data_5MR9
# 
_entry.id   5MR9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MR9         
WWPDB D_1200002886 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MR9 
_pdbx_database_status.recvd_initial_deposition_date   2016-12-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sandmark, J.' 1 ? 
'Oster, L.'    2 ? 
'Aagaard, A.'  3 ? 
'Roth, R.G.'   4 ? 
'Dahl, G.'     5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure and biophysical characterisation of the human complex - a role for heparan sulfate' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sandmark, J.'        1  ? 
primary 'Dahl, G.'            2  ? 
primary 'Oster, L.'           3  ? 
primary 'Xu, B.'              4  ? 
primary 'Johansson, P.'       5  ? 
primary 'Akerud, T.'          6  ? 
primary 'Aagaard, A.'         7  ? 
primary 'Davidsson, P.'       8  ? 
primary 'Sorhede-Winzell, M.' 9  ? 
primary 'Rainey, G.J.'        10 ? 
primary 'Roth, R.G.'          11 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   107.06 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MR9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     58.080 
_cell.length_a_esd                 ? 
_cell.length_b                     32.750 
_cell.length_b_esd                 ? 
_cell.length_c                     61.910 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MR9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                3 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Neurturin 11706.406 2  ? ? ? ? 
2 water   nat water     18.015    34 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   LEU n 
1 4   GLY n 
1 5   ALA n 
1 6   ARG n 
1 7   PRO n 
1 8   CYS n 
1 9   GLY n 
1 10  LEU n 
1 11  ARG n 
1 12  GLU n 
1 13  LEU n 
1 14  GLU n 
1 15  VAL n 
1 16  ARG n 
1 17  VAL n 
1 18  SER n 
1 19  GLU n 
1 20  LEU n 
1 21  GLY n 
1 22  LEU n 
1 23  GLY n 
1 24  TYR n 
1 25  ALA n 
1 26  SER n 
1 27  ASP n 
1 28  GLU n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  PHE n 
1 33  ARG n 
1 34  TYR n 
1 35  CYS n 
1 36  ALA n 
1 37  GLY n 
1 38  ALA n 
1 39  CYS n 
1 40  GLU n 
1 41  ALA n 
1 42  ALA n 
1 43  ALA n 
1 44  ARG n 
1 45  VAL n 
1 46  TYR n 
1 47  ASP n 
1 48  LEU n 
1 49  GLY n 
1 50  LEU n 
1 51  ARG n 
1 52  ARG n 
1 53  LEU n 
1 54  ARG n 
1 55  GLN n 
1 56  ARG n 
1 57  ARG n 
1 58  ARG n 
1 59  LEU n 
1 60  ARG n 
1 61  ARG n 
1 62  GLU n 
1 63  ARG n 
1 64  VAL n 
1 65  ARG n 
1 66  ALA n 
1 67  GLN n 
1 68  PRO n 
1 69  CYS n 
1 70  CYS n 
1 71  ARG n 
1 72  PRO n 
1 73  THR n 
1 74  ALA n 
1 75  TYR n 
1 76  GLU n 
1 77  ASP n 
1 78  GLU n 
1 79  VAL n 
1 80  SER n 
1 81  PHE n 
1 82  LEU n 
1 83  ASP n 
1 84  ALA n 
1 85  HIS n 
1 86  SER n 
1 87  ARG n 
1 88  TYR n 
1 89  HIS n 
1 90  THR n 
1 91  VAL n 
1 92  HIS n 
1 93  GLU n 
1 94  LEU n 
1 95  SER n 
1 96  ALA n 
1 97  ARG n 
1 98  GLU n 
1 99  CYS n 
1 100 ALA n 
1 101 CYS n 
1 102 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   102 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 NRTN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NRTN_HUMAN 
_struct_ref.pdbx_db_accession          Q99748 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
_struct_ref.pdbx_align_begin           96 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5MR9 A 1 ? 102 ? Q99748 96 ? 197 ? 96 197 
2 1 5MR9 B 1 ? 102 ? Q99748 96 ? 197 ? 96 197 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MR9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.45 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.74 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              10.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '40% MPD and 100 mM CAPS pH 10.5.' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 4' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-09-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.992 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.992 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            55.40 
_reflns.entry_id                         5MR9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.4 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       8997 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            8.3341 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -3.3731 
_refine.aniso_B[2][2]                            -3.1199 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -5.2142 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               50.97 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.9074 
_refine.correlation_coeff_Fo_to_Fc_free          0.8848 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MR9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.40 
_refine.ls_d_res_low                             48.15 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     8996 
_refine.ls_number_reflns_R_free                  427 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.81 
_refine.ls_percent_reflns_R_free                 4.75 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2500 
_refine.ls_R_factor_R_free                       0.2885 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2480 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.296 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.294 
_refine.pdbx_overall_SU_R_Blow_DPI               0.507 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.498 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1627 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               1661 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        48.15 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008 ? 1661 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.06  ? 2242 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 618  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 34   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 264  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1661 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 2.44  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 23.33 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 197  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1710 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.68 
_refine_ls_shell.number_reflns_all                2538 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_R_work             2408 
_refine_ls_shell.percent_reflns_obs               99.81 
_refine_ls_shell.percent_reflns_R_free            5.12 
_refine_ls_shell.R_factor_all                     0.3688 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3728 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.3686 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   5 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5MR9 
_struct.title                        'Ligand-receptor complex.' 
_struct.pdbx_descriptor              'Neurturin, GDNF family receptor alpha-2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MR9 
_struct_keywords.text            'Complex, Signalling, Receptor, signaling protein' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 18 ? GLY A 21 ? SER A 113 GLY A 116 5 ? 4  
HELX_P HELX_P2 AA2 ARG A 44 ? ARG A 56 ? ARG A 139 ARG A 151 1 ? 13 
HELX_P HELX_P3 AA3 SER B 18 ? GLY B 21 ? SER B 113 GLY B 116 5 ? 4  
HELX_P HELX_P4 AA4 ARG B 44 ? ARG B 56 ? ARG B 139 ARG B 151 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 70  SG ? ? A CYS 103 A CYS 165 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 130 A CYS 194 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf3 disulf ? ? B CYS 8  SG ? ? ? 1_555 B CYS 70  SG ? ? B CYS 103 B CYS 165 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf4 disulf ? ? B CYS 35 SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 130 B CYS 194 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf5 disulf ? ? B CYS 39 SG ? ? ? 1_555 B CYS 101 SG ? ? B CYS 134 B CYS 196 1_555 ? ? ? ? ? ? ? 2.043 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           41 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            136 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ALA 
_struct_mon_prot_cis.pdbx_label_seq_id_2    42 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ALA 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     137 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 9  ? ARG A 16  ? GLY A 104 ARG A 111 
AA1 2 THR A 29 ? ALA A 36  ? THR A 124 ALA A 131 
AA2 1 CYS A 70 ? TYR A 75  ? CYS A 165 TYR A 170 
AA2 2 ALA A 96 ? CYS A 101 ? ALA A 191 CYS A 196 
AA3 1 VAL A 79 ? LEU A 82  ? VAL A 174 LEU A 177 
AA3 2 TYR A 88 ? VAL A 91  ? TYR A 183 VAL A 186 
AA4 1 GLY B 9  ? ARG B 16  ? GLY B 104 ARG B 111 
AA4 2 THR B 29 ? ALA B 36  ? THR B 124 ALA B 131 
AA5 1 CYS B 70 ? TYR B 75  ? CYS B 165 TYR B 170 
AA5 2 ALA B 96 ? CYS B 101 ? ALA B 191 CYS B 196 
AA6 1 GLU B 78 ? LEU B 82  ? GLU B 173 LEU B 177 
AA6 2 TYR B 88 ? HIS B 92  ? TYR B 183 HIS B 187 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 13 ? N LEU A 108 O PHE A 32 ? O PHE A 127 
AA2 1 2 N ALA A 74 ? N ALA A 169 O ARG A 97 ? O ARG A 192 
AA3 1 2 N PHE A 81 ? N PHE A 176 O HIS A 89 ? O HIS A 184 
AA4 1 2 N LEU B 13 ? N LEU B 108 O PHE B 32 ? O PHE B 127 
AA5 1 2 N ALA B 74 ? N ALA B 169 O ARG B 97 ? O ARG B 192 
AA6 1 2 N VAL B 79 ? N VAL B 174 O VAL B 91 ? O VAL B 186 
# 
_atom_sites.entry_id                    5MR9 
_atom_sites.fract_transf_matrix[1][1]   0.017218 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005284 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.030534 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016896 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A 1 4   ? 31.826  -8.339  14.769  1.00 65.03  ? 99  GLY A N   1 
ATOM   2    C CA  . GLY A 1 4   ? 30.529  -8.863  15.180  1.00 64.65  ? 99  GLY A CA  1 
ATOM   3    C C   . GLY A 1 4   ? 29.533  -7.814  15.642  1.00 67.35  ? 99  GLY A C   1 
ATOM   4    O O   . GLY A 1 4   ? 29.929  -6.750  16.133  1.00 67.29  ? 99  GLY A O   1 
ATOM   5    N N   . ALA A 1 5   ? 28.222  -8.140  15.513  1.00 62.13  ? 100 ALA A N   1 
ATOM   6    C CA  . ALA A 1 5   ? 27.066  -7.294  15.848  1.00 61.17  ? 100 ALA A CA  1 
ATOM   7    C C   . ALA A 1 5   ? 27.163  -5.911  15.170  1.00 61.00  ? 100 ALA A C   1 
ATOM   8    O O   . ALA A 1 5   ? 27.087  -4.865  15.829  1.00 60.79  ? 100 ALA A O   1 
ATOM   9    C CB  . ALA A 1 5   ? 26.889  -7.179  17.363  1.00 62.02  ? 100 ALA A CB  1 
ATOM   10   N N   . ARG A 1 6   ? 27.365  -5.927  13.837  1.00 54.13  ? 101 ARG A N   1 
ATOM   11   C CA  . ARG A 1 6   ? 27.489  -4.720  13.006  1.00 52.32  ? 101 ARG A CA  1 
ATOM   12   C C   . ARG A 1 6   ? 26.147  -3.967  12.746  1.00 52.90  ? 101 ARG A C   1 
ATOM   13   O O   . ARG A 1 6   ? 25.083  -4.591  12.884  1.00 52.44  ? 101 ARG A O   1 
ATOM   14   C CB  . ARG A 1 6   ? 28.312  -4.989  11.713  1.00 50.76  ? 101 ARG A CB  1 
ATOM   15   C CG  . ARG A 1 6   ? 28.062  -6.315  11.005  1.00 55.51  ? 101 ARG A CG  1 
ATOM   16   C CD  . ARG A 1 6   ? 29.161  -6.652  10.010  1.00 54.25  ? 101 ARG A CD  1 
ATOM   17   N NE  . ARG A 1 6   ? 29.154  -5.777  8.833   1.00 50.42  ? 101 ARG A NE  1 
ATOM   18   C CZ  . ARG A 1 6   ? 28.921  -6.181  7.587   1.00 55.90  ? 101 ARG A CZ  1 
ATOM   19   N NH1 . ARG A 1 6   ? 28.665  -7.461  7.335   1.00 43.96  ? 101 ARG A NH1 1 
ATOM   20   N NH2 . ARG A 1 6   ? 28.942  -5.315  6.585   1.00 36.01  ? 101 ARG A NH2 1 
ATOM   21   N N   . PRO A 1 7   ? 26.168  -2.641  12.423  1.00 46.12  ? 102 PRO A N   1 
ATOM   22   C CA  . PRO A 1 7   ? 24.905  -1.917  12.202  1.00 44.86  ? 102 PRO A CA  1 
ATOM   23   C C   . PRO A 1 7   ? 24.143  -2.315  10.939  1.00 46.22  ? 102 PRO A C   1 
ATOM   24   O O   . PRO A 1 7   ? 24.693  -2.986  10.074  1.00 45.53  ? 102 PRO A O   1 
ATOM   25   C CB  . PRO A 1 7   ? 25.348  -0.449  12.137  1.00 46.64  ? 102 PRO A CB  1 
ATOM   26   C CG  . PRO A 1 7   ? 26.735  -0.517  11.589  1.00 50.71  ? 102 PRO A CG  1 
ATOM   27   C CD  . PRO A 1 7   ? 27.323  -1.735  12.254  1.00 46.51  ? 102 PRO A CD  1 
ATOM   28   N N   . CYS A 1 8   ? 22.873  -1.865  10.846  1.00 41.19  ? 103 CYS A N   1 
ATOM   29   C CA  . CYS A 1 8   ? 21.967  -2.112  9.724   1.00 40.06  ? 103 CYS A CA  1 
ATOM   30   C C   . CYS A 1 8   ? 22.575  -1.563  8.420   1.00 40.99  ? 103 CYS A C   1 
ATOM   31   O O   . CYS A 1 8   ? 22.974  -0.401  8.360   1.00 40.43  ? 103 CYS A O   1 
ATOM   32   C CB  . CYS A 1 8   ? 20.584  -1.530  10.012  1.00 40.42  ? 103 CYS A CB  1 
ATOM   33   S SG  . CYS A 1 8   ? 19.408  -1.689  8.644   1.00 44.44  ? 103 CYS A SG  1 
ATOM   34   N N   . GLY A 1 9   ? 22.712  -2.427  7.430   1.00 36.21  ? 104 GLY A N   1 
ATOM   35   C CA  . GLY A 1 9   ? 23.271  -2.064  6.138   1.00 35.65  ? 104 GLY A CA  1 
ATOM   36   C C   . GLY A 1 9   ? 23.073  -3.115  5.077   1.00 38.63  ? 104 GLY A C   1 
ATOM   37   O O   . GLY A 1 9   ? 22.544  -4.193  5.348   1.00 38.19  ? 104 GLY A O   1 
ATOM   38   N N   . LEU A 1 10  ? 23.505  -2.788  3.854   1.00 35.44  ? 105 LEU A N   1 
ATOM   39   C CA  . LEU A 1 10  ? 23.418  -3.651  2.681   1.00 35.48  ? 105 LEU A CA  1 
ATOM   40   C C   . LEU A 1 10  ? 24.394  -4.802  2.750   1.00 37.99  ? 105 LEU A C   1 
ATOM   41   O O   . LEU A 1 10  ? 25.549  -4.613  3.131   1.00 38.10  ? 105 LEU A O   1 
ATOM   42   C CB  . LEU A 1 10  ? 23.666  -2.841  1.404   1.00 35.96  ? 105 LEU A CB  1 
ATOM   43   C CG  . LEU A 1 10  ? 22.439  -2.229  0.741   1.00 41.86  ? 105 LEU A CG  1 
ATOM   44   C CD1 . LEU A 1 10  ? 22.857  -1.159  -0.249  1.00 44.99  ? 105 LEU A CD1 1 
ATOM   45   C CD2 . LEU A 1 10  ? 21.586  -3.302  0.034   1.00 42.13  ? 105 LEU A CD2 1 
ATOM   46   N N   . ARG A 1 11  ? 23.925  -5.994  2.365   1.00 33.33  ? 106 ARG A N   1 
ATOM   47   C CA  . ARG A 1 11  ? 24.683  -7.242  2.348   1.00 32.63  ? 106 ARG A CA  1 
ATOM   48   C C   . ARG A 1 11  ? 24.532  -7.910  0.988   1.00 37.23  ? 106 ARG A C   1 
ATOM   49   O O   . ARG A 1 11  ? 23.475  -7.848  0.375   1.00 36.31  ? 106 ARG A O   1 
ATOM   50   C CB  . ARG A 1 11  ? 24.176  -8.182  3.456   1.00 31.22  ? 106 ARG A CB  1 
ATOM   51   C CG  . ARG A 1 11  ? 24.980  -8.261  4.758   1.00 34.33  ? 106 ARG A CG  1 
ATOM   52   C CD  . ARG A 1 11  ? 25.429  -6.916  5.275   1.00 37.51  ? 106 ARG A CD  1 
ATOM   53   N NE  . ARG A 1 11  ? 25.323  -6.755  6.724   1.00 38.62  ? 106 ARG A NE  1 
ATOM   54   C CZ  . ARG A 1 11  ? 25.516  -5.595  7.342   1.00 41.74  ? 106 ARG A CZ  1 
ATOM   55   N NH1 . ARG A 1 11  ? 25.406  -5.516  8.657   1.00 25.31  ? 106 ARG A NH1 1 
ATOM   56   N NH2 . ARG A 1 11  ? 25.836  -4.511  6.653   1.00 33.98  ? 106 ARG A NH2 1 
ATOM   57   N N   . GLU A 1 12  ? 25.606  -8.532  0.524   1.00 35.81  ? 107 GLU A N   1 
ATOM   58   C CA  . GLU A 1 12  ? 25.702  -9.206  -0.763  1.00 36.49  ? 107 GLU A CA  1 
ATOM   59   C C   . GLU A 1 12  ? 25.991  -10.681 -0.550  1.00 40.20  ? 107 GLU A C   1 
ATOM   60   O O   . GLU A 1 12  ? 26.716  -11.049 0.379   1.00 39.56  ? 107 GLU A O   1 
ATOM   61   C CB  . GLU A 1 12  ? 26.852  -8.597  -1.576  1.00 38.18  ? 107 GLU A CB  1 
ATOM   62   C CG  . GLU A 1 12  ? 26.419  -7.589  -2.621  1.00 50.96  ? 107 GLU A CG  1 
ATOM   63   C CD  . GLU A 1 12  ? 27.516  -6.727  -3.222  1.00 74.04  ? 107 GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 12  ? 27.193  -5.609  -3.687  1.00 69.64  ? 107 GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 12  ? 28.692  -7.161  -3.232  1.00 72.14  ? 107 GLU A OE2 1 
ATOM   66   N N   . LEU A 1 13  ? 25.436  -11.521 -1.432  1.00 37.12  ? 108 LEU A N   1 
ATOM   67   C CA  . LEU A 1 13  ? 25.625  -12.967 -1.440  1.00 37.07  ? 108 LEU A CA  1 
ATOM   68   C C   . LEU A 1 13  ? 25.266  -13.496 -2.812  1.00 41.73  ? 108 LEU A C   1 
ATOM   69   O O   . LEU A 1 13  ? 24.201  -13.178 -3.342  1.00 40.86  ? 108 LEU A O   1 
ATOM   70   C CB  . LEU A 1 13  ? 24.773  -13.662 -0.345  1.00 37.19  ? 108 LEU A CB  1 
ATOM   71   C CG  . LEU A 1 13  ? 24.875  -15.199 -0.236  1.00 41.97  ? 108 LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 13  ? 26.255  -15.650 0.250   1.00 41.82  ? 108 LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 13  ? 23.808  -15.737 0.683   1.00 44.49  ? 108 LEU A CD2 1 
ATOM   74   N N   . GLU A 1 14  ? 26.171  -14.286 -3.393  1.00 40.05  ? 109 GLU A N   1 
ATOM   75   C CA  . GLU A 1 14  ? 25.963  -14.941 -4.677  1.00 40.47  ? 109 GLU A CA  1 
ATOM   76   C C   . GLU A 1 14  ? 25.136  -16.197 -4.377  1.00 45.37  ? 109 GLU A C   1 
ATOM   77   O O   . GLU A 1 14  ? 25.507  -16.977 -3.493  1.00 45.51  ? 109 GLU A O   1 
ATOM   78   C CB  . GLU A 1 14  ? 27.314  -15.268 -5.346  1.00 42.00  ? 109 GLU A CB  1 
ATOM   79   C CG  . GLU A 1 14  ? 27.288  -16.452 -6.303  1.00 55.39  ? 109 GLU A CG  1 
ATOM   80   C CD  . GLU A 1 14  ? 28.194  -16.348 -7.514  1.00 78.01  ? 109 GLU A CD  1 
ATOM   81   O OE1 . GLU A 1 14  ? 29.117  -17.185 -7.643  1.00 69.87  ? 109 GLU A OE1 1 
ATOM   82   O OE2 . GLU A 1 14  ? 27.934  -15.475 -8.373  1.00 79.52  ? 109 GLU A OE2 1 
ATOM   83   N N   . VAL A 1 15  ? 23.979  -16.343 -5.047  1.00 41.97  ? 110 VAL A N   1 
ATOM   84   C CA  . VAL A 1 15  ? 23.060  -17.477 -4.859  1.00 42.13  ? 110 VAL A CA  1 
ATOM   85   C C   . VAL A 1 15  ? 22.642  -18.077 -6.196  1.00 48.39  ? 110 VAL A C   1 
ATOM   86   O O   . VAL A 1 15  ? 22.624  -17.370 -7.203  1.00 47.35  ? 110 VAL A O   1 
ATOM   87   C CB  . VAL A 1 15  ? 21.792  -17.115 -4.020  1.00 45.88  ? 110 VAL A CB  1 
ATOM   88   C CG1 . VAL A 1 15  ? 22.151  -16.555 -2.654  1.00 45.78  ? 110 VAL A CG1 1 
ATOM   89   C CG2 . VAL A 1 15  ? 20.852  -16.164 -4.764  1.00 45.49  ? 110 VAL A CG2 1 
ATOM   90   N N   . ARG A 1 16  ? 22.236  -19.361 -6.188  1.00 47.38  ? 111 ARG A N   1 
ATOM   91   C CA  . ARG A 1 16  ? 21.650  -20.023 -7.353  1.00 47.81  ? 111 ARG A CA  1 
ATOM   92   C C   . ARG A 1 16  ? 20.193  -19.597 -7.268  1.00 52.30  ? 111 ARG A C   1 
ATOM   93   O O   . ARG A 1 16  ? 19.688  -19.449 -6.152  1.00 51.47  ? 111 ARG A O   1 
ATOM   94   C CB  . ARG A 1 16  ? 21.758  -21.553 -7.237  1.00 48.94  ? 111 ARG A CB  1 
ATOM   95   C CG  . ARG A 1 16  ? 23.141  -22.104 -7.535  1.00 63.10  ? 111 ARG A CG  1 
ATOM   96   C CD  . ARG A 1 16  ? 23.487  -23.313 -6.671  1.00 76.95  ? 111 ARG A CD  1 
ATOM   97   N NE  . ARG A 1 16  ? 23.310  -24.600 -7.350  1.00 86.40  ? 111 ARG A NE  1 
ATOM   98   C CZ  . ARG A 1 16  ? 24.132  -25.096 -8.273  1.00 102.96 ? 111 ARG A CZ  1 
ATOM   99   N NH1 . ARG A 1 16  ? 25.185  -24.389 -8.681  1.00 91.89  ? 111 ARG A NH1 1 
ATOM   100  N NH2 . ARG A 1 16  ? 23.896  -26.279 -8.819  1.00 91.29  ? 111 ARG A NH2 1 
ATOM   101  N N   . VAL A 1 17  ? 19.522  -19.347 -8.407  1.00 50.14  ? 112 VAL A N   1 
ATOM   102  C CA  . VAL A 1 17  ? 18.117  -18.919 -8.368  1.00 50.56  ? 112 VAL A CA  1 
ATOM   103  C C   . VAL A 1 17  ? 17.182  -19.961 -7.697  1.00 55.24  ? 112 VAL A C   1 
ATOM   104  O O   . VAL A 1 17  ? 16.259  -19.584 -6.968  1.00 54.64  ? 112 VAL A O   1 
ATOM   105  C CB  . VAL A 1 17  ? 17.606  -18.316 -9.706  1.00 55.15  ? 112 VAL A CB  1 
ATOM   106  C CG1 . VAL A 1 17  ? 17.334  -19.383 -10.755 1.00 54.93  ? 112 VAL A CG1 1 
ATOM   107  C CG2 . VAL A 1 17  ? 16.382  -17.430 -9.491  1.00 55.00  ? 112 VAL A CG2 1 
ATOM   108  N N   . SER A 1 18  ? 17.495  -21.263 -7.882  1.00 52.71  ? 113 SER A N   1 
ATOM   109  C CA  . SER A 1 18  ? 16.793  -22.415 -7.293  1.00 52.83  ? 113 SER A CA  1 
ATOM   110  C C   . SER A 1 18  ? 16.850  -22.421 -5.756  1.00 58.25  ? 113 SER A C   1 
ATOM   111  O O   . SER A 1 18  ? 15.902  -22.884 -5.114  1.00 58.13  ? 113 SER A O   1 
ATOM   112  C CB  . SER A 1 18  ? 17.360  -23.723 -7.836  1.00 55.39  ? 113 SER A CB  1 
ATOM   113  O OG  . SER A 1 18  ? 18.658  -23.568 -8.386  1.00 63.13  ? 113 SER A OG  1 
ATOM   114  N N   . GLU A 1 19  ? 17.958  -21.901 -5.174  1.00 55.35  ? 114 GLU A N   1 
ATOM   115  C CA  . GLU A 1 19  ? 18.168  -21.807 -3.721  1.00 55.57  ? 114 GLU A CA  1 
ATOM   116  C C   . GLU A 1 19  ? 17.220  -20.793 -3.066  1.00 57.90  ? 114 GLU A C   1 
ATOM   117  O O   . GLU A 1 19  ? 17.039  -20.848 -1.853  1.00 58.08  ? 114 GLU A O   1 
ATOM   118  C CB  . GLU A 1 19  ? 19.618  -21.410 -3.376  1.00 57.24  ? 114 GLU A CB  1 
ATOM   119  C CG  . GLU A 1 19  ? 20.713  -22.383 -3.794  1.00 73.00  ? 114 GLU A CG  1 
ATOM   120  C CD  . GLU A 1 19  ? 20.775  -23.736 -3.108  1.00 99.12  ? 114 GLU A CD  1 
ATOM   121  O OE1 . GLU A 1 19  ? 20.408  -23.832 -1.914  1.00 104.18 ? 114 GLU A OE1 1 
ATOM   122  O OE2 . GLU A 1 19  ? 21.221  -24.701 -3.767  1.00 96.99  ? 114 GLU A OE2 1 
ATOM   123  N N   . LEU A 1 20  ? 16.653  -19.852 -3.843  1.00 52.57  ? 115 LEU A N   1 
ATOM   124  C CA  . LEU A 1 20  ? 15.764  -18.803 -3.325  1.00 51.59  ? 115 LEU A CA  1 
ATOM   125  C C   . LEU A 1 20  ? 14.367  -19.281 -2.924  1.00 56.20  ? 115 LEU A C   1 
ATOM   126  O O   . LEU A 1 20  ? 13.657  -18.562 -2.211  1.00 55.75  ? 115 LEU A O   1 
ATOM   127  C CB  . LEU A 1 20  ? 15.643  -17.627 -4.310  1.00 51.09  ? 115 LEU A CB  1 
