data_5NAP
# 
_entry.id   5NAP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NAP         
WWPDB D_1200003786 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NAP 
_pdbx_database_status.recvd_initial_deposition_date   2017-02-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Caliandro, R.' 1 ? 
'Pesaresi, A.'  2 ? 
'Lamba, D.'     3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J Enzyme Inhib Med Chem' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1475-6374 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            33 
_citation.language                  ? 
_citation.page_first                794 
_citation.page_last                 803 
_citation.title                     
;Kinetic and structural studies on the interactions of Torpedo californica acetylcholinesterase with two donepezil-like rigid analogues.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1080/14756366.2018.1458030 
_citation.pdbx_database_id_PubMed   29651884 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Caliandro, R.' 1 
primary 'Pesaresi, A.'  2 
primary 'Cariati, L.'   3 
primary 'Procopio, A.'  4 
primary 'Oliverio, M.'  5 
primary 'Lamba, D.'     6 
# 
_cell.entry_id           5NAP 
_cell.length_a           111.530 
_cell.length_b           111.530 
_cell.length_c           136.880 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5NAP 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat Acetylcholinesterase                                                                      61325.090 1   3.1.1.7 
? ? ? 
2 non-polymer man N-ACETYL-D-GLUCOSAMINE                                                                    221.208   5   ?       
? ? ? 
3 non-polymer man ALPHA-L-FUCOSE                                                                            164.156   1   ?       
? ? ? 
4 non-polymer man BETA-D-MANNOSE                                                                            180.156   2   ?       
? ? ? 
5 non-polymer man ALPHA-D-MANNOSE                                                                           180.156   2   ?       
? ? ? 
6 non-polymer man '(2~{E})-5,6-dimethoxy-2-[[1-(phenylmethyl)piperidin-4-yl]methylidene]-3~{H}-inden-1-one' 377.476   1   ?       
? ? ? 
7 water       nat water                                                                                     18.015    425 ?       
? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           543 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Tetronarce californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TETCF 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_struct_ref.pdbx_align_begin           22 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5NAP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                   ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                  ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                           ? 'C4 H7 N O4' 
133.103 
BMA D-saccharide        . BETA-D-MANNOSE                                                                            ? 'C6 H12 O6' 
180.156 
CYS 'L-peptide linking' y CYSTEINE                                                                                  ? 
'C3 H7 N O2 S'   121.158 
DZ7 non-polymer         . '(2~{E})-5,6-dimethoxy-2-[[1-(phenylmethyl)piperidin-4-yl]methylidene]-3~{H}-inden-1-one' ? 
'C24 H27 N O3'   377.476 
FUC saccharide          . ALPHA-L-FUCOSE                                                                            ? 'C6 H12 O5' 
164.156 
GLN 'L-peptide linking' y GLUTAMINE                                                                                 ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                           ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                   ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                 ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                     ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                   ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                    ? 
'C6 H15 N2 O2 1' 147.195 
MAN D-saccharide        . ALPHA-D-MANNOSE                                                                           ? 'C6 H12 O6' 
180.156 
MET 'L-peptide linking' y METHIONINE                                                                                ? 
'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                                                                    ? 
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE                                                                             ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                   ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                    ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                 ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                  ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                    ? 
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NAP 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         69.31 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;MES 100 mM, pH 6.2
PEG 200 30%
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-07-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5NAP 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             78.920 
_reflns.d_resolution_high            2.170 
_reflns.number_obs                   52442 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.11900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.2000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.900 
_reflns.pdbx_CC_half                 ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.17 
_reflns_shell.d_res_low              2.29 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.52600 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.100 
_reflns_shell.pdbx_redundancy        5.80 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5NAP 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     49664 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             55.90 
_refine.ls_d_res_high                            2.17 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.172 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.170 
_refine.ls_R_factor_R_free                       0.210 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.200 
_refine.ls_number_reflns_R_free                  2705 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.B_iso_mean                               30.66 
_refine.aniso_B[1][1]                            0.85000 
_refine.aniso_B[2][2]                            0.85000 
_refine.aniso_B[3][3]                            -2.76000 
_refine.aniso_B[1][2]                            0.85000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING
 POSITIONS
;
_refine.pdbx_starting_model                      5E4T 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.149 
_refine.pdbx_overall_ESU_R_Free                  0.144 
_refine.overall_SU_ML                            0.092 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.489 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4206 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         152 
_refine_hist.number_atoms_solvent             425 
_refine_hist.number_atoms_total               4783 
_refine_hist.d_res_high                       2.17 
_refine_hist.d_res_low                        55.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.021  0.019  ? 4521 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 4122 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.037  1.983  ? 6164 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.995  3.004  ? 9459 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.762  5.000  ? 535  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.003 23.971 ? 204  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.570 15.000 ? 692  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       16.832 15.000 ? 23   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.127  0.200  ? 675  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.011  0.021  ? 5036 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1071 'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.626  2.711  ? 2131 'X-RAY DIFFRACTION' ? 
r_mcbond_other               2.616  2.708  ? 2130 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.621  4.048  ? 2663 'X-RAY DIFFRACTION' ? 
r_mcangle_other              3.625  4.051  ? 2664 'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.240  3.330  ? 2390 'X-RAY DIFFRACTION' ? 
r_scbond_other               4.239  3.330  ? 2391 'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              6.187  4.859  ? 3500 'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       7.239  23.894 ? 5545 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         7.175  23.477 ? 5375 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.17 
_refine_ls_shell.d_res_low                        2.23 
_refine_ls_shell.number_reflns_R_work             3643 
_refine_ls_shell.R_factor_R_work                  0.2080 
_refine_ls_shell.percent_reflns_obs               99.95 
_refine_ls_shell.R_factor_R_free                  0.2630 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             188 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5NAP 
_struct.title                        
'Torpedo californica acetylcholinesterase in complex with a non-chiral donepezil-like inhibitor 17' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NAP 
_struct_keywords.text            
;Acetylcholinesterase, inhibitors, Alzheimer's disease, donepezil analogues, green chemistry, hydrolase
;
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 2 ? 
E N N 2 ? 
F N N 4 ? 
G N N 5 ? 
H N N 2 ? 
I N N 2 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
M N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  AA4 GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  AA5 GLY A 151 ? LEU A 156 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P6  AA6 ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  AA7 GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  AA8 SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  AA9 SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 AB1 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 AB2 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 AB3 LYS A 270 ? TRP A 279 ? LYS A 270 TRP A 279 1 ? 10 
HELX_P HELX_P13 AB4 ASN A 280 ? LEU A 282 ? ASN A 280 LEU A 282 5 ? 3  
HELX_P HELX_P14 AB5 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 AB6 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 AB7 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P18 AB9 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 AC1 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 AC2 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 AC3 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 AC4 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P23 AC5 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P24 AC6 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P25 AC7 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.127 ? 
disulf2  disulf ?    ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.115 ? 
disulf3  disulf ?    ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.068 ? 
covale1  covale one  ? A ASN 59  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 59  A NAG 601 1_555 ? ? ? ? ? ? ? 1.473 ? 
covale2  covale one  ? A ASN 416 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 416 A NAG 603 1_555 ? ? ? ? ? ? ? 1.458 ? 
covale3  covale one  ? A ASN 457 ND2 ? ? ? 1_555 H NAG .   C1 ? ? A ASN 457 A NAG 607 1_555 ? ? ? ? ? ? ? 1.447 ? 
covale4  covale one  ? B NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? A NAG 601 A FUC 602 1_555 ? ? ? ? ? ? ? 1.438 ? 
covale5  covale both ? D NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? A NAG 603 A NAG 604 1_555 ? ? ? ? ? ? ? 1.449 ? 
covale6  covale both ? E NAG .   O4  ? ? ? 1_555 F BMA .   C1 ? ? A NAG 604 A BMA 605 1_555 ? ? ? ? ? ? ? 1.454 ? 
covale7  covale one  ? F BMA .   O3  ? ? ? 1_555 G MAN .   C1 ? ? A BMA 605 A MAN 606 1_555 ? ? ? ? ? ? ? 1.460 ? 
covale8  covale both ? H NAG .   O4  ? ? ? 1_555 I NAG .   C1 ? ? A NAG 607 A NAG 608 1_555 ? ? ? ? ? ? ? 1.459 ? 
covale9  covale both ? I NAG .   O4  ? ? ? 1_555 J BMA .   C1 ? ? A NAG 608 A BMA 609 1_555 ? ? ? ? ? ? ? 1.468 ? 
covale10 covale one  ? J BMA .   O3  ? ? ? 1_555 K MAN .   C1 ? ? A BMA 609 A MAN 610 1_555 ? ? ? ? ? ? ? 1.460 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA1 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AA2 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AA2 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AA2 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AA2 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AA2 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AA2 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AA2 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AA2 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AA2 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AA2 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AA2 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AA3 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AA3 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA1 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AA2 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AA2 2  3  N PHE A 30  ? N PHE A 30  O ILE A 99  ? O ILE A 99  
AA2 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AA2 4  5  O VAL A 144 ? O VAL A 144 N TRP A 114 ? N TRP A 114 
AA2 5  6  N THR A 109 ? N THR A 109 O ASP A 190 ? O ASP A 190 
AA2 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
AA2 7  8  N ALA A 222 ? N ALA A 222 O LEU A 320 ? O LEU A 320 
AA2 8  9  N VAL A 323 ? N VAL A 323 O PHE A 423 ? O PHE A 423 
AA2 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AA2 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AA3 1  2  N VAL A 236 ? N VAL A 236 O ILE A 296 ? O ILE A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A DZ7 611 ? 10 'binding site for residue DZ7 A 611'                                                       
AC2 Software A ASN 59  ? 2  'binding site for Poly-Saccharide residues NAG A 601 through FUC A 602 bound to ASN A 59'  
AC3 Software A ASN 416 ? 5  'binding site for Poly-Saccharide residues NAG A 603 through MAN A 606 bound to ASN A 416' 
AC4 Software A ASN 457 ? 5  'binding site for Poly-Saccharide residues NAG A 607 through MAN A 610 bound to ASN A 457' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 TYR A 70  ? TYR A 70  . ? 1_555 ? 
2  AC1 10 TRP A 84  ? TRP A 84  . ? 1_555 ? 
3  AC1 10 TYR A 121 ? TYR A 121 . ? 1_555 ? 
4  AC1 10 GLU A 199 ? GLU A 199 . ? 1_555 ? 
5  AC1 10 TRP A 279 ? TRP A 279 . ? 1_555 ? 
6  AC1 10 PHE A 330 ? PHE A 330 . ? 1_555 ? 
7  AC1 10 PHE A 331 ? PHE A 331 . ? 1_555 ? 
8  AC1 10 TYR A 334 ? TYR A 334 . ? 1_555 ? 
9  AC1 10 HOH M .   ? HOH A 708 . ? 1_555 ? 
10 AC1 10 HOH M .   ? HOH A 850 . ? 1_555 ? 
11 AC2 2  ASN A 59  ? ASN A 59  . ? 1_555 ? 
12 AC2 2  SER A 61  ? SER A 61  . ? 1_555 ? 
13 AC3 5  ASN A 416 ? ASN A 416 . ? 1_555 ? 
14 AC3 5  HOH M .   ? HOH A 704 . ? 1_555 ? 
15 AC3 5  HOH M .   ? HOH A 740 . ? 1_555 ? 
16 AC3 5  HOH M .   ? HOH A 831 . ? 1_555 ? 
17 AC3 5  HOH M .   ? HOH A 936 . ? 1_555 ? 
18 AC4 5  LYS A 413 ? LYS A 413 . ? 2_745 ? 
19 AC4 5  PHE A 414 ? PHE A 414 . ? 2_745 ? 
20 AC4 5  GLU A 455 ? GLU A 455 . ? 1_555 ? 
21 AC4 5  ASN A 457 ? ASN A 457 . ? 1_555 ? 
22 AC4 5  HOH M .   ? HOH A 705 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5NAP 
_atom_sites.fract_transf_matrix[1][1]   0.008966 
_atom_sites.fract_transf_matrix[1][2]   0.005177 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010353 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007306 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? 180.926 55.040 148.323 1.00 50.11  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? 181.754 54.679 149.529 1.00 51.38  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? 181.508 53.223 149.978 1.00 46.10  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? 180.429 52.648 149.789 1.00 42.94  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? 181.447 55.636 150.684 1.00 52.28  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? 181.972 55.147 151.915 1.00 60.47  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? 182.536 52.641 150.564 1.00 35.97  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? 182.500 51.293 151.096 1.00 34.48  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? 181.422 51.084 152.180 1.00 36.60  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? 180.894 49.984 152.293 1.00 33.14  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? 183.848 50.958 151.664 1.00 37.53  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? 184.007 49.480 152.071 1.00 44.13  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? 185.462 49.116 152.391 1.00 44.31  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? 186.252 50.061 152.443 1.00 47.43  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? 185.822 47.913 152.564 1.00 44.20  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? 181.127 52.135 152.964 1.00 31.67  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? 180.202 52.087 154.080 1.00 30.49  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? 178.812 52.486 153.660 1.00 29.70  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? 177.908 52.514 154.477 1.00 31.11  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? 180.689 53.023 155.192 1.00 29.53  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? 182.097 52.686 155.663 1.00 30.63  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? 182.501 53.758 156.691 1.00 36.41  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? 182.125 51.323 156.320 1.00 34.25  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? 178.622 52.800 152.392 1.00 31.75  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? 177.316 53.055 151.885 1.00 33.77  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? 176.834 51.897 151.019 1.00 29.64  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? 177.535 51.433 150.118 1.00 32.23  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? 177.248 54.388 151.127 1.00 39.16  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? 175.800 54.662 150.711 1.00 48.49  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? 174.979 55.218 151.873 1.00 52.75  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? 175.741 55.601 149.510 1.00 57.90  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? 175.645 51.384 151.345 1.00 29.82  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? 175.076 50.266 150.598 1.00 27.80  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? 173.655 50.585 150.343 1.00 27.96  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? 172.908 50.998 151.255 1.00 30.21  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? 175.198 48.891 151.304 1.00 29.55  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? 174.420 47.774 150.533 1.00 26.51  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? 176.646 48.516 151.491 1.00 24.92  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? 173.274 50.456 149.079 1.00 26.38  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? 171.870 50.672 148.711 1.00 31.85  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? 171.144 49.316 148.615 1.00 29.26  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? 171.633 48.424 147.996 1.00 33.37  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? 171.742 51.469 147.414 1.00 37.72  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? 170.314 51.905 147.165 1.00 45.52  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? 169.485 51.954 148.079 1.00 48.46  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? 170.017 52.226 145.932 1.00 53.49  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? 169.997 49.165 149.269 1.00 28.86  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? 169.359 47.877 149.387 1.00 25.07  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? 167.996 48.115 148.840 1.00 26.24  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? 167.604 49.235 148.708 1.00 22.75  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? 169.245 47.434 150.893 1.00 25.57  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? 168.253 48.200 151.606 1.00 22.34  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? 170.540 47.520 151.599 1.00 23.80  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? 167.196 47.079 148.672 1.00 25.48  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? 165.811 47.266 148.228 1.00 22.63  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? 164.862 47.909 149.244 1.00 27.87  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? 163.714 48.210 148.930 1.00 30.08  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? 165.283 45.894 147.938 1.00 26.39  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? 166.140 45.156 146.925 1.00 24.67  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? 165.577 43.733 146.799 1.00 25.06  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? 166.138 43.195 145.498 1.00 26.11  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? 166.429 41.768 145.455 1.00 25.78  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? 165.321 48.111 150.476 1.00 27.73  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? 164.532 48.800 151.494 1.00 28.75  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? 165.021 50.240 151.682 1.00 27.43  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? 164.347 51.040 152.365 1.00 30.61  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? 164.661 48.071 152.886 1.00 32.18  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? 164.295 46.690 152.771 1.00 36.87  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? 166.228 50.520 151.175 1.00 28.70  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? 166.789 51.856 151.189 1.00 28.01  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? 168.264 51.804 151.414 1.00 28.36  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? 168.868 50.723 151.498 1.00 29.08  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? 168.867 52.973 151.528 1.00 25.83  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? 170.286 53.042 151.746 1.00 29.54  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? 170.634 52.881 153.206 1.00 27.68  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? 169.884 53.344 154.052 1.00 27.01  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? 170.800 54.421 151.363 1.00 33.13  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? 170.726 54.703 149.862 1.00 45.59  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? 171.466 55.989 149.490 1.00 52.83  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? 171.925 56.013 148.032 1.00 65.10  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? 171.302 57.176 147.333 1.00 73.13  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? 171.828 52.392 153.480 1.00 24.16  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? 172.259 52.294 154.824 1.00 26.88  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? 173.697 52.650 154.835 1.00 27.69  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? 174.443 52.275 153.910 1.00 28.97  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? 172.165 50.855 155.426 1.00 28.50  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? 170.752 50.319 155.375 1.00 28.64  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? 173.048 49.911 154.671 1.00 28.48  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? 174.099 53.219 155.969 1.00 27.74  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? 175.480 53.616 156.246 1.00 28.74  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? 176.039 52.929 157.464 1.00 26.89  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? 175.526 53.077 158.559 1.00 32.47  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? 175.503 55.131 156.549 1.00 34.83  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? 176.888 55.719 156.790 1.00 44.49  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? 177.932 55.683 155.354 1.00 62.60  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? 177.264 56.961 154.410 1.00 43.34  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? 177.135 52.248 157.266 1.00 27.07  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? 177.771 51.500 158.307 1.00 32.51  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? 178.961 52.228 158.843 1.00 32.60  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? 179.042 53.451 158.724 1.00 32.36  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? 179.886 51.474 159.417 1.00 32.54  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? 180.965 52.059 160.179 1.00 31.64  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? 182.105 51.161 160.066 1.00 30.12  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? 181.889 49.972 159.942 1.00 34.39  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? 180.546 52.244 161.663 1.00 34.72  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? 181.595 52.891 162.352 1.00 37.91  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? 180.301 50.883 162.377 1.00 36.82  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? 183.322 51.707 160.068 1.00 29.24  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? 184.545 50.919 159.906 1.00 34.41  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? 184.932 50.491 161.332 1.00 33.06  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? 184.842 51.287 162.256 1.00 41.00  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? 185.673 51.735 159.163 1.00 36.29  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? 186.978 50.998 158.876 1.00 41.20  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? 187.985 51.619 157.828 1.00 39.31  ? 19   ARG A CD  1 
ATOM   115  N N   . VAL A 1 20  ? 185.274 49.226 161.542 1.00 32.32  ? 20   VAL A N   1 
ATOM   116  C CA  . VAL A 1 20  ? 185.542 48.758 162.880 1.00 31.72  ? 20   VAL A CA  1 
ATOM   117  C C   . VAL A 1 20  ? 186.849 48.090 162.888 1.00 30.50  ? 20   VAL A C   1 
ATOM   118  O O   . VAL A 1 20  ? 187.166 47.394 161.972 1.00 31.24  ? 20   VAL A O   1 
ATOM   119  C CB  . VAL A 1 20  ? 184.454 47.816 163.477 1.00 35.73  ? 20   VAL A CB  1 
ATOM   120  C CG1 . VAL A 1 20  ? 183.144 48.536 163.517 1.00 37.63  ? 20   VAL A CG1 1 
ATOM   121  C CG2 . VAL A 1 20  ? 184.311 46.531 162.710 1.00 37.06  ? 20   VAL A CG2 1 
ATOM   122  N N   . PRO A 1 21  ? 187.631 48.299 163.954 1.00 34.94  ? 21   PRO A N   1 
ATOM   123  C CA  . PRO A 1 21  ? 188.943 47.664 164.032 1.00 34.86  ? 21   PRO A CA  1 
ATOM   124  C C   . PRO A 1 21  ? 188.784 46.215 164.470 1.00 34.40  ? 21   PRO A C   1 
ATOM   125  O O   . PRO A 1 21  ? 187.842 45.921 165.174 1.00 31.30  ? 21   PRO A O   1 
ATOM   126  C CB  . PRO A 1 21  ? 189.675 48.521 165.068 1.00 35.80  ? 21   PRO A CB  1 
ATOM   127  C CG  . PRO A 1 21  ? 188.590 49.151 165.887 1.00 36.66  ? 21   PRO A CG  1 
ATOM   128  C CD  . PRO A 1 21  ? 187.403 49.298 165.017 1.00 36.32  ? 21   PRO A CD  1 
ATOM   129  N N   . VAL A 1 22  ? 189.671 45.327 164.026 1.00 30.76  ? 22   VAL A N   1 
ATOM   130  C CA  . VAL A 1 22  ? 189.632 43.942 164.372 1.00 32.73  ? 22   VAL A CA  1 
ATOM   131  C C   . VAL A 1 22  ? 191.023 43.377 164.171 1.00 35.01  ? 22   VAL A C   1 
ATOM   132  O O   . VAL A 1 22  ? 191.503 43.336 163.029 1.00 36.31  ? 22   VAL A O   1 
ATOM   133  C CB  . VAL A 1 22  ? 188.580 43.114 163.516 1.00 34.28  ? 22   VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 22  ? 188.676 43.378 162.010 1.00 35.78  ? 22   VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 22  ? 188.706 41.632 163.760 1.00 32.74  ? 22   VAL A CG2 1 
ATOM   136  N N   . LEU A 1 23  ? 191.652 42.886 165.248 1.00 34.58  ? 23   LEU A N   1 
ATOM   137  C CA  . LEU A 1 23  ? 192.962 42.193 165.149 1.00 40.51  ? 23   LEU A CA  1 
ATOM   138  C C   . LEU A 1 23  ? 194.017 42.909 164.262 1.00 40.57  ? 23   LEU A C   1 
ATOM   139  O O   . LEU A 1 23  ? 194.705 42.252 163.477 1.00 41.56  ? 23   LEU A O   1 
ATOM   140  C CB  . LEU A 1 23  ? 192.779 40.757 164.625 1.00 42.53  ? 23   LEU A CB  1 
ATOM   141  C CG  . LEU A 1 23  ? 191.903 39.838 165.498 1.00 50.36  ? 23   LEU A CG  1 
ATOM   142  C CD1 . LEU A 1 23  ? 191.661 38.492 164.825 1.00 48.22  ? 23   LEU A CD1 1 
ATOM   143  C CD2 . LEU A 1 23  ? 192.523 39.644 166.895 1.00 49.43  ? 23   LEU A CD2 1 
ATOM   144  N N   . SER A 1 24  ? 194.134 44.225 164.415 1.00 39.16  ? 24   SER A N   1 
ATOM   145  C CA  . SER A 1 24  ? 195.151 45.017 163.698 1.00 48.67  ? 24   SER A CA  1 
ATOM   146  C C   . SER A 1 24  ? 194.764 45.423 162.295 1.00 47.79  ? 24   SER A C   1 
ATOM   147  O O   . SER A 1 24  ? 195.612 45.958 161.574 1.00 44.75  ? 24   SER A O   1 
ATOM   148  C CB  . SER A 1 24  ? 196.473 44.268 163.580 1.00 49.59  ? 24   SER A CB  1 
ATOM   149  O OG  . SER A 1 24  ? 196.907 43.903 164.852 1.00 51.68  ? 24   SER A OG  1 
ATOM   150  N N   . SER A 1 25  ? 193.499 45.182 161.921 1.00 37.40  ? 25   SER A N   1 
ATOM   151  C CA  . SER A 1 25  ? 193.016 45.491 160.598 1.00 32.91  ? 25   SER A CA  1 
ATOM   152  C C   . SER A 1 25  ? 191.685 46.103 160.807 1.00 33.65  ? 25   SER A C   1 
ATOM   153  O O   . SER A 1 25  ? 191.403 46.592 161.916 1.00 30.16  ? 25   SER A O   1 
ATOM   154  C CB  . SER A 1 25  ? 193.041 44.274 159.715 1.00 33.88  ? 25   SER A CB  1 
ATOM   155  O OG  . SER A 1 25  ? 192.536 44.519 158.414 1.00 36.67  ? 25   SER A OG  1 
ATOM   156  N N   . HIS A 1 26  ? 190.856 46.131 159.775 1.00 31.52  ? 26   HIS A N   1 
ATOM   157  C CA  . HIS A 1 26  ? 189.570 46.829 159.887 1.00 33.89  ? 26   HIS A CA  1 
ATOM   158  C C   . HIS A 1 26  ? 188.559 46.087 159.027 1.00 32.93  ? 26   HIS A C   1 
ATOM   159  O O   . HIS A 1 26  ? 188.947 45.416 158.063 1.00 30.80  ? 26   HIS A O   1 
ATOM   160  C CB  . HIS A 1 26  ? 189.711 48.268 159.384 1.00 42.28  ? 26   HIS A CB  1 
ATOM   161  C CG  . HIS A 1 26  ? 190.573 49.131 160.258 1.00 51.03  ? 26   HIS A CG  1 
ATOM   162  N ND1 . HIS A 1 26  ? 190.048 50.026 161.176 1.00 62.34  ? 26   HIS A ND1 1 
ATOM   163  C CD2 . HIS A 1 26  ? 191.922 49.235 160.364 1.00 55.58  ? 26   HIS A CD2 1 
ATOM   164  C CE1 . HIS A 1 26  ? 191.033 50.642 161.808 1.00 57.93  ? 26   HIS A CE1 1 
ATOM   165  N NE2 . HIS A 1 26  ? 192.180 50.180 161.334 1.00 60.79  ? 26   HIS A NE2 1 
ATOM   166  N N   . ILE A 1 27  ? 187.273 46.220 159.339 1.00 30.19  ? 27   ILE A N   1 
ATOM   167  C CA  . ILE A 1 27  ? 186.235 45.762 158.413 1.00 27.65  ? 27   ILE A CA  1 
ATOM   168  C C   . ILE A 1 27  ? 185.088 46.699 158.515 1.00 26.63  ? 27   ILE A C   1 
ATOM   169  O O   . ILE A 1 27  ? 185.201 47.660 159.246 1.00 28.76  ? 27   ILE A O   1 
ATOM   170  C CB  . ILE A 1 27  ? 185.857 44.326 158.659 1.00 31.76  ? 27   ILE A CB  1 
ATOM   171  C CG1 . ILE A 1 27  ? 185.253 44.159 160.031 1.00 35.19  ? 27   ILE A CG1 1 
ATOM   172  C CG2 . ILE A 1 27  ? 187.057 43.414 158.431 1.00 30.72  ? 27   ILE A CG2 1 
ATOM   173  C CD1 . ILE A 1 27  ? 184.761 42.745 160.167 1.00 43.35  ? 27   ILE A CD1 1 
ATOM   174  N N   . SER A 1 28  ? 183.999 46.458 157.801 1.00 25.86  ? 28   SER A N   1 
ATOM   175  C CA  . SER A 1 28  ? 182.899 47.354 157.838 1.00 25.04  ? 28   SER A CA  1 
ATOM   176  C C   . SER A 1 28  ? 181.809 46.651 158.638 1.00 25.67  ? 28   SER A C   1 
ATOM   177  O O   . SER A 1 28  ? 181.679 45.447 158.576 1.00 26.72  ? 28   SER A O   1 
ATOM   178  C CB  . SER A 1 28  ? 182.368 47.703 156.432 1.00 28.88  ? 28   SER A CB  1 
ATOM   179  O OG  . SER A 1 28  ? 183.386 47.925 155.430 1.00 29.16  ? 28   SER A OG  1 
ATOM   180  N N   . ALA A 1 29  ? 180.984 47.411 159.339 1.00 26.60  ? 29   ALA A N   1 
ATOM   181  C CA  . ALA A 1 29  ? 179.921 46.809 160.110 1.00 27.45  ? 29   ALA A CA  1 
ATOM   182  C C   . ALA A 1 29  ? 178.685 47.582 159.840 1.00 26.32  ? 29   ALA A C   1 
ATOM   183  O O   . ALA A 1 29  ? 178.742 48.816 159.786 1.00 26.85  ? 29   ALA A O   1 
ATOM   184  C CB  . ALA A 1 29  ? 180.267 46.855 161.612 1.00 29.84  ? 29   ALA A CB  1 
ATOM   185  N N   . PHE A 1 30  ? 177.548 46.899 159.670 1.00 24.95  ? 30   PHE A N   1 
ATOM   186  C CA  . PHE A 1 30  ? 176.286 47.585 159.466 1.00 24.49  ? 30   PHE A CA  1 
ATOM   187  C C   . PHE A 1 30  ? 175.380 47.053 160.548 1.00 25.79  ? 30   PHE A C   1 
ATOM   188  O O   . PHE A 1 30  ? 174.890 45.899 160.468 1.00 22.96  ? 30   PHE A O   1 
ATOM   189  C CB  . PHE A 1 30  ? 175.694 47.271 158.069 1.00 25.51  ? 30   PHE A CB  1 
ATOM   190  C CG  . PHE A 1 30  ? 176.592 47.682 156.925 1.00 25.04  ? 30   PHE A CG  1 
ATOM   191  C CD1 . PHE A 1 30  ? 177.643 46.888 156.575 1.00 22.29  ? 30   PHE A CD1 1 
ATOM   192  C CD2 . PHE A 1 30  ? 176.358 48.867 156.235 1.00 23.61  ? 30   PHE A CD2 1 
ATOM   193  C CE1 . PHE A 1 30  ? 178.502 47.260 155.588 1.00 26.06  ? 30   PHE A CE1 1 
ATOM   194  C CE2 . PHE A 1 30  ? 177.197 49.226 155.200 1.00 25.08  ? 30   PHE A CE2 1 
ATOM   195  C CZ  . PHE A 1 30  ? 178.266 48.413 154.883 1.00 22.64  ? 30   PHE A CZ  1 
ATOM   196  N N   . LEU A 1 31  ? 175.183 47.860 161.571 1.00 25.42  ? 31   LEU A N   1 
ATOM   197  C CA  . LEU A 1 31  ? 174.599 47.405 162.832 1.00 24.91  ? 31   LEU A CA  1 
ATOM   198  C C   . LEU A 1 31  ? 173.228 47.991 162.912 1.00 23.88  ? 31   LEU A C   1 
ATOM   199  O O   . LEU A 1 31  ? 173.053 49.150 162.576 1.00 28.49  ? 31   LEU A O   1 
ATOM   200  C CB  . LEU A 1 31  ? 175.442 47.933 163.989 1.00 26.69  ? 31   LEU A CB  1 
ATOM   201  C CG  . LEU A 1 31  ? 176.884 47.514 163.968 1.00 27.45  ? 31   LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 31  ? 177.635 47.963 165.219 1.00 28.74  ? 31   LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 31  ? 176.938 46.012 163.828 1.00 28.81  ? 31   LEU A CD2 1 
ATOM   204  N N   . GLY A 1 32  ? 172.228 47.204 163.300 1.00 23.22  ? 32   GLY A N   1 
ATOM   205  C CA  . GLY A 1 32  ? 170.897 47.762 163.588 1.00 23.17  ? 32   GLY A CA  1 
ATOM   206  C C   . GLY A 1 32  ? 170.058 48.117 162.342 1.00 23.53  ? 32   GLY A C   1 
ATOM   207  O O   . GLY A 1 32  ? 169.305 49.086 162.334 1.00 23.22  ? 32   GLY A O   1 
ATOM   208  N N   . ILE A 1 33  ? 170.150 47.288 161.300 1.00 25.48  ? 33   ILE A N   1 
ATOM   209  C CA  . ILE A 1 33  ? 169.289 47.442 160.135 1.00 22.92  ? 33   ILE A CA  1 
ATOM   210  C C   . ILE A 1 33  ? 167.935 46.823 160.408 1.00 23.39  ? 33   ILE A C   1 
ATOM   211  O O   . ILE A 1 33  ? 167.846 45.644 160.750 1.00 24.00  ? 33   ILE A O   1 
ATOM   212  C CB  . ILE A 1 33  ? 169.903 46.740 158.915 1.00 26.42  ? 33   ILE A CB  1 
ATOM   213  C CG1 . ILE A 1 33  ? 171.257 47.334 158.611 1.00 25.53  ? 33   ILE A CG1 1 
ATOM   214  C CG2 . ILE A 1 33  ? 168.965 46.912 157.706 1.00 29.17  ? 33   ILE A CG2 1 
ATOM   215  C CD1 . ILE A 1 33  ? 171.982 46.577 157.544 1.00 27.01  ? 33   ILE A CD1 1 
ATOM   216  N N   . PRO A 1 34  ? 166.856 47.579 160.209 1.00 22.89  ? 34   PRO A N   1 
ATOM   217  C CA  . PRO A 1 34  ? 165.549 47.040 160.442 1.00 24.76  ? 34   PRO A CA  1 
ATOM   218  C C   . PRO A 1 34  ? 165.061 46.096 159.344 1.00 28.74  ? 34   PRO A C   1 
ATOM   219  O O   . PRO A 1 34  ? 165.281 46.401 158.187 1.00 30.29  ? 34   PRO A O   1 
ATOM   220  C CB  . PRO A 1 34  ? 164.670 48.278 160.437 1.00 23.99  ? 34   PRO A CB  1 
ATOM   221  C CG  . PRO A 1 34  ? 165.360 49.250 159.552 1.00 24.61  ? 34   PRO A CG  1 
ATOM   222  C CD  . PRO A 1 34  ? 166.820 48.982 159.734 1.00 24.14  ? 34   PRO A CD  1 
ATOM   223  N N   . PHE A 1 35  ? 164.385 44.998 159.703 1.00 25.81  ? 35   PHE A N   1 
ATOM   224  C CA  . PHE A 1 35  ? 163.899 44.041 158.707 1.00 24.53  ? 35   PHE A CA  1 
ATOM   225  C C   . PHE A 1 35  ? 162.420 43.845 158.778 1.00 26.07  ? 35   PHE A C   1 
ATOM   226  O O   . PHE A 1 35  ? 161.853 43.161 157.933 1.00 29.38  ? 35   PHE A O   1 
ATOM   227  C CB  . PHE A 1 35  ? 164.663 42.725 158.765 1.00 23.06  ? 35   PHE A CB  1 
ATOM   228  C CG  . PHE A 1 35  ? 164.482 41.955 160.048 1.00 24.82  ? 35   PHE A CG  1 
ATOM   229  C CD1 . PHE A 1 35  ? 163.325 41.244 160.276 1.00 21.51  ? 35   PHE A CD1 1 
ATOM   230  C CD2 . PHE A 1 35  ? 165.492 41.939 161.016 1.00 22.18  ? 35   PHE A CD2 1 
ATOM   231  C CE1 . PHE A 1 35  ? 163.175 40.516 161.458 1.00 25.96  ? 35   PHE A CE1 1 
ATOM   232  C CE2 . PHE A 1 35  ? 165.310 41.253 162.202 1.00 25.27  ? 35   PHE A CE2 1 
ATOM   233  C CZ  . PHE A 1 35  ? 164.167 40.528 162.403 1.00 21.68  ? 35   PHE A CZ  1 
ATOM   234  N N   . ALA A 1 36  ? 161.782 44.424 159.786 1.00 23.12  ? 36   ALA A N   1 
ATOM   235  C CA  . ALA A 1 36  ? 160.370 44.348 159.931 1.00 25.30  ? 36   ALA A CA  1 
ATOM   236  C C   . ALA A 1 36  ? 159.908 45.648 160.489 1.00 26.83  ? 36   ALA A C   1 
ATOM   237  O O   . ALA A 1 36  ? 160.713 46.387 161.041 1.00 27.83  ? 36   ALA A O   1 
ATOM   238  C CB  . ALA A 1 36  ? 160.057 43.246 160.941 1.00 29.34  ? 36   ALA A CB  1 
ATOM   239  N N   . GLU A 1 37  ? 158.615 45.911 160.416 1.00 25.94  ? 37   GLU A N   1 
ATOM   240  C CA  . GLU A 1 37  ? 158.037 46.984 161.212 1.00 28.54  ? 37   GLU A CA  1 
ATOM   241  C C   . GLU A 1 37  ? 158.080 46.649 162.742 1.00 29.50  ? 37   GLU A C   1 
ATOM   242  O O   . GLU A 1 37  ? 157.838 45.481 163.079 1.00 27.24  ? 37   GLU A O   1 
ATOM   243  C CB  . GLU A 1 37  ? 156.569 47.145 160.818 1.00 31.40  ? 37   GLU A CB  1 
ATOM   244  C CG  . GLU A 1 37  ? 156.396 47.680 159.363 1.00 34.85  ? 37   GLU A CG  1 
ATOM   245  C CD  . GLU A 1 37  ? 156.810 49.139 159.263 1.00 38.65  ? 37   GLU A CD  1 
ATOM   246  O OE1 . GLU A 1 37  ? 156.211 49.911 160.022 1.00 45.31  ? 37   GLU A OE1 1 
ATOM   247  O OE2 . GLU A 1 37  ? 157.764 49.511 158.526 1.00 34.82  ? 37   GLU A OE2 1 
ATOM   248  N N   . PRO A 1 38  ? 158.364 47.637 163.586 1.00 29.89  ? 38   PRO A N   1 
ATOM   249  C CA  . PRO A 1 38  ? 158.333 47.442 165.038 1.00 29.44  ? 38   PRO A CA  1 
ATOM   250  C C   . PRO A 1 38  ? 157.032 46.762 165.433 1.00 29.31  ? 38   PRO A C   1 
ATOM   251  O O   . PRO A 1 38  ? 155.957 47.220 165.046 1.00 27.63  ? 38   PRO A O   1 
ATOM   252  C CB  . PRO A 1 38  ? 158.368 48.871 165.579 1.00 27.94  ? 38   PRO A CB  1 
ATOM   253  C CG  . PRO A 1 38  ? 159.084 49.648 164.528 1.00 31.18  ? 38   PRO A CG  1 
ATOM   254  C CD  . PRO A 1 38  ? 158.685 49.027 163.219 1.00 31.42  ? 38   PRO A CD  1 
ATOM   255  N N   . PRO A 1 39  ? 157.131 45.675 166.187 1.00 27.06  ? 39   PRO A N   1 
ATOM   256  C CA  . PRO A 1 39  ? 155.961 44.875 166.519 1.00 27.30  ? 39   PRO A CA  1 
ATOM   257  C C   . PRO A 1 39  ? 155.299 45.344 167.839 1.00 34.88  ? 39   PRO A C   1 
ATOM   258  O O   . PRO A 1 39  ? 155.247 44.594 168.858 1.00 37.48  ? 39   PRO A O   1 
ATOM   259  C CB  . PRO A 1 39  ? 156.540 43.491 166.592 1.00 27.36  ? 39   PRO A CB  1 
ATOM   260  C CG  . PRO A 1 39  ? 157.883 43.710 167.170 1.00 28.60  ? 39   PRO A CG  1 
ATOM   261  C CD  . PRO A 1 39  ? 158.368 44.974 166.482 1.00 29.99  ? 39   PRO A CD  1 
ATOM   262  N N   . VAL A 1 40  ? 154.804 46.585 167.787 1.00 34.88  ? 40   VAL A N   1 
ATOM   263  C CA  . VAL A 1 40  ? 154.344 47.347 168.952 1.00 31.93  ? 40   VAL A CA  1 
ATOM   264  C C   . VAL A 1 40  ? 152.864 47.657 168.880 1.00 36.23  ? 40   VAL A C   1 
ATOM   265  O O   . VAL A 1 40  ? 152.225 47.490 167.833 1.00 37.46  ? 40   VAL A O   1 
ATOM   266  C CB  . VAL A 1 40  ? 155.116 48.656 169.174 1.00 31.54  ? 40   VAL A CB  1 
ATOM   267  C CG1 . VAL A 1 40  ? 156.603 48.358 169.297 1.00 34.44  ? 40   VAL A CG1 1 
ATOM   268  C CG2 . VAL A 1 40  ? 154.874 49.715 168.068 1.00 34.49  ? 40   VAL A CG2 1 
ATOM   269  N N   . GLY A 1 41  ? 152.301 48.004 170.038 1.00 35.51  ? 41   GLY A N   1 
ATOM   270  C CA  . GLY A 1 41  ? 150.884 48.326 170.164 1.00 33.12  ? 41   GLY A CA  1 
ATOM   271  C C   . GLY A 1 41  ? 150.013 47.166 169.800 1.00 33.11  ? 41   GLY A C   1 
ATOM   272  O O   . GLY A 1 41  ? 150.203 46.037 170.314 1.00 32.94  ? 41   GLY A O   1 
ATOM   273  N N   . ASN A 1 42  ? 149.087 47.409 168.862 1.00 31.94  ? 42   ASN A N   1 
ATOM   274  C CA  . ASN A 1 42  ? 148.200 46.369 168.362 1.00 31.99  ? 42   ASN A CA  1 
ATOM   275  C C   . ASN A 1 42  ? 148.899 45.306 167.504 1.00 30.25  ? 42   ASN A C   1 
ATOM   276  O O   . ASN A 1 42  ? 148.286 44.315 167.191 1.00 33.65  ? 42   ASN A O   1 
ATOM   277  C CB  . ASN A 1 42  ? 146.913 46.930 167.704 1.00 40.80  ? 42   ASN A CB  1 
ATOM   278  C CG  . ASN A 1 42  ? 145.920 47.491 168.744 1.00 44.98  ? 42   ASN A CG  1 
ATOM   279  N N   . MET A 1 43  ? 150.163 45.484 167.184 1.00 29.57  ? 43   MET A N   1 
ATOM   280  C CA  . MET A 1 43  ? 150.973 44.442 166.504 1.00 33.87  ? 43   MET A CA  1 
ATOM   281  C C   . MET A 1 43  ? 151.689 43.466 167.480 1.00 29.88  ? 43   MET A C   1 
ATOM   282  O O   . MET A 1 43  ? 152.321 42.465 167.056 1.00 28.48  ? 43   MET A O   1 
ATOM   283  C CB  . MET A 1 43  ? 152.061 45.100 165.675 1.00 37.12  ? 43   MET A CB  1 
ATOM   284  C CG  . MET A 1 43  ? 151.553 46.225 164.758 1.00 45.46  ? 43   MET A CG  1 
ATOM   285  S SD  . MET A 1 43  ? 151.845 45.763 163.063 1.00 71.41  ? 43   MET A SD  1 
ATOM   286  C CE  . MET A 1 43  ? 150.380 44.740 162.876 1.00 55.32  ? 43   MET A CE  1 
ATOM   287  N N   . ARG A 1 44  ? 151.592 43.738 168.780 1.00 27.39  ? 44   ARG A N   1 
ATOM   288  C CA  . ARG A 1 44  ? 152.166 42.803 169.781 1.00 23.76  ? 44   ARG A CA  1 
ATOM   289  C C   . ARG A 1 44  ? 151.476 41.492 169.612 1.00 25.17  ? 44   ARG A C   1 
ATOM   290  O O   . ARG A 1 44  ? 150.203 41.411 169.589 1.00 25.10  ? 44   ARG A O   1 
ATOM   291  C CB  . ARG A 1 44  ? 152.024 43.331 171.219 1.00 24.95  ? 44   ARG A CB  1 
ATOM   292  C CG  . ARG A 1 44  ? 152.553 42.342 172.252 1.00 25.54  ? 44   ARG A CG  1 
ATOM   293  C CD  . ARG A 1 44  ? 152.230 42.788 173.670 1.00 26.46  ? 44   ARG A CD  1 
ATOM   294  N NE  . ARG A 1 44  ? 153.050 43.890 174.110 1.00 25.90  ? 44   ARG A NE  1 
ATOM   295  C CZ  . ARG A 1 44  ? 152.757 44.594 175.211 1.00 28.27  ? 44   ARG A CZ  1 
ATOM   296  N NH1 . ARG A 1 44  ? 151.720 44.251 175.981 1.00 29.94  ? 44   ARG A NH1 1 
ATOM   297  N NH2 . ARG A 1 44  ? 153.546 45.549 175.605 1.00 28.51  ? 44   ARG A NH2 1 
ATOM   298  N N   . PHE A 1 45  ? 152.300 40.453 169.518 1.00 22.26  ? 45   PHE A N   1 
ATOM   299  C CA  . PHE A 1 45  ? 151.859 39.045 169.347 1.00 22.88  ? 45   PHE A CA  1 
ATOM   300  C C   . PHE A 1 45  ? 151.508 38.678 167.887 1.00 25.53  ? 45   PHE A C   1 
ATOM   301  O O   . PHE A 1 45  ? 151.345 37.486 167.556 1.00 23.54  ? 45   PHE A O   1 
ATOM   302  C CB  . PHE A 1 45  ? 150.698 38.616 170.248 1.00 27.66  ? 45   PHE A CB  1 
ATOM   303  C CG  . PHE A 1 45  ? 150.851 38.989 171.709 1.00 29.46  ? 45   PHE A CG  1 
ATOM   304  C CD1 . PHE A 1 45  ? 151.945 38.553 172.444 1.00 28.47  ? 45   PHE A CD1 1 
ATOM   305  C CD2 . PHE A 1 45  ? 149.816 39.643 172.375 1.00 30.82  ? 45   PHE A CD2 1 
ATOM   306  C CE1 . PHE A 1 45  ? 152.037 38.836 173.788 1.00 28.76  ? 45   PHE A CE1 1 
ATOM   307  C CE2 . PHE A 1 45  ? 149.913 39.935 173.739 1.00 32.73  ? 45   PHE A CE2 1 
ATOM   308  C CZ  . PHE A 1 45  ? 151.020 39.557 174.428 1.00 29.80  ? 45   PHE A CZ  1 
ATOM   309  N N   . ARG A 1 46  ? 151.459 39.685 167.009 1.00 27.95  ? 46   ARG A N   1 
ATOM   310  C CA  . ARG A 1 46  ? 151.160 39.440 165.590 1.00 32.14  ? 46   ARG A CA  1 
ATOM   311  C C   . ARG A 1 46  ? 152.354 38.972 164.793 1.00 27.24  ? 46   ARG A C   1 
ATOM   312  O O   . ARG A 1 46  ? 153.500 39.289 165.135 1.00 22.20  ? 46   ARG A O   1 
ATOM   313  C CB  . ARG A 1 46  ? 150.577 40.716 164.928 1.00 38.74  ? 46   ARG A CB  1 
ATOM   314  C CG  . ARG A 1 46  ? 149.079 40.575 164.729 1.00 51.44  ? 46   ARG A CG  1 
ATOM   315  C CD  . ARG A 1 46  ? 148.480 41.699 163.896 1.00 60.22  ? 46   ARG A CD  1 
ATOM   316  N NE  . ARG A 1 46  ? 147.610 42.531 164.719 1.00 76.58  ? 46   ARG A NE  1 
ATOM   317  C CZ  . ARG A 1 46  ? 147.041 43.686 164.349 1.00 90.49  ? 46   ARG A CZ  1 
ATOM   318  N NH1 . ARG A 1 46  ? 147.251 44.209 163.132 1.00 89.63  ? 46   ARG A NH1 1 
ATOM   319  N NH2 . ARG A 1 46  ? 146.257 44.334 165.224 1.00 86.28  ? 46   ARG A NH2 1 
ATOM   320  N N   . ARG A 1 47  ? 152.093 38.266 163.701 1.00 26.92  ? 47   ARG A N   1 
ATOM   321  C CA  . ARG A 1 47  ? 153.137 38.024 162.664 1.00 28.96  ? 47   ARG A CA  1 
ATOM   322  C C   . ARG A 1 47  ? 153.840 39.313 162.326 1.00 23.98  ? 47   ARG A C   1 
ATOM   323  O O   . ARG A 1 47  ? 153.236 40.346 162.330 1.00 23.51  ? 47   ARG A O   1 
ATOM   324  C CB  . ARG A 1 47  ? 152.556 37.518 161.339 1.00 36.69  ? 47   ARG A CB  1 
ATOM   325  C CG  . ARG A 1 47  ? 151.629 36.364 161.490 1.00 47.12  ? 47   ARG A CG  1 
ATOM   326  C CD  . ARG A 1 47  ? 151.440 35.525 160.234 1.00 57.41  ? 47   ARG A CD  1 
ATOM   327  N NE  . ARG A 1 47  ? 150.907 34.200 160.621 1.00 58.46  ? 47   ARG A NE  1 
ATOM   328  C CZ  . ARG A 1 47  ? 149.660 33.977 161.048 1.00 65.16  ? 47   ARG A CZ  1 
ATOM   329  N NH1 . ARG A 1 47  ? 148.744 34.983 161.170 1.00 48.71  ? 47   ARG A NH1 1 
ATOM   330  N NH2 . ARG A 1 47  ? 149.328 32.722 161.360 1.00 70.52  ? 47   ARG A NH2 1 
ATOM   331  N N   . PRO A 1 48  ? 155.123 39.240 162.021 1.00 20.62  ? 48   PRO A N   1 
ATOM   332  C CA  . PRO A 1 48  ? 155.827 40.408 161.706 1.00 22.36  ? 48   PRO A CA  1 
ATOM   333  C C   . PRO A 1 48  ? 155.379 40.908 160.303 1.00 24.90  ? 48   PRO A C   1 
ATOM   334  O O   . PRO A 1 48  ? 154.889 40.122 159.539 1.00 24.35  ? 48   PRO A O   1 
ATOM   335  C CB  . PRO A 1 48  ? 157.283 39.954 161.647 1.00 19.58  ? 48   PRO A CB  1 
ATOM   336  C CG  . PRO A 1 48  ? 157.219 38.461 161.372 1.00 19.87  ? 48   PRO A CG  1 
ATOM   337  C CD  . PRO A 1 48  ? 155.917 38.005 161.856 1.00 20.83  ? 48   PRO A CD  1 
ATOM   338  N N   . GLU A 1 49  ? 155.567 42.190 160.038 1.00 28.58  ? 49   GLU A N   1 
ATOM   339  C CA  . GLU A 1 49  ? 155.298 42.821 158.721 1.00 32.28  ? 49   GLU A CA  1 
ATOM   340  C C   . GLU A 1 49  ? 156.602 43.362 158.183 1.00 26.90  ? 49   GLU A C   1 
ATOM   341  O O   . GLU A 1 49  ? 157.418 43.869 158.954 1.00 25.28  ? 49   GLU A O   1 
ATOM   342  C CB  . GLU A 1 49  ? 154.354 44.050 158.833 1.00 37.94  ? 49   GLU A CB  1 
ATOM   343  C CG  . GLU A 1 49  ? 153.068 43.871 159.581 1.00 49.37  ? 49   GLU A CG  1 
ATOM   344  C CD  . GLU A 1 49  ? 151.986 43.133 158.810 1.00 59.88  ? 49   GLU A CD  1 
ATOM   345  O OE1 . GLU A 1 49  ? 152.322 42.371 157.879 1.00 71.05  ? 49   GLU A OE1 1 
ATOM   346  O OE2 . GLU A 1 49  ? 150.786 43.300 159.158 1.00 69.67  ? 49   GLU A OE2 1 
ATOM   347  N N   . PRO A 1 50  ? 156.800 43.310 156.861 1.00 28.78  ? 50   PRO A N   1 
ATOM   348  C CA  . PRO A 1 50  ? 158.071 43.761 156.355 1.00 29.03  ? 50   PRO A CA  1 
ATOM   349  C C   . PRO A 1 50  ? 158.288 45.246 156.590 1.00 26.16  ? 50   PRO A C   1 
ATOM   350  O O   . PRO A 1 50  ? 157.355 46.008 156.646 1.00 24.74  ? 50   PRO A O   1 
ATOM   351  C CB  . PRO A 1 50  ? 158.037 43.374 154.847 1.00 35.44  ? 50   PRO A CB  1 
ATOM   352  C CG  . PRO A 1 50  ? 156.626 43.014 154.529 1.00 35.27  ? 50   PRO A CG  1 
ATOM   353  C CD  . PRO A 1 50  ? 155.902 42.747 155.817 1.00 34.42  ? 50   PRO A CD  1 
ATOM   354  N N   . LYS A 1 51  ? 159.514 45.629 156.838 1.00 24.65  ? 51   LYS A N   1 
ATOM   355  C CA  . LYS A 1 51  ? 159.838 47.004 157.036 1.00 30.90  ? 51   LYS A CA  1 
ATOM   356  C C   . LYS A 1 51  ? 159.541 47.783 155.730 1.00 33.35  ? 51   LYS A C   1 
ATOM   357  O O   . LYS A 1 51  ? 160.010 47.376 154.636 1.00 31.67  ? 51   LYS A O   1 
ATOM   358  C CB  . LYS A 1 51  ? 161.322 47.133 157.361 1.00 30.43  ? 51   LYS A CB  1 
ATOM   359  C CG  . LYS A 1 51  ? 161.817 48.541 157.606 1.00 28.17  ? 51   LYS A CG  1 
ATOM   360  C CD  . LYS A 1 51  ? 161.043 49.274 158.690 1.00 30.80  ? 51   LYS A CD  1 
ATOM   361  C CE  . LYS A 1 51  ? 161.637 50.655 158.917 1.00 30.74  ? 51   LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 51  ? 161.173 51.331 160.164 1.00 27.71  ? 51   LYS A NZ  1 
ATOM   363  N N   . LYS A 1 52  ? 158.739 48.844 155.867 1.00 35.79  ? 52   LYS A N   1 
ATOM   364  C CA  . LYS A 1 52  ? 158.439 49.790 154.783 1.00 35.82  ? 52   LYS A CA  1 
ATOM   365  C C   . LYS A 1 52  ? 159.747 50.496 154.387 1.00 33.53  ? 52   LYS A C   1 
ATOM   366  O O   . LYS A 1 52  ? 160.580 50.869 155.217 1.00 30.08  ? 52   LYS A O   1 
ATOM   367  C CB  . LYS A 1 52  ? 157.386 50.808 155.203 1.00 39.40  ? 52   LYS A CB  1 
ATOM   368  C CG  . LYS A 1 52  ? 155.990 50.218 155.403 1.00 45.29  ? 52   LYS A CG  1 
ATOM   369  C CD  . LYS A 1 52  ? 155.039 51.141 156.206 1.00 49.19  ? 52   LYS A CD  1 
ATOM   370  N N   . PRO A 1 53  ? 159.961 50.638 153.099 1.00 34.15  ? 53   PRO A N   1 
ATOM   371  C CA  . PRO A 1 53  ? 161.269 51.159 152.651 1.00 34.88  ? 53   PRO A CA  1 
ATOM   372  C C   . PRO A 1 53  ? 161.446 52.629 153.006 1.00 34.21  ? 53   PRO A C   1 
ATOM   373  O O   . PRO A 1 53  ? 160.471 53.329 153.175 1.00 33.47  ? 53   PRO A O   1 
ATOM   374  C CB  . PRO A 1 53  ? 161.248 50.938 151.153 1.00 39.34  ? 53   PRO A CB  1 
ATOM   375  C CG  . PRO A 1 53  ? 160.163 49.895 150.904 1.00 40.54  ? 53   PRO A CG  1 
ATOM   376  C CD  . PRO A 1 53  ? 159.193 49.949 152.044 1.00 37.04  ? 53   PRO A CD  1 
ATOM   377  N N   . TRP A 1 54  ? 162.674 53.074 153.206 1.00 34.19  ? 54   TRP A N   1 
ATOM   378  C CA  . TRP A 1 54  ? 162.880 54.424 153.722 1.00 35.65  ? 54   TRP A CA  1 
ATOM   379  C C   . TRP A 1 54  ? 163.588 55.262 152.681 1.00 39.10  ? 54   TRP A C   1 
ATOM   380  O O   . TRP A 1 54  ? 164.357 54.743 151.862 1.00 34.21  ? 54   TRP A O   1 
ATOM   381  C CB  . TRP A 1 54  ? 163.658 54.451 155.057 1.00 33.87  ? 54   TRP A CB  1 
ATOM   382  C CG  . TRP A 1 54  ? 164.934 53.767 154.960 1.00 33.45  ? 54   TRP A CG  1 
ATOM   383  C CD1 . TRP A 1 54  ? 166.100 54.279 154.515 1.00 34.67  ? 54   TRP A CD1 1 
ATOM   384  C CD2 . TRP A 1 54  ? 165.161 52.399 155.216 1.00 31.21  ? 54   TRP A CD2 1 
ATOM   385  N NE1 . TRP A 1 54  ? 167.079 53.296 154.506 1.00 33.06  ? 54   TRP A NE1 1 
ATOM   386  C CE2 . TRP A 1 54  ? 166.494 52.134 154.942 1.00 31.29  ? 54   TRP A CE2 1 
ATOM   387  C CE3 . TRP A 1 54  ? 164.354 51.365 155.681 1.00 33.55  ? 54   TRP A CE3 1 
ATOM   388  C CZ2 . TRP A 1 54  ? 167.041 50.897 155.141 1.00 30.32  ? 54   TRP A CZ2 1 
ATOM   389  C CZ3 . TRP A 1 54  ? 164.894 50.156 155.875 1.00 28.68  ? 54   TRP A CZ3 1 
ATOM   390  C CH2 . TRP A 1 54  ? 166.208 49.919 155.607 1.00 31.09  ? 54   TRP A CH2 1 
ATOM   391  N N   . SER A 1 55  ? 163.337 56.572 152.721 1.00 43.47  ? 55   SER A N   1 
ATOM   392  C CA  . SER A 1 55  ? 164.190 57.489 151.977 1.00 48.83  ? 55   SER A CA  1 
ATOM   393  C C   . SER A 1 55  ? 165.322 57.921 152.911 1.00 45.98  ? 55   SER A C   1 
ATOM   394  O O   . SER A 1 55  ? 165.298 57.666 154.114 1.00 50.07  ? 55   SER A O   1 
ATOM   395  C CB  . SER A 1 55  ? 163.379 58.664 151.409 1.00 51.85  ? 55   SER A CB  1 
ATOM   396  O OG  . SER A 1 55  ? 162.738 59.344 152.458 1.00 53.10  ? 55   SER A OG  1 
ATOM   397  N N   . GLY A 1 56  ? 166.342 58.535 152.357 1.00 44.45  ? 56   GLY A N   1 
ATOM   398  C CA  . GLY A 1 56  ? 167.470 58.891 153.168 1.00 40.90  ? 56   GLY A CA  1 
ATOM   399  C C   . GLY A 1 56  ? 168.318 57.689 153.478 1.00 40.70  ? 56   GLY A C   1 
ATOM   400  O O   . GLY A 1 56  ? 168.140 56.590 152.907 1.00 34.29  ? 56   GLY A O   1 
ATOM   401  N N   . VAL A 1 57  ? 169.302 57.956 154.331 1.00 35.40  ? 57   VAL A N   1 
ATOM   402  C CA  . VAL A 1 57  ? 170.331 57.057 154.674 1.00 34.37  ? 57   VAL A CA  1 
ATOM   403  C C   . VAL A 1 57  ? 170.123 56.619 156.139 1.00 36.29  ? 57   VAL A C   1 
ATOM   404  O O   . VAL A 1 57  ? 170.045 57.435 157.051 1.00 35.06  ? 57   VAL A O   1 
ATOM   405  C CB  . VAL A 1 57  ? 171.701 57.689 154.528 1.00 38.08  ? 57   VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 57  ? 172.765 56.661 154.849 1.00 35.36  ? 57   VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 57  ? 171.892 58.202 153.096 1.00 43.11  ? 57   VAL A CG2 1 
ATOM   408  N N   . TRP A 1 58  ? 169.977 55.312 156.324 1.00 32.99  ? 58   TRP A N   1 
ATOM   409  C CA  . TRP A 1 58  ? 169.667 54.721 157.623 1.00 31.95  ? 58   TRP A CA  1 
ATOM   410  C C   . TRP A 1 58  ? 170.977 54.607 158.270 1.00 30.85  ? 58   TRP A C   1 
ATOM   411  O O   . TRP A 1 58  ? 171.921 54.017 157.660 1.00 27.76  ? 58   TRP A O   1 
ATOM   412  C CB  . TRP A 1 58  ? 169.026 53.330 157.501 1.00 33.03  ? 58   TRP A CB  1 
ATOM   413  C CG  . TRP A 1 58  ? 168.715 52.767 158.837 1.00 29.85  ? 58   TRP A CG  1 
ATOM   414  C CD1 . TRP A 1 58  ? 169.588 52.195 159.695 1.00 29.00  ? 58   TRP A CD1 1 
ATOM   415  C CD2 . TRP A 1 58  ? 167.466 52.838 159.495 1.00 27.88  ? 58   TRP A CD2 1 
ATOM   416  N NE1 . TRP A 1 58  ? 168.949 51.874 160.862 1.00 31.70  ? 58   TRP A NE1 1 
ATOM   417  C CE2 . TRP A 1 58  ? 167.630 52.246 160.758 1.00 28.98  ? 58   TRP A CE2 1 
ATOM   418  C CE3 . TRP A 1 58  ? 166.199 53.282 159.114 1.00 30.47  ? 58   TRP A CE3 1 
ATOM   419  C CZ2 . TRP A 1 58  ? 166.579 52.109 161.653 1.00 28.05  ? 58   TRP A CZ2 1 
ATOM   420  C CZ3 . TRP A 1 58  ? 165.129 53.147 160.008 1.00 32.90  ? 58   TRP A CZ3 1 
ATOM   421  C CH2 . TRP A 1 58  ? 165.321 52.575 161.252 1.00 30.88  ? 58   TRP A CH2 1 
ATOM   422  N N   . ASN A 1 59  ? 171.077 55.237 159.454 1.00 30.98  ? 59   ASN A N   1 
ATOM   423  C CA  . ASN A 1 59  ? 172.337 55.279 160.207 1.00 34.30  ? 59   ASN A CA  1 
ATOM   424  C C   . ASN A 1 59  ? 172.534 53.864 160.843 1.00 33.86  ? 59   ASN A C   1 
ATOM   425  O O   . ASN A 1 59  ? 171.800 53.509 161.739 1.00 33.50  ? 59   ASN A O   1 
ATOM   426  C CB  . ASN A 1 59  ? 172.335 56.377 161.312 1.00 37.26  ? 59   ASN A CB  1 
ATOM   427  C CG  . ASN A 1 59  ? 173.705 56.527 162.010 1.00 43.19  ? 59   ASN A CG  1 
ATOM   428  O OD1 . ASN A 1 59  ? 174.484 55.569 162.066 1.00 43.57  ? 59   ASN A OD1 1 
ATOM   429  N ND2 . ASN A 1 59  ? 174.009 57.739 162.549 1.00 55.99  ? 59   ASN A ND2 1 
ATOM   430  N N   . ALA A 1 60  ? 173.492 53.087 160.358 1.00 32.27  ? 60   ALA A N   1 
ATOM   431  C CA  . ALA A 1 60  ? 173.736 51.729 160.869 1.00 29.66  ? 60   ALA A CA  1 
ATOM   432  C C   . ALA A 1 60  ? 175.092 51.625 161.498 1.00 29.26  ? 60   ALA A C   1 
ATOM   433  O O   . ALA A 1 60  ? 175.842 50.648 161.241 1.00 26.06  ? 60   ALA A O   1 
ATOM   434  C CB  . ALA A 1 60  ? 173.663 50.733 159.725 1.00 29.08  ? 60   ALA A CB  1 
ATOM   435  N N   . SER A 1 61  ? 175.438 52.627 162.307 1.00 28.59  ? 61   SER A N   1 
ATOM   436  C CA  . SER A 1 61  ? 176.742 52.663 162.955 1.00 31.25  ? 61   SER A CA  1 
ATOM   437  C C   . SER A 1 61  ? 176.688 52.087 164.418 1.00 28.75  ? 61   SER A C   1 
ATOM   438  O O   . SER A 1 61  ? 177.717 51.886 165.023 1.00 30.66  ? 61   SER A O   1 
ATOM   439  C CB  . SER A 1 61  ? 177.273 54.135 162.952 1.00 31.13  ? 61   SER A CB  1 
ATOM   440  O OG  . SER A 1 61  ? 176.364 54.875 163.729 1.00 34.82  ? 61   SER A OG  1 
ATOM   441  N N   . THR A 1 62  ? 175.509 51.873 164.982 1.00 32.18  ? 62   THR A N   1 
ATOM   442  C CA  . THR A 1 62  ? 175.413 51.386 166.366 1.00 37.27  ? 62   THR A CA  1 
ATOM   443  C C   . THR A 1 62  ? 174.369 50.266 166.538 1.00 31.36  ? 62   THR A C   1 
ATOM   444  O O   . THR A 1 62  ? 173.415 50.128 165.788 1.00 27.62  ? 62   THR A O   1 
ATOM   445  C CB  . THR A 1 62  ? 174.987 52.526 167.296 1.00 39.82  ? 62   THR A CB  1 
ATOM   446  O OG1 . THR A 1 62  ? 173.749 53.022 166.825 1.00 39.51  ? 62   THR A OG1 1 
ATOM   447  C CG2 . THR A 1 62  ? 175.945 53.623 167.213 1.00 42.81  ? 62   THR A CG2 1 
ATOM   448  N N   . TYR A 1 63  ? 174.573 49.474 167.567 1.00 30.55  ? 63   TYR A N   1 
ATOM   449  C CA  . TYR A 1 63  ? 173.764 48.292 167.801 1.00 26.20  ? 63   TYR A CA  1 
ATOM   450  C C   . TYR A 1 63  ? 172.364 48.696 168.108 1.00 25.66  ? 63   TYR A C   1 
ATOM   451  O O   . TYR A 1 63  ? 172.147 49.740 168.585 1.00 28.23  ? 63   TYR A O   1 
ATOM   452  C CB  . TYR A 1 63  ? 174.310 47.543 168.983 1.00 25.59  ? 63   TYR A CB  1 
ATOM   453  C CG  . TYR A 1 63  ? 175.336 46.509 168.723 1.00 24.94  ? 63   TYR A CG  1 
ATOM   454  C CD1 . TYR A 1 63  ? 175.225 45.621 167.671 1.00 27.45  ? 63   TYR A CD1 1 
ATOM   455  C CD2 . TYR A 1 63  ? 176.445 46.376 169.577 1.00 28.75  ? 63   TYR A CD2 1 
ATOM   456  C CE1 . TYR A 1 63  ? 176.173 44.601 167.504 1.00 26.18  ? 63   TYR A CE1 1 
ATOM   457  C CE2 . TYR A 1 63  ? 177.379 45.348 169.424 1.00 27.08  ? 63   TYR A CE2 1 
ATOM   458  C CZ  . TYR A 1 63  ? 177.216 44.459 168.405 1.00 27.15  ? 63   TYR A CZ  1 
ATOM   459  O OH  . TYR A 1 63  ? 178.172 43.507 168.200 1.00 26.33  ? 63   TYR A OH  1 
ATOM   460  N N   . PRO A 1 64  ? 171.382 47.871 167.769 1.00 23.46  ? 64   PRO A N   1 
ATOM   461  C CA  . PRO A 1 64  ? 170.006 48.160 168.038 1.00 23.36  ? 64   PRO A CA  1 
ATOM   462  C C   . PRO A 1 64  ? 169.604 47.807 169.526 1.00 22.95  ? 64   PRO A C   1 
ATOM   463  O O   . PRO A 1 64  ? 170.396 47.291 170.234 1.00 24.92  ? 64   PRO A O   1 
ATOM   464  C CB  . PRO A 1 64  ? 169.300 47.176 167.104 1.00 22.48  ? 64   PRO A CB  1 
ATOM   465  C CG  . PRO A 1 64  ? 170.190 45.960 167.188 1.00 22.67  ? 64   PRO A CG  1 
ATOM   466  C CD  . PRO A 1 64  ? 171.574 46.530 167.164 1.00 23.17  ? 64   PRO A CD  1 
ATOM   467  N N   . ASN A 1 65  ? 168.378 48.125 169.933 1.00 21.79  ? 65   ASN A N   1 
ATOM   468  C CA  . ASN A 1 65  ? 167.791 47.641 171.132 1.00 25.70  ? 65   ASN A CA  1 
