CYS 139 285 285 CYS CYS D . n 
D 2 140 PRO 140 286 286 PRO PRO D . n 
D 2 141 ALA 141 287 287 ALA ALA D . n 
D 2 142 ASP 142 288 288 ASP ASP D . n 
D 2 143 ASN 143 289 289 ASN ASN D . n 
D 2 144 TYR 144 290 290 TYR TYR D . n 
D 2 145 GLN 145 291 291 GLN GLN D . n 
D 2 146 ALA 146 292 292 ALA ALA D . n 
D 2 147 CYS 147 293 293 CYS CYS D . n 
D 2 148 LEU 148 294 294 LEU LEU D . n 
D 2 149 GLY 149 295 295 GLY GLY D . n 
D 2 150 SER 150 296 296 SER SER D . n 
D 2 151 TYR 151 297 297 TYR TYR D . n 
D 2 152 ALA 152 298 298 ALA ALA D . n 
D 2 153 GLY 153 299 299 GLY GLY D . n 
D 2 154 MET 154 300 300 MET MET D . n 
D 2 155 ILE 155 301 301 ILE ILE D . n 
D 2 156 GLY 156 302 302 GLY GLY D . n 
D 2 157 PHE 157 303 303 PHE PHE D . n 
D 2 158 ASP 158 304 304 ASP ASP D . n 
D 2 159 MET 159 305 305 MET MET D . n 
D 2 160 THR 160 306 306 THR THR D . n 
D 2 161 PRO 161 307 307 PRO PRO D . n 
D 2 162 ASN 162 308 308 ASN ASN D . n 
D 2 163 TYR 163 309 309 TYR TYR D . n 
D 2 164 VAL 164 310 310 VAL VAL D . n 
D 2 165 ASP 165 311 311 ASP ASP D . n 
D 2 166 SER 166 312 312 SER SER D . n 
D 2 167 SER 167 313 313 SER SER D . n 
D 2 168 PRO 168 314 314 PRO PRO D . n 
D 2 169 THR 169 315 315 THR THR D . n 
D 2 170 GLY 170 316 316 GLY GLY D . n 
D 2 171 ILE 171 317 317 ILE ILE D . n 
D 2 172 VAL 172 318 318 VAL VAL D . n 
D 2 173 VAL 173 319 319 VAL VAL D . n 
D 2 174 SER 174 320 320 SER SER D . n 
D 2 175 PRO 175 321 321 PRO PRO D . n 
D 2 176 TRP 176 322 322 TRP TRP D . n 
D 2 177 CYS 177 323 323 CYS CYS D . n 
D 2 178 SER 178 324 324 SER SER D . n 
D 2 179 CYS 179 325 325 CYS CYS D . n 
D 2 180 ARG 180 326 326 ARG ARG D . n 
D 2 181 GLY 181 327 327 GLY GLY D . n 
D 2 182 SER 182 328 328 SER SER D . n 
D 2 183 GLY 183 329 329 GLY GLY D . n 
D 2 184 ASN 184 330 330 ASN ASN D . n 
D 2 185 MET 185 331 331 MET MET D . n 
D 2 186 GLU 186 332 332 GLU GLU D . n 
D 2 187 GLU 187 333 333 GLU GLU D . n 
D 2 188 GLU 188 334 334 GLU GLU D . n 
D 2 189 CYS 189 335 335 CYS CYS D . n 
D 2 190 GLU 190 336 336 GLU GLU D . n 
D 2 191 LYS 191 337 337 LYS LYS D . n 
D 2 192 PHE 192 338 338 PHE PHE D . n 
D 2 193 LEU 193 339 339 LEU LEU D . n 
D 2 194 ARG 194 340 340 ARG ARG D . n 
D 2 195 ASP 195 341 341 ASP ASP D . n 
D 2 196 PHE 196 342 342 PHE PHE D . n 
D 2 197 THR 197 343 343 THR THR D . n 
D 2 198 GLU 198 344 344 GLU GLU D . n 
D 2 199 ASN 199 345 345 ASN ASN D . n 
D 2 200 PRO 200 346 346 PRO PRO D . n 
D 2 201 CYS 201 347 347 CYS CYS D . n 
D 2 202 LEU 202 348 348 LEU LEU D . n 
D 2 203 ARG 203 349 349 ARG ARG D . n 
D 2 204 ASN 204 350 350 ASN ASN D . n 
D 2 205 ALA 205 351 351 ALA ALA D . n 
D 2 206 ILE 206 352 352 ILE ILE D . n 
D 2 207 GLN 207 353 353 GLN GLN D . n 
D 2 208 ALA 208 354 354 ALA ALA D . n 
D 2 209 PHE 209 355 355 PHE PHE D . n 
D 2 210 GLY 210 356 356 GLY GLY D . n 
D 2 211 ASN 211 357 ?   ?   ?   D . n 
D 2 212 GLY 212 358 ?   ?   ?   D . n 
D 2 213 THR 213 359 ?   ?   ?   D . n 
D 2 214 ASP 214 360 ?   ?   ?   D . n 
D 2 215 VAL 215 361 ?   ?   ?   D . n 
D 2 216 ASN 216 362 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E  3 SO4 1   201 2   SO4 SO4 A . 
