data_5NJ8
# 
_entry.id   5NJ8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NJ8         
WWPDB D_1200004209 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NJ8 
_pdbx_database_status.recvd_initial_deposition_date   2017-03-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Daumke, O.'    1 ? 
'Schulte, K.W.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                1025 
_citation.page_last                 1033.e3 
_citation.title                     'Structural Basis for Aryl Hydrocarbon Receptor-Mediated Gene Activation.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2017.05.008 
_citation.pdbx_database_id_PubMed   28602820 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schulte, K.W.' 1 ? 
primary 'Green, E.'     2 ? 
primary 'Wilz, A.'      3 ? 
primary 'Platten, M.'   4 ? 
primary 'Daumke, O.'    5 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NJ8 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     91.321 
_cell.length_a_esd                 ? 
_cell.length_b                     91.321 
_cell.length_b_esd                 ? 
_cell.length_c                     464.914 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NJ8 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Aryl hydrocarbon receptor'                          28423.416 2  ? ?     ? ?                              
2 polymer     man 'Aryl hydrocarbon receptor nuclear translocator'     26467.090 2  ? C256S ? 'internal deletion of 274-301' 
3 polymer     syn 
;DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3')
;
3632.382  2  ? ?     ? 'Dioxin response element'      
4 polymer     syn 
;DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3')
;
3694.402  2  ? ?     ? 'Dioxin response element'      
5 non-polymer syn 'ERBIUM (III) ION'                                   167.259   12 ? ?     ? ?                              
6 non-polymer syn 'ACETATE ION'                                        59.044    1  ? ?     ? ?                              
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'AhR,Class E basic helix-loop-helix protein 76,bHLHe76'                                       
2 'ARNT protein,Dioxin receptor,nuclear translocator,Hypoxia-inducible factor 1-beta,HIF1-beta' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPMVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQD
NCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALN
PSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSIL
PPQLALFAIATPLQ
;
;GPMVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQD
NCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALN
PSQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSIL
PPQLALFAIATPLQ
;
A,C ? 
2 'polypeptide(L)'        no no 
;GPGSDADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSF
LTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLD
LKTGTVKKEGQQSSMRMSMGSRRSFICRMRCGTSSHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQV
;
;GPGSDADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSF
LTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLD
LKTGTVKKEGQQSSMRMSMGSRRSFICRMRCGTSSHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQV
;
B,D ? 
3 polydeoxyribonucleotide no no '(DG)(DG)(DT)(DC)(DA)(DC)(DG)(DC)(DA)(DA)(DC)(DC)' GGTCACGCAACC E,G ? 
4 polydeoxyribonucleotide no no '(DG)(DG)(DT)(DT)(DG)(DC)(DG)(DT)(DG)(DA)(DC)(DC)' GGTTGCGTGACC F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   MET n 
1 4   VAL n 
1 5   LYS n 
1 6   PRO n 
1 7   ILE n 
1 8   PRO n 
1 9   ALA n 
1 10  GLU n 
1 11  GLY n 
1 12  ILE n 
1 13  LYS n 
1 14  SER n 
1 15  ASN n 
1 16  PRO n 
1 17  SER n 
1 18  LYS n 
1 19  ARG n 
1 20  HIS n 
1 21  ARG n 
1 22  ASP n 
1 23  ARG n 
1 24  LEU n 
1 25  ASN n 
1 26  THR n 
1 27  GLU n 
1 28  LEU n 
1 29  ASP n 
1 30  ARG n 
1 31  LEU n 
1 32  ALA n 
1 33  SER n 
1 34  LEU n 
1 35  LEU n 
1 36  PRO n 
1 37  PHE n 
1 38  PRO n 
1 39  GLN n 
1 40  ASP n 
1 41  VAL n 
1 42  ILE n 
1 43  ASN n 
1 44  LYS n 
1 45  LEU n 
1 46  ASP n 
1 47  LYS n 
1 48  LEU n 
1 49  SER n 
1 50  VAL n 
1 51  LEU n 
1 52  ARG n 
1 53  LEU n 
1 54  SER n 
1 55  VAL n 
1 56  SER n 
1 57  TYR n 
1 58  LEU n 
1 59  ARG n 
1 60  ALA n 
1 61  LYS n 
1 62  SER n 
1 63  PHE n 
1 64  PHE n 
1 65  ASP n 
1 66  VAL n 
1 67  ALA n 
1 68  LEU n 
1 69  LYS n 
1 70  SER n 
1 71  SER n 
1 72  PRO n 
1 73  THR n 
1 74  GLU n 
1 75  ARG n 
1 76  ASN n 
1 77  GLY n 
1 78  GLY n 
1 79  GLN n 
1 80  ASP n 
1 81  ASN n 
1 82  CYS n 
1 83  ARG n 
1 84  ALA n 
1 85  ALA n 
1 86  ASN n 
1 87  PHE n 
1 88  ARG n 
1 89  GLU n 
1 90  GLY n 
1 91  LEU n 
1 92  ASN n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  GLY n 
1 97  GLU n 
1 98  PHE n 
1 99  LEU n 
1 100 LEU n 
1 101 GLN n 
1 102 ALA n 
1 103 LEU n 
1 104 ASN n 
1 105 GLY n 
1 106 PHE n 
1 107 VAL n 
1 108 LEU n 
1 109 VAL n 
1 110 VAL n 
1 111 THR n 
1 112 THR n 
1 113 ASP n 
1 114 ALA n 
1 115 LEU n 
1 116 VAL n 
1 117 PHE n 
1 118 TYR n 
1 119 ALA n 
1 120 SER n 
1 121 SER n 
1 122 THR n 
1 123 ILE n 
1 124 GLN n 
1 125 ASP n 
1 126 TYR n 
1 127 LEU n 
1 128 GLY n 
1 129 PHE n 
1 130 GLN n 
1 131 GLN n 
1 132 SER n 
1 133 ASP n 
1 134 VAL n 
1 135 ILE n 
1 136 HIS n 
1 137 GLN n 
1 138 SER n 
1 139 VAL n 
1 140 TYR n 
1 141 GLU n 
1 142 LEU n 
1 143 ILE n 
1 144 HIS n 
1 145 THR n 
1 146 GLU n 
1 147 ASP n 
1 148 ARG n 
1 149 ALA n 
1 150 GLU n 
1 151 PHE n 
1 152 GLN n 
1 153 ARG n 
1 154 GLN n 
1 155 LEU n 
1 156 HIS n 
1 157 TRP n 
1 158 ALA n 
1 159 LEU n 
1 160 ASN n 
1 161 PRO n 
1 162 SER n 
1 163 GLN n 
1 164 CYS n 
1 165 THR n 
1 166 GLU n 
1 167 SER n 
1 168 GLY n 
1 169 GLN n 
1 170 GLY n 
1 171 ILE n 
1 172 GLU n 
1 173 GLU n 
1 174 ALA n 
1 175 THR n 
1 176 GLY n 
1 177 LEU n 
1 178 PRO n 
1 179 GLN n 
1 180 THR n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 TYR n 
1 185 ASN n 
1 186 PRO n 
1 187 ASP n 
1 188 GLN n 
1 189 ILE n 
1 190 PRO n 
1 191 PRO n 
1 192 GLU n 
1 193 ASN n 
1 194 SER n 
1 195 PRO n 
1 196 LEU n 
1 197 MET n 
1 198 GLU n 
1 199 ARG n 
1 200 CYS n 
1 201 PHE n 
1 202 ILE n 
1 203 CYS n 
1 204 ARG n 
1 205 LEU n 
1 206 ARG n 
1 207 CYS n 
1 208 LEU n 
1 209 LEU n 
1 210 ASP n 
1 211 ASN n 
1 212 SER n 
1 213 SER n 
1 214 GLY n 
1 215 PHE n 
1 216 LEU n 
1 217 ALA n 
1 218 MET n 
1 219 ASN n 
1 220 PHE n 
1 221 GLN n 
1 222 GLY n 
1 223 LYS n 
1 224 LEU n 
1 225 LYS n 
1 226 TYR n 
1 227 LEU n 
1 228 HIS n 
1 229 GLY n 
1 230 GLN n 
1 231 LYS n 
1 232 LYS n 
1 233 LYS n 
1 234 GLY n 
1 235 LYS n 
1 236 ASP n 
1 237 GLY n 
1 238 SER n 
1 239 ILE n 
1 240 LEU n 
1 241 PRO n 
1 242 PRO n 
1 243 GLN n 
1 244 LEU n 
1 245 ALA n 
1 246 LEU n 
1 247 PHE n 
1 248 ALA n 
1 249 ILE n 
1 250 ALA n 
1 251 THR n 
1 252 PRO n 
1 253 LEU n 
1 254 GLN n 
2 1   GLY n 
2 2   PRO n 
2 3   GLY n 
2 4   SER n 
2 5   ASP n 
2 6   ALA n 
2 7   ASP n 
2 8   LYS n 
2 9   GLU n 
2 10  ARG n 
2 11  LEU n 
2 12  ALA n 
2 13  ARG n 
2 14  GLU n 
2 15  ASN n 
2 16  HIS n 
2 17  SER n 
2 18  GLU n 
2 19  ILE n 
2 20  GLU n 
2 21  ARG n 
2 22  ARG n 
2 23  ARG n 
2 24  ARG n 
2 25  ASN n 
2 26  LYS n 
2 27  MET n 
2 28  THR n 
2 29  ALA n 
2 30  TYR n 
2 31  ILE n 
2 32  THR n 
2 33  GLU n 
2 34  LEU n 
2 35  SER n 
2 36  ASP n 
2 37  MET n 
2 38  VAL n 
2 39  PRO n 
2 40  THR n 
2 41  CYS n 
2 42  SER n 
2 43  ALA n 
2 44  LEU n 
2 45  ALA n 
2 46  ARG n 
2 47  LYS n 
2 48  PRO n 
2 49  ASP n 
2 50  LYS n 
2 51  LEU n 
2 52  THR n 
2 53  ILE n 
2 54  LEU n 
2 55  ARG n 
2 56  MET n 
2 57  ALA n 
2 58  VAL n 
2 59  SER n 
2 60  HIS n 
2 61  MET n 
2 62  LYS n 
2 63  SER n 
2 64  LEU n 
2 65  ARG n 
2 66  GLY n 
2 67  THR n 
2 68  GLY n 
2 69  ASN n 
2 70  THR n 
2 71  SER n 
2 72  THR n 
2 73  ASP n 
2 74  GLY n 
2 75  SER n 
2 76  TYR n 
2 77  LYS n 
2 78  PRO n 
2 79  SER n 
2 80  PHE n 
2 81  LEU n 
2 82  THR n 
2 83  ASP n 
2 84  GLN n 
2 85  GLU n 
2 86  LEU n 
2 87  LYS n 
2 88  HIS n 
2 89  LEU n 
2 90  ILE n 
2 91  LEU n 
2 92  GLU n 
2 93  ALA n 
2 94  ALA n 
2 95  ASP n 
2 96  GLY n 
2 97  PHE n 
2 98  LEU n 
2 99  PHE n 
2 100 ILE n 
2 101 VAL n 
2 102 SER n 
2 103 CYS n 
2 104 GLU n 
2 105 THR n 
2 106 GLY n 
2 107 ARG n 
2 108 VAL n 
2 109 VAL n 
2 110 TYR n 
2 111 VAL n 
2 112 SER n 
2 113 ASP n 
2 114 SER n 
2 115 VAL n 
2 116 THR n 
2 117 PRO n 
2 118 VAL n 
2 119 LEU n 
2 120 ASN n 
2 121 GLN n 
2 122 PRO n 
2 123 GLN n 
2 124 SER n 
2 125 GLU n 
2 126 TRP n 
2 127 PHE n 
2 128 GLY n 
2 129 SER n 
2 130 THR n 
2 131 LEU n 
2 132 TYR n 
2 133 ASP n 
2 134 GLN n 
2 135 VAL n 
2 136 HIS n 
2 137 PRO n 
2 138 ASP n 
2 139 ASP n 
2 140 VAL n 
2 141 ASP n 
2 142 LYS n 
2 143 LEU n 
2 144 ARG n 
2 145 GLU n 
2 146 GLN n 
2 147 LEU n 
2 148 SER n 
2 149 THR n 
2 150 SER n 
2 151 GLU n 
2 152 ASN n 
2 153 ALA n 
2 154 LEU n 
2 155 THR n 
2 156 GLY n 
2 157 ARG n 
2 158 VAL n 
2 159 LEU n 
2 160 ASP n 
2 161 LEU n 
2 162 LYS n 
2 163 THR n 
2 164 GLY n 
2 165 THR n 
2 166 VAL n 
2 167 LYS n 
2 168 LYS n 
2 169 GLU n 
2 170 GLY n 
2 171 GLN n 
2 172 GLN n 
2 173 SER n 
2 174 SER n 
2 175 MET n 
2 176 ARG n 
2 177 MET n 
2 178 SER n 
2 179 MET n 
2 180 GLY n 
2 181 SER n 
2 182 ARG n 
2 183 ARG n 
2 184 SER n 
2 185 PHE n 
2 186 ILE n 
2 187 CYS n 
2 188 ARG n 
2 189 MET n 
2 190 ARG n 
2 191 CYS n 
2 192 GLY n 
2 193 THR n 
2 194 SER n 
2 195 SER n 
2 196 HIS n 
2 197 PHE n 
2 198 VAL n 
2 199 VAL n 
2 200 VAL n 
2 201 HIS n 
2 202 CYS n 
2 203 THR n 
2 204 GLY n 
2 205 TYR n 
2 206 ILE n 
2 207 LYS n 
2 208 ALA n 
2 209 TRP n 
2 210 PRO n 
2 211 PRO n 
2 212 ALA n 
2 213 GLY n 
2 214 VAL n 
2 215 SER n 
2 216 LEU n 
2 217 PRO n 
2 218 ASP n 
2 219 ASP n 
2 220 ASP n 
2 221 PRO n 
2 222 GLU n 
2 223 ALA n 
2 224 GLY n 
2 225 GLN n 
2 226 GLY n 
2 227 SER n 
2 228 LYS n 
2 229 PHE n 
2 230 CYS n 
2 231 LEU n 
2 232 VAL n 
2 233 ALA n 
2 234 ILE n 
2 235 GLY n 
2 236 ARG n 
2 237 LEU n 
2 238 GLN n 
2 239 VAL n 
3 1   DG  n 
3 2   DG  n 
3 3   DT  n 
3 4   DC  n 
3 5   DA  n 
3 6   DC  n 
3 7   DG  n 
3 8   DC  n 
3 9   DA  n 
3 10  DA  n 
3 11  DC  n 
3 12  DC  n 
4 1   DG  n 
4 2   DG  n 
4 3   DT  n 
4 4   DT  n 
4 5   DG  n 
4 6   DC  n 
4 7   DG  n 
4 8   DT  n 
4 9   DG  n 
4 10  DA  n 
4 11  DC  n 
4 12  DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 254 Human ? 'AHR, BHLHE76' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? Rosette ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 239 Mouse ? Arnt           ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562    ? ? ? ? ? ? ? ?       ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 12 'Homo sapiens' Human 9606 ? 