ATOM   469  C C   . ASN A 1 65  ? 167.716 46.114 171.107 1.00 25.81  ? 65   ASN A C   1 
ATOM   470  O O   . ASN A 1 65  ? 167.679 45.504 170.042 1.00 25.64  ? 65   ASN A O   1 
ATOM   471  C CB  . ASN A 1 65  ? 166.375 48.171 171.266 1.00 27.93  ? 65   ASN A CB  1 
ATOM   472  C CG  . ASN A 1 65  ? 166.335 49.713 171.370 1.00 33.78  ? 65   ASN A CG  1 
ATOM   473  O OD1 . ASN A 1 65  ? 167.200 50.328 171.985 1.00 35.25  ? 65   ASN A OD1 1 
ATOM   474  N ND2 . ASN A 1 65  ? 165.364 50.318 170.693 1.00 34.91  ? 65   ASN A ND2 1 
ATOM   475  N N   . ASN A 1 66  ? 167.730 45.520 172.292 1.00 23.50  ? 66   ASN A N   1 
ATOM   476  C CA  . ASN A 1 66  ? 167.431 44.078 172.494 1.00 21.93  ? 66   ASN A CA  1 
ATOM   477  C C   . ASN A 1 66  ? 165.945 43.916 172.751 1.00 20.19  ? 66   ASN A C   1 
ATOM   478  O O   . ASN A 1 66  ? 165.286 44.852 173.247 1.00 24.28  ? 66   ASN A O   1 
ATOM   479  C CB  . ASN A 1 66  ? 168.224 43.549 173.674 1.00 21.53  ? 66   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 66  ? 169.730 43.762 173.506 1.00 24.48  ? 66   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 66  ? 170.437 44.157 174.448 1.00 25.73  ? 66   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 66  ? 170.223 43.539 172.292 1.00 23.04  ? 66   ASN A ND2 1 
ATOM   483  N N   . CYS A 1 67  ? 165.375 42.779 172.393 1.00 20.23  ? 67   CYS A N   1 
ATOM   484  C CA  . CYS A 1 67  ? 163.969 42.531 172.690 1.00 21.05  ? 67   CYS A CA  1 
ATOM   485  C C   . CYS A 1 67  ? 163.711 42.446 174.215 1.00 22.75  ? 67   CYS A C   1 
ATOM   486  O O   . CYS A 1 67  ? 164.608 42.167 174.989 1.00 24.63  ? 67   CYS A O   1 
ATOM   487  C CB  . CYS A 1 67  ? 163.539 41.261 172.003 1.00 24.14  ? 67   CYS A CB  1 
ATOM   488  S SG  . CYS A 1 67  ? 163.661 41.347 170.147 1.00 27.83  ? 67   CYS A SG  1 
ATOM   489  N N   . GLN A 1 68  ? 162.484 42.753 174.616 1.00 24.98  ? 68   GLN A N   1 
ATOM   490  C CA  . GLN A 1 68  ? 162.069 42.702 176.003 1.00 24.11  ? 68   GLN A CA  1 
ATOM   491  C C   . GLN A 1 68  ? 162.212 41.255 176.456 1.00 25.60  ? 68   GLN A C   1 
ATOM   492  O O   . GLN A 1 68  ? 161.779 40.344 175.769 1.00 24.06  ? 68   GLN A O   1 
ATOM   493  C CB  . GLN A 1 68  ? 160.617 43.105 176.133 1.00 25.35  ? 68   GLN A CB  1 
ATOM   494  C CG  . GLN A 1 68  ? 160.422 44.598 175.977 1.00 25.34  ? 68   GLN A CG  1 
ATOM   495  C CD  . GLN A 1 68  ? 160.840 45.404 177.200 1.00 26.96  ? 68   GLN A CD  1 
ATOM   496  O OE1 . GLN A 1 68  ? 161.400 44.884 178.141 1.00 28.02  ? 68   GLN A OE1 1 
ATOM   497  N NE2 . GLN A 1 68  ? 160.654 46.703 177.130 1.00 29.70  ? 68   GLN A NE2 1 
ATOM   498  N N   . GLN A 1 69  ? 162.841 41.059 177.600 1.00 21.74  ? 69   GLN A N   1 
ATOM   499  C CA  . GLN A 1 69  ? 163.118 39.732 178.135 1.00 20.93  ? 69   GLN A CA  1 
ATOM   500  C C   . GLN A 1 69  ? 163.449 39.795 179.646 1.00 21.79  ? 69   GLN A C   1 
ATOM   501  O O   . GLN A 1 69  ? 163.835 40.832 180.175 1.00 18.39  ? 69   GLN A O   1 
ATOM   502  C CB  . GLN A 1 69  ? 164.285 39.124 177.420 1.00 20.35  ? 69   GLN A CB  1 
ATOM   503  C CG  . GLN A 1 69  ? 165.609 39.899 177.506 1.00 20.54  ? 69   GLN A CG  1 
ATOM   504  C CD  . GLN A 1 69  ? 166.646 39.394 176.514 1.00 22.62  ? 69   GLN A CD  1 
ATOM   505  O OE1 . GLN A 1 69  ? 167.501 38.568 176.839 1.00 23.98  ? 69   GLN A OE1 1 
ATOM   506  N NE2 . GLN A 1 69  ? 166.597 39.941 175.244 1.00 24.08  ? 69   GLN A NE2 1 
ATOM   507  N N   . TYR A 1 70  ? 163.259 38.663 180.283 1.00 23.61  ? 70   TYR A N   1 
ATOM   508  C CA  . TYR A 1 70  ? 163.790 38.346 181.566 1.00 25.49  ? 70   TYR A CA  1 
ATOM   509  C C   . TYR A 1 70  ? 165.261 38.609 181.630 1.00 26.25  ? 70   TYR A C   1 
ATOM   510  O O   . TYR A 1 70  ? 166.004 38.269 180.669 1.00 25.33  ? 70   TYR A O   1 
ATOM   511  C CB  . TYR A 1 70  ? 163.538 36.870 181.839 1.00 26.77  ? 70   TYR A CB  1 
ATOM   512  C CG  . TYR A 1 70  ? 164.024 36.473 183.257 1.00 29.98  ? 70   TYR A CG  1 
ATOM   513  C CD1 . TYR A 1 70  ? 163.196 36.679 184.380 1.00 28.26  ? 70   TYR A CD1 1 
ATOM   514  C CD2 . TYR A 1 70  ? 165.297 35.895 183.448 1.00 27.95  ? 70   TYR A CD2 1 
ATOM   515  C CE1 . TYR A 1 70  ? 163.634 36.333 185.667 1.00 31.64  ? 70   TYR A CE1 1 
ATOM   516  C CE2 . TYR A 1 70  ? 165.737 35.548 184.723 1.00 33.11  ? 70   TYR A CE2 1 
ATOM   517  C CZ  . TYR A 1 70  ? 164.911 35.753 185.828 1.00 33.17  ? 70   TYR A CZ  1 
ATOM   518  O OH  . TYR A 1 70  ? 165.350 35.373 187.089 1.00 34.03  ? 70   TYR A OH  1 
ATOM   519  N N   . VAL A 1 71  ? 165.706 39.225 182.740 1.00 22.74  ? 71   VAL A N   1 
ATOM   520  C CA  . VAL A 1 71  ? 167.105 39.599 182.904 1.00 22.88  ? 71   VAL A CA  1 
ATOM   521  C C   . VAL A 1 71  ? 167.660 38.848 184.137 1.00 23.98  ? 71   VAL A C   1 
ATOM   522  O O   . VAL A 1 71  ? 167.115 38.938 185.220 1.00 23.84  ? 71   VAL A O   1 
ATOM   523  C CB  . VAL A 1 71  ? 167.278 41.110 183.085 1.00 25.16  ? 71   VAL A CB  1 
ATOM   524  C CG1 . VAL A 1 71  ? 168.692 41.421 183.475 1.00 28.38  ? 71   VAL A CG1 1 
ATOM   525  C CG2 . VAL A 1 71  ? 166.919 41.896 181.801 1.00 28.55  ? 71   VAL A CG2 1 
ATOM   526  N N   . ASP A 1 72  ? 168.734 38.108 183.962 1.00 26.37  ? 72   ASP A N   1 
ATOM   527  C CA  . ASP A 1 72  ? 169.319 37.298 185.032 1.00 28.82  ? 72   ASP A CA  1 
ATOM   528  C C   . ASP A 1 72  ? 169.963 38.256 186.048 1.00 27.03  ? 72   ASP A C   1 
ATOM   529  O O   . ASP A 1 72  ? 170.849 39.065 185.693 1.00 25.27  ? 72   ASP A O   1 
ATOM   530  C CB  . ASP A 1 72  ? 170.339 36.343 184.419 1.00 29.16  ? 72   ASP A CB  1 
ATOM   531  C CG  . ASP A 1 72  ? 171.075 35.444 185.469 1.00 33.88  ? 72   ASP A CG  1 
ATOM   532  O OD1 . ASP A 1 72  ? 170.983 35.699 186.688 1.00 36.04  ? 72   ASP A OD1 1 
ATOM   533  O OD2 . ASP A 1 72  ? 171.771 34.487 185.061 1.00 27.53  ? 72   ASP A OD2 1 
ATOM   534  N N   . GLU A 1 73  ? 169.524 38.149 187.295 1.00 27.04  ? 73   GLU A N   1 
ATOM   535  C CA  . GLU A 1 73  ? 170.097 38.933 188.419 1.00 30.12  ? 73   GLU A CA  1 
ATOM   536  C C   . GLU A 1 73  ? 170.588 38.015 189.554 1.00 31.03  ? 73   GLU A C   1 
ATOM   537  O O   . GLU A 1 73  ? 170.729 38.424 190.719 1.00 26.00  ? 73   GLU A O   1 
ATOM   538  C CB  . GLU A 1 73  ? 169.005 39.821 189.014 1.00 35.52  ? 73   GLU A CB  1 
ATOM   539  C CG  . GLU A 1 73  ? 168.576 40.959 188.129 1.00 42.98  ? 73   GLU A CG  1 
ATOM   540  C CD  . GLU A 1 73  ? 167.485 41.831 188.733 1.00 50.83  ? 73   GLU A CD  1 
ATOM   541  O OE1 . GLU A 1 73  ? 167.243 41.826 189.971 1.00 54.90  ? 73   GLU A OE1 1 
ATOM   542  O OE2 . GLU A 1 73  ? 166.856 42.532 187.931 1.00 57.34  ? 73   GLU A OE2 1 
ATOM   543  N N   . GLN A 1 74  ? 170.765 36.760 189.248 1.00 29.88  ? 74   GLN A N   1 
ATOM   544  C CA  . GLN A 1 74  ? 171.195 35.829 190.234 1.00 32.63  ? 74   GLN A CA  1 
ATOM   545  C C   . GLN A 1 74  ? 172.621 36.107 190.774 1.00 31.24  ? 74   GLN A C   1 
ATOM   546  O O   . GLN A 1 74  ? 172.860 35.910 191.936 1.00 31.36  ? 74   GLN A O   1 
ATOM   547  C CB  . GLN A 1 74  ? 170.985 34.443 189.663 1.00 35.21  ? 74   GLN A CB  1 
ATOM   548  C CG  . GLN A 1 74  ? 171.279 33.334 190.619 1.00 47.86  ? 74   GLN A CG  1 
ATOM   549  C CD  . GLN A 1 74  ? 170.085 32.898 191.480 1.00 51.06  ? 74   GLN A CD  1 
ATOM   550  O OE1 . GLN A 1 74  ? 169.104 33.632 191.673 1.00 42.85  ? 74   GLN A OE1 1 
ATOM   551  N NE2 . GLN A 1 74  ? 170.172 31.651 191.972 1.00 53.81  ? 74   GLN A NE2 1 
ATOM   552  N N   . PHE A 1 75  ? 173.530 36.661 189.970 1.00 27.76  ? 75   PHE A N   1 
ATOM   553  C CA  . PHE A 1 75  ? 174.926 36.814 190.347 1.00 25.53  ? 75   PHE A CA  1 
ATOM   554  C C   . PHE A 1 75  ? 175.308 38.201 189.857 1.00 29.01  ? 75   PHE A C   1 
ATOM   555  O O   . PHE A 1 75  ? 176.007 38.326 188.887 1.00 27.68  ? 75   PHE A O   1 
ATOM   556  C CB  . PHE A 1 75  ? 175.815 35.719 189.702 1.00 23.95  ? 75   PHE A CB  1 
ATOM   557  C CG  . PHE A 1 75  ? 175.373 34.305 190.024 1.00 22.92  ? 75   PHE A CG  1 
ATOM   558  C CD1 . PHE A 1 75  ? 175.519 33.782 191.333 1.00 22.26  ? 75   PHE A CD1 1 
ATOM   559  C CD2 . PHE A 1 75  ? 174.775 33.491 189.051 1.00 23.39  ? 75   PHE A CD2 1 
ATOM   560  C CE1 . PHE A 1 75  ? 175.055 32.513 191.646 1.00 23.81  ? 75   PHE A CE1 1 
ATOM   561  C CE2 . PHE A 1 75  ? 174.346 32.193 189.354 1.00 26.39  ? 75   PHE A CE2 1 
ATOM   562  C CZ  . PHE A 1 75  ? 174.478 31.691 190.677 1.00 24.18  ? 75   PHE A CZ  1 
ATOM   563  N N   . PRO A 1 76  ? 174.810 39.253 190.509 1.00 30.95  ? 76   PRO A N   1 
ATOM   564  C CA  . PRO A 1 76  ? 175.021 40.593 190.008 1.00 32.32  ? 76   PRO A CA  1 
ATOM   565  C C   . PRO A 1 76  ? 176.493 40.963 189.883 1.00 34.19  ? 76   PRO A C   1 
ATOM   566  O O   . PRO A 1 76  ? 177.326 40.582 190.693 1.00 31.92  ? 76   PRO A O   1 
ATOM   567  C CB  . PRO A 1 76  ? 174.326 41.485 191.055 1.00 34.93  ? 76   PRO A CB  1 
ATOM   568  C CG  . PRO A 1 76  ? 173.320 40.597 191.724 1.00 33.52  ? 76   PRO A CG  1 
ATOM   569  C CD  . PRO A 1 76  ? 174.015 39.253 191.759 1.00 35.39  ? 76   PRO A CD  1 
ATOM   570  N N   . GLY A 1 77  ? 176.804 41.660 188.804 1.00 33.71  ? 77   GLY A N   1 
ATOM   571  C CA  . GLY A 1 77  ? 178.141 41.900 188.417 1.00 34.24  ? 77   GLY A CA  1 
ATOM   572  C C   . GLY A 1 77  ? 178.999 40.707 187.973 1.00 35.63  ? 77   GLY A C   1 
ATOM   573  O O   . GLY A 1 77  ? 180.124 40.955 187.583 1.00 34.05  ? 77   GLY A O   1 
ATOM   574  N N   . PHE A 1 78  ? 178.530 39.444 188.064 1.00 26.94  ? 78   PHE A N   1 
ATOM   575  C CA  . PHE A 1 78  ? 179.390 38.306 187.740 1.00 25.23  ? 78   PHE A CA  1 
ATOM   576  C C   . PHE A 1 78  ? 179.436 38.131 186.188 1.00 25.14  ? 78   PHE A C   1 
ATOM   577  O O   . PHE A 1 78  ? 178.427 37.995 185.554 1.00 26.35  ? 78   PHE A O   1 
ATOM   578  C CB  . PHE A 1 78  ? 178.812 37.085 188.420 1.00 25.97  ? 78   PHE A CB  1 
ATOM   579  C CG  . PHE A 1 78  ? 179.528 35.817 188.112 1.00 25.11  ? 78   PHE A CG  1 
ATOM   580  C CD1 . PHE A 1 78  ? 180.847 35.648 188.466 1.00 30.09  ? 78   PHE A CD1 1 
ATOM   581  C CD2 . PHE A 1 78  ? 178.874 34.793 187.475 1.00 22.86  ? 78   PHE A CD2 1 
ATOM   582  C CE1 . PHE A 1 78  ? 181.519 34.466 188.160 1.00 29.09  ? 78   PHE A CE1 1 
ATOM   583  C CE2 . PHE A 1 78  ? 179.518 33.641 187.152 1.00 26.55  ? 78   PHE A CE2 1 
ATOM   584  C CZ  . PHE A 1 78  ? 180.837 33.461 187.490 1.00 28.13  ? 78   PHE A CZ  1 
ATOM   585  N N   . SER A 1 79  ? 180.603 38.091 185.585 1.00 27.93  ? 79   SER A N   1 
ATOM   586  C CA  . SER A 1 79  ? 180.706 38.132 184.093 1.00 28.28  ? 79   SER A CA  1 
ATOM   587  C C   . SER A 1 79  ? 180.113 36.843 183.501 1.00 28.88  ? 79   SER A C   1 
ATOM   588  O O   . SER A 1 79  ? 179.613 36.834 182.381 1.00 29.69  ? 79   SER A O   1 
ATOM   589  C CB  . SER A 1 79  ? 182.161 38.289 183.649 1.00 27.83  ? 79   SER A CB  1 
ATOM   590  O OG  . SER A 1 79  ? 182.890 37.104 184.010 1.00 30.43  ? 79   SER A OG  1 
ATOM   591  N N   . GLY A 1 80  ? 180.127 35.756 184.257 1.00 25.29  ? 80   GLY A N   1 
ATOM   592  C CA  . GLY A 1 80  ? 179.684 34.479 183.695 1.00 25.65  ? 80   GLY A CA  1 
ATOM   593  C C   . GLY A 1 80  ? 178.189 34.479 183.342 1.00 25.52  ? 80   GLY A C   1 
ATOM   594  O O   . GLY A 1 80  ? 177.796 33.844 182.385 1.00 22.88  ? 80   GLY A O   1 
ATOM   595  N N   . SER A 1 81  ? 177.386 35.221 184.101 1.00 23.54  ? 81   SER A N   1 
ATOM   596  C CA  . SER A 1 81  ? 175.943 35.343 183.843 1.00 24.39  ? 81   SER A CA  1 
ATOM   597  C C   . SER A 1 81  ? 175.582 36.549 183.001 1.00 24.54  ? 81   SER A C   1 
ATOM   598  O O   . SER A 1 81  ? 174.623 36.512 182.150 1.00 21.03  ? 81   SER A O   1 
ATOM   599  C CB  . SER A 1 81  ? 175.148 35.517 185.154 1.00 25.31  ? 81   SER A CB  1 
ATOM   600  O OG  . SER A 1 81  ? 175.862 36.307 186.081 1.00 27.05  ? 81   SER A OG  1 
ATOM   601  N N   . GLU A 1 82  ? 176.261 37.641 183.337 1.00 22.51  ? 82   GLU A N   1 
ATOM   602  C CA  . GLU A 1 82  ? 175.988 38.911 182.699 1.00 26.61  ? 82   GLU A CA  1 
ATOM   603  C C   . GLU A 1 82  ? 176.438 38.948 181.229 1.00 24.32  ? 82   GLU A C   1 
ATOM   604  O O   . GLU A 1 82  ? 175.876 39.669 180.498 1.00 21.65  ? 82   GLU A O   1 
ATOM   605  C CB  . GLU A 1 82  ? 176.604 40.066 183.527 1.00 29.64  ? 82   GLU A CB  1 
ATOM   606  C CG  . GLU A 1 82  ? 175.532 40.391 184.573 1.00 40.95  ? 82   GLU A CG  1 
ATOM   607  C CD  . GLU A 1 82  ? 175.944 41.362 185.591 1.00 48.91  ? 82   GLU A CD  1 
ATOM   608  O OE1 . GLU A 1 82  ? 177.120 41.797 185.537 1.00 55.29  ? 82   GLU A OE1 1 
ATOM   609  O OE2 . GLU A 1 82  ? 175.079 41.669 186.443 1.00 47.24  ? 82   GLU A OE2 1 
ATOM   610  N N   . MET A 1 83  ? 177.404 38.124 180.826 1.00 24.08  ? 83   MET A N   1 
ATOM   611  C CA  . MET A 1 83  ? 177.721 37.978 179.396 1.00 25.14  ? 83   MET A CA  1 
ATOM   612  C C   . MET A 1 83  ? 176.513 37.578 178.505 1.00 26.05  ? 83   MET A C   1 
ATOM   613  O O   . MET A 1 83  ? 176.583 37.783 177.283 1.00 26.23  ? 83   MET A O   1 
ATOM   614  C CB  . MET A 1 83  ? 178.906 37.066 179.180 1.00 24.80  ? 83   MET A CB  1 
ATOM   615  C CG  . MET A 1 83  ? 178.601 35.618 179.497 1.00 25.45  ? 83   MET A CG  1 
ATOM   616  S SD  . MET A 1 83  ? 180.021 34.558 179.293 1.00 32.61  ? 83   MET A SD  1 
ATOM   617  C CE  . MET A 1 83  ? 180.132 34.509 177.498 1.00 35.69  ? 83   MET A CE  1 
ATOM   618  N N   . TRP A 1 84  ? 175.400 37.090 179.108 1.00 24.61  ? 84   TRP A N   1 
ATOM   619  C CA  . TRP A 1 84  ? 174.224 36.630 178.372 1.00 22.21  ? 84   TRP A CA  1 
ATOM   620  C C   . TRP A 1 84  ? 173.044 37.579 178.406 1.00 23.49  ? 84   TRP A C   1 
ATOM   621  O O   . TRP A 1 84  ? 172.077 37.417 177.636 1.00 22.18  ? 84   TRP A O   1 
ATOM   622  C CB  . TRP A 1 84  ? 173.793 35.241 178.841 1.00 23.59  ? 84   TRP A CB  1 
ATOM   623  C CG  . TRP A 1 84  ? 174.873 34.288 178.859 1.00 22.46  ? 84   TRP A CG  1 
ATOM   624  C CD1 . TRP A 1 84  ? 175.540 33.837 179.964 1.00 25.67  ? 84   TRP A CD1 1 
ATOM   625  C CD2 . TRP A 1 84  ? 175.509 33.649 177.728 1.00 22.47  ? 84   TRP A CD2 1 
ATOM   626  N NE1 . TRP A 1 84  ? 176.526 32.952 179.595 1.00 24.11  ? 84   TRP A NE1 1 
ATOM   627  C CE2 . TRP A 1 84  ? 176.524 32.829 178.225 1.00 22.40  ? 84   TRP A CE2 1 
ATOM   628  C CE3 . TRP A 1 84  ? 175.307 33.681 176.352 1.00 23.43  ? 84   TRP A CE3 1 
ATOM   629  C CZ2 . TRP A 1 84  ? 177.329 32.063 177.396 1.00 23.95  ? 84   TRP A CZ2 1 
ATOM   630  C CZ3 . TRP A 1 84  ? 176.141 32.893 175.529 1.00 24.07  ? 84   TRP A CZ3 1 
ATOM   631  C CH2 . TRP A 1 84  ? 177.119 32.127 176.047 1.00 23.98  ? 84   TRP A CH2 1 
ATOM   632  N N   . ASN A 1 85  ? 173.144 38.596 179.263 1.00 21.56  ? 85   ASN A N   1 
ATOM   633  C CA  . ASN A 1 85  ? 172.072 39.510 179.466 1.00 21.30  ? 85   ASN A CA  1 
ATOM   634  C C   . ASN A 1 85  ? 172.128 40.589 178.409 1.00 20.81  ? 85   ASN A C   1 
ATOM   635  O O   . ASN A 1 85  ? 173.159 40.819 177.873 1.00 20.58  ? 85   ASN A O   1 
ATOM   636  C CB  . ASN A 1 85  ? 172.261 40.210 180.833 1.00 24.03  ? 85   ASN A CB  1 
ATOM   637  C CG  . ASN A 1 85  ? 171.624 39.426 182.013 1.00 26.49  ? 85   ASN A CG  1 
ATOM   638  O OD1 . ASN A 1 85  ? 170.665 38.621 181.877 1.00 25.60  ? 85   ASN A OD1 1 
ATOM   639  N ND2 . ASN A 1 85  ? 172.106 39.742 183.169 1.00 23.21  ? 85   ASN A ND2 1 
ATOM   640  N N   . PRO A 1 86  ? 171.019 41.253 178.152 1.00 21.08  ? 86   PRO A N   1 
ATOM   641  C CA  . PRO A 1 86  ? 170.977 42.320 177.211 1.00 24.78  ? 86   PRO A CA  1 
ATOM   642  C C   . PRO A 1 86  ? 172.006 43.413 177.579 1.00 26.59  ? 86   PRO A C   1 
ATOM   643  O O   . PRO A 1 86  ? 172.149 43.804 178.786 1.00 30.16  ? 86   PRO A O   1 
ATOM   644  C CB  . PRO A 1 86  ? 169.562 42.861 177.342 1.00 24.14  ? 86   PRO A CB  1 
ATOM   645  C CG  . PRO A 1 86  ? 168.780 41.885 178.107 1.00 25.30  ? 86   PRO A CG  1 
ATOM   646  C CD  . PRO A 1 86  ? 169.722 40.993 178.792 1.00 22.80  ? 86   PRO A CD  1 
ATOM   647  N N   . ASN A 1 87  ? 172.792 43.823 176.601 1.00 24.13  ? 87   ASN A N   1 
ATOM   648  C CA  . ASN A 1 87  ? 173.754 44.906 176.819 1.00 25.20  ? 87   ASN A CA  1 
ATOM   649  C C   . ASN A 1 87  ? 173.296 46.213 176.157 1.00 27.95  ? 87   ASN A C   1 
ATOM   650  O O   . ASN A 1 87  ? 174.067 47.170 176.090 1.00 24.48  ? 87   ASN A O   1 
ATOM   651  C CB  . ASN A 1 87  ? 175.134 44.501 176.379 1.00 25.48  ? 87   ASN A CB  1 
ATOM   652  C CG  . ASN A 1 87  ? 175.188 44.083 174.900 1.00 30.36  ? 87   ASN A CG  1 
ATOM   653  O OD1 . ASN A 1 87  ? 174.142 43.929 174.213 1.00 32.16  ? 87   ASN A OD1 1 
ATOM   654  N ND2 . ASN A 1 87  ? 176.416 43.963 174.395 1.00 25.34  ? 87   ASN A ND2 1 
ATOM   655  N N   . ARG A 1 88  ? 172.070 46.245 175.640 1.00 25.20  ? 88   ARG A N   1 
ATOM   656  C CA  . ARG A 1 88  ? 171.466 47.490 175.224 1.00 28.84  ? 88   ARG A CA  1 
ATOM   657  C C   . ARG A 1 88  ? 170.152 47.665 175.918 1.00 27.56  ? 88   ARG A C   1 
ATOM   658  O O   . ARG A 1 88  ? 169.662 46.739 176.519 1.00 27.46  ? 88   ARG A O   1 
ATOM   659  C CB  . ARG A 1 88  ? 171.112 47.452 173.726 1.00 31.20  ? 88   ARG A CB  1 
ATOM   660  C CG  . ARG A 1 88  ? 172.124 46.754 172.890 1.00 35.00  ? 88   ARG A CG  1 
ATOM   661  C CD  . ARG A 1 88  ? 173.425 47.423 172.951 1.00 35.22  ? 88   ARG A CD  1 
ATOM   662  N NE  . ARG A 1 88  ? 173.294 48.794 172.562 1.00 37.37  ? 88   ARG A NE  1 
ATOM   663  C CZ  . ARG A 1 88  ? 174.351 49.564 172.452 1.00 43.19  ? 88   ARG A CZ  1 
ATOM   664  N NH1 . ARG A 1 88  ? 174.187 50.797 172.019 1.00 48.46  ? 88   ARG A NH1 1 
ATOM   665  N NH2 . ARG A 1 88  ? 175.572 49.043 172.669 1.00 48.07  ? 88   ARG A NH2 1 
ATOM   666  N N   . GLU A 1 89  ? 169.520 48.808 175.727 1.00 25.20  ? 89   GLU A N   1 
ATOM   667  C CA  . GLU A 1 89  ? 168.186 49.019 176.248 1.00 27.75  ? 89   GLU A CA  1 
ATOM   668  C C   . GLU A 1 89  ? 167.277 48.013 175.604 1.00 28.74  ? 89   GLU A C   1 
ATOM   669  O O   . GLU A 1 89  ? 167.428 47.718 174.407 1.00 25.96  ? 89   GLU A O   1 
ATOM   670  C CB  . GLU A 1 89  ? 167.647 50.458 175.912 1.00 35.35  ? 89   GLU A CB  1 
ATOM   671  C CG  . GLU A 1 89  ? 167.932 51.549 176.989 1.00 49.08  ? 89   GLU A CG  1 
ATOM   672  N N   . MET A 1 90  ? 166.257 47.582 176.350 1.00 25.25  ? 90   MET A N   1 
ATOM   673  C CA  . MET A 1 90  ? 165.277 46.679 175.825 1.00 28.07  ? 90   MET A CA  1 
ATOM   674  C C   . MET A 1 90  ? 164.126 47.445 175.271 1.00 28.02  ? 90   MET A C   1 
ATOM   675  O O   . MET A 1 90  ? 163.718 48.474 175.844 1.00 29.10  ? 90   MET A O   1 
ATOM   676  C CB  . MET A 1 90  ? 164.763 45.676 176.888 1.00 24.46  ? 90   MET A CB  1 
ATOM   677  C CG  . MET A 1 90  ? 165.848 44.764 177.459 1.00 24.04  ? 90   MET A CG  1 
ATOM   678  S SD  . MET A 1 90  ? 165.203 43.485 178.604 1.00 27.55  ? 90   MET A SD  1 
ATOM   679  C CE  . MET A 1 90  ? 164.845 44.519 180.048 1.00 34.63  ? 90   MET A CE  1 
ATOM   680  N N   . SER A 1 91  ? 163.520 46.901 174.219 1.00 26.11  ? 91   SER A N   1 
ATOM   681  C CA  . SER A 1 91  ? 162.350 47.548 173.651 1.00 23.25  ? 91   SER A CA  1 
ATOM   682  C C   . SER A 1 91  ? 161.555 46.544 172.885 1.00 23.72  ? 91   SER A C   1 
ATOM   683  O O   . SER A 1 91  ? 162.139 45.675 172.286 1.00 26.46  ? 91   SER A O   1 
ATOM   684  C CB  . SER A 1 91  ? 162.808 48.672 172.685 1.00 25.32  ? 91   SER A CB  1 
ATOM   685  O OG  . SER A 1 91  ? 161.664 49.213 172.032 1.00 25.45  ? 91   SER A OG  1 
ATOM   686  N N   . GLU A 1 92  ? 160.230 46.666 172.808 1.00 24.01  ? 92   GLU A N   1 
ATOM   687  C CA  . GLU A 1 92  ? 159.495 45.832 171.826 1.00 25.59  ? 92   GLU A CA  1 
ATOM   688  C C   . GLU A 1 92  ? 159.916 46.167 170.339 1.00 27.19  ? 92   GLU A C   1 
ATOM   689  O O   . GLU A 1 92  ? 159.669 45.386 169.417 1.00 28.32  ? 92   GLU A O   1 
ATOM   690  C CB  . GLU A 1 92  ? 158.026 46.016 171.985 1.00 26.23  ? 92   GLU A CB  1 
ATOM   691  C CG  . GLU A 1 92  ? 157.495 45.452 173.302 1.00 26.92  ? 92   GLU A CG  1 
ATOM   692  C CD  . GLU A 1 92  ? 155.987 45.493 173.372 1.00 27.74  ? 92   GLU A CD  1 
ATOM   693  O OE1 . GLU A 1 92  ? 155.462 46.519 173.932 1.00 32.93  ? 92   GLU A OE1 1 
ATOM   694  O OE2 . GLU A 1 92  ? 155.326 44.543 172.863 1.00 28.83  ? 92   GLU A OE2 1 
ATOM   695  N N   . ASP A 1 93  ? 160.572 47.307 170.163 1.00 25.00  ? 93   ASP A N   1 
ATOM   696  C CA  . ASP A 1 93  ? 161.102 47.769 168.860 1.00 28.61  ? 93   ASP A CA  1 
ATOM   697  C C   . ASP A 1 93  ? 162.459 47.220 168.682 1.00 24.58  ? 93   ASP A C   1 
ATOM   698  O O   . ASP A 1 93  ? 163.426 47.894 168.976 1.00 25.90  ? 93   ASP A O   1 
ATOM   699  C CB  . ASP A 1 93  ? 161.150 49.307 168.782 1.00 30.78  ? 93   ASP A CB  1 
ATOM   700  C CG  . ASP A 1 93  ? 161.583 49.817 167.385 1.00 34.74  ? 93   ASP A CG  1 
ATOM   701  O OD1 . ASP A 1 93  ? 161.916 49.008 166.470 1.00 34.77  ? 93   ASP A OD1 1 
ATOM   702  O OD2 . ASP A 1 93  ? 161.623 51.046 167.248 1.00 34.33  ? 93   ASP A OD2 1 
ATOM   703  N N   . CYS A 1 94  ? 162.524 45.937 168.322 1.00 22.39  ? 94   CYS A N   1 
ATOM   704  C CA  . CYS A 1 94  ? 163.809 45.236 168.373 1.00 24.43  ? 94   CYS A CA  1 
ATOM   705  C C   . CYS A 1 94  ? 164.125 44.293 167.195 1.00 25.75  ? 94   CYS A C   1 
ATOM   706  O O   . CYS A 1 94  ? 165.053 43.426 167.295 1.00 21.81  ? 94   CYS A O   1 
ATOM   707  C CB  . CYS A 1 94  ? 163.836 44.358 169.656 1.00 23.29  ? 94   CYS A CB  1 
ATOM   708  S SG  . CYS A 1 94  ? 162.584 43.106 169.626 1.00 24.23  ? 94   CYS A SG  1 
ATOM   709  N N   . LEU A 1 95  ? 163.372 44.423 166.106 1.00 25.27  ? 95   LEU A N   1 
ATOM   710  C CA  . LEU A 1 95  ? 163.632 43.565 164.945 1.00 25.79  ? 95   LEU A CA  1 
ATOM   711  C C   . LEU A 1 95  ? 164.633 44.197 163.992 1.00 25.35  ? 95   LEU A C   1 
ATOM   712  O O   . LEU A 1 95  ? 164.278 44.855 163.006 1.00 27.17  ? 95   LEU A O   1 
ATOM   713  C CB  . LEU A 1 95  ? 162.307 43.243 164.271 1.00 25.38  ? 95   LEU A CB  1 
ATOM   714  C CG  . LEU A 1 95  ? 161.325 42.566 165.214 1.00 25.05  ? 95   LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 95  ? 160.046 42.262 164.478 1.00 28.98  ? 95   LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 95  ? 161.870 41.272 165.746 1.00 26.32  ? 95   LEU A CD2 1 
ATOM   717  N N   . TYR A 1 96  ? 165.894 43.899 164.252 1.00 25.21  ? 96   TYR A N   1 
ATOM   718  C CA  . TYR A 1 96  ? 166.996 44.400 163.504 1.00 23.52  ? 96   TYR A CA  1 
ATOM   719  C C   . TYR A 1 96  ? 168.003 43.284 163.286 1.00 23.95  ? 96   TYR A C   1 
ATOM   720  O O   . TYR A 1 96  ? 168.040 42.292 164.007 1.00 23.03  ? 96   TYR A O   1 
ATOM   721  C CB  . TYR A 1 96  ? 167.661 45.557 164.287 1.00 23.97  ? 96   TYR A CB  1 
ATOM   722  C CG  . TYR A 1 96  ? 166.733 46.698 164.527 1.00 23.60  ? 96   TYR A CG  1 
ATOM   723  C CD1 . TYR A 1 96  ? 165.870 46.699 165.589 1.00 23.39  ? 96   TYR A CD1 1 
ATOM   724  C CD2 . TYR A 1 96  ? 166.709 47.782 163.681 1.00 26.62  ? 96   TYR A CD2 1 
ATOM   725  C CE1 . TYR A 1 96  ? 164.968 47.709 165.806 1.00 23.10  ? 96   TYR A CE1 1 
ATOM   726  C CE2 . TYR A 1 96  ? 165.848 48.852 163.912 1.00 26.83  ? 96   TYR A CE2 1 
ATOM   727  C CZ  . TYR A 1 96  ? 164.950 48.820 164.936 1.00 26.03  ? 96   TYR A CZ  1 
ATOM   728  O OH  . TYR A 1 96  ? 163.974 49.851 165.065 1.00 24.48  ? 96   TYR A OH  1 
ATOM   729  N N   . LEU A 1 97  ? 168.889 43.512 162.339 1.00 22.33  ? 97   LEU A N   1 
ATOM   730  C CA  . LEU A 1 97  ? 169.989 42.657 162.122 1.00 20.70  ? 97   LEU A CA  1 
ATOM   731  C C   . LEU A 1 97  ? 171.262 43.404 161.962 1.00 19.43  ? 97   LEU A C   1 
ATOM   732  O O   . LEU A 1 97  ? 171.242 44.596 161.708 1.00 20.29  ? 97   LEU A O   1 
ATOM   733  C CB  . LEU A 1 97  ? 169.700 41.750 160.921 1.00 24.51  ? 97   LEU A CB  1 
ATOM   734  C CG  . LEU A 1 97  ? 169.321 42.354 159.561 1.00 25.07  ? 97   LEU A CG  1 
ATOM   735  C CD1 . LEU A 1 97  ? 170.527 42.850 158.853 1.00 27.05  ? 97   LEU A CD1 1 
ATOM   736  C CD2 . LEU A 1 97  ? 168.644 41.296 158.687 1.00 24.47  ? 97   LEU A CD2 1 
ATOM   737  N N   . ASN A 1 98  ? 172.362 42.678 162.030 1.00 18.66  ? 98   ASN A N   1 
ATOM   738  C CA  . ASN A 1 98  ? 173.716 43.203 162.010 1.00 20.34  ? 98   ASN A CA  1 
ATOM   739  C C   . ASN A 1 98  ? 174.527 42.482 160.999 1.00 19.52  ? 98   ASN A C   1 
ATOM   740  O O   . ASN A 1 98  ? 174.404 41.295 160.857 1.00 21.91  ? 98   ASN A O   1 
ATOM   741  C CB  . ASN A 1 98  ? 174.439 43.046 163.388 1.00 19.46  ? 98   ASN A CB  1 
ATOM   742  C CG  . ASN A 1 98  ? 173.558 43.560 164.516 1.00 22.49  ? 98   ASN A CG  1 
ATOM   743  O OD1 . ASN A 1 98  ? 173.211 44.731 164.546 1.00 23.87  ? 98   ASN A OD1 1 
ATOM   744  N ND2 . ASN A 1 98  ? 173.045 42.646 165.345 1.00 22.72  ? 98   ASN A ND2 1 
ATOM   745  N N   . ILE A 1 99  ? 175.376 43.206 160.283 1.00 20.79  ? 99   ILE A N   1 
ATOM   746  C CA  . ILE A 1 99  ? 176.152 42.577 159.196 1.00 21.91  ? 99   ILE A CA  1 
ATOM   747  C C   . ILE A 1 99  ? 177.580 43.002 159.298 1.00 20.69  ? 99   ILE A C   1 
ATOM   748  O O   . ILE A 1 99  ? 177.833 44.195 159.307 1.00 21.21  ? 99   ILE A O   1 
ATOM   749  C CB  . ILE A 1 99  ? 175.613 42.966 157.786 1.00 19.65  ? 99   ILE A CB  1 
ATOM   750  C CG1 . ILE A 1 99  ? 174.103 42.749 157.688 1.00 22.37  ? 99   ILE A CG1 1 
ATOM   751  C CG2 . ILE A 1 99  ? 176.315 42.065 156.828 1.00 21.59  ? 99   ILE A CG2 1 
ATOM   752  C CD1 . ILE A 1 99  ? 173.370 43.161 156.385 1.00 25.77  ? 99   ILE A CD1 1 
ATOM   753  N N   . TRP A 1 100 ? 178.499 42.062 159.341 1.00 18.76  ? 100  TRP A N   1 
ATOM   754  C CA  . TRP A 1 100 ? 179.886 42.363 159.264 1.00 22.83  ? 100  TRP A CA  1 
ATOM   755  C C   . TRP A 1 100 ? 180.444 41.917 157.898 1.00 26.01  ? 100  TRP A C   1 
ATOM   756  O O   . TRP A 1 100 ? 180.296 40.759 157.512 1.00 22.52  ? 100  TRP A O   1 
ATOM   757  C CB  . TRP A 1 100 ? 180.720 41.668 160.344 1.00 23.36  ? 100  TRP A CB  1 
ATOM   758  C CG  . TRP A 1 100 ? 180.515 42.261 161.728 1.00 27.94  ? 100  TRP A CG  1 
ATOM   759  C CD1 . TRP A 1 100 ? 181.299 43.197 162.351 1.00 31.24  ? 100  TRP A CD1 1 
ATOM   760  C CD2 . TRP A 1 100 ? 179.491 41.936 162.656 1.00 28.63  ? 100  TRP A CD2 1 
ATOM   761  N NE1 . TRP A 1 100 ? 180.798 43.498 163.599 1.00 31.92  ? 100  TRP A NE1 1 
ATOM   762  C CE2 . TRP A 1 100 ? 179.694 42.737 163.815 1.00 29.81  ? 100  TRP A CE2 1 
ATOM   763  C CE3 . TRP A 1 100 ? 178.417 41.085 162.624 1.00 29.48  ? 100  TRP A CE3 1 
ATOM   764  C CZ2 . TRP A 1 100 ? 178.895 42.650 164.917 1.00 30.85  ? 100  TRP A CZ2 1 
ATOM   765  C CZ3 . TRP A 1 100 ? 177.570 41.028 163.745 1.00 29.13  ? 100  TRP A CZ3 1 
ATOM   766  C CH2 . TRP A 1 100 ? 177.820 41.801 164.862 1.00 27.34  ? 100  TRP A CH2 1 
ATOM   767  N N   . VAL A 1 101 ? 181.126 42.841 157.213 1.00 26.60  ? 101  VAL A N   1 
ATOM   768  C CA  . VAL A 1 101 ? 181.593 42.639 155.813 1.00 26.61  ? 101  VAL A CA  1 
ATOM   769  C C   . VAL A 1 101 ? 183.068 42.870 155.680 1.00 23.13  ? 101  VAL A C   1 
ATOM   770  O O   . VAL A 1 101 ? 183.517 43.963 156.042 1.00 22.90  ? 101  VAL A O   1 
ATOM   771  C CB  . VAL A 1 101 ? 180.904 43.673 154.922 1.00 27.18  ? 101  VAL A CB  1 
ATOM   772  C CG1 . VAL A 1 101 ? 181.342 43.476 153.471 1.00 27.38  ? 101  VAL A CG1 1 
ATOM   773  C CG2 . VAL A 1 101 ? 179.386 43.575 155.099 1.00 27.89  ? 101  VAL A CG2 1 
ATOM   774  N N   . PRO A 1 102 ? 183.820 41.895 155.125 1.00 25.31  ? 102  PRO A N   1 
ATOM   775  C CA  . PRO A 1 102 ? 185.218 42.148 154.872 1.00 25.62  ? 102  PRO A CA  1 
ATOM   776  C C   . PRO A 1 102 ? 185.513 43.449 154.071 1.00 30.63  ? 102  PRO A C   1 
ATOM   777  O O   . PRO A 1 102 ? 184.595 44.143 153.472 1.00 33.38  ? 102  PRO A O   1 
ATOM   778  C CB  . PRO A 1 102 ? 185.682 40.918 154.111 1.00 27.35  ? 102  PRO A CB  1 
ATOM   779  C CG  . PRO A 1 102 ? 184.688 39.836 154.482 1.00 26.45  ? 102  PRO A CG  1 
ATOM   780  C CD  . PRO A 1 102 ? 183.409 40.551 154.658 1.00 25.33  ? 102  PRO A CD  1 
ATOM   781  N N   . SER A 1 103 ? 186.760 43.854 154.178 1.00 31.35  ? 103  SER A N   1 
ATOM   782  C CA  . SER A 1 103 ? 187.215 45.120 153.580 1.00 35.59  ? 103  SER A CA  1 
ATOM   783  C C   . SER A 1 103 ? 188.482 44.803 152.882 1.00 36.52  ? 103  SER A C   1 
ATOM   784  O O   . SER A 1 103 ? 189.400 44.332 153.489 1.00 30.38  ? 103  SER A O   1 
ATOM   785  C CB  . SER A 1 103 ? 187.505 46.210 154.611 1.00 39.08  ? 103  SER A CB  1 
ATOM   786  O OG  . SER A 1 103 ? 187.719 47.461 153.979 1.00 36.43  ? 103  SER A OG  1 
ATOM   787  N N   . PRO A 1 104 ? 188.522 45.027 151.577 1.00 38.28  ? 104  PRO A N   1 
ATOM   788  C CA  . PRO A 1 104 ? 187.449 45.583 150.731 1.00 33.86  ? 104  PRO A CA  1 
ATOM   789  C C   . PRO A 1 104 ? 186.181 44.702 150.517 1.00 30.85  ? 104  PRO A C   1 
ATOM   790  O O   . PRO A 1 104 ? 186.247 43.491 150.557 1.00 33.40  ? 104  PRO A O   1 
ATOM   791  C CB  . PRO A 1 104 ? 188.166 45.844 149.388 1.00 36.39  ? 104  PRO A CB  1 
ATOM   792  C CG  . PRO A 1 104 ? 189.393 44.936 149.414 1.00 39.24  ? 104  PRO A CG  1 
ATOM   793  C CD  . PRO A 1 104 ? 189.775 44.716 150.850 1.00 37.60  ? 104  PRO A CD  1 
ATOM   794  N N   . ARG A 1 105 ? 185.044 45.352 150.258 1.00 30.11  ? 105  ARG A N   1 
ATOM   795  C CA  . ARG A 1 105 ? 183.795 44.672 149.995 1.00 31.93  ? 105  ARG A CA  1 
ATOM   796  C C   . ARG A 1 105 ? 183.958 43.518 149.029 1.00 34.05  ? 105  ARG A C   1 
ATOM   797  O O   . ARG A 1 105 ? 184.518 43.684 147.967 1.00 33.13  ? 105  ARG A O   1 
ATOM   798  C CB  . ARG A 1 105 ? 182.751 45.616 149.474 1.00 32.11  ? 105  ARG A CB  1 
ATOM   799  C CG  . ARG A 1 105 ? 181.396 44.975 149.505 1.00 30.12  ? 105  ARG A CG  1 
ATOM   800  C CD  . ARG A 1 105 ? 180.350 45.915 149.054 1.00 27.44  ? 105  ARG A CD  1 
ATOM   801  N NE  . ARG A 1 105 ? 180.287 47.199 149.742 1.00 29.98  ? 105  ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 105 ? 179.541 48.194 149.300 1.00 30.57  ? 105  ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 105 ? 178.891 48.048 148.146 1.00 35.43  ? 105  ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 105 ? 179.470 49.361 149.929 1.00 33.54  ? 105  ARG A NH2 1 
ATOM   805  N N   . PRO A 1 106 ? 183.523 42.318 149.423 1.00 35.57  ? 106  PRO A N   1 
ATOM   806  C CA  . PRO A 1 106 ? 183.657 41.192 148.463 1.00 33.41  ? 106  PRO A CA  1 
ATOM   807  C C   . PRO A 1 106 ? 182.630 41.354 147.364 1.00 26.77  ? 106  PRO A C   1 
ATOM   808  O O   . PRO A 1 106 ? 181.777 42.228 147.436 1.00 28.60  ? 106  PRO A O   1 
ATOM   809  C CB  . PRO A 1 106 ? 183.292 39.944 149.280 1.00 34.88  ? 106  PRO A CB  1 
ATOM   810  C CG  . PRO A 1 106 ? 183.170 40.377 150.692 1.00 33.96  ? 106  PRO A CG  1 
ATOM   811  C CD  . PRO A 1 106 ? 183.166 41.886 150.772 1.00 35.56  ? 106  PRO A CD  1 
ATOM   812  N N   . LYS A 1 107 ? 182.642 40.471 146.405 1.00 28.92  ? 107  LYS A N   1 
ATOM   813  C CA  . LYS A 1 107 ? 181.668 40.514 145.327 1.00 28.96  ? 107  LYS A CA  1 
ATOM   814  C C   . LYS A 1 107 ? 180.586 39.535 145.637 1.00 29.06  ? 107  LYS A C   1 
ATOM   815  O O   . LYS A 1 107 ? 179.420 39.897 145.592 1.00 28.56  ? 107  LYS A O   1 
ATOM   816  C CB  . LYS A 1 107 ? 182.329 40.159 143.956 1.00 34.67  ? 107  LYS A CB  1 
ATOM   817  C CG  . LYS A 1 107 ? 183.494 41.062 143.561 1.00 35.31  ? 107  LYS A CG  1 
ATOM   818  C CD  . LYS A 1 107 ? 183.090 42.542 143.614 1.00 40.61  ? 107  LYS A CD  1 
ATOM   819  C CE  . LYS A 1 107 ? 184.299 43.509 143.542 1.00 42.73  ? 107  LYS A CE  1 
ATOM   820  N NZ  . LYS A 1 107 ? 183.762 44.893 143.589 1.00 42.44  ? 107  LYS A NZ  1 
ATOM   821  N N   . SER A 1 108 ? 180.970 38.296 145.933 1.00 27.44  ? 108  SER A N   1 
ATOM   822  C CA  . SER A 1 108 ? 179.987 37.252 146.142 1.00 30.96  ? 108  SER A CA  1 
ATOM   823  C C   . SER A 1 108 ? 180.567 36.267 147.131 1.00 30.55  ? 108  SER A C   1 
ATOM   824  O O   . SER A 1 108 ? 181.095 35.270 146.720 1.00 32.05  ? 108  SER A O   1 
ATOM   825  C CB  . SER A 1 108 ? 179.701 36.473 144.858 1.00 33.68  ? 108  SER A CB  1 
ATOM   826  O OG  . SER A 1 108 ? 178.413 35.844 144.923 1.00 37.56  ? 108  SER A OG  1 
ATOM   827  N N   . THR A 1 109 ? 180.531 36.542 148.422 1.00 28.02  ? 109  THR A N   1 
ATOM   828  C CA  . THR A 1 109 ? 181.207 35.610 149.330 1.00 27.95  ? 109  THR A CA  1 
ATOM   829  C C   . THR A 1 109 ? 180.195 34.853 150.209 1.00 26.51  ? 109  THR A C   1 
ATOM   830  O O   . THR A 1 109 ? 179.018 35.231 150.336 1.00 26.19  ? 109  THR A O   1 
ATOM   831  C CB  . THR A 1 109 ? 182.334 36.294 150.143 1.00 31.58  ? 109  THR A CB  1 
ATOM   832  O OG1 . THR A 1 109 ? 183.188 35.276 150.742 1.00 36.95  ? 109  THR A OG1 1 
ATOM   833  C CG2 . THR A 1 109 ? 181.751 37.079 151.240 1.00 27.19  ? 109  THR A CG2 1 
ATOM   834  N N   . THR A 1 110 ? 180.652 33.753 150.785 1.00 28.88  ? 110  THR A N   1 
ATOM   835  C CA  . THR A 1 110 ? 179.828 32.922 151.675 1.00 27.72  ? 110  THR A CA  1 
ATOM   836  C C   . THR A 1 110 ? 179.272 33.777 152.863 1.00 24.56  ? 110  THR A C   1 
ATOM   837  O O   . THR A 1 110 ? 179.951 34.671 153.387 1.00 21.53  ? 110  THR A O   1 
ATOM   838  C CB  . THR A 1 110 ? 180.691 31.794 152.179 1.00 30.64  ? 110  THR A CB  1 
ATOM   839  O OG1 . THR A 1 110 ? 181.096 30.978 151.056 1.00 33.84  ? 110  THR A OG1 1 
ATOM   840  C CG2 . THR A 1 110 ? 179.934 30.956 153.209 1.00 30.47  ? 110  THR A CG2 1 
ATOM   841  N N   . VAL A 1 111 ? 177.991 33.598 153.125 1.00 24.37  ? 111  VAL A N   1 
ATOM   842  C CA  . VAL A 1 111 ? 177.229 34.292 154.153 1.00 22.75  ? 111  VAL A CA  1 
ATOM   843  C C   . VAL A 1 111 ? 176.879 33.282 155.279 1.00 24.06  ? 111  VAL A C   1 
ATOM   844  O O   . VAL A 1 111 ? 176.458 32.134 154.990 1.00 19.44  ? 111  VAL A O   1 
ATOM   845  C CB  . VAL A 1 111 ? 175.904 34.778 153.587 1.00 22.92  ? 111  VAL A CB  1 
ATOM   846  C CG1 . VAL A 1 111 ? 175.116 35.574 154.614 1.00 22.93  ? 111  VAL A CG1 1 
ATOM   847  C CG2 . VAL A 1 111 ? 176.111 35.619 152.366 1.00 22.84  ? 111  VAL A CG2 1 
ATOM   848  N N   . MET A 1 112 ? 177.034 33.727 156.532 1.00 20.99  ? 112  MET A N   1 
ATOM   849  C CA  . MET A 1 112 ? 176.697 32.938 157.747 1.00 23.34  ? 112  MET A CA  1 
ATOM   850  C C   . MET A 1 112 ? 175.773 33.784 158.615 1.00 20.47  ? 112  MET A C   1 
ATOM   851  O O   . MET A 1 112 ? 176.041 34.978 158.828 1.00 23.09  ? 112  MET A O   1 
ATOM   852  C CB  . MET A 1 112 ? 177.958 32.554 158.460 1.00 22.28  ? 112  MET A CB  1 
ATOM   853  C CG  . MET A 1 112 ? 178.795 31.555 157.770 1.00 21.43  ? 112  MET A CG  1 
ATOM   854  S SD  . MET A 1 112 ? 180.330 31.075 158.650 1.00 24.85  ? 112  MET A SD  1 
ATOM   855  C CE  . MET A 1 112 ? 179.612 29.876 159.765 1.00 28.84  ? 112  MET A CE  1 
ATOM   856  N N   . VAL A 1 113 ? 174.580 33.277 158.914 1.00 21.34  ? 113  VAL A N   1 
ATOM   857  C CA  . VAL A 1 113 ? 173.569 34.026 159.632 1.00 19.40  ? 113  VAL A CA  1 
ATOM   858  C C   . VAL A 1 113 ? 173.384 33.344 161.006 1.00 21.10  ? 113  VAL A C   1 
ATOM   859  O O   . VAL A 1 113 ? 172.965 32.186 161.078 1.00 18.11  ? 113  VAL A O   1 
ATOM   860  C CB  . VAL A 1 113 ? 172.235 34.058 158.912 1.00 21.38  ? 113  VAL A CB  1 
ATOM   861  C CG1 . VAL A 1 113 ? 171.201 34.837 159.703 1.00 20.55  ? 113  VAL A CG1 1 
ATOM   862  C CG2 . VAL A 1 113 ? 172.376 34.637 157.500 1.00 22.07  ? 113  VAL A CG2 1 
ATOM   863  N N   . TRP A 1 114 ? 173.653 34.100 162.076 1.00 21.59  ? 114  TRP A N   1 
ATOM   864  C CA  . TRP A 1 114 ? 173.651 33.618 163.475 1.00 19.96  ? 114  TRP A CA  1 
ATOM   865  C C   . TRP A 1 114 ? 172.280 33.869 164.102 1.00 19.79  ? 114  TRP A C   1 
ATOM   866  O O   . TRP A 1 114 ? 171.700 34.948 163.961 1.00 17.60  ? 114  TRP A O   1 
ATOM   867  C CB  . TRP A 1 114 ? 174.760 34.312 164.273 1.00 21.77  ? 114  TRP A CB  1 
ATOM   868  C CG  . TRP A 1 114 ? 174.717 33.971 165.785 1.00 19.78  ? 114  TRP A CG  1 
ATOM   869  C CD1 . TRP A 1 114 ? 174.259 34.783 166.777 1.00 21.35  ? 114  TRP A CD1 1 
ATOM   870  C CD2 . TRP A 1 114 ? 174.999 32.739 166.391 1.00 19.46  ? 114  TRP A CD2 1 
ATOM   871  N NE1 . TRP A 1 114 ? 174.395 34.180 168.019 1.00 20.90  ? 114  TRP A NE1 1 
ATOM   872  C CE2 . TRP A 1 114 ? 174.794 32.897 167.798 1.00 21.72  ? 114  TRP A CE2 1 
ATOM   873  C CE3 . TRP A 1 114 ? 175.523 31.555 165.932 1.00 21.23  ? 114  TRP A CE3 1 
ATOM   874  C CZ2 . TRP A 1 114 ? 175.031 31.874 168.705 1.00 21.10  ? 114  TRP A CZ2 1 
ATOM   875  C CZ3 . TRP A 1 114 ? 175.788 30.531 166.843 1.00 22.55  ? 114  TRP A CZ3 1 
ATOM   876  C CH2 . TRP A 1 114 ? 175.551 30.710 168.224 1.00 21.54  ? 114  TRP A CH2 1 
ATOM   877  N N   . ILE A 1 115 ? 171.720 32.807 164.680 1.00 18.88  ? 115  ILE A N   1 
ATOM   878  C CA  . ILE A 1 115 ? 170.445 32.867 165.380 1.00 18.49  ? 115  ILE A CA  1 
ATOM   879  C C   . ILE A 1 115 ? 170.737 32.603 166.863 1.00 21.10  ? 115  ILE A C   1 
ATOM   880  O O   . ILE A 1 115 ? 171.110 31.499 167.233 1.00 18.98  ? 115  ILE A O   1 
ATOM   881  C CB  . ILE A 1 115 ? 169.499 31.800 164.905 1.00 17.90  ? 115  ILE A CB  1 
ATOM   882  C CG1 . ILE A 1 115 ? 169.292 31.949 163.374 1.00 17.59  ? 115  ILE A CG1 1 
ATOM   883  C CG2 . ILE A 1 115 ? 168.147 31.922 165.609 1.00 17.28  ? 115  ILE A CG2 1 
ATOM   884  C CD1 . ILE A 1 115 ? 168.239 30.976 162.827 1.00 17.98  ? 115  ILE A CD1 1 
ATOM   885  N N   . TYR A 1 116 ? 170.575 33.631 167.702 1.00 21.62  ? 116  TYR A N   1 
ATOM   886  C CA  . TYR A 1 116 ? 170.896 33.427 169.140 1.00 22.27  ? 116  TYR A CA  1 
ATOM   887  C C   . TYR A 1 116 ? 170.006 32.438 169.836 1.00 19.15  ? 116  TYR A C   1 
ATOM   888  O O   . TYR A 1 116 ? 168.811 32.298 169.555 1.00 20.87  ? 116  TYR A O   1 
ATOM   889  C CB  . TYR A 1 116 ? 170.879 34.714 169.947 1.00 19.62  ? 116  TYR A CB  1 
ATOM   890  C CG  . TYR A 1 116 ? 169.671 35.588 169.826 1.00 18.09  ? 116  TYR A CG  1 
ATOM   891  C CD1 . TYR A 1 116 ? 168.560 35.324 170.527 1.00 21.10  ? 116  TYR A CD1 1 
ATOM   892  C CD2 . TYR A 1 116 ? 169.727 36.796 169.193 1.00 19.35  ? 116  TYR A CD2 1 
ATOM   893  C CE1 . TYR A 1 116 ? 167.472 36.175 170.507 1.00 18.65  ? 116  TYR A CE1 1 
ATOM   894  C CE2 . TYR A 1 116 ? 168.589 37.649 169.174 1.00 18.77  ? 116  TYR A CE2 1 
ATOM   895  C CZ  . TYR A 1 116 ? 167.481 37.284 169.799 1.00 18.36  ? 116  TYR A CZ  1 
ATOM   896  O OH  . TYR A 1 116 ? 166.322 38.058 169.808 1.00 20.64  ? 116  TYR A OH  1 
ATOM   897  N N   . GLY A 1 117 ? 170.587 31.824 170.839 1.00 22.13  ? 117  GLY A N   1 
ATOM   898  C CA  . GLY A 1 117 ? 169.789 31.042 171.832 1.00 21.38  ? 117  GLY A CA  1 
ATOM   899  C C   . GLY A 1 117 ? 169.312 31.881 173.011 1.00 20.90  ? 117  GLY A C   1 
ATOM   900  O O   . GLY A 1 117 ? 169.296 33.145 172.975 1.00 21.15  ? 117  GLY A O   1 
ATOM   901  N N   . GLY A 1 118 ? 168.924 31.168 174.070 1.00 20.77  ? 118  GLY A N   1 
ATOM   902  C CA  . GLY A 1 118 ? 168.281 31.769 175.230 1.00 18.54  ? 118  GLY A CA  1 
ATOM   903  C C   . GLY A 1 118 ? 166.943 31.176 175.595 1.00 17.87  ? 118  GLY A C   1 
ATOM   904  O O   . GLY A 1 118 ? 166.060 31.884 176.073 1.00 21.02  ? 118  GLY A O   1 
ATOM   905  N N   . GLY A 1 119 ? 166.742 29.920 175.284 1.00 18.51  ? 119  GLY A N   1 
ATOM   906  C CA  . GLY A 1 119 ? 165.556 29.167 175.739 1.00 21.20  ? 119  GLY A CA  1 
ATOM   907  C C   . GLY A 1 119 ? 164.214 29.679 175.191 1.00 22.13  ? 119  GLY A C   1 
ATOM   908  O O   . GLY A 1 119 ? 163.171 29.349 175.702 1.00 20.51  ? 119  GLY A O   1 
ATOM   909  N N   . PHE A 1 120 ? 164.279 30.474 174.125 1.00 19.80  ? 120  PHE A N   1 
ATOM   910  C CA  . PHE A 1 120 ? 163.141 31.129 173.505 1.00 19.42  ? 120  PHE A CA  1 
ATOM   911  C C   . PHE A 1 120 ? 162.572 32.233 174.392 1.00 21.46  ? 120  PHE A C   1 
ATOM   912  O O   . PHE A 1 120 ? 161.572 32.852 174.018 1.00 18.86  ? 120  PHE A O   1 
ATOM   913  C CB  . PHE A 1 120 ? 162.033 30.178 173.019 1.00 20.40  ? 120  PHE A CB  1 
ATOM   914  C CG  . PHE A 1 120 ? 162.437 29.270 171.890 1.00 19.41  ? 120  PHE A CG  1 
ATOM   915  C CD1 . PHE A 1 120 ? 162.652 29.794 170.641 1.00 19.04  ? 120  PHE A CD1 1 
ATOM   916  C CD2 . PHE A 1 120 ? 162.654 27.917 172.077 1.00 18.74  ? 120  PHE A CD2 1 
ATOM   917  C CE1 . PHE A 1 120 ? 163.024 29.018 169.597 1.00 18.09  ? 120  PHE A CE1 1 
ATOM   918  C CE2 . PHE A 1 120 ? 163.026 27.111 171.012 1.00 17.60  ? 120  PHE A CE2 1 
ATOM   919  C CZ  . PHE A 1 120 ? 163.185 27.660 169.764 1.00 19.33  ? 120  PHE A CZ  1 
ATOM   920  N N   . TYR A 1 121 ? 163.185 32.516 175.554 1.00 22.46  ? 121  TYR A N   1 
ATOM   921  C CA  . TYR A 1 121 ? 162.630 33.568 176.459 1.00 20.52  ? 121  TYR A CA  1 
ATOM   922  C C   . TYR A 1 121 ? 163.601 34.711 176.586 1.00 20.32  ? 121  TYR A C   1 
ATOM   923  O O   . TYR A 1 121 ? 163.294 35.663 177.217 1.00 19.10  ? 121  TYR A O   1 
ATOM   924  C CB  . TYR A 1 121 ? 162.345 32.997 177.914 1.00 21.53  ? 121  TYR A CB  1 
ATOM   925  C CG  . TYR A 1 121 ? 163.596 32.666 178.679 1.00 19.94  ? 121  TYR A CG  1 
ATOM   926  C CD1 . TYR A 1 121 ? 164.232 33.655 179.468 1.00 23.36  ? 121  TYR A CD1 1 
ATOM   927  C CD2 . TYR A 1 121 ? 164.151 31.407 178.641 1.00 21.75  ? 121  TYR A CD2 1 
ATOM   928  C CE1 . TYR A 1 121 ? 165.450 33.366 180.137 1.00 20.89  ? 121  TYR A CE1 1 
ATOM   929  C CE2 . TYR A 1 121 ? 165.340 31.088 179.295 1.00 21.83  ? 121  TYR A CE2 1 
ATOM   930  C CZ  . TYR A 1 121 ? 165.996 32.100 180.053 1.00 23.72  ? 121  TYR A CZ  1 
ATOM   931  O OH  . TYR A 1 121 ? 167.191 31.830 180.736 1.00 24.52  ? 121  TYR A OH  1 
ATOM   932  N N   . SER A 1 122 ? 164.838 34.567 176.070 1.00 20.87  ? 122  SER A N   1 
ATOM   933  C CA  . SER A 1 122 ? 165.809 35.601 176.176 1.00 19.25  ? 122  SER A CA  1 
ATOM   934  C C   . SER A 1 122 ? 166.720 35.517 174.991 1.00 21.25  ? 122  SER A C   1 
ATOM   935  O O   . SER A 1 122 ? 166.606 34.606 174.179 1.00 19.15  ? 122  SER A O   1 
ATOM   936  C CB  . SER A 1 122 ? 166.682 35.395 177.435 1.00 19.76  ? 122  SER A CB  1 
ATOM   937  O OG  . SER A 1 122 ? 167.254 34.125 177.476 1.00 19.45  ? 122  SER A OG  1 
ATOM   938  N N   . GLY A 1 123 ? 167.659 36.437 174.956 1.00 18.57  ? 123  GLY A N   1 
ATOM   939  C CA  . GLY A 1 123 ? 168.798 36.423 174.032 1.00 21.07  ? 123  GLY A CA  1 
ATOM   940  C C   . GLY A 1 123 ? 168.834 37.757 173.271 1.00 21.34  ? 123  GLY A C   1 
ATOM   941  O O   . GLY A 1 123 ? 167.859 38.550 173.278 1.00 22.69  ? 123  GLY A O   1 
ATOM   942  N N   . SER A 1 124 ? 169.974 38.011 172.678 1.00 21.60  ? 124  SER A N   1 
ATOM   943  C CA  . SER A 1 124 ? 170.293 39.310 172.118 1.00 22.02  ? 124  SER A CA  1 
ATOM   944  C C   . SER A 1 124 ? 171.315 39.064 171.019 1.00 21.67  ? 124  SER A C   1 
ATOM   945  O O   . SER A 1 124 ? 172.262 38.276 171.205 1.00 22.93  ? 124  SER A O   1 
ATOM   946  C CB  . SER A 1 124 ? 171.005 40.195 173.190 1.00 24.03  ? 124  SER A CB  1 
ATOM   947  O OG  . SER A 1 124 ? 170.084 40.639 174.188 1.00 24.30  ? 124  SER A OG  1 
ATOM   948  N N   . SER A 1 125 ? 171.214 39.807 169.919 1.00 23.01  ? 125  SER A N   1 
ATOM   949  C CA  . SER A 1 125 ? 172.218 39.708 168.853 1.00 24.94  ? 125  SER A CA  1 
ATOM   950  C C   . SER A 1 125 ? 173.476 40.496 169.117 1.00 25.77  ? 125  SER A C   1 
ATOM   951  O O   . SER A 1 125 ? 174.444 40.359 168.366 1.00 26.28  ? 125  SER A O   1 
ATOM   952  C CB  . SER A 1 125 ? 171.644 40.200 167.548 1.00 23.39  ? 125  SER A CB  1 
ATOM   953  O OG  . SER A 1 125 ? 171.323 41.560 167.611 1.00 23.99  ? 125  SER A OG  1 
ATOM   954  N N   . THR A 1 126 ? 173.457 41.295 170.187 1.00 26.58  ? 126  THR A N   1 
ATOM   955  C CA  . THR A 1 126 ? 174.476 42.314 170.450 1.00 24.08  ? 126  THR A CA  1 
ATOM   956  C C   . THR A 1 126 ? 175.490 41.887 171.446 1.00 27.13  ? 126  THR A C   1 
ATOM   957  O O   . THR A 1 126 ? 176.328 42.648 171.780 1.00 22.52  ? 126  THR A O   1 
ATOM   958  C CB  . THR A 1 126 ? 173.786 43.583 170.929 1.00 23.79  ? 126  THR A CB  1 
ATOM   959  O OG1 . THR A 1 126 ? 172.902 43.359 172.063 1.00 21.84  ? 126  THR A OG1 1 
ATOM   960  C CG2 . THR A 1 126 ? 172.883 44.084 169.793 1.00 21.62  ? 126  THR A CG2 1 
ATOM   961  N N   . LEU A 1 127 ? 175.438 40.641 171.926 1.00 26.59  ? 127  LEU A N   1 
ATOM   962  C CA  . LEU A 1 127 ? 176.337 40.238 172.982 1.00 27.15  ? 127  LEU A CA  1 
ATOM   963  C C   . LEU A 1 127 ? 177.766 40.281 172.504 1.00 27.94  ? 127  LEU A C   1 
ATOM   964  O O   . LEU A 1 127 ? 178.043 39.944 171.341 1.00 27.25  ? 127  LEU A O   1 
ATOM   965  C CB  . LEU A 1 127 ? 176.025 38.828 173.507 1.00 25.04  ? 127  LEU A CB  1 
ATOM   966  C CG  . LEU A 1 127 ? 174.594 38.570 173.947 1.00 25.85  ? 127  LEU A CG  1 
ATOM   967  C CD1 . LEU A 1 127 ? 174.527 37.114 174.398 1.00 25.29  ? 127  LEU A CD1 1 
ATOM   968  C CD2 . LEU A 1 127 ? 174.161 39.535 175.048 1.00 25.82  ? 127  LEU A CD2 1 
ATOM   969  N N   . ASP A 1 128 ? 178.701 40.621 173.401 1.00 25.75  ? 128  ASP A N   1 
ATOM   970  C CA  . ASP A 1 128 ? 180.121 40.583 173.057 1.00 26.78  ? 128  ASP A CA  1 
ATOM   971  C C   . ASP A 1 128 ? 180.548 39.222 172.428 1.00 28.17  ? 128  ASP A C   1 
ATOM   972  O O   . ASP A 1 128 ? 181.398 39.142 171.543 1.00 27.11  ? 128  ASP A O   1 
ATOM   973  C CB  . ASP A 1 128 ? 181.007 40.818 174.291 1.00 32.58  ? 128  ASP A CB  1 
ATOM   974  C CG  . ASP A 1 128 ? 181.015 42.288 174.763 1.00 36.25  ? 128  ASP A CG  1 
ATOM   975  O OD1 . ASP A 1 128 ? 180.401 43.166 174.124 1.00 39.03  ? 128  ASP A OD1 1 
ATOM   976  O OD2 . ASP A 1 128 ? 181.626 42.548 175.807 1.00 45.56  ? 128  ASP A OD2 1 
ATOM   977  N N   . VAL A 1 129 ? 180.013 38.135 172.955 1.00 26.08  ? 129  VAL A N   1 
ATOM   978  C CA  . VAL A 1 129 ? 180.449 36.818 172.543 1.00 23.58  ? 129  VAL A CA  1 
ATOM   979  C C   . VAL A 1 129 ? 179.901 36.454 171.137 1.00 23.01  ? 129  VAL A C   1 
ATOM   980  O O   . VAL A 1 129 ? 180.309 35.422 170.563 1.00 25.68  ? 129  VAL A O   1 
ATOM   981  C CB  . VAL A 1 129 ? 179.981 35.783 173.581 1.00 23.92  ? 129  VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 129 ? 178.488 35.613 173.539 1.00 21.82  ? 129  VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 129 ? 180.593 34.476 173.389 1.00 27.29  ? 129  VAL A CG2 1 
ATOM   984  N N   . TYR A 1 130 ? 178.954 37.241 170.613 1.00 23.85  ? 130  TYR A N   1 
ATOM   985  C CA  . TYR A 1 130 ? 178.404 37.043 169.232 1.00 24.50  ? 130  TYR A CA  1 
ATOM   986  C C   . TYR A 1 130 ? 178.911 38.105 168.240 1.00 25.18  ? 130  TYR A C   1 
ATOM   987  O O   . TYR A 1 130 ? 178.383 38.222 167.171 1.00 24.09  ? 130  TYR A O   1 
ATOM   988  C CB  . TYR A 1 130 ? 176.876 37.096 169.202 1.00 22.89  ? 130  TYR A CB  1 
ATOM   989  C CG  . TYR A 1 130 ? 176.119 36.174 170.130 1.00 20.84  ? 130  TYR A CG  1 
ATOM   990  C CD1 . TYR A 1 130 ? 176.594 34.949 170.475 1.00 22.74  ? 130  TYR A CD1 1 
ATOM   991  C CD2 . TYR A 1 130 ? 174.845 36.538 170.582 1.00 20.07  ? 130  TYR A CD2 1 
ATOM   992  C CE1 . TYR A 1 130 ? 175.825 34.112 171.279 1.00 23.14  ? 130  TYR A CE1 1 
ATOM   993  C CE2 . TYR A 1 130 ? 174.090 35.724 171.373 1.00 19.78  ? 130  TYR A CE2 1 
ATOM   994  C CZ  . TYR A 1 130 ? 174.584 34.513 171.732 1.00 20.79  ? 130  TYR A CZ  1 
ATOM   995  O OH  . TYR A 1 130 ? 173.814 33.717 172.602 1.00 21.83  ? 130  TYR A OH  1 
ATOM   996  N N   . ASN A 1 131 ? 179.942 38.858 168.603 1.00 25.64  ? 131  ASN A N   1 
ATOM   997  C CA  . ASN A 1 131 ? 180.492 39.892 167.731 1.00 25.20  ? 131  ASN A CA  1 
ATOM   998  C C   . ASN A 1 131 ? 181.109 39.213 166.499 1.00 22.44  ? 131  ASN A C   1 
ATOM   999  O O   . ASN A 1 131 ? 182.058 38.397 166.578 1.00 22.48  ? 131  ASN A O   1 
ATOM   1000 C CB  . ASN A 1 131 ? 181.539 40.652 168.511 1.00 29.57  ? 131  ASN A CB  1 
ATOM   1001 C CG  . ASN A 1 131 ? 182.117 41.848 167.763 1.00 34.47  ? 131  ASN A CG  1 
ATOM   1002 O OD1 . ASN A 1 131 ? 182.057 41.973 166.540 1.00 32.54  ? 131  ASN A OD1 1 
ATOM   1003 N ND2 . ASN A 1 131 ? 182.783 42.689 168.524 1.00 38.60  ? 131  ASN A ND2 1 
ATOM   1004 N N   . GLY A 1 132 ? 180.563 39.533 165.343 1.00 23.12  ? 132  GLY A N   1 
ATOM   1005 C CA  . GLY A 1 132 ? 180.954 38.821 164.096 1.00 24.28  ? 132  GLY A CA  1 
ATOM   1006 C C   . GLY A 1 132 ? 182.258 39.192 163.415 1.00 24.51  ? 132  GLY A C   1 
ATOM   1007 O O   . GLY A 1 132 ? 182.715 38.525 162.437 1.00 26.17  ? 132  GLY A O   1 
ATOM   1008 N N   . LYS A 1 133 ? 182.900 40.210 163.962 1.00 25.64  ? 133  LYS A N   1 
ATOM   1009 C CA  . LYS A 1 133 ? 184.025 40.801 163.288 1.00 25.40  ? 133  LYS A CA  1 
ATOM   1010 C C   . LYS A 1 133 ? 185.148 39.837 163.169 1.00 26.38  ? 133  LYS A C   1 
ATOM   1011 O O   . LYS A 1 133 ? 185.782 39.809 162.107 1.00 29.14  ? 133  LYS A O   1 
ATOM   1012 C CB  . LYS A 1 133 ? 184.441 42.128 163.919 1.00 24.23  ? 133  LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 133 ? 185.298 42.001 165.140 1.00 26.92  ? 133  LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 133 ? 185.256 43.331 165.869 1.00 28.80  ? 133  LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 133 ? 186.365 43.447 166.893 1.00 32.36  ? 133  LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 133 ? 186.318 44.834 167.453 1.00 35.80  ? 133  LYS A NZ  1 
ATOM   1017 N N   . TYR A 1 134 ? 185.395 38.979 164.160 1.00 25.68  ? 134  TYR A N   1 
ATOM   1018 C CA  . TYR A 1 134 ? 186.602 38.138 164.081 1.00 26.15  ? 134  TYR A CA  1 
ATOM   1019 C C   . TYR A 1 134 ? 186.472 37.066 162.985 1.00 27.48  ? 134  TYR A C   1 
ATOM   1020 O O   . TYR A 1 134 ? 187.451 36.661 162.341 1.00 27.46  ? 134  TYR A O   1 
ATOM   1021 C CB  . TYR A 1 134 ? 186.913 37.435 165.445 1.00 30.13  ? 134  TYR A CB  1 
ATOM   1022 C CG  . TYR A 1 134 ? 187.039 38.436 166.582 1.00 33.67  ? 134  TYR A CG  1 
ATOM   1023 C CD1 . TYR A 1 134 ? 188.183 39.276 166.699 1.00 33.96  ? 134  TYR A CD1 1 
ATOM   1024 C CD2 . TYR A 1 134 ? 186.001 38.602 167.493 1.00 35.01  ? 134  TYR A CD2 1 
ATOM   1025 C CE1 . TYR A 1 134 ? 188.258 40.256 167.696 1.00 34.18  ? 134  TYR A CE1 1 
ATOM   1026 C CE2 . TYR A 1 134 ? 186.067 39.565 168.494 1.00 39.31  ? 134  TYR A CE2 1 
ATOM   1027 C CZ  . TYR A 1 134 ? 187.191 40.385 168.582 1.00 37.64  ? 134  TYR A CZ  1 
ATOM   1028 O OH  . TYR A 1 134 ? 187.207 41.296 169.566 1.00 43.75  ? 134  TYR A OH  1 
ATOM   1029 N N   . LEU A 1 135 ? 185.267 36.517 162.898 1.00 25.54  ? 135  LEU A N   1 
ATOM   1030 C CA  . LEU A 1 135 ? 184.970 35.429 162.009 1.00 29.47  ? 135  LEU A CA  1 
ATOM   1031 C C   . LEU A 1 135 ? 184.916 36.017 160.579 1.00 27.66  ? 135  LEU A C   1 
ATOM   1032 O O   . LEU A 1 135 ? 185.482 35.444 159.662 1.00 33.25  ? 135  LEU A O   1 
ATOM   1033 C CB  . LEU A 1 135 ? 183.640 34.766 162.425 1.00 31.16  ? 135  LEU A CB  1 
ATOM   1034 C CG  . LEU A 1 135 ? 183.130 33.533 161.731 1.00 33.68  ? 135  LEU A CG  1 
ATOM   1035 C CD1 . LEU A 1 135 ? 184.100 32.382 161.694 1.00 32.43  ? 135  LEU A CD1 1 
ATOM   1036 C CD2 . LEU A 1 135 ? 181.863 33.135 162.442 1.00 34.63  ? 135  LEU A CD2 1 
ATOM   1037 N N   . ALA A 1 136 ? 184.270 37.159 160.430 1.00 26.71  ? 136  ALA A N   1 
ATOM   1038 C CA  . ALA A 1 136 ? 184.103 37.800 159.141 1.00 28.60  ? 136  ALA A CA  1 
ATOM   1039 C C   . ALA A 1 136 ? 185.478 38.144 158.565 1.00 30.17  ? 136  ALA A C   1 
ATOM   1040 O O   . ALA A 1 136 ? 185.811 37.733 157.493 1.00 29.53  ? 136  ALA A O   1 
ATOM   1041 C CB  . ALA A 1 136 ? 183.264 39.035 159.288 1.00 23.34  ? 136  ALA A CB  1 
ATOM   1042 N N   . TYR A 1 137 ? 186.299 38.796 159.376 1.00 31.69  ? 137  TYR A N   1 
ATOM   1043 C CA  . TYR A 1 137 ? 187.677 39.065 159.062 1.00 29.79  ? 137  TYR A CA  1 
ATOM   1044 C C   . TYR A 1 137 ? 188.530 37.857 158.825 1.00 28.74  ? 137  TYR A C   1 
ATOM   1045 O O   . TYR A 1 137 ? 189.277 37.809 157.837 1.00 29.53  ? 137  TYR A O   1 
ATOM   1046 C CB  . TYR A 1 137 ? 188.304 39.896 160.178 1.00 30.59  ? 137  TYR A CB  1 
ATOM   1047 C CG  . TYR A 1 137 ? 189.726 40.164 159.936 1.00 32.01  ? 137  TYR A CG  1 
ATOM   1048 C CD1 . TYR A 1 137 ? 190.141 41.075 158.924 1.00 37.28  ? 137  TYR A CD1 1 
ATOM   1049 C CD2 . TYR A 1 137 ? 190.680 39.501 160.660 1.00 33.52  ? 137  TYR A CD2 1 
ATOM   1050 C CE1 . TYR A 1 137 ? 191.502 41.307 158.686 1.00 36.32  ? 137  TYR A CE1 1 
ATOM   1051 C CE2 . TYR A 1 137 ? 192.018 39.738 160.468 1.00 35.67  ? 137  TYR A CE2 1 
ATOM   1052 C CZ  . TYR A 1 137 ? 192.428 40.618 159.469 1.00 36.52  ? 137  TYR A CZ  1 
ATOM   1053 O OH  . TYR A 1 137 ? 193.765 40.742 159.317 1.00 40.55  ? 137  TYR A OH  1 
ATOM   1054 N N   . THR A 1 138 ? 188.482 36.870 159.697 1.00 28.99  ? 138  THR A N   1 
ATOM   1055 C CA  . THR A 1 138 ? 189.470 35.745 159.605 1.00 28.45  ? 138  THR A CA  1 
ATOM   1056 C C   . THR A 1 138 ? 189.174 34.800 158.485 1.00 29.40  ? 138  THR A C   1 
ATOM   1057 O O   . THR A 1 138 ? 190.085 34.193 157.892 1.00 28.93  ? 138  THR A O   1 
ATOM   1058 C CB  . THR A 1 138 ? 189.561 34.908 160.893 1.00 27.42  ? 138  THR A CB  1 
ATOM   1059 O OG1 . THR A 1 138 ? 190.001 35.755 161.951 1.00 31.61  ? 138  THR A OG1 1 
ATOM   1060 C CG2 . THR A 1 138 ? 190.582 33.806 160.788 1.00 30.81  ? 138  THR A CG2 1 
ATOM   1061 N N   . GLU A 1 139 ? 187.893 34.605 158.234 1.00 29.88  ? 139  GLU A N   1 
ATOM   1062 C CA  . GLU A 1 139 ? 187.488 33.617 157.255 1.00 28.76  ? 139  GLU A CA  1 
ATOM   1063 C C   . GLU A 1 139 ? 186.890 34.233 155.989 1.00 27.15  ? 139  GLU A C   1 
ATOM   1064 O O   . GLU A 1 139 ? 186.435 33.498 155.133 1.00 27.26  ? 139  GLU A O   1 
ATOM   1065 C CB  . GLU A 1 139 ? 186.501 32.622 157.917 1.00 30.02  ? 139  GLU A CB  1 
ATOM   1066 C CG  . GLU A 1 139 ? 187.173 31.732 158.970 1.00 29.33  ? 139  GLU A CG  1 
ATOM   1067 C CD  . GLU A 1 139 ? 188.137 30.781 158.393 1.00 34.79  ? 139  GLU A CD  1 
ATOM   1068 O OE1 . GLU A 1 139 ? 187.874 30.343 157.258 1.00 36.54  ? 139  GLU A OE1 1 
ATOM   1069 O OE2 . GLU A 1 139 ? 189.162 30.468 159.071 1.00 36.34  ? 139  GLU A OE2 1 
ATOM   1070 N N   . GLU A 1 140 ? 186.875 35.556 155.868 1.00 29.78  ? 140  GLU A N   1 
ATOM   1071 C CA  A GLU A 1 140 ? 186.379 36.185 154.665 0.50 33.54  ? 140  GLU A CA  1 
ATOM   1072 C CA  B GLU A 1 140 ? 186.320 36.242 154.686 0.50 33.26  ? 140  GLU A CA  1 
ATOM   1073 C C   . GLU A 1 140 ? 184.898 35.801 154.413 1.00 32.26  ? 140  GLU A C   1 
ATOM   1074 O O   . GLU A 1 140 ? 184.539 35.403 153.306 1.00 33.58  ? 140  GLU A O   1 
ATOM   1075 C CB  A GLU A 1 140 ? 187.318 35.828 153.463 0.50 36.41  ? 140  GLU A CB  1 
ATOM   1076 C CB  B GLU A 1 140 ? 187.184 36.069 153.410 0.50 35.37  ? 140  GLU A CB  1 
ATOM   1077 C CG  A GLU A 1 140 ? 188.822 35.717 153.848 0.50 39.35  ? 140  GLU A CG  1 
ATOM   1078 C CG  B GLU A 1 140 ? 188.300 37.102 153.258 0.50 38.21  ? 140  GLU A CG  1 
ATOM   1079 C CD  A GLU A 1 140 ? 189.808 35.749 152.672 0.50 43.65  ? 140  GLU A CD  1 
ATOM   1080 C CD  B GLU A 1 140 ? 187.856 38.363 152.553 0.50 38.89  ? 140  GLU A CD  1 
ATOM   1081 O OE1 A GLU A 1 140 ? 189.836 34.814 151.827 0.50 41.59  ? 140  GLU A OE1 1 
ATOM   1082 O OE1 B GLU A 1 140 ? 186.966 38.333 151.666 0.50 40.39  ? 140  GLU A OE1 1 
ATOM   1083 O OE2 A GLU A 1 140 ? 190.591 36.717 152.620 0.50 47.19  ? 140  GLU A OE2 1 
ATOM   1084 O OE2 B GLU A 1 140 ? 188.440 39.413 152.873 0.50 45.82  ? 140  GLU A OE2 1 
ATOM   1085 N N   . VAL A 1 141 ? 184.044 35.937 155.434 1.00 28.79  ? 141  VAL A N   1 
ATOM   1086 C CA  . VAL A 1 141 ? 182.612 35.666 155.251 1.00 24.74  ? 141  VAL A CA  1 
ATOM   1087 C C   . VAL A 1 141 ? 181.949 36.924 155.601 1.00 23.38  ? 141  VAL A C   1 
ATOM   1088 O O   . VAL A 1 141 ? 182.526 37.733 156.300 1.00 23.46  ? 141  VAL A O   1 
ATOM   1089 C CB  . VAL A 1 141 ? 182.105 34.495 156.119 1.00 27.20  ? 141  VAL A CB  1 
ATOM   1090 C CG1 . VAL A 1 141 ? 182.914 33.249 155.847 1.00 25.86  ? 141  VAL A CG1 1 
ATOM   1091 C CG2 . VAL A 1 141 ? 182.216 34.775 157.595 1.00 30.40  ? 141  VAL A CG2 1 
ATOM   1092 N N   . VAL A 1 142 ? 180.764 37.116 155.039 1.00 21.82  ? 142  VAL A N   1 
ATOM   1093 C CA  . VAL A 1 142 ? 179.824 38.086 155.480 1.00 22.82  ? 142  VAL A CA  1 
ATOM   1094 C C   . VAL A 1 142 ? 178.980 37.440 156.599 1.00 25.84  ? 142  VAL A C   1 
ATOM   1095 O O   . VAL A 1 142 ? 178.345 36.357 156.380 1.00 25.76  ? 142  VAL A O   1 
ATOM   1096 C CB  . VAL A 1 142 ? 178.886 38.472 154.354 1.00 21.49  ? 142  VAL A CB  1 
ATOM   1097 C CG1 . VAL A 1 142 ? 177.754 39.327 154.835 1.00 23.51  ? 142  VAL A CG1 1 
ATOM   1098 C CG2 . VAL A 1 142 ? 179.692 39.238 153.280 1.00 23.80  ? 142  VAL A CG2 1 
ATOM   1099 N N   . LEU A 1 143 ? 179.006 38.070 157.776 1.00 22.86  ? 143  LEU A N   1 
ATOM   1100 C CA  . LEU A 1 143 ? 178.435 37.461 159.009 1.00 21.94  ? 143  LEU A CA  1 
ATOM   1101 C C   . LEU A 1 143 ? 177.251 38.303 159.354 1.00 20.05  ? 143  LEU A C   1 
ATOM   1102 O O   . LEU A 1 143 ? 177.392 39.495 159.568 1.00 20.60  ? 143  LEU A O   1 
ATOM   1103 C CB  . LEU A 1 143 ? 179.494 37.510 160.117 1.00 25.45  ? 143  LEU A CB  1 
ATOM   1104 C CG  . LEU A 1 143 ? 179.253 36.670 161.387 1.00 27.08  ? 143  LEU A CG  1 
ATOM   1105 C CD1 . LEU A 1 143 ? 178.105 37.290 162.160 1.00 28.61  ? 143  LEU A CD1 1 
ATOM   1106 C CD2 . LEU A 1 143 ? 178.933 35.216 161.100 1.00 27.39  ? 143  LEU A CD2 1 
ATOM   1107 N N   . VAL A 1 144 ? 176.093 37.705 159.419 1.00 18.90  ? 144  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 144 ? 174.887 38.378 159.831 1.00 18.95  ? 144  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 144 ? 174.433 37.807 161.174 1.00 21.01  ? 144  VAL A C   1 
ATOM   1110 O O   . VAL A 1 144 ? 174.457 36.586 161.343 1.00 21.74  ? 144  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 144 ? 173.757 38.104 158.853 1.00 19.23  ? 144  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 144 ? 172.475 38.798 159.249 1.00 19.57  ? 144  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 144 ? 174.128 38.564 157.443 1.00 21.88  ? 144  VAL A CG2 1 
ATOM   1114 N N   . SER A 1 145 ? 173.937 38.659 162.068 1.00 20.42  ? 145  SER A N   1 
ATOM   1115 C CA  . SER A 1 145 ? 173.172 38.156 163.224 1.00 22.38  ? 145  SER A CA  1 
ATOM   1116 C C   . SER A 1 145 ? 171.817 38.793 163.194 1.00 22.48  ? 145  SER A C   1 
