data_5N8A
# 
_entry.id   5N8A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5N8A         
WWPDB D_1200003667 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5N85 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5N8A 
_pdbx_database_status.recvd_initial_deposition_date   2017-02-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Brissett, N.C.' 1 0000-0003-3645-6408 
'Doherty, A.J.'  2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                15222 
_citation.page_last                 15222 
_citation.title                     'Molecular basis for PrimPol recruitment to replication forks by RPA.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms15222 
_citation.pdbx_database_id_PubMed   28534480 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Guilliam, T.A.' 1  
primary 'Brissett, N.C.' 2  
primary 'Ehlinger, A.'   3  
primary 'Keen, B.A.'     4  
primary 'Kolesar, P.'    5  
primary 'Taylor, E.M.'   6  
primary 'Bailey, L.J.'   7  
primary 'Lindsay, H.D.'  8  
primary 'Chazin, W.J.'   9  
primary 'Doherty, A.J.'  10 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5N8A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     38.050 
_cell.length_a_esd                 ? 
_cell.length_b                     53.490 
_cell.length_b_esd                 ? 
_cell.length_c                     53.900 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5N8A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA-directed primase/polymerase protein'          11161.771 1   2.7.7.- ?   'UNP residues 479-559' ? 
2 polymer man 'Replication protein A 70 kDa DNA-binding subunit' 13353.598 1   ?       E7R ?                      ? 
3 water   nat water                                              18.015    140 ?       ?   ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'hPrimpol1,Coiled-coil domain-containing protein 111'                                        
2 'RP-A p70,Replication factor A protein 1,RF-A protein 1,Single-stranded DNA-binding protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSSHHHHHHSSGLVPRGSHMTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENS
LLSYNSEVDEIPDELIIEVLQE
;
;MGSSHHHHHHSSGLVPRGSHMTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENS
LLSYNSEVDEIPDELIIEVLQE
;
X ? 
2 'polypeptide(L)' no no 
;HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQI
HRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
;
;HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQI
HRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  THR n 
1 23  THR n 
1 24  ASP n 
1 25  GLU n 
1 26  ALA n 
1 27  ASP n 
1 28  GLU n 
1 29  THR n 
1 30  ARG n 
1 31  SER n 
1 32  ASN n 
1 33  GLU n 
1 34  THR n 
1 35  GLN n 
1 36  ASN n 
1 37  PRO n 
1 38  HIS n 
1 39  LYS n 
1 40  PRO n 
1 41  SER n 
1 42  PRO n 
1 43  SER n 
1 44  ARG n 
1 45  LEU n 
1 46  SER n 
1 47  THR n 
1 48  GLY n 
1 49  ALA n 
1 50  SER n 
1 51  ALA n 
1 52  ASP n 
1 53  ALA n 
1 54  VAL n 
1 55  TRP n 
1 56  ASP n 
1 57  ASN n 
1 58  GLY n 
1 59  ILE n 
1 60  ASP n 
1 61  ASP n 
1 62  ALA n 
1 63  TYR n 
1 64  PHE n 
1 65  LEU n 
1 66  GLU n 
1 67  ALA n 
1 68  THR n 
1 69  GLU n 
1 70  ASP n 
1 71  ALA n 
1 72  GLU n 
1 73  LEU n 
1 74  ALA n 
1 75  GLU n 
1 76  ALA n 
1 77  ALA n 
1 78  GLU n 
1 79  ASN n 
1 80  SER n 
1 81  LEU n 
1 82  LEU n 
1 83  SER n 
1 84  TYR n 
1 85  ASN n 
1 86  SER n 
1 87  GLU n 
1 88  VAL n 
1 89  ASP n 
1 90  GLU n 
1 91  ILE n 
1 92  PRO n 
1 93  ASP n 
1 94  GLU n 
1 95  LEU n 
1 96  ILE n 
1 97  ILE n 
1 98  GLU n 
1 99  VAL n 
1 100 LEU n 
1 101 GLN n 
1 102 GLU n 
2 1   HIS n 
2 2   MET n 
2 3   VAL n 
2 4   GLY n 
2 5   GLN n 
2 6   LEU n 
2 7   SER n 
2 8   ARG n 
2 9   GLY n 
2 10  ALA n 
2 11  ILE n 
2 12  ALA n 
2 13  ALA n 
2 14  ILE n 
2 15  MET n 
2 16  GLN n 
2 17  LYS n 
2 18  GLY n 
2 19  ASP n 
2 20  THR n 
2 21  ASN n 
2 22  ILE n 
2 23  LYS n 
2 24  PRO n 
2 25  ILE n 
2 26  LEU n 
2 27  GLN n 
2 28  VAL n 
2 29  ILE n 
2 30  ASN n 
2 31  ILE n 
2 32  ARG n 
2 33  PRO n 
2 34  ILE n 
2 35  THR n 
2 36  THR n 
2 37  GLY n 
2 38  ASN n 
2 39  SER n 
2 40  PRO n 
2 41  PRO n 
2 42  ARG n 
2 43  TYR n 
2 44  ARG n 
2 45  LEU n 
2 46  LEU n 
2 47  MET n 
2 48  SER n 
2 49  ASP n 
2 50  GLY n 
2 51  LEU n 
2 52  ASN n 
2 53  THR n 
2 54  LEU n 
2 55  SER n 
2 56  SER n 
2 57  PHE n 
2 58  MET n 
2 59  LEU n 
2 60  ALA n 
2 61  THR n 
2 62  GLN n 
2 63  LEU n 
2 64  ASN n 
2 65  PRO n 
2 66  LEU n 
2 67  VAL n 
2 68  GLU n 
2 69  GLU n 
2 70  GLU n 
2 71  GLN n 
2 72  LEU n 
2 73  SER n 
2 74  SER n 
2 75  ASN n 
2 76  CYS n 
2 77  VAL n 
2 78  CYS n 
2 79  GLN n 
2 80  ILE n 
2 81  HIS n 
2 82  ARG n 
2 83  PHE n 
2 84  ILE n 
2 85  VAL n 
2 86  ASN n 
2 87  THR n 
2 88  LEU n 
2 89  LYS n 
2 90  ASP n 
2 91  GLY n 
2 92  ARG n 
2 93  ARG n 
2 94  VAL n 
2 95  VAL n 
2 96  ILE n 
2 97  LEU n 
2 98  MET n 
2 99  GLU n 
2 100 LEU n 
2 101 GLU n 
2 102 VAL n 
2 103 LEU n 
2 104 LYS n 
2 105 SER n 
2 106 ALA n 
2 107 GLU n 
2 108 ALA n 
2 109 VAL n 
2 110 GLY n 
2 111 VAL n 
2 112 LYS n 
2 113 ILE n 
2 114 GLY n 
2 115 ASN n 
2 116 PRO n 
2 117 VAL n 
2 118 PRO n 
2 119 TYR n 
2 120 ASN n 
2 121 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 102 Human ? 'PRIMPOL, CCDC111'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pET28a ? ? 
2 1 sample 'Biological sequence' 1 121 Human ? 'RPA1, REPA1, RPA70' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? plasmid ? ? ? pET15b ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PRIPO_HUMAN Q96LW4 ? 1 
;TTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQ
E
;
480 
2 UNP RFA1_HUMAN  P27694 ? 2 
;MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIH
RFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
;
1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5N8A X 22 ? 102 ? Q96LW4 480 ? 560 ? -68 12  
2 2 5N8A A 2  ? 121 ? P27694 1   ? 120 ? 1   120 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5N8A MET X 1  ? UNP Q96LW4 ?   ? 'initiating methionine' -89 1  
1 5N8A GLY X 2  ? UNP Q96LW4 ?   ? 'expression tag'        -88 2  
1 5N8A SER X 3  ? UNP Q96LW4 ?   ? 'expression tag'        -87 3  
1 5N8A SER X 4  ? UNP Q96LW4 ?   ? 'expression tag'        -86 4  
1 5N8A HIS X 5  ? UNP Q96LW4 ?   ? 'expression tag'        -85 5  
1 5N8A HIS X 6  ? UNP Q96LW4 ?   ? 'expression tag'        -84 6  
1 5N8A HIS X 7  ? UNP Q96LW4 ?   ? 'expression tag'        -83 7  
1 5N8A HIS X 8  ? UNP Q96LW4 ?   ? 'expression tag'        -82 8  
1 5N8A HIS X 9  ? UNP Q96LW4 ?   ? 'expression tag'        -81 9  
1 5N8A HIS X 10 ? UNP Q96LW4 ?   ? 'expression tag'        -80 10 
1 5N8A SER X 11 ? UNP Q96LW4 ?   ? 'expression tag'        -79 11 
1 5N8A SER X 12 ? UNP Q96LW4 ?   ? 'expression tag'        -78 12 
1 5N8A GLY X 13 ? UNP Q96LW4 ?   ? 'expression tag'        -77 13 
1 5N8A LEU X 14 ? UNP Q96LW4 ?   ? 'expression tag'        -76 14 
1 5N8A VAL X 15 ? UNP Q96LW4 ?   ? 'expression tag'        -75 15 
1 5N8A PRO X 16 ? UNP Q96LW4 ?   ? 'expression tag'        -74 16 
1 5N8A ARG X 17 ? UNP Q96LW4 ?   ? 'expression tag'        -73 17 
1 5N8A GLY X 18 ? UNP Q96LW4 ?   ? 'expression tag'        -72 18 
1 5N8A SER X 19 ? UNP Q96LW4 ?   ? 'expression tag'        -71 19 
1 5N8A HIS X 20 ? UNP Q96LW4 ?   ? 'expression tag'        -70 20 
1 5N8A MET X 21 ? UNP Q96LW4 ?   ? 'expression tag'        -69 21 
2 5N8A HIS A 1  ? UNP P27694 ?   ? 'expression tag'        0   22 
2 5N8A ARG A 8  ? UNP P27694 GLU 7 'engineered mutation'   7   23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5N8A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.88 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         34.66 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2M imidazole malate, 30% w/v PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-30 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91407 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.91407 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5N8A 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.280 
_reflns.d_resolution_low                 16.247 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       29019 
_reflns.number_obs                       351864 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             99.700 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.431 
_reflns.pdbx_Rmerge_I_obs                0.043 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.010 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.984 
_reflns.pdbx_scaling_rejects             8 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.047 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         351864 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1.000 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.280 1.310  ? 1.870  ? ? ? ? 4028 97.700  ? ? ? ? 0.604 ? ? ? ? ? ? ? ? 3.845 ? ? ? ? 0.700 ? ? 1  1 0.677 ? 
1.310 1.350  ? 2.610  ? ? ? ? 3915 99.500  ? ? ? ? 0.522 ? ? ? ? ? ? ? ? 5.043 ? ? ? ? 0.583 ? ? 2  1 0.799 ? 
1.350 1.390  ? 3.250  ? ? ? ? 3810 100.000 ? ? ? ? 0.469 ? ? ? ? ? ? ? ? 5.862 ? ? ? ? 0.515 ? ? 3  1 0.861 ? 
1.390 1.430  ? 4.460  ? ? ? ? 3748 100.000 ? ? ? ? 0.374 ? ? ? ? ? ? ? ? 6.721 ? ? ? ? 0.405 ? ? 4  1 0.936 ? 
1.430 1.480  ? 5.570  ? ? ? ? 3597 100.000 ? ? ? ? 0.307 ? ? ? ? ? ? ? ? 6.758 ? ? ? ? 0.333 ? ? 5  1 0.949 ? 
1.480 1.530  ? 7.000  ? ? ? ? 3534 99.900  ? ? ? ? 0.241 ? ? ? ? ? ? ? ? 6.776 ? ? ? ? 0.261 ? ? 6  1 0.970 ? 
1.530 1.590  ? 8.810  ? ? ? ? 3340 100.000 ? ? ? ? 0.188 ? ? ? ? ? ? ? ? 6.794 ? ? ? ? 0.203 ? ? 7  1 0.982 ? 
1.590 1.650  ? 10.600 ? ? ? ? 3287 100.000 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 6.851 ? ? ? ? 0.169 ? ? 8  1 0.988 ? 
1.650 1.730  ? 13.080 ? ? ? ? 3128 100.000 ? ? ? ? 0.126 ? ? ? ? ? ? ? ? 6.897 ? ? ? ? 0.137 ? ? 9  1 0.991 ? 
1.730 1.810  ? 15.970 ? ? ? ? 2952 100.000 ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 6.842 ? ? ? ? 0.111 ? ? 10 1 0.995 ? 
1.810 1.910  ? 21.640 ? ? ? ? 2839 100.000 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 6.908 ? ? ? ? 0.082 ? ? 11 1 0.997 ? 
1.910 2.020  ? 28.200 ? ? ? ? 2667 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 6.854 ? ? ? ? 0.061 ? ? 12 1 0.998 ? 
2.020 2.160  ? 34.840 ? ? ? ? 2510 100.000 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 6.980 ? ? ? ? 0.049 ? ? 13 1 0.999 ? 
2.160 2.340  ? 40.370 ? ? ? ? 2378 100.000 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 6.971 ? ? ? ? 0.044 ? ? 14 1 0.999 ? 
2.340 2.560  ? 44.570 ? ? ? ? 2145 100.000 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 6.822 ? ? ? ? 0.038 ? ? 15 1 0.999 ? 
2.560 2.860  ? 51.110 ? ? ? ? 1949 100.000 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 7.117 ? ? ? ? 0.034 ? ? 16 1 0.999 ? 
2.860 3.300  ? 59.830 ? ? ? ? 1717 100.000 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 6.863 ? ? ? ? 0.029 ? ? 17 1 1.000 ? 
3.300 4.050  ? 70.580 ? ? ? ? 1460 100.000 ? ? ? ? 0.021 ? ? ? ? ? ? ? ? 6.768 ? ? ? ? 0.023 ? ? 18 1 1.000 ? 
4.050 5.720  ? 76.870 ? ? ? ? 1114 100.000 ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 6.813 ? ? ? ? 0.020 ? ? 19 1 1.000 ? 
5.720 16.247 ? 73.950 ? ? ? ? 595  95.000  ? ? ? ? 0.019 ? ? ? ? ? ? ? ? 6.931 ? ? ? ? 0.020 ? ? 20 1 1.000 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                65.990 
_refine.B_iso_mean                               21.1988 
_refine.B_iso_min                                8.690 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5N8A 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.2800 
_refine.ls_d_res_low                             16.2470 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28966 
_refine.ls_number_reflns_R_free                  1410 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8000 
_refine.ls_percent_reflns_R_free                 4.8700 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1549 
_refine.ls_R_factor_R_free                       0.1785 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1537 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4IPC 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 17.1200 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1200 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.2800 
_refine_hist.d_res_low                        16.2470 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             140 
_refine_hist.number_atoms_total               1139 
_refine_hist.pdbx_number_residues_total       130 
_refine_hist.pdbx_B_iso_mean_solvent          32.95 
_refine_hist.pdbx_number_atoms_protein        999 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 1095 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.912  ? 1502 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.086  ? 185  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 195  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 18.650 ? 444  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.2800 1.3258  2815 . 131 2684 98.0000  . . . 0.2236 0.0000 0.1883 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.3258 1.3788  2837 . 166 2671 100.0000 . . . 0.2150 0.0000 0.1597 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.3788 1.4415  2863 . 131 2732 100.0000 . . . 0.1953 0.0000 0.1416 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.4415 1.5175  2878 . 122 2756 100.0000 . . . 0.1861 0.0000 0.1372 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.5175 1.6125  2870 . 132 2738 100.0000 . . . 0.1667 0.0000 0.1293 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.6125 1.7368  2889 . 117 2772 100.0000 . . . 0.1509 0.0000 0.1345 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.7368 1.9114  2884 . 153 2731 100.0000 . . . 0.1715 0.0000 0.1377 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.9114 2.1874  2906 . 136 2770 100.0000 . . . 0.1718 0.0000 0.1332 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.1874 2.7537  2949 . 182 2767 100.0000 . . . 0.1524 0.0000 0.1620 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.7537 16.2479 3075 . 140 2935 100.0000 . . . 0.2014 0.0000 0.1689 . . . . . . 10 . . . 
# 
_struct.entry_id                     5N8A 
_struct.title                        'Structure of RPA70N in complex with PrimPol (fragment 480-560)' 
_struct.pdbx_descriptor              'Archaeal Phophoesterase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5N8A 
_struct_keywords.text            'Complex, Replication, Basic cleft, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO A 92  ? ILE A 97  ? PRO X 2   ILE X 7   1 ? 6  
HELX_P HELX_P2 AA2 HIS B 1   ? LEU B 6   ? HIS A 0   LEU A 5   5 ? 6  
HELX_P HELX_P3 AA3 GLY B 9   ? GLY B 18  ? GLY A 8   GLY A 17  1 ? 10 
HELX_P HELX_P4 AA4 LEU B 63  ? GLU B 69  ? LEU A 62  GLU A 68  1 ? 7  
HELX_P HELX_P5 AA5 SER B 105 ? GLY B 110 ? SER A 104 GLY A 109 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL B 117 ? PRO B 118 ? VAL A 116 PRO A 117 
AA1 2 ASN B 52  ? LEU B 59  ? ASN A 51  LEU A 58  
AA1 3 ARG B 93  ? LYS B 104 ? ARG A 92  LYS A 103 
AA1 4 VAL B 77  ? THR B 87  ? VAL A 76  THR A 86  
AA1 5 ILE B 25  ? ILE B 34  ? ILE A 24  ILE A 33  
AA1 6 ARG B 42  ? SER B 48  ? ARG A 41  SER A 47  
AA1 7 ASN B 52  ? LEU B 59  ? ASN A 51  LEU A 58  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL B 117 ? O VAL A 116 N THR B 53 ? N THR A 52 
AA1 2 3 N MET B 58  ? N MET A 57  O LEU B 97 ? O LEU A 96 
AA1 3 4 O VAL B 94  ? O VAL A 93  N ASN B 86 ? N ASN A 85 
AA1 4 5 O CYS B 78  ? O CYS A 77  N LEU B 26 ? N LEU A 25 
AA1 5 6 N ILE B 29  ? N ILE A 28  O LEU B 46 ? O LEU A 45 
AA1 6 7 N TYR B 43  ? N TYR A 42  O LEU B 59 ? O LEU A 58 
# 
_atom_sites.entry_id                    5N8A 
_atom_sites.fract_transf_matrix[1][1]   0.026281 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018695 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018553 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 90  ? 10.561  -7.880  4.277   1.00 48.06 ? 0   GLU X N   1 
ATOM   2    C CA  . GLU A 1 90  ? 11.019  -9.102  4.930   1.00 46.89 ? 0   GLU X CA  1 
ATOM   3    C C   . GLU A 1 90  ? 10.108  -10.284 4.595   1.00 40.10 ? 0   GLU X C   1 
ATOM   4    O O   . GLU A 1 90  ? 10.590  -11.368 4.269   1.00 39.39 ? 0   GLU X O   1 
ATOM   5    C CB  . GLU A 1 90  ? 11.125  -8.902  6.444   1.00 51.83 ? 0   GLU X CB  1 
ATOM   6    C CG  . GLU A 1 90  ? 11.721  -10.086 7.194   1.00 55.60 ? 0   GLU X CG  1 
ATOM   7    C CD  . GLU A 1 90  ? 10.667  -10.936 7.875   1.00 58.86 ? 0   GLU X CD  1 
ATOM   8    O OE1 . GLU A 1 90  ? 9.465   -10.646 7.699   1.00 59.95 ? 0   GLU X OE1 1 
ATOM   9    O OE2 . GLU A 1 90  ? 11.040  -11.891 8.590   1.00 60.15 ? 0   GLU X OE2 1 
ATOM   10   N N   . ILE A 1 91  ? 8.796   -10.081 4.677   1.00 33.18 ? 1   ILE X N   1 
ATOM   11   C CA  . ILE A 1 91  ? 7.846   -11.078 4.188   1.00 28.39 ? 1   ILE X CA  1 
ATOM   12   C C   . ILE A 1 91  ? 7.987   -11.132 2.671   1.00 27.23 ? 1   ILE X C   1 
ATOM   13   O O   . ILE A 1 91  ? 7.848   -10.096 2.007   1.00 25.52 ? 1   ILE X O   1 
ATOM   14   C CB  . ILE A 1 91  ? 6.398   -10.732 4.571   1.00 25.62 ? 1   ILE X CB  1 
ATOM   15   C CG1 . ILE A 1 91  ? 6.242   -10.572 6.088   1.00 24.51 ? 1   ILE X CG1 1 
ATOM   16   C CG2 . ILE A 1 91  ? 5.458   -11.812 4.048   1.00 25.27 ? 1   ILE X CG2 1 
ATOM   17   C CD1 . ILE A 1 91  ? 4.872   -10.064 6.512   1.00 24.59 ? 1   ILE X CD1 1 
ATOM   18   N N   . PRO A 1 92  ? 8.246   -12.294 2.080   1.00 27.87 ? 2   PRO X N   1 
ATOM   19   C CA  . PRO A 1 92  ? 8.381   -12.364 0.621   1.00 28.03 ? 2   PRO X CA  1 
ATOM   20   C C   . PRO A 1 92  ? 7.049   -12.121 -0.072  1.00 26.11 ? 2   PRO X C   1 
ATOM   21   O O   . PRO A 1 92  ? 5.973   -12.297 0.505   1.00 24.44 ? 2   PRO X O   1 
ATOM   22   C CB  . PRO A 1 92  ? 8.877   -13.793 0.381   1.00 30.18 ? 2   PRO X CB  1 
ATOM   23   C CG  . PRO A 1 92  ? 8.440   -14.558 1.588   1.00 30.90 ? 2   PRO X CG  1 
ATOM   24   C CD  . PRO A 1 92  ? 8.490   -13.593 2.730   1.00 29.42 ? 2   PRO X CD  1 
ATOM   25   N N   . ASP A 1 93  ? 7.143   -11.705 -1.341  1.00 25.43 ? 3   ASP X N   1 
ATOM   26   C CA  . ASP A 1 93  ? 5.949   -11.384 -2.122  1.00 25.50 ? 3   ASP X CA  1 
ATOM   27   C C   . ASP A 1 93  ? 4.966   -12.546 -2.161  1.00 27.71 ? 3   ASP X C   1 
ATOM   28   O O   . ASP A 1 93  ? 3.749   -12.339 -2.092  1.00 26.54 ? 3   ASP X O   1 
ATOM   29   C CB  . ASP A 1 93  ? 6.337   -11.013 -3.552  1.00 24.05 ? 3   ASP X CB  1 
ATOM   30   C CG  . ASP A 1 93  ? 6.937   -9.636  -3.657  1.00 23.20 ? 3   ASP X CG  1 
ATOM   31   O OD1 . ASP A 1 93  ? 6.981   -8.912  -2.637  1.00 22.96 ? 3   ASP X OD1 1 
ATOM   32   O OD2 . ASP A 1 93  ? 7.355   -9.272  -4.774  1.00 23.01 ? 3   ASP X OD2 1 
ATOM   33   N N   . GLU A 1 94  ? 5.471   -13.775 -2.297  1.00 30.88 ? 4   GLU X N   1 
ATOM   34   C CA  . GLU A 1 94  ? 4.583   -14.925 -2.422  1.00 34.68 ? 4   GLU X CA  1 
ATOM   35   C C   . GLU A 1 94  ? 3.800   -15.205 -1.146  1.00 34.07 ? 4   GLU X C   1 
ATOM   36   O O   . GLU A 1 94  ? 2.747   -15.848 -1.210  1.00 34.81 ? 4   GLU X O   1 
ATOM   37   C CB  . GLU A 1 94  ? 5.358   -16.170 -2.863  1.00 39.12 ? 4   GLU X CB  1 
ATOM   38   C CG  . GLU A 1 94  ? 6.421   -16.640 -1.887  1.00 43.63 ? 4   GLU X CG  1 
ATOM   39   C CD  . GLU A 1 94  ? 7.783   -16.027 -2.157  1.00 47.00 ? 4   GLU X CD  1 
ATOM   40   O OE1 . GLU A 1 94  ? 7.843   -14.953 -2.798  1.00 47.61 ? 4   GLU X OE1 1 
ATOM   41   O OE2 . GLU A 1 94  ? 8.797   -16.625 -1.733  1.00 48.57 ? 4   GLU X OE2 1 
ATOM   42   N N   . LEU A 1 95  ? 4.278   -14.735 0.004   1.00 31.94 ? 5   LEU X N   1 
ATOM   43   C CA  . LEU A 1 95  ? 3.575   -14.950 1.263   1.00 31.55 ? 5   LEU X CA  1 
ATOM   44   C C   . LEU A 1 95  ? 2.767   -13.743 1.719   1.00 30.74 ? 5   LEU X C   1 
ATOM   45   O O   . LEU A 1 95  ? 1.787   -13.914 2.453   1.00 30.15 ? 5   LEU X O   1 
ATOM   46   C CB  . LEU A 1 95  ? 4.564   -15.352 2.364   1.00 31.61 ? 5   LEU X CB  1 
ATOM   47   C CG  . LEU A 1 95  ? 5.338   -16.658 2.142   1.00 32.44 ? 5   LEU X CG  1 
ATOM   48   C CD1 . LEU A 1 95  ? 6.280   -16.948 3.307   1.00 33.22 ? 5   LEU X CD1 1 
ATOM   49   C CD2 . LEU A 1 95  ? 4.398   -17.840 1.916   1.00 33.11 ? 5   LEU X CD2 1 
ATOM   50   N N   . ILE A 1 96  ? 3.137   -12.532 1.293   1.00 30.31 ? 6   ILE X N   1 
ATOM   51   C CA  . ILE A 1 96  ? 2.484   -11.331 1.811   1.00 30.76 ? 6   ILE X CA  1 
ATOM   52   C C   . ILE A 1 96  ? 1.054   -11.207 1.295   1.00 34.34 ? 6   ILE X C   1 
ATOM   53   O O   . ILE A 1 96  ? 0.203   -10.595 1.953   1.00 32.54 ? 6   ILE X O   1 
ATOM   54   C CB  . ILE A 1 96  ? 3.345   -10.079 1.531   1.00 28.67 ? 6   ILE X CB  1 
ATOM   55   C CG1 . ILE A 1 96  ? 2.944   -8.925  2.454   1.00 28.58 ? 6   ILE X CG1 1 
ATOM   56   C CG2 . ILE A 1 96  ? 3.243   -9.649  0.068   1.00 28.70 ? 6   ILE X CG2 1 
ATOM   57   C CD1 . ILE A 1 96  ? 3.887   -7.740  2.394   1.00 29.10 ? 6   ILE X CD1 1 
ATOM   58   N N   . ILE A 1 97  ? 0.755   -11.796 0.130   1.00 39.18 ? 7   ILE X N   1 
ATOM   59   C CA  . ILE A 1 97  ? -0.577  -11.690 -0.461  1.00 44.48 ? 7   ILE X CA  1 
ATOM   60   C C   . ILE A 1 97  ? -1.488  -12.850 -0.082  1.00 48.43 ? 7   ILE X C   1 
ATOM   61   O O   . ILE A 1 97  ? -2.619  -12.926 -0.582  1.00 48.44 ? 7   ILE X O   1 
ATOM   62   C CB  . ILE A 1 97  ? -0.506  -11.511 -1.991  1.00 45.83 ? 7   ILE X CB  1 
ATOM   63   C CG1 . ILE A 1 97  ? 0.217   -12.694 -2.638  1.00 46.61 ? 7   ILE X CG1 1 
ATOM   64   C CG2 . ILE A 1 97  ? 0.180   -10.200 -2.340  1.00 46.00 ? 7   ILE X CG2 1 
ATOM   65   C CD1 . ILE A 1 97  ? 0.482   -12.507 -4.116  1.00 47.21 ? 7   ILE X CD1 1 
ATOM   66   N N   . GLU A 1 98  ? -1.036  -13.752 0.783   1.00 51.66 ? 8   GLU X N   1 
ATOM   67   C CA  . GLU A 1 98  ? -1.849  -14.889 1.195   1.00 54.52 ? 8   GLU X CA  1 
ATOM   68   C C   . GLU A 1 98  ? -2.488  -14.648 2.559   1.00 56.22 ? 8   GLU X C   1 
ATOM   69   O O   . GLU A 1 98  ? -3.107  -13.611 2.792   1.00 56.93 ? 8   GLU X O   1 
ATOM   70   C CB  . GLU A 1 98  ? -1.006  -16.165 1.227   1.00 54.98 ? 8   GLU X CB  1 
ATOM   71   N N   . HIS B 2 1   ? 11.974  20.269  13.980  1.00 41.00 ? 0   HIS A N   1 
ATOM   72   C CA  . HIS B 2 1   ? 11.669  18.989  14.621  1.00 33.55 ? 0   HIS A CA  1 
ATOM   73   C C   . HIS B 2 1   ? 10.711  18.178  13.737  1.00 23.68 ? 0   HIS A C   1 
ATOM   74   O O   . HIS B 2 1   ? 9.556   17.931  14.072  0.97 21.29 ? 0   HIS A O   1 
ATOM   75   C CB  . HIS B 2 1   ? 11.130  19.246  16.036  1.00 37.36 ? 0   HIS A CB  1 
ATOM   76   C CG  . HIS B 2 1   ? 10.901  18.012  16.850  0.77 40.58 ? 0   HIS A CG  1 
ATOM   77   N ND1 . HIS B 2 1   ? 9.677   17.712  17.408  0.67 41.71 ? 0   HIS A ND1 1 
ATOM   78   C CD2 . HIS B 2 1   ? 11.742  17.022  17.231  0.89 41.88 ? 0   HIS A CD2 1 
ATOM   79   C CE1 . HIS B 2 1   ? 9.770   16.583  18.087  1.00 42.15 ? 0   HIS A CE1 1 
ATOM   80   N NE2 . HIS B 2 1   ? 11.013  16.142  17.994  0.70 42.48 ? 0   HIS A NE2 1 
ATOM   81   N N   . MET B 2 2   ? 11.236  17.779  12.573  1.00 18.51 ? 1   MET A N   1 
ATOM   82   C CA  A MET B 2 2   ? 10.375  17.168  11.568  0.59 16.22 ? 1   MET A CA  1 
ATOM   83   C CA  B MET B 2 2   ? 10.404  17.146  11.550  0.41 16.45 ? 1   MET A CA  1 
ATOM   84   C C   . MET B 2 2   ? 9.703   15.901  12.075  1.00 14.31 ? 1   MET A C   1 
ATOM   85   O O   . MET B 2 2   ? 8.582   15.595  11.657  1.00 14.15 ? 1   MET A O   1 
ATOM   86   C CB  A MET B 2 2   ? 11.149  16.904  10.281  0.59 16.36 ? 1   MET A CB  1 
ATOM   87   C CB  B MET B 2 2   ? 11.250  16.778  10.327  0.41 16.84 ? 1   MET A CB  1 
ATOM   88   C CG  A MET B 2 2   ? 11.261  18.143  9.405   0.59 18.07 ? 1   MET A CG  1 
ATOM   89   C CG  B MET B 2 2   ? 11.916  17.959  9.617   0.41 18.51 ? 1   MET A CG  1 
ATOM   90   S SD  A MET B 2 2   ? 12.013  17.820  7.813   0.59 19.20 ? 1   MET A SD  1 
ATOM   91   S SD  B MET B 2 2   ? 12.809  17.489  8.117   0.41 21.45 ? 1   MET A SD  1 
ATOM   92   C CE  A MET B 2 2   ? 13.681  17.414  8.326   0.59 19.24 ? 1   MET A CE  1 
ATOM   93   C CE  B MET B 2 2   ? 11.448  17.104  7.015   0.41 22.27 ? 1   MET A CE  1 
ATOM   94   N N   . VAL B 2 3   ? 10.351  15.161  12.978  1.00 12.54 ? 2   VAL A N   1 
ATOM   95   C CA  . VAL B 2 3   ? 9.759   13.919  13.462  1.00 13.13 ? 2   VAL A CA  1 
ATOM   96   C C   . VAL B 2 3   ? 8.502   14.168  14.278  1.00 11.62 ? 2   VAL A C   1 
ATOM   97   O O   . VAL B 2 3   ? 7.661   13.271  14.417  1.00 11.77 ? 2   VAL A O   1 
ATOM   98   C CB  . VAL B 2 3   ? 10.804  13.078  14.212  1.00 14.42 ? 2   VAL A CB  1 
ATOM   99   C CG1 . VAL B 2 3   ? 11.063  13.640  15.605  1.00 14.50 ? 2   VAL A CG1 1 
ATOM   100  C CG2 . VAL B 2 3   ? 10.376  11.633  14.263  1.00 16.50 ? 2   VAL A CG2 1 
ATOM   101  N N   . GLY B 2 4   ? 8.335   15.381  14.800  1.00 11.46 ? 3   GLY A N   1 
ATOM   102  C CA  . GLY B 2 4   ? 7.097   15.743  15.457  1.00 12.03 ? 3   GLY A CA  1 
ATOM   103  C C   . GLY B 2 4   ? 5.891   15.742  14.541  1.00 11.16 ? 3   GLY A C   1 
ATOM   104  O O   . GLY B 2 4   ? 4.765   15.806  15.040  1.00 12.51 ? 3   GLY A O   1 
ATOM   105  N N   . GLN B 2 5   ? 6.091   15.652  13.221  1.00 10.74 ? 4   GLN A N   1 
ATOM   106  C CA  . GLN B 2 5   ? 4.978   15.552  12.288  1.00 10.65 ? 4   GLN A CA  1 
ATOM   107  C C   . GLN B 2 5   ? 4.444   14.129  12.144  1.00 10.26 ? 4   GLN A C   1 
ATOM   108  O O   . GLN B 2 5   ? 3.389   13.944  11.526  1.00 11.18 ? 4   GLN A O   1 
ATOM   109  C CB  . GLN B 2 5   ? 5.389   16.087  10.910  1.00 13.51 ? 4   GLN A CB  1 
ATOM   110  C CG  . GLN B 2 5   ? 5.799   17.565  10.901  1.00 16.36 ? 4   GLN A CG  1 
ATOM   111  C CD  . GLN B 2 5   ? 4.658   18.503  11.276  1.00 19.48 ? 4   GLN A CD  1 
ATOM   112  O OE1 . GLN B 2 5   ? 4.694   19.149  12.324  1.00 23.22 ? 4   GLN A OE1 1 
ATOM   113  N NE2 . GLN B 2 5   ? 3.655   18.592  10.420  1.00 20.26 ? 4   GLN A NE2 1 
ATOM   114  N N   . LEU B 2 6   ? 5.151   13.125  12.668  1.00 9.81  ? 5   LEU A N   1 
ATOM   115  C CA  . LEU B 2 6   ? 4.792   11.719  12.504  1.00 9.68  ? 5   LEU A CA  1 
ATOM   116  C C   . LEU B 2 6   ? 4.301   11.132  13.821  1.00 8.79  ? 5   LEU A C   1 
ATOM   117  O O   . LEU B 2 6   ? 4.708   11.562  14.899  1.00 9.87  ? 5   LEU A O   1 
ATOM   118  C CB  . LEU B 2 6   ? 6.000   10.924  12.020  1.00 9.98  ? 5   LEU A CB  1 
ATOM   119  C CG  . LEU B 2 6   ? 6.644   11.402  10.715  1.00 10.52 ? 5   LEU A CG  1 
ATOM   120  C CD1 . LEU B 2 6   ? 7.780   10.459  10.312  1.00 12.39 ? 5   LEU A CD1 1 
ATOM   121  C CD2 . LEU B 2 6   ? 5.620   11.561  9.579   1.00 11.43 ? 5   LEU A CD2 1 
ATOM   122  N N   . SER B 2 7   ? 3.415   10.139  13.727  1.00 9.45  ? 6   SER A N   1 
ATOM   123  C CA  . SER B 2 7   ? 2.826   9.485   14.904  1.00 9.91  ? 6   SER A CA  1 
ATOM   124  C C   . SER B 2 7   ? 3.810   8.496   15.533  1.00 9.34  ? 6   SER A C   1 
ATOM   125  O O   . SER B 2 7   ? 3.656   7.277   15.450  1.00 10.33 ? 6   SER A O   1 
ATOM   126  C CB  . SER B 2 7   ? 1.543   8.768   14.509  1.00 10.48 ? 6   SER A CB  1 
ATOM   127  O OG  . SER B 2 7   ? 0.522   9.683   14.187  1.00 10.70 ? 6   SER A OG  1 
ATOM   128  N N   . ARG B 2 8   ? 4.822   9.044   16.204  1.00 10.32 ? 7   ARG A N   1 
ATOM   129  C CA  . ARG B 2 8   ? 5.840   8.213   16.833  1.00 11.03 ? 7   ARG A CA  1 
ATOM   130  C C   . ARG B 2 8   ? 5.194   7.214   17.777  1.00 11.24 ? 7   ARG A C   1 
ATOM   131  O O   . ARG B 2 8   ? 4.414   7.591   18.648  1.00 12.61 ? 7   ARG A O   1 
ATOM   132  C CB  . ARG B 2 8   ? 6.810   9.096   17.620  1.00 11.34 ? 7   ARG A CB  1 
ATOM   133  C CG  . ARG B 2 8   ? 7.778   9.873   16.740  1.00 11.57 ? 7   ARG A CG  1 
ATOM   134  C CD  . ARG B 2 8   ? 8.703   10.763  17.558  1.00 12.68 ? 7   ARG A CD  1 
ATOM   135  N NE  . ARG B 2 8   ? 7.996   11.959  18.004  1.00 14.24 ? 7   ARG A NE  1 
ATOM   136  C CZ  . ARG B 2 8   ? 8.528   12.898  18.777  1.00 17.39 ? 7   ARG A CZ  1 
ATOM   137  N NH1 . ARG B 2 8   ? 9.779   12.777  19.219  1.00 19.88 ? 7   ARG A NH1 1 
ATOM   138  N NH2 . ARG B 2 8   ? 7.810   13.961  19.103  1.00 18.23 ? 7   ARG A NH2 1 
ATOM   139  N N   . GLY B 2 9   ? 5.515   5.934   17.587  1.00 11.44 ? 8   GLY A N   1 
ATOM   140  C CA  . GLY B 2 9   ? 4.975   4.855   18.392  1.00 13.20 ? 8   GLY A CA  1 
ATOM   141  C C   . GLY B 2 9   ? 3.771   4.164   17.790  1.00 12.85 ? 8   GLY A C   1 
ATOM   142  O O   . GLY B 2 9   ? 3.329   3.144   18.326  1.00 13.88 ? 8   GLY A O   1 
ATOM   143  N N   . ALA B 2 10  ? 3.233   4.675   16.685  1.00 11.57 ? 9   ALA A N   1 
ATOM   144  C CA  . ALA B 2 10  ? 2.065   4.047   16.084  1.00 11.33 ? 9   ALA A CA  1 
ATOM   145  C C   . ALA B 2 10  ? 2.367   2.649   15.560  1.00 11.48 ? 9   ALA A C   1 
ATOM   146  O O   . ALA B 2 10  ? 1.497   1.774   15.599  1.00 12.60 ? 9   ALA A O   1 
ATOM   147  C CB  . ALA B 2 10  ? 1.519   4.909   14.956  1.00 11.62 ? 9   ALA A CB  1 
ATOM   148  N N   . ILE B 2 11  ? 3.565   2.419   15.020  1.00 12.03 ? 10  ILE A N   1 
ATOM   149  C CA  . ILE B 2 11  ? 3.850   1.088   14.478  1.00 13.26 ? 10  ILE A CA  1 
ATOM   150  C C   . ILE B 2 11  ? 3.828   0.043   15.590  1.00 14.21 ? 10  ILE A C   1 
ATOM   151  O O   . ILE B 2 11  ? 3.207   -1.020  15.459  1.00 14.68 ? 10  ILE A O   1 
ATOM   152  C CB  . ILE B 2 11  ? 5.155   1.082   13.663  1.00 13.72 ? 10  ILE A CB  1 
ATOM   153  C CG1 . ILE B 2 11  ? 4.911   1.764   12.313  1.00 15.21 ? 10  ILE A CG1 1 