4 1 sample 1 12 'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP AHR_HUMAN  P35869 ? 1 
;VKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCR
AANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQ
CTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQ
LALFAIATPLQ
;
23 
2 UNP ARNT_MOUSE P53762 ? 2 
;DKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQEL
KHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLKTGTV
KKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGEPHFVVVHCTGYIKAWPPAGVSLPD
DDPEAGQGSKFCLVAIGRLQV
;
85 
3 PDB 5NJ8       5NJ8   ? 3 ? 1  
4 PDB 5NJ8       5NJ8   ? 4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5NJ8 A 4 ? 254 ? P35869 23 ? 273 ? 23 273 
2 2 5NJ8 B 7 ? 239 ? P53762 85 ? 345 ? 85 345 
3 1 5NJ8 C 4 ? 254 ? P35869 23 ? 273 ? 23 273 
4 2 5NJ8 D 7 ? 239 ? P53762 85 ? 345 ? 85 345 
5 3 5NJ8 E 1 ? 12  ? 5NJ8   1  ? 12  ? 1  12  
6 4 5NJ8 F 1 ? 12  ? 5NJ8   1  ? 12  ? 1  12  
7 3 5NJ8 G 1 ? 12  ? 5NJ8   1  ? 12  ? 1  12  
8 4 5NJ8 H 1 ? 12  ? 5NJ8   1  ? 12  ? 1  12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5NJ8 GLY A 1   ? UNP P35869 ?   ?   'expression tag'      20  1  
1 5NJ8 PRO A 2   ? UNP P35869 ?   ?   'expression tag'      21  2  
1 5NJ8 MET A 3   ? UNP P35869 ?   ?   'expression tag'      22  3  
2 5NJ8 GLY B 1   ? UNP P53762 ?   ?   'expression tag'      79  4  
2 5NJ8 PRO B 2   ? UNP P53762 ?   ?   'expression tag'      80  5  
2 5NJ8 GLY B 3   ? UNP P53762 ?   ?   'expression tag'      81  6  
2 5NJ8 SER B 4   ? UNP P53762 ?   ?   'expression tag'      82  7  
2 5NJ8 ASP B 5   ? UNP P53762 ?   ?   'expression tag'      83  8  
2 5NJ8 ALA B 6   ? UNP P53762 ?   ?   'expression tag'      84  9  
2 5NJ8 SER B 178 ? UNP P53762 CYS 256 'engineered mutation' 256 10 
2 5NJ8 ?   B ?   ? UNP P53762 VAL 274 deletion              ?   11 
2 5NJ8 ?   B ?   ? UNP P53762 ASP 275 deletion              ?   12 
2 5NJ8 ?   B ?   ? UNP P53762 PRO 276 deletion              ?   13 
2 5NJ8 ?   B ?   ? UNP P53762 VAL 277 deletion              ?   14 
2 5NJ8 ?   B ?   ? UNP P53762 SER 278 deletion              ?   15 
2 5NJ8 ?   B ?   ? UNP P53762 MET 279 deletion              ?   16 
2 5NJ8 ?   B ?   ? UNP P53762 ASN 280 deletion              ?   17 
2 5NJ8 ?   B ?   ? UNP P53762 ARG 281 deletion              ?   18 
2 5NJ8 ?   B ?   ? UNP P53762 LEU 282 deletion              ?   19 
2 5NJ8 ?   B ?   ? UNP P53762 SER 283 deletion              ?   20 
2 5NJ8 ?   B ?   ? UNP P53762 PHE 284 deletion              ?   21 
2 5NJ8 ?   B ?   ? UNP P53762 LEU 285 deletion              ?   22 
2 5NJ8 ?   B ?   ? UNP P53762 ARG 286 deletion              ?   23 
2 5NJ8 ?   B ?   ? UNP P53762 ASN 287 deletion              ?   24 
2 5NJ8 ?   B ?   ? UNP P53762 ARG 288 deletion              ?   25 
2 5NJ8 ?   B ?   ? UNP P53762 CYS 289 deletion              ?   26 
2 5NJ8 ?   B ?   ? UNP P53762 ARG 290 deletion              ?   27 
2 5NJ8 ?   B ?   ? UNP P53762 ASN 291 deletion              ?   28 
2 5NJ8 ?   B ?   ? UNP P53762 GLY 292 deletion              ?   29 
2 5NJ8 ?   B ?   ? UNP P53762 LEU 293 deletion              ?   30 
2 5NJ8 ?   B ?   ? UNP P53762 GLY 294 deletion              ?   31 
2 5NJ8 ?   B ?   ? UNP P53762 SER 295 deletion              ?   32 
2 5NJ8 ?   B ?   ? UNP P53762 VAL 296 deletion              ?   33 
2 5NJ8 ?   B ?   ? UNP P53762 LYS 297 deletion              ?   34 
2 5NJ8 ?   B ?   ? UNP P53762 GLU 298 deletion              ?   35 
2 5NJ8 ?   B ?   ? UNP P53762 GLY 299 deletion              ?   36 
2 5NJ8 ?   B ?   ? UNP P53762 GLU 300 deletion              ?   37 
2 5NJ8 ?   B ?   ? UNP P53762 PRO 301 deletion              ?   38 
3 5NJ8 GLY C 1   ? UNP P35869 ?   ?   'expression tag'      20  39 
3 5NJ8 PRO C 2   ? UNP P35869 ?   ?   'expression tag'      21  40 
3 5NJ8 MET C 3   ? UNP P35869 ?   ?   'expression tag'      22  41 
4 5NJ8 GLY D 1   ? UNP P53762 ?   ?   'expression tag'      79  42 
4 5NJ8 PRO D 2   ? UNP P53762 ?   ?   'expression tag'      80  43 
4 5NJ8 GLY D 3   ? UNP P53762 ?   ?   'expression tag'      81  44 
4 5NJ8 SER D 4   ? UNP P53762 ?   ?   'expression tag'      82  45 
4 5NJ8 ASP D 5   ? UNP P53762 ?   ?   'expression tag'      83  46 
4 5NJ8 ALA D 6   ? UNP P53762 ?   ?   'expression tag'      84  47 
4 5NJ8 SER D 178 ? UNP P53762 CYS 256 'engineered mutation' 256 48 
4 5NJ8 ?   D ?   ? UNP P53762 VAL 274 deletion              ?   49 
4 5NJ8 ?   D ?   ? UNP P53762 ASP 275 deletion              ?   50 
4 5NJ8 ?   D ?   ? UNP P53762 PRO 276 deletion              ?   51 
4 5NJ8 ?   D ?   ? UNP P53762 VAL 277 deletion              ?   52 
4 5NJ8 ?   D ?   ? UNP P53762 SER 278 deletion              ?   53 
4 5NJ8 ?   D ?   ? UNP P53762 MET 279 deletion              ?   54 
4 5NJ8 ?   D ?   ? UNP P53762 ASN 280 deletion              ?   55 
4 5NJ8 ?   D ?   ? UNP P53762 ARG 281 deletion              ?   56 
4 5NJ8 ?   D ?   ? UNP P53762 LEU 282 deletion              ?   57 
4 5NJ8 ?   D ?   ? UNP P53762 SER 283 deletion              ?   58 
4 5NJ8 ?   D ?   ? UNP P53762 PHE 284 deletion              ?   59 
4 5NJ8 ?   D ?   ? UNP P53762 LEU 285 deletion              ?   60 
4 5NJ8 ?   D ?   ? UNP P53762 ARG 286 deletion              ?   61 
4 5NJ8 ?   D ?   ? UNP P53762 ASN 287 deletion              ?   62 
4 5NJ8 ?   D ?   ? UNP P53762 ARG 288 deletion              ?   63 
4 5NJ8 ?   D ?   ? UNP P53762 CYS 289 deletion              ?   64 
4 5NJ8 ?   D ?   ? UNP P53762 ARG 290 deletion              ?   65 
4 5NJ8 ?   D ?   ? UNP P53762 ASN 291 deletion              ?   66 
4 5NJ8 ?   D ?   ? UNP P53762 GLY 292 deletion              ?   67 
4 5NJ8 ?   D ?   ? UNP P53762 LEU 293 deletion              ?   68 
4 5NJ8 ?   D ?   ? UNP P53762 GLY 294 deletion              ?   69 
4 5NJ8 ?   D ?   ? UNP P53762 SER 295 deletion              ?   70 
4 5NJ8 ?   D ?   ? UNP P53762 VAL 296 deletion              ?   71 
4 5NJ8 ?   D ?   ? UNP P53762 LYS 297 deletion              ?   72 
4 5NJ8 ?   D ?   ? UNP P53762 GLU 298 deletion              ?   73 
4 5NJ8 ?   D ?   ? UNP P53762 GLY 299 deletion              ?   74 
4 5NJ8 ?   D ?   ? UNP P53762 GLU 300 deletion              ?   75 
4 5NJ8 ?   D ?   ? UNP P53762 PRO 301 deletion              ?   76 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                        ? 'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
ER3 non-polymer         . 'ERBIUM (III) ION'                   ? 'Er 3'            167.259 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NJ8 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.0 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         39 
_exptl_crystal.description                 Plates 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10 mM HEPES/NaOH pH 6.8, 18% PEG3350, 200 mM ammonium formate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      MIRRORS 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-08-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si111-DCM with sagital bender' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.476 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.476 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_synchrotron_site       BESSY 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5NJ8 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.3 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       32653 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3 
_reflns.percent_possible_obs             98.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  18.0 
_reflns.pdbx_Rmerge_I_obs                0.078 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.098 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.82 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.3 
_reflns_shell.d_res_low                   3.49 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         4.11 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5197 
_reflns_shell.percent_possible_all        98.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.662 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             16.5 
_reflns_shell.pdbx_Rsym_value             0.683 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.979 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5NJ8 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.300 
_refine.ls_d_res_low                             46.830 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18323 
_refine.ls_number_reflns_R_free                  917 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.46 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2942 
_refine.ls_R_factor_R_free                       0.3327 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2921 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.39 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 35.16 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.56 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4864 
_refine_hist.pdbx_number_atoms_nucleic_acid   968 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5848 
_refine_hist.d_res_high                       3.300 
_refine_hist.d_res_low                        46.830 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 6042 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.678  ? 8337 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.888 ? 3448 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 981  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 908  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.3001 3.4740  . . 124 2352 98.00  . . . 0.4147 . 0.3163 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4740 3.6916  . . 125 2385 98.00  . . . 0.3621 . 0.3246 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6916 3.9765  . . 130 2451 100.00 . . . 0.3985 . 0.3184 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9765 4.3764  . . 129 2452 100.00 . . . 0.3353 . 0.2850 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3764 5.0091  . . 130 2479 100.00 . . . 0.3325 . 0.2715 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0091 6.3085  . . 134 2536 100.00 . . . 0.3318 . 0.2990 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3085 46.8351 . . 145 2751 100.00 . . . 0.2952 . 0.2821 . . . . . . . . . . 