ATOM   1117 O O   . SER A 1 145 ? 171.664 39.995 162.995 1.00 22.39  ? 145  SER A O   1 
ATOM   1118 C CB  . SER A 1 145 ? 173.893 38.381 164.565 1.00 20.58  ? 145  SER A CB  1 
ATOM   1119 O OG  . SER A 1 145 ? 174.182 39.764 164.779 1.00 21.58  ? 145  SER A OG  1 
ATOM   1120 N N   . LEU A 1 146 ? 170.796 37.983 163.362 1.00 21.75  ? 146  LEU A N   1 
ATOM   1121 C CA  . LEU A 1 146 ? 169.473 38.527 163.348 1.00 20.16  ? 146  LEU A CA  1 
ATOM   1122 C C   . LEU A 1 146 ? 168.928 38.643 164.803 1.00 22.88  ? 146  LEU A C   1 
ATOM   1123 O O   . LEU A 1 146 ? 169.548 38.251 165.742 1.00 21.45  ? 146  LEU A O   1 
ATOM   1124 C CB  . LEU A 1 146 ? 168.594 37.615 162.456 1.00 22.53  ? 146  LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 146 ? 168.548 36.102 162.667 1.00 22.89  ? 146  LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 146 ? 167.819 35.717 163.978 1.00 24.68  ? 146  LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 146 ? 167.822 35.416 161.542 1.00 23.23  ? 146  LEU A CD2 1 
ATOM   1128 N N   . SER A 1 147 ? 167.720 39.144 164.944 1.00 24.08  ? 147  SER A N   1 
ATOM   1129 C CA  . SER A 1 147 ? 167.031 39.107 166.154 1.00 24.30  ? 147  SER A CA  1 
ATOM   1130 C C   . SER A 1 147 ? 165.625 38.637 165.920 1.00 25.16  ? 147  SER A C   1 
ATOM   1131 O O   . SER A 1 147 ? 165.174 38.461 164.758 1.00 23.34  ? 147  SER A O   1 
ATOM   1132 C CB  . SER A 1 147 ? 167.075 40.445 166.787 1.00 25.02  ? 147  SER A CB  1 
ATOM   1133 O OG  . SER A 1 147 ? 166.282 41.327 166.054 1.00 27.11  ? 147  SER A OG  1 
ATOM   1134 N N   . TYR A 1 148 ? 164.983 38.290 167.027 1.00 22.86  ? 148  TYR A N   1 
ATOM   1135 C CA  . TYR A 1 148 ? 163.622 37.790 167.054 1.00 21.38  ? 148  TYR A CA  1 
ATOM   1136 C C   . TYR A 1 148 ? 162.981 37.917 168.456 1.00 22.56  ? 148  TYR A C   1 
ATOM   1137 O O   . TYR A 1 148 ? 163.677 37.829 169.467 1.00 22.18  ? 148  TYR A O   1 
ATOM   1138 C CB  . TYR A 1 148 ? 163.562 36.329 166.639 1.00 21.59  ? 148  TYR A CB  1 
ATOM   1139 C CG  . TYR A 1 148 ? 164.320 35.321 167.505 1.00 20.55  ? 148  TYR A CG  1 
ATOM   1140 C CD1 . TYR A 1 148 ? 165.680 35.139 167.361 1.00 21.34  ? 148  TYR A CD1 1 
ATOM   1141 C CD2 . TYR A 1 148 ? 163.666 34.534 168.406 1.00 19.40  ? 148  TYR A CD2 1 
ATOM   1142 C CE1 . TYR A 1 148 ? 166.360 34.197 168.113 1.00 18.88  ? 148  TYR A CE1 1 
ATOM   1143 C CE2 . TYR A 1 148 ? 164.326 33.603 169.212 1.00 17.93  ? 148  TYR A CE2 1 
ATOM   1144 C CZ  . TYR A 1 148 ? 165.660 33.464 169.090 1.00 19.07  ? 148  TYR A CZ  1 
ATOM   1145 O OH  . TYR A 1 148 ? 166.295 32.520 169.800 1.00 16.37  ? 148  TYR A OH  1 
ATOM   1146 N N   . ARG A 1 149 ? 161.665 38.109 168.471 1.00 20.94  ? 149  ARG A N   1 
ATOM   1147 C CA  . ARG A 1 149 ? 160.895 38.276 169.668 1.00 21.70  ? 149  ARG A CA  1 
ATOM   1148 C C   . ARG A 1 149 ? 160.960 36.952 170.469 1.00 22.42  ? 149  ARG A C   1 
ATOM   1149 O O   . ARG A 1 149 ? 160.872 35.842 169.908 1.00 17.67  ? 149  ARG A O   1 
ATOM   1150 C CB  . ARG A 1 149 ? 159.434 38.623 169.339 1.00 18.92  ? 149  ARG A CB  1 
ATOM   1151 C CG  . ARG A 1 149 ? 159.252 40.112 168.897 1.00 20.41  ? 149  ARG A CG  1 
ATOM   1152 C CD  . ARG A 1 149 ? 157.794 40.291 168.485 1.00 22.05  ? 149  ARG A CD  1 
ATOM   1153 N NE  . ARG A 1 149 ? 157.588 39.732 167.149 1.00 20.79  ? 149  ARG A NE  1 
ATOM   1154 C CZ  . ARG A 1 149 ? 156.430 39.717 166.538 1.00 21.12  ? 149  ARG A CZ  1 
ATOM   1155 N NH1 . ARG A 1 149 ? 155.348 40.176 167.126 1.00 22.56  ? 149  ARG A NH1 1 
ATOM   1156 N NH2 . ARG A 1 149 ? 156.356 39.259 165.293 1.00 26.89  ? 149  ARG A NH2 1 
ATOM   1157 N N   . VAL A 1 150 ? 161.105 37.110 171.779 1.00 21.48  ? 150  VAL A N   1 
ATOM   1158 C CA  . VAL A 1 150 ? 161.188 35.967 172.690 1.00 20.07  ? 150  VAL A CA  1 
ATOM   1159 C C   . VAL A 1 150 ? 160.126 36.149 173.762 1.00 21.56  ? 150  VAL A C   1 
ATOM   1160 O O   . VAL A 1 150 ? 159.468 37.198 173.865 1.00 21.22  ? 150  VAL A O   1 
ATOM   1161 C CB  . VAL A 1 150 ? 162.594 35.874 173.318 1.00 19.35  ? 150  VAL A CB  1 
ATOM   1162 C CG1 . VAL A 1 150 ? 163.635 35.593 172.247 1.00 23.76  ? 150  VAL A CG1 1 
ATOM   1163 C CG2 . VAL A 1 150 ? 162.988 37.144 174.012 1.00 20.28  ? 150  VAL A CG2 1 
ATOM   1164 N N   . GLY A 1 151 ? 159.963 35.126 174.592 1.00 21.27  ? 151  GLY A N   1 
ATOM   1165 C CA  . GLY A 1 151 ? 158.960 35.180 175.628 1.00 22.08  ? 151  GLY A CA  1 
ATOM   1166 C C   . GLY A 1 151 ? 157.592 35.201 175.037 1.00 22.02  ? 151  GLY A C   1 
ATOM   1167 O O   . GLY A 1 151 ? 157.338 34.727 173.914 1.00 26.03  ? 151  GLY A O   1 
ATOM   1168 N N   . ALA A 1 152 ? 156.667 35.743 175.768 1.00 20.85  ? 152  ALA A N   1 
ATOM   1169 C CA  . ALA A 1 152 ? 155.306 35.772 175.290 1.00 21.98  ? 152  ALA A CA  1 
ATOM   1170 C C   . ALA A 1 152 ? 155.200 36.661 174.066 1.00 21.58  ? 152  ALA A C   1 
ATOM   1171 O O   . ALA A 1 152 ? 154.358 36.401 173.246 1.00 23.15  ? 152  ALA A O   1 
ATOM   1172 C CB  . ALA A 1 152 ? 154.386 36.299 176.385 1.00 23.86  ? 152  ALA A CB  1 
ATOM   1173 N N   . PHE A 1 153 ? 156.099 37.619 173.908 1.00 23.58  ? 153  PHE A N   1 
ATOM   1174 C CA  . PHE A 1 153 ? 156.036 38.530 172.742 1.00 24.87  ? 153  PHE A CA  1 
ATOM   1175 C C   . PHE A 1 153 ? 156.263 37.815 171.409 1.00 23.44  ? 153  PHE A C   1 
ATOM   1176 O O   . PHE A 1 153 ? 155.719 38.236 170.388 1.00 21.61  ? 153  PHE A O   1 
ATOM   1177 C CB  . PHE A 1 153 ? 157.077 39.614 172.891 1.00 24.76  ? 153  PHE A CB  1 
ATOM   1178 C CG  . PHE A 1 153 ? 157.004 40.325 174.214 1.00 30.70  ? 153  PHE A CG  1 
ATOM   1179 C CD1 . PHE A 1 153 ? 156.186 41.421 174.383 1.00 32.05  ? 153  PHE A CD1 1 
ATOM   1180 C CD2 . PHE A 1 153 ? 157.749 39.884 175.304 1.00 30.82  ? 153  PHE A CD2 1 
ATOM   1181 C CE1 . PHE A 1 153 ? 156.112 42.055 175.611 1.00 32.45  ? 153  PHE A CE1 1 
ATOM   1182 C CE2 . PHE A 1 153 ? 157.679 40.513 176.541 1.00 29.54  ? 153  PHE A CE2 1 
ATOM   1183 C CZ  . PHE A 1 153 ? 156.845 41.585 176.704 1.00 31.29  ? 153  PHE A CZ  1 
ATOM   1184 N N   . GLY A 1 154 ? 157.060 36.751 171.478 1.00 20.84  ? 154  GLY A N   1 
ATOM   1185 C CA  . GLY A 1 154 ? 157.453 35.872 170.377 1.00 21.14  ? 154  GLY A CA  1 
ATOM   1186 C C   . GLY A 1 154 ? 156.657 34.624 170.259 1.00 20.45  ? 154  GLY A C   1 
ATOM   1187 O O   . GLY A 1 154 ? 156.498 34.046 169.138 1.00 19.71  ? 154  GLY A O   1 
ATOM   1188 N N   . PHE A 1 155 ? 156.100 34.155 171.372 1.00 19.62  ? 155  PHE A N   1 
ATOM   1189 C CA  . PHE A 1 155 ? 155.586 32.817 171.364 1.00 17.02  ? 155  PHE A CA  1 
ATOM   1190 C C   . PHE A 1 155 ? 154.244 32.543 172.007 1.00 18.06  ? 155  PHE A C   1 
ATOM   1191 O O   . PHE A 1 155 ? 153.728 31.423 171.982 1.00 21.53  ? 155  PHE A O   1 
ATOM   1192 C CB  . PHE A 1 155 ? 156.686 31.870 171.821 1.00 17.73  ? 155  PHE A CB  1 
ATOM   1193 C CG  . PHE A 1 155 ? 157.879 31.871 170.919 1.00 17.68  ? 155  PHE A CG  1 
ATOM   1194 C CD1 . PHE A 1 155 ? 157.847 31.158 169.702 1.00 19.99  ? 155  PHE A CD1 1 
ATOM   1195 C CD2 . PHE A 1 155 ? 158.981 32.638 171.206 1.00 20.14  ? 155  PHE A CD2 1 
ATOM   1196 C CE1 . PHE A 1 155 ? 158.923 31.194 168.844 1.00 19.07  ? 155  PHE A CE1 1 
ATOM   1197 C CE2 . PHE A 1 155 ? 160.059 32.692 170.337 1.00 18.81  ? 155  PHE A CE2 1 
ATOM   1198 C CZ  . PHE A 1 155 ? 160.001 31.951 169.145 1.00 17.50  ? 155  PHE A CZ  1 
ATOM   1199 N N   . LEU A 1 156 ? 153.630 33.542 172.542 1.00 20.92  ? 156  LEU A N   1 
ATOM   1200 C CA  . LEU A 1 156 ? 152.260 33.355 173.024 1.00 21.87  ? 156  LEU A CA  1 
ATOM   1201 C C   . LEU A 1 156 ? 151.419 32.785 171.940 1.00 22.64  ? 156  LEU A C   1 
ATOM   1202 O O   . LEU A 1 156 ? 151.410 33.292 170.824 1.00 27.08  ? 156  LEU A O   1 
ATOM   1203 C CB  . LEU A 1 156 ? 151.655 34.696 173.412 1.00 25.54  ? 156  LEU A CB  1 
ATOM   1204 C CG  . LEU A 1 156 ? 150.308 34.492 174.114 1.00 26.13  ? 156  LEU A CG  1 
ATOM   1205 C CD1 . LEU A 1 156 ? 150.541 34.594 175.588 1.00 27.01  ? 156  LEU A CD1 1 
ATOM   1206 C CD2 . LEU A 1 156 ? 149.368 35.595 173.688 1.00 28.77  ? 156  LEU A CD2 1 
ATOM   1207 N N   . ALA A 1 157 ? 150.702 31.719 172.230 1.00 23.47  ? 157  ALA A N   1 
ATOM   1208 C CA  . ALA A 1 157 ? 150.042 30.999 171.192 1.00 25.93  ? 157  ALA A CA  1 
ATOM   1209 C C   . ALA A 1 157 ? 148.589 30.708 171.509 1.00 30.61  ? 157  ALA A C   1 
ATOM   1210 O O   . ALA A 1 157 ? 148.306 29.769 172.328 1.00 26.48  ? 157  ALA A O   1 
ATOM   1211 C CB  . ALA A 1 157 ? 150.750 29.686 170.989 1.00 25.72  ? 157  ALA A CB  1 
ATOM   1212 N N   . LEU A 1 158 ? 147.684 31.391 170.778 1.00 29.25  ? 158  LEU A N   1 
ATOM   1213 C CA  . LEU A 1 158 ? 146.212 31.102 170.847 1.00 27.79  ? 158  LEU A CA  1 
ATOM   1214 C C   . LEU A 1 158 ? 145.739 30.607 169.489 1.00 28.32  ? 158  LEU A C   1 
ATOM   1215 O O   . LEU A 1 158 ? 145.220 31.335 168.615 1.00 32.93  ? 158  LEU A O   1 
ATOM   1216 C CB  . LEU A 1 158 ? 145.447 32.344 171.339 1.00 27.90  ? 158  LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 158 ? 145.727 32.726 172.819 1.00 31.16  ? 158  LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 158 ? 145.521 34.193 173.144 1.00 32.74  ? 158  LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 158 ? 144.905 31.868 173.762 1.00 32.51  ? 158  LEU A CD2 1 
ATOM   1220 N N   . HIS A 1 159 ? 145.943 29.350 169.267 1.00 30.58  ? 159  HIS A N   1 
ATOM   1221 C CA  . HIS A 1 159 ? 145.789 28.827 167.930 1.00 34.56  ? 159  HIS A CA  1 
ATOM   1222 C C   . HIS A 1 159 ? 144.354 29.027 167.462 1.00 39.93  ? 159  HIS A C   1 
ATOM   1223 O O   . HIS A 1 159 ? 143.433 28.794 168.211 1.00 34.54  ? 159  HIS A O   1 
ATOM   1224 C CB  . HIS A 1 159 ? 146.134 27.361 167.920 1.00 34.02  ? 159  HIS A CB  1 
ATOM   1225 C CG  . HIS A 1 159 ? 145.984 26.715 166.589 1.00 34.53  ? 159  HIS A CG  1 
ATOM   1226 N ND1 . HIS A 1 159 ? 146.745 27.075 165.492 1.00 36.96  ? 159  HIS A ND1 1 
ATOM   1227 C CD2 . HIS A 1 159 ? 145.156 25.722 166.167 1.00 36.47  ? 159  HIS A CD2 1 
ATOM   1228 C CE1 . HIS A 1 159 ? 146.393 26.333 164.452 1.00 34.42  ? 159  HIS A CE1 1 
ATOM   1229 N NE2 . HIS A 1 159 ? 145.437 25.502 164.837 1.00 36.57  ? 159  HIS A NE2 1 
ATOM   1230 N N   . GLY A 1 160 ? 144.181 29.441 166.211 1.00 43.47  ? 160  GLY A N   1 
ATOM   1231 C CA  . GLY A 1 160 ? 142.848 29.787 165.697 1.00 40.59  ? 160  GLY A CA  1 
ATOM   1232 C C   . GLY A 1 160 ? 142.650 31.286 165.617 1.00 41.33  ? 160  GLY A C   1 
ATOM   1233 O O   . GLY A 1 160 ? 141.820 31.760 164.869 1.00 44.24  ? 160  GLY A O   1 
ATOM   1234 N N   . SER A 1 161 ? 143.394 32.026 166.418 1.00 35.75  ? 161  SER A N   1 
ATOM   1235 C CA  . SER A 1 161 ? 143.342 33.443 166.394 1.00 37.29  ? 161  SER A CA  1 
ATOM   1236 C C   . SER A 1 161 ? 144.394 33.882 165.437 1.00 41.68  ? 161  SER A C   1 
ATOM   1237 O O   . SER A 1 161 ? 145.465 33.237 165.316 1.00 45.51  ? 161  SER A O   1 
ATOM   1238 C CB  . SER A 1 161 ? 143.727 34.015 167.738 1.00 38.85  ? 161  SER A CB  1 
ATOM   1239 O OG  . SER A 1 161 ? 144.087 35.393 167.628 1.00 41.47  ? 161  SER A OG  1 
ATOM   1240 N N   . GLN A 1 162 ? 144.142 35.017 164.810 1.00 35.04  ? 162  GLN A N   1 
ATOM   1241 C CA  . GLN A 1 162 ? 145.138 35.618 163.923 1.00 37.20  ? 162  GLN A CA  1 
ATOM   1242 C C   . GLN A 1 162 ? 145.880 36.696 164.599 1.00 31.97  ? 162  GLN A C   1 
ATOM   1243 O O   . GLN A 1 162 ? 146.817 37.261 164.025 1.00 34.76  ? 162  GLN A O   1 
ATOM   1244 C CB  . GLN A 1 162 ? 144.476 36.168 162.620 1.00 46.54  ? 162  GLN A CB  1 
ATOM   1245 C CG  . GLN A 1 162 ? 143.974 35.068 161.664 1.00 52.01  ? 162  GLN A CG  1 
ATOM   1246 C CD  . GLN A 1 162 ? 145.097 34.064 161.310 1.00 57.55  ? 162  GLN A CD  1 
ATOM   1247 O OE1 . GLN A 1 162 ? 146.224 34.452 160.969 1.00 57.52  ? 162  GLN A OE1 1 
ATOM   1248 N NE2 . GLN A 1 162 ? 144.796 32.775 161.432 1.00 59.68  ? 162  GLN A NE2 1 
ATOM   1249 N N   . GLU A 1 163 ? 145.405 37.074 165.774 1.00 32.42  ? 163  GLU A N   1 
ATOM   1250 C CA  . GLU A 1 163 ? 146.000 38.167 166.511 1.00 34.49  ? 163  GLU A CA  1 
ATOM   1251 C C   . GLU A 1 163 ? 147.205 37.667 167.376 1.00 32.49  ? 163  GLU A C   1 
ATOM   1252 O O   . GLU A 1 163 ? 148.093 38.470 167.670 1.00 33.46  ? 163  GLU A O   1 
ATOM   1253 C CB  . GLU A 1 163 ? 144.923 38.855 167.351 1.00 38.44  ? 163  GLU A CB  1 
ATOM   1254 C CG  . GLU A 1 163 ? 143.782 39.525 166.539 1.00 41.15  ? 163  GLU A CG  1 
ATOM   1255 C CD  . GLU A 1 163 ? 144.299 40.628 165.622 1.00 45.09  ? 163  GLU A CD  1 
ATOM   1256 O OE1 . GLU A 1 163 ? 145.262 41.341 166.045 1.00 38.42  ? 163  GLU A OE1 1 
ATOM   1257 O OE2 . GLU A 1 163 ? 143.796 40.756 164.469 1.00 48.14  ? 163  GLU A OE2 1 
ATOM   1258 N N   . ALA A 1 164 ? 147.225 36.362 167.706 1.00 30.17  ? 164  ALA A N   1 
ATOM   1259 C CA  . ALA A 1 164 ? 148.315 35.695 168.500 1.00 30.19  ? 164  ALA A CA  1 
ATOM   1260 C C   . ALA A 1 164 ? 148.367 34.239 168.081 1.00 30.28  ? 164  ALA A C   1 
ATOM   1261 O O   . ALA A 1 164 ? 148.005 33.299 168.855 1.00 29.33  ? 164  ALA A O   1 
ATOM   1262 C CB  . ALA A 1 164 ? 148.072 35.843 169.991 1.00 32.30  ? 164  ALA A CB  1 
ATOM   1263 N N   . PRO A 1 165 ? 148.749 34.027 166.790 1.00 25.58  ? 165  PRO A N   1 
ATOM   1264 C CA  . PRO A 1 165 ? 148.764 32.712 166.248 1.00 25.52  ? 165  PRO A CA  1 
ATOM   1265 C C   . PRO A 1 165 ? 149.790 31.807 166.914 1.00 27.59  ? 165  PRO A C   1 
ATOM   1266 O O   . PRO A 1 165 ? 149.648 30.590 166.820 1.00 33.28  ? 165  PRO A O   1 
ATOM   1267 C CB  . PRO A 1 165 ? 149.117 32.969 164.771 1.00 23.62  ? 165  PRO A CB  1 
ATOM   1268 C CG  . PRO A 1 165 ? 149.980 34.152 164.817 1.00 23.91  ? 165  PRO A CG  1 
ATOM   1269 C CD  . PRO A 1 165 ? 149.422 35.000 165.908 1.00 24.41  ? 165  PRO A CD  1 
ATOM   1270 N N   . GLY A 1 166 ? 150.827 32.375 167.540 1.00 26.49  ? 166  GLY A N   1 
ATOM   1271 C CA  . GLY A 1 166 ? 152.010 31.535 167.947 1.00 25.83  ? 166  GLY A CA  1 
ATOM   1272 C C   . GLY A 1 166 ? 153.133 31.598 166.907 1.00 27.68  ? 166  GLY A C   1 
ATOM   1273 O O   . GLY A 1 166 ? 152.879 32.029 165.792 1.00 25.49  ? 166  GLY A O   1 
ATOM   1274 N N   . ASN A 1 167 ? 154.343 31.165 167.274 1.00 24.20  ? 167  ASN A N   1 
ATOM   1275 C CA  . ASN A 1 167 ? 155.453 31.056 166.370 1.00 24.93  ? 167  ASN A CA  1 
ATOM   1276 C C   . ASN A 1 167 ? 155.903 32.386 165.764 1.00 24.51  ? 167  ASN A C   1 
ATOM   1277 O O   . ASN A 1 167 ? 156.700 32.377 164.864 1.00 21.74  ? 167  ASN A O   1 
ATOM   1278 C CB  . ASN A 1 167 ? 155.128 30.026 165.241 1.00 25.89  ? 167  ASN A CB  1 
ATOM   1279 C CG  . ASN A 1 167 ? 155.057 28.620 165.761 1.00 26.77  ? 167  ASN A CG  1 
ATOM   1280 O OD1 . ASN A 1 167 ? 155.623 28.323 166.816 1.00 23.57  ? 167  ASN A OD1 1 
ATOM   1281 N ND2 . ASN A 1 167 ? 154.341 27.757 165.072 1.00 22.63  ? 167  ASN A ND2 1 
ATOM   1282 N N   . VAL A 1 168 ? 155.483 33.541 166.267 1.00 23.62  ? 168  VAL A N   1 
ATOM   1283 C CA  . VAL A 1 168 ? 155.819 34.765 165.523 1.00 24.16  ? 168  VAL A CA  1 
ATOM   1284 C C   . VAL A 1 168 ? 157.298 35.105 165.595 1.00 25.44  ? 168  VAL A C   1 
ATOM   1285 O O   . VAL A 1 168 ? 157.875 35.731 164.663 1.00 23.27  ? 168  VAL A O   1 
ATOM   1286 C CB  . VAL A 1 168 ? 154.892 35.955 165.811 1.00 25.21  ? 168  VAL A CB  1 
ATOM   1287 C CG1 . VAL A 1 168 ? 153.451 35.529 165.500 1.00 25.96  ? 168  VAL A CG1 1 
ATOM   1288 C CG2 . VAL A 1 168 ? 155.030 36.488 167.239 1.00 28.44  ? 168  VAL A CG2 1 
ATOM   1289 N N   . GLY A 1 169 ? 157.928 34.652 166.681 1.00 22.49  ? 169  GLY A N   1 
ATOM   1290 C CA  . GLY A 1 169 ? 159.354 34.796 166.829 1.00 21.16  ? 169  GLY A CA  1 
ATOM   1291 C C   . GLY A 1 169 ? 160.062 33.974 165.782 1.00 19.41  ? 169  GLY A C   1 
ATOM   1292 O O   . GLY A 1 169 ? 161.098 34.402 165.266 1.00 18.09  ? 169  GLY A O   1 
ATOM   1293 N N   . LEU A 1 170 ? 159.506 32.830 165.420 1.00 18.73  ? 170  LEU A N   1 
ATOM   1294 C CA  . LEU A 1 170 ? 160.147 32.073 164.286 1.00 20.39  ? 170  LEU A CA  1 
ATOM   1295 C C   . LEU A 1 170 ? 159.909 32.795 162.916 1.00 20.70  ? 170  LEU A C   1 
ATOM   1296 O O   . LEU A 1 170 ? 160.770 32.809 162.062 1.00 20.74  ? 170  LEU A O   1 
ATOM   1297 C CB  . LEU A 1 170 ? 159.603 30.665 164.166 1.00 20.86  ? 170  LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 170 ? 160.085 29.728 165.260 1.00 20.34  ? 170  LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 170 ? 159.229 28.495 165.291 1.00 19.44  ? 170  LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 170 ? 161.502 29.305 165.080 1.00 22.11  ? 170  LEU A CD2 1 
ATOM   1301 N N   . LEU A 1 171 ? 158.729 33.351 162.729 1.00 20.28  ? 171  LEU A N   1 
ATOM   1302 C CA  . LEU A 1 171 ? 158.446 34.218 161.550 1.00 21.77  ? 171  LEU A CA  1 
ATOM   1303 C C   . LEU A 1 171 ? 159.347 35.448 161.548 1.00 22.03  ? 171  LEU A C   1 
ATOM   1304 O O   . LEU A 1 171 ? 159.760 35.883 160.489 1.00 20.52  ? 171  LEU A O   1 
ATOM   1305 C CB  . LEU A 1 171 ? 156.970 34.621 161.526 1.00 23.61  ? 171  LEU A CB  1 
ATOM   1306 C CG  . LEU A 1 171 ? 156.043 33.431 161.402 1.00 24.41  ? 171  LEU A CG  1 
ATOM   1307 C CD1 . LEU A 1 171 ? 154.590 33.888 161.483 1.00 25.52  ? 171  LEU A CD1 1 
ATOM   1308 C CD2 . LEU A 1 171 ? 156.243 32.633 160.128 1.00 24.45  ? 171  LEU A CD2 1 
ATOM   1309 N N   . ASP A 1 172 ? 159.702 36.011 162.716 1.00 21.60  ? 172  ASP A N   1 
ATOM   1310 C CA  . ASP A 1 172 ? 160.698 37.050 162.743 1.00 20.97  ? 172  ASP A CA  1 
ATOM   1311 C C   . ASP A 1 172 ? 162.012 36.559 162.145 1.00 20.38  ? 172  ASP A C   1 
ATOM   1312 O O   . ASP A 1 172 ? 162.666 37.218 161.296 1.00 18.73  ? 172  ASP A O   1 
ATOM   1313 C CB  . ASP A 1 172 ? 160.977 37.574 164.178 1.00 23.42  ? 172  ASP A CB  1 
ATOM   1314 C CG  . ASP A 1 172 ? 159.786 38.237 164.835 1.00 25.18  ? 172  ASP A CG  1 
ATOM   1315 O OD1 . ASP A 1 172 ? 158.771 38.630 164.161 1.00 23.94  ? 172  ASP A OD1 1 
ATOM   1316 O OD2 . ASP A 1 172 ? 159.868 38.429 166.096 1.00 26.03  ? 172  ASP A OD2 1 
ATOM   1317 N N   . GLN A 1 173 ? 162.460 35.395 162.570 1.00 19.77  ? 173  GLN A N   1 
ATOM   1318 C CA  . GLN A 1 173 ? 163.738 34.909 162.098 1.00 17.70  ? 173  GLN A CA  1 
ATOM   1319 C C   . GLN A 1 173 ? 163.626 34.756 160.548 1.00 19.10  ? 173  GLN A C   1 
ATOM   1320 O O   . GLN A 1 173 ? 164.555 35.045 159.821 1.00 18.45  ? 173  GLN A O   1 
ATOM   1321 C CB  . GLN A 1 173 ? 164.058 33.572 162.713 1.00 19.54  ? 173  GLN A CB  1 
ATOM   1322 C CG  . GLN A 1 173 ? 164.324 33.588 164.199 1.00 20.05  ? 173  GLN A CG  1 
ATOM   1323 C CD  . GLN A 1 173 ? 164.489 32.195 164.783 1.00 22.57  ? 173  GLN A CD  1 
ATOM   1324 O OE1 . GLN A 1 173 ? 164.714 31.226 164.079 1.00 22.46  ? 173  GLN A OE1 1 
ATOM   1325 N NE2 . GLN A 1 173 ? 164.325 32.092 166.092 1.00 20.75  ? 173  GLN A NE2 1 
ATOM   1326 N N   . ARG A 1 174 ? 162.494 34.267 160.064 1.00 20.20  ? 174  ARG A N   1 
ATOM   1327 C CA  . ARG A 1 174 ? 162.317 33.887 158.676 1.00 19.85  ? 174  ARG A CA  1 
ATOM   1328 C C   . ARG A 1 174 ? 162.312 35.171 157.816 1.00 21.96  ? 174  ARG A C   1 
ATOM   1329 O O   . ARG A 1 174 ? 162.864 35.174 156.752 1.00 23.18  ? 174  ARG A O   1 
ATOM   1330 C CB  . ARG A 1 174 ? 160.982 33.158 158.447 1.00 20.82  ? 174  ARG A CB  1 
ATOM   1331 C CG  . ARG A 1 174 ? 160.696 32.912 156.965 1.00 20.95  ? 174  ARG A CG  1 
ATOM   1332 C CD  . ARG A 1 174 ? 159.325 32.333 156.776 1.00 22.82  ? 174  ARG A CD  1 
ATOM   1333 N NE  . ARG A 1 174 ? 159.192 30.983 157.303 1.00 21.07  ? 174  ARG A NE  1 
ATOM   1334 C CZ  . ARG A 1 174 ? 158.020 30.357 157.364 1.00 23.26  ? 174  ARG A CZ  1 
ATOM   1335 N NH1 . ARG A 1 174 ? 156.925 30.934 156.985 1.00 24.72  ? 174  ARG A NH1 1 
ATOM   1336 N NH2 . ARG A 1 174 ? 157.940 29.105 157.697 1.00 23.57  ? 174  ARG A NH2 1 
ATOM   1337 N N   . MET A 1 175 ? 161.671 36.219 158.312 1.00 23.49  ? 175  MET A N   1 
ATOM   1338 C CA  . MET A 1 175 ? 161.693 37.523 157.706 1.00 24.69  ? 175  MET A CA  1 
ATOM   1339 C C   . MET A 1 175 ? 163.054 38.098 157.637 1.00 25.53  ? 175  MET A C   1 
ATOM   1340 O O   . MET A 1 175 ? 163.386 38.708 156.609 1.00 23.89  ? 175  MET A O   1 
ATOM   1341 C CB  . MET A 1 175 ? 160.715 38.505 158.354 1.00 26.24  ? 175  MET A CB  1 
ATOM   1342 C CG  . MET A 1 175 ? 160.592 39.822 157.560 1.00 31.24  ? 175  MET A CG  1 
ATOM   1343 S SD  . MET A 1 175 ? 159.220 40.830 158.169 1.00 32.58  ? 175  MET A SD  1 
ATOM   1344 C CE  . MET A 1 175 ? 157.880 39.888 157.433 1.00 26.61  ? 175  MET A CE  1 
ATOM   1345 N N   . ALA A 1 176 ? 163.898 37.878 158.639 1.00 24.21  ? 176  ALA A N   1 
ATOM   1346 C CA  . ALA A 1 176 ? 165.293 38.330 158.496 1.00 23.77  ? 176  ALA A CA  1 
ATOM   1347 C C   . ALA A 1 176 ? 166.061 37.526 157.417 1.00 24.01  ? 176  ALA A C   1 
ATOM   1348 O O   . ALA A 1 176 ? 166.865 38.069 156.661 1.00 23.05  ? 176  ALA A O   1 
ATOM   1349 C CB  . ALA A 1 176 ? 166.051 38.309 159.829 1.00 22.82  ? 176  ALA A CB  1 
ATOM   1350 N N   . LEU A 1 177 ? 165.801 36.241 157.346 1.00 25.07  ? 177  LEU A N   1 
ATOM   1351 C CA  . LEU A 1 177 ? 166.454 35.389 156.358 1.00 24.92  ? 177  LEU A CA  1 
ATOM   1352 C C   . LEU A 1 177 ? 165.902 35.760 154.906 1.00 25.68  ? 177  LEU A C   1 
ATOM   1353 O O   . LEU A 1 177 ? 166.621 35.657 153.952 1.00 21.89  ? 177  LEU A O   1 
ATOM   1354 C CB  . LEU A 1 177 ? 166.169 33.941 156.656 1.00 25.36  ? 177  LEU A CB  1 
ATOM   1355 C CG  . LEU A 1 177 ? 166.681 33.296 157.949 1.00 28.33  ? 177  LEU A CG  1 
ATOM   1356 C CD1 . LEU A 1 177 ? 166.171 31.837 157.990 1.00 30.72  ? 177  LEU A CD1 1 
ATOM   1357 C CD2 . LEU A 1 177 ? 168.206 33.394 158.023 1.00 23.89  ? 177  LEU A CD2 1 
ATOM   1358 N N   . GLN A 1 178 ? 164.638 36.141 154.801 1.00 21.30  ? 178  GLN A N   1 
ATOM   1359 C CA  . GLN A 1 178 ? 164.089 36.681 153.549 1.00 23.20  ? 178  GLN A CA  1 
ATOM   1360 C C   . GLN A 1 178 ? 164.817 37.927 153.151 1.00 21.92  ? 178  GLN A C   1 
ATOM   1361 O O   . GLN A 1 178 ? 165.266 38.012 152.000 1.00 23.25  ? 178  GLN A O   1 
ATOM   1362 C CB  . GLN A 1 178 ? 162.599 36.895 153.639 1.00 22.15  ? 178  GLN A CB  1 
ATOM   1363 C CG  . GLN A 1 178 ? 161.831 37.451 152.396 1.00 23.51  ? 178  GLN A CG  1 
ATOM   1364 C CD  . GLN A 1 178 ? 161.813 36.419 151.280 1.00 24.29  ? 178  GLN A CD  1 
ATOM   1365 O OE1 . GLN A 1 178 ? 162.505 36.552 150.246 1.00 32.99  ? 178  GLN A OE1 1 
ATOM   1366 N NE2 . GLN A 1 178 ? 161.149 35.320 151.550 1.00 24.68  ? 178  GLN A NE2 1 
ATOM   1367 N N   . TRP A 1 179 ? 165.002 38.852 154.098 1.00 21.53  ? 179  TRP A N   1 
ATOM   1368 C CA  . TRP A 1 179 ? 165.755 40.063 153.878 1.00 19.83  ? 179  TRP A CA  1 
ATOM   1369 C C   . TRP A 1 179 ? 167.160 39.771 153.400 1.00 22.21  ? 179  TRP A C   1 
ATOM   1370 O O   . TRP A 1 179 ? 167.659 40.415 152.461 1.00 22.88  ? 179  TRP A O   1 
ATOM   1371 C CB  . TRP A 1 179 ? 165.754 40.947 155.094 1.00 22.30  ? 179  TRP A CB  1 
ATOM   1372 C CG  . TRP A 1 179 ? 166.184 42.360 154.843 1.00 22.64  ? 179  TRP A CG  1 
ATOM   1373 C CD1 . TRP A 1 179 ? 165.346 43.439 154.531 1.00 22.96  ? 179  TRP A CD1 1 
ATOM   1374 C CD2 . TRP A 1 179 ? 167.499 42.848 154.724 1.00 20.47  ? 179  TRP A CD2 1 
ATOM   1375 N NE1 . TRP A 1 179 ? 166.085 44.513 154.296 1.00 20.95  ? 179  TRP A NE1 1 
ATOM   1376 C CE2 . TRP A 1 179 ? 167.407 44.197 154.455 1.00 21.65  ? 179  TRP A CE2 1 
ATOM   1377 C CE3 . TRP A 1 179 ? 168.743 42.296 154.920 1.00 22.90  ? 179  TRP A CE3 1 
ATOM   1378 C CZ2 . TRP A 1 179 ? 168.509 44.991 154.308 1.00 22.52  ? 179  TRP A CZ2 1 
ATOM   1379 C CZ3 . TRP A 1 179 ? 169.807 43.069 154.792 1.00 22.70  ? 179  TRP A CZ3 1 
ATOM   1380 C CH2 . TRP A 1 179 ? 169.692 44.421 154.484 1.00 22.19  ? 179  TRP A CH2 1 
ATOM   1381 N N   . VAL A 1 180 ? 167.846 38.857 154.040 1.00 19.02  ? 180  VAL A N   1 
ATOM   1382 C CA  . VAL A 1 180 ? 169.218 38.485 153.635 1.00 20.88  ? 180  VAL A CA  1 
ATOM   1383 C C   . VAL A 1 180 ? 169.196 37.878 152.199 1.00 22.61  ? 180  VAL A C   1 
ATOM   1384 O O   . VAL A 1 180 ? 170.076 38.139 151.368 1.00 23.52  ? 180  VAL A O   1 
ATOM   1385 C CB  . VAL A 1 180 ? 169.794 37.399 154.620 1.00 21.60  ? 180  VAL A CB  1 
ATOM   1386 C CG1 . VAL A 1 180 ? 171.013 36.726 154.125 1.00 21.79  ? 180  VAL A CG1 1 
ATOM   1387 C CG2 . VAL A 1 180 ? 170.167 38.014 155.963 1.00 25.37  ? 180  VAL A CG2 1 
ATOM   1388 N N   . HIS A 1 181 ? 168.209 37.024 151.942 1.00 23.96  ? 181  HIS A N   1 
ATOM   1389 C CA  . HIS A 1 181 ? 168.075 36.383 150.651 1.00 24.77  ? 181  HIS A CA  1 
ATOM   1390 C C   . HIS A 1 181 ? 167.943 37.511 149.601 1.00 24.80  ? 181  HIS A C   1 
ATOM   1391 O O   . HIS A 1 181 ? 168.723 37.552 148.672 1.00 23.91  ? 181  HIS A O   1 
ATOM   1392 C CB  . HIS A 1 181 ? 166.894 35.463 150.616 1.00 24.03  ? 181  HIS A CB  1 
ATOM   1393 C CG  . HIS A 1 181 ? 166.607 34.906 149.253 1.00 27.75  ? 181  HIS A CG  1 
ATOM   1394 N ND1 . HIS A 1 181 ? 167.379 33.928 148.673 1.00 30.59  ? 181  HIS A ND1 1 
ATOM   1395 C CD2 . HIS A 1 181 ? 165.669 35.236 148.339 1.00 30.86  ? 181  HIS A CD2 1 
ATOM   1396 C CE1 . HIS A 1 181 ? 166.902 33.655 147.468 1.00 37.12  ? 181  HIS A CE1 1 
ATOM   1397 N NE2 . HIS A 1 181 ? 165.870 34.444 147.238 1.00 31.83  ? 181  HIS A NE2 1 
ATOM   1398 N N   . ASP A 1 182 ? 167.096 38.476 149.877 1.00 23.82  ? 182  ASP A N   1 
ATOM   1399 C CA  . ASP A 1 182 ? 166.809 39.528 148.948 1.00 26.20  ? 182  ASP A CA  1 
ATOM   1400 C C   . ASP A 1 182 ? 167.905 40.593 148.830 1.00 28.90  ? 182  ASP A C   1 
ATOM   1401 O O   . ASP A 1 182 ? 168.004 41.241 147.783 1.00 25.15  ? 182  ASP A O   1 
ATOM   1402 C CB  . ASP A 1 182 ? 165.512 40.195 149.292 1.00 24.48  ? 182  ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 182 ? 164.297 39.313 149.086 1.00 26.89  ? 182  ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 182 ? 164.327 38.328 148.327 1.00 29.30  ? 182  ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 182 ? 163.241 39.631 149.684 1.00 31.33  ? 182  ASP A OD2 1 
ATOM   1406 N N   . ASN A 1 183 ? 168.721 40.792 149.860 1.00 22.94  ? 183  ASN A N   1 
ATOM   1407 C CA  . ASN A 1 183 ? 169.591 41.980 149.919 1.00 20.01  ? 183  ASN A CA  1 
ATOM   1408 C C   . ASN A 1 183 ? 171.027 41.767 150.143 1.00 19.66  ? 183  ASN A C   1 
ATOM   1409 O O   . ASN A 1 183 ? 171.830 42.725 149.904 1.00 22.57  ? 183  ASN A O   1 
ATOM   1410 C CB  . ASN A 1 183 ? 169.090 42.970 150.993 1.00 23.60  ? 183  ASN A CB  1 
ATOM   1411 C CG  . ASN A 1 183 ? 167.798 43.585 150.627 1.00 27.76  ? 183  ASN A CG  1 
ATOM   1412 O OD1 . ASN A 1 183 ? 167.729 44.483 149.754 1.00 25.86  ? 183  ASN A OD1 1 
ATOM   1413 N ND2 . ASN A 1 183 ? 166.728 43.097 151.238 1.00 29.84  ? 183  ASN A ND2 1 
ATOM   1414 N N   . ILE A 1 184 ? 171.451 40.552 150.520 1.00 19.80  ? 184  ILE A N   1 
ATOM   1415 C CA  . ILE A 1 184 ? 172.855 40.417 150.948 1.00 21.97  ? 184  ILE A CA  1 
ATOM   1416 C C   . ILE A 1 184 ? 173.854 40.610 149.816 1.00 23.30  ? 184  ILE A C   1 
ATOM   1417 O O   . ILE A 1 184 ? 175.087 40.953 150.027 1.00 22.28  ? 184  ILE A O   1 
ATOM   1418 C CB  . ILE A 1 184 ? 173.107 39.078 151.701 1.00 20.98  ? 184  ILE A CB  1 
ATOM   1419 C CG1 . ILE A 1 184 ? 174.367 39.206 152.608 1.00 21.60  ? 184  ILE A CG1 1 
ATOM   1420 C CG2 . ILE A 1 184 ? 173.168 37.889 150.775 1.00 22.43  ? 184  ILE A CG2 1 
ATOM   1421 C CD1 . ILE A 1 184 ? 174.022 40.014 153.878 1.00 22.77  ? 184  ILE A CD1 1 
ATOM   1422 N N   . GLN A 1 185 ? 173.347 40.398 148.599 1.00 24.55  ? 185  GLN A N   1 
ATOM   1423 C CA  . GLN A 1 185 ? 174.153 40.657 147.382 1.00 22.92  ? 185  GLN A CA  1 
ATOM   1424 C C   . GLN A 1 185 ? 174.715 42.063 147.355 1.00 22.50  ? 185  GLN A C   1 
ATOM   1425 O O   . GLN A 1 185 ? 175.868 42.245 146.952 1.00 23.91  ? 185  GLN A O   1 
ATOM   1426 C CB  . GLN A 1 185 ? 173.333 40.376 146.080 1.00 24.69  ? 185  GLN A CB  1 
ATOM   1427 C CG  . GLN A 1 185 ? 172.196 41.329 145.859 1.00 25.99  ? 185  GLN A CG  1 
ATOM   1428 C CD  . GLN A 1 185 ? 171.162 40.776 144.904 1.00 30.56  ? 185  GLN A CD  1 
ATOM   1429 O OE1 . GLN A 1 185 ? 170.384 39.907 145.272 1.00 31.35  ? 185  GLN A OE1 1 
ATOM   1430 N NE2 . GLN A 1 185 ? 171.161 41.270 143.649 1.00 33.72  ? 185  GLN A NE2 1 
ATOM   1431 N N   . PHE A 1 186 ? 173.958 43.043 147.838 1.00 22.95  ? 186  PHE A N   1 
ATOM   1432 C CA  . PHE A 1 186 ? 174.440 44.425 147.833 1.00 24.18  ? 186  PHE A CA  1 
ATOM   1433 C C   . PHE A 1 186 ? 175.571 44.633 148.805 1.00 27.39  ? 186  PHE A C   1 
ATOM   1434 O O   . PHE A 1 186 ? 176.362 45.574 148.643 1.00 22.87  ? 186  PHE A O   1 
ATOM   1435 C CB  . PHE A 1 186 ? 173.321 45.376 148.057 1.00 24.92  ? 186  PHE A CB  1 
ATOM   1436 C CG  . PHE A 1 186 ? 172.226 45.171 147.099 1.00 27.17  ? 186  PHE A CG  1 
ATOM   1437 C CD1 . PHE A 1 186 ? 172.454 45.355 145.734 1.00 26.26  ? 186  PHE A CD1 1 
ATOM   1438 C CD2 . PHE A 1 186 ? 170.970 44.693 147.521 1.00 28.76  ? 186  PHE A CD2 1 
ATOM   1439 C CE1 . PHE A 1 186 ? 171.449 45.083 144.821 1.00 27.76  ? 186  PHE A CE1 1 
ATOM   1440 C CE2 . PHE A 1 186 ? 169.960 44.446 146.609 1.00 26.87  ? 186  PHE A CE2 1 
ATOM   1441 C CZ  . PHE A 1 186 ? 170.189 44.653 145.252 1.00 28.85  ? 186  PHE A CZ  1 
ATOM   1442 N N   . PHE A 1 187 ? 175.733 43.695 149.742 1.00 24.20  ? 187  PHE A N   1 
ATOM   1443 C CA  . PHE A 1 187 ? 176.831 43.790 150.690 1.00 24.57  ? 187  PHE A CA  1 
ATOM   1444 C C   . PHE A 1 187 ? 177.997 42.983 150.257 1.00 24.17  ? 187  PHE A C   1 
ATOM   1445 O O   . PHE A 1 187 ? 178.972 42.929 150.942 1.00 24.42  ? 187  PHE A O   1 
ATOM   1446 C CB  . PHE A 1 187 ? 176.378 43.338 152.081 1.00 24.32  ? 187  PHE A CB  1 
ATOM   1447 C CG  . PHE A 1 187 ? 175.328 44.236 152.666 1.00 22.88  ? 187  PHE A CG  1 
ATOM   1448 C CD1 . PHE A 1 187 ? 174.005 44.077 152.348 1.00 24.35  ? 187  PHE A CD1 1 
ATOM   1449 C CD2 . PHE A 1 187 ? 175.680 45.283 153.481 1.00 26.31  ? 187  PHE A CD2 1 
ATOM   1450 C CE1 . PHE A 1 187 ? 173.051 44.916 152.831 1.00 23.65  ? 187  PHE A CE1 1 
ATOM   1451 C CE2 . PHE A 1 187 ? 174.727 46.130 153.984 1.00 23.03  ? 187  PHE A CE2 1 
ATOM   1452 C CZ  . PHE A 1 187 ? 173.411 45.931 153.678 1.00 24.78  ? 187  PHE A CZ  1 
ATOM   1453 N N   . GLY A 1 188 ? 177.881 42.258 149.145 1.00 23.61  ? 188  GLY A N   1 
ATOM   1454 C CA  . GLY A 1 188 ? 178.963 41.371 148.769 1.00 22.33  ? 188  GLY A CA  1 
ATOM   1455 C C   . GLY A 1 188 ? 178.782 39.903 149.110 1.00 24.29  ? 188  GLY A C   1 
ATOM   1456 O O   . GLY A 1 188 ? 179.682 39.034 148.804 1.00 25.13  ? 188  GLY A O   1 
ATOM   1457 N N   . GLY A 1 189 ? 177.640 39.593 149.715 1.00 22.95  ? 189  GLY A N   1 
ATOM   1458 C CA  . GLY A 1 189 ? 177.339 38.238 150.008 1.00 22.26  ? 189  GLY A CA  1 
ATOM   1459 C C   . GLY A 1 189 ? 176.755 37.507 148.856 1.00 22.28  ? 189  GLY A C   1 
ATOM   1460 O O   . GLY A 1 189 ? 176.051 38.060 148.053 1.00 25.35  ? 189  GLY A O   1 
ATOM   1461 N N   . ASP A 1 190 ? 176.951 36.229 148.850 1.00 24.28  ? 190  ASP A N   1 
ATOM   1462 C CA  . ASP A 1 190 ? 176.305 35.352 147.867 1.00 25.20  ? 190  ASP A CA  1 
ATOM   1463 C C   . ASP A 1 190 ? 175.033 34.711 148.433 1.00 24.77  ? 190  ASP A C   1 
ATOM   1464 O O   . ASP A 1 190 ? 175.143 33.806 149.225 1.00 27.90  ? 190  ASP A O   1 
ATOM   1465 C CB  . ASP A 1 190 ? 177.324 34.275 147.490 1.00 24.55  ? 190  ASP A CB  1 
ATOM   1466 C CG  . ASP A 1 190 ? 176.793 33.266 146.507 1.00 25.26  ? 190  ASP A CG  1 
ATOM   1467 O OD1 . ASP A 1 190 ? 175.706 33.425 145.966 1.00 28.44  ? 190  ASP A OD1 1 
ATOM   1468 O OD2 . ASP A 1 190 ? 177.448 32.275 146.319 1.00 29.84  ? 190  ASP A OD2 1 
ATOM   1469 N N   . PRO A 1 191 ? 173.842 35.116 147.962 1.00 23.57  ? 191  PRO A N   1 
ATOM   1470 C CA  . PRO A 1 191 ? 172.615 34.576 148.442 1.00 23.31  ? 191  PRO A CA  1 
ATOM   1471 C C   . PRO A 1 191 ? 172.364 33.100 148.180 1.00 25.60  ? 191  PRO A C   1 
ATOM   1472 O O   . PRO A 1 191 ? 171.474 32.527 148.763 1.00 26.24  ? 191  PRO A O   1 
ATOM   1473 C CB  . PRO A 1 191 ? 171.554 35.417 147.747 1.00 25.48  ? 191  PRO A CB  1 
ATOM   1474 C CG  . PRO A 1 191 ? 172.176 35.934 146.474 1.00 24.22  ? 191  PRO A CG  1 
ATOM   1475 C CD  . PRO A 1 191 ? 173.625 36.091 146.860 1.00 26.22  ? 191  PRO A CD  1 
ATOM   1476 N N   . LYS A 1 192 ? 173.204 32.450 147.421 1.00 26.58  ? 192  LYS A N   1 
ATOM   1477 C CA  . LYS A 1 192 ? 173.042 31.016 147.276 1.00 30.57  ? 192  LYS A CA  1 
ATOM   1478 C C   . LYS A 1 192 ? 173.937 30.164 148.137 1.00 26.79  ? 192  LYS A C   1 
ATOM   1479 O O   . LYS A 1 192 ? 173.871 28.921 148.102 1.00 23.14  ? 192  LYS A O   1 
ATOM   1480 C CB  . LYS A 1 192 ? 173.093 30.634 145.806 1.00 38.32  ? 192  LYS A CB  1 
ATOM   1481 C CG  . LYS A 1 192 ? 174.308 30.942 145.058 1.00 38.04  ? 192  LYS A CG  1 
ATOM   1482 C CD  . LYS A 1 192 ? 173.947 31.085 143.553 1.00 42.70  ? 192  LYS A CD  1 
ATOM   1483 C CE  . LYS A 1 192 ? 174.885 32.037 142.853 1.00 49.71  ? 192  LYS A CE  1 
ATOM   1484 N NZ  . LYS A 1 192 ? 176.293 31.823 143.199 1.00 49.49  ? 192  LYS A NZ  1 
ATOM   1485 N N   . THR A 1 193 ? 174.723 30.838 148.954 1.00 23.61  ? 193  THR A N   1 
ATOM   1486 C CA  . THR A 1 193 ? 175.554 30.145 149.882 1.00 30.12  ? 193  THR A CA  1 
ATOM   1487 C C   . THR A 1 193 ? 175.400 30.778 151.250 1.00 27.80  ? 193  THR A C   1 
ATOM   1488 O O   . THR A 1 193 ? 176.357 31.325 151.768 1.00 28.73  ? 193  THR A O   1 
ATOM   1489 C CB  . THR A 1 193 ? 176.989 30.221 149.353 1.00 35.22  ? 193  THR A CB  1 
ATOM   1490 O OG1 . THR A 1 193 ? 176.959 29.923 147.943 1.00 38.59  ? 193  THR A OG1 1 
ATOM   1491 C CG2 . THR A 1 193 ? 177.815 29.187 149.990 1.00 34.86  ? 193  THR A CG2 1 
ATOM   1492 N N   . VAL A 1 194 ? 174.152 30.838 151.717 1.00 24.95  ? 194  VAL A N   1 
ATOM   1493 C CA  . VAL A 1 194 ? 173.779 31.289 153.060 1.00 21.76  ? 194  VAL A CA  1 
ATOM   1494 C C   . VAL A 1 194 ? 173.704 30.091 154.005 1.00 22.24  ? 194  VAL A C   1 
ATOM   1495 O O   . VAL A 1 194 ? 172.890 29.185 153.839 1.00 19.41  ? 194  VAL A O   1 
ATOM   1496 C CB  . VAL A 1 194 ? 172.403 31.966 153.100 1.00 21.50  ? 194  VAL A CB  1 
ATOM   1497 C CG1 . VAL A 1 194 ? 171.988 32.365 154.558 1.00 21.12  ? 194  VAL A CG1 1 
ATOM   1498 C CG2 . VAL A 1 194 ? 172.418 33.223 152.257 1.00 22.73  ? 194  VAL A CG2 1 
ATOM   1499 N N   . THR A 1 195 ? 174.567 30.072 154.997 1.00 24.83  ? 195  THR A N   1 
ATOM   1500 C CA  . THR A 1 195 ? 174.514 29.055 156.007 1.00 21.03  ? 195  THR A CA  1 
ATOM   1501 C C   . THR A 1 195 ? 173.843 29.653 157.267 1.00 22.30  ? 195  THR A C   1 
ATOM   1502 O O   . THR A 1 195 ? 174.285 30.729 157.775 1.00 20.39  ? 195  THR A O   1 
ATOM   1503 C CB  . THR A 1 195 ? 175.864 28.512 156.368 1.00 23.00  ? 195  THR A CB  1 
ATOM   1504 O OG1 . THR A 1 195 ? 176.404 27.695 155.336 1.00 23.29  ? 195  THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 195 ? 175.687 27.488 157.577 1.00 23.92  ? 195  THR A CG2 1 
ATOM   1506 N N   . ILE A 1 196 ? 172.796 29.006 157.779 1.00 20.47  ? 196  ILE A N   1 
ATOM   1507 C CA  . ILE A 1 196 ? 172.240 29.484 159.077 1.00 20.59  ? 196  ILE A CA  1 
ATOM   1508 C C   . ILE A 1 196 ? 172.867 28.675 160.200 1.00 20.73  ? 196  ILE A C   1 
ATOM   1509 O O   . ILE A 1 196 ? 173.150 27.471 160.045 1.00 20.42  ? 196  ILE A O   1 
ATOM   1510 C CB  . ILE A 1 196 ? 170.737 29.440 159.170 1.00 21.12  ? 196  ILE A CB  1 
ATOM   1511 C CG1 . ILE A 1 196 ? 170.224 28.047 158.876 1.00 20.93  ? 196  ILE A CG1 1 
ATOM   1512 C CG2 . ILE A 1 196 ? 170.104 30.456 158.219 1.00 22.63  ? 196  ILE A CG2 1 
ATOM   1513 C CD1 . ILE A 1 196 ? 168.742 27.947 159.158 1.00 23.93  ? 196  ILE A CD1 1 
ATOM   1514 N N   . PHE A 1 197 ? 173.215 29.368 161.284 1.00 20.97  ? 197  PHE A N   1 
ATOM   1515 C CA  . PHE A 1 197 ? 173.835 28.687 162.430 1.00 19.07  ? 197  PHE A CA  1 
ATOM   1516 C C   . PHE A 1 197 ? 173.326 29.279 163.719 1.00 19.14  ? 197  PHE A C   1 
ATOM   1517 O O   . PHE A 1 197 ? 172.947 30.481 163.799 1.00 17.57  ? 197  PHE A O   1 
ATOM   1518 C CB  . PHE A 1 197 ? 175.398 28.540 162.353 1.00 17.87  ? 197  PHE A CB  1 
ATOM   1519 C CG  . PHE A 1 197 ? 176.219 29.786 162.643 1.00 18.70  ? 197  PHE A CG  1 
ATOM   1520 C CD1 . PHE A 1 197 ? 176.037 30.942 161.940 1.00 19.25  ? 197  PHE A CD1 1 
ATOM   1521 C CD2 . PHE A 1 197 ? 177.330 29.727 163.505 1.00 18.20  ? 197  PHE A CD2 1 
ATOM   1522 C CE1 . PHE A 1 197 ? 176.846 32.060 162.149 1.00 19.80  ? 197  PHE A CE1 1 
ATOM   1523 C CE2 . PHE A 1 197 ? 178.145 30.854 163.727 1.00 19.83  ? 197  PHE A CE2 1 
ATOM   1524 C CZ  . PHE A 1 197 ? 177.913 32.030 163.051 1.00 19.30  ? 197  PHE A CZ  1 
ATOM   1525 N N   . GLY A 1 198 ? 173.181 28.410 164.711 1.00 19.17  ? 198  GLY A N   1 
ATOM   1526 C CA  . GLY A 1 198 ? 172.741 28.850 166.041 1.00 20.40  ? 198  GLY A CA  1 
ATOM   1527 C C   . GLY A 1 198 ? 173.015 27.825 167.154 1.00 18.00  ? 198  GLY A C   1 
ATOM   1528 O O   . GLY A 1 198 ? 173.284 26.679 166.870 1.00 19.65  ? 198  GLY A O   1 
ATOM   1529 N N   . GLU A 1 199 ? 172.916 28.294 168.391 1.00 19.35  ? 199  GLU A N   1 
ATOM   1530 C CA  . GLU A 1 199 ? 173.186 27.545 169.615 1.00 19.16  ? 199  GLU A CA  1 
ATOM   1531 C C   . GLU A 1 199 ? 171.956 27.500 170.493 1.00 19.80  ? 199  GLU A C   1 
ATOM   1532 O O   . GLU A 1 199 ? 171.290 28.490 170.679 1.00 19.52  ? 199  GLU A O   1 
ATOM   1533 C CB  . GLU A 1 199 ? 174.372 28.062 170.356 1.00 19.34  ? 199  GLU A CB  1 
ATOM   1534 C CG  . GLU A 1 199 ? 174.872 27.135 171.495 1.00 21.61  ? 199  GLU A CG  1 
ATOM   1535 C CD  . GLU A 1 199 ? 174.198 27.470 172.826 1.00 23.49  ? 199  GLU A CD  1 
ATOM   1536 O OE1 . GLU A 1 199 ? 173.527 28.535 172.861 1.00 21.54  ? 199  GLU A OE1 1 
ATOM   1537 O OE2 . GLU A 1 199 ? 174.357 26.694 173.834 1.00 23.98  ? 199  GLU A OE2 1 
ATOM   1538 N N   . SER A 1 200 ? 171.707 26.294 170.990 1.00 20.12  ? 200  SER A N   1 
ATOM   1539 C CA  . SER A 1 200 ? 170.693 25.983 171.969 1.00 21.90  ? 200  SER A CA  1 
ATOM   1540 C C   . SER A 1 200 ? 169.325 26.273 171.322 1.00 19.70  ? 200  SER A C   1 
ATOM   1541 O O   . SER A 1 200 ? 169.000 25.657 170.323 1.00 19.31  ? 200  SER A O   1 
ATOM   1542 C CB  . SER A 1 200 ? 170.902 26.690 173.326 1.00 22.29  ? 200  SER A CB  1 
ATOM   1543 O OG  . SER A 1 200 ? 169.921 26.218 174.304 1.00 25.26  ? 200  SER A OG  1 
ATOM   1544 N N   . ALA A 1 201 ? 168.508 27.154 171.870 1.00 18.58  ? 201  ALA A N   1 
ATOM   1545 C CA  . ALA A 1 201 ? 167.267 27.550 171.157 1.00 17.74  ? 201  ALA A CA  1 
ATOM   1546 C C   . ALA A 1 201 ? 167.523 28.031 169.697 1.00 18.11  ? 201  ALA A C   1 
ATOM   1547 O O   . ALA A 1 201 ? 166.647 27.926 168.844 1.00 18.72  ? 201  ALA A O   1 
ATOM   1548 C CB  . ALA A 1 201 ? 166.516 28.638 171.912 1.00 18.33  ? 201  ALA A CB  1 
ATOM   1549 N N   . GLY A 1 202 ? 168.679 28.640 169.465 1.00 18.09  ? 202  GLY A N   1 
ATOM   1550 C CA  . GLY A 1 202 ? 169.085 29.019 168.162 1.00 19.47  ? 202  GLY A CA  1 
ATOM   1551 C C   . GLY A 1 202 ? 169.320 27.792 167.294 1.00 19.85  ? 202  GLY A C   1 
ATOM   1552 O O   . GLY A 1 202 ? 169.017 27.806 166.120 1.00 19.49  ? 202  GLY A O   1 
ATOM   1553 N N   . GLY A 1 203 ? 169.910 26.736 167.854 1.00 20.08  ? 203  GLY A N   1 
ATOM   1554 C CA  . GLY A 1 203 ? 170.075 25.496 167.102 1.00 19.09  ? 203  GLY A CA  1 
ATOM   1555 C C   . GLY A 1 203 ? 168.757 24.795 166.827 1.00 20.06  ? 203  GLY A C   1 
ATOM   1556 O O   . GLY A 1 203 ? 168.497 24.229 165.724 1.00 22.99  ? 203  GLY A O   1 
ATOM   1557 N N   . ALA A 1 204 ? 167.891 24.775 167.814 1.00 18.43  ? 204  ALA A N   1 
ATOM   1558 C CA  . ALA A 1 204 ? 166.564 24.242 167.574 1.00 19.21  ? 204  ALA A CA  1 
ATOM   1559 C C   . ALA A 1 204 ? 165.893 25.058 166.430 1.00 20.08  ? 204  ALA A C   1 
ATOM   1560 O O   . ALA A 1 204 ? 165.196 24.499 165.590 1.00 20.95  ? 204  ALA A O   1 
ATOM   1561 C CB  . ALA A 1 204 ? 165.696 24.251 168.835 1.00 19.90  ? 204  ALA A CB  1 
ATOM   1562 N N   . SER A 1 205 ? 166.039 26.367 166.500 1.00 18.16  ? 205  SER A N   1 
ATOM   1563 C CA  . SER A 1 205 ? 165.453 27.278 165.536 1.00 20.52  ? 205  SER A CA  1 
ATOM   1564 C C   . SER A 1 205 ? 166.001 26.884 164.104 1.00 20.50  ? 205  SER A C   1 
ATOM   1565 O O   . SER A 1 205 ? 165.212 26.601 163.218 1.00 18.59  ? 205  SER A O   1 
ATOM   1566 C CB  . SER A 1 205 ? 165.804 28.733 165.868 1.00 19.80  ? 205  SER A CB  1 
ATOM   1567 O OG  . SER A 1 205 ? 164.957 29.290 166.856 1.00 19.65  ? 205  SER A OG  1 
ATOM   1568 N N   . VAL A 1 206 ? 167.317 26.753 163.960 1.00 17.63  ? 206  VAL A N   1 
ATOM   1569 C CA  . VAL A 1 206 ? 167.896 26.291 162.680 1.00 18.30  ? 206  VAL A CA  1 
ATOM   1570 C C   . VAL A 1 206 ? 167.167 25.028 162.193 1.00 20.26  ? 206  VAL A C   1 
ATOM   1571 O O   . VAL A 1 206 ? 166.765 24.930 161.042 1.00 22.52  ? 206  VAL A O   1 
ATOM   1572 C CB  . VAL A 1 206 ? 169.372 26.103 162.817 1.00 17.38  ? 206  VAL A CB  1 
ATOM   1573 C CG1 . VAL A 1 206 ? 169.952 25.307 161.648 1.00 19.47  ? 206  VAL A CG1 1 
ATOM   1574 C CG2 . VAL A 1 206 ? 170.051 27.472 162.896 1.00 17.98  ? 206  VAL A CG2 1 
ATOM   1575 N N   . GLY A 1 207 ? 167.014 24.057 163.059 1.00 17.22  ? 207  GLY A N   1 
ATOM   1576 C CA  . GLY A 1 207 ? 166.326 22.845 162.732 1.00 17.64  ? 207  GLY A CA  1 
ATOM   1577 C C   . GLY A 1 207 ? 164.897 23.042 162.302 1.00 18.73  ? 207  GLY A C   1 
ATOM   1578 O O   . GLY A 1 207 ? 164.350 22.261 161.471 1.00 20.38  ? 207  GLY A O   1 
ATOM   1579 N N   . MET A 1 208 ? 164.263 24.005 162.926 1.00 17.28  ? 208  MET A N   1 
ATOM   1580 C CA  . MET A 1 208 ? 162.881 24.278 162.670 1.00 18.44  ? 208  MET A CA  1 
ATOM   1581 C C   . MET A 1 208 ? 162.742 24.907 161.272 1.00 19.05  ? 208  MET A C   1 
ATOM   1582 O O   . MET A 1 208 ? 161.763 24.595 160.579 1.00 18.19  ? 208  MET A O   1 
ATOM   1583 C CB  . MET A 1 208 ? 162.248 25.145 163.746 1.00 16.80  ? 208  MET A CB  1 
ATOM   1584 C CG  . MET A 1 208 ? 162.084 24.352 165.072 1.00 19.20  ? 208  MET A CG  1 
ATOM   1585 S SD  . MET A 1 208 ? 161.714 25.490 166.412 1.00 20.93  ? 208  MET A SD  1 
ATOM   1586 C CE  . MET A 1 208 ? 161.307 24.260 167.640 1.00 21.55  ? 208  MET A CE  1 
ATOM   1587 N N   . HIS A 1 209 ? 163.726 25.671 160.848 1.00 18.99  ? 209  HIS A N   1 
ATOM   1588 C CA  . HIS A 1 209 ? 163.707 26.249 159.450 1.00 20.84  ? 209  HIS A CA  1 
ATOM   1589 C C   . HIS A 1 209 ? 164.042 25.171 158.397 1.00 21.27  ? 209  HIS A C   1 
ATOM   1590 O O   . HIS A 1 209 ? 163.548 25.216 157.253 1.00 20.60  ? 209  HIS A O   1 
ATOM   1591 C CB  . HIS A 1 209 ? 164.678 27.439 159.346 1.00 18.30  ? 209  HIS A CB  1 
ATOM   1592 C CG  . HIS A 1 209 ? 164.227 28.619 160.119 1.00 18.78  ? 209  HIS A CG  1 
ATOM   1593 N ND1 . HIS A 1 209 ? 162.993 29.174 159.960 1.00 21.00  ? 209  HIS A ND1 1 
ATOM   1594 C CD2 . HIS A 1 209 ? 164.793 29.274 161.155 1.00 19.45  ? 209  HIS A CD2 1 
ATOM   1595 C CE1 . HIS A 1 209 ? 162.831 30.179 160.791 1.00 21.40  ? 209  HIS A CE1 1 
ATOM   1596 N NE2 . HIS A 1 209 ? 163.906 30.246 161.541 1.00 22.20  ? 209  HIS A NE2 1 
ATOM   1597 N N   . ILE A 1 210 ? 164.830 24.178 158.786 1.00 21.95  ? 210  ILE A N   1 
ATOM   1598 C CA  . ILE A 1 210 ? 165.078 23.012 157.937 1.00 19.71  ? 210  ILE A CA  1 
ATOM   1599 C C   . ILE A 1 210 ? 163.776 22.278 157.713 1.00 22.87  ? 210  ILE A C   1 
ATOM   1600 O O   . ILE A 1 210 ? 163.488 21.816 156.558 1.00 20.37  ? 210  ILE A O   1 
ATOM   1601 C CB  . ILE A 1 210 ? 166.058 22.093 158.562 1.00 20.17  ? 210  ILE A CB  1 
ATOM   1602 C CG1 . ILE A 1 210 ? 167.412 22.702 158.462 1.00 20.34  ? 210  ILE A CG1 1 
ATOM   1603 C CG2 . ILE A 1 210 ? 166.110 20.752 157.877 1.00 22.89  ? 210  ILE A CG2 1 
ATOM   1604 C CD1 . ILE A 1 210 ? 168.485 21.927 159.190 1.00 20.55  ? 210  ILE A CD1 1 
ATOM   1605 N N   . LEU A 1 211 ? 162.973 22.189 158.773 1.00 18.96  ? 211  LEU A N   1 
ATOM   1606 C CA  . LEU A 1 211 ? 161.720 21.493 158.687 1.00 20.68  ? 211  LEU A CA  1 
ATOM   1607 C C   . LEU A 1 211 ? 160.603 22.301 158.038 1.00 19.69  ? 211  LEU A C   1 
ATOM   1608 O O   . LEU A 1 211 ? 159.799 21.752 157.279 1.00 21.53  ? 211  LEU A O   1 
ATOM   1609 C CB  . LEU A 1 211 ? 161.225 21.011 160.051 1.00 21.87  ? 211  LEU A CB  1 
ATOM   1610 C CG  . LEU A 1 211 ? 161.989 19.908 160.766 1.00 26.05  ? 211  LEU A CG  1 
ATOM   1611 C CD1 . LEU A 1 211 ? 161.672 19.931 162.278 1.00 27.82  ? 211  LEU A CD1 1 
ATOM   1612 C CD2 . LEU A 1 211 ? 161.562 18.620 160.256 1.00 29.71  ? 211  LEU A CD2 1 
ATOM   1613 N N   . SER A 1 212 ? 160.498 23.571 158.356 1.00 19.38  ? 212  SER A N   1 
ATOM   1614 C CA  . SER A 1 212 ? 159.334 24.303 157.944 1.00 22.61  ? 212  SER A CA  1 
ATOM   1615 C C   . SER A 1 212 ? 159.400 24.583 156.399 1.00 23.39  ? 212  SER A C   1 
ATOM   1616 O O   . SER A 1 212 ? 160.353 25.230 155.949 1.00 19.50  ? 212  SER A O   1 
ATOM   1617 C CB  . SER A 1 212 ? 159.298 25.638 158.612 1.00 22.21  ? 212  SER A CB  1 
ATOM   1618 O OG  . SER A 1 212 ? 158.089 26.308 158.224 1.00 23.68  ? 212  SER A OG  1 
ATOM   1619 N N   . PRO A 1 213 ? 158.370 24.146 155.652 1.00 24.95  ? 213  PRO A N   1 
ATOM   1620 C CA  . PRO A 1 213 ? 158.307 24.320 154.181 1.00 24.83  ? 213  PRO A CA  1 
ATOM   1621 C C   . PRO A 1 213 ? 158.431 25.790 153.792 1.00 23.54  ? 213  PRO A C   1 
ATOM   1622 O O   . PRO A 1 213 ? 159.032 26.097 152.816 1.00 23.58  ? 213  PRO A O   1 
ATOM   1623 C CB  . PRO A 1 213 ? 156.919 23.783 153.842 1.00 27.18  ? 213  PRO A CB  1 
ATOM   1624 C CG  . PRO A 1 213 ? 156.679 22.718 154.919 1.00 27.36  ? 213  PRO A CG  1 
ATOM   1625 C CD  . PRO A 1 213 ? 157.244 23.337 156.151 1.00 26.57  ? 213  PRO A CD  1 
ATOM   1626 N N   . GLY A 1 214 ? 157.898 26.694 154.610 1.00 23.20  ? 214  GLY A N   1 
ATOM   1627 C CA  . GLY A 1 214 ? 157.914 28.113 154.323 1.00 21.70  ? 214  GLY A CA  1 
ATOM   1628 C C   . GLY A 1 214 ? 159.236 28.798 154.596 1.00 21.90  ? 214  GLY A C   1 
ATOM   1629 O O   . GLY A 1 214 ? 159.368 29.954 154.267 1.00 23.89  ? 214  GLY A O   1 
ATOM   1630 N N   . SER A 1 215 ? 160.239 28.097 155.146 1.00 20.84  ? 215  SER A N   1 
ATOM   1631 C CA  . SER A 1 215 ? 161.562 28.687 155.335 1.00 19.15  ? 215  SER A CA  1 
ATOM   1632 C C   . SER A 1 215 ? 162.648 28.033 154.525 1.00 18.20  ? 215  SER A C   1 
ATOM   1633 O O   . SER A 1 215 ? 163.726 28.593 154.378 1.00 16.81  ? 215  SER A O   1 
ATOM   1634 C CB  . SER A 1 215 ? 162.058 28.540 156.863 1.00 20.50  ? 215  SER A CB  1 
ATOM   1635 O OG  . SER A 1 215 ? 161.136 29.084 157.754 1.00 21.70  ? 215  SER A OG  1 
ATOM   1636 N N   . ARG A 1 216 ? 162.445 26.785 154.110 1.00 19.40  ? 216  ARG A N   1 
ATOM   1637 C CA  . ARG A 1 216 ? 163.578 26.015 153.548 1.00 21.68  ? 216  ARG A CA  1 
ATOM   1638 C C   . ARG A 1 216 ? 164.268 26.645 152.386 1.00 22.43  ? 216  ARG A C   1 
ATOM   1639 O O   . ARG A 1 216 ? 165.434 26.368 152.151 1.00 23.99  ? 216  ARG A O   1 
ATOM   1640 C CB  . ARG A 1 216 ? 163.110 24.693 152.896 1.00 25.66  ? 216  ARG A CB  1 
ATOM   1641 C CG  . ARG A 1 216 ? 162.343 23.820 153.792 1.00 25.88  ? 216  ARG A CG  1 
ATOM   1642 C CD  . ARG A 1 216 ? 161.872 22.558 153.092 1.00 24.41  ? 216  ARG A CD  1 
ATOM   1643 N NE  . ARG A 1 216 ? 161.009 21.871 154.018 1.00 24.30  ? 216  ARG A NE  1 
ATOM   1644 C CZ  . ARG A 1 216 ? 160.302 20.788 153.735 1.00 27.90  ? 216  ARG A CZ  1 
ATOM   1645 N NH1 . ARG A 1 216 ? 160.370 20.233 152.505 1.00 26.85  ? 216  ARG A NH1 1 
ATOM   1646 N NH2 . ARG A 1 216 ? 159.557 20.263 154.682 1.00 24.35  ? 216  ARG A NH2 1 
ATOM   1647 N N   . ASP A 1 217 ? 163.547 27.425 151.587 1.00 22.46  ? 217  ASP A N   1 
ATOM   1648 C CA  . ASP A 1 217 ? 164.158 27.853 150.298 1.00 23.38  ? 217  ASP A CA  1 
ATOM   1649 C C   . ASP A 1 217 ? 165.094 28.996 150.574 1.00 26.67  ? 217  ASP A C   1 
ATOM   1650 O O   . ASP A 1 217 ? 165.780 29.431 149.668 1.00 29.02  ? 217  ASP A O   1 
ATOM   1651 C CB  . ASP A 1 217 ? 163.064 28.328 149.316 1.00 21.93  ? 217  ASP A CB  1 
ATOM   1652 C CG  . ASP A 1 217 ? 162.123 27.151 148.839 1.00 24.84  ? 217  ASP A CG  1 
ATOM   1653 O OD1 . ASP A 1 217 ? 162.256 26.002 149.294 1.00 24.79  ? 217  ASP A OD1 1 
ATOM   1654 O OD2 . ASP A 1 217 ? 161.172 27.398 148.069 1.00 26.85  ? 217  ASP A OD2 1 
ATOM   1655 N N   . LEU A 1 218 ? 165.050 29.571 151.801 1.00 25.43  ? 218  LEU A N   1 
ATOM   1656 C CA  . LEU A 1 218 ? 165.819 30.780 152.066 1.00 23.65  ? 218  LEU A CA  1 
ATOM   1657 C C   . LEU A 1 218 ? 167.268 30.602 152.440 1.00 22.82  ? 218  LEU A C   1 
ATOM   1658 O O   . LEU A 1 218 ? 167.979 31.586 152.687 1.00 28.28  ? 218  LEU A O   1 
ATOM   1659 C CB  . LEU A 1 218 ? 165.128 31.603 153.114 1.00 23.54  ? 218  LEU A CB  1 
ATOM   1660 C CG  . LEU A 1 218 ? 163.672 31.919 152.838 1.00 25.48  ? 218  LEU A CG  1 
ATOM   1661 C CD1 . LEU A 1 218 ? 163.057 32.698 153.985 1.00 24.97  ? 218  LEU A CD1 1 
ATOM   1662 C CD2 . LEU A 1 218 ? 163.469 32.757 151.600 1.00 27.81  ? 218  LEU A CD2 1 
ATOM   1663 N N   . PHE A 1 219 ? 167.742 29.383 152.565 1.00 19.84  ? 219  PHE A N   1 
ATOM   1664 C CA  . PHE A 1 219 ? 169.147 29.251 152.908 1.00 18.61  ? 219  PHE A CA  1 
ATOM   1665 C C   . PHE A 1 219 ? 169.671 28.020 152.237 1.00 16.41  ? 219  PHE A C   1 
ATOM   1666 O O   . PHE A 1 219 ? 168.872 27.200 151.714 1.00 17.57  ? 219  PHE A O   1 
ATOM   1667 C CB  . PHE A 1 219 ? 169.259 29.223 154.477 1.00 20.46  ? 219  PHE A CB  1 
ATOM   1668 C CG  . PHE A 1 219 ? 168.517 28.094 155.114 1.00 17.19  ? 219  PHE A CG  1 
ATOM   1669 C CD1 . PHE A 1 219 ? 167.180 28.173 155.321 1.00 19.63  ? 219  PHE A CD1 1 
ATOM   1670 C CD2 . PHE A 1 219 ? 169.167 26.942 155.458 1.00 17.34  ? 219  PHE A CD2 1 
ATOM   1671 C CE1 . PHE A 1 219 ? 166.496 27.104 155.877 1.00 17.21  ? 219  PHE A CE1 1 
ATOM   1672 C CE2 . PHE A 1 219 ? 168.506 25.849 155.979 1.00 16.33  ? 219  PHE A CE2 1 
ATOM   1673 C CZ  . PHE A 1 219 ? 167.150 25.946 156.174 1.00 17.21  ? 219  PHE A CZ  1 
ATOM   1674 N N   . ARG A 1 220 ? 170.962 27.817 152.274 1.00 16.29  ? 220  ARG A N   1 
ATOM   1675 C CA  . ARG A 1 220 ? 171.564 26.705 151.608 1.00 20.21  ? 220  ARG A CA  1 
ATOM   1676 C C   . ARG A 1 220 ? 171.862 25.499 152.541 1.00 22.19  ? 220  ARG A C   1 
ATOM   1677 O O   . ARG A 1 220 ? 171.636 24.306 152.187 1.00 23.58  ? 220  ARG A O   1 
ATOM   1678 C CB  . ARG A 1 220 ? 172.864 27.224 151.007 1.00 21.23  ? 220  ARG A CB  1 
ATOM   1679 C CG  . ARG A 1 220 ? 173.697 26.232 150.255 1.00 23.63  ? 220  ARG A CG  1 
ATOM   1680 C CD  . ARG A 1 220 ? 172.975 25.699 149.044 1.00 26.40  ? 220  ARG A CD  1 
ATOM   1681 N NE  . ARG A 1 220 ? 173.798 24.780 148.244 1.00 29.18  ? 220  ARG A NE  1 
ATOM   1682 C CZ  . ARG A 1 220 ? 174.565 25.157 147.216 1.00 33.25  ? 220  ARG A CZ  1 
ATOM   1683 N NH1 . ARG A 1 220 ? 174.671 26.422 146.868 1.00 30.58  ? 220  ARG A NH1 1 
ATOM   1684 N NH2 . ARG A 1 220 ? 175.247 24.237 146.550 1.00 34.79  ? 220  ARG A NH2 1 
ATOM   1685 N N   . ARG A 1 221 ? 172.507 25.804 153.662 1.00 21.89  ? 221  ARG A N   1 
ATOM   1686 C CA  . ARG A 1 221 ? 172.918 24.757 154.625 1.00 20.76  ? 221  ARG A CA  1 
ATOM   1687 C C   . ARG A 1 221 ? 172.909 25.256 156.064 1.00 19.50  ? 221  ARG A C   1 
ATOM   1688 O O   . ARG A 1 221 ? 172.460 26.397 156.332 1.00 19.15  ? 221  ARG A O   1 
ATOM   1689 C CB  . ARG A 1 221 ? 174.238 24.145 154.215 1.00 22.24  ? 221  ARG A CB  1 
ATOM   1690 C CG  . ARG A 1 221 ? 175.338 25.112 154.044 1.00 24.98  ? 221  ARG A CG  1 
ATOM   1691 C CD  . ARG A 1 221 ? 176.603 24.446 153.490 1.00 27.34  ? 221  ARG A CD  1 
ATOM   1692 N NE  . ARG A 1 221 ? 176.516 23.834 152.184 1.00 25.62  ? 221  ARG A NE  1 
ATOM   1693 C CZ  . ARG A 1 221 ? 176.997 24.336 151.029 1.00 27.53  ? 221  ARG A CZ  1 
ATOM   1694 N NH1 . ARG A 1 221 ? 176.826 23.636 149.922 1.00 25.23  ? 221  ARG A NH1 1 
ATOM   1695 N NH2 . ARG A 1 221 ? 177.629 25.501 150.938 1.00 26.51  ? 221  ARG A NH2 1 
ATOM   1696 N N   . ALA A 1 222 ? 173.282 24.386 156.985 1.00 18.52  ? 222  ALA A N   1 
ATOM   1697 C CA  . ALA A 1 222 ? 172.899 24.587 158.405 1.00 19.70  ? 222  ALA A CA  1 
ATOM   1698 C C   . ALA A 1 222 ? 173.849 23.997 159.404 1.00 20.00  ? 222  ALA A C   1 
ATOM   1699 O O   . ALA A 1 222 ? 174.411 22.940 159.198 1.00 20.19  ? 222  ALA A O   1 
ATOM   1700 C CB  . ALA A 1 222 ? 171.497 24.145 158.682 1.00 20.07  ? 222  ALA A CB  1 
ATOM   1701 N N   . ILE A 1 223 ? 174.099 24.778 160.464 1.00 21.24  ? 223  ILE A N   1 
ATOM   1702 C CA  . ILE A 1 223 ? 174.888 24.345 161.603 1.00 20.75  ? 223  ILE A CA  1 
ATOM   1703 C C   . ILE A 1 223 ? 174.018 24.462 162.882 1.00 20.46  ? 223  ILE A C   1 
ATOM   1704 O O   . ILE A 1 223 ? 173.442 25.536 163.149 1.00 19.09  ? 223  ILE A O   1 
ATOM   1705 C CB  . ILE A 1 223 ? 176.173 25.158 161.730 1.00 19.71  ? 223  ILE A CB  1 
ATOM   1706 C CG1 . ILE A 1 223 ? 177.056 25.024 160.504 1.00 20.65  ? 223  ILE A CG1 1 
ATOM   1707 C CG2 . ILE A 1 223 ? 177.033 24.747 162.956 1.00 20.84  ? 223  ILE A CG2 1 
ATOM   1708 C CD1 . ILE A 1 223 ? 178.198 26.024 160.538 1.00 19.93  ? 223  ILE A CD1 1 
ATOM   1709 N N   . LEU A 1 224 ? 173.901 23.361 163.637 1.00 17.45  ? 224  LEU A N   1 
ATOM   1710 C CA  . LEU A 1 224 ? 173.168 23.347 164.891 1.00 16.42  ? 224  LEU A CA  1 
ATOM   1711 C C   . LEU A 1 224 ? 174.085 23.019 166.083 1.00 18.02  ? 224  LEU A C   1 
ATOM   1712 O O   . LEU A 1 224 ? 174.705 21.977 166.152 1.00 17.41  ? 224  LEU A O   1 
ATOM   1713 C CB  . LEU A 1 224 ? 172.042 22.351 164.877 1.00 17.27  ? 224  LEU A CB  1 
ATOM   1714 C CG  . LEU A 1 224 ? 170.974 22.398 163.805 1.00 17.18  ? 224  LEU A CG  1 
ATOM   1715 C CD1 . LEU A 1 224 ? 171.461 21.891 162.469 1.00 18.22  ? 224  LEU A CD1 1 
ATOM   1716 C CD2 . LEU A 1 224 ? 169.801 21.559 164.176 1.00 16.23  ? 224  LEU A CD2 1 
ATOM   1717 N N   . GLN A 1 225 ? 174.167 23.926 167.046 1.00 19.73  ? 225  GLN A N   1 
ATOM   1718 C CA  . GLN A 1 225 ? 175.082 23.732 168.192 1.00 19.17  ? 225  GLN A CA  1 
ATOM   1719 C C   . GLN A 1 225 ? 174.233 23.534 169.438 1.00 18.46  ? 225  GLN A C   1 
ATOM   1720 O O   . GLN A 1 225 ? 173.458 24.406 169.811 1.00 18.45  ? 225  GLN A O   1 
ATOM   1721 C CB  . GLN A 1 225 ? 175.966 24.964 168.352 1.00 20.29  ? 225  GLN A CB  1 
ATOM   1722 C CG  . GLN A 1 225 ? 176.955 25.163 167.213 1.00 22.92  ? 225  GLN A CG  1 
ATOM   1723 C CD  . GLN A 1 225 ? 177.556 26.562 167.180 1.00 24.61  ? 225  GLN A CD  1 
ATOM   1724 O OE1 . GLN A 1 225 ? 177.790 27.143 166.130 1.00 23.19  ? 225  GLN A OE1 1 
ATOM   1725 N NE2 . GLN A 1 225 ? 177.772 27.129 168.353 1.00 25.33  ? 225  GLN A NE2 1 
ATOM   1726 N N   . SER A 1 226 ? 174.241 22.319 169.976 1.00 21.68  ? 226  SER A N   1 
ATOM   1727 C CA  . SER A 1 226 ? 173.621 22.032 171.277 1.00 20.83  ? 226  SER A CA  1 
ATOM   1728 C C   . SER A 1 226 ? 172.163 22.357 171.238 1.00 20.88  ? 226  SER A C   1 
ATOM   1729 O O   . SER A 1 226 ? 171.606 22.919 172.193 1.00 19.70  ? 226  SER A O   1 
ATOM   1730 C CB  . SER A 1 226 ? 174.291 22.887 172.402 1.00 21.68  ? 226  SER A CB  1 
ATOM   1731 O OG  . SER A 1 226 ? 175.637 22.536 172.562 1.00 22.17  ? 226  SER A OG  1 
ATOM   1732 N N   . GLY A 1 227 ? 171.488 21.931 170.199 1.00 19.87  ? 227  GLY A N   1 
ATOM   1733 C CA  . GLY A 1 227 ? 170.087 22.239 170.070 1.00 19.33  ? 227  GLY A CA  1 
ATOM   1734 C C   . GLY A 1 227 ? 169.545 21.592 168.847 1.00 21.05  ? 227  GLY A C   1 
ATOM   1735 O O   . GLY A 1 227 ? 170.260 21.422 167.841 1.00 22.82  ? 227  GLY A O   1 
ATOM   1736 N N   . SER A 1 228 ? 168.301 21.167 168.936 1.00 21.53  ? 228  SER A N   1 
ATOM   1737 C CA  . SER A 1 228 ? 167.702 20.465 167.832 1.00 22.76  ? 228  SER A CA  1 
ATOM   1738 C C   . SER A 1 228 ? 166.200 20.671 167.951 1.00 21.33  ? 228  SER A C   1 
ATOM   1739 O O   . SER A 1 228 ? 165.698 20.983 169.031 1.00 20.76  ? 228  SER A O   1 
ATOM   1740 C CB  . SER A 1 228 ? 168.148 19.006 167.772 1.00 24.30  ? 228  SER A CB  1 
ATOM   1741 O OG  . SER A 1 228 ? 167.428 18.203 168.626 1.00 28.00  ? 228  SER A OG  1 
ATOM   1742 N N   . PRO A 1 229 ? 165.482 20.581 166.815 1.00 22.14  ? 229  PRO A N   1 
ATOM   1743 C CA  . PRO A 1 229 ? 164.089 21.029 166.804 1.00 22.76  ? 229  PRO A CA  1 
ATOM   1744 C C   . PRO A 1 229 ? 163.170 20.157 167.586 1.00 19.16  ? 229  PRO A C   1 
ATOM   1745 O O   . PRO A 1 229 ? 162.161 20.617 168.065 1.00 21.73  ? 229  PRO A O   1 
ATOM   1746 C CB  . PRO A 1 229 ? 163.732 21.043 165.312 1.00 22.97  ? 229  PRO A CB  1 
ATOM   1747 C CG  . PRO A 1 229 ? 164.666 20.060 164.710 1.00 22.98  ? 229  PRO A CG  1 
ATOM   1748 C CD  . PRO A 1 229 ? 165.945 20.153 165.481 1.00 22.41  ? 229  PRO A CD  1 
ATOM   1749 N N   . ASN A 1 230 ? 163.560 18.920 167.779 1.00 19.12  ? 230  ASN A N   1 
ATOM   1750 C CA  . ASN A 1 230 ? 162.787 17.987 168.578 1.00 19.80  ? 230  ASN A CA  1 
ATOM   1751 C C   . ASN A 1 230 ? 163.124 17.985 170.080 1.00 20.47  ? 230  ASN A C   1 
ATOM   1752 O O   . ASN A 1 230 ? 162.657 17.103 170.779 1.00 19.62  ? 230  ASN A O   1 
ATOM   1753 C CB  . ASN A 1 230 ? 162.969 16.584 168.029 1.00 19.61  ? 230  ASN A CB  1 
ATOM   1754 C CG  . ASN A 1 230 ? 164.426 16.190 167.964 1.00 23.49  ? 230  ASN A CG  1 
ATOM   1755 O OD1 . ASN A 1 230 ? 165.271 16.975 167.489 1.00 24.38  ? 230  ASN A OD1 1 
ATOM   1756 N ND2 . ASN A 1 230 ? 164.746 14.999 168.396 1.00 21.55  ? 230  ASN A ND2 1 
ATOM   1757 N N   . CYS A 1 231 ? 163.920 18.933 170.574 1.00 19.03  ? 231  CYS A N   1 
ATOM   1758 C CA  . CYS A 1 231 ? 164.223 18.940 172.013 1.00 18.95  ? 231  CYS A CA  1 
ATOM   1759 C C   . CYS A 1 231 ? 162.926 19.038 172.831 1.00 19.53  ? 231  CYS A C   1 
ATOM   1760 O O   . CYS A 1 231 ? 161.943 19.711 172.394 1.00 18.47  ? 231  CYS A O   1 
ATOM   1761 C CB  . CYS A 1 231 ? 165.140 20.087 172.360 1.00 17.57  ? 231  CYS A CB  1 
ATOM   1762 S SG  . CYS A 1 231 ? 166.803 19.864 171.779 1.00 20.08  ? 231  CYS A SG  1 
ATOM   1763 N N   . PRO A 1 232 ? 162.881 18.351 173.998 1.00 19.11  ? 232  PRO A N   1 
ATOM   1764 C CA  . PRO A 1 232 ? 161.578 18.261 174.721 1.00 19.02  ? 232  PRO A CA  1 
ATOM   1765 C C   . PRO A 1 232 ? 161.095 19.606 175.234 1.00 19.52  ? 232  PRO A C   1 