ATOM   154  C CG2 . ILE B 2 11  ? 5.688   -0.361  13.480  1.00 14.97 ? 10  ILE A CG2 1 
ATOM   155  C CD1 . ILE B 2 11  ? 6.163   2.068   11.557  1.00 16.39 ? 10  ILE A CD1 1 
ATOM   156  N N   . ALA B 2 12  ? 4.479   0.341   16.715  1.00 14.93 ? 11  ALA A N   1 
ATOM   157  C CA  . ALA B 2 12  ? 4.412   -0.572  17.853  1.00 16.51 ? 11  ALA A CA  1 
ATOM   158  C C   . ALA B 2 12  ? 2.973   -0.772  18.325  1.00 17.03 ? 11  ALA A C   1 
ATOM   159  O O   . ALA B 2 12  ? 2.578   -1.894  18.668  1.00 19.03 ? 11  ALA A O   1 
ATOM   160  C CB  . ALA B 2 12  ? 5.304   -0.061  18.985  1.00 18.57 ? 11  ALA A CB  1 
ATOM   161  N N   . ALA B 2 13  ? 2.173   0.298   18.360  1.00 15.70 ? 12  ALA A N   1 
ATOM   162  C CA  . ALA B 2 13  ? 0.787   0.163   18.807  1.00 16.23 ? 12  ALA A CA  1 
ATOM   163  C C   . ALA B 2 13  ? 0.002   -0.762  17.890  1.00 16.68 ? 12  ALA A C   1 
ATOM   164  O O   . ALA B 2 13  ? -0.775  -1.604  18.357  1.00 18.48 ? 12  ALA A O   1 
ATOM   165  C CB  . ALA B 2 13  ? 0.114   1.533   18.889  1.00 17.40 ? 12  ALA A CB  1 
ATOM   166  N N   . ILE B 2 14  ? 0.204   -0.632  16.579  1.00 14.91 ? 13  ILE A N   1 
ATOM   167  C CA  . ILE B 2 14  ? -0.499  -1.504  15.644  1.00 16.08 ? 13  ILE A CA  1 
ATOM   168  C C   . ILE B 2 14  ? -0.050  -2.940  15.825  1.00 18.01 ? 13  ILE A C   1 
ATOM   169  O O   . ILE B 2 14  ? -0.868  -3.859  15.941  1.00 19.08 ? 13  ILE A O   1 
ATOM   170  C CB  . ILE B 2 14  ? -0.240  -1.041  14.204  1.00 15.88 ? 13  ILE A CB  1 
ATOM   171  C CG1 . ILE B 2 14  ? -0.889  0.320   13.969  1.00 16.22 ? 13  ILE A CG1 1 
ATOM   172  C CG2 . ILE B 2 14  ? -0.724  -2.103  13.216  1.00 16.82 ? 13  ILE A CG2 1 
ATOM   173  C CD1 . ILE B 2 14  ? -0.428  0.989   12.705  1.00 16.92 ? 13  ILE A CD1 1 
ATOM   174  N N   A MET B 2 15  ? 1.258   -3.157  15.858  0.68 16.43 ? 14  MET A N   1 
ATOM   175  N N   B MET B 2 15  ? 1.263   -3.150  15.836  0.32 19.25 ? 14  MET A N   1 
ATOM   176  C CA  A MET B 2 15  ? 1.777   -4.517  15.839  0.68 18.10 ? 14  MET A CA  1 
ATOM   177  C CA  B MET B 2 15  ? 1.815   -4.497  15.890  0.32 21.56 ? 14  MET A CA  1 
ATOM   178  C C   A MET B 2 15  ? 1.737   -5.206  17.207  0.68 21.77 ? 14  MET A C   1 
ATOM   179  C C   B MET B 2 15  ? 1.505   -5.169  17.218  0.32 22.64 ? 14  MET A C   1 
ATOM   180  O O   A MET B 2 15  ? 1.693   -6.442  17.253  0.68 22.94 ? 14  MET A O   1 
ATOM   181  O O   B MET B 2 15  ? 1.069   -6.326  17.259  0.32 21.78 ? 14  MET A O   1 
ATOM   182  C CB  A MET B 2 15  ? 3.182   -4.549  15.217  0.68 17.28 ? 14  MET A CB  1 
ATOM   183  C CB  B MET B 2 15  ? 3.325   -4.417  15.681  0.32 22.84 ? 14  MET A CB  1 
ATOM   184  C CG  A MET B 2 15  ? 3.280   -3.979  13.784  0.68 17.25 ? 14  MET A CG  1 
ATOM   185  C CG  B MET B 2 15  ? 3.723   -4.179  14.248  0.32 23.91 ? 14  MET A CG  1 
ATOM   186  S SD  A MET B 2 15  ? 2.674   -5.045  12.433  0.68 17.39 ? 14  MET A SD  1 
ATOM   187  S SD  B MET B 2 15  ? 3.336   -5.638  13.278  0.32 24.65 ? 14  MET A SD  1 
ATOM   188  C CE  A MET B 2 15  ? 3.957   -6.299  12.318  0.68 16.49 ? 14  MET A CE  1 
ATOM   189  C CE  B MET B 2 15  ? 1.885   -5.103  12.384  0.32 25.13 ? 14  MET A CE  1 
ATOM   190  N N   . GLN B 2 16  ? 1.726   -4.455  18.317  1.00 24.24 ? 15  GLN A N   1 
ATOM   191  C CA  . GLN B 2 16  ? 1.644   -5.056  19.648  1.00 29.02 ? 15  GLN A CA  1 
ATOM   192  C C   . GLN B 2 16  ? 0.237   -5.086  20.222  1.00 32.29 ? 15  GLN A C   1 
ATOM   193  O O   . GLN B 2 16  ? -0.145  -6.077  20.852  1.00 32.96 ? 15  GLN A O   1 
ATOM   194  C CB  . GLN B 2 16  ? 2.570   -4.336  20.634  1.00 32.25 ? 15  GLN A CB  1 
ATOM   195  C CG  . GLN B 2 16  ? 4.035   -4.448  20.292  1.00 35.92 ? 15  GLN A CG  1 
ATOM   196  C CD  . GLN B 2 16  ? 4.898   -3.422  21.010  1.00 38.87 ? 15  GLN A CD  1 
ATOM   197  O OE1 . GLN B 2 16  ? 4.454   -2.762  21.949  1.00 40.78 ? 15  GLN A OE1 1 
ATOM   198  N NE2 . GLN B 2 16  ? 6.138   -3.278  20.560  1.00 38.63 ? 15  GLN A NE2 1 
ATOM   199  N N   . LYS B 2 17  ? -0.541  -4.022  20.043  1.00 33.65 ? 16  LYS A N   1 
ATOM   200  C CA  . LYS B 2 17  ? -1.867  -3.947  20.635  1.00 36.84 ? 16  LYS A CA  1 
ATOM   201  C C   . LYS B 2 17  ? -2.983  -4.260  19.655  1.00 36.36 ? 16  LYS A C   1 
ATOM   202  O O   . LYS B 2 17  ? -4.130  -4.416  20.081  1.00 36.61 ? 16  LYS A O   1 
ATOM   203  C CB  . LYS B 2 17  ? -2.106  -2.564  21.253  1.00 41.04 ? 16  LYS A CB  1 
ATOM   204  C CG  . LYS B 2 17  ? -1.430  -2.367  22.596  1.00 45.24 ? 16  LYS A CG  1 
ATOM   205  C CD  . LYS B 2 17  ? -1.675  -0.971  23.136  1.00 48.55 ? 16  LYS A CD  1 
ATOM   206  C CE  . LYS B 2 17  ? -0.432  -0.430  23.814  1.00 50.57 ? 16  LYS A CE  1 
ATOM   207  N NZ  . LYS B 2 17  ? 0.793   -0.760  23.033  1.00 51.75 ? 16  LYS A NZ  1 
ATOM   208  N N   . GLY B 2 18  ? -2.682  -4.363  18.366  1.00 35.83 ? 17  GLY A N   1 
ATOM   209  C CA  . GLY B 2 18  ? -3.742  -4.517  17.394  1.00 35.38 ? 17  GLY A CA  1 
ATOM   210  C C   . GLY B 2 18  ? -4.697  -3.350  17.351  1.00 34.60 ? 17  GLY A C   1 
ATOM   211  O O   . GLY B 2 18  ? -5.841  -3.514  16.925  1.00 35.20 ? 17  GLY A O   1 
ATOM   212  N N   . ASP B 2 19  ? -4.253  -2.171  17.789  1.00 33.42 ? 18  ASP A N   1 
ATOM   213  C CA  . ASP B 2 19  ? -5.063  -0.957  17.769  1.00 32.33 ? 18  ASP A CA  1 
ATOM   214  C C   . ASP B 2 19  ? -5.324  -0.561  16.320  1.00 31.87 ? 18  ASP A C   1 
ATOM   215  O O   . ASP B 2 19  ? -4.391  -0.197  15.597  1.00 31.52 ? 18  ASP A O   1 
ATOM   216  C CB  . ASP B 2 19  ? -4.288  0.143   18.496  1.00 32.54 ? 18  ASP A CB  1 
ATOM   217  C CG  . ASP B 2 19  ? -5.084  1.438   18.672  1.00 33.08 ? 18  ASP A CG  1 
ATOM   218  O OD1 . ASP B 2 19  ? -5.943  1.764   17.826  1.00 32.76 ? 18  ASP A OD1 1 
ATOM   219  O OD2 . ASP B 2 19  ? -4.819  2.160   19.656  1.00 32.88 ? 18  ASP A OD2 1 
ATOM   220  N N   . THR B 2 20  ? -6.587  -0.622  15.888  1.00 32.19 ? 19  THR A N   1 
ATOM   221  C CA  . THR B 2 20  ? -6.966  -0.168  14.553  1.00 32.45 ? 19  THR A CA  1 
ATOM   222  C C   . THR B 2 20  ? -7.849  1.074   14.573  1.00 28.67 ? 19  THR A C   1 
ATOM   223  O O   . THR B 2 20  ? -8.336  1.489   13.514  1.00 28.18 ? 19  THR A O   1 
ATOM   224  C CB  . THR B 2 20  ? -7.634  -1.281  13.737  1.00 35.68 ? 19  THR A CB  1 
ATOM   225  O OG1 . THR B 2 20  ? -8.840  -1.697  14.385  1.00 37.40 ? 19  THR A OG1 1 
ATOM   226  C CG2 . THR B 2 20  ? -6.699  -2.473  13.580  1.00 35.88 ? 19  THR A CG2 1 
ATOM   227  N N   . ASN B 2 21  ? -8.062  1.683   15.743  1.00 25.24 ? 20  ASN A N   1 
ATOM   228  C CA  . ASN B 2 21  ? -8.837  2.919   15.830  1.00 24.21 ? 20  ASN A CA  1 
ATOM   229  C C   . ASN B 2 21  ? -7.997  4.168   15.606  1.00 20.73 ? 20  ASN A C   1 
ATOM   230  O O   . ASN B 2 21  ? -8.543  5.217   15.242  1.00 21.30 ? 20  ASN A O   1 
ATOM   231  C CB  . ASN B 2 21  ? -9.514  3.019   17.198  1.00 27.75 ? 20  ASN A CB  1 
ATOM   232  C CG  . ASN B 2 21  ? -10.613 2.000   17.370  1.00 31.31 ? 20  ASN A CG  1 
ATOM   233  O OD1 . ASN B 2 21  ? -11.244 1.588   16.396  1.00 33.68 ? 20  ASN A OD1 1 
ATOM   234  N ND2 . ASN B 2 21  ? -10.849 1.580   18.609  1.00 31.82 ? 20  ASN A ND2 1 
ATOM   235  N N   . ILE B 2 22  ? -6.690  4.088   15.838  1.00 17.00 ? 21  ILE A N   1 
ATOM   236  C CA  . ILE B 2 22  ? -5.830  5.230   15.593  1.00 14.67 ? 21  ILE A CA  1 
ATOM   237  C C   . ILE B 2 22  ? -5.851  5.586   14.108  1.00 13.01 ? 21  ILE A C   1 
ATOM   238  O O   . ILE B 2 22  ? -6.105  4.738   13.242  1.00 13.04 ? 21  ILE A O   1 
ATOM   239  C CB  . ILE B 2 22  ? -4.400  4.936   16.085  1.00 14.79 ? 21  ILE A CB  1 
ATOM   240  C CG1 . ILE B 2 22  ? -3.857  3.638   15.487  1.00 15.29 ? 21  ILE A CG1 1 
ATOM   241  C CG2 . ILE B 2 22  ? -4.332  4.879   17.600  1.00 16.53 ? 21  ILE A CG2 1 
ATOM   242  C CD1 . ILE B 2 22  ? -2.376  3.486   15.701  1.00 16.79 ? 21  ILE A CD1 1 
ATOM   243  N N   . LYS B 2 23  ? -5.577  6.860   13.817  1.00 11.45 ? 22  LYS A N   1 
ATOM   244  C CA  . LYS B 2 23  ? -5.441  7.373   12.453  1.00 11.10 ? 22  LYS A CA  1 
ATOM   245  C C   . LYS B 2 23  ? -4.036  7.954   12.306  1.00 10.51 ? 22  LYS A C   1 
ATOM   246  O O   . LYS B 2 23  ? -3.854  9.173   12.166  1.00 10.52 ? 22  LYS A O   1 
ATOM   247  C CB  . LYS B 2 23  ? -6.533  8.389   12.117  1.00 13.11 ? 22  LYS A CB  1 
ATOM   248  C CG  . LYS B 2 23  ? -7.911  7.784   12.253  1.00 17.19 ? 22  LYS A CG  1 
ATOM   249  C CD  . LYS B 2 23  ? -8.993  8.683   11.729  1.00 22.29 ? 22  LYS A CD  1 
ATOM   250  C CE  . LYS B 2 23  ? -10.345 8.012   11.904  1.00 27.16 ? 22  LYS A CE  1 
ATOM   251  N NZ  . LYS B 2 23  ? -10.384 6.673   11.240  1.00 31.01 ? 22  LYS A NZ  1 
ATOM   252  N N   . PRO B 2 24  ? -3.013  7.104   12.335  1.00 10.01 ? 23  PRO A N   1 
ATOM   253  C CA  . PRO B 2 24  ? -1.644  7.602   12.479  1.00 9.81  ? 23  PRO A CA  1 
ATOM   254  C C   . PRO B 2 24  ? -1.126  8.285   11.229  1.00 9.30  ? 23  PRO A C   1 
ATOM   255  O O   . PRO B 2 24  ? -1.512  7.966   10.096  1.00 10.11 ? 23  PRO A O   1 
ATOM   256  C CB  . PRO B 2 24  ? -0.834  6.339   12.770  1.00 10.71 ? 23  PRO A CB  1 
ATOM   257  C CG  . PRO B 2 24  ? -1.625  5.252   12.075  1.00 11.47 ? 23  PRO A CG  1 
ATOM   258  C CD  . PRO B 2 24  ? -3.066  5.634   12.281  1.00 11.16 ? 23  PRO A CD  1 
ATOM   259  N N   . ILE B 2 25  ? -0.205  9.210   11.453  1.00 9.37  ? 24  ILE A N   1 
ATOM   260  C CA  . ILE B 2 25  ? 0.473   9.917   10.377  1.00 9.19  ? 24  ILE A CA  1 
ATOM   261  C C   . ILE B 2 25  ? 1.838   9.269   10.213  1.00 9.05  ? 24  ILE A C   1 
ATOM   262  O O   . ILE B 2 25  ? 2.628   9.196   11.162  1.00 9.81  ? 24  ILE A O   1 
ATOM   263  C CB  . ILE B 2 25  ? 0.566   11.425  10.668  1.00 9.87  ? 24  ILE A CB  1 
ATOM   264  C CG1 . ILE B 2 25  ? -0.854  12.019  10.749  1.00 11.64 ? 24  ILE A CG1 1 
ATOM   265  C CG2 . ILE B 2 25  ? 1.409   12.123  9.615   1.00 10.78 ? 24  ILE A CG2 1 
ATOM   266  C CD1 . ILE B 2 25  ? -0.897  13.485  11.163  1.00 13.48 ? 24  ILE A CD1 1 
ATOM   267  N N   . LEU B 2 26  ? 2.092   8.751   9.019   1.00 9.26  ? 25  LEU A N   1 
ATOM   268  C CA  . LEU B 2 26  ? 3.288   7.978   8.714   1.00 8.92  ? 25  LEU A CA  1 
ATOM   269  C C   . LEU B 2 26  ? 3.953   8.563   7.479   1.00 8.93  ? 25  LEU A C   1 
ATOM   270  O O   . LEU B 2 26  ? 3.324   9.254   6.681   1.00 11.40 ? 25  LEU A O   1 
ATOM   271  C CB  . LEU B 2 26  ? 2.918   6.515   8.406   1.00 10.35 ? 25  LEU A CB  1 
ATOM   272  C CG  . LEU B 2 26  ? 2.129   5.798   9.491   1.00 11.65 ? 25  LEU A CG  1 
ATOM   273  C CD1 . LEU B 2 26  ? 1.728   4.410   8.980   1.00 12.89 ? 25  LEU A CD1 1 
ATOM   274  C CD2 . LEU B 2 26  ? 2.966   5.690   10.758  1.00 12.85 ? 25  LEU A CD2 1 
ATOM   275  N N   . GLN B 2 27  ? 5.232   8.255   7.309   1.00 8.69  ? 26  GLN A N   1 
ATOM   276  C CA  . GLN B 2 27  ? 5.961   8.635   6.105   1.00 9.11  ? 26  GLN A CA  1 
ATOM   277  C C   . GLN B 2 27  ? 6.221   7.398   5.255   1.00 8.76  ? 26  GLN A C   1 
ATOM   278  O O   . GLN B 2 27  ? 6.642   6.356   5.769   1.00 9.70  ? 26  GLN A O   1 
ATOM   279  C CB  . GLN B 2 27  ? 7.300   9.297   6.429   1.00 9.98  ? 26  GLN A CB  1 
ATOM   280  C CG  . GLN B 2 27  ? 7.999   9.815   5.172   1.00 10.41 ? 26  GLN A CG  1 
ATOM   281  C CD  . GLN B 2 27  ? 9.311   10.511  5.444   1.00 9.89  ? 26  GLN A CD  1 
ATOM   282  O OE1 . GLN B 2 27  ? 10.038  10.157  6.368   1.00 10.29 ? 26  GLN A OE1 1 
ATOM   283  N NE2 . GLN B 2 27  ? 9.624   11.515  4.627   1.00 10.83 ? 26  GLN A NE2 1 
ATOM   284  N N   . VAL B 2 28  ? 5.994   7.524   3.950   1.00 9.08  ? 27  VAL A N   1 
ATOM   285  C CA  . VAL B 2 28  ? 6.376   6.475   3.010   1.00 10.00 ? 27  VAL A CA  1 
ATOM   286  C C   . VAL B 2 28  ? 7.879   6.563   2.811   1.00 9.72  ? 27  VAL A C   1 
ATOM   287  O O   . VAL B 2 28  ? 8.395   7.614   2.426   1.00 10.90 ? 27  VAL A O   1 
ATOM   288  C CB  . VAL B 2 28  ? 5.654   6.642   1.667   1.00 10.54 ? 27  VAL A CB  1 
ATOM   289  C CG1 . VAL B 2 28  ? 6.113   5.557   0.698   1.00 11.62 ? 27  VAL A CG1 1 
ATOM   290  C CG2 . VAL B 2 28  ? 4.140   6.601   1.862   1.00 12.51 ? 27  VAL A CG2 1 
ATOM   291  N N   . ILE B 2 29  ? 8.583   5.458   3.042   1.00 9.97  ? 28  ILE A N   1 
ATOM   292  C CA  . ILE B 2 29  ? 10.008  5.403   2.743   1.00 10.56 ? 28  ILE A CA  1 
ATOM   293  C C   . ILE B 2 29  ? 10.253  4.822   1.362   1.00 10.95 ? 28  ILE A C   1 
ATOM   294  O O   . ILE B 2 29  ? 11.073  5.336   0.601   1.00 13.03 ? 28  ILE A O   1 
ATOM   295  C CB  . ILE B 2 29  ? 10.780  4.627   3.833   1.00 10.83 ? 28  ILE A CB  1 
ATOM   296  C CG1 . ILE B 2 29  ? 10.508  5.221   5.224   1.00 12.20 ? 28  ILE A CG1 1 
ATOM   297  C CG2 . ILE B 2 29  ? 12.267  4.607   3.503   1.00 12.54 ? 28  ILE A CG2 1 
ATOM   298  C CD1 . ILE B 2 29  ? 10.799  6.711   5.342   1.00 13.88 ? 28  ILE A CD1 1 
ATOM   299  N N   . ASN B 2 30  ? 9.543   3.753   1.013   1.00 11.15 ? 29  ASN A N   1 
ATOM   300  C CA  . ASN B 2 30  ? 9.677   3.135   -0.297  1.00 12.97 ? 29  ASN A CA  1 
ATOM   301  C C   . ASN B 2 30  ? 8.363   2.461   -0.657  1.00 10.98 ? 29  ASN A C   1 
ATOM   302  O O   . ASN B 2 30  ? 7.579   2.091   0.217   1.00 11.82 ? 29  ASN A O   1 
ATOM   303  C CB  . ASN B 2 30  ? 10.812  2.105   -0.288  1.00 17.99 ? 29  ASN A CB  1 
ATOM   304  C CG  . ASN B 2 30  ? 11.071  1.541   -1.639  1.00 25.18 ? 29  ASN A CG  1 
ATOM   305  O OD1 . ASN B 2 30  ? 11.487  2.265   -2.542  1.00 28.67 ? 29  ASN A OD1 1 
ATOM   306  N ND2 . ASN B 2 30  ? 10.801  0.248   -1.810  1.00 27.51 ? 29  ASN A ND2 1 
ATOM   307  N N   . ILE B 2 31  ? 8.137   2.303   -1.963  1.00 11.03 ? 30  ILE A N   1 
ATOM   308  C CA  . ILE B 2 31  ? 6.997   1.579   -2.518  1.00 12.85 ? 30  ILE A CA  1 
ATOM   309  C C   . ILE B 2 31  ? 7.534   0.732   -3.652  1.00 13.01 ? 30  ILE A C   1 
ATOM   310  O O   . ILE B 2 31  ? 8.359   1.196   -4.446  1.00 14.30 ? 30  ILE A O   1 
ATOM   311  C CB  . ILE B 2 31  ? 5.941   2.520   -3.131  1.00 14.09 ? 30  ILE A CB  1 
ATOM   312  C CG1 . ILE B 2 31  ? 5.513   3.592   -2.148  1.00 15.92 ? 30  ILE A CG1 1 
ATOM   313  C CG2 . ILE B 2 31  ? 4.719   1.738   -3.609  1.00 15.11 ? 30  ILE A CG2 1 
ATOM   314  C CD1 . ILE B 2 31  ? 4.477   4.529   -2.720  1.00 18.32 ? 30  ILE A CD1 1 
ATOM   315  N N   . ARG B 2 32  ? 7.071   -0.503  -3.748  1.00 12.02 ? 31  ARG A N   1 
ATOM   316  C CA  . ARG B 2 32  ? 7.401   -1.273  -4.936  1.00 13.50 ? 31  ARG A CA  1 
ATOM   317  C C   . ARG B 2 32  ? 6.245   -2.203  -5.255  1.00 13.17 ? 31  ARG A C   1 
ATOM   318  O O   . ARG B 2 32  ? 5.431   -2.523  -4.381  1.00 13.73 ? 31  ARG A O   1 
ATOM   319  C CB  . ARG B 2 32  ? 8.701   -2.063  -4.767  1.00 15.78 ? 31  ARG A CB  1 
ATOM   320  C CG  . ARG B 2 32  ? 8.600   -3.221  -3.819  1.00 16.71 ? 31  ARG A CG  1 
ATOM   321  C CD  . ARG B 2 32  ? 9.812   -4.110  -4.041  1.00 17.99 ? 31  ARG A CD  1 
ATOM   322  N NE  . ARG B 2 32  ? 9.896   -5.230  -3.108  1.00 19.59 ? 31  ARG A NE  1 
ATOM   323  C CZ  . ARG B 2 32  ? 9.313   -6.413  -3.299  1.00 20.16 ? 31  ARG A CZ  1 
ATOM   324  N NH1 . ARG B 2 32  ? 9.461   -7.368  -2.390  1.00 21.45 ? 31  ARG A NH1 1 
ATOM   325  N NH2 . ARG B 2 32  ? 8.584   -6.645  -4.394  1.00 20.65 ? 31  ARG A NH2 1 
ATOM   326  N N   . PRO B 2 33  ? 6.132   -2.638  -6.500  1.00 13.47 ? 32  PRO A N   1 
ATOM   327  C CA  . PRO B 2 33  ? 5.117   -3.639  -6.816  1.00 13.16 ? 32  PRO A CA  1 
ATOM   328  C C   . PRO B 2 33  ? 5.478   -4.962  -6.174  1.00 14.06 ? 32  PRO A C   1 
ATOM   329  O O   . PRO B 2 33  ? 6.652   -5.295  -5.991  1.00 14.99 ? 32  PRO A O   1 
ATOM   330  C CB  . PRO B 2 33  ? 5.186   -3.746  -8.345  1.00 12.94 ? 32  PRO A CB  1 
ATOM   331  C CG  . PRO B 2 33  ? 6.011   -2.578  -8.797  1.00 13.86 ? 32  PRO A CG  1 
ATOM   332  C CD  . PRO B 2 33  ? 6.938   -2.284  -7.680  1.00 14.42 ? 32  PRO A CD  1 
ATOM   333  N N   . ILE B 2 34  ? 4.447   -5.695  -5.815  1.00 16.17 ? 33  ILE A N   1 
ATOM   334  C CA  . ILE B 2 34  ? 4.537   -7.084  -5.387  1.00 18.90 ? 33  ILE A CA  1 
ATOM   335  C C   . ILE B 2 34  ? 4.404   -7.944  -6.629  1.00 19.35 ? 33  ILE A C   1 
ATOM   336  O O   . ILE B 2 34  ? 3.625   -7.617  -7.533  1.00 20.91 ? 33  ILE A O   1 
ATOM   337  C CB  . ILE B 2 34  ? 3.391   -7.389  -4.410  1.00 21.88 ? 33  ILE A CB  1 
ATOM   338  C CG1 . ILE B 2 34  ? 3.434   -6.417  -3.247  1.00 23.54 ? 33  ILE A CG1 1 
ATOM   339  C CG2 . ILE B 2 34  ? 3.447   -8.833  -3.945  1.00 23.20 ? 33  ILE A CG2 1 
ATOM   340  C CD1 . ILE B 2 34  ? 2.269   -6.527  -2.448  1.00 25.21 ? 33  ILE A CD1 1 
ATOM   341  N N   . THR B 2 35  ? 5.149   -9.047  -6.681  1.00 19.61 ? 34  THR A N   1 
ATOM   342  C CA  . THR B 2 35  ? 5.003   -9.975  -7.794  1.00 23.16 ? 34  THR A CA  1 
ATOM   343  C C   . THR B 2 35  ? 3.571   -10.480 -7.869  1.00 29.17 ? 34  THR A C   1 
ATOM   344  O O   . THR B 2 35  ? 3.055   -11.047 -6.903  1.00 28.71 ? 34  THR A O   1 
ATOM   345  C CB  . THR B 2 35  ? 5.959   -11.149 -7.626  1.00 22.97 ? 34  THR A CB  1 
ATOM   346  O OG1 . THR B 2 35  ? 7.298   -10.650 -7.553  1.00 23.02 ? 34  THR A OG1 1 
ATOM   347  C CG2 . THR B 2 35  ? 5.839   -12.083 -8.817  1.00 23.99 ? 34  THR A CG2 1 
ATOM   348  N N   . THR B 2 36  ? 2.927   -10.263 -9.016  1.00 35.18 ? 35  THR A N   1 
ATOM   349  C CA  . THR B 2 36  ? 1.556   -10.696 -9.243  1.00 41.72 ? 35  THR A CA  1 
ATOM   350  C C   . THR B 2 36  ? 1.443   -11.356 -10.610 1.00 47.71 ? 35  THR A C   1 
ATOM   351  O O   . THR B 2 36  ? 2.270   -11.137 -11.498 1.00 48.06 ? 35  THR A O   1 
ATOM   352  C CB  . THR B 2 36  ? 0.563   -9.525  -9.173  1.00 41.92 ? 35  THR A CB  1 
ATOM   353  O OG1 . THR B 2 36  ? 0.893   -8.549  -10.173 1.00 41.83 ? 35  THR A OG1 1 
ATOM   354  C CG2 . THR B 2 36  ? 0.575   -8.879  -7.791  1.00 42.29 ? 35  THR A CG2 1 
ATOM   355  N N   . GLY B 2 37  ? 0.391   -12.155 -10.776 1.00 52.75 ? 36  GLY A N   1 
ATOM   356  C CA  . GLY B 2 37  ? 0.155   -12.843 -12.033 1.00 56.84 ? 36  GLY A CA  1 
ATOM   357  C C   . GLY B 2 37  ? -0.846  -12.125 -12.916 1.00 60.29 ? 36  GLY A C   1 
ATOM   358  O O   . GLY B 2 37  ? -0.632  -10.966 -13.273 1.00 61.20 ? 36  GLY A O   1 
ATOM   359  N N   . ASN B 2 38  ? -1.936  -12.798 -13.284 1.00 62.05 ? 37  ASN A N   1 
ATOM   360  C CA  . ASN B 2 38  ? -2.985  -12.187 -14.106 1.00 63.22 ? 37  ASN A CA  1 
ATOM   361  C C   . ASN B 2 38  ? -4.066  -11.588 -13.205 1.00 63.28 ? 37  ASN A C   1 
ATOM   362  O O   . ASN B 2 38  ? -5.158  -12.130 -13.021 1.00 65.99 ? 37  ASN A O   1 
ATOM   363  C CB  . ASN B 2 38  ? -3.554  -13.203 -15.094 1.00 63.66 ? 37  ASN A CB  1 
ATOM   364  N N   . SER B 2 39  ? -3.724  -10.436 -12.638 1.00 59.20 ? 38  SER A N   1 
ATOM   365  C CA  . SER B 2 39  ? -4.554  -9.773  -11.643 1.00 54.47 ? 38  SER A CA  1 
ATOM   366  C C   . SER B 2 39  ? -4.156  -8.306  -11.616 1.00 48.64 ? 38  SER A C   1 
ATOM   367  O O   . SER B 2 39  ? -3.150  -7.923  -12.227 1.00 49.17 ? 38  SER A O   1 
ATOM   368  C CB  . SER B 2 39  ? -4.359  -10.417 -10.259 1.00 55.17 ? 38  SER A CB  1 
ATOM   369  O OG  . SER B 2 39  ? -3.024  -10.274 -9.809  1.00 55.52 ? 38  SER A OG  1 
ATOM   370  N N   . PRO B 2 40  ? -4.933  -7.454  -10.950 1.00 41.46 ? 39  PRO A N   1 
ATOM   371  C CA  . PRO B 2 40  ? -4.481  -6.085  -10.739 1.00 36.31 ? 39  PRO A CA  1 
ATOM   372  C C   . PRO B 2 40  ? -3.147  -6.081  -10.026 1.00 30.72 ? 39  PRO A C   1 
ATOM   373  O O   . PRO B 2 40  ? -2.863  -6.966  -9.195  1.00 30.68 ? 39  PRO A O   1 
ATOM   374  C CB  . PRO B 2 40  ? -5.587  -5.484  -9.860  1.00 37.31 ? 39  PRO A CB  1 
ATOM   375  C CG  . PRO B 2 40  ? -6.798  -6.271  -10.206 1.00 38.63 ? 39  PRO A CG  1 
ATOM   376  C CD  . PRO B 2 40  ? -6.308  -7.663  -10.459 1.00 40.29 ? 39  PRO A CD  1 
ATOM   377  N N   . PRO B 2 41  ? -2.285  -5.113  -10.324 1.00 25.98 ? 40  PRO A N   1 
ATOM   378  C CA  . PRO B 2 41  ? -1.013  -5.036  -9.602  1.00 22.28 ? 40  PRO A CA  1 
ATOM   379  C C   . PRO B 2 41  ? -1.271  -4.781  -8.127  1.00 18.41 ? 40  PRO A C   1 
ATOM   380  O O   . PRO B 2 41  ? -2.333  -4.309  -7.726  1.00 18.12 ? 40  PRO A O   1 
ATOM   381  C CB  . PRO B 2 41  ? -0.298  -3.846  -10.254 1.00 24.06 ? 40  PRO A CB  1 
ATOM   382  C CG  . PRO B 2 41  ? -1.373  -3.034  -10.854 1.00 25.25 ? 40  PRO A CG  1 
ATOM   383  C CD  . PRO B 2 41  ? -2.465  -3.987  -11.256 1.00 25.87 ? 40  PRO A CD  1 
ATOM   384  N N   . ARG B 2 42  ? -0.280  -5.115  -7.312  1.00 17.70 ? 41  ARG A N   1 
ATOM   385  C CA  . ARG B 2 42  ? -0.339  -4.870  -5.880  1.00 17.92 ? 41  ARG A CA  1 
ATOM   386  C C   . ARG B 2 42  ? 0.936   -4.163  -5.467  1.00 16.10 ? 41  ARG A C   1 
ATOM   387  O O   . ARG B 2 42  ? 2.000   -4.412  -6.045  1.00 17.80 ? 41  ARG A O   1 
ATOM   388  C CB  . ARG B 2 42  ? -0.444  -6.192  -5.110  1.00 23.08 ? 41  ARG A CB  1 
ATOM   389  C CG  . ARG B 2 42  ? -1.772  -6.918  -5.276  1.00 30.09 ? 41  ARG A CG  1 
ATOM   390  C CD  . ARG B 2 42  ? -2.793  -6.337  -4.330  1.00 37.86 ? 41  ARG A CD  1 
ATOM   391  N NE  . ARG B 2 42  ? -3.321  -7.322  -3.391  1.00 44.13 ? 41  ARG A NE  1 
ATOM   392  C CZ  . ARG B 2 42  ? -3.946  -7.003  -2.261  1.00 48.21 ? 41  ARG A CZ  1 
ATOM   393  N NH1 . ARG B 2 42  ? -4.106  -5.728  -1.931  1.00 48.58 ? 41  ARG A NH1 1 
ATOM   394  N NH2 . ARG B 2 42  ? -4.398  -7.955  -1.456  1.00 49.96 ? 41  ARG A NH2 1 
ATOM   395  N N   . TYR B 2 43  ? 0.827   -3.279  -4.466  1.00 13.96 ? 42  TYR A N   1 
ATOM   396  C CA  . TYR B 2 43  ? 1.965   -2.500  -3.992  1.00 13.28 ? 42  TYR A CA  1 
ATOM   397  C C   . TYR B 2 43  ? 2.225   -2.743  -2.516  1.00 12.49 ? 42  TYR A C   1 
ATOM   398  O O   . TYR B 2 43  ? 1.294   -2.812  -1.707  1.00 13.16 ? 42  TYR A O   1 
ATOM   399  C CB  . TYR B 2 43  ? 1.753   -0.998  -4.236  1.00 12.51 ? 42  TYR A CB  1 
ATOM   400  C CG  . TYR B 2 43  ? 1.584   -0.717  -5.694  1.00 12.28 ? 42  TYR A CG  1 
ATOM   401  C CD1 . TYR B 2 43  ? 2.682   -0.694  -6.540  1.00 13.82 ? 42  TYR A CD1 1 
ATOM   402  C CD2 . TYR B 2 43  ? 0.327   -0.529  -6.241  1.00 13.88 ? 42  TYR A CD2 1 
ATOM   403  C CE1 . TYR B 2 43  ? 2.536   -0.484  -7.894  1.00 14.63 ? 42  TYR A CE1 1 
ATOM   404  C CE2 . TYR B 2 43  ? 0.165   -0.307  -7.592  1.00 14.24 ? 42  TYR A CE2 1 
ATOM   405  C CZ  . TYR B 2 43  ? 1.273   -0.281  -8.414  1.00 14.46 ? 42  TYR A CZ  1 
ATOM   406  O OH  . TYR B 2 43  ? 1.112   -0.060  -9.765  1.00 16.72 ? 42  TYR A OH  1 
ATOM   407  N N   . ARG B 2 44  ? 3.505   -2.851  -2.174  1.00 12.03 ? 43  ARG A N   1 
ATOM   408  C CA  . ARG B 2 44  ? 3.936   -2.955  -0.791  1.00 12.31 ? 43  ARG A CA  1 
ATOM   409  C C   . ARG B 2 44  ? 4.768   -1.737  -0.429  1.00 10.96 ? 43  ARG A C   1 
ATOM   410  O O   . ARG B 2 44  ? 5.452   -1.158  -1.281  1.00 13.21 ? 43  ARG A O   1 
ATOM   411  C CB  . ARG B 2 44  ? 4.736   -4.237  -0.548  1.00 13.62 ? 43  ARG A CB  1 
ATOM   412  C CG  . ARG B 2 44  ? 5.931   -4.398  -1.448  1.00 16.50 ? 43  ARG A CG  1 
ATOM   413  C CD  . ARG B 2 44  ? 6.576   -5.749  -1.181  1.00 17.91 ? 43  ARG A CD  1 
ATOM   414  N NE  . ARG B 2 44  ? 6.895   -5.873  0.240   1.00 17.34 ? 43  ARG A NE  1 
ATOM   415  C CZ  . ARG B 2 44  ? 7.156   -7.021  0.856   1.00 18.51 ? 43  ARG A CZ  1 
ATOM   416  N NH1 . ARG B 2 44  ? 7.135   -8.172  0.182   1.00 20.12 ? 43  ARG A NH1 1 
ATOM   417  N NH2 . ARG B 2 44  ? 7.445   -7.014  2.153   1.00 19.06 ? 43  ARG A NH2 1 
ATOM   418  N N   . LEU B 2 45  ? 4.699   -1.347  0.847   1.00 10.52 ? 44  LEU A N   1 
ATOM   419  C CA  . LEU B 2 45  ? 5.317   -0.114  1.310   1.00 10.57 ? 44  LEU A CA  1 
ATOM   420  C C   . LEU B 2 45  ? 6.187   -0.372  2.525   1.00 10.73 ? 44  LEU A C   1 
ATOM   421  O O   . LEU B 2 45  ? 5.842   -1.172  3.403   1.00 12.58 ? 44  LEU A O   1 
ATOM   422  C CB  . LEU B 2 45  ? 4.273   0.937   1.684   1.00 11.17 ? 44  LEU A CB  1 
ATOM   423  C CG  . LEU B 2 45  ? 3.326   1.349   0.564   1.00 12.43 ? 44  LEU A CG  1 
ATOM   424  C CD1 . LEU B 2 45  ? 2.126   0.426   0.527   1.00 16.33 ? 44  LEU A CD1 1 
ATOM   425  C CD2 . LEU B 2 45  ? 2.855   2.771   0.751   1.00 14.54 ? 44  LEU A CD2 1 
ATOM   426  N N   . LEU B 2 46  ? 7.309   0.324   2.563   1.00 10.13 ? 45  LEU A N   1 
ATOM   427  C CA  . LEU B 2 46  ? 8.113   0.500   3.763   1.00 10.10 ? 45  LEU A CA  1 
ATOM   428  C C   . LEU B 2 46  ? 7.704   1.848   4.339   1.00 9.11  ? 45  LEU A C   1 
ATOM   429  O O   . LEU B 2 46  ? 7.877   2.877   3.676   1.00 9.78  ? 45  LEU A O   1 
ATOM   430  C CB  . LEU B 2 46  ? 9.597   0.513   3.380   1.00 11.69 ? 45  LEU A CB  1 
ATOM   431  C CG  . LEU B 2 46  ? 10.594  0.699   4.529   1.00 12.20 ? 45  LEU A CG  1 
ATOM   432  C CD1 . LEU B 2 46  ? 10.544  -0.470  5.514   1.00 13.34 ? 45  LEU A CD1 1 
ATOM   433  C CD2 . LEU B 2 46  ? 12.017  0.913   4.001   1.00 13.42 ? 45  LEU A CD2 1 
ATOM   434  N N   . MET B 2 47  ? 7.108   1.847   5.531   1.00 9.62  ? 46  MET A N   1 
ATOM   435  C CA  A MET B 2 47  ? 6.663   3.096   6.121   0.41 10.00 ? 46  MET A CA  1 
ATOM   436  C CA  B MET B 2 47  ? 6.566   3.039   6.179   0.59 9.52  ? 46  MET A CA  1 
ATOM   437  C C   . MET B 2 47  ? 7.325   3.324   7.468   1.00 8.78  ? 46  MET A C   1 
ATOM   438  O O   . MET B 2 47  ? 7.838   2.403   8.111   1.00 10.42 ? 46  MET A O   1 
ATOM   439  C CB  A MET B 2 47  ? 5.146   3.153   6.232   0.41 11.57 ? 46  MET A CB  1 
ATOM   440  C CB  B MET B 2 47  ? 5.092   2.832   6.562   0.59 10.48 ? 46  MET A CB  1 
ATOM   441  C CG  A MET B 2 47  ? 4.495   2.922   4.897   0.41 11.58 ? 46  MET A CG  1 
ATOM   442  C CG  B MET B 2 47  ? 4.195   2.397   5.416   0.59 10.96 ? 46  MET A CG  1 
ATOM   443  S SD  A MET B 2 47  ? 2.717   3.016   5.001   0.41 12.49 ? 46  MET A SD  1 
ATOM   444  S SD  B MET B 2 47  ? 3.933   3.654   4.182   0.59 10.22 ? 46  MET A SD  1 
ATOM   445  C CE  A MET B 2 47  ? 2.462   4.773   4.824   0.41 12.21 ? 46  MET A CE  1 
ATOM   446  C CE  B MET B 2 47  ? 3.202   4.942   5.178   0.59 10.92 ? 46  MET A CE  1 
ATOM   447  N N   . SER B 2 48  ? 7.324   4.589   7.881   1.00 8.76  ? 47  SER A N   1 
ATOM   448  C CA  . SER B 2 48  ? 7.987   5.057   9.089   1.00 9.13  ? 47  SER A CA  1 
ATOM   449  C C   . SER B 2 48  ? 7.015   5.842   9.959   1.00 8.72  ? 47  SER A C   1 
ATOM   450  O O   . SER B 2 48  ? 6.236   6.655   9.457   1.00 10.06 ? 47  SER A O   1 
ATOM   451  C CB  . SER B 2 48  ? 9.117   5.984   8.695   1.00 9.73  ? 47  SER A CB  1 
ATOM   452  O OG  . SER B 2 48  ? 9.634   6.651   9.833   1.00 10.53 ? 47  SER A OG  1 
ATOM   453  N N   . ASP B 2 49  ? 7.085   5.627   11.271  1.00 9.57  ? 48  ASP A N   1 
ATOM   454  C CA  . ASP B 2 49  ? 6.403   6.491   12.229  1.00 11.14 ? 48  ASP A CA  1 
ATOM   455  C C   . ASP B 2 49  ? 7.357   7.463   12.906  1.00 12.34 ? 48  ASP A C   1 
ATOM   456  O O   . ASP B 2 49  ? 6.976   8.110   13.887  1.00 13.97 ? 48  ASP A O   1 
ATOM   457  C CB  . ASP B 2 49  ? 5.601   5.676   13.260  1.00 11.85 ? 48  ASP A CB  1 
ATOM   458  C CG  . ASP B 2 49  ? 6.476   4.906   14.232  1.00 12.82 ? 48  ASP A CG  1 
ATOM   459  O OD1 . ASP B 2 49  ? 7.726   4.949   14.142  1.00 13.25 ? 48  ASP A OD1 1 
ATOM   460  O OD2 . ASP B 2 49  ? 5.893   4.250   15.130  1.00 14.05 ? 48  ASP A OD2 1 
ATOM   461  N N   . GLY B 2 50  ? 8.591   7.574   12.415  1.00 12.18 ? 49  GLY A N   1 
ATOM   462  C CA  . GLY B 2 50  ? 9.606   8.402   13.030  1.00 14.27 ? 49  GLY A CA  1 
ATOM   463  C C   . GLY B 2 50  ? 10.538  7.656   13.965  1.00 15.61 ? 49  GLY A C   1 
ATOM   464  O O   . GLY B 2 50  ? 11.692  8.055   14.110  1.00 18.09 ? 49  GLY A O   1 
ATOM   465  N N   . LEU B 2 51  ? 10.055  6.601   14.618  1.00 13.67 ? 50  LEU A N   1 
ATOM   466  C CA  . LEU B 2 51  ? 10.884  5.758   15.478  1.00 14.39 ? 50  LEU A CA  1 
ATOM   467  C C   . LEU B 2 51  ? 11.254  4.452   14.812  1.00 13.61 ? 50  LEU A C   1 
ATOM   468  O O   . LEU B 2 51  ? 12.413  4.021   14.893  1.00 13.41 ? 50  LEU A O   1 
ATOM   469  C CB  . LEU B 2 51  ? 10.157  5.420   16.780  1.00 15.99 ? 50  LEU A CB  1 
ATOM   470  C CG  . LEU B 2 51  ? 9.849   6.587   17.709  1.00 17.41 ? 50  LEU A CG  1 
ATOM   471  C CD1 . LEU B 2 51  ? 9.176   6.073   18.958  1.00 17.62 ? 50  LEU A CD1 1 
ATOM   472  C CD2 . LEU B 2 51  ? 11.118  7.356   18.040  1.00 18.26 ? 50  LEU A CD2 1 
ATOM   473  N N   . ASN B 2 52  ? 10.279  3.815   14.167  1.00 12.95 ? 51  ASN A N   1 
ATOM   474  C CA  . ASN B 2 52  ? 10.465  2.546   13.494  1.00 12.81 ? 51  ASN A CA  1 
ATOM   475  C C   . ASN B 2 52  ? 10.054  2.646   12.035  1.00 11.96 ? 51  ASN A C   1 
ATOM   476  O O   . ASN B 2 52  ? 9.215   3.470   11.650  1.00 11.97 ? 51  ASN A O   1 
ATOM   477  C CB  . ASN B 2 52  ? 9.579   1.461   14.123  1.00 13.92 ? 51  ASN A CB  1 
ATOM   478  C CG  . ASN B 2 52  ? 10.057  1.028   15.484  1.00 14.86 ? 51  ASN A CG  1 
ATOM   479  O OD1 . ASN B 2 52  ? 9.331   1.147   16.469  1.00 15.66 ? 51  ASN A OD1 1 
ATOM   480  N ND2 . ASN B 2 52  ? 11.279  0.520   15.545  1.00 15.33 ? 51  ASN A ND2 1 
ATOM   481  N N   . THR B 2 53  ? 10.641  1.761   11.235  1.00 12.33 ? 52  THR A N   1 
ATOM   482  C CA  . THR B 2 53  ? 10.100  1.414   9.932   1.00 12.27 ? 52  THR A CA  1 
ATOM   483  C C   . THR B 2 53  ? 9.520   0.006   9.976   1.00 12.90 ? 52  THR A C   1 
ATOM   484  O O   . THR B 2 53  ? 9.884   -0.828  10.819  1.00 15.40 ? 52  THR A O   1 
ATOM   485  C CB  . THR B 2 53  ? 11.167  1.470   8.832   1.00 13.69 ? 52  THR A CB  1 
ATOM   486  O OG1 . THR B 2 53  ? 12.205  0.528   9.120   1.00 15.17 ? 52  THR A OG1 1 