F  3 SO4 1   202 4   SO4 SO4 A . 
G  3 SO4 1   203 5   SO4 SO4 A . 
H  3 SO4 1   201 1   SO4 SO4 B . 
I  3 SO4 1   202 3   SO4 SO4 B . 
J  3 SO4 1   203 11  SO4 SO4 B . 
K  3 SO4 1   204 12  SO4 SO4 B . 
L  3 SO4 1   205 16  SO4 SO4 B . 
M  4 GOL 1   206 1   GOL GOL B . 
N  3 SO4 1   401 9   SO4 SO4 C . 
O  3 SO4 1   402 13  SO4 SO4 C . 
P  3 SO4 1   403 14  SO4 SO4 C . 
Q  3 SO4 1   404 15  SO4 SO4 C . 
R  3 SO4 1   405 17  SO4 SO4 C . 
S  3 SO4 1   406 18  SO4 SO4 C . 
T  3 SO4 1   407 19  SO4 SO4 C . 
U  4 GOL 1   408 2   GOL GOL C . 
V  3 SO4 1   401 6   SO4 SO4 D . 
W  3 SO4 1   402 7   SO4 SO4 D . 
X  3 SO4 1   403 8   SO4 SO4 D . 
Y  3 SO4 1   404 20  SO4 SO4 D . 
Z  5 HOH 1   301 38  HOH HOH A . 
Z  5 HOH 2   302 33  HOH HOH A . 
Z  5 HOH 3   303 22  HOH HOH A . 
Z  5 HOH 4   304 25  HOH HOH A . 
Z  5 HOH 5   305 21  HOH HOH A . 
Z  5 HOH 6   306 4   HOH HOH A . 
Z  5 HOH 7   307 77  HOH HOH A . 
Z  5 HOH 8   308 134 HOH HOH A . 
Z  5 HOH 9   309 29  HOH HOH A . 
Z  5 HOH 10  310 109 HOH HOH A . 
Z  5 HOH 11  311 64  HOH HOH A . 
Z  5 HOH 12  312 16  HOH HOH A . 
Z  5 HOH 13  313 26  HOH HOH A . 
Z  5 HOH 14  314 11  HOH HOH A . 
Z  5 HOH 15  315 15  HOH HOH A . 
Z  5 HOH 16  316 68  HOH HOH A . 
Z  5 HOH 17  317 12  HOH HOH A . 
Z  5 HOH 18  318 75  HOH HOH A . 
Z  5 HOH 19  319 91  HOH HOH A . 
Z  5 HOH 20  320 14  HOH HOH A . 
Z  5 HOH 21  321 78  HOH HOH A . 
Z  5 HOH 22  322 1   HOH HOH A . 
Z  5 HOH 23  323 62  HOH HOH A . 
Z  5 HOH 24  324 277 HOH HOH A . 
Z  5 HOH 25  325 92  HOH HOH A . 
Z  5 HOH 26  326 44  HOH HOH A . 
Z  5 HOH 27  327 37  HOH HOH A . 
Z  5 HOH 28  328 74  HOH HOH A . 
Z  5 HOH 29  329 284 HOH HOH A . 
Z  5 HOH 30  330 48  HOH HOH A . 
Z  5 HOH 31  331 61  HOH HOH A . 
Z  5 HOH 32  332 27  HOH HOH A . 
Z  5 HOH 33  333 289 HOH HOH A . 
Z  5 HOH 34  334 30  HOH HOH A . 
Z  5 HOH 35  335 58  HOH HOH A . 
Z  5 HOH 36  336 288 HOH HOH A . 