ATOM   128  C CG  . LEU A 1 20  ? 16.876  -16.747 -4.537  1.00 54.90  ? 115 LEU A CG  1 
ATOM   129  C CD1 . LEU A 1 20  ? 16.628  -15.776 -5.671  1.00 54.95  ? 115 LEU A CD1 1 
ATOM   130  C CD2 . LEU A 1 20  ? 17.259  -15.972 -3.282  1.00 56.09  ? 115 LEU A CD2 1 
ATOM   131  N N   . GLY A 1 21  ? 13.968  -20.453 -3.410  1.00 53.27  ? 116 GLY A N   1 
ATOM   132  C CA  . GLY A 1 21  ? 12.645  -21.000 -3.137  1.00 53.14  ? 116 GLY A CA  1 
ATOM   133  C C   . GLY A 1 21  ? 11.546  -20.192 -3.793  1.00 57.02  ? 116 GLY A C   1 
ATOM   134  O O   . GLY A 1 21  ? 10.486  -19.987 -3.198  1.00 56.31  ? 116 GLY A O   1 
ATOM   135  N N   . LEU A 1 22  ? 11.821  -19.698 -5.012  1.00 54.19  ? 117 LEU A N   1 
ATOM   136  C CA  . LEU A 1 22  ? 10.899  -18.906 -5.824  1.00 54.11  ? 117 LEU A CA  1 
ATOM   137  C C   . LEU A 1 22  ? 10.198  -19.757 -6.895  1.00 59.54  ? 117 LEU A C   1 
ATOM   138  O O   . LEU A 1 22  ? 9.350   -19.249 -7.635  1.00 58.97  ? 117 LEU A O   1 
ATOM   139  C CB  . LEU A 1 22  ? 11.641  -17.722 -6.480  1.00 53.98  ? 117 LEU A CB  1 
ATOM   140  C CG  . LEU A 1 22  ? 12.029  -16.531 -5.589  1.00 57.86  ? 117 LEU A CG  1 
ATOM   141  C CD1 . LEU A 1 22  ? 12.455  -15.349 -6.441  1.00 57.79  ? 117 LEU A CD1 1 
ATOM   142  C CD2 . LEU A 1 22  ? 10.882  -16.096 -4.690  1.00 58.64  ? 117 LEU A CD2 1 
ATOM   143  N N   . GLY A 1 23  ? 10.558  -21.036 -6.964  1.00 57.36  ? 118 GLY A N   1 
ATOM   144  C CA  . GLY A 1 23  ? 9.989   -21.974 -7.923  1.00 57.60  ? 118 GLY A CA  1 
ATOM   145  C C   . GLY A 1 23  ? 10.679  -21.990 -9.273  1.00 62.04  ? 118 GLY A C   1 
ATOM   146  O O   . GLY A 1 23  ? 10.108  -22.491 -10.246 1.00 61.84  ? 118 GLY A O   1 
ATOM   147  N N   . TYR A 1 24  ? 11.916  -21.450 -9.341  1.00 58.41  ? 119 TYR A N   1 
ATOM   148  C CA  . TYR A 1 24  ? 12.716  -21.414 -10.565 1.00 57.93  ? 119 TYR A CA  1 
ATOM   149  C C   . TYR A 1 24  ? 13.660  -22.606 -10.665 1.00 62.25  ? 119 TYR A C   1 
ATOM   150  O O   . TYR A 1 24  ? 14.376  -22.927 -9.712  1.00 61.28  ? 119 TYR A O   1 
ATOM   151  C CB  . TYR A 1 24  ? 13.459  -20.073 -10.728 1.00 58.79  ? 119 TYR A CB  1 
ATOM   152  C CG  . TYR A 1 24  ? 12.534  -18.909 -11.011 1.00 59.66  ? 119 TYR A CG  1 
ATOM   153  C CD1 . TYR A 1 24  ? 11.788  -18.849 -12.181 1.00 61.47  ? 119 TYR A CD1 1 
ATOM   154  C CD2 . TYR A 1 24  ? 12.427  -17.849 -10.113 1.00 60.11  ? 119 TYR A CD2 1 
ATOM   155  C CE1 . TYR A 1 24  ? 10.918  -17.793 -12.434 1.00 62.20  ? 119 TYR A CE1 1 
ATOM   156  C CE2 . TYR A 1 24  ? 11.564  -16.782 -10.356 1.00 60.77  ? 119 TYR A CE2 1 
ATOM   157  C CZ  . TYR A 1 24  ? 10.816  -16.756 -11.522 1.00 67.78  ? 119 TYR A CZ  1 
ATOM   158  O OH  . TYR A 1 24  ? 9.967   -15.707 -11.775 1.00 68.14  ? 119 TYR A OH  1 
ATOM   159  N N   . ALA A 1 25  ? 13.639  -23.269 -11.830 1.00 59.72  ? 120 ALA A N   1 
ATOM   160  C CA  . ALA A 1 25  ? 14.430  -24.463 -12.130 1.00 59.72  ? 120 ALA A CA  1 
ATOM   161  C C   . ALA A 1 25  ? 15.907  -24.166 -12.356 1.00 63.21  ? 120 ALA A C   1 
ATOM   162  O O   . ALA A 1 25  ? 16.753  -24.998 -12.007 1.00 62.23  ? 120 ALA A O   1 
ATOM   163  C CB  . ALA A 1 25  ? 13.854  -25.166 -13.350 1.00 60.69  ? 120 ALA A CB  1 
ATOM   164  N N   . SER A 1 26  ? 16.215  -23.000 -12.970 1.00 59.91  ? 121 SER A N   1 
ATOM   165  C CA  . SER A 1 26  ? 17.573  -22.554 -13.303 1.00 59.74  ? 121 SER A CA  1 
ATOM   166  C C   . SER A 1 26  ? 18.566  -22.665 -12.143 1.00 63.73  ? 121 SER A C   1 
ATOM   167  O O   . SER A 1 26  ? 18.195  -22.475 -10.982 1.00 63.56  ? 121 SER A O   1 
ATOM   168  C CB  . SER A 1 26  ? 17.548  -21.131 -13.851 1.00 62.31  ? 121 SER A CB  1 
ATOM   169  O OG  . SER A 1 26  ? 18.844  -20.673 -14.205 1.00 67.07  ? 121 SER A OG  1 
ATOM   170  N N   . ASP A 1 27  ? 19.817  -23.015 -12.466 1.00 59.77  ? 122 ASP A N   1 
ATOM   171  C CA  . ASP A 1 27  ? 20.894  -23.134 -11.483 1.00 59.25  ? 122 ASP A CA  1 
ATOM   172  C C   . ASP A 1 27  ? 21.905  -21.997 -11.653 1.00 60.96  ? 122 ASP A C   1 
ATOM   173  O O   . ASP A 1 27  ? 22.917  -21.947 -10.946 1.00 60.70  ? 122 ASP A O   1 
ATOM   174  C CB  . ASP A 1 27  ? 21.546  -24.533 -11.508 1.00 61.28  ? 122 ASP A CB  1 
ATOM   175  C CG  . ASP A 1 27  ? 20.695  -25.638 -10.892 1.00 73.37  ? 122 ASP A CG  1 
ATOM   176  O OD1 . ASP A 1 27  ? 19.940  -25.348 -9.933  1.00 74.16  ? 122 ASP A OD1 1 
ATOM   177  O OD2 . ASP A 1 27  ? 20.823  -26.801 -11.330 1.00 78.98  ? 122 ASP A OD2 1 
ATOM   178  N N   . GLU A 1 28  ? 21.593  -21.053 -12.569 1.00 55.29  ? 123 GLU A N   1 
ATOM   179  C CA  . GLU A 1 28  ? 22.401  -19.867 -12.829 1.00 54.12  ? 123 GLU A CA  1 
ATOM   180  C C   . GLU A 1 28  ? 22.409  -18.993 -11.582 1.00 55.29  ? 123 GLU A C   1 
ATOM   181  O O   . GLU A 1 28  ? 21.394  -18.887 -10.889 1.00 55.05  ? 123 GLU A O   1 
ATOM   182  C CB  . GLU A 1 28  ? 21.844  -19.069 -14.017 1.00 55.45  ? 123 GLU A CB  1 
ATOM   183  C CG  . GLU A 1 28  ? 22.926  -18.364 -14.821 1.00 64.26  ? 123 GLU A CG  1 
ATOM   184  C CD  . GLU A 1 28  ? 22.525  -17.098 -15.560 1.00 80.58  ? 123 GLU A CD  1 
ATOM   185  O OE1 . GLU A 1 28  ? 21.604  -17.160 -16.408 1.00 71.16  ? 123 GLU A OE1 1 
ATOM   186  O OE2 . GLU A 1 28  ? 23.181  -16.056 -15.342 1.00 76.61  ? 123 GLU A OE2 1 
ATOM   187  N N   . THR A 1 29  ? 23.562  -18.394 -11.289 1.00 49.57  ? 124 THR A N   1 
ATOM   188  C CA  . THR A 1 29  ? 23.720  -17.551 -10.111 1.00 48.24  ? 124 THR A CA  1 
ATOM   189  C C   . THR A 1 29  ? 23.316  -16.107 -10.353 1.00 49.69  ? 124 THR A C   1 
ATOM   190  O O   . THR A 1 29  ? 23.467  -15.590 -11.462 1.00 49.71  ? 124 THR A O   1 
ATOM   191  C CB  . THR A 1 29  ? 25.148  -17.626 -9.534  1.00 54.89  ? 124 THR A CB  1 
ATOM   192  O OG1 . THR A 1 29  ? 26.077  -17.118 -10.488 1.00 52.63  ? 124 THR A OG1 1 
ATOM   193  C CG2 . THR A 1 29  ? 25.541  -19.032 -9.085  1.00 54.73  ? 124 THR A CG2 1 
ATOM   194  N N   . VAL A 1 30  ? 22.828  -15.453 -9.293  1.00 43.95  ? 125 VAL A N   1 
ATOM   195  C CA  . VAL A 1 30  ? 22.476  -14.033 -9.272  1.00 42.64  ? 125 VAL A CA  1 
ATOM   196  C C   . VAL A 1 30  ? 23.050  -13.433 -7.995  1.00 44.39  ? 125 VAL A C   1 
ATOM   197  O O   . VAL A 1 30  ? 23.161  -14.132 -6.985  1.00 43.40  ? 125 VAL A O   1 
ATOM   198  C CB  . VAL A 1 30  ? 20.956  -13.708 -9.423  1.00 46.21  ? 125 VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 30  ? 20.448  -14.016 -10.829 1.00 46.04  ? 125 VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 30  ? 20.102  -14.398 -8.357  1.00 45.92  ? 125 VAL A CG2 1 
ATOM   201  N N   . LEU A 1 31  ? 23.409  -12.146 -8.028  1.00 39.67  ? 126 LEU A N   1 
ATOM   202  C CA  . LEU A 1 31  ? 23.891  -11.485 -6.827  1.00 38.70  ? 126 LEU A CA  1 
ATOM   203  C C   . LEU A 1 31  ? 22.673  -11.019 -6.031  1.00 38.66  ? 126 LEU A C   1 
ATOM   204  O O   . LEU A 1 31  ? 21.853  -10.259 -6.551  1.00 38.99  ? 126 LEU A O   1 
ATOM   205  C CB  . LEU A 1 31  ? 24.847  -10.320 -7.152  1.00 39.07  ? 126 LEU A CB  1 
ATOM   206  C CG  . LEU A 1 31  ? 25.393  -9.541  -5.941  1.00 44.71  ? 126 LEU A CG  1 
ATOM   207  C CD1 . LEU A 1 31  ? 26.277  -10.424 -5.048  1.00 45.17  ? 126 LEU A CD1 1 
ATOM   208  C CD2 . LEU A 1 31  ? 26.147  -8.300  -6.382  1.00 47.71  ? 126 LEU A CD2 1 
ATOM   209  N N   . PHE A 1 32  ? 22.534  -11.516 -4.793  1.00 31.15  ? 127 PHE A N   1 
ATOM   210  C CA  . PHE A 1 32  ? 21.423  -11.181 -3.915  1.00 28.54  ? 127 PHE A CA  1 
ATOM   211  C C   . PHE A 1 32  ? 21.833  -10.185 -2.837  1.00 31.12  ? 127 PHE A C   1 
ATOM   212  O O   . PHE A 1 32  ? 22.749  -10.445 -2.062  1.00 30.52  ? 127 PHE A O   1 
ATOM   213  C CB  . PHE A 1 32  ? 20.810  -12.454 -3.299  1.00 29.65  ? 127 PHE A CB  1 
ATOM   214  C CG  . PHE A 1 32  ? 19.609  -12.212 -2.409  1.00 30.46  ? 127 PHE A CG  1 
ATOM   215  C CD1 . PHE A 1 32  ? 18.381  -11.847 -2.951  1.00 33.55  ? 127 PHE A CD1 1 
ATOM   216  C CD2 . PHE A 1 32  ? 19.717  -12.307 -1.030  1.00 31.77  ? 127 PHE A CD2 1 
ATOM   217  C CE1 . PHE A 1 32  ? 17.276  -11.608 -2.126  1.00 34.38  ? 127 PHE A CE1 1 
ATOM   218  C CE2 . PHE A 1 32  ? 18.610  -12.072 -0.205  1.00 34.78  ? 127 PHE A CE2 1 
ATOM   219  C CZ  . PHE A 1 32  ? 17.396  -11.733 -0.758  1.00 33.08  ? 127 PHE A CZ  1 
ATOM   220  N N   . ARG A 1 33  ? 21.130  -9.054  -2.777  1.00 27.89  ? 128 ARG A N   1 
ATOM   221  C CA  . ARG A 1 33  ? 21.367  -8.005  -1.796  1.00 27.41  ? 128 ARG A CA  1 
ATOM   222  C C   . ARG A 1 33  ? 20.241  -7.911  -0.788  1.00 30.48  ? 128 ARG A C   1 
ATOM   223  O O   . ARG A 1 33  ? 19.068  -8.013  -1.147  1.00 30.20  ? 128 ARG A O   1 
ATOM   224  C CB  . ARG A 1 33  ? 21.635  -6.667  -2.469  1.00 29.72  ? 128 ARG A CB  1 
ATOM   225  C CG  . ARG A 1 33  ? 23.072  -6.509  -2.915  1.00 43.37  ? 128 ARG A CG  1 
ATOM   226  C CD  . ARG A 1 33  ? 23.425  -5.038  -3.037  1.00 56.40  ? 128 ARG A CD  1 
ATOM   227  N NE  . ARG A 1 33  ? 24.268  -4.764  -4.203  1.00 69.06  ? 128 ARG A NE  1 
ATOM   228  C CZ  . ARG A 1 33  ? 23.836  -4.750  -5.462  1.00 83.94  ? 128 ARG A CZ  1 
ATOM   229  N NH1 . ARG A 1 33  ? 22.563  -5.013  -5.739  1.00 72.81  ? 128 ARG A NH1 1 
ATOM   230  N NH2 . ARG A 1 33  ? 24.676  -4.493  -6.454  1.00 72.16  ? 128 ARG A NH2 1 
ATOM   231  N N   . TYR A 1 34  ? 20.602  -7.747  0.485   1.00 26.55  ? 129 TYR A N   1 
ATOM   232  C CA  . TYR A 1 34  ? 19.644  -7.740  1.583   1.00 26.50  ? 129 TYR A CA  1 
ATOM   233  C C   . TYR A 1 34  ? 20.068  -6.856  2.742   1.00 32.40  ? 129 TYR A C   1 
ATOM   234  O O   . TYR A 1 34  ? 21.254  -6.565  2.904   1.00 30.86  ? 129 TYR A O   1 
ATOM   235  C CB  . TYR A 1 34  ? 19.389  -9.195  2.054   1.00 26.94  ? 129 TYR A CB  1 
ATOM   236  C CG  . TYR A 1 34  ? 20.583  -9.899  2.674   1.00 27.51  ? 129 TYR A CG  1 
ATOM   237  C CD1 . TYR A 1 34  ? 20.783  -9.885  4.054   1.00 28.70  ? 129 TYR A CD1 1 
ATOM   238  C CD2 . TYR A 1 34  ? 21.482  -10.613 1.890   1.00 28.03  ? 129 TYR A CD2 1 
ATOM   239  C CE1 . TYR A 1 34  ? 21.859  -10.559 4.635   1.00 28.72  ? 129 TYR A CE1 1 
ATOM   240  C CE2 . TYR A 1 34  ? 22.561  -11.290 2.459   1.00 28.79  ? 129 TYR A CE2 1 
ATOM   241  C CZ  . TYR A 1 34  ? 22.742  -11.265 3.834   1.00 34.83  ? 129 TYR A CZ  1 
ATOM   242  O OH  . TYR A 1 34  ? 23.816  -11.916 4.401   1.00 36.00  ? 129 TYR A OH  1 
ATOM   243  N N   . CYS A 1 35  ? 19.105  -6.483  3.584   1.00 32.73  ? 130 CYS A N   1 
ATOM   244  C CA  . CYS A 1 35  ? 19.312  -5.673  4.776   1.00 35.17  ? 130 CYS A CA  1 
ATOM   245  C C   . CYS A 1 35  ? 19.443  -6.550  6.006   1.00 38.98  ? 130 CYS A C   1 
ATOM   246  O O   . CYS A 1 35  ? 18.612  -7.415  6.249   1.00 37.70  ? 130 CYS A O   1 
ATOM   247  C CB  . CYS A 1 35  ? 18.201  -4.642  4.927   1.00 37.16  ? 130 CYS A CB  1 
ATOM   248  S SG  . CYS A 1 35  ? 17.975  -3.593  3.477   1.00 42.62  ? 130 CYS A SG  1 
ATOM   249  N N   . ALA A 1 36  ? 20.530  -6.319  6.755   1.00 36.83  ? 131 ALA A N   1 
ATOM   250  C CA  . ALA A 1 36  ? 20.876  -7.049  7.982   1.00 36.94  ? 131 ALA A CA  1 
ATOM   251  C C   . ALA A 1 36  ? 21.654  -6.126  8.901   1.00 42.02  ? 131 ALA A C   1 
ATOM   252  O O   . ALA A 1 36  ? 22.334  -5.224  8.413   1.00 41.65  ? 131 ALA A O   1 
ATOM   253  C CB  . ALA A 1 36  ? 21.721  -8.269  7.629   1.00 37.67  ? 131 ALA A CB  1 
ATOM   254  N N   . GLY A 1 37  ? 21.558  -6.356  10.204  1.00 40.60  ? 132 GLY A N   1 
ATOM   255  C CA  . GLY A 1 37  ? 22.288  -5.564  11.184  1.00 41.89  ? 132 GLY A CA  1 
ATOM   256  C C   . GLY A 1 37  ? 21.528  -5.146  12.423  1.00 48.68  ? 132 GLY A C   1 
ATOM   257  O O   . GLY A 1 37  ? 20.441  -5.655  12.700  1.00 47.90  ? 132 GLY A O   1 
ATOM   258  N N   . ALA A 1 38  ? 22.125  -4.211  13.181  1.00 48.18  ? 133 ALA A N   1 
ATOM   259  C CA  . ALA A 1 38  ? 21.609  -3.677  14.441  1.00 48.94  ? 133 ALA A CA  1 
ATOM   260  C C   . ALA A 1 38  ? 21.009  -2.281  14.283  1.00 55.36  ? 133 ALA A C   1 
ATOM   261  O O   . ALA A 1 38  ? 21.492  -1.486  13.478  1.00 54.27  ? 133 ALA A O   1 
ATOM   262  C CB  . ALA A 1 38  ? 22.720  -3.651  15.481  1.00 49.85  ? 133 ALA A CB  1 
ATOM   263  N N   . CYS A 1 39  ? 19.962  -1.987  15.075  1.00 55.10  ? 134 CYS A N   1 
ATOM   264  C CA  . CYS A 1 39  ? 19.260  -0.700  15.081  1.00 56.54  ? 134 CYS A CA  1 
ATOM   265  C C   . CYS A 1 39  ? 19.364  -0.020  16.463  1.00 63.59  ? 134 CYS A C   1 
ATOM   266  O O   . CYS A 1 39  ? 18.341  0.270   17.092  1.00 63.83  ? 134 CYS A O   1 
ATOM   267  C CB  . CYS A 1 39  ? 17.805  -0.876  14.643  1.00 57.00  ? 134 CYS A CB  1 
ATOM   268  S SG  . CYS A 1 39  ? 17.594  -1.713  13.049  1.00 61.01  ? 134 CYS A SG  1 
ATOM   269  N N   . GLU A 1 40  ? 20.604  0.236   16.929  1.00 62.13  ? 135 GLU A N   1 
ATOM   270  C CA  . GLU A 1 40  ? 20.874  0.875   18.229  1.00 62.96  ? 135 GLU A CA  1 
ATOM   271  C C   . GLU A 1 40  ? 21.228  2.369   18.058  1.00 66.90  ? 135 GLU A C   1 
ATOM   272  O O   . GLU A 1 40  ? 22.280  2.821   18.521  1.00 66.64  ? 135 GLU A O   1 
ATOM   273  C CB  . GLU A 1 40  ? 21.994  0.124   18.983  1.00 64.63  ? 135 GLU A CB  1 
ATOM   274  C CG  . GLU A 1 40  ? 21.651  -1.301  19.384  1.00 76.16  ? 135 GLU A CG  1 
ATOM   275  C CD  . GLU A 1 40  ? 22.862  -2.176  19.647  1.00 97.32  ? 135 GLU A CD  1 
ATOM   276  O OE1 . GLU A 1 40  ? 23.002  -2.669  20.789  1.00 95.46  ? 135 GLU A OE1 1 
ATOM   277  O OE2 . GLU A 1 40  ? 23.670  -2.372  18.710  1.00 94.64  ? 135 GLU A OE2 1 
ATOM   278  N N   . ALA A 1 41  ? 20.339  3.128   17.387  1.00 62.63  ? 136 ALA A N   1 
ATOM   279  C CA  . ALA A 1 41  ? 20.521  4.555   17.104  1.00 61.84  ? 136 ALA A CA  1 
ATOM   280  C C   . ALA A 1 41  ? 19.752  5.440   18.103  1.00 64.90  ? 136 ALA A C   1 
ATOM   281  O O   . ALA A 1 41  ? 19.225  6.497   17.724  1.00 65.04  ? 136 ALA A O   1 
ATOM   282  C CB  . ALA A 1 41  ? 20.095  4.853   15.671  1.00 62.59  ? 136 ALA A CB  1 
ATOM   283  N N   . ALA A 1 42  ? 19.744  5.016   19.399  1.00 59.52  ? 137 ALA A N   1 
ATOM   284  C CA  . ALA A 1 42  ? 19.050  5.621   20.555  1.00 57.98  ? 137 ALA A CA  1 
ATOM   285  C C   . ALA A 1 42  ? 17.536  5.603   20.358  1.00 59.20  ? 137 ALA A C   1 
ATOM   286  O O   . ALA A 1 42  ? 17.037  6.011   19.308  1.00 58.59  ? 137 ALA A O   1 
ATOM   287  C CB  . ALA A 1 42  ? 19.552  7.034   20.846  1.00 58.76  ? 137 ALA A CB  1 
ATOM   288  N N   . ALA A 1 43  ? 16.809  5.097   21.356  1.00 53.41  ? 138 ALA A N   1 
ATOM   289  C CA  . ALA A 1 43  ? 15.354  4.979   21.307  1.00 51.79  ? 138 ALA A CA  1 
ATOM   290  C C   . ALA A 1 43  ? 14.655  6.275   20.878  1.00 52.28  ? 138 ALA A C   1 
ATOM   291  O O   . ALA A 1 43  ? 14.952  7.344   21.414  1.00 51.58  ? 138 ALA A O   1 
ATOM   292  C CB  . ALA A 1 43  ? 14.833  4.527   22.653  1.00 52.45  ? 138 ALA A CB  1 
ATOM   293  N N   . ARG A 1 44  ? 13.762  6.174   19.879  1.00 46.02  ? 139 ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? 12.985  7.307   19.390  1.00 44.17  ? 139 ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? 11.939  7.661   20.450  1.00 43.22  ? 139 ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? 11.496  6.775   21.190  1.00 42.69  ? 139 ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? 12.269  6.977   18.074  1.00 44.27  ? 139 ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? 13.166  6.911   16.837  1.00 54.38  ? 139 ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? 12.362  6.836   15.542  1.00 59.82  ? 139 ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? 11.643  8.085   15.272  1.00 60.58  ? 139 ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? 11.811  8.842   14.193  1.00 65.23  ? 139 ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? 11.112  9.956   14.045  1.00 49.13  ? 139 ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? 12.660  8.476   13.242  1.00 54.43  ? 139 ARG A NH2 1 
ATOM   304  N N   . VAL A 1 45  ? 11.548  8.960   20.510  1.00 36.48  ? 140 VAL A N   1 
ATOM   305  C CA  . VAL A 1 45  ? 10.574  9.540   21.458  1.00 34.98  ? 140 VAL A CA  1 
ATOM   306  C C   . VAL A 1 45  ? 9.180   8.850   21.315  1.00 36.22  ? 140 VAL A C   1 
ATOM   307  O O   . VAL A 1 45  ? 8.564   8.464   22.317  1.00 34.89  ? 140 VAL A O   1 
ATOM   308  C CB  . VAL A 1 45  ? 10.597  11.108  21.454  1.00 39.00  ? 140 VAL A CB  1 
ATOM   309  C CG1 . VAL A 1 45  ? 9.496   11.727  20.604  1.00 38.65  ? 140 VAL A CG1 1 
ATOM   310  C CG2 . VAL A 1 45  ? 10.636  11.667  22.872  1.00 38.78  ? 140 VAL A CG2 1 
ATOM   311  N N   . TYR A 1 46  ? 8.842   8.504   20.046  1.00 31.25  ? 141 TYR A N   1 
ATOM   312  C CA  . TYR A 1 46  ? 7.667   7.760   19.611  1.00 30.10  ? 141 TYR A CA  1 
ATOM   313  C C   . TYR A 1 46  ? 7.676   6.326   20.195  1.00 34.61  ? 141 TYR A C   1 
ATOM   314  O O   . TYR A 1 46  ? 6.681   5.909   20.792  1.00 33.40  ? 141 TYR A O   1 
ATOM   315  C CB  . TYR A 1 46  ? 7.610   7.735   18.064  1.00 29.31  ? 141 TYR A CB  1 
ATOM   316  C CG  . TYR A 1 46  ? 6.637   6.703   17.495  1.00 27.84  ? 141 TYR A CG  1 
ATOM   317  C CD1 . TYR A 1 46  ? 5.287   6.994   17.335  1.00 28.04  ? 141 TYR A CD1 1 
ATOM   318  C CD2 . TYR A 1 46  ? 7.085   5.429   17.119  1.00 28.38  ? 141 TYR A CD2 1 
ATOM   319  C CE1 . TYR A 1 46  ? 4.397   6.050   16.834  1.00 27.11  ? 141 TYR A CE1 1 
ATOM   320  C CE2 . TYR A 1 46  ? 6.191   4.468   16.646  1.00 28.89  ? 141 TYR A CE2 1 
ATOM   321  C CZ  . TYR A 1 46  ? 4.858   4.788   16.498  1.00 31.41  ? 141 TYR A CZ  1 
ATOM   322  O OH  . TYR A 1 46  ? 3.996   3.846   16.010  1.00 28.20  ? 141 TYR A OH  1 
ATOM   323  N N   . ASP A 1 47  ? 8.833   5.621   20.066  1.00 32.35  ? 142 ASP A N   1 
ATOM   324  C CA  . ASP A 1 47  ? 9.041   4.252   20.560  1.00 32.61  ? 142 ASP A CA  1 
ATOM   325  C C   . ASP A 1 47  ? 8.928   4.142   22.085  1.00 37.63  ? 142 ASP A C   1 
ATOM   326  O O   . ASP A 1 47  ? 8.292   3.210   22.585  1.00 38.74  ? 142 ASP A O   1 
ATOM   327  C CB  . ASP A 1 47  ? 10.358  3.619   20.024  1.00 34.41  ? 142 ASP A CB  1 
ATOM   328  C CG  . ASP A 1 47  ? 10.315  3.177   18.573  1.00 46.91  ? 142 ASP A CG  1 
ATOM   329  O OD1 . ASP A 1 47  ? 9.213   2.900   18.075  1.00 47.66  ? 142 ASP A OD1 1 
ATOM   330  O OD2 . ASP A 1 47  ? 11.400  3.078   17.946  1.00 54.91  ? 142 ASP A OD2 1 
ATOM   331  N N   . LEU A 1 48  ? 9.516   5.117   22.807  1.00 32.96  ? 143 LEU A N   1 
ATOM   332  C CA  . LEU A 1 48  ? 9.536   5.229   24.275  1.00 32.44  ? 143 LEU A CA  1 
ATOM   333  C C   . LEU A 1 48  ? 8.117   5.406   24.840  1.00 37.09  ? 143 LEU A C   1 
ATOM   334  O O   . LEU A 1 48  ? 7.705   4.680   25.749  1.00 36.44  ? 143 LEU A O   1 
ATOM   335  C CB  . LEU A 1 48  ? 10.474  6.387   24.715  1.00 32.34  ? 143 LEU A CB  1 
ATOM   336  C CG  . LEU A 1 48  ? 11.768  6.022   25.419  1.00 37.05  ? 143 LEU A CG  1 
ATOM   337  C CD1 . LEU A 1 48  ? 12.275  4.624   25.024  1.00 36.84  ? 143 LEU A CD1 1 
ATOM   338  C CD2 . LEU A 1 48  ? 12.848  7.068   25.129  1.00 39.44  ? 143 LEU A CD2 1 
ATOM   339  N N   . GLY A 1 49  ? 7.395   6.371   24.266  1.00 34.99  ? 144 GLY A N   1 
ATOM   340  C CA  . GLY A 1 49  ? 6.006   6.690   24.580  1.00 35.01  ? 144 GLY A CA  1 
ATOM   341  C C   . GLY A 1 49  ? 5.086   5.499   24.359  1.00 39.38  ? 144 GLY A C   1 
ATOM   342  O O   . GLY A 1 49  ? 4.244   5.184   25.204  1.00 38.22  ? 144 GLY A O   1 
ATOM   343  N N   . LEU A 1 50  ? 5.297   4.790   23.230  1.00 37.70  ? 145 LEU A N   1 
ATOM   344  C CA  . LEU A 1 50  ? 4.573   3.573   22.816  1.00 37.92  ? 145 LEU A CA  1 
ATOM   345  C C   . LEU A 1 50  ? 4.770   2.374   23.762  1.00 43.33  ? 145 LEU A C   1 
ATOM   346  O O   . LEU A 1 50  ? 3.782   1.720   24.093  1.00 43.44  ? 145 LEU A O   1 
ATOM   347  C CB  . LEU A 1 50  ? 4.898   3.194   21.355  1.00 37.95  ? 145 LEU A CB  1 
ATOM   348  C CG  . LEU A 1 50  ? 3.907   2.353   20.565  1.00 42.51  ? 145 LEU A CG  1 
ATOM   349  C CD1 . LEU A 1 50  ? 2.489   2.923   20.618  1.00 42.88  ? 145 LEU A CD1 1 
ATOM   350  C CD2 . LEU A 1 50  ? 4.311   2.332   19.120  1.00 44.17  ? 145 LEU A CD2 1 
ATOM   351  N N   . ARG A 1 51  ? 6.033   2.098   24.190  1.00 40.51  ? 146 ARG A N   1 
ATOM   352  C CA  . ARG A 1 51  ? 6.403   1.025   25.138  1.00 40.74  ? 146 ARG A CA  1 
ATOM   353  C C   . ARG A 1 51  ? 5.734   1.225   26.498  1.00 45.84  ? 146 ARG A C   1 
ATOM   354  O O   . ARG A 1 51  ? 5.218   0.252   27.058  1.00 46.29  ? 146 ARG A O   1 
ATOM   355  C CB  . ARG A 1 51  ? 7.930   0.919   25.333  1.00 39.56  ? 146 ARG A CB  1 
ATOM   356  C CG  . ARG A 1 51  ? 8.628   0.466   24.077  1.00 45.87  ? 146 ARG A CG  1 
ATOM   357  C CD  . ARG A 1 51  ? 9.963   -0.167  24.313  1.00 53.14  ? 146 ARG A CD  1 
ATOM   358  N NE  . ARG A 1 51  ? 11.096  0.765   24.294  1.00 57.75  ? 146 ARG A NE  1 
ATOM   359  C CZ  . ARG A 1 51  ? 11.805  1.064   23.212  1.00 69.82  ? 146 ARG A CZ  1 
ATOM   360  N NH1 . ARG A 1 51  ? 12.850  1.877   23.295  1.00 63.39  ? 146 ARG A NH1 1 
ATOM   361  N NH2 . ARG A 1 51  ? 11.473  0.549   22.034  1.00 53.38  ? 146 ARG A NH2 1 