ATOM   487  C CG2 . THR B 2 53  ? 11.751  2.873   8.687   1.00 14.91 ? 52  THR A CG2 1 
ATOM   488  N N   . LEU B 2 54  ? 8.616   -0.257  9.041   1.00 13.17 ? 53  LEU A N   1 
ATOM   489  C CA  . LEU B 2 54  ? 8.024   -1.580  8.908   1.00 13.61 ? 53  LEU A CA  1 
ATOM   490  C C   . LEU B 2 54  ? 7.757   -1.811  7.428   1.00 12.04 ? 53  LEU A C   1 
ATOM   491  O O   . LEU B 2 54  ? 7.196   -0.941  6.757   1.00 11.21 ? 53  LEU A O   1 
ATOM   492  C CB  . LEU B 2 54  ? 6.715   -1.651  9.694   1.00 15.98 ? 53  LEU A CB  1 
ATOM   493  C CG  . LEU B 2 54  ? 5.965   -2.984  9.670   1.00 17.73 ? 53  LEU A CG  1 
ATOM   494  C CD1 . LEU B 2 54  ? 6.741   -4.099  10.347  1.00 21.37 ? 53  LEU A CD1 1 
ATOM   495  C CD2 . LEU B 2 54  ? 4.595   -2.824  10.306  1.00 18.09 ? 53  LEU A CD2 1 
ATOM   496  N N   . SER B 2 55  ? 8.157   -2.975  6.915   1.00 12.72 ? 54  SER A N   1 
ATOM   497  C CA  . SER B 2 55  ? 8.080   -3.265  5.489   1.00 13.49 ? 54  SER A CA  1 
ATOM   498  C C   . SER B 2 55  ? 6.834   -4.045  5.108   1.00 12.30 ? 54  SER A C   1 
ATOM   499  O O   . SER B 2 55  ? 6.644   -4.349  3.923   1.00 14.18 ? 54  SER A O   1 
ATOM   500  C CB  . SER B 2 55  ? 9.321   -4.041  5.031   1.00 16.81 ? 54  SER A CB  1 
ATOM   501  O OG  . SER B 2 55  ? 9.353   -5.313  5.641   1.00 18.88 ? 54  SER A OG  1 
ATOM   502  N N   . SER B 2 56  ? 5.966   -4.359  6.067   1.00 11.33 ? 55  SER A N   1 
ATOM   503  C CA  A SER B 2 56  ? 4.844   -5.261  5.836   0.27 12.17 ? 55  SER A CA  1 
ATOM   504  C CA  B SER B 2 56  ? 4.844   -5.260  5.843   0.73 11.41 ? 55  SER A CA  1 
ATOM   505  C C   . SER B 2 56  ? 3.533   -4.527  5.575   1.00 12.29 ? 55  SER A C   1 
ATOM   506  O O   . SER B 2 56  ? 2.459   -5.025  5.926   1.00 14.90 ? 55  SER A O   1 
ATOM   507  C CB  A SER B 2 56  ? 4.693   -6.244  6.995   0.27 13.60 ? 55  SER A CB  1 
ATOM   508  C CB  B SER B 2 56  ? 4.707   -6.218  7.023   0.73 13.12 ? 55  SER A CB  1 
ATOM   509  O OG  A SER B 2 56  ? 4.410   -5.561  8.199   0.27 15.00 ? 55  SER A OG  1 
ATOM   510  O OG  B SER B 2 56  ? 5.925   -6.921  7.224   0.73 14.89 ? 55  SER A OG  1 
ATOM   511  N N   . PHE B 2 57  ? 3.591   -3.360  4.957   1.00 13.21 ? 56  PHE A N   1 
ATOM   512  C CA  . PHE B 2 57  ? 2.381   -2.662  4.563   1.00 12.40 ? 56  PHE A CA  1 
ATOM   513  C C   . PHE B 2 57  ? 2.017   -3.027  3.135   1.00 11.81 ? 56  PHE A C   1 
ATOM   514  O O   . PHE B 2 57  ? 2.881   -3.095  2.256   1.00 12.79 ? 56  PHE A O   1 
ATOM   515  C CB  . PHE B 2 57  ? 2.584   -1.153  4.644   1.00 13.18 ? 56  PHE A CB  1 
ATOM   516  C CG  . PHE B 2 57  ? 2.617   -0.618  6.039   1.00 13.12 ? 56  PHE A CG  1 
ATOM   517  C CD1 . PHE B 2 57  ? 1.453   -0.215  6.665   1.00 13.16 ? 56  PHE A CD1 1 
ATOM   518  C CD2 . PHE B 2 57  ? 3.812   -0.515  6.723   1.00 16.72 ? 56  PHE A CD2 1 
ATOM   519  C CE1 . PHE B 2 57  ? 1.487   0.308   7.949   1.00 14.65 ? 56  PHE A CE1 1 
ATOM   520  C CE2 . PHE B 2 57  ? 3.852   -0.000  8.004   1.00 18.26 ? 56  PHE A CE2 1 
ATOM   521  C CZ  . PHE B 2 57  ? 2.687   0.411   8.617   1.00 17.22 ? 56  PHE A CZ  1 
ATOM   522  N N   . MET B 2 58  ? 0.731   -3.239  2.910   1.00 13.27 ? 57  MET A N   1 
ATOM   523  C CA  A MET B 2 58  ? 0.173   -3.533  1.599   0.47 14.18 ? 57  MET A CA  1 
ATOM   524  C CA  B MET B 2 58  ? 0.213   -3.494  1.580   0.53 13.29 ? 57  MET A CA  1 
ATOM   525  C C   . MET B 2 58  ? -0.916  -2.524  1.291   1.00 12.73 ? 57  MET A C   1 
ATOM   526  O O   . MET B 2 58  ? -1.741  -2.236  2.152   1.00 13.69 ? 57  MET A O   1 
ATOM   527  C CB  A MET B 2 58  ? -0.528  -4.866  1.685   0.47 17.94 ? 57  MET A CB  1 
ATOM   528  C CB  B MET B 2 58  ? -0.302  -4.922  1.448   0.53 16.30 ? 57  MET A CB  1 
ATOM   529  C CG  A MET B 2 58  ? 0.410   -5.958  1.979   0.47 23.13 ? 57  MET A CG  1 
ATOM   530  C CG  B MET B 2 58  ? 0.802   -5.919  1.227   0.53 21.55 ? 57  MET A CG  1 
ATOM   531  S SD  A MET B 2 58  ? 1.148   -6.436  0.463   0.47 28.04 ? 57  MET A SD  1 
ATOM   532  S SD  B MET B 2 58  ? 0.188   -7.506  0.674   0.53 25.36 ? 57  MET A SD  1 
ATOM   533  C CE  A MET B 2 58  ? -0.376  -6.893  -0.385  0.47 27.61 ? 57  MET A CE  1 
ATOM   534  C CE  B MET B 2 58  ? -1.005  -7.019  -0.549  0.53 18.50 ? 57  MET A CE  1 
ATOM   535  N N   . LEU B 2 59  ? -0.950  -2.015  0.065   1.00 11.84 ? 58  LEU A N   1 
ATOM   536  C CA  . LEU B 2 59  ? -2.011  -1.104  -0.338  1.00 12.33 ? 58  LEU A CA  1 
ATOM   537  C C   . LEU B 2 59  ? -3.223  -1.899  -0.818  1.00 12.32 ? 58  LEU A C   1 
ATOM   538  O O   . LEU B 2 59  ? -3.083  -2.824  -1.621  1.00 13.34 ? 58  LEU A O   1 
ATOM   539  C CB  . LEU B 2 59  ? -1.495  -0.225  -1.471  1.00 14.44 ? 58  LEU A CB  1 
ATOM   540  C CG  . LEU B 2 59  ? -2.189  1.090   -1.757  1.00 17.02 ? 58  LEU A CG  1 
ATOM   541  C CD1 . LEU B 2 59  ? -2.029  2.054   -0.590  1.00 18.43 ? 58  LEU A CD1 1 
ATOM   542  C CD2 . LEU B 2 59  ? -1.579  1.664   -3.009  1.00 17.99 ? 58  LEU A CD2 1 
ATOM   543  N N   . ALA B 2 60  ? -4.408  -1.555  -0.325  1.00 13.37 ? 59  ALA A N   1 
ATOM   544  C CA  . ALA B 2 60  ? -5.614  -2.062  -0.961  1.00 14.25 ? 59  ALA A CA  1 
ATOM   545  C C   . ALA B 2 60  ? -5.616  -1.645  -2.428  1.00 13.88 ? 59  ALA A C   1 
ATOM   546  O O   . ALA B 2 60  ? -5.191  -0.545  -2.779  1.00 13.65 ? 59  ALA A O   1 
ATOM   547  C CB  . ALA B 2 60  ? -6.842  -1.489  -0.261  1.00 15.32 ? 59  ALA A CB  1 
ATOM   548  N N   . THR B 2 61  ? -6.081  -2.539  -3.301  1.00 15.06 ? 60  THR A N   1 
ATOM   549  C CA  A THR B 2 61  ? -6.012  -2.249  -4.734  0.89 15.39 ? 60  THR A CA  1 
ATOM   550  C CA  B THR B 2 61  ? -6.023  -2.268  -4.731  0.11 14.90 ? 60  THR A CA  1 
ATOM   551  C C   . THR B 2 61  ? -6.848  -1.047  -5.123  1.00 14.16 ? 60  THR A C   1 
ATOM   552  O O   . THR B 2 61  ? -6.549  -0.404  -6.134  1.00 14.33 ? 60  THR A O   1 
ATOM   553  C CB  A THR B 2 61  ? -6.443  -3.440  -5.583  0.89 18.41 ? 60  THR A CB  1 
ATOM   554  C CB  B THR B 2 61  ? -6.483  -3.503  -5.492  0.11 15.61 ? 60  THR A CB  1 
ATOM   555  O OG1 A THR B 2 61  ? -7.787  -3.794  -5.249  0.89 19.92 ? 60  THR A OG1 1 
ATOM   556  O OG1 B THR B 2 61  ? -6.332  -3.275  -6.897  0.11 15.65 ? 60  THR A OG1 1 
ATOM   557  C CG2 A THR B 2 61  ? -5.528  -4.606  -5.345  0.89 19.39 ? 60  THR A CG2 1 
ATOM   558  C CG2 B THR B 2 61  ? -7.933  -3.812  -5.162  0.11 16.06 ? 60  THR A CG2 1 
ATOM   559  N N   . GLN B 2 62  ? -7.889  -0.723  -4.349  1.00 14.30 ? 61  GLN A N   1 
ATOM   560  C CA  . GLN B 2 62  ? -8.664  0.478   -4.638  1.00 16.16 ? 61  GLN A CA  1 
ATOM   561  C C   . GLN B 2 62  ? -7.817  1.743   -4.553  1.00 16.36 ? 61  GLN A C   1 
ATOM   562  O O   . GLN B 2 62  ? -8.220  2.778   -5.095  1.00 18.98 ? 61  GLN A O   1 
ATOM   563  C CB  . GLN B 2 62  ? -9.866  0.577   -3.694  1.00 18.37 ? 61  GLN A CB  1 
ATOM   564  C CG  . GLN B 2 62  ? -9.473  0.700   -2.227  1.00 22.47 ? 61  GLN A CG  1 
ATOM   565  C CD  . GLN B 2 62  ? -10.658 0.632   -1.283  1.00 26.31 ? 61  GLN A CD  1 
ATOM   566  O OE1 . GLN B 2 62  ? -11.784 0.352   -1.692  1.00 28.85 ? 61  GLN A OE1 1 
ATOM   567  N NE2 . GLN B 2 62  ? -10.406 0.891   -0.007  1.00 27.95 ? 61  GLN A NE2 1 
ATOM   568  N N   . LEU B 2 63  ? -6.662  1.687   -3.884  1.00 14.62 ? 62  LEU A N   1 
ATOM   569  C CA  . LEU B 2 63  ? -5.760  2.823   -3.774  1.00 13.69 ? 62  LEU A CA  1 
ATOM   570  C C   . LEU B 2 63  ? -4.646  2.808   -4.814  1.00 12.95 ? 62  LEU A C   1 
ATOM   571  O O   . LEU B 2 63  ? -3.811  3.716   -4.816  1.00 13.08 ? 62  LEU A O   1 
ATOM   572  C CB  . LEU B 2 63  ? -5.153  2.888   -2.368  1.00 15.70 ? 62  LEU A CB  1 
ATOM   573  C CG  . LEU B 2 63  ? -6.156  3.021   -1.222  1.00 18.80 ? 62  LEU A CG  1 
ATOM   574  C CD1 . LEU B 2 63  ? -5.447  3.186   0.112   1.00 20.49 ? 62  LEU A CD1 1 
ATOM   575  C CD2 . LEU B 2 63  ? -7.087  4.187   -1.486  1.00 20.48 ? 62  LEU A CD2 1 
ATOM   576  N N   . ASN B 2 64  ? -4.613  1.810   -5.698  1.00 12.61 ? 63  ASN A N   1 
ATOM   577  C CA  . ASN B 2 64  ? -3.559  1.749   -6.712  1.00 12.51 ? 63  ASN A CA  1 
ATOM   578  C C   . ASN B 2 64  ? -3.401  3.036   -7.510  1.00 12.24 ? 63  ASN A C   1 
ATOM   579  O O   . ASN B 2 64  ? -2.251  3.402   -7.810  1.00 12.03 ? 63  ASN A O   1 
ATOM   580  C CB  . ASN B 2 64  ? -3.786  0.578   -7.676  1.00 13.26 ? 63  ASN A CB  1 
ATOM   581  C CG  . ASN B 2 64  ? -3.417  -0.754  -7.082  1.00 13.50 ? 63  ASN A CG  1 
ATOM   582  O OD1 . ASN B 2 64  ? -3.019  -0.861  -5.914  1.00 13.61 ? 63  ASN A OD1 1 
ATOM   583  N ND2 . ASN B 2 64  ? -3.555  -1.799  -7.892  1.00 14.67 ? 63  ASN A ND2 1 
ATOM   584  N N   . PRO B 2 65  ? -4.465  3.756   -7.880  1.00 13.15 ? 64  PRO A N   1 
ATOM   585  C CA  . PRO B 2 65  ? -4.250  4.991   -8.646  1.00 14.61 ? 64  PRO A CA  1 
ATOM   586  C C   . PRO B 2 65  ? -3.375  5.998   -7.933  1.00 13.60 ? 64  PRO A C   1 
ATOM   587  O O   . PRO B 2 65  ? -2.699  6.788   -8.604  1.00 14.58 ? 64  PRO A O   1 
ATOM   588  C CB  . PRO B 2 65  ? -5.671  5.525   -8.859  1.00 15.90 ? 64  PRO A CB  1 
ATOM   589  C CG  . PRO B 2 65  ? -6.518  4.292   -8.869  1.00 16.70 ? 64  PRO A CG  1 
ATOM   590  C CD  . PRO B 2 65  ? -5.896  3.390   -7.851  1.00 15.10 ? 64  PRO A CD  1 
ATOM   591  N N   . LEU B 2 66  ? -3.341  5.995   -6.595  1.00 13.10 ? 65  LEU A N   1 
ATOM   592  C CA  A LEU B 2 66  ? -2.490  6.947   -5.884  0.59 13.49 ? 65  LEU A CA  1 
ATOM   593  C CA  B LEU B 2 66  ? -2.492  6.951   -5.891  0.41 12.99 ? 65  LEU A CA  1 
ATOM   594  C C   . LEU B 2 66  ? -1.019  6.708   -6.191  1.00 13.14 ? 65  LEU A C   1 
ATOM   595  O O   . LEU B 2 66  ? -0.230  7.661   -6.284  1.00 13.24 ? 65  LEU A O   1 
ATOM   596  C CB  A LEU B 2 66  ? -2.722  6.852   -4.377  0.59 15.14 ? 65  LEU A CB  1 
ATOM   597  C CB  B LEU B 2 66  ? -2.756  6.890   -4.389  0.41 13.43 ? 65  LEU A CB  1 
ATOM   598  C CG  A LEU B 2 66  ? -4.158  6.981   -3.870  0.59 16.36 ? 65  LEU A CG  1 
ATOM   599  C CG  B LEU B 2 66  ? -3.983  7.646   -3.871  0.41 13.62 ? 65  LEU A CG  1 
ATOM   600  C CD1 A LEU B 2 66  ? -4.195  7.000   -2.344  0.59 17.51 ? 65  LEU A CD1 1 
ATOM   601  C CD1 B LEU B 2 66  ? -5.294  7.100   -4.436  0.41 13.61 ? 65  LEU A CD1 1 
ATOM   602  C CD2 A LEU B 2 66  ? -4.819  8.218   -4.447  0.59 17.80 ? 65  LEU A CD2 1 
ATOM   603  C CD2 B LEU B 2 66  ? -3.996  7.623   -2.352  0.41 14.77 ? 65  LEU A CD2 1 
ATOM   604  N N   . VAL B 2 67  ? -0.630  5.441   -6.338  1.00 12.37 ? 66  VAL A N   1 
ATOM   605  C CA  . VAL B 2 67  ? 0.751   5.112   -6.677  1.00 12.66 ? 66  VAL A CA  1 
ATOM   606  C C   . VAL B 2 67  ? 1.006   5.367   -8.149  1.00 13.33 ? 66  VAL A C   1 
ATOM   607  O O   . VAL B 2 67  ? 2.005   5.988   -8.531  1.00 13.56 ? 66  VAL A O   1 
ATOM   608  C CB  . VAL B 2 67  ? 1.046   3.650   -6.301  1.00 13.27 ? 66  VAL A CB  1 
ATOM   609  C CG1 . VAL B 2 67  ? 2.421   3.214   -6.836  1.00 14.09 ? 66  VAL A CG1 1 
ATOM   610  C CG2 . VAL B 2 67  ? 0.957   3.511   -4.810  1.00 14.87 ? 66  VAL A CG2 1 
ATOM   611  N N   . GLU B 2 68  ? 0.087   4.909   -8.995  1.00 13.64 ? 67  GLU A N   1 
ATOM   612  C CA  . GLU B 2 68  ? 0.288   4.965   -10.433 1.00 15.50 ? 67  GLU A CA  1 
ATOM   613  C C   . GLU B 2 68  ? 0.273   6.387   -10.969 1.00 15.00 ? 67  GLU A C   1 
ATOM   614  O O   . GLU B 2 68  ? 0.938   6.667   -11.970 0.86 15.79 ? 67  GLU A O   1 
ATOM   615  C CB  . GLU B 2 68  ? -0.733  4.066   -11.113 0.98 17.16 ? 67  GLU A CB  1 
ATOM   616  C CG  . GLU B 2 68  ? -0.449  2.623   -10.719 0.99 18.87 ? 67  GLU A CG  1 
ATOM   617  C CD  . GLU B 2 68  ? -1.538  1.644   -11.079 0.81 20.68 ? 67  GLU A CD  1 
ATOM   618  O OE1 . GLU B 2 68  ? -2.532  2.041   -11.727 0.78 22.88 ? 67  GLU A OE1 1 
ATOM   619  O OE2 . GLU B 2 68  ? -1.379  0.458   -10.711 0.92 21.33 ? 67  GLU A OE2 1 
ATOM   620  N N   . GLU B 2 69  ? -0.458  7.293   -10.328 1.00 13.64 ? 68  GLU A N   1 
ATOM   621  C CA  . GLU B 2 69  ? -0.466  8.695   -10.717 1.00 14.99 ? 68  GLU A CA  1 
ATOM   622  C C   . GLU B 2 69  ? 0.501   9.537   -9.900  1.00 14.50 ? 68  GLU A C   1 
ATOM   623  O O   . GLU B 2 69  ? 0.502   10.764  -10.027 1.00 15.50 ? 68  GLU A O   1 
ATOM   624  C CB  . GLU B 2 69  ? -1.886  9.251   -10.696 1.00 16.53 ? 68  GLU A CB  1 
ATOM   625  C CG  . GLU B 2 69  ? -2.808  8.398   -11.550 1.00 19.04 ? 68  GLU A CG  1 
ATOM   626  C CD  . GLU B 2 69  ? -4.155  9.026   -11.794 1.00 20.97 ? 68  GLU A CD  1 
ATOM   627  O OE1 . GLU B 2 69  ? -4.258  10.275  -11.772 1.00 23.34 ? 68  GLU A OE1 1 
ATOM   628  O OE2 . GLU B 2 69  ? -5.116  8.260   -12.003 1.00 21.36 ? 68  GLU A OE2 1 
ATOM   629  N N   . GLU B 2 70  ? 1.342   8.896   -9.087  1.00 16.05 ? 69  GLU A N   1 
ATOM   630  C CA  . GLU B 2 70  ? 2.502   9.505   -8.449  1.00 17.57 ? 69  GLU A CA  1 
ATOM   631  C C   . GLU B 2 70  ? 2.143   10.503  -7.357  1.00 18.56 ? 69  GLU A C   1 
ATOM   632  O O   . GLU B 2 70  ? 2.936   11.405  -7.062  1.00 22.25 ? 69  GLU A O   1 
ATOM   633  C CB  . GLU B 2 70  ? 3.466   10.121  -9.469  1.00 21.62 ? 69  GLU A CB  1 
ATOM   634  C CG  . GLU B 2 70  ? 3.910   9.142   -10.538 1.00 26.70 ? 69  GLU A CG  1 
ATOM   635  C CD  . GLU B 2 70  ? 5.024   9.690   -11.399 1.00 32.48 ? 69  GLU A CD  1 
ATOM   636  O OE1 . GLU B 2 70  ? 6.201   9.387   -11.104 1.00 35.36 ? 69  GLU A OE1 1 
ATOM   637  O OE2 . GLU B 2 70  ? 4.726   10.415  -12.369 1.00 34.80 ? 69  GLU A OE2 1 
ATOM   638  N N   . GLN B 2 71  ? 0.963   10.382  -6.752  1.00 16.16 ? 70  GLN A N   1 
ATOM   639  C CA  . GLN B 2 71  ? 0.640   11.209  -5.593  1.00 17.24 ? 70  GLN A CA  1 
ATOM   640  C C   . GLN B 2 71  ? 1.121   10.588  -4.297  1.00 16.55 ? 70  GLN A C   1 
ATOM   641  O O   . GLN B 2 71  ? 1.455   11.313  -3.353  1.00 18.90 ? 70  GLN A O   1 
ATOM   642  C CB  . GLN B 2 71  ? -0.862  11.442  -5.458  1.00 22.10 ? 70  GLN A CB  1 
ATOM   643  C CG  . GLN B 2 71  ? -1.466  12.300  -6.522  1.00 28.29 ? 70  GLN A CG  1 
ATOM   644  C CD  . GLN B 2 71  ? -2.191  11.465  -7.530  1.00 33.23 ? 70  GLN A CD  1 
ATOM   645  O OE1 . GLN B 2 71  ? -1.927  10.265  -7.659  1.00 35.03 ? 70  GLN A OE1 1 
ATOM   646  N NE2 . GLN B 2 71  ? -3.131  12.074  -8.237  1.00 35.09 ? 70  GLN A NE2 1 
ATOM   647  N N   . LEU B 2 72  ? 1.127   9.264   -4.219  1.00 16.12 ? 71  LEU A N   1 
ATOM   648  C CA  . LEU B 2 72  ? 1.669   8.528   -3.086  1.00 15.89 ? 71  LEU A CA  1 
ATOM   649  C C   . LEU B 2 72  ? 3.017   7.992   -3.543  1.00 15.36 ? 71  LEU A C   1 
ATOM   650  O O   . LEU B 2 72  ? 3.076   7.105   -4.403  1.00 15.81 ? 71  LEU A O   1 
ATOM   651  C CB  . LEU B 2 72  ? 0.716   7.392   -2.724  1.00 17.21 ? 71  LEU A CB  1 
ATOM   652  C CG  . LEU B 2 72  ? 1.064   6.525   -1.517  1.00 18.60 ? 71  LEU A CG  1 
ATOM   653  C CD1 . LEU B 2 72  ? 0.974   7.332   -0.262  1.00 19.76 ? 71  LEU A CD1 1 
ATOM   654  C CD2 . LEU B 2 72  ? 0.115   5.340   -1.444  1.00 19.52 ? 71  LEU A CD2 1 
ATOM   655  N N   . SER B 2 73  ? 4.099   8.545   -2.996  1.00 15.34 ? 72  SER A N   1 
ATOM   656  C CA  A SER B 2 73  ? 5.429   8.137   -3.414  0.58 15.79 ? 72  SER A CA  1 
ATOM   657  C CA  B SER B 2 73  ? 5.453   8.244   -3.447  0.42 15.96 ? 72  SER A CA  1 
ATOM   658  C C   . SER B 2 73  ? 6.403   8.323   -2.261  1.00 14.25 ? 72  SER A C   1 
ATOM   659  O O   . SER B 2 73  ? 6.085   8.924   -1.235  1.00 13.53 ? 72  SER A O   1 
ATOM   660  C CB  A SER B 2 73  ? 5.894   8.930   -4.631  0.58 18.25 ? 72  SER A CB  1 
ATOM   661  C CB  B SER B 2 73  ? 5.928   9.250   -4.503  0.42 18.81 ? 72  SER A CB  1 
ATOM   662  O OG  A SER B 2 73  ? 6.072   10.274  -4.256  0.58 18.86 ? 72  SER A OG  1 
ATOM   663  O OG  B SER B 2 73  ? 5.055   9.300   -5.612  0.42 20.25 ? 72  SER A OG  1 
ATOM   664  N N   . SER B 2 74  ? 7.607   7.783   -2.451  1.00 13.83 ? 73  SER A N   1 
ATOM   665  C CA  A SER B 2 74  ? 8.623   7.817   -1.408  0.67 13.84 ? 73  SER A CA  1 
ATOM   666  C CA  B SER B 2 74  ? 8.630   7.817   -1.414  0.33 13.43 ? 73  SER A CA  1 
ATOM   667  C C   . SER B 2 74  ? 8.861   9.238   -0.921  1.00 11.99 ? 73  SER A C   1 
ATOM   668  O O   . SER B 2 74  ? 9.054   10.165  -1.722  1.00 13.09 ? 73  SER A O   1 
ATOM   669  C CB  A SER B 2 74  ? 9.924   7.233   -1.952  0.67 16.19 ? 73  SER A CB  1 
ATOM   670  C CB  B SER B 2 74  ? 9.933   7.254   -1.979  0.33 14.56 ? 73  SER A CB  1 
ATOM   671  O OG  A SER B 2 74  ? 9.708   5.916   -2.423  0.67 18.66 ? 73  SER A OG  1 
ATOM   672  O OG  B SER B 2 74  ? 11.008  7.489   -1.091  0.33 15.67 ? 73  SER A OG  1 
ATOM   673  N N   . ASN B 2 75  ? 8.851   9.392   0.407   1.00 11.58 ? 74  ASN A N   1 
ATOM   674  C CA  . ASN B 2 75  ? 9.045   10.598  1.207   1.00 12.33 ? 74  ASN A CA  1 
ATOM   675  C C   . ASN B 2 75  ? 7.749   11.301  1.557   1.00 10.67 ? 74  ASN A C   1 
ATOM   676  O O   . ASN B 2 75  ? 7.763   12.180  2.413   1.00 11.08 ? 74  ASN A O   1 
ATOM   677  C CB  . ASN B 2 75  ? 10.026  11.614  0.601   1.00 14.35 ? 74  ASN A CB  1 
ATOM   678  C CG  . ASN B 2 75  ? 11.415  11.080  0.511   1.00 17.84 ? 74  ASN A CG  1 
ATOM   679  O OD1 . ASN B 2 75  ? 11.860  10.324  1.377   1.00 19.09 ? 74  ASN A OD1 1 
ATOM   680  N ND2 . ASN B 2 75  ? 12.120  11.463  -0.548  1.00 19.54 ? 74  ASN A ND2 1 
ATOM   681  N N   . CYS B 2 76  ? 6.633   10.971  0.913   1.00 10.64 ? 75  CYS A N   1 
ATOM   682  C CA  . CYS B 2 76  ? 5.409   11.675  1.268   1.00 9.89  ? 75  CYS A CA  1 
ATOM   683  C C   . CYS B 2 76  ? 4.948   11.294  2.668   1.00 9.74  ? 75  CYS A C   1 
ATOM   684  O O   . CYS B 2 76  ? 5.292   10.236  3.211   1.00 10.26 ? 75  CYS A O   1 
ATOM   685  C CB  . CYS B 2 76  ? 4.295   11.449  0.245   1.00 12.11 ? 75  CYS A CB  1 
ATOM   686  S SG  . CYS B 2 76  ? 3.354   9.929   0.382   1.00 14.15 ? 75  CYS A SG  1 
ATOM   687  N N   . VAL B 2 77  ? 4.180   12.196  3.268   1.00 10.48 ? 76  VAL A N   1 
ATOM   688  C CA  . VAL B 2 77  ? 3.613   12.005  4.600   1.00 10.38 ? 76  VAL A CA  1 
ATOM   689  C C   . VAL B 2 77  ? 2.115   11.837  4.432   1.00 10.66 ? 76  VAL A C   1 
ATOM   690  O O   . VAL B 2 77  ? 1.467   12.647  3.761   1.00 11.64 ? 76  VAL A O   1 
ATOM   691  C CB  . VAL B 2 77  ? 3.956   13.193  5.515   1.00 11.99 ? 76  VAL A CB  1 
ATOM   692  C CG1 . VAL B 2 77  ? 3.218   13.103  6.829   1.00 13.04 ? 76  VAL A CG1 1 
ATOM   693  C CG2 . VAL B 2 77  ? 5.455   13.227  5.760   1.00 13.03 ? 76  VAL A CG2 1 
ATOM   694  N N   A CYS B 2 78  ? 1.561   10.794  5.039   0.50 10.24 ? 77  CYS A N   1 
ATOM   695  N N   B CYS B 2 78  ? 1.577   10.770  5.021   0.50 10.69 ? 77  CYS A N   1 
ATOM   696  C CA  A CYS B 2 78  ? 0.158   10.469  4.845   0.50 10.30 ? 77  CYS A CA  1 
ATOM   697  C CA  B CYS B 2 78  ? 0.184   10.376  4.878   0.50 11.28 ? 77  CYS A CA  1 
ATOM   698  C C   A CYS B 2 78  ? -0.478  10.036  6.157   0.50 9.42  ? 77  CYS A C   1 
ATOM   699  C C   B CYS B 2 78  ? -0.447  10.194  6.245   0.50 10.33 ? 77  CYS A C   1 
ATOM   700  O O   A CYS B 2 78  ? 0.174   9.457   7.030   0.50 10.31 ? 77  CYS A O   1 
ATOM   701  O O   B CYS B 2 78  ? 0.231   9.920   7.236   0.50 11.76 ? 77  CYS A O   1 
ATOM   702  C CB  A CYS B 2 78  ? -0.022  9.375   3.784   0.50 12.30 ? 77  CYS A CB  1 
ATOM   703  C CB  B CYS B 2 78  ? 0.052   9.022   4.173   0.50 14.26 ? 77  CYS A CB  1 
ATOM   704  S SG  A CYS B 2 78  ? 0.789   7.836   4.195   0.50 12.54 ? 77  CYS A SG  1 
ATOM   705  S SG  B CYS B 2 78  ? 0.824   8.934   2.580   0.50 16.57 ? 77  CYS A SG  1 
ATOM   706  N N   . GLN B 2 79  ? -1.767  10.320  6.278   1.00 9.96  ? 78  GLN A N   1 
ATOM   707  C CA  . GLN B 2 79  ? -2.552  9.908   7.428   1.00 10.17 ? 78  GLN A CA  1 
ATOM   708  C C   . GLN B 2 79  ? -3.359  8.682   7.036   1.00 9.49  ? 78  GLN A C   1 
ATOM   709  O O   . GLN B 2 79  ? -4.051  8.685   6.010   1.00 10.45 ? 78  GLN A O   1 
ATOM   710  C CB  . GLN B 2 79  ? -3.495  11.012  7.889   1.00 11.49 ? 78  GLN A CB  1 
ATOM   711  C CG  . GLN B 2 79  ? -4.284  10.590  9.122   1.00 11.65 ? 78  GLN A CG  1 
ATOM   712  C CD  . GLN B 2 79  ? -4.854  11.762  9.869   1.00 13.05 ? 78  GLN A CD  1 
ATOM   713  O OE1 . GLN B 2 79  ? -5.159  12.804  9.277   1.00 17.58 ? 78  GLN A OE1 1 
ATOM   714  N NE2 . GLN B 2 79  ? -4.980  11.617  11.177  1.00 14.59 ? 78  GLN A NE2 1 
ATOM   715  N N   . ILE B 2 80  ? -3.271  7.634   7.845   1.00 9.42  ? 79  ILE A N   1 
ATOM   716  C CA  . ILE B 2 80  ? -4.010  6.406   7.579   1.00 9.82  ? 79  ILE A CA  1 
ATOM   717  C C   . ILE B 2 80  ? -5.376  6.527   8.233   1.00 10.24 ? 79  ILE A C   1 
ATOM   718  O O   . ILE B 2 80  ? -5.477  6.645   9.455   1.00 13.48 ? 79  ILE A O   1 
ATOM   719  C CB  . ILE B 2 80  ? -3.257  5.182   8.108   1.00 10.81 ? 79  ILE A CB  1 
ATOM   720  C CG1 . ILE B 2 80  ? -1.803  5.179   7.611   1.00 11.91 ? 79  ILE A CG1 1 
ATOM   721  C CG2 . ILE B 2 80  ? -3.997  3.917   7.697   1.00 13.01 ? 79  ILE A CG2 1 
ATOM   722  C CD1 . ILE B 2 80  ? -1.626  5.360   6.100   1.00 14.04 ? 79  ILE A CD1 1 
ATOM   723  N N   . HIS B 2 81  ? -6.433  6.511   7.428   1.00 10.29 ? 80  HIS A N   1 
ATOM   724  C CA  . HIS B 2 81  ? -7.783  6.633   7.949   1.00 11.27 ? 80  HIS A CA  1 
ATOM   725  C C   . HIS B 2 81  ? -8.494  5.310   8.163   1.00 13.34 ? 80  HIS A C   1 
ATOM   726  O O   . HIS B 2 81  ? -9.444  5.265   8.947   1.00 16.58 ? 80  HIS A O   1 
ATOM   727  C CB  . HIS B 2 81  ? -8.616  7.517   7.026   1.00 13.06 ? 80  HIS A CB  1 
ATOM   728  C CG  . HIS B 2 81  ? -8.259  8.958   7.141   1.00 14.97 ? 80  HIS A CG  1 
ATOM   729  N ND1 . HIS B 2 81  ? -8.812  9.775   8.100   1.00 18.15 ? 80  HIS A ND1 1 
ATOM   730  C CD2 . HIS B 2 81  ? -7.389  9.725   6.445   1.00 16.55 ? 80  HIS A CD2 1 
ATOM   731  C CE1 . HIS B 2 81  ? -8.308  10.990  7.983   1.00 19.27 ? 80  HIS A CE1 1 
ATOM   732  N NE2 . HIS B 2 81  ? -7.440  10.985  6.989   1.00 17.38 ? 80  HIS A NE2 1 
ATOM   733  N N   . ARG B 2 82  ? -8.072  4.246   7.489   1.00 11.53 ? 81  ARG A N   1 
ATOM   734  C CA  . ARG B 2 82  ? -8.663  2.932   7.690   1.00 12.82 ? 81  ARG A CA  1 
ATOM   735  C C   . ARG B 2 82  ? -7.621  1.905   7.289   1.00 11.68 ? 81  ARG A C   1 
ATOM   736  O O   . ARG B 2 82  ? -7.043  1.989   6.200   1.00 11.96 ? 81  ARG A O   1 
ATOM   737  C CB  . ARG B 2 82  ? -9.931  2.747   6.854   1.00 15.00 ? 81  ARG A CB  1 
ATOM   738  C CG  . ARG B 2 82  ? -10.705 1.486   7.228   1.00 19.61 ? 81  ARG A CG  1 
ATOM   739  C CD  . ARG B 2 82  ? -12.153 1.543   6.763   1.00 24.89 ? 81  ARG A CD  1 
ATOM   740  N NE  . ARG B 2 82  ? -12.263 1.564   5.310   1.00 29.13 ? 81  ARG A NE  1 
ATOM   741  C CZ  . ARG B 2 82  ? -12.362 0.479   4.553   1.00 33.02 ? 81  ARG A CZ  1 
ATOM   742  N NH1 . ARG B 2 82  ? -12.457 0.594   3.234   1.00 33.97 ? 81  ARG A NH1 1 
ATOM   743  N NH2 . ARG B 2 82  ? -12.367 -0.722  5.116   1.00 34.39 ? 81  ARG A NH2 1 
ATOM   744  N N   . PHE B 2 83  ? -7.365  0.954   8.177   1.00 11.84 ? 82  PHE A N   1 
ATOM   745  C CA  . PHE B 2 83  ? -6.455  -0.140  7.876   1.00 11.30 ? 82  PHE A CA  1 
ATOM   746  C C   . PHE B 2 83  ? -6.930  -1.386  8.596   1.00 11.91 ? 82  PHE A C   1 
ATOM   747  O O   . PHE B 2 83  ? -7.723  -1.322  9.537   1.00 12.60 ? 82  PHE A O   1 
ATOM   748  C CB  . PHE B 2 83  ? -5.011  0.201   8.262   1.00 12.35 ? 82  PHE A CB  1 
ATOM   749  C CG  . PHE B 2 83  ? -4.801  0.390   9.744   1.00 12.66 ? 82  PHE A CG  1 
ATOM   750  C CD1 . PHE B 2 83  ? -5.065  1.616   10.362  1.00 13.64 ? 82  PHE A CD1 1 
ATOM   751  C CD2 . PHE B 2 83  ? -4.333  -0.655  10.520  1.00 14.66 ? 82  PHE A CD2 1 
ATOM   752  C CE1 . PHE B 2 83  ? -4.862  1.782   11.724  1.00 15.34 ? 82  PHE A CE1 1 
ATOM   753  C CE2 . PHE B 2 83  ? -4.129  -0.486  11.882  1.00 16.32 ? 82  PHE A CE2 1 
ATOM   754  C CZ  . PHE B 2 83  ? -4.392  0.733   12.476  1.00 16.20 ? 82  PHE A CZ  1 
ATOM   755  N N   . ILE B 2 84  ? -6.449  -2.527  8.128   1.00 12.92 ? 83  ILE A N   1 
ATOM   756  C CA  . ILE B 2 84  ? -6.741  -3.794  8.775   1.00 15.70 ? 83  ILE A CA  1 
ATOM   757  C C   . ILE B 2 84  ? -5.433  -4.550  8.907   1.00 14.36 ? 83  ILE A C   1 
ATOM   758  O O   . ILE B 2 84  ? -4.494  -4.341  8.141   1.00 17.66 ? 83  ILE A O   1 
ATOM   759  C CB  . ILE B 2 84  ? -7.784  -4.627  8.011   1.00 19.18 ? 83  ILE A CB  1 
ATOM   760  C CG1 . ILE B 2 84  ? -7.236  -5.052  6.662   1.00 22.30 ? 83  ILE A CG1 1 
ATOM   761  C CG2 . ILE B 2 84  ? -9.093  -3.878  7.857   1.00 20.75 ? 83  ILE A CG2 1 
ATOM   762  C CD1 . ILE B 2 84  ? -7.875  -6.314  6.153   1.00 25.28 ? 83  ILE A CD1 1 
ATOM   763  N N   . VAL B 2 85  ? -5.359  -5.405  9.912   1.00 14.49 ? 84  VAL A N   1 
ATOM   764  C CA  . VAL B 2 85  ? -4.203  -6.265  10.113  1.00 14.68 ? 84  VAL A CA  1 
ATOM   765  C C   . VAL B 2 85  ? -4.603  -7.681  9.731   1.00 14.43 ? 84  VAL A C   1 
ATOM   766  O O   . VAL B 2 85  ? -5.688  -8.145  10.104  1.00 16.43 ? 84  VAL A O   1 
ATOM   767  C CB  . VAL B 2 85  ? -3.702  -6.200  11.566  1.00 16.62 ? 84  VAL A CB  1 
ATOM   768  C CG1 . VAL B 2 85  ? -2.619  -7.249  11.805  1.00 17.65 ? 84  VAL A CG1 1 
ATOM   769  C CG2 . VAL B 2 85  ? -3.191  -4.795  11.882  1.00 18.44 ? 84  VAL A CG2 1 
ATOM   770  N N   . ASN B 2 86  ? -3.746  -8.353  8.971   1.00 13.04 ? 85  ASN A N   1 
ATOM   771  C CA  A ASN B 2 86  ? -3.936  -9.759  8.665   0.25 14.53 ? 85  ASN A CA  1 
ATOM   772  C CA  B ASN B 2 86  ? -3.921  -9.758  8.619   0.75 13.87 ? 85  ASN A CA  1 
ATOM   773  C C   . ASN B 2 86  ? -2.705  -10.536 9.098   1.00 13.56 ? 85  ASN A C   1 
ATOM   774  O O   . ASN B 2 86  ? -1.571  -10.136 8.834   1.00 16.82 ? 85  ASN A O   1 
ATOM   775  C CB  A ASN B 2 86  ? -4.281  -9.988  7.192   0.25 17.08 ? 85  ASN A CB  1 
ATOM   776  C CB  B ASN B 2 86  ? -4.058  -9.919  7.099   0.75 15.69 ? 85  ASN A CB  1 
ATOM   777  C CG  A ASN B 2 86  ? -5.769  -9.819  6.917   0.25 19.18 ? 85  ASN A CG  1 
ATOM   778  C CG  B ASN B 2 86  ? -4.312  -11.361 6.682   0.75 17.88 ? 85  ASN A CG  1 
ATOM   779  O OD1 A ASN B 2 86  ? -6.607  -10.056 7.794   0.25 19.83 ? 85  ASN A OD1 1 
ATOM   780  O OD1 B ASN B 2 86  ? -5.062  -12.079 7.337   0.75 19.14 ? 85  ASN A OD1 1 
ATOM   781  N ND2 A ASN B 2 86  ? -6.103  -9.412  5.702   0.25 20.66 ? 85  ASN A ND2 1 
ATOM   782  N ND2 B ASN B 2 86  ? -3.676  -11.791 5.598   0.75 20.56 ? 85  ASN A ND2 1 
ATOM   783  N N   . THR B 2 87  ? -2.934  -11.634 9.787   1.00 10.91 ? 86  THR A N   1 
ATOM   784  C CA  . THR B 2 87  ? -1.860  -12.458 10.318  1.00 10.78 ? 86  THR A CA  1 
ATOM   785  C C   . THR B 2 87  ? -1.738  -13.707 9.455   1.00 11.18 ? 86  THR A C   1 
ATOM   786  O O   . THR B 2 87  ? -2.720  -14.435 9.252   1.00 12.40 ? 86  THR A O   1 
ATOM   787  C CB  . THR B 2 87  ? -2.136  -12.820 11.781  1.00 11.74 ? 86  THR A CB  1 
ATOM   788  O OG1 . THR B 2 87  ? -2.296  -11.617 12.553  1.00 11.89 ? 86  THR A OG1 1 
ATOM   789  C CG2 . THR B 2 87  ? -0.999  -13.665 12.363  1.00 11.96 ? 86  THR A CG2 1 
ATOM   790  N N   . LEU B 2 88  ? -0.533  -13.947 8.955   1.00 11.89 ? 87  LEU A N   1 
ATOM   791  C CA  . LEU B 2 88  ? -0.238  -15.080 8.097   1.00 13.01 ? 87  LEU A CA  1 
ATOM   792  C C   . LEU B 2 88  ? -0.123  -16.362 8.918   1.00 12.88 ? 87  LEU A C   1 
ATOM   793  O O   . LEU B 2 88  ? 0.032   -16.343 10.142  1.00 12.46 ? 87  LEU A O   1 
ATOM   794  C CB  . LEU B 2 88  ? 1.072   -14.839 7.350   1.00 15.61 ? 87  LEU A CB  1 
ATOM   795  C CG  . LEU B 2 88  ? 1.129   -13.527 6.562   1.00 18.12 ? 87  LEU A CG  1 
ATOM   796  C CD1 . LEU B 2 88  ? 2.450   -13.424 5.826   1.00 19.06 ? 87  LEU A CD1 1 
ATOM   797  C CD2 . LEU B 2 88  ? -0.043  -13.444 5.591   1.00 19.72 ? 87  LEU A CD2 1 
ATOM   798  N N   . LYS B 2 89  ? -0.185  -17.497 8.217   1.00 14.11 ? 88  LYS A N   1 
ATOM   799  C CA  . LYS B 2 89  ? -0.015  -18.785 8.884   1.00 15.44 ? 88  LYS A CA  1 
ATOM   800  C C   . LYS B 2 89  ? 1.291   -18.849 9.667   1.00 14.90 ? 88  LYS A C   1 
ATOM   801  O O   . LYS B 2 89  ? 1.344   -19.460 10.744  1.00 16.05 ? 88  LYS A O   1 
ATOM   802  C CB  . LYS B 2 89  ? -0.051  -19.907 7.850   1.00 18.72 ? 88  LYS A CB  1 
ATOM   803  C CG  . LYS B 2 89  ? -1.430  -20.162 7.276   1.00 21.00 ? 88  LYS A CG  1 
ATOM   804  C CD  . LYS B 2 89  ? -1.389  -21.264 6.228   1.00 25.50 ? 88  LYS A CD  1 
ATOM   805  C CE  . LYS B 2 89  ? -0.562  -20.833 5.036   1.00 28.95 ? 88  LYS A CE  1 
ATOM   806  N NZ  . LYS B 2 89  ? -0.917  -21.621 3.830   1.00 31.13 ? 88  LYS A NZ  1 
ATOM   807  N N   . ASP B 2 90  ? 2.350   -18.211 9.157   1.00 15.15 ? 89  ASP A N   1 
ATOM   808  C CA  . ASP B 2 90  ? 3.648   -18.287 9.823   1.00 15.25 ? 89  ASP A CA  1 
ATOM   809  C C   . ASP B 2 90  ? 3.774   -17.347 11.014  1.00 14.48 ? 89  ASP A C   1 
ATOM   810  O O   . ASP B 2 90  ? 4.802   -17.389 11.699  1.00 15.75 ? 89  ASP A O   1 
ATOM   811  C CB  . ASP B 2 90  ? 4.823   -18.133 8.830   1.00 16.90 ? 89  ASP A CB  1 
ATOM   812  C CG  . ASP B 2 90  ? 4.923   -16.743 8.192   1.00 18.49 ? 89  ASP A CG  1 
ATOM   813  O OD1 . ASP B 2 90  ? 4.600   -15.712 8.808   1.00 20.06 ? 89  ASP A OD1 1 
ATOM   814  O OD2 . ASP B 2 90  ? 5.379   -16.687 7.034   1.00 20.08 ? 89  ASP A OD2 1 
ATOM   815  N N   . GLY B 2 91  ? 2.767   -16.516 11.272  1.00 12.86 ? 90  GLY A N   1 
ATOM   816  C CA  . GLY B 2 91  ? 2.759   -15.635 12.413  1.00 12.92 ? 90  GLY A CA  1 
ATOM   817  C C   . GLY B 2 91  ? 3.047   -14.181 12.099  1.00 12.75 ? 90  GLY A C   1 
ATOM   818  O O   . GLY B 2 91  ? 2.757   -13.321 12.935  1.00 14.75 ? 90  GLY A O   1 