Z  5 HOH 37  337 312 HOH HOH A . 
Z  5 HOH 38  338 85  HOH HOH A . 
Z  5 HOH 39  339 35  HOH HOH A . 
Z  5 HOH 40  340 42  HOH HOH A . 
Z  5 HOH 41  341 51  HOH HOH A . 
Z  5 HOH 42  342 90  HOH HOH A . 
Z  5 HOH 43  343 53  HOH HOH A . 
AA 5 HOH 1   301 79  HOH HOH B . 
AA 5 HOH 2   302 28  HOH HOH B . 
AA 5 HOH 3   303 248 HOH HOH B . 
AA 5 HOH 4   304 63  HOH HOH B . 
AA 5 HOH 5   305 17  HOH HOH B . 
AA 5 HOH 6   306 36  HOH HOH B . 
AA 5 HOH 7   307 23  HOH HOH B . 
AA 5 HOH 8   308 5   HOH HOH B . 
AA 5 HOH 9   309 8   HOH HOH B . 
AA 5 HOH 10  310 316 HOH HOH B . 
AA 5 HOH 11  311 19  HOH HOH B . 
AA 5 HOH 12  312 9   HOH HOH B . 
AA 5 HOH 13  313 298 HOH HOH B . 
AA 5 HOH 14  314 55  HOH HOH B . 
AA 5 HOH 15  315 66  HOH HOH B . 
AA 5 HOH 16  316 24  HOH HOH B . 
AA 5 HOH 17  317 32  HOH HOH B . 
AA 5 HOH 18  318 39  HOH HOH B . 
AA 5 HOH 19  319 169 HOH HOH B . 
AA 5 HOH 20  320 72  HOH HOH B . 
AA 5 HOH 21  321 205 HOH HOH B . 
AA 5 HOH 22  322 3   HOH HOH B . 
AA 5 HOH 23  323 71  HOH HOH B . 
AA 5 HOH 24  324 7   HOH HOH B . 
AA 5 HOH 25  325 59  HOH HOH B . 
AA 5 HOH 26  326 45  HOH HOH B . 
AA 5 HOH 27  327 274 HOH HOH B . 
AA 5 HOH 28  328 52  HOH HOH B . 
AA 5 HOH 29  329 60  HOH HOH B . 
AA 5 HOH 30  330 272 HOH HOH B . 
AA 5 HOH 31  331 140 HOH HOH B . 
AA 5 HOH 32  332 20  HOH HOH B . 
AA 5 HOH 33  333 319 HOH HOH B . 
AA 5 HOH 34  334 13  HOH HOH B . 
AA 5 HOH 35  335 293 HOH HOH B . 
AA 5 HOH 36  336 31  HOH HOH B . 
AA 5 HOH 37  337 6   HOH HOH B . 
AA 5 HOH 38  338 67  HOH HOH B . 
AA 5 HOH 39  339 40  HOH HOH B . 
AA 5 HOH 40  340 70  HOH HOH B . 
AA 5 HOH 41  341 57  HOH HOH B . 
AA 5 HOH 42  342 80  HOH HOH B . 
AA 5 HOH 43  343 76  HOH HOH B . 
AA 5 HOH 44  344 65  HOH HOH B . 
AA 5 HOH 45  345 297 HOH HOH B . 
AA 5 HOH 46  346 82  HOH HOH B . 
AA 5 HOH 47  347 83  HOH HOH B . 
AA 5 HOH 48  348 81  HOH HOH B . 
AA 5 HOH 49  349 56  HOH HOH B . 
AA 5 HOH 50  350 73  HOH HOH B . 
AA 5 HOH 51  351 2   HOH HOH B . 
AA 5 HOH 52  352 250 HOH HOH B . 
AA 5 HOH 53  353 47  HOH HOH B . 
AA 5 HOH 54  354 10  HOH HOH B . 
AA 5 HOH 55  355 18  HOH HOH B . 
AA 5 HOH 56  356 322 HOH HOH B . 
AA 5 HOH 57  357 318 HOH HOH B . 
AA 5 HOH 58  358 320 HOH HOH B . 
AA 5 HOH 59  359 249 HOH HOH B . 
AA 5 HOH 60  360 275 HOH HOH B . 
AA 5 HOH 61  361 69  HOH HOH B . 
AA 5 HOH 62  362 279 HOH HOH B . 
AA 5 HOH 63  363 46  HOH HOH B . 