ATOM   362  N N   . ARG A 1 52  ? 5.758   2.488   27.023  1.00 41.56  ? 147 ARG A N   1 
ATOM   363  C CA  . ARG A 1 52  ? 5.147   2.891   28.299  1.00 40.74  ? 147 ARG A CA  1 
ATOM   364  C C   . ARG A 1 52  ? 3.624   2.684   28.293  1.00 43.59  ? 147 ARG A C   1 
ATOM   365  O O   . ARG A 1 52  ? 3.098   2.134   29.261  1.00 42.78  ? 147 ARG A O   1 
ATOM   366  C CB  . ARG A 1 52  ? 5.541   4.339   28.709  1.00 39.85  ? 147 ARG A CB  1 
ATOM   367  C CG  . ARG A 1 52  ? 5.220   4.717   30.192  1.00 49.27  ? 147 ARG A CG  1 
ATOM   368  C CD  . ARG A 1 52  ? 5.824   3.776   31.224  1.00 58.25  ? 147 ARG A CD  1 
ATOM   369  N NE  . ARG A 1 52  ? 7.292   3.859   31.182  1.00 65.51  ? 147 ARG A NE  1 
ATOM   370  C CZ  . ARG A 1 52  ? 8.020   4.687   31.927  1.00 79.62  ? 147 ARG A CZ  1 
ATOM   371  N NH1 . ARG A 1 52  ? 7.434   5.458   32.836  1.00 74.93  ? 147 ARG A NH1 1 
ATOM   372  N NH2 . ARG A 1 52  ? 9.341   4.741   31.781  1.00 60.28  ? 147 ARG A NH2 1 
ATOM   373  N N   . LEU A 1 53  ? 2.937   3.102   27.191  1.00 39.15  ? 148 LEU A N   1 
ATOM   374  C CA  . LEU A 1 53  ? 1.487   2.935   26.971  1.00 38.71  ? 148 LEU A CA  1 
ATOM   375  C C   . LEU A 1 53  ? 1.118   1.436   26.760  1.00 43.95  ? 148 LEU A C   1 
ATOM   376  O O   . LEU A 1 53  ? 0.012   1.006   27.121  1.00 43.53  ? 148 LEU A O   1 
ATOM   377  C CB  . LEU A 1 53  ? 0.972   3.792   25.787  1.00 38.39  ? 148 LEU A CB  1 
ATOM   378  C CG  . LEU A 1 53  ? 1.112   5.310   25.886  1.00 42.61  ? 148 LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 53  ? 0.885   5.958   24.521  1.00 43.14  ? 148 LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 53  ? 0.151   5.925   26.915  1.00 43.12  ? 148 LEU A CD2 1 
ATOM   381  N N   . ARG A 1 54  ? 2.064   0.660   26.180  1.00 40.79  ? 149 ARG A N   1 
ATOM   382  C CA  . ARG A 1 54  ? 1.920   -0.773  25.937  1.00 41.02  ? 149 ARG A CA  1 
ATOM   383  C C   . ARG A 1 54  ? 1.846   -1.580  27.250  1.00 47.88  ? 149 ARG A C   1 
ATOM   384  O O   . ARG A 1 54  ? 0.914   -2.371  27.411  1.00 48.43  ? 149 ARG A O   1 
ATOM   385  C CB  . ARG A 1 54  ? 3.016   -1.300  25.011  1.00 38.48  ? 149 ARG A CB  1 
ATOM   386  C CG  . ARG A 1 54  ? 2.522   -2.395  24.086  1.00 42.03  ? 149 ARG A CG  1 
ATOM   387  C CD  . ARG A 1 54  ? 3.533   -3.479  24.042  1.00 40.73  ? 149 ARG A CD  1 
ATOM   388  N NE  . ARG A 1 54  ? 4.357   -3.470  22.839  1.00 41.97  ? 149 ARG A NE  1 
ATOM   389  C CZ  . ARG A 1 54  ? 5.663   -3.251  22.842  1.00 54.98  ? 149 ARG A CZ  1 
ATOM   390  N NH1 . ARG A 1 54  ? 6.298   -2.950  23.965  1.00 42.61  ? 149 ARG A NH1 1 
ATOM   391  N NH2 . ARG A 1 54  ? 6.345   -3.304  21.702  1.00 44.41  ? 149 ARG A NH2 1 
ATOM   392  N N   . GLN A 1 55  ? 2.788   -1.336  28.202  1.00 45.26  ? 150 GLN A N   1 
ATOM   393  C CA  . GLN A 1 55  ? 2.816   -1.989  29.527  1.00 45.47  ? 150 GLN A CA  1 
ATOM   394  C C   . GLN A 1 55  ? 1.716   -1.523  30.473  1.00 49.21  ? 150 GLN A C   1 
ATOM   395  O O   . GLN A 1 55  ? 1.389   -2.198  31.455  1.00 49.42  ? 150 GLN A O   1 
ATOM   396  C CB  . GLN A 1 55  ? 4.195   -1.867  30.191  1.00 47.14  ? 150 GLN A CB  1 
ATOM   397  C CG  . GLN A 1 55  ? 4.518   -0.491  30.822  1.00 58.54  ? 150 GLN A CG  1 
ATOM   398  C CD  . GLN A 1 55  ? 5.886   -0.469  31.482  1.00 76.79  ? 150 GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 55  ? 6.031   -0.064  32.641  1.00 73.18  ? 150 GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 55  ? 6.924   -0.865  30.740  1.00 67.65  ? 150 GLN A NE2 1 
ATOM   401  N N   . ARG A 1 56  ? 1.151   -0.354  30.161  1.00 44.97  ? 151 ARG A N   1 
ATOM   402  C CA  . ARG A 1 56  ? 0.043   0.237   30.915  1.00 44.23  ? 151 ARG A CA  1 
ATOM   403  C C   . ARG A 1 56  ? -1.367  -0.209  30.457  1.00 47.94  ? 151 ARG A C   1 
ATOM   404  O O   . ARG A 1 56  ? -2.363  0.302   30.972  1.00 48.76  ? 151 ARG A O   1 
ATOM   405  C CB  . ARG A 1 56  ? 0.126   1.758   30.865  1.00 44.48  ? 151 ARG A CB  1 
ATOM   406  C CG  . ARG A 1 56  ? 0.083   2.378   32.236  1.00 57.51  ? 151 ARG A CG  1 
ATOM   407  C CD  . ARG A 1 56  ? -0.583  3.731   32.163  1.00 70.21  ? 151 ARG A CD  1 
ATOM   408  N NE  . ARG A 1 56  ? 0.110   4.699   33.013  1.00 78.62  ? 151 ARG A NE  1 
ATOM   409  C CZ  . ARG A 1 56  ? 1.167   5.401   32.627  1.00 89.92  ? 151 ARG A CZ  1 
ATOM   410  N NH1 . ARG A 1 56  ? 1.688   5.208   31.419  1.00 72.65  ? 151 ARG A NH1 1 
ATOM   411  N NH2 . ARG A 1 56  ? 1.719   6.297   33.439  1.00 78.10  ? 151 ARG A NH2 1 
ATOM   412  N N   . ARG A 1 57  ? -1.435  -1.162  29.504  1.00 43.55  ? 152 ARG A N   1 
ATOM   413  C CA  . ARG A 1 57  ? -2.660  -1.729  28.886  1.00 43.16  ? 152 ARG A CA  1 
ATOM   414  C C   . ARG A 1 57  ? -3.605  -0.694  28.268  1.00 48.69  ? 152 ARG A C   1 
ATOM   415  O O   . ARG A 1 57  ? -4.807  -0.937  28.102  1.00 48.82  ? 152 ARG A O   1 
ATOM   416  C CB  . ARG A 1 57  ? -3.386  -2.723  29.815  1.00 41.39  ? 152 ARG A CB  1 
ATOM   417  C CG  . ARG A 1 57  ? -2.510  -3.871  30.229  1.00 49.42  ? 152 ARG A CG  1 
ATOM   418  C CD  . ARG A 1 57  ? -2.918  -4.503  31.560  1.00 63.02  ? 152 ARG A CD  1 
ATOM   419  N NE  . ARG A 1 57  ? -1.762  -5.131  32.224  1.00 66.49  ? 152 ARG A NE  1 
ATOM   420  C CZ  . ARG A 1 57  ? -1.293  -6.335  31.912  1.00 77.77  ? 152 ARG A CZ  1 
ATOM   421  N NH1 . ARG A 1 57  ? -1.871  -7.052  30.959  1.00 64.18  ? 152 ARG A NH1 1 
ATOM   422  N NH2 . ARG A 1 57  ? -0.242  -6.837  32.559  1.00 66.01  ? 152 ARG A NH2 1 
ATOM   423  N N   . ARG A 1 58  ? -3.016  0.457   27.923  1.00 45.63  ? 153 ARG A N   1 
ATOM   424  C CA  . ARG A 1 58  ? -3.667  1.622   27.334  1.00 45.42  ? 153 ARG A CA  1 
ATOM   425  C C   . ARG A 1 58  ? -3.918  1.409   25.856  1.00 50.55  ? 153 ARG A C   1 
ATOM   426  O O   . ARG A 1 58  ? -4.918  1.870   25.295  1.00 50.06  ? 153 ARG A O   1 
ATOM   427  C CB  . ARG A 1 58  ? -2.817  2.873   27.566  1.00 44.68  ? 153 ARG A CB  1 
ATOM   428  C CG  . ARG A 1 58  ? -2.809  3.332   29.023  1.00 49.07  ? 153 ARG A CG  1 
ATOM   429  C CD  . ARG A 1 58  ? -3.640  4.581   29.308  1.00 55.62  ? 153 ARG A CD  1 
ATOM   430  N NE  . ARG A 1 58  ? -4.825  4.712   28.458  1.00 58.47  ? 153 ARG A NE  1 
ATOM   431  C CZ  . ARG A 1 58  ? -5.186  5.831   27.840  1.00 67.64  ? 153 ARG A CZ  1 
ATOM   432  N NH1 . ARG A 1 58  ? -4.457  6.933   27.973  1.00 56.27  ? 153 ARG A NH1 1 
ATOM   433  N NH2 . ARG A 1 58  ? -6.277  5.862   27.090  1.00 53.28  ? 153 ARG A NH2 1 
ATOM   434  N N   . LEU A 1 59  ? -3.020  0.646   25.249  1.00 48.36  ? 154 LEU A N   1 
ATOM   435  C CA  . LEU A 1 59  ? -3.071  0.280   23.854  1.00 48.64  ? 154 LEU A CA  1 
ATOM   436  C C   . LEU A 1 59  ? -4.062  -0.841  23.670  1.00 55.37  ? 154 LEU A C   1 
ATOM   437  O O   . LEU A 1 59  ? -4.112  -1.776  24.478  1.00 55.97  ? 154 LEU A O   1 
ATOM   438  C CB  . LEU A 1 59  ? -1.674  -0.150  23.387  1.00 48.38  ? 154 LEU A CB  1 
ATOM   439  C CG  . LEU A 1 59  ? -0.872  0.843   22.544  1.00 52.19  ? 154 LEU A CG  1 
ATOM   440  C CD1 . LEU A 1 59  ? -1.259  2.298   22.804  1.00 52.01  ? 154 LEU A CD1 1 
ATOM   441  C CD2 . LEU A 1 59  ? 0.590   0.629   22.739  1.00 54.67  ? 154 LEU A CD2 1 
ATOM   442  N N   . ARG A 1 60  ? -4.853  -0.750  22.598  1.00 52.69  ? 155 ARG A N   1 
ATOM   443  C CA  . ARG A 1 60  ? -5.838  -1.765  22.259  1.00 53.00  ? 155 ARG A CA  1 
ATOM   444  C C   . ARG A 1 60  ? -5.115  -3.070  21.923  1.00 57.83  ? 155 ARG A C   1 
ATOM   445  O O   . ARG A 1 60  ? -4.010  -3.035  21.367  1.00 57.70  ? 155 ARG A O   1 
ATOM   446  C CB  . ARG A 1 60  ? -6.740  -1.283  21.101  1.00 53.11  ? 155 ARG A CB  1 
ATOM   447  C CG  . ARG A 1 60  ? -8.098  -1.992  20.960  1.00 64.79  ? 155 ARG A CG  1 
ATOM   448  C CD  . ARG A 1 60  ? -8.713  -2.483  22.270  1.00 78.34  ? 155 ARG A CD  1 
ATOM   449  N NE  . ARG A 1 60  ? -9.870  -1.694  22.701  1.00 91.29  ? 155 ARG A NE  1 
ATOM   450  C CZ  . ARG A 1 60  ? -11.020 -2.217  23.123  1.00 108.04 ? 155 ARG A CZ  1 
ATOM   451  N NH1 . ARG A 1 60  ? -11.186 -3.535  23.159  1.00 98.96  ? 155 ARG A NH1 1 
ATOM   452  N NH2 . ARG A 1 60  ? -12.014 -1.427  23.506  1.00 95.68  ? 155 ARG A NH2 1 
ATOM   453  N N   . ARG A 1 61  ? -5.698  -4.206  22.350  1.00 54.03  ? 156 ARG A N   1 
ATOM   454  C CA  . ARG A 1 61  ? -5.152  -5.552  22.144  1.00 53.60  ? 156 ARG A CA  1 
ATOM   455  C C   . ARG A 1 61  ? -4.915  -5.794  20.651  1.00 57.27  ? 156 ARG A C   1 
ATOM   456  O O   . ARG A 1 61  ? -5.825  -6.179  19.906  1.00 56.90  ? 156 ARG A O   1 
ATOM   457  C CB  . ARG A 1 61  ? -6.036  -6.637  22.793  1.00 54.28  ? 156 ARG A CB  1 
ATOM   458  C CG  . ARG A 1 61  ? -7.408  -6.146  23.253  1.00 68.63  ? 156 ARG A CG  1 
ATOM   459  C CD  . ARG A 1 61  ? -8.500  -7.132  22.900  1.00 81.74  ? 156 ARG A CD  1 
ATOM   460  N NE  . ARG A 1 61  ? -9.161  -7.651  24.096  1.00 91.84  ? 156 ARG A NE  1 
ATOM   461  C CZ  . ARG A 1 61  ? -10.464 -7.553  24.338  1.00 105.24 ? 156 ARG A CZ  1 
ATOM   462  N NH1 . ARG A 1 61  ? -11.267 -6.959  23.461  1.00 93.98  ? 156 ARG A NH1 1 
ATOM   463  N NH2 . ARG A 1 61  ? -10.978 -8.053  25.453  1.00 91.61  ? 156 ARG A NH2 1 
ATOM   464  N N   . GLU A 1 62  ? -3.688  -5.461  20.216  1.00 52.85  ? 157 GLU A N   1 
ATOM   465  C CA  . GLU A 1 62  ? -3.241  -5.525  18.832  1.00 52.02  ? 157 GLU A CA  1 
ATOM   466  C C   . GLU A 1 62  ? -1.732  -5.679  18.781  1.00 54.19  ? 157 GLU A C   1 
ATOM   467  O O   . GLU A 1 62  ? -1.036  -5.415  19.764  1.00 54.15  ? 157 GLU A O   1 
ATOM   468  C CB  . GLU A 1 62  ? -3.648  -4.229  18.100  1.00 53.31  ? 157 GLU A CB  1 
ATOM   469  C CG  . GLU A 1 62  ? -3.793  -4.396  16.597  1.00 61.51  ? 157 GLU A CG  1 
ATOM   470  C CD  . GLU A 1 62  ? -4.463  -3.272  15.833  1.00 74.61  ? 157 GLU A CD  1 
ATOM   471  O OE1 . GLU A 1 62  ? -4.647  -2.169  16.401  1.00 59.51  ? 157 GLU A OE1 1 
ATOM   472  O OE2 . GLU A 1 62  ? -4.793  -3.496  14.647  1.00 71.19  ? 157 GLU A OE2 1 
ATOM   473  N N   . ARG A 1 63  ? -1.232  -6.085  17.614  1.00 49.04  ? 158 ARG A N   1 
ATOM   474  C CA  . ARG A 1 63  ? 0.180   -6.250  17.342  1.00 47.91  ? 158 ARG A CA  1 
ATOM   475  C C   . ARG A 1 63  ? 0.813   -4.874  17.173  1.00 49.45  ? 158 ARG A C   1 
ATOM   476  O O   . ARG A 1 63  ? 0.511   -4.156  16.213  1.00 48.79  ? 158 ARG A O   1 
ATOM   477  C CB  . ARG A 1 63  ? 0.348   -7.067  16.074  1.00 48.75  ? 158 ARG A CB  1 
ATOM   478  C CG  . ARG A 1 63  ? 1.617   -7.852  16.077  1.00 60.36  ? 158 ARG A CG  1 
ATOM   479  C CD  . ARG A 1 63  ? 1.406   -9.168  15.387  1.00 71.22  ? 158 ARG A CD  1 
ATOM   480  N NE  . ARG A 1 63  ? 2.582   -9.467  14.590  1.00 80.37  ? 158 ARG A NE  1 
ATOM   481  C CZ  . ARG A 1 63  ? 2.898   -10.654 14.097  1.00 91.35  ? 158 ARG A CZ  1 
ATOM   482  N NH1 . ARG A 1 63  ? 2.102   -11.701 14.324  1.00 80.09  ? 158 ARG A NH1 1 
ATOM   483  N NH2 . ARG A 1 63  ? 3.993   -10.820 13.389  1.00 77.90  ? 158 ARG A NH2 1 
ATOM   484  N N   . VAL A 1 64  ? 1.653   -4.488  18.146  1.00 43.81  ? 159 VAL A N   1 
ATOM   485  C CA  . VAL A 1 64  ? 2.325   -3.191  18.152  1.00 42.21  ? 159 VAL A CA  1 
ATOM   486  C C   . VAL A 1 64  ? 3.844   -3.371  18.156  1.00 43.56  ? 159 VAL A C   1 
ATOM   487  O O   . VAL A 1 64  ? 4.400   -4.016  19.049  1.00 42.31  ? 159 VAL A O   1 
ATOM   488  C CB  . VAL A 1 64  ? 1.848   -2.255  19.301  1.00 45.67  ? 159 VAL A CB  1 
ATOM   489  C CG1 . VAL A 1 64  ? 2.331   -0.829  19.075  1.00 45.35  ? 159 VAL A CG1 1 
ATOM   490  C CG2 . VAL A 1 64  ? 0.330   -2.279  19.470  1.00 45.28  ? 159 VAL A CG2 1 
ATOM   491  N N   . ARG A 1 65  ? 4.504   -2.803  17.141  1.00 39.06  ? 160 ARG A N   1 
ATOM   492  C CA  . ARG A 1 65  ? 5.957   -2.837  17.011  1.00 38.34  ? 160 ARG A CA  1 
ATOM   493  C C   . ARG A 1 65  ? 6.484   -1.486  17.485  1.00 40.05  ? 160 ARG A C   1 
ATOM   494  O O   . ARG A 1 65  ? 6.247   -0.464  16.837  1.00 38.53  ? 160 ARG A O   1 
ATOM   495  C CB  . ARG A 1 65  ? 6.375   -3.168  15.561  1.00 38.79  ? 160 ARG A CB  1 
ATOM   496  C CG  . ARG A 1 65  ? 7.876   -3.105  15.268  1.00 49.36  ? 160 ARG A CG  1 
ATOM   497  C CD  . ARG A 1 65  ? 8.705   -4.202  15.913  1.00 54.24  ? 160 ARG A CD  1 
ATOM   498  N NE  . ARG A 1 65  ? 10.126  -4.020  15.614  1.00 56.97  ? 160 ARG A NE  1 
ATOM   499  C CZ  . ARG A 1 65  ? 11.065  -4.942  15.809  1.00 71.64  ? 160 ARG A CZ  1 
ATOM   500  N NH1 . ARG A 1 65  ? 10.748  -6.131  16.307  1.00 59.46  ? 160 ARG A NH1 1 
ATOM   501  N NH2 . ARG A 1 65  ? 12.328  -4.686  15.491  1.00 60.10  ? 160 ARG A NH2 1 
ATOM   502  N N   . ALA A 1 66  ? 7.115   -1.479  18.664  1.00 36.17  ? 161 ALA A N   1 
ATOM   503  C CA  . ALA A 1 66  ? 7.656   -0.263  19.260  1.00 36.04  ? 161 ALA A CA  1 
ATOM   504  C C   . ALA A 1 66  ? 9.186   -0.303  19.212  1.00 41.27  ? 161 ALA A C   1 
ATOM   505  O O   . ALA A 1 66  ? 9.860   0.250   20.077  1.00 40.68  ? 161 ALA A O   1 
ATOM   506  C CB  . ALA A 1 66  ? 7.150   -0.116  20.689  1.00 36.89  ? 161 ALA A CB  1 
ATOM   507  N N   . GLN A 1 67  ? 9.729   -0.948  18.171  1.00 39.66  ? 162 GLN A N   1 
ATOM   508  C CA  . GLN A 1 67  ? 11.170  -1.097  17.969  1.00 40.39  ? 162 GLN A CA  1 
ATOM   509  C C   . GLN A 1 67  ? 11.522  -0.852  16.499  1.00 45.85  ? 162 GLN A C   1 
ATOM   510  O O   . GLN A 1 67  ? 10.787  -1.319  15.624  1.00 45.47  ? 162 GLN A O   1 
ATOM   511  C CB  . GLN A 1 67  ? 11.607  -2.516  18.374  1.00 41.76  ? 162 GLN A CB  1 
ATOM   512  C CG  . GLN A 1 67  ? 12.655  -2.562  19.469  1.00 55.04  ? 162 GLN A CG  1 
ATOM   513  C CD  . GLN A 1 67  ? 12.882  -3.971  19.959  1.00 72.39  ? 162 GLN A CD  1 
ATOM   514  O OE1 . GLN A 1 67  ? 13.136  -4.900  19.185  1.00 65.37  ? 162 GLN A OE1 1 
ATOM   515  N NE2 . GLN A 1 67  ? 12.786  -4.163  21.262  1.00 66.70  ? 162 GLN A NE2 1 
ATOM   516  N N   . PRO A 1 68  ? 12.644  -0.155  16.193  1.00 44.07  ? 163 PRO A N   1 
ATOM   517  C CA  . PRO A 1 68  ? 13.024  0.037   14.775  1.00 44.32  ? 163 PRO A CA  1 
ATOM   518  C C   . PRO A 1 68  ? 13.363  -1.292  14.080  1.00 48.52  ? 163 PRO A C   1 
ATOM   519  O O   . PRO A 1 68  ? 13.834  -2.227  14.730  1.00 48.21  ? 163 PRO A O   1 
ATOM   520  C CB  . PRO A 1 68  ? 14.252  0.954   14.863  1.00 46.03  ? 163 PRO A CB  1 
ATOM   521  C CG  . PRO A 1 68  ? 14.831  0.681   16.207  1.00 50.29  ? 163 PRO A CG  1 
ATOM   522  C CD  . PRO A 1 68  ? 13.647  0.439   17.106  1.00 45.75  ? 163 PRO A CD  1 
ATOM   523  N N   . CYS A 1 69  ? 13.116  -1.369  12.770  1.00 45.74  ? 164 CYS A N   1 
ATOM   524  C CA  . CYS A 1 69  ? 13.373  -2.566  11.977  1.00 45.71  ? 164 CYS A CA  1 
ATOM   525  C C   . CYS A 1 69  ? 14.364  -2.302  10.860  1.00 45.39  ? 164 CYS A C   1 
ATOM   526  O O   . CYS A 1 69  ? 14.199  -1.330  10.140  1.00 44.19  ? 164 CYS A O   1 
ATOM   527  C CB  . CYS A 1 69  ? 12.080  -3.150  11.425  1.00 47.09  ? 164 CYS A CB  1 
ATOM   528  S SG  . CYS A 1 69  ? 10.878  -3.562  12.690  1.00 52.00  ? 164 CYS A SG  1 
ATOM   529  N N   . CYS A 1 70  ? 15.345  -3.193  10.685  1.00 40.10  ? 165 CYS A N   1 
ATOM   530  C CA  . CYS A 1 70  ? 16.319  -3.082  9.595   1.00 39.31  ? 165 CYS A CA  1 
ATOM   531  C C   . CYS A 1 70  ? 15.675  -3.670  8.345   1.00 39.27  ? 165 CYS A C   1 
ATOM   532  O O   . CYS A 1 70  ? 15.587  -4.902  8.206   1.00 37.80  ? 165 CYS A O   1 
ATOM   533  C CB  . CYS A 1 70  ? 17.630  -3.776  9.945   1.00 40.17  ? 165 CYS A CB  1 
ATOM   534  S SG  . CYS A 1 70  ? 18.874  -3.656  8.651   1.00 44.42  ? 165 CYS A SG  1 
ATOM   535  N N   . ARG A 1 71  ? 15.151  -2.808  7.470   1.00 34.29  ? 166 ARG A N   1 
ATOM   536  C CA  . ARG A 1 71  ? 14.416  -3.233  6.274   1.00 33.64  ? 166 ARG A CA  1 
ATOM   537  C C   . ARG A 1 71  ? 14.794  -2.422  5.025   1.00 37.04  ? 166 ARG A C   1 
ATOM   538  O O   . ARG A 1 71  ? 15.277  -1.291  5.173   1.00 36.89  ? 166 ARG A O   1 
ATOM   539  C CB  . ARG A 1 71  ? 12.894  -3.138  6.527   1.00 31.13  ? 166 ARG A CB  1 
ATOM   540  C CG  . ARG A 1 71  ? 12.312  -4.197  7.482   1.00 35.19  ? 166 ARG A CG  1 
ATOM   541  C CD  . ARG A 1 71  ? 12.162  -5.579  6.856   1.00 36.12  ? 166 ARG A CD  1 
ATOM   542  N NE  . ARG A 1 71  ? 11.319  -5.565  5.659   1.00 34.38  ? 166 ARG A NE  1 
ATOM   543  C CZ  . ARG A 1 71  ? 11.050  -6.636  4.921   1.00 47.05  ? 166 ARG A CZ  1 
ATOM   544  N NH1 . ARG A 1 71  ? 11.555  -7.818  5.246   1.00 28.82  ? 166 ARG A NH1 1 
ATOM   545  N NH2 . ARG A 1 71  ? 10.269  -6.534  3.854   1.00 39.04  ? 166 ARG A NH2 1 
ATOM   546  N N   . PRO A 1 72  ? 14.560  -2.942  3.791   1.00 32.21  ? 167 PRO A N   1 
ATOM   547  C CA  . PRO A 1 72  ? 14.860  -2.137  2.597   1.00 31.86  ? 167 PRO A CA  1 
ATOM   548  C C   . PRO A 1 72  ? 13.931  -0.941  2.416   1.00 36.74  ? 167 PRO A C   1 
ATOM   549  O O   . PRO A 1 72  ? 12.718  -1.080  2.560   1.00 37.32  ? 167 PRO A O   1 
ATOM   550  C CB  . PRO A 1 72  ? 14.704  -3.130  1.441   1.00 33.39  ? 167 PRO A CB  1 
ATOM   551  C CG  . PRO A 1 72  ? 14.597  -4.483  2.073   1.00 37.17  ? 167 PRO A CG  1 
ATOM   552  C CD  . PRO A 1 72  ? 14.012  -4.260  3.413   1.00 32.79  ? 167 PRO A CD  1 
ATOM   553  N N   . THR A 1 73  ? 14.504  0.232   2.107   1.00 33.44  ? 168 THR A N   1 
ATOM   554  C CA  . THR A 1 73  ? 13.754  1.459   1.813   1.00 33.29  ? 168 THR A CA  1 
ATOM   555  C C   . THR A 1 73  ? 13.600  1.604   0.295   1.00 38.15  ? 168 THR A C   1 
ATOM   556  O O   . THR A 1 73  ? 12.800  2.413   -0.175  1.00 37.78  ? 168 THR A O   1 
ATOM   557  C CB  . THR A 1 73  ? 14.388  2.687   2.476   1.00 42.31  ? 168 THR A CB  1 
ATOM   558  O OG1 . THR A 1 73  ? 15.777  2.748   2.153   1.00 45.63  ? 168 THR A OG1 1 
ATOM   559  C CG2 . THR A 1 73  ? 14.200  2.696   3.981   1.00 39.54  ? 168 THR A CG2 1 
ATOM   560  N N   . ALA A 1 74  ? 14.353  0.788   -0.470  1.00 35.51  ? 169 ALA A N   1 
ATOM   561  C CA  . ALA A 1 74  ? 14.327  0.749   -1.937  1.00 35.38  ? 169 ALA A CA  1 
ATOM   562  C C   . ALA A 1 74  ? 14.733  -0.627  -2.442  1.00 39.76  ? 169 ALA A C   1 
ATOM   563  O O   . ALA A 1 74  ? 15.539  -1.306  -1.805  1.00 38.87  ? 169 ALA A O   1 
ATOM   564  C CB  . ALA A 1 74  ? 15.266  1.800   -2.511  1.00 36.16  ? 169 ALA A CB  1 
ATOM   565  N N   . TYR A 1 75  ? 14.207  -1.017  -3.607  1.00 37.33  ? 170 TYR A N   1 
ATOM   566  C CA  . TYR A 1 75  ? 14.500  -2.309  -4.224  1.00 37.46  ? 170 TYR A CA  1 
ATOM   567  C C   . TYR A 1 75  ? 15.136  -2.161  -5.598  1.00 43.41  ? 170 TYR A C   1 
ATOM   568  O O   . TYR A 1 75  ? 14.907  -1.160  -6.279  1.00 42.18  ? 170 TYR A O   1 
ATOM   569  C CB  . TYR A 1 75  ? 13.224  -3.167  -4.306  1.00 38.02  ? 170 TYR A CB  1 
ATOM   570  C CG  . TYR A 1 75  ? 12.697  -3.567  -2.950  1.00 39.06  ? 170 TYR A CG  1 
ATOM   571  C CD1 . TYR A 1 75  ? 11.865  -2.722  -2.222  1.00 40.56  ? 170 TYR A CD1 1 
ATOM   572  C CD2 . TYR A 1 75  ? 13.067  -4.780  -2.368  1.00 39.74  ? 170 TYR A CD2 1 
ATOM   573  C CE1 . TYR A 1 75  ? 11.423  -3.061  -0.947  1.00 41.19  ? 170 TYR A CE1 1 
ATOM   574  C CE2 . TYR A 1 75  ? 12.615  -5.139  -1.101  1.00 40.43  ? 170 TYR A CE2 1 
ATOM   575  C CZ  . TYR A 1 75  ? 11.785  -4.280  -0.397  1.00 47.63  ? 170 TYR A CZ  1 
ATOM   576  O OH  . TYR A 1 75  ? 11.326  -4.636  0.849   1.00 51.63  ? 170 TYR A OH  1 
ATOM   577  N N   . GLU A 1 76  ? 15.940  -3.164  -6.002  1.00 42.74  ? 171 GLU A N   1 
ATOM   578  C CA  . GLU A 1 76  ? 16.592  -3.208  -7.312  1.00 43.63  ? 171 GLU A CA  1 
ATOM   579  C C   . GLU A 1 76  ? 15.499  -3.390  -8.353  1.00 50.00  ? 171 GLU A C   1 
ATOM   580  O O   . GLU A 1 76  ? 14.585  -4.186  -8.127  1.00 50.52  ? 171 GLU A O   1 
ATOM   581  C CB  . GLU A 1 76  ? 17.612  -4.355  -7.379  1.00 45.09  ? 171 GLU A CB  1 
ATOM   582  C CG  . GLU A 1 76  ? 18.973  -3.995  -6.804  1.00 57.44  ? 171 GLU A CG  1 
ATOM   583  C CD  . GLU A 1 76  ? 19.865  -3.161  -7.706  1.00 81.80  ? 171 GLU A CD  1 
ATOM   584  O OE1 . GLU A 1 76  ? 20.370  -3.707  -8.716  1.00 80.35  ? 171 GLU A OE1 1 
ATOM   585  O OE2 . GLU A 1 76  ? 20.077  -1.966  -7.394  1.00 76.67  ? 171 GLU A OE2 1 
ATOM   586  N N   . ASP A 1 77  ? 15.544  -2.612  -9.449  1.00 47.34  ? 172 ASP A N   1 
ATOM   587  C CA  . ASP A 1 77  ? 14.509  -2.637  -10.484 1.00 47.59  ? 172 ASP A CA  1 
ATOM   588  C C   . ASP A 1 77  ? 14.281  -4.013  -11.094 1.00 51.15  ? 172 ASP A C   1 
ATOM   589  O O   . ASP A 1 77  ? 13.139  -4.480  -11.132 1.00 51.41  ? 172 ASP A O   1 
ATOM   590  C CB  . ASP A 1 77  ? 14.763  -1.563  -11.563 1.00 50.26  ? 172 ASP A CB  1 
ATOM   591  C CG  . ASP A 1 77  ? 16.046  -1.719  -12.372 1.00 68.14  ? 172 ASP A CG  1 
ATOM   592  O OD1 . ASP A 1 77  ? 16.017  -1.436  -13.594 1.00 70.17  ? 172 ASP A OD1 1 
ATOM   593  O OD2 . ASP A 1 77  ? 17.093  -2.082  -11.776 1.00 74.60  ? 172 ASP A OD2 1 
ATOM   594  N N   . GLU A 1 78  ? 15.367  -4.679  -11.523 1.00 46.81  ? 173 GLU A N   1 
ATOM   595  C CA  . GLU A 1 78  ? 15.313  -5.987  -12.179 1.00 46.44  ? 173 GLU A CA  1 
ATOM   596  C C   . GLU A 1 78  ? 16.623  -6.777  -12.131 1.00 48.52  ? 173 GLU A C   1 