ATOM   1766 O O   . PRO A 1 232 ? 159.916 19.776 175.484 1.00 20.74  ? 232  PRO A O   1 
ATOM   1767 C CB  . PRO A 1 232 ? 161.871 17.262 175.855 1.00 20.96  ? 232  PRO A CB  1 
ATOM   1768 C CG  . PRO A 1 232 ? 163.359 17.332 176.048 1.00 20.39  ? 232  PRO A CG  1 
ATOM   1769 C CD  . PRO A 1 232 ? 163.933 17.549 174.661 1.00 19.74  ? 232  PRO A CD  1 
ATOM   1770 N N   . TRP A 1 233 ? 161.994 20.584 175.341 1.00 18.82  ? 233  TRP A N   1 
ATOM   1771 C CA  . TRP A 1 233 ? 161.695 21.909 175.794 1.00 17.15  ? 233  TRP A CA  1 
ATOM   1772 C C   . TRP A 1 233 ? 161.355 22.937 174.680 1.00 19.88  ? 233  TRP A C   1 
ATOM   1773 O O   . TRP A 1 233 ? 160.979 24.068 174.958 1.00 19.46  ? 233  TRP A O   1 
ATOM   1774 C CB  . TRP A 1 233 ? 162.903 22.443 176.576 1.00 17.86  ? 233  TRP A CB  1 
ATOM   1775 C CG  . TRP A 1 233 ? 164.201 22.310 175.879 1.00 18.68  ? 233  TRP A CG  1 
ATOM   1776 C CD1 . TRP A 1 233 ? 165.033 21.250 175.959 1.00 17.68  ? 233  TRP A CD1 1 
ATOM   1777 C CD2 . TRP A 1 233 ? 164.780 23.206 174.900 1.00 17.72  ? 233  TRP A CD2 1 
ATOM   1778 N NE1 . TRP A 1 233 ? 166.128 21.429 175.168 1.00 17.45  ? 233  TRP A NE1 1 
ATOM   1779 C CE2 . TRP A 1 233 ? 165.992 22.611 174.474 1.00 19.12  ? 233  TRP A CE2 1 
ATOM   1780 C CE3 . TRP A 1 233 ? 164.415 24.445 174.382 1.00 19.59  ? 233  TRP A CE3 1 
ATOM   1781 C CZ2 . TRP A 1 233 ? 166.828 23.198 173.513 1.00 19.47  ? 233  TRP A CZ2 1 
ATOM   1782 C CZ3 . TRP A 1 233 ? 165.249 25.069 173.435 1.00 20.34  ? 233  TRP A CZ3 1 
ATOM   1783 C CH2 . TRP A 1 233 ? 166.445 24.422 172.990 1.00 21.00  ? 233  TRP A CH2 1 
ATOM   1784 N N   . ALA A 1 234 ? 161.565 22.563 173.422 1.00 20.36  ? 234  ALA A N   1 
ATOM   1785 C CA  . ALA A 1 234 ? 161.576 23.518 172.324 1.00 19.43  ? 234  ALA A CA  1 
ATOM   1786 C C   . ALA A 1 234 ? 160.256 23.690 171.673 1.00 20.87  ? 234  ALA A C   1 
ATOM   1787 O O   . ALA A 1 234 ? 160.151 24.521 170.802 1.00 20.27  ? 234  ALA A O   1 
ATOM   1788 C CB  . ALA A 1 234 ? 162.580 23.067 171.256 1.00 20.42  ? 234  ALA A CB  1 
ATOM   1789 N N   . SER A 1 235 ? 159.230 22.880 171.995 1.00 21.91  ? 235  SER A N   1 
ATOM   1790 C CA  . SER A 1 235 ? 157.955 23.148 171.434 1.00 21.52  ? 235  SER A CA  1 
ATOM   1791 C C   . SER A 1 235 ? 156.849 22.616 172.344 1.00 24.04  ? 235  SER A C   1 
ATOM   1792 O O   . SER A 1 235 ? 157.115 21.817 173.198 1.00 19.97  ? 235  SER A O   1 
ATOM   1793 C CB  . SER A 1 235 ? 157.843 22.503 170.029 1.00 23.27  ? 235  SER A CB  1 
ATOM   1794 O OG  . SER A 1 235 ? 157.847 21.034 170.088 1.00 21.98  ? 235  SER A OG  1 
ATOM   1795 N N   . VAL A 1 236 ? 155.641 23.130 172.172 1.00 20.34  ? 236  VAL A N   1 
ATOM   1796 C CA  . VAL A 1 236 ? 154.441 22.602 172.832 1.00 22.66  ? 236  VAL A CA  1 
ATOM   1797 C C   . VAL A 1 236 ? 153.335 22.414 171.807 1.00 22.43  ? 236  VAL A C   1 
ATOM   1798 O O   . VAL A 1 236 ? 153.430 22.935 170.694 1.00 20.16  ? 236  VAL A O   1 
ATOM   1799 C CB  . VAL A 1 236 ? 153.943 23.575 173.909 1.00 22.71  ? 236  VAL A CB  1 
ATOM   1800 C CG1 . VAL A 1 236 ? 155.028 23.734 175.001 1.00 22.39  ? 236  VAL A CG1 1 
ATOM   1801 C CG2 . VAL A 1 236 ? 153.638 24.953 173.310 1.00 20.73  ? 236  VAL A CG2 1 
ATOM   1802 N N   . SER A 1 237 ? 152.309 21.684 172.200 1.00 21.03  ? 237  SER A N   1 
ATOM   1803 C CA  . SER A 1 237 ? 151.131 21.438 171.414 1.00 22.75  ? 237  SER A CA  1 
ATOM   1804 C C   . SER A 1 237 ? 150.301 22.702 171.434 1.00 23.67  ? 237  SER A C   1 
ATOM   1805 O O   . SER A 1 237 ? 150.565 23.585 172.258 1.00 22.66  ? 237  SER A O   1 
ATOM   1806 C CB  . SER A 1 237 ? 150.319 20.260 172.040 1.00 23.69  ? 237  SER A CB  1 
ATOM   1807 O OG  . SER A 1 237 ? 149.716 20.710 173.251 1.00 26.18  ? 237  SER A OG  1 
ATOM   1808 N N   . VAL A 1 238 ? 149.312 22.807 170.528 1.00 23.74  ? 238  VAL A N   1 
ATOM   1809 C CA  . VAL A 1 238 ? 148.472 23.958 170.539 1.00 26.48  ? 238  VAL A CA  1 
ATOM   1810 C C   . VAL A 1 238 ? 147.607 23.988 171.810 1.00 23.38  ? 238  VAL A C   1 
ATOM   1811 O O   . VAL A 1 238 ? 147.360 25.067 172.329 1.00 28.50  ? 238  VAL A O   1 
ATOM   1812 C CB  . VAL A 1 238 ? 147.534 24.143 169.323 1.00 29.40  ? 238  VAL A CB  1 
ATOM   1813 C CG1 . VAL A 1 238 ? 148.290 24.278 168.034 1.00 34.88  ? 238  VAL A CG1 1 
ATOM   1814 C CG2 . VAL A 1 238 ? 146.542 23.047 169.225 1.00 33.44  ? 238  VAL A CG2 1 
ATOM   1815 N N   . ALA A 1 239 ? 147.113 22.858 172.276 1.00 26.52  ? 239  ALA A N   1 
ATOM   1816 C CA  . ALA A 1 239 ? 146.384 22.857 173.575 1.00 27.18  ? 239  ALA A CA  1 
ATOM   1817 C C   . ALA A 1 239 ? 147.246 23.374 174.772 1.00 24.45  ? 239  ALA A C   1 
ATOM   1818 O O   . ALA A 1 239 ? 146.833 24.245 175.529 1.00 28.71  ? 239  ALA A O   1 
ATOM   1819 C CB  . ALA A 1 239 ? 145.802 21.484 173.846 1.00 29.87  ? 239  ALA A CB  1 
ATOM   1820 N N   . GLU A 1 240 ? 148.498 22.976 174.839 1.00 28.01  ? 240  GLU A N   1 
ATOM   1821 C CA  . GLU A 1 240 ? 149.367 23.406 175.957 1.00 25.70  ? 240  GLU A CA  1 
ATOM   1822 C C   . GLU A 1 240 ? 149.718 24.830 175.813 1.00 24.31  ? 240  GLU A C   1 
ATOM   1823 O O   . GLU A 1 240 ? 149.659 25.613 176.796 1.00 21.48  ? 240  GLU A O   1 
ATOM   1824 C CB  . GLU A 1 240 ? 150.593 22.503 176.128 1.00 28.28  ? 240  GLU A CB  1 
ATOM   1825 C CG  . GLU A 1 240 ? 151.606 22.931 177.189 1.00 26.64  ? 240  GLU A CG  1 
ATOM   1826 C CD  . GLU A 1 240 ? 150.984 22.997 178.580 1.00 28.78  ? 240  GLU A CD  1 
ATOM   1827 O OE1 . GLU A 1 240 ? 149.846 22.469 178.774 1.00 28.74  ? 240  GLU A OE1 1 
ATOM   1828 O OE2 . GLU A 1 240 ? 151.598 23.658 179.443 1.00 26.26  ? 240  GLU A OE2 1 
ATOM   1829 N N   . GLY A 1 241 ? 149.930 25.268 174.573 1.00 23.42  ? 241  GLY A N   1 
ATOM   1830 C CA  . GLY A 1 241 ? 150.063 26.691 174.375 1.00 22.68  ? 241  GLY A CA  1 
ATOM   1831 C C   . GLY A 1 241 ? 148.880 27.593 174.756 1.00 21.92  ? 241  GLY A C   1 
ATOM   1832 O O   . GLY A 1 241 ? 149.021 28.681 175.330 1.00 21.73  ? 241  GLY A O   1 
ATOM   1833 N N   . ARG A 1 242 ? 147.711 27.185 174.358 1.00 23.86  ? 242  ARG A N   1 
ATOM   1834 C CA  . ARG A 1 242 ? 146.522 27.890 174.753 1.00 24.16  ? 242  ARG A CA  1 
ATOM   1835 C C   . ARG A 1 242 ? 146.440 27.922 176.288 1.00 24.64  ? 242  ARG A C   1 
ATOM   1836 O O   . ARG A 1 242 ? 146.218 28.974 176.895 1.00 25.71  ? 242  ARG A O   1 
ATOM   1837 C CB  . ARG A 1 242 ? 145.328 27.119 174.181 1.00 26.76  ? 242  ARG A CB  1 
ATOM   1838 C CG  . ARG A 1 242 ? 143.983 27.778 174.466 1.00 30.99  ? 242  ARG A CG  1 
ATOM   1839 C CD  . ARG A 1 242 ? 142.857 27.226 173.548 1.00 34.83  ? 242  ARG A CD  1 
ATOM   1840 N NE  . ARG A 1 242 ? 142.951 27.860 172.233 1.00 32.50  ? 242  ARG A NE  1 
ATOM   1841 C CZ  . ARG A 1 242 ? 142.521 29.097 171.996 1.00 34.47  ? 242  ARG A CZ  1 
ATOM   1842 N NH1 . ARG A 1 242 ? 141.924 29.832 172.956 1.00 34.03  ? 242  ARG A NH1 1 
ATOM   1843 N NH2 . ARG A 1 242 ? 142.687 29.611 170.797 1.00 33.49  ? 242  ARG A NH2 1 
ATOM   1844 N N   . ARG A 1 243 ? 146.656 26.761 176.909 1.00 26.35  ? 243  ARG A N   1 
ATOM   1845 C CA  . ARG A 1 243 ? 146.569 26.678 178.390 1.00 26.80  ? 243  ARG A CA  1 
ATOM   1846 C C   . ARG A 1 243 ? 147.480 27.681 179.037 1.00 25.15  ? 243  ARG A C   1 
ATOM   1847 O O   . ARG A 1 243 ? 147.046 28.435 179.909 1.00 25.61  ? 243  ARG A O   1 
ATOM   1848 C CB  . ARG A 1 243 ? 146.821 25.258 178.897 1.00 29.03  ? 243  ARG A CB  1 
ATOM   1849 C CG  . ARG A 1 243 ? 146.558 25.106 180.415 1.00 35.40  ? 243  ARG A CG  1 
ATOM   1850 C CD  . ARG A 1 243 ? 147.251 23.886 181.062 1.00 34.93  ? 243  ARG A CD  1 
ATOM   1851 N NE  . ARG A 1 243 ? 148.704 24.080 181.136 1.00 30.77  ? 243  ARG A NE  1 
ATOM   1852 C CZ  . ARG A 1 243 ? 149.349 24.936 181.949 1.00 34.90  ? 243  ARG A CZ  1 
ATOM   1853 N NH1 . ARG A 1 243 ? 148.723 25.700 182.857 1.00 35.68  ? 243  ARG A NH1 1 
ATOM   1854 N NH2 . ARG A 1 243 ? 150.661 25.000 181.889 1.00 33.00  ? 243  ARG A NH2 1 
ATOM   1855 N N   . ARG A 1 244 ? 148.730 27.785 178.555 1.00 24.08  ? 244  ARG A N   1 
ATOM   1856 C CA  . ARG A 1 244 ? 149.660 28.727 179.138 1.00 20.82  ? 244  ARG A CA  1 
ATOM   1857 C C   . ARG A 1 244 ? 149.285 30.153 178.877 1.00 24.64  ? 244  ARG A C   1 
ATOM   1858 O O   . ARG A 1 244 ? 149.650 31.062 179.712 1.00 22.15  ? 244  ARG A O   1 
ATOM   1859 C CB  . ARG A 1 244 ? 151.115 28.458 178.703 1.00 21.75  ? 244  ARG A CB  1 
ATOM   1860 C CG  . ARG A 1 244 ? 151.660 27.076 179.148 1.00 20.38  ? 244  ARG A CG  1 
ATOM   1861 C CD  . ARG A 1 244 ? 153.038 26.814 178.607 1.00 18.92  ? 244  ARG A CD  1 
ATOM   1862 N NE  . ARG A 1 244 ? 153.489 25.432 178.802 1.00 20.02  ? 244  ARG A NE  1 
ATOM   1863 C CZ  . ARG A 1 244 ? 154.734 25.046 178.565 1.00 20.47  ? 244  ARG A CZ  1 
ATOM   1864 N NH1 . ARG A 1 244 ? 155.671 25.886 178.132 1.00 20.04  ? 244  ARG A NH1 1 
ATOM   1865 N NH2 . ARG A 1 244 ? 155.056 23.809 178.761 1.00 23.56  ? 244  ARG A NH2 1 
ATOM   1866 N N   . ALA A 1 245 ? 148.676 30.449 177.712 1.00 24.46  ? 245  ALA A N   1 
ATOM   1867 C CA  . ALA A 1 245 ? 148.349 31.846 177.477 1.00 25.42  ? 245  ALA A CA  1 
ATOM   1868 C C   . ALA A 1 245 ? 147.165 32.289 178.336 1.00 24.03  ? 245  ALA A C   1 
ATOM   1869 O O   . ALA A 1 245 ? 147.113 33.404 178.788 1.00 25.73  ? 245  ALA A O   1 
ATOM   1870 C CB  . ALA A 1 245 ? 148.051 32.119 176.015 1.00 30.75  ? 245  ALA A CB  1 
ATOM   1871 N N   . VAL A 1 246 ? 146.230 31.406 178.540 1.00 26.02  ? 246  VAL A N   1 
ATOM   1872 C CA  . VAL A 1 246 ? 145.139 31.659 179.453 1.00 30.94  ? 246  VAL A CA  1 
ATOM   1873 C C   . VAL A 1 246 ? 145.679 31.800 180.921 1.00 32.64  ? 246  VAL A C   1 
ATOM   1874 O O   . VAL A 1 246 ? 145.346 32.761 181.611 1.00 33.39  ? 246  VAL A O   1 
ATOM   1875 C CB  . VAL A 1 246 ? 144.113 30.540 179.326 1.00 31.59  ? 246  VAL A CB  1 
ATOM   1876 C CG1 . VAL A 1 246 ? 143.006 30.652 180.395 1.00 32.46  ? 246  VAL A CG1 1 
ATOM   1877 C CG2 . VAL A 1 246 ? 143.484 30.520 177.909 1.00 30.20  ? 246  VAL A CG2 1 
ATOM   1878 N N   . GLU A 1 247 ? 146.560 30.897 181.360 1.00 31.72  ? 247  GLU A N   1 
ATOM   1879 C CA  . GLU A 1 247 ? 147.147 31.060 182.696 1.00 28.10  ? 247  GLU A CA  1 
ATOM   1880 C C   . GLU A 1 247 ? 147.890 32.386 182.800 1.00 28.53  ? 247  GLU A C   1 
ATOM   1881 O O   . GLU A 1 247 ? 147.863 33.062 183.859 1.00 25.28  ? 247  GLU A O   1 
ATOM   1882 C CB  . GLU A 1 247 ? 147.999 29.843 183.027 1.00 31.92  ? 247  GLU A CB  1 
ATOM   1883 C CG  . GLU A 1 247 ? 148.491 29.789 184.457 1.00 42.55  ? 247  GLU A CG  1 
ATOM   1884 C CD  . GLU A 1 247 ? 147.353 29.653 185.513 1.00 47.64  ? 247  GLU A CD  1 
ATOM   1885 O OE1 . GLU A 1 247 ? 146.179 29.366 185.143 1.00 40.54  ? 247  GLU A OE1 1 
ATOM   1886 O OE2 . GLU A 1 247 ? 147.655 29.864 186.717 1.00 49.05  ? 247  GLU A OE2 1 
ATOM   1887 N N   . LEU A 1 248 ? 148.542 32.842 181.705 1.00 25.19  ? 248  LEU A N   1 
ATOM   1888 C CA  . LEU A 1 248 ? 149.253 34.100 181.787 1.00 24.10  ? 248  LEU A CA  1 
ATOM   1889 C C   . LEU A 1 248 ? 148.240 35.187 182.026 1.00 28.31  ? 248  LEU A C   1 
ATOM   1890 O O   . LEU A 1 248 ? 148.445 36.089 182.829 1.00 23.47  ? 248  LEU A O   1 
ATOM   1891 C CB  . LEU A 1 248 ? 150.026 34.433 180.519 1.00 27.10  ? 248  LEU A CB  1 
ATOM   1892 C CG  . LEU A 1 248 ? 150.861 35.716 180.568 1.00 28.83  ? 248  LEU A CG  1 
ATOM   1893 C CD1 . LEU A 1 248 ? 152.154 35.490 181.348 1.00 31.44  ? 248  LEU A CD1 1 
ATOM   1894 C CD2 . LEU A 1 248 ? 151.275 36.167 179.186 1.00 29.21  ? 248  LEU A CD2 1 
ATOM   1895 N N   . GLY A 1 249 ? 147.140 35.094 181.311 1.00 28.33  ? 249  GLY A N   1 
ATOM   1896 C CA  . GLY A 1 249 ? 146.059 36.027 181.524 1.00 32.94  ? 249  GLY A CA  1 
ATOM   1897 C C   . GLY A 1 249 ? 145.517 36.014 182.952 1.00 30.08  ? 249  GLY A C   1 
ATOM   1898 O O   . GLY A 1 249 ? 145.230 37.082 183.485 1.00 27.09  ? 249  GLY A O   1 
ATOM   1899 N N   . ARG A 1 250 ? 145.332 34.825 183.510 1.00 28.94  ? 250  ARG A N   1 
ATOM   1900 C CA  . ARG A 1 250 ? 144.890 34.679 184.905 1.00 31.59  ? 250  ARG A CA  1 
ATOM   1901 C C   . ARG A 1 250 ? 145.814 35.416 185.835 1.00 34.53  ? 250  ARG A C   1 
ATOM   1902 O O   . ARG A 1 250 ? 145.342 36.129 186.697 1.00 33.42  ? 250  ARG A O   1 
ATOM   1903 C CB  . ARG A 1 250 ? 144.816 33.234 185.299 1.00 37.89  ? 250  ARG A CB  1 
ATOM   1904 C CG  . ARG A 1 250 ? 143.693 32.859 186.291 1.00 40.65  ? 250  ARG A CG  1 
ATOM   1905 C CD  . ARG A 1 250 ? 143.664 31.348 186.424 1.00 38.40  ? 250  ARG A CD  1 
ATOM   1906 N NE  . ARG A 1 250 ? 142.594 30.749 185.599 1.00 40.81  ? 250  ARG A NE  1 
ATOM   1907 C CZ  . ARG A 1 250 ? 142.736 29.908 184.548 1.00 51.69  ? 250  ARG A CZ  1 
ATOM   1908 N NH1 . ARG A 1 250 ? 143.955 29.513 184.055 1.00 48.95  ? 250  ARG A NH1 1 
ATOM   1909 N NH2 . ARG A 1 250 ? 141.616 29.438 183.946 1.00 46.75  ? 250  ARG A NH2 1 
ATOM   1910 N N   . ASN A 1 251 ? 147.134 35.329 185.588 1.00 30.56  ? 251  ASN A N   1 
ATOM   1911 C CA  . ASN A 1 251 ? 148.100 35.951 186.434 1.00 29.16  ? 251  ASN A CA  1 
ATOM   1912 C C   . ASN A 1 251 ? 147.984 37.417 186.360 1.00 30.21  ? 251  ASN A C   1 
ATOM   1913 O O   . ASN A 1 251 ? 148.485 38.101 187.252 1.00 29.68  ? 251  ASN A O   1 
ATOM   1914 C CB  . ASN A 1 251 ? 149.549 35.527 186.068 1.00 29.24  ? 251  ASN A CB  1 
ATOM   1915 C CG  . ASN A 1 251 ? 149.960 34.251 186.768 1.00 29.60  ? 251  ASN A CG  1 
ATOM   1916 O OD1 . ASN A 1 251 ? 150.695 34.315 187.736 1.00 31.79  ? 251  ASN A OD1 1 
ATOM   1917 N ND2 . ASN A 1 251 ? 149.483 33.110 186.311 1.00 25.92  ? 251  ASN A ND2 1 
ATOM   1918 N N   . LEU A 1 252 ? 147.406 37.957 185.275 1.00 32.39  ? 252  LEU A N   1 
ATOM   1919 C CA  . LEU A 1 252 ? 147.330 39.427 185.184 1.00 33.15  ? 252  LEU A CA  1 
ATOM   1920 C C   . LEU A 1 252 ? 145.899 39.941 185.276 1.00 34.16  ? 252  LEU A C   1 
ATOM   1921 O O   . LEU A 1 252 ? 145.628 41.035 184.814 1.00 34.33  ? 252  LEU A O   1 
ATOM   1922 C CB  . LEU A 1 252 ? 148.007 39.945 183.918 1.00 32.13  ? 252  LEU A CB  1 
ATOM   1923 C CG  . LEU A 1 252 ? 149.458 39.506 183.804 1.00 33.48  ? 252  LEU A CG  1 
ATOM   1924 C CD1 . LEU A 1 252 ? 149.948 39.517 182.365 1.00 32.95  ? 252  LEU A CD1 1 
ATOM   1925 C CD2 . LEU A 1 252 ? 150.289 40.447 184.628 1.00 32.77  ? 252  LEU A CD2 1 
ATOM   1926 N N   . ASN A 1 253 ? 145.013 39.123 185.837 1.00 34.06  ? 253  ASN A N   1 
ATOM   1927 C CA  . ASN A 1 253 ? 143.620 39.485 186.050 1.00 42.13  ? 253  ASN A CA  1 
ATOM   1928 C C   . ASN A 1 253 ? 142.999 39.926 184.743 1.00 42.36  ? 253  ASN A C   1 
ATOM   1929 O O   . ASN A 1 253 ? 142.451 41.012 184.684 1.00 35.90  ? 253  ASN A O   1 
ATOM   1930 C CB  . ASN A 1 253 ? 143.504 40.649 187.044 1.00 47.77  ? 253  ASN A CB  1 
ATOM   1931 C CG  . ASN A 1 253 ? 144.435 40.495 188.248 1.00 60.79  ? 253  ASN A CG  1 
ATOM   1932 O OD1 . ASN A 1 253 ? 145.274 41.385 188.513 1.00 58.51  ? 253  ASN A OD1 1 
ATOM   1933 N ND2 . ASN A 1 253 ? 144.316 39.355 188.970 1.00 57.17  ? 253  ASN A ND2 1 
ATOM   1934 N N   . CYS A 1 254 ? 143.139 39.116 183.701 1.00 36.89  ? 254  CYS A N   1 
ATOM   1935 C CA  . CYS A 1 254 ? 142.593 39.456 182.396 1.00 34.19  ? 254  CYS A CA  1 
ATOM   1936 C C   . CYS A 1 254 ? 141.216 38.862 182.319 1.00 35.03  ? 254  CYS A C   1 
ATOM   1937 O O   . CYS A 1 254 ? 140.894 37.872 182.986 1.00 31.04  ? 254  CYS A O   1 
ATOM   1938 C CB  . CYS A 1 254 ? 143.478 38.885 181.244 1.00 34.45  ? 254  CYS A CB  1 
ATOM   1939 S SG  . CYS A 1 254 ? 145.002 39.857 180.981 1.00 37.53  ? 254  CYS A SG  1 
ATOM   1940 N N   . ASN A 1 255 ? 140.406 39.419 181.421 1.00 38.48  ? 255  ASN A N   1 
ATOM   1941 C CA  . ASN A 1 255 ? 139.204 38.734 180.999 1.00 37.14  ? 255  ASN A CA  1 
ATOM   1942 C C   . ASN A 1 255 ? 139.630 37.596 180.110 1.00 33.81  ? 255  ASN A C   1 
ATOM   1943 O O   . ASN A 1 255 ? 140.397 37.814 179.157 1.00 38.81  ? 255  ASN A O   1 
ATOM   1944 C CB  . ASN A 1 255 ? 138.298 39.688 180.240 1.00 45.35  ? 255  ASN A CB  1 
ATOM   1945 C CG  . ASN A 1 255 ? 136.924 39.096 179.972 1.00 44.56  ? 255  ASN A CG  1 
ATOM   1946 O OD1 . ASN A 1 255 ? 136.774 37.968 179.523 1.00 44.08  ? 255  ASN A OD1 1 
ATOM   1947 N ND2 . ASN A 1 255 ? 135.925 39.857 180.298 1.00 54.38  ? 255  ASN A ND2 1 
ATOM   1948 N N   . LEU A 1 256 ? 139.142 36.403 180.440 1.00 31.75  ? 256  LEU A N   1 
ATOM   1949 C CA  . LEU A 1 256 ? 139.484 35.117 179.812 1.00 31.86  ? 256  LEU A CA  1 
ATOM   1950 C C   . LEU A 1 256 ? 138.399 34.483 178.969 1.00 35.80  ? 256  LEU A C   1 
ATOM   1951 O O   . LEU A 1 256 ? 138.542 33.319 178.543 1.00 29.21  ? 256  LEU A O   1 
ATOM   1952 C CB  . LEU A 1 256 ? 139.835 34.090 180.891 1.00 32.64  ? 256  LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 256 ? 140.863 34.574 181.912 1.00 33.85  ? 256  LEU A CG  1 
ATOM   1954 C CD1 . LEU A 1 256 ? 141.211 33.417 182.836 1.00 36.48  ? 256  LEU A CD1 1 
ATOM   1955 C CD2 . LEU A 1 256 ? 142.091 35.163 181.201 1.00 33.91  ? 256  LEU A CD2 1 
ATOM   1956 N N   . ASN A 1 257 ? 137.311 35.225 178.727 1.00 41.45  ? 257  ASN A N   1 
ATOM   1957 C CA  . ASN A 1 257 ? 136.151 34.650 178.003 1.00 44.77  ? 257  ASN A CA  1 
ATOM   1958 C C   . ASN A 1 257 ? 136.313 34.408 176.512 1.00 40.30  ? 257  ASN A C   1 
ATOM   1959 O O   . ASN A 1 257 ? 135.608 33.591 175.947 1.00 41.19  ? 257  ASN A O   1 
ATOM   1960 C CB  . ASN A 1 257 ? 134.928 35.519 178.238 1.00 51.81  ? 257  ASN A CB  1 
ATOM   1961 C CG  . ASN A 1 257 ? 134.432 35.385 179.661 1.00 55.28  ? 257  ASN A CG  1 
ATOM   1962 O OD1 . ASN A 1 257 ? 134.682 34.354 180.311 1.00 52.04  ? 257  ASN A OD1 1 
ATOM   1963 N ND2 . ASN A 1 257 ? 133.793 36.433 180.174 1.00 57.04  ? 257  ASN A ND2 1 
ATOM   1964 N N   . SER A 1 258 ? 137.241 35.123 175.891 1.00 38.01  ? 258  SER A N   1 
ATOM   1965 C CA  . SER A 1 258 ? 137.545 34.921 174.487 1.00 37.82  ? 258  SER A CA  1 
ATOM   1966 C C   . SER A 1 258 ? 138.990 35.284 174.187 1.00 35.12  ? 258  SER A C   1 
ATOM   1967 O O   . SER A 1 258 ? 139.663 36.015 174.956 1.00 35.65  ? 258  SER A O   1 
ATOM   1968 C CB  . SER A 1 258 ? 136.633 35.818 173.628 1.00 35.84  ? 258  SER A CB  1 
ATOM   1969 O OG  . SER A 1 258 ? 136.973 37.212 173.809 1.00 38.04  ? 258  SER A OG  1 
ATOM   1970 N N   . ASP A 1 259 ? 139.438 34.836 173.026 1.00 35.23  ? 259  ASP A N   1 
ATOM   1971 C CA  . ASP A 1 259 ? 140.776 35.210 172.514 1.00 35.65  ? 259  ASP A CA  1 
ATOM   1972 C C   . ASP A 1 259 ? 140.875 36.715 172.432 1.00 37.08  ? 259  ASP A C   1 
ATOM   1973 O O   . ASP A 1 259 ? 141.863 37.293 172.870 1.00 37.13  ? 259  ASP A O   1 
ATOM   1974 C CB  . ASP A 1 259 ? 141.049 34.517 171.150 1.00 31.38  ? 259  ASP A CB  1 
ATOM   1975 C CG  . ASP A 1 259 ? 141.220 33.018 171.292 1.00 37.10  ? 259  ASP A CG  1 
ATOM   1976 O OD1 . ASP A 1 259 ? 141.255 32.551 172.454 1.00 40.62  ? 259  ASP A OD1 1 
ATOM   1977 O OD2 . ASP A 1 259 ? 141.358 32.255 170.287 1.00 41.22  ? 259  ASP A OD2 1 
ATOM   1978 N N   . GLU A 1 260 ? 139.836 37.361 171.894 1.00 37.05  ? 260  GLU A N   1 
ATOM   1979 C CA  . GLU A 1 260 ? 139.882 38.819 171.680 1.00 37.12  ? 260  GLU A CA  1 
ATOM   1980 C C   . GLU A 1 260 ? 139.905 39.588 172.992 1.00 33.98  ? 260  GLU A C   1 
ATOM   1981 O O   . GLU A 1 260 ? 140.625 40.588 173.130 1.00 41.21  ? 260  GLU A O   1 
ATOM   1982 C CB  . GLU A 1 260 ? 138.710 39.338 170.823 1.00 39.64  ? 260  GLU A CB  1 
ATOM   1983 C CG  . GLU A 1 260 ? 138.388 38.473 169.593 1.00 48.22  ? 260  GLU A CG  1 
ATOM   1984 N N   . GLU A 1 261 ? 139.128 39.150 173.967 1.00 36.74  ? 261  GLU A N   1 
ATOM   1985 C CA  . GLU A 1 261 ? 139.243 39.765 175.317 1.00 39.28  ? 261  GLU A CA  1 
ATOM   1986 C C   . GLU A 1 261 ? 140.660 39.532 175.924 1.00 30.93  ? 261  GLU A C   1 
ATOM   1987 O O   . GLU A 1 261 ? 141.280 40.431 176.433 1.00 31.24  ? 261  GLU A O   1 
ATOM   1988 C CB  . GLU A 1 261 ? 138.176 39.197 176.274 1.00 42.18  ? 261  GLU A CB  1 
ATOM   1989 C CG  . GLU A 1 261 ? 136.717 39.245 175.776 1.00 57.80  ? 261  GLU A CG  1 
ATOM   1990 C CD  . GLU A 1 261 ? 135.899 40.367 176.381 1.00 66.27  ? 261  GLU A CD  1 
ATOM   1991 O OE1 . GLU A 1 261 ? 136.502 41.378 176.842 1.00 68.74  ? 261  GLU A OE1 1 
ATOM   1992 O OE2 . GLU A 1 261 ? 134.648 40.216 176.393 1.00 77.92  ? 261  GLU A OE2 1 
ATOM   1993 N N   . LEU A 1 262 ? 141.186 38.318 175.824 1.00 30.15  ? 262  LEU A N   1 
ATOM   1994 C CA  . LEU A 1 262 ? 142.516 38.023 176.454 1.00 29.89  ? 262  LEU A CA  1 
ATOM   1995 C C   . LEU A 1 262 ? 143.635 38.795 175.797 1.00 28.43  ? 262  LEU A C   1 
ATOM   1996 O O   . LEU A 1 262 ? 144.381 39.553 176.422 1.00 28.04  ? 262  LEU A O   1 
ATOM   1997 C CB  . LEU A 1 262 ? 142.761 36.536 176.418 1.00 27.02  ? 262  LEU A CB  1 
ATOM   1998 C CG  . LEU A 1 262 ? 144.116 36.081 176.946 1.00 27.34  ? 262  LEU A CG  1 
ATOM   1999 C CD1 . LEU A 1 262 ? 144.332 36.511 178.352 1.00 26.09  ? 262  LEU A CD1 1 
ATOM   2000 C CD2 . LEU A 1 262 ? 144.110 34.581 176.889 1.00 26.63  ? 262  LEU A CD2 1 
ATOM   2001 N N   . ILE A 1 263 ? 143.663 38.736 174.480 1.00 33.08  ? 263  ILE A N   1 
ATOM   2002 C CA  . ILE A 1 263 ? 144.703 39.437 173.774 1.00 30.47  ? 263  ILE A CA  1 
ATOM   2003 C C   . ILE A 1 263 ? 144.613 40.902 173.994 1.00 31.93  ? 263  ILE A C   1 
ATOM   2004 O O   . ILE A 1 263 ? 145.661 41.557 174.217 1.00 35.03  ? 263  ILE A O   1 
ATOM   2005 C CB  . ILE A 1 263 ? 144.710 39.095 172.274 1.00 35.96  ? 263  ILE A CB  1 
ATOM   2006 C CG1 . ILE A 1 263 ? 145.088 37.629 172.071 1.00 35.25  ? 263  ILE A CG1 1 
ATOM   2007 C CG2 . ILE A 1 263 ? 145.693 40.012 171.581 1.00 35.44  ? 263  ILE A CG2 1 
ATOM   2008 C CD1 . ILE A 1 263 ? 144.548 37.005 170.808 1.00 36.57  ? 263  ILE A CD1 1 
ATOM   2009 N N   . HIS A 1 264 ? 143.393 41.467 173.975 1.00 32.21  ? 264  HIS A N   1 
ATOM   2010 C CA  . HIS A 1 264 ? 143.292 42.894 174.184 1.00 35.90  ? 264  HIS A CA  1 
ATOM   2011 C C   . HIS A 1 264 ? 143.876 43.224 175.563 1.00 35.08  ? 264  HIS A C   1 
ATOM   2012 O O   . HIS A 1 264 ? 144.653 44.212 175.754 1.00 34.50  ? 264  HIS A O   1 
ATOM   2013 C CB  . HIS A 1 264 ? 141.819 43.377 174.067 1.00 46.63  ? 264  HIS A CB  1 
ATOM   2014 C CG  . HIS A 1 264 ? 141.605 44.791 174.551 1.00 59.12  ? 264  HIS A CG  1 
ATOM   2015 N ND1 . HIS A 1 264 ? 141.155 45.097 175.828 1.00 70.38  ? 264  HIS A ND1 1 
ATOM   2016 C CD2 . HIS A 1 264 ? 141.798 45.985 173.932 1.00 65.24  ? 264  HIS A CD2 1 
ATOM   2017 C CE1 . HIS A 1 264 ? 141.086 46.413 175.971 1.00 66.73  ? 264  HIS A CE1 1 
ATOM   2018 N NE2 . HIS A 1 264 ? 141.482 46.974 174.839 1.00 61.89  ? 264  HIS A NE2 1 
ATOM   2019 N N   . CYS A 1 265 ? 143.480 42.426 176.559 1.00 33.61  ? 265  CYS A N   1 
ATOM   2020 C CA  . CYS A 1 265 ? 143.982 42.652 177.912 1.00 34.79  ? 265  CYS A CA  1 
ATOM   2021 C C   . CYS A 1 265 ? 145.514 42.566 177.910 1.00 32.09  ? 265  CYS A C   1 
ATOM   2022 O O   . CYS A 1 265 ? 146.174 43.465 178.414 1.00 30.66  ? 265  CYS A O   1 
ATOM   2023 C CB  . CYS A 1 265 ? 143.346 41.671 178.950 1.00 43.01  ? 265  CYS A CB  1 
ATOM   2024 S SG  . CYS A 1 265 ? 144.206 41.774 180.573 1.00 61.42  ? 265  CYS A SG  1 
ATOM   2025 N N   . LEU A 1 266 ? 146.077 41.507 177.300 1.00 33.10  ? 266  LEU A N   1 
ATOM   2026 C CA  . LEU A 1 266 ? 147.543 41.339 177.289 1.00 30.57  ? 266  LEU A CA  1 
ATOM   2027 C C   . LEU A 1 266 ? 148.250 42.460 176.560 1.00 32.41  ? 266  LEU A C   1 
ATOM   2028 O O   . LEU A 1 266 ? 149.329 42.880 176.932 1.00 31.22  ? 266  LEU A O   1 
ATOM   2029 C CB  . LEU A 1 266 ? 147.931 39.982 176.744 1.00 28.89  ? 266  LEU A CB  1 
ATOM   2030 C CG  . LEU A 1 266 ? 147.545 38.803 177.605 1.00 30.38  ? 266  LEU A CG  1 
ATOM   2031 C CD1 . LEU A 1 266 ? 147.708 37.478 176.902 1.00 29.58  ? 266  LEU A CD1 1 
ATOM   2032 C CD2 . LEU A 1 266 ? 148.250 38.787 178.967 1.00 31.97  ? 266  LEU A CD2 1 
ATOM   2033 N N   . ARG A 1 267 ? 147.638 43.009 175.522 1.00 35.81  ? 267  ARG A N   1 
ATOM   2034 C CA  . ARG A 1 267 ? 148.278 44.125 174.823 1.00 33.62  ? 267  ARG A CA  1 
ATOM   2035 C C   . ARG A 1 267 ? 148.286 45.434 175.574 1.00 33.81  ? 267  ARG A C   1 
ATOM   2036 O O   . ARG A 1 267 ? 149.061 46.282 175.247 1.00 32.02  ? 267  ARG A O   1 
ATOM   2037 C CB  . ARG A 1 267 ? 147.593 44.348 173.474 1.00 36.78  ? 267  ARG A CB  1 
ATOM   2038 C CG  . ARG A 1 267 ? 147.951 43.306 172.444 1.00 38.56  ? 267  ARG A CG  1 
ATOM   2039 C CD  . ARG A 1 267 ? 147.362 43.700 171.096 1.00 38.28  ? 267  ARG A CD  1 
ATOM   2040 N NE  . ARG A 1 267 ? 147.730 42.693 170.124 1.00 36.40  ? 267  ARG A NE  1 
ATOM   2041 C CZ  . ARG A 1 267 ? 146.981 42.278 169.111 1.00 39.53  ? 267  ARG A CZ  1 
ATOM   2042 N NH1 . ARG A 1 267 ? 145.752 42.783 168.910 1.00 35.29  ? 267  ARG A NH1 1 
ATOM   2043 N NH2 . ARG A 1 267 ? 147.473 41.329 168.302 1.00 39.44  ? 267  ARG A NH2 1 
ATOM   2044 N N   . GLU A 1 268 ? 147.419 45.620 176.559 1.00 38.42  ? 268  GLU A N   1 
ATOM   2045 C CA  . GLU A 1 268 ? 147.414 46.867 177.363 1.00 38.84  ? 268  GLU A CA  1 
ATOM   2046 C C   . GLU A 1 268 ? 148.597 46.828 178.369 1.00 37.72  ? 268  GLU A C   1 
ATOM   2047 O O   . GLU A 1 268 ? 149.055 47.866 178.842 1.00 34.14  ? 268  GLU A O   1 
ATOM   2048 C CB  . GLU A 1 268 ? 146.074 47.026 178.179 1.00 41.30  ? 268  GLU A CB  1 
ATOM   2049 C CG  . GLU A 1 268 ? 144.761 47.304 177.429 1.00 39.11  ? 268  GLU A CG  1 
ATOM   2050 N N   . LYS A 1 269 ? 149.106 45.642 178.707 1.00 30.37  ? 269  LYS A N   1 
ATOM   2051 C CA  . LYS A 1 269 ? 150.098 45.563 179.812 1.00 28.95  ? 269  LYS A CA  1 
ATOM   2052 C C   . LYS A 1 269 ? 151.453 46.082 179.409 1.00 29.87  ? 269  LYS A C   1 
ATOM   2053 O O   . LYS A 1 269 ? 151.816 45.954 178.254 1.00 36.24  ? 269  LYS A O   1 
ATOM   2054 C CB  . LYS A 1 269 ? 150.244 44.118 180.243 1.00 29.82  ? 269  LYS A CB  1 
ATOM   2055 C CG  . LYS A 1 269 ? 148.954 43.479 180.600 1.00 34.22  ? 269  LYS A CG  1 
ATOM   2056 C CD  . LYS A 1 269 ? 148.411 44.125 181.884 1.00 34.00  ? 269  LYS A CD  1 
ATOM   2057 C CE  . LYS A 1 269 ? 147.070 43.530 182.238 1.00 32.85  ? 269  LYS A CE  1 
ATOM   2058 N NZ  . LYS A 1 269 ? 146.559 44.262 183.421 1.00 37.65  ? 269  LYS A NZ  1 
ATOM   2059 N N   . LYS A 1 270 ? 152.214 46.682 180.314 1.00 30.61  ? 270  LYS A N   1 
ATOM   2060 C CA  . LYS A 1 270 ? 153.616 46.992 179.996 1.00 33.58  ? 270  LYS A CA  1 
ATOM   2061 C C   . LYS A 1 270 ? 154.460 45.704 179.834 1.00 32.09  ? 270  LYS A C   1 
ATOM   2062 O O   . LYS A 1 270 ? 154.147 44.647 180.412 1.00 28.09  ? 270  LYS A O   1 
ATOM   2063 C CB  . LYS A 1 270 ? 154.257 47.886 181.032 1.00 38.57  ? 270  LYS A CB  1 
ATOM   2064 C CG  . LYS A 1 270 ? 153.659 49.294 181.040 1.00 46.36  ? 270  LYS A CG  1 
ATOM   2065 C CD  . LYS A 1 270 ? 154.242 50.122 182.171 1.00 56.53  ? 270  LYS A CD  1 
ATOM   2066 C CE  . LYS A 1 270 ? 153.537 49.843 183.498 1.00 61.70  ? 270  LYS A CE  1 
ATOM   2067 N NZ  . LYS A 1 270 ? 154.321 50.373 184.655 1.00 67.95  ? 270  LYS A NZ  1 
ATOM   2068 N N   . PRO A 1 271 ? 155.513 45.781 179.009 1.00 29.35  ? 271  PRO A N   1 
ATOM   2069 C CA  . PRO A 1 271 ? 156.244 44.547 178.764 1.00 29.45  ? 271  PRO A CA  1 
ATOM   2070 C C   . PRO A 1 271 ? 156.700 43.881 180.111 1.00 29.46  ? 271  PRO A C   1 
ATOM   2071 O O   . PRO A 1 271 ? 156.436 42.696 180.332 1.00 25.44  ? 271  PRO A O   1 
ATOM   2072 C CB  . PRO A 1 271 ? 157.412 44.979 177.929 1.00 30.24  ? 271  PRO A CB  1 
ATOM   2073 C CG  . PRO A 1 271 ? 157.080 46.346 177.400 1.00 35.14  ? 271  PRO A CG  1 
ATOM   2074 C CD  . PRO A 1 271 ? 156.034 46.946 178.286 1.00 29.40  ? 271  PRO A CD  1 
ATOM   2075 N N   . GLN A 1 272 ? 157.260 44.662 181.022 1.00 27.69  ? 272  GLN A N   1 
ATOM   2076 C CA  . GLN A 1 272 ? 157.746 44.066 182.281 1.00 30.49  ? 272  GLN A CA  1 
ATOM   2077 C C   . GLN A 1 272 ? 156.656 43.334 183.086 1.00 27.71  ? 272  GLN A C   1 
ATOM   2078 O O   . GLN A 1 272 ? 156.967 42.444 183.841 1.00 26.24  ? 272  GLN A O   1 
ATOM   2079 C CB  . GLN A 1 272 ? 158.479 45.085 183.146 1.00 31.91  ? 272  GLN A CB  1 
ATOM   2080 C CG  . GLN A 1 272 ? 159.270 44.454 184.314 1.00 34.05  ? 272  GLN A CG  1 
ATOM   2081 C CD  . GLN A 1 272 ? 160.329 43.455 183.798 1.00 35.39  ? 272  GLN A CD  1 
ATOM   2082 O OE1 . GLN A 1 272 ? 161.004 43.702 182.788 1.00 30.75  ? 272  GLN A OE1 1 
ATOM   2083 N NE2 . GLN A 1 272 ? 160.483 42.339 184.508 1.00 35.09  ? 272  GLN A NE2 1 
ATOM   2084 N N   . GLU A 1 273 ? 155.376 43.630 182.878 1.00 26.90  ? 273  GLU A N   1 
ATOM   2085 C CA  . GLU A 1 273 ? 154.332 42.947 183.636 1.00 27.25  ? 273  GLU A CA  1 
ATOM   2086 C C   . GLU A 1 273 ? 154.174 41.553 183.196 1.00 28.72  ? 273  GLU A C   1 
ATOM   2087 O O   . GLU A 1 273 ? 153.888 40.662 184.005 1.00 27.90  ? 273  GLU A O   1 
ATOM   2088 C CB  . GLU A 1 273 ? 152.976 43.659 183.500 1.00 27.95  ? 273  GLU A CB  1 
ATOM   2089 C CG  . GLU A 1 273 ? 153.016 45.089 183.985 1.00 30.22  ? 273  GLU A CG  1 
ATOM   2090 C CD  . GLU A 1 273 ? 151.652 45.799 183.846 1.00 37.21  ? 273  GLU A CD  1 
ATOM   2091 O OE1 . GLU A 1 273 ? 150.701 45.488 184.595 1.00 43.24  ? 273  GLU A OE1 1 
ATOM   2092 O OE2 . GLU A 1 273 ? 151.508 46.658 182.964 1.00 38.27  ? 273  GLU A OE2 1 
ATOM   2093 N N   . LEU A 1 274 ? 154.342 41.327 181.893 1.00 29.38  ? 274  LEU A N   1 
ATOM   2094 C CA  . LEU A 1 274 ? 154.269 39.972 181.359 1.00 27.53  ? 274  LEU A CA  1 
ATOM   2095 C C   . LEU A 1 274 ? 155.488 39.210 181.831 1.00 23.21  ? 274  LEU A C   1 
ATOM   2096 O O   . LEU A 1 274 ? 155.375 38.075 182.215 1.00 23.51  ? 274  LEU A O   1 
ATOM   2097 C CB  . LEU A 1 274 ? 154.210 39.909 179.812 1.00 31.66  ? 274  LEU A CB  1 
ATOM   2098 C CG  . LEU A 1 274 ? 153.020 40.473 179.032 1.00 32.64  ? 274  LEU A CG  1 
ATOM   2099 C CD1 . LEU A 1 274 ? 153.201 40.451 177.562 1.00 33.51  ? 274  LEU A CD1 1 
ATOM   2100 C CD2 . LEU A 1 274 ? 151.801 39.614 179.309 1.00 38.44  ? 274  LEU A CD2 1 
ATOM   2101 N N   . ILE A 1 275 ? 156.646 39.802 181.727 1.00 24.56  ? 275  ILE A N   1 
ATOM   2102 C CA  . ILE A 1 275 ? 157.886 39.124 182.104 1.00 24.99  ? 275  ILE A CA  1 
ATOM   2103 C C   . ILE A 1 275 ? 157.854 38.687 183.639 1.00 27.22  ? 275  ILE A C   1 
ATOM   2104 O O   . ILE A 1 275 ? 158.220 37.588 183.986 1.00 24.18  ? 275  ILE A O   1 
ATOM   2105 C CB  . ILE A 1 275 ? 159.041 40.037 181.795 1.00 27.59  ? 275  ILE A CB  1 
ATOM   2106 C CG1 . ILE A 1 275 ? 159.255 40.142 180.258 1.00 29.39  ? 275  ILE A CG1 1 
ATOM   2107 C CG2 . ILE A 1 275 ? 160.370 39.594 182.448 1.00 28.13  ? 275  ILE A CG2 1 
ATOM   2108 C CD1 . ILE A 1 275 ? 160.006 41.400 179.887 1.00 28.58  ? 275  ILE A CD1 1 
ATOM   2109 N N   . ASP A 1 276 ? 157.273 39.519 184.489 1.00 22.37  ? 276  ASP A N   1 
ATOM   2110 C CA  . ASP A 1 276 ? 157.239 39.278 185.931 1.00 25.64  ? 276  ASP A CA  1 
ATOM   2111 C C   . ASP A 1 276 ? 156.549 38.012 186.293 1.00 24.51  ? 276  ASP A C   1 
ATOM   2112 O O   . ASP A 1 276 ? 156.956 37.404 187.267 1.00 26.97  ? 276  ASP A O   1 
ATOM   2113 C CB  . ASP A 1 276 ? 156.579 40.492 186.675 1.00 26.79  ? 276  ASP A CB  1 
ATOM   2114 C CG  . ASP A 1 276 ? 157.529 41.640 186.867 1.00 27.47  ? 276  ASP A CG  1 
ATOM   2115 O OD1 . ASP A 1 276 ? 158.756 41.550 186.675 1.00 36.25  ? 276  ASP A OD1 1 
ATOM   2116 O OD2 . ASP A 1 276 ? 157.049 42.691 187.161 1.00 35.23  ? 276  ASP A OD2 1 
ATOM   2117 N N   . VAL A 1 277 ? 155.529 37.603 185.529 1.00 22.58  ? 277  VAL A N   1 
ATOM   2118 C CA  . VAL A 1 277 ? 154.775 36.379 185.791 1.00 21.71  ? 277  VAL A CA  1 
ATOM   2119 C C   . VAL A 1 277 ? 154.921 35.221 184.830 1.00 24.10  ? 277  VAL A C   1 
ATOM   2120 O O   . VAL A 1 277 ? 154.239 34.161 184.947 1.00 23.91  ? 277  VAL A O   1 
ATOM   2121 C CB  . VAL A 1 277 ? 153.282 36.716 185.868 1.00 25.50  ? 277  VAL A CB  1 
ATOM   2122 C CG1 . VAL A 1 277 ? 153.071 37.772 186.959 1.00 24.34  ? 277  VAL A CG1 1 
ATOM   2123 C CG2 . VAL A 1 277 ? 152.735 37.282 184.530 1.00 28.88  ? 277  VAL A CG2 1 
ATOM   2124 N N   . GLU A 1 278 ? 155.777 35.418 183.842 1.00 23.73  ? 278  GLU A N   1 
ATOM   2125 C CA  . GLU A 1 278 ? 155.968 34.453 182.747 1.00 24.45  ? 278  GLU A CA  1 
ATOM   2126 C C   . GLU A 1 278 ? 156.288 33.044 183.282 1.00 22.44  ? 278  GLU A C   1 
ATOM   2127 O O   . GLU A 1 278 ? 155.817 32.005 182.816 1.00 21.71  ? 278  GLU A O   1 
ATOM   2128 C CB  . GLU A 1 278 ? 157.133 35.026 181.874 1.00 27.16  ? 278  GLU A CB  1 
ATOM   2129 C CG  . GLU A 1 278 ? 157.975 34.017 181.152 1.00 28.96  ? 278  GLU A CG  1 
ATOM   2130 C CD  . GLU A 1 278 ? 158.992 34.590 180.162 1.00 33.63  ? 278  GLU A CD  1 
ATOM   2131 O OE1 . GLU A 1 278 ? 159.108 35.835 179.973 1.00 31.60  ? 278  GLU A OE1 1 
ATOM   2132 O OE2 . GLU A 1 278 ? 159.717 33.730 179.621 1.00 34.20  ? 278  GLU A OE2 1 
ATOM   2133 N N   . TRP A 1 279 ? 157.126 32.965 184.288 1.00 23.73  ? 279  TRP A N   1 
ATOM   2134 C CA  . TRP A 1 279 ? 157.496 31.655 184.784 1.00 24.96  ? 279  TRP A CA  1 
ATOM   2135 C C   . TRP A 1 279 ? 156.401 31.031 185.586 1.00 25.37  ? 279  TRP A C   1 
ATOM   2136 O O   . TRP A 1 279 ? 156.485 29.874 185.872 1.00 27.87  ? 279  TRP A O   1 
ATOM   2137 C CB  . TRP A 1 279 ? 158.762 31.741 185.636 1.00 27.42  ? 279  TRP A CB  1 
ATOM   2138 C CG  . TRP A 1 279 ? 159.848 32.292 184.887 1.00 28.90  ? 279  TRP A CG  1 
ATOM   2139 C CD1 . TRP A 1 279 ? 160.213 33.591 184.829 1.00 29.49  ? 279  TRP A CD1 1 
ATOM   2140 C CD2 . TRP A 1 279 ? 160.767 31.562 184.060 1.00 26.76  ? 279  TRP A CD2 1 
ATOM   2141 N NE1 . TRP A 1 279 ? 161.319 33.726 184.026 1.00 30.41  ? 279  TRP A NE1 1 
ATOM   2142 C CE2 . TRP A 1 279 ? 161.670 32.496 183.526 1.00 30.46  ? 279  TRP A CE2 1 
ATOM   2143 C CE3 . TRP A 1 279 ? 160.920 30.229 183.753 1.00 26.21  ? 279  TRP A CE3 1 
ATOM   2144 C CZ2 . TRP A 1 279 ? 162.699 32.136 182.646 1.00 28.38  ? 279  TRP A CZ2 1 
ATOM   2145 C CZ3 . TRP A 1 279 ? 161.970 29.836 182.874 1.00 28.26  ? 279  TRP A CZ3 1 
ATOM   2146 C CH2 . TRP A 1 279 ? 162.856 30.803 182.350 1.00 27.93  ? 279  TRP A CH2 1 
ATOM   2147 N N   . ASN A 1 280 ? 155.304 31.735 185.851 1.00 25.78  ? 280  ASN A N   1 
ATOM   2148 C CA  . ASN A 1 280 ? 154.237 31.105 186.606 1.00 25.59  ? 280  ASN A CA  1 
ATOM   2149 C C   . ASN A 1 280 ? 153.361 30.167 185.875 1.00 25.69  ? 280  ASN A C   1 
ATOM   2150 O O   . ASN A 1 280 ? 152.472 29.578 186.480 1.00 25.10  ? 280  ASN A O   1 
ATOM   2151 C CB  . ASN A 1 280 ? 153.367 32.176 187.299 1.00 24.95  ? 280  ASN A CB  1 
ATOM   2152 C CG  . ASN A 1 280 ? 154.172 33.094 188.197 1.00 26.14  ? 280  ASN A CG  1 
ATOM   2153 O OD1 . ASN A 1 280 ? 155.312 32.793 188.630 1.00 25.39  ? 280  ASN A OD1 1 
ATOM   2154 N ND2 . ASN A 1 280 ? 153.561 34.210 188.543 1.00 28.20  ? 280  ASN A ND2 1 
ATOM   2155 N N   . VAL A 1 281 ? 153.513 30.041 184.569 1.00 27.30  ? 281  VAL A N   1 
ATOM   2156 C CA  . VAL A 1 281 ? 152.523 29.277 183.762 1.00 24.74  ? 281  VAL A CA  1 
ATOM   2157 C C   . VAL A 1 281 ? 152.941 27.860 183.428 1.00 24.08  ? 281  VAL A C   1 
ATOM   2158 O O   . VAL A 1 281 ? 152.173 27.073 182.844 1.00 22.61  ? 281  VAL A O   1 
ATOM   2159 C CB  . VAL A 1 281 ? 152.149 30.024 182.449 1.00 25.88  ? 281  VAL A CB  1 
ATOM   2160 C CG1 . VAL A 1 281 ? 151.649 31.436 182.789 1.00 26.25  ? 281  VAL A CG1 1 
ATOM   2161 C CG2 . VAL A 1 281 ? 153.312 30.096 181.440 1.00 24.43  ? 281  VAL A CG2 1 
ATOM   2162 N N   . LEU A 1 282 ? 154.155 27.519 183.797 1.00 22.84  ? 282  LEU A N   1 
ATOM   2163 C CA  . LEU A 1 282 ? 154.687 26.177 183.497 1.00 21.91  ? 282  LEU A CA  1 
ATOM   2164 C C   . LEU A 1 282 ? 153.840 25.152 184.195 1.00 27.87  ? 282  LEU A C   1 
ATOM   2165 O O   . LEU A 1 282 ? 153.493 25.366 185.332 1.00 26.22  ? 282  LEU A O   1 
ATOM   2166 C CB  . LEU A 1 282 ? 156.085 26.051 183.998 1.00 22.60  ? 282  LEU A CB  1 
ATOM   2167 C CG  . LEU A 1 282 ? 157.093 26.741 183.087 1.00 25.27  ? 282  LEU A CG  1 
ATOM   2168 C CD1 . LEU A 1 282 ? 158.437 26.746 183.784 1.00 27.83  ? 282  LEU A CD1 1 
ATOM   2169 C CD2 . LEU A 1 282 ? 157.253 26.035 181.732 1.00 27.35  ? 282  LEU A CD2 1 
ATOM   2170 N N   . PRO A 1 283 ? 153.522 24.022 183.542 1.00 25.50  ? 283  PRO A N   1 
ATOM   2171 C CA  . PRO A 1 283 ? 152.605 23.140 184.193 1.00 27.51  ? 283  PRO A CA  1 
ATOM   2172 C C   . PRO A 1 283 ? 153.249 22.291 185.309 1.00 31.85  ? 283  PRO A C   1 
ATOM   2173 O O   . PRO A 1 283 ? 152.543 21.811 186.168 1.00 33.65  ? 283  PRO A O   1 
ATOM   2174 C CB  . PRO A 1 283 ? 152.169 22.190 183.049 1.00 29.61  ? 283  PRO A CB  1 
ATOM   2175 C CG  . PRO A 1 283 ? 153.409 22.125 182.163 1.00 27.62  ? 283  PRO A CG  1 
ATOM   2176 C CD  . PRO A 1 283 ? 153.906 23.549 182.196 1.00 27.87  ? 283  PRO A CD  1 
ATOM   2177 N N   . PHE A 1 284 ? 154.544 22.033 185.251 1.00 29.73  ? 284  PHE A N   1 
ATOM   2178 C CA  . PHE A 1 284 ? 155.210 21.181 186.237 1.00 30.33  ? 284  PHE A CA  1 
ATOM   2179 C C   . PHE A 1 284 ? 156.334 21.918 186.890 1.00 30.03  ? 284  PHE A C   1 
ATOM   2180 O O   . PHE A 1 284 ? 156.860 22.862 186.351 1.00 27.41  ? 284  PHE A O   1 
ATOM   2181 C CB  . PHE A 1 284 ? 155.791 19.928 185.583 1.00 34.49  ? 284  PHE A CB  1 
ATOM   2182 C CG  . PHE A 1 284 ? 154.796 19.196 184.737 1.00 40.96  ? 284  PHE A CG  1 
ATOM   2183 C CD1 . PHE A 1 284 ? 153.571 18.814 185.283 1.00 46.17  ? 284  PHE A CD1 1 
ATOM   2184 C CD2 . PHE A 1 284 ? 155.034 18.973 183.376 1.00 44.68  ? 284  PHE A CD2 1 
ATOM   2185 C CE1 . PHE A 1 284 ? 152.624 18.164 184.491 1.00 49.13  ? 284  PHE A CE1 1 
ATOM   2186 C CE2 . PHE A 1 284 ? 154.099 18.324 182.582 1.00 45.43  ? 284  PHE A CE2 1 
ATOM   2187 C CZ  . PHE A 1 284 ? 152.896 17.914 183.139 1.00 44.96  ? 284  PHE A CZ  1 
ATOM   2188 N N   . ASP A 1 285 ? 156.719 21.447 188.066 1.00 30.18  ? 285  ASP A N   1 
ATOM   2189 C CA  . ASP A 1 285 ? 157.942 21.886 188.744 1.00 25.92  ? 285  ASP A CA  1 
ATOM   2190 C C   . ASP A 1 285 ? 159.068 21.190 187.963 1.00 24.43  ? 285  ASP A C   1 
ATOM   2191 O O   . ASP A 1 285 ? 159.177 19.969 187.935 1.00 25.18  ? 285  ASP A O   1 
ATOM   2192 C CB  . ASP A 1 285 ? 157.850 21.360 190.186 1.00 27.58  ? 285  ASP A CB  1 
ATOM   2193 C CG  . ASP A 1 285 ? 158.948 21.875 191.082 1.00 28.37  ? 285  ASP A CG  1 
ATOM   2194 O OD1 . ASP A 1 285 ? 159.720 22.745 190.665 1.00 23.21  ? 285  ASP A OD1 1 
ATOM   2195 O OD2 . ASP A 1 285 ? 159.037 21.351 192.216 1.00 33.14  ? 285  ASP A OD2 1 
ATOM   2196 N N   . SER A 1 286 ? 159.924 21.944 187.318 1.00 21.58  ? 286  SER A N   1 
ATOM   2197 C CA  . SER A 1 286 ? 160.754 21.340 186.303 1.00 23.56  ? 286  SER A CA  1 
ATOM   2198 C C   . SER A 1 286 ? 162.017 22.136 186.128 1.00 24.71  ? 286  SER A C   1 
ATOM   2199 O O   . SER A 1 286 ? 162.107 23.284 186.509 1.00 26.63  ? 286  SER A O   1 
ATOM   2200 C CB  . SER A 1 286 ? 159.955 21.307 184.970 1.00 26.74  ? 286  SER A CB  1 
ATOM   2201 O OG  . SER A 1 286 ? 159.490 22.648 184.614 1.00 29.82  ? 286  SER A OG  1 
ATOM   2202 N N   . ILE A 1 287 ? 163.047 21.514 185.600 1.00 26.11  ? 287  ILE A N   1 
ATOM   2203 C CA  . ILE A 1 287 ? 164.129 22.291 185.098 1.00 25.08  ? 287  ILE A CA  1 
ATOM   2204 C C   . ILE A 1 287 ? 164.229 22.104 183.533 1.00 23.05  ? 287  ILE A C   1 
ATOM   2205 O O   . ILE A 1 287 ? 163.682 21.134 182.975 1.00 21.46  ? 287  ILE A O   1 
ATOM   2206 C CB  . ILE A 1 287 ? 165.406 21.919 185.757 1.00 27.95  ? 287  ILE A CB  1 
ATOM   2207 C CG1 . ILE A 1 287 ? 165.670 20.482 185.549 1.00 27.90  ? 287  ILE A CG1 1 
ATOM   2208 C CG2 . ILE A 1 287 ? 165.427 22.336 187.252 1.00 29.25  ? 287  ILE A CG2 1 
ATOM   2209 C CD1 . ILE A 1 287 ? 167.050 20.188 186.052 1.00 34.77  ? 287  ILE A CD1 1 
ATOM   2210 N N   . PHE A 1 288 ? 164.945 23.025 182.903 1.00 19.01  ? 288  PHE A N   1 
ATOM   2211 C CA  . PHE A 1 288 ? 165.138 23.079 181.452 1.00 19.85  ? 288  PHE A CA  1 
ATOM   2212 C C   . PHE A 1 288 ? 163.753 23.089 180.734 1.00 19.66  ? 288  PHE A C   1 
ATOM   2213 O O   . PHE A 1 288 ? 163.495 22.304 179.852 1.00 20.31  ? 288  PHE A O   1 
ATOM   2214 C CB  . PHE A 1 288 ? 166.044 21.926 181.018 1.00 18.53  ? 288  PHE A CB  1 
ATOM   2215 C CG  . PHE A 1 288 ? 166.945 22.242 179.842 1.00 20.79  ? 288  PHE A CG  1 
ATOM   2216 C CD1 . PHE A 1 288 ? 166.499 22.959 178.777 1.00 22.49  ? 288  PHE A CD1 1 
ATOM   2217 C CD2 . PHE A 1 288 ? 168.218 21.756 179.798 1.00 22.70  ? 288  PHE A CD2 1 
ATOM   2218 C CE1 . PHE A 1 288 ? 167.318 23.204 177.673 1.00 22.22  ? 288  PHE A CE1 1 
ATOM   2219 C CE2 . PHE A 1 288 ? 169.027 22.018 178.725 1.00 24.36  ? 288  PHE A CE2 1 
ATOM   2220 C CZ  . PHE A 1 288 ? 168.561 22.747 177.654 1.00 21.77  ? 288  PHE A CZ  1 
ATOM   2221 N N   . ARG A 1 289 ? 162.865 23.959 181.204 1.00 19.14  ? 289  ARG A N   1 
ATOM   2222 C CA  . ARG A 1 289 ? 161.538 24.124 180.657 1.00 19.74  ? 289  ARG A CA  1 
ATOM   2223 C C   . ARG A 1 289 ? 161.218 25.605 180.698 1.00 22.67  ? 289  ARG A C   1 
ATOM   2224 O O   . ARG A 1 289 ? 161.468 26.283 181.724 1.00 18.07  ? 289  ARG A O   1 
ATOM   2225 C CB  . ARG A 1 289 ? 160.466 23.357 181.377 1.00 20.50  ? 289  ARG A CB  1 
ATOM   2226 C CG  . ARG A 1 289 ? 160.528 21.824 181.262 1.00 21.30  ? 289  ARG A CG  1 
ATOM   2227 C CD  . ARG A 1 289 ? 160.433 21.322 179.824 1.00 20.72  ? 289  ARG A CD  1 
ATOM   2228 N NE  . ARG A 1 289 ? 160.445 19.878 179.760 1.00 20.92  ? 289  ARG A NE  1 
ATOM   2229 C CZ  . ARG A 1 289 ? 161.525 19.116 179.646 1.00 20.29  ? 289  ARG A CZ  1 
ATOM   2230 N NH1 . ARG A 1 289 ? 162.747 19.622 179.634 1.00 19.91  ? 289  ARG A NH1 1 
ATOM   2231 N NH2 . ARG A 1 289 ? 161.355 17.835 179.531 1.00 21.16  ? 289  ARG A NH2 1 
ATOM   2232 N N   . PHE A 1 290 ? 160.750 26.115 179.531 1.00 19.15  ? 290  PHE A N   1 
ATOM   2233 C CA  . PHE A 1 290 ? 160.503 27.531 179.337 1.00 20.10  ? 290  PHE A CA  1 
ATOM   2234 C C   . PHE A 1 290 ? 159.064 27.672 178.888 1.00 19.33  ? 290  PHE A C   1 
ATOM   2235 O O   . PHE A 1 290 ? 158.456 26.791 178.260 1.00 18.45  ? 290  PHE A O   1 
ATOM   2236 C CB  . PHE A 1 290 ? 161.504 28.120 178.312 1.00 22.43  ? 290  PHE A CB  1 
ATOM   2237 C CG  . PHE A 1 290 ? 162.889 27.574 178.458 1.00 22.27  ? 290  PHE A CG  1 
ATOM   2238 C CD1 . PHE A 1 290 ? 163.615 27.859 179.563 1.00 24.69  ? 290  PHE A CD1 1 
ATOM   2239 C CD2 . PHE A 1 290 ? 163.380 26.626 177.540 1.00 22.98  ? 290  PHE A CD2 1 
ATOM   2240 C CE1 . PHE A 1 290 ? 164.910 27.319 179.735 1.00 26.97  ? 290  PHE A CE1 1 
ATOM   2241 C CE2 . PHE A 1 290 ? 164.637 26.080 177.677 1.00 24.62  ? 290  PHE A CE2 1 
ATOM   2242 C CZ  . PHE A 1 290 ? 165.421 26.444 178.779 1.00 28.04  ? 290  PHE A CZ  1 
ATOM   2243 N N   . SER A 1 291 ? 158.490 28.802 179.223 1.00 22.07  ? 291  SER A N   1 
ATOM   2244 C CA  . SER A 1 291 ? 157.047 28.922 179.154 1.00 23.16  ? 291  SER A CA  1 
ATOM   2245 C C   . SER A 1 291 ? 156.493 29.127 177.709 1.00 22.75  ? 291  SER A C   1 
ATOM   2246 O O   . SER A 1 291 ? 155.497 28.527 177.341 1.00 20.21  ? 291  SER A O   1 
ATOM   2247 C CB  . SER A 1 291 ? 156.643 30.154 179.977 1.00 27.66  ? 291  SER A CB  1 
ATOM   2248 O OG  . SER A 1 291 ? 156.946 30.000 181.336 1.00 29.90  ? 291  SER A OG  1 
ATOM   2249 N N   . PHE A 1 292 ? 157.080 30.064 176.981 1.00 18.75  ? 292  PHE A N   1 
ATOM   2250 C CA  . PHE A 1 292 ? 156.577 30.444 175.655 1.00 20.37  ? 292  PHE A CA  1 
ATOM   2251 C C   . PHE A 1 292 ? 157.561 30.080 174.586 1.00 18.85  ? 292  PHE A C   1 
ATOM   2252 O O   . PHE A 1 292 ? 158.612 30.692 174.482 1.00 19.05  ? 292  PHE A O   1 
ATOM   2253 C CB  . PHE A 1 292 ? 156.265 31.897 175.618 1.00 20.25  ? 292  PHE A CB  1 
ATOM   2254 C CG  . PHE A 1 292 ? 155.183 32.258 176.590 1.00 20.64  ? 292  PHE A CG  1 
ATOM   2255 C CD1 . PHE A 1 292 ? 153.902 31.885 176.331 1.00 21.69  ? 292  PHE A CD1 1 
ATOM   2256 C CD2 . PHE A 1 292 ? 155.480 32.870 177.801 1.00 21.61  ? 292  PHE A CD2 1 
ATOM   2257 C CE1 . PHE A 1 292 ? 152.870 32.153 177.236 1.00 22.32  ? 292  PHE A CE1 1 
ATOM   2258 C CE2 . PHE A 1 292 ? 154.467 33.055 178.735 1.00 24.75  ? 292  PHE A CE2 1 
ATOM   2259 C CZ  . PHE A 1 292 ? 153.180 32.720 178.443 1.00 23.10  ? 292  PHE A CZ  1 
ATOM   2260 N N   . VAL A 1 293 ? 157.219 29.002 173.904 1.00 17.08  ? 293  VAL A N   1 
ATOM   2261 C CA  . VAL A 1 293 ? 158.074 28.361 172.947 1.00 18.77  ? 293  VAL A CA  1 
ATOM   2262 C C   . VAL A 1 293 ? 157.250 28.066 171.650 1.00 19.42  ? 293  VAL A C   1 
ATOM   2263 O O   . VAL A 1 293 ? 156.004 28.204 171.649 1.00 19.39  ? 293  VAL A O   1 
ATOM   2264 C CB  . VAL A 1 293 ? 158.650 27.055 173.491 1.00 19.43  ? 293  VAL A CB  1 
ATOM   2265 C CG1 . VAL A 1 293 ? 159.562 27.284 174.711 1.00 21.47  ? 293  VAL A CG1 1 
ATOM   2266 C CG2 . VAL A 1 293 ? 157.552 26.026 173.794 1.00 18.75  ? 293  VAL A CG2 1 
ATOM   2267 N N   . PRO A 1 294 ? 157.928 27.674 170.549 1.00 20.82  ? 294  PRO A N   1 
ATOM   2268 C CA  . PRO A 1 294 ? 157.216 27.267 169.321 1.00 19.83  ? 294  PRO A CA  1 
ATOM   2269 C C   . PRO A 1 294 ? 156.067 26.284 169.564 1.00 23.09  ? 294  PRO A C   1 
ATOM   2270 O O   . PRO A 1 294 ? 156.174 25.400 170.424 1.00 22.36  ? 294  PRO A O   1 
ATOM   2271 C CB  . PRO A 1 294 ? 158.307 26.616 168.490 1.00 21.15  ? 294  PRO A CB  1 
ATOM   2272 C CG  . PRO A 1 294 ? 159.514 27.449 168.834 1.00 21.32  ? 294  PRO A CG  1 
ATOM   2273 C CD  . PRO A 1 294 ? 159.389 27.730 170.331 1.00 20.99  ? 294  PRO A CD  1 
ATOM   2274 N N   . VAL A 1 295 ? 155.015 26.424 168.776 1.00 21.15  ? 295  VAL A N   1 
ATOM   2275 C CA  . VAL A 1 295 ? 153.853 25.563 168.820 1.00 23.76  ? 295  VAL A CA  1 
ATOM   2276 C C   . VAL A 1 295 ? 153.670 24.689 167.558 1.00 24.92  ? 295  VAL A C   1 
ATOM   2277 O O   . VAL A 1 295 ? 153.890 25.127 166.437 1.00 25.81  ? 295  VAL A O   1 
ATOM   2278 C CB  . VAL A 1 295 ? 152.647 26.426 169.162 1.00 24.47  ? 295  VAL A CB  1 
ATOM   2279 C CG1 . VAL A 1 295 ? 152.384 27.492 168.069 1.00 25.90  ? 295  VAL A CG1 1 
ATOM   2280 C CG2 . VAL A 1 295 ? 151.452 25.597 169.426 1.00 29.73  ? 295  VAL A CG2 1 
ATOM   2281 N N   . ILE A 1 296 ? 153.308 23.419 167.739 1.00 22.72  ? 296  ILE A N   1 
ATOM   2282 C CA  . ILE A 1 296 ? 153.186 22.514 166.621 1.00 23.79  ? 296  ILE A CA  1 
ATOM   2283 C C   . ILE A 1 296 ? 151.771 22.818 166.092 1.00 27.10  ? 296  ILE A C   1 
ATOM   2284 O O   . ILE A 1 296 ? 150.793 22.324 166.638 1.00 28.60  ? 296  ILE A O   1 
ATOM   2285 C CB  . ILE A 1 296 ? 153.418 21.072 167.050 1.00 25.96  ? 296  ILE A CB  1 
ATOM   2286 C CG1 . ILE A 1 296 ? 154.857 20.877 167.643 1.00 25.41  ? 296  ILE A CG1 1 
ATOM   2287 C CG2 . ILE A 1 296 ? 153.226 20.142 165.867 1.00 29.25  ? 296  ILE A CG2 1 
ATOM   2288 C CD1 . ILE A 1 296 ? 155.935 21.438 166.747 1.00 26.42  ? 296  ILE A CD1 1 
ATOM   2289 N N   . ASP A 1 297 ? 151.690 23.724 165.103 1.00 24.67  ? 297  ASP A N   1 
ATOM   2290 C CA  . ASP A 1 297 ? 150.452 24.440 164.739 1.00 28.17  ? 297  ASP A CA  1 
ATOM   2291 C C   . ASP A 1 297 ? 149.699 23.943 163.496 1.00 30.34  ? 297  ASP A C   1 
ATOM   2292 O O   . ASP A 1 297 ? 148.626 24.469 163.198 1.00 32.21  ? 297  ASP A O   1 
ATOM   2293 C CB  . ASP A 1 297 ? 150.714 25.949 164.487 1.00 25.16  ? 297  ASP A CB  1 
ATOM   2294 C CG  . ASP A 1 297 ? 151.767 26.204 163.423 1.00 27.35  ? 297  ASP A CG  1 
ATOM   2295 O OD1 . ASP A 1 297 ? 152.440 25.225 163.009 1.00 27.61  ? 297  ASP A OD1 1 
ATOM   2296 O OD2 . ASP A 1 297 ? 152.012 27.403 163.037 1.00 30.09  ? 297  ASP A OD2 1 
ATOM   2297 N N   . GLY A 1 298 ? 150.296 23.045 162.745 1.00 28.47  ? 298  GLY A N   1 
ATOM   2298 C CA  . GLY A 1 298 ? 149.810 22.734 161.401 1.00 35.82  ? 298  GLY A CA  1 
ATOM   2299 C C   . GLY A 1 298 ? 150.191 23.681 160.261 1.00 39.21  ? 298  GLY A C   1 
ATOM   2300 O O   . GLY A 1 298 ? 149.839 23.409 159.113 1.00 36.80  ? 298  GLY A O   1 
ATOM   2301 N N   . GLU A 1 299 ? 150.870 24.796 160.547 1.00 35.30  ? 299  GLU A N   1 
ATOM   2302 C CA  . GLU A 1 299 ? 151.118 25.813 159.541 1.00 30.68  ? 299  GLU A CA  1 
ATOM   2303 C C   . GLU A 1 299 ? 152.665 25.962 159.362 1.00 29.35  ? 299  GLU A C   1 
ATOM   2304 O O   . GLU A 1 299 ? 153.221 25.550 158.360 1.00 26.49  ? 299  GLU A O   1 
ATOM   2305 C CB  . GLU A 1 299 ? 150.460 27.170 159.920 1.00 36.77  ? 299  GLU A CB  1 
ATOM   2306 C CG  . GLU A 1 299 ? 148.913 27.242 160.150 1.00 39.61  ? 299  GLU A CG  1 
ATOM   2307 N N   . PHE A 1 300 ? 153.372 26.547 160.340 1.00 24.38  ? 300  PHE A N   1 
ATOM   2308 C CA  . PHE A 1 300 ? 154.829 26.571 160.292 1.00 21.95  ? 300  PHE A CA  1 
ATOM   2309 C C   . PHE A 1 300 ? 155.365 25.150 160.229 1.00 20.55  ? 300  PHE A C   1 
ATOM   2310 O O   . PHE A 1 300 ? 156.305 24.811 159.468 1.00 21.84  ? 300  PHE A O   1 
ATOM   2311 C CB  . PHE A 1 300 ? 155.358 27.420 161.506 1.00 22.73  ? 300  PHE A CB  1 
ATOM   2312 C CG  . PHE A 1 300 ? 156.800 27.744 161.430 1.00 22.55  ? 300  PHE A CG  1 
ATOM   2313 C CD1 . PHE A 1 300 ? 157.744 26.788 161.711 1.00 23.27  ? 300  PHE A CD1 1 
ATOM   2314 C CD2 . PHE A 1 300 ? 157.203 28.968 161.019 1.00 21.30  ? 300  PHE A CD2 1 
ATOM   2315 C CE1 . PHE A 1 300 ? 159.082 27.110 161.658 1.00 22.07  ? 300  PHE A CE1 1 
ATOM   2316 C CE2 . PHE A 1 300 ? 158.513 29.291 160.925 1.00 19.83  ? 300  PHE A CE2 1 
ATOM   2317 C CZ  . PHE A 1 300 ? 159.457 28.363 161.255 1.00 20.74  ? 300  PHE A CZ  1 
ATOM   2318 N N   . PHE A 1 301 ? 154.729 24.294 161.010 1.00 21.27  ? 301  PHE A N   1 
ATOM   2319 C CA  . PHE A 1 301 ? 155.014 22.867 161.073 1.00 21.47  ? 301  PHE A CA  1 
ATOM   2320 C C   . PHE A 1 301 ? 153.763 22.179 160.590 1.00 22.95  ? 301  PHE A C   1 
ATOM   2321 O O   . PHE A 1 301 ? 152.736 22.268 161.219 1.00 24.80  ? 301  PHE A O   1 
ATOM   2322 C CB  . PHE A 1 301 ? 155.288 22.447 162.532 1.00 22.12  ? 301  PHE A CB  1 
ATOM   2323 C CG  . PHE A 1 301 ? 156.461 23.181 163.176 1.00 21.24  ? 301  PHE A CG  1 
ATOM   2324 C CD1 . PHE A 1 301 ? 157.741 22.873 162.824 1.00 21.50  ? 301  PHE A CD1 1 
ATOM   2325 C CD2 . PHE A 1 301 ? 156.258 24.140 164.129 1.00 21.96  ? 301  PHE A CD2 1 
ATOM   2326 C CE1 . PHE A 1 301 ? 158.815 23.533 163.440 1.00 24.16  ? 301  PHE A CE1 1 
ATOM   2327 C CE2 . PHE A 1 301 ? 157.313 24.828 164.723 1.00 21.80  ? 301  PHE A CE2 1 
ATOM   2328 C CZ  . PHE A 1 301 ? 158.591 24.533 164.372 1.00 21.71  ? 301  PHE A CZ  1 
ATOM   2329 N N   . PRO A 1 302 ? 153.827 21.487 159.448 1.00 29.06  ? 302  PRO A N   1 
ATOM   2330 C CA  . PRO A 1 302 ? 152.544 20.987 158.968 1.00 28.64  ? 302  PRO A CA  1 
ATOM   2331 C C   . PRO A 1 302 ? 152.011 19.753 159.700 1.00 28.63  ? 302  PRO A C   1 
ATOM   2332 O O   . PRO A 1 302 ? 150.831 19.540 159.691 1.00 28.60  ? 302  PRO A O   1 
ATOM   2333 C CB  . PRO A 1 302 ? 152.828 20.684 157.490 1.00 30.77  ? 302  PRO A CB  1 
ATOM   2334 C CG  . PRO A 1 302 ? 154.294 20.730 157.329 1.00 30.57  ? 302  PRO A CG  1 
ATOM   2335 C CD  . PRO A 1 302 ? 154.838 21.579 158.386 1.00 28.63  ? 302  PRO A CD  1 
ATOM   2336 N N   . THR A 1 303 ? 152.880 18.925 160.273 1.00 28.50  ? 303  THR A N   1 
ATOM   2337 C CA  . THR A 1 303 ? 152.484 17.752 161.043 1.00 29.70  ? 303  THR A CA  1 
ATOM   2338 C C   . THR A 1 303 ? 153.468 17.669 162.257 1.00 27.84  ? 303  THR A C   1 
ATOM   2339 O O   . THR A 1 303 ? 154.339 18.498 162.391 1.00 24.55  ? 303  THR A O   1 
ATOM   2340 C CB  . THR A 1 303 ? 152.581 16.422 160.210 1.00 35.74  ? 303  THR A CB  1 
ATOM   2341 O OG1 . THR A 1 303 ? 153.954 16.090 159.866 1.00 34.13  ? 303  THR A OG1 1 
ATOM   2342 C CG2 . THR A 1 303 ? 151.788 16.517 158.910 1.00 40.48  ? 303  THR A CG2 1 
ATOM   2343 N N   . SER A 1 304 ? 153.405 16.597 163.028 1.00 25.88  ? 304  SER A N   1 
ATOM   2344 C CA  . SER A 1 304 ? 154.258 16.451 164.208 1.00 24.44  ? 304  SER A CA  1 
ATOM   2345 C C   . SER A 1 304 ? 155.675 16.387 163.716 1.00 24.39  ? 304  SER A C   1 
ATOM   2346 O O   . SER A 1 304 ? 155.936 16.004 162.546 1.00 22.21  ? 304  SER A O   1 
ATOM   2347 C CB  . SER A 1 304 ? 153.910 15.182 164.954 1.00 24.39  ? 304  SER A CB  1 
ATOM   2348 O OG  . SER A 1 304 ? 154.402 14.113 164.207 1.00 24.97  ? 304  SER A OG  1 
ATOM   2349 N N   . LEU A 1 305 ? 156.601 16.789 164.576 1.00 24.69  ? 305  LEU A N   1 
ATOM   2350 C CA  . LEU A 1 305 ? 157.987 16.841 164.180 1.00 25.30  ? 305  LEU A CA  1 
ATOM   2351 C C   . LEU A 1 305 ? 158.487 15.409 163.877 1.00 28.24  ? 305  LEU A C   1 
ATOM   2352 O O   . LEU A 1 305 ? 159.294 15.197 162.948 1.00 24.47  ? 305  LEU A O   1 
ATOM   2353 C CB  . LEU A 1 305 ? 158.849 17.476 165.237 1.00 23.37  ? 305  LEU A CB  1 
ATOM   2354 C CG  . LEU A 1 305 ? 158.518 18.901 165.646 1.00 24.54  ? 305  LEU A CG  1 
ATOM   2355 C CD1 . LEU A 1 305 ? 159.521 19.396 166.714 1.00 27.05  ? 305  LEU A CD1 1 
ATOM   2356 C CD2 . LEU A 1 305 ? 158.495 19.861 164.499 1.00 26.82  ? 305  LEU A CD2 1 
ATOM   2357 N N   . GLU A 1 306 ? 158.005 14.433 164.635 1.00 27.48  ? 306  GLU A N   1 
ATOM   2358 C CA  . GLU A 1 306 ? 158.462 13.060 164.441 1.00 28.65  ? 306  GLU A CA  1 
ATOM   2359 C C   . GLU A 1 306 ? 157.976 12.512 163.081 1.00 25.76  ? 306  GLU A C   1 
ATOM   2360 O O   . GLU A 1 306 ? 158.742 11.854 162.372 1.00 21.94  ? 306  GLU A O   1 
ATOM   2361 C CB  . GLU A 1 306 ? 157.974 12.149 165.587 1.00 32.76  ? 306  GLU A CB  1 
ATOM   2362 C CG  . GLU A 1 306 ? 158.493 10.709 165.600 1.00 34.27  ? 306  GLU A CG  1 
ATOM   2363 C CD  . GLU A 1 306 ? 160.028 10.589 165.666 1.00 40.88  ? 306  GLU A CD  1 
ATOM   2364 O OE1 . GLU A 1 306 ? 160.752 11.576 165.949 1.00 42.82  ? 306  GLU A OE1 1 
ATOM   2365 O OE2 . GLU A 1 306 ? 160.520 9.484  165.451 1.00 43.44  ? 306  GLU A OE2 1 
ATOM   2366 N N   . SER A 1 307 ? 156.724 12.753 162.721 1.00 24.88  ? 307  SER A N   1 
ATOM   2367 C CA  . SER A 1 307 ? 156.273 12.332 161.367 1.00 28.10  ? 307  SER A CA  1 
ATOM   2368 C C   . SER A 1 307 ? 157.044 13.060 160.232 1.00 24.98  ? 307  SER A C   1 
ATOM   2369 O O   . SER A 1 307 ? 157.352 12.455 159.239 1.00 27.65  ? 307  SER A O   1 
ATOM   2370 C CB  . SER A 1 307 ? 154.723 12.441 161.186 1.00 28.33  ? 307  SER A CB  1 
ATOM   2371 O OG  . SER A 1 307 ? 154.312 13.771 161.306 1.00 38.90  ? 307  SER A OG  1 
ATOM   2372 N N   . MET A 1 308 ? 157.451 14.312 160.439 1.00 24.11  ? 308  MET A N   1 
ATOM   2373 C CA  . MET A 1 308 ? 158.195 15.020 159.425 1.00 22.76  ? 308  MET A CA  1 
ATOM   2374 C C   . MET A 1 308 ? 159.519 14.382 159.331 1.00 23.25  ? 308  MET A C   1 
ATOM   2375 O O   . MET A 1 308 ? 159.997 14.130 158.245 1.00 23.95  ? 308  MET A O   1 
ATOM   2376 C CB  . MET A 1 308 ? 158.289 16.538 159.693 1.00 22.16  ? 308  MET A CB  1 
ATOM   2377 C CG  . MET A 1 308 ? 156.954 17.225 159.624 1.00 22.39  ? 308  MET A CG  1 
ATOM   2378 S SD  . MET A 1 308 ? 157.170 18.967 159.986 1.00 27.42  ? 308  MET A SD  1 
ATOM   2379 C CE  . MET A 1 308 ? 158.043 19.507 158.491 1.00 27.91  ? 308  MET A CE  1 
ATOM   2380 N N   . LEU A 1 309 ? 160.158 14.113 160.455 1.00 24.25  ? 309  LEU A N   1 
ATOM   2381 C CA  . LEU A 1 309 ? 161.463 13.497 160.408 1.00 26.89  ? 309  LEU A CA  1 
ATOM   2382 C C   . LEU A 1 309 ? 161.482 12.110 159.813 1.00 26.44  ? 309  LEU A C   1 
ATOM   2383 O O   . LEU A 1 309 ? 162.455 11.729 159.117 1.00 29.85  ? 309  LEU A O   1 
ATOM   2384 C CB  . LEU A 1 309 ? 162.097 13.438 161.799 1.00 27.59  ? 309  LEU A CB  1 
ATOM   2385 C CG  . LEU A 1 309 ? 162.568 14.766 162.367 1.00 27.76  ? 309  LEU A CG  1 
ATOM   2386 C CD1 . LEU A 1 309 ? 163.015 14.535 163.798 1.00 31.29  ? 309  LEU A CD1 1 
ATOM   2387 C CD2 . LEU A 1 309 ? 163.708 15.333 161.542 1.00 27.14  ? 309  LEU A CD2 1 
ATOM   2388 N N   . ASN A 1 310 ? 160.460 11.336 160.123 1.00 28.47  ? 310  ASN A N   1 
ATOM   2389 C CA  . ASN A 1 310 ? 160.355 9.952  159.619 1.00 29.17  ? 310  ASN A CA  1 
ATOM   2390 C C   . ASN A 1 310 ? 160.072 9.858  158.148 1.00 26.29  ? 310  ASN A C   1 
ATOM   2391 O O   . ASN A 1 310 ? 160.526 8.969  157.546 1.00 31.06  ? 310  ASN A O   1 
ATOM   2392 C CB  . ASN A 1 310 ? 159.221 9.185  160.314 1.00 35.64  ? 310  ASN A CB  1 
ATOM   2393 C CG  . ASN A 1 310 ? 159.645 8.642  161.613 1.00 41.87  ? 310  ASN A CG  1 
ATOM   2394 O OD1 . ASN A 1 310 ? 160.832 8.432  161.827 1.00 48.21  ? 310  ASN A OD1 1 
ATOM   2395 N ND2 . ASN A 1 310 ? 158.681 8.399  162.514 1.00 49.61  ? 310  ASN A ND2 1 
ATOM   2396 N N   . SER A 1 311 ? 159.318 10.797 157.592 1.00 29.64  ? 311  SER A N   1 
ATOM   2397 C CA  . SER A 1 311 ? 158.893 10.759 156.201 1.00 30.40  ? 311  SER A CA  1 
ATOM   2398 C C   . SER A 1 311 ? 159.843 11.582 155.279 1.00 30.85  ? 311  SER A C   1 
ATOM   2399 O O   . SER A 1 311 ? 159.657 11.634 154.101 1.00 28.95  ? 311  SER A O   1 
ATOM   2400 C CB  . SER A 1 311 ? 157.497 11.344 156.129 1.00 30.99  ? 311  SER A CB  1 
ATOM   2401 O OG  . SER A 1 311 ? 157.510 12.751 156.379 1.00 34.74  ? 311  SER A OG  1 
ATOM   2402 N N   . GLY A 1 312 ? 160.837 12.260 155.833 1.00 25.46  ? 312  GLY A N   1 
ATOM   2403 C CA  . GLY A 1 312 ? 161.716 13.065 155.033 1.00 24.56  ? 312  GLY A CA  1 
ATOM   2404 C C   . GLY A 1 312 ? 161.071 14.358 154.613 1.00 25.18  ? 312  GLY A C   1 
ATOM   2405 O O   . GLY A 1 312 ? 161.454 14.939 153.600 1.00 26.78  ? 312  GLY A O   1 
ATOM   2406 N N   . ASN A 1 313 ? 160.063 14.816 155.345 1.00 22.17  ? 313  ASN A N   1 
ATOM   2407 C CA  . ASN A 1 313 ? 159.502 16.105 155.080 1.00 22.57  ? 313  ASN A CA  1 
ATOM   2408 C C   . ASN A 1 313 ? 160.383 17.239 155.693 1.00 24.91  ? 313  ASN A C   1 
ATOM   2409 O O   . ASN A 1 313 ? 160.083 17.825 156.712 1.00 25.91  ? 313  ASN A O   1 
ATOM   2410 C CB  . ASN A 1 313 ? 158.085 16.097 155.496 1.00 23.38  ? 313  ASN A CB  1 
ATOM   2411 C CG  . ASN A 1 313 ? 157.328 17.281 155.023 1.00 25.20  ? 313  ASN A CG  1 
ATOM   2412 O OD1 . ASN A 1 313 ? 157.843 18.144 154.321 1.00 27.64  ? 313  ASN A OD1 1 
ATOM   2413 N ND2 . ASN A 1 313 ? 156.108 17.387 155.508 1.00 24.49  ? 313  ASN A ND2 1 
ATOM   2414 N N   . PHE A 1 314 ? 161.493 17.479 155.024 1.00 23.53  ? 314  PHE A N   1 
ATOM   2415 C CA  . PHE A 1 314 ? 162.421 18.535 155.395 1.00 24.57  ? 314  PHE A CA  1 