BA 5 HOH 1   501 89  HOH HOH C . 
BA 5 HOH 2   502 254 HOH HOH C . 
BA 5 HOH 3   503 216 HOH HOH C . 
BA 5 HOH 4   504 255 HOH HOH C . 
BA 5 HOH 5   505 253 HOH HOH C . 
BA 5 HOH 6   506 246 HOH HOH C . 
BA 5 HOH 7   507 215 HOH HOH C . 
BA 5 HOH 8   508 300 HOH HOH C . 
BA 5 HOH 9   509 172 HOH HOH C . 
BA 5 HOH 10  510 259 HOH HOH C . 
BA 5 HOH 11  511 177 HOH HOH C . 
BA 5 HOH 12  512 225 HOH HOH C . 
BA 5 HOH 13  513 150 HOH HOH C . 
BA 5 HOH 14  514 86  HOH HOH C . 
BA 5 HOH 15  515 210 HOH HOH C . 
BA 5 HOH 16  516 299 HOH HOH C . 
BA 5 HOH 17  517 145 HOH HOH C . 
BA 5 HOH 18  518 222 HOH HOH C . 
BA 5 HOH 19  519 190 HOH HOH C . 
BA 5 HOH 20  520 137 HOH HOH C . 
BA 5 HOH 21  521 148 HOH HOH C . 
BA 5 HOH 22  522 198 HOH HOH C . 
BA 5 HOH 23  523 175 HOH HOH C . 
BA 5 HOH 24  524 187 HOH HOH C . 
BA 5 HOH 25  525 290 HOH HOH C . 
BA 5 HOH 26  526 261 HOH HOH C . 
BA 5 HOH 27  527 294 HOH HOH C . 
BA 5 HOH 28  528 112 HOH HOH C . 
BA 5 HOH 29  529 125 HOH HOH C . 
BA 5 HOH 30  530 301 HOH HOH C . 
BA 5 HOH 31  531 135 HOH HOH C . 
BA 5 HOH 32  532 233 HOH HOH C . 
BA 5 HOH 33  533 105 HOH HOH C . 
BA 5 HOH 34  534 191 HOH HOH C . 
BA 5 HOH 35  535 186 HOH HOH C . 
BA 5 HOH 36  536 141 HOH HOH C . 
BA 5 HOH 37  537 220 HOH HOH C . 
BA 5 HOH 38  538 168 HOH HOH C . 
BA 5 HOH 39  539 87  HOH HOH C . 
BA 5 HOH 40  540 132 HOH HOH C . 
BA 5 HOH 41  541 285 HOH HOH C . 
BA 5 HOH 42  542 144 HOH HOH C . 
BA 5 HOH 43  543 124 HOH HOH C . 
BA 5 HOH 44  544 207 HOH HOH C . 
BA 5 HOH 45  545 110 HOH HOH C . 
BA 5 HOH 46  546 117 HOH HOH C . 
BA 5 HOH 47  547 131 HOH HOH C . 
BA 5 HOH 48  548 147 HOH HOH C . 
BA 5 HOH 49  549 291 HOH HOH C . 
BA 5 HOH 50  550 260 HOH HOH C . 
BA 5 HOH 51  551 313 HOH HOH C . 
BA 5 HOH 52  552 278 HOH HOH C . 
BA 5 HOH 53  553 130 HOH HOH C . 
BA 5 HOH 54  554 164 HOH HOH C . 
BA 5 HOH 55  555 229 HOH HOH C . 
BA 5 HOH 56  556 292 HOH HOH C . 
BA 5 HOH 57  557 149 HOH HOH C . 
BA 5 HOH 58  558 251 HOH HOH C . 
BA 5 HOH 59  559 159 HOH HOH C . 
BA 5 HOH 60  560 122 HOH HOH C . 
BA 5 HOH 61  561 139 HOH HOH C . 
BA 5 HOH 62  562 230 HOH HOH C . 
BA 5 HOH 63  563 170 HOH HOH C . 
BA 5 HOH 64  564 88  HOH HOH C . 
BA 5 HOH 65  565 100 HOH HOH C . 
BA 5 HOH 66  566 163 HOH HOH C . 
BA 5 HOH 67  567 171 HOH HOH C . 
BA 5 HOH 68  568 206 HOH HOH C . 
BA 5 HOH 69  569 258 HOH HOH C . 
BA 5 HOH 70  570 94  HOH HOH C . 