ATOM   819  N N   . ARG B 2 92  ? 3.613   -13.881 10.935  1.00 14.51 ? 91  ARG A N   1 
ATOM   820  C CA  . ARG B 2 92  ? 3.920   -12.493 10.631  1.00 15.36 ? 91  ARG A CA  1 
ATOM   821  C C   . ARG B 2 92  ? 2.655   -11.743 10.246  1.00 13.99 ? 91  ARG A C   1 
ATOM   822  O O   . ARG B 2 92  ? 1.684   -12.317 9.735   1.00 13.77 ? 91  ARG A O   1 
ATOM   823  C CB  . ARG B 2 92  ? 4.994   -12.388 9.549   1.00 17.41 ? 91  ARG A CB  1 
ATOM   824  C CG  . ARG B 2 92  ? 6.370   -12.806 10.064  1.00 18.40 ? 91  ARG A CG  1 
ATOM   825  C CD  . ARG B 2 92  ? 7.399   -12.821 8.965   1.00 21.53 ? 91  ARG A CD  1 
ATOM   826  N NE  . ARG B 2 92  ? 7.091   -13.828 7.955   1.00 22.36 ? 91  ARG A NE  1 
ATOM   827  C CZ  . ARG B 2 92  ? 7.870   -14.105 6.916   1.00 24.32 ? 91  ARG A CZ  1 
ATOM   828  N NH1 . ARG B 2 92  ? 9.007   -13.444 6.744   1.00 25.51 ? 91  ARG A NH1 1 
ATOM   829  N NH2 . ARG B 2 92  ? 7.511   -15.040 6.048   1.00 24.73 ? 91  ARG A NH2 1 
ATOM   830  N N   . ARG B 2 93  ? 2.663   -10.450 10.529  1.00 13.87 ? 92  ARG A N   1 
ATOM   831  C CA  . ARG B 2 93  ? 1.501   -9.607  10.323  1.00 12.75 ? 92  ARG A CA  1 
ATOM   832  C C   . ARG B 2 93  ? 1.694   -8.663  9.152   1.00 12.35 ? 92  ARG A C   1 
ATOM   833  O O   . ARG B 2 93  ? 2.772   -8.089  8.957   1.00 14.73 ? 92  ARG A O   1 
ATOM   834  C CB  . ARG B 2 93  ? 1.156   -8.832  11.589  1.00 14.85 ? 92  ARG A CB  1 
ATOM   835  C CG  . ARG B 2 93  ? 0.550   -9.784  12.597  1.00 16.73 ? 92  ARG A CG  1 
ATOM   836  C CD  . ARG B 2 93  ? 0.118   -9.127  13.858  1.00 17.97 ? 92  ARG A CD  1 
ATOM   837  N NE  . ARG B 2 93  ? -0.736  -10.045 14.604  1.00 16.44 ? 92  ARG A NE  1 
ATOM   838  C CZ  . ARG B 2 93  ? -0.909  -9.995  15.917  1.00 15.37 ? 92  ARG A CZ  1 
ATOM   839  N NH1 . ARG B 2 93  ? -0.275  -9.072  16.638  1.00 16.52 ? 92  ARG A NH1 1 
ATOM   840  N NH2 . ARG B 2 93  ? -1.707  -10.862 16.513  1.00 14.09 ? 92  ARG A NH2 1 
ATOM   841  N N   . VAL B 2 94  ? 0.627   -8.496  8.389   1.00 11.37 ? 93  VAL A N   1 
ATOM   842  C CA  A VAL B 2 94  ? 0.565   -7.569  7.266   0.70 11.85 ? 93  VAL A CA  1 
ATOM   843  C CA  B VAL B 2 94  ? 0.608   -7.533  7.301   0.30 11.29 ? 93  VAL A CA  1 
ATOM   844  C C   . VAL B 2 94  ? -0.442  -6.482  7.610   1.00 11.56 ? 93  VAL A C   1 
ATOM   845  O O   . VAL B 2 94  ? -1.532  -6.784  8.113   1.00 13.17 ? 93  VAL A O   1 
ATOM   846  C CB  A VAL B 2 94  ? 0.081   -8.343  6.027   0.70 13.54 ? 93  VAL A CB  1 
ATOM   847  C CB  B VAL B 2 94  ? 0.388   -8.175  5.916   0.30 11.59 ? 93  VAL A CB  1 
ATOM   848  C CG1 A VAL B 2 94  ? 0.017   -7.434  4.837   0.70 14.22 ? 93  VAL A CG1 1 
ATOM   849  C CG1 B VAL B 2 94  ? 1.464   -9.206  5.640   0.30 12.41 ? 93  VAL A CG1 1 
ATOM   850  C CG2 A VAL B 2 94  ? 0.968   -9.556  5.758   0.70 16.21 ? 93  VAL A CG2 1 
ATOM   851  C CG2 B VAL B 2 94  ? -0.991  -8.786  5.813   0.30 12.42 ? 93  VAL A CG2 1 
ATOM   852  N N   . VAL B 2 95  ? -0.094  -5.232  7.334   1.00 10.90 ? 94  VAL A N   1 
ATOM   853  C CA  . VAL B 2 95  ? -0.994  -4.108  7.564   1.00 10.56 ? 94  VAL A CA  1 
ATOM   854  C C   . VAL B 2 95  ? -1.503  -3.651  6.205   1.00 10.43 ? 94  VAL A C   1 
ATOM   855  O O   . VAL B 2 95  ? -0.716  -3.199  5.365   1.00 12.51 ? 94  VAL A O   1 
ATOM   856  C CB  . VAL B 2 95  ? -0.283  -2.962  8.300   1.00 11.70 ? 94  VAL A CB  1 
ATOM   857  C CG1 . VAL B 2 95  ? -1.283  -1.860  8.619   1.00 13.50 ? 94  VAL A CG1 1 
ATOM   858  C CG2 . VAL B 2 95  ? 0.413   -3.463  9.563   1.00 14.17 ? 94  VAL A CG2 1 
ATOM   859  N N   . ILE B 2 96  ? -2.805  -3.786  5.978   1.00 10.92 ? 95  ILE A N   1 
ATOM   860  C CA  . ILE B 2 96  ? -3.411  -3.429  4.701   1.00 11.28 ? 95  ILE A CA  1 
ATOM   861  C C   . ILE B 2 96  ? -4.024  -2.042  4.826   1.00 10.48 ? 95  ILE A C   1 
ATOM   862  O O   . ILE B 2 96  ? -4.918  -1.812  5.657   1.00 11.76 ? 95  ILE A O   1 
ATOM   863  C CB  . ILE B 2 96  ? -4.456  -4.465  4.261   1.00 13.40 ? 95  ILE A CB  1 
ATOM   864  C CG1 . ILE B 2 96  ? -3.828  -5.868  4.193   1.00 17.59 ? 95  ILE A CG1 1 
ATOM   865  C CG2 . ILE B 2 96  ? -5.033  -4.064  2.924   1.00 15.15 ? 95  ILE A CG2 1 
ATOM   866  C CD1 . ILE B 2 96  ? -4.839  -6.979  4.079   1.00 21.18 ? 95  ILE A CD1 1 
ATOM   867  N N   . LEU B 2 97  ? -3.516  -1.109  4.029   1.00 10.50 ? 96  LEU A N   1 
ATOM   868  C CA  . LEU B 2 97  ? -3.995  0.269   4.046   1.00 10.43 ? 96  LEU A CA  1 
ATOM   869  C C   . LEU B 2 97  ? -5.212  0.400   3.137   1.00 11.34 ? 96  LEU A C   1 
ATOM   870  O O   . LEU B 2 97  ? -5.121  0.164   1.928   1.00 12.48 ? 96  LEU A O   1 
ATOM   871  C CB  . LEU B 2 97  ? -2.881  1.200   3.581   1.00 11.21 ? 96  LEU A CB  1 
ATOM   872  C CG  . LEU B 2 97  ? -1.566  1.081   4.358   1.00 11.70 ? 96  LEU A CG  1 
ATOM   873  C CD1 . LEU B 2 97  ? -0.527  2.006   3.751   1.00 13.67 ? 96  LEU A CD1 1 
ATOM   874  C CD2 . LEU B 2 97  ? -1.754  1.394   5.851   1.00 12.94 ? 96  LEU A CD2 1 
ATOM   875  N N   . MET B 2 98  ? -6.344  0.782   3.712   1.00 11.56 ? 97  MET A N   1 
ATOM   876  C CA  A MET B 2 98  ? -7.614  0.845   2.992   0.68 11.61 ? 97  MET A CA  1 
ATOM   877  C CA  B MET B 2 98  ? -7.585  0.847   2.955   0.32 12.48 ? 97  MET A CA  1 
ATOM   878  C C   . MET B 2 98  ? -7.999  2.263   2.589   1.00 11.35 ? 97  MET A C   1 
ATOM   879  O O   . MET B 2 98  ? -8.554  2.473   1.507   1.00 13.41 ? 97  MET A O   1 
ATOM   880  C CB  A MET B 2 98  ? -8.745  0.259   3.851   0.68 13.56 ? 97  MET A CB  1 
ATOM   881  C CB  B MET B 2 98  ? -8.703  0.161   3.736   0.32 15.35 ? 97  MET A CB  1 
ATOM   882  C CG  A MET B 2 98  ? -8.552  -1.179  4.331   0.68 16.00 ? 97  MET A CG  1 
ATOM   883  C CG  B MET B 2 98  ? -8.263  -1.160  4.308   0.32 18.14 ? 97  MET A CG  1 
ATOM   884  S SD  A MET B 2 98  ? -8.314  -2.379  3.013   0.68 19.59 ? 97  MET A SD  1 
ATOM   885  S SD  B MET B 2 98  ? -9.650  -2.102  4.911   0.32 20.35 ? 97  MET A SD  1 
ATOM   886  C CE  A MET B 2 98  ? -8.891  -3.884  3.785   0.68 22.27 ? 97  MET A CE  1 
ATOM   887  C CE  B MET B 2 98  ? -10.410 -2.595  3.364   0.32 22.17 ? 97  MET A CE  1 
ATOM   888  N N   . GLU B 2 99  ? -7.743  3.236   3.457   1.00 11.24 ? 98  GLU A N   1 
ATOM   889  C CA  . GLU B 2 99  ? -8.034  4.635   3.181   1.00 12.09 ? 98  GLU A CA  1 
ATOM   890  C C   . GLU B 2 99  ? -6.889  5.434   3.759   1.00 11.74 ? 98  GLU A C   1 
ATOM   891  O O   . GLU B 2 99  ? -6.470  5.190   4.897   1.00 11.45 ? 98  GLU A O   1 
ATOM   892  C CB  . GLU B 2 99  ? -9.324  5.077   3.867   1.00 15.43 ? 98  GLU A CB  1 
ATOM   893  C CG  . GLU B 2 99  ? -10.581 4.461   3.289   1.00 20.19 ? 98  GLU A CG  1 
ATOM   894  C CD  . GLU B 2 99  ? -11.799 4.816   4.104   1.00 26.78 ? 98  GLU A CD  1 
ATOM   895  O OE1 . GLU B 2 99  ? -11.721 5.796   4.871   1.00 29.48 ? 98  GLU A OE1 1 
ATOM   896  O OE2 . GLU B 2 99  ? -12.820 4.105   3.996   1.00 30.57 ? 98  GLU A OE2 1 
ATOM   897  N N   . LEU B 2 100 ? -6.367  6.363   2.971   1.00 12.96 ? 99  LEU A N   1 
ATOM   898  C CA  . LEU B 2 100 ? -5.362  7.267   3.495   1.00 14.97 ? 99  LEU A CA  1 
ATOM   899  C C   . LEU B 2 100 ? -5.453  8.590   2.760   1.00 15.31 ? 99  LEU A C   1 
ATOM   900  O O   . LEU B 2 100 ? -6.009  8.685   1.662   1.00 18.98 ? 99  LEU A O   1 
ATOM   901  C CB  . LEU B 2 100 ? -3.960  6.671   3.389   1.00 16.46 ? 99  LEU A CB  1 
ATOM   902  C CG  . LEU B 2 100 ? -3.454  6.375   1.976   1.00 16.88 ? 99  LEU A CG  1 
ATOM   903  C CD1 . LEU B 2 100 ? -2.804  7.608   1.310   1.00 17.86 ? 99  LEU A CD1 1 
ATOM   904  C CD2 . LEU B 2 100 ? -2.466  5.225   1.991   1.00 18.93 ? 99  LEU A CD2 1 
ATOM   905  N N   . GLU B 2 101 ? -4.898  9.616   3.386   1.00 12.67 ? 100 GLU A N   1 
ATOM   906  C CA  . GLU B 2 101 ? -4.789  10.920  2.754   1.00 13.40 ? 100 GLU A CA  1 
ATOM   907  C C   . GLU B 2 101 ? -3.326  11.334  2.734   1.00 11.77 ? 100 GLU A C   1 
ATOM   908  O O   . GLU B 2 101 ? -2.624  11.183  3.732   1.00 13.39 ? 100 GLU A O   1 
ATOM   909  C CB  . GLU B 2 101 ? -5.635  11.971  3.475   1.00 18.05 ? 100 GLU A CB  1 
ATOM   910  C CG  . GLU B 2 101 ? -7.132  11.649  3.493   1.00 23.65 ? 100 GLU A CG  1 
ATOM   911  C CD  . GLU B 2 101 ? -8.016  12.847  3.775   1.00 27.62 ? 100 GLU A CD  1 
ATOM   912  O OE1 . GLU B 2 101 ? -7.957  13.842  3.023   1.00 27.42 ? 100 GLU A OE1 1 
ATOM   913  O OE2 . GLU B 2 101 ? -8.785  12.784  4.756   1.00 29.95 ? 100 GLU A OE2 1 
ATOM   914  N N   . VAL B 2 102 ? -2.859  11.833  1.596   1.00 11.30 ? 101 VAL A N   1 
ATOM   915  C CA  . VAL B 2 102 ? -1.516  12.386  1.512   1.00 11.46 ? 101 VAL A CA  1 
ATOM   916  C C   . VAL B 2 102 ? -1.566  13.798  2.071   1.00 12.50 ? 101 VAL A C   1 
ATOM   917  O O   . VAL B 2 102 ? -2.256  14.669  1.532   1.00 15.98 ? 101 VAL A O   1 
ATOM   918  C CB  . VAL B 2 102 ? -0.994  12.359  0.068   1.00 13.02 ? 101 VAL A CB  1 
ATOM   919  C CG1 . VAL B 2 102 ? 0.374   13.019  -0.017  1.00 15.33 ? 101 VAL A CG1 1 
ATOM   920  C CG2 . VAL B 2 102 ? -0.917  10.921  -0.425  1.00 14.50 ? 101 VAL A CG2 1 
ATOM   921  N N   . LEU B 2 103 ? -0.861  14.024  3.174   1.00 11.81 ? 102 LEU A N   1 
ATOM   922  C CA  . LEU B 2 103 ? -0.851  15.337  3.809   1.00 12.70 ? 102 LEU A CA  1 
ATOM   923  C C   . LEU B 2 103 ? 0.188   16.266  3.214   1.00 12.70 ? 102 LEU A C   1 
ATOM   924  O O   . LEU B 2 103 ? -0.028  17.486  3.162   1.00 14.90 ? 102 LEU A O   1 
ATOM   925  C CB  . LEU B 2 103 ? -0.545  15.202  5.301   1.00 13.63 ? 102 LEU A CB  1 
ATOM   926  C CG  . LEU B 2 103 ? -1.524  14.338  6.091   1.00 13.99 ? 102 LEU A CG  1 
ATOM   927  C CD1 . LEU B 2 103 ? -1.163  14.383  7.559   1.00 14.90 ? 102 LEU A CD1 1 
ATOM   928  C CD2 . LEU B 2 103 ? -2.937  14.830  5.861   1.00 17.22 ? 102 LEU A CD2 1 
ATOM   929  N N   . LYS B 2 104 ? 1.315   15.721  2.777   1.00 13.37 ? 103 LYS A N   1 
ATOM   930  C CA  . LYS B 2 104 ? 2.390   16.516  2.205   1.00 13.50 ? 103 LYS A CA  1 
ATOM   931  C C   . LYS B 2 104 ? 3.065   15.653  1.157   1.00 12.22 ? 103 LYS A C   1 
ATOM   932  O O   . LYS B 2 104 ? 3.416   14.496  1.426   1.00 12.82 ? 103 LYS A O   1 
ATOM   933  C CB  . LYS B 2 104 ? 3.390   16.965  3.279   1.00 16.71 ? 103 LYS A CB  1 
ATOM   934  C CG  . LYS B 2 104 ? 4.197   18.215  2.918   1.00 21.34 ? 103 LYS A CG  1 
ATOM   935  C CD  . LYS B 2 104 ? 4.699   18.902  4.188   1.00 25.81 ? 103 LYS A CD  1 
ATOM   936  C CE  . LYS B 2 104 ? 5.614   20.074  3.879   1.00 29.50 ? 103 LYS A CE  1 
ATOM   937  N NZ  . LYS B 2 104 ? 6.175   20.641  5.138   1.00 31.72 ? 103 LYS A NZ  1 
ATOM   938  N N   . SER B 2 105 ? 3.220   16.205  -0.040  1.00 12.91 ? 104 SER A N   1 
ATOM   939  C CA  . SER B 2 105 ? 3.762   15.441  -1.147  1.00 12.97 ? 104 SER A CA  1 
ATOM   940  C C   . SER B 2 105 ? 5.230   15.115  -0.900  1.00 13.16 ? 104 SER A C   1 
ATOM   941  O O   . SER B 2 105 ? 5.928   15.777  -0.128  1.00 12.98 ? 104 SER A O   1 
ATOM   942  C CB  . SER B 2 105 ? 3.670   16.257  -2.428  1.00 15.57 ? 104 SER A CB  1 
ATOM   943  O OG  . SER B 2 105 ? 4.579   17.343  -2.359  1.00 17.48 ? 104 SER A OG  1 
ATOM   944  N N   . ALA B 2 106 ? 5.714   14.099  -1.618  1.00 12.50 ? 105 ALA A N   1 
ATOM   945  C CA  . ALA B 2 106 ? 7.121   13.735  -1.512  1.00 13.51 ? 105 ALA A CA  1 
ATOM   946  C C   . ALA B 2 106 ? 8.009   14.925  -1.825  1.00 14.73 ? 105 ALA A C   1 
ATOM   947  O O   . ALA B 2 106 ? 9.039   15.137  -1.170  1.00 15.10 ? 105 ALA A O   1 
ATOM   948  C CB  . ALA B 2 106 ? 7.421   12.593  -2.474  1.00 15.72 ? 105 ALA A CB  1 
ATOM   949  N N   . GLU B 2 107 ? 7.617   15.715  -2.830  1.00 15.33 ? 106 GLU A N   1 
ATOM   950  C CA  . GLU B 2 107 ? 8.415   16.861  -3.242  1.00 18.29 ? 106 GLU A CA  1 
ATOM   951  C C   . GLU B 2 107 ? 8.458   17.937  -2.168  1.00 16.68 ? 106 GLU A C   1 
ATOM   952  O O   . GLU B 2 107 ? 9.452   18.666  -2.064  1.00 17.84 ? 106 GLU A O   1 
ATOM   953  C CB  . GLU B 2 107 ? 7.891   17.440  -4.564  1.00 22.23 ? 106 GLU A CB  1 
ATOM   954  C CG  . GLU B 2 107 ? 7.913   16.495  -5.763  1.00 26.97 ? 106 GLU A CG  1 
ATOM   955  C CD  . GLU B 2 107 ? 6.605   15.726  -5.967  1.00 32.83 ? 106 GLU A CD  1 
ATOM   956  O OE1 . GLU B 2 107 ? 6.288   15.428  -7.136  1.00 33.54 ? 106 GLU A OE1 1 
ATOM   957  O OE2 . GLU B 2 107 ? 5.881   15.452  -4.988  1.00 34.56 ? 106 GLU A OE2 1 
ATOM   958  N N   . ALA B 2 108 ? 7.395   18.068  -1.376  1.00 15.64 ? 107 ALA A N   1 
ATOM   959  C CA  . ALA B 2 108 ? 7.370   19.072  -0.323  1.00 16.26 ? 107 ALA A CA  1 
ATOM   960  C C   . ALA B 2 108 ? 8.093   18.615  0.934   1.00 16.83 ? 107 ALA A C   1 
ATOM   961  O O   . ALA B 2 108 ? 8.531   19.463  1.717   1.00 20.22 ? 107 ALA A O   1 
ATOM   962  C CB  . ALA B 2 108 ? 5.931   19.469  0.004   1.00 17.60 ? 107 ALA A CB  1 
ATOM   963  N N   . VAL B 2 109 ? 8.259   17.304  1.128   1.00 14.69 ? 108 VAL A N   1 
ATOM   964  C CA  . VAL B 2 109 ? 8.955   16.761  2.294   1.00 13.91 ? 108 VAL A CA  1 
ATOM   965  C C   . VAL B 2 109 ? 10.435  16.595  1.974   1.00 16.90 ? 108 VAL A C   1 
ATOM   966  O O   . VAL B 2 109 ? 11.291  17.125  2.686   1.00 19.79 ? 108 VAL A O   1 
ATOM   967  C CB  . VAL B 2 109 ? 8.337   15.432  2.767   1.00 12.78 ? 108 VAL A CB  1 
ATOM   968  C CG1 . VAL B 2 109 ? 9.089   14.916  3.975   1.00 13.75 ? 108 VAL A CG1 1 
ATOM   969  C CG2 . VAL B 2 109 ? 6.864   15.626  3.105   1.00 13.70 ? 108 VAL A CG2 1 
ATOM   970  N N   . GLY B 2 110 ? 10.745  15.818  0.933   1.00 16.87 ? 109 GLY A N   1 
ATOM   971  C CA  . GLY B 2 110 ? 12.054  15.810  0.316   1.00 17.70 ? 109 GLY A CA  1 
ATOM   972  C C   . GLY B 2 110 ? 13.051  14.805  0.854   1.00 16.06 ? 109 GLY A C   1 
ATOM   973  O O   . GLY B 2 110 ? 14.023  14.498  0.157   1.00 16.54 ? 109 GLY A O   1 
ATOM   974  N N   . VAL B 2 111 ? 12.869  14.309  2.080   1.00 17.11 ? 110 VAL A N   1 
ATOM   975  C CA  . VAL B 2 111 ? 13.874  13.484  2.743   1.00 17.40 ? 110 VAL A CA  1 
ATOM   976  C C   . VAL B 2 111 ? 13.166  12.543  3.705   1.00 15.05 ? 110 VAL A C   1 
ATOM   977  O O   . VAL B 2 111 ? 12.062  12.821  4.173   1.00 14.17 ? 110 VAL A O   1 
ATOM   978  C CB  . VAL B 2 111 ? 14.893  14.332  3.558   1.00 19.42 ? 110 VAL A CB  1 
ATOM   979  C CG1 . VAL B 2 111 ? 15.597  15.368  2.709   1.00 21.85 ? 110 VAL A CG1 1 
ATOM   980  C CG2 . VAL B 2 111 ? 14.214  15.008  4.735   1.00 21.71 ? 110 VAL A CG2 1 
ATOM   981  N N   . LYS B 2 112 ? 13.833  11.433  4.035   1.00 15.19 ? 111 LYS A N   1 
ATOM   982  C CA  . LYS B 2 112 ? 13.396  10.607  5.154   1.00 15.80 ? 111 LYS A CA  1 
ATOM   983  C C   . LYS B 2 112 ? 13.506  11.401  6.452   1.00 15.39 ? 111 LYS A C   1 
ATOM   984  O O   . LYS B 2 112 ? 14.546  11.999  6.748   1.00 17.70 ? 111 LYS A O   1 
ATOM   985  C CB  . LYS B 2 112 ? 14.239  9.328   5.236   1.00 17.83 ? 111 LYS A CB  1 
ATOM   986  C CG  . LYS B 2 112 ? 13.988  8.514   6.512   1.00 19.69 ? 111 LYS A CG  1 
ATOM   987  C CD  . LYS B 2 112 ? 14.553  7.099   6.455   1.00 23.56 ? 111 LYS A CD  1 
ATOM   988  C CE  . LYS B 2 112 ? 16.062  7.089   6.498   1.00 26.37 ? 111 LYS A CE  1 
ATOM   989  N NZ  . LYS B 2 112 ? 16.581  5.700   6.644   1.00 28.16 ? 111 LYS A NZ  1 
ATOM   990  N N   . ILE B 2 113 ? 12.428  11.411  7.224   1.00 13.04 ? 112 ILE A N   1 
ATOM   991  C CA  . ILE B 2 113 ? 12.373  12.172  8.469   1.00 13.86 ? 112 ILE A CA  1 
ATOM   992  C C   . ILE B 2 113 ? 13.008  11.369  9.594   1.00 14.18 ? 112 ILE A C   1 
ATOM   993  O O   . ILE B 2 113 ? 12.661  10.201  9.821   1.00 14.53 ? 112 ILE A O   1 
ATOM   994  C CB  . ILE B 2 113 ? 10.917  12.522  8.801   1.00 13.36 ? 112 ILE A CB  1 
ATOM   995  C CG1 . ILE B 2 113 ? 10.371  13.522  7.778   1.00 13.66 ? 112 ILE A CG1 1 
ATOM   996  C CG2 . ILE B 2 113 ? 10.783  13.059  10.220  1.00 15.66 ? 112 ILE A CG2 1 
ATOM   997  C CD1 . ILE B 2 113 ? 8.853   13.640  7.799   1.00 15.17 ? 112 ILE A CD1 1 
ATOM   998  N N   . GLY B 2 114 ? 13.931  11.995  10.313  1.00 17.03 ? 113 GLY A N   1 
ATOM   999  C CA  . GLY B 2 114 ? 14.493  11.330  11.462  1.00 17.77 ? 113 GLY A CA  1 
ATOM   1000 C C   . GLY B 2 114 ? 15.379  10.143  11.105  1.00 18.13 ? 113 GLY A C   1 
ATOM   1001 O O   . GLY B 2 114 ? 15.911  10.016  9.999   1.00 19.24 ? 113 GLY A O   1 
ATOM   1002 N N   . ASN B 2 115 ? 15.541  9.261   12.087  1.00 18.50 ? 114 ASN A N   1 
ATOM   1003 C CA  . ASN B 2 115 ? 16.398  8.083   11.950  1.00 18.84 ? 114 ASN A CA  1 
ATOM   1004 C C   . ASN B 2 115 ? 15.673  6.829   12.433  1.00 16.28 ? 114 ASN A C   1 
ATOM   1005 O O   . ASN B 2 115 ? 16.113  6.152   13.368  1.00 17.26 ? 114 ASN A O   1 
ATOM   1006 C CB  . ASN B 2 115 ? 17.709  8.304   12.702  1.00 24.17 ? 114 ASN A CB  1 
ATOM   1007 C CG  . ASN B 2 115 ? 18.676  7.156   12.535  1.00 29.86 ? 114 ASN A CG  1 
ATOM   1008 O OD1 . ASN B 2 115 ? 18.731  6.527   11.477  1.00 32.63 ? 114 ASN A OD1 1 
ATOM   1009 N ND2 . ASN B 2 115 ? 19.446  6.873   13.582  1.00 32.13 ? 114 ASN A ND2 1 
ATOM   1010 N N   . PRO B 2 116 ? 14.568  6.472   11.793  1.00 14.40 ? 115 PRO A N   1 
ATOM   1011 C CA  . PRO B 2 116 ? 13.811  5.302   12.243  1.00 14.56 ? 115 PRO A CA  1 
ATOM   1012 C C   . PRO B 2 116 ? 14.583  4.012   12.003  1.00 14.61 ? 115 PRO A C   1 
ATOM   1013 O O   . PRO B 2 116 ? 15.366  3.886   11.059  1.00 16.23 ? 115 PRO A O   1 
ATOM   1014 C CB  . PRO B 2 116 ? 12.549  5.357   11.374  1.00 14.15 ? 115 PRO A CB  1 
ATOM   1015 C CG  . PRO B 2 116 ? 13.016  6.021   10.113  1.00 13.67 ? 115 PRO A CG  1 
ATOM   1016 C CD  . PRO B 2 116 ? 13.969  7.081   10.594  1.00 14.23 ? 115 PRO A CD  1 
ATOM   1017 N N   . VAL B 2 117 ? 14.367  3.044   12.888  1.00 14.85 ? 116 VAL A N   1 
ATOM   1018 C CA  . VAL B 2 117 ? 15.051  1.754   12.795  1.00 15.74 ? 116 VAL A CA  1 
ATOM   1019 C C   . VAL B 2 117 ? 14.027  0.647   12.563  1.00 15.05 ? 116 VAL A C   1 
ATOM   1020 O O   . VAL B 2 117 ? 12.861  0.803   12.946  1.00 14.73 ? 116 VAL A O   1 
ATOM   1021 C CB  . VAL B 2 117 ? 15.904  1.474   14.044  1.00 18.35 ? 116 VAL A CB  1 
ATOM   1022 C CG1 . VAL B 2 117 ? 16.964  2.550   14.213  1.00 20.47 ? 116 VAL A CG1 1 
ATOM   1023 C CG2 . VAL B 2 117 ? 15.023  1.386   15.278  1.00 17.53 ? 116 VAL A CG2 1 
ATOM   1024 N N   . PRO B 2 118 ? 14.394  -0.467  11.926  1.00 16.47 ? 117 PRO A N   1 
ATOM   1025 C CA  . PRO B 2 118 ? 13.388  -1.491  11.629  1.00 16.14 ? 117 PRO A CA  1 
ATOM   1026 C C   . PRO B 2 118 ? 12.716  -2.025  12.883  1.00 15.54 ? 117 PRO A C   1 
ATOM   1027 O O   . PRO B 2 118 ? 13.364  -2.321  13.891  1.00 16.29 ? 117 PRO A O   1 
ATOM   1028 C CB  . PRO B 2 118 ? 14.192  -2.584  10.918  1.00 18.13 ? 117 PRO A CB  1 
ATOM   1029 C CG  . PRO B 2 118 ? 15.318  -1.847  10.289  1.00 18.95 ? 117 PRO A CG  1 
ATOM   1030 C CD  . PRO B 2 118 ? 15.683  -0.779  11.283  1.00 18.17 ? 117 PRO A CD  1 
ATOM   1031 N N   . TYR B 2 119 ? 11.397  -2.149  12.806  1.00 16.15 ? 118 TYR A N   1 
ATOM   1032 C CA  . TYR B 2 119 ? 10.632  -2.730  13.894  1.00 17.70 ? 118 TYR A CA  1 
ATOM   1033 C C   . TYR B 2 119 ? 10.988  -4.202  14.048  1.00 19.69 ? 118 TYR A C   1 
ATOM   1034 O O   . TYR B 2 119 ? 11.128  -4.933  13.064  1.00 21.16 ? 118 TYR A O   1 
ATOM   1035 C CB  . TYR B 2 119 ? 9.137   -2.586  13.608  1.00 18.90 ? 118 TYR A CB  1 
ATOM   1036 C CG  . TYR B 2 119 ? 8.271   -3.118  14.710  1.00 20.79 ? 118 TYR A CG  1 
ATOM   1037 C CD1 . TYR B 2 119 ? 8.109   -2.414  15.893  1.00 22.44 ? 118 TYR A CD1 1 
ATOM   1038 C CD2 . TYR B 2 119 ? 7.620   -4.338  14.576  1.00 22.97 ? 118 TYR A CD2 1 
ATOM   1039 C CE1 . TYR B 2 119 ? 7.326   -2.911  16.917  1.00 24.41 ? 118 TYR A CE1 1 
ATOM   1040 C CE2 . TYR B 2 119 ? 6.837   -4.843  15.592  1.00 24.43 ? 118 TYR A CE2 1 
ATOM   1041 C CZ  . TYR B 2 119 ? 6.688   -4.128  16.760  1.00 25.64 ? 118 TYR A CZ  1 
ATOM   1042 O OH  . TYR B 2 119 ? 5.901   -4.639  17.766  1.00 28.59 ? 118 TYR A OH  1 
ATOM   1043 N N   . ASN B 2 120 ? 11.143  -4.628  15.297  1.00 21.03 ? 119 ASN A N   1 
ATOM   1044 C CA  . ASN B 2 120 ? 11.472  -6.010  15.637  1.00 24.96 ? 119 ASN A CA  1 
ATOM   1045 C C   . ASN B 2 120 ? 10.157  -6.704  15.959  1.00 28.18 ? 119 ASN A C   1 
ATOM   1046 O O   . ASN B 2 120 ? 9.612   -6.557  17.056  1.00 28.85 ? 119 ASN A O   1 
ATOM   1047 C CB  . ASN B 2 120 ? 12.451  -6.075  16.810  1.00 26.05 ? 119 ASN A CB  1 
ATOM   1048 C CG  . ASN B 2 120 ? 13.773  -5.411  16.495  1.00 27.78 ? 119 ASN A CG  1 
ATOM   1049 O OD1 . ASN B 2 120 ? 14.348  -5.629  15.425  1.00 29.22 ? 119 ASN A OD1 1 
ATOM   1050 N ND2 . ASN B 2 120 ? 14.254  -4.574  17.413  1.00 29.20 ? 119 ASN A ND2 1 
ATOM   1051 N N   . GLU B 2 121 ? 9.643   -7.445  14.989  1.00 30.00 ? 120 GLU A N   1 
ATOM   1052 C CA  . GLU B 2 121 ? 8.360   -8.111  15.126  0.96 31.91 ? 120 GLU A CA  1 
ATOM   1053 C C   . GLU B 2 121 ? 8.482   -9.397  15.932  0.38 34.03 ? 120 GLU A C   1 
ATOM   1054 O O   . GLU B 2 121 ? 9.491   -10.096 15.854  0.63 34.56 ? 120 GLU A O   1 
ATOM   1055 C CB  . GLU B 2 121 ? 7.801   -8.410  13.740  0.79 31.56 ? 120 GLU A CB  1 
ATOM   1056 C CG  . GLU B 2 121 ? 6.452   -9.061  13.744  0.66 31.27 ? 120 GLU A CG  1 
ATOM   1057 C CD  . GLU B 2 121 ? 5.865   -9.133  12.361  0.75 30.96 ? 120 GLU A CD  1 
ATOM   1058 O OE1 . GLU B 2 121 ? 6.525   -8.674  11.407  0.69 31.68 ? 120 GLU A OE1 1 
ATOM   1059 O OE2 . GLU B 2 121 ? 4.734   -9.626  12.228  0.95 29.16 ? 120 GLU A OE2 1 
ATOM   1060 O OXT . GLU B 2 121 ? 7.573   -9.762  16.678  0.77 35.08 ? 120 GLU A OXT 1 
HETATM 1061 O O   . HOH C 3 .   ? -2.315  -10.643 3.245   1.00 35.77 ? 101 HOH X O   1 
HETATM 1062 O O   . HOH C 3 .   ? 9.756   -10.989 -2.397  1.00 33.18 ? 102 HOH X O   1 
HETATM 1063 O O   . HOH C 3 .   ? 9.610   -18.713 -3.602  1.00 55.85 ? 103 HOH X O   1 
HETATM 1064 O O   . HOH C 3 .   ? 1.550   -16.468 3.921   1.00 24.05 ? 104 HOH X O   1 
HETATM 1065 O O   . HOH C 3 .   ? -2.799  -16.954 4.991   1.00 38.47 ? 105 HOH X O   1 
HETATM 1066 O O   . HOH C 3 .   ? 14.695  -9.340  5.955   1.00 51.61 ? 106 HOH X O   1 
HETATM 1067 O O   . HOH C 3 .   ? 15.698  -9.136  7.848   1.00 45.95 ? 107 HOH X O   1 
HETATM 1068 O O   . HOH D 3 .   ? 3.527   -12.580 -5.409  1.00 48.08 ? 201 HOH A O   1 
HETATM 1069 O O   . HOH D 3 .   ? -4.359  3.271   -11.581 1.00 37.37 ? 202 HOH A O   1 
HETATM 1070 O O   . HOH D 3 .   ? -9.777  14.390  5.901   1.00 36.30 ? 203 HOH A O   1 
HETATM 1071 O O   . HOH D 3 .   ? 1.737   1.138   22.160  1.00 34.45 ? 204 HOH A O   1 
HETATM 1072 O O   . HOH D 3 .   ? 9.758   4.010   -3.717  1.00 28.02 ? 205 HOH A O   1 
HETATM 1073 O O   . HOH D 3 .   ? 5.422   -8.436  9.350   1.00 22.46 ? 206 HOH A O   1 
HETATM 1074 O O   . HOH D 3 .   ? 4.036   13.746  -5.566  1.00 36.59 ? 207 HOH A O   1 
HETATM 1075 O O   . HOH D 3 .   ? -14.717 4.147   5.756   1.00 42.61 ? 208 HOH A O   1 
HETATM 1076 O O   . HOH D 3 .   ? -6.145  13.218  6.666   1.00 23.94 ? 209 HOH A O   1 
HETATM 1077 O O   . HOH D 3 .   ? -8.314  7.516   16.487  1.00 37.52 ? 210 HOH A O   1 
HETATM 1078 O O   . HOH D 3 .   ? 14.383  0.905   7.692   1.00 27.03 ? 211 HOH A O   1 
HETATM 1079 O O   . HOH D 3 .   ? 11.038  20.102  -0.526  1.00 19.29 ? 212 HOH A O   1 
HETATM 1080 O O   . HOH D 3 .   ? -3.997  16.055  0.114   1.00 34.90 ? 213 HOH A O   1 
HETATM 1081 O O   . HOH D 3 .   ? -4.779  5.667   -12.387 1.00 32.79 ? 214 HOH A O   1 
HETATM 1082 O O   . HOH D 3 .   ? 2.100   -6.049  -9.024  1.00 19.66 ? 215 HOH A O   1 
HETATM 1083 O O   . HOH D 3 .   ? 3.957   -11.311 14.177  1.00 30.13 ? 216 HOH A O   1 
HETATM 1084 O O   . HOH D 3 .   ? 10.775  8.725   8.632   1.00 11.62 ? 217 HOH A O   1 
HETATM 1085 O O   . HOH D 3 .   ? -7.178  4.353   10.803  1.00 26.58 ? 218 HOH A O   1 
HETATM 1086 O O   . HOH D 3 .   ? 6.784   19.024  14.027  1.00 29.66 ? 219 HOH A O   1 
HETATM 1087 O O   . HOH D 3 .   ? 1.137   19.871  3.684   1.00 26.68 ? 220 HOH A O   1 
HETATM 1088 O O   . HOH D 3 .   ? 11.683  -2.030  8.406   1.00 26.56 ? 221 HOH A O   1 
HETATM 1089 O O   . HOH D 3 .   ? -1.984  -2.643  -4.158  1.00 13.80 ? 222 HOH A O   1 
HETATM 1090 O O   . HOH D 3 .   ? 15.890  -3.163  14.384  1.00 25.12 ? 223 HOH A O   1 
HETATM 1091 O O   . HOH D 3 .   ? 9.278   10.374  -4.413  1.00 23.75 ? 224 HOH A O   1 
HETATM 1092 O O   . HOH D 3 .   ? 11.190  -4.223  -0.950  1.00 37.18 ? 225 HOH A O   1 
HETATM 1093 O O   . HOH D 3 .   ? 10.898  -7.845  12.620  1.00 34.50 ? 226 HOH A O   1 
HETATM 1094 O O   . HOH D 3 .   ? 4.196   6.468   -6.797  1.00 19.08 ? 227 HOH A O   1 
HETATM 1095 O O   . HOH D 3 .   ? -2.205  18.763  4.183   1.00 32.29 ? 228 HOH A O   1 
HETATM 1096 O O   . HOH D 3 .   ? 6.781   2.327   16.843  1.00 15.55 ? 229 HOH A O   1 
HETATM 1097 O O   . HOH D 3 .   ? 11.929  5.084   -3.764  1.00 35.12 ? 230 HOH A O   1 
HETATM 1098 O O   . HOH D 3 .   ? 4.455   19.463  -4.067  1.00 33.33 ? 231 HOH A O   1 
HETATM 1099 O O   . HOH D 3 .   ? 4.041   12.160  -3.143  1.00 20.59 ? 232 HOH A O   1 
HETATM 1100 O O   . HOH D 3 .   ? 8.870   -7.423  10.751  1.00 38.72 ? 233 HOH A O   1 
HETATM 1101 O O   . HOH D 3 .   ? 15.027  5.313   15.739  1.00 25.80 ? 234 HOH A O   1 
HETATM 1102 O O   . HOH D 3 .   ? 7.104   -18.668 6.250   1.00 30.60 ? 235 HOH A O   1 
HETATM 1103 O O   . HOH D 3 .   ? -10.028 2.980   -7.147  1.00 37.12 ? 236 HOH A O   1 
HETATM 1104 O O   . HOH D 3 .   ? 13.852  9.717   14.459  1.00 37.00 ? 237 HOH A O   1 
HETATM 1105 O O   . HOH D 3 .   ? 11.074  -2.878  17.419  1.00 34.17 ? 238 HOH A O   1 
HETATM 1106 O O   . HOH D 3 .   ? 10.821  0.838   -5.624  1.00 27.49 ? 239 HOH A O   1 
HETATM 1107 O O   . HOH D 3 .   ? 7.717   -7.510  5.212   1.00 19.02 ? 240 HOH A O   1 
HETATM 1108 O O   . HOH D 3 .   ? 16.764  5.608   9.413   1.00 23.75 ? 241 HOH A O   1 
HETATM 1109 O O   . HOH D 3 .   ? 3.614   2.568   21.013  1.00 22.01 ? 242 HOH A O   1 
HETATM 1110 O O   . HOH D 3 .   ? -10.451 -1.081  9.913   1.00 27.75 ? 243 HOH A O   1 
HETATM 1111 O O   . HOH D 3 .   ? -8.544  -5.975  -6.782  1.00 37.85 ? 244 HOH A O   1 
HETATM 1112 O O   . HOH D 3 .   ? -4.774  1.435   22.332  1.00 40.03 ? 245 HOH A O   1 
HETATM 1113 O O   . HOH D 3 .   ? 7.702   18.400  5.754   1.00 33.38 ? 246 HOH A O   1 
HETATM 1114 O O   . HOH D 3 .   ? 3.233   16.913  8.235   1.00 30.18 ? 247 HOH A O   1 
HETATM 1115 O O   . HOH D 3 .   ? -8.572  1.705   10.739  1.00 18.90 ? 248 HOH A O   1 
HETATM 1116 O O   . HOH D 3 .   ? 12.372  -0.795  -3.872  1.00 39.69 ? 249 HOH A O   1 
HETATM 1117 O O   . HOH D 3 .   ? 15.183  14.490  10.163  1.00 36.89 ? 250 HOH A O   1 
HETATM 1118 O O   . HOH D 3 .   ? -5.576  -14.730 6.612   1.00 31.26 ? 251 HOH A O   1 
HETATM 1119 O O   . HOH D 3 .   ? -6.807  4.062   20.191  1.00 29.37 ? 252 HOH A O   1 
HETATM 1120 O O   . HOH D 3 .   ? -0.961  12.892  -11.124 1.00 33.66 ? 253 HOH A O   1 
HETATM 1121 O O   . HOH D 3 .   ? 12.074  -5.772  6.186   1.00 37.41 ? 254 HOH A O   1 
HETATM 1122 O O   . HOH D 3 .   ? -0.659  -17.262 5.447   1.00 23.32 ? 255 HOH A O   1 
HETATM 1123 O O   . HOH D 3 .   ? 11.196  -4.236  10.311  1.00 27.66 ? 256 HOH A O   1 
HETATM 1124 O O   . HOH D 3 .   ? 9.845   -15.984 4.723   1.00 46.32 ? 257 HOH A O   1 
HETATM 1125 O O   . HOH D 3 .   ? 3.670   10.271  19.268  1.00 16.37 ? 258 HOH A O   1 
HETATM 1126 O O   . HOH D 3 .   ? 2.021   8.642   -13.717 1.00 38.08 ? 259 HOH A O   1 
HETATM 1127 O O   . HOH D 3 .   ? 12.800  7.541   1.146   1.00 24.70 ? 260 HOH A O   1 
HETATM 1128 O O   . HOH D 3 .   ? 7.778   -3.311  1.502   1.00 25.25 ? 261 HOH A O   1 
HETATM 1129 O O   . HOH D 3 .   ? 9.180   0.362   19.228  1.00 26.63 ? 262 HOH A O   1 
HETATM 1130 O O   . HOH D 3 .   ? 13.131  15.428  13.686  1.00 26.61 ? 263 HOH A O   1 
HETATM 1131 O O   . HOH D 3 .   ? 1.784   20.334  11.763  1.00 22.51 ? 264 HOH A O   1 
HETATM 1132 O O   . HOH D 3 .   ? -5.450  -13.706 9.862   1.00 12.78 ? 265 HOH A O   1 
HETATM 1133 O O   . HOH D 3 .   ? 3.127   1.977   -10.165 1.00 24.99 ? 266 HOH A O   1 
HETATM 1134 O O   . HOH D 3 .   ? -5.962  15.334  4.497   1.00 33.32 ? 267 HOH A O   1 
HETATM 1135 O O   . HOH D 3 .   ? 2.827   -17.727 6.131   1.00 19.37 ? 268 HOH A O   1 
HETATM 1136 O O   . HOH D 3 .   ? 6.800   -15.422 12.495  1.00 26.03 ? 269 HOH A O   1 
HETATM 1137 O O   . HOH D 3 .   ? 7.992   6.239   -4.896  1.00 24.68 ? 270 HOH A O   1 
HETATM 1138 O O   . HOH D 3 .   ? 2.205   18.932  -0.286  1.00 22.12 ? 271 HOH A O   1 
HETATM 1139 O O   . HOH D 3 .   ? -3.967  -0.900  -10.756 1.00 29.97 ? 272 HOH A O   1 
HETATM 1140 O O   . HOH D 3 .   ? 6.145   11.696  -6.896  1.00 38.59 ? 273 HOH A O   1 
HETATM 1141 O O   . HOH D 3 .   ? 5.110   -7.381  17.032  1.00 30.86 ? 274 HOH A O   1 
HETATM 1142 O O   . HOH D 3 .   ? -9.431  -2.488  -2.559  1.00 30.63 ? 275 HOH A O   1 
HETATM 1143 O O   . HOH D 3 .   ? -0.697  -8.764  19.549  1.00 27.68 ? 276 HOH A O   1 
HETATM 1144 O O   . HOH D 3 .   ? 10.605  -3.980  8.239   1.00 31.77 ? 277 HOH A O   1 
HETATM 1145 O O   . HOH D 3 .   ? 0.961   14.235  -3.465  1.00 33.07 ? 278 HOH A O   1 
HETATM 1146 O O   . HOH D 3 .   ? 8.051   22.374  2.076   1.00 35.57 ? 279 HOH A O   1 
HETATM 1147 O O   . HOH D 3 .   ? -7.183  -5.023  -2.089  1.00 31.41 ? 280 HOH A O   1 
HETATM 1148 O O   . HOH D 3 .   ? 8.242   -1.412  -0.251  1.00 17.88 ? 281 HOH A O   1 
HETATM 1149 O O   . HOH D 3 .   ? 12.967  -0.887  17.568  1.00 32.78 ? 282 HOH A O   1 
HETATM 1150 O O   . HOH D 3 .   ? -12.911 -0.888  16.703  1.00 33.56 ? 283 HOH A O   1 
HETATM 1151 O O   . HOH D 3 .   ? 9.061   -5.121  8.830   1.00 31.35 ? 284 HOH A O   1 