ATOM   2416 C C   . PHE A 1 314 ? 163.437 18.840 154.299 1.00 23.57  ? 314  PHE A C   1 
ATOM   2417 O O   . PHE A 1 314 ? 163.666 18.024 153.370 1.00 20.35  ? 314  PHE A O   1 
ATOM   2418 C CB  . PHE A 1 314 ? 163.181 18.154 156.697 1.00 22.23  ? 314  PHE A CB  1 
ATOM   2419 C CG  . PHE A 1 314 ? 163.809 16.807 156.696 1.00 21.66  ? 314  PHE A CG  1 
ATOM   2420 C CD1 . PHE A 1 314 ? 165.041 16.606 156.137 1.00 23.94  ? 314  PHE A CD1 1 
ATOM   2421 C CD2 . PHE A 1 314 ? 163.212 15.744 157.346 1.00 25.57  ? 314  PHE A CD2 1 
ATOM   2422 C CE1 . PHE A 1 314 ? 165.664 15.384 156.206 1.00 20.96  ? 314  PHE A CE1 1 
ATOM   2423 C CE2 . PHE A 1 314 ? 163.839 14.499 157.385 1.00 20.72  ? 314  PHE A CE2 1 
ATOM   2424 C CZ  . PHE A 1 314 ? 165.056 14.347 156.837 1.00 20.18  ? 314  PHE A CZ  1 
ATOM   2425 N N   . LYS A 1 315 ? 164.118 19.978 154.446 1.00 24.46  ? 315  LYS A N   1 
ATOM   2426 C CA  . LYS A 1 315 ? 165.131 20.357 153.493 1.00 20.77  ? 315  LYS A CA  1 
ATOM   2427 C C   . LYS A 1 315 ? 166.266 19.373 153.542 1.00 22.63  ? 315  LYS A C   1 
ATOM   2428 O O   . LYS A 1 315 ? 166.867 19.119 154.612 1.00 19.87  ? 315  LYS A O   1 
ATOM   2429 C CB  . LYS A 1 315 ? 165.657 21.756 153.753 1.00 23.08  ? 315  LYS A CB  1 
ATOM   2430 C CG  . LYS A 1 315 ? 166.595 22.360 152.708 1.00 21.70  ? 315  LYS A CG  1 
ATOM   2431 C CD  . LYS A 1 315 ? 167.185 23.657 153.251 1.00 21.93  ? 315  LYS A CD  1 
ATOM   2432 C CE  . LYS A 1 315 ? 168.175 24.212 152.267 1.00 21.09  ? 315  LYS A CE  1 
ATOM   2433 N NZ  . LYS A 1 315 ? 167.470 24.840 151.117 1.00 19.36  ? 315  LYS A NZ  1 
ATOM   2434 N N   . LYS A 1 316 ? 166.661 18.905 152.342 1.00 20.42  ? 316  LYS A N   1 
ATOM   2435 C CA  . LYS A 1 316 ? 167.763 17.975 152.172 1.00 23.18  ? 316  LYS A CA  1 
ATOM   2436 C C   . LYS A 1 316 ? 169.007 18.745 151.755 1.00 26.01  ? 316  LYS A C   1 
ATOM   2437 O O   . LYS A 1 316 ? 169.062 19.331 150.697 1.00 28.67  ? 316  LYS A O   1 
ATOM   2438 C CB  . LYS A 1 316 ? 167.358 16.860 151.183 1.00 28.11  ? 316  LYS A CB  1 
ATOM   2439 C CG  . LYS A 1 316 ? 166.280 16.027 151.868 1.00 33.14  ? 316  LYS A CG  1 
ATOM   2440 C CD  . LYS A 1 316 ? 165.524 15.123 150.945 1.00 39.36  ? 316  LYS A CD  1 
ATOM   2441 C CE  . LYS A 1 316 ? 164.323 14.578 151.713 1.00 38.67  ? 316  LYS A CE  1 
ATOM   2442 N NZ  . LYS A 1 316 ? 163.140 15.444 151.561 1.00 40.72  ? 316  LYS A NZ  1 
ATOM   2443 N N   . THR A 1 317 ? 170.005 18.784 152.614 1.00 22.04  ? 317  THR A N   1 
ATOM   2444 C CA  . THR A 1 317 ? 171.194 19.578 152.351 1.00 22.94  ? 317  THR A CA  1 
ATOM   2445 C C   . THR A 1 317 ? 172.251 19.025 153.258 1.00 21.91  ? 317  THR A C   1 
ATOM   2446 O O   . THR A 1 317 ? 172.116 17.867 153.653 1.00 22.75  ? 317  THR A O   1 
ATOM   2447 C CB  . THR A 1 317 ? 170.956 21.068 152.529 1.00 23.79  ? 317  THR A CB  1 
ATOM   2448 O OG1 . THR A 1 317 ? 172.135 21.780 152.207 1.00 22.24  ? 317  THR A OG1 1 
ATOM   2449 C CG2 . THR A 1 317 ? 170.449 21.432 154.020 1.00 23.15  ? 317  THR A CG2 1 
ATOM   2450 N N   . GLN A 1 318 ? 173.309 19.783 153.511 1.00 21.64  ? 318  GLN A N   1 
ATOM   2451 C CA  . GLN A 1 318 ? 174.380 19.371 154.369 1.00 21.56  ? 318  GLN A CA  1 
ATOM   2452 C C   . GLN A 1 318 ? 174.135 20.045 155.726 1.00 22.95  ? 318  GLN A C   1 
ATOM   2453 O O   . GLN A 1 318 ? 173.639 21.193 155.783 1.00 20.57  ? 318  GLN A O   1 
ATOM   2454 C CB  . GLN A 1 318 ? 175.786 19.735 153.892 1.00 24.13  ? 318  GLN A CB  1 
ATOM   2455 C CG  . GLN A 1 318 ? 176.208 19.243 152.486 1.00 26.02  ? 318  GLN A CG  1 
ATOM   2456 C CD  . GLN A 1 318 ? 175.559 20.089 151.382 1.00 28.24  ? 318  GLN A CD  1 
ATOM   2457 O OE1 . GLN A 1 318 ? 175.406 21.312 151.509 1.00 27.11  ? 318  GLN A OE1 1 
ATOM   2458 N NE2 . GLN A 1 318 ? 175.098 19.424 150.319 1.00 33.39  ? 318  GLN A NE2 1 
ATOM   2459 N N   . ILE A 1 319 ? 174.442 19.307 156.804 1.00 21.73  ? 319  ILE A N   1 
ATOM   2460 C CA  . ILE A 1 319 ? 174.385 19.857 158.144 1.00 21.27  ? 319  ILE A CA  1 
ATOM   2461 C C   . ILE A 1 319 ? 175.638 19.469 158.912 1.00 19.72  ? 319  ILE A C   1 
ATOM   2462 O O   . ILE A 1 319 ? 176.198 18.394 158.699 1.00 21.23  ? 319  ILE A O   1 
ATOM   2463 C CB  . ILE A 1 319 ? 173.166 19.419 158.941 1.00 21.02  ? 319  ILE A CB  1 
ATOM   2464 C CG1 . ILE A 1 319 ? 173.190 17.912 159.193 1.00 21.43  ? 319  ILE A CG1 1 
ATOM   2465 C CG2 . ILE A 1 319 ? 171.905 19.877 158.340 1.00 21.20  ? 319  ILE A CG2 1 
ATOM   2466 C CD1 . ILE A 1 319 ? 172.030 17.475 160.038 1.00 22.72  ? 319  ILE A CD1 1 
ATOM   2467 N N   . LEU A 1 320 ? 176.095 20.415 159.735 1.00 18.93  ? 320  LEU A N   1 
ATOM   2468 C CA  . LEU A 1 320 ? 177.206 20.228 160.684 1.00 19.46  ? 320  LEU A CA  1 
ATOM   2469 C C   . LEU A 1 320 ? 176.600 20.542 162.057 1.00 20.34  ? 320  LEU A C   1 
ATOM   2470 O O   . LEU A 1 320 ? 175.861 21.506 162.216 1.00 18.28  ? 320  LEU A O   1 
ATOM   2471 C CB  . LEU A 1 320 ? 178.309 21.171 160.372 1.00 20.79  ? 320  LEU A CB  1 
ATOM   2472 C CG  . LEU A 1 320 ? 179.595 21.103 161.157 1.00 21.62  ? 320  LEU A CG  1 
ATOM   2473 C CD1 . LEU A 1 320 ? 180.785 21.524 160.297 1.00 25.20  ? 320  LEU A CD1 1 
ATOM   2474 C CD2 . LEU A 1 320 ? 179.555 21.901 162.411 1.00 20.44  ? 320  LEU A CD2 1 
ATOM   2475 N N   . LEU A 1 321 ? 176.883 19.707 163.038 1.00 23.47  ? 321  LEU A N   1 
ATOM   2476 C CA  . LEU A 1 321 ? 176.171 19.799 164.303 1.00 23.09  ? 321  LEU A CA  1 
ATOM   2477 C C   . LEU A 1 321 ? 176.874 18.986 165.381 1.00 22.76  ? 321  LEU A C   1 
ATOM   2478 O O   . LEU A 1 321 ? 177.767 18.155 165.113 1.00 23.11  ? 321  LEU A O   1 
ATOM   2479 C CB  . LEU A 1 321 ? 174.683 19.422 164.179 1.00 20.10  ? 321  LEU A CB  1 
ATOM   2480 C CG  . LEU A 1 321 ? 174.295 17.962 164.152 1.00 20.19  ? 321  LEU A CG  1 
ATOM   2481 C CD1 . LEU A 1 321 ? 172.801 17.820 164.156 1.00 20.41  ? 321  LEU A CD1 1 
ATOM   2482 C CD2 . LEU A 1 321 ? 174.880 17.235 162.933 1.00 22.14  ? 321  LEU A CD2 1 
ATOM   2483 N N   . GLY A 1 322 ? 176.561 19.358 166.620 1.00 19.61  ? 322  GLY A N   1 
ATOM   2484 C CA  . GLY A 1 322 ? 177.166 18.709 167.757 1.00 18.50  ? 322  GLY A CA  1 
ATOM   2485 C C   . GLY A 1 322 ? 176.712 19.273 169.093 1.00 19.38  ? 322  GLY A C   1 
ATOM   2486 O O   . GLY A 1 322 ? 175.838 20.128 169.161 1.00 19.26  ? 322  GLY A O   1 
ATOM   2487 N N   . VAL A 1 323 ? 177.354 18.757 170.131 1.00 20.05  ? 323  VAL A N   1 
ATOM   2488 C CA  . VAL A 1 323 ? 177.032 19.014 171.528 1.00 20.84  ? 323  VAL A CA  1 
ATOM   2489 C C   . VAL A 1 323 ? 178.302 19.241 172.387 1.00 21.65  ? 323  VAL A C   1 
ATOM   2490 O O   . VAL A 1 323 ? 179.398 18.969 171.950 1.00 21.79  ? 323  VAL A O   1 
ATOM   2491 C CB  . VAL A 1 323 ? 176.218 17.898 172.133 1.00 19.62  ? 323  VAL A CB  1 
ATOM   2492 C CG1 . VAL A 1 323 ? 174.969 17.681 171.338 1.00 20.32  ? 323  VAL A CG1 1 
ATOM   2493 C CG2 . VAL A 1 323 ? 177.057 16.646 172.273 1.00 21.55  ? 323  VAL A CG2 1 
ATOM   2494 N N   . ASN A 1 324 ? 178.131 19.890 173.552 1.00 20.75  ? 324  ASN A N   1 
ATOM   2495 C CA  . ASN A 1 324 ? 179.217 20.055 174.502 1.00 20.79  ? 324  ASN A CA  1 
ATOM   2496 C C   . ASN A 1 324 ? 179.120 18.926 175.521 1.00 20.32  ? 324  ASN A C   1 
ATOM   2497 O O   . ASN A 1 324 ? 178.077 18.372 175.709 1.00 19.99  ? 324  ASN A O   1 
ATOM   2498 C CB  . ASN A 1 324 ? 179.108 21.347 175.213 1.00 20.16  ? 324  ASN A CB  1 
ATOM   2499 C CG  . ASN A 1 324 ? 179.319 22.521 174.300 1.00 22.16  ? 324  ASN A CG  1 
ATOM   2500 O OD1 . ASN A 1 324 ? 179.526 22.386 173.124 1.00 20.82  ? 324  ASN A OD1 1 
ATOM   2501 N ND2 . ASN A 1 324 ? 179.299 23.699 174.878 1.00 23.53  ? 324  ASN A ND2 1 
ATOM   2502 N N   . LYS A 1 325 ? 180.214 18.615 176.189 1.00 20.66  ? 325  LYS A N   1 
ATOM   2503 C CA  . LYS A 1 325 ? 180.228 17.521 177.128 1.00 23.57  ? 325  LYS A CA  1 
ATOM   2504 C C   . LYS A 1 325 ? 179.254 17.660 178.311 1.00 23.76  ? 325  LYS A C   1 
ATOM   2505 O O   . LYS A 1 325 ? 178.604 16.677 178.661 1.00 22.25  ? 325  LYS A O   1 
ATOM   2506 C CB  . LYS A 1 325 ? 181.624 17.288 177.644 1.00 24.59  ? 325  LYS A CB  1 
ATOM   2507 C CG  . LYS A 1 325 ? 181.741 16.054 178.534 1.00 28.46  ? 325  LYS A CG  1 
ATOM   2508 C CD  . LYS A 1 325 ? 183.157 16.038 179.081 1.00 34.89  ? 325  LYS A CD  1 
ATOM   2509 C CE  . LYS A 1 325 ? 183.360 14.907 180.065 1.00 42.29  ? 325  LYS A CE  1 
ATOM   2510 N NZ  . LYS A 1 325 ? 182.125 14.646 180.867 1.00 43.66  ? 325  LYS A NZ  1 
ATOM   2511 N N   . ASP A 1 326 ? 179.141 18.849 178.901 1.00 21.66  ? 326  ASP A N   1 
ATOM   2512 C CA  . ASP A 1 326 ? 178.299 18.976 180.138 1.00 21.71  ? 326  ASP A CA  1 
ATOM   2513 C C   . ASP A 1 326 ? 177.168 19.963 179.948 1.00 22.98  ? 326  ASP A C   1 
ATOM   2514 O O   . ASP A 1 326 ? 177.123 21.056 180.534 1.00 26.28  ? 326  ASP A O   1 
ATOM   2515 C CB  . ASP A 1 326 ? 179.234 19.324 181.338 1.00 21.90  ? 326  ASP A CB  1 
ATOM   2516 C CG  . ASP A 1 326 ? 180.317 18.275 181.506 1.00 21.56  ? 326  ASP A CG  1 
ATOM   2517 O OD1 . ASP A 1 326 ? 179.938 17.081 181.763 1.00 23.67  ? 326  ASP A OD1 1 
ATOM   2518 O OD2 . ASP A 1 326 ? 181.509 18.596 181.310 1.00 23.92  ? 326  ASP A OD2 1 
ATOM   2519 N N   . GLU A 1 327 ? 176.232 19.558 179.102 1.00 25.05  ? 327  GLU A N   1 
ATOM   2520 C CA  . GLU A 1 327 ? 175.150 20.411 178.722 1.00 24.11  ? 327  GLU A CA  1 
ATOM   2521 C C   . GLU A 1 327 ? 174.222 20.724 179.919 1.00 22.62  ? 327  GLU A C   1 
ATOM   2522 O O   . GLU A 1 327 ? 173.694 21.811 179.975 1.00 23.81  ? 327  GLU A O   1 
ATOM   2523 C CB  . GLU A 1 327 ? 174.324 19.767 177.596 1.00 25.48  ? 327  GLU A CB  1 
ATOM   2524 C CG  . GLU A 1 327 ? 175.060 19.550 176.294 1.00 25.59  ? 327  GLU A CG  1 
ATOM   2525 C CD  . GLU A 1 327 ? 175.134 20.815 175.458 1.00 26.72  ? 327  GLU A CD  1 
ATOM   2526 O OE1 . GLU A 1 327 ? 174.692 21.870 175.895 1.00 27.74  ? 327  GLU A OE1 1 
ATOM   2527 O OE2 . GLU A 1 327 ? 175.643 20.755 174.344 1.00 25.14  ? 327  GLU A OE2 1 
ATOM   2528 N N   . GLY A 1 328 ? 174.022 19.773 180.842 1.00 22.16  ? 328  GLY A N   1 
ATOM   2529 C CA  . GLY A 1 328 ? 173.039 19.923 181.921 1.00 20.90  ? 328  GLY A CA  1 
ATOM   2530 C C   . GLY A 1 328 ? 173.384 20.957 183.033 1.00 21.63  ? 328  GLY A C   1 
ATOM   2531 O O   . GLY A 1 328 ? 172.500 21.425 183.766 1.00 22.54  ? 328  GLY A O   1 
ATOM   2532 N N   . SER A 1 329 ? 174.644 21.280 183.200 1.00 22.58  ? 329  SER A N   1 
ATOM   2533 C CA  . SER A 1 329 ? 175.128 21.919 184.461 1.00 21.00  ? 329  SER A CA  1 
ATOM   2534 C C   . SER A 1 329 ? 174.493 23.270 184.748 1.00 22.98  ? 329  SER A C   1 
ATOM   2535 O O   . SER A 1 329 ? 174.023 23.529 185.905 1.00 22.25  ? 329  SER A O   1 
ATOM   2536 C CB  . SER A 1 329 ? 176.625 21.896 184.481 1.00 22.72  ? 329  SER A CB  1 
ATOM   2537 O OG  . SER A 1 329 ? 177.154 22.681 183.453 1.00 24.13  ? 329  SER A OG  1 
ATOM   2538 N N   . PHE A 1 330 ? 174.356 24.115 183.726 1.00 19.71  ? 330  PHE A N   1 
ATOM   2539 C CA  . PHE A 1 330 ? 173.733 25.424 183.891 1.00 21.76  ? 330  PHE A CA  1 
ATOM   2540 C C   . PHE A 1 330 ? 172.353 25.342 184.499 1.00 22.84  ? 330  PHE A C   1 
ATOM   2541 O O   . PHE A 1 330 ? 171.976 26.166 185.336 1.00 23.34  ? 330  PHE A O   1 
ATOM   2542 C CB  . PHE A 1 330 ? 173.606 26.139 182.521 1.00 25.36  ? 330  PHE A CB  1 
ATOM   2543 C CG  . PHE A 1 330 ? 174.399 27.418 182.371 1.00 26.86  ? 330  PHE A CG  1 
ATOM   2544 C CD1 . PHE A 1 330 ? 174.463 28.353 183.385 1.00 30.05  ? 330  PHE A CD1 1 
ATOM   2545 C CD2 . PHE A 1 330 ? 175.017 27.705 181.163 1.00 28.76  ? 330  PHE A CD2 1 
ATOM   2546 C CE1 . PHE A 1 330 ? 175.147 29.532 183.223 1.00 32.10  ? 330  PHE A CE1 1 
ATOM   2547 C CE2 . PHE A 1 330 ? 175.719 28.869 180.990 1.00 33.14  ? 330  PHE A CE2 1 
ATOM   2548 C CZ  . PHE A 1 330 ? 175.795 29.796 182.026 1.00 33.98  ? 330  PHE A CZ  1 
ATOM   2549 N N   . PHE A 1 331 ? 171.578 24.351 184.046 1.00 21.48  ? 331  PHE A N   1 
ATOM   2550 C CA  . PHE A 1 331 ? 170.159 24.229 184.382 1.00 23.57  ? 331  PHE A CA  1 
ATOM   2551 C C   . PHE A 1 331 ? 170.013 23.665 185.760 1.00 22.33  ? 331  PHE A C   1 
ATOM   2552 O O   . PHE A 1 331 ? 169.027 23.940 186.410 1.00 23.80  ? 331  PHE A O   1 
ATOM   2553 C CB  . PHE A 1 331 ? 169.423 23.347 183.302 1.00 23.34  ? 331  PHE A CB  1 
ATOM   2554 C CG  . PHE A 1 331 ? 169.669 23.865 181.908 1.00 24.17  ? 331  PHE A CG  1 
ATOM   2555 C CD1 . PHE A 1 331 ? 170.825 23.523 181.232 1.00 25.09  ? 331  PHE A CD1 1 
ATOM   2556 C CD2 . PHE A 1 331 ? 168.885 24.891 181.409 1.00 25.74  ? 331  PHE A CD2 1 
ATOM   2557 C CE1 . PHE A 1 331 ? 171.107 24.093 180.004 1.00 27.78  ? 331  PHE A CE1 1 
ATOM   2558 C CE2 . PHE A 1 331 ? 169.176 25.465 180.190 1.00 24.92  ? 331  PHE A CE2 1 
ATOM   2559 C CZ  . PHE A 1 331 ? 170.279 25.090 179.496 1.00 24.79  ? 331  PHE A CZ  1 
ATOM   2560 N N   . LEU A 1 332 ? 170.973 22.850 186.197 1.00 21.09  ? 332  LEU A N   1 
ATOM   2561 C CA  . LEU A 1 332 ? 170.982 22.375 187.564 1.00 22.06  ? 332  LEU A CA  1 
ATOM   2562 C C   . LEU A 1 332 ? 171.343 23.508 188.517 1.00 21.07  ? 332  LEU A C   1 
ATOM   2563 O O   . LEU A 1 332 ? 170.666 23.754 189.570 1.00 21.35  ? 332  LEU A O   1 
ATOM   2564 C CB  . LEU A 1 332 ? 171.925 21.160 187.722 1.00 22.42  ? 332  LEU A CB  1 
ATOM   2565 C CG  . LEU A 1 332 ? 171.412 19.913 187.022 1.00 19.87  ? 332  LEU A CG  1 
ATOM   2566 C CD1 . LEU A 1 332 ? 172.543 18.946 186.812 1.00 22.38  ? 332  LEU A CD1 1 
ATOM   2567 C CD2 . LEU A 1 332 ? 170.357 19.270 187.844 1.00 22.12  ? 332  LEU A CD2 1 
ATOM   2568 N N   . LEU A 1 333 ? 172.400 24.225 188.179 1.00 19.78  ? 333  LEU A N   1 
ATOM   2569 C CA  . LEU A 1 333 ? 172.757 25.414 188.941 1.00 20.72  ? 333  LEU A CA  1 
ATOM   2570 C C   . LEU A 1 333 ? 171.601 26.320 189.154 1.00 24.26  ? 333  LEU A C   1 
ATOM   2571 O O   . LEU A 1 333 ? 171.372 26.823 190.253 1.00 22.25  ? 333  LEU A O   1 
ATOM   2572 C CB  . LEU A 1 333 ? 173.866 26.218 188.277 1.00 20.12  ? 333  LEU A CB  1 
ATOM   2573 C CG  . LEU A 1 333 ? 174.224 27.492 189.024 1.00 21.60  ? 333  LEU A CG  1 
ATOM   2574 C CD1 . LEU A 1 333 ? 174.936 27.260 190.413 1.00 19.97  ? 333  LEU A CD1 1 
ATOM   2575 C CD2 . LEU A 1 333 ? 175.157 28.322 188.151 1.00 21.09  ? 333  LEU A CD2 1 
ATOM   2576 N N   . TYR A 1 334 ? 170.926 26.671 188.083 1.00 24.00  ? 334  TYR A N   1 
ATOM   2577 C CA  . TYR A 1 334 ? 169.837 27.623 188.244 1.00 24.43  ? 334  TYR A CA  1 
ATOM   2578 C C   . TYR A 1 334 ? 168.540 26.990 188.802 1.00 28.34  ? 334  TYR A C   1 
ATOM   2579 O O   . TYR A 1 334 ? 167.693 27.678 189.320 1.00 28.22  ? 334  TYR A O   1 
ATOM   2580 C CB  . TYR A 1 334 ? 169.529 28.366 186.930 1.00 24.73  ? 334  TYR A CB  1 
ATOM   2581 C CG  . TYR A 1 334 ? 170.468 29.496 186.659 1.00 21.73  ? 334  TYR A CG  1 
ATOM   2582 C CD1 . TYR A 1 334 ? 171.713 29.257 186.260 1.00 22.36  ? 334  TYR A CD1 1 
ATOM   2583 C CD2 . TYR A 1 334 ? 170.097 30.840 186.921 1.00 22.07  ? 334  TYR A CD2 1 
ATOM   2584 C CE1 . TYR A 1 334 ? 172.632 30.325 186.096 1.00 24.82  ? 334  TYR A CE1 1 
ATOM   2585 C CE2 . TYR A 1 334 ? 170.956 31.887 186.730 1.00 21.80  ? 334  TYR A CE2 1 
ATOM   2586 C CZ  . TYR A 1 334 ? 172.235 31.631 186.265 1.00 24.93  ? 334  TYR A CZ  1 
ATOM   2587 O OH  . TYR A 1 334 ? 173.113 32.684 186.030 1.00 21.93  ? 334  TYR A OH  1 
ATOM   2588 N N   . GLY A 1 335 ? 168.342 25.698 188.676 1.00 26.12  ? 335  GLY A N   1 
ATOM   2589 C CA  . GLY A 1 335 ? 166.994 25.176 188.838 1.00 23.38  ? 335  GLY A CA  1 
ATOM   2590 C C   . GLY A 1 335 ? 166.865 24.105 189.908 1.00 24.96  ? 335  GLY A C   1 
ATOM   2591 O O   . GLY A 1 335 ? 165.745 23.800 190.278 1.00 23.69  ? 335  GLY A O   1 
ATOM   2592 N N   . ALA A 1 336 ? 167.951 23.493 190.384 1.00 23.17  ? 336  ALA A N   1 
ATOM   2593 C CA  . ALA A 1 336 ? 167.770 22.312 191.197 1.00 22.26  ? 336  ALA A CA  1 
ATOM   2594 C C   . ALA A 1 336 ? 168.405 22.527 192.560 1.00 22.90  ? 336  ALA A C   1 
ATOM   2595 O O   . ALA A 1 336 ? 169.471 22.968 192.616 1.00 18.58  ? 336  ALA A O   1 
ATOM   2596 C CB  . ALA A 1 336 ? 168.408 21.095 190.590 1.00 20.57  ? 336  ALA A CB  1 
ATOM   2597 N N   . PRO A 1 337 ? 167.815 21.981 193.627 1.00 27.90  ? 337  PRO A N   1 
ATOM   2598 C CA  . PRO A 1 337 ? 168.383 22.096 194.976 1.00 30.57  ? 337  PRO A CA  1 
ATOM   2599 C C   . PRO A 1 337 ? 169.687 21.336 195.181 1.00 29.96  ? 337  PRO A C   1 
ATOM   2600 O O   . PRO A 1 337 ? 169.809 20.225 194.705 1.00 24.87  ? 337  PRO A O   1 
ATOM   2601 C CB  . PRO A 1 337 ? 167.289 21.499 195.879 1.00 36.51  ? 337  PRO A CB  1 
ATOM   2602 C CG  . PRO A 1 337 ? 166.491 20.601 194.945 1.00 41.85  ? 337  PRO A CG  1 
ATOM   2603 C CD  . PRO A 1 337 ? 166.463 21.397 193.650 1.00 33.04  ? 337  PRO A CD  1 
ATOM   2604 N N   . GLY A 1 338 ? 170.633 21.977 195.905 1.00 27.59  ? 338  GLY A N   1 
ATOM   2605 C CA  . GLY A 1 338 ? 171.937 21.418 196.207 1.00 25.21  ? 338  GLY A CA  1 
ATOM   2606 C C   . GLY A 1 338 ? 173.064 21.783 195.233 1.00 25.72  ? 338  GLY A C   1 
ATOM   2607 O O   . GLY A 1 338 ? 174.205 21.439 195.518 1.00 26.14  ? 338  GLY A O   1 
ATOM   2608 N N   . PHE A 1 339 ? 172.766 22.492 194.116 1.00 26.28  ? 339  PHE A N   1 
ATOM   2609 C CA  . PHE A 1 339 ? 173.788 22.907 193.145 1.00 23.97  ? 339  PHE A CA  1 
ATOM   2610 C C   . PHE A 1 339 ? 173.992 24.365 193.397 1.00 25.30  ? 339  PHE A C   1 
ATOM   2611 O O   . PHE A 1 339 ? 173.063 25.080 193.391 1.00 24.54  ? 339  PHE A O   1 
ATOM   2612 C CB  . PHE A 1 339 ? 173.333 22.686 191.695 1.00 25.13  ? 339  PHE A CB  1 
ATOM   2613 C CG  . PHE A 1 339 ? 173.164 21.223 191.342 1.00 20.57  ? 339  PHE A CG  1 
ATOM   2614 C CD1 . PHE A 1 339 ? 171.985 20.558 191.683 1.00 20.13  ? 339  PHE A CD1 1 
ATOM   2615 C CD2 . PHE A 1 339 ? 174.191 20.517 190.762 1.00 20.90  ? 339  PHE A CD2 1 
ATOM   2616 C CE1 . PHE A 1 339 ? 171.831 19.206 191.429 1.00 21.76  ? 339  PHE A CE1 1 
ATOM   2617 C CE2 . PHE A 1 339 ? 174.061 19.166 190.483 1.00 20.74  ? 339  PHE A CE2 1 
ATOM   2618 C CZ  . PHE A 1 339 ? 172.869 18.496 190.824 1.00 20.27  ? 339  PHE A CZ  1 
ATOM   2619 N N   . SER A 1 340 ? 175.215 24.815 193.657 1.00 24.44  ? 340  SER A N   1 
ATOM   2620 C CA  . SER A 1 340 ? 175.445 26.256 193.824 1.00 26.11  ? 340  SER A CA  1 
ATOM   2621 C C   . SER A 1 340 ? 176.698 26.679 193.139 1.00 24.50  ? 340  SER A C   1 
ATOM   2622 O O   . SER A 1 340 ? 177.572 25.869 192.854 1.00 22.61  ? 340  SER A O   1 
ATOM   2623 C CB  . SER A 1 340 ? 175.600 26.593 195.313 1.00 29.11  ? 340  SER A CB  1 
ATOM   2624 O OG  . SER A 1 340 ? 174.549 26.018 196.029 1.00 34.29  ? 340  SER A OG  1 
ATOM   2625 N N   . LYS A 1 341 ? 176.839 27.963 192.948 1.00 24.68  ? 341  LYS A N   1 
ATOM   2626 C CA  . LYS A 1 341 ? 177.955 28.400 192.164 1.00 26.19  ? 341  LYS A CA  1 
ATOM   2627 C C   . LYS A 1 341 ? 179.309 28.314 192.837 1.00 25.96  ? 341  LYS A C   1 
ATOM   2628 O O   . LYS A 1 341 ? 180.317 28.112 192.132 1.00 24.76  ? 341  LYS A O   1 
ATOM   2629 C CB  . LYS A 1 341 ? 177.740 29.843 191.758 1.00 29.41  ? 341  LYS A CB  1 
ATOM   2630 C CG  . LYS A 1 341 ? 178.821 30.305 190.816 1.00 30.08  ? 341  LYS A CG  1 
ATOM   2631 C CD  . LYS A 1 341 ? 178.419 31.616 190.155 1.00 31.60  ? 341  LYS A CD  1 
ATOM   2632 C CE  . LYS A 1 341 ? 178.796 32.803 191.015 1.00 32.81  ? 341  LYS A CE  1 
ATOM   2633 N NZ  . LYS A 1 341 ? 180.203 32.774 191.499 1.00 36.69  ? 341  LYS A NZ  1 
ATOM   2634 N N   . ASP A 1 342 ? 179.355 28.461 194.172 1.00 22.32  ? 342  ASP A N   1 
ATOM   2635 C CA  . ASP A 1 342 ? 180.634 28.538 194.907 1.00 22.90  ? 342  ASP A CA  1 
ATOM   2636 C C   . ASP A 1 342 ? 180.897 27.295 195.737 1.00 24.66  ? 342  ASP A C   1 
ATOM   2637 O O   . ASP A 1 342 ? 181.751 27.254 196.563 1.00 21.39  ? 342  ASP A O   1 
ATOM   2638 C CB  . ASP A 1 342 ? 180.723 29.804 195.766 1.00 25.02  ? 342  ASP A CB  1 
ATOM   2639 C CG  . ASP A 1 342 ? 180.408 31.086 194.981 1.00 28.96  ? 342  ASP A CG  1 
ATOM   2640 O OD1 . ASP A 1 342 ? 180.576 31.062 193.737 1.00 27.95  ? 342  ASP A OD1 1 
ATOM   2641 O OD2 . ASP A 1 342 ? 180.001 32.113 195.617 1.00 33.49  ? 342  ASP A OD2 1 
ATOM   2642 N N   . SER A 1 343 ? 180.128 26.262 195.499 1.00 27.37  ? 343  SER A N   1 
ATOM   2643 C CA  . SER A 1 343 ? 180.325 24.988 196.144 1.00 25.53  ? 343  SER A CA  1 
ATOM   2644 C C   . SER A 1 343 ? 180.564 23.944 195.063 1.00 27.96  ? 343  SER A C   1 
ATOM   2645 O O   . SER A 1 343 ? 180.023 24.042 193.970 1.00 23.98  ? 343  SER A O   1 
ATOM   2646 C CB  . SER A 1 343 ? 179.014 24.666 196.832 1.00 26.00  ? 343  SER A CB  1 
ATOM   2647 O OG  . SER A 1 343 ? 178.962 23.319 197.157 1.00 31.40  ? 343  SER A OG  1 
ATOM   2648 N N   . GLU A 1 344 ? 181.265 22.910 195.434 1.00 28.10  ? 344  GLU A N   1 
ATOM   2649 C CA  . GLU A 1 344 ? 181.458 21.700 194.642 1.00 31.42  ? 344  GLU A CA  1 
ATOM   2650 C C   . GLU A 1 344 ? 180.156 20.958 194.394 1.00 28.19  ? 344  GLU A C   1 
ATOM   2651 O O   . GLU A 1 344 ? 180.108 20.055 193.570 1.00 25.04  ? 344  GLU A O   1 
ATOM   2652 C CB  . GLU A 1 344 ? 182.365 20.727 195.406 1.00 35.04  ? 344  GLU A CB  1 
ATOM   2653 C CG  . GLU A 1 344 ? 183.824 21.045 195.314 1.00 46.28  ? 344  GLU A CG  1 
ATOM   2654 C CD  . GLU A 1 344 ? 184.720 20.019 196.071 1.00 58.45  ? 344  GLU A CD  1 
ATOM   2655 O OE1 . GLU A 1 344 ? 184.386 18.797 196.115 1.00 51.56  ? 344  GLU A OE1 1 
ATOM   2656 O OE2 . GLU A 1 344 ? 185.773 20.454 196.620 1.00 58.78  ? 344  GLU A OE2 1 
ATOM   2657 N N   . SER A 1 345 ? 179.128 21.297 195.160 1.00 24.57  ? 345  SER A N   1 
ATOM   2658 C CA  . SER A 1 345 ? 177.790 20.832 194.918 1.00 24.27  ? 345  SER A CA  1 
ATOM   2659 C C   . SER A 1 345 ? 177.706 19.310 194.868 1.00 28.88  ? 345  SER A C   1 
ATOM   2660 O O   . SER A 1 345 ? 176.978 18.719 194.027 1.00 25.00  ? 345  SER A O   1 
ATOM   2661 C CB  . SER A 1 345 ? 177.247 21.405 193.619 1.00 24.67  ? 345  SER A CB  1 
ATOM   2662 O OG  . SER A 1 345 ? 177.311 22.811 193.576 1.00 25.97  ? 345  SER A OG  1 
ATOM   2663 N N   . LYS A 1 346 ? 178.309 18.653 195.857 1.00 28.23  ? 346  LYS A N   1 
ATOM   2664 C CA  . LYS A 1 346 ? 178.065 17.234 196.028 1.00 29.33  ? 346  LYS A CA  1 
ATOM   2665 C C   . LYS A 1 346 ? 176.631 17.036 196.472 1.00 28.66  ? 346  LYS A C   1 
ATOM   2666 O O   . LYS A 1 346 ? 176.109 17.787 197.223 1.00 33.07  ? 346  LYS A O   1 
ATOM   2667 C CB  . LYS A 1 346 ? 179.003 16.681 197.063 1.00 36.81  ? 346  LYS A CB  1 
ATOM   2668 C CG  . LYS A 1 346 ? 180.441 16.792 196.614 1.00 40.36  ? 346  LYS A CG  1 
ATOM   2669 C CD  . LYS A 1 346 ? 181.372 16.254 197.690 1.00 49.59  ? 346  LYS A CD  1 
ATOM   2670 C CE  . LYS A 1 346 ? 182.694 17.001 197.637 1.00 60.10  ? 346  LYS A CE  1 
ATOM   2671 N NZ  . LYS A 1 346 ? 183.719 16.563 198.640 1.00 66.26  ? 346  LYS A NZ  1 
ATOM   2672 N N   . ILE A 1 347 ? 175.969 16.025 195.955 1.00 28.77  ? 347  ILE A N   1 
ATOM   2673 C CA  . ILE A 1 347 ? 174.553 15.893 196.072 1.00 29.84  ? 347  ILE A CA  1 
ATOM   2674 C C   . ILE A 1 347 ? 174.208 14.611 196.890 1.00 30.62  ? 347  ILE A C   1 
ATOM   2675 O O   . ILE A 1 347 ? 174.664 13.541 196.570 1.00 27.62  ? 347  ILE A O   1 
ATOM   2676 C CB  . ILE A 1 347 ? 173.984 15.736 194.624 1.00 30.70  ? 347  ILE A CB  1 
ATOM   2677 C CG1 . ILE A 1 347 ? 174.209 17.013 193.856 1.00 33.41  ? 347  ILE A CG1 1 
ATOM   2678 C CG2 . ILE A 1 347 ? 172.533 15.405 194.615 1.00 33.51  ? 347  ILE A CG2 1 
ATOM   2679 C CD1 . ILE A 1 347 ? 173.546 18.207 194.481 1.00 36.81  ? 347  ILE A CD1 1 
ATOM   2680 N N   . SER A 1 348 ? 173.333 14.778 197.878 1.00 34.94  ? 348  SER A N   1 
ATOM   2681 C CA  . SER A 1 348 ? 172.769 13.706 198.692 1.00 41.15  ? 348  SER A CA  1 
ATOM   2682 C C   . SER A 1 348 ? 171.840 12.882 197.849 1.00 48.98  ? 348  SER A C   1 
ATOM   2683 O O   . SER A 1 348 ? 171.318 13.418 196.861 1.00 45.23  ? 348  SER A O   1 
ATOM   2684 C CB  . SER A 1 348 ? 171.963 14.360 199.836 1.00 41.91  ? 348  SER A CB  1 
ATOM   2685 O OG  . SER A 1 348 ? 171.105 15.446 199.415 1.00 40.15  ? 348  SER A OG  1 
ATOM   2686 N N   . ARG A 1 349 ? 171.656 11.605 198.191 1.00 49.12  ? 349  ARG A N   1 
ATOM   2687 C CA  . ARG A 1 349 ? 170.618 10.766 197.580 1.00 54.73  ? 349  ARG A CA  1 
ATOM   2688 C C   . ARG A 1 349 ? 169.308 11.514 197.435 1.00 48.07  ? 349  ARG A C   1 
ATOM   2689 O O   . ARG A 1 349 ? 168.629 11.352 196.452 1.00 47.39  ? 349  ARG A O   1 
ATOM   2690 C CB  . ARG A 1 349 ? 170.324 9.509  198.399 1.00 59.42  ? 349  ARG A CB  1 
ATOM   2691 C CG  . ARG A 1 349 ? 171.089 8.247  197.977 1.00 68.58  ? 349  ARG A CG  1 
ATOM   2692 C CD  . ARG A 1 349 ? 170.519 7.517  196.739 1.00 68.56  ? 349  ARG A CD  1 
ATOM   2693 N NE  . ARG A 1 349 ? 171.390 7.735  195.581 1.00 71.21  ? 349  ARG A NE  1 
ATOM   2694 C CZ  . ARG A 1 349 ? 171.177 7.310  194.335 1.00 62.56  ? 349  ARG A CZ  1 
ATOM   2695 N NH1 . ARG A 1 349 ? 172.087 7.596  193.415 1.00 56.07  ? 349  ARG A NH1 1 
ATOM   2696 N NH2 . ARG A 1 349 ? 170.087 6.612  193.998 1.00 63.39  ? 349  ARG A NH2 1 
ATOM   2697 N N   . GLU A 1 350 ? 168.963 12.336 198.405 1.00 41.43  ? 350  GLU A N   1 
ATOM   2698 C CA  . GLU A 1 350 ? 167.662 12.963 198.433 1.00 51.38  ? 350  GLU A CA  1 
ATOM   2699 C C   . GLU A 1 350 ? 167.643 14.124 197.458 1.00 49.42  ? 350  GLU A C   1 
ATOM   2700 O O   . GLU A 1 350 ? 166.592 14.428 196.851 1.00 39.99  ? 350  GLU A O   1 
ATOM   2701 C CB  . GLU A 1 350 ? 167.277 13.525 199.827 1.00 64.97  ? 350  GLU A CB  1 
ATOM   2702 C CG  . GLU A 1 350 ? 167.274 12.501 200.977 1.00 81.82  ? 350  GLU A CG  1 
ATOM   2703 C CD  . GLU A 1 350 ? 168.678 12.121 201.484 1.00 85.97  ? 350  GLU A CD  1 
ATOM   2704 O OE1 . GLU A 1 350 ? 169.470 13.029 201.885 1.00 75.97  ? 350  GLU A OE1 1 
ATOM   2705 O OE2 . GLU A 1 350 ? 168.985 10.899 201.453 1.00 91.29  ? 350  GLU A OE2 1 
ATOM   2706 N N   . ASP A 1 351 ? 168.765 14.821 197.312 1.00 42.04  ? 351  ASP A N   1 
ATOM   2707 C CA  . ASP A 1 351 ? 168.758 15.875 196.322 1.00 43.17  ? 351  ASP A CA  1 
ATOM   2708 C C   . ASP A 1 351 ? 168.850 15.225 194.895 1.00 36.72  ? 351  ASP A C   1 
ATOM   2709 O O   . ASP A 1 351 ? 168.301 15.774 193.976 1.00 34.29  ? 351  ASP A O   1 
ATOM   2710 C CB  . ASP A 1 351 ? 169.792 16.976 196.624 1.00 47.18  ? 351  ASP A CB  1 
ATOM   2711 C CG  . ASP A 1 351 ? 169.270 18.047 197.627 1.00 53.23  ? 351  ASP A CG  1 
ATOM   2712 O OD1 . ASP A 1 351 ? 168.030 18.144 197.914 1.00 56.68  ? 351  ASP A OD1 1 
ATOM   2713 O OD2 . ASP A 1 351 ? 170.128 18.821 198.105 1.00 47.44  ? 351  ASP A OD2 1 
ATOM   2714 N N   . PHE A 1 352 ? 169.445 14.041 194.769 1.00 31.41  ? 352  PHE A N   1 
ATOM   2715 C CA  . PHE A 1 352 ? 169.501 13.289 193.513 1.00 33.25  ? 352  PHE A CA  1 
ATOM   2716 C C   . PHE A 1 352 ? 168.093 12.924 193.091 1.00 38.37  ? 352  PHE A C   1 
ATOM   2717 O O   . PHE A 1 352 ? 167.707 13.155 191.964 1.00 32.62  ? 352  PHE A O   1 
ATOM   2718 C CB  . PHE A 1 352 ? 170.293 12.001 193.661 1.00 27.70  ? 352  PHE A CB  1 
ATOM   2719 C CG  . PHE A 1 352 ? 170.473 11.257 192.376 1.00 28.22  ? 352  PHE A CG  1 
ATOM   2720 C CD1 . PHE A 1 352 ? 171.383 11.675 191.450 1.00 25.52  ? 352  PHE A CD1 1 
ATOM   2721 C CD2 . PHE A 1 352 ? 169.692 10.190 192.082 1.00 26.99  ? 352  PHE A CD2 1 
ATOM   2722 C CE1 . PHE A 1 352 ? 171.526 11.039 190.260 1.00 25.49  ? 352  PHE A CE1 1 
ATOM   2723 C CE2 . PHE A 1 352 ? 169.803 9.571  190.901 1.00 26.96  ? 352  PHE A CE2 1 
ATOM   2724 C CZ  . PHE A 1 352 ? 170.759 9.968  189.984 1.00 27.03  ? 352  PHE A CZ  1 
ATOM   2725 N N   . MET A 1 353 ? 167.325 12.348 194.006 1.00 39.92  ? 353  MET A N   1 
ATOM   2726 C CA  . MET A 1 353 ? 165.999 11.924 193.664 1.00 42.47  ? 353  MET A CA  1 
ATOM   2727 C C   . MET A 1 353 ? 165.037 13.060 193.352 1.00 40.96  ? 353  MET A C   1 
ATOM   2728 O O   . MET A 1 353 ? 164.181 12.899 192.474 1.00 35.88  ? 353  MET A O   1 
ATOM   2729 C CB  . MET A 1 353 ? 165.450 10.955 194.695 1.00 50.15  ? 353  MET A CB  1 
ATOM   2730 C CG  . MET A 1 353 ? 165.974 9.561  194.368 1.00 63.01  ? 353  MET A CG  1 
ATOM   2731 S SD  . MET A 1 353 ? 165.937 8.401  195.727 1.00 91.96  ? 353  MET A SD  1 
ATOM   2732 C CE  . MET A 1 353 ? 166.703 7.007  194.882 1.00 91.26  ? 353  MET A CE  1 
ATOM   2733 N N   . SER A 1 354 ? 165.202 14.178 194.033 1.00 35.71  ? 354  SER A N   1 
ATOM   2734 C CA  . SER A 1 354 ? 164.473 15.362 193.727 1.00 43.75  ? 354  SER A CA  1 
ATOM   2735 C C   . SER A 1 354 ? 164.857 15.867 192.341 1.00 36.72  ? 354  SER A C   1 
ATOM   2736 O O   . SER A 1 354 ? 164.010 16.345 191.628 1.00 30.46  ? 354  SER A O   1 
ATOM   2737 C CB  . SER A 1 354 ? 164.837 16.512 194.685 1.00 46.63  ? 354  SER A CB  1 
ATOM   2738 O OG  . SER A 1 354 ? 164.145 16.404 195.877 1.00 58.19  ? 354  SER A OG  1 
ATOM   2739 N N   . GLY A 1 355 ? 166.164 15.898 192.081 1.00 29.65  ? 355  GLY A N   1 
ATOM   2740 C CA  . GLY A 1 355 ? 166.729 16.340 190.828 1.00 28.89  ? 355  GLY A CA  1 
ATOM   2741 C C   . GLY A 1 355 ? 166.152 15.533 189.658 1.00 25.80  ? 355  GLY A C   1 
ATOM   2742 O O   . GLY A 1 355 ? 165.786 16.110 188.669 1.00 27.70  ? 355  GLY A O   1 
ATOM   2743 N N   . VAL A 1 356 ? 166.019 14.234 189.846 1.00 22.21  ? 356  VAL A N   1 
ATOM   2744 C CA  . VAL A 1 356 ? 165.507 13.348 188.817 1.00 25.87  ? 356  VAL A CA  1 
ATOM   2745 C C   . VAL A 1 356 ? 164.109 13.705 188.475 1.00 27.26  ? 356  VAL A C   1 
ATOM   2746 O O   . VAL A 1 356 ? 163.743 13.830 187.288 1.00 22.24  ? 356  VAL A O   1 
ATOM   2747 C CB  . VAL A 1 356 ? 165.595 11.881 189.202 1.00 24.22  ? 356  VAL A CB  1 
ATOM   2748 C CG1 . VAL A 1 356 ? 164.875 11.059 188.196 1.00 27.26  ? 356  VAL A CG1 1 
ATOM   2749 C CG2 . VAL A 1 356 ? 167.036 11.463 189.171 1.00 28.43  ? 356  VAL A CG2 1 
ATOM   2750 N N   . LYS A 1 357 ? 163.324 13.912 189.514 1.00 26.22  ? 357  LYS A N   1 
ATOM   2751 C CA  . LYS A 1 357 ? 161.953 14.312 189.311 1.00 29.36  ? 357  LYS A CA  1 
ATOM   2752 C C   . LYS A 1 357 ? 161.767 15.672 188.626 1.00 25.68  ? 357  LYS A C   1 
ATOM   2753 O O   . LYS A 1 357 ? 160.869 15.798 187.816 1.00 24.78  ? 357  LYS A O   1 
ATOM   2754 C CB  . LYS A 1 357 ? 161.186 14.337 190.634 1.00 32.77  ? 357  LYS A CB  1 
ATOM   2755 C CG  . LYS A 1 357 ? 159.676 14.281 190.382 1.00 36.41  ? 357  LYS A CG  1 
ATOM   2756 C CD  . LYS A 1 357 ? 158.826 14.183 191.630 1.00 44.73  ? 357  LYS A CD  1 
ATOM   2757 C CE  . LYS A 1 357 ? 157.344 14.315 191.265 1.00 49.53  ? 357  LYS A CE  1 
ATOM   2758 N NZ  . LYS A 1 357 ? 156.695 12.970 191.191 1.00 54.68  ? 357  LYS A NZ  1 
ATOM   2759 N N   . LEU A 1 358 ? 162.556 16.680 189.006 1.00 22.16  ? 358  LEU A N   1 
ATOM   2760 C CA  . LEU A 1 358 ? 162.629 17.927 188.260 1.00 26.10  ? 358  LEU A CA  1 
ATOM   2761 C C   . LEU A 1 358 ? 163.096 17.805 186.761 1.00 25.34  ? 358  LEU A C   1 
ATOM   2762 O O   . LEU A 1 358 ? 162.673 18.583 185.906 1.00 27.08  ? 358  LEU A O   1 
ATOM   2763 C CB  . LEU A 1 358 ? 163.601 18.887 188.937 1.00 27.50  ? 358  LEU A CB  1 
ATOM   2764 C CG  . LEU A 1 358 ? 163.218 19.458 190.300 1.00 28.96  ? 358  LEU A CG  1 
ATOM   2765 C CD1 . LEU A 1 358 ? 164.333 20.289 190.894 1.00 26.52  ? 358  LEU A CD1 1 
ATOM   2766 C CD2 . LEU A 1 358 ? 161.987 20.343 190.163 1.00 29.28  ? 358  LEU A CD2 1 
ATOM   2767 N N   . SER A 1 359 ? 164.000 16.859 186.497 1.00 24.09  ? 359  SER A N   1 
ATOM   2768 C CA  . SER A 1 359 ? 164.599 16.658 185.193 1.00 24.46  ? 359  SER A CA  1 
ATOM   2769 C C   . SER A 1 359 ? 163.644 16.019 184.175 1.00 25.81  ? 359  SER A C   1 
ATOM   2770 O O   . SER A 1 359 ? 163.712 16.314 183.008 1.00 30.14  ? 359  SER A O   1 
ATOM   2771 C CB  . SER A 1 359 ? 165.818 15.787 185.375 1.00 24.05  ? 359  SER A CB  1 
ATOM   2772 O OG  . SER A 1 359 ? 166.801 16.546 186.070 1.00 26.61  ? 359  SER A OG  1 
ATOM   2773 N N   . VAL A 1 360 ? 162.733 15.180 184.636 1.00 25.66  ? 360  VAL A N   1 
ATOM   2774 C CA  . VAL A 1 360 ? 161.839 14.472 183.794 1.00 26.56  ? 360  VAL A CA  1 
ATOM   2775 C C   . VAL A 1 360 ? 160.414 14.680 184.295 1.00 26.61  ? 360  VAL A C   1 
ATOM   2776 O O   . VAL A 1 360 ? 159.765 13.754 184.820 1.00 26.42  ? 360  VAL A O   1 
ATOM   2777 C CB  . VAL A 1 360 ? 162.166 12.975 183.834 1.00 28.92  ? 360  VAL A CB  1 
ATOM   2778 C CG1 . VAL A 1 360 ? 161.526 12.310 182.664 1.00 32.15  ? 360  VAL A CG1 1 
ATOM   2779 C CG2 . VAL A 1 360 ? 163.656 12.741 183.781 1.00 30.80  ? 360  VAL A CG2 1 
ATOM   2780 N N   . PRO A 1 361 ? 159.869 15.872 184.066 1.00 30.40  ? 361  PRO A N   1 
ATOM   2781 C CA  . PRO A 1 361 ? 158.640 16.250 184.783 1.00 34.18  ? 361  PRO A CA  1 
ATOM   2782 C C   . PRO A 1 361 ? 157.387 15.458 184.391 1.00 31.87  ? 361  PRO A C   1 
ATOM   2783 O O   . PRO A 1 361 ? 156.484 15.216 185.178 1.00 36.09  ? 361  PRO A O   1 
ATOM   2784 C CB  . PRO A 1 361 ? 158.504 17.732 184.407 1.00 36.61  ? 361  PRO A CB  1 
ATOM   2785 C CG  . PRO A 1 361 ? 159.341 17.917 183.172 1.00 36.69  ? 361  PRO A CG  1 
ATOM   2786 C CD  . PRO A 1 361 ? 160.505 17.039 183.444 1.00 33.25  ? 361  PRO A CD  1 
ATOM   2787 N N   . HIS A 1 362 ? 157.351 15.047 183.151 1.00 39.06  ? 362  HIS A N   1 
ATOM   2788 C CA  . HIS A 1 362 ? 156.233 14.276 182.636 1.00 53.65  ? 362  HIS A CA  1 
ATOM   2789 C C   . HIS A 1 362 ? 156.240 12.758 183.034 1.00 51.79  ? 362  HIS A C   1 
ATOM   2790 O O   . HIS A 1 362 ? 155.485 11.992 182.435 1.00 48.71  ? 362  HIS A O   1 
ATOM   2791 C CB  . HIS A 1 362 ? 156.239 14.416 181.096 1.00 60.25  ? 362  HIS A CB  1 
ATOM   2792 C CG  . HIS A 1 362 ? 157.542 14.018 180.459 1.00 68.85  ? 362  HIS A CG  1 
ATOM   2793 N ND1 . HIS A 1 362 ? 158.648 14.855 180.423 1.00 72.62  ? 362  HIS A ND1 1 
ATOM   2794 C CD2 . HIS A 1 362 ? 157.918 12.867 179.842 1.00 65.78  ? 362  HIS A CD2 1 
ATOM   2795 C CE1 . HIS A 1 362 ? 159.641 14.231 179.810 1.00 72.48  ? 362  HIS A CE1 1 
ATOM   2796 N NE2 . HIS A 1 362 ? 159.222 13.029 179.436 1.00 66.22  ? 362  HIS A NE2 1 
ATOM   2797 N N   . ALA A 1 363 ? 157.076 12.325 184.002 1.00 45.47  ? 363  ALA A N   1 
ATOM   2798 C CA  . ALA A 1 363 ? 157.337 10.896 184.187 1.00 38.87  ? 363  ALA A CA  1 
ATOM   2799 C C   . ALA A 1 363 ? 156.566 10.390 185.348 1.00 33.63  ? 363  ALA A C   1 
ATOM   2800 O O   . ALA A 1 363 ? 156.585 10.990 186.353 1.00 32.23  ? 363  ALA A O   1 
ATOM   2801 C CB  . ALA A 1 363 ? 158.813 10.613 184.424 1.00 38.92  ? 363  ALA A CB  1 
ATOM   2802 N N   . ASN A 1 364 ? 155.919 9.246  185.203 1.00 30.08  ? 364  ASN A N   1 
ATOM   2803 C CA  . ASN A 1 364 ? 155.356 8.567  186.353 1.00 31.30  ? 364  ASN A CA  1 
ATOM   2804 C C   . ASN A 1 364 ? 156.456 7.896  187.210 1.00 31.23  ? 364  ASN A C   1 
ATOM   2805 O O   . ASN A 1 364 ? 157.656 7.974  186.901 1.00 29.55  ? 364  ASN A O   1 
ATOM   2806 C CB  . ASN A 1 364 ? 154.328 7.575  185.869 1.00 32.26  ? 364  ASN A CB  1 
ATOM   2807 C CG  . ASN A 1 364 ? 154.935 6.471  185.023 1.00 33.09  ? 364  ASN A CG  1 
ATOM   2808 O OD1 . ASN A 1 364 ? 156.160 6.273  184.982 1.00 32.23  ? 364  ASN A OD1 1 
ATOM   2809 N ND2 . ASN A 1 364 ? 154.097 5.743  184.363 1.00 34.27  ? 364  ASN A ND2 1 
ATOM   2810 N N   . ASP A 1 365 ? 156.071 7.309  188.331 1.00 30.61  ? 365  ASP A N   1 
ATOM   2811 C CA  . ASP A 1 365 ? 157.046 6.803  189.250 1.00 32.18  ? 365  ASP A CA  1 
ATOM   2812 C C   . ASP A 1 365 ? 157.946 5.741  188.647 1.00 27.46  ? 365  ASP A C   1 
ATOM   2813 O O   . ASP A 1 365 ? 159.126 5.680  188.967 1.00 28.50  ? 365  ASP A O   1 
ATOM   2814 C CB  . ASP A 1 365 ? 156.405 6.231  190.543 1.00 43.46  ? 365  ASP A CB  1 
ATOM   2815 C CG  . ASP A 1 365 ? 156.010 7.351  191.553 1.00 56.11  ? 365  ASP A CG  1 
ATOM   2816 O OD1 . ASP A 1 365 ? 156.267 8.552  191.264 1.00 62.97  ? 365  ASP A OD1 1 
ATOM   2817 O OD2 . ASP A 1 365 ? 155.450 7.036  192.634 1.00 64.30  ? 365  ASP A OD2 1 
ATOM   2818 N N   . LEU A 1 366 ? 157.385 4.880  187.843 1.00 27.44  ? 366  LEU A N   1 
ATOM   2819 C CA  . LEU A 1 366 ? 158.170 3.802  187.247 1.00 28.00  ? 366  LEU A CA  1 
ATOM   2820 C C   . LEU A 1 366 ? 159.217 4.419  186.318 1.00 26.85  ? 366  LEU A C   1 
ATOM   2821 O O   . LEU A 1 366 ? 160.359 3.983  186.264 1.00 26.85  ? 366  LEU A O   1 
ATOM   2822 C CB  . LEU A 1 366 ? 157.261 2.869  186.476 1.00 30.14  ? 366  LEU A CB  1 
ATOM   2823 C CG  . LEU A 1 366 ? 157.990 1.717  185.771 1.00 33.91  ? 366  LEU A CG  1 
ATOM   2824 C CD1 . LEU A 1 366 ? 158.524 0.744  186.816 1.00 35.74  ? 366  LEU A CD1 1 
ATOM   2825 C CD2 . LEU A 1 366 ? 156.997 1.052  184.868 1.00 31.91  ? 366  LEU A CD2 1 
ATOM   2826 N N   . GLY A 1 367 ? 158.816 5.470  185.620 1.00 25.15  ? 367  GLY A N   1 
ATOM   2827 C CA  . GLY A 1 367 ? 159.717 6.198  184.710 1.00 24.77  ? 367  GLY A CA  1 
ATOM   2828 C C   . GLY A 1 367 ? 160.833 6.815  185.500 1.00 23.24  ? 367  GLY A C   1 
ATOM   2829 O O   . GLY A 1 367 ? 161.976 6.667  185.125 1.00 23.13  ? 367  GLY A O   1 
ATOM   2830 N N   . LEU A 1 368 ? 160.511 7.429  186.656 1.00 25.11  ? 368  LEU A N   1 
ATOM   2831 C CA  . LEU A 1 368 ? 161.553 7.952  187.521 1.00 23.49  ? 368  LEU A CA  1 
ATOM   2832 C C   . LEU A 1 368 ? 162.492 6.870  188.017 1.00 25.19  ? 368  LEU A C   1 
ATOM   2833 O O   . LEU A 1 368 ? 163.714 7.124  188.078 1.00 24.84  ? 368  LEU A O   1 
ATOM   2834 C CB  . LEU A 1 368 ? 160.981 8.714  188.706 1.00 26.68  ? 368  LEU A CB  1 
ATOM   2835 C CG  . LEU A 1 368 ? 160.108 9.941  188.339 1.00 31.43  ? 368  LEU A CG  1 
ATOM   2836 C CD1 . LEU A 1 368 ? 159.336 10.494 189.531 1.00 32.77  ? 368  LEU A CD1 1 
ATOM   2837 C CD2 . LEU A 1 368 ? 160.898 11.042 187.693 1.00 32.34  ? 368  LEU A CD2 1 
ATOM   2838 N N   . ASP A 1 369 ? 161.958 5.676  188.372 1.00 24.66  ? 369  ASP A N   1 
ATOM   2839 C CA  . ASP A 1 369 ? 162.839 4.582  188.792 1.00 25.78  ? 369  ASP A CA  1 
ATOM   2840 C C   . ASP A 1 369 ? 163.737 4.131  187.596 1.00 22.55  ? 369  ASP A C   1 
ATOM   2841 O O   . ASP A 1 369 ? 164.920 3.757  187.796 1.00 20.39  ? 369  ASP A O   1 
ATOM   2842 C CB  . ASP A 1 369 ? 162.062 3.336  189.275 1.00 31.09  ? 369  ASP A CB  1 
ATOM   2843 C CG  . ASP A 1 369 ? 161.292 3.546  190.587 1.00 39.34  ? 369  ASP A CG  1 
ATOM   2844 O OD1 . ASP A 1 369 ? 161.573 4.469  191.377 1.00 39.36  ? 369  ASP A OD1 1 
ATOM   2845 O OD2 . ASP A 1 369 ? 160.400 2.717  190.835 1.00 49.71  ? 369  ASP A OD2 1 
ATOM   2846 N N   . ALA A 1 370 ? 163.189 4.149  186.372 1.00 19.73  ? 370  ALA A N   1 
ATOM   2847 C CA  . ALA A 1 370 ? 164.011 3.758  185.210 1.00 20.35  ? 370  ALA A CA  1 
ATOM   2848 C C   . ALA A 1 370 ? 165.167 4.691  185.016 1.00 18.84  ? 370  ALA A C   1 
ATOM   2849 O O   . ALA A 1 370 ? 166.275 4.247  184.807 1.00 20.74  ? 370  ALA A O   1 
ATOM   2850 C CB  . ALA A 1 370 ? 163.198 3.619  183.928 1.00 20.35  ? 370  ALA A CB  1 
ATOM   2851 N N   . VAL A 1 371 ? 164.954 5.978  185.148 1.00 21.25  ? 371  VAL A N   1 
ATOM   2852 C CA  . VAL A 1 371 ? 166.035 6.956  184.925 1.00 19.49  ? 371  VAL A CA  1 
ATOM   2853 C C   . VAL A 1 371 ? 167.077 6.803  186.024 1.00 21.17  ? 371  VAL A C   1 
ATOM   2854 O O   . VAL A 1 371 ? 168.293 6.766  185.775 1.00 23.13  ? 371  VAL A O   1 
ATOM   2855 C CB  . VAL A 1 371 ? 165.479 8.419  184.978 1.00 19.40  ? 371  VAL A CB  1 
ATOM   2856 C CG1 . VAL A 1 371 ? 166.580 9.416  184.988 1.00 19.40  ? 371  VAL A CG1 1 
ATOM   2857 C CG2 . VAL A 1 371 ? 164.490 8.733  183.838 1.00 21.84  ? 371  VAL A CG2 1 
ATOM   2858 N N   . THR A 1 372 ? 166.595 6.666  187.246 1.00 21.52  ? 372  THR A N   1 
ATOM   2859 C CA  . THR A 1 372 ? 167.477 6.463  188.421 1.00 25.01  ? 372  THR A CA  1 
ATOM   2860 C C   . THR A 1 372 ? 168.351 5.265  188.290 1.00 27.57  ? 372  THR A C   1 
ATOM   2861 O O   . THR A 1 372 ? 169.574 5.353  188.443 1.00 25.42  ? 372  THR A O   1 
ATOM   2862 C CB  . THR A 1 372 ? 166.628 6.331  189.688 1.00 28.23  ? 372  THR A CB  1 
ATOM   2863 O OG1 . THR A 1 372 ? 165.927 7.525  189.797 1.00 27.39  ? 372  THR A OG1 1 
ATOM   2864 C CG2 . THR A 1 372 ? 167.437 6.111  191.009 1.00 28.25  ? 372  THR A CG2 1 
ATOM   2865 N N   . LEU A 1 373 ? 167.745 4.146  187.898 1.00 29.80  ? 373  LEU A N   1 
ATOM   2866 C CA  . LEU A 1 373 ? 168.527 2.952  187.642 1.00 28.63  ? 373  LEU A CA  1 
ATOM   2867 C C   . LEU A 1 373 ? 169.571 3.142  186.573 1.00 28.24  ? 373  LEU A C   1 
ATOM   2868 O O   . LEU A 1 373 ? 170.675 2.638  186.649 1.00 27.10  ? 373  LEU A O   1 
ATOM   2869 C CB  . LEU A 1 373 ? 167.590 1.819  187.176 1.00 31.93  ? 373  LEU A CB  1 
ATOM   2870 C CG  . LEU A 1 373 ? 168.186 0.427  187.139 1.00 33.97  ? 373  LEU A CG  1 
ATOM   2871 C CD1 . LEU A 1 373 ? 168.393 -0.109 188.530 1.00 36.64  ? 373  LEU A CD1 1 
ATOM   2872 C CD2 . LEU A 1 373 ? 167.193 -0.483 186.450 1.00 40.46  ? 373  LEU A CD2 1 
ATOM   2873 N N   . GLN A 1 374 ? 169.189 3.818  185.494 1.00 28.42  ? 374  GLN A N   1 
ATOM   2874 C CA  . GLN A 1 374 ? 170.076 3.959  184.362 1.00 26.95  ? 374  GLN A CA  1 
ATOM   2875 C C   . GLN A 1 374 ? 171.333 4.764  184.741 1.00 25.16  ? 374  GLN A C   1 
ATOM   2876 O O   . GLN A 1 374 ? 172.383 4.586  184.164 1.00 23.35  ? 374  GLN A O   1 
ATOM   2877 C CB  . GLN A 1 374 ? 169.304 4.677  183.219 1.00 30.07  ? 374  GLN A CB  1 
ATOM   2878 C CG  . GLN A 1 374 ? 170.128 4.996  182.008 1.00 32.56  ? 374  GLN A CG  1 
ATOM   2879 C CD  . GLN A 1 374 ? 170.349 3.776  181.140 1.00 34.87  ? 374  GLN A CD  1 
ATOM   2880 O OE1 . GLN A 1 374 ? 171.154 3.807  180.227 1.00 43.50  ? 374  GLN A OE1 1 
ATOM   2881 N NE2 . GLN A 1 374 ? 169.645 2.712  181.431 1.00 35.00  ? 374  GLN A NE2 1 
ATOM   2882 N N   . TYR A 1 375 ? 171.225 5.699  185.669 1.00 22.61  ? 375  TYR A N   1 
ATOM   2883 C CA  . TYR A 1 375 ? 172.375 6.534  185.989 1.00 25.45  ? 375  TYR A CA  1 
ATOM   2884 C C   . TYR A 1 375 ? 172.978 6.270  187.382 1.00 30.62  ? 375  TYR A C   1 
ATOM   2885 O O   . TYR A 1 375 ? 173.837 7.011  187.842 1.00 32.97  ? 375  TYR A O   1 
ATOM   2886 C CB  . TYR A 1 375 ? 171.898 7.988  185.903 1.00 26.55  ? 375  TYR A CB  1 
ATOM   2887 C CG  . TYR A 1 375 ? 171.775 8.446  184.458 1.00 23.64  ? 375  TYR A CG  1 
ATOM   2888 C CD1 . TYR A 1 375 ? 170.605 8.222  183.747 1.00 21.27  ? 375  TYR A CD1 1 
ATOM   2889 C CD2 . TYR A 1 375 ? 172.850 9.068  183.806 1.00 24.14  ? 375  TYR A CD2 1 
ATOM   2890 C CE1 . TYR A 1 375 ? 170.475 8.614  182.401 1.00 22.94  ? 375  TYR A CE1 1 
ATOM   2891 C CE2 . TYR A 1 375 ? 172.752 9.468  182.449 1.00 23.03  ? 375  TYR A CE2 1 
ATOM   2892 C CZ  . TYR A 1 375 ? 171.568 9.241  181.748 1.00 21.18  ? 375  TYR A CZ  1 
ATOM   2893 O OH  . TYR A 1 375 ? 171.401 9.647  180.422 1.00 20.80  ? 375  TYR A OH  1 
ATOM   2894 N N   . THR A 1 376 ? 172.543 5.239  188.089 1.00 25.90  ? 376  THR A N   1 
ATOM   2895 C CA  . THR A 1 376 ? 173.142 5.029  189.441 1.00 24.30  ? 376  THR A CA  1 
ATOM   2896 C C   . THR A 1 376 ? 174.147 3.952  189.408 1.00 24.08  ? 376  THR A C   1 
ATOM   2897 O O   . THR A 1 376 ? 173.861 2.863  188.926 1.00 21.84  ? 376  THR A O   1 
ATOM   2898 C CB  . THR A 1 376 ? 172.046 4.645  190.437 1.00 26.23  ? 376  THR A CB  1 
ATOM   2899 O OG1 . THR A 1 376 ? 171.168 5.755  190.545 1.00 24.82  ? 376  THR A OG1 1 
ATOM   2900 C CG2 . THR A 1 376 ? 172.612 4.270  191.823 1.00 28.16  ? 376  THR A CG2 1 
ATOM   2901 N N   . ASP A 1 377 ? 175.315 4.221  189.968 1.00 25.24  ? 377  ASP A N   1 
ATOM   2902 C CA  . ASP A 1 377 ? 176.290 3.191  190.276 1.00 29.50  ? 377  ASP A CA  1 
ATOM   2903 C C   . ASP A 1 377 ? 175.934 2.551  191.639 1.00 31.15  ? 377  ASP A C   1 
ATOM   2904 O O   . ASP A 1 377 ? 176.234 3.156  192.717 1.00 27.22  ? 377  ASP A O   1 
ATOM   2905 C CB  . ASP A 1 377 ? 177.669 3.817  190.328 1.00 30.79  ? 377  ASP A CB  1 
ATOM   2906 C CG  . ASP A 1 377 ? 178.752 2.821  190.736 1.00 35.78  ? 377  ASP A CG  1 
ATOM   2907 O OD1 . ASP A 1 377 ? 178.436 1.621  190.979 1.00 33.92  ? 377  ASP A OD1 1 
ATOM   2908 O OD2 . ASP A 1 377 ? 179.910 3.279  190.860 1.00 32.90  ? 377  ASP A OD2 1 
ATOM   2909 N N   . TRP A 1 378 ? 175.341 1.345  191.616 1.00 26.89  ? 378  TRP A N   1 
ATOM   2910 C CA  . TRP A 1 378 ? 174.866 0.717  192.857 1.00 29.37  ? 378  TRP A CA  1 
ATOM   2911 C C   . TRP A 1 378 ? 175.959 0.121  193.723 1.00 31.62  ? 378  TRP A C   1 
ATOM   2912 O O   . TRP A 1 378 ? 175.683 -0.283 194.843 1.00 33.92  ? 378  TRP A O   1 
ATOM   2913 C CB  . TRP A 1 378 ? 173.791 -0.329 192.664 1.00 28.82  ? 378  TRP A CB  1 
ATOM   2914 C CG  . TRP A 1 378 ? 172.594 0.262  192.166 1.00 34.12  ? 378  TRP A CG  1 
ATOM   2915 C CD1 . TRP A 1 378 ? 172.219 0.248  190.907 1.00 32.89  ? 378  TRP A CD1 1 
ATOM   2916 C CD2 . TRP A 1 378 ? 171.628 1.009  192.871 1.00 35.65  ? 378  TRP A CD2 1 
ATOM   2917 N NE1 . TRP A 1 378 ? 171.080 0.868  190.752 1.00 36.07  ? 378  TRP A NE1 1 
ATOM   2918 C CE2 . TRP A 1 378 ? 170.681 1.389  191.940 1.00 39.82  ? 378  TRP A CE2 1 
ATOM   2919 C CE3 . TRP A 1 378 ? 171.485 1.412  194.182 1.00 46.43  ? 378  TRP A CE3 1 
ATOM   2920 C CZ2 . TRP A 1 378 ? 169.574 2.182  192.247 1.00 45.47  ? 378  TRP A CZ2 1 
ATOM   2921 C CZ3 . TRP A 1 378 ? 170.377 2.196  194.515 1.00 43.44  ? 378  TRP A CZ3 1 
ATOM   2922 C CH2 . TRP A 1 378 ? 169.453 2.575  193.554 1.00 50.42  ? 378  TRP A CH2 1 
ATOM   2923 N N   . MET A 1 379 ? 177.176 0.069  193.221 1.00 31.79  ? 379  MET A N   1 
ATOM   2924 C CA  . MET A 1 379 ? 178.325 -0.206 194.090 1.00 37.74  ? 379  MET A CA  1 
ATOM   2925 C C   . MET A 1 379 ? 178.699 0.985  194.941 1.00 40.35  ? 379  MET A C   1 
ATOM   2926 O O   . MET A 1 379 ? 179.501 0.847  195.846 1.00 41.65  ? 379  MET A O   1 
ATOM   2927 C CB  . MET A 1 379 ? 179.577 -0.521 193.284 1.00 42.89  ? 379  MET A CB  1 
ATOM   2928 C CG  . MET A 1 379 ? 179.420 -1.652 192.282 1.00 52.26  ? 379  MET A CG  1 
ATOM   2929 S SD  . MET A 1 379 ? 180.823 -2.750 192.386 1.00 76.46  ? 379  MET A SD  1 
ATOM   2930 C CE  . MET A 1 379 ? 180.623 -3.321 194.102 1.00 58.91  ? 379  MET A CE  1 
ATOM   2931 N N   . ASP A 1 380 ? 178.189 2.175  194.642 1.00 39.81  ? 380  ASP A N   1 
ATOM   2932 C CA  . ASP A 1 380 ? 178.724 3.358  195.305 1.00 35.00  ? 380  ASP A CA  1 
ATOM   2933 C C   . ASP A 1 380 ? 177.665 4.399  195.235 1.00 34.30  ? 380  ASP A C   1 
ATOM   2934 O O   . ASP A 1 380 ? 177.893 5.445  194.687 1.00 32.32  ? 380  ASP A O   1 
ATOM   2935 C CB  . ASP A 1 380 ? 179.953 3.826  194.515 1.00 37.10  ? 380  ASP A CB  1 
ATOM   2936 C CG  . ASP A 1 380 ? 180.801 4.910  195.232 1.00 39.09  ? 380  ASP A CG  1 
ATOM   2937 O OD1 . ASP A 1 380 ? 180.547 5.243  196.417 1.00 41.46  ? 380  ASP A OD1 1 
ATOM   2938 O OD2 . ASP A 1 380 ? 181.732 5.422  194.556 1.00 36.32  ? 380  ASP A OD2 1 
ATOM   2939 N N   . ASP A 1 381 ? 176.490 4.104  195.755 1.00 35.49  ? 381  ASP A N   1 
ATOM   2940 C CA  . ASP A 1 381 ? 175.340 4.957  195.456 1.00 42.77  ? 381  ASP A CA  1 
ATOM   2941 C C   . ASP A 1 381 ? 175.258 6.223  196.334 1.00 48.18  ? 381  ASP A C   1 
ATOM   2942 O O   . ASP A 1 381 ? 174.406 7.093  196.069 1.00 44.64  ? 381  ASP A O   1 
ATOM   2943 C CB  . ASP A 1 381 ? 174.010 4.181  195.519 1.00 44.81  ? 381  ASP A CB  1 
ATOM   2944 C CG  . ASP A 1 381 ? 173.755 3.575  196.890 1.00 48.21  ? 381  ASP A CG  1 
ATOM   2945 O OD1 . ASP A 1 381 ? 174.588 2.749  197.348 1.00 44.29  ? 381  ASP A OD1 1 
ATOM   2946 O OD2 . ASP A 1 381 ? 172.723 3.926  197.483 1.00 51.91  ? 381  ASP A OD2 1 
ATOM   2947 N N   . ASN A 1 382 ? 176.141 6.338  197.334 1.00 47.73  ? 382  ASN A N   1 
ATOM   2948 C CA  . ASN A 1 382 ? 176.215 7.560  198.138 1.00 52.75  ? 382  ASN A CA  1 
ATOM   2949 C C   . ASN A 1 382 ? 177.358 8.491  197.781 1.00 43.97  ? 382  ASN A C   1 
ATOM   2950 O O   . ASN A 1 382 ? 177.682 9.363  198.548 1.00 46.87  ? 382  ASN A O   1 
ATOM   2951 C CB  . ASN A 1 382 ? 176.286 7.188  199.619 1.00 58.38  ? 382  ASN A CB  1 
ATOM   2952 C CG  . ASN A 1 382 ? 174.967 6.692  200.109 1.00 71.07  ? 382  ASN A CG  1 
ATOM   2953 O OD1 . ASN A 1 382 ? 174.781 5.482  200.288 1.00 82.65  ? 382  ASN A OD1 1 
ATOM   2954 N ND2 . ASN A 1 382 ? 174.000 7.603  200.228 1.00 72.02  ? 382  ASN A ND2 1 
ATOM   2955 N N   . ASN A 1 383 ? 178.003 8.293  196.651 1.00 35.90  ? 383  ASN A N   1 
ATOM   2956 C CA  . ASN A 1 383 ? 179.065 9.217  196.260 1.00 34.67  ? 383  ASN A CA  1 
ATOM   2957 C C   . ASN A 1 383 ? 178.431 10.538 195.763 1.00 36.21  ? 383  ASN A C   1 
ATOM   2958 O O   . ASN A 1 383 ? 177.638 10.562 194.808 1.00 29.63  ? 383  ASN A O   1 
ATOM   2959 C CB  . ASN A 1 383 ? 179.790 8.536  195.167 1.00 36.97  ? 383  ASN A CB  1 
ATOM   2960 C CG  . ASN A 1 383 ? 180.975 9.280  194.713 1.00 38.09  ? 383  ASN A CG  1 
ATOM   2961 O OD1 . ASN A 1 383 ? 180.990 10.521 194.612 1.00 33.96  ? 383  ASN A OD1 1 
ATOM   2962 N ND2 . ASN A 1 383 ? 182.012 8.515  194.418 1.00 37.89  ? 383  ASN A ND2 1 
ATOM   2963 N N   . GLY A 1 384 ? 178.708 11.619 196.464 1.00 34.17  ? 384  GLY A N   1 
ATOM   2964 C CA  . GLY A 1 384 ? 178.155 12.934 196.154 1.00 34.08  ? 384  GLY A CA  1 
ATOM   2965 C C   . GLY A 1 384 ? 178.542 13.495 194.804 1.00 29.88  ? 384  GLY A C   1 
ATOM   2966 O O   . GLY A 1 384 ? 177.758 14.198 194.172 1.00 29.80  ? 384  GLY A O   1 
ATOM   2967 N N   . ILE A 1 385 ? 179.747 13.165 194.408 1.00 28.84  ? 385  ILE A N   1 
ATOM   2968 C CA  . ILE A 1 385 ? 180.308 13.539 193.139 1.00 30.70  ? 385  ILE A CA  1 
ATOM   2969 C C   . ILE A 1 385 ? 179.583 12.798 192.029 1.00 30.54  ? 385  ILE A C   1 
ATOM   2970 O O   . ILE A 1 385 ? 179.126 13.421 191.066 1.00 30.09  ? 385  ILE A O   1 
ATOM   2971 C CB  . ILE A 1 385 ? 181.779 13.198 193.060 1.00 29.24  ? 385  ILE A CB  1 
ATOM   2972 C CG1 . ILE A 1 385 ? 182.605 14.046 194.056 1.00 37.11  ? 385  ILE A CG1 1 
ATOM   2973 C CG2 . ILE A 1 385 ? 182.339 13.433 191.663 1.00 32.30  ? 385  ILE A CG2 1 
ATOM   2974 C CD1 . ILE A 1 385 ? 182.690 15.496 193.695 1.00 40.64  ? 385  ILE A CD1 1 
ATOM   2975 N N   . LYS A 1 386 ? 179.462 11.493 192.175 1.00 28.42  ? 386  LYS A N   1 
ATOM   2976 C CA  . LYS A 1 386 ? 178.734 10.684 191.205 1.00 29.25  ? 386  LYS A CA  1 
ATOM   2977 C C   . LYS A 1 386 ? 177.303 11.119 191.081 1.00 30.16  ? 386  LYS A C   1 
ATOM   2978 O O   . LYS A 1 386 ? 176.785 11.152 189.968 1.00 29.64  ? 386  LYS A O   1 
ATOM   2979 C CB  . LYS A 1 386 ? 178.825 9.226  191.473 1.00 28.54  ? 386  LYS A CB  1 
ATOM   2980 C CG  . LYS A 1 386 ? 180.213 8.698  191.275 1.00 33.80  ? 386  LYS A CG  1 
ATOM   2981 C CD  . LYS A 1 386 ? 180.221 7.190  191.396 1.00 36.88  ? 386  LYS A CD  1 
ATOM   2982 C CE  . LYS A 1 386 ? 181.588 6.666  190.956 1.00 41.08  ? 386  LYS A CE  1 
ATOM   2983 N NZ  . LYS A 1 386 ? 181.826 5.268  191.437 1.00 45.43  ? 386  LYS A NZ  1 
ATOM   2984 N N   . ASN A 1 387 ? 176.654 11.445 192.193 1.00 27.13  ? 387  ASN A N   1 
ATOM   2985 C CA  . ASN A 1 387 ? 175.308 11.877 192.117 1.00 23.87  ? 387  ASN A CA  1 
ATOM   2986 C C   . ASN A 1 387 ? 175.173 13.216 191.351 1.00 21.47  ? 387  ASN A C   1 
ATOM   2987 O O   . ASN A 1 387 ? 174.229 13.404 190.624 1.00 21.83  ? 387  ASN A O   1 
ATOM   2988 C CB  . ASN A 1 387 ? 174.699 12.024 193.478 1.00 28.12  ? 387  ASN A CB  1 
ATOM   2989 C CG  . ASN A 1 387 ? 174.419 10.678 194.168 1.00 36.09  ? 387  ASN A CG  1 
ATOM   2990 O OD1 . ASN A 1 387 ? 174.457 9.597  193.570 1.00 35.97  ? 387  ASN A OD1 1 
ATOM   2991 N ND2 . ASN A 1 387 ? 174.193 10.761 195.473 1.00 38.55  ? 387  ASN A ND2 1 
ATOM   2992 N N   . ARG A 1 388 ? 176.071 14.135 191.613 1.00 20.44  ? 388  ARG A N   1 
ATOM   2993 C CA  . ARG A 1 388 ? 176.125 15.380 190.954 1.00 22.75  ? 388  ARG A CA  1 
ATOM   2994 C C   . ARG A 1 388 ? 176.342 15.187 189.444 1.00 24.85  ? 388  ARG A C   1 
ATOM   2995 O O   . ARG A 1 388 ? 175.572 15.733 188.673 1.00 25.06  ? 388  ARG A O   1 
ATOM   2996 C CB  . ARG A 1 388 ? 177.237 16.233 191.510 1.00 21.58  ? 388  ARG A CB  1 
ATOM   2997 C CG  . ARG A 1 388 ? 177.250 17.659 190.980 1.00 21.69  ? 388  ARG A CG  1 
ATOM   2998 C CD  . ARG A 1 388 ? 178.582 18.285 191.263 1.00 23.36  ? 388  ARG A CD  1 
ATOM   2999 N NE  . ARG A 1 388 ? 179.632 17.549 190.554 1.00 24.56  ? 388  ARG A NE  1 
ATOM   3000 C CZ  . ARG A 1 388 ? 180.914 17.499 190.901 1.00 26.45  ? 388  ARG A CZ  1 
ATOM   3001 N NH1 . ARG A 1 388 ? 181.373 18.139 191.977 1.00 26.66  ? 388  ARG A NH1 1 
ATOM   3002 N NH2 . ARG A 1 388 ? 181.765 16.803 190.155 1.00 25.39  ? 388  ARG A NH2 1 
ATOM   3003 N N   . ASP A 1 389 ? 177.378 14.439 189.069 1.00 22.99  ? 389  ASP A N   1 
ATOM   3004 C CA  . ASP A 1 389 ? 177.722 14.229 187.669 1.00 25.07  ? 389  ASP A CA  1 
ATOM   3005 C C   . ASP A 1 389 ? 176.627 13.433 186.934 1.00 24.82  ? 389  ASP A C   1 
ATOM   3006 O O   . ASP A 1 389 ? 176.323 13.692 185.755 1.00 23.87  ? 389  ASP A O   1 
ATOM   3007 C CB  . ASP A 1 389 ? 179.082 13.547 187.532 1.00 24.40  ? 389  ASP A CB  1 
ATOM   3008 C CG  . ASP A 1 389 ? 180.244 14.454 187.960 1.00 27.72  ? 389  ASP A CG  1 
ATOM   3009 O OD1 . ASP A 1 389 ? 180.037 15.679 188.151 1.00 27.78  ? 389  ASP A OD1 1 
ATOM   3010 O OD2 . ASP A 1 389 ? 181.346 13.917 188.111 1.00 31.61  ? 389  ASP A OD2 1 
ATOM   3011 N N   . GLY A 1 390 ? 176.032 12.497 187.650 1.00 22.86  ? 390  GLY A N   1 
ATOM   3012 C CA  . GLY A 1 390 ? 174.923 11.738 187.192 1.00 24.29  ? 390  GLY A CA  1 
ATOM   3013 C C   . GLY A 1 390 ? 173.695 12.600 186.846 1.00 25.84  ? 390  GLY A C   1 
ATOM   3014 O O   . GLY A 1 390 ? 173.074 12.432 185.779 1.00 23.11  ? 390  GLY A O   1 
ATOM   3015 N N   . LEU A 1 391 ? 173.310 13.504 187.726 1.00 23.94  ? 391  LEU A N   1 
ATOM   3016 C CA  . LEU A 1 391 ? 172.274 14.469 187.351 1.00 23.50  ? 391  LEU A CA  1 
ATOM   3017 C C   . LEU A 1 391 ? 172.685 15.380 186.178 1.00 21.97  ? 391  LEU A C   1 
ATOM   3018 O O   . LEU A 1 391 ? 171.879 15.744 185.365 1.00 21.67  ? 391  LEU A O   1 
ATOM   3019 C CB  . LEU A 1 391 ? 171.854 15.345 188.534 1.00 25.04  ? 391  LEU A CB  1 
ATOM   3020 C CG  . LEU A 1 391 ? 170.678 14.836 189.343 1.00 30.82  ? 391  LEU A CG  1 
ATOM   3021 C CD1 . LEU A 1 391 ? 170.505 15.606 190.654 1.00 31.75  ? 391  LEU A CD1 1 
ATOM   3022 C CD2 . LEU A 1 391 ? 169.389 14.913 188.514 1.00 32.17  ? 391  LEU A CD2 1 
ATOM   3023 N N   . ASP A 1 392 ? 173.910 15.821 186.147 1.00 20.92  ? 392  ASP A N   1 
ATOM   3024 C CA  . ASP A 1 392 ? 174.374 16.648 185.055 1.00 25.18  ? 392  ASP A CA  1 
ATOM   3025 C C   . ASP A 1 392 ? 174.135 15.870 183.700 1.00 23.86  ? 392  ASP A C   1 
ATOM   3026 O O   . ASP A 1 392 ? 173.594 16.411 182.753 1.00 22.84  ? 392  ASP A O   1 
ATOM   3027 C CB  . ASP A 1 392 ? 175.854 16.937 185.282 1.00 25.07  ? 392  ASP A CB  1 
ATOM   3028 C CG  . ASP A 1 392 ? 176.377 18.027 184.432 1.00 30.90  ? 392  ASP A CG  1 
ATOM   3029 O OD1 . ASP A 1 392 ? 175.770 18.370 183.387 1.00 34.85  ? 392  ASP A OD1 1 
ATOM   3030 O OD2 . ASP A 1 392 ? 177.447 18.537 184.811 1.00 36.91  ? 392  ASP A OD2 1 
ATOM   3031 N N   . ASP A 1 393 ? 174.569 14.608 183.650 1.00 23.63  ? 393  ASP A N   1 
ATOM   3032 C CA  . ASP A 1 393 ? 174.344 13.744 182.520 1.00 21.85  ? 393  ASP A CA  1 
ATOM   3033 C C   . ASP A 1 393 ? 172.867 13.518 182.232 1.00 23.11  ? 393  ASP A C   1 
ATOM   3034 O O   . ASP A 1 393 ? 172.476 13.556 181.056 1.00 21.13  ? 393  ASP A O   1 
ATOM   3035 C CB  . ASP A 1 393 ? 175.006 12.427 182.750 1.00 23.27  ? 393  ASP A CB  1 
ATOM   3036 C CG  . ASP A 1 393 ? 176.502 12.519 182.542 1.00 25.96  ? 393  ASP A CG  1 
ATOM   3037 O OD1 . ASP A 1 393 ? 177.016 13.428 181.786 1.00 31.82  ? 393  ASP A OD1 1 
ATOM   3038 O OD2 . ASP A 1 393 ? 177.167 11.661 183.088 1.00 29.00  ? 393  ASP A OD2 1 
ATOM   3039 N N   . ILE A 1 394 ? 172.039 13.304 183.267 1.00 18.32  ? 394  ILE A N   1 
ATOM   3040 C CA  . ILE A 1 394 ? 170.610 13.141 183.014 1.00 19.17  ? 394  ILE A CA  1 
ATOM   3041 C C   . ILE A 1 394 ? 170.055 14.369 182.271 1.00 18.87  ? 394  ILE A C   1 
ATOM   3042 O O   . ILE A 1 394 ? 169.335 14.232 181.276 1.00 19.13  ? 394  ILE A O   1 
ATOM   3043 C CB  . ILE A 1 394 ? 169.795 12.900 184.285 1.00 20.30  ? 394  ILE A CB  1 
ATOM   3044 C CG1 . ILE A 1 394 ? 170.071 11.495 184.798 1.00 20.72  ? 394  ILE A CG1 1 
ATOM   3045 C CG2 . ILE A 1 394 ? 168.279 13.129 184.098 1.00 19.81  ? 394  ILE A CG2 1 
ATOM   3046 C CD1 . ILE A 1 394 ? 169.712 11.365 186.268 1.00 25.09  ? 394  ILE A CD1 1 
ATOM   3047 N N   . VAL A 1 395 ? 170.387 15.548 182.746 1.00 17.23  ? 395  VAL A N   1 
ATOM   3048 C CA  . VAL A 1 395 ? 169.825 16.749 182.210 1.00 18.11  ? 395  VAL A CA  1 
ATOM   3049 C C   . VAL A 1 395 ? 170.289 16.999 180.792 1.00 18.13  ? 395  VAL A C   1 
ATOM   3050 O O   . VAL A 1 395 ? 169.461 17.319 179.957 1.00 18.98  ? 395  VAL A O   1 
ATOM   3051 C CB  . VAL A 1 395 ? 170.036 17.949 183.151 1.00 17.77  ? 395  VAL A CB  1 
ATOM   3052 C CG1 . VAL A 1 395 ? 169.554 19.251 182.548 1.00 16.33  ? 395  VAL A CG1 1 
ATOM   3053 C CG2 . VAL A 1 395 ? 169.279 17.742 184.465 1.00 20.22  ? 395  VAL A CG2 1 
ATOM   3054 N N   . GLY A 1 396 ? 171.587 16.809 180.564 1.00 21.37  ? 396  GLY A N   1 
ATOM   3055 C CA  . GLY A 1 396 ? 172.264 17.004 179.267 1.00 19.44  ? 396  GLY A CA  1 
ATOM   3056 C C   . GLY A 1 396 ? 171.720 16.021 178.243 1.00 22.27  ? 396  GLY A C   1 
ATOM   3057 O O   . GLY A 1 396 ? 171.358 16.424 177.113 1.00 21.31  ? 396  GLY A O   1 
ATOM   3058 N N   . ASP A 1 397 ? 171.661 14.749 178.637 1.00 19.46  ? 397  ASP A N   1 
ATOM   3059 C CA  . ASP A 1 397 ? 171.175 13.681 177.807 1.00 17.82  ? 397  ASP A CA  1 
ATOM   3060 C C   . ASP A 1 397 ? 169.744 13.816 177.393 1.00 19.78  ? 397  ASP A C   1 
ATOM   3061 O O   . ASP A 1 397 ? 169.376 13.646 176.205 1.00 20.35  ? 397  ASP A O   1 
ATOM   3062 C CB  . ASP A 1 397 ? 171.351 12.325 178.451 1.00 17.41  ? 397  ASP A CB  1 
ATOM   3063 C CG  . ASP A 1 397 ? 172.824 11.902 178.577 1.00 20.74  ? 397  ASP A CG  1 
ATOM   3064 O OD1 . ASP A 1 397 ? 173.692 12.550 177.955 1.00 21.49  ? 397  ASP A OD1 1 
ATOM   3065 O OD2 . ASP A 1 397 ? 173.137 10.944 179.341 1.00 19.99  ? 397  ASP A OD2 1 
ATOM   3066 N N   . HIS A 1 398 ? 168.890 14.036 178.345 1.00 18.12  ? 398  HIS A N   1 