# 
_struct.entry_id                     5NJ8 
_struct.title                        'Structural basis for aryl hydrocarbon receptor mediated gene activation' 
_struct.pdbx_descriptor              'Aryl hydrocarbon receptor, Aryl hydrocarbon receptor nuclear translocator/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NJ8 
_struct_keywords.text            'basic helix loop helix PAS domain transcription factor, transcription' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 15  ? LEU A 34  ? ASN A 34  LEU A 53  1 ? 20 
HELX_P HELX_P2  AA2 PRO A 38  ? ASN A 43  ? PRO A 57  ASN A 62  1 ? 6  
HELX_P HELX_P3  AA3 ASP A 46  ? LEU A 68  ? ASP A 65  LEU A 87  1 ? 23 
HELX_P HELX_P4  AA4 LEU A 93  ? LEU A 103 ? LEU A 112 LEU A 122 1 ? 11 
HELX_P HELX_P5  AA5 THR A 122 ? GLY A 128 ? THR A 141 GLY A 147 1 ? 7  
HELX_P HELX_P6  AA6 GLN A 130 ? VAL A 134 ? GLN A 149 VAL A 153 5 ? 5  
HELX_P HELX_P7  AA7 SER A 138 ? ILE A 143 ? SER A 157 ILE A 162 5 ? 6  
HELX_P HELX_P8  AA8 HIS A 144 ? HIS A 156 ? HIS A 163 HIS A 175 1 ? 13 
HELX_P HELX_P9  AA9 LYS B 8   ? SER B 35  ? LYS B 86  SER B 113 1 ? 28 
HELX_P HELX_P10 AB1 ASP B 49  ? ARG B 65  ? ASP B 127 ARG B 143 1 ? 17 
HELX_P HELX_P11 AB2 THR B 82  ? ALA B 94  ? THR B 160 ALA B 172 1 ? 13 
HELX_P HELX_P12 AB3 ASP B 113 ? THR B 116 ? ASP B 191 THR B 194 5 ? 4  
HELX_P HELX_P13 AB4 THR B 130 ? VAL B 135 ? THR B 208 VAL B 213 5 ? 6  
HELX_P HELX_P14 AB5 HIS B 136 ? ASP B 138 ? HIS B 214 ASP B 216 5 ? 3  
HELX_P HELX_P15 AB6 ASP B 139 ? GLU B 145 ? ASP B 217 GLU B 223 1 ? 7  
HELX_P HELX_P16 AB7 ASN C 15  ? LEU C 34  ? ASN C 34  LEU C 53  1 ? 20 
HELX_P HELX_P17 AB8 PRO C 38  ? ASN C 43  ? PRO C 57  ASN C 62  1 ? 6  
HELX_P HELX_P18 AB9 ASP C 46  ? LYS C 69  ? ASP C 65  LYS C 88  1 ? 24 
HELX_P HELX_P19 AC1 GLY C 90  ? LEU C 103 ? GLY C 109 LEU C 122 1 ? 14 
HELX_P HELX_P20 AC2 THR C 122 ? LEU C 127 ? THR C 141 LEU C 146 1 ? 6  
HELX_P HELX_P21 AC3 GLN C 130 ? ILE C 135 ? GLN C 149 ILE C 154 1 ? 6  
HELX_P HELX_P22 AC4 SER C 138 ? ILE C 143 ? SER C 157 ILE C 162 5 ? 6  
HELX_P HELX_P23 AC5 HIS C 144 ? GLN C 154 ? HIS C 163 GLN C 173 1 ? 11 
HELX_P HELX_P24 AC6 LYS D 8   ? VAL D 38  ? LYS D 86  VAL D 116 1 ? 31 
HELX_P HELX_P25 AC7 VAL D 38  ? ALA D 43  ? VAL D 116 ALA D 121 1 ? 6  
HELX_P HELX_P26 AC8 ASP D 49  ? ARG D 65  ? ASP D 127 ARG D 143 1 ? 17 
HELX_P HELX_P27 AC9 THR D 82  ? ASP D 95  ? THR D 160 ASP D 173 1 ? 14 
HELX_P HELX_P28 AD1 SER D 112 ? THR D 116 ? SER D 190 THR D 194 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 46  OD2 ? ? ? 1_555 L ER3 .  ER  ? ? A ASP 65  A ER3 304 1_555 ? ? ? ? ? ? ?                       2.757 
? 
metalc2  metalc ? ? A LEU 93  O   ? ? ? 1_555 J ER3 .  ER  ? ? A LEU 112 A ER3 302 1_555 ? ? ? ? ? ? ?                       2.659 
? 
metalc3  metalc ? ? A GLU 97  OE1 ? ? ? 1_555 J ER3 .  ER  ? ? A GLU 116 A ER3 302 1_555 ? ? ? ? ? ? ?                       3.178 
? 
metalc4  metalc ? ? A GLU 146 OE1 ? ? ? 1_555 I ER3 .  ER  ? ? A GLU 165 A ER3 301 1_555 ? ? ? ? ? ? ?                       2.703 
? 
metalc5  metalc ? ? A GLU 146 OE2 ? ? ? 1_555 I ER3 .  ER  ? ? A GLU 165 A ER3 301 1_555 ? ? ? ? ? ? ?                       2.683 
? 
metalc6  metalc ? ? B GLU 9   OE1 ? ? ? 1_555 O ER3 .  ER  ? ? B GLU 87  B ER3 403 1_555 ? ? ? ? ? ? ?                       2.719 
? 
metalc7  metalc ? ? B GLU 9   OE2 ? ? ? 1_555 O ER3 .  ER  ? ? B GLU 87  B ER3 403 1_555 ? ? ? ? ? ? ?                       2.722 
? 
metalc8  metalc ? ? B ASP 83  OD1 ? ? ? 1_555 J ER3 .  ER  ? ? B ASP 161 A ER3 302 1_555 ? ? ? ? ? ? ?                       2.621 
? 
metalc9  metalc ? ? B ASP 83  OD2 ? ? ? 1_555 J ER3 .  ER  ? ? B ASP 161 A ER3 302 1_555 ? ? ? ? ? ? ?                       2.662 
? 
metalc10 metalc ? ? B ASP 95  OD1 ? ? ? 1_555 N ER3 .  ER  ? ? B ASP 173 B ER3 402 1_555 ? ? ? ? ? ? ?                       2.637 
? 
metalc11 metalc ? ? B ASP 95  OD2 ? ? ? 1_555 N ER3 .  ER  ? ? B ASP 173 B ER3 402 1_555 ? ? ? ? ? ? ?                       2.624 
? 
metalc12 metalc ? ? B GLU 125 OE1 ? ? ? 1_555 M ER3 .  ER  ? ? B GLU 203 B ER3 401 1_555 ? ? ? ? ? ? ?                       2.742 
? 
metalc13 metalc ? ? B ASP 220 OD1 ? ? ? 1_555 P ER3 .  ER  ? ? B ASP 326 B ER3 404 1_555 ? ? ? ? ? ? ?                       2.783 
? 
metalc14 metalc ? ? C ASP 46  OD2 ? ? ? 1_555 R ER3 .  ER  ? ? C ASP 65  C ER3 302 1_555 ? ? ? ? ? ? ?                       2.761 
? 
metalc15 metalc ? ? C LEU 93  O   ? ? ? 1_555 P ER3 .  ER  ? ? C LEU 112 B ER3 404 1_555 ? ? ? ? ? ? ?                       2.659 
? 
metalc16 metalc ? ? C GLU 97  OE1 ? ? ? 1_555 P ER3 .  ER  ? ? C GLU 116 B ER3 404 1_555 ? ? ? ? ? ? ?                       2.610 
? 
metalc17 metalc ? ? C GLU 97  OE2 ? ? ? 1_555 P ER3 .  ER  ? ? C GLU 116 B ER3 404 1_555 ? ? ? ? ? ? ?                       2.705 
? 
metalc18 metalc ? ? C GLU 146 O   ? ? ? 1_555 Q ER3 .  ER  ? ? C GLU 165 C ER3 301 1_555 ? ? ? ? ? ? ?                       3.331 
? 
metalc19 metalc ? ? C GLU 150 OE1 ? ? ? 1_555 Q ER3 .  ER  ? ? C GLU 169 C ER3 301 1_555 ? ? ? ? ? ? ?                       2.701 
? 
metalc20 metalc ? ? C GLU 150 OE2 ? ? ? 1_555 Q ER3 .  ER  ? ? C GLU 169 C ER3 301 1_555 ? ? ? ? ? ? ?                       2.753 
? 
metalc21 metalc ? ? D ASP 83  OD1 ? ? ? 1_555 P ER3 .  ER  ? ? D ASP 161 B ER3 404 1_555 ? ? ? ? ? ? ?                       2.633 
? 
metalc22 metalc ? ? D ASP 83  OD2 ? ? ? 1_555 P ER3 .  ER  ? ? D ASP 161 B ER3 404 1_555 ? ? ? ? ? ? ?                       2.739 
? 
metalc23 metalc ? ? E DT  3   OP1 ? ? ? 1_555 L ER3 .  ER  ? ? E DT  3   A ER3 304 1_555 ? ? ? ? ? ? ?                       2.743 
? 
metalc24 metalc ? ? G DT  3   OP1 ? ? ? 1_555 R ER3 .  ER  ? ? G DT  3   C ER3 302 1_555 ? ? ? ? ? ? ?                       2.693 
? 
metalc25 metalc ? ? H DT  8   OP1 ? ? ? 1_555 U ER3 .  ER  ? ? H DT  8   H ER3 101 1_555 ? ? ? ? ? ? ?                       2.625 
? 
metalc26 metalc ? ? H DT  8   OP2 ? ? ? 1_555 U ER3 .  ER  ? ? H DT  8   H ER3 101 1_555 ? ? ? ? ? ? ?                       3.399 
? 
metalc27 metalc ? ? J ER3 .   ER  ? ? ? 1_555 K ACT .  OXT ? ? A ER3 302 A ACT 303 1_555 ? ? ? ? ? ? ?                       2.764 
? 
metalc28 metalc ? ? H DT  8   OP1 ? ? ? 1_555 U ER3 .  ER  ? ? H DT  8   H ER3 101 8_556 ? ? ? ? ? ? ?                       2.625 
? 
metalc29 metalc ? ? H DT  8   OP2 ? ? ? 1_555 U ER3 .  ER  ? ? H DT  8   H ER3 101 8_556 ? ? ? ? ? ? ?                       3.399 
? 
hydrog1  hydrog ? ? E DG  1   N1  ? ? ? 1_555 F DC  12 N3  ? ? E DG  1   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog2  hydrog ? ? E DG  1   N2  ? ? ? 1_555 F DC  12 O2  ? ? E DG  1   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog3  hydrog ? ? E DG  1   O6  ? ? ? 1_555 F DC  12 N4  ? ? E DG  1   F DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog4  hydrog ? ? E DG  2   N1  ? ? ? 1_555 F DC  11 N3  ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog5  hydrog ? ? E DG  2   N2  ? ? ? 1_555 F DC  11 O2  ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog6  hydrog ? ? E DG  2   O6  ? ? ? 1_555 F DC  11 N4  ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog7  hydrog ? ? E DT  3   N3  ? ? ? 1_555 F DA  10 N1  ? ? E DT  3   F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog8  hydrog ? ? E DT  3   O4  ? ? ? 1_555 F DA  10 N6  ? ? E DT  3   F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog9  hydrog ? ? E DC  4   N3  ? ? ? 1_555 F DG  9  N1  ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog10 hydrog ? ? E DC  4   N4  ? ? ? 1_555 F DG  9  O6  ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog11 hydrog ? ? E DC  4   O2  ? ? ? 1_555 F DG  9  N2  ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog12 hydrog ? ? E DA  5   N1  ? ? ? 1_555 F DT  8  N3  ? ? E DA  5   F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog13 hydrog ? ? E DA  5   N6  ? ? ? 1_555 F DT  8  O4  ? ? E DA  5   F DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog14 hydrog ? ? E DC  6   N3  ? ? ? 1_555 F DG  7  N1  ? ? E DC  6   F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog15 hydrog ? ? E DC  6   N4  ? ? ? 1_555 F DG  7  O6  ? ? E DC  6   F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog16 hydrog ? ? E DC  6   O2  ? ? ? 1_555 F DG  7  N2  ? ? E DC  6   F DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog17 hydrog ? ? E DG  7   N1  ? ? ? 1_555 F DC  6  N3  ? ? E DG  7   F DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog18 hydrog ? ? E DG  7   N2  ? ? ? 1_555 F DC  6  O2  ? ? E DG  7   F DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog19 hydrog ? ? E DG  7   O6  ? ? ? 