HETATM 1152 O O   . HOH D 3 .   ? 16.670  11.692  3.039   1.00 42.06 ? 285 HOH A O   1 
HETATM 1153 O O   . HOH D 3 .   ? 16.693  1.913   9.198   1.00 41.97 ? 286 HOH A O   1 
HETATM 1154 O O   . HOH D 3 .   ? -4.623  16.390  2.437   1.00 38.54 ? 287 HOH A O   1 
HETATM 1155 O O   . HOH D 3 .   ? 4.251   -13.299 -12.394 1.00 35.17 ? 288 HOH A O   1 
HETATM 1156 O O   . HOH D 3 .   ? 0.771   -24.089 4.579   1.00 41.98 ? 289 HOH A O   1 
HETATM 1157 O O   . HOH D 3 .   ? -10.399 -2.359  -6.047  1.00 31.60 ? 290 HOH A O   1 
HETATM 1158 O O   . HOH D 3 .   ? 15.713  9.716   2.268   1.00 27.38 ? 291 HOH A O   1 
HETATM 1159 O O   . HOH D 3 .   ? -12.540 3.579   14.392  1.00 47.81 ? 292 HOH A O   1 
HETATM 1160 O O   . HOH D 3 .   ? 7.910   -12.852 16.459  1.00 38.73 ? 293 HOH A O   1 
HETATM 1161 O O   . HOH D 3 .   ? -6.170  -2.285  21.201  1.00 42.91 ? 294 HOH A O   1 
HETATM 1162 O O   . HOH D 3 .   ? 14.667  3.235   6.099   1.00 27.49 ? 295 HOH A O   1 
HETATM 1163 O O   . HOH D 3 .   ? -12.140 -1.506  8.220   1.00 38.86 ? 296 HOH A O   1 
HETATM 1164 O O   . HOH D 3 .   ? -4.103  15.762  9.958   1.00 37.54 ? 297 HOH A O   1 
HETATM 1165 O O   . HOH D 3 .   ? 12.954  -4.592  20.385  1.00 35.44 ? 298 HOH A O   1 
HETATM 1166 O O   . HOH D 3 .   ? 4.269   -7.933  -10.858 1.00 40.35 ? 299 HOH A O   1 
HETATM 1167 O O   . HOH D 3 .   ? 10.184  19.449  4.690   1.00 40.01 ? 300 HOH A O   1 
HETATM 1168 O O   . HOH D 3 .   ? 2.042   -20.542 2.892   1.00 31.05 ? 301 HOH A O   1 
HETATM 1169 O O   . HOH D 3 .   ? -7.632  -0.049  20.090  1.00 40.69 ? 302 HOH A O   1 
HETATM 1170 O O   . HOH D 3 .   ? 12.696  -5.666  -4.914  1.00 47.98 ? 303 HOH A O   1 
HETATM 1171 O O   . HOH D 3 .   ? 6.118   -12.992 14.099  1.00 25.53 ? 304 HOH A O   1 
HETATM 1172 O O   . HOH D 3 .   ? 3.671   -9.157  18.511  1.00 42.71 ? 305 HOH A O   1 
HETATM 1173 O O   . HOH D 3 .   ? 7.946   2.521   19.515  1.00 28.72 ? 306 HOH A O   1 
HETATM 1174 O O   . HOH D 3 .   ? -12.772 3.804   0.283   1.00 36.73 ? 307 HOH A O   1 
HETATM 1175 O O   . HOH D 3 .   ? 11.222  -10.163 -0.562  1.00 38.99 ? 308 HOH A O   1 
HETATM 1176 O O   . HOH D 3 .   ? -11.343 1.308   11.155  1.00 41.07 ? 309 HOH A O   1 
HETATM 1177 O O   . HOH D 3 .   ? -8.159  6.361   18.899  1.00 34.99 ? 310 HOH A O   1 
HETATM 1178 O O   . HOH D 3 .   ? 3.408   -14.730 -10.154 1.00 45.40 ? 311 HOH A O   1 
HETATM 1179 O O   . HOH D 3 .   ? 6.887   -7.150  21.368  1.00 45.14 ? 312 HOH A O   1 
HETATM 1180 O O   . HOH D 3 .   ? 9.361   8.146   -6.064  1.00 43.37 ? 313 HOH A O   1 
HETATM 1181 O O   . HOH D 3 .   ? 7.786   21.276  15.476  1.00 27.65 ? 314 HOH A O   1 
HETATM 1182 O O   . HOH D 3 .   ? 1.045   -18.423 2.077   1.00 33.98 ? 315 HOH A O   1 
HETATM 1183 O O   . HOH D 3 .   ? 12.645  -1.831  1.306   1.00 49.76 ? 316 HOH A O   1 
HETATM 1184 O O   . HOH D 3 .   ? 6.201   2.955   21.528  1.00 31.15 ? 317 HOH A O   1 
HETATM 1185 O O   . HOH D 3 .   ? 6.383   16.948  7.372   1.00 45.83 ? 318 HOH A O   1 
HETATM 1186 O O   . HOH D 3 .   ? 3.239   -20.382 5.486   1.00 26.49 ? 319 HOH A O   1 
HETATM 1187 O O   . HOH D 3 .   ? 14.334  2.447   0.834   1.00 37.03 ? 320 HOH A O   1 
HETATM 1188 O O   . HOH D 3 .   ? 3.911   -8.079  20.645  1.00 42.00 ? 321 HOH A O   1 
HETATM 1189 O O   . HOH D 3 .   ? 12.060  -3.010  3.023   1.00 43.73 ? 322 HOH A O   1 
HETATM 1190 O O   . HOH D 3 .   ? -14.651 1.974   13.581  1.00 38.34 ? 323 HOH A O   1 
HETATM 1191 O O   . HOH D 3 .   ? 13.194  -3.080  6.702   1.00 34.67 ? 324 HOH A O   1 
HETATM 1192 O O   . HOH D 3 .   ? 5.807   -20.697 5.116   1.00 33.23 ? 325 HOH A O   1 
HETATM 1193 O O   . HOH D 3 .   ? 18.033  8.989   3.979   1.00 39.84 ? 326 HOH A O   1 
HETATM 1194 O O   . HOH D 3 .   ? 15.149  6.935   2.580   1.00 31.17 ? 327 HOH A O   1 
HETATM 1195 O O   . HOH D 3 .   ? 14.992  -1.270  6.090   1.00 38.64 ? 328 HOH A O   1 
HETATM 1196 O O   . HOH D 3 .   ? 2.424   -22.938 6.547   1.00 26.42 ? 329 HOH A O   1 
HETATM 1197 O O   . HOH D 3 .   ? 2.314   21.044  1.586   1.00 40.46 ? 330 HOH A O   1 
HETATM 1198 O O   . HOH D 3 .   ? 15.375  2.490   3.360   1.00 38.21 ? 331 HOH A O   1 
HETATM 1199 O O   . HOH D 3 .   ? -12.184 -5.582  -2.708  1.00 48.59 ? 332 HOH A O   1 
HETATM 1200 O O   . HOH D 3 .   ? 17.587  -2.282  7.488   1.00 50.19 ? 333 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 90  ? 0.5601 0.5586 0.7075 0.0704  0.0039  0.0198  0   GLU X N   
2    C CA  . GLU A 90  ? 0.5460 0.5433 0.6923 0.0820  0.0087  0.0167  0   GLU X CA  
3    C C   . GLU A 90  ? 0.4676 0.4734 0.5827 0.1131  0.0047  -0.0016 0   GLU X C   
4    O O   . GLU A 90  ? 0.4483 0.4608 0.5875 0.1425  -0.0004 -0.0157 0   GLU X O   
5    C CB  . GLU A 90  ? 0.5980 0.5946 0.7765 0.0556  0.0206  0.0322  0   GLU X CB  
6    C CG  . GLU A 90  ? 0.6331 0.6329 0.8464 0.0380  0.0285  0.0436  0   GLU X CG  
7    C CD  . GLU A 90  ? 0.6709 0.6632 0.9024 0.0224  0.0353  0.0527  0   GLU X CD  
8    O OE1 . GLU A 90  ? 0.6822 0.6739 0.9219 0.0095  0.0411  0.0539  0   GLU X OE1 
9    O OE2 . GLU A 90  ? 0.6892 0.6754 0.9210 0.0201  0.0356  0.0580  0   GLU X OE2 
10   N N   . ILE A 91  ? 0.3997 0.4021 0.4590 0.1247  0.0122  -0.0048 1   ILE X N   
11   C CA  . ILE A 91  ? 0.3804 0.3501 0.3483 0.1158  0.0184  -0.0022 1   ILE X CA  
12   C C   . ILE A 91  ? 0.4125 0.3218 0.3003 0.1197  0.0099  -0.0328 1   ILE X C   
13   O O   . ILE A 91  ? 0.3734 0.3095 0.2867 0.1042  0.0051  -0.0395 1   ILE X O   
14   C CB  . ILE A 91  ? 0.3393 0.3386 0.2957 0.0868  0.0381  0.0166  1   ILE X CB  
15   C CG1 . ILE A 91  ? 0.3194 0.3315 0.2805 0.0827  0.0404  0.0261  1   ILE X CG1 
16   C CG2 . ILE A 91  ? 0.3435 0.3360 0.2808 0.0767  0.0556  0.0190  1   ILE X CG2 
17   C CD1 . ILE A 91  ? 0.3239 0.3279 0.2825 0.0488  0.0334  0.0343  1   ILE X CD1 
18   N N   . PRO A 92  ? 0.4793 0.3019 0.2777 0.1340  0.0153  -0.0436 2   PRO X N   
19   C CA  . PRO A 92  ? 0.4964 0.2957 0.2730 0.1282  0.0229  -0.0605 2   PRO X CA  
20   C C   . PRO A 92  ? 0.4643 0.2702 0.2574 0.0786  0.0407  -0.0632 2   PRO X C   
21   O O   . PRO A 92  ? 0.4210 0.2532 0.2544 0.0746  0.0356  -0.0615 2   PRO X O   
22   C CB  . PRO A 92  ? 0.5446 0.3106 0.2914 0.1523  0.0116  -0.0659 2   PRO X CB  
23   C CG  . PRO A 92  ? 0.5592 0.3150 0.3000 0.1544  0.0061  -0.0693 2   PRO X CG  
24   C CD  . PRO A 92  ? 0.5253 0.3022 0.2904 0.1632  0.0092  -0.0593 2   PRO X CD  
25   N N   . ASP A 93  ? 0.4539 0.2568 0.2557 0.0303  0.0611  -0.0426 3   ASP X N   
26   C CA  . ASP A 93  ? 0.4445 0.2540 0.2705 0.0013  0.0903  -0.0275 3   ASP X CA  
27   C C   . ASP A 93  ? 0.4744 0.2728 0.3055 0.0025  0.1019  -0.0278 3   ASP X C   
28   O O   . ASP A 93  ? 0.4741 0.2511 0.2831 -0.0043 0.0921  -0.0206 3   ASP X O   
29   C CB  . ASP A 93  ? 0.4186 0.2332 0.2619 -0.0075 0.0950  -0.0367 3   ASP X CB  
30   C CG  . ASP A 93  ? 0.3864 0.2127 0.2825 -0.0122 0.0732  -0.0538 3   ASP X CG  
31   O OD1 . ASP A 93  ? 0.3815 0.2157 0.2750 -0.0116 0.0685  -0.0602 3   ASP X OD1 
32   O OD2 . ASP A 93  ? 0.3716 0.2048 0.2981 -0.0314 0.0539  -0.0363 3   ASP X OD2 
33   N N   . GLU A 94  ? 0.5040 0.3069 0.3624 0.0146  0.1194  -0.0524 4   GLU X N   
34   C CA  . GLU A 94  ? 0.5309 0.3494 0.4373 0.0325  0.1280  -0.0632 4   GLU X CA  
35   C C   . GLU A 94  ? 0.5268 0.3437 0.4240 0.0157  0.1128  -0.0677 4   GLU X C   
36   O O   . GLU A 94  ? 0.5403 0.3592 0.4232 -0.0092 0.0947  -0.0675 4   GLU X O   
37   C CB  . GLU A 94  ? 0.5616 0.4010 0.5237 0.0699  0.1447  -0.0644 4   GLU X CB  
38   C CG  . GLU A 94  ? 0.6003 0.4527 0.6047 0.0959  0.1476  -0.0544 4   GLU X CG  
39   C CD  . GLU A 94  ? 0.6256 0.4916 0.6686 0.1311  0.1535  -0.0508 4   GLU X CD  
40   O OE1 . GLU A 94  ? 0.6258 0.4998 0.6834 0.1531  0.1644  -0.0627 4   GLU X OE1 
41   O OE2 . GLU A 94  ? 0.6455 0.5041 0.6960 0.1394  0.1435  -0.0395 4   GLU X OE2 
42   N N   . LEU A 95  ? 0.4912 0.3156 0.4069 0.0226  0.1126  -0.0806 5   LEU X N   
43   C CA  . LEU A 95  ? 0.4798 0.3068 0.4124 0.0241  0.0993  -0.0687 5   LEU X CA  
44   C C   . LEU A 95  ? 0.4559 0.3186 0.3935 0.0122  0.1171  -0.0881 5   LEU X C   
45   O O   . LEU A 95  ? 0.4506 0.3140 0.3810 0.0085  0.1284  -0.0955 5   LEU X O   
46   C CB  . LEU A 95  ? 0.4856 0.2815 0.4338 0.0466  0.0626  -0.0596 5   LEU X CB  
47   C CG  . LEU A 95  ? 0.5057 0.2707 0.4563 0.0545  0.0162  -0.0499 5   LEU X CG  
48   C CD1 . LEU A 95  ? 0.5156 0.2825 0.4642 0.0421  -0.0008 -0.0322 5   LEU X CD1 
49   C CD2 . LEU A 95  ? 0.5203 0.2707 0.4672 0.0527  -0.0007 -0.0480 5   LEU X CD2 
50   N N   . ILE A 96  ? 0.4381 0.3259 0.3877 0.0150  0.1266  -0.0983 6   ILE X N   
51   C CA  . ILE A 96  ? 0.4253 0.3500 0.3935 -0.0221 0.1229  -0.1002 6   ILE X CA  
52   C C   . ILE A 96  ? 0.4464 0.4256 0.4330 -0.0474 0.1071  -0.0539 6   ILE X C   
53   O O   . ILE A 96  ? 0.3950 0.4138 0.4273 -0.0622 0.1103  -0.0587 6   ILE X O   
54   C CB  . ILE A 96  ? 0.4042 0.3146 0.3704 -0.0248 0.1278  -0.1395 6   ILE X CB  
55   C CG1 . ILE A 96  ? 0.3980 0.3059 0.3819 -0.0268 0.1233  -0.1555 6   ILE X CG1 
56   C CG2 . ILE A 96  ? 0.4099 0.3160 0.3647 -0.0264 0.1243  -0.1259 6   ILE X CG2 
57   C CD1 . ILE A 96  ? 0.4012 0.3088 0.3957 -0.0341 0.1101  -0.1501 6   ILE X CD1 
58   N N   . ILE A 97  ? 0.4952 0.5198 0.4737 -0.0629 0.0820  -0.0043 7   ILE X N   
59   C CA  . ILE A 97  ? 0.5496 0.6166 0.5238 -0.0712 0.0617  0.0476  7   ILE X CA  
60   C C   . ILE A 97  ? 0.5813 0.6895 0.5694 -0.0641 0.0463  0.0937  7   ILE X C   
61   O O   . ILE A 97  ? 0.5741 0.6928 0.5737 -0.0664 0.0426  0.0948  7   ILE X O   
62   C CB  . ILE A 97  ? 0.5764 0.6374 0.5275 -0.0817 0.0551  0.0486  7   ILE X CB  
63   C CG1 . ILE A 97  ? 0.5900 0.6516 0.5295 -0.0858 0.0529  0.0471  7   ILE X CG1 
64   C CG2 . ILE A 97  ? 0.5791 0.6410 0.5278 -0.0893 0.0583  0.0522  7   ILE X CG2 
65   C CD1 . ILE A 97  ? 0.6012 0.6602 0.5322 -0.0868 0.0485  0.0452  7   ILE X CD1 
66   N N   . GLU A 98  ? 0.6077 0.7518 0.6035 -0.0553 0.0433  0.1390  8   GLU X N   
67   C CA  . GLU A 98  ? 0.6310 0.8081 0.6324 -0.0450 0.0438  0.1772  8   GLU X CA  
68   C C   . GLU A 98  ? 0.6419 0.8458 0.6485 -0.0327 0.0429  0.1996  8   GLU X C   
69   O O   . GLU A 98  ? 0.6438 0.8625 0.6567 -0.0246 0.0425  0.2103  8   GLU X O   
70   C CB  . GLU A 98  ? 0.6341 0.8159 0.6391 -0.0464 0.0428  0.1837  8   GLU X CB  
71   N N   . HIS B 1   ? 0.6061 0.4083 0.5433 -0.0812 0.0944  -0.0423 0   HIS A N   
72   C CA  . HIS B 1   ? 0.5024 0.3338 0.4387 -0.0858 0.0962  -0.0482 0   HIS A CA  
73   C C   . HIS B 1   ? 0.3549 0.2268 0.3182 -0.0724 0.1013  -0.0429 0   HIS A C   
74   O O   . HIS B 1   ? 0.3261 0.1710 0.3117 -0.0643 0.1116  -0.0567 0   HIS A O   
75   C CB  . HIS B 1   ? 0.5767 0.3743 0.4687 -0.0957 0.0715  -0.0534 0   HIS A CB  
76   C CG  . HIS B 1   ? 0.6423 0.4060 0.4937 -0.1032 0.0542  -0.0515 0   HIS A CG  
77   N ND1 . HIS B 1   ? 0.6665 0.4175 0.5008 -0.1105 0.0445  -0.0565 0   HIS A ND1 
78   C CD2 . HIS B 1   ? 0.6688 0.4179 0.5044 -0.1041 0.0480  -0.0487 0   HIS A CD2 
79   C CE1 . HIS B 1   ? 0.6753 0.4229 0.5034 -0.1106 0.0442  -0.0525 0   HIS A CE1 
80   N NE2 . HIS B 1   ? 0.6812 0.4253 0.5076 -0.1078 0.0435  -0.0496 0   HIS A NE2 
81   N N   . MET B 2   ? 0.2786 0.1845 0.2402 -0.0492 0.0663  -0.0179 1   MET A N   
82   C CA  A MET B 2   ? 0.2536 0.1712 0.1915 -0.0499 0.0349  0.0061  1   MET A CA  
83   C CA  B MET B 2   ? 0.2562 0.1703 0.1986 -0.0435 0.0437  0.0078  1   MET A CA  
84   C C   . MET B 2   ? 0.2237 0.1589 0.1611 -0.0309 0.0289  0.0082  1   MET A C   
85   O O   . MET B 2   ? 0.2101 0.1558 0.1719 -0.0228 0.0243  0.0230  1   MET A O   
86   C CB  A MET B 2   ? 0.2696 0.1748 0.1773 -0.0827 0.0412  0.0262  1   MET A CB  
87   C CB  B MET B 2   ? 0.2710 0.1721 0.1968 -0.0603 0.0596  0.0314  1   MET A CB  
88   C CG  A MET B 2   ? 0.3095 0.1987 0.1785 -0.0900 0.0274  0.0326  1   MET A CG  
89   C CG  B MET B 2   ? 0.3001 0.1915 0.2119 -0.0530 0.0571  0.0401  1   MET A CG  
90   S SD  A MET B 2   ? 0.3238 0.2183 0.1875 -0.0784 0.0012  0.0336  1   MET A SD  
91   S SD  B MET B 2   ? 0.3516 0.2275 0.2361 -0.0414 0.0415  0.0373  1   MET A SD  
92   C CE  A MET B 2   ? 0.3147 0.2236 0.1927 -0.0657 0.0092  0.0446  1   MET A CE  
93   C CE  B MET B 2   ? 0.3644 0.2340 0.2478 -0.0403 0.0368  0.0310  1   MET A CE  
94   N N   . VAL B 3   ? 0.2001 0.1463 0.1300 -0.0208 0.0159  -0.0052 2   VAL A N   
95   C CA  . VAL B 3   ? 0.2011 0.1575 0.1404 -0.0112 0.0177  0.0015  2   VAL A CA  
96   C C   . VAL B 3   ? 0.1824 0.1387 0.1203 -0.0222 0.0022  -0.0048 2   VAL A C   
97   O O   . VAL B 3   ? 0.1922 0.1357 0.1192 -0.0108 -0.0075 0.0041  2   VAL A O   
98   C CB  . VAL B 3   ? 0.2086 0.1703 0.1690 0.0062  -0.0096 0.0017  2   VAL A CB  
99   C CG1 . VAL B 3   ? 0.1994 0.1936 0.1580 -0.0140 -0.0078 0.0107  2   VAL A CG1 
100  C CG2 . VAL B 3   ? 0.2348 0.1802 0.2119 -0.0103 -0.0121 0.0120  2   VAL A CG2 
101  N N   . GLY B 4   ? 0.1809 0.1445 0.1100 0.0030  0.0027  -0.0315 3   GLY A N   
102  C CA  . GLY B 4   ? 0.1706 0.1534 0.1332 -0.0057 0.0145  -0.0245 3   GLY A CA  
103  C C   . GLY B 4   ? 0.1880 0.1244 0.1117 -0.0030 0.0066  -0.0125 3   GLY A C   
104  O O   . GLY B 4   ? 0.1858 0.1466 0.1429 -0.0055 0.0129  -0.0215 3   GLY A O   
105  N N   . GLN B 5   ? 0.1920 0.1053 0.1106 -0.0192 0.0053  -0.0037 4   GLN A N   
106  C CA  . GLN B 5   ? 0.1819 0.1214 0.1012 -0.0112 0.0093  0.0127  4   GLN A CA  
107  C C   . GLN B 5   ? 0.1628 0.1197 0.1075 0.0112  0.0109  -0.0056 4   GLN A C   
108  O O   . GLN B 5   ? 0.1715 0.1303 0.1229 0.0048  -0.0108 -0.0133 4   GLN A O   
109  C CB  . GLN B 5   ? 0.2140 0.1506 0.1487 -0.0236 0.0021  0.0278  4   GLN A CB  
110  C CG  . GLN B 5   ? 0.2221 0.1806 0.2189 -0.0173 0.0025  0.0284  4   GLN A CG  
111  C CD  . GLN B 5   ? 0.2623 0.2028 0.2749 -0.0257 -0.0271 0.0234  4   GLN A CD  
112  O OE1 . GLN B 5   ? 0.3092 0.2580 0.3151 -0.0080 -0.0017 0.0003  4   GLN A OE1 
113  N NE2 . GLN B 5   ? 0.2749 0.1846 0.3105 -0.0482 -0.0530 0.0556  4   GLN A NE2 
114  N N   . LEU B 6   ? 0.1642 0.1021 0.1064 -0.0052 0.0148  0.0078  5   LEU A N   
115  C CA  . LEU B 6   ? 0.1721 0.0966 0.0992 -0.0044 0.0179  0.0044  5   LEU A CA  
116  C C   . LEU B 6   ? 0.1578 0.1012 0.0751 -0.0133 0.0086  0.0093  5   LEU A C   
117  O O   . LEU B 6   ? 0.1863 0.1158 0.0729 -0.0050 0.0083  -0.0121 5   LEU A O   
118  C CB  . LEU B 6   ? 0.1774 0.1071 0.0948 -0.0119 0.0191  -0.0028 5   LEU A CB  
119  C CG  . LEU B 6   ? 0.1682 0.1310 0.1005 -0.0254 0.0223  0.0186  5   LEU A CG  
120  C CD1 . LEU B 6   ? 0.1785 0.1543 0.1378 -0.0105 0.0284  0.0010  5   LEU A CD1 
121  C CD2 . LEU B 6   ? 0.2044 0.1379 0.0918 -0.0129 -0.0039 0.0152  5   LEU A CD2 
122  N N   . SER B 7   ? 0.1556 0.1144 0.0889 -0.0077 0.0116  0.0113  6   SER A N   
123  C CA  . SER B 7   ? 0.1661 0.1282 0.0821 -0.0096 -0.0033 0.0130  6   SER A CA  
124  C C   . SER B 7   ? 0.1632 0.1135 0.0782 -0.0085 0.0028  -0.0036 6   SER A C   
125  O O   . SER B 7   ? 0.1867 0.1148 0.0909 -0.0096 -0.0020 0.0105  6   SER A O   
126  C CB  . SER B 7   ? 0.1580 0.1436 0.0967 -0.0013 -0.0122 0.0092  6   SER A CB  
127  O OG  . SER B 7   ? 0.1715 0.1364 0.0985 0.0076  0.0039  0.0010  6   SER A OG  
128  N N   . ARG B 8   ? 0.1701 0.1431 0.0789 0.0029  -0.0055 -0.0031 7   ARG A N   
129  C CA  . ARG B 8   ? 0.1747 0.1507 0.0937 -0.0057 -0.0224 0.0079  7   ARG A CA  
130  C C   . ARG B 8   ? 0.1837 0.1528 0.0907 -0.0182 -0.0095 0.0113  7   ARG A C   
131  O O   . ARG B 8   ? 0.2059 0.1810 0.0922 -0.0128 0.0059  0.0073  7   ARG A O   
132  C CB  . ARG B 8   ? 0.1751 0.1575 0.0983 -0.0164 -0.0162 0.0067  7   ARG A CB  
133  C CG  . ARG B 8   ? 0.1800 0.1506 0.1092 -0.0220 0.0020  0.0026  7   ARG A CG  
134  C CD  . ARG B 8   ? 0.1877 0.1459 0.1480 0.0063  -0.0033 -0.0173 7   ARG A CD  
135  N NE  . ARG B 8   ? 0.2021 0.1670 0.1719 -0.0082 -0.0181 -0.0282 7   ARG A NE  
136  C CZ  . ARG B 8   ? 0.2228 0.2063 0.2315 -0.0115 -0.0263 -0.0476 7   ARG A CZ  
137  N NH1 . ARG B 8   ? 0.2431 0.2603 0.2520 -0.0176 -0.0424 -0.0438 7   ARG A NH1 
138  N NH2 . ARG B 8   ? 0.2610 0.1755 0.2560 -0.0133 0.0105  -0.0574 7   ARG A NH2 
139  N N   . GLY B 9   ? 0.2045 0.1268 0.1034 -0.0094 -0.0038 0.0311  8   GLY A N   
140  C CA  . GLY B 9   ? 0.2424 0.1435 0.1155 -0.0273 -0.0232 0.0357  8   GLY A CA  
141  C C   . GLY B 9   ? 0.2159 0.1503 0.1222 -0.0308 -0.0225 0.0461  8   GLY A C   
142  O O   . GLY B 9   ? 0.2390 0.1721 0.1163 -0.0500 -0.0329 0.0592  8   GLY A O   
143  N N   . ALA B 10  ? 0.2029 0.1345 0.1020 -0.0230 -0.0167 0.0108  9   ALA A N   
144  C CA  . ALA B 10  ? 0.1907 0.1263 0.1135 -0.0014 -0.0187 0.0245  9   ALA A CA  
145  C C   . ALA B 10  ? 0.1859 0.1359 0.1144 -0.0018 -0.0109 0.0499  9   ALA A C   
146  O O   . ALA B 10  ? 0.1965 0.1284 0.1537 -0.0087 -0.0194 0.0543  9   ALA A O   
147  C CB  . ALA B 10  ? 0.1980 0.1234 0.1201 0.0015  -0.0238 0.0369  9   ALA A CB  
148  N N   . ILE B 11  ? 0.2089 0.1302 0.1180 0.0109  -0.0160 0.0204  10  ILE A N   
149  C CA  . ILE B 11  ? 0.2184 0.1251 0.1602 0.0152  0.0038  0.0496  10  ILE A CA  
150  C C   . ILE B 11  ? 0.2018 0.1464 0.1916 0.0011  -0.0220 0.0769  10  ILE A C   
151  O O   . ILE B 11  ? 0.1983 0.1347 0.2248 -0.0163 -0.0152 0.0757  10  ILE A O   
152  C CB  . ILE B 11  ? 0.2425 0.1176 0.1611 0.0003  0.0155  0.0422  10  ILE A CB  
153  C CG1 . ILE B 11  ? 0.2580 0.1370 0.1830 0.0074  0.0312  0.0388  10  ILE A CG1 
154  C CG2 . ILE B 11  ? 0.2507 0.1178 0.2004 0.0127  0.0236  0.0423  10  ILE A CG2 
155  C CD1 . ILE B 11  ? 0.2544 0.1500 0.2181 -0.0195 0.0535  0.0311  10  ILE A CD1 
156  N N   . ALA B 12  ? 0.2103 0.1705 0.1866 0.0052  -0.0279 0.1012  11  ALA A N   
157  C CA  . ALA B 12  ? 0.2271 0.2071 0.1932 -0.0174 -0.0330 0.1166  11  ALA A CA  
158  C C   . ALA B 12  ? 0.2437 0.2009 0.2027 -0.0258 -0.0338 0.1171  11  ALA A C   
159  O O   . ALA B 12  ? 0.2658 0.2004 0.2568 -0.0338 -0.0126 0.1307  11  ALA A O   
160  C CB  . ALA B 12  ? 0.2610 0.2416 0.2032 -0.0202 -0.0470 0.1255  11  ALA A CB  
161  N N   . ALA B 13  ? 0.2189 0.2044 0.1733 -0.0442 -0.0215 0.0995  12  ALA A N   
162  C CA  . ALA B 13  ? 0.2176 0.2188 0.1802 -0.0330 -0.0034 0.0541  12  ALA A CA  
163  C C   . ALA B 13  ? 0.2265 0.2089 0.1986 -0.0359 0.0059  0.0686  12  ALA A C   
164  O O   . ALA B 13  ? 0.2573 0.2199 0.2249 -0.0413 0.0066  0.0700  12  ALA A O   
165  C CB  . ALA B 13  ? 0.2373 0.2368 0.1869 -0.0025 0.0180  0.0199  12  ALA A CB  
166  N N   . ILE B 14  ? 0.2008 0.1582 0.2075 -0.0232 -0.0026 0.0368  13  ILE A N   
167  C CA  . ILE B 14  ? 0.2123 0.1461 0.2527 -0.0079 -0.0169 0.0091  13  ILE A CA  
168  C C   . ILE B 14  ? 0.2323 0.1372 0.3147 -0.0074 0.0186  0.0353  13  ILE A C   
169  O O   . ILE B 14  ? 0.2354 0.1504 0.3390 -0.0118 0.0253  0.0308  13  ILE A O   
170  C CB  . ILE B 14  ? 0.2242 0.1413 0.2378 0.0007  -0.0414 -0.0042 13  ILE A CB  
171  C CG1 . ILE B 14  ? 0.2325 0.1577 0.2261 0.0110  -0.0531 0.0033  13  ILE A CG1 
172  C CG2 . ILE B 14  ? 0.2351 0.1505 0.2535 0.0092  -0.0488 -0.0200 13  ILE A CG2 
173  C CD1 . ILE B 14  ? 0.2580 0.1712 0.2136 0.0016  -0.0416 -0.0043 13  ILE A CD1 
174  N N   A MET B 15  ? 0.2021 0.1059 0.3162 0.0217  0.0404  0.0559  14  MET A N   
175  N N   B MET B 15  ? 0.2396 0.1534 0.3384 0.0072  0.0241  0.0694  14  MET A N   
176  C CA  A MET B 15  ? 0.2207 0.1320 0.3351 0.0301  0.0585  0.0886  14  MET A CA  
177  C CA  B MET B 15  ? 0.2667 0.1876 0.3651 0.0153  0.0335  0.1069  14  MET A CA  
178  C C   A MET B 15  ? 0.2600 0.1843 0.3828 0.0303  0.0756  0.1303  14  MET A C   
179  C C   B MET B 15  ? 0.2621 0.2045 0.3936 0.0041  0.0598  0.1411  14  MET A C   
180  O O   A MET B 15  ? 0.2778 0.1865 0.4074 0.0425  0.0753  0.1309  14  MET A O   
181  O O   B MET B 15  ? 0.2344 0.1968 0.3964 -0.0194 0.0553  0.1302  14  MET A O   
182  C CB  A MET B 15  ? 0.2139 0.1325 0.3101 0.0017  0.0451  0.0634  14  MET A CB  
183  C CB  B MET B 15  ? 0.2963 0.2131 0.3583 0.0284  0.0074  0.1023  14  MET A CB  
184  C CG  A MET B 15  ? 0.2242 0.1398 0.2913 -0.0062 0.0319  0.0432  14  MET A CG  
185  C CG  B MET B 15  ? 0.3279 0.2367 0.3439 0.0404  -0.0238 0.1005  14  MET A CG  
186  S SD  A MET B 15  ? 0.2213 0.1732 0.2663 -0.0443 0.0040  0.0341  14  MET A SD  
187  S SD  B MET B 15  ? 0.3531 0.2552 0.3282 0.0448  -0.0478 0.0973  14  MET A SD  
188  C CE  A MET B 15  ? 0.1837 0.1694 0.2735 -0.0257 0.0234  0.0043  14  MET A CE  
189  C CE  B MET B 15  ? 0.3625 0.2694 0.3231 0.0476  -0.0654 0.1014  14  MET A CE  
190  N N   . GLN B 16  ? 0.2830 0.2386 0.3994 0.0364  0.0757  0.1669  15  GLN A N   
191  C CA  . GLN B 16  ? 0.3357 0.3153 0.4516 0.0462  0.1059  0.2075  15  GLN A CA  
192  C C   . GLN B 16  ? 0.3819 0.3374 0.5074 0.0445  0.1367  0.2078  15  GLN A C   
193  O O   . GLN B 16  ? 0.4002 0.3341 0.5178 0.0127  0.1273  0.2137  15  GLN A O   
194  C CB  . GLN B 16  ? 0.3784 0.3872 0.4597 0.0827  0.0814  0.2429  15  GLN A CB  
195  C CG  . GLN B 16  ? 0.4068 0.4724 0.4855 0.1131  0.0959  0.2699  15  GLN A CG  
196  C CD  . GLN B 16  ? 0.4168 0.5543 0.5055 0.1417  0.0838  0.2788  15  GLN A CD  
197  O OE1 . GLN B 16  ? 0.4302 0.5966 0.5228 0.1399  0.0804  0.2713  15  GLN A OE1 
198  N NE2 . GLN B 16  ? 0.3927 0.5701 0.5050 0.1610  0.0763  0.2922  15  GLN A NE2 
199  N N   . LYS B 17  ? 0.3839 0.3579 0.5369 0.0551  0.1700  0.1970  16  LYS A N   
200  C CA  . LYS B 17  ? 0.4375 0.3956 0.5668 0.0399  0.2001  0.1646  16  LYS A CA  
201  C C   . LYS B 17  ? 0.4302 0.3822 0.5692 0.0475  0.2019  0.1399  16  LYS A C   
202  O O   . LYS B 17  ? 0.4225 0.3880 0.5807 0.0392  0.2047  0.1390  16  LYS A O   
203  C CB  . LYS B 17  ? 0.5066 0.4495 0.6032 0.0312  0.2010  0.1480  16  LYS A CB  
204  C CG  . LYS B 17  ? 0.5807 0.4986 0.6398 0.0212  0.1899  0.1292  16  LYS A CG  
205  C CD  . LYS B 17  ? 0.6434 0.5366 0.6645 0.0135  0.1812  0.1203  16  LYS A CD  
206  C CE  . LYS B 17  ? 0.6837 0.5598 0.6779 0.0075  0.1778  0.1184  16  LYS A CE  
207  N NZ  . LYS B 17  ? 0.7103 0.5710 0.6850 0.0065  0.1726  0.1188  16  LYS A NZ  
208  N N   . GLY B 18  ? 0.4427 0.3632 0.5554 0.0450  0.1870  0.1297  17  GLY A N   
209  C CA  . GLY B 18  ? 0.4449 0.3511 0.5480 0.0389  0.1791  0.1041  17  GLY A CA  
210  C C   . GLY B 18  ? 0.4582 0.3295 0.5270 0.0408  0.1566  0.0967  17  GLY A C   
211  O O   . GLY B 18  ? 0.4519 0.3293 0.5560 0.0468  0.1634  0.0814  17  GLY A O   
212  N N   . ASP B 19  ? 0.4818 0.3203 0.4675 0.0314  0.1363  0.1030  18  ASP A N   
213  C CA  . ASP B 19  ? 0.4950 0.3146 0.4189 0.0307  0.0835  0.1092  18  ASP A CA  
214  C C   . ASP B 19  ? 0.4754 0.3218 0.4138 0.0015  0.0504  0.0862  18  ASP A C   
215  O O   . ASP B 19  ? 0.4659 0.3180 0.4138 0.0090  0.0165  0.0590  18  ASP A O   
216  C CB  . ASP B 19  ? 0.5365 0.3149 0.3851 0.0426  0.0503  0.1276  18  ASP A CB  
217  C CG  . ASP B 19  ? 0.5683 0.3195 0.3693 0.0274  0.0348  0.1337  18  ASP A CG  
218  O OD1 . ASP B 19  ? 0.5646 0.3139 0.3662 0.0369  0.0159  0.1355  18  ASP A OD1 
219  O OD2 . ASP B 19  ? 0.5765 0.3223 0.3504 0.0172  0.0248  0.1432  18  ASP A OD2 
220  N N   . THR B 20  ? 0.4634 0.3330 0.4266 -0.0247 0.0467  0.0812  19  THR A N   
221  C CA  . THR B 20  ? 0.4372 0.3530 0.4429 -0.0455 0.0450  0.0639  19  THR A CA  
222  C C   . THR B 20  ? 0.3507 0.3391 0.3994 -0.0472 0.0562  0.0727  19  THR A C   
223  O O   . THR B 20  ? 0.3262 0.3529 0.3916 -0.0275 0.0426  0.0545  19  THR A O   
224  C CB  . THR B 20  ? 0.4745 0.3863 0.4947 -0.0556 0.0429  0.0505  19  THR A CB  
225  O OG1 . THR B 20  ? 0.5002 0.4027 0.5182 -0.0631 0.0465  0.0512  19  THR A OG1 
226  C CG2 . THR B 20  ? 0.4709 0.3855 0.5069 -0.0726 0.0454  0.0411  19  THR A CG2 
227  N N   . ASN B 21  ? 0.3020 0.3040 0.3531 -0.0747 0.0663  0.0842  20  ASN A N   
228  C CA  . ASN B 21  ? 0.3139 0.3005 0.3053 -0.0583 0.0784  0.0903  20  ASN A CA  
229  C C   . ASN B 21  ? 0.2823 0.2622 0.2431 -0.0256 0.0571  0.0684  20  ASN A C   
230  O O   . ASN B 21  ? 0.2806 0.2865 0.2423 -0.0158 0.0481  0.0669  20  ASN A O   
231  C CB  . ASN B 21  ? 0.3963 0.3386 0.3196 -0.0746 0.0986  0.1004  20  ASN A CB  
232  C CG  . ASN B 21  ? 0.4661 0.3796 0.3440 -0.0785 0.0938  0.1032  20  ASN A CG  
233  O OD1 . ASN B 21  ? 0.5082 0.4119 0.3594 -0.0689 0.0913  0.0970  20  ASN A OD1 
234  N ND2 . ASN B 21  ? 0.4725 0.3846 0.3520 -0.0782 0.0995  0.1035  20  ASN A ND2 
235  N N   . ILE B 22  ? 0.2458 0.2045 0.1955 -0.0192 0.0667  0.0458  21  ILE A N   
236  C CA  . ILE B 22  ? 0.2243 0.1767 0.1564 0.0073  0.0650  0.0251  21  ILE A CA  
237  C C   . ILE B 22  ? 0.2041 0.1588 0.1315 -0.0053 0.0505  0.0009  21  ILE A C   
238  O O   . ILE B 22  ? 0.2010 0.1572 0.1374 -0.0317 0.0330  0.0144  21  ILE A O   
239  C CB  . ILE B 22  ? 0.2403 0.1814 0.1401 0.0426  0.0356  0.0071  21  ILE A CB  
240  C CG1 . ILE B 22  ? 0.2401 0.1788 0.1620 0.0385  0.0156  0.0157  21  ILE A CG1 
241  C CG2 . ILE B 22  ? 0.2896 0.2083 0.1301 0.0359  0.0336  0.0002  21  ILE A CG2 
242  C CD1 . ILE B 22  ? 0.2551 0.2080 0.1747 0.0570  0.0129  0.0329  21  ILE A CD1 
243  N N   . LYS B 23  ? 0.1762 0.1511 0.1079 -0.0088 0.0322  0.0096  22  LYS A N   
244  C CA  . LYS B 23  ? 0.1700 0.1432 0.1084 0.0037  0.0161  0.0187  22  LYS A CA  
245  C C   . LYS B 23  ? 0.1740 0.1191 0.1060 -0.0040 0.0357  0.0070  22  LYS A C   
246  O O   . LYS B 23  ? 0.1742 0.1188 0.1066 -0.0045 0.0229  0.0057  22  LYS A O   
247  C CB  . LYS B 23  ? 0.1480 0.1877 0.1626 -0.0009 0.0123  0.0272  22  LYS A CB  
248  C CG  . LYS B 23  ? 0.1574 0.2432 0.2524 0.0145  0.0047  0.0598  22  LYS A CG  
249  C CD  . LYS B 23  ? 0.2037 0.2929 0.3503 0.0290  -0.0060 0.0518  22  LYS A CD  
250  C CE  . LYS B 23  ? 0.2759 0.3182 0.4380 0.0434  -0.0142 0.0517  22  LYS A CE  
251  N NZ  . LYS B 23  ? 0.3433 0.3549 0.4799 0.0234  -0.0223 0.0492  22  LYS A NZ  
252  N N   . PRO B 24  ? 0.1638 0.1121 0.1046 -0.0113 0.0241  0.0042  23  PRO A N   
253  C CA  . PRO B 24  ? 0.1532 0.1061 0.1135 -0.0142 0.0153  0.0130  23  PRO A CA  
254  C C   . PRO B 24  ? 0.1559 0.0982 0.0992 -0.0245 0.0051  -0.0080 23  PRO A C   
255  O O   . PRO B 24  ? 0.1677 0.1090 0.1076 -0.0092 -0.0080 -0.0067 23  PRO A O   
256  C CB  . PRO B 24  ? 0.1586 0.1173 0.1311 -0.0156 -0.0052 0.0246  23  PRO A CB  
257  C CG  . PRO B 24  ? 0.1744 0.1218 0.1396 -0.0073 0.0057  0.0203  23  PRO A CG  
258  C CD  . PRO B 24  ? 0.1773 0.1076 0.1392 0.0049  0.0137  0.0055  23  PRO A CD  
259  N N   . ILE B 25  ? 0.1633 0.1004 0.0921 -0.0170 0.0167  0.0023  24  ILE A N   
260  C CA  . ILE B 25  ? 0.1565 0.0941 0.0987 -0.0145 0.0100  -0.0007 24  ILE A CA  
261  C C   . ILE B 25  ? 0.1522 0.0985 0.0933 -0.0064 -0.0042 -0.0137 24  ILE A C   
262  O O   . ILE B 25  ? 0.1631 0.1275 0.0823 -0.0078 0.0164  -0.0057 24  ILE A O   
263  C CB  . ILE B 25  ? 0.1659 0.1008 0.1082 0.0027  0.0225  0.0113  24  ILE A CB  
264  C CG1 . ILE B 25  ? 0.1874 0.1100 0.1448 0.0096  0.0303  -0.0048 24  ILE A CG1 
265  C CG2 . ILE B 25  ? 0.1937 0.1144 0.1015 -0.0027 0.0141  0.0295  24  ILE A CG2 
266  C CD1 . ILE B 25  ? 0.2101 0.1365 0.1657 0.0090  0.0230  -0.0282 24  ILE A CD1 
267  N N   . LEU B 26  ? 0.1696 0.0947 0.0875 -0.0006 0.0133  -0.0079 25  LEU A N   
268  C CA  . LEU B 26  ? 0.1523 0.0908 0.0958 -0.0078 0.0209  0.0113  25  LEU A CA  
269  C C   . LEU B 26  ? 0.1462 0.1105 0.0825 0.0094  0.0076  0.0134  25  LEU A C   
270  O O   . LEU B 26  ? 0.1656 0.1601 0.1074 0.0258  0.0118  0.0340  25  LEU A O   
271  C CB  . LEU B 26  ? 0.1891 0.0959 0.1081 -0.0091 0.0157  0.0101  25  LEU A CB  
272  C CG  . LEU B 26  ? 0.2122 0.0939 0.1366 -0.0175 0.0209  0.0148  25  LEU A CG  
273  C CD1 . LEU B 26  ? 0.2206 0.1070 0.1620 -0.0100 0.0403  0.0171  25  LEU A CD1 
274  C CD2 . LEU B 26  ? 0.2273 0.1190 0.1421 0.0025  0.0214  0.0222  25  LEU A CD2 
275  N N   . GLN B 27  ? 0.1495 0.0988 0.0818 0.0064  0.0117  -0.0042 26  GLN A N   
276  C CA  . GLN B 27  ? 0.1724 0.0945 0.0793 -0.0012 0.0259  0.0004  26  GLN A CA  
277  C C   . GLN B 27  ? 0.1655 0.0971 0.0701 -0.0071 0.0136  0.0251  26  GLN A C   
278  O O   . GLN B 27  ? 0.1861 0.0963 0.0861 0.0004  0.0064  0.0146  26  GLN A O   
279  C CB  . GLN B 27  ? 0.1708 0.1205 0.0880 -0.0147 0.0274  0.0098  26  GLN A CB  
280  C CG  . GLN B 27  ? 0.1975 0.1166 0.0813 -0.0316 0.0044  0.0144  26  GLN A CG  
281  C CD  . GLN B 27  ? 0.1964 0.1113 0.0681 0.0005  0.0031  0.0159  26  GLN A CD  
282  O OE1 . GLN B 27  ? 0.1854 0.1240 0.0817 -0.0131 0.0065  0.0083  26  GLN A OE1 
283  N NE2 . GLN B 27  ? 0.1944 0.1153 0.1015 -0.0052 0.0116  0.0213  26  GLN A NE2 
284  N N   . VAL B 28  ? 0.1766 0.1000 0.0684 0.0065  0.0103  0.0043  27  VAL A N   
285  C CA  . VAL B 28  ? 0.1945 0.1060 0.0794 0.0057  0.0002  -0.0126 27  VAL A CA  
286  C C   . VAL B 28  ? 0.1784 0.1081 0.0829 0.0067  0.0265  0.0102  27  VAL A C   
287  O O   . VAL B 28  ? 0.1975 0.1166 0.0999 0.0010  0.0302  0.0197  27  VAL A O   
288  C CB  . VAL B 28  ? 0.1968 0.1240 0.0797 0.0030  -0.0034 -0.0087 27  VAL A CB  
289  C CG1 . VAL B 28  ? 0.2275 0.1319 0.0819 0.0047  -0.0047 -0.0143 27  VAL A CG1 
290  C CG2 . VAL B 28  ? 0.2036 0.1432 0.1284 0.0000  -0.0104 -0.0039 27  VAL A CG2 
291  N N   . ILE B 29  ? 0.1625 0.1232 0.0933 0.0092  0.0212  0.0037  28  ILE A N   
292  C CA  . ILE B 29  ? 0.1685 0.1431 0.0897 0.0055  0.0044  -0.0101 28  ILE A CA  
293  C C   . ILE B 29  ? 0.1674 0.1498 0.0987 0.0063  0.0140  -0.0088 28  ILE A C   
294  O O   . ILE B 29  ? 0.2068 0.1725 0.1158 -0.0118 0.0373  -0.0059 28  ILE A O   