ATOM   3067 C CA  . HIS A 1 398 ? 167.483 14.143 178.060 1.00 17.79  ? 398  HIS A CA  1 
ATOM   3068 C C   . HIS A 1 398 ? 167.178 15.349 177.200 1.00 16.95  ? 398  HIS A C   1 
ATOM   3069 O O   . HIS A 1 398 ? 166.337 15.236 176.334 1.00 17.62  ? 398  HIS A O   1 
ATOM   3070 C CB  . HIS A 1 398 ? 166.706 14.229 179.364 1.00 18.41  ? 398  HIS A CB  1 
ATOM   3071 C CG  . HIS A 1 398 ? 165.271 14.494 179.217 1.00 18.30  ? 398  HIS A CG  1 
ATOM   3072 N ND1 . HIS A 1 398 ? 164.457 13.783 178.357 1.00 19.64  ? 398  HIS A ND1 1 
ATOM   3073 C CD2 . HIS A 1 398 ? 164.487 15.448 179.771 1.00 21.91  ? 398  HIS A CD2 1 
ATOM   3074 C CE1 . HIS A 1 398 ? 163.225 14.235 178.432 1.00 18.22  ? 398  HIS A CE1 1 
ATOM   3075 N NE2 . HIS A 1 398 ? 163.211 15.246 179.290 1.00 23.15  ? 398  HIS A NE2 1 
ATOM   3076 N N   . ASN A 1 399 ? 167.787 16.491 177.485 1.00 17.87  ? 399  ASN A N   1 
ATOM   3077 C CA  . ASN A 1 399 ? 167.355 17.704 176.911 1.00 17.74  ? 399  ASN A CA  1 
ATOM   3078 C C   . ASN A 1 399 ? 168.100 18.136 175.650 1.00 18.43  ? 399  ASN A C   1 
ATOM   3079 O O   . ASN A 1 399 ? 167.563 18.960 174.887 1.00 19.07  ? 399  ASN A O   1 
ATOM   3080 C CB  . ASN A 1 399 ? 167.422 18.844 177.941 1.00 16.86  ? 399  ASN A CB  1 
ATOM   3081 C CG  . ASN A 1 399 ? 166.314 18.735 178.994 1.00 18.24  ? 399  ASN A CG  1 
ATOM   3082 O OD1 . ASN A 1 399 ? 165.149 18.947 178.715 1.00 16.87  ? 399  ASN A OD1 1 
ATOM   3083 N ND2 . ASN A 1 399 ? 166.710 18.421 180.231 1.00 17.17  ? 399  ASN A ND2 1 
ATOM   3084 N N   . VAL A 1 400 ? 169.330 17.677 175.466 1.00 17.75  ? 400  VAL A N   1 
ATOM   3085 C CA  . VAL A 1 400 ? 170.178 18.194 174.377 1.00 17.62  ? 400  VAL A CA  1 
ATOM   3086 C C   . VAL A 1 400 ? 170.775 17.040 173.557 1.00 19.18  ? 400  VAL A C   1 
ATOM   3087 O O   . VAL A 1 400 ? 170.490 16.901 172.338 1.00 19.24  ? 400  VAL A O   1 
ATOM   3088 C CB  . VAL A 1 400 ? 171.280 19.135 174.887 1.00 18.28  ? 400  VAL A CB  1 
ATOM   3089 C CG1 . VAL A 1 400 ? 172.184 19.665 173.770 1.00 17.24  ? 400  VAL A CG1 1 
ATOM   3090 C CG2 . VAL A 1 400 ? 170.630 20.353 175.590 1.00 19.10  ? 400  VAL A CG2 1 
ATOM   3091 N N   . ILE A 1 401 ? 171.547 16.166 174.191 1.00 17.05  ? 401  ILE A N   1 
ATOM   3092 C CA  . ILE A 1 401 ? 172.337 15.213 173.467 1.00 17.39  ? 401  ILE A CA  1 
ATOM   3093 C C   . ILE A 1 401 ? 171.472 14.163 172.794 1.00 20.82  ? 401  ILE A C   1 
ATOM   3094 O O   . ILE A 1 401 ? 171.617 13.936 171.570 1.00 17.28  ? 401  ILE A O   1 
ATOM   3095 C CB  . ILE A 1 401 ? 173.414 14.599 174.311 1.00 18.92  ? 401  ILE A CB  1 
ATOM   3096 C CG1 . ILE A 1 401 ? 174.368 15.686 174.814 1.00 19.30  ? 401  ILE A CG1 1 
ATOM   3097 C CG2 . ILE A 1 401 ? 174.181 13.576 173.506 1.00 19.76  ? 401  ILE A CG2 1 
ATOM   3098 C CD1 . ILE A 1 401 ? 175.402 15.116 175.764 1.00 21.50  ? 401  ILE A CD1 1 
ATOM   3099 N N   . CYS A 1 402 ? 170.559 13.534 173.536 1.00 19.68  ? 402  CYS A N   1 
ATOM   3100 C CA  . CYS A 1 402 ? 169.776 12.474 172.939 1.00 20.52  ? 402  CYS A CA  1 
ATOM   3101 C C   . CYS A 1 402 ? 168.754 13.015 171.896 1.00 21.75  ? 402  CYS A C   1 
ATOM   3102 O O   . CYS A 1 402 ? 168.527 12.362 170.937 1.00 19.44  ? 402  CYS A O   1 
ATOM   3103 C CB  . CYS A 1 402 ? 169.166 11.522 174.002 1.00 18.92  ? 402  CYS A CB  1 
ATOM   3104 S SG  . CYS A 1 402 ? 170.558 10.746 174.912 1.00 21.16  ? 402  CYS A SG  1 
ATOM   3105 N N   . PRO A 1 403 ? 168.121 14.178 172.119 1.00 20.01  ? 403  PRO A N   1 
ATOM   3106 C CA  . PRO A 1 403 ? 167.304 14.690 171.037 1.00 19.08  ? 403  PRO A CA  1 
ATOM   3107 C C   . PRO A 1 403 ? 168.150 14.983 169.786 1.00 19.49  ? 403  PRO A C   1 
ATOM   3108 O O   . PRO A 1 403 ? 167.728 14.664 168.674 1.00 17.75  ? 403  PRO A O   1 
ATOM   3109 C CB  . PRO A 1 403 ? 166.700 15.940 171.589 1.00 19.79  ? 403  PRO A CB  1 
ATOM   3110 C CG  . PRO A 1 403 ? 166.625 15.631 173.098 1.00 21.29  ? 403  PRO A CG  1 
ATOM   3111 C CD  . PRO A 1 403 ? 167.873 14.862 173.381 1.00 19.64  ? 403  PRO A CD  1 
ATOM   3112 N N   . LEU A 1 404 ? 169.330 15.503 169.962 1.00 19.54  ? 404  LEU A N   1 
ATOM   3113 C CA  . LEU A 1 404 ? 170.193 15.726 168.834 1.00 18.21  ? 404  LEU A CA  1 
ATOM   3114 C C   . LEU A 1 404 ? 170.619 14.482 168.118 1.00 21.85  ? 404  LEU A C   1 
ATOM   3115 O O   . LEU A 1 404 ? 170.606 14.467 166.861 1.00 19.62  ? 404  LEU A O   1 
ATOM   3116 C CB  . LEU A 1 404 ? 171.387 16.586 169.187 1.00 18.94  ? 404  LEU A CB  1 
ATOM   3117 C CG  . LEU A 1 404 ? 172.290 17.045 168.042 1.00 19.68  ? 404  LEU A CG  1 
ATOM   3118 C CD1 . LEU A 1 404 ? 172.769 18.443 168.213 1.00 19.54  ? 404  LEU A CD1 1 
ATOM   3119 C CD2 . LEU A 1 404 ? 173.494 16.111 167.894 1.00 18.77  ? 404  LEU A CD2 1 
ATOM   3120 N N   . MET A 1 405 ? 170.977 13.430 168.861 1.00 20.73  ? 405  MET A N   1 
ATOM   3121 C CA  . MET A 1 405 ? 171.302 12.186 168.255 1.00 19.93  ? 405  MET A CA  1 
ATOM   3122 C C   . MET A 1 405 ? 170.164 11.582 167.475 1.00 21.52  ? 405  MET A C   1 
ATOM   3123 O O   . MET A 1 405 ? 170.364 10.912 166.421 1.00 19.26  ? 405  MET A O   1 
ATOM   3124 C CB  . MET A 1 405 ? 171.844 11.190 169.284 1.00 20.99  ? 405  MET A CB  1 
ATOM   3125 C CG  . MET A 1 405 ? 173.196 11.648 169.782 1.00 21.56  ? 405  MET A CG  1 
ATOM   3126 S SD  . MET A 1 405 ? 174.388 12.186 168.503 1.00 22.74  ? 405  MET A SD  1 
ATOM   3127 C CE  . MET A 1 405 ? 174.557 10.580 167.711 1.00 22.95  ? 405  MET A CE  1 
ATOM   3128 N N   . HIS A 1 406 ? 168.957 11.782 167.948 1.00 19.90  ? 406  HIS A N   1 
ATOM   3129 C CA  . HIS A 1 406 ? 167.830 11.237 167.253 1.00 20.73  ? 406  HIS A CA  1 
ATOM   3130 C C   . HIS A 1 406 ? 167.613 12.065 165.948 1.00 21.57  ? 406  HIS A C   1 
ATOM   3131 O O   . HIS A 1 406 ? 167.326 11.519 164.895 1.00 21.89  ? 406  HIS A O   1 
ATOM   3132 C CB  . HIS A 1 406 ? 166.600 11.385 168.124 1.00 20.54  ? 406  HIS A CB  1 
ATOM   3133 C CG  . HIS A 1 406 ? 165.347 10.921 167.499 1.00 22.25  ? 406  HIS A CG  1 
ATOM   3134 N ND1 . HIS A 1 406 ? 165.059 9.590  167.362 1.00 25.65  ? 406  HIS A ND1 1 
ATOM   3135 C CD2 . HIS A 1 406 ? 164.245 11.598 167.068 1.00 25.24  ? 406  HIS A CD2 1 
ATOM   3136 C CE1 . HIS A 1 406 ? 163.866 9.453  166.799 1.00 23.86  ? 406  HIS A CE1 1 
ATOM   3137 N NE2 . HIS A 1 406 ? 163.348 10.650 166.621 1.00 25.71  ? 406  HIS A NE2 1 
ATOM   3138 N N   . PHE A 1 407 ? 167.698 13.372 166.068 1.00 20.33  ? 407  PHE A N   1 
ATOM   3139 C CA  . PHE A 1 407 ? 167.589 14.242 164.914 1.00 23.03  ? 407  PHE A CA  1 
ATOM   3140 C C   . PHE A 1 407 ? 168.647 13.811 163.886 1.00 23.34  ? 407  PHE A C   1 
ATOM   3141 O O   . PHE A 1 407 ? 168.324 13.611 162.738 1.00 22.17  ? 407  PHE A O   1 
ATOM   3142 C CB  . PHE A 1 407 ? 167.773 15.696 165.282 1.00 20.58  ? 407  PHE A CB  1 
ATOM   3143 C CG  . PHE A 1 407 ? 167.795 16.618 164.089 1.00 18.95  ? 407  PHE A CG  1 
ATOM   3144 C CD1 . PHE A 1 407 ? 166.646 16.952 163.458 1.00 19.18  ? 407  PHE A CD1 1 
ATOM   3145 C CD2 . PHE A 1 407 ? 168.956 17.158 163.649 1.00 20.27  ? 407  PHE A CD2 1 
ATOM   3146 C CE1 . PHE A 1 407 ? 166.633 17.819 162.327 1.00 22.34  ? 407  PHE A CE1 1 
ATOM   3147 C CE2 . PHE A 1 407 ? 168.997 17.997 162.543 1.00 21.81  ? 407  PHE A CE2 1 
ATOM   3148 C CZ  . PHE A 1 407 ? 167.818 18.340 161.876 1.00 19.69  ? 407  PHE A CZ  1 
ATOM   3149 N N   . VAL A 1 408 ? 169.888 13.647 164.306 1.00 22.29  ? 408  VAL A N   1 
ATOM   3150 C CA  . VAL A 1 408 ? 170.920 13.414 163.348 1.00 24.58  ? 408  VAL A CA  1 
ATOM   3151 C C   . VAL A 1 408 ? 170.791 12.082 162.662 1.00 26.63  ? 408  VAL A C   1 
ATOM   3152 O O   . VAL A 1 408 ? 171.117 11.975 161.468 1.00 24.45  ? 408  VAL A O   1 
ATOM   3153 C CB  . VAL A 1 408 ? 172.331 13.638 163.890 1.00 29.75  ? 408  VAL A CB  1 
ATOM   3154 C CG1 . VAL A 1 408 ? 172.813 12.483 164.714 1.00 29.43  ? 408  VAL A CG1 1 
ATOM   3155 C CG2 . VAL A 1 408 ? 173.283 13.757 162.730 1.00 36.61  ? 408  VAL A CG2 1 
ATOM   3156 N N   . ASN A 1 409 ? 170.296 11.058 163.381 1.00 23.75  ? 409  ASN A N   1 
ATOM   3157 C CA  . ASN A 1 409 ? 170.107 9.776  162.785 1.00 26.31  ? 409  ASN A CA  1 
ATOM   3158 C C   . ASN A 1 409 ? 168.930 9.828  161.774 1.00 26.48  ? 409  ASN A C   1 
ATOM   3159 O O   . ASN A 1 409 ? 169.010 9.270  160.661 1.00 23.23  ? 409  ASN A O   1 
ATOM   3160 C CB  . ASN A 1 409 ? 170.022 8.616  163.824 1.00 27.76  ? 409  ASN A CB  1 
ATOM   3161 C CG  . ASN A 1 409 ? 171.413 8.164  164.253 1.00 29.80  ? 409  ASN A CG  1 
ATOM   3162 O OD1 . ASN A 1 409 ? 172.142 7.498  163.485 1.00 34.70  ? 409  ASN A OD1 1 
ATOM   3163 N ND2 . ASN A 1 409 ? 171.822 8.566  165.454 1.00 30.19  ? 409  ASN A ND2 1 
ATOM   3164 N N   . LYS A 1 410 ? 167.846 10.478 162.136 1.00 22.74  ? 410  LYS A N   1 
ATOM   3165 C CA  . LYS A 1 410 ? 166.742 10.617 161.212 1.00 24.74  ? 410  LYS A CA  1 
ATOM   3166 C C   . LYS A 1 410 ? 167.128 11.473 159.955 1.00 26.67  ? 410  LYS A C   1 
ATOM   3167 O O   . LYS A 1 410 ? 166.743 11.164 158.855 1.00 25.66  ? 410  LYS A O   1 
ATOM   3168 C CB  . LYS A 1 410 ? 165.551 11.276 161.884 1.00 26.36  ? 410  LYS A CB  1 
ATOM   3169 C CG  . LYS A 1 410 ? 164.862 10.437 162.938 1.00 30.73  ? 410  LYS A CG  1 
ATOM   3170 C CD  . LYS A 1 410 ? 164.372 9.115  162.394 1.00 31.94  ? 410  LYS A CD  1 
ATOM   3171 C CE  . LYS A 1 410 ? 163.560 8.394  163.438 1.00 38.50  ? 410  LYS A CE  1 
ATOM   3172 N NZ  . LYS A 1 410 ? 162.839 7.323  162.777 1.00 38.77  ? 410  LYS A NZ  1 
ATOM   3173 N N   . TYR A 1 411 ? 167.901 12.518 160.150 1.00 22.18  ? 411  TYR A N   1 
ATOM   3174 C CA  . TYR A 1 411 ? 168.126 13.467 159.097 1.00 24.92  ? 411  TYR A CA  1 
ATOM   3175 C C   . TYR A 1 411 ? 169.028 12.789 158.068 1.00 25.86  ? 411  TYR A C   1 
ATOM   3176 O O   . TYR A 1 411 ? 168.853 12.961 156.873 1.00 25.07  ? 411  TYR A O   1 
ATOM   3177 C CB  . TYR A 1 411 ? 168.827 14.741 159.587 1.00 22.71  ? 411  TYR A CB  1 
ATOM   3178 C CG  . TYR A 1 411 ? 169.007 15.745 158.472 1.00 21.27  ? 411  TYR A CG  1 
ATOM   3179 C CD1 . TYR A 1 411 ? 167.975 16.628 158.173 1.00 20.69  ? 411  TYR A CD1 1 
ATOM   3180 C CD2 . TYR A 1 411 ? 170.173 15.779 157.727 1.00 20.57  ? 411  TYR A CD2 1 
ATOM   3181 C CE1 . TYR A 1 411 ? 168.072 17.490 157.145 1.00 22.43  ? 411  TYR A CE1 1 
ATOM   3182 C CE2 . TYR A 1 411 ? 170.301 16.658 156.692 1.00 23.58  ? 411  TYR A CE2 1 
ATOM   3183 C CZ  . TYR A 1 411 ? 169.235 17.487 156.389 1.00 22.40  ? 411  TYR A CZ  1 
ATOM   3184 O OH  . TYR A 1 411 ? 169.257 18.365 155.379 1.00 21.60  ? 411  TYR A OH  1 
ATOM   3185 N N   . THR A 1 412 ? 169.995 12.056 158.552 1.00 24.66  ? 412  THR A N   1 
ATOM   3186 C CA  . THR A 1 412 ? 171.015 11.462 157.708 1.00 24.17  ? 412  THR A CA  1 
ATOM   3187 C C   . THR A 1 412 ? 170.512 10.453 156.694 1.00 26.83  ? 412  THR A C   1 
ATOM   3188 O O   . THR A 1 412 ? 171.134 10.248 155.680 1.00 28.07  ? 412  THR A O   1 
ATOM   3189 C CB  . THR A 1 412 ? 172.109 10.919 158.613 1.00 22.28  ? 412  THR A CB  1 
ATOM   3190 O OG1 . THR A 1 412 ? 172.713 12.054 159.273 1.00 24.38  ? 412  THR A OG1 1 
ATOM   3191 C CG2 . THR A 1 412 ? 173.171 10.191 157.840 1.00 21.65  ? 412  THR A CG2 1 
ATOM   3192 N N   . LYS A 1 413 ? 169.406 9.822  156.988 1.00 29.49  ? 413  LYS A N   1 
ATOM   3193 C CA  . LYS A 1 413 ? 168.764 8.908  156.071 1.00 34.12  ? 413  LYS A CA  1 
ATOM   3194 C C   . LYS A 1 413 ? 168.429 9.580  154.732 1.00 34.95  ? 413  LYS A C   1 
ATOM   3195 O O   . LYS A 1 413 ? 168.565 8.939  153.733 1.00 27.61  ? 413  LYS A O   1 
ATOM   3196 C CB  . LYS A 1 413 ? 167.478 8.336  156.655 1.00 37.51  ? 413  LYS A CB  1 
ATOM   3197 C CG  . LYS A 1 413 ? 167.760 7.244  157.659 1.00 56.38  ? 413  LYS A CG  1 
ATOM   3198 C CD  . LYS A 1 413 ? 166.510 6.607  158.286 1.00 66.30  ? 413  LYS A CD  1 
ATOM   3199 C CE  . LYS A 1 413 ? 166.874 5.869  159.596 1.00 72.24  ? 413  LYS A CE  1 
ATOM   3200 N NZ  . LYS A 1 413 ? 165.774 5.867  160.620 1.00 75.79  ? 413  LYS A NZ  1 
ATOM   3201 N N   . PHE A 1 414 ? 167.997 10.842 154.744 1.00 29.69  ? 414  PHE A N   1 
ATOM   3202 C CA  . PHE A 1 414 ? 167.540 11.556 153.550 1.00 29.20  ? 414  PHE A CA  1 
ATOM   3203 C C   . PHE A 1 414 ? 168.403 12.714 153.089 1.00 29.78  ? 414  PHE A C   1 
ATOM   3204 O O   . PHE A 1 414 ? 168.194 13.243 151.989 1.00 28.39  ? 414  PHE A O   1 
ATOM   3205 C CB  . PHE A 1 414 ? 166.176 12.140 153.817 1.00 26.97  ? 414  PHE A CB  1 
ATOM   3206 C CG  . PHE A 1 414 ? 165.105 11.132 153.983 1.00 32.08  ? 414  PHE A CG  1 
ATOM   3207 C CD1 . PHE A 1 414 ? 164.407 10.669 152.873 1.00 38.46  ? 414  PHE A CD1 1 
ATOM   3208 C CD2 . PHE A 1 414 ? 164.720 10.715 155.226 1.00 28.31  ? 414  PHE A CD2 1 
ATOM   3209 C CE1 . PHE A 1 414 ? 163.346 9.804  153.032 1.00 40.16  ? 414  PHE A CE1 1 
ATOM   3210 C CE2 . PHE A 1 414 ? 163.706 9.834  155.400 1.00 32.10  ? 414  PHE A CE2 1 
ATOM   3211 C CZ  . PHE A 1 414 ? 163.014 9.359  154.314 1.00 39.76  ? 414  PHE A CZ  1 
ATOM   3212 N N   . GLY A 1 415 ? 169.368 13.131 153.909 1.00 27.22  ? 415  GLY A N   1 
ATOM   3213 C CA  . GLY A 1 415 ? 170.074 14.381 153.667 1.00 25.80  ? 415  GLY A CA  1 
ATOM   3214 C C   . GLY A 1 415 ? 171.295 14.211 152.833 1.00 25.95  ? 415  GLY A C   1 
ATOM   3215 O O   . GLY A 1 415 ? 171.629 13.135 152.457 1.00 23.90  ? 415  GLY A O   1 
ATOM   3216 N N   . ASN A 1 416 ? 172.012 15.296 152.599 1.00 24.55  ? 416  ASN A N   1 
ATOM   3217 C CA  . ASN A 1 416 ? 173.121 15.216 151.662 1.00 25.38  ? 416  ASN A CA  1 
ATOM   3218 C C   . ASN A 1 416 ? 174.486 15.364 152.262 1.00 29.20  ? 416  ASN A C   1 
ATOM   3219 O O   . ASN A 1 416 ? 175.466 15.596 151.545 1.00 28.55  ? 416  ASN A O   1 
ATOM   3220 C CB  . ASN A 1 416 ? 172.856 16.243 150.508 1.00 30.80  ? 416  ASN A CB  1 
ATOM   3221 C CG  . ASN A 1 416 ? 173.848 16.107 149.359 1.00 29.64  ? 416  ASN A CG  1 
ATOM   3222 O OD1 . ASN A 1 416 ? 174.564 17.057 149.018 1.00 30.13  ? 416  ASN A OD1 1 
ATOM   3223 N ND2 . ASN A 1 416 ? 173.951 14.895 148.810 1.00 31.34  ? 416  ASN A ND2 1 
ATOM   3224 N N   . GLY A 1 417 ? 174.624 15.120 153.580 1.00 25.09  ? 417  GLY A N   1 
ATOM   3225 C CA  . GLY A 1 417 ? 175.961 15.160 154.181 1.00 23.16  ? 417  GLY A CA  1 
ATOM   3226 C C   . GLY A 1 417 ? 175.905 15.746 155.623 1.00 25.27  ? 417  GLY A C   1 
ATOM   3227 O O   . GLY A 1 417 ? 175.479 16.909 155.820 1.00 22.28  ? 417  GLY A O   1 
ATOM   3228 N N   . THR A 1 418 ? 176.370 14.955 156.580 1.00 24.43  ? 418  THR A N   1 
ATOM   3229 C CA  . THR A 1 418 ? 176.294 15.231 158.030 1.00 22.76  ? 418  THR A CA  1 
ATOM   3230 C C   . THR A 1 418 ? 177.684 15.114 158.615 1.00 21.20  ? 418  THR A C   1 
ATOM   3231 O O   . THR A 1 418 ? 178.386 14.145 158.305 1.00 21.77  ? 418  THR A O   1 
ATOM   3232 C CB  . THR A 1 418 ? 175.398 14.198 158.703 1.00 23.26  ? 418  THR A CB  1 
ATOM   3233 O OG1 . THR A 1 418 ? 174.045 14.259 158.164 1.00 21.13  ? 418  THR A OG1 1 
ATOM   3234 C CG2 . THR A 1 418 ? 175.304 14.507 160.258 1.00 23.54  ? 418  THR A CG2 1 
ATOM   3235 N N   . TYR A 1 419 ? 178.096 16.152 159.359 1.00 19.88  ? 419  TYR A N   1 
ATOM   3236 C CA  . TYR A 1 419 ? 179.289 16.216 160.147 1.00 20.02  ? 419  TYR A CA  1 
ATOM   3237 C C   . TYR A 1 419 ? 178.942 16.477 161.660 1.00 21.67  ? 419  TYR A C   1 
ATOM   3238 O O   . TYR A 1 419 ? 178.275 17.462 162.007 1.00 21.15  ? 419  TYR A O   1 
ATOM   3239 C CB  . TYR A 1 419 ? 180.227 17.276 159.602 1.00 20.10  ? 419  TYR A CB  1 
ATOM   3240 C CG  . TYR A 1 419 ? 180.685 16.959 158.177 1.00 20.49  ? 419  TYR A CG  1 
ATOM   3241 C CD1 . TYR A 1 419 ? 181.865 16.257 157.928 1.00 23.11  ? 419  TYR A CD1 1 
ATOM   3242 C CD2 . TYR A 1 419 ? 179.923 17.363 157.100 1.00 22.83  ? 419  TYR A CD2 1 
ATOM   3243 C CE1 . TYR A 1 419 ? 182.265 15.949 156.619 1.00 24.29  ? 419  TYR A CE1 1 
ATOM   3244 C CE2 . TYR A 1 419 ? 180.302 17.094 155.801 1.00 25.58  ? 419  TYR A CE2 1 
ATOM   3245 C CZ  . TYR A 1 419 ? 181.468 16.391 155.559 1.00 26.14  ? 419  TYR A CZ  1 
ATOM   3246 O OH  . TYR A 1 419 ? 181.765 16.133 154.240 1.00 26.66  ? 419  TYR A OH  1 
ATOM   3247 N N   . LEU A 1 420 ? 179.385 15.567 162.535 1.00 21.77  ? 420  LEU A N   1 
ATOM   3248 C CA  . LEU A 1 420 ? 178.983 15.570 163.935 1.00 20.89  ? 420  LEU A CA  1 
ATOM   3249 C C   . LEU A 1 420 ? 180.204 15.771 164.802 1.00 21.37  ? 420  LEU A C   1 
ATOM   3250 O O   . LEU A 1 420 ? 181.234 15.136 164.601 1.00 20.76  ? 420  LEU A O   1 
ATOM   3251 C CB  . LEU A 1 420 ? 178.302 14.221 164.282 1.00 19.81  ? 420  LEU A CB  1 
ATOM   3252 C CG  . LEU A 1 420 ? 177.770 14.002 165.708 1.00 18.99  ? 420  LEU A CG  1 
ATOM   3253 C CD1 . LEU A 1 420 ? 176.734 15.057 166.036 1.00 19.31  ? 420  LEU A CD1 1 
ATOM   3254 C CD2 . LEU A 1 420 ? 177.205 12.590 165.955 1.00 18.97  ? 420  LEU A CD2 1 
ATOM   3255 N N   . TYR A 1 421 ? 180.079 16.646 165.797 1.00 20.42  ? 421  TYR A N   1 
ATOM   3256 C CA  . TYR A 1 421 ? 181.177 16.894 166.748 1.00 20.07  ? 421  TYR A CA  1 
ATOM   3257 C C   . TYR A 1 421 ? 180.734 16.733 168.245 1.00 20.02  ? 421  TYR A C   1 
ATOM   3258 O O   . TYR A 1 421 ? 179.549 16.870 168.620 1.00 22.34  ? 421  TYR A O   1 
ATOM   3259 C CB  . TYR A 1 421 ? 181.759 18.277 166.566 1.00 18.60  ? 421  TYR A CB  1 
ATOM   3260 C CG  . TYR A 1 421 ? 180.856 19.432 167.024 1.00 21.62  ? 421  TYR A CG  1 
ATOM   3261 C CD1 . TYR A 1 421 ? 180.779 19.817 168.376 1.00 21.71  ? 421  TYR A CD1 1 
ATOM   3262 C CD2 . TYR A 1 421 ? 180.091 20.145 166.110 1.00 20.46  ? 421  TYR A CD2 1 
ATOM   3263 C CE1 . TYR A 1 421 ? 179.943 20.872 168.761 1.00 20.60  ? 421  TYR A CE1 1 
ATOM   3264 C CE2 . TYR A 1 421 ? 179.283 21.190 166.497 1.00 21.39  ? 421  TYR A CE2 1 
ATOM   3265 C CZ  . TYR A 1 421 ? 179.203 21.539 167.844 1.00 21.65  ? 421  TYR A CZ  1 
ATOM   3266 O OH  . TYR A 1 421 ? 178.376 22.549 168.253 1.00 19.74  ? 421  TYR A OH  1 
ATOM   3267 N N   . PHE A 1 422 ? 181.721 16.525 169.082 1.00 21.57  ? 422  PHE A N   1 
ATOM   3268 C CA  . PHE A 1 422 ? 181.569 16.499 170.541 1.00 21.64  ? 422  PHE A CA  1 
ATOM   3269 C C   . PHE A 1 422 ? 182.634 17.448 171.110 1.00 21.45  ? 422  PHE A C   1 
ATOM   3270 O O   . PHE A 1 422 ? 183.847 17.194 171.046 1.00 22.97  ? 422  PHE A O   1 
ATOM   3271 C CB  . PHE A 1 422 ? 181.709 15.059 171.007 1.00 23.84  ? 422  PHE A CB  1 
ATOM   3272 C CG  . PHE A 1 422 ? 181.556 14.861 172.509 1.00 26.01  ? 422  PHE A CG  1 
ATOM   3273 C CD1 . PHE A 1 422 ? 180.293 14.853 173.093 1.00 26.03  ? 422  PHE A CD1 1 
ATOM   3274 C CD2 . PHE A 1 422 ? 182.656 14.632 173.307 1.00 24.22  ? 422  PHE A CD2 1 
ATOM   3275 C CE1 . PHE A 1 422 ? 180.107 14.610 174.445 1.00 26.56  ? 422  PHE A CE1 1 
ATOM   3276 C CE2 . PHE A 1 422 ? 182.500 14.432 174.709 1.00 28.74  ? 422  PHE A CE2 1 
ATOM   3277 C CZ  . PHE A 1 422 ? 181.229 14.425 175.274 1.00 28.60  ? 422  PHE A CZ  1 
ATOM   3278 N N   . PHE A 1 423 ? 182.178 18.589 171.594 1.00 20.58  ? 423  PHE A N   1 
ATOM   3279 C CA  . PHE A 1 423 ? 183.077 19.615 172.037 1.00 21.63  ? 423  PHE A CA  1 
ATOM   3280 C C   . PHE A 1 423 ? 183.325 19.369 173.531 1.00 23.97  ? 423  PHE A C   1 
ATOM   3281 O O   . PHE A 1 423 ? 182.379 19.432 174.345 1.00 23.32  ? 423  PHE A O   1 
ATOM   3282 C CB  . PHE A 1 423 ? 182.444 20.954 171.817 1.00 20.84  ? 423  PHE A CB  1 
ATOM   3283 C CG  . PHE A 1 423 ? 183.263 22.081 172.338 1.00 22.08  ? 423  PHE A CG  1 
ATOM   3284 C CD1 . PHE A 1 423 ? 184.274 22.610 171.583 1.00 23.00  ? 423  PHE A CD1 1 
ATOM   3285 C CD2 . PHE A 1 423 ? 183.004 22.628 173.599 1.00 22.94  ? 423  PHE A CD2 1 
ATOM   3286 C CE1 . PHE A 1 423 ? 185.040 23.669 172.072 1.00 23.75  ? 423  PHE A CE1 1 
ATOM   3287 C CE2 . PHE A 1 423 ? 183.768 23.659 174.084 1.00 21.76  ? 423  PHE A CE2 1 
ATOM   3288 C CZ  . PHE A 1 423 ? 184.773 24.183 173.319 1.00 23.14  ? 423  PHE A CZ  1 
ATOM   3289 N N   . ASN A 1 424 ? 184.554 19.029 173.887 1.00 23.98  ? 424  ASN A N   1 
ATOM   3290 C CA  . ASN A 1 424 ? 184.832 18.707 175.279 1.00 26.95  ? 424  ASN A CA  1 
ATOM   3291 C C   . ASN A 1 424 ? 186.078 19.389 175.827 1.00 26.24  ? 424  ASN A C   1 
ATOM   3292 O O   . ASN A 1 424 ? 186.764 18.809 176.650 1.00 24.51  ? 424  ASN A O   1 
ATOM   3293 C CB  . ASN A 1 424 ? 184.907 17.208 175.457 1.00 25.85  ? 424  ASN A CB  1 
ATOM   3294 C CG  . ASN A 1 424 ? 186.069 16.608 174.742 1.00 27.91  ? 424  ASN A CG  1 
ATOM   3295 O OD1 . ASN A 1 424 ? 186.764 17.270 173.958 1.00 25.21  ? 424  ASN A OD1 1 
ATOM   3296 N ND2 . ASN A 1 424 ? 186.305 15.352 175.018 1.00 29.33  ? 424  ASN A ND2 1 
ATOM   3297 N N   . HIS A 1 425 ? 186.312 20.633 175.407 1.00 27.13  ? 425  HIS A N   1 
ATOM   3298 C CA  . HIS A 1 425 ? 187.388 21.446 175.963 1.00 26.96  ? 425  HIS A CA  1 
ATOM   3299 C C   . HIS A 1 425 ? 186.787 22.514 176.859 1.00 26.80  ? 425  HIS A C   1 
ATOM   3300 O O   . HIS A 1 425 ? 186.038 23.359 176.411 1.00 29.15  ? 425  HIS A O   1 
ATOM   3301 C CB  . HIS A 1 425 ? 188.242 22.158 174.886 1.00 25.83  ? 425  HIS A CB  1 
ATOM   3302 C CG  . HIS A 1 425 ? 189.295 23.056 175.460 1.00 24.20  ? 425  HIS A CG  1 
ATOM   3303 N ND1 . HIS A 1 425 ? 190.419 22.558 176.079 1.00 26.30  ? 425  HIS A ND1 1 
ATOM   3304 C CD2 . HIS A 1 425 ? 189.349 24.397 175.607 1.00 23.27  ? 425  HIS A CD2 1 
ATOM   3305 C CE1 . HIS A 1 425 ? 191.153 23.554 176.525 1.00 24.04  ? 425  HIS A CE1 1 
ATOM   3306 N NE2 . HIS A 1 425 ? 190.508 24.681 176.283 1.00 27.94  ? 425  HIS A NE2 1 
ATOM   3307 N N   . ARG A 1 426 ? 187.190 22.495 178.113 1.00 29.19  ? 426  ARG A N   1 
ATOM   3308 C CA  . ARG A 1 426 ? 186.780 23.502 179.052 1.00 28.69  ? 426  ARG A CA  1 
ATOM   3309 C C   . ARG A 1 426 ? 187.775 24.691 178.954 1.00 25.30  ? 426  ARG A C   1 
ATOM   3310 O O   . ARG A 1 426 ? 188.953 24.526 179.191 1.00 26.67  ? 426  ARG A O   1 
ATOM   3311 C CB  . ARG A 1 426 ? 186.807 22.943 180.485 1.00 30.04  ? 426  ARG A CB  1 
ATOM   3312 C CG  . ARG A 1 426 ? 186.390 24.028 181.488 1.00 31.55  ? 426  ARG A CG  1 
ATOM   3313 C CD  . ARG A 1 426 ? 186.347 23.541 182.908 1.00 30.26  ? 426  ARG A CD  1 
ATOM   3314 N NE  . ARG A 1 426 ? 186.335 24.635 183.880 1.00 29.75  ? 426  ARG A NE  1 
ATOM   3315 C CZ  . ARG A 1 426 ? 185.284 25.061 184.590 1.00 28.47  ? 426  ARG A CZ  1 
ATOM   3316 N NH1 . ARG A 1 426 ? 184.034 24.606 184.413 1.00 25.68  ? 426  ARG A NH1 1 
ATOM   3317 N NH2 . ARG A 1 426 ? 185.486 26.013 185.482 1.00 30.21  ? 426  ARG A NH2 1 
ATOM   3318 N N   . ALA A 1 427 ? 187.262 25.858 178.645 1.00 24.06  ? 427  ALA A N   1 
ATOM   3319 C CA  . ALA A 1 427 ? 188.082 27.064 178.533 1.00 28.17  ? 427  ALA A CA  1 
ATOM   3320 C C   . ALA A 1 427 ? 188.868 27.298 179.804 1.00 28.88  ? 427  ALA A C   1 
ATOM   3321 O O   . ALA A 1 427 ? 188.354 27.166 180.922 1.00 29.82  ? 427  ALA A O   1 
ATOM   3322 C CB  . ALA A 1 427 ? 187.210 28.278 178.249 1.00 27.33  ? 427  ALA A CB  1 
ATOM   3323 N N   . SER A 1 428 ? 190.113 27.706 179.632 1.00 34.51  ? 428  SER A N   1 
ATOM   3324 C CA  . SER A 1 428 ? 191.064 27.800 180.730 1.00 31.82  ? 428  SER A CA  1 
ATOM   3325 C C   . SER A 1 428 ? 190.714 28.967 181.654 1.00 30.48  ? 428  SER A C   1 
ATOM   3326 O O   . SER A 1 428 ? 191.142 28.977 182.773 1.00 30.29  ? 428  SER A O   1 
ATOM   3327 C CB  . SER A 1 428 ? 192.457 28.058 180.125 1.00 34.95  ? 428  SER A CB  1 
ATOM   3328 O OG  . SER A 1 428 ? 192.412 29.320 179.440 1.00 30.89  ? 428  SER A OG  1 
ATOM   3329 N N   . ASN A 1 429 ? 189.986 29.968 181.148 1.00 27.58  ? 429  ASN A N   1 
ATOM   3330 C CA  . ASN A 1 429 ? 189.658 31.193 181.840 1.00 26.53  ? 429  ASN A CA  1 
ATOM   3331 C C   . ASN A 1 429 ? 188.166 31.195 182.250 1.00 25.71  ? 429  ASN A C   1 
ATOM   3332 O O   . ASN A 1 429 ? 187.552 32.256 182.552 1.00 25.64  ? 429  ASN A O   1 
ATOM   3333 C CB  . ASN A 1 429 ? 189.950 32.377 180.910 1.00 27.79  ? 429  ASN A CB  1 
ATOM   3334 C CG  . ASN A 1 429 ? 189.160 32.292 179.545 1.00 29.74  ? 429  ASN A CG  1 
ATOM   3335 O OD1 . ASN A 1 429 ? 188.360 31.349 179.305 1.00 24.99  ? 429  ASN A OD1 1 
ATOM   3336 N ND2 . ASN A 1 429 ? 189.397 33.281 178.648 1.00 28.52  ? 429  ASN A ND2 1 
ATOM   3337 N N   . LEU A 1 430 ? 187.556 30.027 182.199 1.00 26.33  ? 430  LEU A N   1 
ATOM   3338 C CA  . LEU A 1 430 ? 186.126 29.923 182.579 1.00 29.08  ? 430  LEU A CA  1 
ATOM   3339 C C   . LEU A 1 430 ? 185.880 30.385 184.013 1.00 27.44  ? 430  LEU A C   1 
ATOM   3340 O O   . LEU A 1 430 ? 186.562 29.948 184.916 1.00 29.60  ? 430  LEU A O   1 
ATOM   3341 C CB  . LEU A 1 430 ? 185.606 28.494 182.416 1.00 29.87  ? 430  LEU A CB  1 
ATOM   3342 C CG  . LEU A 1 430 ? 184.404 28.450 181.454 1.00 32.76  ? 430  LEU A CG  1 
ATOM   3343 C CD1 . LEU A 1 430 ? 184.062 27.060 180.965 1.00 40.14  ? 430  LEU A CD1 1 
ATOM   3344 C CD2 . LEU A 1 430 ? 183.174 28.985 182.100 1.00 36.31  ? 430  LEU A CD2 1 
ATOM   3345 N N   . VAL A 1 431 ? 184.920 31.263 184.229 1.00 27.70  ? 431  VAL A N   1 
ATOM   3346 C CA  . VAL A 1 431 ? 184.739 31.857 185.571 1.00 27.10  ? 431  VAL A CA  1 
ATOM   3347 C C   . VAL A 1 431 ? 183.709 31.071 186.385 1.00 26.98  ? 431  VAL A C   1 
ATOM   3348 O O   . VAL A 1 431 ? 183.555 31.285 187.552 1.00 24.96  ? 431  VAL A O   1 
ATOM   3349 C CB  . VAL A 1 431 ? 184.327 33.326 185.467 1.00 30.39  ? 431  VAL A CB  1 
ATOM   3350 C CG1 . VAL A 1 431 ? 185.459 34.152 184.827 1.00 30.90  ? 431  VAL A CG1 1 
ATOM   3351 C CG2 . VAL A 1 431 ? 183.033 33.492 184.661 1.00 30.90  ? 431  VAL A CG2 1 
ATOM   3352 N N   . TRP A 1 432 ? 182.961 30.188 185.741 1.00 25.16  ? 432  TRP A N   1 
ATOM   3353 C CA  . TRP A 1 432 ? 182.032 29.266 186.441 1.00 24.36  ? 432  TRP A CA  1 
ATOM   3354 C C   . TRP A 1 432 ? 182.831 28.170 187.137 1.00 21.20  ? 432  TRP A C   1 
ATOM   3355 O O   . TRP A 1 432 ? 183.945 27.871 186.724 1.00 23.87  ? 432  TRP A O   1 
ATOM   3356 C CB  . TRP A 1 432 ? 181.090 28.628 185.426 1.00 22.63  ? 432  TRP A CB  1 
ATOM   3357 C CG  . TRP A 1 432 ? 180.108 29.573 184.847 1.00 21.87  ? 432  TRP A CG  1 
ATOM   3358 C CD1 . TRP A 1 432 ? 180.138 30.109 183.584 1.00 21.04  ? 432  TRP A CD1 1 
ATOM   3359 C CD2 . TRP A 1 432 ? 178.968 30.156 185.498 1.00 20.02  ? 432  TRP A CD2 1 
ATOM   3360 N NE1 . TRP A 1 432 ? 179.087 31.016 183.426 1.00 19.38  ? 432  TRP A NE1 1 
ATOM   3361 C CE2 . TRP A 1 432 ? 178.345 31.035 184.565 1.00 21.52  ? 432  TRP A CE2 1 
ATOM   3362 C CE3 . TRP A 1 432 ? 178.454 30.070 186.779 1.00 20.59  ? 432  TRP A CE3 1 
ATOM   3363 C CZ2 . TRP A 1 432 ? 177.183 31.763 184.858 1.00 24.86  ? 432  TRP A CZ2 1 
ATOM   3364 C CZ3 . TRP A 1 432 ? 177.284 30.760 187.081 1.00 22.93  ? 432  TRP A CZ3 1 
ATOM   3365 C CH2 . TRP A 1 432 ? 176.666 31.621 186.123 1.00 27.25  ? 432  TRP A CH2 1 
ATOM   3366 N N   . PRO A 1 433 ? 182.265 27.528 188.165 1.00 24.51  ? 433  PRO A N   1 
ATOM   3367 C CA  . PRO A 1 433 ? 183.087 26.512 188.857 1.00 23.64  ? 433  PRO A CA  1 
ATOM   3368 C C   . PRO A 1 433 ? 183.359 25.261 188.045 1.00 25.09  ? 433  PRO A C   1 
ATOM   3369 O O   . PRO A 1 433 ? 182.641 24.919 187.071 1.00 21.98  ? 433  PRO A O   1 
ATOM   3370 C CB  . PRO A 1 433 ? 182.236 26.135 190.033 1.00 24.04  ? 433  PRO A CB  1 
ATOM   3371 C CG  . PRO A 1 433 ? 180.804 26.385 189.574 1.00 23.50  ? 433  PRO A CG  1 
ATOM   3372 C CD  . PRO A 1 433 ? 180.920 27.640 188.762 1.00 23.54  ? 433  PRO A CD  1 
ATOM   3373 N N   . GLU A 1 434 ? 184.283 24.473 188.548 1.00 23.57  ? 434  GLU A N   1 
ATOM   3374 C CA  . GLU A 1 434 ? 184.791 23.309 187.865 1.00 26.18  ? 434  GLU A CA  1 
ATOM   3375 C C   . GLU A 1 434 ? 183.779 22.234 187.778 1.00 24.81  ? 434  GLU A C   1 
ATOM   3376 O O   . GLU A 1 434 ? 183.778 21.476 186.814 1.00 26.17  ? 434  GLU A O   1 
ATOM   3377 C CB  . GLU A 1 434 ? 186.059 22.772 188.558 1.00 31.02  ? 434  GLU A CB  1 
ATOM   3378 C CG  . GLU A 1 434 ? 187.150 23.785 188.416 1.00 41.18  ? 434  GLU A CG  1 
ATOM   3379 C CD  . GLU A 1 434 ? 188.518 23.220 188.734 1.00 62.48  ? 434  GLU A CD  1 
ATOM   3380 O OE1 . GLU A 1 434 ? 188.678 22.592 189.830 1.00 57.31  ? 434  GLU A OE1 1 
ATOM   3381 O OE2 . GLU A 1 434 ? 189.431 23.427 187.883 1.00 73.44  ? 434  GLU A OE2 1 
ATOM   3382 N N   . TRP A 1 435 ? 182.880 22.157 188.752 1.00 22.93  ? 435  TRP A N   1 
ATOM   3383 C CA  . TRP A 1 435 ? 181.945 21.071 188.730 1.00 22.82  ? 435  TRP A CA  1 
ATOM   3384 C C   . TRP A 1 435 ? 181.031 21.117 187.434 1.00 21.71  ? 435  TRP A C   1 
ATOM   3385 O O   . TRP A 1 435 ? 180.460 20.156 187.049 1.00 19.03  ? 435  TRP A O   1 
ATOM   3386 C CB  . TRP A 1 435 ? 181.100 21.018 190.002 1.00 19.94  ? 435  TRP A CB  1 
ATOM   3387 C CG  . TRP A 1 435 ? 180.052 22.077 190.218 1.00 20.13  ? 435  TRP A CG  1 
ATOM   3388 C CD1 . TRP A 1 435 ? 180.153 23.152 191.061 1.00 20.34  ? 435  TRP A CD1 1 
ATOM   3389 C CD2 . TRP A 1 435 ? 178.741 22.138 189.664 1.00 19.95  ? 435  TRP A CD2 1 
ATOM   3390 N NE1 . TRP A 1 435 ? 178.991 23.873 191.060 1.00 21.84  ? 435  TRP A NE1 1 
ATOM   3391 C CE2 . TRP A 1 435 ? 178.100 23.264 190.223 1.00 19.01  ? 435  TRP A CE2 1 
ATOM   3392 C CE3 . TRP A 1 435 ? 178.024 21.320 188.797 1.00 19.83  ? 435  TRP A CE3 1 
ATOM   3393 C CZ2 . TRP A 1 435 ? 176.846 23.676 189.854 1.00 18.84  ? 435  TRP A CZ2 1 
ATOM   3394 C CZ3 . TRP A 1 435 ? 176.707 21.687 188.475 1.00 20.76  ? 435  TRP A CZ3 1 
ATOM   3395 C CH2 . TRP A 1 435 ? 176.139 22.880 189.016 1.00 21.14  ? 435  TRP A CH2 1 
ATOM   3396 N N   . MET A 1 436 ? 180.851 22.304 186.895 1.00 23.02  ? 436  MET A N   1 
ATOM   3397 C CA  . MET A 1 436 ? 179.999 22.525 185.732 1.00 22.38  ? 436  MET A CA  1 
ATOM   3398 C C   . MET A 1 436 ? 180.640 21.997 184.411 1.00 23.35  ? 436  MET A C   1 
ATOM   3399 O O   . MET A 1 436 ? 179.903 21.762 183.431 1.00 25.37  ? 436  MET A O   1 
ATOM   3400 C CB  . MET A 1 436 ? 179.658 23.985 185.622 1.00 21.12  ? 436  MET A CB  1 
ATOM   3401 C CG  . MET A 1 436 ? 178.737 24.424 186.772 1.00 22.66  ? 436  MET A CG  1 
ATOM   3402 S SD  . MET A 1 436 ? 178.299 26.149 186.839 1.00 21.81  ? 436  MET A SD  1 
ATOM   3403 C CE  . MET A 1 436 ? 176.999 26.242 185.565 1.00 20.82  ? 436  MET A CE  1 
ATOM   3404 N N   . GLY A 1 437 ? 181.956 21.784 184.421 1.00 22.18  ? 437  GLY A N   1 
ATOM   3405 C CA  . GLY A 1 437 ? 182.659 21.086 183.307 1.00 21.58  ? 437  GLY A CA  1 
ATOM   3406 C C   . GLY A 1 437 ? 182.626 21.947 182.023 1.00 21.35  ? 437  GLY A C   1 
ATOM   3407 O O   . GLY A 1 437 ? 182.899 23.125 182.036 1.00 20.23  ? 437  GLY A O   1 
ATOM   3408 N N   . VAL A 1 438 ? 182.270 21.332 180.913 1.00 24.22  ? 438  VAL A N   1 
ATOM   3409 C CA  . VAL A 1 438 ? 182.266 22.009 179.611 1.00 22.28  ? 438  VAL A CA  1 
ATOM   3410 C C   . VAL A 1 438 ? 180.831 22.404 179.353 1.00 20.09  ? 438  VAL A C   1 
ATOM   3411 O O   . VAL A 1 438 ? 179.999 21.616 178.882 1.00 21.35  ? 438  VAL A O   1 
ATOM   3412 C CB  . VAL A 1 438 ? 182.744 21.027 178.525 1.00 24.43  ? 438  VAL A CB  1 
ATOM   3413 C CG1 . VAL A 1 438 ? 182.790 21.704 177.158 1.00 25.60  ? 438  VAL A CG1 1 
ATOM   3414 C CG2 . VAL A 1 438 ? 184.098 20.438 178.897 1.00 24.80  ? 438  VAL A CG2 1 
ATOM   3415 N N   . ILE A 1 439 ? 180.562 23.633 179.703 1.00 19.89  ? 439  ILE A N   1 
ATOM   3416 C CA  . ILE A 1 439 ? 179.246 24.137 179.958 1.00 21.37  ? 439  ILE A CA  1 
ATOM   3417 C C   . ILE A 1 439 ? 178.547 24.501 178.644 1.00 23.99  ? 439  ILE A C   1 
ATOM   3418 O O   . ILE A 1 439 ? 179.173 24.904 177.718 1.00 21.78  ? 439  ILE A O   1 
ATOM   3419 C CB  . ILE A 1 439 ? 179.348 25.412 180.792 1.00 21.37  ? 439  ILE A CB  1 
ATOM   3420 C CG1 . ILE A 1 439 ? 179.955 25.095 182.134 1.00 24.92  ? 439  ILE A CG1 1 
ATOM   3421 C CG2 . ILE A 1 439 ? 178.004 26.121 181.065 1.00 23.53  ? 439  ILE A CG2 1 
ATOM   3422 C CD1 . ILE A 1 439 ? 180.165 26.374 182.928 1.00 24.89  ? 439  ILE A CD1 1 
ATOM   3423 N N   . HIS A 1 440 ? 177.228 24.383 178.648 1.00 21.88  ? 440  HIS A N   1 
ATOM   3424 C CA  . HIS A 1 440 ? 176.358 24.762 177.567 1.00 23.31  ? 440  HIS A CA  1 
ATOM   3425 C C   . HIS A 1 440 ? 176.667 26.212 177.226 1.00 22.43  ? 440  HIS A C   1 
ATOM   3426 O O   . HIS A 1 440 ? 176.706 27.039 178.094 1.00 25.26  ? 440  HIS A O   1 
ATOM   3427 C CB  . HIS A 1 440 ? 174.974 24.561 178.120 1.00 24.37  ? 440  HIS A CB  1 
ATOM   3428 C CG  . HIS A 1 440 ? 173.869 24.923 177.222 1.00 28.06  ? 440  HIS A CG  1 
ATOM   3429 N ND1 . HIS A 1 440 ? 173.448 24.094 176.197 1.00 26.42  ? 440  HIS A ND1 1 
ATOM   3430 C CD2 . HIS A 1 440 ? 173.056 26.013 177.207 1.00 29.41  ? 440  HIS A CD2 1 
ATOM   3431 C CE1 . HIS A 1 440 ? 172.382 24.628 175.631 1.00 28.32  ? 440  HIS A CE1 1 
ATOM   3432 N NE2 . HIS A 1 440 ? 172.127 25.793 176.216 1.00 31.62  ? 440  HIS A NE2 1 
ATOM   3433 N N   . GLY A 1 441 ? 176.963 26.504 175.977 1.00 20.84  ? 441  GLY A N   1 
ATOM   3434 C CA  . GLY A 1 441 ? 177.243 27.846 175.543 1.00 20.68  ? 441  GLY A CA  1 
ATOM   3435 C C   . GLY A 1 441 ? 178.715 28.224 175.379 1.00 20.96  ? 441  GLY A C   1 
ATOM   3436 O O   . GLY A 1 441 ? 179.044 29.257 174.784 1.00 21.50  ? 441  GLY A O   1 
ATOM   3437 N N   . TYR A 1 442 ? 179.599 27.447 175.937 1.00 19.28  ? 442  TYR A N   1 
ATOM   3438 C CA  . TYR A 1 442 ? 180.969 27.890 176.061 1.00 20.64  ? 442  TYR A CA  1 
ATOM   3439 C C   . TYR A 1 442 ? 181.845 27.343 174.893 1.00 23.40  ? 442  TYR A C   1 
ATOM   3440 O O   . TYR A 1 442 ? 183.068 27.471 174.938 1.00 22.94  ? 442  TYR A O   1 
ATOM   3441 C CB  . TYR A 1 442 ? 181.535 27.566 177.489 1.00 21.25  ? 442  TYR A CB  1 
ATOM   3442 C CG  . TYR A 1 442 ? 181.040 28.650 178.408 1.00 20.74  ? 442  TYR A CG  1 
ATOM   3443 C CD1 . TYR A 1 442 ? 179.793 28.549 179.021 1.00 21.97  ? 442  TYR A CD1 1 
ATOM   3444 C CD2 . TYR A 1 442 ? 181.694 29.890 178.475 1.00 20.97  ? 442  TYR A CD2 1 
ATOM   3445 C CE1 . TYR A 1 442 ? 179.266 29.603 179.780 1.00 19.79  ? 442  TYR A CE1 1 
ATOM   3446 C CE2 . TYR A 1 442 ? 181.161 30.926 179.236 1.00 20.83  ? 442  TYR A CE2 1 
ATOM   3447 C CZ  . TYR A 1 442 ? 179.959 30.756 179.910 1.00 20.20  ? 442  TYR A CZ  1 
ATOM   3448 O OH  . TYR A 1 442 ? 179.385 31.820 180.571 1.00 21.49  ? 442  TYR A OH  1 
ATOM   3449 N N   . GLU A 1 443 ? 181.207 26.748 173.856 1.00 20.97  ? 443  GLU A N   1 
ATOM   3450 C CA  . GLU A 1 443 ? 181.865 26.635 172.553 1.00 22.03  ? 443  GLU A CA  1 
ATOM   3451 C C   . GLU A 1 443 ? 181.695 27.908 171.705 1.00 21.83  ? 443  GLU A C   1 
ATOM   3452 O O   . GLU A 1 443 ? 182.427 28.118 170.773 1.00 23.73  ? 443  GLU A O   1 
ATOM   3453 C CB  . GLU A 1 443 ? 181.398 25.378 171.771 1.00 22.49  ? 443  GLU A CB  1 
ATOM   3454 C CG  . GLU A 1 443 ? 180.129 25.511 170.938 1.00 26.01  ? 443  GLU A CG  1 
ATOM   3455 C CD  . GLU A 1 443 ? 178.840 25.883 171.712 1.00 29.22  ? 443  GLU A CD  1 
ATOM   3456 O OE1 . GLU A 1 443 ? 178.793 25.927 172.968 1.00 24.81  ? 443  GLU A OE1 1 
ATOM   3457 O OE2 . GLU A 1 443 ? 177.838 26.141 171.010 1.00 25.76  ? 443  GLU A OE2 1 
ATOM   3458 N N   . ILE A 1 444 ? 180.723 28.756 172.047 1.00 24.27  ? 444  ILE A N   1 
ATOM   3459 C CA  . ILE A 1 444 ? 180.320 29.847 171.186 1.00 22.39  ? 444  ILE A CA  1 
ATOM   3460 C C   . ILE A 1 444 ? 181.521 30.778 171.057 1.00 25.21  ? 444  ILE A C   1 
ATOM   3461 O O   . ILE A 1 444 ? 181.859 31.244 169.949 1.00 24.16  ? 444  ILE A O   1 
ATOM   3462 C CB  . ILE A 1 444 ? 179.099 30.609 171.748 1.00 22.36  ? 444  ILE A CB  1 
ATOM   3463 C CG1 . ILE A 1 444 ? 177.848 29.701 171.836 1.00 20.86  ? 444  ILE A CG1 1 
ATOM   3464 C CG2 . ILE A 1 444 ? 178.817 31.841 170.901 1.00 22.08  ? 444  ILE A CG2 1 
ATOM   3465 C CD1 . ILE A 1 444 ? 176.617 30.442 172.310 1.00 20.83  ? 444  ILE A CD1 1 
ATOM   3466 N N   . GLU A 1 445 ? 182.211 31.023 172.176 1.00 22.43  ? 445  GLU A N   1 
ATOM   3467 C CA  . GLU A 1 445 ? 183.374 31.913 172.108 1.00 24.39  ? 445  GLU A CA  1 
ATOM   3468 C C   . GLU A 1 445 ? 184.473 31.416 171.124 1.00 23.78  ? 445  GLU A C   1 
ATOM   3469 O O   . GLU A 1 445 ? 185.212 32.230 170.545 1.00 25.87  ? 445  GLU A O   1 
ATOM   3470 C CB  . GLU A 1 445 ? 183.989 32.166 173.541 1.00 24.01  ? 445  GLU A CB  1 
ATOM   3471 C CG  . GLU A 1 445 ? 184.386 30.962 174.314 1.00 23.85  ? 445  GLU A CG  1 
ATOM   3472 C CD  . GLU A 1 445 ? 184.370 31.189 175.854 1.00 27.67  ? 445  GLU A CD  1 
ATOM   3473 O OE1 . GLU A 1 445 ? 183.397 31.795 176.343 1.00 29.11  ? 445  GLU A OE1 1 
ATOM   3474 O OE2 . GLU A 1 445 ? 185.306 30.714 176.564 1.00 27.95  ? 445  GLU A OE2 1 
ATOM   3475 N N   . PHE A 1 446 ? 184.609 30.097 170.978 1.00 21.81  ? 446  PHE A N   1 
ATOM   3476 C CA  . PHE A 1 446 ? 185.558 29.550 170.070 1.00 23.37  ? 446  PHE A CA  1 
ATOM   3477 C C   . PHE A 1 446 ? 185.087 29.736 168.580 1.00 26.02  ? 446  PHE A C   1 
ATOM   3478 O O   . PHE A 1 446 ? 185.874 29.987 167.675 1.00 25.77  ? 446  PHE A O   1 
ATOM   3479 C CB  . PHE A 1 446 ? 185.787 28.088 170.397 1.00 24.05  ? 446  PHE A CB  1 
ATOM   3480 C CG  . PHE A 1 446 ? 186.625 27.874 171.660 1.00 25.04  ? 446  PHE A CG  1 
ATOM   3481 C CD1 . PHE A 1 446 ? 186.026 27.861 172.926 1.00 25.11  ? 446  PHE A CD1 1 
ATOM   3482 C CD2 . PHE A 1 446 ? 188.028 27.775 171.572 1.00 26.78  ? 446  PHE A CD2 1 
ATOM   3483 C CE1 . PHE A 1 446 ? 186.809 27.726 174.072 1.00 24.88  ? 446  PHE A CE1 1 
ATOM   3484 C CE2 . PHE A 1 446 ? 188.799 27.609 172.726 1.00 26.71  ? 446  PHE A CE2 1 
ATOM   3485 C CZ  . PHE A 1 446 ? 188.177 27.609 173.965 1.00 23.26  ? 446  PHE A CZ  1 
ATOM   3486 N N   . VAL A 1 447 ? 183.792 29.602 168.369 1.00 25.74  ? 447  VAL A N   1 
ATOM   3487 C CA  . VAL A 1 447 ? 183.219 29.697 167.053 1.00 23.19  ? 447  VAL A CA  1 
ATOM   3488 C C   . VAL A 1 447 ? 183.322 31.170 166.593 1.00 25.75  ? 447  VAL A C   1 
ATOM   3489 O O   . VAL A 1 447 ? 183.599 31.422 165.416 1.00 22.11  ? 447  VAL A O   1 
ATOM   3490 C CB  . VAL A 1 447 ? 181.744 29.230 167.060 1.00 22.97  ? 447  VAL A CB  1 
ATOM   3491 C CG1 . VAL A 1 447 ? 181.006 29.694 165.770 1.00 22.84  ? 447  VAL A CG1 1 
ATOM   3492 C CG2 . VAL A 1 447 ? 181.659 27.724 167.222 1.00 21.78  ? 447  VAL A CG2 1 
ATOM   3493 N N   . PHE A 1 448 ? 183.122 32.142 167.508 1.00 23.76  ? 448  PHE A N   1 
ATOM   3494 C CA  . PHE A 1 448 ? 183.254 33.556 167.117 1.00 24.33  ? 448  PHE A CA  1 
ATOM   3495 C C   . PHE A 1 448 ? 184.694 34.136 167.272 1.00 23.80  ? 448  PHE A C   1 
ATOM   3496 O O   . PHE A 1 448 ? 184.921 35.337 167.078 1.00 25.00  ? 448  PHE A O   1 
ATOM   3497 C CB  . PHE A 1 448 ? 182.261 34.388 167.853 1.00 23.06  ? 448  PHE A CB  1 
ATOM   3498 C CG  . PHE A 1 448 ? 180.882 34.264 167.320 1.00 23.29  ? 448  PHE A CG  1 
ATOM   3499 C CD1 . PHE A 1 448 ? 180.078 33.165 167.632 1.00 22.75  ? 448  PHE A CD1 1 
ATOM   3500 C CD2 . PHE A 1 448 ? 180.383 35.232 166.457 1.00 25.62  ? 448  PHE A CD2 1 
ATOM   3501 C CE1 . PHE A 1 448 ? 178.795 33.065 167.128 1.00 23.25  ? 448  PHE A CE1 1 
ATOM   3502 C CE2 . PHE A 1 448 ? 179.059 35.143 165.968 1.00 26.39  ? 448  PHE A CE2 1 
ATOM   3503 C CZ  . PHE A 1 448 ? 178.302 34.038 166.266 1.00 24.35  ? 448  PHE A CZ  1 
ATOM   3504 N N   . GLY A 1 449 ? 185.637 33.279 167.585 1.00 22.17  ? 449  GLY A N   1 
ATOM   3505 C CA  . GLY A 1 449 ? 187.054 33.630 167.590 1.00 25.60  ? 449  GLY A CA  1 
ATOM   3506 C C   . GLY A 1 449 ? 187.577 34.506 168.722 1.00 27.86  ? 449  GLY A C   1 
ATOM   3507 O O   . GLY A 1 449 ? 188.651 35.079 168.612 1.00 28.53  ? 449  GLY A O   1 
ATOM   3508 N N   . LEU A 1 450 ? 186.860 34.585 169.829 1.00 27.83  ? 450  LEU A N   1 
ATOM   3509 C CA  . LEU A 1 450 ? 187.345 35.373 170.973 1.00 27.96  ? 450  LEU A CA  1 
ATOM   3510 C C   . LEU A 1 450 ? 188.741 34.999 171.441 1.00 27.18  ? 450  LEU A C   1 
ATOM   3511 O O   . LEU A 1 450 ? 189.476 35.873 171.825 1.00 28.32  ? 450  LEU A O   1 
ATOM   3512 C CB  . LEU A 1 450 ? 186.377 35.368 172.144 1.00 28.55  ? 450  LEU A CB  1 
ATOM   3513 C CG  . LEU A 1 450 ? 185.228 36.376 171.928 1.00 31.11  ? 450  LEU A CG  1 
ATOM   3514 C CD1 . LEU A 1 450 ? 184.411 36.051 170.722 1.00 33.69  ? 450  LEU A CD1 1 
ATOM   3515 C CD2 . LEU A 1 450 ? 184.298 36.397 173.100 1.00 33.29  ? 450  LEU A CD2 1 
ATOM   3516 N N   . PRO A 1 451 ? 189.118 33.729 171.413 1.00 25.79  ? 451  PRO A N   1 
ATOM   3517 C CA  . PRO A 1 451 ? 190.468 33.432 171.844 1.00 28.25  ? 451  PRO A CA  1 
ATOM   3518 C C   . PRO A 1 451 ? 191.625 34.059 171.017 1.00 32.84  ? 451  PRO A C   1 
ATOM   3519 O O   . PRO A 1 451 ? 192.802 33.940 171.398 1.00 31.06  ? 451  PRO A O   1 
ATOM   3520 C CB  . PRO A 1 451 ? 190.535 31.928 171.721 1.00 26.97  ? 451  PRO A CB  1 
ATOM   3521 C CG  . PRO A 1 451 ? 189.162 31.517 171.962 1.00 28.91  ? 451  PRO A CG  1 
ATOM   3522 C CD  . PRO A 1 451 ? 188.374 32.497 171.174 1.00 25.83  ? 451  PRO A CD  1 
ATOM   3523 N N   . LEU A 1 452 ? 191.295 34.719 169.919 1.00 34.17  ? 452  LEU A N   1 
ATOM   3524 C CA  . LEU A 1 452 ? 192.325 35.312 169.083 1.00 34.35  ? 452  LEU A CA  1 
ATOM   3525 C C   . LEU A 1 452 ? 192.736 36.657 169.678 1.00 33.61  ? 452  LEU A C   1 
ATOM   3526 O O   . LEU A 1 452 ? 193.728 37.230 169.243 1.00 33.73  ? 452  LEU A O   1 
ATOM   3527 C CB  . LEU A 1 452 ? 191.827 35.519 167.635 1.00 28.76  ? 452  LEU A CB  1 
ATOM   3528 C CG  . LEU A 1 452 ? 192.023 34.363 166.683 1.00 32.31  ? 452  LEU A CG  1 
ATOM   3529 C CD1 . LEU A 1 452 ? 191.239 33.075 167.083 1.00 31.88  ? 452  LEU A CD1 1 
ATOM   3530 C CD2 . LEU A 1 452 ? 191.558 34.838 165.310 1.00 34.40  ? 452  LEU A CD2 1 
ATOM   3531 N N   . VAL A 1 453 ? 191.902 37.188 170.570 1.00 31.46  ? 453  VAL A N   1 
ATOM   3532 C CA  . VAL A 1 453 ? 192.107 38.443 171.255 1.00 31.98  ? 453  VAL A CA  1 
ATOM   3533 C C   . VAL A 1 453 ? 192.933 38.202 172.568 1.00 36.62  ? 453  VAL A C   1 
ATOM   3534 O O   . VAL A 1 453 ? 192.438 37.559 173.552 1.00 31.64  ? 453  VAL A O   1 
ATOM   3535 C CB  . VAL A 1 453 ? 190.755 39.066 171.614 1.00 35.46  ? 453  VAL A CB  1 
ATOM   3536 C CG1 . VAL A 1 453 ? 190.947 40.344 172.440 1.00 36.60  ? 453  VAL A CG1 1 
ATOM   3537 C CG2 . VAL A 1 453 ? 189.943 39.392 170.368 1.00 35.77  ? 453  VAL A CG2 1 
ATOM   3538 N N   . LYS A 1 454 ? 194.160 38.713 172.577 1.00 34.86  ? 454  LYS A N   1 
ATOM   3539 C CA  . LYS A 1 454 ? 195.138 38.517 173.687 1.00 40.50  ? 454  LYS A CA  1 
ATOM   3540 C C   . LYS A 1 454 ? 194.574 38.894 175.054 1.00 33.62  ? 454  LYS A C   1 
ATOM   3541 O O   . LYS A 1 454 ? 194.630 38.126 175.981 1.00 35.41  ? 454  LYS A O   1 
ATOM   3542 C CB  . LYS A 1 454 ? 196.445 39.306 173.419 1.00 41.15  ? 454  LYS A CB  1 
ATOM   3543 N N   . GLU A 1 455 ? 193.975 40.054 175.147 1.00 34.31  ? 455  GLU A N   1 
ATOM   3544 C CA  . GLU A 1 455 ? 193.400 40.562 176.395 1.00 43.28  ? 455  GLU A CA  1 
ATOM   3545 C C   . GLU A 1 455 ? 192.408 39.627 177.119 1.00 46.11  ? 455  GLU A C   1 
ATOM   3546 O O   . GLU A 1 455 ? 192.153 39.778 178.335 1.00 43.14  ? 455  GLU A O   1 
ATOM   3547 C CB  . GLU A 1 455 ? 192.684 41.893 176.120 1.00 44.42  ? 455  GLU A CB  1 
ATOM   3548 C CG  . GLU A 1 455 ? 193.632 43.009 175.697 1.00 58.39  ? 455  GLU A CG  1 
ATOM   3549 C CD  . GLU A 1 455 ? 193.924 43.110 174.182 1.00 70.66  ? 455  GLU A CD  1 
ATOM   3550 O OE1 . GLU A 1 455 ? 193.599 42.187 173.371 1.00 55.78  ? 455  GLU A OE1 1 
ATOM   3551 O OE2 . GLU A 1 455 ? 194.507 44.162 173.802 1.00 76.32  ? 455  GLU A OE2 1 
ATOM   3552 N N   . LEU A 1 456 ? 191.814 38.690 176.383 1.00 38.50  ? 456  LEU A N   1 
ATOM   3553 C CA  . LEU A 1 456 ? 190.788 37.891 176.946 1.00 37.07  ? 456  LEU A CA  1 
ATOM   3554 C C   . LEU A 1 456 ? 191.372 36.671 177.636 1.00 40.53  ? 456  LEU A C   1 
ATOM   3555 O O   . LEU A 1 456 ? 190.632 35.856 178.193 1.00 37.61  ? 456  LEU A O   1 
ATOM   3556 C CB  . LEU A 1 456 ? 189.740 37.563 175.876 1.00 35.84  ? 456  LEU A CB  1 
ATOM   3557 C CG  . LEU A 1 456 ? 188.915 38.756 175.378 1.00 34.44  ? 456  LEU A CG  1 
ATOM   3558 C CD1 . LEU A 1 456 ? 187.991 38.313 174.228 1.00 37.37  ? 456  LEU A CD1 1 
ATOM   3559 C CD2 . LEU A 1 456 ? 188.098 39.425 176.487 1.00 35.02  ? 456  LEU A CD2 1 
ATOM   3560 N N   . ASN A 1 457 ? 192.694 36.519 177.579 1.00 40.93  ? 457  ASN A N   1 
ATOM   3561 C CA  . ASN A 1 457 ? 193.385 35.574 178.458 1.00 41.64  ? 457  ASN A CA  1 
ATOM   3562 C C   . ASN A 1 457 ? 193.164 34.096 178.151 1.00 40.26  ? 457  ASN A C   1 
ATOM   3563 O O   . ASN A 1 457 ? 193.135 33.295 179.097 1.00 38.50  ? 457  ASN A O   1 
ATOM   3564 C CB  . ASN A 1 457 ? 192.958 35.756 179.940 1.00 48.95  ? 457  ASN A CB  1 
ATOM   3565 C CG  . ASN A 1 457 ? 193.324 37.110 180.541 1.00 53.37  ? 457  ASN A CG  1 
ATOM   3566 O OD1 . ASN A 1 457 ? 194.201 37.815 180.068 1.00 48.44  ? 457  ASN A OD1 1 
ATOM   3567 N ND2 . ASN A 1 457 ? 192.617 37.473 181.625 1.00 64.40  ? 457  ASN A ND2 1 
ATOM   3568 N N   . TYR A 1 458 ? 192.986 33.716 176.881 1.00 35.82  ? 458  TYR A N   1 
ATOM   3569 C CA  . TYR A 1 458 ? 192.963 32.299 176.496 1.00 30.73  ? 458  TYR A CA  1 
ATOM   3570 C C   . TYR A 1 458 ? 194.405 31.847 176.258 1.00 30.99  ? 458  TYR A C   1 
ATOM   3571 O O   . TYR A 1 458 ? 195.259 32.675 176.093 1.00 33.34  ? 458  TYR A O   1 
ATOM   3572 C CB  . TYR A 1 458 ? 192.105 32.068 175.245 1.00 30.41  ? 458  TYR A CB  1 
ATOM   3573 C CG  . TYR A 1 458 ? 190.615 32.374 175.365 1.00 26.26  ? 458  TYR A CG  1 
ATOM   3574 C CD1 . TYR A 1 458 ? 190.131 33.643 175.213 1.00 27.26  ? 458  TYR A CD1 1 
ATOM   3575 C CD2 . TYR A 1 458 ? 189.677 31.355 175.611 1.00 27.14  ? 458  TYR A CD2 1 
ATOM   3576 C CE1 . TYR A 1 458 ? 188.752 33.908 175.283 1.00 26.50  ? 458  TYR A CE1 1 
ATOM   3577 C CE2 . TYR A 1 458 ? 188.285 31.630 175.744 1.00 25.31  ? 458  TYR A CE2 1 
ATOM   3578 C CZ  . TYR A 1 458 ? 187.824 32.871 175.547 1.00 27.37  ? 458  TYR A CZ  1 
ATOM   3579 O OH  . TYR A 1 458 ? 186.437 33.167 175.637 1.00 24.35  ? 458  TYR A OH  1 
ATOM   3580 N N   . THR A 1 459 ? 194.681 30.548 176.280 1.00 30.45  ? 459  THR A N   1 
ATOM   3581 C CA  . THR A 1 459 ? 195.996 30.041 175.915 1.00 31.27  ? 459  THR A CA  1 
ATOM   3582 C C   . THR A 1 459 ? 196.242 30.039 174.390 1.00 36.12  ? 459  THR A C   1 
ATOM   3583 O O   . THR A 1 459 ? 195.300 30.108 173.582 1.00 32.67  ? 459  THR A O   1 
ATOM   3584 C CB  . THR A 1 459 ? 196.110 28.585 176.345 1.00 33.57  ? 459  THR A CB  1 
ATOM   3585 O OG1 . THR A 1 459 ? 195.089 27.789 175.680 1.00 33.06  ? 459  THR A OG1 1 
ATOM   3586 C CG2 . THR A 1 459 ? 195.974 28.479 177.907 1.00 33.15  ? 459  THR A CG2 1 
ATOM   3587 N N   . ALA A 1 460 ? 197.498 29.848 173.999 1.00 33.95  ? 460  ALA A N   1 
ATOM   3588 C CA  . ALA A 1 460 ? 197.891 29.669 172.589 1.00 35.38  ? 460  ALA A CA  1 
ATOM   3589 C C   . ALA A 1 460 ? 197.158 28.484 171.979 1.00 32.42  ? 460  ALA A C   1 
ATOM   3590 O O   . ALA A 1 460 ? 196.732 28.556 170.861 1.00 33.13  ? 460  ALA A O   1 
ATOM   3591 C CB  . ALA A 1 460 ? 199.425 29.473 172.436 1.00 34.14  ? 460  ALA A CB  1 
ATOM   3592 N N   . GLU A 1 461 ? 196.996 27.413 172.732 1.00 30.22  ? 461  GLU A N   1 
ATOM   3593 C CA  . GLU A 1 461 ? 196.346 26.206 172.214 1.00 32.77  ? 461  GLU A CA  1 
ATOM   3594 C C   . GLU A 1 461 ? 194.818 26.460 171.997 1.00 32.69  ? 461  GLU A C   1 
ATOM   3595 O O   . GLU A 1 461 ? 194.195 25.832 171.138 1.00 32.04  ? 461  GLU A O   1 
ATOM   3596 C CB  . GLU A 1 461 ? 196.576 25.027 173.163 1.00 35.92  ? 461  GLU A CB  1 
ATOM   3597 C CG  . GLU A 1 461 ? 198.053 24.638 173.239 1.00 48.33  ? 461  GLU A CG  1 
ATOM   3598 C CD  . GLU A 1 461 ? 198.859 25.258 174.415 1.00 55.90  ? 461  GLU A CD  1 
ATOM   3599 O OE1 . GLU A 1 461 ? 199.792 24.522 174.825 1.00 71.29  ? 461  GLU A OE1 1 
ATOM   3600 O OE2 . GLU A 1 461 ? 198.632 26.425 174.918 1.00 42.93  ? 461  GLU A OE2 1 
ATOM   3601 N N   . GLU A 1 462 ? 194.262 27.386 172.767 1.00 30.92  ? 462  GLU A N   1 
ATOM   3602 C CA  . GLU A 1 462 ? 192.852 27.732 172.638 1.00 30.94  ? 462  GLU A CA  1 
ATOM   3603 C C   . GLU A 1 462 ? 192.652 28.600 171.396 1.00 33.80  ? 462  GLU A C   1 
ATOM   3604 O O   . GLU A 1 462 ? 191.630 28.471 170.658 1.00 28.96  ? 462  GLU A O   1 
ATOM   3605 C CB  . GLU A 1 462 ? 192.344 28.415 173.920 1.00 27.39  ? 462  GLU A CB  1 
ATOM   3606 C CG  . GLU A 1 462 ? 192.127 27.361 174.990 1.00 29.48  ? 462  GLU A CG  1 
ATOM   3607 C CD  . GLU A 1 462 ? 191.814 27.879 176.395 1.00 27.86  ? 462  GLU A CD  1 
ATOM   3608 O OE1 . GLU A 1 462 ? 192.244 28.970 176.758 1.00 27.87  ? 462  GLU A OE1 1 
ATOM   3609 O OE2 . GLU A 1 462 ? 191.162 27.124 177.147 1.00 31.59  ? 462  GLU A OE2 1 
ATOM   3610 N N   . GLU A 1 463 ? 193.599 29.510 171.191 1.00 28.75  ? 463  GLU A N   1 
ATOM   3611 C CA  . GLU A 1 463 ? 193.657 30.261 169.956 1.00 32.66  ? 463  GLU A CA  1 
ATOM   3612 C C   . GLU A 1 463 ? 193.700 29.321 168.762 1.00 31.04  ? 463  GLU A C   1 
ATOM   3613 O O   . GLU A 1 463 ? 192.837 29.423 167.876 1.00 30.04  ? 463  GLU A O   1 
ATOM   3614 C CB  . GLU A 1 463 ? 194.836 31.229 169.885 1.00 35.21  ? 463  GLU A CB  1 
ATOM   3615 C CG  . GLU A 1 463 ? 194.820 31.969 168.552 1.00 39.96  ? 463  GLU A CG  1 
ATOM   3616 C CD  . GLU A 1 463 ? 195.925 32.991 168.375 1.00 41.63  ? 463  GLU A CD  1 
ATOM   3617 O OE1 . GLU A 1 463 ? 196.735 33.167 169.325 1.00 43.00  ? 463  GLU A OE1 1 
ATOM   3618 O OE2 . GLU A 1 463 ? 195.945 33.643 167.288 1.00 39.33  ? 463  GLU A OE2 1 
ATOM   3619 N N   . ALA A 1 464 ? 194.640 28.392 168.729 1.00 28.99  ? 464  ALA A N   1 
ATOM   3620 C CA  . ALA A 1 464 ? 194.668 27.428 167.648 1.00 31.43  ? 464  ALA A CA  1 
ATOM   3621 C C   . ALA A 1 464 ? 193.330 26.623 167.460 1.00 31.73  ? 464  ALA A C   1 
ATOM   3622 O O   . ALA A 1 464 ? 192.883 26.345 166.324 1.00 27.72  ? 464  ALA A O   1 
ATOM   3623 C CB  . ALA A 1 464 ? 195.847 26.432 167.828 1.00 33.44  ? 464  ALA A CB  1 
ATOM   3624 N N   . LEU A 1 465 ? 192.748 26.200 168.568 1.00 30.70  ? 465  LEU A N   1 
ATOM   3625 C CA  . LEU A 1 465 ? 191.488 25.498 168.551 1.00 30.03  ? 465  LEU A CA  1 
ATOM   3626 C C   . LEU A 1 465 ? 190.372 26.389 167.954 1.00 28.01  ? 465  LEU A C   1 
ATOM   3627 O O   . LEU A 1 465 ? 189.597 25.958 167.095 1.00 25.14  ? 465  LEU A O   1 
ATOM   3628 C CB  . LEU A 1 465 ? 191.131 24.941 169.959 1.00 30.24  ? 465  LEU A CB  1 
ATOM   3629 C CG  . LEU A 1 465 ? 189.682 24.440 170.140 1.00 26.28  ? 465  LEU A CG  1 
ATOM   3630 C CD1 . LEU A 1 465 ? 189.407 23.317 169.166 1.00 28.39  ? 465  LEU A CD1 1 
ATOM   3631 C CD2 . LEU A 1 465 ? 189.398 23.991 171.572 1.00 23.46  ? 465  LEU A CD2 1 
ATOM   3632 N N   . SER A 1 466 ? 190.323 27.640 168.350 1.00 24.86  ? 466  SER A N   1 
ATOM   3633 C CA  . SER A 1 466 ? 189.351 28.526 167.799 1.00 25.91  ? 466  SER A CA  1 
ATOM   3634 C C   . SER A 1 466 ? 189.541 28.726 166.247 1.00 29.00  ? 466  SER A C   1 
ATOM   3635 O O   . SER A 1 466 ? 188.567 28.699 165.465 1.00 26.48  ? 466  SER A O   1 
ATOM   3636 C CB  . SER A 1 466 ? 189.442 29.844 168.478 1.00 24.48  ? 466  SER A CB  1 
ATOM   3637 O OG  . SER A 1 466 ? 188.470 30.716 168.008 1.00 25.40  ? 466  SER A OG  1 
ATOM   3638 N N   . ARG A 1 467 ? 190.784 28.870 165.826 1.00 24.80  ? 467  ARG A N   1 
ATOM   3639 C CA  . ARG A 1 467 ? 191.105 29.072 164.383 1.00 25.57  ? 467  ARG A CA  1 
ATOM   3640 C C   . ARG A 1 467 ? 190.627 27.909 163.600 1.00 26.38  ? 467  ARG A C   1 
ATOM   3641 O O   . ARG A 1 467 ? 189.925 28.034 162.598 1.00 27.21  ? 467  ARG A O   1 
ATOM   3642 C CB  . ARG A 1 467 ? 192.583 29.311 164.178 1.00 24.26  ? 467  ARG A CB  1 
ATOM   3643 C CG  . ARG A 1 467 ? 192.970 30.766 164.524 1.00 26.38  ? 467  ARG A CG  1 
ATOM   3644 C CD  . ARG A 1 467 ? 194.485 31.038 164.218 1.00 28.24  ? 467  ARG A CD  1 
ATOM   3645 N NE  . ARG A 1 467 ? 194.830 32.384 164.599 1.00 28.61  ? 467  ARG A NE  1 
ATOM   3646 C CZ  . ARG A 1 467 ? 194.488 33.493 163.963 1.00 31.68  ? 467  ARG A CZ  1 
ATOM   3647 N NH1 . ARG A 1 467 ? 193.811 33.420 162.839 1.00 33.09  ? 467  ARG A NH1 1 
ATOM   3648 N NH2 . ARG A 1 467 ? 194.834 34.699 164.466 1.00 32.12  ? 467  ARG A NH2 1 
ATOM   3649 N N   . ARG A 1 468 ? 190.910 26.752 164.132 1.00 26.11  ? 468  ARG A N   1 
ATOM   3650 C CA  . ARG A 1 468 ? 190.483 25.539 163.516 1.00 29.10  ? 468  ARG A CA  1 
ATOM   3651 C C   . ARG A 1 468 ? 188.956 25.369 163.470 1.00 28.15  ? 468  ARG A C   1 
ATOM   3652 O O   . ARG A 1 468 ? 188.384 24.961 162.459 1.00 23.12  ? 468  ARG A O   1 
ATOM   3653 C CB  . ARG A 1 468 ? 191.062 24.425 164.344 1.00 36.06  ? 468  ARG A CB  1 
ATOM   3654 C CG  . ARG A 1 468 ? 191.558 23.263 163.596 1.00 41.39  ? 468  ARG A CG  1 
ATOM   3655 C CD  . ARG A 1 468 ? 192.480 22.440 164.496 1.00 42.16  ? 468  ARG A CD  1 
ATOM   3656 N NE  . ARG A 1 468 ? 191.667 21.355 164.937 1.00 46.63  ? 468  ARG A NE  1 
ATOM   3657 C CZ  . ARG A 1 468 ? 191.457 20.982 166.184 1.00 52.89  ? 468  ARG A CZ  1 
ATOM   3658 N NH1 . ARG A 1 468 ? 192.106 21.565 167.222 1.00 57.85  ? 468  ARG A NH1 1 
ATOM   3659 N NH2 . ARG A 1 468 ? 190.638 19.948 166.348 1.00 48.85  ? 468  ARG A NH2 1 
ATOM   3660 N N   . ILE A 1 469 ? 188.279 25.673 164.573 1.00 24.64  ? 469  ILE A N   1 
ATOM   3661 C CA  . ILE A 1 469 ? 186.838 25.643 164.569 1.00 22.35  ? 469  ILE A CA  1 
ATOM   3662 C C   . ILE A 1 469 ? 186.278 26.621 163.565 1.00 22.02  ? 469  ILE A C   1 
ATOM   3663 O O   . ILE A 1 469 ? 185.305 26.314 162.810 1.00 22.36  ? 469  ILE A O   1 
ATOM   3664 C CB  . ILE A 1 469 ? 186.260 25.881 165.993 1.00 22.46  ? 469  ILE A CB  1 
ATOM   3665 C CG1 . ILE A 1 469 ? 186.467 24.593 166.796 1.00 22.31  ? 469  ILE A CG1 1 
ATOM   3666 C CG2 . ILE A 1 469 ? 184.784 26.264 165.933 1.00 21.40  ? 469  ILE A CG2 1 
ATOM   3667 C CD1 . ILE A 1 469 ? 186.226 24.693 168.303 1.00 24.89  ? 469  ILE A CD1 1 
ATOM   3668 N N   . MET A 1 470 ? 186.768 27.838 163.588 1.00 21.89  ? 470  MET A N   1 
ATOM   3669 C CA  . MET A 1 470 ? 186.211 28.842 162.674 1.00 23.21  ? 470  MET A CA  1 
ATOM   3670 C C   . MET A 1 470 ? 186.332 28.426 161.183 1.00 22.84  ? 470  MET A C   1 
ATOM   3671 O O   . MET A 1 470 ? 185.472 28.754 160.334 1.00 24.84  ? 470  MET A O   1 
ATOM   3672 C CB  . MET A 1 470 ? 186.899 30.200 162.820 1.00 25.07  ? 470  MET A CB  1 
ATOM   3673 C CG  . MET A 1 470 ? 186.524 30.963 164.049 1.00 27.50  ? 470  MET A CG  1 
ATOM   3674 S SD  . MET A 1 470 ? 187.046 32.668 164.082 1.00 32.85  ? 470  MET A SD  1 
ATOM   3675 C CE  . MET A 1 470 ? 188.745 32.326 164.447 1.00 27.89  ? 470  MET A CE  1 
ATOM   3676 N N   . HIS A 1 471 ? 187.454 27.805 160.885 1.00 24.02  ? 471  HIS A N   1 
ATOM   3677 C CA  . HIS A 1 471 ? 187.779 27.447 159.547 1.00 26.22  ? 471  HIS A CA  1 
ATOM   3678 C C   . HIS A 1 471 ? 186.949 26.233 159.169 1.00 24.11  ? 471  HIS A C   1 
ATOM   3679 O O   . HIS A 1 471 ? 186.473 26.149 158.054 1.00 24.14  ? 471  HIS A O   1 
ATOM   3680 C CB  . HIS A 1 471 ? 189.282 27.170 159.396 1.00 29.66  ? 471  HIS A CB  1 
ATOM   3681 C CG  . HIS A 1 471 ? 189.706 26.977 157.982 1.00 31.90  ? 471  HIS A CG  1 
ATOM   3682 N ND1 . HIS A 1 471 ? 189.528 27.948 157.017 1.00 38.42  ? 471  HIS A ND1 1 
ATOM   3683 C CD2 . HIS A 1 471 ? 190.283 25.925 157.352 1.00 38.05  ? 471  HIS A CD2 1 
ATOM   3684 C CE1 . HIS A 1 471 ? 189.991 27.513 155.851 1.00 34.29  ? 471  HIS A CE1 1 
ATOM   3685 N NE2 . HIS A 1 471 ? 190.448 26.289 156.029 1.00 41.71  ? 471  HIS A NE2 1 
ATOM   3686 N N   . TYR A 1 472 ? 186.725 25.316 160.082 1.00 22.48  ? 472  TYR A N   1 
ATOM   3687 C CA  . TYR A 1 472 ? 185.773 24.254 159.791 1.00 24.97  ? 472  TYR A CA  1 
ATOM   3688 C C   . TYR A 1 472 ? 184.379 24.836 159.504 1.00 23.76  ? 472  TYR A C   1 
ATOM   3689 O O   . TYR A 1 472 ? 183.706 24.439 158.553 1.00 23.15  ? 472  TYR A O   1 
ATOM   3690 C CB  . TYR A 1 472 ? 185.606 23.298 160.941 1.00 24.88  ? 472  TYR A CB  1 
ATOM   3691 C CG  . TYR A 1 472 ? 186.703 22.363 161.295 1.00 28.58  ? 472  TYR A CG  1 
ATOM   3692 C CD1 . TYR A 1 472 ? 187.485 21.725 160.338 1.00 30.74  ? 472  TYR A CD1 1 
ATOM   3693 C CD2 . TYR A 1 472 ? 186.915 22.018 162.657 1.00 31.54  ? 472  TYR A CD2 1 
ATOM   3694 C CE1 . TYR A 1 472 ? 188.490 20.806 160.712 1.00 27.77  ? 472  TYR A CE1 1 
ATOM   3695 C CE2 . TYR A 1 472 ? 187.865 21.102 163.044 1.00 28.71  ? 472  TYR A CE2 1 
ATOM   3696 C CZ  . TYR A 1 472 ? 188.660 20.514 162.056 1.00 32.76  ? 472  TYR A CZ  1 
ATOM   3697 O OH  . TYR A 1 472 ? 189.593 19.636 162.447 1.00 34.18  ? 472  TYR A OH  1 
ATOM   3698 N N   . TRP A 1 473 ? 183.911 25.712 160.380 1.00 23.17  ? 473  TRP A N   1 
ATOM   3699 C CA  . TRP A 1 473 ? 182.544 26.238 160.276 1.00 21.83  ? 473  TRP A CA  1 
ATOM   3700 C C   . TRP A 1 473 ? 182.471 26.975 158.891 1.00 25.00  ? 473  TRP A C   1 
ATOM   3701 O O   . TRP A 1 473 ? 181.534 26.765 158.121 1.00 23.12  ? 473  TRP A O   1 
ATOM   3702 C CB  . TRP A 1 473 ? 182.212 27.225 161.403 1.00 21.81  ? 473  TRP A CB  1 
ATOM   3703 C CG  . TRP A 1 473 ? 181.437 26.691 162.629 1.00 19.56  ? 473  TRP A CG  1 
ATOM   3704 C CD1 . TRP A 1 473 ? 180.290 27.242 163.171 1.00 18.61  ? 473  TRP A CD1 1 
ATOM   3705 C CD2 . TRP A 1 473 ? 181.719 25.516 163.379 1.00 17.98  ? 473  TRP A CD2 1 
ATOM   3706 N NE1 . TRP A 1 473 ? 179.863 26.464 164.237 1.00 18.92  ? 473  TRP A NE1 1 
ATOM   3707 C CE2 . TRP A 1 473 ? 180.719 25.399 164.372 1.00 20.07  ? 473  TRP A CE2 1 
ATOM   3708 C CE3 . TRP A 1 473 ? 182.689 24.504 163.273 1.00 20.35  ? 473  TRP A CE3 1 
ATOM   3709 C CZ2 . TRP A 1 473 ? 180.691 24.341 165.276 1.00 19.65  ? 473  TRP A CZ2 1 
ATOM   3710 C CZ3 . TRP A 1 473 ? 182.685 23.458 164.169 1.00 22.23  ? 473  TRP A CZ3 1 
ATOM   3711 C CH2 . TRP A 1 473 ? 181.691 23.394 165.197 1.00 22.14  ? 473  TRP A CH2 1 
ATOM   3712 N N   . ALA A 1 474 ? 183.424 27.853 158.604 1.00 23.91  ? 474  ALA A N   1 
ATOM   3713 C CA  . ALA A 1 474 ? 183.372 28.663 157.336 1.00 24.98  ? 474  ALA A CA  1 
ATOM   3714 C C   . ALA A 1 474 ? 183.610 27.868 156.047 1.00 21.75  ? 474  ALA A C   1 
ATOM   3715 O O   . ALA A 1 474 ? 182.973 28.100 155.072 1.00 21.39  ? 474  ALA A O   1 
ATOM   3716 C CB  . ALA A 1 474 ? 184.344 29.826 157.395 1.00 24.77  ? 474  ALA A CB  1 
ATOM   3717 N N   . THR A 1 475 ? 184.514 26.923 156.050 1.00 26.69  ? 475  THR A N   1 