ATOM   597  O O   . GLU A 1 78  ? 17.699  -6.201  -11.964 1.00 47.10  ? 173 GLU A O   1 
ATOM   598  C CB  . GLU A 1 78  ? 14.820  -5.849  -13.639 1.00 47.81  ? 173 GLU A CB  1 
ATOM   599  C CG  . GLU A 1 78  ? 15.472  -4.737  -14.454 1.00 59.28  ? 173 GLU A CG  1 
ATOM   600  C CD  . GLU A 1 78  ? 15.093  -4.699  -15.924 1.00 81.93  ? 173 GLU A CD  1 
ATOM   601  O OE1 . GLU A 1 78  ? 16.019  -4.712  -16.767 1.00 76.47  ? 173 GLU A OE1 1 
ATOM   602  O OE2 . GLU A 1 78  ? 13.882  -4.638  -16.240 1.00 79.92  ? 173 GLU A OE2 1 
ATOM   603  N N   . VAL A 1 79  ? 16.504  -8.116  -12.253 1.00 44.87  ? 174 VAL A N   1 
ATOM   604  C CA  . VAL A 1 79  ? 17.596  -9.098  -12.317 1.00 44.31  ? 174 VAL A CA  1 
ATOM   605  C C   . VAL A 1 79  ? 17.202  -10.078 -13.410 1.00 47.71  ? 174 VAL A C   1 
ATOM   606  O O   . VAL A 1 79  ? 16.065  -10.547 -13.432 1.00 46.80  ? 174 VAL A O   1 
ATOM   607  C CB  . VAL A 1 79  ? 17.937  -9.887  -11.011 1.00 48.05  ? 174 VAL A CB  1 
ATOM   608  C CG1 . VAL A 1 79  ? 19.398  -10.335 -11.027 1.00 47.57  ? 174 VAL A CG1 1 
ATOM   609  C CG2 . VAL A 1 79  ? 17.645  -9.093  -9.740  1.00 47.97  ? 174 VAL A CG2 1 
ATOM   610  N N   . SER A 1 80  ? 18.132  -10.389 -14.309 1.00 45.05  ? 175 SER A N   1 
ATOM   611  C CA  . SER A 1 80  ? 17.864  -11.322 -15.396 1.00 45.13  ? 175 SER A CA  1 
ATOM   612  C C   . SER A 1 80  ? 18.755  -12.552 -15.284 1.00 49.19  ? 175 SER A C   1 
ATOM   613  O O   . SER A 1 80  ? 19.917  -12.453 -14.880 1.00 48.60  ? 175 SER A O   1 
ATOM   614  C CB  . SER A 1 80  ? 18.031  -10.640 -16.750 1.00 48.48  ? 175 SER A CB  1 
ATOM   615  O OG  . SER A 1 80  ? 17.368  -9.384  -16.773 1.00 57.73  ? 175 SER A OG  1 
ATOM   616  N N   . PHE A 1 81  ? 18.185  -13.717 -15.600 1.00 45.88  ? 176 PHE A N   1 
ATOM   617  C CA  . PHE A 1 81  ? 18.882  -15.001 -15.588 1.00 45.84  ? 176 PHE A CA  1 
ATOM   618  C C   . PHE A 1 81  ? 18.269  -15.889 -16.658 1.00 50.30  ? 176 PHE A C   1 
ATOM   619  O O   . PHE A 1 81  ? 17.118  -15.678 -17.038 1.00 49.08  ? 176 PHE A O   1 
ATOM   620  C CB  . PHE A 1 81  ? 18.811  -15.676 -14.199 1.00 47.76  ? 176 PHE A CB  1 
ATOM   621  C CG  . PHE A 1 81  ? 17.434  -16.127 -13.764 1.00 49.22  ? 176 PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 81  ? 16.947  -17.383 -14.122 1.00 51.94  ? 176 PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 81  ? 16.631  -15.305 -12.984 1.00 51.26  ? 176 PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 81  ? 15.672  -17.794 -13.736 1.00 52.62  ? 176 PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 81  ? 15.357  -15.722 -12.590 1.00 54.20  ? 176 PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 81  ? 14.890  -16.968 -12.963 1.00 52.16  ? 176 PHE A CZ  1 
ATOM   627  N N   . LEU A 1 82  ? 19.018  -16.893 -17.122 1.00 48.61  ? 177 LEU A N   1 
ATOM   628  C CA  . LEU A 1 82  ? 18.529  -17.838 -18.124 1.00 49.24  ? 177 LEU A CA  1 
ATOM   629  C C   . LEU A 1 82  ? 17.711  -18.914 -17.410 1.00 54.71  ? 177 LEU A C   1 
ATOM   630  O O   . LEU A 1 82  ? 18.263  -19.660 -16.605 1.00 54.86  ? 177 LEU A O   1 
ATOM   631  C CB  . LEU A 1 82  ? 19.703  -18.459 -18.909 1.00 49.26  ? 177 LEU A CB  1 
ATOM   632  C CG  . LEU A 1 82  ? 19.330  -19.384 -20.076 1.00 53.86  ? 177 LEU A CG  1 
ATOM   633  C CD1 . LEU A 1 82  ? 19.266  -18.625 -21.380 1.00 53.82  ? 177 LEU A CD1 1 
ATOM   634  C CD2 . LEU A 1 82  ? 20.316  -20.525 -20.200 1.00 56.60  ? 177 LEU A CD2 1 
ATOM   635  N N   . ASP A 1 83  ? 16.396  -18.972 -17.692 1.00 52.02  ? 178 ASP A N   1 
ATOM   636  C CA  . ASP A 1 83  ? 15.459  -19.923 -17.089 1.00 52.45  ? 178 ASP A CA  1 
ATOM   637  C C   . ASP A 1 83  ? 15.498  -21.321 -17.766 1.00 56.75  ? 178 ASP A C   1 
ATOM   638  O O   . ASP A 1 83  ? 16.412  -21.623 -18.556 1.00 56.27  ? 178 ASP A O   1 
ATOM   639  C CB  . ASP A 1 83  ? 14.014  -19.319 -17.037 1.00 54.71  ? 178 ASP A CB  1 
ATOM   640  C CG  . ASP A 1 83  ? 13.278  -19.137 -18.373 1.00 66.62  ? 178 ASP A CG  1 
ATOM   641  O OD1 . ASP A 1 83  ? 13.606  -19.854 -19.338 1.00 68.55  ? 178 ASP A OD1 1 
ATOM   642  O OD2 . ASP A 1 83  ? 12.328  -18.317 -18.428 1.00 71.02  ? 178 ASP A OD2 1 
ATOM   643  N N   . ALA A 1 84  ? 14.493  -22.171 -17.419 1.00 53.04  ? 179 ALA A N   1 
ATOM   644  C CA  . ALA A 1 84  ? 14.298  -23.535 -17.938 1.00 52.52  ? 179 ALA A CA  1 
ATOM   645  C C   . ALA A 1 84  ? 13.989  -23.612 -19.439 1.00 55.74  ? 179 ALA A C   1 
ATOM   646  O O   . ALA A 1 84  ? 14.526  -24.493 -20.138 1.00 55.63  ? 179 ALA A O   1 
ATOM   647  C CB  . ALA A 1 84  ? 13.233  -24.271 -17.126 1.00 53.30  ? 179 ALA A CB  1 
ATOM   648  N N   . HIS A 1 85  ? 13.147  -22.676 -19.944 1.00 51.31  ? 180 HIS A N   1 
ATOM   649  C CA  A HIS A 1 85  ? 12.797  -22.655 -21.373 0.50 51.31  ? 180 HIS A CA  1 
ATOM   650  C CA  B HIS A 1 85  ? 12.750  -22.579 -21.357 0.50 50.68  ? 180 HIS A CA  1 
ATOM   651  C C   . HIS A 1 85  ? 13.836  -21.901 -22.216 1.00 54.22  ? 180 HIS A C   1 
ATOM   652  O O   . HIS A 1 85  ? 13.651  -21.663 -23.421 1.00 53.53  ? 180 HIS A O   1 
ATOM   653  C CB  A HIS A 1 85  ? 11.348  -22.198 -21.634 0.50 52.45  ? 180 HIS A CB  1 
ATOM   654  C CB  B HIS A 1 85  ? 11.354  -21.948 -21.502 0.50 51.10  ? 180 HIS A CB  1 
ATOM   655  C CG  A HIS A 1 85  ? 10.699  -22.897 -22.800 0.50 56.36  ? 180 HIS A CG  1 
ATOM   656  C CG  B HIS A 1 85  ? 10.388  -22.389 -20.442 0.50 54.33  ? 180 HIS A CG  1 
ATOM   657  N ND1 A HIS A 1 85  ? 9.852   -23.978 -22.613 0.50 58.41  ? 180 HIS A ND1 1 
ATOM   658  N ND1 B HIS A 1 85  ? 9.752   -23.613 -20.495 0.50 55.83  ? 180 HIS A ND1 1 
ATOM   659  C CD2 A HIS A 1 85  ? 10.795  -22.649 -24.130 0.50 58.39  ? 180 HIS A CD2 1 
ATOM   660  C CD2 B HIS A 1 85  ? 9.957   -21.723 -19.349 0.50 55.60  ? 180 HIS A CD2 1 
ATOM   661  C CE1 A HIS A 1 85  ? 9.455   -24.339 -23.824 0.50 57.95  ? 180 HIS A CE1 1 
ATOM   662  C CE1 B HIS A 1 85  ? 8.954   -23.639 -19.442 0.50 55.02  ? 180 HIS A CE1 1 
ATOM   663  N NE2 A HIS A 1 85  ? 10.001  -23.574 -24.769 0.50 58.29  ? 180 HIS A NE2 1 
ATOM   664  N NE2 B HIS A 1 85  ? 9.046   -22.524 -18.728 0.50 55.35  ? 180 HIS A NE2 1 
ATOM   665  N N   . SER A 1 86  ? 14.979  -21.633 -21.589 1.00 50.40  ? 181 SER A N   1 
ATOM   666  C CA  . SER A 1 86  ? 16.172  -20.980 -22.104 1.00 50.13  ? 181 SER A CA  1 
ATOM   667  C C   . SER A 1 86  ? 15.935  -19.557 -22.611 1.00 52.00  ? 181 SER A C   1 
ATOM   668  O O   . SER A 1 86  ? 16.731  -19.037 -23.401 1.00 51.45  ? 181 SER A O   1 
ATOM   669  C CB  . SER A 1 86  ? 16.917  -21.867 -23.100 1.00 54.88  ? 181 SER A CB  1 
ATOM   670  O OG  . SER A 1 86  ? 16.219  -22.093 -24.315 1.00 65.38  ? 181 SER A OG  1 
ATOM   671  N N   . ARG A 1 87  ? 14.882  -18.897 -22.079 1.00 47.22  ? 182 ARG A N   1 
ATOM   672  C CA  . ARG A 1 87  ? 14.619  -17.478 -22.340 1.00 46.74  ? 182 ARG A CA  1 
ATOM   673  C C   . ARG A 1 87  ? 15.252  -16.706 -21.174 1.00 50.65  ? 182 ARG A C   1 
ATOM   674  O O   . ARG A 1 87  ? 15.459  -17.292 -20.109 1.00 49.65  ? 182 ARG A O   1 
ATOM   675  C CB  . ARG A 1 87  ? 13.121  -17.104 -22.511 1.00 46.90  ? 182 ARG A CB  1 
ATOM   676  C CG  . ARG A 1 87  ? 12.088  -18.156 -22.149 1.00 58.36  ? 182 ARG A CG  1 
ATOM   677  C CD  . ARG A 1 87  ? 10.701  -17.547 -22.023 1.00 68.72  ? 182 ARG A CD  1 
ATOM   678  N NE  . ARG A 1 87  ? 10.405  -17.157 -20.643 1.00 76.04  ? 182 ARG A NE  1 
ATOM   679  C CZ  . ARG A 1 87  ? 10.378  -15.906 -20.190 1.00 89.12  ? 182 ARG A CZ  1 
ATOM   680  N NH1 . ARG A 1 87  ? 10.621  -14.887 -21.009 1.00 75.24  ? 182 ARG A NH1 1 
ATOM   681  N NH2 . ARG A 1 87  ? 10.097  -15.662 -18.917 1.00 77.17  ? 182 ARG A NH2 1 
ATOM   682  N N   . TYR A 1 88  ? 15.612  -15.423 -21.373 1.00 47.61  ? 183 TYR A N   1 
ATOM   683  C CA  . TYR A 1 88  ? 16.179  -14.624 -20.289 1.00 47.22  ? 183 TYR A CA  1 
ATOM   684  C C   . TYR A 1 88  ? 15.028  -14.017 -19.509 1.00 51.46  ? 183 TYR A C   1 
ATOM   685  O O   . TYR A 1 88  ? 14.282  -13.188 -20.031 1.00 50.58  ? 183 TYR A O   1 
ATOM   686  C CB  . TYR A 1 88  ? 17.198  -13.598 -20.799 1.00 48.00  ? 183 TYR A CB  1 
ATOM   687  C CG  . TYR A 1 88  ? 18.522  -14.245 -21.140 1.00 48.86  ? 183 TYR A CG  1 
ATOM   688  C CD1 . TYR A 1 88  ? 19.459  -14.514 -20.148 1.00 50.80  ? 183 TYR A CD1 1 
ATOM   689  C CD2 . TYR A 1 88  ? 18.811  -14.636 -22.443 1.00 49.35  ? 183 TYR A CD2 1 
ATOM   690  C CE1 . TYR A 1 88  ? 20.673  -15.127 -20.454 1.00 52.14  ? 183 TYR A CE1 1 
ATOM   691  C CE2 . TYR A 1 88  ? 20.020  -15.253 -22.757 1.00 50.11  ? 183 TYR A CE2 1 
ATOM   692  C CZ  . TYR A 1 88  ? 20.953  -15.489 -21.761 1.00 57.46  ? 183 TYR A CZ  1 
ATOM   693  O OH  . TYR A 1 88  ? 22.141  -16.108 -22.059 1.00 59.40  ? 183 TYR A OH  1 
ATOM   694  N N   . HIS A 1 89  ? 14.814  -14.550 -18.299 1.00 48.86  ? 184 HIS A N   1 
ATOM   695  C CA  . HIS A 1 89  ? 13.715  -14.195 -17.415 1.00 48.70  ? 184 HIS A CA  1 
ATOM   696  C C   . HIS A 1 89  ? 14.091  -13.109 -16.423 1.00 51.16  ? 184 HIS A C   1 
ATOM   697  O O   . HIS A 1 89  ? 15.125  -13.197 -15.764 1.00 50.87  ? 184 HIS A O   1 
ATOM   698  C CB  . HIS A 1 89  ? 13.176  -15.448 -16.704 1.00 49.69  ? 184 HIS A CB  1 
ATOM   699  C CG  . HIS A 1 89  ? 12.015  -15.159 -15.810 1.00 53.47  ? 184 HIS A CG  1 
ATOM   700  N ND1 . HIS A 1 89  ? 10.772  -14.849 -16.325 1.00 55.42  ? 184 HIS A ND1 1 
ATOM   701  C CD2 . HIS A 1 89  ? 11.957  -15.095 -14.459 1.00 55.19  ? 184 HIS A CD2 1 
ATOM   702  C CE1 . HIS A 1 89  ? 9.998   -14.623 -15.280 1.00 54.73  ? 184 HIS A CE1 1 
ATOM   703  N NE2 . HIS A 1 89  ? 10.666  -14.757 -14.137 1.00 54.98  ? 184 HIS A NE2 1 
ATOM   704  N N   . THR A 1 90  ? 13.239  -12.089 -16.318 1.00 46.89  ? 185 THR A N   1 
ATOM   705  C CA  . THR A 1 90  ? 13.447  -10.969 -15.413 1.00 46.19  ? 185 THR A CA  1 
ATOM   706  C C   . THR A 1 90  ? 12.553  -11.080 -14.180 1.00 47.66  ? 185 THR A C   1 
ATOM   707  O O   . THR A 1 90  ? 11.341  -11.253 -14.303 1.00 47.30  ? 185 THR A O   1 
ATOM   708  C CB  . THR A 1 90  ? 13.307  -9.633  -16.171 1.00 57.73  ? 185 THR A CB  1 
ATOM   709  O OG1 . THR A 1 90  ? 14.240  -9.598  -17.254 1.00 61.28  ? 185 THR A OG1 1 
ATOM   710  C CG2 . THR A 1 90  ? 13.555  -8.436  -15.287 1.00 56.31  ? 185 THR A CG2 1 
ATOM   711  N N   . VAL A 1 91  ? 13.173  -10.997 -12.996 1.00 41.52  ? 186 VAL A N   1 
ATOM   712  C CA  . VAL A 1 91  ? 12.511  -10.991 -11.693 1.00 39.90  ? 186 VAL A CA  1 
ATOM   713  C C   . VAL A 1 91  ? 12.684  -9.552  -11.207 1.00 40.29  ? 186 VAL A C   1 
ATOM   714  O O   . VAL A 1 91  ? 13.761  -8.974  -11.368 1.00 39.49  ? 186 VAL A O   1 
ATOM   715  C CB  . VAL A 1 91  ? 13.121  -12.053 -10.731 1.00 44.30  ? 186 VAL A CB  1 
ATOM   716  C CG1 . VAL A 1 91  ? 12.710  -11.824 -9.272  1.00 44.10  ? 186 VAL A CG1 1 
ATOM   717  C CG2 . VAL A 1 91  ? 12.745  -13.465 -11.177 1.00 44.18  ? 186 VAL A CG2 1 
ATOM   718  N N   . HIS A 1 92  ? 11.615  -8.954  -10.685 1.00 34.99  ? 187 HIS A N   1 
ATOM   719  C CA  . HIS A 1 92  ? 11.635  -7.567  -10.238 1.00 33.71  ? 187 HIS A CA  1 
ATOM   720  C C   . HIS A 1 92  ? 11.572  -7.455  -8.740  1.00 36.98  ? 187 HIS A C   1 
ATOM   721  O O   . HIS A 1 92  ? 10.858  -8.214  -8.080  1.00 36.92  ? 187 HIS A O   1 
ATOM   722  C CB  . HIS A 1 92  ? 10.494  -6.778  -10.879 1.00 34.17  ? 187 HIS A CB  1 
ATOM   723  C CG  . HIS A 1 92  ? 10.524  -6.802  -12.374 1.00 37.24  ? 187 HIS A CG  1 
ATOM   724  N ND1 . HIS A 1 92  ? 9.930   -7.825  -13.087 1.00 38.92  ? 187 HIS A ND1 1 
ATOM   725  C CD2 . HIS A 1 92  ? 11.081  -5.929  -13.243 1.00 38.88  ? 187 HIS A CD2 1 
ATOM   726  C CE1 . HIS A 1 92  ? 10.132  -7.539  -14.362 1.00 38.17  ? 187 HIS A CE1 1 
ATOM   727  N NE2 . HIS A 1 92  ? 10.820  -6.409  -14.507 1.00 38.85  ? 187 HIS A NE2 1 
ATOM   728  N N   . GLU A 1 93  ? 12.333  -6.497  -8.203  1.00 33.48  ? 188 GLU A N   1 
ATOM   729  C CA  . GLU A 1 93  ? 12.429  -6.196  -6.775  1.00 33.11  ? 188 GLU A CA  1 
ATOM   730  C C   . GLU A 1 93  ? 12.912  -7.385  -5.927  1.00 34.46  ? 188 GLU A C   1 
ATOM   731  O O   . GLU A 1 93  ? 12.464  -7.559  -4.799  1.00 33.67  ? 188 GLU A O   1 
ATOM   732  C CB  . GLU A 1 93  ? 11.121  -5.577  -6.240  1.00 34.74  ? 188 GLU A CB  1 
ATOM   733  C CG  . GLU A 1 93  ? 10.618  -4.393  -7.053  1.00 43.01  ? 188 GLU A CG  1 
ATOM   734  C CD  . GLU A 1 93  ? 9.746   -3.412  -6.296  1.00 63.66  ? 188 GLU A CD  1 
ATOM   735  O OE1 . GLU A 1 93  ? 8.887   -3.857  -5.503  1.00 55.82  ? 188 GLU A OE1 1 
ATOM   736  O OE2 . GLU A 1 93  ? 9.912   -2.189  -6.509  1.00 69.11  ? 188 GLU A OE2 1 
ATOM   737  N N   . LEU A 1 94  ? 13.851  -8.182  -6.467  1.00 29.65  ? 189 LEU A N   1 
ATOM   738  C CA  . LEU A 1 94  ? 14.445  -9.316  -5.768  1.00 29.06  ? 189 LEU A CA  1 
ATOM   739  C C   . LEU A 1 94  ? 15.387  -8.856  -4.650  1.00 33.05  ? 189 LEU A C   1 
ATOM   740  O O   . LEU A 1 94  ? 15.275  -9.335  -3.521  1.00 33.22  ? 189 LEU A O   1 
ATOM   741  C CB  . LEU A 1 94  ? 15.178  -10.239 -6.761  1.00 28.89  ? 189 LEU A CB  1 
ATOM   742  C CG  . LEU A 1 94  ? 15.758  -11.571 -6.234  1.00 33.17  ? 189 LEU A CG  1 
ATOM   743  C CD1 . LEU A 1 94  ? 14.746  -12.350 -5.372  1.00 33.76  ? 189 LEU A CD1 1 
ATOM   744  C CD2 . LEU A 1 94  ? 16.215  -12.439 -7.382  1.00 33.90  ? 189 LEU A CD2 1 
ATOM   745  N N   . SER A 1 95  ? 16.290  -7.916  -4.966  1.00 29.43  ? 190 SER A N   1 
ATOM   746  C CA  . SER A 1 95  ? 17.286  -7.402  -4.031  1.00 28.99  ? 190 SER A CA  1 
ATOM   747  C C   . SER A 1 95  ? 16.964  -6.011  -3.503  1.00 33.21  ? 190 SER A C   1 
ATOM   748  O O   . SER A 1 95  ? 16.269  -5.230  -4.158  1.00 32.51  ? 190 SER A O   1 
ATOM   749  C CB  . SER A 1 95  ? 18.672  -7.405  -4.675  1.00 31.74  ? 190 SER A CB  1 
ATOM   750  O OG  . SER A 1 95  ? 19.023  -8.672  -5.205  1.00 36.67  ? 190 SER A OG  1 
ATOM   751  N N   . ALA A 1 96  ? 17.467  -5.724  -2.292  1.00 29.94  ? 191 ALA A N   1 
ATOM   752  C CA  . ALA A 1 96  ? 17.377  -4.441  -1.611  1.00 29.70  ? 191 ALA A CA  1 
ATOM   753  C C   . ALA A 1 96  ? 18.403  -3.521  -2.278  1.00 34.01  ? 191 ALA A C   1 
ATOM   754  O O   . ALA A 1 96  ? 19.501  -3.981  -2.609  1.00 32.35  ? 191 ALA A O   1 
ATOM   755  C CB  . ALA A 1 96  ? 17.736  -4.621  -0.145  1.00 30.37  ? 191 ALA A CB  1 
ATOM   756  N N   . ARG A 1 97  ? 18.031  -2.246  -2.516  1.00 32.62  ? 192 ARG A N   1 
ATOM   757  C CA  . ARG A 1 97  ? 18.896  -1.228  -3.130  1.00 33.17  ? 192 ARG A CA  1 
ATOM   758  C C   . ARG A 1 97  ? 19.445  -0.353  -2.028  1.00 39.27  ? 192 ARG A C   1 
ATOM   759  O O   . ARG A 1 97  ? 20.601  0.073   -2.082  1.00 39.20  ? 192 ARG A O   1 
ATOM   760  C CB  . ARG A 1 97  ? 18.118  -0.378  -4.159  1.00 32.90  ? 192 ARG A CB  1 
ATOM   761  C CG  . ARG A 1 97  ? 18.961  0.666   -4.913  1.00 46.21  ? 192 ARG A CG  1 
ATOM   762  C CD  . ARG A 1 97  ? 18.237  1.296   -6.097  1.00 60.29  ? 192 ARG A CD  1 
ATOM   763  N NE  . ARG A 1 97  ? 18.152  0.384   -7.240  1.00 68.90  ? 192 ARG A NE  1 
ATOM   764  C CZ  . ARG A 1 97  ? 18.342  0.738   -8.508  1.00 83.86  ? 192 ARG A CZ  1 
ATOM   765  N NH1 . ARG A 1 97  ? 18.243  -0.162  -9.477  1.00 72.14  ? 192 ARG A NH1 1 
ATOM   766  N NH2 . ARG A 1 97  ? 18.632  1.998   -8.818  1.00 70.37  ? 192 ARG A NH2 1 
ATOM   767  N N   . GLU A 1 98  ? 18.601  -0.087  -1.017  1.00 36.95  ? 193 GLU A N   1 
ATOM   768  C CA  . GLU A 1 98  ? 18.881  0.751   0.152   1.00 36.95  ? 193 GLU A CA  1 
ATOM   769  C C   . GLU A 1 98  ? 18.309  0.122   1.400   1.00 40.91  ? 193 GLU A C   1 
ATOM   770  O O   . GLU A 1 98  ? 17.304  -0.585  1.347   1.00 41.13  ? 193 GLU A O   1 
ATOM   771  C CB  . GLU A 1 98  ? 18.274  2.143   -0.066  1.00 38.45  ? 193 GLU A CB  1 
ATOM   772  C CG  . GLU A 1 98  ? 19.310  3.237   -0.229  1.00 49.39  ? 193 GLU A CG  1 
ATOM   773  C CD  . GLU A 1 98  ? 19.027  4.204   -1.363  1.00 71.77  ? 193 GLU A CD  1 
ATOM   774  O OE1 . GLU A 1 98  ? 18.113  5.047   -1.212  1.00 63.18  ? 193 GLU A OE1 1 
ATOM   775  O OE2 . GLU A 1 98  ? 19.719  4.121   -2.404  1.00 68.16  ? 193 GLU A OE2 1 
ATOM   776  N N   . CYS A 1 99  ? 18.939  0.384   2.535   1.00 37.83  ? 194 CYS A N   1 
ATOM   777  C CA  . CYS A 1 99  ? 18.559  -0.152  3.843   1.00 38.55  ? 194 CYS A CA  1 
ATOM   778  C C   . CYS A 1 99  ? 18.446  1.008   4.813   1.00 44.58  ? 194 CYS A C   1 
ATOM   779  O O   . CYS A 1 99  ? 19.105  2.028   4.632   1.00 44.73  ? 194 CYS A O   1 
ATOM   780  C CB  . CYS A 1 99  ? 19.568  -1.184  4.342   1.00 38.79  ? 194 CYS A CB  1 
ATOM   781  S SG  . CYS A 1 99  ? 19.730  -2.617  3.275   1.00 43.07  ? 194 CYS A SG  1 
ATOM   782  N N   . ALA A 1 100 ? 17.636  0.820   5.861   1.00 42.54  ? 195 ALA A N   1 
ATOM   783  C CA  . ALA A 1 100 ? 17.443  1.785   6.961   1.00 43.07  ? 195 ALA A CA  1 
ATOM   784  C C   . ALA A 1 100 ? 16.734  1.134   8.127   1.00 49.35  ? 195 ALA A C   1 
ATOM   785  O O   . ALA A 1 100 ? 16.233  0.006   8.012   1.00 49.88  ? 195 ALA A O   1 
ATOM   786  C CB  . ALA A 1 100 ? 16.661  2.999   6.478   1.00 43.94  ? 195 ALA A CB  1 
ATOM   787  N N   . CYS A 1 101 ? 16.686  1.850   9.239   1.00 47.43  ? 196 CYS A N   1 
ATOM   788  C CA  . CYS A 1 101 ? 15.982  1.429   10.441  1.00 48.83  ? 196 CYS A CA  1 
ATOM   789  C C   . CYS A 1 101 ? 14.636  2.148   10.396  1.00 53.08  ? 196 CYS A C   1 
ATOM   790  O O   . CYS A 1 101 ? 14.599  3.383   10.398  1.00 53.21  ? 196 CYS A O   1 
ATOM   791  C CB  . CYS A 1 101 ? 16.771  1.783   11.699  1.00 49.84  ? 196 CYS A CB  1 
ATOM   792  S SG  . CYS A 1 101 ? 18.535  1.392   11.596  1.00 54.83  ? 196 CYS A SG  1 
ATOM   793  N N   . VAL A 1 102 ? 13.546  1.379   10.258  1.00 49.50  ? 197 VAL A N   1 
ATOM   794  C CA  . VAL A 1 102 ? 12.181  1.908   10.203  1.00 51.70  ? 197 VAL A CA  1 
ATOM   795  C C   . VAL A 1 102 ? 11.482  1.510   11.506  1.00 55.71  ? 197 VAL A C   1 
ATOM   796  O O   . VAL A 1 102 ? 11.416  2.353   12.426  1.00 53.66  ? 197 VAL A O   1 
ATOM   797  C CB  . VAL A 1 102 ? 11.363  1.515   8.926   1.00 55.07  ? 197 VAL A CB  1 
ATOM   798  C CG1 . VAL A 1 102 ? 10.527  2.691   8.432   1.00 54.87  ? 197 VAL A CG1 1 
ATOM   799  C CG2 . VAL A 1 102 ? 12.256  0.993   7.802   1.00 54.78  ? 197 VAL A CG2 1 
ATOM   800  O OXT . VAL A 1 102 ? 11.133  0.322   11.665  1.00 72.02  ? 197 VAL A OXT 1 
ATOM   801  N N   . ARG B 1 2   ? -3.274  -16.183 11.918  1.00 55.78  ? 97  ARG B N   1 
ATOM   802  C CA  . ARG B 1 2   ? -4.579  -15.580 12.172  1.00 55.82  ? 97  ARG B CA  1 
ATOM   803  C C   . ARG B 1 2   ? -5.071  -14.769 10.967  1.00 58.94  ? 97  ARG B C   1 
ATOM   804  O O   . ARG B 1 2   ? -4.545  -13.682 10.683  1.00 59.04  ? 97  ARG B O   1 
ATOM   805  C CB  . ARG B 1 2   ? -4.555  -14.720 13.454  1.00 57.44  ? 97  ARG B CB  1 
ATOM   806  C CG  . ARG B 1 2   ? -5.935  -14.203 13.874  1.00 67.45  ? 97  ARG B CG  1 
ATOM   807  C CD  . ARG B 1 2   ? -5.851  -13.128 14.956  1.00 74.85  ? 97  ARG B CD  1 
ATOM   808  N NE  . ARG B 1 2   ? -6.887  -12.067 14.966  1.00 79.73  ? 97  ARG B NE  1 
ATOM   809  C CZ  . ARG B 1 2   ? -7.986  -12.002 14.212  1.00 88.03  ? 97  ARG B CZ  1 
ATOM   810  N NH1 . ARG B 1 2   ? -8.250  -12.930 13.305  1.00 72.45  ? 97  ARG B NH1 1 
ATOM   811  N NH2 . ARG B 1 2   ? -8.814  -10.966 14.335  1.00 71.40  ? 97  ARG B NH2 1 
ATOM   812  N N   . LEU B 1 3   ? -6.109  -15.292 10.289  1.00 53.64  ? 98  LEU B N   1 
ATOM   813  C CA  . LEU B 1 3   ? -6.723  -14.676 9.112   1.00 52.41  ? 98  LEU B CA  1 
ATOM   814  C C   . LEU B 1 3   ? -7.739  -13.614 9.542   1.00 53.58  ? 98  LEU B C   1 
ATOM   815  O O   . LEU B 1 3   ? -8.651  -13.906 10.321  1.00 53.23  ? 98  LEU B O   1 
ATOM   816  C CB  . LEU B 1 3   ? -7.383  -15.760 8.225   1.00 52.55  ? 98  LEU B CB  1 
ATOM   817  C CG  . LEU B 1 3   ? -6.510  -16.614 7.251   1.00 57.77  ? 98  LEU B CG  1 
ATOM   818  C CD1 . LEU B 1 3   ? -6.550  -16.078 5.836   1.00 58.10  ? 98  LEU B CD1 1 
ATOM   819  C CD2 . LEU B 1 3   ? -5.066  -16.848 7.743   1.00 60.91  ? 98  LEU B CD2 1 
ATOM   820  N N   . GLY B 1 4   ? -7.559  -12.393 9.046   1.00 48.05  ? 99  GLY B N   1 
ATOM   821  C CA  . GLY B 1 4   ? -8.432  -11.265 9.357   1.00 47.03  ? 99  GLY B CA  1 
ATOM   822  C C   . GLY B 1 4   ? -8.120  -10.627 10.690  1.00 49.40  ? 99  GLY B C   1 
ATOM   823  O O   . GLY B 1 4   ? -9.033  -10.259 11.433  1.00 48.61  ? 99  GLY B O   1 
ATOM   824  N N   . ALA B 1 5   ? -6.812  -10.478 10.982  1.00 45.27  ? 100 ALA B N   1 
ATOM   825  C CA  . ALA B 1 5   ? -6.283  -9.893  12.213  1.00 44.42  ? 100 ALA B CA  1 
ATOM   826  C C   . ALA B 1 5   ? -6.441  -8.370  12.307  1.00 46.41  ? 100 ALA B C   1 
ATOM   827  O O   . ALA B 1 5   ? -6.452  -7.847  13.428  1.00 47.06  ? 100 ALA B O   1 
ATOM   828  C CB  . ALA B 1 5   ? -4.825  -10.293 12.403  1.00 45.21  ? 100 ALA B CB  1 
ATOM   829  N N   . ARG B 1 6   ? -6.582  -7.693  11.118  1.00 40.22  ? 101 ARG B N   1 
ATOM   830  C CA  A ARG B 1 6   ? -6.718  -6.238  10.884  0.50 39.73  ? 101 ARG B CA  1 
ATOM   831  C CA  B ARG B 1 6   ? -6.715  -6.247  10.847  0.50 39.75  ? 101 ARG B CA  1 