1_555 F DC  6  N4  ? ? E DG  7   F DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog20 hydrog ? ? E DC  8   N3  ? ? ? 1_555 F DG  5  N1  ? ? E DC  8   F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog21 hydrog ? ? E DC  8   N4  ? ? ? 1_555 F DG  5  O6  ? ? E DC  8   F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog22 hydrog ? ? E DC  8   O2  ? ? ? 1_555 F DG  5  N2  ? ? E DC  8   F DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog23 hydrog ? ? E DA  9   N1  ? ? ? 1_555 F DT  4  N3  ? ? E DA  9   F DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog24 hydrog ? ? E DA  9   N6  ? ? ? 1_555 F DT  4  O4  ? ? E DA  9   F DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog25 hydrog ? ? E DA  10  N1  ? ? ? 1_555 F DT  3  N3  ? ? E DA  10  F DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog26 hydrog ? ? E DA  10  N6  ? ? ? 1_555 F DT  3  O4  ? ? E DA  10  F DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog27 hydrog ? ? E DC  11  N3  ? ? ? 1_555 F DG  2  N2  ? ? E DC  11  F DG  2   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog28 hydrog ? ? E DC  11  O2  ? ? ? 1_555 F DG  2  N1  ? ? E DC  11  F DG  2   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog29 hydrog ? ? E DC  12  N3  ? ? ? 1_555 F DG  1  N1  ? ? E DC  12  F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog30 hydrog ? ? E DC  12  N4  ? ? ? 1_555 F DG  1  O6  ? ? E DC  12  F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog31 hydrog ? ? E DC  12  O2  ? ? ? 1_555 F DG  1  N2  ? ? E DC  12  F DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog32 hydrog ? ? G DG  1   N1  ? ? ? 1_555 H DC  12 N3  ? ? G DG  1   H DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog33 hydrog ? ? G DG  1   N2  ? ? ? 1_555 H DC  12 O2  ? ? G DG  1   H DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog34 hydrog ? ? G DG  1   O6  ? ? ? 1_555 H DC  12 N4  ? ? G DG  1   H DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog35 hydrog ? ? G DG  2   N1  ? ? ? 1_555 H DC  11 N3  ? ? G DG  2   H DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog36 hydrog ? ? G DG  2   N2  ? ? ? 1_555 H DC  11 O2  ? ? G DG  2   H DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog37 hydrog ? ? G DG  2   O6  ? ? ? 1_555 H DC  11 N4  ? ? G DG  2   H DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog38 hydrog ? ? G DT  3   N3  ? ? ? 1_555 H DA  10 N1  ? ? G DT  3   H DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog39 hydrog ? ? G DT  3   O4  ? ? ? 1_555 H DA  10 N6  ? ? G DT  3   H DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog40 hydrog ? ? G DC  4   N3  ? ? ? 1_555 H DG  9  N1  ? ? G DC  4   H DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog41 hydrog ? ? G DC  4   N4  ? ? ? 1_555 H DG  9  O6  ? ? G DC  4   H DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog42 hydrog ? ? G DC  4   O2  ? ? ? 1_555 H DG  9  N2  ? ? G DC  4   H DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog43 hydrog ? ? G DA  5   N1  ? ? ? 1_555 H DT  8  N3  ? ? G DA  5   H DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog44 hydrog ? ? G DA  5   N6  ? ? ? 1_555 H DT  8  O4  ? ? G DA  5   H DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog45 hydrog ? ? G DC  6   N3  ? ? ? 1_555 H DG  7  N1  ? ? G DC  6   H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog46 hydrog ? ? G DC  6   N4  ? ? ? 1_555 H DG  7  O6  ? ? G DC  6   H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog47 hydrog ? ? G DC  6   O2  ? ? ? 1_555 H DG  7  N2  ? ? G DC  6   H DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog48 hydrog ? ? G DG  7   N1  ? ? ? 1_555 H DC  6  N3  ? ? G DG  7   H DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog49 hydrog ? ? G DG  7   N2  ? ? ? 1_555 H DC  6  O2  ? ? G DG  7   H DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog50 hydrog ? ? G DG  7   O6  ? ? ? 1_555 H DC  6  N4  ? ? G DG  7   H DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog51 hydrog ? ? G DC  8   N3  ? ? ? 1_555 H DG  5  N1  ? ? G DC  8   H DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog52 hydrog ? ? G DC  8   N4  ? ? ? 1_555 H DG  5  O6  ? ? G DC  8   H DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog53 hydrog ? ? G DC  8   O2  ? ? ? 1_555 H DG  5  N2  ? ? G DC  8   H DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog54 hydrog ? ? G DA  9   N1  ? ? ? 1_555 H DT  4  N3  ? ? G DA  9   H DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog55 hydrog ? ? G DA  9   N6  ? ? ? 1_555 H DT  4  O4  ? ? G DA  9   H DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog56 hydrog ? ? G DA  10  N1  ? ? ? 1_555 H DT  3  N3  ? ? G DA  10  H DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog57 hydrog ? ? G DA  10  N6  ? ? ? 1_555 H DT  3  O4  ? ? G DA  10  H DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog58 hydrog ? ? G DC  11  N3  ? ? ? 1_555 H DG  2  N1  ? ? G DC  11  H DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog59 hydrog ? ? G DC  11  N4  ? ? ? 1_555 H DG  2  O6  ? ? G DC  11  H DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog60 hydrog ? ? G DC  11  O2  ? ? ? 1_555 H DG  2  N2  ? ? G DC  11  H DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog61 hydrog ? ? G DC  12  N3  ? ? ? 1_555 H DG  1  N1  ? ? G DC  12  H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog62 hydrog ? ? G DC  12  N4  ? ? ? 1_555 H DG  1  O6  ? ? G DC  12  H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog63 hydrog ? ? G DC  12  O2  ? ? ? 1_555 H DG  1  N2  ? ? G DC  12  H DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 116 ? ALA A 119 ? VAL A 135 ALA A 138 
AA1 2 VAL A 107 ? THR A 111 ? VAL A 126 THR A 130 
AA1 3 GLN A 243 ? THR A 251 ? GLN A 262 THR A 270 
AA1 4 LEU A 216 ? LEU A 227 ? LEU A 235 LEU A 246 
AA1 5 GLU A 198 ? LEU A 205 ? GLU A 217 LEU A 224 
AA2 1 VAL B 108 ? VAL B 111 ? VAL B 186 VAL B 189 
AA2 2 GLY B 96  ? SER B 102 ? GLY B 174 SER B 180 
AA2 3 PHE B 229 ? LEU B 237 ? PHE B 335 LEU B 343 
AA2 4 VAL B 198 ? ALA B 208 ? VAL B 304 ALA B 314 
AA2 5 ARG B 182 ? MET B 189 ? ARG B 260 MET B 267 
AA3 1 VAL C 116 ? ALA C 119 ? VAL C 135 ALA C 138 
AA3 2 VAL C 107 ? THR C 111 ? VAL C 126 THR C 130 
AA3 3 LEU C 244 ? ILE C 249 ? LEU C 263 ILE C 268 
AA3 4 GLN C 221 ? GLY C 222 ? GLN C 240 GLY C 241 
AA4 1 VAL C 116 ? ALA C 119 ? VAL C 135 ALA C 138 
AA4 2 VAL C 107 ? THR C 111 ? VAL C 126 THR C 130 
AA4 3 LEU C 244 ? ILE C 249 ? LEU C 263 ILE C 268 
AA4 4 LYS C 225 ? TYR C 226 ? LYS C 244 TYR C 245 
AA5 1 ILE C 202 ? CYS C 203 ? ILE C 221 CYS C 222 
AA5 2 MET C 218 ? ASN C 219 ? MET C 237 ASN C 238 
AA6 1 CYS D 202 ? TYR D 205 ? CYS D 308 TYR D 311 
AA6 2 VAL D 232 ? GLY D 235 ? VAL D 338 GLY D 341 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O TYR A 118 ? O TYR A 137 N VAL A 109 ? N VAL A 128 
AA1 2 3 N LEU A 108 ? N LEU A 127 O ALA A 248 ? O ALA A 267 
AA1 3 4 O GLN A 243 ? O GLN A 262 N LEU A 227 ? N LEU A 246 
AA1 4 5 O MET A 218 ? O MET A 237 N CYS A 203 ? N CYS A 222 
AA2 1 2 O VAL B 109 ? O VAL B 187 N ILE B 100 ? N ILE B 178 
AA2 2 3 N PHE B 99  ? N PHE B 177 O ALA B 233 ? O ALA B 339 
AA2 3 4 O ARG B 236 ? O ARG B 342 N HIS B 201 ? N HIS B 307 
AA2 4 5 O VAL B 200 ? O VAL B 306 N CYS B 187 ? N CYS B 265 
AA3 1 2 O PHE C 117 ? O PHE C 136 N VAL C 109 ? N VAL C 128 
AA3 2 3 N VAL C 110 ? N VAL C 129 O LEU C 246 ? O LEU C 265 
AA3 3 4 O ILE C 249 ? O ILE C 268 N GLN C 221 ? N GLN C 240 
AA4 1 2 O PHE C 117 ? O PHE C 136 N VAL C 109 ? N VAL C 128 
AA4 2 3 N VAL C 110 ? N VAL C 129 O LEU C 246 ? O LEU C 265 
AA4 3 4 O ALA C 245 ? O ALA C 264 N LYS C 225 ? N LYS C 244 
AA5 1 2 N CYS C 203 ? N CYS C 222 O MET C 218 ? O MET C 237 
AA6 1 2 N THR D 203 ? N THR D 309 O ILE D 234 ? O ILE D 340 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ER3 301 ? 1 'binding site for residue ER3 A 301' 
AC2 Software A ER3 302 ? 4 'binding site for residue ER3 A 302' 
AC3 Software A ACT 303 ? 3 'binding site for residue ACT A 303' 
AC4 Software A ER3 304 ? 2 'binding site for residue ER3 A 304' 
AC5 Software B ER3 401 ? 1 'binding site for residue ER3 B 401' 
AC6 Software B ER3 402 ? 1 'binding site for residue ER3 B 402' 
AC7 Software B ER3 403 ? 1 'binding site for residue ER3 B 403' 
AC8 Software B ER3 404 ? 4 'binding site for residue ER3 B 404' 
AC9 Software C ER3 301 ? 2 'binding site for residue ER3 C 301' 
AD1 Software C ER3 302 ? 2 'binding site for residue ER3 C 302' 
AD2 Software D ER3 401 ? 1 'binding site for residue ER3 D 401' 
AD3 Software D ER3 402 ? 1 'binding site for residue ER3 D 402' 
AD4 Software H ER3 101 ? 2 'binding site for residue ER3 H 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1 GLU A 146 ? GLU A 165 . ? 1_555 ? 