295  C CB  . ILE B 29  ? 0.1584 0.1503 0.1029 0.0031  0.0115  -0.0053 28  ILE A CB  
296  C CG1 . ILE B 29  ? 0.2122 0.1487 0.1027 -0.0105 -0.0068 -0.0072 28  ILE A CG1 
297  C CG2 . ILE B 29  ? 0.1718 0.1701 0.1345 0.0101  0.0102  -0.0056 28  ILE A CG2 
298  C CD1 . ILE B 29  ? 0.2494 0.1642 0.1136 -0.0448 0.0074  -0.0356 28  ILE A CD1 
299  N N   . ASN B 30  ? 0.1768 0.1453 0.1014 0.0061  0.0017  -0.0264 29  ASN A N   
300  C CA  . ASN B 30  ? 0.1847 0.1804 0.1277 0.0121  0.0084  -0.0503 29  ASN A CA  
301  C C   . ASN B 30  ? 0.1783 0.1410 0.0979 -0.0043 0.0139  -0.0306 29  ASN A C   
302  O O   . ASN B 30  ? 0.1804 0.1566 0.1121 0.0126  0.0132  -0.0013 29  ASN A O   
303  C CB  . ASN B 30  ? 0.2385 0.2596 0.1855 0.0361  0.0071  -0.0946 29  ASN A CB  
304  C CG  . ASN B 30  ? 0.3792 0.3152 0.2624 0.0258  0.0172  -0.0866 29  ASN A CG  
305  O OD1 . ASN B 30  ? 0.4478 0.3509 0.2906 -0.0241 0.0544  -0.0772 29  ASN A OD1 
306  N ND2 . ASN B 30  ? 0.4198 0.3305 0.2950 0.0626  0.0060  -0.0893 29  ASN A ND2 
307  N N   . ILE B 31  ? 0.1705 0.1385 0.1099 0.0045  0.0098  -0.0194 30  ILE A N   
308  C CA  . ILE B 31  ? 0.2036 0.1541 0.1306 -0.0122 0.0034  -0.0159 30  ILE A CA  
309  C C   . ILE B 31  ? 0.2122 0.1660 0.1161 -0.0186 0.0152  -0.0252 30  ILE A C   
310  O O   . ILE B 31  ? 0.2378 0.1757 0.1298 -0.0315 0.0215  -0.0291 30  ILE A O   
311  C CB  . ILE B 31  ? 0.1988 0.1743 0.1625 0.0038  -0.0088 -0.0101 30  ILE A CB  
312  C CG1 . ILE B 31  ? 0.2355 0.2045 0.1647 0.0436  -0.0224 -0.0133 30  ILE A CG1 
313  C CG2 . ILE B 31  ? 0.2010 0.1820 0.1911 -0.0073 -0.0160 -0.0268 30  ILE A CG2 
314  C CD1 . ILE B 31  ? 0.2859 0.2182 0.1919 0.0470  -0.0560 -0.0316 30  ILE A CD1 
315  N N   . ARG B 32  ? 0.1866 0.1535 0.1166 0.0006  0.0259  -0.0460 31  ARG A N   
316  C CA  . ARG B 32  ? 0.2010 0.1710 0.1408 -0.0037 0.0194  -0.0445 31  ARG A CA  
317  C C   . ARG B 32  ? 0.1804 0.1845 0.1356 -0.0145 0.0465  -0.0461 31  ARG A C   
318  O O   . ARG B 32  ? 0.1862 0.2020 0.1336 -0.0206 0.0443  -0.0619 31  ARG A O   
319  C CB  . ARG B 32  ? 0.2311 0.1951 0.1733 0.0018  0.0158  -0.0101 31  ARG A CB  
320  C CG  . ARG B 32  ? 0.2339 0.2013 0.1996 0.0245  -0.0036 0.0031  31  ARG A CG  
321  C CD  . ARG B 32  ? 0.2343 0.2154 0.2337 0.0397  -0.0052 0.0002  31  ARG A CD  
322  N NE  . ARG B 32  ? 0.2396 0.2476 0.2570 0.0306  -0.0019 0.0205  31  ARG A NE  
323  C CZ  . ARG B 32  ? 0.2351 0.2652 0.2656 0.0190  -0.0171 0.0398  31  ARG A CZ  
324  N NH1 . ARG B 32  ? 0.2689 0.2738 0.2723 0.0296  -0.0208 0.0368  31  ARG A NH1 
325  N NH2 . ARG B 32  ? 0.2511 0.2680 0.2656 0.0308  -0.0120 0.0543  31  ARG A NH2 
326  N N   . PRO B 33  ? 0.1919 0.1847 0.1352 -0.0123 0.0302  -0.0438 32  PRO A N   
327  C CA  . PRO B 33  ? 0.2055 0.1642 0.1304 -0.0188 0.0208  -0.0442 32  PRO A CA  
328  C C   . PRO B 33  ? 0.2131 0.1852 0.1360 -0.0079 0.0176  -0.0275 32  PRO A C   
329  O O   . PRO B 33  ? 0.2177 0.1877 0.1641 -0.0085 0.0203  -0.0122 32  PRO A O   
330  C CB  . PRO B 33  ? 0.2095 0.1638 0.1184 0.0040  0.0344  -0.0267 32  PRO A CB  
331  C CG  . PRO B 33  ? 0.2142 0.1762 0.1362 -0.0233 0.0296  -0.0272 32  PRO A CG  
332  C CD  . PRO B 33  ? 0.2197 0.1907 0.1375 -0.0083 0.0412  -0.0219 32  PRO A CD  
333  N N   . ILE B 34  ? 0.2579 0.1991 0.1573 -0.0550 0.0199  -0.0204 33  ILE A N   
334  C CA  . ILE B 34  ? 0.3237 0.2342 0.1601 -0.0938 0.0442  -0.0233 33  ILE A CA  
335  C C   . ILE B 34  ? 0.3357 0.2550 0.1448 -0.0802 0.0430  -0.0419 33  ILE A C   
336  O O   . ILE B 34  ? 0.3799 0.2569 0.1577 -0.0556 0.0043  -0.0273 33  ILE A O   
337  C CB  . ILE B 34  ? 0.3923 0.2559 0.1834 -0.1151 0.0616  -0.0365 33  ILE A CB  
338  C CG1 . ILE B 34  ? 0.4209 0.2909 0.1825 -0.1268 0.0529  -0.0222 33  ILE A CG1 
339  C CG2 . ILE B 34  ? 0.4115 0.2573 0.2126 -0.1099 0.0876  -0.0469 33  ILE A CG2 
340  C CD1 . ILE B 34  ? 0.4441 0.3065 0.2074 -0.1145 0.0027  -0.0160 33  ILE A CD1 
341  N N   . THR B 35  ? 0.3019 0.2884 0.1547 -0.0626 0.0639  -0.0700 34  THR A N   
342  C CA  . THR B 35  ? 0.3105 0.3311 0.2384 -0.0125 0.0556  -0.1034 34  THR A CA  
343  C C   . THR B 35  ? 0.3901 0.3787 0.3394 0.0178  0.0397  -0.1713 34  THR A C   
344  O O   . THR B 35  ? 0.3883 0.3601 0.3423 -0.0086 0.0285  -0.1884 34  THR A O   
345  C CB  . THR B 35  ? 0.2840 0.3360 0.2525 0.0223  0.0778  -0.0616 34  THR A CB  
346  O OG1 . THR B 35  ? 0.2433 0.3435 0.2879 0.0245  0.0796  0.0001  34  THR A OG1 
347  C CG2 . THR B 35  ? 0.3145 0.3482 0.2488 0.0616  0.0891  -0.0700 34  THR A CG2 
348  N N   . THR B 36  ? 0.4631 0.4373 0.4364 0.0555  0.0268  -0.2182 35  THR A N   
349  C CA  . THR B 36  ? 0.5483 0.5003 0.5368 0.0681  0.0107  -0.2453 35  THR A CA  
350  C C   . THR B 36  ? 0.6284 0.5531 0.6311 0.0583  -0.0096 -0.2455 35  THR A C   
351  O O   . THR B 36  ? 0.6459 0.5554 0.6246 0.0559  -0.0224 -0.2602 35  THR A O   
352  C CB  . THR B 36  ? 0.5494 0.5082 0.5353 0.0821  0.0172  -0.2675 35  THR A CB  
353  O OG1 . THR B 36  ? 0.5477 0.5114 0.5302 0.0994  0.0162  -0.2826 35  THR A OG1 
354  C CG2 . THR B 36  ? 0.5522 0.5125 0.5419 0.0735  0.0245  -0.2666 35  THR A CG2 
355  N N   . GLY B 37  ? 0.6854 0.5962 0.7228 0.0443  -0.0144 -0.2334 36  GLY A N   
356  C CA  . GLY B 37  ? 0.7233 0.6299 0.8064 0.0280  -0.0148 -0.2225 36  GLY A CA  
357  C C   . GLY B 37  ? 0.7473 0.6584 0.8850 0.0086  -0.0100 -0.2062 36  GLY A C   
358  O O   . GLY B 37  ? 0.7659 0.6694 0.8902 0.0045  -0.0214 -0.2016 36  GLY A O   
359  N N   . ASN B 38  ? 0.7408 0.6647 0.9521 -0.0036 0.0124  -0.1956 37  ASN A N   
360  C CA  . ASN B 38  ? 0.7295 0.6618 1.0108 -0.0136 0.0311  -0.1872 37  ASN A CA  
361  C C   . ASN B 38  ? 0.7117 0.6438 1.0489 -0.0267 0.0426  -0.1780 37  ASN A C   
362  O O   . ASN B 38  ? 0.7080 0.6515 1.1479 -0.0292 0.0488  -0.1778 37  ASN A O   
363  C CB  . ASN B 38  ? 0.7327 0.6675 1.0185 -0.0117 0.0346  -0.1889 37  ASN A CB  
364  N N   . SER B 39  ? 0.6907 0.6107 0.9478 -0.0370 0.0447  -0.1682 38  SER A N   
365  C CA  . SER B 39  ? 0.6612 0.5735 0.8348 -0.0498 0.0413  -0.1549 38  SER A CA  
366  C C   . SER B 39  ? 0.6057 0.5220 0.7204 -0.0482 0.0519  -0.1496 38  SER A C   
367  O O   . SER B 39  ? 0.6335 0.5176 0.7170 -0.0552 0.0596  -0.1561 38  SER A O   
368  C CB  . SER B 39  ? 0.6782 0.5847 0.8331 -0.0576 0.0303  -0.1486 38  SER A CB  
369  O OG  . SER B 39  ? 0.6879 0.5908 0.8309 -0.0588 0.0186  -0.1449 38  SER A OG  
370  N N   . PRO B 40  ? 0.4901 0.4761 0.6090 -0.0422 0.0537  -0.1354 39  PRO A N   
371  C CA  . PRO B 40  ? 0.4247 0.4273 0.5275 -0.0348 0.0515  -0.1303 39  PRO A CA  
372  C C   . PRO B 40  ? 0.3700 0.3587 0.4387 -0.0633 0.0337  -0.1256 39  PRO A C   
373  O O   . PRO B 40  ? 0.3794 0.3423 0.4439 -0.0999 0.0105  -0.1322 39  PRO A O   
374  C CB  . PRO B 40  ? 0.4250 0.4479 0.5447 -0.0247 0.0538  -0.1270 39  PRO A CB  
375  C CG  . PRO B 40  ? 0.4389 0.4638 0.5651 -0.0294 0.0540  -0.1238 39  PRO A CG  
376  C CD  . PRO B 40  ? 0.4705 0.4743 0.5861 -0.0305 0.0553  -0.1264 39  PRO A CD  
377  N N   . PRO B 41  ? 0.3213 0.3052 0.3606 -0.0480 0.0364  -0.0999 40  PRO A N   
378  C CA  . PRO B 41  ? 0.2763 0.2616 0.3087 -0.0455 0.0305  -0.0959 40  PRO A CA  
379  C C   . PRO B 41  ? 0.2298 0.2070 0.2626 -0.0430 0.0402  -0.0912 40  PRO A C   
380  O O   . PRO B 41  ? 0.2225 0.1995 0.2663 -0.0425 0.0424  -0.0385 40  PRO A O   
381  C CB  . PRO B 41  ? 0.3024 0.2913 0.3206 -0.0293 0.0481  -0.0769 40  PRO A CB  
382  C CG  . PRO B 41  ? 0.3098 0.3109 0.3387 -0.0416 0.0529  -0.0659 40  PRO A CG  
383  C CD  . PRO B 41  ? 0.3269 0.3112 0.3450 -0.0544 0.0438  -0.0791 40  PRO A CD  
384  N N   . ARG B 42  ? 0.2209 0.1947 0.2570 -0.0211 0.0129  -0.0947 41  ARG A N   
385  C CA  . ARG B 42  ? 0.2247 0.1910 0.2651 -0.0365 0.0227  -0.0864 41  ARG A CA  
386  C C   . ARG B 42  ? 0.2141 0.1682 0.2293 -0.0116 0.0382  -0.0868 41  ARG A C   
387  O O   . ARG B 42  ? 0.2407 0.1992 0.2364 -0.0105 0.0359  -0.1089 41  ARG A O   
388  C CB  . ARG B 42  ? 0.3020 0.2318 0.3431 -0.0929 0.0160  -0.0647 41  ARG A CB  
389  C CG  . ARG B 42  ? 0.4272 0.2976 0.4184 -0.1215 0.0115  -0.0593 41  ARG A CG  
390  C CD  . ARG B 42  ? 0.5549 0.3772 0.5065 -0.1160 0.0102  -0.0196 41  ARG A CD  
391  N NE  . ARG B 42  ? 0.6680 0.4348 0.5739 -0.0944 0.0016  -0.0038 41  ARG A NE  
392  C CZ  . ARG B 42  ? 0.7391 0.4700 0.6227 -0.0839 -0.0026 -0.0010 41  ARG A CZ  
393  N NH1 . ARG B 42  ? 0.7534 0.4621 0.6302 -0.0853 -0.0055 0.0056  41  ARG A NH1 
394  N NH2 . ARG B 42  ? 0.7640 0.4886 0.6458 -0.0867 -0.0036 -0.0063 41  ARG A NH2 
395  N N   . TYR B 43  ? 0.2068 0.1292 0.1942 -0.0148 0.0141  -0.0441 42  TYR A N   
396  C CA  . TYR B 43  ? 0.2073 0.1293 0.1680 -0.0299 0.0051  -0.0378 42  TYR A CA  
397  C C   . TYR B 43  ? 0.1887 0.1341 0.1519 -0.0137 0.0268  -0.0387 42  TYR A C   
398  O O   . TYR B 43  ? 0.1790 0.1540 0.1670 -0.0069 0.0326  -0.0124 42  TYR A O   
399  C CB  . TYR B 43  ? 0.1948 0.1299 0.1508 0.0003  0.0012  -0.0282 42  TYR A CB  
400  C CG  . TYR B 43  ? 0.2032 0.1295 0.1338 -0.0192 0.0196  -0.0460 42  TYR A CG  
401  C CD1 . TYR B 43  ? 0.2210 0.1475 0.1565 -0.0039 0.0306  -0.0290 42  TYR A CD1 
402  C CD2 . TYR B 43  ? 0.2161 0.1603 0.1509 -0.0170 0.0169  -0.0384 42  TYR A CD2 
403  C CE1 . TYR B 43  ? 0.2307 0.1728 0.1522 0.0194  0.0147  -0.0407 42  TYR A CE1 
404  C CE2 . TYR B 43  ? 0.2123 0.1806 0.1482 -0.0020 0.0228  -0.0449 42  TYR A CE2 
405  C CZ  . TYR B 43  ? 0.2214 0.1838 0.1442 0.0062  0.0102  -0.0307 42  TYR A CZ  
406  O OH  . TYR B 43  ? 0.2750 0.2033 0.1568 0.0223  0.0244  -0.0161 42  TYR A OH  
407  N N   . ARG B 44  ? 0.1934 0.1312 0.1325 -0.0104 0.0042  -0.0431 43  ARG A N   
408  C CA  . ARG B 44  ? 0.1948 0.1398 0.1333 0.0075  0.0147  -0.0425 43  ARG A CA  
409  C C   . ARG B 44  ? 0.1699 0.1261 0.1203 -0.0078 0.0300  -0.0282 43  ARG A C   
410  O O   . ARG B 44  ? 0.1822 0.1600 0.1597 -0.0190 0.0445  -0.0504 43  ARG A O   
411  C CB  . ARG B 44  ? 0.2361 0.1475 0.1340 0.0100  0.0224  -0.0298 43  ARG A CB  
412  C CG  . ARG B 44  ? 0.2579 0.1836 0.1856 0.0330  0.0099  -0.0040 43  ARG A CG  
413  C CD  . ARG B 44  ? 0.2899 0.1968 0.1939 0.0358  -0.0111 0.0048  43  ARG A CD  
414  N NE  . ARG B 44  ? 0.2657 0.1949 0.1983 0.0400  -0.0200 -0.0085 43  ARG A NE  
415  C CZ  . ARG B 44  ? 0.2580 0.2148 0.2304 0.0135  -0.0124 -0.0088 43  ARG A CZ  
416  N NH1 . ARG B 44  ? 0.2691 0.2322 0.2633 0.0101  0.0244  -0.0167 43  ARG A NH1 
417  N NH2 . ARG B 44  ? 0.2541 0.2445 0.2256 0.0053  -0.0051 -0.0123 43  ARG A NH2 
418  N N   . LEU B 45  ? 0.1710 0.1099 0.1189 0.0042  -0.0096 -0.0172 44  LEU A N   
419  C CA  . LEU B 45  ? 0.1910 0.0928 0.1180 0.0016  -0.0343 -0.0097 44  LEU A CA  
420  C C   . LEU B 45  ? 0.1845 0.0961 0.1271 -0.0083 -0.0122 0.0003  44  LEU A C   
421  O O   . LEU B 45  ? 0.2109 0.1225 0.1448 -0.0276 -0.0207 0.0362  44  LEU A O   
422  C CB  . LEU B 45  ? 0.1884 0.1141 0.1219 0.0084  -0.0136 0.0012  44  LEU A CB  
423  C CG  . LEU B 45  ? 0.1868 0.1322 0.1533 0.0300  -0.0158 -0.0127 44  LEU A CG  
424  C CD1 . LEU B 45  ? 0.2137 0.1789 0.2278 0.0114  -0.0373 -0.0155 44  LEU A CD1 
425  C CD2 . LEU B 45  ? 0.2401 0.1388 0.1737 0.0471  -0.0225 0.0138  44  LEU A CD2 
426  N N   . LEU B 46  ? 0.1585 0.1031 0.1232 -0.0143 -0.0111 -0.0278 45  LEU A N   
427  C CA  . LEU B 46  ? 0.1650 0.1106 0.1081 -0.0045 -0.0012 -0.0150 45  LEU A CA  
428  C C   . LEU B 46  ? 0.1523 0.0934 0.1003 -0.0040 0.0023  -0.0168 45  LEU A C   
429  O O   . LEU B 46  ? 0.1660 0.0932 0.1124 -0.0020 0.0012  0.0021  45  LEU A O   
430  C CB  . LEU B 46  ? 0.1714 0.1351 0.1378 0.0101  -0.0130 -0.0118 45  LEU A CB  
431  C CG  . LEU B 46  ? 0.1608 0.1488 0.1538 0.0066  -0.0002 0.0094  45  LEU A CG  
432  C CD1 . LEU B 46  ? 0.2072 0.1256 0.1740 0.0140  0.0091  0.0159  45  LEU A CD1 
433  C CD2 . LEU B 46  ? 0.1659 0.1690 0.1751 0.0068  0.0244  -0.0129 45  LEU A CD2 
434  N N   . MET B 47  ? 0.1590 0.1084 0.0981 0.0213  -0.0041 -0.0028 46  MET A N   
435  C CA  A MET B 47  ? 0.1626 0.1117 0.1056 0.0124  -0.0068 -0.0148 46  MET A CA  
436  C CA  B MET B 47  ? 0.1510 0.1142 0.0964 0.0267  -0.0165 -0.0160 46  MET A CA  
437  C C   . MET B 47  ? 0.1601 0.0900 0.0836 0.0018  -0.0048 0.0059  46  MET A C   
438  O O   . MET B 47  ? 0.1970 0.0895 0.1095 -0.0004 -0.0317 0.0180  46  MET A O   
439  C CB  A MET B 47  ? 0.1749 0.1330 0.1317 0.0104  -0.0150 -0.0278 46  MET A CB  
440  C CB  B MET B 47  ? 0.1588 0.1396 0.1000 0.0295  -0.0367 -0.0250 46  MET A CB  
441  C CG  A MET B 47  ? 0.1749 0.1247 0.1404 0.0168  -0.0234 -0.0117 46  MET A CG  
442  C CG  B MET B 47  ? 0.1876 0.1278 0.1012 0.0166  -0.0373 -0.0146 46  MET A CG  
443  S SD  A MET B 47  ? 0.1841 0.1340 0.1565 -0.0034 -0.0221 0.0057  46  MET A SD  
444  S SD  B MET B 47  ? 0.1883 0.1037 0.0964 0.0087  -0.0194 -0.0052 46  MET A SD  
445  C CE  A MET B 47  ? 0.1736 0.1353 0.1550 0.0116  -0.0469 -0.0077 46  MET A CE  
446  C CE  B MET B 47  ? 0.1939 0.1271 0.0939 0.0077  -0.0120 0.0163  46  MET A CE  
447  N N   . SER B 48  ? 0.1649 0.0970 0.0710 0.0116  0.0008  -0.0027 47  SER A N   
448  C CA  . SER B 48  ? 0.1635 0.1026 0.0808 -0.0008 0.0050  -0.0047 47  SER A CA  
449  C C   . SER B 48  ? 0.1737 0.0906 0.0671 0.0140  0.0069  0.0181  47  SER A C   
450  O O   . SER B 48  ? 0.1874 0.1099 0.0851 0.0131  0.0166  0.0199  47  SER A O   
451  C CB  . SER B 48  ? 0.1565 0.1273 0.0857 -0.0210 0.0042  0.0067  47  SER A CB  
452  O OG  . SER B 48  ? 0.1791 0.1376 0.0832 -0.0257 -0.0055 -0.0036 47  SER A OG  
453  N N   . ASP B 49  ? 0.1882 0.1093 0.0659 -0.0128 0.0152  0.0059  48  ASP A N   
454  C CA  . ASP B 49  ? 0.2211 0.1198 0.0823 -0.0236 0.0330  0.0011  48  ASP A CA  
455  C C   . ASP B 49  ? 0.2541 0.1244 0.0904 -0.0404 0.0209  -0.0047 48  ASP A C   
456  O O   . ASP B 49  ? 0.2988 0.1327 0.0992 -0.0326 0.0198  -0.0147 48  ASP A O   
457  C CB  . ASP B 49  ? 0.2298 0.1248 0.0956 -0.0098 0.0307  0.0014  48  ASP A CB  
458  C CG  . ASP B 49  ? 0.2358 0.1457 0.1056 -0.0130 0.0409  0.0156  48  ASP A CG  
459  O OD1 . ASP B 49  ? 0.2284 0.1554 0.1195 -0.0225 0.0013  0.0335  48  ASP A OD1 
460  O OD2 . ASP B 49  ? 0.2542 0.1720 0.1076 -0.0291 0.0198  0.0320  48  ASP A OD2 
461  N N   . GLY B 50  ? 0.2469 0.1188 0.0970 -0.0538 -0.0109 0.0165  49  GLY A N   
462  C CA  . GLY B 50  ? 0.2847 0.1373 0.1202 -0.0671 -0.0322 0.0111  49  GLY A CA  
463  C C   . GLY B 50  ? 0.2916 0.1764 0.1252 -0.0683 -0.0230 0.0126  49  GLY A C   
464  O O   . GLY B 50  ? 0.3145 0.2117 0.1611 -0.0701 -0.0363 0.0288  49  GLY A O   
465  N N   . LEU B 51  ? 0.2577 0.1600 0.1015 -0.0523 -0.0092 0.0141  50  LEU A N   
466  C CA  . LEU B 51  ? 0.2567 0.1927 0.0974 -0.0495 -0.0073 0.0288  50  LEU A CA  
467  C C   . LEU B 51  ? 0.2423 0.1734 0.1017 -0.0436 -0.0109 0.0314  50  LEU A C   
468  O O   . LEU B 51  ? 0.2180 0.1822 0.1091 -0.0594 -0.0167 0.0246  50  LEU A O   
469  C CB  . LEU B 51  ? 0.2523 0.2266 0.1285 -0.0396 -0.0198 0.0204  50  LEU A CB  
470  C CG  . LEU B 51  ? 0.2554 0.2608 0.1453 -0.0100 0.0116  0.0088  50  LEU A CG  
471  C CD1 . LEU B 51  ? 0.2384 0.3018 0.1295 0.0145  0.0226  0.0258  50  LEU A CD1 
472  C CD2 . LEU B 51  ? 0.2829 0.2468 0.1641 0.0001  -0.0114 -0.0079 50  LEU A CD2 
473  N N   . ASN B 52  ? 0.2464 0.1447 0.1009 -0.0441 -0.0448 0.0424  51  ASN A N   
474  C CA  . ASN B 52  ? 0.2439 0.1273 0.1154 -0.0388 -0.0493 0.0456  51  ASN A CA  
475  C C   . ASN B 52  ? 0.2255 0.1029 0.1259 -0.0166 -0.0460 0.0418  51  ASN A C   
476  O O   . ASN B 52  ? 0.2204 0.1219 0.1126 0.0000  -0.0218 0.0377  51  ASN A O   
477  C CB  . ASN B 52  ? 0.2506 0.1489 0.1294 -0.0453 -0.0414 0.0651  51  ASN A CB  
478  C CG  . ASN B 52  ? 0.2610 0.1615 0.1422 -0.0468 -0.0475 0.0661  51  ASN A CG  
479  O OD1 . ASN B 52  ? 0.2766 0.1977 0.1208 -0.0262 -0.0515 0.0622  51  ASN A OD1 
480  N ND2 . ASN B 52  ? 0.2635 0.1629 0.1559 -0.0450 -0.0724 0.0598  51  ASN A ND2 
481  N N   . THR B 53  ? 0.2175 0.1118 0.1393 -0.0136 -0.0521 0.0139  52  THR A N   
482  C CA  . THR B 53  ? 0.2052 0.1155 0.1455 -0.0116 -0.0574 0.0115  52  THR A CA  
483  C C   . THR B 53  ? 0.2259 0.0991 0.1652 -0.0127 -0.0669 0.0319  52  THR A C   
484  O O   . THR B 53  ? 0.2615 0.1217 0.2019 -0.0105 -0.0967 0.0536  52  THR A O   
485  C CB  . THR B 53  ? 0.2196 0.1424 0.1582 0.0161  -0.0440 0.0110  52  THR A CB  
486  O OG1 . THR B 53  ? 0.2626 0.1602 0.1536 0.0383  -0.0423 0.0113  52  THR A OG1 
487  C CG2 . THR B 53  ? 0.2388 0.1463 0.1814 0.0058  -0.0406 0.0159  52  THR A CG2 
488  N N   . LEU B 54  ? 0.2128 0.1120 0.1756 -0.0186 -0.0676 -0.0035 53  LEU A N   
489  C CA  . LEU B 54  ? 0.2203 0.1173 0.1796 -0.0292 -0.0475 0.0050  53  LEU A CA  
490  C C   . LEU B 54  ? 0.1839 0.1051 0.1683 -0.0101 -0.0440 0.0008  53  LEU A C   
491  O O   . LEU B 54  ? 0.1736 0.1043 0.1481 0.0086  -0.0198 0.0073  53  LEU A O   
492  C CB  . LEU B 54  ? 0.2517 0.1505 0.2051 -0.0573 -0.0366 0.0290  53  LEU A CB  
493  C CG  . LEU B 54  ? 0.2378 0.1852 0.2505 -0.0627 -0.0450 0.0435  53  LEU A CG  
494  C CD1 . LEU B 54  ? 0.2703 0.2132 0.3286 -0.0479 -0.0512 0.0610  53  LEU A CD1 
495  C CD2 . LEU B 54  ? 0.2399 0.2171 0.2306 -0.0743 -0.0001 0.0567  53  LEU A CD2 
496  N N   . SER B 55  ? 0.1860 0.1076 0.1896 0.0029  -0.0327 -0.0003 54  SER A N   
497  C CA  . SER B 55  ? 0.1617 0.1342 0.2165 0.0099  -0.0004 -0.0185 54  SER A CA  
498  C C   . SER B 55  ? 0.1673 0.1122 0.1880 -0.0103 0.0005  0.0040  54  SER A C   
499  O O   . SER B 55  ? 0.2052 0.1447 0.1890 -0.0016 0.0015  0.0106  54  SER A O   
500  C CB  . SER B 55  ? 0.2049 0.1565 0.2774 0.0254  -0.0025 -0.0259 54  SER A CB  
501  O OG  . SER B 55  ? 0.2481 0.1714 0.2978 0.0161  -0.0325 -0.0188 54  SER A OG  
502  N N   . SER B 56  ? 0.1438 0.0981 0.1887 -0.0025 0.0072  0.0119  55  SER A N   
503  C CA  A SER B 56  ? 0.1727 0.1035 0.1862 -0.0087 0.0095  0.0231  55  SER A CA  
504  C CA  B SER B 56  ? 0.1593 0.1046 0.1697 -0.0096 0.0023  0.0158  55  SER A CA  
505  C C   . SER B 56  ? 0.1726 0.1078 0.1864 -0.0019 0.0316  0.0275  55  SER A C   
506  O O   . SER B 56  ? 0.1938 0.1237 0.2488 0.0166  0.0491  0.0493  55  SER A O   
507  C CB  A SER B 56  ? 0.2112 0.1058 0.1998 -0.0093 -0.0006 0.0403  55  SER A CB  
508  C CB  B SER B 56  ? 0.1825 0.1227 0.1932 0.0120  0.0023  0.0395  55  SER A CB  
509  O OG  A SER B 56  ? 0.2450 0.1117 0.2132 -0.0167 0.0019  0.0455  55  SER A OG  
510  O OG  B SER B 56  ? 0.1874 0.1569 0.2216 0.0065  0.0319  0.0237  55  SER A OG  
511  N N   . PHE B 57  ? 0.1859 0.1346 0.1817 -0.0039 -0.0015 0.0488  56  PHE A N   
512  C CA  . PHE B 57  ? 0.1862 0.1332 0.1517 0.0042  -0.0129 0.0501  56  PHE A CA  
513  C C   . PHE B 57  ? 0.1593 0.1309 0.1586 0.0009  0.0077  0.0406  56  PHE A C   
514  O O   . PHE B 57  ? 0.1548 0.1451 0.1860 -0.0172 0.0118  0.0217  56  PHE A O   
515  C CB  . PHE B 57  ? 0.2029 0.1323 0.1654 -0.0226 -0.0091 0.0304  56  PHE A CB  
516  C CG  . PHE B 57  ? 0.1918 0.1349 0.1719 0.0000  -0.0534 0.0397  56  PHE A CG  
517  C CD1 . PHE B 57  ? 0.2174 0.1158 0.1667 -0.0045 -0.0349 0.0319  56  PHE A CD1 
518  C CD2 . PHE B 57  ? 0.2353 0.2017 0.1981 0.0151  -0.0808 0.0234  56  PHE A CD2 
519  C CE1 . PHE B 57  ? 0.2517 0.1315 0.1735 -0.0087 -0.0479 0.0501  56  PHE A CE1 
520  C CE2 . PHE B 57  ? 0.2677 0.2156 0.2103 -0.0005 -0.0855 0.0198  56  PHE A CE2 
521  C CZ  . PHE B 57  ? 0.2788 0.1830 0.1926 -0.0021 -0.0518 0.0479  56  PHE A CZ  
522  N N   . MET B 58  ? 0.1763 0.1458 0.1821 0.0049  -0.0182 0.0305  57  MET A N   
523  C CA  A MET B 58  ? 0.1841 0.1610 0.1935 0.0040  -0.0121 0.0076  57  MET A CA  
524  C CA  B MET B 58  ? 0.1760 0.1535 0.1756 -0.0187 0.0055  0.0003  57  MET A CA  
525  C C   . MET B 58  ? 0.1782 0.1515 0.1540 0.0113  -0.0177 0.0031  57  MET A C   
526  O O   . MET B 58  ? 0.2095 0.1837 0.1272 0.0484  0.0266  0.0191  57  MET A O   
527  C CB  A MET B 58  ? 0.2431 0.1884 0.2501 0.0177  -0.0131 -0.0176 57  MET A CB  
528  C CB  B MET B 58  ? 0.2469 0.1692 0.2031 -0.0344 0.0256  -0.0399 57  MET A CB  
529  C CG  A MET B 58  ? 0.3315 0.2349 0.3125 0.0451  -0.0086 -0.0179 57  MET A CG  
530  C CG  B MET B 58  ? 0.3547 0.2060 0.2582 -0.0290 0.0615  -0.0408 57  MET A CG  
531  S SD  A MET B 58  ? 0.4312 0.2688 0.3653 0.0913  -0.0262 -0.0278 57  MET A SD  
532  S SD  B MET B 58  ? 0.4111 0.2288 0.3235 -0.0479 0.1026  -0.0237 57  MET A SD  
533  C CE  A MET B 58  ? 0.4218 0.2662 0.3610 0.0901  -0.0350 -0.0281 57  MET A CE  
534  C CE  B MET B 58  ? 0.2918 0.1424 0.2686 -0.0591 0.1634  -0.0564 57  MET A CE  
535  N N   . LEU B 59  ? 0.1744 0.1333 0.1420 -0.0198 -0.0098 -0.0079 58  LEU A N   
536  C CA  . LEU B 59  ? 0.1919 0.1537 0.1231 0.0046  -0.0067 -0.0055 58  LEU A CA  
537  C C   . LEU B 59  ? 0.1693 0.1694 0.1293 0.0106  0.0038  0.0007  58  LEU A C   
538  O O   . LEU B 59  ? 0.1925 0.1667 0.1478 -0.0052 -0.0016 -0.0211 58  LEU A O   
539  C CB  . LEU B 59  ? 0.2648 0.1797 0.1040 0.0015  0.0124  0.0061  58  LEU A CB  
540  C CG  . LEU B 59  ? 0.3242 0.1947 0.1277 -0.0244 0.0341  -0.0097 58  LEU A CG  
541  C CD1 . LEU B 59  ? 0.3587 0.1848 0.1567 -0.0425 0.0439  -0.0295 58  LEU A CD1 
542  C CD2 . LEU B 59  ? 0.3455 0.2098 0.1282 -0.0344 0.0416  0.0287  58  LEU A CD2 
543  N N   . ALA B 60  ? 0.1942 0.1877 0.1262 -0.0128 -0.0077 -0.0310 59  ALA A N   
544  C CA  . ALA B 60  ? 0.1847 0.2130 0.1438 -0.0187 -0.0021 -0.0235 59  ALA A CA  
545  C C   . ALA B 60  ? 0.1825 0.1970 0.1478 -0.0217 -0.0222 -0.0422 59  ALA A C   
546  O O   . ALA B 60  ? 0.1878 0.1821 0.1489 -0.0120 -0.0153 -0.0404 59  ALA A O   
547  C CB  . ALA B 60  ? 0.1776 0.2547 0.1498 -0.0187 0.0032  -0.0417 59  ALA A CB  
548  N N   . THR B 61  ? 0.2149 0.2060 0.1513 -0.0142 -0.0285 -0.0458 60  THR A N   
549  C CA  A THR B 61  ? 0.2176 0.2054 0.1616 -0.0152 -0.0454 -0.0632 60  THR A CA  
550  C CA  B THR B 61  ? 0.2094 0.2050 0.1516 -0.0142 -0.0326 -0.0590 60  THR A CA  
551  C C   . THR B 61  ? 0.1852 0.2005 0.1525 -0.0249 -0.0344 -0.0661 60  THR A C   
552  O O   . THR B 61  ? 0.1890 0.2078 0.1478 -0.0285 -0.0333 -0.0526 60  THR A O   
553  C CB  A THR B 61  ? 0.2806 0.2174 0.2017 -0.0180 -0.0500 -0.0670 60  THR A CB  
554  C CB  B THR B 61  ? 0.2320 0.2086 0.1526 -0.0028 -0.0291 -0.0635 60  THR A CB  
555  O OG1 A THR B 61  ? 0.3002 0.2305 0.2263 -0.0569 -0.0432 -0.0531 60  THR A OG1 
556  O OG1 B THR B 61  ? 0.2379 0.2071 0.1498 0.0057  -0.0201 -0.0648 60  THR A OG1 
557  C CG2 A THR B 61  ? 0.3109 0.2039 0.2219 0.0075  -0.0418 -0.0632 60  THR A CG2 
558  C CG2 B THR B 61  ? 0.2413 0.2114 0.1576 -0.0039 -0.0308 -0.0598 60  THR A CG2 
559  N N   . GLN B 62  ? 0.1490 0.2115 0.1830 -0.0227 -0.0241 -0.0464 61  GLN A N   
560  C CA  . GLN B 62  ? 0.1460 0.2456 0.2223 -0.0188 -0.0081 -0.0286 61  GLN A CA  
561  C C   . GLN B 62  ? 0.1760 0.2309 0.2145 -0.0069 -0.0176 -0.0290 61  GLN A C   
562  O O   . GLN B 62  ? 0.2161 0.2532 0.2518 0.0171  -0.0234 -0.0020 61  GLN A O   
563  C CB  . GLN B 62  ? 0.1445 0.3063 0.2473 -0.0162 -0.0063 -0.0358 61  GLN A CB  
564  C CG  . GLN B 62  ? 0.2107 0.3717 0.2714 -0.0187 0.0109  -0.0737 61  GLN A CG  
565  C CD  . GLN B 62  ? 0.2626 0.4390 0.2982 -0.0298 -0.0062 -0.0898 61  GLN A CD  
566  O OE1 . GLN B 62  ? 0.3106 0.4675 0.3180 -0.0432 0.0053  -0.0932 61  GLN A OE1 
567  N NE2 . GLN B 62  ? 0.3114 0.4545 0.2960 -0.0329 -0.0106 -0.0912 61  GLN A NE2 
568  N N   . LEU B 63  ? 0.1852 0.1907 0.1797 -0.0237 0.0033  -0.0609 62  LEU A N   
569  C CA  . LEU B 63  ? 0.1938 0.1679 0.1586 -0.0344 0.0146  -0.0731 62  LEU A CA  
570  C C   . LEU B 63  ? 0.1887 0.1560 0.1472 -0.0081 0.0092  -0.0540 62  LEU A C   
571  O O   . LEU B 63  ? 0.2071 0.1441 0.1456 -0.0076 0.0104  -0.0323 62  LEU A O   
572  C CB  . LEU B 63  ? 0.2306 0.1952 0.1707 -0.0593 0.0401  -0.0772 62  LEU A CB  
573  C CG  . LEU B 63  ? 0.2885 0.2262 0.1996 -0.0513 0.0741  -0.0771 62  LEU A CG  
574  C CD1 . LEU B 63  ? 0.3079 0.2489 0.2218 -0.0891 0.0709  -0.0771 62  LEU A CD1 
575  C CD2 . LEU B 63  ? 0.3095 0.2440 0.2248 -0.0385 0.0848  -0.0729 62  LEU A CD2 
576  N N   . ASN B 64  ? 0.1827 0.1563 0.1401 0.0123  0.0045  -0.0423 63  ASN A N   
577  C CA  . ASN B 64  ? 0.1899 0.1411 0.1445 -0.0002 0.0112  -0.0336 63  ASN A CA  
578  C C   . ASN B 64  ? 0.1879 0.1449 0.1324 0.0090  -0.0090 -0.0139 63  ASN A C   
579  O O   . ASN B 64  ? 0.1836 0.1499 0.1237 0.0224  0.0057  -0.0133 63  ASN A O   
580  C CB  . ASN B 64  ? 0.2075 0.1435 0.1527 -0.0064 -0.0067 -0.0489 63  ASN A CB  
581  C CG  . ASN B 64  ? 0.1940 0.1609 0.1581 -0.0059 -0.0013 -0.0433 63  ASN A CG  
582  O OD1 . ASN B 64  ? 0.1904 0.1543 0.1726 0.0037  0.0075  -0.0370 63  ASN A OD1 
583  N ND2 . ASN B 64  ? 0.2223 0.1730 0.1622 -0.0308 0.0137  -0.0447 63  ASN A ND2 
584  N N   . PRO B 65  ? 0.1912 0.1578 0.1508 0.0374  -0.0180 -0.0279 64  PRO A N   
585  C CA  . PRO B 65  ? 0.2137 0.1623 0.1791 0.0449  -0.0270 0.0020  64  PRO A CA  
586  C C   . PRO B 65  ? 0.1894 0.1593 0.1680 0.0360  -0.0209 -0.0167 64  PRO A C   
587  O O   . PRO B 65  ? 0.1949 0.1763 0.1826 0.0435  0.0022  0.0101  64  PRO A O   
588  C CB  . PRO B 65  ? 0.2094 0.1793 0.2156 0.0232  -0.0362 0.0003  64  PRO A CB  
589  C CG  . PRO B 65  ? 0.2188 0.1978 0.2179 0.0141  -0.0439 0.0078  64  PRO A CG  
590  C CD  . PRO B 65  ? 0.2067 0.1885 0.1787 0.0221  -0.0363 -0.0215 64  PRO A CD  
591  N N   . LEU B 66  ? 0.1706 0.1639 0.1631 0.0264  0.0047  -0.0382 65  LEU A N   
592  C CA  A LEU B 66  ? 0.1856 0.1621 0.1648 0.0138  0.0006  -0.0286 65  LEU A CA  
593  C CA  B LEU B 66  ? 0.1634 0.1635 0.1666 0.0097  -0.0044 -0.0348 65  LEU A CA  
594  C C   . LEU B 66  ? 0.1856 0.1582 0.1556 0.0091  -0.0096 -0.0100 65  LEU A C   
595  O O   . LEU B 66  ? 0.1824 0.1470 0.1739 0.0051  -0.0031 0.0057  65  LEU A O   
596  C CB  A LEU B 66  ? 0.2178 0.1869 0.1706 0.0110  0.0094  -0.0317 65  LEU A CB  
597  C CB  B LEU B 66  ? 0.1497 0.1835 0.1772 0.0008  -0.0072 -0.0512 65  LEU A CB  
598  C CG  A LEU B 66  ? 0.2445 0.2022 0.1749 0.0130  0.0240  -0.0152 65  LEU A CG  
599  C CG  B LEU B 66  ? 0.1341 0.1987 0.1848 0.0057  -0.0015 -0.0565 65  LEU A CG  
600  C CD1 A LEU B 66  ? 0.2768 0.2090 0.1795 -0.0155 0.0302  -0.0166 65  LEU A CD1 
601  C CD1 B LEU B 66  ? 0.1170 0.2038 0.1964 0.0037  0.0100  -0.0416 65  LEU A CD1 
602  C CD2 A LEU B 66  ? 0.2658 0.2258 0.1849 0.0306  0.0152  0.0000  65  LEU A CD2 
603  C CD2 B LEU B 66  ? 0.1724 0.2005 0.1883 0.0179  -0.0063 -0.0794 65  LEU A CD2 
604  N N   . VAL B 67  ? 0.1769 0.1562 0.1368 0.0246  -0.0017 -0.0069 66  VAL A N   
605  C CA  . VAL B 67  ? 0.1784 0.1499 0.1526 0.0248  -0.0071 0.0001  66  VAL A CA  
606  C C   . VAL B 67  ? 0.2037 0.1506 0.1521 0.0271  -0.0048 -0.0030 66  VAL A C   
607  O O   . VAL B 67  ? 0.2010 0.1481 0.1661 0.0093  0.0143  0.0097  66  VAL A O   
608  C CB  . VAL B 67  ? 0.1899 0.1579 0.1563 0.0326  -0.0097 -0.0013 66  VAL A CB  
609  C CG1 . VAL B 67  ? 0.1927 0.1753 0.1672 0.0431  -0.0018 0.0023  66  VAL A CG1 
610  C CG2 . VAL B 67  ? 0.2488 0.1575 0.1587 0.0344  0.0088  0.0053  66  VAL A CG2 
611  N N   . GLU B 68  ? 0.2227 0.1663 0.1291 0.0429  0.0172  -0.0180 67  GLU A N   
612  C CA  . GLU B 68  ? 0.2706 0.1912 0.1271 0.0512  0.0097  -0.0190 67  GLU A CA  
613  C C   . GLU B 68  ? 0.2442 0.1924 0.1334 0.0724  0.0063  -0.0003 67  GLU A C   
614  O O   . GLU B 68  ? 0.2719 0.2012 0.1267 0.0730  0.0394  0.0081  67  GLU A O   
615  C CB  . GLU B 68  ? 0.2861 0.2099 0.1559 0.0469  -0.0151 -0.0206 67  GLU A CB  
616  C CG  . GLU B 68  ? 0.3155 0.2185 0.1829 0.0399  -0.0244 -0.0236 67  GLU A CG  
617  C CD  . GLU B 68  ? 0.3288 0.2612 0.1957 0.0109  -0.0807 -0.0149 67  GLU A CD  
618  O OE1 . GLU B 68  ? 0.3488 0.2795 0.2412 -0.0200 -0.1153 0.0014  67  GLU A OE1 
619  O OE2 . GLU B 68  ? 0.3342 0.2845 0.1916 0.0173  -0.0765 -0.0285 67  GLU A OE2 
620  N N   . GLU B 69  ? 0.2049 0.1796 0.1338 0.0534  0.0034  0.0020  68  GLU A N   
621  C CA  . GLU B 69  ? 0.2254 0.1937 0.1504 0.0455  -0.0064 0.0195  68  GLU A CA  
622  C C   . GLU B 69  ? 0.2088 0.1793 0.1628 0.0479  0.0029  0.0163  68  GLU A C   
623  O O   . GLU B 69  ? 0.2509 0.1848 0.1532 0.0293  -0.0173 0.0282  68  GLU A O   
624  C CB  . GLU B 69  ? 0.2439 0.2049 0.1791 0.0596  -0.0221 -0.0070 68  GLU A CB  
625  C CG  . GLU B 69  ? 0.2592 0.2287 0.2354 0.0796  -0.0521 -0.0198 68  GLU A CG  
626  C CD  . GLU B 69  ? 0.2808 0.2322 0.2838 0.1062  -0.0500 -0.0262 68  GLU A CD  
627  O OE1 . GLU B 69  ? 0.3272 0.2398 0.3196 0.1179  -0.0663 -0.0001 68  GLU A OE1 
628  O OE2 . GLU B 69  ? 0.2704 0.2481 0.2933 0.0922  -0.0460 -0.0329 68  GLU A OE2 
629  N N   . GLU B 70  ? 0.2168 0.1969 0.1963 0.0171  -0.0216 0.0293  69  GLU A N   
630  C CA  . GLU B 70  ? 0.1988 0.2225 0.2463 0.0078  -0.0072 0.0352  69  GLU A CA  
631  C C   . GLU B 70  ? 0.2013 0.2495 0.2546 -0.0138 -0.0105 -0.0039 69  GLU A C   
632  O O   . GLU B 70  ? 0.2229 0.3074 0.3151 -0.0301 0.0271  -0.0561 69  GLU A O   
633  C CB  . GLU B 70  ? 0.2500 0.2704 0.3010 -0.0007 0.0314  0.0478  69  GLU A CB  
634  C CG  . GLU B 70  ? 0.3118 0.3444 0.3584 0.0100  0.0600  0.0633  69  GLU A CG  
635  C CD  . GLU B 70  ? 0.3779 0.4315 0.4248 0.0135  0.0644  0.0655  69  GLU A CD  
636  O OE1 . GLU B 70  ? 0.4217 0.4645 0.4575 0.0025  0.0576  0.0671  69  GLU A OE1 
637  O OE2 . GLU B 70  ? 0.4080 0.4654 0.4490 0.0116  0.0766  0.0603  69  GLU A OE2 
638  N N   . GLN B 71  ? 0.2085 0.2185 0.1868 -0.0139 -0.0024 0.0415  70  GLN A N   