ATOM   832  C C   . ARG B 1 6   ? -5.432  -5.669  10.261  1.00 43.60  ? 101 ARG B C   1 
ATOM   833  O O   . ARG B 1 6   ? -4.365  -5.789  10.878  1.00 42.79  ? 101 ARG B O   1 
ATOM   834  C CB  A ARG B 1 6   ? -7.119  -5.438  12.151  0.50 39.20  ? 101 ARG B CB  1 
ATOM   835  C CB  B ARG B 1 6   ? -7.210  -5.400  12.045  0.50 39.35  ? 101 ARG B CB  1 
ATOM   836  C CG  A ARG B 1 6   ? -7.354  -3.953  11.906  0.50 44.74  ? 101 ARG B CG  1 
ATOM   837  C CG  B ARG B 1 6   ? -7.655  -3.996  11.645  0.50 45.06  ? 101 ARG B CG  1 
ATOM   838  C CD  A ARG B 1 6   ? -8.600  -3.475  12.605  0.50 48.73  ? 101 ARG B CD  1 
ATOM   839  C CD  B ARG B 1 6   ? -8.067  -3.169  12.831  0.50 48.05  ? 101 ARG B CD  1 
ATOM   840  N NE  A ARG B 1 6   ? -8.366  -2.282  13.419  0.50 52.55  ? 101 ARG B NE  1 
ATOM   841  N NE  B ARG B 1 6   ? -8.256  -1.765  12.465  0.50 50.27  ? 101 ARG B NE  1 
ATOM   842  C CZ  A ARG B 1 6   ? -8.804  -2.129  14.665  0.50 59.41  ? 101 ARG B CZ  1 
ATOM   843  C CZ  B ARG B 1 6   ? -8.428  -0.775  13.337  0.50 58.16  ? 101 ARG B CZ  1 
ATOM   844  N NH1 A ARG B 1 6   ? -8.551  -1.009  15.330  0.50 45.74  ? 101 ARG B NH1 1 
ATOM   845  N NH1 B ARG B 1 6   ? -8.583  0.471   12.912  0.50 38.18  ? 101 ARG B NH1 1 
ATOM   846  N NH2 A ARG B 1 6   ? -9.499  -3.095  15.256  0.50 41.39  ? 101 ARG B NH2 1 
ATOM   847  N NH2 B ARG B 1 6   ? -8.435  -1.022  14.642  0.50 47.12  ? 101 ARG B NH2 1 
ATOM   848  N N   . PRO B 1 7   ? -5.498  -5.020  9.066   1.00 39.81  ? 102 PRO B N   1 
ATOM   849  C CA  . PRO B 1 7   ? -4.267  -4.479  8.478   1.00 39.18  ? 102 PRO B CA  1 
ATOM   850  C C   . PRO B 1 7   ? -3.576  -3.370  9.272   1.00 41.49  ? 102 PRO B C   1 
ATOM   851  O O   . PRO B 1 7   ? -4.174  -2.702  10.117  1.00 40.59  ? 102 PRO B O   1 
ATOM   852  C CB  . PRO B 1 7   ? -4.726  -3.954  7.107   1.00 41.03  ? 102 PRO B CB  1 
ATOM   853  C CG  . PRO B 1 7   ? -5.985  -4.658  6.824   1.00 45.23  ? 102 PRO B CG  1 
ATOM   854  C CD  . PRO B 1 7   ? -6.642  -4.783  8.160   1.00 40.74  ? 102 PRO B CD  1 
ATOM   855  N N   . CYS B 1 8   ? -2.280  -3.204  8.975   1.00 37.38  ? 103 CYS B N   1 
ATOM   856  C CA  . CYS B 1 8   ? -1.395  -2.183  9.507   1.00 36.68  ? 103 CYS B CA  1 
ATOM   857  C C   . CYS B 1 8   ? -2.000  -0.829  9.167   1.00 39.37  ? 103 CYS B C   1 
ATOM   858  O O   . CYS B 1 8   ? -2.386  -0.594  8.018   1.00 38.39  ? 103 CYS B O   1 
ATOM   859  C CB  . CYS B 1 8   ? 0.005   -2.339  8.920   1.00 37.15  ? 103 CYS B CB  1 
ATOM   860  S SG  . CYS B 1 8   ? 1.084   -0.913  9.200   1.00 40.95  ? 103 CYS B SG  1 
ATOM   861  N N   . GLY B 1 9   ? -2.103  0.031   10.164  1.00 36.05  ? 104 GLY B N   1 
ATOM   862  C CA  . GLY B 1 9   ? -2.660  1.356   9.970   1.00 35.83  ? 104 GLY B CA  1 
ATOM   863  C C   . GLY B 1 9   ? -2.464  2.272   11.147  1.00 40.25  ? 104 GLY B C   1 
ATOM   864  O O   . GLY B 1 9   ? -1.990  1.863   12.212  1.00 39.47  ? 104 GLY B O   1 
ATOM   865  N N   . LEU B 1 10  ? -2.839  3.534   10.933  1.00 38.00  ? 105 LEU B N   1 
ATOM   866  C CA  . LEU B 1 10  ? -2.753  4.615   11.902  1.00 38.29  ? 105 LEU B CA  1 
ATOM   867  C C   . LEU B 1 10  ? -3.810  4.414   12.968  1.00 42.34  ? 105 LEU B C   1 
ATOM   868  O O   . LEU B 1 10  ? -4.934  3.996   12.671  1.00 42.22  ? 105 LEU B O   1 
ATOM   869  C CB  . LEU B 1 10  ? -2.945  5.947   11.156  1.00 38.67  ? 105 LEU B CB  1 
ATOM   870  C CG  . LEU B 1 10  ? -2.087  7.188   11.510  1.00 43.86  ? 105 LEU B CG  1 
ATOM   871  C CD1 . LEU B 1 10  ? -0.747  6.846   12.124  1.00 43.81  ? 105 LEU B CD1 1 
ATOM   872  C CD2 . LEU B 1 10  ? -1.878  8.060   10.289  1.00 47.14  ? 105 LEU B CD2 1 
ATOM   873  N N   . ARG B 1 11  ? -3.412  4.635   14.224  1.00 39.09  ? 106 ARG B N   1 
ATOM   874  C CA  . ARG B 1 11  ? -4.268  4.514   15.404  1.00 38.81  ? 106 ARG B CA  1 
ATOM   875  C C   . ARG B 1 11  ? -4.117  5.773   16.260  1.00 43.60  ? 106 ARG B C   1 
ATOM   876  O O   . ARG B 1 11  ? -3.009  6.293   16.393  1.00 43.01  ? 106 ARG B O   1 
ATOM   877  C CB  . ARG B 1 11  ? -3.919  3.257   16.220  1.00 37.63  ? 106 ARG B CB  1 
ATOM   878  C CG  . ARG B 1 11  ? -3.777  1.964   15.427  1.00 39.29  ? 106 ARG B CG  1 
ATOM   879  C CD  . ARG B 1 11  ? -5.107  1.293   15.145  1.00 38.02  ? 106 ARG B CD  1 
ATOM   880  N NE  . ARG B 1 11  ? -4.911  -0.034  14.563  1.00 28.57  ? 106 ARG B NE  1 
ATOM   881  C CZ  . ARG B 1 11  ? -4.947  -0.296  13.264  1.00 38.11  ? 106 ARG B CZ  1 
ATOM   882  N NH1 . ARG B 1 11  ? -4.748  -1.528  12.826  1.00 32.24  ? 106 ARG B NH1 1 
ATOM   883  N NH2 . ARG B 1 11  ? -5.190  0.673   12.392  1.00 26.32  ? 106 ARG B NH2 1 
ATOM   884  N N   . GLU B 1 12  ? -5.238  6.269   16.811  1.00 41.13  ? 107 GLU B N   1 
ATOM   885  C CA  . GLU B 1 12  ? -5.315  7.490   17.613  1.00 41.22  ? 107 GLU B CA  1 
ATOM   886  C C   . GLU B 1 12  ? -5.893  7.242   18.994  1.00 46.15  ? 107 GLU B C   1 
ATOM   887  O O   . GLU B 1 12  ? -6.944  6.610   19.133  1.00 45.94  ? 107 GLU B O   1 
ATOM   888  C CB  . GLU B 1 12  ? -6.173  8.548   16.899  1.00 42.61  ? 107 GLU B CB  1 
ATOM   889  C CG  . GLU B 1 12  ? -5.377  9.587   16.138  1.00 55.56  ? 107 GLU B CG  1 
ATOM   890  C CD  . GLU B 1 12  ? -6.190  10.528  15.267  1.00 80.08  ? 107 GLU B CD  1 
ATOM   891  O OE1 . GLU B 1 12  ? -6.278  10.284  14.040  1.00 74.22  ? 107 GLU B OE1 1 
ATOM   892  O OE2 . GLU B 1 12  ? -6.724  11.523  15.805  1.00 78.63  ? 107 GLU B OE2 1 
ATOM   893  N N   . LEU B 1 13  ? -5.220  7.778   20.016  1.00 43.21  ? 108 LEU B N   1 
ATOM   894  C CA  . LEU B 1 13  ? -5.669  7.701   21.400  1.00 42.95  ? 108 LEU B CA  1 
ATOM   895  C C   . LEU B 1 13  ? -5.256  8.925   22.216  1.00 45.85  ? 108 LEU B C   1 
ATOM   896  O O   . LEU B 1 13  ? -4.150  9.446   22.043  1.00 44.69  ? 108 LEU B O   1 
ATOM   897  C CB  . LEU B 1 13  ? -5.330  6.344   22.070  1.00 42.96  ? 108 LEU B CB  1 
ATOM   898  C CG  . LEU B 1 13  ? -4.123  6.225   22.997  1.00 47.77  ? 108 LEU B CG  1 
ATOM   899  C CD1 . LEU B 1 13  ? -4.403  5.248   24.108  1.00 48.10  ? 108 LEU B CD1 1 
ATOM   900  C CD2 . LEU B 1 13  ? -2.893  5.802   22.244  1.00 50.10  ? 108 LEU B CD2 1 
ATOM   901  N N   . GLU B 1 14  ? -6.186  9.418   23.049  1.00 43.17  ? 109 GLU B N   1 
ATOM   902  C CA  . GLU B 1 14  ? -5.982  10.563  23.936  1.00 43.76  ? 109 GLU B CA  1 
ATOM   903  C C   . GLU B 1 14  ? -5.141  10.101  25.115  1.00 47.18  ? 109 GLU B C   1 
ATOM   904  O O   . GLU B 1 14  ? -5.458  9.082   25.732  1.00 47.53  ? 109 GLU B O   1 
ATOM   905  C CB  . GLU B 1 14  ? -7.325  11.088  24.474  1.00 45.64  ? 109 GLU B CB  1 
ATOM   906  C CG  . GLU B 1 14  ? -7.986  12.192  23.669  1.00 61.61  ? 109 GLU B CG  1 
ATOM   907  C CD  . GLU B 1 14  ? -7.882  13.580  24.275  1.00 85.07  ? 109 GLU B CD  1 
ATOM   908  O OE1 . GLU B 1 14  ? -8.923  14.110  24.729  1.00 81.86  ? 109 GLU B OE1 1 
ATOM   909  O OE2 . GLU B 1 14  ? -6.762  14.139  24.292  1.00 80.65  ? 109 GLU B OE2 1 
ATOM   910  N N   . VAL B 1 15  ? -4.065  10.829  25.421  1.00 43.32  ? 110 VAL B N   1 
ATOM   911  C CA  . VAL B 1 15  ? -3.166  10.505  26.535  1.00 42.92  ? 110 VAL B CA  1 
ATOM   912  C C   . VAL B 1 15  ? -2.743  11.776  27.268  1.00 46.97  ? 110 VAL B C   1 
ATOM   913  O O   . VAL B 1 15  ? -2.783  12.864  26.693  1.00 46.42  ? 110 VAL B O   1 
ATOM   914  C CB  . VAL B 1 15  ? -1.909  9.657   26.127  1.00 46.39  ? 110 VAL B CB  1 
ATOM   915  C CG1 . VAL B 1 15  ? -2.287  8.305   25.535  1.00 46.03  ? 110 VAL B CG1 1 
ATOM   916  C CG2 . VAL B 1 15  ? -0.963  10.417  25.196  1.00 46.06  ? 110 VAL B CG2 1 
ATOM   917  N N   . ARG B 1 16  ? -2.298  11.620  28.524  1.00 43.51  ? 111 ARG B N   1 
ATOM   918  C CA  . ARG B 1 16  ? -1.691  12.677  29.329  1.00 42.98  ? 111 ARG B CA  1 
ATOM   919  C C   . ARG B 1 16  ? -0.214  12.585  28.950  1.00 44.91  ? 111 ARG B C   1 
ATOM   920  O O   . ARG B 1 16  ? 0.271   11.473  28.711  1.00 43.47  ? 111 ARG B O   1 
ATOM   921  C CB  . ARG B 1 16  ? -1.828  12.371  30.833  1.00 44.25  ? 111 ARG B CB  1 
ATOM   922  C CG  . ARG B 1 16  ? -2.920  13.128  31.564  1.00 57.00  ? 111 ARG B CG  1 
ATOM   923  C CD  . ARG B 1 16  ? -4.280  12.439  31.487  1.00 69.06  ? 111 ARG B CD  1 
ATOM   924  N NE  . ARG B 1 16  ? -5.210  12.896  32.519  1.00 74.54  ? 111 ARG B NE  1 
ATOM   925  C CZ  . ARG B 1 16  ? -5.658  14.142  32.661  1.00 86.79  ? 111 ARG B CZ  1 
ATOM   926  N NH1 . ARG B 1 16  ? -5.236  15.097  31.830  1.00 74.61  ? 111 ARG B NH1 1 
ATOM   927  N NH2 . ARG B 1 16  ? -6.508  14.453  33.620  1.00 75.02  ? 111 ARG B NH2 1 
ATOM   928  N N   . VAL B 1 17  ? 0.506   13.725  28.885  1.00 40.90  ? 112 VAL B N   1 
ATOM   929  C CA  . VAL B 1 17  ? 1.939   13.697  28.555  1.00 40.42  ? 112 VAL B CA  1 
ATOM   930  C C   . VAL B 1 17  ? 2.744   12.911  29.616  1.00 43.95  ? 112 VAL B C   1 
ATOM   931  O O   . VAL B 1 17  ? 3.715   12.236  29.275  1.00 42.76  ? 112 VAL B O   1 
ATOM   932  C CB  . VAL B 1 17  ? 2.575   15.044  28.045  1.00 44.10  ? 112 VAL B CB  1 
ATOM   933  C CG1 . VAL B 1 17  ? 1.574   16.190  28.020  1.00 43.92  ? 112 VAL B CG1 1 
ATOM   934  C CG2 . VAL B 1 17  ? 3.825   15.443  28.818  1.00 43.73  ? 112 VAL B CG2 1 
ATOM   935  N N   . SER B 1 18  ? 2.272   12.941  30.880  1.00 42.02  ? 113 SER B N   1 
ATOM   936  C CA  . SER B 1 18  ? 2.840   12.211  32.026  1.00 42.51  ? 113 SER B CA  1 
ATOM   937  C C   . SER B 1 18  ? 2.905   10.687  31.790  1.00 49.01  ? 113 SER B C   1 
ATOM   938  O O   . SER B 1 18  ? 3.920   10.067  32.122  1.00 49.33  ? 113 SER B O   1 
ATOM   939  C CB  . SER B 1 18  ? 2.069   12.518  33.309  1.00 45.27  ? 113 SER B CB  1 
ATOM   940  O OG  . SER B 1 18  ? 0.762   13.025  33.082  1.00 52.67  ? 113 SER B OG  1 
ATOM   941  N N   . GLU B 1 19  ? 1.844   10.106  31.178  1.00 46.56  ? 114 GLU B N   1 
ATOM   942  C CA  . GLU B 1 19  ? 1.708   8.676   30.844  1.00 46.62  ? 114 GLU B CA  1 
ATOM   943  C C   . GLU B 1 19  ? 2.821   8.147   29.934  1.00 51.24  ? 114 GLU B C   1 
ATOM   944  O O   . GLU B 1 19  ? 3.105   6.950   29.963  1.00 51.40  ? 114 GLU B O   1 
ATOM   945  C CB  . GLU B 1 19  ? 0.379   8.421   30.126  1.00 47.98  ? 114 GLU B CB  1 
ATOM   946  C CG  . GLU B 1 19  ? -0.876  8.557   30.965  1.00 58.23  ? 114 GLU B CG  1 
ATOM   947  C CD  . GLU B 1 19  ? -2.135  8.476   30.123  1.00 76.18  ? 114 GLU B CD  1 
ATOM   948  O OE1 . GLU B 1 19  ? -2.301  7.465   29.404  1.00 65.14  ? 114 GLU B OE1 1 
ATOM   949  O OE2 . GLU B 1 19  ? -2.933  9.440   30.144  1.00 78.09  ? 114 GLU B OE2 1 
ATOM   950  N N   . LEU B 1 20  ? 3.394   9.018   29.077  1.00 46.87  ? 115 LEU B N   1 
ATOM   951  C CA  . LEU B 1 20  ? 4.434   8.654   28.109  1.00 46.21  ? 115 LEU B CA  1 
ATOM   952  C C   . LEU B 1 20  ? 5.772   8.304   28.771  1.00 50.12  ? 115 LEU B C   1 
ATOM   953  O O   . LEU B 1 20  ? 6.571   7.577   28.180  1.00 49.76  ? 115 LEU B O   1 
ATOM   954  C CB  . LEU B 1 20  ? 4.607   9.759   27.042  1.00 46.12  ? 115 LEU B CB  1 
ATOM   955  C CG  . LEU B 1 20  ? 3.334   10.239  26.290  1.00 50.23  ? 115 LEU B CG  1 
ATOM   956  C CD1 . LEU B 1 20  ? 3.605   11.515  25.525  1.00 50.30  ? 115 LEU B CD1 1 
ATOM   957  C CD2 . LEU B 1 20  ? 2.814   9.187   25.316  1.00 51.48  ? 115 LEU B CD2 1 
ATOM   958  N N   . GLY B 1 21  ? 5.981   8.797   29.994  1.00 47.10  ? 116 GLY B N   1 
ATOM   959  C CA  . GLY B 1 21  ? 7.185   8.550   30.778  1.00 47.19  ? 116 GLY B CA  1 
ATOM   960  C C   . GLY B 1 21  ? 8.429   9.139   30.151  1.00 51.70  ? 116 GLY B C   1 
ATOM   961  O O   . GLY B 1 21  ? 9.497   8.519   30.180  1.00 51.18  ? 116 GLY B O   1 
ATOM   962  N N   . LEU B 1 22  ? 8.280   10.339  29.559  1.00 48.42  ? 117 LEU B N   1 
ATOM   963  C CA  . LEU B 1 22  ? 9.365   11.073  28.904  1.00 48.24  ? 117 LEU B CA  1 
ATOM   964  C C   . LEU B 1 22  ? 10.045  12.047  29.876  1.00 53.10  ? 117 LEU B C   1 
ATOM   965  O O   . LEU B 1 22  ? 11.076  12.638  29.547  1.00 52.70  ? 117 LEU B O   1 
ATOM   966  C CB  . LEU B 1 22  ? 8.866   11.778  27.623  1.00 47.98  ? 117 LEU B CB  1 
ATOM   967  C CG  . LEU B 1 22  ? 8.308   10.864  26.516  1.00 52.05  ? 117 LEU B CG  1 
ATOM   968  C CD1 . LEU B 1 22  ? 7.606   11.658  25.452  1.00 51.97  ? 117 LEU B CD1 1 
ATOM   969  C CD2 . LEU B 1 22  ? 9.390   9.996   25.901  1.00 54.37  ? 117 LEU B CD2 1 
ATOM   970  N N   . GLY B 1 23  ? 9.484   12.163  31.077  1.00 50.02  ? 118 GLY B N   1 
ATOM   971  C CA  . GLY B 1 23  ? 10.035  12.998  32.135  1.00 49.76  ? 118 GLY B CA  1 
ATOM   972  C C   . GLY B 1 23  ? 9.493   14.409  32.194  1.00 53.34  ? 118 GLY B C   1 
ATOM   973  O O   . GLY B 1 23  ? 10.032  15.244  32.926  1.00 53.31  ? 118 GLY B O   1 
ATOM   974  N N   . TYR B 1 24  ? 8.416   14.682  31.446  1.00 48.93  ? 119 TYR B N   1 
ATOM   975  C CA  . TYR B 1 24  ? 7.783   15.994  31.439  1.00 48.28  ? 119 TYR B CA  1 
ATOM   976  C C   . TYR B 1 24  ? 6.739   16.072  32.543  1.00 51.44  ? 119 TYR B C   1 
ATOM   977  O O   . TYR B 1 24  ? 5.920   15.159  32.686  1.00 51.66  ? 119 TYR B O   1 
ATOM   978  C CB  . TYR B 1 24  ? 7.141   16.297  30.076  1.00 49.18  ? 119 TYR B CB  1 
ATOM   979  C CG  . TYR B 1 24  ? 8.112   16.409  28.924  1.00 50.33  ? 119 TYR B CG  1 
ATOM   980  C CD1 . TYR B 1 24  ? 8.834   17.581  28.710  1.00 52.29  ? 119 TYR B CD1 1 
ATOM   981  C CD2 . TYR B 1 24  ? 8.245   15.383  27.996  1.00 51.00  ? 119 TYR B CD2 1 
ATOM   982  C CE1 . TYR B 1 24  ? 9.700   17.708  27.625  1.00 52.78  ? 119 TYR B CE1 1 
ATOM   983  C CE2 . TYR B 1 24  ? 9.114   15.494  26.912  1.00 51.85  ? 119 TYR B CE2 1 
ATOM   984  C CZ  . TYR B 1 24  ? 9.835   16.663  26.727  1.00 59.22  ? 119 TYR B CZ  1 
ATOM   985  O OH  . TYR B 1 24  ? 10.683  16.783  25.652  1.00 61.65  ? 119 TYR B OH  1 
ATOM   986  N N   . ALA B 1 25  ? 6.767   17.172  33.313  1.00 46.26  ? 120 ALA B N   1 
ATOM   987  C CA  . ALA B 1 25  ? 5.839   17.422  34.407  1.00 45.21  ? 120 ALA B CA  1 
ATOM   988  C C   . ALA B 1 25  ? 4.590   18.135  33.876  1.00 46.97  ? 120 ALA B C   1 
ATOM   989  O O   . ALA B 1 25  ? 4.314   19.285  34.226  1.00 46.32  ? 120 ALA B O   1 
ATOM   990  C CB  . ALA B 1 25  ? 6.523   18.238  35.499  1.00 46.04  ? 120 ALA B CB  1 
ATOM   991  N N   . SER B 1 26  ? 3.826   17.427  33.028  1.00 41.60  ? 121 SER B N   1 
ATOM   992  C CA  . SER B 1 26  ? 2.611   17.944  32.412  1.00 40.20  ? 121 SER B CA  1 
ATOM   993  C C   . SER B 1 26  ? 1.476   16.926  32.430  1.00 44.42  ? 121 SER B C   1 
ATOM   994  O O   . SER B 1 26  ? 1.707   15.731  32.247  1.00 44.56  ? 121 SER B O   1 
ATOM   995  C CB  . SER B 1 26  ? 2.894   18.385  30.979  1.00 41.36  ? 121 SER B CB  1 
ATOM   996  O OG  . SER B 1 26  ? 1.731   18.888  30.346  1.00 45.86  ? 121 SER B OG  1 
ATOM   997  N N   . ASP B 1 27  ? 0.248   17.423  32.631  1.00 40.63  ? 122 ASP B N   1 
ATOM   998  C CA  . ASP B 1 27  ? -0.989  16.652  32.643  1.00 40.54  ? 122 ASP B CA  1 
ATOM   999  C C   . ASP B 1 27  ? -1.822  16.960  31.377  1.00 44.14  ? 122 ASP B C   1 
ATOM   1000 O O   . ASP B 1 27  ? -3.000  16.596  31.308  1.00 43.22  ? 122 ASP B O   1 
ATOM   1001 C CB  . ASP B 1 27  ? -1.791  16.944  33.936  1.00 42.58  ? 122 ASP B CB  1 
ATOM   1002 C CG  . ASP B 1 27  ? -2.252  18.386  34.155  1.00 51.76  ? 122 ASP B CG  1 
ATOM   1003 O OD1 . ASP B 1 27  ? -2.952  18.637  35.158  1.00 52.10  ? 122 ASP B OD1 1 
ATOM   1004 O OD2 . ASP B 1 27  ? -1.903  19.265  33.326  1.00 56.44  ? 122 ASP B OD2 1 
ATOM   1005 N N   . GLU B 1 28  ? -1.212  17.665  30.393  1.00 41.37  ? 123 GLU B N   1 
ATOM   1006 C CA  . GLU B 1 28  ? -1.862  18.047  29.136  1.00 41.70  ? 123 GLU B CA  1 
ATOM   1007 C C   . GLU B 1 28  ? -2.292  16.824  28.321  1.00 44.57  ? 123 GLU B C   1 
ATOM   1008 O O   . GLU B 1 28  ? -1.565  15.834  28.244  1.00 41.83  ? 123 GLU B O   1 
ATOM   1009 C CB  . GLU B 1 28  ? -0.964  18.976  28.285  1.00 43.40  ? 123 GLU B CB  1 
ATOM   1010 C CG  . GLU B 1 28  ? -1.522  20.386  28.159  1.00 55.95  ? 123 GLU B CG  1 
ATOM   1011 C CD  . GLU B 1 28  ? -1.007  21.257  27.026  1.00 78.04  ? 123 GLU B CD  1 
ATOM   1012 O OE1 . GLU B 1 28  ? -1.276  20.932  25.846  1.00 75.93  ? 123 GLU B OE1 1 
ATOM   1013 O OE2 . GLU B 1 28  ? -0.410  22.318  27.324  1.00 71.27  ? 123 GLU B OE2 1 
ATOM   1014 N N   . THR B 1 29  ? -3.495  16.879  27.750  1.00 43.27  ? 124 THR B N   1 
ATOM   1015 C CA  . THR B 1 29  ? -3.962  15.775  26.928  1.00 43.76  ? 124 THR B CA  1 
ATOM   1016 C C   . THR B 1 29  ? -3.525  16.004  25.492  1.00 48.39  ? 124 THR B C   1 
ATOM   1017 O O   . THR B 1 29  ? -3.757  17.077  24.931  1.00 48.16  ? 124 THR B O   1 
ATOM   1018 C CB  . THR B 1 29  ? -5.465  15.522  27.061  1.00 55.61  ? 124 THR B CB  1 
ATOM   1019 O OG1 . THR B 1 29  ? -6.184  16.605  26.479  1.00 57.19  ? 124 THR B OG1 1 
ATOM   1020 C CG2 . THR B 1 29  ? -5.905  15.277  28.498  1.00 56.34  ? 124 THR B CG2 1 
ATOM   1021 N N   . VAL B 1 30  ? -2.850  15.015  24.917  1.00 44.66  ? 125 VAL B N   1 
ATOM   1022 C CA  . VAL B 1 30  ? -2.409  15.073  23.531  1.00 44.25  ? 125 VAL B CA  1 
ATOM   1023 C C   . VAL B 1 30  ? -3.023  13.886  22.781  1.00 48.02  ? 125 VAL B C   1 
ATOM   1024 O O   . VAL B 1 30  ? -3.429  12.904  23.414  1.00 47.41  ? 125 VAL B O   1 
ATOM   1025 C CB  . VAL B 1 30  ? -0.861  15.169  23.362  1.00 48.38  ? 125 VAL B CB  1 
ATOM   1026 C CG1 . VAL B 1 30  ? -0.297  16.432  24.019  1.00 48.20  ? 125 VAL B CG1 1 
ATOM   1027 C CG2 . VAL B 1 30  ? -0.147  13.923  23.882  1.00 48.21  ? 125 VAL B CG2 1 
ATOM   1028 N N   . LEU B 1 31  ? -3.131  13.992  21.448  1.00 44.09  ? 126 LEU B N   1 
ATOM   1029 C CA  . LEU B 1 31  ? -3.624  12.900  20.624  0.50 43.21  ? 126 LEU B CA  1 
ATOM   1030 C C   . LEU B 1 31  ? -2.401  12.175  20.141  1.00 44.87  ? 126 LEU B C   1 
ATOM   1031 O O   . LEU B 1 31  ? -1.597  12.752  19.405  1.00 44.43  ? 126 LEU B O   1 
ATOM   1032 C CB  . LEU B 1 31  ? -4.480  13.382  19.433  1.00 43.30  ? 126 LEU B CB  1 
ATOM   1033 C CG  . LEU B 1 31  ? -5.968  13.705  19.687  1.00 48.60  ? 126 LEU B CG  1 
ATOM   1034 C CD1 . LEU B 1 31  ? -6.790  13.497  18.433  1.00 48.90  ? 126 LEU B CD1 1 
ATOM   1035 C CD2 . LEU B 1 31  ? -6.561  12.836  20.763  1.00 51.61  ? 126 LEU B CD2 1 
ATOM   1036 N N   . PHE B 1 32  ? -2.205  10.942  20.628  1.00 40.22  ? 127 PHE B N   1 
ATOM   1037 C CA  . PHE B 1 32  ? -1.062  10.124  20.244  1.00 38.76  ? 127 PHE B CA  1 
ATOM   1038 C C   . PHE B 1 32  ? -1.456  9.226   19.081  1.00 42.41  ? 127 PHE B C   1 
ATOM   1039 O O   . PHE B 1 32  ? -2.431  8.476   19.174  1.00 41.63  ? 127 PHE B O   1 
ATOM   1040 C CB  . PHE B 1 32  ? -0.515  9.325   21.439  1.00 39.86  ? 127 PHE B CB  1 
ATOM   1041 C CG  . PHE B 1 32  ? 0.747   8.551   21.133  1.00 40.34  ? 127 PHE B CG  1 
ATOM   1042 C CD1 . PHE B 1 32  ? 1.977   9.196   21.051  1.00 42.59  ? 127 PHE B CD1 1 
ATOM   1043 C CD2 . PHE B 1 32  ? 0.710   7.176   20.947  1.00 41.05  ? 127 PHE B CD2 1 
ATOM   1044 C CE1 . PHE B 1 32  ? 3.142   8.478   20.773  1.00 43.02  ? 127 PHE B CE1 1 
ATOM   1045 C CE2 . PHE B 1 32  ? 1.874   6.461   20.665  1.00 43.42  ? 127 PHE B CE2 1 
ATOM   1046 C CZ  . PHE B 1 32  ? 3.082   7.117   20.570  1.00 41.63  ? 127 PHE B CZ  1 
ATOM   1047 N N   . ARG B 1 33  ? -0.736  9.372   17.960  1.00 38.77  ? 128 ARG B N   1 
ATOM   1048 C CA  . ARG B 1 33  ? -0.925  8.629   16.717  1.00 37.99  ? 128 ARG B CA  1 
ATOM   1049 C C   . ARG B 1 33  ? 0.199   7.617   16.583  1.00 40.48  ? 128 ARG B C   1 
ATOM   1050 O O   . ARG B 1 33  ? 1.372   7.968   16.741  1.00 39.18  ? 128 ARG B O   1 
ATOM   1051 C CB  . ARG B 1 33  ? -0.939  9.588   15.519  1.00 38.99  ? 128 ARG B CB  1 
ATOM   1052 C CG  . ARG B 1 33  ? -2.315  9.833   14.943  1.00 50.33  ? 128 ARG B CG  1 
ATOM   1053 C CD  . ARG B 1 33  ? -2.364  11.072  14.065  1.00 60.44  ? 128 ARG B CD  1 
ATOM   1054 N NE  . ARG B 1 33  ? -3.127  12.159  14.687  1.00 69.85  ? 128 ARG B NE  1 
ATOM   1055 C CZ  . ARG B 1 33  ? -2.615  13.074  15.509  1.00 85.39  ? 128 ARG B CZ  1 
ATOM   1056 N NH1 . ARG B 1 33  ? -1.329  13.042  15.836  1.00 74.60  ? 128 ARG B NH1 1 
ATOM   1057 N NH2 . ARG B 1 33  ? -3.391  14.024  16.016  1.00 73.45  ? 128 ARG B NH2 1 
ATOM   1058 N N   . TYR B 1 34  ? -0.161  6.353   16.322  1.00 36.30  ? 129 TYR B N   1 
ATOM   1059 C CA  . TYR B 1 34  ? 0.798   5.248   16.207  1.00 35.33  ? 129 TYR B CA  1 
ATOM   1060 C C   . TYR B 1 34  ? 0.420   4.220   15.128  1.00 40.20  ? 129 TYR B C   1 
ATOM   1061 O O   . TYR B 1 34  ? -0.687  4.258   14.597  1.00 40.12  ? 129 TYR B O   1 
ATOM   1062 C CB  . TYR B 1 34  ? 1.021   4.579   17.584  1.00 35.16  ? 129 TYR B CB  1 
ATOM   1063 C CG  . TYR B 1 34  ? -0.173  3.856   18.170  1.00 34.93  ? 129 TYR B CG  1 
ATOM   1064 C CD1 . TYR B 1 34  ? -0.233  2.461   18.163  1.00 36.29  ? 129 TYR B CD1 1 
ATOM   1065 C CD2 . TYR B 1 34  ? -1.206  4.550   18.784  1.00 35.45  ? 129 TYR B CD2 1 
ATOM   1066 C CE1 . TYR B 1 34  ? -1.310  1.785   18.737  1.00 36.03  ? 129 TYR B CE1 1 
ATOM   1067 C CE2 . TYR B 1 34  ? -2.291  3.885   19.350  1.00 36.07  ? 129 TYR B CE2 1 