2  AC2 4 LEU A 93  ? LEU A 112 . ? 1_555 ? 
3  AC2 4 GLU A 97  ? GLU A 116 . ? 1_555 ? 
4  AC2 4 ACT K .   ? ACT A 303 . ? 1_555 ? 
5  AC2 4 ASP B 83  ? ASP B 161 . ? 1_555 ? 
6  AC3 3 GLU A 97  ? GLU A 116 . ? 1_555 ? 
7  AC3 3 ER3 J .   ? ER3 A 302 . ? 1_555 ? 
8  AC3 3 LYS B 77  ? LYS B 155 . ? 1_555 ? 
9  AC4 2 ASP A 46  ? ASP A 65  . ? 1_555 ? 
10 AC4 2 DT  E 3   ? DT  E 3   . ? 1_555 ? 
11 AC5 1 GLU B 125 ? GLU B 203 . ? 1_555 ? 
12 AC6 1 ASP B 95  ? ASP B 173 . ? 1_555 ? 
13 AC7 1 GLU B 9   ? GLU B 87  . ? 1_555 ? 
14 AC8 4 ASP B 220 ? ASP B 326 . ? 1_555 ? 
15 AC8 4 LEU C 93  ? LEU C 112 . ? 1_555 ? 
16 AC8 4 GLU C 97  ? GLU C 116 . ? 1_555 ? 
17 AC8 4 ASP D 83  ? ASP D 161 . ? 1_555 ? 
18 AC9 2 GLU C 146 ? GLU C 165 . ? 1_555 ? 
19 AC9 2 GLU C 150 ? GLU C 169 . ? 1_555 ? 
20 AD1 2 ASP C 46  ? ASP C 65  . ? 1_555 ? 
21 AD1 2 DT  G 3   ? DT  G 3   . ? 1_555 ? 
22 AD2 1 ASP D 95  ? ASP D 173 . ? 1_555 ? 
23 AD3 1 ASN D 15  ? ASN D 93  . ? 1_555 ? 
24 AD4 2 DT  H 8   ? DT  H 8   . ? 8_556 ? 
25 AD4 2 DT  H 8   ? DT  H 8   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5NJ8 
_atom_sites.fract_transf_matrix[1][1]   0.010950 
_atom_sites.fract_transf_matrix[1][2]   0.006322 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012644 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002151 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
ER 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . ASN A 1 15  ? 2.419   6.622  188.542 1.00 202.22 ? 34  ASN A N      1 
ATOM   2     C  CA     . ASN A 1 15  ? 1.023   6.756  188.138 1.00 203.53 ? 34  ASN A CA     1 
ATOM   3     C  C      . ASN A 1 15  ? 0.662   8.199  187.791 1.00 197.23 ? 34  ASN A C      1 
ATOM   4     O  O      . ASN A 1 15  ? 1.423   9.120  188.081 1.00 197.15 ? 34  ASN A O      1 
ATOM   5     C  CB     . ASN A 1 15  ? 0.098   6.260  189.248 1.00 89.26  ? 34  ASN A CB     1 
ATOM   6     C  CG     . ASN A 1 15  ? 0.006   4.747  189.303 1.00 138.93 ? 34  ASN A CG     1 
ATOM   7     O  OD1    . ASN A 1 15  ? 0.191   4.064  188.296 1.00 170.86 ? 34  ASN A OD1    1 
ATOM   8     N  ND2    . ASN A 1 15  ? -0.288  4.214  190.486 1.00 81.04  ? 34  ASN A ND2    1 
ATOM   9     H  HA     . ASN A 1 15  ? 0.868   6.210  187.351 1.00 244.23 ? 34  ASN A HA     1 
ATOM   10    H  HB2    . ASN A 1 15  ? 0.435   6.571  190.102 1.00 107.12 ? 34  ASN A HB2    1 
ATOM   11    H  HB3    . ASN A 1 15  ? -0.794  6.609  189.096 1.00 107.12 ? 34  ASN A HB3    1 
ATOM   12    H  HD21   . ASN A 1 15  ? -0.352  3.360  190.569 1.00 97.24  ? 34  ASN A HD21   1 
ATOM   13    H  HD22   . ASN A 1 15  ? -0.415  4.723  191.167 1.00 97.24  ? 34  ASN A HD22   1 
ATOM   14    N  N      . PRO A 1 16  ? -0.500  8.393  187.156 1.00 188.55 ? 35  PRO A N      1 
ATOM   15    C  CA     . PRO A 1 16  ? -0.952  9.763  186.867 1.00 194.74 ? 35  PRO A CA     1 
ATOM   16    C  C      . PRO A 1 16  ? -1.661  10.434 188.027 1.00 202.24 ? 35  PRO A C      1 
ATOM   17    O  O      . PRO A 1 16  ? -1.752  11.674 188.056 1.00 192.51 ? 35  PRO A O      1 
ATOM   18    C  CB     . PRO A 1 16  ? -1.901  9.577  185.682 1.00 195.86 ? 35  PRO A CB     1 
ATOM   19    C  CG     . PRO A 1 16  ? -2.426  8.201  185.848 1.00 198.61 ? 35  PRO A CG     1 
ATOM   20    C  CD     . PRO A 1 16  ? -1.301  7.391  186.431 1.00 211.24 ? 35  PRO A CD     1 
ATOM   21    H  HA     . PRO A 1 16  ? -0.201  10.312 186.591 1.00 233.69 ? 35  PRO A HA     1 
ATOM   22    H  HB2    . PRO A 1 16  ? -2.618  10.229 185.728 1.00 235.03 ? 35  PRO A HB2    1 
ATOM   23    H  HB3    . PRO A 1 16  ? -1.409  9.661  184.850 1.00 235.03 ? 35  PRO A HB3    1 
ATOM   24    H  HG2    . PRO A 1 16  ? -3.184  8.214  186.454 1.00 238.33 ? 35  PRO A HG2    1 
ATOM   25    H  HG3    . PRO A 1 16  ? -2.688  7.847  184.984 1.00 238.33 ? 35  PRO A HG3    1 
ATOM   26    H  HD2    . PRO A 1 16  ? -1.646  6.725  187.046 1.00 253.49 ? 35  PRO A HD2    1 
ATOM   27    H  HD3    . PRO A 1 16  ? -0.775  6.985  185.725 1.00 253.49 ? 35  PRO A HD3    1 
ATOM   28    N  N      . SER A 1 17  ? -2.179  9.668  188.987 1.00 207.54 ? 36  SER A N      1 
ATOM   29    C  CA     . SER A 1 17  ? -2.746  10.297 190.169 1.00 169.33 ? 36  SER A CA     1 
ATOM   30    C  C      . SER A 1 17  ? -1.647  10.845 191.069 1.00 156.40 ? 36  SER A C      1 
ATOM   31    O  O      . SER A 1 17  ? -1.807  11.912 191.677 1.00 153.11 ? 36  SER A O      1 
ATOM   32    C  CB     . SER A 1 17  ? -3.631  9.302  190.906 1.00 160.90 ? 36  SER A CB     1 
ATOM   33    O  OG     . SER A 1 17  ? -4.523  9.984  191.764 1.00 157.94 ? 36  SER A OG     1 
ATOM   34    H  H      . SER A 1 17  ? -2.213  8.809  188.976 1.00 249.05 ? 36  SER A H      1 
ATOM   35    H  HA     . SER A 1 17  ? -3.302  11.042 189.892 1.00 203.19 ? 36  SER A HA     1 
ATOM   36    H  HB2    . SER A 1 17  ? -4.141  8.790  190.259 1.00 193.08 ? 36  SER A HB2    1 
ATOM   37    H  HB3    . SER A 1 17  ? -3.073  8.710  191.434 1.00 193.08 ? 36  SER A HB3    1 
ATOM   38    H  HG     . SER A 1 17  ? -5.010  9.432  192.170 1.00 189.53 ? 36  SER A HG     1 
ATOM   39    N  N      . LYS A 1 18  ? -0.514  10.143 191.143 1.00 156.30 ? 37  LYS A N      1 
ATOM   40    C  CA     . LYS A 1 18  ? 0.604   10.634 191.940 1.00 151.00 ? 37  LYS A CA     1 
ATOM   41    C  C      . LYS A 1 18  ? 1.134   11.959 191.398 1.00 155.84 ? 37  LYS A C      1 
ATOM   42    O  O      . LYS A 1 18  ? 1.413   12.885 192.172 1.00 155.22 ? 37  LYS A O      1 
ATOM   43    C  CB     . LYS A 1 18  ? 1.710   9.583  191.988 1.00 156.37 ? 37  LYS A CB     1 
ATOM   44    C  CG     . LYS A 1 18  ? 2.814   9.877  192.987 1.00 152.95 ? 37  LYS A CG     1 
ATOM   45    C  CD     . LYS A 1 18  ? 3.964   10.633 192.348 1.00 157.03 ? 37  LYS A CD     1 
ATOM   46    C  CE     . LYS A 1 18  ? 5.160   10.711 193.280 1.00 183.62 ? 37  LYS A CE     1 
ATOM   47    N  NZ     . LYS A 1 18  ? 4.848   11.430 194.548 1.00 157.87 ? 37  LYS A NZ     1 
ATOM   48    H  H      . LYS A 1 18  ? -0.372  9.392  190.748 1.00 187.57 ? 37  LYS A H      1 
ATOM   49    H  HA     . LYS A 1 18  ? 0.298   10.785 192.848 1.00 181.20 ? 37  LYS A HA     1 
ATOM   50    H  HB2    . LYS A 1 18  ? 1.317   8.729  192.228 1.00 187.64 ? 37  LYS A HB2    1 
ATOM   51    H  HB3    . LYS A 1 18  ? 2.117   9.520  191.110 1.00 187.64 ? 37  LYS A HB3    1 
ATOM   52    H  HG2    . LYS A 1 18  ? 2.456   10.421 193.707 1.00 183.54 ? 37  LYS A HG2    1 
ATOM   53    H  HG3    . LYS A 1 18  ? 3.158   9.041  193.339 1.00 183.54 ? 37  LYS A HG3    1 
ATOM   54    H  HD2    . LYS A 1 18  ? 4.238   10.174 191.539 1.00 188.44 ? 37  LYS A HD2    1 
ATOM   55    H  HD3    . LYS A 1 18  ? 3.679   11.537 192.142 1.00 188.44 ? 37  LYS A HD3    1 
ATOM   56    H  HE2    . LYS A 1 18  ? 5.445   9.812  193.506 1.00 220.34 ? 37  LYS A HE2    1 
ATOM   57    H  HE3    . LYS A 1 18  ? 5.879   11.186 192.834 1.00 220.34 ? 37  LYS A HE3    1 
ATOM   58    H  HZ1    . LYS A 1 18  ? 5.570   11.456 195.068 1.00 189.45 ? 37  LYS A HZ1    1 
ATOM   59    H  HZ2    . LYS A 1 18  ? 4.589   12.262 194.370 1.00 189.45 ? 37  LYS A HZ2    1 
ATOM   60    H  HZ3    . LYS A 1 18  ? 4.194   11.010 194.982 1.00 189.45 ? 37  LYS A HZ3    1 
ATOM   61    N  N      . ARG A 1 19  ? 1.291   12.076 190.075 1.00 205.80 ? 38  ARG A N      1 
ATOM   62    C  CA     . ARG A 1 19  ? 1.638   13.378 189.506 1.00 178.61 ? 38  ARG A CA     1 
ATOM   63    C  C      . ARG A 1 19  ? 0.566   14.405 189.841 1.00 157.29 ? 38  ARG A C      1 
ATOM   64    O  O      . ARG A 1 19  ? 0.885   15.538 190.223 1.00 164.89 ? 38  ARG A O      1 
ATOM   65    C  CB     . ARG A 1 19  ? 1.839   13.285 187.989 1.00 141.60 ? 38  ARG A CB     1 
ATOM   66    C  CG     . ARG A 1 19  ? 0.627   12.768 187.276 1.00 155.58 ? 38  ARG A CG     1 
ATOM   67    C  CD     . ARG A 1 19  ? 0.793   12.604 185.765 1.00 121.88 ? 38  ARG A CD     1 
ATOM   68    N  NE     . ARG A 1 19  ? 1.004   13.868 185.060 1.00 131.62 ? 38  ARG A NE     1 
ATOM   69    C  CZ     . ARG A 1 19  ? 1.137   13.980 183.741 1.00 150.17 ? 38  ARG A CZ     1 
ATOM   70    N  NH1    . ARG A 1 19  ? 1.074   12.908 182.957 1.00 110.45 ? 38  ARG A NH1    1 
ATOM   71    N  NH2    . ARG A 1 19  ? 1.316   15.179 183.210 1.00 141.73 ? 38  ARG A NH2    1 
ATOM   72    H  H      . ARG A 1 19  ? 1.205   11.439 189.504 1.00 246.96 ? 38  ARG A H      1 
ATOM   73    H  HA     . ARG A 1 19  ? 2.472   13.679 189.899 1.00 214.33 ? 38  ARG A HA     1 
ATOM   74    H  HB2    . ARG A 1 19  ? 2.038   14.169 187.641 1.00 169.92 ? 38  ARG A HB2    1 
ATOM   75    H  HB3    . ARG A 1 19  ? 2.576   12.682 187.804 1.00 169.92 ? 38  ARG A HB3    1 
ATOM   76    H  HG2    . ARG A 1 19  ? 0.400   11.899 187.642 1.00 186.69 ? 38  ARG A HG2    1 
ATOM   77    H  HG3    . ARG A 1 19  ? -0.106  13.386 187.425 1.00 186.69 ? 38  ARG A HG3    1 
ATOM   78    H  HD2    . ARG A 1 19  ? 1.561   12.037 185.594 1.00 146.26 ? 38  ARG A HD2    1 
ATOM   79    H  HD3    . ARG A 1 19  ? -0.008  12.193 185.405 1.00 146.26 ? 38  ARG A HD3    1 
ATOM   80    H  HE     . ARG A 1 19  ? 1.044   14.588 185.530 1.00 157.94 ? 38  ARG A HE     1 
ATOM   81    H  HH11   . ARG A 1 19  ? 0.954   12.129 183.302 1.00 132.55 ? 38  ARG A HH11   1 
ATOM   82    H  HH12   . ARG A 1 19  ? 1.159   12.992 182.106 1.00 132.55 ? 38  ARG A HH12   1 
ATOM   83    H  HH21   . ARG A 1 19  ? 1.356   15.872 183.717 1.00 170.08 ? 38  ARG A HH21   1 
ATOM   84    H  HH22   . ARG A 1 19  ? 1.403   15.263 182.359 1.00 170.08 ? 38  ARG A HH22   1 
ATOM   85    N  N      . HIS A 1 20  ? -0.715  14.023 189.732 1.00 159.55 ? 39  HIS A N      1 