639  C CA  . GLN B 71  ? 0.2045 0.2551 0.1956 0.0089  0.0148  0.0329  70  GLN A CA  
640  C C   . GLN B 71  ? 0.2390 0.2217 0.1683 -0.0229 -0.0014 0.0095  70  GLN A C   
641  O O   . GLN B 71  ? 0.3186 0.2313 0.1680 -0.0362 0.0355  -0.0196 70  GLN A O   
642  C CB  . GLN B 71  ? 0.2285 0.3362 0.2748 0.0490  0.0221  0.0725  70  GLN A CB  
643  C CG  . GLN B 71  ? 0.3078 0.4329 0.3342 0.0931  0.0243  0.0843  70  GLN A CG  
644  C CD  . GLN B 71  ? 0.3809 0.5041 0.3775 0.1460  0.0174  0.0879  70  GLN A CD  
645  O OE1 . GLN B 71  ? 0.4002 0.5381 0.3929 0.1521  0.0064  0.0800  70  GLN A OE1 
646  N NE2 . GLN B 71  ? 0.4061 0.5250 0.4021 0.1641  0.0217  0.0964  70  GLN A NE2 
647  N N   . LEU B 72  ? 0.2583 0.2025 0.1518 -0.0058 -0.0294 0.0037  71  LEU A N   
648  C CA  . LEU B 72  ? 0.2609 0.2053 0.1374 -0.0026 -0.0258 -0.0080 71  LEU A CA  
649  C C   . LEU B 72  ? 0.2565 0.2109 0.1163 -0.0068 -0.0385 -0.0275 71  LEU A C   
650  O O   . LEU B 72  ? 0.2600 0.2134 0.1274 -0.0008 -0.0327 -0.0241 71  LEU A O   
651  C CB  . LEU B 72  ? 0.2554 0.2246 0.1739 0.0087  -0.0333 -0.0022 71  LEU A CB  
652  C CG  . LEU B 72  ? 0.2792 0.2400 0.1874 0.0208  -0.0161 -0.0015 71  LEU A CG  
653  C CD1 . LEU B 72  ? 0.2927 0.2552 0.2027 0.0159  -0.0278 0.0112  71  LEU A CD1 
654  C CD2 . LEU B 72  ? 0.3046 0.2295 0.2076 0.0253  0.0044  0.0001  71  LEU A CD2 
655  N N   . SER B 73  ? 0.2402 0.2080 0.1345 0.0015  -0.0159 -0.0120 72  SER A N   
656  C CA  A SER B 73  ? 0.2476 0.2168 0.1356 0.0051  0.0009  0.0161  72  SER A CA  
657  C CA  B SER B 73  ? 0.2394 0.2287 0.1385 0.0061  -0.0086 0.0107  72  SER A CA  
658  C C   . SER B 73  ? 0.2119 0.1989 0.1308 0.0112  0.0069  0.0094  72  SER A C   
659  O O   . SER B 73  ? 0.1992 0.2029 0.1118 -0.0054 0.0079  -0.0014 72  SER A O   
660  C CB  A SER B 73  ? 0.3159 0.2276 0.1500 0.0171  -0.0119 0.0350  72  SER A CB  
661  C CB  B SER B 73  ? 0.2855 0.2715 0.1574 0.0153  -0.0337 0.0229  72  SER A CB  
662  O OG  A SER B 73  ? 0.3387 0.2185 0.1594 0.0087  -0.0201 0.0393  72  SER A OG  
663  O OG  B SER B 73  ? 0.2988 0.3036 0.1671 0.0194  -0.0564 0.0209  72  SER A OG  
664  N N   . SER B 74  ? 0.2217 0.1689 0.1348 0.0000  -0.0002 0.0230  73  SER A N   
665  C CA  A SER B 74  ? 0.2179 0.1633 0.1445 0.0232  0.0071  0.0136  73  SER A CA  
666  C CA  B SER B 74  ? 0.2038 0.1585 0.1480 0.0023  0.0110  0.0246  73  SER A CA  
667  C C   . SER B 74  ? 0.1913 0.1370 0.1273 -0.0116 0.0280  0.0485  73  SER A C   
668  O O   . SER B 74  ? 0.2011 0.1542 0.1421 -0.0068 0.0305  0.0442  73  SER A O   
669  C CB  A SER B 74  ? 0.2510 0.2062 0.1581 0.0478  0.0075  -0.0047 73  SER A CB  
670  C CB  B SER B 74  ? 0.2026 0.1778 0.1728 0.0016  0.0121  0.0154  73  SER A CB  
671  O OG  A SER B 74  ? 0.3077 0.2317 0.1695 0.0582  -0.0073 0.0053  73  SER A OG  
672  O OG  B SER B 74  ? 0.2136 0.1862 0.1957 -0.0066 0.0100  0.0188  73  SER A OG  
673  N N   . ASN B 75  ? 0.1823 0.1406 0.1171 0.0257  0.0234  0.0303  74  ASN A N   
674  C CA  . ASN B 75  ? 0.1822 0.1587 0.1274 -0.0084 0.0149  0.0367  74  ASN A CA  
675  C C   . ASN B 75  ? 0.1648 0.1331 0.1076 0.0041  0.0096  0.0399  74  ASN A C   
676  O O   . ASN B 75  ? 0.2025 0.1242 0.0945 0.0065  0.0053  0.0220  74  ASN A O   
677  C CB  . ASN B 75  ? 0.1759 0.1914 0.1780 -0.0117 0.0109  0.0201  74  ASN A CB  
678  C CG  . ASN B 75  ? 0.1996 0.2450 0.2331 -0.0119 0.0125  0.0162  74  ASN A CG  
679  O OD1 . ASN B 75  ? 0.1914 0.2879 0.2463 0.0086  -0.0154 -0.0046 74  ASN A OD1 
680  N ND2 . ASN B 75  ? 0.2173 0.2623 0.2630 -0.0476 0.0386  0.0202  74  ASN A ND2 
681  N N   . CYS B 76  ? 0.1642 0.1338 0.1061 0.0139  0.0083  0.0325  75  CYS A N   
682  C CA  . CYS B 76  ? 0.1505 0.1397 0.0856 0.0150  0.0091  0.0208  75  CYS A CA  
683  C C   . CYS B 76  ? 0.1641 0.1105 0.0955 0.0013  0.0019  0.0314  75  CYS A C   
684  O O   . CYS B 76  ? 0.1787 0.0986 0.1124 0.0144  0.0005  0.0204  75  CYS A O   
685  C CB  . CYS B 76  ? 0.1861 0.1641 0.1100 -0.0196 0.0001  0.0283  75  CYS A CB  
686  S SG  . CYS B 76  ? 0.2237 0.1789 0.1349 -0.0047 0.0003  0.0440  75  CYS A SG  
687  N N   . VAL B 77  ? 0.1602 0.1250 0.1131 0.0053  0.0129  0.0231  76  VAL A N   
688  C CA  . VAL B 77  ? 0.1533 0.1366 0.1046 0.0047  0.0151  0.0228  76  VAL A CA  
689  C C   . VAL B 77  ? 0.1570 0.1340 0.1140 0.0115  0.0056  0.0180  76  VAL A C   
690  O O   . VAL B 77  ? 0.1699 0.1258 0.1466 0.0203  -0.0014 0.0259  76  VAL A O   
691  C CB  . VAL B 77  ? 0.1745 0.1532 0.1278 -0.0096 0.0216  0.0052  76  VAL A CB  
692  C CG1 . VAL B 77  ? 0.1955 0.1640 0.1360 -0.0122 0.0376  0.0157  76  VAL A CG1 
693  C CG2 . VAL B 77  ? 0.1692 0.1755 0.1503 -0.0241 0.0098  0.0219  76  VAL A CG2 
694  N N   A CYS B 78  ? 0.1554 0.1247 0.1090 -0.0113 0.0111  0.0184  77  CYS A N   
695  N N   B CYS B 78  ? 0.1634 0.1370 0.1057 -0.0216 0.0219  0.0181  77  CYS A N   
696  C CA  A CYS B 78  ? 0.1675 0.1207 0.1030 -0.0022 0.0010  0.0037  77  CYS A CA  
697  C CA  B CYS B 78  ? 0.1860 0.1458 0.0969 -0.0167 0.0148  0.0067  77  CYS A CA  
698  C C   A CYS B 78  ? 0.1437 0.1177 0.0964 0.0005  -0.0184 0.0172  77  CYS A C   
699  C C   B CYS B 78  ? 0.1654 0.1356 0.0914 -0.0023 -0.0014 0.0160  77  CYS A C   
700  O O   A CYS B 78  ? 0.1559 0.1314 0.1044 0.0139  -0.0146 0.0129  77  CYS A O   
701  O O   B CYS B 78  ? 0.1933 0.1552 0.0982 0.0244  0.0119  0.0155  77  CYS A O   
702  C CB  A CYS B 78  ? 0.2082 0.1269 0.1324 0.0137  -0.0024 -0.0054 77  CYS A CB  
703  C CB  B CYS B 78  ? 0.2400 0.1790 0.1227 -0.0163 0.0125  0.0049  77  CYS A CB  
704  S SG  A CYS B 78  ? 0.2126 0.1074 0.1565 0.0114  0.0014  -0.0015 77  CYS A SG  
705  S SG  B CYS B 78  ? 0.2914 0.2068 0.1313 0.0074  0.0330  0.0097  77  CYS A SG  
706  N N   . GLN B 79  ? 0.1503 0.1161 0.1121 -0.0059 0.0061  0.0325  78  GLN A N   
707  C CA  . GLN B 79  ? 0.1661 0.1085 0.1117 -0.0178 0.0051  0.0117  78  GLN A CA  
708  C C   . GLN B 79  ? 0.1676 0.1067 0.0863 -0.0197 -0.0059 0.0096  78  GLN A C   
709  O O   . GLN B 79  ? 0.1707 0.1281 0.0981 -0.0240 -0.0112 0.0133  78  GLN A O   
710  C CB  . GLN B 79  ? 0.2003 0.1058 0.1305 -0.0060 0.0198  0.0146  78  GLN A CB  
711  C CG  . GLN B 79  ? 0.2060 0.1154 0.1212 -0.0033 0.0434  0.0119  78  GLN A CG  
712  C CD  . GLN B 79  ? 0.2345 0.1162 0.1452 0.0342  0.0190  0.0150  78  GLN A CD  
713  O OE1 . GLN B 79  ? 0.3308 0.1459 0.1913 0.0585  0.0050  0.0191  78  GLN A OE1 
714  N NE2 . GLN B 79  ? 0.2449 0.1516 0.1580 0.0150  0.0373  -0.0021 78  GLN A NE2 
715  N N   . ILE B 80  ? 0.1722 0.0994 0.0864 -0.0168 0.0047  0.0195  79  ILE A N   
716  C CA  . ILE B 80  ? 0.1619 0.1029 0.1084 -0.0110 -0.0025 0.0024  79  ILE A CA  
717  C C   . ILE B 80  ? 0.1649 0.1268 0.0975 -0.0100 0.0048  -0.0053 79  ILE A C   
718  O O   . ILE B 80  ? 0.1922 0.2173 0.1027 -0.0136 0.0076  -0.0131 79  ILE A O   
719  C CB  . ILE B 80  ? 0.1743 0.1009 0.1355 -0.0067 0.0072  0.0071  79  ILE A CB  
720  C CG1 . ILE B 80  ? 0.1793 0.1423 0.1307 0.0113  0.0001  0.0050  79  ILE A CG1 
721  C CG2 . ILE B 80  ? 0.2238 0.1079 0.1625 -0.0118 -0.0120 0.0005  79  ILE A CG2 
722  C CD1 . ILE B 80  ? 0.2123 0.1820 0.1391 -0.0054 0.0103  0.0179  79  ILE A CD1 
723  N N   . HIS B 81  ? 0.1478 0.1082 0.1349 0.0160  -0.0026 0.0168  80  HIS A N   
724  C CA  . HIS B 81  ? 0.1566 0.1120 0.1596 0.0054  -0.0040 0.0121  80  HIS A CA  
725  C C   . HIS B 81  ? 0.1931 0.1361 0.1776 0.0054  0.0140  -0.0011 80  HIS A C   
726  O O   . HIS B 81  ? 0.2205 0.1692 0.2402 0.0239  0.0706  0.0021  80  HIS A O   
727  C CB  . HIS B 81  ? 0.1979 0.1296 0.1687 0.0182  -0.0107 0.0169  80  HIS A CB  
728  C CG  . HIS B 81  ? 0.2229 0.1400 0.2057 0.0512  -0.0096 0.0113  80  HIS A CG  
729  N ND1 . HIS B 81  ? 0.3143 0.1487 0.2267 0.0392  0.0073  -0.0075 80  HIS A ND1 
730  C CD2 . HIS B 81  ? 0.2313 0.1386 0.2589 0.0421  -0.0177 -0.0048 80  HIS A CD2 
731  C CE1 . HIS B 81  ? 0.3194 0.1523 0.2604 0.0189  -0.0213 -0.0151 80  HIS A CE1 
732  N NE2 . HIS B 81  ? 0.2477 0.1410 0.2717 0.0382  -0.0267 -0.0140 80  HIS A NE2 
733  N N   . ARG B 82  ? 0.1783 0.1136 0.1463 -0.0055 0.0120  0.0116  81  ARG A N   
734  C CA  . ARG B 82  ? 0.1805 0.1248 0.1817 0.0059  0.0125  0.0158  81  ARG A CA  
735  C C   . ARG B 82  ? 0.1655 0.1160 0.1625 0.0065  0.0169  0.0039  81  ARG A C   
736  O O   . ARG B 82  ? 0.1737 0.1331 0.1475 0.0149  0.0227  0.0072  81  ARG A O   
737  C CB  . ARG B 82  ? 0.1809 0.1590 0.2300 -0.0170 0.0096  0.0106  81  ARG A CB  
738  C CG  . ARG B 82  ? 0.2202 0.2352 0.2896 -0.0717 -0.0166 0.0078  81  ARG A CG  
739  C CD  . ARG B 82  ? 0.2659 0.3297 0.3500 -0.0958 -0.0243 -0.0016 81  ARG A CD  
740  N NE  . ARG B 82  ? 0.3007 0.4113 0.3947 -0.1145 -0.0307 -0.0276 81  ARG A NE  
741  C CZ  . ARG B 82  ? 0.3422 0.4815 0.4307 -0.1198 -0.0454 -0.0507 81  ARG A CZ  
742  N NH1 . ARG B 82  ? 0.3434 0.5098 0.4373 -0.1110 -0.0625 -0.0708 81  ARG A NH1 
743  N NH2 . ARG B 82  ? 0.3653 0.4955 0.4458 -0.1239 -0.0418 -0.0529 81  ARG A NH2 
744  N N   . PHE B 83  ? 0.1986 0.1019 0.1493 0.0130  0.0167  0.0220  82  PHE A N   
745  C CA  . PHE B 83  ? 0.1833 0.0917 0.1545 -0.0033 0.0247  0.0282  82  PHE A CA  
746  C C   . PHE B 83  ? 0.1812 0.1061 0.1654 -0.0142 0.0182  0.0155  82  PHE A C   
747  O O   . PHE B 83  ? 0.1865 0.1166 0.1757 0.0002  0.0302  0.0278  82  PHE A O   
748  C CB  . PHE B 83  ? 0.1716 0.1264 0.1714 -0.0200 0.0177  -0.0117 82  PHE A CB  
749  C CG  . PHE B 83  ? 0.1751 0.1379 0.1678 -0.0108 0.0186  -0.0110 82  PHE A CG  
750  C CD1 . PHE B 83  ? 0.1941 0.1684 0.1555 -0.0050 0.0260  -0.0211 82  PHE A CD1 
751  C CD2 . PHE B 83  ? 0.2023 0.1738 0.1808 0.0376  0.0026  0.0082  82  PHE A CD2 
752  C CE1 . PHE B 83  ? 0.1998 0.1962 0.1870 -0.0007 0.0177  -0.0255 82  PHE A CE1 
753  C CE2 . PHE B 83  ? 0.2343 0.1897 0.1959 0.0487  -0.0352 -0.0117 82  PHE A CE2 
754  C CZ  . PHE B 83  ? 0.2284 0.1994 0.1875 0.0189  -0.0192 -0.0278 82  PHE A CZ  
755  N N   . ILE B 84  ? 0.1866 0.1004 0.2039 -0.0116 0.0216  0.0246  83  ILE A N   
756  C CA  . ILE B 84  ? 0.2089 0.1280 0.2594 -0.0101 0.0323  0.0416  83  ILE A CA  
757  C C   . ILE B 84  ? 0.1885 0.1250 0.2322 -0.0052 0.0663  0.0567  83  ILE A C   
758  O O   . ILE B 84  ? 0.2291 0.1957 0.2460 0.0321  0.0698  0.1151  83  ILE A O   
759  C CB  . ILE B 84  ? 0.2264 0.1604 0.3421 -0.0289 0.0224  0.0295  83  ILE A CB  
760  C CG1 . ILE B 84  ? 0.2766 0.1966 0.3741 -0.0546 -0.0085 0.0248  83  ILE A CG1 
761  C CG2 . ILE B 84  ? 0.2362 0.1839 0.3684 0.0010  -0.0037 -0.0040 83  ILE A CG2 
762  C CD1 . ILE B 84  ? 0.3224 0.2234 0.4146 -0.0496 -0.0202 0.0037  83  ILE A CD1 
763  N N   . VAL B 85  ? 0.2170 0.1052 0.2285 0.0043  0.0667  0.0450  84  VAL A N   
764  C CA  . VAL B 85  ? 0.2244 0.1157 0.2176 0.0186  0.0314  0.0389  84  VAL A CA  
765  C C   . VAL B 85  ? 0.2093 0.1032 0.2356 0.0049  0.0329  0.0558  84  VAL A C   
766  O O   . VAL B 85  ? 0.2129 0.1209 0.2906 -0.0024 0.0480  0.0558  84  VAL A O   
767  C CB  . VAL B 85  ? 0.2729 0.1540 0.2047 0.0218  0.0302  0.0221  84  VAL A CB  
768  C CG1 . VAL B 85  ? 0.2834 0.1859 0.2013 0.0348  0.0182  0.0223  84  VAL A CG1 
769  C CG2 . VAL B 85  ? 0.3007 0.1748 0.2253 -0.0104 0.0161  0.0098  84  VAL A CG2 
770  N N   . ASN B 86  ? 0.1949 0.0965 0.2042 -0.0093 -0.0072 0.0414  85  ASN A N   
771  C CA  A ASN B 86  ? 0.2135 0.1285 0.2100 -0.0181 -0.0185 0.0264  85  ASN A CA  
772  C CA  B ASN B 86  ? 0.1939 0.1268 0.2062 -0.0045 -0.0301 0.0299  85  ASN A CA  
773  C C   . ASN B 86  ? 0.1890 0.1230 0.2031 -0.0128 -0.0131 0.0388  85  ASN A C   
774  O O   . ASN B 86  ? 0.2009 0.1472 0.2910 -0.0078 -0.0081 0.0954  85  ASN A O   
775  C CB  A ASN B 86  ? 0.2620 0.1690 0.2182 -0.0404 -0.0248 0.0020  85  ASN A CB  
776  C CB  B ASN B 86  ? 0.2175 0.1784 0.2003 -0.0195 -0.0392 0.0169  85  ASN A CB  
777  C CG  A ASN B 86  ? 0.3032 0.1988 0.2267 -0.0763 -0.0299 -0.0096 85  ASN A CG  
778  C CG  B ASN B 86  ? 0.2578 0.2138 0.2077 -0.0617 -0.0325 0.0314  85  ASN A CG  
779  O OD1 A ASN B 86  ? 0.3159 0.2113 0.2262 -0.1091 -0.0602 -0.0218 85  ASN A OD1 
780  O OD1 B ASN B 86  ? 0.2833 0.2249 0.2191 -0.0925 -0.0324 0.0461  85  ASN A OD1 
781  N ND2 A ASN B 86  ? 0.3327 0.2131 0.2392 -0.0709 -0.0184 -0.0116 85  ASN A ND2 
782  N ND2 B ASN B 86  ? 0.3046 0.2344 0.2421 -0.0709 -0.0186 0.0169  85  ASN A ND2 
783  N N   . THR B 87  ? 0.1804 0.1041 0.1303 -0.0036 0.0057  0.0186  86  THR A N   
784  C CA  . THR B 87  ? 0.1738 0.1126 0.1232 -0.0001 0.0102  0.0105  86  THR A CA  
785  C C   . THR B 87  ? 0.1831 0.1055 0.1361 -0.0342 0.0192  0.0103  86  THR A C   
786  O O   . THR B 87  ? 0.2079 0.1223 0.1411 -0.0236 0.0311  -0.0123 86  THR A O   
787  C CB  . THR B 87  ? 0.2082 0.1168 0.1211 0.0043  0.0173  0.0043  86  THR A CB  
788  O OG1 . THR B 87  ? 0.2057 0.1164 0.1296 -0.0135 0.0098  0.0000  86  THR A OG1 
789  C CG2 . THR B 87  ? 0.2008 0.1209 0.1327 0.0204  0.0000  0.0263  86  THR A CG2 
790  N N   . LEU B 88  ? 0.2034 0.1161 0.1321 -0.0002 0.0224  0.0202  87  LEU A N   
791  C CA  . LEU B 88  ? 0.2400 0.1264 0.1281 0.0090  0.0542  0.0368  87  LEU A CA  
792  C C   . LEU B 88  ? 0.2439 0.1301 0.1155 0.0126  0.0490  0.0147  87  LEU A C   
793  O O   . LEU B 88  ? 0.2343 0.1275 0.1118 0.0086  0.0373  0.0121  87  LEU A O   
794  C CB  . LEU B 88  ? 0.2738 0.1727 0.1466 0.0014  0.0588  0.0519  87  LEU A CB  
795  C CG  . LEU B 88  ? 0.3142 0.2148 0.1596 -0.0332 0.0541  0.0491  87  LEU A CG  
796  C CD1 . LEU B 88  ? 0.3172 0.2244 0.1828 -0.0442 0.0731  0.0488  87  LEU A CD1 
797  C CD2 . LEU B 88  ? 0.3480 0.2291 0.1722 -0.0245 0.0435  0.0486  87  LEU A CD2 
798  N N   . LYS B 89  ? 0.2671 0.1313 0.1379 -0.0021 0.0538  0.0010  88  LYS A N   
799  C CA  . LYS B 89  ? 0.3073 0.1332 0.1460 -0.0040 0.0664  -0.0022 88  LYS A CA  
800  C C   . LYS B 89  ? 0.2963 0.1442 0.1255 0.0421  0.0782  0.0240  88  LYS A C   
801  O O   . LYS B 89  ? 0.3240 0.1489 0.1367 0.0477  0.0818  0.0147  88  LYS A O   
802  C CB  . LYS B 89  ? 0.3591 0.1608 0.1916 -0.0233 0.0585  -0.0301 88  LYS A CB  
803  C CG  . LYS B 89  ? 0.3858 0.2008 0.2113 -0.0285 0.0585  -0.0628 88  LYS A CG  
804  C CD  . LYS B 89  ? 0.4662 0.2569 0.2459 -0.0257 0.0412  -0.0940 88  LYS A CD  
805  C CE  . LYS B 89  ? 0.5257 0.3016 0.2727 -0.0175 0.0370  -0.1197 88  LYS A CE  
806  N NZ  . LYS B 89  ? 0.5700 0.3201 0.2926 -0.0118 0.0187  -0.1167 88  LYS A NZ  
807  N N   . ASP B 90  ? 0.2712 0.1821 0.1222 0.0505  0.0600  0.0049  89  ASP A N   
808  C CA  . ASP B 90  ? 0.2614 0.1838 0.1343 0.0582  0.0682  0.0218  89  ASP A CA  
809  C C   . ASP B 90  ? 0.2288 0.1797 0.1415 0.0436  0.0596  0.0365  89  ASP A C   
810  O O   . ASP B 90  ? 0.2391 0.1926 0.1669 0.0518  0.0566  0.0398  89  ASP A O   
811  C CB  . ASP B 90  ? 0.2996 0.1874 0.1550 0.0484  0.0792  0.0376  89  ASP A CB  
812  C CG  . ASP B 90  ? 0.3248 0.2025 0.1753 0.0495  0.1004  0.0413  89  ASP A CG  
813  O OD1 . ASP B 90  ? 0.3574 0.2120 0.1930 0.0610  0.1075  0.0522  89  ASP A OD1 
814  O OD2 . ASP B 90  ? 0.3412 0.2292 0.1926 0.0252  0.1198  0.0292  89  ASP A OD2 
815  N N   . GLY B 91  ? 0.2173 0.1515 0.1199 0.0392  0.0536  0.0314  90  GLY A N   
816  C CA  . GLY B 91  ? 0.2225 0.1409 0.1274 0.0095  0.0300  0.0313  90  GLY A CA  
817  C C   . GLY B 91  ? 0.1943 0.1464 0.1437 0.0173  0.0390  0.0522  90  GLY A C   
818  O O   . GLY B 91  ? 0.2255 0.1519 0.1828 -0.0083 0.0174  0.0232  90  GLY A O   
819  N N   . ARG B 92  ? 0.2112 0.1589 0.1813 -0.0038 0.0210  0.0773  91  ARG A N   
820  C CA  . ARG B 92  ? 0.2155 0.1731 0.1951 -0.0003 0.0381  0.0641  91  ARG A CA  
821  C C   . ARG B 92  ? 0.2123 0.1600 0.1591 -0.0115 0.0023  0.0278  91  ARG A C   
822  O O   . ARG B 92  ? 0.2230 0.1467 0.1536 0.0096  0.0069  0.0095  91  ARG A O   
823  C CB  . ARG B 92  ? 0.2361 0.1904 0.2351 0.0174  0.0560  0.0833  91  ARG A CB  
824  C CG  . ARG B 92  ? 0.2354 0.1927 0.2712 0.0151  0.0592  0.0702  91  ARG A CG  
825  C CD  . ARG B 92  ? 0.2936 0.2293 0.2950 0.0210  0.0807  0.0478  91  ARG A CD  
826  N NE  . ARG B 92  ? 0.3042 0.2342 0.3111 0.0231  0.0872  0.0358  91  ARG A NE  
827  C CZ  . ARG B 92  ? 0.3173 0.2667 0.3402 0.0160  0.1099  0.0474  91  ARG A CZ  
828  N NH1 . ARG B 92  ? 0.3268 0.2890 0.3535 -0.0037 0.1090  0.0417  91  ARG A NH1 
829  N NH2 . ARG B 92  ? 0.3246 0.2721 0.3427 0.0353  0.1283  0.0503  91  ARG A NH2 
830  N N   . ARG B 93  ? 0.2104 0.1579 0.1586 -0.0190 -0.0130 0.0558  92  ARG A N   
831  C CA  . ARG B 93  ? 0.1791 0.1507 0.1547 -0.0160 0.0080  0.0322  92  ARG A CA  
832  C C   . ARG B 93  ? 0.1825 0.1269 0.1601 -0.0263 0.0185  0.0339  92  ARG A C   
833  O O   . ARG B 93  ? 0.2055 0.1706 0.1835 -0.0477 0.0150  0.0567  92  ARG A O   
834  C CB  . ARG B 93  ? 0.2141 0.1898 0.1603 -0.0171 0.0139  0.0280  92  ARG A CB  
835  C CG  . ARG B 93  ? 0.2293 0.2131 0.1934 -0.0398 0.0191  0.0371  92  ARG A CG  
836  C CD  . ARG B 93  ? 0.2568 0.2247 0.2012 -0.0315 0.0154  0.0224  92  ARG A CD  
837  N NE  . ARG B 93  ? 0.2250 0.2149 0.1847 -0.0221 0.0041  0.0192  92  ARG A NE  
838  C CZ  . ARG B 93  ? 0.2424 0.1716 0.1702 -0.0125 -0.0045 0.0095  92  ARG A CZ  
839  N NH1 . ARG B 93  ? 0.2791 0.1765 0.1721 -0.0334 -0.0408 0.0175  92  ARG A NH1 
840  N NH2 . ARG B 93  ? 0.1985 0.1491 0.1877 -0.0023 0.0037  0.0193  92  ARG A NH2 
841  N N   . VAL B 94  ? 0.1701 0.1123 0.1498 0.0033  0.0022  0.0292  93  VAL A N   
842  C CA  A VAL B 94  ? 0.1967 0.1043 0.1491 0.0151  0.0067  0.0317  93  VAL A CA  
843  C CA  B VAL B 94  ? 0.1791 0.1072 0.1428 0.0126  0.0072  0.0150  93  VAL A CA  
844  C C   . VAL B 94  ? 0.1877 0.0978 0.1537 -0.0053 0.0191  0.0321  93  VAL A C   
845  O O   . VAL B 94  ? 0.1960 0.1125 0.1919 -0.0118 0.0399  0.0317  93  VAL A O   
846  C CB  A VAL B 94  ? 0.2245 0.1180 0.1719 0.0118  0.0033  0.0387  93  VAL A CB  
847  C CB  B VAL B 94  ? 0.1814 0.1206 0.1384 0.0284  0.0050  -0.0102 93  VAL A CB  
848  C CG1 A VAL B 94  ? 0.2304 0.1289 0.1811 0.0156  0.0040  0.0590  93  VAL A CG1 
849  C CG1 B VAL B 94  ? 0.1856 0.1360 0.1498 0.0446  0.0335  -0.0256 93  VAL A CG1 
850  C CG2 A VAL B 94  ? 0.2648 0.1452 0.2060 0.0028  0.0191  0.0288  93  VAL A CG2 
851  C CG2 B VAL B 94  ? 0.1998 0.1284 0.1438 0.0167  -0.0094 -0.0099 93  VAL A CG2 
852  N N   . VAL B 95  ? 0.1768 0.0904 0.1468 0.0108  -0.0050 0.0313  94  VAL A N   
853  C CA  . VAL B 95  ? 0.1643 0.1024 0.1346 0.0118  -0.0025 0.0191  94  VAL A CA  
854  C C   . VAL B 95  ? 0.1512 0.1090 0.1359 -0.0092 -0.0064 0.0178  94  VAL A C   
855  O O   . VAL B 95  ? 0.1828 0.1447 0.1477 -0.0019 0.0216  0.0311  94  VAL A O   
856  C CB  . VAL B 95  ? 0.1805 0.1190 0.1452 0.0036  0.0064  0.0042  94  VAL A CB  
857  C CG1 . VAL B 95  ? 0.1947 0.1417 0.1764 0.0274  0.0326  -0.0112 94  VAL A CG1 
858  C CG2 . VAL B 95  ? 0.2314 0.1518 0.1550 -0.0220 0.0018  0.0066  94  VAL A CG2 
859  N N   . ILE B 96  ? 0.1642 0.1118 0.1389 0.0030  -0.0078 0.0058  95  ILE A N   
860  C CA  . ILE B 96  ? 0.1732 0.1162 0.1390 0.0120  -0.0085 -0.0157 95  ILE A CA  
861  C C   . ILE B 96  ? 0.1690 0.1147 0.1146 0.0028  -0.0028 -0.0008 95  ILE A C   
862  O O   . ILE B 96  ? 0.1907 0.1141 0.1421 0.0030  0.0212  0.0015  95  ILE A O   
863  C CB  . ILE B 96  ? 0.2136 0.1203 0.1753 -0.0015 -0.0244 -0.0256 95  ILE A CB  
864  C CG1 . ILE B 96  ? 0.2796 0.1502 0.2385 -0.0204 -0.0232 -0.0391 95  ILE A CG1 
865  C CG2 . ILE B 96  ? 0.2262 0.1544 0.1951 -0.0101 -0.0638 -0.0271 95  ILE A CG2 
866  C CD1 . ILE B 96  ? 0.3322 0.1861 0.2865 -0.0421 -0.0099 -0.0079 95  ILE A CD1 
867  N N   . LEU B 97  ? 0.1675 0.1185 0.1130 0.0131  0.0055  0.0077  96  LEU A N   
868  C CA  . LEU B 97  ? 0.1537 0.1126 0.1300 -0.0009 0.0046  0.0061  96  LEU A CA  
869  C C   . LEU B 97  ? 0.1749 0.1283 0.1275 -0.0072 -0.0137 0.0017  96  LEU A C   
870  O O   . LEU B 97  ? 0.1923 0.1584 0.1234 0.0015  -0.0060 -0.0167 96  LEU A O   
871  C CB  . LEU B 97  ? 0.1477 0.1361 0.1420 -0.0169 0.0007  0.0172  96  LEU A CB  
872  C CG  . LEU B 97  ? 0.1581 0.1450 0.1414 -0.0073 -0.0186 0.0080  96  LEU A CG  
873  C CD1 . LEU B 97  ? 0.1812 0.1634 0.1750 -0.0231 -0.0052 0.0176  96  LEU A CD1 
874  C CD2 . LEU B 97  ? 0.2079 0.1433 0.1403 0.0273  -0.0297 -0.0007 96  LEU A CD2 
875  N N   . MET B 98  ? 0.1573 0.1332 0.1488 -0.0045 -0.0187 0.0076  97  MET A N   
876  C CA  A MET B 98  ? 0.1629 0.1231 0.1554 -0.0039 -0.0125 0.0022  97  MET A CA  
877  C CA  B MET B 98  ? 0.1606 0.1450 0.1687 -0.0046 -0.0122 0.0117  97  MET A CA  
878  C C   . MET B 98  ? 0.1524 0.1306 0.1480 0.0030  -0.0325 0.0041  97  MET A C   
879  O O   . MET B 98  ? 0.1970 0.1586 0.1541 0.0207  -0.0530 -0.0064 97  MET A O   
880  C CB  A MET B 98  ? 0.2146 0.1182 0.1825 -0.0150 0.0152  -0.0018 97  MET A CB  
881  C CB  B MET B 98  ? 0.1951 0.1737 0.2144 -0.0140 0.0154  0.0202  97  MET A CB  
882  C CG  A MET B 98  ? 0.2603 0.1344 0.2132 -0.0301 0.0205  -0.0122 97  MET A CG  
883  C CG  B MET B 98  ? 0.2281 0.2002 0.2609 -0.0303 0.0302  0.0250  97  MET A CG  
884  S SD  A MET B 98  ? 0.3444 0.1672 0.2327 -0.0246 0.0398  -0.0168 97  MET A SD  
885  S SD  B MET B 98  ? 0.2559 0.2197 0.2975 -0.0324 0.0331  0.0286  97  MET A SD  
886  C CE  A MET B 98  ? 0.3804 0.2048 0.2609 -0.0202 0.0326  -0.0092 97  MET A CE  
887  C CE  B MET B 98  ? 0.2889 0.2377 0.3157 -0.0332 0.0239  0.0223  97  MET A CE  
888  N N   . GLU B 99  ? 0.1674 0.1119 0.1480 -0.0051 -0.0131 0.0088  98  GLU A N   
889  C CA  . GLU B 99  ? 0.1756 0.1282 0.1556 -0.0011 -0.0315 0.0248  98  GLU A CA  
890  C C   . GLU B 99  ? 0.1860 0.1307 0.1295 -0.0115 -0.0370 0.0264  98  GLU A C   
891  O O   . GLU B 99  ? 0.2010 0.1128 0.1212 0.0004  -0.0313 0.0121  98  GLU A O   
892  C CB  . GLU B 99  ? 0.1923 0.1631 0.2308 -0.0020 -0.0143 0.0362  98  GLU A CB  
893  C CG  . GLU B 99  ? 0.2055 0.2283 0.3334 0.0068  0.0136  0.0288  98  GLU A CG  
894  C CD  . GLU B 99  ? 0.2758 0.3005 0.4411 0.0007  0.0433  0.0145  98  GLU A CD  
895  O OE1 . GLU B 99  ? 0.3113 0.3220 0.4868 0.0179  0.0685  0.0153  98  GLU A OE1 
896  O OE2 . GLU B 99  ? 0.3242 0.3527 0.4846 0.0035  0.0551  0.0135  98  GLU A OE2 
897  N N   . LEU B 100 ? 0.2300 0.1332 0.1291 -0.0186 -0.0482 0.0174  99  LEU A N   
898  C CA  . LEU B 100 ? 0.2700 0.1559 0.1429 -0.0463 -0.0430 0.0449  99  LEU A CA  
899  C C   . LEU B 100 ? 0.2766 0.1630 0.1420 -0.0448 -0.0590 0.0628  99  LEU A C   
900  O O   . LEU B 100 ? 0.3506 0.1819 0.1886 -0.0508 -0.1043 0.0549  99  LEU A O   
901  C CB  . LEU B 100 ? 0.2943 0.1659 0.1653 -0.0348 0.0142  0.0159  99  LEU A CB  
902  C CG  . LEU B 100 ? 0.3178 0.1727 0.1510 0.0020  0.0363  0.0075  99  LEU A CG  
903  C CD1 . LEU B 100 ? 0.3417 0.1920 0.1449 -0.0256 0.0342  0.0254  99  LEU A CD1 
904  C CD2 . LEU B 100 ? 0.3522 0.1723 0.1949 0.0301  0.0171  0.0046  99  LEU A CD2 
905  N N   . GLU B 101 ? 0.1953 0.1523 0.1336 -0.0416 -0.0216 0.0557  100 GLU A N   
906  C CA  . GLU B 101 ? 0.1915 0.1643 0.1533 -0.0076 0.0108  0.0569  100 GLU A CA  
907  C C   . GLU B 101 ? 0.1737 0.1377 0.1357 -0.0109 -0.0091 0.0590  100 GLU A C   
908  O O   . GLU B 101 ? 0.2074 0.1650 0.1365 -0.0356 -0.0216 0.0670  100 GLU A O   
909  C CB  . GLU B 101 ? 0.2151 0.2437 0.2271 0.0195  0.0320  0.0246  100 GLU A CB  
910  C CG  . GLU B 101 ? 0.2898 0.3120 0.2968 0.0360  0.0316  0.0239  100 GLU A CG  
911  C CD  . GLU B 101 ? 0.3487 0.3649 0.3360 0.0650  0.0381  0.0225  100 GLU A CD  
912  O OE1 . GLU B 101 ? 0.3340 0.3593 0.3485 0.1369  0.0061  0.0404  100 GLU A OE1 
913  O OE2 . GLU B 101 ? 0.3872 0.4036 0.3473 0.0525  0.0594  0.0104  100 GLU A OE2 
914  N N   . VAL B 102 ? 0.1692 0.1286 0.1316 -0.0084 0.0119  0.0308  101 VAL A N   
915  C CA  . VAL B 102 ? 0.1694 0.1393 0.1267 -0.0010 -0.0021 0.0354  101 VAL A CA  
916  C C   . VAL B 102 ? 0.1905 0.1158 0.1685 -0.0002 -0.0274 0.0496  101 VAL A C   
917  O O   . VAL B 102 ? 0.2535 0.1464 0.2072 0.0150  -0.0532 0.0530  101 VAL A O   
918  C CB  . VAL B 102 ? 0.1805 0.1778 0.1365 -0.0090 0.0191  0.0307  101 VAL A CB  
919  C CG1 . VAL B 102 ? 0.2074 0.2236 0.1514 -0.0391 0.0150  0.0550  101 VAL A CG1 
920  C CG2 . VAL B 102 ? 0.2056 0.1865 0.1587 0.0359  0.0256  0.0172  101 VAL A CG2 
921  N N   . LEU B 103 ? 0.1813 0.1087 0.1588 0.0037  -0.0001 0.0290  102 LEU A N   
922  C CA  . LEU B 103 ? 0.1812 0.1115 0.1898 0.0066  0.0125  0.0238  102 LEU A CA  
923  C C   . LEU B 103 ? 0.1960 0.1056 0.1810 0.0014  0.0155  0.0442  102 LEU A C   
924  O O   . LEU B 103 ? 0.2437 0.1205 0.2020 -0.0056 0.0302  0.0478  102 LEU A O   
925  C CB  . LEU B 103 ? 0.1794 0.1423 0.1960 -0.0054 0.0111  0.0312  102 LEU A CB  
926  C CG  . LEU B 103 ? 0.1939 0.1545 0.1831 -0.0159 0.0237  0.0363  102 LEU A CG  
927  C CD1 . LEU B 103 ? 0.2284 0.1642 0.1734 0.0075  0.0134  0.0393  102 LEU A CD1 
928  C CD2 . LEU B 103 ? 0.2134 0.2078 0.2331 -0.0069 0.0465  0.0397  102 LEU A CD2 
929  N N   . LYS B 104 ? 0.1909 0.1312 0.1861 -0.0129 0.0378  0.0390  103 LYS A N   
930  C CA  . LYS B 104 ? 0.1776 0.1436 0.1919 -0.0274 0.0143  0.0416  103 LYS A CA  
931  C C   . LYS B 104 ? 0.1840 0.1248 0.1555 -0.0100 0.0078  0.0478  103 LYS A C   
932  O O   . LYS B 104 ? 0.1882 0.1301 0.1690 -0.0010 -0.0022 0.0602  103 LYS A O   
933  C CB  . LYS B 104 ? 0.2225 0.1860 0.2263 -0.0543 0.0028  0.0630  103 LYS A CB  
934  C CG  . LYS B 104 ? 0.3017 0.2524 0.2569 -0.0621 -0.0160 0.0378  103 LYS A CG  
935  C CD  . LYS B 104 ? 0.3691 0.3238 0.2878 -0.0716 -0.0542 0.0189  103 LYS A CD  
936  C CE  . LYS B 104 ? 0.4357 0.3880 0.2971 -0.0588 -0.0716 0.0162  103 LYS A CE  
937  N NZ  . LYS B 104 ? 0.4773 0.4220 0.3058 -0.0477 -0.0792 0.0073  103 LYS A NZ  
938  N N   . SER B 105 ? 0.1903 0.1536 0.1467 -0.0102 0.0188  0.0426  104 SER A N   
939  C CA  . SER B 105 ? 0.1948 0.1591 0.1390 -0.0015 0.0056  0.0532  104 SER A CA  
940  C C   . SER B 105 ? 0.2126 0.1499 0.1374 -0.0092 -0.0001 0.0485  104 SER A C   
941  O O   . SER B 105 ? 0.1936 0.1668 0.1329 -0.0155 0.0020  0.0378  104 SER A O   
942  C CB  . SER B 105 ? 0.2375 0.1868 0.1672 -0.0025 -0.0135 0.0795  104 SER A CB  
943  O OG  . SER B 105 ? 0.2826 0.2108 0.1706 -0.0135 -0.0113 0.0799  104 SER A OG  
944  N N   . ALA B 106 ? 0.2011 0.1346 0.1391 0.0108  0.0246  0.0359  105 ALA A N   
945  C CA  . ALA B 106 ? 0.2095 0.1450 0.1587 -0.0013 0.0441  0.0425  105 ALA A CA  
946  C C   . ALA B 106 ? 0.2184 0.1680 0.1731 0.0185  0.0316  0.0540  105 ALA A C   
947  O O   . ALA B 106 ? 0.2260 0.1570 0.1906 0.0029  0.0158  0.0601  105 ALA A O   
948  C CB  . ALA B 106 ? 0.2507 0.1746 0.1721 0.0123  0.0215  0.0220  105 ALA A CB  
949  N N   . GLU B 107 ? 0.2231 0.2034 0.1562 0.0080  0.0521  0.0736  106 GLU A N   
950  C CA  . GLU B 107 ? 0.2590 0.2425 0.1934 -0.0180 0.0452  0.1016  106 GLU A CA  
951  C C   . GLU B 107 ? 0.2224 0.2199 0.1915 -0.0126 0.0291  0.1038  106 GLU A C   
952  O O   . GLU B 107 ? 0.2002 0.2665 0.2111 -0.0294 0.0118  0.0850  106 GLU A O   
953  C CB  . GLU B 107 ? 0.3035 0.3285 0.2127 -0.0554 0.0419  0.1004  106 GLU A CB  
954  C CG  . GLU B 107 ? 0.3437 0.4244 0.2566 -0.0674 0.0249  0.1028  106 GLU A CG  
955  C CD  . GLU B 107 ? 0.4164 0.5194 0.3115 -0.0545 -0.0122 0.0888  106 GLU A CD  
956  O OE1 . GLU B 107 ? 0.4188 0.5391 0.3163 -0.0589 -0.0065 0.0904  106 GLU A OE1 
957  O OE2 . GLU B 107 ? 0.4392 0.5460 0.3280 -0.0542 -0.0236 0.1030  106 GLU A OE2 
958  N N   . ALA B 108 ? 0.2120 0.1773 0.2048 0.0189  0.0171  0.0673  107 ALA A N   
959  C CA  . ALA B 108 ? 0.2259 0.1747 0.2173 0.0167  -0.0068 0.0417  107 ALA A CA  
960  C C   . ALA B 108 ? 0.2617 0.1628 0.2150 0.0071  -0.0393 0.0344  107 ALA A C   
961  O O   . ALA B 108 ? 0.3274 0.1731 0.2679 -0.0204 -0.0595 0.0312  107 ALA A O   
962  C CB  . ALA B 108 ? 0.2352 0.1920 0.2416 0.0234  -0.0136 0.0165  107 ALA A CB  
963  N N   . VAL B 109 ? 0.2164 0.1497 0.1922 -0.0158 -0.0267 0.0564  108 VAL A N   
964  C CA  . VAL B 109 ? 0.1898 0.1650 0.1737 -0.0186 -0.0142 0.0397  108 VAL A CA  
965  C C   . VAL B 109 ? 0.2065 0.2075 0.2282 -0.0421 -0.0128 0.0658  108 VAL A C   
966  O O   . VAL B 109 ? 0.2528 0.2051 0.2941 -0.0517 -0.0540 0.0653  108 VAL A O   
967  C CB  . VAL B 109 ? 0.1780 0.1585 0.1490 -0.0329 0.0028  0.0390  108 VAL A CB  
968  C CG1 . VAL B 109 ? 0.2222 0.1620 0.1384 -0.0198 -0.0051 0.0164  108 VAL A CG1 
969  C CG2 . VAL B 109 ? 0.1747 0.1904 0.1554 -0.0388 0.0166  0.0388  108 VAL A CG2 
970  N N   . GLY B 110 ? 0.1728 0.2705 0.1978 -0.0278 0.0182  0.0862  109 GLY A N   
971  C CA  . GLY B 110 ? 0.1663 0.3024 0.2038 -0.0053 0.0228  0.0981  109 GLY A CA  
972  C C   . GLY B 110 ? 0.1435 0.2918 0.1747 -0.0289 0.0144  0.0942  109 GLY A C   
973  O O   . GLY B 110 ? 0.1721 0.2845 0.1720 -0.0232 0.0182  0.0905  109 GLY A O   
974  N N   . VAL B 111 ? 0.1838 0.2977 0.1685 -0.0135 0.0247  0.0853  110 VAL A N   
975  C CA  . VAL B 111 ? 0.1906 0.2920 0.1786 -0.0191 0.0149  0.0996  110 VAL A CA  
976  C C   . VAL B 111 ? 0.1695 0.2497 0.1528 -0.0030 0.0251  0.0752  110 VAL A C   
977  O O   . VAL B 111 ? 0.1648 0.2139 0.1598 -0.0127 0.0316  0.0541  110 VAL A O   
978  C CB  . VAL B 111 ? 0.1867 0.3190 0.2324 -0.0591 0.0088  0.1038  110 VAL A CB  
979  C CG1 . VAL B 111 ? 0.2294 0.3379 0.2627 -0.0446 0.0310  0.0925  110 VAL A CG1 
980  C CG2 . VAL B 111 ? 0.2456 0.3331 0.2462 -0.0690 0.0127  0.0990  110 VAL A CG2 
981  N N   . LYS B 112 ? 0.1856 0.2510 0.1406 0.0439  0.0278  0.0670  111 LYS A N   
982  C CA  . LYS B 112 ? 0.2021 0.2503 0.1480 0.0403  0.0229  0.0712  111 LYS A CA  
983  C C   . LYS B 112 ? 0.2043 0.2366 0.1439 0.0004  0.0235  0.0655  111 LYS A C   