ATOM   1068 C CZ  . TYR B 1 34  ? -2.336  2.500   19.330  1.00 42.09  ? 129 TYR B CZ  1 
ATOM   1069 O OH  . TYR B 1 34  ? -3.401  1.843   19.894  1.00 44.73  ? 129 TYR B OH  1 
ATOM   1070 N N   . CYS B 1 35  ? 1.346   3.321   14.798  1.00 37.87  ? 130 CYS B N   1 
ATOM   1071 C CA  . CYS B 1 35  ? 1.157   2.274   13.807  1.00 39.40  ? 130 CYS B CA  1 
ATOM   1072 C C   . CYS B 1 35  ? 1.036   0.933   14.490  1.00 41.71  ? 130 CYS B C   1 
ATOM   1073 O O   . CYS B 1 35  ? 1.924   0.553   15.254  1.00 41.75  ? 130 CYS B O   1 
ATOM   1074 C CB  . CYS B 1 35  ? 2.296   2.279   12.791  1.00 41.23  ? 130 CYS B CB  1 
ATOM   1075 S SG  . CYS B 1 35  ? 2.458   3.823   11.866  1.00 47.77  ? 130 CYS B SG  1 
ATOM   1076 N N   . ALA B 1 36  ? -0.073  0.226   14.223  1.00 36.96  ? 131 ALA B N   1 
ATOM   1077 C CA  . ALA B 1 36  ? -0.342  -1.114  14.753  1.00 36.79  ? 131 ALA B CA  1 
ATOM   1078 C C   . ALA B 1 36  ? -1.131  -1.930  13.727  1.00 41.84  ? 131 ALA B C   1 
ATOM   1079 O O   . ALA B 1 36  ? -1.702  -1.356  12.801  1.00 41.81  ? 131 ALA B O   1 
ATOM   1080 C CB  . ALA B 1 36  ? -1.108  -1.016  16.063  1.00 37.57  ? 131 ALA B CB  1 
ATOM   1081 N N   . GLY B 1 37  ? -1.141  -3.247  13.896  1.00 39.58  ? 132 GLY B N   1 
ATOM   1082 C CA  . GLY B 1 37  ? -1.852  -4.164  13.018  1.00 40.22  ? 132 GLY B CA  1 
ATOM   1083 C C   . GLY B 1 37  ? -0.977  -5.221  12.374  1.00 46.32  ? 132 GLY B C   1 
ATOM   1084 O O   . GLY B 1 37  ? 0.244   -5.239  12.568  1.00 45.89  ? 132 GLY B O   1 
ATOM   1085 N N   . ALA B 1 38  ? -1.616  -6.114  11.600  1.00 44.86  ? 133 ALA B N   1 
ATOM   1086 C CA  . ALA B 1 38  ? -0.969  -7.223  10.896  1.00 45.59  ? 133 ALA B CA  1 
ATOM   1087 C C   . ALA B 1 38  ? -0.342  -6.800  9.581   1.00 51.21  ? 133 ALA B C   1 
ATOM   1088 O O   . ALA B 1 38  ? -0.838  -5.896  8.907   1.00 50.78  ? 133 ALA B O   1 
ATOM   1089 C CB  . ALA B 1 38  ? -1.965  -8.348  10.657  1.00 46.55  ? 133 ALA B CB  1 
ATOM   1090 N N   . CYS B 1 39  ? 0.766   -7.459  9.227   1.00 50.32  ? 134 CYS B N   1 
ATOM   1091 C CA  . CYS B 1 39  ? 1.505   -7.233  7.991   1.00 51.57  ? 134 CYS B CA  1 
ATOM   1092 C C   . CYS B 1 39  ? 1.709   -8.559  7.256   1.00 61.29  ? 134 CYS B C   1 
ATOM   1093 O O   . CYS B 1 39  ? 2.850   -9.001  7.080   1.00 62.10  ? 134 CYS B O   1 
ATOM   1094 C CB  . CYS B 1 39  ? 2.838   -6.536  8.254   1.00 51.00  ? 134 CYS B CB  1 
ATOM   1095 S SG  . CYS B 1 39  ? 2.771   -4.725  8.230   1.00 55.62  ? 134 CYS B SG  1 
ATOM   1096 N N   . GLU B 1 40  ? 0.614   -9.209  6.838   1.00 61.66  ? 135 GLU B N   1 
ATOM   1097 C CA  . GLU B 1 40  ? 0.722   -10.432 6.033   1.00 63.40  ? 135 GLU B CA  1 
ATOM   1098 C C   . GLU B 1 40  ? 0.706   -9.887  4.617   1.00 69.07  ? 135 GLU B C   1 
ATOM   1099 O O   . GLU B 1 40  ? -0.363  -9.771  4.002   1.00 67.78  ? 135 GLU B O   1 
ATOM   1100 C CB  . GLU B 1 40  ? -0.439  -11.429 6.261   1.00 65.30  ? 135 GLU B CB  1 
ATOM   1101 C CG  . GLU B 1 40  ? -1.065  -11.420 7.647   1.00 79.24  ? 135 GLU B CG  1 
ATOM   1102 C CD  . GLU B 1 40  ? -2.446  -10.792 7.708   1.00 103.55 ? 135 GLU B CD  1 
ATOM   1103 O OE1 . GLU B 1 40  ? -3.210  -11.135 8.639   1.00 104.14 ? 135 GLU B OE1 1 
ATOM   1104 O OE2 . GLU B 1 40  ? -2.764  -9.954  6.832   1.00 100.38 ? 135 GLU B OE2 1 
ATOM   1105 N N   . ALA B 1 41  ? 1.892   -9.410  4.167   1.00 67.65  ? 136 ALA B N   1 
ATOM   1106 C CA  . ALA B 1 41  ? 2.069   -8.774  2.862   1.00 68.09  ? 136 ALA B CA  1 
ATOM   1107 C C   . ALA B 1 41  ? 1.233   -9.391  1.729   1.00 71.57  ? 136 ALA B C   1 
ATOM   1108 O O   . ALA B 1 41  ? 0.346   -8.681  1.278   1.00 71.02  ? 136 ALA B O   1 
ATOM   1109 C CB  . ALA B 1 41  ? 3.544   -8.631  2.489   1.00 69.09  ? 136 ALA B CB  1 
ATOM   1110 N N   . ALA B 1 42  ? 1.402   -10.689 1.323   1.00 67.61  ? 137 ALA B N   1 
ATOM   1111 C CA  . ALA B 1 42  ? 2.385   -11.673 1.813   1.00 66.85  ? 137 ALA B CA  1 
ATOM   1112 C C   . ALA B 1 42  ? 3.253   -12.245 0.698   1.00 68.48  ? 137 ALA B C   1 
ATOM   1113 O O   . ALA B 1 42  ? 2.887   -12.131 -0.473  1.00 68.22  ? 137 ALA B O   1 
ATOM   1114 C CB  . ALA B 1 42  ? 1.677   -12.797 2.557   1.00 67.76  ? 137 ALA B CB  1 
ATOM   1115 N N   . ALA B 1 43  ? 4.397   -12.874 1.073   1.00 62.36  ? 138 ALA B N   1 
ATOM   1116 C CA  . ALA B 1 43  ? 5.356   -13.528 0.181   1.00 60.75  ? 138 ALA B CA  1 
ATOM   1117 C C   . ALA B 1 43  ? 5.923   -12.636 -0.946  1.00 60.17  ? 138 ALA B C   1 
ATOM   1118 O O   . ALA B 1 43  ? 5.725   -12.911 -2.135  1.00 60.11  ? 138 ALA B O   1 
ATOM   1119 C CB  . ALA B 1 43  ? 4.775   -14.831 -0.365  1.00 61.61  ? 138 ALA B CB  1 
ATOM   1120 N N   . ARG B 1 44  ? 6.629   -11.558 -0.549  1.00 52.35  ? 139 ARG B N   1 
ATOM   1121 C CA  . ARG B 1 44  ? 7.333   -10.636 -1.450  1.00 49.78  ? 139 ARG B CA  1 
ATOM   1122 C C   . ARG B 1 44  ? 8.587   -11.422 -1.879  1.00 48.79  ? 139 ARG B C   1 
ATOM   1123 O O   . ARG B 1 44  ? 9.175   -12.099 -1.033  1.00 49.02  ? 139 ARG B O   1 
ATOM   1124 C CB  . ARG B 1 44  ? 7.741   -9.361  -0.683  1.00 48.80  ? 139 ARG B CB  1 
ATOM   1125 C CG  . ARG B 1 44  ? 7.895   -8.103  -1.522  1.00 56.05  ? 139 ARG B CG  1 
ATOM   1126 C CD  . ARG B 1 44  ? 8.954   -7.182  -0.936  1.00 63.46  ? 139 ARG B CD  1 
ATOM   1127 N NE  . ARG B 1 44  ? 8.470   -5.817  -0.711  1.00 66.16  ? 139 ARG B NE  1 
ATOM   1128 C CZ  . ARG B 1 44  ? 8.552   -4.825  -1.596  1.00 74.42  ? 139 ARG B CZ  1 
ATOM   1129 N NH1 . ARG B 1 44  ? 9.092   -5.033  -2.791  1.00 57.30  ? 139 ARG B NH1 1 
ATOM   1130 N NH2 . ARG B 1 44  ? 8.098   -3.617  -1.290  1.00 63.58  ? 139 ARG B NH2 1 
ATOM   1131 N N   . VAL B 1 45  ? 8.960   -11.400 -3.177  1.00 41.20  ? 140 VAL B N   1 
ATOM   1132 C CA  . VAL B 1 45  ? 10.119  -12.163 -3.686  1.00 39.53  ? 140 VAL B CA  1 
ATOM   1133 C C   . VAL B 1 45  ? 11.395  -12.040 -2.847  1.00 39.12  ? 140 VAL B C   1 
ATOM   1134 O O   . VAL B 1 45  ? 12.091  -13.035 -2.638  1.00 38.73  ? 140 VAL B O   1 
ATOM   1135 C CB  . VAL B 1 45  ? 10.361  -12.061 -5.216  1.00 43.73  ? 140 VAL B CB  1 
ATOM   1136 C CG1 . VAL B 1 45  ? 9.065   -12.302 -5.977  1.00 43.72  ? 140 VAL B CG1 1 
ATOM   1137 C CG2 . VAL B 1 45  ? 10.984  -10.725 -5.617  1.00 43.27  ? 140 VAL B CG2 1 
ATOM   1138 N N   . TYR B 1 46  ? 11.650  -10.826 -2.322  1.00 32.08  ? 141 TYR B N   1 
ATOM   1139 C CA  . TYR B 1 46  ? 12.770  -10.488 -1.457  1.00 30.16  ? 141 TYR B CA  1 
ATOM   1140 C C   . TYR B 1 46  ? 12.669  -11.273 -0.148  1.00 35.24  ? 141 TYR B C   1 
ATOM   1141 O O   . TYR B 1 46  ? 13.649  -11.881 0.279   1.00 34.13  ? 141 TYR B O   1 
ATOM   1142 C CB  . TYR B 1 46  ? 12.793  -8.967  -1.198  1.00 29.44  ? 141 TYR B CB  1 
ATOM   1143 C CG  . TYR B 1 46  ? 13.749  -8.551  -0.102  1.00 28.22  ? 141 TYR B CG  1 
ATOM   1144 C CD1 . TYR B 1 46  ? 15.116  -8.432  -0.356  1.00 29.43  ? 141 TYR B CD1 1 
ATOM   1145 C CD2 . TYR B 1 46  ? 13.303  -8.307  1.187   1.00 28.20  ? 141 TYR B CD2 1 
ATOM   1146 C CE1 . TYR B 1 46  ? 16.008  -8.090  0.657   1.00 29.10  ? 141 TYR B CE1 1 
ATOM   1147 C CE2 . TYR B 1 46  ? 14.189  -8.007  2.216   1.00 28.89  ? 141 TYR B CE2 1 
ATOM   1148 C CZ  . TYR B 1 46  ? 15.541  -7.882  1.942   1.00 33.54  ? 141 TYR B CZ  1 
ATOM   1149 O OH  . TYR B 1 46  ? 16.409  -7.527  2.942   1.00 32.59  ? 141 TYR B OH  1 
ATOM   1150 N N   . ASP B 1 47  ? 11.475  -11.254 0.472   1.00 34.00  ? 142 ASP B N   1 
ATOM   1151 C CA  . ASP B 1 47  ? 11.140  -11.931 1.727   1.00 34.96  ? 142 ASP B CA  1 
ATOM   1152 C C   . ASP B 1 47  ? 11.177  -13.453 1.600   1.00 38.60  ? 142 ASP B C   1 
ATOM   1153 O O   . ASP B 1 47  ? 11.733  -14.119 2.478   1.00 39.04  ? 142 ASP B O   1 
ATOM   1154 C CB  . ASP B 1 47  ? 9.775   -11.446 2.232   1.00 37.59  ? 142 ASP B CB  1 
ATOM   1155 C CG  . ASP B 1 47  ? 9.776   -9.997  2.681   1.00 49.25  ? 142 ASP B CG  1 
ATOM   1156 O OD1 . ASP B 1 47  ? 10.751  -9.580  3.347   1.00 49.88  ? 142 ASP B OD1 1 
ATOM   1157 O OD2 . ASP B 1 47  ? 8.787   -9.291  2.405   1.00 55.82  ? 142 ASP B OD2 1 
ATOM   1158 N N   . LEU B 1 48  ? 10.631  -13.996 0.491   1.00 33.95  ? 143 LEU B N   1 
ATOM   1159 C CA  . LEU B 1 48  ? 10.618  -15.430 0.175   1.00 33.21  ? 143 LEU B CA  1 
ATOM   1160 C C   . LEU B 1 48  ? 12.039  -15.955 0.038   1.00 37.72  ? 143 LEU B C   1 
ATOM   1161 O O   . LEU B 1 48  ? 12.352  -17.025 0.567   1.00 38.10  ? 143 LEU B O   1 
ATOM   1162 C CB  . LEU B 1 48  ? 9.883   -15.638 -1.154  1.00 32.97  ? 143 LEU B CB  1 
ATOM   1163 C CG  . LEU B 1 48  ? 8.600   -16.456 -1.208  1.00 36.90  ? 143 LEU B CG  1 
ATOM   1164 C CD1 . LEU B 1 48  ? 7.908   -16.580 0.158   1.00 36.86  ? 143 LEU B CD1 1 
ATOM   1165 C CD2 . LEU B 1 48  ? 7.679   -15.866 -2.242  1.00 37.64  ? 143 LEU B CD2 1 
ATOM   1166 N N   . GLY B 1 49  ? 12.872  -15.203 -0.689  1.00 33.79  ? 144 GLY B N   1 
ATOM   1167 C CA  . GLY B 1 49  ? 14.272  -15.531 -0.912  1.00 33.39  ? 144 GLY B CA  1 
ATOM   1168 C C   . GLY B 1 49  ? 15.100  -15.406 0.352   1.00 36.43  ? 144 GLY B C   1 
ATOM   1169 O O   . GLY B 1 49  ? 15.944  -16.257 0.617   1.00 35.90  ? 144 GLY B O   1 
ATOM   1170 N N   . LEU B 1 50  ? 14.834  -14.362 1.154   1.00 33.32  ? 145 LEU B N   1 
ATOM   1171 C CA  . LEU B 1 50  ? 15.519  -14.086 2.413   1.00 33.32  ? 145 LEU B CA  1 
ATOM   1172 C C   . LEU B 1 50  ? 15.220  -15.151 3.464   1.00 42.16  ? 145 LEU B C   1 
ATOM   1173 O O   . LEU B 1 50  ? 16.144  -15.590 4.150   1.00 42.07  ? 145 LEU B O   1 
ATOM   1174 C CB  . LEU B 1 50  ? 15.167  -12.677 2.932   1.00 32.70  ? 145 LEU B CB  1 
ATOM   1175 C CG  . LEU B 1 50  ? 16.114  -12.042 3.959   1.00 36.35  ? 145 LEU B CG  1 
ATOM   1176 C CD1 . LEU B 1 50  ? 17.565  -12.020 3.468   1.00 35.98  ? 145 LEU B CD1 1 
ATOM   1177 C CD2 . LEU B 1 50  ? 15.662  -10.645 4.319   1.00 36.91  ? 145 LEU B CD2 1 
ATOM   1178 N N   . ARG B 1 51  ? 13.936  -15.566 3.589   1.00 42.02  ? 146 ARG B N   1 
ATOM   1179 C CA  . ARG B 1 51  ? 13.510  -16.610 4.532   1.00 42.96  ? 146 ARG B CA  1 
ATOM   1180 C C   . ARG B 1 51  ? 14.134  -17.946 4.181   1.00 49.09  ? 146 ARG B C   1 
ATOM   1181 O O   . ARG B 1 51  ? 14.588  -18.662 5.075   1.00 49.38  ? 146 ARG B O   1 
ATOM   1182 C CB  . ARG B 1 51  ? 11.982  -16.738 4.582   1.00 43.42  ? 146 ARG B CB  1 
ATOM   1183 C CG  . ARG B 1 51  ? 11.341  -15.786 5.569   1.00 53.95  ? 146 ARG B CG  1 
ATOM   1184 C CD  . ARG B 1 51  ? 9.893   -16.130 5.892   1.00 68.51  ? 146 ARG B CD  1 
ATOM   1185 N NE  . ARG B 1 51  ? 8.965   -15.829 4.799   1.00 76.46  ? 146 ARG B NE  1 
ATOM   1186 C CZ  . ARG B 1 51  ? 8.493   -14.620 4.507   1.00 89.32  ? 146 ARG B CZ  1 
ATOM   1187 N NH1 . ARG B 1 51  ? 7.647   -14.450 3.505   1.00 78.44  ? 146 ARG B NH1 1 
ATOM   1188 N NH2 . ARG B 1 51  ? 8.874   -13.565 5.223   1.00 77.23  ? 146 ARG B NH2 1 
ATOM   1189 N N   . ARG B 1 52  ? 14.191  -18.260 2.877   1.00 46.36  ? 147 ARG B N   1 
ATOM   1190 C CA  . ARG B 1 52  ? 14.773  -19.496 2.369   1.00 46.36  ? 147 ARG B CA  1 
ATOM   1191 C C   . ARG B 1 52  ? 16.279  -19.569 2.611   1.00 50.91  ? 147 ARG B C   1 
ATOM   1192 O O   . ARG B 1 52  ? 16.783  -20.639 2.952   1.00 51.03  ? 147 ARG B O   1 
ATOM   1193 C CB  . ARG B 1 52  ? 14.418  -19.685 0.885   1.00 46.86  ? 147 ARG B CB  1 
ATOM   1194 C CG  . ARG B 1 52  ? 14.756  -21.057 0.305   1.00 58.30  ? 147 ARG B CG  1 
ATOM   1195 C CD  . ARG B 1 52  ? 13.987  -22.216 0.925   1.00 68.93  ? 147 ARG B CD  1 
ATOM   1196 N NE  . ARG B 1 52  ? 12.949  -22.733 0.033   1.00 79.46  ? 147 ARG B NE  1 
ATOM   1197 C CZ  . ARG B 1 52  ? 13.150  -23.654 -0.906  1.00 94.14  ? 147 ARG B CZ  1 
ATOM   1198 N NH1 . ARG B 1 52  ? 14.364  -24.146 -1.115  1.00 82.84  ? 147 ARG B NH1 1 
ATOM   1199 N NH2 . ARG B 1 52  ? 12.144  -24.068 -1.664  1.00 81.94  ? 147 ARG B NH2 1 
ATOM   1200 N N   . LEU B 1 53  ? 16.991  -18.435 2.470   1.00 47.38  ? 148 LEU B N   1 
ATOM   1201 C CA  . LEU B 1 53  ? 18.441  -18.374 2.695   1.00 47.06  ? 148 LEU B CA  1 
ATOM   1202 C C   . LEU B 1 53  ? 18.804  -18.481 4.181   1.00 50.47  ? 148 LEU B C   1 
ATOM   1203 O O   . LEU B 1 53  ? 19.903  -18.921 4.524   1.00 49.53  ? 148 LEU B O   1 
ATOM   1204 C CB  . LEU B 1 53  ? 19.044  -17.103 2.083   1.00 47.15  ? 148 LEU B CB  1 
ATOM   1205 C CG  . LEU B 1 53  ? 19.139  -17.067 0.564   1.00 51.21  ? 148 LEU B CG  1 
ATOM   1206 C CD1 . LEU B 1 53  ? 19.333  -15.659 0.082   1.00 51.19  ? 148 LEU B CD1 1 
ATOM   1207 C CD2 . LEU B 1 53  ? 20.232  -17.984 0.056   1.00 52.38  ? 148 LEU B CD2 1 
ATOM   1208 N N   . ARG B 1 54  ? 17.872  -18.072 5.047   1.00 47.10  ? 149 ARG B N   1 
ATOM   1209 C CA  . ARG B 1 54  ? 17.987  -18.125 6.499   1.00 47.35  ? 149 ARG B CA  1 
ATOM   1210 C C   . ARG B 1 54  ? 17.887  -19.585 6.964   1.00 52.92  ? 149 ARG B C   1 
ATOM   1211 O O   . ARG B 1 54  ? 18.576  -19.972 7.907   1.00 52.21  ? 149 ARG B O   1 
ATOM   1212 C CB  . ARG B 1 54  ? 16.858  -17.297 7.106   1.00 46.97  ? 149 ARG B CB  1 
ATOM   1213 C CG  . ARG B 1 54  ? 17.149  -16.713 8.465   1.00 57.36  ? 149 ARG B CG  1 
ATOM   1214 C CD  . ARG B 1 54  ? 16.015  -15.778 8.818   1.00 69.57  ? 149 ARG B CD  1 
ATOM   1215 N NE  . ARG B 1 54  ? 15.344  -16.155 10.056  1.00 79.78  ? 149 ARG B NE  1 
ATOM   1216 C CZ  . ARG B 1 54  ? 14.055  -15.947 10.302  1.00 94.76  ? 149 ARG B CZ  1 
ATOM   1217 N NH1 . ARG B 1 54  ? 13.279  -15.376 9.386   1.00 81.26  ? 149 ARG B NH1 1 
ATOM   1218 N NH2 . ARG B 1 54  ? 13.526  -16.321 11.459  1.00 84.79  ? 149 ARG B NH2 1 
ATOM   1219 N N   . GLN B 1 55  ? 17.033  -20.388 6.282   1.00 50.56  ? 150 GLN B N   1 
ATOM   1220 C CA  . GLN B 1 55  ? 16.820  -21.820 6.533   1.00 50.64  ? 150 GLN B CA  1 
ATOM   1221 C C   . GLN B 1 55  ? 18.082  -22.621 6.212   1.00 55.47  ? 150 GLN B C   1 
ATOM   1222 O O   . GLN B 1 55  ? 18.387  -23.589 6.907   1.00 56.03  ? 150 GLN B O   1 
ATOM   1223 C CB  . GLN B 1 55  ? 15.638  -22.355 5.701   1.00 51.94  ? 150 GLN B CB  1 
ATOM   1224 C CG  . GLN B 1 55  ? 14.254  -21.870 6.159   1.00 63.66  ? 150 GLN B CG  1 
ATOM   1225 C CD  . GLN B 1 55  ? 13.134  -22.239 5.201   1.00 81.77  ? 150 GLN B CD  1 
ATOM   1226 O OE1 . GLN B 1 55  ? 13.089  -23.338 4.632   1.00 80.32  ? 150 GLN B OE1 1 
ATOM   1227 N NE2 . GLN B 1 55  ? 12.172  -21.341 5.038   1.00 68.56  ? 150 GLN B NE2 1 
ATOM   1228 N N   . ARG B 1 56  ? 18.824  -22.199 5.175   1.00 52.07  ? 151 ARG B N   1 
ATOM   1229 C CA  . ARG B 1 56  ? 20.076  -22.811 4.724   1.00 51.75  ? 151 ARG B CA  1 
ATOM   1230 C C   . ARG B 1 56  ? 21.278  -22.366 5.579   1.00 55.81  ? 151 ARG B C   1 
ATOM   1231 O O   . ARG B 1 56  ? 22.378  -22.900 5.399   1.00 55.70  ? 151 ARG B O   1 
ATOM   1232 C CB  . ARG B 1 56  ? 20.345  -22.453 3.247   1.00 51.52  ? 151 ARG B CB  1 
ATOM   1233 C CG  . ARG B 1 56  ? 19.239  -22.804 2.258   1.00 60.14  ? 151 ARG B CG  1 
ATOM   1234 C CD  . ARG B 1 56  ? 19.434  -24.168 1.631   1.00 70.25  ? 151 ARG B CD  1 
ATOM   1235 N NE  . ARG B 1 56  ? 18.863  -24.219 0.288   1.00 77.12  ? 151 ARG B NE  1 
ATOM   1236 C CZ  . ARG B 1 56  ? 17.602  -24.531 0.006   1.00 86.63  ? 151 ARG B CZ  1 
ATOM   1237 N NH1 . ARG B 1 56  ? 16.754  -24.842 0.982   1.00 73.90  ? 151 ARG B NH1 1 
ATOM   1238 N NH2 . ARG B 1 56  ? 17.181  -24.548 -1.249  1.00 71.71  ? 151 ARG B NH2 1 
ATOM   1239 N N   . ARG B 1 57  ? 21.072  -21.377 6.491   1.00 52.23  ? 152 ARG B N   1 
ATOM   1240 C CA  . ARG B 1 57  ? 22.080  -20.773 7.391   1.00 51.94  ? 152 ARG B CA  1 
ATOM   1241 C C   . ARG B 1 57  ? 23.198  -20.080 6.594   1.00 55.66  ? 152 ARG B C   1 
ATOM   1242 O O   . ARG B 1 57  ? 24.379  -20.149 6.957   1.00 55.08  ? 152 ARG B O   1 
ATOM   1243 C CB  . ARG B 1 57  ? 22.650  -21.797 8.404   1.00 52.23  ? 152 ARG B CB  1 
ATOM   1244 C CG  . ARG B 1 57  ? 21.602  -22.516 9.238   1.00 60.55  ? 152 ARG B CG  1 
ATOM   1245 C CD  . ARG B 1 57  ? 21.339  -21.828 10.561  1.00 70.72  ? 152 ARG B CD  1 
ATOM   1246 N NE  . ARG B 1 57  ? 20.034  -22.217 11.095  1.00 79.11  ? 152 ARG B NE  1 
ATOM   1247 C CZ  . ARG B 1 57  ? 18.983  -21.408 11.172  1.00 91.18  ? 152 ARG B CZ  1 
ATOM   1248 N NH1 . ARG B 1 57  ? 19.080  -20.142 10.782  1.00 78.45  ? 152 ARG B NH1 1 
ATOM   1249 N NH2 . ARG B 1 57  ? 17.832  -21.851 11.660  1.00 79.48  ? 152 ARG B NH2 1 
ATOM   1250 N N   . ARG B 1 58  ? 22.799  -19.391 5.510   1.00 51.49  ? 153 ARG B N   1 
ATOM   1251 C CA  . ARG B 1 58  ? 23.696  -18.702 4.584   1.00 50.86  ? 153 ARG B CA  1 
ATOM   1252 C C   . ARG B 1 58  ? 23.777  -17.182 4.799   1.00 54.95  ? 153 ARG B C   1 
ATOM   1253 O O   . ARG B 1 58  ? 24.412  -16.484 4.002   1.00 54.24  ? 153 ARG B O   1 
ATOM   1254 C CB  . ARG B 1 58  ? 23.262  -19.014 3.149   1.00 49.51  ? 153 ARG B CB  1 
ATOM   1255 C CG  . ARG B 1 58  ? 23.307  -20.495 2.806   1.00 55.12  ? 153 ARG B CG  1 
ATOM   1256 C CD  . ARG B 1 58  ? 23.321  -20.697 1.312   1.00 60.58  ? 153 ARG B CD  1 
ATOM   1257 N NE  . ARG B 1 58  ? 24.496  -20.049 0.736   1.00 64.75  ? 153 ARG B NE  1 
ATOM   1258 C CZ  . ARG B 1 58  ? 24.576  -19.590 -0.504  1.00 76.05  ? 153 ARG B CZ  1 
ATOM   1259 N NH1 . ARG B 1 58  ? 23.550  -19.726 -1.336  1.00 64.25  ? 153 ARG B NH1 1 
ATOM   1260 N NH2 . ARG B 1 58  ? 25.682  -18.999 -0.929  1.00 66.69  ? 153 ARG B NH2 1 
ATOM   1261 N N   . LEU B 1 59  ? 23.167  -16.680 5.887   1.00 52.17  ? 154 LEU B N   1 
ATOM   1262 C CA  . LEU B 1 59  ? 23.062  -15.253 6.193   1.00 52.13  ? 154 LEU B CA  1 
ATOM   1263 C C   . LEU B 1 59  ? 24.059  -14.653 7.212   1.00 59.13  ? 154 LEU B C   1 
ATOM   1264 O O   . LEU B 1 59  ? 23.804  -13.566 7.740   1.00 59.89  ? 154 LEU B O   1 
ATOM   1265 C CB  . LEU B 1 59  ? 21.593  -14.882 6.511   1.00 51.67  ? 154 LEU B CB  1 
ATOM   1266 C CG  . LEU B 1 59  ? 20.535  -15.153 5.407   1.00 55.47  ? 154 LEU B CG  1 
ATOM   1267 C CD1 . LEU B 1 59  ? 19.184  -14.600 5.801   1.00 57.23  ? 154 LEU B CD1 1 
ATOM   1268 C CD2 . LEU B 1 59  ? 20.946  -14.559 4.063   1.00 55.43  ? 154 LEU B CD2 1 
ATOM   1269 N N   . ARG B 1 60  ? 25.213  -15.327 7.445   1.00 56.66  ? 155 ARG B N   1 
ATOM   1270 C CA  . ARG B 1 60  ? 26.307  -14.887 8.337   1.00 56.90  ? 155 ARG B CA  1 
ATOM   1271 C C   . ARG B 1 60  ? 25.959  -14.820 9.838   1.00 61.95  ? 155 ARG B C   1 
ATOM   1272 O O   . ARG B 1 60  ? 26.744  -14.257 10.604  1.00 61.45  ? 155 ARG B O   1 
ATOM   1273 C CB  . ARG B 1 60  ? 26.926  -13.532 7.897   1.00 56.07  ? 155 ARG B CB  1 
ATOM   1274 C CG  . ARG B 1 60  ? 27.264  -13.378 6.424   1.00 61.00  ? 155 ARG B CG  1 
ATOM   1275 C CD  . ARG B 1 60  ? 28.427  -12.417 6.237   1.00 62.79  ? 155 ARG B CD  1 
ATOM   1276 N NE  . ARG B 1 60  ? 28.095  -11.224 5.454   1.00 62.12  ? 155 ARG B NE  1 
ATOM   1277 C CZ  . ARG B 1 60  ? 27.995  -11.191 4.128   1.00 68.63  ? 155 ARG B CZ  1 
ATOM   1278 N NH1 . ARG B 1 60  ? 27.715  -10.054 3.507   1.00 49.37  ? 155 ARG B NH1 1 
ATOM   1279 N NH2 . ARG B 1 60  ? 28.150  -12.300 3.414   1.00 57.96  ? 155 ARG B NH2 1 
ATOM   1280 N N   . ARG B 1 61  ? 24.804  -15.384 10.258  1.00 59.37  ? 156 ARG B N   1 
ATOM   1281 C CA  . ARG B 1 61  ? 24.299  -15.392 11.649  1.00 59.38  ? 156 ARG B CA  1 
ATOM   1282 C C   . ARG B 1 61  ? 23.564  -14.104 12.085  1.00 62.79  ? 156 ARG B C   1 
ATOM   1283 O O   . ARG B 1 61  ? 22.926  -14.095 13.144  1.00 62.22  ? 156 ARG B O   1 
ATOM   1284 C CB  . ARG B 1 61  ? 25.338  -15.962 12.683  1.00 60.79  ? 156 ARG B CB  1 
ATOM   1285 C CG  . ARG B 1 61  ? 25.734  -15.119 13.935  1.00 74.98  ? 156 ARG B CG  1 
ATOM   1286 C CD  . ARG B 1 61  ? 26.408  -13.772 13.636  1.00 89.55  ? 156 ARG B CD  1 
ATOM   1287 N NE  . ARG B 1 61  ? 26.927  -13.097 14.832  1.00 99.96  ? 156 ARG B NE  1 
ATOM   1288 C CZ  . ARG B 1 61  ? 26.910  -11.777 15.024  1.00 113.19 ? 156 ARG B CZ  1 
ATOM   1289 N NH1 . ARG B 1 61  ? 26.362  -10.970 14.125  1.00 100.65 ? 156 ARG B NH1 1 
ATOM   1290 N NH2 . ARG B 1 61  ? 27.425  -11.259 16.134  1.00 100.64 ? 156 ARG B NH2 1 
ATOM   1291 N N   . GLU B 1 62  ? 23.623  -13.038 11.245  1.00 59.35  ? 157 GLU B N   1 
ATOM   1292 C CA  . GLU B 1 62  ? 22.985  -11.738 11.497  1.00 59.01  ? 157 GLU B CA  1 
ATOM   1293 C C   . GLU B 1 62  ? 21.499  -11.784 11.825  1.00 63.03  ? 157 GLU B C   1 
ATOM   1294 O O   . GLU B 1 62  ? 20.817  -12.762 11.502  1.00 62.83  ? 157 GLU B O   1 
ATOM   1295 C CB  . GLU B 1 62  ? 23.292  -10.722 10.396  1.00 60.27  ? 157 GLU B CB  1 
ATOM   1296 C CG  . GLU B 1 62  ? 24.166  -9.609  10.933  1.00 64.91  ? 157 GLU B CG  1 
ATOM   1297 C CD  . GLU B 1 62  ? 24.916  -8.781  9.914   1.00 73.04  ? 157 GLU B CD  1 
ATOM   1298 O OE1 . GLU B 1 62  ? 25.187  -7.600  10.225  1.00 64.25  ? 157 GLU B OE1 1 
ATOM   1299 O OE2 . GLU B 1 62  ? 25.256  -9.304  8.829   1.00 57.79  ? 157 GLU B OE2 1 
ATOM   1300 N N   . ARG B 1 63  ? 21.022  -10.739 12.523  1.00 59.41  ? 158 ARG B N   1 
ATOM   1301 C CA  . ARG B 1 63  ? 19.643  -10.603 12.979  1.00 59.21  ? 158 ARG B CA  1 
ATOM   1302 C C   . ARG B 1 63  ? 18.617  -10.954 11.912  1.00 62.23  ? 158 ARG B C   1 
ATOM   1303 O O   . ARG B 1 63  ? 17.841  -11.899 12.104  1.00 62.70  ? 158 ARG B O   1 