ATOM   86    C  CA     . HIS A 1 20  ? -1.786  14.947 190.100 1.00 155.32 ? 39  HIS A CA     1 
ATOM   87    C  C      . HIS A 1 20  ? -1.507  15.580 191.460 1.00 164.89 ? 39  HIS A C      1 
ATOM   88    O  O      . HIS A 1 20  ? -1.310  16.800 191.575 1.00 167.35 ? 39  HIS A O      1 
ATOM   89    C  CB     . HIS A 1 20  ? -3.135  14.217 190.109 1.00 163.79 ? 39  HIS A CB     1 
ATOM   90    C  CG     . HIS A 1 20  ? -4.281  15.056 190.590 1.00 152.98 ? 39  HIS A CG     1 
ATOM   91    N  ND1    . HIS A 1 20  ? -4.196  16.423 190.755 1.00 139.00 ? 39  HIS A ND1    1 
ATOM   92    C  CD2    . HIS A 1 20  ? -5.543  14.715 190.946 1.00 143.99 ? 39  HIS A CD2    1 
ATOM   93    C  CE1    . HIS A 1 20  ? -5.353  16.886 191.194 1.00 136.52 ? 39  HIS A CE1    1 
ATOM   94    N  NE2    . HIS A 1 20  ? -6.187  15.870 191.318 1.00 145.79 ? 39  HIS A NE2    1 
ATOM   95    H  H      . HIS A 1 20  ? -0.980  13.254 189.455 1.00 191.46 ? 39  HIS A H      1 
ATOM   96    H  HA     . HIS A 1 20  ? -1.833  15.657 189.441 1.00 186.39 ? 39  HIS A HA     1 
ATOM   97    H  HB2    . HIS A 1 20  ? -3.339  13.928 189.205 1.00 196.55 ? 39  HIS A HB2    1 
ATOM   98    H  HB3    . HIS A 1 20  ? -3.068  13.445 190.692 1.00 196.55 ? 39  HIS A HB3    1 
ATOM   99    H  HD1    . HIS A 1 20  ? -3.497  16.899 190.600 1.00 166.80 ? 39  HIS A HD1    1 
ATOM   100   H  HD2    . HIS A 1 20  ? -5.905  13.858 190.943 1.00 172.79 ? 39  HIS A HD2    1 
ATOM   101   H  HE1    . HIS A 1 20  ? -5.547  17.776 191.380 1.00 163.83 ? 39  HIS A HE1    1 
ATOM   102   N  N      . ARG A 1 21  ? -1.472  14.755 192.510 1.00 160.30 ? 40  ARG A N      1 
ATOM   103   C  CA     . ARG A 1 21  ? -1.271  15.298 193.850 1.00 125.31 ? 40  ARG A CA     1 
ATOM   104   C  C      . ARG A 1 21  ? 0.061   16.027 193.970 1.00 126.09 ? 40  ARG A C      1 
ATOM   105   O  O      . ARG A 1 21  ? 0.153   17.026 194.688 1.00 145.56 ? 40  ARG A O      1 
ATOM   106   C  CB     . ARG A 1 21  ? -1.359  14.185 194.891 1.00 140.23 ? 40  ARG A CB     1 
ATOM   107   C  CG     . ARG A 1 21  ? -2.734  13.533 194.995 1.00 140.71 ? 40  ARG A CG     1 
ATOM   108   C  CD     . ARG A 1 21  ? -2.807  12.596 196.188 1.00 123.91 ? 40  ARG A CD     1 
ATOM   109   N  NE     . ARG A 1 21  ? -1.559  11.856 196.333 1.00 123.82 ? 40  ARG A NE     1 
ATOM   110   C  CZ     . ARG A 1 21  ? -1.293  10.698 195.743 1.00 123.65 ? 40  ARG A CZ     1 
ATOM   111   N  NH1    . ARG A 1 21  ? -2.194  10.114 194.965 1.00 135.24 ? 40  ARG A NH1    1 
ATOM   112   N  NH2    . ARG A 1 21  ? -0.118  10.121 195.934 1.00 123.59 ? 40  ARG A NH2    1 
ATOM   113   H  H      . ARG A 1 21  ? -1.560  13.900 192.474 1.00 192.36 ? 40  ARG A H      1 
ATOM   114   H  HA     . ARG A 1 21  ? -1.976  15.937 194.038 1.00 150.38 ? 40  ARG A HA     1 
ATOM   115   H  HB2    . ARG A 1 21  ? -0.721  13.492 194.660 1.00 168.28 ? 40  ARG A HB2    1 
ATOM   116   H  HB3    . ARG A 1 21  ? -1.141  14.554 195.761 1.00 168.28 ? 40  ARG A HB3    1 
ATOM   117   H  HG2    . ARG A 1 21  ? -3.408  14.221 195.107 1.00 168.86 ? 40  ARG A HG2    1 
ATOM   118   H  HG3    . ARG A 1 21  ? -2.907  13.018 194.192 1.00 168.86 ? 40  ARG A HG3    1 
ATOM   119   H  HD2    . ARG A 1 21  ? -2.953  13.111 196.996 1.00 148.69 ? 40  ARG A HD2    1 
ATOM   120   H  HD3    . ARG A 1 21  ? -3.527  11.960 196.056 1.00 148.69 ? 40  ARG A HD3    1 
ATOM   121   H  HE     . ARG A 1 21  ? -0.951  12.195 196.838 1.00 148.58 ? 40  ARG A HE     1 
ATOM   122   H  HH11   . ARG A 1 21  ? -2.958  10.489 194.835 1.00 162.29 ? 40  ARG A HH11   1 
ATOM   123   H  HH12   . ARG A 1 21  ? -2.015  9.362  194.588 1.00 162.29 ? 40  ARG A HH12   1 
ATOM   124   H  HH21   . ARG A 1 21  ? 0.467   10.495 196.442 1.00 148.30 ? 40  ARG A HH21   1 
ATOM   125   H  HH22   . ARG A 1 21  ? 0.057   9.366  195.560 1.00 148.30 ? 40  ARG A HH22   1 
ATOM   126   N  N      . ASP A 1 22  ? 1.099   15.553 193.280 1.00 124.09 ? 41  ASP A N      1 
ATOM   127   C  CA     . ASP A 1 22  ? 2.421   16.159 193.421 1.00 136.53 ? 41  ASP A CA     1 
ATOM   128   C  C      . ASP A 1 22  ? 2.422   17.597 192.912 1.00 129.39 ? 41  ASP A C      1 
ATOM   129   O  O      . ASP A 1 22  ? 2.690   18.542 193.669 1.00 148.32 ? 41  ASP A O      1 
ATOM   130   C  CB     . ASP A 1 22  ? 3.466   15.319 192.680 1.00 160.77 ? 41  ASP A CB     1 
ATOM   131   C  CG     . ASP A 1 22  ? 4.888   15.662 193.091 1.00 189.29 ? 41  ASP A CG     1 
ATOM   132   O  OD1    . ASP A 1 22  ? 5.147   16.837 193.426 1.00 199.52 ? 41  ASP A OD1    1 
ATOM   133   O  OD2    . ASP A 1 22  ? 5.747   14.754 193.083 1.00 184.56 ? 41  ASP A OD2    1 
ATOM   134   H  H      . ASP A 1 22  ? 1.065   14.892 192.731 1.00 148.91 ? 41  ASP A H      1 
ATOM   135   H  HA     . ASP A 1 22  ? 2.661   16.174 194.361 1.00 163.83 ? 41  ASP A HA     1 
ATOM   136   H  HB2    . ASP A 1 22  ? 3.314   14.381 192.875 1.00 192.92 ? 41  ASP A HB2    1 
ATOM   137   H  HB3    . ASP A 1 22  ? 3.382   15.479 191.727 1.00 192.92 ? 41  ASP A HB3    1 
ATOM   138   N  N      . ARG A 1 23  ? 2.130   17.788 191.624 1.00 158.91 ? 42  ARG A N      1 
ATOM   139   C  CA     . ARG A 1 23  ? 2.117   19.145 191.096 1.00 159.58 ? 42  ARG A CA     1 
ATOM   140   C  C      . ARG A 1 23  ? 1.016   19.984 191.726 1.00 144.20 ? 42  ARG A C      1 
ATOM   141   O  O      . ARG A 1 23  ? 1.074   21.215 191.647 1.00 162.30 ? 42  ARG A O      1 
ATOM   142   C  CB     . ARG A 1 23  ? 1.969   19.143 189.573 1.00 119.94 ? 42  ARG A CB     1 
ATOM   143   C  CG     . ARG A 1 23  ? 0.674   18.549 189.068 1.00 122.42 ? 42  ARG A CG     1 
ATOM   144   C  CD     . ARG A 1 23  ? 0.557   18.678 187.568 1.00 128.35 ? 42  ARG A CD     1 
ATOM   145   N  NE     . ARG A 1 23  ? -0.682  18.081 187.088 1.00 131.91 ? 42  ARG A NE     1 
ATOM   146   C  CZ     . ARG A 1 23  ? -1.048  18.030 185.814 1.00 107.00 ? 42  ARG A CZ     1 
ATOM   147   N  NH1    . ARG A 1 23  ? -0.266  18.545 184.869 1.00 91.31  ? 42  ARG A NH1    1 
ATOM   148   N  NH2    . ARG A 1 23  ? -2.198  17.463 185.484 1.00 88.45  ? 42  ARG A NH2    1 
ATOM   149   H  H      . ARG A 1 23  ? 1.943   17.170 191.056 1.00 190.69 ? 42  ARG A H      1 
ATOM   150   H  HA     . ARG A 1 23  ? 2.965   19.567 191.308 1.00 191.50 ? 42  ARG A HA     1 
ATOM   151   H  HB2    . ARG A 1 23  ? 2.015   20.058 189.255 1.00 143.93 ? 42  ARG A HB2    1 
ATOM   152   H  HB3    . ARG A 1 23  ? 2.697   18.628 189.191 1.00 143.93 ? 42  ARG A HB3    1 
ATOM   153   H  HG2    . ARG A 1 23  ? 0.643   17.606 189.295 1.00 146.91 ? 42  ARG A HG2    1 
ATOM   154   H  HG3    . ARG A 1 23  ? -0.073  19.016 189.473 1.00 146.91 ? 42  ARG A HG3    1 
ATOM   155   H  HD2    . ARG A 1 23  ? 0.558   19.617 187.325 1.00 154.02 ? 42  ARG A HD2    1 
ATOM   156   H  HD3    . ARG A 1 23  ? 1.301   18.220 187.146 1.00 154.02 ? 42  ARG A HD3    1 
ATOM   157   H  HE     . ARG A 1 23  ? -1.213  17.738 187.671 1.00 158.29 ? 42  ARG A HE     1 
ATOM   158   H  HH11   . ARG A 1 23  ? 0.481   18.913 185.083 1.00 109.58 ? 42  ARG A HH11   1 
ATOM   159   H  HH12   . ARG A 1 23  ? -0.508  18.509 184.045 1.00 109.58 ? 42  ARG A HH12   1 
ATOM   160   H  HH21   . ARG A 1 23  ? -2.704  17.129 186.094 1.00 106.14 ? 42  ARG A HH21   1 
ATOM   161   H  HH22   . ARG A 1 23  ? -2.439  17.427 184.659 1.00 106.14 ? 42  ARG A HH22   1 
ATOM   162   N  N      . LEU A 1 24  ? 0.012   19.354 192.344 1.00 126.68 ? 43  LEU A N      1 
ATOM   163   C  CA     . LEU A 1 24  ? -0.923  20.131 193.149 1.00 145.22 ? 43  LEU A CA     1 
ATOM   164   C  C      . LEU A 1 24  ? -0.271  20.608 194.442 1.00 139.64 ? 43  LEU A C      1 
ATOM   165   O  O      . LEU A 1 24  ? -0.626  21.673 194.960 1.00 117.96 ? 43  LEU A O      1 
ATOM   166   C  CB     . LEU A 1 24  ? -2.175  19.307 193.454 1.00 131.93 ? 43  LEU A CB     1 
ATOM   167   C  CG     . LEU A 1 24  ? -3.381  20.114 193.946 1.00 122.19 ? 43  LEU A CG     1 
ATOM   168   C  CD1    . LEU A 1 24  ? -4.676  19.476 193.472 1.00 121.12 ? 43  LEU A CD1    1 
ATOM   169   C  CD2    . LEU A 1 24  ? -3.389  20.245 195.464 1.00 138.68 ? 43  LEU A CD2    1 
ATOM   170   H  H      . LEU A 1 24  ? -0.143  18.509 192.314 1.00 152.02 ? 43  LEU A H      1 
ATOM   171   H  HA     . LEU A 1 24  ? -1.196  20.914 192.646 1.00 174.26 ? 43  LEU A HA     1 
ATOM   172   H  HB2    . LEU A 1 24  ? -2.443  18.844 192.644 1.00 158.32 ? 43  LEU A HB2    1 
ATOM   173   H  HB3    . LEU A 1 24  ? -1.957  18.658 194.141 1.00 158.32 ? 43  LEU A HB3    1 
ATOM   174   H  HG     . LEU A 1 24  ? -3.335  21.007 193.571 1.00 146.63 ? 43  LEU A HG     1 
ATOM   175   H  HD11   . LEU A 1 24  ? -5.424  20.003 193.795 1.00 145.34 ? 43  LEU A HD11   1 
ATOM   176   H  HD12   . LEU A 1 24  ? -4.681  19.454 192.502 1.00 145.34 ? 43  LEU A HD12   1 
ATOM   177   H  HD13   . LEU A 1 24  ? -4.731  18.574 193.824 1.00 145.34 ? 43  LEU A HD13   1 
ATOM   178   H  HD21   . LEU A 1 24  ? -4.166  20.760 195.731 1.00 166.42 ? 43  LEU A HD21   1 
ATOM   179   H  HD22   . LEU A 1 24  ? -3.428  19.359 195.856 1.00 166.42 ? 43  LEU A HD22   1 
ATOM   180   H  HD23   . LEU A 1 24  ? -2.579  20.697 195.745 1.00 166.42 ? 43  LEU A HD23   1 
ATOM   181   N  N      . ASN A 1 25  ? 0.693   19.849 194.966 1.00 133.60 ? 44  ASN A N      1 
ATOM   182   C  CA     . ASN A 1 25  ? 1.347   20.219 196.216 1.00 103.77 ? 44  ASN A CA     1 
ATOM   183   C  C      . ASN A 1 25  ? 2.387   21.310 195.999 1.00 107.73 ? 44  ASN A C      1 
ATOM   184   O  O      . ASN A 1 25  ? 2.437   22.285 196.759 1.00 141.70 ? 44  ASN A O      1 
ATOM   185   C  CB     . ASN A 1 25  ? 2.001   18.991 196.857 1.00 116.69 ? 44  ASN A CB     1 