ATOM   3718 C CA  . THR A 1 475 ? 184.682 26.018 154.912 1.00 25.16  ? 475  THR A CA  1 
ATOM   3719 C C   . THR A 1 475 ? 183.430 25.147 154.762 1.00 28.32  ? 475  THR A C   1 
ATOM   3720 O O   . THR A 1 475 ? 182.946 24.891 153.641 1.00 24.01  ? 475  THR A O   1 
ATOM   3721 C CB  . THR A 1 475 ? 185.842 25.084 155.142 1.00 26.16  ? 475  THR A CB  1 
ATOM   3722 O OG1 . THR A 1 475 ? 187.001 25.847 155.474 1.00 23.91  ? 475  THR A OG1 1 
ATOM   3723 C CG2 . THR A 1 475 ? 186.103 24.192 153.962 1.00 29.05  ? 475  THR A CG2 1 
ATOM   3724 N N   . PHE A 1 476 ? 182.843 24.695 155.869 1.00 24.31  ? 476  PHE A N   1 
ATOM   3725 C CA  . PHE A 1 476 ? 181.575 24.006 155.697 1.00 20.54  ? 476  PHE A CA  1 
ATOM   3726 C C   . PHE A 1 476 ? 180.553 24.922 155.074 1.00 20.59  ? 476  PHE A C   1 
ATOM   3727 O O   . PHE A 1 476 ? 179.781 24.513 154.209 1.00 20.81  ? 476  PHE A O   1 
ATOM   3728 C CB  . PHE A 1 476 ? 181.028 23.481 157.021 1.00 22.70  ? 476  PHE A CB  1 
ATOM   3729 C CG  . PHE A 1 476 ? 179.658 22.949 156.931 1.00 19.21  ? 476  PHE A CG  1 
ATOM   3730 C CD1 . PHE A 1 476 ? 179.428 21.664 156.410 1.00 22.59  ? 476  PHE A CD1 1 
ATOM   3731 C CD2 . PHE A 1 476 ? 178.595 23.742 157.256 1.00 19.84  ? 476  PHE A CD2 1 
ATOM   3732 C CE1 . PHE A 1 476 ? 178.127 21.152 156.322 1.00 19.29  ? 476  PHE A CE1 1 
ATOM   3733 C CE2 . PHE A 1 476 ? 177.298 23.237 157.164 1.00 22.36  ? 476  PHE A CE2 1 
ATOM   3734 C CZ  . PHE A 1 476 ? 177.071 21.939 156.697 1.00 19.45  ? 476  PHE A CZ  1 
ATOM   3735 N N   . ALA A 1 477 ? 180.439 26.154 155.541 1.00 20.11  ? 477  ALA A N   1 
ATOM   3736 C CA  . ALA A 1 477 ? 179.416 27.021 154.990 1.00 21.31  ? 477  ALA A CA  1 
ATOM   3737 C C   . ALA A 1 477 ? 179.633 27.263 153.455 1.00 23.95  ? 477  ALA A C   1 
ATOM   3738 O O   . ALA A 1 477 ? 178.687 27.324 152.689 1.00 26.30  ? 477  ALA A O   1 
ATOM   3739 C CB  . ALA A 1 477 ? 179.425 28.335 155.685 1.00 19.69  ? 477  ALA A CB  1 
ATOM   3740 N N   . LYS A 1 478 ? 180.899 27.373 153.070 1.00 26.40  ? 478  LYS A N   1 
ATOM   3741 C CA  . LYS A 1 478 ? 181.279 27.653 151.694 1.00 30.71  ? 478  LYS A CA  1 
ATOM   3742 C C   . LYS A 1 478 ? 180.993 26.463 150.729 1.00 29.95  ? 478  LYS A C   1 
ATOM   3743 O O   . LYS A 1 478 ? 180.436 26.655 149.640 1.00 28.30  ? 478  LYS A O   1 
ATOM   3744 C CB  . LYS A 1 478 ? 182.749 28.030 151.680 1.00 33.38  ? 478  LYS A CB  1 
ATOM   3745 C CG  . LYS A 1 478 ? 183.286 28.320 150.262 1.00 48.19  ? 478  LYS A CG  1 
ATOM   3746 C CD  . LYS A 1 478 ? 184.682 28.969 150.241 1.00 50.26  ? 478  LYS A CD  1 
ATOM   3747 C CE  . LYS A 1 478 ? 185.585 28.275 149.225 1.00 56.28  ? 478  LYS A CE  1 
ATOM   3748 N NZ  . LYS A 1 478 ? 186.343 29.261 148.409 1.00 62.64  ? 478  LYS A NZ  1 
ATOM   3749 N N   . THR A 1 479 ? 181.317 25.253 151.176 1.00 25.74  ? 479  THR A N   1 
ATOM   3750 C CA  . THR A 1 479 ? 181.368 24.102 150.315 1.00 28.43  ? 479  THR A CA  1 
ATOM   3751 C C   . THR A 1 479 ? 180.476 22.941 150.751 1.00 28.56  ? 479  THR A C   1 
ATOM   3752 O O   . THR A 1 479 ? 180.250 22.036 149.979 1.00 27.19  ? 479  THR A O   1 
ATOM   3753 C CB  . THR A 1 479 ? 182.794 23.527 150.305 1.00 28.18  ? 479  THR A CB  1 
ATOM   3754 O OG1 . THR A 1 479 ? 183.097 22.910 151.577 1.00 28.66  ? 479  THR A OG1 1 
ATOM   3755 C CG2 . THR A 1 479 ? 183.897 24.667 150.020 1.00 29.45  ? 479  THR A CG2 1 
ATOM   3756 N N   . GLY A 1 480 ? 180.017 22.897 152.007 1.00 26.13  ? 480  GLY A N   1 
ATOM   3757 C CA  . GLY A 1 480 ? 179.211 21.766 152.445 1.00 24.57  ? 480  GLY A CA  1 
ATOM   3758 C C   . GLY A 1 480 ? 180.065 20.708 153.055 1.00 23.19  ? 480  GLY A C   1 
ATOM   3759 O O   . GLY A 1 480 ? 179.590 19.623 153.349 1.00 23.19  ? 480  GLY A O   1 
ATOM   3760 N N   . ASN A 1 481 ? 181.353 21.025 153.231 1.00 24.39  ? 481  ASN A N   1 
ATOM   3761 C CA  . ASN A 1 481 ? 182.325 20.075 153.798 1.00 26.90  ? 481  ASN A CA  1 
ATOM   3762 C C   . ASN A 1 481 ? 183.344 20.867 154.644 1.00 25.76  ? 481  ASN A C   1 
ATOM   3763 O O   . ASN A 1 481 ? 183.947 21.820 154.138 1.00 26.00  ? 481  ASN A O   1 
ATOM   3764 C CB  . ASN A 1 481 ? 183.048 19.368 152.656 1.00 29.46  ? 481  ASN A CB  1 
ATOM   3765 C CG  . ASN A 1 481 ? 184.037 18.316 153.133 1.00 30.65  ? 481  ASN A CG  1 
ATOM   3766 O OD1 . ASN A 1 481 ? 184.548 18.337 154.257 1.00 33.76  ? 481  ASN A OD1 1 
ATOM   3767 N ND2 . ASN A 1 481 ? 184.322 17.387 152.252 1.00 30.05  ? 481  ASN A ND2 1 
ATOM   3768 N N   . PRO A 1 482 ? 183.510 20.516 155.943 1.00 26.13  ? 482  PRO A N   1 
ATOM   3769 C CA  . PRO A 1 482 ? 184.349 21.388 156.782 1.00 26.27  ? 482  PRO A CA  1 
ATOM   3770 C C   . PRO A 1 482 ? 185.868 21.254 156.505 1.00 26.43  ? 482  PRO A C   1 
ATOM   3771 O O   . PRO A 1 482 ? 186.634 22.115 156.911 1.00 25.83  ? 482  PRO A O   1 
ATOM   3772 C CB  . PRO A 1 482 ? 184.088 20.878 158.184 1.00 24.69  ? 482  PRO A CB  1 
ATOM   3773 C CG  . PRO A 1 482 ? 183.772 19.413 157.987 1.00 26.50  ? 482  PRO A CG  1 
ATOM   3774 C CD  . PRO A 1 482 ? 182.942 19.389 156.721 1.00 25.74  ? 482  PRO A CD  1 
ATOM   3775 N N   . ASN A 1 483 ? 186.252 20.182 155.830 1.00 26.81  ? 483  ASN A N   1 
ATOM   3776 C CA  . ASN A 1 483 ? 187.649 19.920 155.422 1.00 30.33  ? 483  ASN A CA  1 
ATOM   3777 C C   . ASN A 1 483 ? 188.056 20.575 154.075 1.00 33.13  ? 483  ASN A C   1 
ATOM   3778 O O   . ASN A 1 483 ? 187.254 20.630 153.115 1.00 32.30  ? 483  ASN A O   1 
ATOM   3779 C CB  . ASN A 1 483 ? 187.812 18.444 155.210 1.00 28.92  ? 483  ASN A CB  1 
ATOM   3780 C CG  . ASN A 1 483 ? 187.397 17.642 156.411 1.00 30.92  ? 483  ASN A CG  1 
ATOM   3781 O OD1 . ASN A 1 483 ? 188.101 17.640 157.426 1.00 34.23  ? 483  ASN A OD1 1 
ATOM   3782 N ND2 . ASN A 1 483 ? 186.302 16.908 156.287 1.00 26.93  ? 483  ASN A ND2 1 
ATOM   3783 N N   . GLU A 1 484 ? 189.262 21.110 154.068 1.00 43.08  ? 484  GLU A N   1 
ATOM   3784 C CA  . GLU A 1 484 ? 189.989 21.573 152.859 1.00 53.66  ? 484  GLU A CA  1 
ATOM   3785 C C   . GLU A 1 484 ? 190.238 20.386 151.938 1.00 55.34  ? 484  GLU A C   1 
ATOM   3786 O O   . GLU A 1 484 ? 190.870 19.385 152.348 1.00 42.23  ? 484  GLU A O   1 
ATOM   3787 C CB  . GLU A 1 484 ? 191.380 22.115 153.246 1.00 63.22  ? 484  GLU A CB  1 
ATOM   3788 C CG  . GLU A 1 484 ? 191.429 23.462 153.972 1.00 63.79  ? 484  GLU A CG  1 
ATOM   3789 C CD  . GLU A 1 484 ? 191.135 24.593 153.029 1.00 63.84  ? 484  GLU A CD  1 
ATOM   3790 O OE1 . GLU A 1 484 ? 190.361 24.354 152.083 1.00 65.43  ? 484  GLU A OE1 1 
ATOM   3791 O OE2 . GLU A 1 484 ? 191.649 25.704 153.237 1.00 67.54  ? 484  GLU A OE2 1 
ATOM   3792 N N   . PRO A 1 485 ? 189.746 20.479 150.694 1.00 69.63  ? 485  PRO A N   1 
ATOM   3793 C CA  . PRO A 1 485 ? 189.780 19.315 149.790 1.00 73.76  ? 485  PRO A CA  1 
ATOM   3794 C C   . PRO A 1 485 ? 191.141 18.564 149.784 1.00 76.93  ? 485  PRO A C   1 
ATOM   3795 O O   . PRO A 1 485 ? 191.175 17.331 149.967 1.00 72.04  ? 485  PRO A O   1 
ATOM   3796 C CB  . PRO A 1 485 ? 189.463 19.913 148.408 1.00 73.04  ? 485  PRO A CB  1 
ATOM   3797 C CG  . PRO A 1 485 ? 189.242 21.379 148.602 1.00 72.91  ? 485  PRO A CG  1 
ATOM   3798 C CD  . PRO A 1 485 ? 189.163 21.679 150.067 1.00 70.24  ? 485  PRO A CD  1 
ATOM   3799 N N   . HIS A 1 486 ? 192.250 19.288 149.621 1.00 70.21  ? 486  HIS A N   1 
ATOM   3800 C CA  . HIS A 1 486 ? 193.558 18.620 149.566 1.00 75.75  ? 486  HIS A CA  1 
ATOM   3801 C C   . HIS A 1 486 ? 194.519 19.050 150.698 1.00 75.52  ? 486  HIS A C   1 
ATOM   3802 O O   . HIS A 1 486 ? 195.714 19.161 150.463 1.00 79.92  ? 486  HIS A O   1 
ATOM   3803 C CB  . HIS A 1 486 ? 194.204 18.815 148.169 1.00 73.68  ? 486  HIS A CB  1 
ATOM   3804 N N   . SER A 1 487 ? 194.009 19.262 151.918 1.00 67.77  ? 487  SER A N   1 
ATOM   3805 C CA  . SER A 1 487 ? 194.857 19.538 153.104 1.00 61.08  ? 487  SER A CA  1 
ATOM   3806 C C   . SER A 1 487 ? 195.747 18.328 153.452 1.00 54.23  ? 487  SER A C   1 
ATOM   3807 O O   . SER A 1 487 ? 195.434 17.206 153.055 1.00 48.65  ? 487  SER A O   1 
ATOM   3808 C CB  . SER A 1 487 ? 193.987 19.897 154.333 1.00 54.29  ? 487  SER A CB  1 
ATOM   3809 N N   . GLN A 1 488 ? 196.852 18.570 154.172 1.00 59.24  ? 488  GLN A N   1 
ATOM   3810 C CA  . GLN A 1 488 ? 197.573 17.502 154.916 1.00 64.80  ? 488  GLN A CA  1 
ATOM   3811 C C   . GLN A 1 488 ? 196.962 17.299 156.349 1.00 61.94  ? 488  GLN A C   1 
ATOM   3812 O O   . GLN A 1 488 ? 197.228 16.296 157.027 1.00 55.63  ? 488  GLN A O   1 
ATOM   3813 C CB  . GLN A 1 488 ? 199.101 17.780 154.982 1.00 62.62  ? 488  GLN A CB  1 
ATOM   3814 N N   . GLU A 1 489 ? 196.090 18.214 156.776 1.00 62.63  ? 489  GLU A N   1 
ATOM   3815 C CA  . GLU A 1 489 ? 195.451 18.137 158.114 1.00 60.88  ? 489  GLU A CA  1 
ATOM   3816 C C   . GLU A 1 489 ? 194.518 16.909 158.263 1.00 52.92  ? 489  GLU A C   1 
ATOM   3817 O O   . GLU A 1 489 ? 194.032 16.375 157.262 1.00 48.51  ? 489  GLU A O   1 
ATOM   3818 C CB  . GLU A 1 489 ? 194.694 19.447 158.406 1.00 65.79  ? 489  GLU A CB  1 
ATOM   3819 C CG  . GLU A 1 489 ? 195.495 20.738 158.195 1.00 74.09  ? 489  GLU A CG  1 
ATOM   3820 C CD  . GLU A 1 489 ? 196.643 20.924 159.188 1.00 82.90  ? 489  GLU A CD  1 
ATOM   3821 O OE1 . GLU A 1 489 ? 196.886 22.079 159.605 1.00 101.38 ? 489  GLU A OE1 1 
ATOM   3822 O OE2 . GLU A 1 489 ? 197.316 19.942 159.568 1.00 78.99  ? 489  GLU A OE2 1 
ATOM   3823 N N   . SER A 1 490 ? 194.272 16.431 159.491 1.00 49.71  ? 490  SER A N   1 
ATOM   3824 C CA  . SER A 1 490 ? 193.424 15.216 159.653 1.00 51.19  ? 490  SER A CA  1 
ATOM   3825 C C   . SER A 1 490 ? 191.950 15.525 159.280 1.00 40.15  ? 490  SER A C   1 
ATOM   3826 O O   . SER A 1 490 ? 191.507 16.662 159.386 1.00 37.72  ? 490  SER A O   1 
ATOM   3827 C CB  . SER A 1 490 ? 193.584 14.565 161.037 1.00 56.06  ? 490  SER A CB  1 
ATOM   3828 O OG  . SER A 1 490 ? 194.181 15.458 161.960 1.00 63.17  ? 490  SER A OG  1 
ATOM   3829 N N   . LYS A 1 491 ? 191.261 14.536 158.732 1.00 37.71  ? 491  LYS A N   1 
ATOM   3830 C CA  . LYS A 1 491 ? 190.015 14.759 158.065 1.00 40.80  ? 491  LYS A CA  1 
ATOM   3831 C C   . LYS A 1 491 ? 188.862 14.458 159.012 1.00 36.40  ? 491  LYS A C   1 
ATOM   3832 O O   . LYS A 1 491 ? 188.805 13.401 159.620 1.00 34.92  ? 491  LYS A O   1 
ATOM   3833 C CB  . LYS A 1 491 ? 189.900 13.890 156.804 1.00 43.02  ? 491  LYS A CB  1 
ATOM   3834 C CG  . LYS A 1 491 ? 190.782 14.391 155.633 1.00 50.59  ? 491  LYS A CG  1 
ATOM   3835 C CD  . LYS A 1 491 ? 190.079 15.357 154.680 1.00 57.04  ? 491  LYS A CD  1 
ATOM   3836 N N   . TRP A 1 492 ? 187.897 15.360 159.047 1.00 31.22  ? 492  TRP A N   1 
ATOM   3837 C CA  . TRP A 1 492 ? 186.665 15.100 159.750 1.00 26.00  ? 492  TRP A CA  1 
ATOM   3838 C C   . TRP A 1 492 ? 185.785 14.295 158.865 1.00 26.76  ? 492  TRP A C   1 
ATOM   3839 O O   . TRP A 1 492 ? 185.291 14.750 157.844 1.00 30.29  ? 492  TRP A O   1 
ATOM   3840 C CB  . TRP A 1 492 ? 186.075 16.455 160.127 1.00 26.97  ? 492  TRP A CB  1 
ATOM   3841 C CG  . TRP A 1 492 ? 184.787 16.514 161.002 1.00 24.70  ? 492  TRP A CG  1 
ATOM   3842 C CD1 . TRP A 1 492 ? 183.918 15.472 161.311 1.00 25.15  ? 492  TRP A CD1 1 
ATOM   3843 C CD2 . TRP A 1 492 ? 184.229 17.686 161.571 1.00 21.71  ? 492  TRP A CD2 1 
ATOM   3844 N NE1 . TRP A 1 492 ? 182.837 15.953 162.021 1.00 25.26  ? 492  TRP A NE1 1 
ATOM   3845 C CE2 . TRP A 1 492 ? 183.007 17.311 162.202 1.00 22.39  ? 492  TRP A CE2 1 
ATOM   3846 C CE3 . TRP A 1 492 ? 184.635 19.013 161.611 1.00 22.68  ? 492  TRP A CE3 1 
ATOM   3847 C CZ2 . TRP A 1 492 ? 182.211 18.214 162.873 1.00 21.51  ? 492  TRP A CZ2 1 
ATOM   3848 C CZ3 . TRP A 1 492 ? 183.834 19.950 162.275 1.00 22.38  ? 492  TRP A CZ3 1 
ATOM   3849 C CH2 . TRP A 1 492 ? 182.635 19.534 162.929 1.00 22.87  ? 492  TRP A CH2 1 
ATOM   3850 N N   . PRO A 1 493 ? 185.499 13.072 159.255 1.00 29.26  ? 493  PRO A N   1 
ATOM   3851 C CA  . PRO A 1 493 ? 184.715 12.273 158.361 1.00 26.93  ? 493  PRO A CA  1 
ATOM   3852 C C   . PRO A 1 493 ? 183.236 12.505 158.485 1.00 30.90  ? 493  PRO A C   1 
ATOM   3853 O O   . PRO A 1 493 ? 182.744 12.980 159.489 1.00 24.28  ? 493  PRO A O   1 
ATOM   3854 C CB  . PRO A 1 493 ? 184.991 10.873 158.872 1.00 30.88  ? 493  PRO A CB  1 
ATOM   3855 C CG  . PRO A 1 493 ? 185.140 11.087 160.338 1.00 29.27  ? 493  PRO A CG  1 
ATOM   3856 C CD  . PRO A 1 493 ? 185.904 12.314 160.450 1.00 27.44  ? 493  PRO A CD  1 
ATOM   3857 N N   . LEU A 1 494 ? 182.544 12.132 157.434 1.00 28.29  ? 494  LEU A N   1 
ATOM   3858 C CA  . LEU A 1 494 ? 181.156 12.216 157.344 1.00 28.92  ? 494  LEU A CA  1 
ATOM   3859 C C   . LEU A 1 494 ? 180.502 11.197 158.320 1.00 27.36  ? 494  LEU A C   1 
ATOM   3860 O O   . LEU A 1 494 ? 180.978 10.059 158.477 1.00 23.35  ? 494  LEU A O   1 
ATOM   3861 C CB  . LEU A 1 494 ? 180.853 11.880 155.880 1.00 33.08  ? 494  LEU A CB  1 
ATOM   3862 C CG  . LEU A 1 494 ? 179.767 12.377 154.946 1.00 37.49  ? 494  LEU A CG  1 
ATOM   3863 C CD1 . LEU A 1 494 ? 179.494 13.860 155.027 1.00 32.65  ? 494  LEU A CD1 1 
ATOM   3864 C CD2 . LEU A 1 494 ? 180.168 11.930 153.502 1.00 38.44  ? 494  LEU A CD2 1 
ATOM   3865 N N   . PHE A 1 495 ? 179.424 11.651 158.969 1.00 24.61  ? 495  PHE A N   1 
ATOM   3866 C CA  . PHE A 1 495 ? 178.590 10.838 159.780 1.00 23.52  ? 495  PHE A CA  1 
ATOM   3867 C C   . PHE A 1 495 ? 177.714 10.102 158.801 1.00 24.25  ? 495  PHE A C   1 
ATOM   3868 O O   . PHE A 1 495 ? 176.959 10.722 158.100 1.00 22.39  ? 495  PHE A O   1 
ATOM   3869 C CB  . PHE A 1 495 ? 177.673 11.711 160.662 1.00 21.65  ? 495  PHE A CB  1 
ATOM   3870 C CG  . PHE A 1 495 ? 176.654 10.922 161.478 1.00 21.75  ? 495  PHE A CG  1 
ATOM   3871 C CD1 . PHE A 1 495 ? 175.471 10.516 160.928 1.00 21.93  ? 495  PHE A CD1 1 
ATOM   3872 C CD2 . PHE A 1 495 ? 176.886 10.624 162.817 1.00 23.18  ? 495  PHE A CD2 1 
ATOM   3873 C CE1 . PHE A 1 495 ? 174.525 9.807  161.668 1.00 25.61  ? 495  PHE A CE1 1 
ATOM   3874 C CE2 . PHE A 1 495 ? 175.948 9.913  163.579 1.00 24.51  ? 495  PHE A CE2 1 
ATOM   3875 C CZ  . PHE A 1 495 ? 174.766 9.477  163.000 1.00 26.64  ? 495  PHE A CZ  1 
ATOM   3876 N N   . THR A 1 496 ? 177.740 8.793  158.800 1.00 25.85  ? 496  THR A N   1 
ATOM   3877 C CA  . THR A 1 496 ? 176.820 8.038  157.964 1.00 25.59  ? 496  THR A CA  1 
ATOM   3878 C C   . THR A 1 496 ? 175.977 7.174  158.814 1.00 27.78  ? 496  THR A C   1 
ATOM   3879 O O   . THR A 1 496 ? 176.313 6.864  159.980 1.00 27.41  ? 496  THR A O   1 
ATOM   3880 C CB  . THR A 1 496 ? 177.595 7.068  157.026 1.00 29.22  ? 496  THR A CB  1 
ATOM   3881 O OG1 . THR A 1 496 ? 178.380 6.157  157.809 1.00 31.62  ? 496  THR A OG1 1 
ATOM   3882 C CG2 . THR A 1 496 ? 178.529 7.858  156.157 1.00 26.36  ? 496  THR A CG2 1 
ATOM   3883 N N   . THR A 1 497 ? 174.903 6.714  158.208 1.00 30.41  ? 497  THR A N   1 
ATOM   3884 C CA  . THR A 1 497 ? 173.912 5.897  158.891 1.00 35.87  ? 497  THR A CA  1 
ATOM   3885 C C   . THR A 1 497 ? 174.502 4.650  159.481 1.00 38.04  ? 497  THR A C   1 
ATOM   3886 O O   . THR A 1 497 ? 174.095 4.235  160.591 1.00 34.61  ? 497  THR A O   1 
ATOM   3887 C CB  . THR A 1 497 ? 172.774 5.429  157.935 1.00 35.23  ? 497  THR A CB  1 
ATOM   3888 O OG1 . THR A 1 497 ? 172.059 6.551  157.464 1.00 37.75  ? 497  THR A OG1 1 
ATOM   3889 C CG2 . THR A 1 497 ? 171.795 4.567  158.658 1.00 38.96  ? 497  THR A CG2 1 
ATOM   3890 N N   . LYS A 1 498 ? 175.392 4.016  158.711 1.00 39.28  ? 498  LYS A N   1 
ATOM   3891 C CA  . LYS A 1 498 ? 175.971 2.755  159.108 1.00 39.66  ? 498  LYS A CA  1 
ATOM   3892 C C   . LYS A 1 498 ? 177.005 2.990  160.169 1.00 35.98  ? 498  LYS A C   1 
ATOM   3893 O O   . LYS A 1 498 ? 177.039 2.273  161.127 1.00 34.97  ? 498  LYS A O   1 
ATOM   3894 C CB  . LYS A 1 498 ? 176.669 1.985  157.950 1.00 45.35  ? 498  LYS A CB  1 
ATOM   3895 C CG  . LYS A 1 498 ? 177.058 0.526  158.345 1.00 51.02  ? 498  LYS A CG  1 
ATOM   3896 C CD  . LYS A 1 498 ? 178.156 -0.175 157.505 1.00 52.36  ? 498  LYS A CD  1 
ATOM   3897 N N   . GLU A 1 499 ? 177.925 3.912  159.943 1.00 32.14  ? 499  GLU A N   1 
ATOM   3898 C CA  . GLU A 1 499 ? 179.097 3.993  160.801 1.00 32.03  ? 499  GLU A CA  1 
ATOM   3899 C C   . GLU A 1 499 ? 179.028 5.062  161.899 1.00 29.90  ? 499  GLU A C   1 
ATOM   3900 O O   . GLU A 1 499 ? 179.757 5.012  162.860 1.00 27.99  ? 499  GLU A O   1 
ATOM   3901 C CB  . GLU A 1 499 ? 180.303 4.227  159.935 1.00 37.58  ? 499  GLU A CB  1 
ATOM   3902 C CG  . GLU A 1 499 ? 180.395 3.220  158.781 1.00 45.26  ? 499  GLU A CG  1 
ATOM   3903 C CD  . GLU A 1 499 ? 181.645 2.454  158.886 1.00 57.82  ? 499  GLU A CD  1 
ATOM   3904 O OE1 . GLU A 1 499 ? 181.599 1.502  159.691 1.00 71.11  ? 499  GLU A OE1 1 
ATOM   3905 O OE2 . GLU A 1 499 ? 182.658 2.818  158.221 1.00 65.42  ? 499  GLU A OE2 1 
ATOM   3906 N N   . GLN A 1 500 ? 178.213 6.084  161.709 1.00 28.89  ? 500  GLN A N   1 
ATOM   3907 C CA  . GLN A 1 500 ? 177.895 7.025  162.831 1.00 31.92  ? 500  GLN A CA  1 
ATOM   3908 C C   . GLN A 1 500 ? 179.101 7.698  163.459 1.00 27.76  ? 500  GLN A C   1 
ATOM   3909 O O   . GLN A 1 500 ? 179.153 7.934  164.663 1.00 21.19  ? 500  GLN A O   1 
ATOM   3910 C CB  . GLN A 1 500 ? 177.041 6.294  163.879 1.00 31.83  ? 500  GLN A CB  1 
ATOM   3911 C CG  . GLN A 1 500 ? 175.733 5.857  163.249 1.00 31.30  ? 500  GLN A CG  1 
ATOM   3912 C CD  . GLN A 1 500 ? 174.885 4.997  164.153 1.00 34.93  ? 500  GLN A CD  1 
ATOM   3913 O OE1 . GLN A 1 500 ? 174.666 5.290  165.308 1.00 33.61  ? 500  GLN A OE1 1 
ATOM   3914 N NE2 . GLN A 1 500 ? 174.382 3.931  163.603 1.00 37.74  ? 500  GLN A NE2 1 
ATOM   3915 N N   . LYS A 1 501 ? 180.055 8.075  162.612 1.00 24.72  ? 501  LYS A N   1 
ATOM   3916 C CA  . LYS A 1 501 ? 181.241 8.731  163.080 1.00 22.80  ? 501  LYS A CA  1 
ATOM   3917 C C   . LYS A 1 501 ? 181.114 10.171 163.499 1.00 22.50  ? 501  LYS A C   1 
ATOM   3918 O O   . LYS A 1 501 ? 180.355 10.993 162.918 1.00 24.47  ? 501  LYS A O   1 
ATOM   3919 C CB  . LYS A 1 501 ? 182.373 8.625  162.065 1.00 24.92  ? 501  LYS A CB  1 
ATOM   3920 C CG  . LYS A 1 501 ? 182.761 7.175  161.757 1.00 26.89  ? 501  LYS A CG  1 
ATOM   3921 C CD  . LYS A 1 501 ? 183.841 7.145  160.649 1.00 31.48  ? 501  LYS A CD  1 
ATOM   3922 C CE  . LYS A 1 501 ? 184.275 5.697  160.339 1.00 39.44  ? 501  LYS A CE  1 
ATOM   3923 N NZ  . LYS A 1 501 ? 185.439 5.676  159.422 1.00 43.29  ? 501  LYS A NZ  1 
ATOM   3924 N N   . PHE A 1 502 ? 181.963 10.516 164.443 1.00 20.46  ? 502  PHE A N   1 
ATOM   3925 C CA  . PHE A 1 502 ? 182.029 11.914 164.923 1.00 23.08  ? 502  PHE A CA  1 
ATOM   3926 C C   . PHE A 1 502 ? 183.430 12.219 165.389 1.00 20.82  ? 502  PHE A C   1 
ATOM   3927 O O   . PHE A 1 502 ? 184.221 11.314 165.516 1.00 24.96  ? 502  PHE A O   1 
ATOM   3928 C CB  . PHE A 1 502 ? 180.987 12.184 166.032 1.00 23.09  ? 502  PHE A CB  1 
ATOM   3929 C CG  . PHE A 1 502 ? 181.268 11.493 167.359 1.00 23.28  ? 502  PHE A CG  1 
ATOM   3930 C CD1 . PHE A 1 502 ? 180.740 10.241 167.627 1.00 23.30  ? 502  PHE A CD1 1 
ATOM   3931 C CD2 . PHE A 1 502 ? 181.956 12.142 168.352 1.00 22.74  ? 502  PHE A CD2 1 
ATOM   3932 C CE1 . PHE A 1 502 ? 180.995 9.618  168.835 1.00 25.33  ? 502  PHE A CE1 1 
ATOM   3933 C CE2 . PHE A 1 502 ? 182.190 11.550 169.575 1.00 23.71  ? 502  PHE A CE2 1 
ATOM   3934 C CZ  . PHE A 1 502 ? 181.696 10.290 169.837 1.00 23.81  ? 502  PHE A CZ  1 
ATOM   3935 N N   . ILE A 1 503 ? 183.744 13.488 165.592 1.00 23.19  ? 503  ILE A N   1 
ATOM   3936 C CA  . ILE A 1 503 ? 185.018 13.873 166.150 1.00 24.37  ? 503  ILE A CA  1 
ATOM   3937 C C   . ILE A 1 503 ? 184.878 14.645 167.487 1.00 27.27  ? 503  ILE A C   1 
ATOM   3938 O O   . ILE A 1 503 ? 183.840 15.258 167.774 1.00 23.58  ? 503  ILE A O   1 
ATOM   3939 C CB  . ILE A 1 503 ? 185.838 14.736 165.203 1.00 24.95  ? 503  ILE A CB  1 
ATOM   3940 C CG1 . ILE A 1 503 ? 185.163 16.043 164.889 1.00 24.69  ? 503  ILE A CG1 1 
ATOM   3941 C CG2 . ILE A 1 503 ? 186.188 13.977 163.927 1.00 27.46  ? 503  ILE A CG2 1 
ATOM   3942 C CD1 . ILE A 1 503 ? 186.162 17.073 164.386 1.00 26.09  ? 503  ILE A CD1 1 
ATOM   3943 N N   . ASP A 1 504 ? 185.913 14.530 168.307 1.00 24.45  ? 504  ASP A N   1 
ATOM   3944 C CA  . ASP A 1 504 ? 186.061 15.358 169.493 1.00 28.43  ? 504  ASP A CA  1 
ATOM   3945 C C   . ASP A 1 504 ? 186.635 16.669 168.946 1.00 26.16  ? 504  ASP A C   1 
ATOM   3946 O O   . ASP A 1 504 ? 187.449 16.615 168.074 1.00 29.68  ? 504  ASP A O   1 
ATOM   3947 C CB  . ASP A 1 504 ? 187.071 14.752 170.507 1.00 28.77  ? 504  ASP A CB  1 
ATOM   3948 C CG  . ASP A 1 504 ? 186.610 13.472 171.171 1.00 34.60  ? 504  ASP A CG  1 
ATOM   3949 O OD1 . ASP A 1 504 ? 187.506 12.716 171.680 1.00 39.50  ? 504  ASP A OD1 1 
ATOM   3950 O OD2 . ASP A 1 504 ? 185.392 13.196 171.235 1.00 38.40  ? 504  ASP A OD2 1 
ATOM   3951 N N   . LEU A 1 505 ? 186.168 17.813 169.432 1.00 28.14  ? 505  LEU A N   1 
ATOM   3952 C CA  . LEU A 1 505 ? 186.763 19.123 169.208 1.00 26.18  ? 505  LEU A CA  1 
ATOM   3953 C C   . LEU A 1 505 ? 187.383 19.573 170.509 1.00 29.76  ? 505  LEU A C   1 
ATOM   3954 O O   . LEU A 1 505 ? 186.657 19.873 171.461 1.00 31.25  ? 505  LEU A O   1 
ATOM   3955 C CB  . LEU A 1 505 ? 185.702 20.154 168.821 1.00 29.00  ? 505  LEU A CB  1 
ATOM   3956 C CG  . LEU A 1 505 ? 185.169 20.158 167.404 1.00 30.93  ? 505  LEU A CG  1 
ATOM   3957 C CD1 . LEU A 1 505 ? 184.083 21.210 167.284 1.00 28.38  ? 505  LEU A CD1 1 
ATOM   3958 C CD2 . LEU A 1 505 ? 186.360 20.417 166.429 1.00 31.30  ? 505  LEU A CD2 1 
ATOM   3959 N N   . ASN A 1 506 ? 188.719 19.617 170.556 1.00 31.88  ? 506  ASN A N   1 
ATOM   3960 C CA  . ASN A 1 506 ? 189.471 19.989 171.721 1.00 31.12  ? 506  ASN A CA  1 
ATOM   3961 C C   . ASN A 1 506 ? 190.908 20.268 171.278 1.00 32.08  ? 506  ASN A C   1 
ATOM   3962 O O   . ASN A 1 506 ? 191.188 20.432 170.106 1.00 29.72  ? 506  ASN A O   1 
ATOM   3963 C CB  . ASN A 1 506 ? 189.369 18.895 172.816 1.00 29.03  ? 506  ASN A CB  1 
ATOM   3964 C CG  . ASN A 1 506 ? 189.918 17.579 172.371 1.00 27.83  ? 506  ASN A CG  1 
ATOM   3965 O OD1 . ASN A 1 506 ? 190.931 17.538 171.690 1.00 28.11  ? 506  ASN A OD1 1 
ATOM   3966 N ND2 . ASN A 1 506 ? 189.266 16.482 172.774 1.00 24.88  ? 506  ASN A ND2 1 
ATOM   3967 N N   . THR A 1 507 ? 191.817 20.411 172.213 1.00 32.69  ? 507  THR A N   1 
ATOM   3968 C CA  . THR A 1 507 ? 193.120 20.981 171.876 1.00 33.62  ? 507  THR A CA  1 
ATOM   3969 C C   . THR A 1 507 ? 194.027 19.844 171.492 1.00 34.81  ? 507  THR A C   1 
ATOM   3970 O O   . THR A 1 507 ? 195.143 20.075 171.124 1.00 42.22  ? 507  THR A O   1 
ATOM   3971 C CB  . THR A 1 507 ? 193.748 21.773 173.067 1.00 32.47  ? 507  THR A CB  1 
ATOM   3972 O OG1 . THR A 1 507 ? 193.722 20.971 174.252 1.00 32.54  ? 507  THR A OG1 1 
ATOM   3973 C CG2 . THR A 1 507 ? 192.986 22.996 173.338 1.00 31.21  ? 507  THR A CG2 1 
ATOM   3974 N N   . GLU A 1 508 ? 193.555 18.610 171.596 1.00 39.01  ? 508  GLU A N   1 
ATOM   3975 C CA  . GLU A 1 508 ? 194.381 17.432 171.340 1.00 41.31  ? 508  GLU A CA  1 
ATOM   3976 C C   . GLU A 1 508 ? 194.235 17.066 169.871 1.00 44.57  ? 508  GLU A C   1 
ATOM   3977 O O   . GLU A 1 508 ? 193.306 17.543 169.225 1.00 35.10  ? 508  GLU A O   1 
ATOM   3978 C CB  . GLU A 1 508 ? 193.950 16.189 172.169 1.00 43.00  ? 508  GLU A CB  1 
ATOM   3979 C CG  . GLU A 1 508 ? 194.035 16.255 173.684 1.00 51.92  ? 508  GLU A CG  1 
ATOM   3980 C CD  . GLU A 1 508 ? 195.169 17.111 174.198 1.00 59.96  ? 508  GLU A CD  1 
ATOM   3981 O OE1 . GLU A 1 508 ? 196.239 16.540 174.454 1.00 82.49  ? 508  GLU A OE1 1 
ATOM   3982 O OE2 . GLU A 1 508 ? 195.007 18.352 174.352 1.00 72.80  ? 508  GLU A OE2 1 
ATOM   3983 N N   . PRO A 1 509 ? 195.156 16.225 169.343 1.00 48.41  ? 509  PRO A N   1 
ATOM   3984 C CA  . PRO A 1 509 ? 195.014 15.736 167.964 1.00 55.83  ? 509  PRO A CA  1 
ATOM   3985 C C   . PRO A 1 509 ? 193.659 15.037 167.739 1.00 52.74  ? 509  PRO A C   1 
ATOM   3986 O O   . PRO A 1 509 ? 193.251 14.248 168.573 1.00 47.04  ? 509  PRO A O   1 
ATOM   3987 C CB  . PRO A 1 509 ? 196.163 14.725 167.809 1.00 55.14  ? 509  PRO A CB  1 
ATOM   3988 C CG  . PRO A 1 509 ? 197.146 15.057 168.886 1.00 55.84  ? 509  PRO A CG  1 
ATOM   3989 C CD  . PRO A 1 509 ? 196.366 15.699 170.006 1.00 53.42  ? 509  PRO A CD  1 
ATOM   3990 N N   . MET A 1 510 ? 193.010 15.330 166.608 1.00 53.79  ? 510  MET A N   1 
ATOM   3991 C CA  . MET A 1 510 ? 191.665 14.869 166.275 1.00 50.89  ? 510  MET A CA  1 
ATOM   3992 C C   . MET A 1 510 ? 191.531 13.399 166.503 1.00 48.79  ? 510  MET A C   1 
ATOM   3993 O O   . MET A 1 510 ? 192.369 12.635 166.077 1.00 53.15  ? 510  MET A O   1 
ATOM   3994 C CB  . MET A 1 510 ? 191.385 15.157 164.813 1.00 54.74  ? 510  MET A CB  1 
ATOM   3995 C CG  . MET A 1 510 ? 189.915 15.207 164.393 1.00 59.32  ? 510  MET A CG  1 
ATOM   3996 S SD  . MET A 1 510 ? 189.667 15.342 162.585 1.00 50.53  ? 510  MET A SD  1 
ATOM   3997 C CE  . MET A 1 510 ? 190.059 13.648 162.231 1.00 57.63  ? 510  MET A CE  1 
ATOM   3998 N N   . LYS A 1 511 ? 190.498 12.994 167.222 1.00 42.01  ? 511  LYS A N   1 
ATOM   3999 C CA  . LYS A 1 511 ? 190.147 11.602 167.304 1.00 37.96  ? 511  LYS A CA  1 
ATOM   4000 C C   . LYS A 1 511 ? 188.742 11.502 166.746 1.00 35.75  ? 511  LYS A C   1 
ATOM   4001 O O   . LYS A 1 511 ? 187.893 12.401 166.969 1.00 37.48  ? 511  LYS A O   1 
ATOM   4002 C CB  . LYS A 1 511 ? 190.085 11.109 168.738 1.00 44.70  ? 511  LYS A CB  1 
ATOM   4003 C CG  . LYS A 1 511 ? 191.379 10.994 169.480 1.00 57.37  ? 511  LYS A CG  1 
ATOM   4004 C CD  . LYS A 1 511 ? 191.386 9.674  170.265 1.00 68.31  ? 511  LYS A CD  1 
ATOM   4005 C CE  . LYS A 1 511 ? 192.647 9.525  171.118 1.00 73.30  ? 511  LYS A CE  1 
ATOM   4006 N NZ  . LYS A 1 511 ? 192.537 8.410  172.108 1.00 77.77  ? 511  LYS A NZ  1 
ATOM   4007 N N   . VAL A 1 512 ? 188.504 10.372 166.125 1.00 26.98  ? 512  VAL A N   1 
ATOM   4008 C CA  . VAL A 1 512 ? 187.280 9.961  165.538 1.00 29.94  ? 512  VAL A CA  1 
ATOM   4009 C C   . VAL A 1 512 ? 186.708 8.835  166.371 1.00 31.14  ? 512  VAL A C   1 
ATOM   4010 O O   . VAL A 1 512 ? 187.434 7.968  166.800 1.00 31.12  ? 512  VAL A O   1 
ATOM   4011 C CB  . VAL A 1 512 ? 187.521 9.353  164.143 1.00 29.52  ? 512  VAL A CB  1 
ATOM   4012 C CG1 . VAL A 1 512 ? 186.241 8.747  163.549 1.00 32.80  ? 512  VAL A CG1 1 
ATOM   4013 C CG2 . VAL A 1 512 ? 188.068 10.422 163.226 1.00 31.70  ? 512  VAL A CG2 1 
ATOM   4014 N N   . HIS A 1 513 ? 185.392 8.843  166.568 1.00 29.12  ? 513  HIS A N   1 
ATOM   4015 C CA  . HIS A 1 513 ? 184.702 7.801  167.341 1.00 27.49  ? 513  HIS A CA  1 
ATOM   4016 C C   . HIS A 1 513 ? 183.419 7.509  166.666 1.00 23.82  ? 513  HIS A C   1 
ATOM   4017 O O   . HIS A 1 513 ? 183.052 8.193  165.695 1.00 23.12  ? 513  HIS A O   1 
ATOM   4018 C CB  . HIS A 1 513 ? 184.328 8.318  168.739 1.00 31.52  ? 513  HIS A CB  1 
ATOM   4019 C CG  . HIS A 1 513 ? 185.460 8.901  169.523 1.00 32.52  ? 513  HIS A CG  1 
ATOM   4020 N ND1 . HIS A 1 513 ? 186.406 8.120  170.150 1.00 36.05  ? 513  HIS A ND1 1 
ATOM   4021 C CD2 . HIS A 1 513 ? 185.735 10.183 169.870 1.00 37.11  ? 513  HIS A CD2 1 
ATOM   4022 C CE1 . HIS A 1 513 ? 187.258 8.902  170.797 1.00 40.51  ? 513  HIS A CE1 1 
ATOM   4023 N NE2 . HIS A 1 513 ? 186.861 10.156 170.659 1.00 40.94  ? 513  HIS A NE2 1 
ATOM   4024 N N   . GLN A 1 514 ? 182.669 6.570  167.222 1.00 25.44  ? 514  GLN A N   1 
ATOM   4025 C CA  . GLN A 1 514 ? 181.390 6.199  166.689 1.00 27.51  ? 514  GLN A CA  1 
ATOM   4026 C C   . GLN A 1 514 ? 180.284 6.106  167.754 1.00 26.77  ? 514  GLN A C   1 
ATOM   4027 O O   . GLN A 1 514 ? 180.554 5.782  168.893 1.00 24.99  ? 514  GLN A O   1 
ATOM   4028 C CB  . GLN A 1 514 ? 181.540 4.847  166.022 1.00 29.42  ? 514  GLN A CB  1 
ATOM   4029 C CG  . GLN A 1 514 ? 182.579 4.834  164.922 1.00 35.73  ? 514  GLN A CG  1 
ATOM   4030 C CD  . GLN A 1 514 ? 182.717 3.455  164.293 1.00 36.17  ? 514  GLN A CD  1 
ATOM   4031 O OE1 . GLN A 1 514 ? 183.637 2.743  164.625 1.00 45.65  ? 514  GLN A OE1 1 
ATOM   4032 N NE2 . GLN A 1 514 ? 181.758 3.058  163.438 1.00 34.00  ? 514  GLN A NE2 1 
ATOM   4033 N N   . ARG A 1 515 ? 179.051 6.400  167.343 1.00 25.72  ? 515  ARG A N   1 
ATOM   4034 C CA  . ARG A 1 515 ? 177.872 6.145  168.127 1.00 27.70  ? 515  ARG A CA  1 
ATOM   4035 C C   . ARG A 1 515 ? 177.885 6.946  169.462 1.00 24.85  ? 515  ARG A C   1 
ATOM   4036 O O   . ARG A 1 515 ? 177.911 6.391  170.569 1.00 22.62  ? 515  ARG A O   1 
ATOM   4037 C CB  . ARG A 1 515 ? 177.820 4.627  168.369 1.00 27.85  ? 515  ARG A CB  1 
ATOM   4038 C CG  . ARG A 1 515 ? 177.495 3.864  167.084 1.00 29.69  ? 515  ARG A CG  1 
ATOM   4039 C CD  . ARG A 1 515 ? 177.106 2.430  167.346 1.00 34.34  ? 515  ARG A CD  1 
ATOM   4040 N NE  . ARG A 1 515 ? 176.696 1.748  166.144 1.00 38.51  ? 515  ARG A NE  1 
ATOM   4041 C CZ  . ARG A 1 515 ? 176.020 0.592  166.122 1.00 52.03  ? 515  ARG A CZ  1 
ATOM   4042 N NH1 . ARG A 1 515 ? 175.669 -0.051 167.252 1.00 52.75  ? 515  ARG A NH1 1 
ATOM   4043 N NH2 . ARG A 1 515 ? 175.701 0.046  164.958 1.00 55.39  ? 515  ARG A NH2 1 
ATOM   4044 N N   . LEU A 1 516 ? 177.885 8.236  169.298 1.00 22.22  ? 516  LEU A N   1 
ATOM   4045 C CA  . LEU A 1 516 ? 177.896 9.242  170.369 1.00 27.20  ? 516  LEU A CA  1 
ATOM   4046 C C   . LEU A 1 516 ? 176.789 9.010  171.427 1.00 25.27  ? 516  LEU A C   1 
ATOM   4047 O O   . LEU A 1 516 ? 175.584 9.064  171.120 1.00 22.97  ? 516  LEU A O   1 
ATOM   4048 C CB  . LEU A 1 516 ? 177.714 10.625 169.744 1.00 26.33  ? 516  LEU A CB  1 
ATOM   4049 C CG  . LEU A 1 516 ? 178.191 11.836 170.573 1.00 28.83  ? 516  LEU A CG  1 
ATOM   4050 C CD1 . LEU A 1 516 ? 178.190 13.034 169.647 1.00 29.43  ? 516  LEU A CD1 1 
ATOM   4051 C CD2 . LEU A 1 516 ? 177.315 12.114 171.764 1.00 32.16  ? 516  LEU A CD2 1 
ATOM   4052 N N   . ARG A 1 517 ? 177.233 8.734  172.658 1.00 28.48  ? 517  ARG A N   1 
ATOM   4053 C CA  . ARG A 1 517 ? 176.356 8.358  173.808 1.00 25.14  ? 517  ARG A CA  1 
ATOM   4054 C C   . ARG A 1 517 ? 175.235 7.430  173.460 1.00 22.78  ? 517  ARG A C   1 
ATOM   4055 O O   . ARG A 1 517 ? 174.113 7.584  173.922 1.00 21.81  ? 517  ARG A O   1 
ATOM   4056 C CB  . ARG A 1 517 ? 175.836 9.632  174.543 1.00 31.61  ? 517  ARG A CB  1 
ATOM   4057 C CG  . ARG A 1 517 ? 177.023 10.088 175.439 1.00 35.60  ? 517  ARG A CG  1 
ATOM   4058 C CD  . ARG A 1 517 ? 176.831 11.366 176.208 1.00 35.86  ? 517  ARG A CD  1 
ATOM   4059 N NE  . ARG A 1 517 ? 176.122 11.108 177.460 1.00 36.67  ? 517  ARG A NE  1 
ATOM   4060 C CZ  . ARG A 1 517 ? 176.655 10.507 178.523 1.00 35.94  ? 517  ARG A CZ  1 
ATOM   4061 N NH1 . ARG A 1 517 ? 177.893 10.073 178.473 1.00 39.19  ? 517  ARG A NH1 1 
ATOM   4062 N NH2 . ARG A 1 517 ? 175.942 10.325 179.641 1.00 31.28  ? 517  ARG A NH2 1 
ATOM   4063 N N   . VAL A 1 518 ? 175.534 6.416  172.664 1.00 24.67  ? 518  VAL A N   1 
ATOM   4064 C CA  . VAL A 1 518 ? 174.471 5.555  172.152 1.00 22.74  ? 518  VAL A CA  1 
ATOM   4065 C C   . VAL A 1 518 ? 173.751 4.806  173.293 1.00 22.07  ? 518  VAL A C   1 
ATOM   4066 O O   . VAL A 1 518 ? 172.571 4.596  173.242 1.00 21.17  ? 518  VAL A O   1 
ATOM   4067 C CB  . VAL A 1 518 ? 175.021 4.577  171.105 1.00 22.05  ? 518  VAL A CB  1 
ATOM   4068 C CG1 . VAL A 1 518 ? 176.117 3.679  171.660 1.00 22.24  ? 518  VAL A CG1 1 
ATOM   4069 C CG2 . VAL A 1 518 ? 173.879 3.761  170.463 1.00 23.27  ? 518  VAL A CG2 1 
ATOM   4070 N N   . GLN A 1 519 ? 174.485 4.378  174.312 1.00 24.05  ? 519  GLN A N   1 
ATOM   4071 C CA  . GLN A 1 519 ? 173.890 3.601  175.425 1.00 27.49  ? 519  GLN A CA  1 
ATOM   4072 C C   . GLN A 1 519 ? 172.766 4.398  176.108 1.00 23.91  ? 519  GLN A C   1 
ATOM   4073 O O   . GLN A 1 519 ? 171.615 3.988  176.172 1.00 26.50  ? 519  GLN A O   1 
ATOM   4074 C CB  . GLN A 1 519 ? 175.006 3.208  176.441 1.00 30.23  ? 519  GLN A CB  1 
ATOM   4075 C CG  . GLN A 1 519 ? 174.504 2.077  177.329 1.00 39.05  ? 519  GLN A CG  1 
ATOM   4076 C CD  . GLN A 1 519 ? 174.420 0.726  176.617 1.00 42.71  ? 519  GLN A CD  1 
ATOM   4077 O OE1 . GLN A 1 519 ? 175.225 0.442  175.703 1.00 40.03  ? 519  GLN A OE1 1 
ATOM   4078 N NE2 . GLN A 1 519 ? 173.429 -0.119 177.029 1.00 45.61  ? 519  GLN A NE2 1 
ATOM   4079 N N   . MET A 1 520 ? 173.101 5.620  176.497 1.00 23.07  ? 520  MET A N   1 
ATOM   4080 C CA  . MET A 1 520 ? 172.126 6.489  177.143 1.00 21.27  ? 520  MET A CA  1 
ATOM   4081 C C   . MET A 1 520 ? 171.062 6.905  176.127 1.00 22.40  ? 520  MET A C   1 
ATOM   4082 O O   . MET A 1 520 ? 169.865 6.997  176.465 1.00 23.40  ? 520  MET A O   1 
ATOM   4083 C CB  . MET A 1 520 ? 172.786 7.713  177.796 1.00 21.54  ? 520  MET A CB  1 
ATOM   4084 C CG  . MET A 1 520 ? 173.757 7.438  178.959 1.00 21.72  ? 520  MET A CG  1 
ATOM   4085 S SD  . MET A 1 520 ? 172.926 6.677  180.334 1.00 23.88  ? 520  MET A SD  1 
ATOM   4086 C CE  . MET A 1 520 ? 173.413 4.963  180.199 1.00 26.82  ? 520  MET A CE  1 
ATOM   4087 N N   . CYS A 1 521 ? 171.412 7.106  174.846 1.00 22.21  ? 521  CYS A N   1 
ATOM   4088 C CA  . CYS A 1 521 ? 170.366 7.618  173.911 1.00 21.34  ? 521  CYS A CA  1 
ATOM   4089 C C   . CYS A 1 521 ? 169.341 6.561  173.521 1.00 20.21  ? 521  CYS A C   1 
ATOM   4090 O O   . CYS A 1 521 ? 168.142 6.896  173.319 1.00 22.21  ? 521  CYS A O   1 
ATOM   4091 C CB  . CYS A 1 521 ? 170.959 8.450  172.759 1.00 26.35  ? 521  CYS A CB  1 
ATOM   4092 S SG  . CYS A 1 521 ? 171.788 9.955  173.450 1.00 25.75  ? 521  CYS A SG  1 
ATOM   4093 N N   . VAL A 1 522 ? 169.727 5.294  173.480 1.00 21.02  ? 522  VAL A N   1 
ATOM   4094 C CA  . VAL A 1 522 ? 168.691 4.252  173.319 1.00 23.28  ? 522  VAL A CA  1 
ATOM   4095 C C   . VAL A 1 522 ? 167.720 4.305  174.479 1.00 22.71  ? 522  VAL A C   1 
ATOM   4096 O O   . VAL A 1 522 ? 166.516 4.114  174.337 1.00 19.43  ? 522  VAL A O   1 
ATOM   4097 C CB  . VAL A 1 522 ? 169.280 2.821  173.279 1.00 26.12  ? 522  VAL A CB  1 
ATOM   4098 C CG1 . VAL A 1 522 ? 168.161 1.791  173.291 1.00 25.24  ? 522  VAL A CG1 1 
ATOM   4099 C CG2 . VAL A 1 522 ? 170.095 2.661  171.993 1.00 28.30  ? 522  VAL A CG2 1 
ATOM   4100 N N   . PHE A 1 523 ? 168.243 4.605  175.659 1.00 24.27  ? 523  PHE A N   1 
ATOM   4101 C CA  . PHE A 1 523 ? 167.348 4.685  176.819 1.00 20.68  ? 523  PHE A CA  1 
ATOM   4102 C C   . PHE A 1 523 ? 166.377 5.822  176.633 1.00 18.46  ? 523  PHE A C   1 
ATOM   4103 O O   . PHE A 1 523 ? 165.167 5.617  176.714 1.00 22.01  ? 523  PHE A O   1 
ATOM   4104 C CB  . PHE A 1 523 ? 168.126 4.867  178.127 1.00 21.01  ? 523  PHE A CB  1 
ATOM   4105 C CG  . PHE A 1 523 ? 167.236 5.217  179.286 1.00 20.69  ? 523  PHE A CG  1 
ATOM   4106 C CD1 . PHE A 1 523 ? 166.565 4.246  179.950 1.00 20.85  ? 523  PHE A CD1 1 
ATOM   4107 C CD2 . PHE A 1 523 ? 167.065 6.545  179.677 1.00 22.17  ? 523  PHE A CD2 1 
ATOM   4108 C CE1 . PHE A 1 523 ? 165.710 4.580  181.013 1.00 21.59  ? 523  PHE A CE1 1 
ATOM   4109 C CE2 . PHE A 1 523 ? 166.239 6.896  180.726 1.00 22.44  ? 523  PHE A CE2 1 
ATOM   4110 C CZ  . PHE A 1 523 ? 165.559 5.874  181.401 1.00 24.60  ? 523  PHE A CZ  1 
ATOM   4111 N N   . TRP A 1 524 ? 166.873 7.022  176.376 1.00 17.54  ? 524  TRP A N   1 
ATOM   4112 C CA  . TRP A 1 524 ? 165.954 8.193  176.244 1.00 17.89  ? 524  TRP A CA  1 
ATOM   4113 C C   . TRP A 1 524 ? 165.087 8.198  174.989 1.00 19.13  ? 524  TRP A C   1 
ATOM   4114 O O   . TRP A 1 524 ? 163.952 8.630  174.989 1.00 20.75  ? 524  TRP A O   1 
ATOM   4115 C CB  . TRP A 1 524 ? 166.762 9.493  176.290 1.00 18.08  ? 524  TRP A CB  1 
ATOM   4116 C CG  . TRP A 1 524 ? 167.369 9.733  177.648 1.00 18.64  ? 524  TRP A CG  1 
ATOM   4117 C CD1 . TRP A 1 524 ? 168.645 9.584  178.015 1.00 19.58  ? 524  TRP A CD1 1 
ATOM   4118 C CD2 . TRP A 1 524 ? 166.668 10.202 178.785 1.00 18.44  ? 524  TRP A CD2 1 
ATOM   4119 N NE1 . TRP A 1 524 ? 168.812 9.947  179.336 1.00 21.35  ? 524  TRP A NE1 1 
ATOM   4120 C CE2 . TRP A 1 524 ? 167.588 10.327 179.828 1.00 21.30  ? 524  TRP A CE2 1 
ATOM   4121 C CE3 . TRP A 1 524 ? 165.352 10.566 179.009 1.00 21.02  ? 524  TRP A CE3 1 
ATOM   4122 C CZ2 . TRP A 1 524 ? 167.217 10.752 181.116 1.00 19.48  ? 524  TRP A CZ2 1 
ATOM   4123 C CZ3 . TRP A 1 524 ? 164.977 11.012 180.297 1.00 22.82  ? 524  TRP A CZ3 1 
ATOM   4124 C CH2 . TRP A 1 524 ? 165.927 11.105 181.321 1.00 20.03  ? 524  TRP A CH2 1 
ATOM   4125 N N   . ASN A 1 525 ? 165.627 7.696  173.895 1.00 22.60  ? 525  ASN A N   1 
ATOM   4126 C CA  . ASN A 1 525 ? 164.947 7.777  172.579 1.00 23.51  ? 525  ASN A CA  1 
ATOM   4127 C C   . ASN A 1 525 ? 164.055 6.588  172.307 1.00 26.84  ? 525  ASN A C   1 
ATOM   4128 O O   . ASN A 1 525 ? 163.066 6.735  171.639 1.00 26.78  ? 525  ASN A O   1 
ATOM   4129 C CB  . ASN A 1 525 ? 166.012 7.888  171.482 1.00 22.52  ? 525  ASN A CB  1 
ATOM   4130 C CG  . ASN A 1 525 ? 166.694 9.259  171.524 1.00 23.71  ? 525  ASN A CG  1 
ATOM   4131 O OD1 . ASN A 1 525 ? 166.170 10.177 172.127 1.00 27.31  ? 525  ASN A OD1 1 
ATOM   4132 N ND2 . ASN A 1 525 ? 167.836 9.372  170.960 1.00 23.87  ? 525  ASN A ND2 1 
ATOM   4133 N N   . GLN A 1 526 ? 164.357 5.422  172.850 1.00 24.59  ? 526  GLN A N   1 
ATOM   4134 C CA  . GLN A 1 526 ? 163.515 4.249  172.566 1.00 27.06  ? 526  GLN A CA  1 
ATOM   4135 C C   . GLN A 1 526 ? 162.826 3.659  173.779 1.00 27.34  ? 526  GLN A C   1 
ATOM   4136 O O   . GLN A 1 526 ? 161.626 3.419  173.725 1.00 26.32  ? 526  GLN A O   1 
ATOM   4137 C CB  . GLN A 1 526 ? 164.358 3.152  171.917 1.00 32.14  ? 526  GLN A CB  1 
ATOM   4138 C CG  . GLN A 1 526 ? 164.514 3.381  170.426 1.00 40.53  ? 526  GLN A CG  1 
ATOM   4139 C CD  . GLN A 1 526 ? 165.941 3.189  169.979 1.00 56.37  ? 526  GLN A CD  1 
ATOM   4140 O OE1 . GLN A 1 526 ? 166.335 2.072  169.539 1.00 53.56  ? 526  GLN A OE1 1 
ATOM   4141 N NE2 . GLN A 1 526 ? 166.751 4.273  170.091 1.00 57.57  ? 526  GLN A NE2 1 
ATOM   4142 N N   . PHE A 1 527 ? 163.578 3.389  174.859 1.00 24.62  ? 527  PHE A N   1 
ATOM   4143 C CA  . PHE A 1 527 ? 162.995 2.614  175.960 1.00 23.66  ? 527  PHE A CA  1 
ATOM   4144 C C   . PHE A 1 527 ? 162.081 3.484  176.823 1.00 22.26  ? 527  PHE A C   1 
ATOM   4145 O O   . PHE A 1 527 ? 160.920 3.164  177.046 1.00 21.44  ? 527  PHE A O   1 
ATOM   4146 C CB  . PHE A 1 527 ? 164.064 1.917  176.829 1.00 23.30  ? 527  PHE A CB  1 
ATOM   4147 C CG  . PHE A 1 527 ? 163.471 1.247  178.011 1.00 24.77  ? 527  PHE A CG  1 
ATOM   4148 C CD1 . PHE A 1 527 ? 162.843 0.036  177.860 1.00 25.24  ? 527  PHE A CD1 1 
ATOM   4149 C CD2 . PHE A 1 527 ? 163.459 1.850  179.255 1.00 26.14  ? 527  PHE A CD2 1 
ATOM   4150 C CE1 . PHE A 1 527 ? 162.225 -0.588 178.927 1.00 24.16  ? 527  PHE A CE1 1 
ATOM   4151 C CE2 . PHE A 1 527 ? 162.842 1.227  180.337 1.00 28.05  ? 527  PHE A CE2 1 
ATOM   4152 C CZ  . PHE A 1 527 ? 162.218 0.001  180.155 1.00 28.15  ? 527  PHE A CZ  1 
ATOM   4153 N N   . LEU A 1 528 ? 162.571 4.615  177.293 1.00 22.23  ? 528  LEU A N   1 
ATOM   4154 C CA  . LEU A 1 528 ? 161.738 5.390  178.213 1.00 22.94  ? 528  LEU A CA  1 
ATOM   4155 C C   . LEU A 1 528 ? 160.400 5.811  177.573 1.00 26.93  ? 528  LEU A C   1 
ATOM   4156 O O   . LEU A 1 528 ? 159.331 5.728  178.222 1.00 28.60  ? 528  LEU A O   1 
ATOM   4157 C CB  . LEU A 1 528 ? 162.485 6.605  178.754 1.00 22.43  ? 528  LEU A CB  1 
ATOM   4158 C CG  . LEU A 1 528 ? 161.717 7.432  179.773 1.00 22.11  ? 528  LEU A CG  1 
ATOM   4159 C CD1 . LEU A 1 528 ? 161.374 6.578  181.009 1.00 24.41  ? 528  LEU A CD1 1 
ATOM   4160 C CD2 . LEU A 1 528 ? 162.545 8.609  180.240 1.00 20.38  ? 528  LEU A CD2 1 
ATOM   4161 N N   . PRO A 1 529 ? 160.426 6.319  176.329 1.00 27.16  ? 529  PRO A N   1 
ATOM   4162 C CA  . PRO A 1 529 ? 159.105 6.672  175.783 1.00 29.14  ? 529  PRO A CA  1 
ATOM   4163 C C   . PRO A 1 529 ? 158.138 5.495  175.705 1.00 29.02  ? 529  PRO A C   1 
ATOM   4164 O O   . PRO A 1 529 ? 156.940 5.625  175.989 1.00 30.25  ? 529  PRO A O   1 
ATOM   4165 C CB  . PRO A 1 529 ? 159.427 7.243  174.375 1.00 30.81  ? 529  PRO A CB  1 
ATOM   4166 C CG  . PRO A 1 529 ? 160.828 7.760  174.499 1.00 30.39  ? 529  PRO A CG  1 
ATOM   4167 C CD  . PRO A 1 529 ? 161.526 6.875  175.538 1.00 26.60  ? 529  PRO A CD  1 
ATOM   4168 N N   . LYS A 1 530 ? 158.655 4.330  175.349 1.00 30.65  ? 530  LYS A N   1 
ATOM   4169 C CA  . LYS A 1 530 ? 157.830 3.133  175.329 1.00 34.57  ? 530  LYS A CA  1 
ATOM   4170 C C   . LYS A 1 530 ? 157.258 2.828  176.736 1.00 33.65  ? 530  LYS A C   1 
ATOM   4171 O O   . LYS A 1 530 ? 156.081 2.510  176.916 1.00 32.40  ? 530  LYS A O   1 
ATOM   4172 C CB  . LYS A 1 530 ? 158.680 1.974  174.789 1.00 39.26  ? 530  LYS A CB  1 
ATOM   4173 C CG  . LYS A 1 530 ? 157.830 0.837  174.318 1.00 44.97  ? 530  LYS A CG  1 
ATOM   4174 C CD  . LYS A 1 530 ? 158.564 -0.280 173.591 1.00 53.51  ? 530  LYS A CD  1 
ATOM   4175 C CE  . LYS A 1 530 ? 157.631 -1.513 173.618 1.00 58.50  ? 530  LYS A CE  1 
ATOM   4176 N NZ  . LYS A 1 530 ? 158.055 -2.727 172.872 1.00 59.99  ? 530  LYS A NZ  1 
ATOM   4177 N N   . LEU A 1 531 ? 158.101 2.981  177.752 1.00 30.82  ? 531  LEU A N   1 
ATOM   4178 C CA  . LEU A 1 531 ? 157.693 2.768  179.101 1.00 30.11  ? 531  LEU A CA  1 
ATOM   4179 C C   . LEU A 1 531 ? 156.582 3.728  179.503 1.00 31.62  ? 531  LEU A C   1 
ATOM   4180 O O   . LEU A 1 531 ? 155.573 3.331  180.111 1.00 31.10  ? 531  LEU A O   1 
ATOM   4181 C CB  . LEU A 1 531 ? 158.906 2.887  180.036 1.00 30.51  ? 531  LEU A CB  1 
ATOM   4182 C CG  . LEU A 1 531 ? 158.700 2.654  181.530 1.00 32.07  ? 531  LEU A CG  1 
ATOM   4183 C CD1 . LEU A 1 531 ? 159.984 2.285  182.282 1.00 33.79  ? 531  LEU A CD1 1 
ATOM   4184 C CD2 . LEU A 1 531 ? 158.056 3.862  182.157 1.00 35.47  ? 531  LEU A CD2 1 
ATOM   4185 N N   . LEU A 1 532 ? 156.765 4.998  179.217 1.00 30.71  ? 532  LEU A N   1 
ATOM   4186 C CA  . LEU A 1 532 ? 155.762 5.991  179.616 1.00 35.73  ? 532  LEU A CA  1 
ATOM   4187 C C   . LEU A 1 532 ? 154.456 5.836  178.801 1.00 36.62  ? 532  LEU A C   1 
ATOM   4188 O O   . LEU A 1 532 ? 153.372 6.058  179.317 1.00 35.09  ? 532  LEU A O   1 
ATOM   4189 C CB  . LEU A 1 532 ? 156.306 7.440  179.532 1.00 34.91  ? 532  LEU A CB  1 
ATOM   4190 C CG  . LEU A 1 532 ? 157.495 7.769  180.432 1.00 33.17  ? 532  LEU A CG  1 
ATOM   4191 C CD1 . LEU A 1 532 ? 158.077 9.094  179.989 1.00 38.17  ? 532  LEU A CD1 1 
ATOM   4192 C CD2 . LEU A 1 532 ? 157.156 7.806  181.905 1.00 31.75  ? 532  LEU A CD2 1 
ATOM   4193 N N   . ASN A 1 533 ? 154.562 5.382  177.571 1.00 41.26  ? 533  ASN A N   1 
ATOM   4194 C CA  . ASN A 1 533 ? 153.363 5.034  176.807 1.00 47.72  ? 533  ASN A CA  1 
ATOM   4195 C C   . ASN A 1 533 ? 152.578 3.809  177.323 1.00 46.99  ? 533  ASN A C   1 
ATOM   4196 O O   . ASN A 1 533 ? 151.380 3.720  177.134 1.00 48.70  ? 533  ASN A O   1 
ATOM   4197 C CB  . ASN A 1 533 ? 153.702 4.820  175.319 1.00 52.10  ? 533  ASN A CB  1 
ATOM   4198 C CG  . ASN A 1 533 ? 152.464 4.811  174.428 1.00 52.26  ? 533  ASN A CG  1 
ATOM   4199 O OD1 . ASN A 1 533 ? 152.192 3.825  173.770 1.00 59.08  ? 533  ASN A OD1 1 
ATOM   4200 N ND2 . ASN A 1 533 ? 151.704 5.909  174.427 1.00 52.87  ? 533  ASN A ND2 1 
ATOM   4201 N N   . ALA A 1 534 ? 153.222 2.849  177.942 1.00 42.23  ? 534  ALA A N   1 
ATOM   4202 C CA  . ALA A 1 534 ? 152.512 1.641  178.262 1.00 48.12  ? 534  ALA A CA  1 
ATOM   4203 C C   . ALA A 1 534 ? 151.750 1.834  179.574 1.00 59.59  ? 534  ALA A C   1 
ATOM   4204 O O   . ALA A 1 534 ? 150.624 1.342  179.721 1.00 65.55  ? 534  ALA A O   1 
ATOM   4205 C CB  . ALA A 1 534 ? 153.463 0.465  178.324 1.00 50.36  ? 534  ALA A CB  1 
ATOM   4206 N N   . THR A 1 535 ? 152.339 2.602  180.496 1.00 68.17  ? 535  THR A N   1 
ATOM   4207 C CA  . THR A 1 535 ? 151.653 2.995  181.729 1.00 72.97  ? 535  THR A CA  1 
ATOM   4208 C C   . THR A 1 535 ? 150.593 4.041  181.408 1.00 84.04  ? 535  THR A C   1 
ATOM   4209 O O   . THR A 1 535 ? 150.926 5.152  180.995 1.00 85.52  ? 535  THR A O   1 
ATOM   4210 C CB  . THR A 1 535 ? 152.602 3.597  182.790 1.00 77.28  ? 535  THR A CB  1 
ATOM   4211 O OG1 . THR A 1 535 ? 153.610 2.644  183.187 1.00 59.70  ? 535  THR A OG1 1 
ATOM   4212 C CG2 . THR A 1 535 ? 151.784 4.110  184.032 1.00 81.16  ? 535  THR A CG2 1 
HETATM 4213 C C1  . NAG B 2 .   ? 175.267 58.093 163.229 1.00 61.67  ? 601  NAG A C1  1 
HETATM 4214 C C2  . NAG B 2 .   ? 175.747 59.552 163.144 1.00 68.72  ? 601  NAG A C2  1 
HETATM 4215 C C3  . NAG B 2 .   ? 177.025 59.962 163.945 1.00 74.25  ? 601  NAG A C3  1 
HETATM 4216 C C4  . NAG B 2 .   ? 177.038 59.451 165.375 1.00 69.45  ? 601  NAG A C4  1 
HETATM 4217 C C5  . NAG B 2 .   ? 176.591 57.966 165.293 1.00 64.82  ? 601  NAG A C5  1 
HETATM 4218 C C6  . NAG B 2 .   ? 176.374 57.455 166.716 1.00 63.13  ? 601  NAG A C6  1 
HETATM 4219 C C7  . NAG B 2 .   ? 174.970 60.545 161.095 1.00 72.92  ? 601  NAG A C7  1 
HETATM 4220 C C8  . NAG B 2 .   ? 175.258 60.933 159.665 1.00 72.86  ? 601  NAG A C8  1 
HETATM 4221 N N2  . NAG B 2 .   ? 175.934 59.924 161.760 1.00 67.38  ? 601  NAG A N2  1 
HETATM 4222 O O3  . NAG B 2 .   ? 177.181 61.363 164.072 1.00 73.65  ? 601  NAG A O3  1 
HETATM 4223 O O4  . NAG B 2 .   ? 178.291 59.814 166.029 1.00 63.88  ? 601  NAG A O4  1 
HETATM 4224 O O5  . NAG B 2 .   ? 175.339 57.699 164.575 1.00 59.71  ? 601  NAG A O5  1 
HETATM 4225 O O6  . NAG B 2 .   ? 175.042 57.813 167.051 1.00 63.34  ? 601  NAG A O6  1 
HETATM 4226 O O7  . NAG B 2 .   ? 173.871 60.772 161.622 1.00 77.40  ? 601  NAG A O7  1 
HETATM 4227 C C1  . FUC C 3 .   ? 174.761 57.753 168.460 1.00 77.62  ? 602  FUC A C1  1 
HETATM 4228 C C2  . FUC C 3 .   ? 174.953 59.171 169.018 1.00 86.77  ? 602  FUC A C2  1 
HETATM 4229 C C3  . FUC C 3 .   ? 173.979 60.050 168.223 1.00 92.18  ? 602  FUC A C3  1 
HETATM 4230 C C4  . FUC C 3 .   ? 172.524 59.482 168.258 1.00 92.20  ? 602  FUC A C4  1 
HETATM 4231 C C5  . FUC C 3 .   ? 172.463 57.976 167.919 1.00 84.39  ? 602  FUC A C5  1 
HETATM 4232 C C6  . FUC C 3 .   ? 171.096 57.352 168.205 1.00 84.82  ? 602  FUC A C6  1 
HETATM 4233 O O2  . FUC C 3 .   ? 176.302 59.649 168.931 1.00 82.97  ? 602  FUC A O2  1 
HETATM 4234 O O3  . FUC C 3 .   ? 174.125 61.405 168.603 1.00 83.14  ? 602  FUC A O3  1 
HETATM 4235 O O4  . FUC C 3 .   ? 171.859 59.710 169.489 1.00 93.32  ? 602  FUC A O4  1 
HETATM 4236 O O5  . FUC C 3 .   ? 173.432 57.293 168.688 1.00 75.79  ? 602  FUC A O5  1 
HETATM 4237 C C1  . NAG D 2 .   ? 174.881 14.685 147.707 1.00 37.18  ? 603  NAG A C1  1 
HETATM 4238 C C2  . NAG D 2 .   ? 175.508 13.327 147.764 1.00 35.81  ? 603  NAG A C2  1 
HETATM 4239 C C3  . NAG D 2 .   ? 176.310 13.089 146.492 1.00 43.60  ? 603  NAG A C3  1 
HETATM 4240 C C4  . NAG D 2 .   ? 175.423 13.281 145.254 1.00 50.42  ? 603  NAG A C4  1 
HETATM 4241 C C5  . NAG D 2 .   ? 174.952 14.733 145.348 1.00 51.60  ? 603  NAG A C5  1 
HETATM 4242 C C6  . NAG D 2 .   ? 174.160 15.315 144.167 1.00 54.42  ? 603  NAG A C6  1 
HETATM 4243 C C7  . NAG D 2 .   ? 176.044 12.606 150.020 1.00 35.52  ? 603  NAG A C7  1 
HETATM 4244 C C8  . NAG D 2 .   ? 176.978 12.552 151.195 1.00 39.90  ? 603  NAG A C8  1 
HETATM 4245 N N2  . NAG D 2 .   ? 176.395 13.268 148.905 1.00 34.84  ? 603  NAG A N2  1 
HETATM 4246 O O3  . NAG D 2 .   ? 176.883 11.833 146.630 1.00 44.84  ? 603  NAG A O3  1 
HETATM 4247 O O4  . NAG D 2 .   ? 176.234 13.098 144.125 1.00 66.31  ? 603  NAG A O4  1 
HETATM 4248 O O5  . NAG D 2 .   ? 174.123 14.763 146.496 1.00 40.12  ? 603  NAG A O5  1 
HETATM 4249 O O6  . NAG D 2 .   ? 172.895 14.688 144.066 1.00 52.27  ? 603  NAG A O6  1 
HETATM 4250 O O7  . NAG D 2 .   ? 174.975 12.065 150.120 1.00 37.19  ? 603  NAG A O7  1 
HETATM 4251 C C1  . NAG E 2 .   ? 175.824 12.030 143.236 1.00 78.95  ? 604  NAG A C1  1 
HETATM 4252 C C2  . NAG E 2 .   ? 176.145 12.386 141.772 1.00 85.85  ? 604  NAG A C2  1 
HETATM 4253 C C3  . NAG E 2 .   ? 175.509 11.331 140.878 1.00 96.78  ? 604  NAG A C3  1 
HETATM 4254 C C4  . NAG E 2 .   ? 176.243 10.026 141.145 1.00 96.58  ? 604  NAG A C4  1 
HETATM 4255 C C5  . NAG E 2 .   ? 176.191 9.713  142.664 1.00 90.00  ? 604  NAG A C5  1 
HETATM 4256 C C6  . NAG E 2 .   ? 177.118 8.564  143.055 1.00 84.60  ? 604  NAG A C6  1 
HETATM 4257 C C7  . NAG E 2 .   ? 176.762 14.684 141.288 1.00 72.00  ? 604  NAG A C7  1 
HETATM 4258 C C8  . NAG E 2 .   ? 176.395 16.045 140.735 1.00 67.97  ? 604  NAG A C8  1 
HETATM 4259 N N2  . NAG E 2 .   ? 175.825 13.730 141.266 1.00 74.38  ? 604  NAG A N2  1 
HETATM 4260 O O3  . NAG E 2 .   ? 175.571 11.687 139.512 1.00 104.60 ? 604  NAG A O3  1 
HETATM 4261 O O4  . NAG E 2 .   ? 175.603 9.042  140.341 1.00 108.00 ? 604  NAG A O4  1 
HETATM 4262 O O5  . NAG E 2 .   ? 176.502 10.813 143.523 1.00 80.14  ? 604  NAG A O5  1 
HETATM 4263 O O6  . NAG E 2 .   ? 176.386 7.810  143.982 1.00 74.82  ? 604  NAG A O6  1 
HETATM 4264 O O7  . NAG E 2 .   ? 177.890 14.456 141.766 1.00 60.65  ? 604  NAG A O7  1 
HETATM 4265 C C1  . BMA F 4 .   ? 176.479 8.418  139.363 1.00 121.58 ? 605  BMA A C1  1 
HETATM 4266 C C2  . BMA F 4 .   ? 175.918 7.011  139.093 1.00 123.38 ? 605  BMA A C2  1 
HETATM 4267 C C3  . BMA F 4 .   ? 176.725 6.328  137.967 1.00 128.76 ? 605  BMA A C3  1 
HETATM 4268 C C4  . BMA F 4 .   ? 176.814 7.220  136.714 1.00 125.98 ? 605  BMA A C4  1 
HETATM 4269 C C5  . BMA F 4 .   ? 177.497 8.542  137.130 1.00 118.40 ? 605  BMA A C5  1 
HETATM 4270 C C6  . BMA F 4 .   ? 177.793 9.471  135.936 1.00 103.34 ? 605  BMA A C6  1 
HETATM 4271 O O2  . BMA F 4 .   ? 174.494 7.048  138.839 1.00 103.48 ? 605  BMA A O2  1 
HETATM 4272 O O3  . BMA F 4 .   ? 176.207 5.010  137.675 1.00 126.85 ? 605  BMA A O3  1 
HETATM 4273 O O4  . BMA F 4 .   ? 177.493 6.550  135.625 1.00 114.65 ? 605  BMA A O4  1 
HETATM 4274 O O5  . BMA F 4 .   ? 176.676 9.178  138.142 1.00 125.17 ? 605  BMA A O5  1 
HETATM 4275 O O6  . BMA F 4 .   ? 177.067 10.706 135.997 1.00 91.91  ? 605  BMA A O6  1 
HETATM 4276 C C1  . MAN G 5 .   ? 177.236 3.998  137.898 1.00 121.76 ? 606  MAN A C1  1 
HETATM 4277 C C2  . MAN G 5 .   ? 176.767 2.676  137.283 1.00 111.29 ? 606  MAN A C2  1 
HETATM 4278 C C3  . MAN G 5 .   ? 175.530 2.224  138.088 1.00 106.01 ? 606  MAN A C3  1 
HETATM 4279 C C4  . MAN G 5 .   ? 175.780 2.207  139.608 1.00 108.76 ? 606  MAN A C4  1 
HETATM 4280 C C5  . MAN G 5 .   ? 176.474 3.480  140.104 1.00 108.82 ? 606  MAN A C5  1 
HETATM 4281 C C6  . MAN G 5 .   ? 176.917 3.365  141.564 1.00 103.09 ? 606  MAN A C6  1 
HETATM 4282 O O2  . MAN G 5 .   ? 177.851 1.743  137.188 1.00 81.36  ? 606  MAN A O2  1 
HETATM 4283 O O3  . MAN G 5 .   ? 175.044 0.977  137.644 1.00 102.71 ? 606  MAN A O3  1 
HETATM 4284 O O4  . MAN G 5 .   ? 174.556 2.083  140.303 1.00 94.93  ? 606  MAN A O4  1 
HETATM 4285 O O5  . MAN G 5 .   ? 177.582 3.795  139.271 1.00 119.72 ? 606  MAN A O5  1 
HETATM 4286 O O6  . MAN G 5 .   ? 176.289 4.376  142.323 1.00 87.52  ? 606  MAN A O6  1 
HETATM 4287 C C1  . NAG H 2 .   ? 192.859 38.701 182.352 1.00 60.52  ? 607  NAG A C1  1 
HETATM 4288 C C2  . NAG H 2 .   ? 191.581 39.349 182.788 1.00 55.71  ? 607  NAG A C2  1 
HETATM 4289 C C3  . NAG H 2 .   ? 191.847 40.544 183.695 1.00 69.29  ? 607  NAG A C3  1 
HETATM 4290 C C4  . NAG H 2 .   ? 192.832 40.200 184.834 1.00 77.39  ? 607  NAG A C4  1 
HETATM 4291 C C5  . NAG H 2 .   ? 194.097 39.545 184.221 1.00 75.53  ? 607  NAG A C5  1 
HETATM 4292 C C6  . NAG H 2 .   ? 195.243 39.147 185.180 1.00 74.71  ? 607  NAG A C6  1 
HETATM 4293 C C7  . NAG H 2 .   ? 189.736 39.726 181.301 1.00 58.98  ? 607  NAG A C7  1 
HETATM 4294 C C8  . NAG H 2 .   ? 189.201 40.424 180.074 1.00 61.02  ? 607  NAG A C8  1 
HETATM 4295 N N2  . NAG H 2 .   ? 190.992 39.923 181.636 1.00 53.69  ? 607  NAG A N2  1 
HETATM 4296 O O3  . NAG H 2 .   ? 190.615 41.063 184.169 1.00 62.39  ? 607  NAG A O3  1 
HETATM 4297 O O4  . NAG H 2 .   ? 193.112 41.361 185.631 1.00 86.89  ? 607  NAG A O4  1 
HETATM 4298 O O5  . NAG H 2 .   ? 193.663 38.414 183.487 1.00 69.00  ? 607  NAG A O5  1 
HETATM 4299 O O6  . NAG H 2 .   ? 194.783 38.379 186.279 1.00 72.75  ? 607  NAG A O6  1 
HETATM 4300 O O7  . NAG H 2 .   ? 189.023 38.981 181.949 1.00 56.05  ? 607  NAG A O7  1 
HETATM 4301 C C1  . NAG I 2 .   ? 192.513 41.328 186.961 1.00 80.55  ? 608  NAG A C1  1 
HETATM 4302 C C2  . NAG I 2 .   ? 193.405 42.113 187.947 1.00 83.32  ? 608  NAG A C2  1 
HETATM 4303 C C3  . NAG I 2 .   ? 192.681 42.476 189.255 1.00 81.14  ? 608  NAG A C3  1 
HETATM 4304 C C4  . NAG I 2 .   ? 191.253 42.994 189.068 1.00 77.47  ? 608  NAG A C4  1 
HETATM 4305 C C5  . NAG I 2 .   ? 190.453 42.193 188.014 1.00 73.99  ? 608  NAG A C5  1 
HETATM 4306 C C6  . NAG I 2 .   ? 189.360 43.067 187.427 1.00 74.72  ? 608  NAG A C6  1 
HETATM 4307 C C7  . NAG I 2 .   ? 195.848 41.661 187.816 1.00 81.64  ? 608  NAG A C7  1 
HETATM 4308 C C8  . NAG I 2 .   ? 197.005 40.787 188.256 1.00 80.03  ? 608  NAG A C8  1 
HETATM 4309 N N2  . NAG I 2 .   ? 194.627 41.360 188.288 1.00 82.62  ? 608  NAG A N2  1 
HETATM 4310 O O3  . NAG I 2 .   ? 193.436 43.476 189.908 1.00 75.56  ? 608  NAG A O3  1 
HETATM 4311 O O4  . NAG I 2 .   ? 190.608 42.984 190.349 1.00 70.90  ? 608  NAG A O4  1 
HETATM 4312 O O5  . NAG I 2 .   ? 191.184 41.806 186.872 1.00 70.52  ? 608  NAG A O5  1 
HETATM 4313 O O6  . NAG I 2 .   ? 188.262 42.934 188.278 1.00 73.16  ? 608  NAG A O6  1 
HETATM 4314 O O7  . NAG I 2 .   ? 196.021 42.606 187.037 1.00 75.87  ? 608  NAG A O7  1 
HETATM 4315 C C1  . BMA J 4 .   ? 190.355 44.317 190.910 1.00 71.91  ? 609  BMA A C1  1 
HETATM 4316 C C2  . BMA J 4 .   ? 189.264 44.175 191.993 1.00 67.59  ? 609  BMA A C2  1 
HETATM 4317 C C3  . BMA J 4 .   ? 189.062 45.521 192.720 1.00 68.30  ? 609  BMA A C3  1 
HETATM 4318 C C4  . BMA J 4 .   ? 190.343 46.264 193.184 1.00 71.88  ? 609  BMA A C4  1 
HETATM 4319 C C5  . BMA J 4 .   ? 191.420 46.298 192.061 1.00 72.47  ? 609  BMA A C5  1 
HETATM 4320 C C6  . BMA J 4 .   ? 192.815 46.829 192.524 1.00 69.30  ? 609  BMA A C6  1 
HETATM 4321 O O2  . BMA J 4 .   ? 189.572 43.116 192.925 1.00 54.17  ? 609  BMA A O2  1 
HETATM 4322 O O3  . BMA J 4 .   ? 188.204 45.275 193.851 1.00 69.34  ? 609  BMA A O3  1 
HETATM 4323 O O4  . BMA J 4 .   ? 189.982 47.602 193.670 1.00 73.81  ? 609  BMA A O4  1 
HETATM 4324 O O5  . BMA J 4 .   ? 191.544 44.996 191.426 1.00 69.94  ? 609  BMA A O5  1 
HETATM 4325 O O6  . BMA J 4 .   ? 193.614 45.927 193.349 1.00 67.07  ? 609  BMA A O6  1 
HETATM 4326 C C1  . MAN K 5 .   ? 186.846 45.761 193.623 1.00 60.58  ? 610  MAN A C1  1 
HETATM 4327 C C2  . MAN K 5 .   ? 186.239 46.076 194.997 1.00 56.25  ? 610  MAN A C2  1 
HETATM 4328 C C3  . MAN K 5 .   ? 185.968 44.853 195.877 1.00 50.86  ? 610  MAN A C3  1 
HETATM 4329 C C4  . MAN K 5 .   ? 185.223 43.785 195.011 1.00 49.29  ? 610  MAN A C4  1 
HETATM 4330 C C5  . MAN K 5 .   ? 185.993 43.583 193.679 1.00 56.78  ? 610  MAN A C5  1 
HETATM 4331 C C6  . MAN K 5 .   ? 185.495 42.441 192.786 1.00 64.72  ? 610  MAN A C6  1 
HETATM 4332 O O2  . MAN K 5 .   ? 184.940 46.550 194.759 1.00 47.94  ? 610  MAN A O2  1 
HETATM 4333 O O3  . MAN K 5 .   ? 185.190 45.362 196.955 1.00 58.64  ? 610  MAN A O3  1 
HETATM 4334 O O4  . MAN K 5 .   ? 185.019 42.529 195.636 1.00 46.13  ? 610  MAN A O4  1 
HETATM 4335 O O5  . MAN K 5 .   ? 186.007 44.818 192.936 1.00 53.40  ? 610  MAN A O5  1 
HETATM 4336 O O6  . MAN K 5 .   ? 184.757 42.941 191.703 1.00 61.63  ? 610  MAN A O6  1 
HETATM 4337 O OAC . DZ7 L 6 .   ? 167.247 26.800 183.886 1.00 46.12  ? 611  DZ7 A OAC 1 
HETATM 4338 C CAU . DZ7 L 6 .   ? 167.189 28.030 184.032 1.00 36.06  ? 611  DZ7 A CAU 1 
HETATM 4339 C CAZ . DZ7 L 6 .   ? 166.198 28.738 184.674 1.00 35.41  ? 611  DZ7 A CAZ 1 
HETATM 4340 C CAK . DZ7 L 6 .   ? 165.108 28.245 185.268 1.00 37.08  ? 611  DZ7 A CAK 1 
HETATM 4341 C CAY . DZ7 L 6 .   ? 164.181 29.081 185.878 1.00 40.27  ? 611  DZ7 A CAY 1 
HETATM 4342 O OAS . DZ7 L 6 .   ? 163.010 28.720 186.523 1.00 51.38  ? 611  DZ7 A OAS 1 
HETATM 4343 C CAB . DZ7 L 6 .   ? 162.579 27.342 186.388 1.00 55.01  ? 611  DZ7 A CAB 1 
HETATM 4344 C CAX . DZ7 L 6 .   ? 164.466 30.412 185.873 1.00 33.31  ? 611  DZ7 A CAX 1 
HETATM 4345 O OAR . DZ7 L 6 .   ? 163.477 31.083 186.478 1.00 31.97  ? 611  DZ7 A OAR 1 
HETATM 4346 C CAA . DZ7 L 6 .   ? 163.651 32.504 186.519 1.00 35.63  ? 611  DZ7 A CAA 1 
HETATM 4347 C CAJ . DZ7 L 6 .   ? 165.640 30.910 185.217 1.00 30.79  ? 611  DZ7 A CAJ 1 
HETATM 4348 C CAW . DZ7 L 6 .   ? 166.499 30.071 184.598 1.00 32.97  ? 611  DZ7 A CAW 1 
HETATM 4349 C CAP . DZ7 L 6 .   ? 167.709 30.191 183.936 1.00 32.15  ? 611  DZ7 A CAP 1 
HETATM 4350 C CAT . DZ7 L 6 .   ? 168.124 28.892 183.593 1.00 35.89  ? 611  DZ7 A CAT 1 
HETATM 4351 C CAD . DZ7 L 6 .   ? 169.280 28.548 182.943 1.00 40.73  ? 611  DZ7 A CAD 1 
HETATM 4352 C CBA . DZ7 L 6 .   ? 170.485 29.300 182.329 1.00 44.77  ? 611  DZ7 A CBA 1 
HETATM 4353 C CAM . DZ7 L 6 .   ? 170.570 28.819 180.856 1.00 46.01  ? 611  DZ7 A CAM 1 
HETATM 4354 C CAO . DZ7 L 6 .   ? 171.865 29.216 180.270 1.00 45.89  ? 611  DZ7 A CAO 1 
HETATM 4355 C CAL . DZ7 L 6 .   ? 170.494 30.776 182.407 1.00 44.16  ? 611  DZ7 A CAL 1 
HETATM 4356 C CAN . DZ7 L 6 .   ? 171.823 31.185 181.731 1.00 44.66  ? 611  DZ7 A CAN 1 
HETATM 4357 N NBB . DZ7 L 6 .   ? 171.924 30.702 180.310 1.00 44.69  ? 611  DZ7 A NBB 1 
HETATM 4358 C CAQ . DZ7 L 6 .   ? 173.111 31.285 179.582 1.00 45.56  ? 611  DZ7 A CAQ 1 
HETATM 4359 C CAV . DZ7 L 6 .   ? 173.109 30.959 178.169 1.00 38.21  ? 611  DZ7 A CAV 1 
HETATM 4360 C CAH . DZ7 L 6 .   ? 172.273 31.705 177.302 1.00 35.87  ? 611  DZ7 A CAH 1 
HETATM 4361 C CAF . DZ7 L 6 .   ? 172.192 31.435 175.926 1.00 36.94  ? 611  DZ7 A CAF 1 
HETATM 4362 C CAE . DZ7 L 6 .   ? 172.951 30.376 175.423 1.00 34.93  ? 611  DZ7 A CAE 1 
HETATM 4363 C CAG . DZ7 L 6 .   ? 173.806 29.656 176.280 1.00 35.80  ? 611  DZ7 A CAG 1 
HETATM 4364 C CAI . DZ7 L 6 .   ? 173.890 29.931 177.646 1.00 34.77  ? 611  DZ7 A CAI 1 
HETATM 4365 O O   . HOH M 7 .   ? 169.050 28.095 175.146 1.00 32.18  ? 701  HOH A O   1 
HETATM 4366 O O   . HOH M 7 .   ? 154.860 43.165 187.303 1.00 35.84  ? 702  HOH A O   1 
HETATM 4367 O O   . HOH M 7 .   ? 167.932 35.407 190.753 1.00 39.75  ? 703  HOH A O   1 
HETATM 4368 O O   . HOH M 7 .   ? 177.591 0.870  135.052 1.00 60.63  ? 704  HOH A O   1 