ATOM   1304 C CB  . ARG B 1 63  ? 19.404  -9.225  13.599  1.00 59.50  ? 158 ARG B CB  1 
ATOM   1305 C CG  . ARG B 1 63  ? 19.655  -9.230  15.097  1.00 71.23  ? 158 ARG B CG  1 
ATOM   1306 C CD  . ARG B 1 63  ? 19.788  -7.826  15.651  1.00 80.30  ? 158 ARG B CD  1 
ATOM   1307 N NE  . ARG B 1 63  ? 18.806  -7.562  16.704  1.00 86.70  ? 158 ARG B NE  1 
ATOM   1308 C CZ  . ARG B 1 63  ? 19.084  -7.522  18.004  1.00 99.30  ? 158 ARG B CZ  1 
ATOM   1309 N NH1 . ARG B 1 63  ? 20.326  -7.709  18.434  1.00 87.32  ? 158 ARG B NH1 1 
ATOM   1310 N NH2 . ARG B 1 63  ? 18.121  -7.280  18.885  1.00 85.27  ? 158 ARG B NH2 1 
ATOM   1311 N N   . VAL B 1 64  ? 18.686  -10.259 10.762  1.00 56.39  ? 159 VAL B N   1 
ATOM   1312 C CA  . VAL B 1 64  ? 17.831  -10.439 9.589   1.00 55.16  ? 159 VAL B CA  1 
ATOM   1313 C C   . VAL B 1 64  ? 16.306  -10.358 9.833   1.00 55.67  ? 159 VAL B C   1 
ATOM   1314 O O   . VAL B 1 64  ? 15.737  -11.154 10.582  1.00 54.92  ? 159 VAL B O   1 
ATOM   1315 C CB  . VAL B 1 64  ? 18.318  -11.589 8.657   1.00 59.39  ? 159 VAL B CB  1 
ATOM   1316 C CG1 . VAL B 1 64  ? 17.298  -12.708 8.506   1.00 59.28  ? 159 VAL B CG1 1 
ATOM   1317 C CG2 . VAL B 1 64  ? 18.751  -11.053 7.299   1.00 59.05  ? 159 VAL B CG2 1 
ATOM   1318 N N   . ARG B 1 65  ? 15.661  -9.361  9.217   1.00 50.36  ? 160 ARG B N   1 
ATOM   1319 C CA  . ARG B 1 65  ? 14.212  -9.195  9.302   1.00 49.34  ? 160 ARG B CA  1 
ATOM   1320 C C   . ARG B 1 65  ? 13.635  -9.595  7.951   1.00 51.82  ? 160 ARG B C   1 
ATOM   1321 O O   . ARG B 1 65  ? 13.692  -8.837  6.980   1.00 51.18  ? 160 ARG B O   1 
ATOM   1322 C CB  . ARG B 1 65  ? 13.808  -7.778  9.750   1.00 48.89  ? 160 ARG B CB  1 
ATOM   1323 C CG  . ARG B 1 65  ? 12.654  -7.782  10.755  1.00 61.63  ? 160 ARG B CG  1 
ATOM   1324 C CD  . ARG B 1 65  ? 12.874  -6.866  11.962  1.00 74.03  ? 160 ARG B CD  1 
ATOM   1325 N NE  . ARG B 1 65  ? 13.547  -7.531  13.085  1.00 80.83  ? 160 ARG B NE  1 
ATOM   1326 C CZ  . ARG B 1 65  ? 12.954  -8.333  13.965  1.00 93.13  ? 160 ARG B CZ  1 
ATOM   1327 N NH1 . ARG B 1 65  ? 11.659  -8.620  13.843  1.00 81.39  ? 160 ARG B NH1 1 
ATOM   1328 N NH2 . ARG B 1 65  ? 13.648  -8.887  14.949  1.00 80.63  ? 160 ARG B NH2 1 
ATOM   1329 N N   . ALA B 1 66  ? 13.180  -10.846 7.878   1.00 47.69  ? 161 ALA B N   1 
ATOM   1330 C CA  . ALA B 1 66  ? 12.652  -11.426 6.653   1.00 47.05  ? 161 ALA B CA  1 
ATOM   1331 C C   . ALA B 1 66  ? 11.146  -11.208 6.465   1.00 50.40  ? 161 ALA B C   1 
ATOM   1332 O O   . ALA B 1 66  ? 10.577  -11.692 5.490   1.00 50.00  ? 161 ALA B O   1 
ATOM   1333 C CB  . ALA B 1 66  ? 13.006  -12.899 6.588   1.00 47.88  ? 161 ALA B CB  1 
ATOM   1334 N N   . GLN B 1 67  ? 10.513  -10.439 7.361   1.00 46.35  ? 162 GLN B N   1 
ATOM   1335 C CA  . GLN B 1 67  ? 9.084   -10.135 7.291   1.00 45.79  ? 162 GLN B CA  1 
ATOM   1336 C C   . GLN B 1 67  ? 8.828   -8.641  7.327   1.00 48.15  ? 162 GLN B C   1 
ATOM   1337 O O   . GLN B 1 67  ? 9.563   -7.928  8.022   1.00 48.15  ? 162 GLN B O   1 
ATOM   1338 C CB  . GLN B 1 67  ? 8.330   -10.783 8.461   1.00 47.24  ? 162 GLN B CB  1 
ATOM   1339 C CG  . GLN B 1 67  ? 7.737   -12.139 8.137   1.00 62.78  ? 162 GLN B CG  1 
ATOM   1340 C CD  . GLN B 1 67  ? 8.331   -13.223 8.998   1.00 78.85  ? 162 GLN B CD  1 
ATOM   1341 O OE1 . GLN B 1 67  ? 8.743   -12.995 10.141  1.00 75.37  ? 162 GLN B OE1 1 
ATOM   1342 N NE2 . GLN B 1 67  ? 8.385   -14.432 8.469   1.00 65.92  ? 162 GLN B NE2 1 
ATOM   1343 N N   . PRO B 1 68  ? 7.741   -8.150  6.678   1.00 43.22  ? 163 PRO B N   1 
ATOM   1344 C CA  . PRO B 1 68  ? 7.428   -6.714  6.771   1.00 43.12  ? 163 PRO B CA  1 
ATOM   1345 C C   . PRO B 1 68  ? 6.991   -6.310  8.185   1.00 47.58  ? 163 PRO B C   1 
ATOM   1346 O O   . PRO B 1 68  ? 6.485   -7.140  8.949   1.00 46.95  ? 163 PRO B O   1 
ATOM   1347 C CB  . PRO B 1 68  ? 6.288   -6.526  5.758   1.00 44.70  ? 163 PRO B CB  1 
ATOM   1348 C CG  . PRO B 1 68  ? 6.260   -7.768  4.936   1.00 48.46  ? 163 PRO B CG  1 
ATOM   1349 C CD  . PRO B 1 68  ? 6.748   -8.852  5.839   1.00 44.11  ? 163 PRO B CD  1 
ATOM   1350 N N   . CYS B 1 69  ? 7.198   -5.042  8.521   1.00 44.56  ? 164 CYS B N   1 
ATOM   1351 C CA  . CYS B 1 69  ? 6.848   -4.515  9.827   1.00 44.46  ? 164 CYS B CA  1 
ATOM   1352 C C   . CYS B 1 69  ? 5.929   -3.303  9.714   1.00 42.95  ? 164 CYS B C   1 
ATOM   1353 O O   . CYS B 1 69  ? 6.139   -2.486  8.838   1.00 41.52  ? 164 CYS B O   1 
ATOM   1354 C CB  . CYS B 1 69  ? 8.090   -4.187  10.643  1.00 46.14  ? 164 CYS B CB  1 
ATOM   1355 S SG  . CYS B 1 69  ? 9.211   -5.575  10.858  1.00 51.31  ? 164 CYS B SG  1 
ATOM   1356 N N   . CYS B 1 70  ? 4.925   -3.212  10.595  1.00 37.46  ? 165 CYS B N   1 
ATOM   1357 C CA  . CYS B 1 70  ? 4.017   -2.069  10.623  1.00 36.22  ? 165 CYS B CA  1 
ATOM   1358 C C   . CYS B 1 70  ? 4.713   -0.949  11.371  1.00 35.77  ? 165 CYS B C   1 
ATOM   1359 O O   . CYS B 1 70  ? 4.858   -1.017  12.600  1.00 34.41  ? 165 CYS B O   1 
ATOM   1360 C CB  . CYS B 1 70  ? 2.671   -2.425  11.235  1.00 37.02  ? 165 CYS B CB  1 
ATOM   1361 S SG  . CYS B 1 70  ? 1.487   -1.075  11.186  1.00 41.18  ? 165 CYS B SG  1 
ATOM   1362 N N   . ARG B 1 71  ? 5.259   0.014   10.644  1.00 30.67  ? 166 ARG B N   1 
ATOM   1363 C CA  . ARG B 1 71  ? 6.046   1.089   11.226  1.00 29.98  ? 166 ARG B CA  1 
ATOM   1364 C C   . ARG B 1 71  ? 5.710   2.424   10.583  1.00 35.54  ? 166 ARG B C   1 
ATOM   1365 O O   . ARG B 1 71  ? 5.243   2.435   9.442   1.00 34.92  ? 166 ARG B O   1 
ATOM   1366 C CB  . ARG B 1 71  ? 7.558   0.789   11.092  1.00 27.84  ? 166 ARG B CB  1 
ATOM   1367 C CG  . ARG B 1 71  ? 8.088   -0.326  12.011  1.00 35.81  ? 166 ARG B CG  1 
ATOM   1368 C CD  . ARG B 1 71  ? 8.178   0.070   13.483  1.00 40.83  ? 166 ARG B CD  1 
ATOM   1369 N NE  . ARG B 1 71  ? 9.156   1.130   13.727  1.00 32.15  ? 166 ARG B NE  1 
ATOM   1370 C CZ  . ARG B 1 71  ? 9.275   1.804   14.869  1.00 39.09  ? 166 ARG B CZ  1 
ATOM   1371 N NH1 . ARG B 1 71  ? 8.469   1.530   15.887  1.00 26.36  ? 166 ARG B NH1 1 
ATOM   1372 N NH2 . ARG B 1 71  ? 10.185  2.751   14.994  1.00 29.50  ? 166 ARG B NH2 1 
ATOM   1373 N N   . PRO B 1 72  ? 5.945   3.570   11.265  1.00 33.57  ? 167 PRO B N   1 
ATOM   1374 C CA  . PRO B 1 72  ? 5.681   4.863   10.620  1.00 34.06  ? 167 PRO B CA  1 
ATOM   1375 C C   . PRO B 1 72  ? 6.679   5.181   9.503   1.00 40.46  ? 167 PRO B C   1 
ATOM   1376 O O   . PRO B 1 72  ? 7.886   5.015   9.689   1.00 40.21  ? 167 PRO B O   1 
ATOM   1377 C CB  . PRO B 1 72  ? 5.786   5.864   11.774  1.00 35.35  ? 167 PRO B CB  1 
ATOM   1378 C CG  . PRO B 1 72  ? 5.809   5.029   13.034  1.00 39.20  ? 167 PRO B CG  1 
ATOM   1379 C CD  . PRO B 1 72  ? 6.473   3.766   12.626  1.00 34.52  ? 167 PRO B CD  1 
ATOM   1380 N N   . THR B 1 73  ? 6.171   5.618   8.335   1.00 38.61  ? 168 THR B N   1 
ATOM   1381 C CA  . THR B 1 73  ? 7.016   6.041   7.206   1.00 39.12  ? 168 THR B CA  1 
ATOM   1382 C C   . THR B 1 73  ? 7.216   7.545   7.294   1.00 44.12  ? 168 THR B C   1 
ATOM   1383 O O   . THR B 1 73  ? 8.120   8.091   6.663   1.00 44.35  ? 168 THR B O   1 
ATOM   1384 C CB  . THR B 1 73  ? 6.418   5.642   5.851   1.00 47.27  ? 168 THR B CB  1 
ATOM   1385 O OG1 . THR B 1 73  ? 5.054   6.056   5.778   1.00 47.70  ? 168 THR B OG1 1 
ATOM   1386 C CG2 . THR B 1 73  ? 6.546   4.167   5.579   1.00 47.11  ? 168 THR B CG2 1 
ATOM   1387 N N   . ALA B 1 74  ? 6.376   8.204   8.101   1.00 40.87  ? 169 ALA B N   1 
ATOM   1388 C CA  . ALA B 1 74  ? 6.414   9.637   8.337   1.00 41.05  ? 169 ALA B CA  1 
ATOM   1389 C C   . ALA B 1 74  ? 5.972   9.941   9.755   1.00 45.21  ? 169 ALA B C   1 
ATOM   1390 O O   . ALA B 1 74  ? 5.113   9.246   10.302  1.00 44.32  ? 169 ALA B O   1 
ATOM   1391 C CB  . ALA B 1 74  ? 5.509   10.348  7.349   1.00 41.82  ? 169 ALA B CB  1 
ATOM   1392 N N   . TYR B 1 75  ? 6.546   11.000  10.337  1.00 42.20  ? 170 TYR B N   1 
ATOM   1393 C CA  . TYR B 1 75  ? 6.232   11.424  11.696  1.00 41.86  ? 170 TYR B CA  1 
ATOM   1394 C C   . TYR B 1 75  ? 5.735   12.856  11.745  1.00 48.18  ? 170 TYR B C   1 
ATOM   1395 O O   . TYR B 1 75  ? 6.218   13.714  10.992  1.00 47.91  ? 170 TYR B O   1 
ATOM   1396 C CB  . TYR B 1 75  ? 7.456   11.271  12.613  1.00 41.67  ? 170 TYR B CB  1 
ATOM   1397 C CG  . TYR B 1 75  ? 7.858   9.839   12.884  1.00 41.44  ? 170 TYR B CG  1 
ATOM   1398 C CD1 . TYR B 1 75  ? 8.698   9.153   12.009  1.00 42.61  ? 170 TYR B CD1 1 
ATOM   1399 C CD2 . TYR B 1 75  ? 7.435   9.179   14.033  1.00 41.66  ? 170 TYR B CD2 1 
ATOM   1400 C CE1 . TYR B 1 75  ? 9.088   7.840   12.264  1.00 42.71  ? 170 TYR B CE1 1 
ATOM   1401 C CE2 . TYR B 1 75  ? 7.818   7.867   14.299  1.00 41.92  ? 170 TYR B CE2 1 
ATOM   1402 C CZ  . TYR B 1 75  ? 8.654   7.204   13.416  1.00 46.28  ? 170 TYR B CZ  1 
ATOM   1403 O OH  . TYR B 1 75  ? 9.028   5.906   13.666  1.00 43.26  ? 170 TYR B OH  1 
ATOM   1404 N N   . GLU B 1 76  ? 4.769   13.109  12.649  1.00 46.15  ? 171 GLU B N   1 
ATOM   1405 C CA  . GLU B 1 76  ? 4.215   14.428  12.928  1.00 46.70  ? 171 GLU B CA  1 
ATOM   1406 C C   . GLU B 1 76  ? 5.391   15.274  13.434  1.00 51.70  ? 171 GLU B C   1 
ATOM   1407 O O   . GLU B 1 76  ? 6.144   14.832  14.302  1.00 50.33  ? 171 GLU B O   1 
ATOM   1408 C CB  . GLU B 1 76  ? 3.063   14.317  13.952  1.00 48.03  ? 171 GLU B CB  1 
ATOM   1409 C CG  . GLU B 1 76  ? 2.963   15.458  14.950  1.00 58.72  ? 171 GLU B CG  1 
ATOM   1410 C CD  . GLU B 1 76  ? 3.172   15.022  16.387  1.00 79.21  ? 171 GLU B CD  1 
ATOM   1411 O OE1 . GLU B 1 76  ? 2.170   14.991  17.140  1.00 80.24  ? 171 GLU B OE1 1 
ATOM   1412 O OE2 . GLU B 1 76  ? 4.323   14.690  16.757  1.00 65.41  ? 171 GLU B OE2 1 
ATOM   1413 N N   . ASP B 1 77  ? 5.603   16.431  12.804  1.00 50.46  ? 172 ASP B N   1 
ATOM   1414 C CA  . ASP B 1 77  ? 6.718   17.330  13.083  1.00 50.93  ? 172 ASP B CA  1 
ATOM   1415 C C   . ASP B 1 77  ? 6.966   17.612  14.559  1.00 53.25  ? 172 ASP B C   1 
ATOM   1416 O O   . ASP B 1 77  ? 8.075   17.354  15.031  1.00 52.18  ? 172 ASP B O   1 
ATOM   1417 C CB  . ASP B 1 77  ? 6.589   18.619  12.267  1.00 53.72  ? 172 ASP B CB  1 
ATOM   1418 C CG  . ASP B 1 77  ? 5.307   19.410  12.464  1.00 68.59  ? 172 ASP B CG  1 
ATOM   1419 O OD1 . ASP B 1 77  ? 4.308   18.829  12.972  1.00 68.96  ? 172 ASP B OD1 1 
ATOM   1420 O OD2 . ASP B 1 77  ? 5.292   20.602  12.102  1.00 76.13  ? 172 ASP B OD2 1 
ATOM   1421 N N   . GLU B 1 78  ? 5.930   18.088  15.296  1.00 49.67  ? 173 GLU B N   1 
ATOM   1422 C CA  . GLU B 1 78  ? 6.026   18.399  16.729  1.00 49.23  ? 173 GLU B CA  1 
ATOM   1423 C C   . GLU B 1 78  ? 4.719   18.480  17.517  1.00 50.05  ? 173 GLU B C   1 
ATOM   1424 O O   . GLU B 1 78  ? 3.640   18.629  16.943  1.00 49.24  ? 173 GLU B O   1 
ATOM   1425 C CB  . GLU B 1 78  ? 6.885   19.654  16.998  1.00 51.00  ? 173 GLU B CB  1 
ATOM   1426 C CG  . GLU B 1 78  ? 6.407   20.938  16.335  1.00 63.96  ? 173 GLU B CG  1 
ATOM   1427 C CD  . GLU B 1 78  ? 7.125   22.195  16.795  1.00 82.46  ? 173 GLU B CD  1 
ATOM   1428 O OE1 . GLU B 1 78  ? 7.246   22.396  18.026  1.00 79.41  ? 173 GLU B OE1 1 
ATOM   1429 O OE2 . GLU B 1 78  ? 7.520   23.007  15.927  1.00 72.17  ? 173 GLU B OE2 1 
ATOM   1430 N N   . VAL B 1 79  ? 4.845   18.377  18.857  1.00 45.05  ? 174 VAL B N   1 
ATOM   1431 C CA  . VAL B 1 79  ? 3.777   18.519  19.856  1.00 44.12  ? 174 VAL B CA  1 
ATOM   1432 C C   . VAL B 1 79  ? 4.272   19.531  20.863  1.00 46.28  ? 174 VAL B C   1 
ATOM   1433 O O   . VAL B 1 79  ? 5.388   19.410  21.376  1.00 45.04  ? 174 VAL B O   1 
ATOM   1434 C CB  . VAL B 1 79  ? 3.327   17.236  20.613  1.00 47.95  ? 174 VAL B CB  1 
ATOM   1435 C CG1 . VAL B 1 79  ? 1.847   17.315  20.970  1.00 47.70  ? 174 VAL B CG1 1 
ATOM   1436 C CG2 . VAL B 1 79  ? 3.619   15.969  19.835  1.00 47.83  ? 174 VAL B CG2 1 
ATOM   1437 N N   . SER B 1 80  ? 3.430   20.507  21.166  1.00 42.39  ? 175 SER B N   1 
ATOM   1438 C CA  . SER B 1 80  ? 3.756   21.559  22.109  1.00 41.88  ? 175 SER B CA  1 
ATOM   1439 C C   . SER B 1 80  ? 2.778   21.570  23.263  1.00 44.44  ? 175 SER B C   1 
ATOM   1440 O O   . SER B 1 80  ? 1.582   21.330  23.070  1.00 44.05  ? 175 SER B O   1 
ATOM   1441 C CB  . SER B 1 80  ? 3.788   22.907  21.402  1.00 45.26  ? 175 SER B CB  1 
ATOM   1442 O OG  . SER B 1 80  ? 4.911   22.988  20.540  1.00 52.84  ? 175 SER B OG  1 
ATOM   1443 N N   . PHE B 1 81  ? 3.294   21.823  24.470  1.00 39.52  ? 176 PHE B N   1 
ATOM   1444 C CA  . PHE B 1 81  ? 2.507   21.844  25.698  1.00 38.23  ? 176 PHE B CA  1 
ATOM   1445 C C   . PHE B 1 81  ? 3.162   22.698  26.789  1.00 41.93  ? 176 PHE B C   1 
ATOM   1446 O O   . PHE B 1 81  ? 4.334   23.058  26.691  1.00 39.72  ? 176 PHE B O   1 
ATOM   1447 C CB  . PHE B 1 81  ? 2.247   20.404  26.209  1.00 39.41  ? 176 PHE B CB  1 
ATOM   1448 C CG  . PHE B 1 81  ? 3.482   19.578  26.445  1.00 40.12  ? 176 PHE B CG  1 
ATOM   1449 C CD1 . PHE B 1 81  ? 4.154   19.630  27.663  1.00 42.64  ? 176 PHE B CD1 1 
ATOM   1450 C CD2 . PHE B 1 81  ? 3.984   18.753  25.448  1.00 41.70  ? 176 PHE B CD2 1 
ATOM   1451 C CE1 . PHE B 1 81  ? 5.312   18.880  27.872  1.00 43.29  ? 176 PHE B CE1 1 
ATOM   1452 C CE2 . PHE B 1 81  ? 5.134   17.996  25.663  1.00 44.20  ? 176 PHE B CE2 1 
ATOM   1453 C CZ  . PHE B 1 81  ? 5.790   18.063  26.871  1.00 42.24  ? 176 PHE B CZ  1 
ATOM   1454 N N   . LEU B 1 82  ? 2.395   22.976  27.845  1.00 40.51  ? 177 LEU B N   1 
ATOM   1455 C CA  . LEU B 1 82  ? 2.816   23.723  29.017  1.00 41.02  ? 177 LEU B CA  1 
ATOM   1456 C C   . LEU B 1 82  ? 2.915   22.753  30.201  1.00 47.72  ? 177 LEU B C   1 
ATOM   1457 O O   . LEU B 1 82  ? 1.938   22.070  30.534  1.00 47.64  ? 177 LEU B O   1 
ATOM   1458 C CB  . LEU B 1 82  ? 1.775   24.822  29.304  1.00 40.97  ? 177 LEU B CB  1 
ATOM   1459 C CG  . LEU B 1 82  ? 2.226   26.295  29.373  1.00 45.28  ? 177 LEU B CG  1 
ATOM   1460 C CD1 . LEU B 1 82  ? 3.442   26.582  28.507  1.00 46.74  ? 177 LEU B CD1 1 
ATOM   1461 C CD2 . LEU B 1 82  ? 1.084   27.220  28.971  1.00 45.48  ? 177 LEU B CD2 1 
ATOM   1462 N N   . ASP B 1 83  ? 4.111   22.669  30.815  1.00 45.90  ? 178 ASP B N   1 
ATOM   1463 C CA  . ASP B 1 83  ? 4.334   21.834  31.996  1.00 46.31  ? 178 ASP B CA  1 
ATOM   1464 C C   . ASP B 1 83  ? 3.704   22.506  33.243  1.00 52.47  ? 178 ASP B C   1 
ATOM   1465 O O   . ASP B 1 83  ? 3.169   23.619  33.133  1.00 51.57  ? 178 ASP B O   1 
ATOM   1466 C CB  . ASP B 1 83  ? 5.835   21.457  32.166  1.00 48.08  ? 178 ASP B CB  1 
ATOM   1467 C CG  . ASP B 1 83  ? 6.754   22.427  32.904  1.00 56.30  ? 178 ASP B CG  1 
ATOM   1468 O OD1 . ASP B 1 83  ? 6.308   23.552  33.221  1.00 57.85  ? 178 ASP B OD1 1 
ATOM   1469 O OD2 . ASP B 1 83  ? 7.924   22.057  33.161  1.00 58.91  ? 178 ASP B OD2 1 
ATOM   1470 N N   . ALA B 1 84  ? 3.768   21.844  34.414  1.00 51.40  ? 179 ALA B N   1 
ATOM   1471 C CA  . ALA B 1 84  ? 3.178   22.339  35.662  1.00 52.06  ? 179 ALA B CA  1 
ATOM   1472 C C   . ALA B 1 84  ? 3.729   23.697  36.122  1.00 57.29  ? 179 ALA B C   1 
ATOM   1473 O O   . ALA B 1 84  ? 2.958   24.532  36.612  1.00 56.82  ? 179 ALA B O   1 
ATOM   1474 C CB  . ALA B 1 84  ? 3.311   21.298  36.761  1.00 52.96  ? 179 ALA B CB  1 
ATOM   1475 N N   . HIS B 1 85  ? 5.041   23.931  35.931  1.00 55.34  ? 180 HIS B N   1 
ATOM   1476 C CA  A HIS B 1 85  ? 5.643   25.198  36.328  0.50 55.66  ? 180 HIS B CA  1 
ATOM   1477 C CA  B HIS B 1 85  ? 5.721   25.172  36.299  0.50 55.32  ? 180 HIS B CA  1 
ATOM   1478 C C   . HIS B 1 85  ? 5.522   26.274  35.236  1.00 59.21  ? 180 HIS B C   1 
ATOM   1479 O O   . HIS B 1 85  ? 6.284   27.245  35.220  1.00 58.81  ? 180 HIS B O   1 
ATOM   1480 C CB  A HIS B 1 85  ? 7.085   25.005  36.815  0.50 56.88  ? 180 HIS B CB  1 
ATOM   1481 C CB  B HIS B 1 85  ? 7.227   24.878  36.469  0.50 56.14  ? 180 HIS B CB  1 
ATOM   1482 C CG  A HIS B 1 85  ? 7.471   26.008  37.855  0.50 60.71  ? 180 HIS B CG  1 
ATOM   1483 C CG  B HIS B 1 85  ? 7.543   23.567  37.128  0.50 59.62  ? 180 HIS B CG  1 
ATOM   1484 N ND1 A HIS B 1 85  ? 7.219   25.788  39.193  0.50 62.60  ? 180 HIS B ND1 1 
ATOM   1485 N ND1 B HIS B 1 85  ? 7.452   23.411  38.492  0.50 61.35  ? 180 HIS B ND1 1 
ATOM   1486 C CD2 A HIS B 1 85  ? 8.027   27.233  37.710  0.50 62.82  ? 180 HIS B CD2 1 
ATOM   1487 C CD2 B HIS B 1 85  ? 7.963   22.401  36.580  0.50 61.33  ? 180 HIS B CD2 1 
ATOM   1488 C CE1 A HIS B 1 85  ? 7.661   26.865  39.823  0.50 62.32  ? 180 HIS B CE1 1 
ATOM   1489 C CE1 B HIS B 1 85  ? 7.829   22.167  38.732  0.50 60.79  ? 180 HIS B CE1 1 
ATOM   1490 N NE2 A HIS B 1 85  ? 8.152   27.762  38.972  0.50 62.59  ? 180 HIS B NE2 1 
ATOM   1491 N NE2 B HIS B 1 85  ? 8.144   21.523  37.611  0.50 61.10  ? 180 HIS B NE2 1 
ATOM   1492 N N   . SER B 1 86  ? 4.510   26.130  34.348  1.00 55.14  ? 181 SER B N   1 
ATOM   1493 C CA  . SER B 1 86  ? 4.198   27.033  33.224  1.00 54.46  ? 181 SER B CA  1 
ATOM   1494 C C   . SER B 1 86  ? 5.375   27.220  32.245  1.00 57.25  ? 181 SER B C   1 
ATOM   1495 O O   . SER B 1 86  ? 5.663   28.333  31.795  1.00 57.20  ? 181 SER B O   1 
ATOM   1496 C CB  . SER B 1 86  ? 3.589   28.360  33.683  1.00 57.66  ? 181 SER B CB  1 
ATOM   1497 O OG  . SER B 1 86  ? 2.241   28.195  34.090  1.00 64.86  ? 181 SER B OG  1 
ATOM   1498 N N   . ARG B 1 87  ? 6.046   26.109  31.916  1.00 52.45  ? 182 ARG B N   1 
ATOM   1499 C CA  . ARG B 1 87  ? 7.177   26.086  30.994  1.00 51.71  ? 182 ARG B CA  1 
ATOM   1500 C C   . ARG B 1 87  ? 6.764   25.410  29.693  1.00 53.94  ? 182 ARG B C   1 
ATOM   1501 O O   . ARG B 1 87  ? 6.218   24.300  29.703  1.00 53.53  ? 182 ARG B O   1 
ATOM   1502 C CB  . ARG B 1 87  ? 8.375   25.364  31.628  1.00 52.47  ? 182 ARG B CB  1 
ATOM   1503 C CG  . ARG B 1 87  ? 9.651   26.193  31.695  1.00 65.77  ? 182 ARG B CG  1 
ATOM   1504 C CD  . ARG B 1 87  ? 10.644  25.672  32.728  1.00 80.95  ? 182 ARG B CD  1 
ATOM   1505 N NE  . ARG B 1 87  ? 11.013  24.266  32.524  1.00 92.48  ? 182 ARG B NE  1 
ATOM   1506 C CZ  . ARG B 1 87  ? 12.043  23.848  31.793  1.00 106.69 ? 182 ARG B CZ  1 
ATOM   1507 N NH1 . ARG B 1 87  ? 12.830  24.725  31.180  1.00 94.80  ? 182 ARG B NH1 1 
ATOM   1508 N NH2 . ARG B 1 87  ? 12.295  22.552  31.670  1.00 93.90  ? 182 ARG B NH2 1 
ATOM   1509 N N   . TYR B 1 88  ? 6.986   26.111  28.578  1.00 48.62  ? 183 TYR B N   1 
ATOM   1510 C CA  . TYR B 1 88  ? 6.660   25.632  27.243  1.00 47.01  ? 183 TYR B CA  1 
ATOM   1511 C C   . TYR B 1 88  ? 7.662   24.593  26.799  1.00 48.58  ? 183 TYR B C   1 
ATOM   1512 O O   . TYR B 1 88  ? 8.874   24.787  26.928  1.00 48.42  ? 183 TYR B O   1 
ATOM   1513 C CB  . TYR B 1 88  ? 6.575   26.800  26.251  1.00 47.93  ? 183 TYR B CB  1 
ATOM   1514 C CG  . TYR B 1 88  ? 6.368   26.394  24.809  1.00 48.95  ? 183 TYR B CG  1 
ATOM   1515 C CD1 . TYR B 1 88  ? 5.093   26.234  24.284  1.00 50.15  ? 183 TYR B CD1 1 
ATOM   1516 C CD2 . TYR B 1 88  ? 7.455   26.196  23.960  1.00 50.05  ? 183 TYR B CD2 1 
ATOM   1517 C CE1 . TYR B 1 88  ? 4.897   25.898  22.948  1.00 50.47  ? 183 TYR B CE1 1 
ATOM   1518 C CE2 . TYR B 1 88  ? 7.274   25.829  22.630  1.00 51.04  ? 183 TYR B CE2 1 
ATOM   1519 C CZ  . TYR B 1 88  ? 5.993   25.685  22.126  1.00 57.02  ? 183 TYR B CZ  1 
ATOM   1520 O OH  . TYR B 1 88  ? 5.820   25.342  20.809  1.00 57.87  ? 183 TYR B OH  1 
ATOM   1521 N N   . HIS B 1 89  ? 7.148   23.489  26.264  1.00 43.12  ? 184 HIS B N   1 
ATOM   1522 C CA  . HIS B 1 89  ? 7.974   22.388  25.788  1.00 41.90  ? 184 HIS B CA  1 
ATOM   1523 C C   . HIS B 1 89  ? 7.545   21.955  24.423  1.00 45.75  ? 184 HIS B C   1 
ATOM   1524 O O   . HIS B 1 89  ? 6.357   21.993  24.098  1.00 44.80  ? 184 HIS B O   1 
ATOM   1525 C CB  . HIS B 1 89  ? 7.875   21.187  26.734  1.00 42.16  ? 184 HIS B CB  1 
ATOM   1526 C CG  . HIS B 1 89  ? 8.562   21.397  28.038  1.00 44.64  ? 184 HIS B CG  1 
ATOM   1527 N ND1 . HIS B 1 89  ? 9.923   21.263  28.153  1.00 46.43  ? 184 HIS B ND1 1 
ATOM   1528 C CD2 . HIS B 1 89  ? 8.046   21.710  29.246  1.00 46.02  ? 184 HIS B CD2 1 
ATOM   1529 C CE1 . HIS B 1 89  ? 10.201  21.506  29.423  1.00 45.60  ? 184 HIS B CE1 1 
ATOM   1530 N NE2 . HIS B 1 89  ? 9.103   21.781  30.119  1.00 45.85  ? 184 HIS B NE2 1 
ATOM   1531 N N   . THR B 1 90  ? 8.519   21.524  23.628  1.00 43.03  ? 185 THR B N   1 
ATOM   1532 C CA  . THR B 1 90  ? 8.291   20.998  22.294  1.00 42.95  ? 185 THR B CA  1 
ATOM   1533 C C   . THR B 1 90  ? 8.869   19.602  22.208  1.00 46.02  ? 185 THR B C   1 
ATOM   1534 O O   . THR B 1 90  ? 10.010  19.374  22.623  1.00 44.75  ? 185 THR B O   1 
ATOM   1535 C CB  . THR B 1 90  ? 8.765   21.964  21.191  1.00 55.19  ? 185 THR B CB  1 
ATOM   1536 O OG1 . THR B 1 90  ? 8.414   21.402  19.926  1.00 57.73  ? 185 THR B OG1 1 
ATOM   1537 C CG2 . THR B 1 90  ? 10.275  22.250  21.239  1.00 53.98  ? 185 THR B CG2 1 
ATOM   1538 N N   . VAL B 1 91  ? 8.048   18.660  21.729  1.00 42.89  ? 186 VAL B N   1 