ATOM   186   C  CG     . ASN A 1 25  ? 0.987   17.989 197.373 1.00 107.68 ? 44  ASN A CG     1 
ATOM   187   O  OD1    . ASN A 1 25  ? -0.195  18.299 197.513 1.00 105.52 ? 44  ASN A OD1    1 
ATOM   188   N  ND2    . ASN A 1 25  ? 1.449   16.779 197.668 1.00 105.99 ? 44  ASN A ND2    1 
ATOM   189   H  H      . ASN A 1 25  ? 0.984   19.119 194.617 1.00 160.32 ? 44  ASN A H      1 
ATOM   190   H  HA     . ASN A 1 25  ? 0.680   20.559 196.832 1.00 124.53 ? 44  ASN A HA     1 
ATOM   191   H  HB2    . ASN A 1 25  ? 2.553   18.546 196.195 1.00 140.03 ? 44  ASN A HB2    1 
ATOM   192   H  HB3    . ASN A 1 25  ? 2.546   19.279 197.606 1.00 140.03 ? 44  ASN A HB3    1 
ATOM   193   H  HD21   . ASN A 1 25  ? 0.913   16.174 197.964 1.00 127.19 ? 44  ASN A HD21   1 
ATOM   194   H  HD22   . ASN A 1 25  ? 2.283   16.599 197.563 1.00 127.19 ? 44  ASN A HD22   1 
ATOM   195   N  N      . THR A 1 26  ? 3.231   21.162 194.973 1.00 126.06 ? 45  THR A N      1 
ATOM   196   C  CA     . THR A 1 26  ? 4.313   22.124 194.772 1.00 136.90 ? 45  THR A CA     1 
ATOM   197   C  C      . THR A 1 26  ? 3.803   23.560 194.782 1.00 127.53 ? 45  THR A C      1 
ATOM   198   O  O      . THR A 1 26  ? 4.506   24.469 195.242 1.00 134.29 ? 45  THR A O      1 
ATOM   199   C  CB     . THR A 1 26  ? 5.044   21.844 193.458 1.00 141.41 ? 45  THR A CB     1 
ATOM   200   O  OG1    . THR A 1 26  ? 6.132   22.766 193.309 1.00 158.49 ? 45  THR A OG1    1 
ATOM   201   C  CG2    . THR A 1 26  ? 4.098   21.979 192.274 1.00 156.22 ? 45  THR A CG2    1 
ATOM   202   H  H      . THR A 1 26  ? 3.199   20.527 194.394 1.00 151.27 ? 45  THR A H      1 
ATOM   203   H  HA     . THR A 1 26  ? 4.953   22.031 195.494 1.00 164.27 ? 45  THR A HA     1 
ATOM   204   H  HB     . THR A 1 26  ? 5.390   20.938 193.470 1.00 169.69 ? 45  THR A HB     1 
ATOM   205   H  HG1    . THR A 1 26  ? 6.538   22.618 192.589 1.00 190.19 ? 45  THR A HG1    1 
ATOM   206   H  HG21   . THR A 1 26  ? 4.573   21.798 191.448 1.00 187.47 ? 45  THR A HG21   1 
ATOM   207   H  HG22   . THR A 1 26  ? 3.366   21.348 192.361 1.00 187.47 ? 45  THR A HG22   1 
ATOM   208   H  HG23   . THR A 1 26  ? 3.736   22.878 192.240 1.00 187.47 ? 45  THR A HG23   1 
ATOM   209   N  N      . GLU A 1 27  ? 2.582   23.785 194.292 1.00 120.33 ? 46  GLU A N      1 
ATOM   210   C  CA     . GLU A 1 27  ? 2.017   25.130 194.303 1.00 132.97 ? 46  GLU A CA     1 
ATOM   211   C  C      . GLU A 1 27  ? 1.669   25.568 195.716 1.00 114.87 ? 46  GLU A C      1 
ATOM   212   O  O      . GLU A 1 27  ? 1.843   26.740 196.069 1.00 127.77 ? 46  GLU A O      1 
ATOM   213   C  CB     . GLU A 1 27  ? 0.785   25.182 193.404 1.00 82.40  ? 46  GLU A CB     1 
ATOM   214   C  CG     . GLU A 1 27  ? 1.129   25.021 191.933 1.00 118.80 ? 46  GLU A CG     1 
ATOM   215   C  CD     . GLU A 1 27  ? -0.055  24.596 191.090 1.00 170.57 ? 46  GLU A CD     1 
ATOM   216   O  OE1    . GLU A 1 27  ? -1.198  24.652 191.590 1.00 219.24 ? 46  GLU A OE1    1 
ATOM   217   O  OE2    . GLU A 1 27  ? 0.160   24.201 189.924 1.00 133.21 ? 46  GLU A OE2    1 
ATOM   218   H  H      . GLU A 1 27  ? 2.070   23.183 193.953 1.00 144.39 ? 46  GLU A H      1 
ATOM   219   H  HA     . GLU A 1 27  ? 2.673   25.751 193.949 1.00 159.56 ? 46  GLU A HA     1 
ATOM   220   H  HB2    . GLU A 1 27  ? 0.181   24.465 193.652 1.00 98.88  ? 46  GLU A HB2    1 
ATOM   221   H  HB3    . GLU A 1 27  ? 0.346   26.040 193.518 1.00 98.88  ? 46  GLU A HB3    1 
ATOM   222   H  HG2    . GLU A 1 27  ? 1.451   25.869 191.589 1.00 142.55 ? 46  GLU A HG2    1 
ATOM   223   H  HG3    . GLU A 1 27  ? 1.818   24.344 191.843 1.00 142.55 ? 46  GLU A HG3    1 
ATOM   224   N  N      . LEU A 1 28  ? 1.170   24.646 196.539 1.00 138.17 ? 47  LEU A N      1 
ATOM   225   C  CA     . LEU A 1 28  ? 0.938   24.971 197.940 1.00 110.44 ? 47  LEU A CA     1 
ATOM   226   C  C      . LEU A 1 28  ? 2.246   25.304 198.645 1.00 87.73  ? 47  LEU A C      1 
ATOM   227   O  O      . LEU A 1 28  ? 2.286   26.192 199.503 1.00 109.89 ? 47  LEU A O      1 
ATOM   228   C  CB     . LEU A 1 28  ? 0.225   23.814 198.638 1.00 90.57  ? 47  LEU A CB     1 
ATOM   229   C  CG     . LEU A 1 28  ? -1.305  23.880 198.601 1.00 89.21  ? 47  LEU A CG     1 
ATOM   230   C  CD1    . LEU A 1 28  ? -1.810  23.987 197.176 1.00 158.31 ? 47  LEU A CD1    1 
ATOM   231   C  CD2    . LEU A 1 28  ? -1.907  22.665 199.279 1.00 96.54  ? 47  LEU A CD2    1 
ATOM   232   H  H      . LEU A 1 28  ? 0.963   23.842 196.315 1.00 165.80 ? 47  LEU A H      1 
ATOM   233   H  HA     . LEU A 1 28  ? 0.364   25.751 197.992 1.00 132.52 ? 47  LEU A HA     1 
ATOM   234   H  HB2    . LEU A 1 28  ? 0.492   22.985 198.211 1.00 108.68 ? 47  LEU A HB2    1 
ATOM   235   H  HB3    . LEU A 1 28  ? 0.495   23.803 199.569 1.00 108.68 ? 47  LEU A HB3    1 
ATOM   236   H  HG     . LEU A 1 28  ? -1.599  24.669 199.083 1.00 107.05 ? 47  LEU A HG     1 
ATOM   237   H  HD11   . LEU A 1 28  ? -2.779  24.026 197.187 1.00 189.97 ? 47  LEU A HD11   1 
ATOM   238   H  HD12   . LEU A 1 28  ? -1.450  24.793 196.773 1.00 189.97 ? 47  LEU A HD12   1 
ATOM   239   H  HD13   . LEU A 1 28  ? -1.516  23.208 196.678 1.00 189.97 ? 47  LEU A HD13   1 
ATOM   240   H  HD21   . LEU A 1 28  ? -2.874  22.730 199.243 1.00 115.84 ? 47  LEU A HD21   1 
ATOM   241   H  HD22   . LEU A 1 28  ? -1.611  21.866 198.815 1.00 115.84 ? 47  LEU A HD22   1 
ATOM   242   H  HD23   . LEU A 1 28  ? -1.611  22.640 200.202 1.00 115.84 ? 47  LEU A HD23   1 
ATOM   243   N  N      . ASP A 1 29  ? 3.331   24.615 198.286 1.00 89.19  ? 48  ASP A N      1 
ATOM   244   C  CA     . ASP A 1 29  ? 4.619   24.903 198.910 1.00 92.09  ? 48  ASP A CA     1 
ATOM   245   C  C      . ASP A 1 29  ? 5.135   26.277 198.494 1.00 105.61 ? 48  ASP A C      1 
ATOM   246   O  O      . ASP A 1 29  ? 5.570   27.067 199.338 1.00 136.94 ? 48  ASP A O      1 
ATOM   247   C  CB     . ASP A 1 29  ? 5.632   23.811 198.563 1.00 143.04 ? 48  ASP A CB     1 
ATOM   248   C  CG     . ASP A 1 29  ? 6.922   23.938 199.355 1.00 161.57 ? 48  ASP A CG     1 
ATOM   249   O  OD1    . ASP A 1 29  ? 7.603   24.978 199.230 1.00 157.91 ? 48  ASP A OD1    1 
ATOM   250   O  OD2    . ASP A 1 29  ? 7.248   23.001 200.115 1.00 130.36 ? 48  ASP A OD2    1 
ATOM   251   H  H      . ASP A 1 29  ? 3.347   23.989 197.697 1.00 107.03 ? 48  ASP A H      1 
ATOM   252   H  HA     . ASP A 1 29  ? 4.506   24.908 199.873 1.00 110.51 ? 48  ASP A HA     1 
ATOM   253   H  HB2    . ASP A 1 29  ? 5.243   22.944 198.759 1.00 171.65 ? 48  ASP A HB2    1 
ATOM   254   H  HB3    . ASP A 1 29  ? 5.851   23.872 197.620 1.00 171.65 ? 48  ASP A HB3    1 
ATOM   255   N  N      . ARG A 1 30  ? 5.100   26.581 197.195 1.00 113.72 ? 49  ARG A N      1 
ATOM   256   C  CA     . ARG A 1 30  ? 5.490   27.914 196.740 1.00 114.32 ? 49  ARG A CA     1 
ATOM   257   C  C      . ARG A 1 30  ? 4.661   28.987 197.437 1.00 127.25 ? 49  ARG A C      1 
ATOM   258   O  O      . ARG A 1 30  ? 5.199   29.900 198.078 1.00 106.73 ? 49  ARG A O      1 
ATOM   259   C  CB     . ARG A 1 30  ? 5.327   28.013 195.222 1.00 98.53  ? 49  ARG A CB     1 
ATOM   260   C  CG     . ARG A 1 30  ? 6.207   27.060 194.433 1.00 107.32 ? 49  ARG A CG     1 
ATOM   261   C  CD     . ARG A 1 30  ? 5.885   27.109 192.946 1.00 81.71  ? 49  ARG A CD     1 
ATOM   262   N  NE     . ARG A 1 30  ? 6.695   26.161 192.186 1.00 128.41 ? 49  ARG A NE     1 
ATOM   263   C  CZ     . ARG A 1 30  ? 6.633   26.010 190.867 1.00 135.06 ? 49  ARG A CZ     1 
ATOM   264   N  NH1    . ARG A 1 30  ? 5.794   26.745 190.148 1.00 125.01 ? 49  ARG A NH1    1 
ATOM   265   N  NH2    . ARG A 1 30  ? 7.412   25.121 190.264 1.00 101.14 ? 49  ARG A NH2    1 
ATOM   266   H  H      . ARG A 1 30  ? 4.859   26.044 196.568 1.00 136.46 ? 49  ARG A H      1 
ATOM   267   H  HA     . ARG A 1 30  ? 6.424   28.064 196.956 1.00 137.18 ? 49  ARG A HA     1 
ATOM   268   H  HB2    . ARG A 1 30  ? 4.404   27.818 194.996 1.00 118.24 ? 49  ARG A HB2    1 
ATOM   269   H  HB3    . ARG A 1 30  ? 5.548   28.916 194.945 1.00 118.24 ? 49  ARG A HB3    1 
ATOM   270   H  HG2    . ARG A 1 30  ? 7.137   27.309 194.551 1.00 128.79 ? 49  ARG A HG2    1 
ATOM   271   H  HG3    . ARG A 1 30  ? 6.060   26.154 194.747 1.00 128.79 ? 49  ARG A HG3    1 
ATOM   272   H  HD2    . ARG A 1 30  ? 4.950   26.883 192.814 1.00 98.05  ? 49  ARG A HD2    1 
ATOM   273   H  HD3    . ARG A 1 30  ? 6.065   28.000 192.609 1.00 98.05  ? 49  ARG A HD3    1 
ATOM   274   H  HE     . ARG A 1 30  ? 7.250   25.669 192.620 1.00 154.09 ? 49  ARG A HE     1 
ATOM   275   H  HH11   . ARG A 1 30  ? 5.288   27.323 190.536 1.00 150.01 ? 49  ARG A HH11   1 
ATOM   276   H  HH12   . ARG A 1 30  ? 5.757   26.645 189.295 1.00 150.01 ? 49  ARG A HH12   1 
ATOM   277   H  HH21   . ARG A 1 30  ? 7.956   24.642 190.727 1.00 121.37 ? 49  ARG A HH21   1 
ATOM   278   H  HH22   . ARG A 1 30  ? 7.372   25.022 189.410 1.00 121.37 ? 49  ARG A HH22   1 
ATOM   279   N  N      . LEU A 1 31  ? 3.336   28.885 197.312 1.00 124.54 ? 50  LEU A N      1 
ATOM   280   C  CA     . LEU A 1 31  ? 2.435   29.829 197.959 1.00 99.67  ? 50  LEU A CA     1 
ATOM   281   C  C      . LEU A 1 31  ? 2.803   30.025 199.423 1.00 107.83 ? 50  LEU A C      1 
ATOM   282   O  O      . LEU A 1 31  ? 2.930   31.158 199.900 1.00 127.70 ? 50  LEU A O      1 
ATOM   283   C  CB     . LEU A 1 31  ? 0.997   29.325 197.826 1.00 83.84  ? 50  LEU A CB     1 
ATOM   284   C  CG     . LEU A 1 31  ? -0.070  30.020 198.667 1.00 110.73 ? 50  LEU A CG     1 
ATOM   285   C  CD1    . LEU A 1 31  ? 0.033   31.520 198.525 1.00 122.35 ? 50  LEU A CD1    1 