HETATM 4369 O O   . HOH M 7 .   ? 193.937 36.609 187.631 1.00 55.78  ? 705  HOH A O   1 
HETATM 4370 O O   . HOH M 7 .   ? 193.162 35.497 174.567 1.00 30.78  ? 706  HOH A O   1 
HETATM 4371 O O   . HOH M 7 .   ? 193.799 31.228 180.229 1.00 42.13  ? 707  HOH A O   1 
HETATM 4372 O O   . HOH M 7 .   ? 166.348 24.686 184.810 1.00 38.08  ? 708  HOH A O   1 
HETATM 4373 O O   . HOH M 7 .   ? 191.210 23.827 179.951 1.00 52.25  ? 709  HOH A O   1 
HETATM 4374 O O   . HOH M 7 .   ? 150.507 4.549  172.087 1.00 58.57  ? 710  HOH A O   1 
HETATM 4375 O O   . HOH M 7 .   ? 181.506 11.464 188.573 1.00 30.89  ? 711  HOH A O   1 
HETATM 4376 O O   . HOH M 7 .   ? 146.066 30.426 188.575 1.00 50.90  ? 712  HOH A O   1 
HETATM 4377 O O   . HOH M 7 .   ? 171.660 34.750 173.400 1.00 17.98  ? 713  HOH A O   1 
HETATM 4378 O O   . HOH M 7 .   ? 169.462 42.804 166.454 1.00 29.58  ? 714  HOH A O   1 
HETATM 4379 O O   . HOH M 7 .   ? 140.360 33.082 168.126 1.00 38.76  ? 715  HOH A O   1 
HETATM 4380 O O   . HOH M 7 .   ? 195.274 36.607 167.350 1.00 41.77  ? 716  HOH A O   1 
HETATM 4381 O O   . HOH M 7 .   ? 156.036 43.786 162.587 1.00 28.96  ? 717  HOH A O   1 
HETATM 4382 O O   . HOH M 7 .   ? 155.092 40.659 170.058 1.00 20.19  ? 718  HOH A O   1 
HETATM 4383 O O   . HOH M 7 .   ? 190.329 18.780 157.810 1.00 42.15  ? 719  HOH A O   1 
HETATM 4384 O O   . HOH M 7 .   ? 195.561 35.799 176.381 1.00 46.13  ? 720  HOH A O   1 
HETATM 4385 O O   . HOH M 7 .   ? 191.429 18.900 160.585 1.00 41.20  ? 721  HOH A O   1 
HETATM 4386 O O   . HOH M 7 .   ? 192.618 34.414 157.887 1.00 49.15  ? 722  HOH A O   1 
HETATM 4387 O O   . HOH M 7 .   ? 173.248 40.076 187.203 1.00 40.94  ? 723  HOH A O   1 
HETATM 4388 O O   . HOH M 7 .   ? 180.136 16.956 152.464 1.00 38.54  ? 724  HOH A O   1 
HETATM 4389 O O   . HOH M 7 .   ? 167.503 36.241 188.150 1.00 24.57  ? 725  HOH A O   1 
HETATM 4390 O O   . HOH M 7 .   ? 161.794 42.960 155.380 1.00 33.62  ? 726  HOH A O   1 
HETATM 4391 O O   . HOH M 7 .   ? 163.592 34.911 188.897 1.00 32.92  ? 727  HOH A O   1 
HETATM 4392 O O   . HOH M 7 .   ? 165.498 12.527 172.916 1.00 35.96  ? 728  HOH A O   1 
HETATM 4393 O O   . HOH M 7 .   ? 174.900 20.128 197.615 1.00 25.59  ? 729  HOH A O   1 
HETATM 4394 O O   . HOH M 7 .   ? 176.324 25.044 173.683 1.00 23.47  ? 730  HOH A O   1 
HETATM 4395 O O   . HOH M 7 .   ? 188.456 28.211 185.043 1.00 39.34  ? 731  HOH A O   1 
HETATM 4396 O O   . HOH M 7 .   ? 160.020 52.960 156.614 1.00 39.36  ? 732  HOH A O   1 
HETATM 4397 O O   . HOH M 7 .   ? 192.761 45.698 166.026 1.00 47.19  ? 733  HOH A O   1 
HETATM 4398 O O   . HOH M 7 .   ? 185.694 31.328 179.042 1.00 24.19  ? 734  HOH A O   1 
HETATM 4399 O O   . HOH M 7 .   ? 146.031 30.785 164.736 1.00 37.76  ? 735  HOH A O   1 
HETATM 4400 O O   . HOH M 7 .   ? 166.803 55.202 151.172 1.00 32.87  ? 736  HOH A O   1 
HETATM 4401 O O   . HOH M 7 .   ? 148.258 29.128 165.084 1.00 45.01  ? 737  HOH A O   1 
HETATM 4402 O O   . HOH M 7 .   ? 183.464 46.504 153.271 1.00 26.88  ? 738  HOH A O   1 
HETATM 4403 O O   . HOH M 7 .   ? 182.488 8.762  156.820 1.00 32.04  ? 739  HOH A O   1 
HETATM 4404 O O   . HOH M 7 .   ? 180.194 0.714  136.782 1.00 63.60  ? 740  HOH A O   1 
HETATM 4405 O O   . HOH M 7 .   ? 155.369 13.717 157.478 1.00 54.46  ? 741  HOH A O   1 
HETATM 4406 O O   . HOH M 7 .   ? 150.632 43.564 186.348 1.00 45.17  ? 742  HOH A O   1 
HETATM 4407 O O   . HOH M 7 .   ? 156.846 48.630 174.583 1.00 34.68  ? 743  HOH A O   1 
HETATM 4408 O O   . HOH M 7 .   ? 172.494 35.008 182.230 1.00 28.38  ? 744  HOH A O   1 
HETATM 4409 O O   . HOH M 7 .   ? 176.621 28.887 153.008 1.00 31.52  ? 745  HOH A O   1 
HETATM 4410 O O   . HOH M 7 .   ? 185.553 21.763 151.491 1.00 30.52  ? 746  HOH A O   1 
HETATM 4411 O O   . HOH M 7 .   ? 162.331 47.049 162.981 1.00 25.44  ? 747  HOH A O   1 
HETATM 4412 O O   . HOH M 7 .   ? 158.685 51.770 159.503 1.00 46.64  ? 748  HOH A O   1 
HETATM 4413 O O   . HOH M 7 .   ? 176.079 39.417 166.540 1.00 27.04  ? 749  HOH A O   1 
HETATM 4414 O O   . HOH M 7 .   ? 178.692 17.906 187.024 1.00 30.62  ? 750  HOH A O   1 
HETATM 4415 O O   . HOH M 7 .   ? 174.796 7.729  166.252 1.00 24.86  ? 751  HOH A O   1 
HETATM 4416 O O   . HOH M 7 .   ? 183.772 4.421  156.472 1.00 49.17  ? 752  HOH A O   1 
HETATM 4417 O O   . HOH M 7 .   ? 177.088 40.862 144.860 1.00 38.90  ? 753  HOH A O   1 
HETATM 4418 O O   . HOH M 7 .   ? 183.556 36.765 165.159 1.00 24.68  ? 754  HOH A O   1 
HETATM 4419 O O   . HOH M 7 .   ? 147.620 27.616 170.980 1.00 24.85  ? 755  HOH A O   1 
HETATM 4420 O O   . HOH M 7 .   ? 180.302 7.811  159.679 1.00 19.50  ? 756  HOH A O   1 
HETATM 4421 O O   . HOH M 7 .   ? 163.951 23.995 149.530 1.00 40.17  ? 757  HOH A O   1 
HETATM 4422 O O   . HOH M 7 .   ? 177.534 16.190 182.388 1.00 33.85  ? 758  HOH A O   1 
HETATM 4423 O O   . HOH M 7 .   ? 190.838 43.930 156.480 1.00 46.76  ? 759  HOH A O   1 
HETATM 4424 O O   . HOH M 7 .   ? 151.712 35.027 168.452 1.00 22.94  ? 760  HOH A O   1 
HETATM 4425 O O   . HOH M 7 .   ? 183.687 14.357 153.869 1.00 36.37  ? 761  HOH A O   1 
HETATM 4426 O O   . HOH M 7 .   ? 190.409 30.433 161.403 1.00 28.84  ? 762  HOH A O   1 
HETATM 4427 O O   . HOH M 7 .   ? 149.762 20.772 168.515 1.00 22.44  ? 763  HOH A O   1 
HETATM 4428 O O   . HOH M 7 .   ? 163.181 42.147 182.375 1.00 24.12  ? 764  HOH A O   1 
HETATM 4429 O O   . HOH M 7 .   ? 186.313 7.604  157.833 1.00 54.24  ? 765  HOH A O   1 
HETATM 4430 O O   . HOH M 7 .   ? 178.182 14.194 177.845 1.00 29.35  ? 766  HOH A O   1 
HETATM 4431 O O   . HOH M 7 .   ? 150.070 30.638 187.503 1.00 36.34  ? 767  HOH A O   1 
HETATM 4432 O O   . HOH M 7 .   ? 154.389 29.934 169.881 1.00 20.61  ? 768  HOH A O   1 
HETATM 4433 O O   . HOH M 7 .   ? 169.814 34.123 178.198 1.00 26.19  ? 769  HOH A O   1 
HETATM 4434 O O   . HOH M 7 .   ? 183.836 17.621 182.162 1.00 35.58  ? 770  HOH A O   1 
HETATM 4435 O O   . HOH M 7 .   ? 169.300 33.049 150.296 1.00 29.45  ? 771  HOH A O   1 
HETATM 4436 O O   . HOH M 7 .   ? 181.024 31.039 174.690 1.00 22.23  ? 772  HOH A O   1 
HETATM 4437 O O   . HOH M 7 .   ? 171.139 36.198 166.346 1.00 18.20  ? 773  HOH A O   1 
HETATM 4438 O O   . HOH M 7 .   ? 147.988 1.012  179.959 1.00 48.50  ? 774  HOH A O   1 
HETATM 4439 O O   . HOH M 7 .   ? 164.895 18.603 182.314 1.00 20.30  ? 775  HOH A O   1 
HETATM 4440 O O   . HOH M 7 .   ? 177.721 38.154 191.730 1.00 42.87  ? 776  HOH A O   1 
HETATM 4441 O O   . HOH M 7 .   ? 161.194 45.423 180.754 1.00 33.64  ? 777  HOH A O   1 
HETATM 4442 O O   . HOH M 7 .   ? 159.029 31.990 177.711 1.00 23.58  ? 778  HOH A O   1 
HETATM 4443 O O   . HOH M 7 .   ? 164.436 9.819  158.689 1.00 28.67  ? 779  HOH A O   1 
HETATM 4444 O O   . HOH M 7 .   ? 163.385 24.725 189.418 1.00 30.81  ? 780  HOH A O   1 
HETATM 4445 O O   . HOH M 7 .   ? 162.082 37.486 147.134 1.00 41.62  ? 781  HOH A O   1 
HETATM 4446 O O   . HOH M 7 .   ? 153.694 11.750 165.251 1.00 43.06  ? 782  HOH A O   1 
HETATM 4447 O O   . HOH M 7 .   ? 161.553 52.081 164.778 1.00 38.59  ? 783  HOH A O   1 
HETATM 4448 O O   . HOH M 7 .   ? 158.883 43.024 170.408 1.00 27.50  ? 784  HOH A O   1 
HETATM 4449 O O   . HOH M 7 .   ? 167.563 43.528 168.229 1.00 25.59  ? 785  HOH A O   1 
HETATM 4450 O O   . HOH M 7 .   ? 194.491 25.381 176.698 1.00 37.05  ? 786  HOH A O   1 
HETATM 4451 O O   . HOH M 7 .   ? 153.098 47.127 172.812 1.00 29.48  ? 787  HOH A O   1 
HETATM 4452 O O   . HOH M 7 .   ? 156.637 18.694 169.565 1.00 22.79  ? 788  HOH A O   1 
HETATM 4453 O O   . HOH M 7 .   ? 159.731 24.610 177.275 1.00 18.94  ? 789  HOH A O   1 
HETATM 4454 O O   . HOH M 7 .   ? 170.940 43.364 181.150 1.00 32.02  ? 790  HOH A O   1 
HETATM 4455 O O   . HOH M 7 .   ? 163.263 41.113 151.932 1.00 30.22  ? 791  HOH A O   1 
HETATM 4456 O O   . HOH M 7 .   ? 185.001 2.483  159.508 1.00 53.08  ? 792  HOH A O   1 
HETATM 4457 O O   . HOH M 7 .   ? 172.510 17.511 198.405 1.00 39.54  ? 793  HOH A O   1 
HETATM 4458 O O   . HOH M 7 .   ? 186.956 30.622 154.737 1.00 46.16  ? 794  HOH A O   1 
HETATM 4459 O O   . HOH M 7 .   ? 183.900 46.024 167.631 1.00 40.38  ? 795  HOH A O   1 
HETATM 4460 O O   . HOH M 7 .   ? 177.913 22.665 170.975 1.00 20.82  ? 796  HOH A O   1 
HETATM 4461 O O   . HOH M 7 .   ? 181.871 1.589  191.640 1.00 35.28  ? 797  HOH A O   1 
HETATM 4462 O O   . HOH M 7 .   ? 165.593 41.037 185.988 1.00 45.64  ? 798  HOH A O   1 
HETATM 4463 O O   . HOH M 7 .   ? 148.483 18.800 174.717 1.00 51.32  ? 799  HOH A O   1 
HETATM 4464 O O   . HOH M 7 .   ? 181.231 47.309 152.524 1.00 29.34  ? 800  HOH A O   1 
HETATM 4465 O O   . HOH M 7 .   ? 166.960 40.463 171.587 1.00 26.33  ? 801  HOH A O   1 
HETATM 4466 O O   . HOH M 7 .   ? 183.653 40.633 171.375 1.00 42.31  ? 802  HOH A O   1 
HETATM 4467 O O   . HOH M 7 .   ? 160.657 11.443 177.771 1.00 43.44  ? 803  HOH A O   1 
HETATM 4468 O O   . HOH M 7 .   ? 160.608 30.548 176.315 1.00 21.46  ? 804  HOH A O   1 
HETATM 4469 O O   . HOH M 7 .   ? 157.535 37.004 178.090 1.00 26.31  ? 805  HOH A O   1 
HETATM 4470 O O   . HOH M 7 .   ? 192.688 36.125 162.126 1.00 34.00  ? 806  HOH A O   1 
HETATM 4471 O O   . HOH M 7 .   ? 168.888 33.956 153.661 1.00 33.21  ? 807  HOH A O   1 
HETATM 4472 O O   . HOH M 7 .   ? 168.729 37.763 192.438 1.00 37.90  ? 808  HOH A O   1 
HETATM 4473 O O   . HOH M 7 .   ? 160.390 20.072 170.167 1.00 22.25  ? 809  HOH A O   1 
HETATM 4474 O O   . HOH M 7 .   ? 162.056 24.904 184.000 1.00 37.18  ? 810  HOH A O   1 
HETATM 4475 O O   . HOH M 7 .   ? 175.158 23.562 197.044 1.00 39.69  ? 811  HOH A O   1 
HETATM 4476 O O   . HOH M 7 .   ? 157.868 47.315 180.834 1.00 42.62  ? 812  HOH A O   1 
HETATM 4477 O O   . HOH M 7 .   ? 194.719 26.328 164.302 1.00 30.03  ? 813  HOH A O   1 
HETATM 4478 O O   . HOH M 7 .   ? 139.578 30.332 164.234 1.00 54.89  ? 814  HOH A O   1 
HETATM 4479 O O   . HOH M 7 .   ? 188.685 26.229 183.468 1.00 36.05  ? 815  HOH A O   1 
HETATM 4480 O O   . HOH M 7 .   ? 170.852 39.054 147.846 1.00 22.94  ? 816  HOH A O   1 
HETATM 4481 O O   . HOH M 7 .   ? 161.411 46.542 165.399 1.00 19.76  ? 817  HOH A O   1 
HETATM 4482 O O   . HOH M 7 .   ? 173.558 37.384 187.098 1.00 30.00  ? 818  HOH A O   1 
HETATM 4483 O O   . HOH M 7 .   ? 137.960 32.752 172.037 1.00 52.99  ? 819  HOH A O   1 
HETATM 4484 O O   . HOH M 7 .   ? 175.599 23.423 181.112 1.00 26.54  ? 820  HOH A O   1 
HETATM 4485 O O   . HOH M 7 .   ? 170.187 38.620 176.054 1.00 22.84  ? 821  HOH A O   1 
HETATM 4486 O O   . HOH M 7 .   ? 160.967 28.319 151.846 1.00 34.43  ? 822  HOH A O   1 
HETATM 4487 O O   . HOH M 7 .   ? 152.915 41.873 186.266 1.00 33.84  ? 823  HOH A O   1 
HETATM 4488 O O   . HOH M 7 .   ? 168.263 30.027 190.620 1.00 34.70  ? 824  HOH A O   1 
HETATM 4489 O O   . HOH M 7 .   ? 159.583 34.564 153.675 1.00 42.27  ? 825  HOH A O   1 
HETATM 4490 O O   . HOH M 7 .   ? 177.796 9.621  187.924 1.00 35.82  ? 826  HOH A O   1 
HETATM 4491 O O   . HOH M 7 .   ? 175.882 41.128 178.065 1.00 23.90  ? 827  HOH A O   1 
HETATM 4492 O O   . HOH M 7 .   ? 161.478 47.575 147.462 1.00 54.41  ? 828  HOH A O   1 
HETATM 4493 O O   . HOH M 7 .   ? 180.977 13.379 161.702 1.00 20.97  ? 829  HOH A O   1 
HETATM 4494 O O   . HOH M 7 .   ? 183.140 32.335 149.809 1.00 38.12  ? 830  HOH A O   1 
HETATM 4495 O O   . HOH M 7 .   ? 178.900 14.403 148.720 1.00 41.48  ? 831  HOH A O   1 
HETATM 4496 O O   . HOH M 7 .   ? 153.855 28.861 173.247 1.00 21.71  ? 832  HOH A O   1 
HETATM 4497 O O   . HOH M 7 .   ? 157.746 31.752 152.946 1.00 43.70  ? 833  HOH A O   1 
HETATM 4498 O O   . HOH M 7 .   ? 173.159 22.396 149.476 1.00 35.38  ? 834  HOH A O   1 
HETATM 4499 O O   . HOH M 7 .   ? 183.773 4.864  169.091 1.00 41.26  ? 835  HOH A O   1 
HETATM 4500 O O   . HOH M 7 .   ? 190.529 11.391 160.402 1.00 51.63  ? 836  HOH A O   1 
HETATM 4501 O O   . HOH M 7 .   ? 151.130 30.514 174.687 1.00 25.85  ? 837  HOH A O   1 
HETATM 4502 O O   . HOH M 7 .   ? 175.684 14.062 179.147 1.00 26.21  ? 838  HOH A O   1 
HETATM 4503 O O   . HOH M 7 .   ? 178.743 38.747 175.839 1.00 27.87  ? 839  HOH A O   1 
HETATM 4504 O O   . HOH M 7 .   ? 176.086 11.828 155.713 1.00 25.99  ? 840  HOH A O   1 
HETATM 4505 O O   . HOH M 7 .   ? 160.659 39.690 173.317 1.00 21.23  ? 841  HOH A O   1 
HETATM 4506 O O   . HOH M 7 .   ? 173.222 31.158 171.707 1.00 23.57  ? 842  HOH A O   1 
HETATM 4507 O O   . HOH M 7 .   ? 169.748 14.334 149.964 1.00 32.49  ? 843  HOH A O   1 
HETATM 4508 O O   . HOH M 7 .   ? 169.404 19.048 170.950 1.00 34.76  ? 844  HOH A O   1 
HETATM 4509 O O   . HOH M 7 .   ? 168.267 30.496 149.038 1.00 31.82  ? 845  HOH A O   1 
HETATM 4510 O O   . HOH M 7 .   ? 156.164 42.843 170.810 1.00 26.10  ? 846  HOH A O   1 
HETATM 4511 O O   . HOH M 7 .   ? 157.581 21.253 175.880 1.00 22.59  ? 847  HOH A O   1 
HETATM 4512 O O   . HOH M 7 .   ? 144.139 24.155 176.211 1.00 40.31  ? 848  HOH A O   1 
HETATM 4513 O O   . HOH M 7 .   ? 168.585 18.414 192.986 1.00 35.10  ? 849  HOH A O   1 
HETATM 4514 O O   . HOH M 7 .   ? 169.385 31.389 179.077 1.00 35.45  ? 850  HOH A O   1 
HETATM 4515 O O   . HOH M 7 .   ? 185.927 21.070 185.085 1.00 28.92  ? 851  HOH A O   1 
HETATM 4516 O O   . HOH M 7 .   ? 159.936 24.892 150.371 1.00 24.04  ? 852  HOH A O   1 
HETATM 4517 O O   . HOH M 7 .   ? 161.810 29.656 146.562 1.00 29.17  ? 853  HOH A O   1 
HETATM 4518 O O   . HOH M 7 .   ? 167.255 6.732  162.822 1.00 49.82  ? 854  HOH A O   1 
HETATM 4519 O O   . HOH M 7 .   ? 182.051 31.153 189.900 1.00 27.01  ? 855  HOH A O   1 
HETATM 4520 O O   . HOH M 7 .   ? 182.752 29.441 191.816 1.00 25.27  ? 856  HOH A O   1 
HETATM 4521 O O   . HOH M 7 .   ? 159.784 33.288 150.207 1.00 33.23  ? 857  HOH A O   1 
HETATM 4522 O O   . HOH M 7 .   ? 149.408 37.922 163.013 1.00 38.70  ? 858  HOH A O   1 
HETATM 4523 O O   . HOH M 7 .   ? 172.043 12.896 149.244 1.00 27.98  ? 859  HOH A O   1 
HETATM 4524 O O   . HOH M 7 .   ? 161.725 17.340 192.899 1.00 40.28  ? 860  HOH A O   1 
HETATM 4525 O O   . HOH M 7 .   ? 143.919 25.844 170.552 1.00 40.94  ? 861  HOH A O   1 
HETATM 4526 O O   . HOH M 7 .   ? 151.764 31.709 163.244 1.00 32.73  ? 862  HOH A O   1 
HETATM 4527 O O   . HOH M 7 .   ? 189.920 23.923 160.360 1.00 36.69  ? 863  HOH A O   1 
HETATM 4528 O O   . HOH M 7 .   ? 185.771 35.742 176.520 1.00 46.33  ? 864  HOH A O   1 
HETATM 4529 O O   . HOH M 7 .   ? 132.886 38.729 178.846 1.00 57.97  ? 865  HOH A O   1 
HETATM 4530 O O   . HOH M 7 .   ? 191.599 30.348 157.688 1.00 40.68  ? 866  HOH A O   1 
HETATM 4531 O O   . HOH M 7 .   ? 147.477 21.276 177.862 1.00 35.79  ? 867  HOH A O   1 
HETATM 4532 O O   . HOH M 7 .   ? 172.753 14.108 155.679 1.00 22.35  ? 868  HOH A O   1 
HETATM 4533 O O   . HOH M 7 .   ? 170.492 15.101 203.477 1.00 55.28  ? 869  HOH A O   1 
HETATM 4534 O O   . HOH M 7 .   ? 160.917 7.732  167.608 1.00 67.56  ? 870  HOH A O   1 
HETATM 4535 O O   . HOH M 7 .   ? 192.897 31.322 161.211 1.00 34.16  ? 871  HOH A O   1 
HETATM 4536 O O   . HOH M 7 .   ? 188.883 20.425 188.053 1.00 52.26  ? 872  HOH A O   1 
HETATM 4537 O O   . HOH M 7 .   ? 155.221 19.322 189.133 1.00 39.46  ? 873  HOH A O   1 
HETATM 4538 O O   . HOH M 7 .   ? 168.463 37.624 179.468 1.00 37.95  ? 874  HOH A O   1 
HETATM 4539 O O   . HOH M 7 .   ? 155.792 8.183  175.776 1.00 46.02  ? 875  HOH A O   1 
HETATM 4540 O O   . HOH M 7 .   ? 163.025 13.319 169.860 1.00 27.99  ? 876  HOH A O   1 
HETATM 4541 O O   . HOH M 7 .   ? 171.700 30.180 150.302 1.00 26.30  ? 877  HOH A O   1 
HETATM 4542 O O   . HOH M 7 .   ? 158.057 35.852 158.245 1.00 26.01  ? 878  HOH A O   1 
HETATM 4543 O O   . HOH M 7 .   ? 151.057 46.242 172.992 1.00 25.85  ? 879  HOH A O   1 
HETATM 4544 O O   . HOH M 7 .   ? 141.530 36.542 167.928 1.00 46.25  ? 880  HOH A O   1 
HETATM 4545 O O   . HOH M 7 .   ? 170.961 1.843  178.199 1.00 38.77  ? 881  HOH A O   1 
HETATM 4546 O O   . HOH M 7 .   ? 165.348 52.319 165.252 1.00 49.98  ? 882  HOH A O   1 
HETATM 4547 O O   . HOH M 7 .   ? 190.751 15.353 169.898 1.00 35.99  ? 883  HOH A O   1 
HETATM 4548 O O   . HOH M 7 .   ? 152.066 49.325 165.677 1.00 39.06  ? 884  HOH A O   1 
HETATM 4549 O O   . HOH M 7 .   ? 149.986 20.463 180.777 1.00 40.12  ? 885  HOH A O   1 
HETATM 4550 O O   . HOH M 7 .   ? 171.486 35.141 176.046 1.00 20.73  ? 886  HOH A O   1 
HETATM 4551 O O   . HOH M 7 .   ? 170.704 50.866 174.167 1.00 52.16  ? 887  HOH A O   1 
HETATM 4552 O O   . HOH M 7 .   ? 183.732 37.722 146.320 1.00 41.14  ? 888  HOH A O   1 
HETATM 4553 O O   . HOH M 7 .   ? 162.168 8.771  169.859 1.00 56.94  ? 889  HOH A O   1 
HETATM 4554 O O   . HOH M 7 .   ? 175.294 49.920 147.137 1.00 43.99  ? 890  HOH A O   1 
HETATM 4555 O O   . HOH M 7 .   ? 144.817 27.721 181.549 1.00 35.16  ? 891  HOH A O   1 
HETATM 4556 O O   . HOH M 7 .   ? 181.748 45.143 165.735 1.00 31.97  ? 892  HOH A O   1 
HETATM 4557 O O   . HOH M 7 .   ? 177.006 49.715 169.052 1.00 37.76  ? 893  HOH A O   1 
HETATM 4558 O O   . HOH M 7 .   ? 157.642 22.854 177.993 1.00 20.64  ? 894  HOH A O   1 
HETATM 4559 O O   . HOH M 7 .   ? 159.287 48.388 174.891 1.00 29.83  ? 895  HOH A O   1 
HETATM 4560 O O   . HOH M 7 .   ? 176.259 47.262 146.326 1.00 52.27  ? 896  HOH A O   1 
HETATM 4561 O O   . HOH M 7 .   ? 175.314 16.866 180.501 1.00 29.05  ? 897  HOH A O   1 
HETATM 4562 O O   . HOH M 7 .   ? 148.850 18.398 161.428 1.00 52.11  ? 898  HOH A O   1 
HETATM 4563 O O   . HOH M 7 .   ? 153.113 28.390 175.745 1.00 28.04  ? 899  HOH A O   1 
HETATM 4564 O O   . HOH M 7 .   ? 171.157 7.460  160.035 1.00 48.77  ? 900  HOH A O   1 
HETATM 4565 O O   . HOH M 7 .   ? 178.209 25.477 148.125 1.00 32.11  ? 901  HOH A O   1 
HETATM 4566 O O   . HOH M 7 .   ? 168.617 46.422 179.179 1.00 36.51  ? 902  HOH A O   1 
HETATM 4567 O O   . HOH M 7 .   ? 165.269 19.692 149.951 1.00 21.59  ? 903  HOH A O   1 
HETATM 4568 O O   . HOH M 7 .   ? 164.845 12.922 175.497 1.00 32.34  ? 904  HOH A O   1 
HETATM 4569 O O   . HOH M 7 .   ? 150.701 41.251 161.308 1.00 46.11  ? 905  HOH A O   1 
HETATM 4570 O O   . HOH M 7 .   ? 174.321 7.404  169.132 1.00 31.22  ? 906  HOH A O   1 
HETATM 4571 O O   . HOH M 7 .   ? 166.182 23.789 148.757 1.00 42.85  ? 907  HOH A O   1 
HETATM 4572 O O   . HOH M 7 .   ? 182.983 38.760 187.076 1.00 34.39  ? 908  HOH A O   1 
HETATM 4573 O O   . HOH M 7 .   ? 160.143 31.061 180.638 1.00 37.55  ? 909  HOH A O   1 
HETATM 4574 O O   . HOH M 7 .   ? 137.471 35.683 182.689 1.00 40.43  ? 910  HOH A O   1 
HETATM 4575 O O   . HOH M 7 .   ? 155.596 26.597 156.369 1.00 29.48  ? 911  HOH A O   1 
HETATM 4576 O O   . HOH M 7 .   ? 176.134 38.376 145.168 1.00 42.88  ? 912  HOH A O   1 
HETATM 4577 O O   . HOH M 7 .   ? 181.172 35.462 192.063 1.00 41.01  ? 913  HOH A O   1 
HETATM 4578 O O   . HOH M 7 .   ? 182.807 23.082 197.901 1.00 38.39  ? 914  HOH A O   1 
HETATM 4579 O O   . HOH M 7 .   ? 168.947 41.634 170.067 1.00 22.29  ? 915  HOH A O   1 
HETATM 4580 O O   . HOH M 7 .   ? 156.828 14.993 167.243 1.00 28.45  ? 916  HOH A O   1 
HETATM 4581 O O   . HOH M 7 .   ? 173.974 8.368  190.969 1.00 45.67  ? 917  HOH A O   1 
HETATM 4582 O O   . HOH M 7 .   ? 184.724 25.869 177.106 1.00 32.07  ? 918  HOH A O   1 
HETATM 4583 O O   . HOH M 7 .   ? 149.258 50.133 167.830 1.00 49.50  ? 919  HOH A O   1 
HETATM 4584 O O   . HOH M 7 .   ? 163.062 10.255 191.938 1.00 51.23  ? 920  HOH A O   1 
HETATM 4585 O O   . HOH M 7 .   ? 167.249 7.677  167.643 1.00 33.79  ? 921  HOH A O   1 
HETATM 4586 O O   . HOH M 7 .   ? 177.242 4.939  175.134 1.00 39.87  ? 922  HOH A O   1 
HETATM 4587 O O   . HOH M 7 .   ? 180.500 11.830 198.782 1.00 47.28  ? 923  HOH A O   1 
HETATM 4588 O O   . HOH M 7 .   ? 177.877 41.005 176.195 1.00 23.45  ? 924  HOH A O   1 
HETATM 4589 O O   . HOH M 7 .   ? 156.914 22.324 183.229 1.00 21.54  ? 925  HOH A O   1 
HETATM 4590 O O   . HOH M 7 .   ? 177.801 50.525 146.980 1.00 34.48  ? 926  HOH A O   1 
HETATM 4591 O O   . HOH M 7 .   ? 171.873 37.018 194.486 1.00 23.23  ? 927  HOH A O   1 
HETATM 4592 O O   . HOH M 7 .   ? 183.529 22.873 191.540 1.00 22.82  ? 928  HOH A O   1 
HETATM 4593 O O   . HOH M 7 .   ? 174.952 21.517 147.661 1.00 39.06  ? 929  HOH A O   1 
HETATM 4594 O O   . HOH M 7 .   ? 162.272 49.952 162.534 1.00 28.64  ? 930  HOH A O   1 
HETATM 4595 O O   . HOH M 7 .   ? 154.801 29.002 157.693 1.00 41.27  ? 931  HOH A O   1 
HETATM 4596 O O   . HOH M 7 .   ? 167.199 49.782 167.781 1.00 38.21  ? 932  HOH A O   1 
HETATM 4597 O O   . HOH M 7 .   ? 189.255 20.535 178.934 1.00 30.08  ? 933  HOH A O   1 
HETATM 4598 O O   . HOH M 7 .   ? 166.425 48.323 179.221 1.00 31.84  ? 934  HOH A O   1 
HETATM 4599 O O   . HOH M 7 .   ? 145.802 25.812 183.394 1.00 44.49  ? 935  HOH A O   1 
HETATM 4600 O O   . HOH M 7 .   ? 171.363 15.871 146.434 1.00 53.87  ? 936  HOH A O   1 
HETATM 4601 O O   . HOH M 7 .   ? 173.535 11.716 154.697 1.00 33.20  ? 937  HOH A O   1 
HETATM 4602 O O   . HOH M 7 .   ? 179.241 19.902 198.399 1.00 30.94  ? 938  HOH A O   1 
HETATM 4603 O O   . HOH M 7 .   ? 182.225 12.154 196.780 1.00 45.58  ? 939  HOH A O   1 
HETATM 4604 O O   . HOH M 7 .   ? 193.185 12.262 159.055 1.00 56.50  ? 940  HOH A O   1 
HETATM 4605 O O   . HOH M 7 .   ? 171.696 26.771 195.492 1.00 42.82  ? 941  HOH A O   1 
HETATM 4606 O O   . HOH M 7 .   ? 154.049 42.437 164.325 1.00 41.11  ? 942  HOH A O   1 
HETATM 4607 O O   . HOH M 7 .   ? 183.414 33.947 178.442 1.00 50.06  ? 943  HOH A O   1 
HETATM 4608 O O   . HOH M 7 .   ? 185.532 25.606 191.037 1.00 31.21  ? 944  HOH A O   1 
HETATM 4609 O O   . HOH M 7 .   ? 187.674 36.168 178.658 1.00 44.64  ? 945  HOH A O   1 
HETATM 4610 O O   . HOH M 7 .   ? 163.830 43.824 150.855 1.00 30.25  ? 946  HOH A O   1 
HETATM 4611 O O   . HOH M 7 .   ? 183.204 54.712 160.257 1.00 42.28  ? 947  HOH A O   1 
HETATM 4612 O O   . HOH M 7 .   ? 151.120 14.620 162.969 1.00 37.39  ? 948  HOH A O   1 
HETATM 4613 O O   . HOH M 7 .   ? 153.195 7.852  189.087 1.00 41.39  ? 949  HOH A O   1 
HETATM 4614 O O   . HOH M 7 .   ? 184.230 18.078 192.964 1.00 36.50  ? 950  HOH A O   1 
HETATM 4615 O O   . HOH M 7 .   ? 155.539 17.398 167.342 1.00 22.52  ? 951  HOH A O   1 
HETATM 4616 O O   . HOH M 7 .   ? 191.220 19.675 175.624 1.00 32.63  ? 952  HOH A O   1 
HETATM 4617 O O   . HOH M 7 .   ? 169.625 60.857 155.139 1.00 45.33  ? 953  HOH A O   1 
HETATM 4618 O O   . HOH M 7 .   ? 146.760 20.151 170.963 1.00 30.99  ? 954  HOH A O   1 
HETATM 4619 O O   . HOH M 7 .   ? 168.642 56.168 161.000 1.00 37.49  ? 955  HOH A O   1 
HETATM 4620 O O   . HOH M 7 .   ? 175.509 4.480  155.715 1.00 37.73  ? 956  HOH A O   1 
HETATM 4621 O O   . HOH M 7 .   ? 184.799 16.604 190.176 1.00 38.64  ? 957  HOH A O   1 
HETATM 4622 O O   . HOH M 7 .   ? 156.367 33.913 156.681 1.00 32.92  ? 958  HOH A O   1 
HETATM 4623 O O   . HOH M 7 .   ? 167.710 33.449 186.943 1.00 35.89  ? 959  HOH A O   1 
HETATM 4624 O O   . HOH M 7 .   ? 140.739 42.318 180.519 1.00 45.91  ? 960  HOH A O   1 
HETATM 4625 O O   . HOH M 7 .   ? 157.673 18.614 180.002 1.00 36.93  ? 961  HOH A O   1 
HETATM 4626 O O   . HOH M 7 .   ? 159.965 38.257 177.087 1.00 21.94  ? 962  HOH A O   1 
HETATM 4627 O O   . HOH M 7 .   ? 185.256 48.144 149.013 1.00 36.73  ? 963  HOH A O   1 
HETATM 4628 O O   . HOH M 7 .   ? 163.559 40.455 184.559 1.00 36.08  ? 964  HOH A O   1 
HETATM 4629 O O   . HOH M 7 .   ? 160.094 42.311 172.708 1.00 25.16  ? 965  HOH A O   1 
HETATM 4630 O O   . HOH M 7 .   ? 149.654 26.498 185.694 1.00 36.94  ? 966  HOH A O   1 
HETATM 4631 O O   . HOH M 7 .   ? 162.873 11.038 176.608 1.00 45.29  ? 967  HOH A O   1 
HETATM 4632 O O   . HOH M 7 .   ? 161.947 40.448 154.490 1.00 34.08  ? 968  HOH A O   1 
HETATM 4633 O O   . HOH M 7 .   ? 152.961 20.319 174.911 1.00 23.05  ? 969  HOH A O   1 
HETATM 4634 O O   . HOH M 7 .   ? 169.957 28.424 149.052 1.00 24.03  ? 970  HOH A O   1 
HETATM 4635 O O   . HOH M 7 .   ? 180.285 8.809  173.323 1.00 27.36  ? 971  HOH A O   1 
HETATM 4636 O O   . HOH M 7 .   ? 184.799 13.739 177.235 1.00 34.91  ? 972  HOH A O   1 
HETATM 4637 O O   . HOH M 7 .   ? 186.540 16.943 179.151 1.00 50.02  ? 973  HOH A O   1 
HETATM 4638 O O   . HOH M 7 .   ? 154.319 4.255  187.938 1.00 37.06  ? 974  HOH A O   1 
HETATM 4639 O O   . HOH M 7 .   ? 181.717 7.158  171.455 1.00 46.30  ? 975  HOH A O   1 
HETATM 4640 O O   . HOH M 7 .   ? 194.660 37.600 163.280 1.00 40.57  ? 976  HOH A O   1 
HETATM 4641 O O   . HOH M 7 .   ? 159.500 17.602 151.015 1.00 39.05  ? 977  HOH A O   1 
HETATM 4642 O O   . HOH M 7 .   ? 170.406 23.115 149.519 1.00 44.56  ? 978  HOH A O   1 
HETATM 4643 O O   . HOH M 7 .   ? 144.618 46.557 173.618 1.00 43.44  ? 979  HOH A O   1 
HETATM 4644 O O   . HOH M 7 .   ? 154.331 19.597 154.083 1.00 33.58  ? 980  HOH A O   1 
HETATM 4645 O O   . HOH M 7 .   ? 137.632 35.853 170.174 1.00 49.96  ? 981  HOH A O   1 
HETATM 4646 O O   . HOH M 7 .   ? 134.665 39.122 172.735 1.00 61.12  ? 982  HOH A O   1 
HETATM 4647 O O   . HOH M 7 .   ? 184.298 11.357 154.893 1.00 43.03  ? 983  HOH A O   1 
HETATM 4648 O O   . HOH M 7 .   ? 189.087 13.799 174.999 1.00 46.60  ? 984  HOH A O   1 
HETATM 4649 O O   . HOH M 7 .   ? 185.400 32.873 151.563 1.00 51.69  ? 985  HOH A O   1 
HETATM 4650 O O   . HOH M 7 .   ? 154.157 20.743 178.944 1.00 33.39  ? 986  HOH A O   1 
HETATM 4651 O O   . HOH M 7 .   ? 187.699 7.857  160.058 1.00 40.55  ? 987  HOH A O   1 
HETATM 4652 O O   . HOH M 7 .   ? 162.091 34.646 147.701 1.00 35.21  ? 988  HOH A O   1 
HETATM 4653 O O   . HOH M 7 .   ? 174.467 57.699 147.333 1.00 55.45  ? 989  HOH A O   1 
HETATM 4654 O O   . HOH M 7 .   ? 176.480 33.605 140.503 1.00 29.13  ? 990  HOH A O   1 
HETATM 4655 O O   . HOH M 7 .   ? 161.035 5.657  164.895 1.00 55.49  ? 991  HOH A O   1 
HETATM 4656 O O   . HOH M 7 .   ? 169.155 54.832 163.079 1.00 49.97  ? 992  HOH A O   1 
HETATM 4657 O O   . HOH M 7 .   ? 197.996 32.003 165.275 1.00 64.27  ? 993  HOH A O   1 
HETATM 4658 O O   . HOH M 7 .   ? 160.425 13.787 176.484 1.00 39.61  ? 994  HOH A O   1 
HETATM 4659 O O   . HOH M 7 .   ? 171.853 4.199  166.626 1.00 53.95  ? 995  HOH A O   1 
HETATM 4660 O O   . HOH M 7 .   ? 170.427 50.487 171.332 1.00 45.31  ? 996  HOH A O   1 
HETATM 4661 O O   . HOH M 7 .   ? 163.308 7.222  158.901 1.00 47.75  ? 997  HOH A O   1 
HETATM 4662 O O   . HOH M 7 .   ? 187.865 5.800  161.674 1.00 50.89  ? 998  HOH A O   1 
HETATM 4663 O O   . HOH M 7 .   ? 174.995 43.523 180.469 1.00 49.95  ? 999  HOH A O   1 
HETATM 4664 O O   . HOH M 7 .   ? 146.382 24.906 160.776 1.00 57.45  ? 1000 HOH A O   1 
HETATM 4665 O O   . HOH M 7 .   ? 184.075 32.583 181.287 1.00 28.87  ? 1001 HOH A O   1 
HETATM 4666 O O   . HOH M 7 .   ? 147.861 5.105  182.342 1.00 58.18  ? 1002 HOH A O   1 
HETATM 4667 O O   . HOH M 7 .   ? 186.864 15.345 153.014 1.00 39.02  ? 1003 HOH A O   1 
HETATM 4668 O O   . HOH M 7 .   ? 175.451 16.709 200.325 1.00 54.77  ? 1004 HOH A O   1 
HETATM 4669 O O   . HOH M 7 .   ? 196.854 34.671 172.357 1.00 45.99  ? 1005 HOH A O   1 
HETATM 4670 O O   . HOH M 7 .   ? 151.268 24.830 187.840 1.00 51.81  ? 1006 HOH A O   1 
HETATM 4671 O O   . HOH M 7 .   ? 193.527 26.622 161.968 1.00 39.44  ? 1007 HOH A O   1 
HETATM 4672 O O   . HOH M 7 .   ? 186.448 28.833 188.816 1.00 47.72  ? 1008 HOH A O   1 
HETATM 4673 O O   . HOH M 7 .   ? 185.049 31.280 152.923 1.00 48.13  ? 1009 HOH A O   1 
HETATM 4674 O O   . HOH M 7 .   ? 163.123 10.769 170.568 1.00 34.43  ? 1010 HOH A O   1 
HETATM 4675 O O   . HOH M 7 .   ? 155.591 8.618  160.930 1.00 50.84  ? 1011 HOH A O   1 
HETATM 4676 O O   . HOH M 7 .   ? 156.861 13.473 153.034 1.00 58.19  ? 1012 HOH A O   1 
HETATM 4677 O O   . HOH M 7 .   ? 170.142 35.459 180.507 1.00 36.00  ? 1013 HOH A O   1 
HETATM 4678 O O   . HOH M 7 .   ? 193.482 18.382 164.678 1.00 47.62  ? 1014 HOH A O   1 
HETATM 4679 O O   . HOH M 7 .   ? 181.902 6.192  157.718 1.00 48.93  ? 1015 HOH A O   1 
HETATM 4680 O O   . HOH M 7 .   ? 171.708 20.597 148.791 1.00 57.17  ? 1016 HOH A O   1 
HETATM 4681 O O   . HOH M 7 .   ? 196.958 29.698 166.443 1.00 42.78  ? 1017 HOH A O   1 
HETATM 4682 O O   . HOH M 7 .   ? 170.182 7.469  169.173 1.00 37.89  ? 1018 HOH A O   1 
HETATM 4683 O O   . HOH M 7 .   ? 156.722 21.332 180.641 1.00 31.69  ? 1019 HOH A O   1 
HETATM 4684 O O   . HOH M 7 .   ? 143.343 44.699 167.180 1.00 60.01  ? 1020 HOH A O   1 
HETATM 4685 O O   . HOH M 7 .   ? 160.113 7.160  193.138 1.00 60.16  ? 1021 HOH A O   1 
HETATM 4686 O O   . HOH M 7 .   ? 146.292 35.294 189.996 1.00 47.08  ? 1022 HOH A O   1 
HETATM 4687 O O   . HOH M 7 .   ? 174.505 7.678  154.825 1.00 36.70  ? 1023 HOH A O   1 
HETATM 4688 O O   . HOH M 7 .   ? 156.980 18.293 172.818 1.00 45.55  ? 1024 HOH A O   1 
HETATM 4689 O O   . HOH M 7 .   ? 151.875 49.169 176.737 1.00 50.49  ? 1025 HOH A O   1 
HETATM 4690 O O   . HOH M 7 .   ? 166.021 57.274 157.575 1.00 39.80  ? 1026 HOH A O   1 
HETATM 4691 O O   . HOH M 7 .   ? 148.640 21.604 183.699 1.00 52.49  ? 1027 HOH A O   1 
HETATM 4692 O O   . HOH M 7 .   ? 152.424 5.801  170.812 1.00 52.40  ? 1028 HOH A O   1 
HETATM 4693 O O   . HOH M 7 .   ? 155.285 36.671 158.720 1.00 46.08  ? 1029 HOH A O   1 
HETATM 4694 O O   . HOH M 7 .   ? 173.201 46.887 180.252 1.00 54.57  ? 1030 HOH A O   1 
HETATM 4695 O O   . HOH M 7 .   ? 163.895 51.689 148.080 1.00 49.72  ? 1031 HOH A O   1 
HETATM 4696 O O   . HOH M 7 .   ? 171.314 49.377 144.160 1.00 50.79  ? 1032 HOH A O   1 
HETATM 4697 O O   . HOH M 7 .   ? 143.213 26.423 177.895 1.00 40.86  ? 1033 HOH A O   1 
HETATM 4698 O O   . HOH M 7 .   ? 190.306 18.158 176.693 1.00 43.20  ? 1034 HOH A O   1 
HETATM 4699 O O   . HOH M 7 .   ? 152.761 50.809 172.258 1.00 58.90  ? 1035 HOH A O   1 
HETATM 4700 O O   . HOH M 7 .   ? 189.958 43.520 168.369 1.00 35.39  ? 1036 HOH A O   1 
HETATM 4701 O O   . HOH M 7 .   ? 192.800 37.527 157.102 1.00 49.48  ? 1037 HOH A O   1 
HETATM 4702 O O   . HOH M 7 .   ? 148.741 0.000  182.498 0.50 59.42  ? 1038 HOH A O   1 
HETATM 4703 O O   . HOH M 7 .   ? 189.672 31.471 185.965 1.00 56.32  ? 1039 HOH A O   1 
HETATM 4704 O O   . HOH M 7 .   ? 138.045 43.831 174.471 1.00 45.51  ? 1040 HOH A O   1 
HETATM 4705 O O   . HOH M 7 .   ? 153.960 18.777 170.762 1.00 39.90  ? 1041 HOH A O   1 
HETATM 4706 O O   . HOH M 7 .   ? 144.225 21.207 170.781 1.00 40.07  ? 1042 HOH A O   1 
HETATM 4707 O O   . HOH M 7 .   ? 159.047 36.373 155.749 1.00 33.70  ? 1043 HOH A O   1 
HETATM 4708 O O   . HOH M 7 .   ? 155.143 9.776  164.182 1.00 48.87  ? 1044 HOH A O   1 
HETATM 4709 O O   . HOH M 7 .   ? 189.609 31.723 153.832 1.00 59.37  ? 1045 HOH A O   1 
HETATM 4710 O O   . HOH M 7 .   ? 138.930 40.153 185.418 1.00 66.56  ? 1046 HOH A O   1 
HETATM 4711 O O   . HOH M 7 .   ? 197.675 39.166 177.877 1.00 54.23  ? 1047 HOH A O   1 
HETATM 4712 O O   . HOH M 7 .   ? 155.519 46.912 185.394 1.00 55.05  ? 1048 HOH A O   1 
HETATM 4713 O O   . HOH M 7 .   ? 150.389 35.637 191.221 1.00 38.20  ? 1049 HOH A O   1 
HETATM 4714 O O   . HOH M 7 .   ? 153.292 49.148 176.680 1.00 46.09  ? 1050 HOH A O   1 
HETATM 4715 O O   . HOH M 7 .   ? 140.294 30.876 176.185 1.00 30.26  ? 1051 HOH A O   1 
HETATM 4716 O O   . HOH M 7 .   ? 181.926 17.063 185.182 1.00 43.32  ? 1052 HOH A O   1 
HETATM 4717 O O   . HOH M 7 .   ? 166.783 31.977 189.182 1.00 32.99  ? 1053 HOH A O   1 
HETATM 4718 O O   . HOH M 7 .   ? 195.558 20.011 167.022 1.00 51.81  ? 1054 HOH A O   1 
HETATM 4719 O O   . HOH M 7 .   ? 143.442 23.679 171.753 1.00 38.64  ? 1055 HOH A O   1 
HETATM 4720 O O   . HOH M 7 .   ? 184.461 37.043 187.476 1.00 60.92  ? 1056 HOH A O   1 
HETATM 4721 O O   . HOH M 7 .   ? 197.174 33.894 161.098 1.00 61.06  ? 1057 HOH A O   1 
HETATM 4722 O O   . HOH M 7 .   ? 160.198 35.867 188.600 1.00 53.47  ? 1058 HOH A O   1 
HETATM 4723 O O   . HOH M 7 .   ? 147.775 48.633 172.245 1.00 52.45  ? 1059 HOH A O   1 
HETATM 4724 O O   . HOH M 7 .   ? 156.312 4.687  172.302 1.00 49.77  ? 1060 HOH A O   1 
HETATM 4725 O O   . HOH M 7 .   ? 152.044 19.433 179.715 1.00 38.17  ? 1061 HOH A O   1 
HETATM 4726 O O   . HOH M 7 .   ? 176.872 13.932 199.728 1.00 51.07  ? 1062 HOH A O   1 
HETATM 4727 O O   . HOH M 7 .   ? 160.439 46.429 149.982 1.00 42.43  ? 1063 HOH A O   1 
HETATM 4728 O O   . HOH M 7 .   ? 176.324 3.587  186.014 1.00 45.05  ? 1064 HOH A O   1 
HETATM 4729 O O   . HOH M 7 .   ? 146.987 18.057 172.439 1.00 46.08  ? 1065 HOH A O   1 
HETATM 4730 O O   . HOH M 7 .   ? 180.629 46.394 167.301 1.00 50.97  ? 1066 HOH A O   1 
HETATM 4731 O O   . HOH M 7 .   ? 185.132 18.930 189.442 1.00 34.13  ? 1067 HOH A O   1 
HETATM 4732 O O   . HOH M 7 .   ? 180.544 10.000 137.626 1.00 65.80  ? 1068 HOH A O   1 
HETATM 4733 O O   . HOH M 7 .   ? 150.931 13.152 165.721 1.00 56.41  ? 1069 HOH A O   1 
HETATM 4734 O O   . HOH M 7 .   ? 164.358 -0.385 174.067 1.00 36.35  ? 1070 HOH A O   1 
HETATM 4735 O O   . HOH M 7 .   ? 183.265 17.700 185.746 1.00 38.38  ? 1071 HOH A O   1 
HETATM 4736 O O   . HOH M 7 .   ? 183.970 25.524 193.779 1.00 37.18  ? 1072 HOH A O   1 
HETATM 4737 O O   . HOH M 7 .   ? 185.135 20.572 149.115 1.00 43.43  ? 1073 HOH A O   1 
HETATM 4738 O O   . HOH M 7 .   ? 159.442 15.266 168.240 1.00 32.92  ? 1074 HOH A O   1 
HETATM 4739 O O   . HOH M 7 .   ? 172.451 51.445 176.290 1.00 53.07  ? 1075 HOH A O   1 
HETATM 4740 O O   . HOH M 7 .   ? 147.608 40.294 161.422 1.00 50.38  ? 1076 HOH A O   1 
HETATM 4741 O O   . HOH M 7 .   ? 145.025 21.761 178.077 1.00 42.37  ? 1077 HOH A O   1 
HETATM 4742 O O   . HOH M 7 .   ? 155.028 12.859 167.946 1.00 45.62  ? 1078 HOH A O   1 
HETATM 4743 O O   . HOH M 7 .   ? 140.875 29.791 189.090 1.00 50.68  ? 1079 HOH A O   1 
HETATM 4744 O O   . HOH M 7 .   ? 161.751 4.401  160.249 1.00 47.89  ? 1080 HOH A O   1 
HETATM 4745 O O   . HOH M 7 .   ? 147.476 20.842 164.585 1.00 49.68  ? 1081 HOH A O   1 
HETATM 4746 O O   . HOH M 7 .   ? 152.568 14.587 184.418 1.00 55.17  ? 1082 HOH A O   1 
HETATM 4747 O O   . HOH M 7 .   ? 149.276 19.388 164.152 1.00 44.75  ? 1083 HOH A O   1 
HETATM 4748 O O   . HOH M 7 .   ? 195.330 13.022 155.353 1.00 56.72  ? 1084 HOH A O   1 
HETATM 4749 O O   . HOH M 7 .   ? 182.825 2.592  198.542 1.00 52.87  ? 1085 HOH A O   1 
HETATM 4750 O O   . HOH M 7 .   ? 151.193 19.070 176.938 1.00 47.94  ? 1086 HOH A O   1 
HETATM 4751 O O   . HOH M 7 .   ? 185.735 19.851 182.571 1.00 35.74  ? 1087 HOH A O   1 
HETATM 4752 O O   . HOH M 7 .   ? 164.918 33.344 190.657 1.00 41.58  ? 1088 HOH A O   1 
HETATM 4753 O O   . HOH M 7 .   ? 188.005 36.862 185.345 1.00 48.39  ? 1089 HOH A O   1 
HETATM 4754 O O   . HOH M 7 .   ? 175.629 45.688 180.011 1.00 51.07  ? 1090 HOH A O   1 
HETATM 4755 O O   . HOH M 7 .   ? 153.638 24.095 189.449 1.00 42.28  ? 1091 HOH A O   1 
HETATM 4756 O O   . HOH M 7 .   ? 171.989 48.293 179.612 1.00 49.79  ? 1092 HOH A O   1 
HETATM 4757 O O   . HOH M 7 .   ? 168.772 52.223 168.389 1.00 51.14  ? 1093 HOH A O   1 
HETATM 4758 O O   . HOH M 7 .   ? 146.268 32.809 189.371 1.00 52.77  ? 1094 HOH A O   1 
HETATM 4759 O O   . HOH M 7 .   ? 177.341 -1.814 178.554 1.00 42.75  ? 1095 HOH A O   1 
HETATM 4760 O O   . HOH M 7 .   ? 158.498 10.070 176.234 1.00 56.84  ? 1096 HOH A O   1 
HETATM 4761 O O   . HOH M 7 .   ? 187.807 10.482 156.718 1.00 57.13  ? 1097 HOH A O   1 
HETATM 4762 O O   . HOH M 7 .   ? 151.601 18.635 169.325 1.00 25.83  ? 1098 HOH A O   1 
HETATM 4763 O O   . HOH M 7 .   ? 198.829 35.247 163.121 1.00 54.30  ? 1099 HOH A O   1 
HETATM 4764 O O   . HOH M 7 .   ? 168.882 48.295 144.737 1.00 42.98  ? 1100 HOH A O   1 
HETATM 4765 O O   . HOH M 7 .   ? 178.288 4.239  186.832 1.00 62.03  ? 1101 HOH A O   1 
HETATM 4766 O O   . HOH M 7 .   ? 193.807 36.397 159.139 1.00 44.47  ? 1102 HOH A O   1 
HETATM 4767 O O   . HOH M 7 .   ? 155.188 19.970 176.646 1.00 28.60  ? 1103 HOH A O   1 
HETATM 4768 O O   . HOH M 7 .   ? 149.777 17.659 165.222 1.00 38.57  ? 1104 HOH A O   1 
HETATM 4769 O O   . HOH M 7 .   ? 147.612 19.490 168.198 1.00 32.27  ? 1105 HOH A O   1 
HETATM 4770 O O   . HOH M 7 .   ? 140.160 27.889 163.522 1.00 60.11  ? 1106 HOH A O   1 
HETATM 4771 O O   . HOH M 7 .   ? 196.779 27.783 164.668 1.00 38.92  ? 1107 HOH A O   1 
HETATM 4772 O O   . HOH M 7 .   ? 142.586 23.540 174.137 1.00 37.00  ? 1108 HOH A O   1 
HETATM 4773 O O   . HOH M 7 .   ? 185.324 12.227 189.457 1.00 41.69  ? 1109 HOH A O   1 
HETATM 4774 O O   . HOH M 7 .   ? 144.928 38.480 159.338 1.00 47.80  ? 1110 HOH A O   1 
HETATM 4775 O O   . HOH M 7 .   ? 142.965 26.521 180.425 1.00 39.41  ? 1111 HOH A O   1 
HETATM 4776 O O   . HOH M 7 .   ? 149.975 17.005 170.581 1.00 39.64  ? 1112 HOH A O   1 
HETATM 4777 O O   . HOH M 7 .   ? 161.264 54.646 148.468 1.00 56.78  ? 1113 HOH A O   1 
HETATM 4778 O O   . HOH M 7 .   ? 152.866 17.155 167.619 1.00 24.87  ? 1114 HOH A O   1 
HETATM 4779 O O   . HOH M 7 .   ? 181.122 11.110 173.638 1.00 41.62  ? 1115 HOH A O   1 
HETATM 4780 O O   . HOH M 7 .   ? 159.187 48.318 147.796 1.00 56.65  ? 1116 HOH A O   1 
HETATM 4781 O O   . HOH M 7 .   ? 133.447 34.980 184.830 1.00 57.77  ? 1117 HOH A O   1 
HETATM 4782 O O   . HOH M 7 .   ? 194.413 29.065 160.853 1.00 37.39  ? 1118 HOH A O   1 
HETATM 4783 O O   . HOH M 7 .   ? 183.650 9.723  153.035 1.00 45.53  ? 1119 HOH A O   1 
HETATM 4784 O O   . HOH M 7 .   ? 172.956 61.512 152.775 1.00 54.15  ? 1120 HOH A O   1 
HETATM 4785 O O   . HOH M 7 .   ? 167.043 45.456 183.298 1.00 42.58  ? 1121 HOH A O   1 
HETATM 4786 O O   . HOH M 7 .   ? 145.201 18.308 175.774 1.00 49.31  ? 1122 HOH A O   1 
HETATM 4787 O O   . HOH M 7 .   ? 133.927 36.163 187.898 1.00 61.16  ? 1123 HOH A O   1 
HETATM 4788 O O   . HOH M 7 .   ? 164.392 56.189 177.923 1.00 59.37  ? 1124 HOH A O   1 
HETATM 4789 O O   . HOH M 7 .   ? 181.830 5.303  150.164 1.00 58.08  ? 1125 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   601  601  NAG NAG A . 
C 3 FUC 2   602  602  FUC FUC A . 
D 2 NAG 1   603  603  NAG NAG A . 
E 2 NAG 2   604  604  NAG NAG A . 
F 4 BMA 3   605  605  BMA BMA A . 
G 5 MAN 4   606  606  MAN MAN A . 
H 2 NAG 1   607  607  NAG NAG A . 
I 2 NAG 2   608  608  NAG NAG A . 
J 4 BMA 3   609  609  BMA BMA A . 
K 5 MAN 4   610  610  MAN MAN A . 
L 6 DZ7 1   611  612  DZ7 DZ7 A . 
M 7 HOH 1   701  701  HOH HOH A . 
M 7 HOH 2   702  702  HOH HOH A . 
M 7 HOH 3   703  703  HOH HOH A . 
M 7 HOH 4   704  704  HOH HOH A . 
M 7 HOH 5   705  705  HOH HOH A . 
M 7 HOH 6   706  706  HOH HOH A . 
M 7 HOH 7   707  707  HOH HOH A . 
M 7 HOH 8   708  708  HOH HOH A . 
M 7 HOH 9   709  709  HOH HOH A . 
M 7 HOH 10  710  710  HOH HOH A . 
M 7 HOH 11  711  711  HOH HOH A . 
M 7 HOH 12  712  712  HOH HOH A . 
M 7 HOH 13  713  713  HOH HOH A . 
M 7 HOH 14  714  714  HOH HOH A . 
M 7 HOH 15  715  715  HOH HOH A . 
M 7 HOH 16  716  716  HOH HOH A . 
M 7 HOH 17  717  717  HOH HOH A . 
M 7 HOH 18  718  718  HOH HOH A . 
M 7 HOH 19  719  719  HOH HOH A . 
M 7 HOH 20  720  720  HOH HOH A . 
M 7 HOH 21  721  721  HOH HOH A . 
M 7 HOH 22  722  722  HOH HOH A . 
M 7 HOH 23  723  723  HOH HOH A . 
M 7 HOH 24  724  724  HOH HOH A . 
M 7 HOH 25  725  725  HOH HOH A . 
M 7 HOH 26  726  726  HOH HOH A . 
M 7 HOH 27  727  727  HOH HOH A . 
M 7 HOH 28  728  728  HOH HOH A . 
M 7 HOH 29  729  729  HOH HOH A . 
M 7 HOH 30  730  730  HOH HOH A . 
M 7 HOH 31  731  731  HOH HOH A . 
M 7 HOH 32  732  733  HOH HOH A . 
M 7 HOH 33  733  734  HOH HOH A . 
M 7 HOH 34  734  735  HOH HOH A . 
M 7 HOH 35  735  736  HOH HOH A . 
M 7 HOH 36  736  737  HOH HOH A . 
M 7 HOH 37  737  738  HOH HOH A . 
M 7 HOH 38  738  739  HOH HOH A . 
M 7 HOH 39  739  740  HOH HOH A . 
M 7 HOH 40  740  741  HOH HOH A . 
M 7 HOH 41  741  742  HOH HOH A . 
M 7 HOH 42  742  743  HOH HOH A . 
M 7 HOH 43  743  744  HOH HOH A . 
M 7 HOH 44  744  745  HOH HOH A . 
M 7 HOH 45  745  746  HOH HOH A . 
M 7 HOH 46  746  747  HOH HOH A . 
M 7 HOH 47  747  748  HOH HOH A . 
M 7 HOH 48  748  749  HOH HOH A . 
M 7 HOH 49  749  750  HOH HOH A . 
M 7 HOH 50  750  751  HOH HOH A . 
M 7 HOH 51  751  752  HOH HOH A . 
M 7 HOH 52  752  753  HOH HOH A . 
M 7 HOH 53  753  754  HOH HOH A . 
M 7 HOH 54  754  755  HOH HOH A . 
M 7 HOH 55  755  756  HOH HOH A . 
M 7 HOH 56  756  757  HOH HOH A . 
M 7 HOH 57  757  758  HOH HOH A . 
M 7 HOH 58  758  759  HOH HOH A . 
M 7 HOH 59  759  760  HOH HOH A . 
M 7 HOH 60  760  761  HOH HOH A . 
M 7 HOH 61  761  762  HOH HOH A . 
M 7 HOH 62  762  763  HOH HOH A . 
M 7 HOH 63  763  764  HOH HOH A . 
M 7 HOH 64  764  765  HOH HOH A . 
M 7 HOH 65  765  766  HOH HOH A . 
M 7 HOH 66  766  767  HOH HOH A . 
M 7 HOH 67  767  768  HOH HOH A . 
M 7 HOH 68  768  769  HOH HOH A . 
M 7 HOH 69  769  770  HOH HOH A . 
M 7 HOH 70  770  771  HOH HOH A . 
M 7 HOH 71  771  772  HOH HOH A . 
M 7 HOH 72  772  773  HOH HOH A . 
M 7 HOH 73  773  774  HOH HOH A . 
M 7 HOH 74  774  775  HOH HOH A . 
M 7 HOH 75  775  776  HOH HOH A . 
M 7 HOH 76  776  777  HOH HOH A . 
M 7 HOH 77  777  778  HOH HOH A . 
M 7 HOH 78  778  779  HOH HOH A . 
M 7 HOH 79  779  780  HOH HOH A . 
M 7 HOH 80  780  781  HOH HOH A . 
M 7 HOH 81  781  782  HOH HOH A . 
M 7 HOH 82  782  783  HOH HOH A . 
M 7 HOH 83  783  784  HOH HOH A . 
M 7 HOH 84  784  785  HOH HOH A . 
M 7 HOH 85  785  786  HOH HOH A . 
M 7 HOH 86  786  787  HOH HOH A . 
M 7 HOH 87  787  788  HOH HOH A . 
M 7 HOH 88  788  789  HOH HOH A . 
M 7 HOH 89  789  790  HOH HOH A . 
M 7 HOH 90  790  791  HOH HOH A . 
M 7 HOH 91  791  792  HOH HOH A . 
M 7 HOH 92  792  793  HOH HOH A . 
M 7 HOH 93  793  794  HOH HOH A . 
M 7 HOH 94  794  795  HOH HOH A . 
M 7 HOH 95  795  796  HOH HOH A . 
M 7 HOH 96  796  797  HOH HOH A . 
M 7 HOH 97  797  798  HOH HOH A . 
M 7 HOH 98  798  799  HOH HOH A . 
M 7 HOH 99  799  800  HOH HOH A . 
M 7 HOH 100 800  801  HOH HOH A . 
M 7 HOH 101 801  802  HOH HOH A . 
M 7 HOH 102 802  803  HOH HOH A . 
M 7 HOH 103 803  804  HOH HOH A . 
M 7 HOH 104 804  805  HOH HOH A . 
M 7 HOH 105 805  806  HOH HOH A . 
M 7 HOH 106 806  807  HOH HOH A . 
M 7 HOH 107 807  808  HOH HOH A . 
M 7 HOH 108 808  809  HOH HOH A . 
M 7 HOH 109 809  810  HOH HOH A . 
M 7 HOH 110 810  811  HOH HOH A . 
M 7 HOH 111 811  812  HOH HOH A . 
M 7 HOH 112 812  813  HOH HOH A . 
M 7 HOH 113 813  814  HOH HOH A . 
M 7 HOH 114 814  815  HOH HOH A . 
M 7 HOH 115 815  816  HOH HOH A . 
M 7 HOH 116 816  817  HOH HOH A . 
M 7 HOH 117 817  818  HOH HOH A . 
M 7 HOH 118 818  819  HOH HOH A . 
M 7 HOH 119 819  820  HOH HOH A . 
M 7 HOH 120 820  821  HOH HOH A . 
M 7 HOH 121 821  822  HOH HOH A . 
M 7 HOH 122 822  823  HOH HOH A . 
M 7 HOH 123 823  824  HOH HOH A . 
M 7 HOH 124 824  825  HOH HOH A . 
M 7 HOH 125 825  826  HOH HOH A . 
M 7 HOH 126 826  827  HOH HOH A . 
M 7 HOH 127 827  828  HOH HOH A . 
M 7 HOH 128 828  829  HOH HOH A . 
M 7 HOH 129 829  830  HOH HOH A . 
M 7 HOH 130 830  831  HOH HOH A . 
M 7 HOH 131 831  832  HOH HOH A . 
M 7 HOH 132 832  833  HOH HOH A . 
M 7 HOH 133 833  834  HOH HOH A . 
M 7 HOH 134 834  835  HOH HOH A . 
M 7 HOH 135 835  836  HOH HOH A . 
M 7 HOH 136 836  837  HOH HOH A . 
M 7 HOH 137 837  838  HOH HOH A . 
M 7 HOH 138 838  839  HOH HOH A . 
M 7 HOH 139 839  840  HOH HOH A . 
M 7 HOH 140 840  841  HOH HOH A . 
M 7 HOH 141 841  842  HOH HOH A . 
M 7 HOH 142 842  843  HOH HOH A . 
M 7 HOH 143 843  844  HOH HOH A . 
M 7 HOH 144 844  845  HOH HOH A . 
M 7 HOH 145 845  846  HOH HOH A . 
M 7 HOH 146 846  847  HOH HOH A . 
M 7 HOH 147 847  848  HOH HOH A . 
M 7 HOH 148 848  849  HOH HOH A . 
M 7 HOH 149 849  850  HOH HOH A . 
M 7 HOH 150 850  851  HOH HOH A . 
M 7 HOH 151 851  852  HOH HOH A . 
M 7 HOH 152 852  853  HOH HOH A . 
M 7 HOH 153 853  854  HOH HOH A . 
M 7 HOH 154 854  855  HOH HOH A . 
M 7 HOH 155 855  856  HOH HOH A . 
M 7 HOH 156 856  857  HOH HOH A . 
M 7 HOH 157 857  858  HOH HOH A . 
M 7 HOH 158 858  859  HOH HOH A . 
M 7 HOH 159 859  860  HOH HOH A . 
M 7 HOH 160 860  861  HOH HOH A . 
M 7 HOH 161 861  862  HOH HOH A . 
M 7 HOH 162 862  863  HOH HOH A . 
M 7 HOH 163 863  864  HOH HOH A . 
M 7 HOH 164 864  865  HOH HOH A . 
M 7 HOH 165 865  866  HOH HOH A . 
M 7 HOH 166 866  867  HOH HOH A . 
M 7 HOH 167 867  868  HOH HOH A . 
M 7 HOH 168 868  869  HOH HOH A . 
M 7 HOH 169 869  870  HOH HOH A . 
M 7 HOH 170 870  871  HOH HOH A . 
M 7 HOH 171 871  872  HOH HOH A . 
M 7 HOH 172 872  873  HOH HOH A . 
M 7 HOH 173 873  874  HOH HOH A . 
M 7 HOH 174 874  875  HOH HOH A . 
M 7 HOH 175 875  876  HOH HOH A . 
M 7 HOH 176 876  877  HOH HOH A . 
M 7 HOH 177 877  878  HOH HOH A . 
M 7 HOH 178 878  879  HOH HOH A . 
M 7 HOH 179 879  880  HOH HOH A . 
M 7 HOH 180 880  881  HOH HOH A . 
M 7 HOH 181 881  882  HOH HOH A . 
M 7 HOH 182 882  883  HOH HOH A . 
M 7 HOH 183 883  884  HOH HOH A . 
M 7 HOH 184 884  885  HOH HOH A . 
M 7 HOH 185 885  886  HOH HOH A . 
M 7 HOH 186 886  887  HOH HOH A . 
M 7 HOH 187 887  888  HOH HOH A . 
M 7 HOH 188 888  889  HOH HOH A . 
M 7 HOH 189 889  890  HOH HOH A . 
M 7 HOH 190 890  891  HOH HOH A . 
M 7 HOH 191 891  892  HOH HOH A . 
M 7 HOH 192 892  893  HOH HOH A . 
M 7 HOH 193 893  894  HOH HOH A . 
M 7 HOH 194 894  895  HOH HOH A . 
M 7 HOH 195 895  896  HOH HOH A . 
M 7 HOH 196 896  897  HOH HOH A . 
M 7 HOH 197 897  898  HOH HOH A . 
M 7 HOH 198 898  899  HOH HOH A . 
M 7 HOH 199 899  900  HOH HOH A . 
M 7 HOH 200 900  901  HOH HOH A . 
M 7 HOH 201 901  902  HOH HOH A . 
M 7 HOH 202 902  903  HOH HOH A . 
M 7 HOH 203 903  904  HOH HOH A . 
M 7 HOH 204 904  905  HOH HOH A . 
M 7 HOH 205 905  906  HOH HOH A . 
M 7 HOH 206 906  907  HOH HOH A . 
M 7 HOH 207 907  908  HOH HOH A . 
M 7 HOH 208 908  909  HOH HOH A . 
M 7 HOH 209 909  910  HOH HOH A . 
M 7 HOH 210 910  911  HOH HOH A . 
M 7 HOH 211 911  912  HOH HOH A . 
M 7 HOH 212 912  913  HOH HOH A . 
M 7 HOH 213 913  914  HOH HOH A . 
M 7 HOH 214 914  915  HOH HOH A . 
M 7 HOH 215 915  916  HOH HOH A . 
M 7 HOH 216 916  917  HOH HOH A . 
M 7 HOH 217 917  918  HOH HOH A . 
M 7 HOH 218 918  919  HOH HOH A . 
M 7 HOH 219 919  920  HOH HOH A . 
M 7 HOH 220 920  921  HOH HOH A . 
M 7 HOH 221 921  922  HOH HOH A . 
M 7 HOH 222 922  923  HOH HOH A . 
M 7 HOH 223 923  924  HOH HOH A . 
M 7 HOH 224 924  925  HOH HOH A . 
M 7 HOH 225 925  926  HOH HOH A . 
M 7 HOH 226 926  927  HOH HOH A . 
M 7 HOH 227 927  928  HOH HOH A . 
M 7 HOH 228 928  929  HOH HOH A . 
M 7 HOH 229 929  930  HOH HOH A . 
M 7 HOH 230 930  931  HOH HOH A . 
M 7 HOH 231 931  932  HOH HOH A . 
M 7 HOH 232 932  933  HOH HOH A . 
M 7 HOH 233 933  934  HOH HOH A . 
M 7 HOH 234 934  935  HOH HOH A . 
M 7 HOH 235 935  936  HOH HOH A . 
M 7 HOH 236 936  937  HOH HOH A . 
M 7 HOH 237 937  938  HOH HOH A . 
M 7 HOH 238 938  939  HOH HOH A . 
M 7 HOH 239 939  940  HOH HOH A . 
M 7 HOH 240 940  941  HOH HOH A . 
M 7 HOH 241 941  942  HOH HOH A . 
M 7 HOH 242 942  943  HOH HOH A . 
M 7 HOH 243 943  944  HOH HOH A . 
M 7 HOH 244 944  945  HOH HOH A . 
M 7 HOH 245 945  946  HOH HOH A . 
M 7 HOH 246 946  947  HOH HOH A . 
M 7 HOH 247 947  948  HOH HOH A . 
M 7 HOH 248 948  949  HOH HOH A . 
M 7 HOH 249 949  950  HOH HOH A . 
M 7 HOH 250 950  951  HOH HOH A . 
M 7 HOH 251 951  952  HOH HOH A . 
M 7 HOH 252 952  953  HOH HOH A . 
M 7 HOH 253 953  954  HOH HOH A . 
M 7 HOH 254 954  955  HOH HOH A . 
M 7 HOH 255 955  956  HOH HOH A . 
M 7 HOH 256 956  957  HOH HOH A . 
M 7 HOH 257 957  958  HOH HOH A . 
M 7 HOH 258 958  959  HOH HOH A . 
M 7 HOH 259 959  960  HOH HOH A . 
M 7 HOH 260 960  961  HOH HOH A . 
M 7 HOH 261 961  962  HOH HOH A . 
M 7 HOH 262 962  963  HOH HOH A . 
M 7 HOH 263 963  964  HOH HOH A . 
M 7 HOH 264 964  965  HOH HOH A . 
M 7 HOH 265 965  966  HOH HOH A . 
M 7 HOH 266 966  967  HOH HOH A . 
M 7 HOH 267 967  968  HOH HOH A . 
M 7 HOH 268 968  969  HOH HOH A . 
M 7 HOH 269 969  970  HOH HOH A . 
M 7 HOH 270 970  971  HOH HOH A . 
M 7 HOH 271 971  972  HOH HOH A . 
M 7 HOH 272 972  973  HOH HOH A . 
M 7 HOH 273 973  974  HOH HOH A . 
M 7 HOH 274 974  975  HOH HOH A . 
M 7 HOH 275 975  976  HOH HOH A . 
M 7 HOH 276 976  977  HOH HOH A . 
M 7 HOH 277 977  978  HOH HOH A . 
M 7 HOH 278 978  979  HOH HOH A . 
M 7 HOH 279 979  980  HOH HOH A . 
M 7 HOH 280 980  981  HOH HOH A . 
M 7 HOH 281 981  982  HOH HOH A . 
M 7 HOH 282 982  983  HOH HOH A . 
M 7 HOH 283 983  984  HOH HOH A . 
M 7 HOH 284 984  985  HOH HOH A . 
M 7 HOH 285 985  986  HOH HOH A . 
M 7 HOH 286 986  987  HOH HOH A . 
M 7 HOH 287 987  988  HOH HOH A . 
M 7 HOH 288 988  989  HOH HOH A . 
M 7 HOH 289 989  990  HOH HOH A . 
M 7 HOH 290 990  991  HOH HOH A . 
M 7 HOH 291 991  992  HOH HOH A . 
M 7 HOH 292 992  993  HOH HOH A . 
M 7 HOH 293 993  994  HOH HOH A . 
M 7 HOH 294 994  995  HOH HOH A . 
M 7 HOH 295 995  996  HOH HOH A . 
M 7 HOH 296 996  997  HOH HOH A . 
M 7 HOH 297 997  998  HOH HOH A . 
M 7 HOH 298 998  999  HOH HOH A . 
M 7 HOH 299 999  1000 HOH HOH A . 
M 7 HOH 300 1000 1001 HOH HOH A . 
M 7 HOH 301 1001 1002 HOH HOH A . 
M 7 HOH 302 1002 1003 HOH HOH A . 
M 7 HOH 303 1003 1004 HOH HOH A . 
M 7 HOH 304 1004 1005 HOH HOH A . 
M 7 HOH 305 1005 1006 HOH HOH A . 
M 7 HOH 306 1006 1007 HOH HOH A . 
M 7 HOH 307 1007 1008 HOH HOH A . 
M 7 HOH 308 1008 1009 HOH HOH A . 
M 7 HOH 309 1009 1010 HOH HOH A . 
M 7 HOH 310 1010 1011 HOH HOH A . 
M 7 HOH 311 1011 1012 HOH HOH A . 
M 7 HOH 312 1012 1013 HOH HOH A . 
M 7 HOH 313 1013 1014 HOH HOH A . 
M 7 HOH 314 1014 1015 HOH HOH A . 
M 7 HOH 315 1015 1016 HOH HOH A . 
M 7 HOH 316 1016 1017 HOH HOH A . 
M 7 HOH 317 1017 1018 HOH HOH A . 
M 7 HOH 318 1018 1019 HOH HOH A . 
M 7 HOH 319 1019 1020 HOH HOH A . 
M 7 HOH 320 1020 1021 HOH HOH A . 
M 7 HOH 321 1021 1022 HOH HOH A . 
M 7 HOH 322 1022 1023 HOH HOH A . 
M 7 HOH 323 1023 1024 HOH HOH A . 
M 7 HOH 324 1024 1025 HOH HOH A . 
M 7 HOH 325 1025 1026 HOH HOH A . 
M 7 HOH 326 1026 1027 HOH HOH A . 
M 7 HOH 327 1027 1028 HOH HOH A . 
M 7 HOH 328 1028 1029 HOH HOH A . 
M 7 HOH 329 1029 1030 HOH HOH A . 
M 7 HOH 330 1030 1031 HOH HOH A . 
M 7 HOH 331 1031 1032 HOH HOH A . 
M 7 HOH 332 1032 1033 HOH HOH A . 
M 7 HOH 333 1033 1034 HOH HOH A . 
M 7 HOH 334 1034 1035 HOH HOH A . 
M 7 HOH 335 1035 1036 HOH HOH A . 
M 7 HOH 336 1036 1037 HOH HOH A . 
M 7 HOH 337 1037 1038 HOH HOH A . 
M 7 HOH 338 1038 1039 HOH HOH A . 
M 7 HOH 339 1039 1040 HOH HOH A . 
M 7 HOH 340 1040 1041 HOH HOH A . 
M 7 HOH 341 1041 1042 HOH HOH A . 
M 7 HOH 342 1042 1043 HOH HOH A . 
M 7 HOH 343 1043 1044 HOH HOH A . 
M 7 HOH 344 1044 1045 HOH HOH A . 
M 7 HOH 345 1045 1046 HOH HOH A . 
M 7 HOH 346 1046 1047 HOH HOH A . 
M 7 HOH 347 1047 1048 HOH HOH A . 
M 7 HOH 348 1048 1049 HOH HOH A . 
M 7 HOH 349 1049 1050 HOH HOH A . 
M 7 HOH 350 1050 1051 HOH HOH A . 
M 7 HOH 351 1051 1052 HOH HOH A . 
M 7 HOH 352 1052 1053 HOH HOH A . 
M 7 HOH 353 1053 1054 HOH HOH A . 
M 7 HOH 354 1054 1055 HOH HOH A . 
M 7 HOH 355 1055 1056 HOH HOH A . 
M 7 HOH 356 1056 1057 HOH HOH A . 
M 7 HOH 357 1057 1058 HOH HOH A . 
M 7 HOH 358 1058 1059 HOH HOH A . 
M 7 HOH 359 1059 1060 HOH HOH A . 
M 7 HOH 360 1060 1061 HOH HOH A . 
M 7 HOH 361 1061 1062 HOH HOH A . 
M 7 HOH 362 1062 1063 HOH HOH A . 
M 7 HOH 363 1063 1064 HOH HOH A . 
M 7 HOH 364 1064 1065 HOH HOH A . 
M 7 HOH 365 1065 1066 HOH HOH A . 
M 7 HOH 366 1066 1067 HOH HOH A . 
M 7 HOH 367 1067 1068 HOH HOH A . 
M 7 HOH 368 1068 1069 HOH HOH A . 
M 7 HOH 369 1069 1070 HOH HOH A . 
M 7 HOH 370 1070 1071 HOH HOH A . 
M 7 HOH 371 1071 1072 HOH HOH A . 
M 7 HOH 372 1072 1073 HOH HOH A . 
M 7 HOH 373 1073 1074 HOH HOH A . 
M 7 HOH 374 1074 1075 HOH HOH A . 
M 7 HOH 375 1075 1076 HOH HOH A . 
M 7 HOH 376 1076 1077 HOH HOH A . 
M 7 HOH 377 1077 1078 HOH HOH A . 
M 7 HOH 378 1078 1079 HOH HOH A . 
M 7 HOH 379 1079 1080 HOH HOH A . 
M 7 HOH 380 1080 1081 HOH HOH A . 
M 7 HOH 381 1081 1082 HOH HOH A . 
M 7 HOH 382 1082 1084 HOH HOH A . 
M 7 HOH 383 1083 1085 HOH HOH A . 
M 7 HOH 384 1084 1086 HOH HOH A . 
M 7 HOH 385 1085 1087 HOH HOH A . 
M 7 HOH 386 1086 1088 HOH HOH A . 
M 7 HOH 387 1087 1089 HOH HOH A . 
M 7 HOH 388 1088 1090 HOH HOH A . 
M 7 HOH 389 1089 1091 HOH HOH A . 
M 7 HOH 390 1090 1092 HOH HOH A . 
M 7 HOH 391 1091 1093 HOH HOH A . 
M 7 HOH 392 1092 1094 HOH HOH A . 
M 7 HOH 393 1093 1095 HOH HOH A . 
M 7 HOH 394 1094 1096 HOH HOH A . 
M 7 HOH 395 1095 1097 HOH HOH A . 
M 7 HOH 396 1096 1098 HOH HOH A . 
M 7 HOH 397 1097 1099 HOH HOH A . 
M 7 HOH 398 1098 1100 HOH HOH A . 
M 7 HOH 399 1099 1101 HOH HOH A . 
M 7 HOH 400 1100 1102 HOH HOH A . 
M 7 HOH 401 1101 1103 HOH HOH A . 
M 7 HOH 402 1102 1105 HOH HOH A . 
M 7 HOH 403 1103 1106 HOH HOH A . 
M 7 HOH 404 1104 1107 HOH HOH A . 
M 7 HOH 405 1105 1108 HOH HOH A . 
M 7 HOH 406 1106 1109 HOH HOH A . 
M 7 HOH 407 1107 1110 HOH HOH A . 
M 7 HOH 408 1108 1111 HOH HOH A . 
M 7 HOH 409 1109 1112 HOH HOH A . 
M 7 HOH 410 1110 1113 HOH HOH A . 
M 7 HOH 411 1111 1114 HOH HOH A . 
M 7 HOH 412 1112 1115 HOH HOH A . 
M 7 HOH 413 1113 1116 HOH HOH A . 
M 7 HOH 414 1114 1117 HOH HOH A . 
M 7 HOH 415 1115 1118 HOH HOH A . 
M 7 HOH 416 1116 1119 HOH HOH A . 
M 7 HOH 417 1117 1120 HOH HOH A . 
M 7 HOH 418 1118 1121 HOH HOH A . 
M 7 HOH 419 1119 1122 HOH HOH A . 
M 7 HOH 420 1120 1123 HOH HOH A . 
M 7 HOH 421 1121 1124 HOH HOH A . 
M 7 HOH 422 1122 1125 HOH HOH A . 
M 7 HOH 423 1123 1126 HOH HOH A . 
M 7 HOH 424 1124 1127 HOH HOH A . 
M 7 HOH 425 1125 1128 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B NAG ? A NAG 601 ? NAG -D 
2 C FUC ? A FUC 602 ? FUC -L 
3 D NAG ? A NAG 603 ? NAG -D 
4 E NAG ? A NAG 604 ? NAG -D 
5 G MAN ? A MAN 606 ? MAN -D 
6 H NAG ? A NAG 607 ? NAG -D 
7 I NAG ? A NAG 608 ? NAG -D 
8 K MAN ? A MAN 610 ? MAN -D 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5420  ? 
1 MORE         40    ? 
1 'SSA (A^2)'  41430 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 5_557 x-y,-y,-z+8/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 365.0133333333 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1038 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   M 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2018-05-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0032 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? 7.0.7    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? 3.3.2.1  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.3.0    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 1025 ? ? O A HOH 1050 ? ? 1.42 
2 1 O A HOH 1052 ? ? O A HOH 1071 ? ? 1.59 
3 1 O A HOH 1030 ? ? O A HOH 1092 ? ? 1.96 
4 1 O A HOH 952  ? ? O A HOH 1034 ? ? 2.07 
5 1 O A HOH 1083 ? ? O A HOH 1104 ? ? 2.09 
6 1 O A HOH 985  ? ? O A HOH 1009 ? ? 2.12 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 1091 ? ? 1_555 O A HOH 1100 ? ? 2_745 2.01 
2 1 O A HOH 1064 ? ? 1_555 O A HOH 1095 ? ? 5_557 2.09 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 123.71 120.30 3.41  0.50 N 
2 1 NE A ARG 250 ? ? CZ A ARG 250 ? ? NH1 A ARG 250 ? ? 123.42 120.30 3.12  0.50 N 
3 1 NE A ARG 426 ? ? CZ A ARG 426 ? ? NH1 A ARG 426 ? ? 123.62 120.30 3.32  0.50 N 
4 1 NE A ARG 468 ? ? CZ A ARG 468 ? ? NH2 A ARG 468 ? ? 115.78 120.30 -4.52 0.50 N 
5 1 CA A LEU 494 ? ? CB A LEU 494 ? ? CG  A LEU 494 ? ? 131.17 115.30 15.87 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 24  ? ? 83.40   8.50    
2  1 PHE A 45  ? ? 81.24   -9.02   
3  1 ALA A 164 ? ? -151.86 65.66   
4  1 SER A 200 ? ? 64.45   -120.79 
5  1 GLU A 299 ? ? -119.04 -71.76  
6  1 THR A 317 ? ? -161.14 -161.07 
7  1 ASP A 380 ? ? -157.16 57.25   
8  1 VAL A 400 ? ? -129.71 -59.96  
9  1 ASN A 457 ? ? 71.08   32.79   
10 1 ASN A 506 ? ? -165.47 -169.04 
11 1 ARG A 515 ? ? 62.16   62.48   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 1123 ? 7.73 . 
2 1 O ? A HOH 1124 ? 8.02 . 
3 1 O ? A HOH 1125 ? 8.43 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 19  ? NE  ? A ARG 19  NE  
2  1 Y 1 A ARG 19  ? CZ  ? A ARG 19  CZ  
3  1 Y 1 A ARG 19  ? NH1 ? A ARG 19  NH1 
4  1 Y 1 A ARG 19  ? NH2 ? A ARG 19  NH2 
5  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
6  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
7  1 Y 1 A LYS 52  ? CE  ? A LYS 52  CE  
8  1 Y 1 A LYS 52  ? NZ  ? A LYS 52  NZ  
9  1 Y 1 A GLU 89  ? CD  ? A GLU 89  CD  
10 1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
11 1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
12 1 Y 1 A GLU 260 ? CD  ? A GLU 260 CD  
13 1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
14 1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
15 1 Y 1 A GLU 268 ? CD  ? A GLU 268 CD  
16 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
17 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
18 1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
19 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
20 1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
21 1 Y 1 A LYS 454 ? CG  ? A LYS 454 CG  
22 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
23 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
24 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
25 1 Y 1 A HIS 486 ? CG  ? A HIS 486 CG  
26 1 Y 1 A HIS 486 ? ND1 ? A HIS 486 ND1 
27 1 Y 1 A HIS 486 ? CD2 ? A HIS 486 CD2 
28 1 Y 1 A HIS 486 ? CE1 ? A HIS 486 CE1 
29 1 Y 1 A HIS 486 ? NE2 ? A HIS 486 NE2 
30 1 Y 1 A SER 487 ? OG  ? A SER 487 OG  
31 1 Y 1 A GLN 488 ? CG  ? A GLN 488 CG  
32 1 Y 1 A GLN 488 ? CD  ? A GLN 488 CD  
33 1 Y 1 A GLN 488 ? OE1 ? A GLN 488 OE1 
34 1 Y 1 A GLN 488 ? NE2 ? A GLN 488 NE2 
35 1 Y 1 A LYS 491 ? CE  ? A LYS 491 CE  
36 1 Y 1 A LYS 491 ? NZ  ? A LYS 491 NZ  
37 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
38 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A ALA 536 ? A ALA 536 
5  1 Y 1 A CYS 537 ? A CYS 537 
6  1 Y 1 A ASP 538 ? A ASP 538 
7  1 Y 1 A GLY 539 ? A GLY 539 
8  1 Y 1 A GLU 540 ? A GLU 540 
9  1 Y 1 A LEU 541 ? A LEU 541 
10 1 Y 1 A SER 542 ? A SER 542 
11 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE                                                                    NAG 
3 ALPHA-L-FUCOSE                                                                            FUC 
4 BETA-D-MANNOSE                                                                            BMA 
5 ALPHA-D-MANNOSE                                                                           MAN 
6 '(2~{E})-5,6-dimethoxy-2-[[1-(phenylmethyl)piperidin-4-yl]methylidene]-3~{H}-inden-1-one' DZ7 
7 water                                                                                     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#