BA 5 HOH 71  571 183 HOH HOH C . 
BA 5 HOH 72  572 116 HOH HOH C . 
BA 5 HOH 73  573 280 HOH HOH C . 
BA 5 HOH 74  574 156 HOH HOH C . 
BA 5 HOH 75  575 219 HOH HOH C . 
BA 5 HOH 76  576 181 HOH HOH C . 
BA 5 HOH 77  577 323 HOH HOH C . 
BA 5 HOH 78  578 193 HOH HOH C . 
BA 5 HOH 79  579 256 HOH HOH C . 
BA 5 HOH 80  580 262 HOH HOH C . 
BA 5 HOH 81  581 41  HOH HOH C . 
BA 5 HOH 82  582 276 HOH HOH C . 
BA 5 HOH 83  583 252 HOH HOH C . 
BA 5 HOH 84  584 239 HOH HOH C . 
BA 5 HOH 85  585 287 HOH HOH C . 
BA 5 HOH 86  586 247 HOH HOH C . 
BA 5 HOH 87  587 242 HOH HOH C . 
BA 5 HOH 88  588 240 HOH HOH C . 
BA 5 HOH 89  589 326 HOH HOH C . 
BA 5 HOH 90  590 203 HOH HOH C . 
BA 5 HOH 91  591 317 HOH HOH C . 
BA 5 HOH 92  592 176 HOH HOH C . 
BA 5 HOH 93  593 281 HOH HOH C . 
BA 5 HOH 94  594 232 HOH HOH C . 
BA 5 HOH 95  595 257 HOH HOH C . 
CA 5 HOH 1   501 269 HOH HOH D . 
CA 5 HOH 2   502 265 HOH HOH D . 
CA 5 HOH 3   503 324 HOH HOH D . 
CA 5 HOH 4   504 226 HOH HOH D . 
CA 5 HOH 5   505 268 HOH HOH D . 
CA 5 HOH 6   506 194 HOH HOH D . 
CA 5 HOH 7   507 106 HOH HOH D . 
CA 5 HOH 8   508 209 HOH HOH D . 
CA 5 HOH 9   509 302 HOH HOH D . 
CA 5 HOH 10  510 161 HOH HOH D . 
CA 5 HOH 11  511 218 HOH HOH D . 
CA 5 HOH 12  512 167 HOH HOH D . 
CA 5 HOH 13  513 325 HOH HOH D . 
CA 5 HOH 14  514 142 HOH HOH D . 
CA 5 HOH 15  515 96  HOH HOH D . 
CA 5 HOH 16  516 173 HOH HOH D . 
CA 5 HOH 17  517 162 HOH HOH D . 
CA 5 HOH 18  518 307 HOH HOH D . 
CA 5 HOH 19  519 227 HOH HOH D . 
CA 5 HOH 20  520 195 HOH HOH D . 
CA 5 HOH 21  521 178 HOH HOH D . 
CA 5 HOH 22  522 303 HOH HOH D . 
CA 5 HOH 23  523 107 HOH HOH D . 
CA 5 HOH 24  524 155 HOH HOH D . 
CA 5 HOH 25  525 166 HOH HOH D . 
CA 5 HOH 26  526 152 HOH HOH D . 
CA 5 HOH 27  527 115 HOH HOH D . 
CA 5 HOH 28  528 221 HOH HOH D . 
CA 5 HOH 29  529 126 HOH HOH D . 
CA 5 HOH 30  530 151 HOH HOH D . 
CA 5 HOH 31  531 295 HOH HOH D . 
CA 5 HOH 32  532 138 HOH HOH D . 
CA 5 HOH 33  533 120 HOH HOH D . 
CA 5 HOH 34  534 327 HOH HOH D . 
CA 5 HOH 35  535 34  HOH HOH D . 
CA 5 HOH 36  536 202 HOH HOH D . 
CA 5 HOH 37  537 123 HOH HOH D . 
CA 5 HOH 38  538 184 HOH HOH D . 
CA 5 HOH 39  539 204 HOH HOH D . 
CA 5 HOH 40  540 113 HOH HOH D . 
CA 5 HOH 41  541 103 HOH HOH D . 
CA 5 HOH 42  542 133 HOH HOH D . 
CA 5 HOH 43  543 101 HOH HOH D . 
CA 5 HOH 44  544 118 HOH HOH D . 
CA 5 HOH 45  545 93  HOH HOH D . 