ATOM   1539 C CA  . VAL B 1 91  ? 8.425   17.262  21.533  1.00 42.19  ? 186 VAL B CA  1 
ATOM   1540 C C   . VAL B 1 91  ? 8.359   17.012  20.041  1.00 45.71  ? 186 VAL B C   1 
ATOM   1541 O O   . VAL B 1 91  ? 7.305   17.190  19.430  1.00 45.11  ? 186 VAL B O   1 
ATOM   1542 C CB  . VAL B 1 91  ? 7.555   16.251  22.335  1.00 45.52  ? 186 VAL B CB  1 
ATOM   1543 C CG1 . VAL B 1 91  ? 8.092   14.833  22.185  1.00 44.90  ? 186 VAL B CG1 1 
ATOM   1544 C CG2 . VAL B 1 91  ? 7.503   16.622  23.805  1.00 45.34  ? 186 VAL B CG2 1 
ATOM   1545 N N   . HIS B 1 92  ? 9.498   16.637  19.455  1.00 42.55  ? 187 HIS B N   1 
ATOM   1546 C CA  . HIS B 1 92  ? 9.605   16.381  18.023  1.00 42.39  ? 187 HIS B CA  1 
ATOM   1547 C C   . HIS B 1 92  ? 9.471   14.914  17.691  1.00 43.05  ? 187 HIS B C   1 
ATOM   1548 O O   . HIS B 1 92  ? 10.077  14.072  18.354  1.00 41.42  ? 187 HIS B O   1 
ATOM   1549 C CB  . HIS B 1 92  ? 10.918  16.943  17.458  1.00 43.66  ? 187 HIS B CB  1 
ATOM   1550 C CG  . HIS B 1 92  ? 10.933  18.438  17.369  1.00 47.62  ? 187 HIS B CG  1 
ATOM   1551 N ND1 . HIS B 1 92  ? 11.740  19.201  18.190  1.00 49.45  ? 187 HIS B ND1 1 
ATOM   1552 C CD2 . HIS B 1 92  ? 10.249  19.262  16.540  1.00 49.59  ? 187 HIS B CD2 1 
ATOM   1553 C CE1 . HIS B 1 92  ? 11.507  20.459  17.851  1.00 49.03  ? 187 HIS B CE1 1 
ATOM   1554 N NE2 . HIS B 1 92  ? 10.606  20.545  16.873  1.00 49.31  ? 187 HIS B NE2 1 
ATOM   1555 N N   . GLU B 1 93  ? 8.693   14.625  16.631  1.00 38.53  ? 188 GLU B N   1 
ATOM   1556 C CA  . GLU B 1 93  ? 8.441   13.292  16.078  1.00 37.93  ? 188 GLU B CA  1 
ATOM   1557 C C   . GLU B 1 93  ? 7.786   12.314  17.080  1.00 40.53  ? 188 GLU B C   1 
ATOM   1558 O O   . GLU B 1 93  ? 8.100   11.124  17.087  1.00 39.50  ? 188 GLU B O   1 
ATOM   1559 C CB  . GLU B 1 93  ? 9.700   12.716  15.382  1.00 39.38  ? 188 GLU B CB  1 
ATOM   1560 C CG  . GLU B 1 93  ? 10.376  13.701  14.435  1.00 51.02  ? 188 GLU B CG  1 
ATOM   1561 C CD  . GLU B 1 93  ? 10.947  13.128  13.153  1.00 73.59  ? 188 GLU B CD  1 
ATOM   1562 O OE1 . GLU B 1 93  ? 11.980  12.422  13.221  1.00 69.76  ? 188 GLU B OE1 1 
ATOM   1563 O OE2 . GLU B 1 93  ? 10.402  13.444  12.072  1.00 68.19  ? 188 GLU B OE2 1 
ATOM   1564 N N   . LEU B 1 94  ? 6.846   12.825  17.895  1.00 36.82  ? 189 LEU B N   1 
ATOM   1565 C CA  . LEU B 1 94  ? 6.135   12.037  18.896  1.00 36.34  ? 189 LEU B CA  1 
ATOM   1566 C C   . LEU B 1 94  ? 5.083   11.117  18.275  1.00 40.45  ? 189 LEU B C   1 
ATOM   1567 O O   . LEU B 1 94  ? 4.961   9.975   18.704  1.00 40.41  ? 189 LEU B O   1 
ATOM   1568 C CB  . LEU B 1 94  ? 5.550   12.935  20.009  1.00 36.26  ? 189 LEU B CB  1 
ATOM   1569 C CG  . LEU B 1 94  ? 4.861   12.248  21.213  1.00 40.97  ? 189 LEU B CG  1 
ATOM   1570 C CD1 . LEU B 1 94  ? 5.859   11.492  22.081  1.00 41.14  ? 189 LEU B CD1 1 
ATOM   1571 C CD2 . LEU B 1 94  ? 4.130   13.252  22.068  1.00 42.44  ? 189 LEU B CD2 1 
ATOM   1572 N N   . SER B 1 95  ? 4.354   11.597  17.256  1.00 36.70  ? 190 SER B N   1 
ATOM   1573 C CA  . SER B 1 95  ? 3.314   10.814  16.598  1.00 35.64  ? 190 SER B CA  1 
ATOM   1574 C C   . SER B 1 95  ? 3.665   10.416  15.171  1.00 39.37  ? 190 SER B C   1 
ATOM   1575 O O   . SER B 1 95  ? 4.396   11.124  14.478  1.00 38.79  ? 190 SER B O   1 
ATOM   1576 C CB  . SER B 1 95  ? 1.985   11.566  16.610  1.00 37.31  ? 190 SER B CB  1 
ATOM   1577 O OG  . SER B 1 95  ? 1.544   11.837  17.928  1.00 42.42  ? 190 SER B OG  1 
ATOM   1578 N N   . ALA B 1 96  ? 3.110   9.282   14.740  1.00 36.07  ? 191 ALA B N   1 
ATOM   1579 C CA  . ALA B 1 96  ? 3.205   8.756   13.393  1.00 35.91  ? 191 ALA B CA  1 
ATOM   1580 C C   . ALA B 1 96  ? 2.261   9.599   12.515  1.00 40.88  ? 191 ALA B C   1 
ATOM   1581 O O   . ALA B 1 96  ? 1.118   9.856   12.909  1.00 39.17  ? 191 ALA B O   1 
ATOM   1582 C CB  . ALA B 1 96  ? 2.760   7.302   13.388  1.00 36.64  ? 191 ALA B CB  1 
ATOM   1583 N N   . ARG B 1 97  ? 2.757   10.059  11.350  1.00 39.65  ? 192 ARG B N   1 
ATOM   1584 C CA  . ARG B 1 97  ? 1.988   10.848  10.379  1.00 40.35  ? 192 ARG B CA  1 
ATOM   1585 C C   . ARG B 1 97  ? 1.399   9.891   9.335   1.00 45.40  ? 192 ARG B C   1 
ATOM   1586 O O   . ARG B 1 97  ? 0.294   10.122  8.837   1.00 44.61  ? 192 ARG B O   1 
ATOM   1587 C CB  . ARG B 1 97  ? 2.901   11.897  9.706   1.00 42.80  ? 192 ARG B CB  1 
ATOM   1588 C CG  . ARG B 1 97  ? 2.187   13.028  8.975   1.00 53.89  ? 192 ARG B CG  1 
ATOM   1589 C CD  . ARG B 1 97  ? 3.166   13.920  8.226   1.00 62.50  ? 192 ARG B CD  1 
ATOM   1590 N NE  . ARG B 1 97  ? 2.705   14.199  6.864   1.00 70.72  ? 192 ARG B NE  1 
ATOM   1591 C CZ  . ARG B 1 97  ? 3.186   13.618  5.767   1.00 84.64  ? 192 ARG B CZ  1 
ATOM   1592 N NH1 . ARG B 1 97  ? 4.169   12.731  5.852   1.00 69.89  ? 192 ARG B NH1 1 
ATOM   1593 N NH2 . ARG B 1 97  ? 2.700   13.933  4.574   1.00 75.88  ? 192 ARG B NH2 1 
ATOM   1594 N N   . GLU B 1 98  ? 2.142   8.800   9.021   1.00 43.29  ? 193 GLU B N   1 
ATOM   1595 C CA  . GLU B 1 98  ? 1.795   7.763   8.031   1.00 44.04  ? 193 GLU B CA  1 
ATOM   1596 C C   . GLU B 1 98  ? 2.348   6.405   8.456   1.00 45.65  ? 193 GLU B C   1 
ATOM   1597 O O   . GLU B 1 98  ? 3.424   6.335   9.050   1.00 44.81  ? 193 GLU B O   1 
ATOM   1598 C CB  . GLU B 1 98  ? 2.400   8.148   6.666   1.00 45.81  ? 193 GLU B CB  1 
ATOM   1599 C CG  . GLU B 1 98  ? 1.853   7.380   5.473   1.00 60.09  ? 193 GLU B CG  1 
ATOM   1600 C CD  . GLU B 1 98  ? 2.624   7.603   4.185   1.00 88.94  ? 193 GLU B CD  1 
ATOM   1601 O OE1 . GLU B 1 98  ? 3.232   6.632   3.676   1.00 89.29  ? 193 GLU B OE1 1 
ATOM   1602 O OE2 . GLU B 1 98  ? 2.640   8.754   3.692   1.00 89.07  ? 193 GLU B OE2 1 
ATOM   1603 N N   . CYS B 1 99  ? 1.633   5.323   8.111   1.00 42.28  ? 194 CYS B N   1 
ATOM   1604 C CA  . CYS B 1 99  ? 1.979   3.919   8.389   1.00 42.78  ? 194 CYS B CA  1 
ATOM   1605 C C   . CYS B 1 99  ? 2.143   3.170   7.065   1.00 47.77  ? 194 CYS B C   1 
ATOM   1606 O O   . CYS B 1 99  ? 1.551   3.559   6.063   1.00 47.15  ? 194 CYS B O   1 
ATOM   1607 C CB  . CYS B 1 99  ? 0.921   3.235   9.253   1.00 43.32  ? 194 CYS B CB  1 
ATOM   1608 S SG  . CYS B 1 99  ? 0.693   3.976   10.874  1.00 46.61  ? 194 CYS B SG  1 
ATOM   1609 N N   . ALA B 1 100 ? 2.903   2.047   7.098   1.00 45.79  ? 195 ALA B N   1 
ATOM   1610 C CA  . ALA B 1 100 ? 3.146   1.126   5.965   1.00 46.22  ? 195 ALA B CA  1 
ATOM   1611 C C   . ALA B 1 100 ? 3.789   -0.162  6.448   1.00 50.73  ? 195 ALA B C   1 
ATOM   1612 O O   . ALA B 1 100 ? 4.418   -0.171  7.509   1.00 49.20  ? 195 ALA B O   1 
ATOM   1613 C CB  . ALA B 1 100 ? 4.029   1.791   4.919   1.00 47.08  ? 195 ALA B CB  1 
ATOM   1614 N N   . CYS B 1 101 ? 3.641   -1.239  5.664   1.00 49.22  ? 196 CYS B N   1 
ATOM   1615 C CA  . CYS B 1 101 ? 4.280   -2.521  5.940   1.00 49.94  ? 196 CYS B CA  1 
ATOM   1616 C C   . CYS B 1 101 ? 5.653   -2.464  5.279   1.00 55.90  ? 196 CYS B C   1 
ATOM   1617 O O   . CYS B 1 101 ? 5.764   -2.574  4.054   1.00 56.24  ? 196 CYS B O   1 
ATOM   1618 C CB  . CYS B 1 101 ? 3.448   -3.694  5.427   1.00 50.56  ? 196 CYS B CB  1 
ATOM   1619 S SG  . CYS B 1 101 ? 2.002   -4.081  6.450   1.00 53.80  ? 196 CYS B SG  1 
ATOM   1620 N N   . VAL B 1 102 ? 6.685   -2.194  6.093   1.00 52.93  ? 197 VAL B N   1 
ATOM   1621 C CA  . VAL B 1 102 ? 8.075   -2.058  5.646   1.00 56.42  ? 197 VAL B CA  1 
ATOM   1622 C C   . VAL B 1 102 ? 8.778   -3.415  5.423   1.00 69.12  ? 197 VAL B C   1 
ATOM   1623 O O   . VAL B 1 102 ? 9.168   -3.719  4.280   1.00 69.80  ? 197 VAL B O   1 
ATOM   1624 C CB  . VAL B 1 102 ? 8.915   -1.022  6.471   1.00 60.38  ? 197 VAL B CB  1 
ATOM   1625 C CG1 . VAL B 1 102 ? 8.207   0.330   6.546   1.00 60.12  ? 197 VAL B CG1 1 
ATOM   1626 C CG2 . VAL B 1 102 ? 9.265   -1.526  7.876   1.00 60.13  ? 197 VAL B CG2 1 
ATOM   1627 O OXT . VAL B 1 102 ? 8.931   -4.192  6.380   1.00 92.73  ? 197 VAL B OXT 1 
HETATM 1628 O O   . HOH C 2 .   ? 10.006  -7.855  -4.058  1.00 45.43  ? 201 HOH A O   1 
HETATM 1629 O O   . HOH C 2 .   ? 8.290   -4.043  20.028  1.00 20.97  ? 202 HOH A O   1 
HETATM 1630 O O   . HOH C 2 .   ? 4.881   1.207   15.263  1.00 25.60  ? 203 HOH A O   1 
HETATM 1631 O O   . HOH C 2 .   ? 13.594  -20.450 -7.289  1.00 39.98  ? 204 HOH A O   1 
HETATM 1632 O O   . HOH C 2 .   ? 21.537  1.572   2.289   1.00 34.01  ? 205 HOH A O   1 
HETATM 1633 O O   . HOH C 2 .   ? 13.117  -22.893 -5.820  1.00 46.31  ? 206 HOH A O   1 
HETATM 1634 O O   . HOH C 2 .   ? 14.924  -7.450  -9.085  1.00 37.68  ? 207 HOH A O   1 
HETATM 1635 O O   . HOH C 2 .   ? 8.926   -17.260 -16.768 1.00 55.26  ? 208 HOH A O   1 
HETATM 1636 O O   . HOH C 2 .   ? 11.701  0.045   -4.873  1.00 39.26  ? 209 HOH A O   1 
HETATM 1637 O O   . HOH C 2 .   ? 16.674  2.619   18.190  1.00 38.93  ? 210 HOH A O   1 
HETATM 1638 O O   . HOH C 2 .   ? 12.924  11.337  19.013  1.00 42.03  ? 211 HOH A O   1 
HETATM 1639 O O   . HOH C 2 .   ? 6.934   -22.469 -10.432 1.00 51.03  ? 212 HOH A O   1 
HETATM 1640 O O   . HOH C 2 .   ? 24.577  0.288   3.484   1.00 50.73  ? 213 HOH A O   1 
HETATM 1641 O O   . HOH C 2 .   ? 14.867  1.480   20.069  1.00 40.73  ? 214 HOH A O   1 
HETATM 1642 O O   . HOH D 2 .   ? 5.721   26.277  18.379  1.00 41.82  ? 201 HOH B O   1 
HETATM 1643 O O   . HOH D 2 .   ? -6.079  -0.891  9.908   1.00 47.24  ? 202 HOH B O   1 
HETATM 1644 O O   . HOH D 2 .   ? 3.411   -1.702  14.725  1.00 31.01  ? 203 HOH B O   1 
HETATM 1645 O O   . HOH D 2 .   ? 13.390  17.981  19.898  1.00 63.14  ? 204 HOH B O   1 
HETATM 1646 O O   . HOH D 2 .   ? 6.301   12.281  29.945  1.00 40.28  ? 205 HOH B O   1 
HETATM 1647 O O   . HOH D 2 .   ? 10.401  9.739   17.192  1.00 49.03  ? 206 HOH B O   1 
HETATM 1648 O O   . HOH D 2 .   ? 9.953   4.619   11.485  1.00 45.63  ? 207 HOH B O   1 
HETATM 1649 O O   . HOH D 2 .   ? 15.502  -7.044  5.493   1.00 27.78  ? 208 HOH B O   1 
HETATM 1650 O O   . HOH D 2 .   ? 6.276   -12.074 4.345   1.00 61.80  ? 209 HOH B O   1 
HETATM 1651 O O   . HOH D 2 .   ? -3.021  -0.981  19.167  1.00 53.84  ? 210 HOH B O   1 
HETATM 1652 O O   . HOH D 2 .   ? 19.749  -10.321 19.711  1.00 55.59  ? 211 HOH B O   1 
HETATM 1653 O O   . HOH D 2 .   ? 8.093   28.862  28.446  1.00 42.42  ? 212 HOH B O   1 
HETATM 1654 O O   . HOH D 2 .   ? 12.176  -12.286 10.288  1.00 47.62  ? 213 HOH B O   1 
HETATM 1655 O O   . HOH D 2 .   ? 9.389   -8.355  11.888  1.00 44.54  ? 214 HOH B O   1 
HETATM 1656 O O   . HOH D 2 .   ? 22.705  -17.285 9.196   1.00 40.29  ? 215 HOH B O   1 
HETATM 1657 O O   . HOH D 2 .   ? -4.306  4.313   8.320   1.00 42.73  ? 216 HOH B O   1 
HETATM 1658 O O   . HOH D 2 .   ? -3.619  -6.982  14.460  1.00 65.58  ? 217 HOH B O   1 
HETATM 1659 O O   . HOH D 2 .   ? -2.344  21.668  31.029  1.00 60.40  ? 218 HOH B O   1 
HETATM 1660 O O   . HOH D 2 .   ? -7.587  4.609   10.057  1.00 57.62  ? 219 HOH B O   1 
HETATM 1661 O O   . HOH D 2 .   ? 23.205  -18.534 11.698  1.00 54.89  ? 220 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   96  ?   ?   ?   A . n 
A 1 2   ARG 2   97  ?   ?   ?   A . n 
A 1 3   LEU 3   98  ?   ?   ?   A . n 
A 1 4   GLY 4   99  99  GLY GLY A . n 
A 1 5   ALA 5   100 100 ALA ALA A . n 
A 1 6   ARG 6   101 101 ARG ARG A . n 
A 1 7   PRO 7   102 102 PRO PRO A . n 
A 1 8   CYS 8   103 103 CYS CYS A . n 
A 1 9   GLY 9   104 104 GLY GLY A . n 
A 1 10  LEU 10  105 105 LEU LEU A . n 
A 1 11  ARG 11  106 106 ARG ARG A . n 
A 1 12  GLU 12  107 107 GLU GLU A . n 
A 1 13  LEU 13  108 108 LEU LEU A . n 
A 1 14  GLU 14  109 109 GLU GLU A . n 
A 1 15  VAL 15  110 110 VAL VAL A . n 
A 1 16  ARG 16  111 111 ARG ARG A . n 
A 1 17  VAL 17  112 112 VAL VAL A . n 
A 1 18  SER 18  113 113 SER SER A . n 
A 1 19  GLU 19  114 114 GLU GLU A . n 
A 1 20  LEU 20  115 115 LEU LEU A . n 
A 1 21  GLY 21  116 116 GLY GLY A . n 
A 1 22  LEU 22  117 117 LEU LEU A . n 
A 1 23  GLY 23  118 118 GLY GLY A . n 
A 1 24  TYR 24  119 119 TYR TYR A . n 
A 1 25  ALA 25  120 120 ALA ALA A . n 
A 1 26  SER 26  121 121 SER SER A . n 
A 1 27  ASP 27  122 122 ASP ASP A . n 
A 1 28  GLU 28  123 123 GLU GLU A . n 
A 1 29  THR 29  124 124 THR THR A . n 
A 1 30  VAL 30  125 125 VAL VAL A . n 
A 1 31  LEU 31  126 126 LEU LEU A . n 
A 1 32  PHE 32  127 127 PHE PHE A . n 
A 1 33  ARG 33  128 128 ARG ARG A . n 
A 1 34  TYR 34  129 129 TYR TYR A . n 
A 1 35  CYS 35  130 130 CYS CYS A . n 
A 1 36  ALA 36  131 131 ALA ALA A . n 
A 1 37  GLY 37  132 132 GLY GLY A . n 
A 1 38  ALA 38  133 133 ALA ALA A . n 
A 1 39  CYS 39  134 134 CYS CYS A . n 
A 1 40  GLU 40  135 135 GLU GLU A . n 
A 1 41  ALA 41  136 136 ALA ALA A . n 
A 1 42  ALA 42  137 137 ALA ALA A . n 
A 1 43  ALA 43  138 138 ALA ALA A . n 
A 1 44  ARG 44  139 139 ARG ARG A . n 
A 1 45  VAL 45  140 140 VAL VAL A . n 
A 1 46  TYR 46  141 141 TYR TYR A . n 
A 1 47  ASP 47  142 142 ASP ASP A . n 
A 1 48  LEU 48  143 143 LEU LEU A . n 
A 1 49  GLY 49  144 144 GLY GLY A . n 
A 1 50  LEU 50  145 145 LEU LEU A . n 
A 1 51  ARG 51  146 146 ARG ARG A . n 
A 1 52  ARG 52  147 147 ARG ARG A . n 
A 1 53  LEU 53  148 148 LEU LEU A . n 
A 1 54  ARG 54  149 149 ARG ARG A . n 
A 1 55  GLN 55  150 150 GLN GLN A . n 
A 1 56  ARG 56  151 151 ARG ARG A . n 
A 1 57  ARG 57  152 152 ARG ARG A . n 
A 1 58  ARG 58  153 153 ARG ARG A . n 
A 1 59  LEU 59  154 154 LEU LEU A . n 
A 1 60  ARG 60  155 155 ARG ARG A . n 
A 1 61  ARG 61  156 156 ARG ARG A . n 
A 1 62  GLU 62  157 157 GLU GLU A . n 
A 1 63  ARG 63  158 158 ARG ARG A . n 
A 1 64  VAL 64  159 159 VAL VAL A . n 
A 1 65  ARG 65  160 160 ARG ARG A . n 
A 1 66  ALA 66  161 161 ALA ALA A . n 
A 1 67  GLN 67  162 162 GLN GLN A . n 
A 1 68  PRO 68  163 163 PRO PRO A . n 
A 1 69  CYS 69  164 164 CYS CYS A . n 
A 1 70  CYS 70  165 165 CYS CYS A . n 
A 1 71  ARG 71  166 166 ARG ARG A . n 
A 1 72  PRO 72  167 167 PRO PRO A . n 
A 1 73  THR 73  168 168 THR THR A . n 
A 1 74  ALA 74  169 169 ALA ALA A . n 
A 1 75  TYR 75  170 170 TYR TYR A . n 
A 1 76  GLU 76  171 171 GLU GLU A . n 
A 1 77  ASP 77  172 172 ASP ASP A . n 
A 1 78  GLU 78  173 173 GLU GLU A . n 
A 1 79  VAL 79  174 174 VAL VAL A . n 
A 1 80  SER 80  175 175 SER SER A . n 
A 1 81  PHE 81  176 176 PHE PHE A . n 
A 1 82  LEU 82  177 177 LEU LEU A . n 
A 1 83  ASP 83  178 178 ASP ASP A . n 
A 1 84  ALA 84  179 179 ALA ALA A . n 
A 1 85  HIS 85  180 180 HIS HIS A . n 
A 1 86  SER 86  181 181 SER SER A . n 
A 1 87  ARG 87  182 182 ARG ARG A . n 
A 1 88  TYR 88  183 183 TYR TYR A . n 
A 1 89  HIS 89  184 184 HIS HIS A . n 
A 1 90  THR 90  185 185 THR THR A . n 
A 1 91  VAL 91  186 186 VAL VAL A . n 
A 1 92  HIS 92  187 187 HIS HIS A . n 
A 1 93  GLU 93  188 188 GLU GLU A . n 
A 1 94  LEU 94  189 189 LEU LEU A . n 
A 1 95  SER 95  190 190 SER SER A . n 
A 1 96  ALA 96  191 191 ALA ALA A . n 
A 1 97  ARG 97  192 192 ARG ARG A . n 
A 1 98  GLU 98  193 193 GLU GLU A . n 
A 1 99  CYS 99  194 194 CYS CYS A . n 
A 1 100 ALA 100 195 195 ALA ALA A . n 
A 1 101 CYS 101 196 196 CYS CYS A . n 
A 1 102 VAL 102 197 197 VAL VAL A . n 
B 1 1   ALA 1   96  ?   ?   ?   B . n 
B 1 2   ARG 2   97  97  ARG ARG B . n 
B 1 3   LEU 3   98  98  LEU LEU B . n 
B 1 4   GLY 4   99  99  GLY GLY B . n 
B 1 5   ALA 5   100 100 ALA ALA B . n 
B 1 6   ARG 6   101 101 ARG ARG B . n 
B 1 7   PRO 7   102 102 PRO PRO B . n 
B 1 8   CYS 8   103 103 CYS CYS B . n 
B 1 9   GLY 9   104 104 GLY GLY B . n 
B 1 10  LEU 10  105 105 LEU LEU B . n 
B 1 11  ARG 11  106 106 ARG ARG B . n 
B 1 12  GLU 12  107 107 GLU GLU B . n 
B 1 13  LEU 13  108 108 LEU LEU B . n 
B 1 14  GLU 14  109 109 GLU GLU B . n 
B 1 15  VAL 15  110 110 VAL VAL B . n 
B 1 16  ARG 16  111 111 ARG ARG B . n 
B 1 17  VAL 17  112 112 VAL VAL B . n 
B 1 18  SER 18  113 113 SER SER B . n 
B 1 19  GLU 19  114 114 GLU GLU B . n 
B 1 20  LEU 20  115 115 LEU LEU B . n 
B 1 21  GLY 21  116 116 GLY GLY B . n 
B 1 22  LEU 22  117 117 LEU LEU B . n 
B 1 23  GLY 23  118 118 GLY GLY B . n 
B 1 24  TYR 24  119 119 TYR TYR B . n 
B 1 25  ALA 25  120 120 ALA ALA B . n 
B 1 26  SER 26  121 121 SER SER B . n 
B 1 27  ASP 27  122 122 ASP ASP B . n 
B 1 28  GLU 28  123 123 GLU GLU B . n 
B 1 29  THR 29  124 124 THR THR B . n 
B 1 30  VAL 30  125 125 VAL VAL B . n 
B 1 31  LEU 31  126 126 LEU LEU B . n 
B 1 32  PHE 32  127 127 PHE PHE B . n 
B 1 33  ARG 33  128 128 ARG ARG B . n 
B 1 34  TYR 34  129 129 TYR TYR B . n 
B 1 35  CYS 35  130 130 CYS CYS B . n 
B 1 36  ALA 36  131 131 ALA ALA B . n 
B 1 37  GLY 37  132 132 GLY GLY B . n 
B 1 38  ALA 38  133 133 ALA ALA B . n 
B 1 39  CYS 39  134 134 CYS CYS B . n 
B 1 40  GLU 40  135 135 GLU GLU B . n 
B 1 41  ALA 41  136 136 ALA ALA B . n 
B 1 42  ALA 42  137 137 ALA ALA B . n 
B 1 43  ALA 43  138 138 ALA ALA B . n 
B 1 44  ARG 44  139 139 ARG ARG B . n 
B 1 45  VAL 45  140 140 VAL VAL B . n 
B 1 46  TYR 46  141 141 TYR TYR B . n 
B 1 47  ASP 47  142 142 ASP ASP B . n 
B 1 48  LEU 48  143 143 LEU LEU B . n 
B 1 49  GLY 49  144 144 GLY GLY B . n 
B 1 50  LEU 50  145 145 LEU LEU B . n 
B 1 51  ARG 51  146 146 ARG ARG B . n 
B 1 52  ARG 52  147 147 ARG ARG B . n 
B 1 53  LEU 53  148 148 LEU LEU B . n 
B 1 54  ARG 54  149 149 ARG ARG B . n 
B 1 55  GLN 55  150 150 GLN GLN B . n 
B 1 56  ARG 56  151 151 ARG ARG B . n 
B 1 57  ARG 57  152 152 ARG ARG B . n 
B 1 58  ARG 58  153 153 ARG ARG B . n 
B 1 59  LEU 59  154 154 LEU LEU B . n 
B 1 60  ARG 60  155 155 ARG ARG B . n 
B 1 61  ARG 61  156 156 ARG ARG B . n 
B 1 62  GLU 62  157 157 GLU GLU B . n 
B 1 63  ARG 63  158 158 ARG ARG B . n 
B 1 64  VAL 64  159 159 VAL VAL B . n 
B 1 65  ARG 65  160 160 ARG ARG B . n 
B 1 66  ALA 66  161 161 ALA ALA B . n 
B 1 67  GLN 67  162 162 GLN GLN B . n 
B 1 68  PRO 68  163 163 PRO PRO B . n 
B 1 69  CYS 69  164 164 CYS CYS B . n 
B 1 70  CYS 70  165 165 CYS CYS B . n 
B 1 71  ARG 71  166 166 ARG ARG B . n 
B 1 72  PRO 72  167 167 PRO PRO B . n 
B 1 73  THR 73  168 168 THR THR B . n 
B 1 74  ALA 74  169 169 ALA ALA B . n 
B 1 75  TYR 75  170 170 TYR TYR B . n 
B 1 76  GLU 76  171 171 GLU GLU B . n 
B 1 77  ASP 77  172 172 ASP ASP B . n 
B 1 78  GLU 78  173 173 GLU GLU B . n 
B 1 79  VAL 79  174 174 VAL VAL B . n 
B 1 80  SER 80  175 175 SER SER B . n 
B 1 81  PHE 81  176 176 PHE PHE B . n 
B 1 82  LEU 82  177 177 LEU LEU B . n 
B 1 83  ASP 83  178 178 ASP ASP B . n 
B 1 84  ALA 84  179 179 ALA ALA B . n 
B 1 85  HIS 85  180 180 HIS HIS B . n 
B 1 86  SER 86  181 181 SER SER B . n 
B 1 87  ARG 87  182 182 ARG ARG B . n 
B 1 88  TYR 88  183 183 TYR TYR B . n 
B 1 89  HIS 89  184 184 HIS HIS B . n 
B 1 90  THR 90  185 185 THR THR B . n 
B 1 91  VAL 91  186 186 VAL VAL B . n 
B 1 92  HIS 92  187 187 HIS HIS B . n 
B 1 93  GLU 93  188 188 GLU GLU B . n 
B 1 94  LEU 94  189 189 LEU LEU B . n 
B 1 95  SER 95  190 190 SER SER B . n 
B 1 96  ALA 96  191 191 ALA ALA B . n 
B 1 97  ARG 97  192 192 ARG ARG B . n 
B 1 98  GLU 98  193 193 GLU GLU B . n 
B 1 99  CYS 99  194 194 CYS CYS B . n 
B 1 100 ALA 100 195 195 ALA ALA B . n 
B 1 101 CYS 101 196 196 CYS CYS B . n 
B 1 102 VAL 102 197 197 VAL VAL B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  201 37 HOH HOH A . 
C 2 HOH 2  202 3  HOH HOH A . 
C 2 HOH 3  203 18 HOH HOH A . 
C 2 HOH 4  204 23 HOH HOH A . 
C 2 HOH 5  205 35 HOH HOH A . 
C 2 HOH 6  206 14 HOH HOH A . 
C 2 HOH 7  207 19 HOH HOH A . 
C 2 HOH 8  208 39 HOH HOH A . 
C 2 HOH 9  209 8  HOH HOH A . 
C 2 HOH 10 210 24 HOH HOH A . 
C 2 HOH 11 211 43 HOH HOH A . 
C 2 HOH 12 212 22 HOH HOH A . 
C 2 HOH 13 213 36 HOH HOH A . 
C 2 HOH 14 214 17 HOH HOH A . 
D 2 HOH 1  201 9  HOH HOH B . 
D 2 HOH 2  202 31 HOH HOH B . 
D 2 HOH 3  203 6  HOH HOH B . 
D 2 HOH 4  204 44 HOH HOH B . 
D 2 HOH 5  205 2  HOH HOH B . 
D 2 HOH 6  206 41 HOH HOH B . 
D 2 HOH 7  207 27 HOH HOH B . 
D 2 HOH 8  208 15 HOH HOH B . 
D 2 HOH 9  209 28 HOH HOH B . 
D 2 HOH 10 210 25 HOH HOH B . 
D 2 HOH 11 211 33 HOH HOH B . 
D 2 HOH 12 212 29 HOH HOH B . 
D 2 HOH 13 213 4  HOH HOH B . 
D 2 HOH 14 214 16 HOH HOH B . 
D 2 HOH 15 215 42 HOH HOH B . 
D 2 HOH 16 216 30 HOH HOH B . 
D 2 HOH 17 217 26 HOH HOH B . 
D 2 HOH 18 218 40 HOH HOH B . 
D 2 HOH 19 219 32 HOH HOH B . 
D 2 HOH 20 220 11 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4110  ? 
1 MORE         -8    ? 
1 'SSA (A^2)'  11660 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-01-17 
2 'Structure model' 1 1 2019-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Data collection' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            reflns_shell 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.1 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .      4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 134 ? ? -118.57 58.46  
2 1 GLU A 135 ? ? -101.46 54.87  
3 1 ALA A 136 ? ? -99.05  38.64  
4 1 ALA A 137 ? ? 62.72   128.95 
5 1 ARG A 156 ? ? -55.71  91.07  
6 1 ARG B 101 ? ? 108.06  122.61 
7 1 ARG B 101 ? ? 105.99  124.00 
8 1 ARG B 156 ? ? 82.06   -9.43  
9 1 VAL B 159 ? ? 54.37   116.88 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 96 ? A ALA 1 
2 1 Y 1 A ARG 97 ? A ARG 2 
3 1 Y 1 A LEU 98 ? A LEU 3 
4 1 Y 1 B ALA 96 ? B ALA 1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#