984  O O   . LYS B 112 ? 0.1990 0.3104 0.1632 -0.0281 0.0145  0.0547  111 LYS A O   
985  C CB  . LYS B 112 ? 0.2310 0.2784 0.1681 0.0586  0.0183  0.0891  111 LYS A CB  
986  C CG  . LYS B 112 ? 0.2419 0.3057 0.2006 0.0670  0.0250  0.1039  111 LYS A CG  
987  C CD  . LYS B 112 ? 0.2860 0.3527 0.2565 0.0818  0.0203  0.1019  111 LYS A CD  
988  C CE  . LYS B 112 ? 0.3224 0.3801 0.2995 0.1027  0.0216  0.1173  111 LYS A CE  
989  N NZ  . LYS B 112 ? 0.3441 0.3993 0.3265 0.1357  0.0190  0.1122  111 LYS A NZ  
990  N N   . ILE B 113 ? 0.1985 0.1625 0.1344 -0.0029 0.0259  0.0479  112 ILE A N   
991  C CA  . ILE B 113 ? 0.2450 0.1454 0.1363 -0.0148 -0.0038 0.0245  112 ILE A CA  
992  C C   . ILE B 113 ? 0.2478 0.1529 0.1382 -0.0480 -0.0333 0.0087  112 ILE A C   
993  O O   . ILE B 113 ? 0.2718 0.1458 0.1345 -0.0722 -0.0347 0.0297  112 ILE A O   
994  C CB  . ILE B 113 ? 0.2395 0.1522 0.1157 -0.0045 0.0191  0.0181  112 ILE A CB  
995  C CG1 . ILE B 113 ? 0.2232 0.1545 0.1411 -0.0004 0.0072  0.0189  112 ILE A CG1 
996  C CG2 . ILE B 113 ? 0.3089 0.1850 0.1012 -0.0075 0.0051  -0.0030 112 ILE A CG2 
997  C CD1 . ILE B 113 ? 0.2329 0.1825 0.1610 -0.0007 0.0253  0.0141  112 ILE A CD1 
998  N N   . GLY B 114 ? 0.2780 0.1961 0.1727 -0.0670 -0.0604 -0.0008 113 GLY A N   
999  C CA  . GLY B 114 ? 0.2821 0.2031 0.1901 -0.0568 -0.0590 0.0139  113 GLY A CA  
1000 C C   . GLY B 114 ? 0.2550 0.2246 0.2093 -0.0692 -0.0647 0.0418  113 GLY A C   
1001 O O   . GLY B 114 ? 0.2539 0.2479 0.2290 -0.0500 -0.0513 0.0539  113 GLY A O   
1002 N N   . ASN B 115 ? 0.2536 0.2326 0.2166 -0.0859 -0.0814 0.0548  114 ASN A N   
1003 C CA  . ASN B 115 ? 0.2181 0.2485 0.2494 -0.0733 -0.0798 0.0792  114 ASN A CA  
1004 C C   . ASN B 115 ? 0.2068 0.2229 0.1890 -0.0519 -0.0422 0.0747  114 ASN A C   
1005 O O   . ASN B 115 ? 0.2258 0.2380 0.1918 -0.0453 -0.0572 0.0802  114 ASN A O   
1006 C CB  . ASN B 115 ? 0.2481 0.3219 0.3484 -0.0697 -0.0821 0.0877  114 ASN A CB  
1007 C CG  . ASN B 115 ? 0.3084 0.3925 0.4336 -0.0369 -0.0570 0.1004  114 ASN A CG  
1008 O OD1 . ASN B 115 ? 0.3379 0.4280 0.4738 -0.0135 -0.0268 0.0981  114 ASN A OD1 
1009 N ND2 . ASN B 115 ? 0.3375 0.4144 0.4688 -0.0187 -0.0576 0.1078  114 ASN A ND2 
1010 N N   . PRO B 116 ? 0.1946 0.2002 0.1522 -0.0436 -0.0244 0.0744  115 PRO A N   
1011 C CA  . PRO B 116 ? 0.1947 0.1993 0.1591 -0.0511 -0.0276 0.0714  115 PRO A CA  
1012 C C   . PRO B 116 ? 0.1892 0.2048 0.1612 -0.0330 -0.0459 0.0690  115 PRO A C   
1013 O O   . PRO B 116 ? 0.2147 0.2090 0.1931 -0.0207 -0.0127 0.0718  115 PRO A O   
1014 C CB  . PRO B 116 ? 0.2027 0.1920 0.1431 -0.0644 -0.0385 0.0696  115 PRO A CB  
1015 C CG  . PRO B 116 ? 0.2077 0.1800 0.1316 -0.0593 -0.0478 0.0550  115 PRO A CG  
1016 C CD  . PRO B 116 ? 0.2278 0.1849 0.1279 -0.0460 -0.0348 0.0626  115 PRO A CD  
1017 N N   . VAL B 117 ? 0.2025 0.1970 0.1646 -0.0342 -0.0649 0.0778  116 VAL A N   
1018 C CA  . VAL B 117 ? 0.1903 0.2072 0.2007 -0.0053 -0.0738 0.0839  116 VAL A CA  
1019 C C   . VAL B 117 ? 0.1912 0.1878 0.1928 -0.0057 -0.0648 0.0962  116 VAL A C   
1020 O O   . VAL B 117 ? 0.1991 0.1746 0.1860 -0.0165 -0.0669 0.0766  116 VAL A O   
1021 C CB  . VAL B 117 ? 0.2255 0.2574 0.2145 -0.0266 -0.0781 0.0748  116 VAL A CB  
1022 C CG1 . VAL B 117 ? 0.2472 0.2814 0.2494 -0.0386 -0.1006 0.0525  116 VAL A CG1 
1023 C CG2 . VAL B 117 ? 0.2166 0.2637 0.1857 -0.0377 -0.0801 0.0785  116 VAL A CG2 
1024 N N   . PRO B 118 ? 0.2152 0.1945 0.2161 -0.0022 -0.0438 0.0826  117 PRO A N   
1025 C CA  . PRO B 118 ? 0.2021 0.1851 0.2259 -0.0004 -0.0421 0.0576  117 PRO A CA  
1026 C C   . PRO B 118 ? 0.1978 0.1910 0.2017 -0.0060 -0.0674 0.0795  117 PRO A C   
1027 O O   . PRO B 118 ? 0.2073 0.2176 0.1940 -0.0037 -0.0429 0.0914  117 PRO A O   
1028 C CB  . PRO B 118 ? 0.2435 0.2061 0.2395 0.0093  -0.0273 0.0245  117 PRO A CB  
1029 C CG  . PRO B 118 ? 0.2579 0.2100 0.2521 -0.0031 -0.0160 0.0285  117 PRO A CG  
1030 C CD  . PRO B 118 ? 0.2414 0.2017 0.2474 0.0086  -0.0310 0.0473  117 PRO A CD  
1031 N N   . TYR B 119 ? 0.1970 0.1810 0.2357 -0.0293 -0.0665 0.0796  118 TYR A N   
1032 C CA  . TYR B 119 ? 0.2050 0.1829 0.2847 -0.0087 -0.0639 0.0954  118 TYR A CA  
1033 C C   . TYR B 119 ? 0.2446 0.2163 0.2872 -0.0109 -0.0448 0.0940  118 TYR A C   
1034 O O   . TYR B 119 ? 0.2921 0.2349 0.2768 -0.0172 -0.0284 0.0695  118 TYR A O   
1035 C CB  . TYR B 119 ? 0.1876 0.1940 0.3366 -0.0093 -0.0651 0.1293  118 TYR A CB  
1036 C CG  . TYR B 119 ? 0.1875 0.2148 0.3876 -0.0035 -0.0315 0.1505  118 TYR A CG  
1037 C CD1 . TYR B 119 ? 0.2035 0.2444 0.4048 -0.0097 -0.0283 0.1576  118 TYR A CD1 
1038 C CD2 . TYR B 119 ? 0.2085 0.2421 0.4223 -0.0323 -0.0015 0.1487  118 TYR A CD2 
1039 C CE1 . TYR B 119 ? 0.2229 0.2816 0.4231 -0.0054 0.0047  0.1615  118 TYR A CE1 
1040 C CE2 . TYR B 119 ? 0.2287 0.2598 0.4397 -0.0283 0.0237  0.1690  118 TYR A CE2 
1041 C CZ  . TYR B 119 ? 0.2436 0.2926 0.4379 -0.0113 0.0309  0.1781  118 TYR A CZ  
1042 O OH  . TYR B 119 ? 0.2833 0.3434 0.4594 0.0017  0.0525  0.1781  118 TYR A OH  
1043 N N   . ASN B 120 ? 0.2576 0.2339 0.3074 0.0090  -0.0608 0.1447  119 ASN A N   
1044 C CA  . ASN B 120 ? 0.3132 0.2810 0.3542 -0.0364 -0.0704 0.1361  119 ASN A CA  
1045 C C   . ASN B 120 ? 0.3608 0.3035 0.4063 -0.0777 -0.0490 0.1216  119 ASN A C   
1046 O O   . ASN B 120 ? 0.3897 0.3118 0.3946 -0.0946 -0.0596 0.1207  119 ASN A O   
1047 C CB  . ASN B 120 ? 0.3271 0.3225 0.3400 -0.0368 -0.0992 0.1236  119 ASN A CB  
1048 C CG  . ASN B 120 ? 0.3377 0.3680 0.3499 -0.0427 -0.1241 0.0942  119 ASN A CG  
1049 O OD1 . ASN B 120 ? 0.3669 0.3754 0.3681 -0.0386 -0.0909 0.0904  119 ASN A OD1 
1050 N ND2 . ASN B 120 ? 0.3615 0.3949 0.3531 -0.0731 -0.1452 0.0858  119 ASN A ND2 
1051 N N   . GLU B 121 ? 0.3625 0.3135 0.4640 -0.0832 -0.0503 0.1089  120 GLU A N   
1052 C CA  . GLU B 121 ? 0.3729 0.3316 0.5081 -0.0854 -0.0660 0.1219  120 GLU A CA  
1053 C C   . GLU B 121 ? 0.4135 0.3502 0.5295 -0.1010 -0.0746 0.1296  120 GLU A C   
1054 O O   . GLU B 121 ? 0.4357 0.3358 0.5418 -0.1036 -0.0803 0.1425  120 GLU A O   
1055 C CB  . GLU B 121 ? 0.3529 0.3235 0.5228 -0.0632 -0.0768 0.1348  120 GLU A CB  
1056 C CG  . GLU B 121 ? 0.3395 0.3159 0.5327 -0.0623 -0.0734 0.1472  120 GLU A CG  
1057 C CD  . GLU B 121 ? 0.3264 0.3100 0.5400 -0.0661 -0.0651 0.1500  120 GLU A CD  
1058 O OE1 . GLU B 121 ? 0.3102 0.3486 0.5449 -0.0772 -0.0519 0.1411  120 GLU A OE1 
1059 O OE2 . GLU B 121 ? 0.3046 0.2616 0.5416 -0.0701 -0.0828 0.1476  120 GLU A OE2 
1060 O OXT . GLU B 121 ? 0.4318 0.3728 0.5284 -0.1034 -0.0778 0.1301  120 GLU A OXT 
1071 O O   . HOH D .   ? 0.4462 0.5687 0.2941 -0.1188 -0.0323 0.1764  204 HOH A O   
1076 O O   . HOH D .   ? 0.2588 0.1971 0.4537 0.0067  0.0613  -0.0355 209 HOH A O   
1079 O O   . HOH D .   ? 0.3111 0.2581 0.1638 -0.1377 0.0504  -0.0214 212 HOH A O   
1082 O O   . HOH D .   ? 0.2794 0.2123 0.2552 -0.0078 0.0084  -0.0344 215 HOH A O   
1083 O O   . HOH D .   ? 0.4662 0.2462 0.4326 -0.1773 -0.0039 -0.0373 216 HOH A O   
1084 O O   . HOH D .   ? 0.2123 0.1273 0.1020 -0.0338 -0.0147 0.0179  217 HOH A O   
1085 O O   . HOH D .   ? 0.5104 0.2627 0.2368 -0.0411 -0.0847 -0.0147 218 HOH A O   
1086 O O   . HOH D .   ? 0.5699 0.2228 0.3344 0.1202  0.0359  -0.0520 219 HOH A O   
1088 O O   . HOH D .   ? 0.5621 0.1934 0.2535 0.0850  -0.1536 -0.0095 221 HOH A O   
1089 O O   . HOH D .   ? 0.1973 0.1780 0.1491 0.0084  -0.0141 -0.0320 222 HOH A O   
1090 O O   . HOH D .   ? 0.2782 0.3690 0.3073 0.0537  -0.1124 -0.0235 223 HOH A O   
1094 O O   . HOH D .   ? 0.2525 0.2439 0.2286 0.0205  0.0084  -0.0528 227 HOH A O   
1096 O O   . HOH D .   ? 0.2474 0.2134 0.1299 -0.0565 -0.0238 0.0432  229 HOH A O   
1099 O O   . HOH D .   ? 0.2737 0.2488 0.2597 -0.0277 -0.0604 -0.0283 232 HOH A O   
1102 O O   . HOH D .   ? 0.4129 0.4863 0.2634 0.1644  0.0912  0.0305  235 HOH A O   
1104 O O   . HOH D .   ? 0.4065 0.7292 0.2703 -0.2624 0.0258  -0.0178 237 HOH A O   
1107 O O   . HOH D .   ? 0.2567 0.1798 0.2862 0.0254  -0.0014 0.0008  240 HOH A O   
1108 O O   . HOH D .   ? 0.3925 0.2555 0.2544 0.0156  0.1218  0.0828  241 HOH A O   
1109 O O   . HOH D .   ? 0.4067 0.2924 0.1371 -0.0141 -0.0496 0.0686  242 HOH A O   
1115 O O   . HOH D .   ? 0.3051 0.2292 0.1836 0.0375  0.0489  0.0117  248 HOH A O   
1116 O O   . HOH D .   ? 0.5036 0.5791 0.4252 0.0342  0.0195  -0.2876 249 HOH A O   
1117 O O   . HOH D .   ? 0.4259 0.2826 0.6931 -0.1621 0.0332  -0.0371 250 HOH A O   
1122 O O   . HOH D .   ? 0.4825 0.2343 0.1692 -0.0790 0.0292  -0.0189 255 HOH A O   
1125 O O   . HOH D .   ? 0.2859 0.1900 0.1463 0.0262  0.0284  0.0169  258 HOH A O   
1127 O O   . HOH D .   ? 0.3011 0.2451 0.3922 -0.0393 -0.0103 0.0769  260 HOH A O   
1128 O O   . HOH D .   ? 0.4963 0.2131 0.2498 0.0872  0.1456  0.0312  261 HOH A O   
1130 O O   . HOH D .   ? 0.2163 0.4328 0.3619 -0.0842 -0.0507 0.1401  263 HOH A O   
1131 O O   . HOH D .   ? 0.3812 0.1808 0.2933 0.0380  0.0314  -0.0260 264 HOH A O   
1132 O O   . HOH D .   ? 0.2270 0.1486 0.1100 -0.0220 -0.0105 0.0361  265 HOH A O   
1133 O O   . HOH D .   ? 0.3521 0.3193 0.2781 -0.0787 0.0320  -0.0829 266 HOH A O   
1135 O O   . HOH D .   ? 0.3585 0.2186 0.1590 0.0825  0.0452  -0.0125 268 HOH A O   
1137 O O   . HOH D .   ? 0.3543 0.3679 0.2156 0.0748  -0.0198 -0.0892 270 HOH A O   
1138 O O   . HOH D .   ? 0.3656 0.1805 0.2944 0.0815  0.0126  0.0691  271 HOH A O   
1139 O O   . HOH D .   ? 0.6427 0.2808 0.2151 0.0441  -0.0867 -0.0643 272 HOH A O   
1142 O O   . HOH D .   ? 0.2697 0.4956 0.3985 -0.1232 -0.0070 0.1156  275 HOH A O   
1143 O O   . HOH D .   ? 0.5430 0.2116 0.2973 -0.0351 0.0422  0.0431  276 HOH A O   
1147 O O   . HOH D .   ? 0.5937 0.3080 0.2916 -0.2280 0.0009  -0.0165 280 HOH A O   
1148 O O   . HOH D .   ? 0.2566 0.2158 0.2072 0.0077  0.0352  -0.0312 281 HOH A O   
1149 O O   . HOH D .   ? 0.6634 0.2508 0.3312 -0.0132 -0.2236 0.0473  282 HOH A O   
1152 O O   . HOH D .   ? 0.4574 0.8154 0.3252 -0.1886 0.0624  0.1343  285 HOH A O   
1171 O O   . HOH D .   ? 0.4270 0.2606 0.2826 -0.1178 0.0413  0.0566  304 HOH A O   
1173 O O   . HOH D .   ? 0.3330 0.5823 0.1758 -0.1442 -0.0419 0.0533  306 HOH A O   
1181 O O   . HOH D .   ? 0.3762 0.2381 0.4363 -0.0244 0.2284  -0.0711 314 HOH A O   
1184 O O   . HOH D .   ? 0.3744 0.4938 0.3152 -0.0663 -0.1368 0.1086  317 HOH A O   
1186 O O   . HOH D .   ? 0.4258 0.2835 0.2971 0.0385  0.0264  -0.1382 319 HOH A O   
1196 O O   . HOH D .   ? 0.3712 0.3483 0.2844 -0.0403 -0.0143 -0.0805 329 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -89 ?   ?   ?   X . n 
A 1 2   GLY 2   -88 ?   ?   ?   X . n 
A 1 3   SER 3   -87 ?   ?   ?   X . n 
A 1 4   SER 4   -86 ?   ?   ?   X . n 
A 1 5   HIS 5   -85 ?   ?   ?   X . n 
A 1 6   HIS 6   -84 ?   ?   ?   X . n 
A 1 7   HIS 7   -83 ?   ?   ?   X . n 
A 1 8   HIS 8   -82 ?   ?   ?   X . n 
A 1 9   HIS 9   -81 ?   ?   ?   X . n 
A 1 10  HIS 10  -80 ?   ?   ?   X . n 
A 1 11  SER 11  -79 ?   ?   ?   X . n 
A 1 12  SER 12  -78 ?   ?   ?   X . n 
A 1 13  GLY 13  -77 ?   ?   ?   X . n 
A 1 14  LEU 14  -76 ?   ?   ?   X . n 
A 1 15  VAL 15  -75 ?   ?   ?   X . n 
A 1 16  PRO 16  -74 ?   ?   ?   X . n 
A 1 17  ARG 17  -73 ?   ?   ?   X . n 
A 1 18  GLY 18  -72 ?   ?   ?   X . n 
A 1 19  SER 19  -71 ?   ?   ?   X . n 
A 1 20  HIS 20  -70 ?   ?   ?   X . n 
A 1 21  MET 21  -69 ?   ?   ?   X . n 
A 1 22  THR 22  -68 ?   ?   ?   X . n 
A 1 23  THR 23  -67 ?   ?   ?   X . n 
A 1 24  ASP 24  -66 ?   ?   ?   X . n 
A 1 25  GLU 25  -65 ?   ?   ?   X . n 
A 1 26  ALA 26  -64 ?   ?   ?   X . n 
A 1 27  ASP 27  -63 ?   ?   ?   X . n 
A 1 28  GLU 28  -62 ?   ?   ?   X . n 
A 1 29  THR 29  -61 ?   ?   ?   X . n 
A 1 30  ARG 30  -60 ?   ?   ?   X . n 
A 1 31  SER 31  -59 ?   ?   ?   X . n 
A 1 32  ASN 32  -58 ?   ?   ?   X . n 
A 1 33  GLU 33  -57 ?   ?   ?   X . n 
A 1 34  THR 34  -56 ?   ?   ?   X . n 
A 1 35  GLN 35  -55 ?   ?   ?   X . n 
A 1 36  ASN 36  -54 ?   ?   ?   X . n 
A 1 37  PRO 37  -53 ?   ?   ?   X . n 
A 1 38  HIS 38  -52 ?   ?   ?   X . n 
A 1 39  LYS 39  -51 ?   ?   ?   X . n 
A 1 40  PRO 40  -50 ?   ?   ?   X . n 
A 1 41  SER 41  -49 ?   ?   ?   X . n 
A 1 42  PRO 42  -48 ?   ?   ?   X . n 
A 1 43  SER 43  -47 ?   ?   ?   X . n 
A 1 44  ARG 44  -46 ?   ?   ?   X . n 
A 1 45  LEU 45  -45 ?   ?   ?   X . n 
A 1 46  SER 46  -44 ?   ?   ?   X . n 
A 1 47  THR 47  -43 ?   ?   ?   X . n 
A 1 48  GLY 48  -42 ?   ?   ?   X . n 
A 1 49  ALA 49  -41 ?   ?   ?   X . n 
A 1 50  SER 50  -40 ?   ?   ?   X . n 
A 1 51  ALA 51  -39 ?   ?   ?   X . n 
A 1 52  ASP 52  -38 ?   ?   ?   X . n 
A 1 53  ALA 53  -37 ?   ?   ?   X . n 
A 1 54  VAL 54  -36 ?   ?   ?   X . n 
A 1 55  TRP 55  -35 ?   ?   ?   X . n 
A 1 56  ASP 56  -34 ?   ?   ?   X . n 
A 1 57  ASN 57  -33 ?   ?   ?   X . n 
A 1 58  GLY 58  -32 ?   ?   ?   X . n 
A 1 59  ILE 59  -31 ?   ?   ?   X . n 
A 1 60  ASP 60  -30 ?   ?   ?   X . n 
A 1 61  ASP 61  -29 ?   ?   ?   X . n 
A 1 62  ALA 62  -28 ?   ?   ?   X . n 
A 1 63  TYR 63  -27 ?   ?   ?   X . n 
A 1 64  PHE 64  -26 ?   ?   ?   X . n 
A 1 65  LEU 65  -25 ?   ?   ?   X . n 
A 1 66  GLU 66  -24 ?   ?   ?   X . n 
A 1 67  ALA 67  -23 ?   ?   ?   X . n 
A 1 68  THR 68  -22 ?   ?   ?   X . n 
A 1 69  GLU 69  -21 ?   ?   ?   X . n 
A 1 70  ASP 70  -20 ?   ?   ?   X . n 
A 1 71  ALA 71  -19 ?   ?   ?   X . n 
A 1 72  GLU 72  -18 ?   ?   ?   X . n 
A 1 73  LEU 73  -17 ?   ?   ?   X . n 
A 1 74  ALA 74  -16 ?   ?   ?   X . n 
A 1 75  GLU 75  -15 ?   ?   ?   X . n 
A 1 76  ALA 76  -14 ?   ?   ?   X . n 
A 1 77  ALA 77  -13 ?   ?   ?   X . n 
A 1 78  GLU 78  -12 ?   ?   ?   X . n 
A 1 79  ASN 79  -11 ?   ?   ?   X . n 
A 1 80  SER 80  -10 ?   ?   ?   X . n 
A 1 81  LEU 81  -9  ?   ?   ?   X . n 
A 1 82  LEU 82  -8  ?   ?   ?   X . n 
A 1 83  SER 83  -7  ?   ?   ?   X . n 
A 1 84  TYR 84  -6  ?   ?   ?   X . n 
A 1 85  ASN 85  -5  ?   ?   ?   X . n 
A 1 86  SER 86  -4  ?   ?   ?   X . n 
A 1 87  GLU 87  -3  ?   ?   ?   X . n 
A 1 88  VAL 88  -2  ?   ?   ?   X . n 
A 1 89  ASP 89  -1  ?   ?   ?   X . n 
A 1 90  GLU 90  0   0   GLU GLU X . n 
A 1 91  ILE 91  1   1   ILE ILE X . n 
A 1 92  PRO 92  2   2   PRO PRO X . n 
A 1 93  ASP 93  3   3   ASP ASP X . n 
A 1 94  GLU 94  4   4   GLU GLU X . n 
A 1 95  LEU 95  5   5   LEU LEU X . n 
A 1 96  ILE 96  6   6   ILE ILE X . n 
A 1 97  ILE 97  7   7   ILE ILE X . n 
A 1 98  GLU 98  8   8   GLU GLU X . n 
A 1 99  VAL 99  9   ?   ?   ?   X . n 
A 1 100 LEU 100 10  ?   ?   ?   X . n 
A 1 101 GLN 101 11  ?   ?   ?   X . n 
A 1 102 GLU 102 12  ?   ?   ?   X . n 
B 2 1   HIS 1   0   0   HIS HIS A . n 
B 2 2   MET 2   1   1   MET MET A . n 
B 2 3   VAL 3   2   2   VAL VAL A . n 
B 2 4   GLY 4   3   3   GLY GLY A . n 
B 2 5   GLN 5   4   4   GLN GLN A . n 
B 2 6   LEU 6   5   5   LEU LEU A . n 
B 2 7   SER 7   6   6   SER SER A . n 
B 2 8   ARG 8   7   7   ARG ARG A . n 
B 2 9   GLY 9   8   8   GLY GLY A . n 
B 2 10  ALA 10  9   9   ALA ALA A . n 
B 2 11  ILE 11  10  10  ILE ILE A . n 
B 2 12  ALA 12  11  11  ALA ALA A . n 
B 2 13  ALA 13  12  12  ALA ALA A . n 
B 2 14  ILE 14  13  13  ILE ILE A . n 
B 2 15  MET 15  14  14  MET MET A . n 
B 2 16  GLN 16  15  15  GLN GLN A . n 
B 2 17  LYS 17  16  16  LYS LYS A . n 
B 2 18  GLY 18  17  17  GLY GLY A . n 
B 2 19  ASP 19  18  18  ASP ASP A . n 
B 2 20  THR 20  19  19  THR THR A . n 
B 2 21  ASN 21  20  20  ASN ASN A . n 
B 2 22  ILE 22  21  21  ILE ILE A . n 
B 2 23  LYS 23  22  22  LYS LYS A . n 
B 2 24  PRO 24  23  23  PRO PRO A . n 
B 2 25  ILE 25  24  24  ILE ILE A . n 
B 2 26  LEU 26  25  25  LEU LEU A . n 
B 2 27  GLN 27  26  26  GLN GLN A . n 
B 2 28  VAL 28  27  27  VAL VAL A . n 
B 2 29  ILE 29  28  28  ILE ILE A . n 
B 2 30  ASN 30  29  29  ASN ASN A . n 
B 2 31  ILE 31  30  30  ILE ILE A . n 
B 2 32  ARG 32  31  31  ARG ARG A . n 
B 2 33  PRO 33  32  32  PRO PRO A . n 
B 2 34  ILE 34  33  33  ILE ILE A . n 
B 2 35  THR 35  34  34  THR THR A . n 
B 2 36  THR 36  35  35  THR THR A . n 
B 2 37  GLY 37  36  36  GLY GLY A . n 
B 2 38  ASN 38  37  37  ASN ASN A . n 
B 2 39  SER 39  38  38  SER SER A . n 
B 2 40  PRO 40  39  39  PRO PRO A . n 
B 2 41  PRO 41  40  40  PRO PRO A . n 
B 2 42  ARG 42  41  41  ARG ARG A . n 
B 2 43  TYR 43  42  42  TYR TYR A . n 
B 2 44  ARG 44  43  43  ARG ARG A . n 
B 2 45  LEU 45  44  44  LEU LEU A . n 
B 2 46  LEU 46  45  45  LEU LEU A . n 
B 2 47  MET 47  46  46  MET MET A . n 
B 2 48  SER 48  47  47  SER SER A . n 
B 2 49  ASP 49  48  48  ASP ASP A . n 
B 2 50  GLY 50  49  49  GLY GLY A . n 
B 2 51  LEU 51  50  50  LEU LEU A . n 
B 2 52  ASN 52  51  51  ASN ASN A . n 
B 2 53  THR 53  52  52  THR THR A . n 
B 2 54  LEU 54  53  53  LEU LEU A . n 
B 2 55  SER 55  54  54  SER SER A . n 
B 2 56  SER 56  55  55  SER SER A . n 
B 2 57  PHE 57  56  56  PHE PHE A . n 
B 2 58  MET 58  57  57  MET MET A . n 
B 2 59  LEU 59  58  58  LEU LEU A . n 
B 2 60  ALA 60  59  59  ALA ALA A . n 
B 2 61  THR 61  60  60  THR THR A . n 
B 2 62  GLN 62  61  61  GLN GLN A . n 
B 2 63  LEU 63  62  62  LEU LEU A . n 
B 2 64  ASN 64  63  63  ASN ASN A . n 
B 2 65  PRO 65  64  64  PRO PRO A . n 
B 2 66  LEU 66  65  65  LEU LEU A . n 
B 2 67  VAL 67  66  66  VAL VAL A . n 
B 2 68  GLU 68  67  67  GLU GLU A . n 
B 2 69  GLU 69  68  68  GLU GLU A . n 
B 2 70  GLU 70  69  69  GLU GLU A . n 
B 2 71  GLN 71  70  70  GLN GLN A . n 
B 2 72  LEU 72  71  71  LEU LEU A . n 
B 2 73  SER 73  72  72  SER SER A . n 
B 2 74  SER 74  73  73  SER SER A . n 
B 2 75  ASN 75  74  74  ASN ASN A . n 
B 2 76  CYS 76  75  75  CYS CYS A . n 
B 2 77  VAL 77  76  76  VAL VAL A . n 
B 2 78  CYS 78  77  77  CYS CYS A . n 
B 2 79  GLN 79  78  78  GLN GLN A . n 
B 2 80  ILE 80  79  79  ILE ILE A . n 
B 2 81  HIS 81  80  80  HIS HIS A . n 
B 2 82  ARG 82  81  81  ARG ARG A . n 
B 2 83  PHE 83  82  82  PHE PHE A . n 
B 2 84  ILE 84  83  83  ILE ILE A . n 
B 2 85  VAL 85  84  84  VAL VAL A . n 
B 2 86  ASN 86  85  85  ASN ASN A . n 
B 2 87  THR 87  86  86  THR THR A . n 
B 2 88  LEU 88  87  87  LEU LEU A . n 
B 2 89  LYS 89  88  88  LYS LYS A . n 
B 2 90  ASP 90  89  89  ASP ASP A . n 
B 2 91  GLY 91  90  90  GLY GLY A . n 
B 2 92  ARG 92  91  91  ARG ARG A . n 
B 2 93  ARG 93  92  92  ARG ARG A . n 
B 2 94  VAL 94  93  93  VAL VAL A . n 
B 2 95  VAL 95  94  94  VAL VAL A . n 
B 2 96  ILE 96  95  95  ILE ILE A . n 
B 2 97  LEU 97  96  96  LEU LEU A . n 
B 2 98  MET 98  97  97  MET MET A . n 
B 2 99  GLU 99  98  98  GLU GLU A . n 
B 2 100 LEU 100 99  99  LEU LEU A . n 
B 2 101 GLU 101 100 100 GLU GLU A . n 
B 2 102 VAL 102 101 101 VAL VAL A . n 
B 2 103 LEU 103 102 102 LEU LEU A . n 
B 2 104 LYS 104 103 103 LYS LYS A . n 
B 2 105 SER 105 104 104 SER SER A . n 
B 2 106 ALA 106 105 105 ALA ALA A . n 
B 2 107 GLU 107 106 106 GLU GLU A . n 
B 2 108 ALA 108 107 107 ALA ALA A . n 
B 2 109 VAL 109 108 108 VAL VAL A . n 
B 2 110 GLY 110 109 109 GLY GLY A . n 
B 2 111 VAL 111 110 110 VAL VAL A . n 
B 2 112 LYS 112 111 111 LYS LYS A . n 
B 2 113 ILE 113 112 112 ILE ILE A . n 
B 2 114 GLY 114 113 113 GLY GLY A . n 
B 2 115 ASN 115 114 114 ASN ASN A . n 
B 2 116 PRO 116 115 115 PRO PRO A . n 
B 2 117 VAL 117 116 116 VAL VAL A . n 
B 2 118 PRO 118 117 117 PRO PRO A . n 
B 2 119 TYR 119 118 118 TYR TYR A . n 
B 2 120 ASN 120 119 119 ASN ASN A . n 
B 2 121 GLU 121 120 120 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   101 83  HOH HOH X . 
C 3 HOH 2   102 84  HOH HOH X . 
C 3 HOH 3   103 138 HOH HOH X . 
C 3 HOH 4   104 52  HOH HOH X . 
C 3 HOH 5   105 58  HOH HOH X . 
C 3 HOH 6   106 111 HOH HOH X . 
C 3 HOH 7   107 114 HOH HOH X . 
D 3 HOH 1   201 101 HOH HOH A . 
D 3 HOH 2   202 69  HOH HOH A . 
D 3 HOH 3   203 57  HOH HOH A . 
D 3 HOH 4   204 45  HOH HOH A . 
D 3 HOH 5   205 51  HOH HOH A . 
D 3 HOH 6   206 47  HOH HOH A . 
D 3 HOH 7   207 99  HOH HOH A . 
D 3 HOH 8   208 108 HOH HOH A . 
D 3 HOH 9   209 21  HOH HOH A . 
D 3 HOH 10  210 125 HOH HOH A . 
D 3 HOH 11  211 63  HOH HOH A . 
D 3 HOH 12  212 8   HOH HOH A . 
D 3 HOH 13  213 120 HOH HOH A . 
D 3 HOH 14  214 86  HOH HOH A . 
D 3 HOH 15  215 28  HOH HOH A . 
D 3 HOH 16  216 30  HOH HOH A . 
D 3 HOH 17  217 3   HOH HOH A . 
D 3 HOH 18  218 41  HOH HOH A . 
D 3 HOH 19  219 22  HOH HOH A . 
D 3 HOH 20  220 68  HOH HOH A . 
D 3 HOH 21  221 6   HOH HOH A . 
D 3 HOH 22  222 4   HOH HOH A . 
D 3 HOH 23  223 29  HOH HOH A . 
D 3 HOH 24  224 48  HOH HOH A . 
D 3 HOH 25  225 62  HOH HOH A . 
D 3 HOH 26  226 67  HOH HOH A . 
D 3 HOH 27  227 14  HOH HOH A . 
D 3 HOH 28  228 73  HOH HOH A . 
D 3 HOH 29  229 2   HOH HOH A . 
D 3 HOH 30  230 107 HOH HOH A . 
D 3 HOH 31  231 82  HOH HOH A . 
D 3 HOH 32  232 17  HOH HOH A . 
D 3 HOH 33  233 123 HOH HOH A . 
D 3 HOH 34  234 53  HOH HOH A . 
D 3 HOH 35  235 42  HOH HOH A . 
D 3 HOH 36  236 92  HOH HOH A . 
D 3 HOH 37  237 34  HOH HOH A . 
D 3 HOH 38  238 56  HOH HOH A . 
D 3 HOH 39  239 130 HOH HOH A . 
D 3 HOH 40  240 26  HOH HOH A . 
D 3 HOH 41  241 23  HOH HOH A . 
D 3 HOH 42  242 9   HOH HOH A . 
D 3 HOH 43  243 54  HOH HOH A . 
D 3 HOH 44  244 132 HOH HOH A . 
D 3 HOH 45  245 88  HOH HOH A . 
D 3 HOH 46  246 77  HOH HOH A . 
D 3 HOH 47  247 98  HOH HOH A . 
D 3 HOH 48  248 5   HOH HOH A . 
D 3 HOH 49  249 37  HOH HOH A . 
D 3 HOH 50  250 40  HOH HOH A . 
D 3 HOH 51  251 72  HOH HOH A . 
D 3 HOH 52  252 121 HOH HOH A . 
D 3 HOH 53  253 102 HOH HOH A . 
D 3 HOH 54  254 106 HOH HOH A . 
D 3 HOH 55  255 15  HOH HOH A . 
D 3 HOH 56  256 49  HOH HOH A . 
D 3 HOH 57  257 139 HOH HOH A . 
D 3 HOH 58  258 10  HOH HOH A . 
D 3 HOH 59  259 115 HOH HOH A . 
D 3 HOH 60  260 31  HOH HOH A . 
D 3 HOH 61  261 33  HOH HOH A . 
D 3 HOH 62  262 50  HOH HOH A . 
D 3 HOH 63  263 13  HOH HOH A . 
D 3 HOH 64  264 12  HOH HOH A . 
D 3 HOH 65  265 1   HOH HOH A . 
D 3 HOH 66  266 39  HOH HOH A . 
D 3 HOH 67  267 78  HOH HOH A . 
D 3 HOH 68  268 7   HOH HOH A . 
D 3 HOH 69  269 55  HOH HOH A . 
D 3 HOH 70  270 18  HOH HOH A . 
D 3 HOH 71  271 20  HOH HOH A . 
D 3 HOH 72  272 24  HOH HOH A . 
D 3 HOH 73  273 80  HOH HOH A . 
D 3 HOH 74  274 133 HOH HOH A . 
D 3 HOH 75  275 19  HOH HOH A . 
D 3 HOH 76  276 27  HOH HOH A . 
D 3 HOH 77  277 118 HOH HOH A . 
D 3 HOH 78  278 59  HOH HOH A . 
D 3 HOH 79  279 76  HOH HOH A . 
D 3 HOH 80  280 36  HOH HOH A . 
D 3 HOH 81  281 16  HOH HOH A . 
D 3 HOH 82  282 25  HOH HOH A . 
D 3 HOH 83  283 93  HOH HOH A . 
D 3 HOH 84  284 117 HOH HOH A . 
D 3 HOH 85  285 44  HOH HOH A . 
D 3 HOH 86  286 70  HOH HOH A . 
D 3 HOH 87  287 134 HOH HOH A . 
D 3 HOH 88  288 81  HOH HOH A . 
D 3 HOH 89  289 135 HOH HOH A . 
D 3 HOH 90  290 131 HOH HOH A . 
D 3 HOH 91  291 79  HOH HOH A . 
D 3 HOH 92  292 124 HOH HOH A . 
D 3 HOH 93  293 90  HOH HOH A . 
D 3 HOH 94  294 137 HOH HOH A . 
D 3 HOH 95  295 116 HOH HOH A . 
D 3 HOH 96  296 91  HOH HOH A . 
D 3 HOH 97  297 85  HOH HOH A . 
D 3 HOH 98  298 74  HOH HOH A . 
D 3 HOH 99  299 100 HOH HOH A . 
D 3 HOH 100 300 119 HOH HOH A . 
D 3 HOH 101 301 64  HOH HOH A . 
D 3 HOH 102 302 126 HOH HOH A . 
D 3 HOH 103 303 136 HOH HOH A . 
D 3 HOH 104 304 32  HOH HOH A . 
D 3 HOH 105 305 109 HOH HOH A . 
D 3 HOH 106 306 43  HOH HOH A . 
D 3 HOH 107 307 110 HOH HOH A . 
D 3 HOH 108 308 113 HOH HOH A . 
D 3 HOH 109 309 71  HOH HOH A . 
D 3 HOH 110 310 75  HOH HOH A . 
D 3 HOH 111 311 105 HOH HOH A . 
D 3 HOH 112 312 129 HOH HOH A . 
D 3 HOH 113 313 122 HOH HOH A . 
D 3 HOH 114 314 11  HOH HOH A . 
D 3 HOH 115 315 65  HOH HOH A . 
D 3 HOH 116 316 140 HOH HOH A . 
D 3 HOH 117 317 38  HOH HOH A . 
D 3 HOH 118 318 96  HOH HOH A . 
D 3 HOH 119 319 35  HOH HOH A . 
D 3 HOH 120 320 95  HOH HOH A . 
D 3 HOH 121 321 104 HOH HOH A . 
D 3 HOH 122 322 103 HOH HOH A . 
D 3 HOH 123 323 97  HOH HOH A . 
D 3 HOH 124 324 66  HOH HOH A . 
D 3 HOH 125 325 60  HOH HOH A . 
D 3 HOH 126 326 87  HOH HOH A . 
D 3 HOH 127 327 61  HOH HOH A . 
D 3 HOH 128 328 112 HOH HOH A . 
D 3 HOH 129 329 46  HOH HOH A . 
D 3 HOH 130 330 94  HOH HOH A . 
D 3 HOH 131 331 89  HOH HOH A . 
D 3 HOH 132 332 128 HOH HOH A . 
D 3 HOH 133 333 127 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 980  ? 
1 MORE         -3   ? 
1 'SSA (A^2)'  6830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-06-07 
2 'Structure model' 1 1 2017-08-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Author supporting evidence' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            pdbx_audit_support 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
_pdbx_phasing_MR.entry_id                     5N8A 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          1.280 
_pdbx_phasing_MR.d_res_low_rotation           16.250 
_pdbx_phasing_MR.d_res_high_translation       1.280 
_pdbx_phasing_MR.d_res_low_translation        16.250 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .     1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .     2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .     3 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.5.6 4 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? .     5 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22  6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 277 ? ? O A HOH 284 ? ? 2.01 
2 1 O X HOH 106 ? ? O X HOH 107 ? ? 2.15 
3 1 O A HOH 316 ? ? O A HOH 322 ? ? 2.16 
4 1 O A HOH 256 ? ? O A HOH 277 ? ? 2.17 
5 1 O A THR 34  ? ? O A HOH 201 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLN 
_pdbx_validate_symm_contact.auth_seq_id_1     70 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     250 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_455 
_pdbx_validate_symm_contact.dist              2.06 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 55 ? ? -98.51 32.21  
2 1 SER A 55 ? ? -98.14 31.68  
3 1 ASN A 74 ? ? 92.95  -14.09 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 X GLU 8  ? CG  ? A GLU 98 CG  
2 1 Y 1 X GLU 8  ? CD  ? A GLU 98 CD  
3 1 Y 1 X GLU 8  ? OE1 ? A GLU 98 OE1 
4 1 Y 1 X GLU 8  ? OE2 ? A GLU 98 OE2 
5 1 Y 1 A ASN 37 ? CG  ? B ASN 38 CG  
6 1 Y 1 A ASN 37 ? OD1 ? B ASN 38 OD1 
7 1 Y 1 A ASN 37 ? ND2 ? B ASN 38 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X MET -89 ? A MET 1   
2  1 Y 1 X GLY -88 ? A GLY 2   
3  1 Y 1 X SER -87 ? A SER 3   
4  1 Y 1 X SER -86 ? A SER 4   
5  1 Y 1 X HIS -85 ? A HIS 5   
6  1 Y 1 X HIS -84 ? A HIS 6   
7  1 Y 1 X HIS -83 ? A HIS 7   
8  1 Y 1 X HIS -82 ? A HIS 8   
9  1 Y 1 X HIS -81 ? A HIS 9   
10 1 Y 1 X HIS -80 ? A HIS 10  
11 1 Y 1 X SER -79 ? A SER 11  
12 1 Y 1 X SER -78 ? A SER 12  
13 1 Y 1 X GLY -77 ? A GLY 13  
14 1 Y 1 X LEU -76 ? A LEU 14  
15 1 Y 1 X VAL -75 ? A VAL 15  
16 1 Y 1 X PRO -74 ? A PRO 16  
17 1 Y 1 X ARG -73 ? A ARG 17  
18 1 Y 1 X GLY -72 ? A GLY 18  
19 1 Y 1 X SER -71 ? A SER 19  
20 1 Y 1 X HIS -70 ? A HIS 20  
21 1 Y 1 X MET -69 ? A MET 21  
22 1 Y 1 X THR -68 ? A THR 22  
23 1 Y 1 X THR -67 ? A THR 23  
24 1 Y 1 X ASP -66 ? A ASP 24  
25 1 Y 1 X GLU -65 ? A GLU 25  
26 1 Y 1 X ALA -64 ? A ALA 26  
27 1 Y 1 X ASP -63 ? A ASP 27  
28 1 Y 1 X GLU -62 ? A GLU 28  
29 1 Y 1 X THR -61 ? A THR 29  
30 1 Y 1 X ARG -60 ? A ARG 30  
31 1 Y 1 X SER -59 ? A SER 31  
32 1 Y 1 X ASN -58 ? A ASN 32  
33 1 Y 1 X GLU -57 ? A GLU 33  
34 1 Y 1 X THR -56 ? A THR 34  
35 1 Y 1 X GLN -55 ? A GLN 35  
36 1 Y 1 X ASN -54 ? A ASN 36  
37 1 Y 1 X PRO -53 ? A PRO 37  
38 1 Y 1 X HIS -52 ? A HIS 38  
39 1 Y 1 X LYS -51 ? A LYS 39  
40 1 Y 1 X PRO -50 ? A PRO 40  
41 1 Y 1 X SER -49 ? A SER 41  
42 1 Y 1 X PRO -48 ? A PRO 42  
43 1 Y 1 X SER -47 ? A SER 43  
44 1 Y 1 X ARG -46 ? A ARG 44  
45 1 Y 1 X LEU -45 ? A LEU 45  
46 1 Y 1 X SER -44 ? A SER 46  
47 1 Y 1 X THR -43 ? A THR 47  
48 1 Y 1 X GLY -42 ? A GLY 48  
49 1 Y 1 X ALA -41 ? A ALA 49  
50 1 Y 1 X SER -40 ? A SER 50  
51 1 Y 1 X ALA -39 ? A ALA 51  
52 1 Y 1 X ASP -38 ? A ASP 52  
53 1 Y 1 X ALA -37 ? A ALA 53  
54 1 Y 1 X VAL -36 ? A VAL 54  
55 1 Y 1 X TRP -35 ? A TRP 55  
56 1 Y 1 X ASP -34 ? A ASP 56  
57 1 Y 1 X ASN -33 ? A ASN 57  
58 1 Y 1 X GLY -32 ? A GLY 58  
59 1 Y 1 X ILE -31 ? A ILE 59  
60 1 Y 1 X ASP -30 ? A ASP 60  
61 1 Y 1 X ASP -29 ? A ASP 61  
62 1 Y 1 X ALA -28 ? A ALA 62  
63 1 Y 1 X TYR -27 ? A TYR 63  
64 1 Y 1 X PHE -26 ? A PHE 64  
65 1 Y 1 X LEU -25 ? A LEU 65  
66 1 Y 1 X GLU -24 ? A GLU 66  
67 1 Y 1 X ALA -23 ? A ALA 67  
68 1 Y 1 X THR -22 ? A THR 68  
69 1 Y 1 X GLU -21 ? A GLU 69  
70 1 Y 1 X ASP -20 ? A ASP 70  
71 1 Y 1 X ALA -19 ? A ALA 71  
72 1 Y 1 X GLU -18 ? A GLU 72  
73 1 Y 1 X LEU -17 ? A LEU 73  
74 1 Y 1 X ALA -16 ? A ALA 74  
75 1 Y 1 X GLU -15 ? A GLU 75  
76 1 Y 1 X ALA -14 ? A ALA 76  
77 1 Y 1 X ALA -13 ? A ALA 77  
78 1 Y 1 X GLU -12 ? A GLU 78  
79 1 Y 1 X ASN -11 ? A ASN 79  
80 1 Y 1 X SER -10 ? A SER 80  
81 1 Y 1 X LEU -9  ? A LEU 81  
82 1 Y 1 X LEU -8  ? A LEU 82  
83 1 Y 1 X SER -7  ? A SER 83  
84 1 Y 1 X TYR -6  ? A TYR 84  
85 1 Y 1 X ASN -5  ? A ASN 85  
86 1 Y 1 X SER -4  ? A SER 86  
87 1 Y 1 X GLU -3  ? A GLU 87  
88 1 Y 1 X VAL -2  ? A VAL 88  
89 1 Y 1 X ASP -1  ? A ASP 89  
90 1 Y 1 X VAL 9   ? A VAL 99  
91 1 Y 1 X LEU 10  ? A LEU 100 
92 1 Y 1 X GLN 11  ? A GLN 101 
93 1 Y 1 X GLU 12  ? A GLU 102 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/H019723/1 1 
'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/M008800/1 2 
'Biotechnology and Biological Sciences Research Council' 'United Kingdom' BB/M004236/1 3 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration'                   ? 
2 1 'light scattering'                 ? 
3 1 'isothermal titration calorimetry' ? 
#