CA 5 HOH 46  546 271 HOH HOH D . 
CA 5 HOH 47  547 200 HOH HOH D . 
CA 5 HOH 48  548 304 HOH HOH D . 
CA 5 HOH 49  549 99  HOH HOH D . 
CA 5 HOH 50  550 108 HOH HOH D . 
CA 5 HOH 51  551 98  HOH HOH D . 
CA 5 HOH 52  552 231 HOH HOH D . 
CA 5 HOH 53  553 127 HOH HOH D . 
CA 5 HOH 54  554 153 HOH HOH D . 
CA 5 HOH 55  555 201 HOH HOH D . 
CA 5 HOH 56  556 213 HOH HOH D . 
CA 5 HOH 57  557 282 HOH HOH D . 
CA 5 HOH 58  558 95  HOH HOH D . 
CA 5 HOH 59  559 111 HOH HOH D . 
CA 5 HOH 60  560 270 HOH HOH D . 
CA 5 HOH 61  561 179 HOH HOH D . 
CA 5 HOH 62  562 182 HOH HOH D . 
CA 5 HOH 63  563 185 HOH HOH D . 
CA 5 HOH 64  564 214 HOH HOH D . 
CA 5 HOH 65  565 97  HOH HOH D . 
CA 5 HOH 66  566 119 HOH HOH D . 
CA 5 HOH 67  567 157 HOH HOH D . 
CA 5 HOH 68  568 104 HOH HOH D . 
CA 5 HOH 69  569 128 HOH HOH D . 
CA 5 HOH 70  570 245 HOH HOH D . 
CA 5 HOH 71  571 228 HOH HOH D . 
CA 5 HOH 72  572 102 HOH HOH D . 
CA 5 HOH 73  573 286 HOH HOH D . 
CA 5 HOH 74  574 197 HOH HOH D . 
CA 5 HOH 75  575 211 HOH HOH D . 
CA 5 HOH 76  576 306 HOH HOH D . 
CA 5 HOH 77  577 196 HOH HOH D . 
CA 5 HOH 78  578 160 HOH HOH D . 
CA 5 HOH 79  579 114 HOH HOH D . 
CA 5 HOH 80  580 154 HOH HOH D . 
CA 5 HOH 81  581 208 HOH HOH D . 
CA 5 HOH 82  582 309 HOH HOH D . 
CA 5 HOH 83  583 266 HOH HOH D . 
CA 5 HOH 84  584 188 HOH HOH D . 
CA 5 HOH 85  585 158 HOH HOH D . 
CA 5 HOH 86  586 121 HOH HOH D . 
CA 5 HOH 87  587 180 HOH HOH D . 
CA 5 HOH 88  588 192 HOH HOH D . 
CA 5 HOH 89  589 199 HOH HOH D . 
CA 5 HOH 90  590 217 HOH HOH D . 
CA 5 HOH 91  591 296 HOH HOH D . 
CA 5 HOH 92  592 263 HOH HOH D . 
CA 5 HOH 93  593 224 HOH HOH D . 
CA 5 HOH 94  594 212 HOH HOH D . 
CA 5 HOH 95  595 311 HOH HOH D . 
CA 5 HOH 96  596 174 HOH HOH D . 
CA 5 HOH 97  597 236 HOH HOH D . 
CA 5 HOH 98  598 310 HOH HOH D . 
CA 5 HOH 99  599 223 HOH HOH D . 
CA 5 HOH 100 600 264 HOH HOH D . 
CA 5 HOH 101 601 235 HOH HOH D . 
CA 5 HOH 102 602 308 HOH HOH D . 
CA 5 HOH 103 603 189 HOH HOH D . 
CA 5 HOH 104 604 314 HOH HOH D . 
CA 5 HOH 105 605 315 HOH HOH D . 
CA 5 HOH 106 606 241 HOH HOH D . 
CA 5 HOH 107 607 143 HOH HOH D . 
CA 5 HOH 108 608 54  HOH HOH D . 
CA 5 HOH 109 609 243 HOH HOH D . 
CA 5 HOH 110 610 238 HOH HOH D . 
CA 5 HOH 111 611 146 HOH HOH D . 
CA 5 HOH 112 612 84  HOH HOH D . 
CA 5 HOH 113 613 49  HOH HOH D . 
CA 5 HOH 114 614 237 HOH HOH D . 
CA 5 HOH 115 615 244 HOH HOH D . 
CA 5 HOH 116 616 305 HOH HOH D . 
CA 5 HOH 117 617 165 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10720 ? 
1 MORE         -210  ? 
1 'SSA (A^2)'  29480 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-01-17 
2 'Structure model' 1 1 2018-02-14 
3 'Structure model' 1 2 2018-02-21 
4 'Structure model' 1 3 2018-04-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Data collection'     
4 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 4 'Structure model' citation        
5 4 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.pdbx_database_id_DOI'    
7  2 'Structure model' '_citation.title'                   
8  2 'Structure model' '_citation.year'                    
9  3 'Structure model' '_citation.journal_abbrev'          
10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 3 'Structure model' '_citation.title'                   
12 4 'Structure model' '_citation.journal_volume'          
13 4 'Structure model' '_citation.page_first'              
14 4 'Structure model' '_citation.page_last'               
15 4 'Structure model' '_citation.title'                   
16 4 'Structure model' '_citation_author.name'             
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0135 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   D 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    281 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   D 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    501 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.85 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 155 ? ? -110.18 57.88  
2 1 ARG A 156 ? ? 48.73   28.47  
3 1 GLU B 157 ? ? 177.53  161.17 
4 1 TYR C 243 ? ? -125.55 -59.77 
5 1 GLU C 344 ? ? -140.07 56.39  
6 1 TYR D 243 ? ? -126.47 -59.56 
7 1 ASP D 304 ? ? -83.13  47.30  
8 1 MET D 305 ? ? -155.07 39.09  
9 1 SER D 312 ? ? -98.27  30.98  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 96  ? A ALA 1   
2  1 Y 1 A ARG 97  ? A ARG 2   
3  1 Y 1 A LEU 98  ? A LEU 3   
4  1 Y 1 A GLY 99  ? A GLY 4   
5  1 Y 1 B ALA 96  ? B ALA 1   
6  1 Y 1 B ARG 97  ? B ARG 2   
7  1 Y 1 B LEU 98  ? B LEU 3   
8  1 Y 1 B GLY 99  ? B GLY 4   
9  1 Y 1 C GLY 147 ? C GLY 1   
10 1 Y 1 C THR 148 ? C THR 2   
11 1 Y 1 C GLY 149 ? C GLY 3   
12 1 Y 1 C ALA 150 ? C ALA 4   
13 1 Y 1 C ASP 151 ? C ASP 5   
14 1 Y 1 C PRO 152 ? C PRO 6   
15 1 Y 1 C VAL 153 ? C VAL 7   
16 1 Y 1 C VAL 154 ? C VAL 8   
17 1 Y 1 C SER 155 ? C SER 9   
18 1 Y 1 C ALA 156 ? C ALA 10  
19 1 Y 1 C LYS 157 ? C LYS 11  
20 1 Y 1 C SER 158 ? C SER 12  
21 1 Y 1 C ASN 357 ? C ASN 211 
22 1 Y 1 C GLY 358 ? C GLY 212 
23 1 Y 1 C THR 359 ? C THR 213 
24 1 Y 1 C ASP 360 ? C ASP 214 
25 1 Y 1 C VAL 361 ? C VAL 215 
26 1 Y 1 C ASN 362 ? C ASN 216 
27 1 Y 1 D GLY 147 ? D GLY 1   
28 1 Y 1 D THR 148 ? D THR 2   
29 1 Y 1 D GLY 149 ? D GLY 3   
30 1 Y 1 D ALA 150 ? D ALA 4   
31 1 Y 1 D ASP 151 ? D ASP 5   
32 1 Y 1 D PRO 152 ? D PRO 6   
33 1 Y 1 D VAL 153 ? D VAL 7   
34 1 Y 1 D VAL 154 ? D VAL 8   
35 1 Y 1 D SER 155 ? D SER 9   
36 1 Y 1 D ALA 156 ? D ALA 10  
37 1 Y 1 D LYS 157 ? D LYS 11  
38 1 Y 1 D SER 158 ? D SER 12  
39 1 Y 1 D ASN 357 ? D ASN 211 
40 1 Y 1 D GLY 358 ? D GLY 212 
41 1 Y 1 D THR 359 ? D THR 213 
42 1 Y 1 D ASP 360 ? D ASP 214 
43 1 Y 1 D VAL 361 ? D VAL 215 
44 1 Y 1 D ASN 362 ? D ASN 216 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 GLYCEROL      GOL 
5 water         HOH 
#