ATOM   286   C  CD2    . LEU A 1 31  ? -1.449  29.538 198.242 1.00 99.23  ? 50  LEU A CD2    1 
ATOM   287   H  H      . LEU A 1 31  ? 2.937   28.276 196.855 1.00 149.45 ? 50  LEU A H      1 
ATOM   288   H  HA     . LEU A 1 31  ? 2.498   30.688 197.514 1.00 119.61 ? 50  LEU A HA     1 
ATOM   289   H  HB2    . LEU A 1 31  ? 0.732   29.417 196.897 1.00 100.60 ? 50  LEU A HB2    1 
ATOM   290   H  HB3    . LEU A 1 31  ? 0.984   28.386 198.069 1.00 100.60 ? 50  LEU A HB3    1 
ATOM   291   H  HG     . LEU A 1 31  ? 0.059   29.792 199.601 1.00 132.87 ? 50  LEU A HG     1 
ATOM   292   H  HD11   . LEU A 1 31  ? -0.655  31.935 199.068 1.00 146.82 ? 50  LEU A HD11   1 
ATOM   293   H  HD12   . LEU A 1 31  ? 0.910   31.806 198.825 1.00 146.82 ? 50  LEU A HD12   1 
ATOM   294   H  HD13   . LEU A 1 31  ? -0.093  31.758 197.593 1.00 146.82 ? 50  LEU A HD13   1 
ATOM   295   H  HD21   . LEU A 1 31  ? -2.120  29.985 198.782 1.00 119.07 ? 50  LEU A HD21   1 
ATOM   296   H  HD22   . LEU A 1 31  ? -1.582  29.751 197.305 1.00 119.07 ? 50  LEU A HD22   1 
ATOM   297   H  HD23   . LEU A 1 31  ? -1.503  28.579 198.374 1.00 119.07 ? 50  LEU A HD23   1 
ATOM   298   N  N      . ALA A 1 32  ? 2.982   28.922 200.153 1.00 131.94 ? 51  ALA A N      1 
ATOM   299   C  CA     . ALA A 1 32  ? 3.354   29.014 201.561 1.00 84.18  ? 51  ALA A CA     1 
ATOM   300   C  C      . ALA A 1 32  ? 4.642   29.807 201.732 1.00 108.98 ? 51  ALA A C      1 
ATOM   301   O  O      . ALA A 1 32  ? 4.720   30.720 202.562 1.00 100.22 ? 51  ALA A O      1 
ATOM   302   C  CB     . ALA A 1 32  ? 3.503   27.615 202.160 1.00 80.85  ? 51  ALA A CB     1 
ATOM   303   H  H      . ALA A 1 32  ? 2.895   28.118 199.859 1.00 158.33 ? 51  ALA A H      1 
ATOM   304   H  HA     . ALA A 1 32  ? 2.651   29.475 202.045 1.00 101.02 ? 51  ALA A HA     1 
ATOM   305   H  HB1    . ALA A 1 32  ? 3.750   27.697 203.094 1.00 97.02  ? 51  ALA A HB1    1 
ATOM   306   H  HB2    . ALA A 1 32  ? 2.658   27.146 202.080 1.00 97.02  ? 51  ALA A HB2    1 
ATOM   307   H  HB3    . ALA A 1 32  ? 4.194   27.137 201.676 1.00 97.02  ? 51  ALA A HB3    1 
ATOM   308   N  N      . SER A 1 33  ? 5.670   29.470 200.950 1.00 122.00 ? 52  SER A N      1 
ATOM   309   C  CA     . SER A 1 33  ? 6.932   30.191 201.032 1.00 117.27 ? 52  SER A CA     1 
ATOM   310   C  C      . SER A 1 33  ? 6.759   31.674 200.742 1.00 113.00 ? 52  SER A C      1 
ATOM   311   O  O      . SER A 1 33  ? 7.584   32.481 201.185 1.00 145.61 ? 52  SER A O      1 
ATOM   312   C  CB     . SER A 1 33  ? 7.949   29.588 200.062 1.00 122.49 ? 52  SER A CB     1 
ATOM   313   O  OG     . SER A 1 33  ? 9.209   30.223 200.191 1.00 125.67 ? 52  SER A OG     1 
ATOM   314   H  H      . SER A 1 33  ? 5.659   28.833 200.372 1.00 146.40 ? 52  SER A H      1 
ATOM   315   H  HA     . SER A 1 33  ? 7.287   30.102 201.930 1.00 140.72 ? 52  SER A HA     1 
ATOM   316   H  HB2    . SER A 1 33  ? 8.050   28.643 200.258 1.00 146.99 ? 52  SER A HB2    1 
ATOM   317   H  HB3    . SER A 1 33  ? 7.627   29.705 199.154 1.00 146.99 ? 52  SER A HB3    1 
ATOM   318   H  HG     . SER A 1 33  ? 9.758   29.883 199.653 1.00 150.80 ? 52  SER A HG     1 
ATOM   319   N  N      . LEU A 1 34  ? 5.709   32.056 200.014 1.00 80.02  ? 53  LEU A N      1 
ATOM   320   C  CA     . LEU A 1 34  ? 5.464   33.469 199.750 1.00 101.31 ? 53  LEU A CA     1 
ATOM   321   C  C      . LEU A 1 34  ? 4.746   34.180 200.891 1.00 84.44  ? 53  LEU A C      1 
ATOM   322   O  O      . LEU A 1 34  ? 4.597   35.405 200.836 1.00 87.37  ? 53  LEU A O      1 
ATOM   323   C  CB     . LEU A 1 34  ? 4.656   33.627 198.463 1.00 118.60 ? 53  LEU A CB     1 
ATOM   324   C  CG     . LEU A 1 34  ? 5.502   33.903 197.218 1.00 94.37  ? 53  LEU A CG     1 
ATOM   325   C  CD1    . LEU A 1 34  ? 6.429   32.729 196.915 1.00 139.36 ? 53  LEU A CD1    1 
ATOM   326   C  CD2    . LEU A 1 34  ? 4.611   34.209 196.034 1.00 107.44 ? 53  LEU A CD2    1 
ATOM   327   H  H      . LEU A 1 34  ? 5.131   31.522 199.666 1.00 96.02  ? 53  LEU A H      1 
ATOM   328   H  HA     . LEU A 1 34  ? 6.318   33.911 199.619 1.00 121.57 ? 53  LEU A HA     1 
ATOM   329   H  HB2    . LEU A 1 34  ? 4.158   32.810 198.306 1.00 142.32 ? 53  LEU A HB2    1 
ATOM   330   H  HB3    . LEU A 1 34  ? 4.041   34.369 198.571 1.00 142.32 ? 53  LEU A HB3    1 
ATOM   331   H  HG     . LEU A 1 34  ? 6.055   34.682 197.383 1.00 113.24 ? 53  LEU A HG     1 
ATOM   332   H  HD11   . LEU A 1 34  ? 6.950   32.935 196.123 1.00 167.23 ? 53  LEU A HD11   1 
ATOM   333   H  HD12   . LEU A 1 34  ? 7.019   32.590 197.673 1.00 167.23 ? 53  LEU A HD12   1 
ATOM   334   H  HD13   . LEU A 1 34  ? 5.893   31.935 196.763 1.00 167.23 ? 53  LEU A HD13   1 
ATOM   335   H  HD21   . LEU A 1 34  ? 5.167   34.380 195.257 1.00 128.93 ? 53  LEU A HD21   1 
ATOM   336   H  HD22   . LEU A 1 34  ? 4.035   33.446 195.867 1.00 128.93 ? 53  LEU A HD22   1 
ATOM   337   H  HD23   . LEU A 1 34  ? 4.075   34.991 196.236 1.00 128.93 ? 53  LEU A HD23   1 
ATOM   338   N  N      . LEU A 1 35  ? 4.310   33.458 201.918 1.00 109.53 ? 54  LEU A N      1 
ATOM   339   C  CA     . LEU A 1 35  ? 3.547   34.070 202.989 1.00 80.66  ? 54  LEU A CA     1 
ATOM   340   C  C      . LEU A 1 35  ? 4.424   35.008 203.815 1.00 89.39  ? 54  LEU A C      1 
ATOM   341   O  O      . LEU A 1 35  ? 5.648   34.857 203.854 1.00 102.95 ? 54  LEU A O      1 
ATOM   342   C  CB     . LEU A 1 35  ? 2.944   32.995 203.883 1.00 94.11  ? 54  LEU A CB     1 
ATOM   343   C  CG     . LEU A 1 35  ? 1.934   32.107 203.166 1.00 82.54  ? 54  LEU A CG     1 
ATOM   344   C  CD1    . LEU A 1 35  ? 1.701   30.839 203.964 1.00 128.28 ? 54  LEU A CD1    1 
ATOM   345   C  CD2    . LEU A 1 35  ? 0.640   32.870 202.938 1.00 81.46  ? 54  LEU A CD2    1 
ATOM   346   H  H      . LEU A 1 35  ? 4.445   32.614 202.015 1.00 131.44 ? 54  LEU A H      1 
ATOM   347   H  HA     . LEU A 1 35  ? 2.822   34.590 202.608 1.00 96.79  ? 54  LEU A HA     1 
ATOM   348   H  HB2    . LEU A 1 35  ? 3.656   32.427 204.216 1.00 112.93 ? 54  LEU A HB2    1 
ATOM   349   H  HB3    . LEU A 1 35  ? 2.490   33.423 204.626 1.00 112.93 ? 54  LEU A HB3    1 
ATOM   350   H  HG     . LEU A 1 35  ? 2.291   31.856 202.300 1.00 99.05  ? 54  LEU A HG     1 
ATOM   351   H  HD11   . LEU A 1 35  ? 1.057   30.285 203.495 1.00 153.93 ? 54  LEU A HD11   1 
ATOM   352   H  HD12   . LEU A 1 35  ? 2.542   30.364 204.054 1.00 153.93 ? 54  LEU A HD12   1 
ATOM   353   H  HD13   . LEU A 1 35  ? 1.359   31.076 204.840 1.00 153.93 ? 54  LEU A HD13   1 
ATOM   354   H  HD21   . LEU A 1 35  ? 0.009   32.291 202.482 1.00 97.75  ? 54  LEU A HD21   1 
ATOM   355   H  HD22   . LEU A 1 35  ? 0.279   33.142 203.796 1.00 97.75  ? 54  LEU A HD22   1 
ATOM   356   H  HD23   . LEU A 1 35  ? 0.827   33.651 202.394 1.00 97.75  ? 54  LEU A HD23   1 
ATOM   357   N  N      . PRO A 1 36  ? 3.807   35.984 204.517 1.00 93.80  ? 55  PRO A N      1 
ATOM   358   C  CA     . PRO A 1 36  ? 4.565   37.037 205.200 1.00 88.75  ? 55  PRO A CA     1 
ATOM   359   C  C      . PRO A 1 36  ? 4.894   36.707 206.655 1.00 81.35  ? 55  PRO A C      1 
ATOM   360   O  O      . PRO A 1 36  ? 4.718   37.529 207.560 1.00 100.71 ? 55  PRO A O      1 
ATOM   361   C  CB     . PRO A 1 36  ? 3.623   38.245 205.089 1.00 83.92  ? 55  PRO A CB     1 
ATOM   362   C  CG     . PRO A 1 36  ? 2.227   37.632 205.024 1.00 86.77  ? 55  PRO A CG     1 
ATOM   363   C  CD     . PRO A 1 36  ? 2.362   36.151 204.745 1.00 86.26  ? 55  PRO A CD     1 
ATOM   364   H  HA     . PRO A 1 36  ? 5.386   37.226 204.720 1.00 106.49 ? 55  PRO A HA     1 
ATOM   365   H  HB2    . PRO A 1 36  ? 3.717   38.808 205.874 1.00 100.70 ? 55  PRO A HB2    1 
ATOM   366   H  HB3    . PRO A 1 36  ? 3.820   38.743 204.281 1.00 100.70 ? 55  PRO A HB3    1 
ATOM   367   H  HG2    . PRO A 1 36  ? 1.780   37.770 205.874 1.00 104.12 ? 55  PRO A HG2    1 
ATOM   368   H  HG3    . PRO A 1 36  ? 1.726   38.060 204.312 1.00 104.12 ? 55  PRO A HG3    1 
ATOM   369   H  HD2    . PRO A 1 36  ? 2.078   35.634 205.514 1.00 103.52 ? 55  PRO A HD2    1 
ATOM   370   H  HD3    . PRO A 1 36  ? 1.863   35.910 203.949 1.00 103.52 ? 55  PRO A HD3    1 
ATOM   371   N  N      . PHE A 1 37  ? 5.385   35.497 206.890 1.00 122.80 ? 56  PHE A N      1 
ATOM   372   C  CA     . PHE A 1 37  ? 5.757   35.051 208.220 1.00 79.82  ? 56  PHE A CA     1 
ATOM   373   C  C      . PHE A 1 37  ? 7.212   34.607 208.240 1.00 86.16  ? 56  PHE A C      1 
ATOM   374   O  O      . PHE A 1 37  ? 7.823   34.397 207.185 1.00 84.64  ? 56  PHE A O      1 
ATOM   375   C  CB     . PHE A 1 37  ? 4.863   33.890 208.679 1.00 62.91  ? 56  PHE A CB     1 
ATOM   376   C  CG     . PHE A 1 37  ? 3.394   34.216 208.690 1.00 62.36  ? 56  PHE A CG     1 
ATOM   377   C  CD1    . PHE A 1 37  ? 2.954   35.498 208.972 1.00 66.24  ? 56  PHE A CD1    1 
ATOM   378   C  CD2    . PHE A 1 37  ? 2.454   33.237 208.419 1.00 66.31  ? 56  PHE A CD2    1 
ATOM   379   C  CE1    . PHE A 1 37  ? 1.607   35.795 208.986 1.00 71.81  ? 56  PHE A CE1    1 
ATOM   380   C  CE2    . PHE A 1 37  ? 1.106   33.528 208.432 1.00 72.30  ? 56  PHE A CE2    1 
ATOM   381   C  CZ     . PHE A 1 37  ? 0.681   34.808 208.715 1.00 61.42  ? 56  PHE A CZ     1 
ATOM   382   H  H      . PHE A 1 37  ? 5.513   34.905 206.280 1.00 147.36 ? 56  PHE A H      1 
ATOM   383   H  HA     . PHE A 1 37  ? 5.652   35.784 208.847 1.00 95.78  ? 56  PHE A HA     1 
ATOM   384   H  HB2    . PHE A 1 37  ? 4.995   33.139 208.080 1.00 75.49  ? 56  PHE A HB2    1 
ATOM   385   H  HB3    . PHE A 1 37  ? 5.117   33.639 209.581 1.00 75.49  ? 56  PHE A HB3    1 
ATOM   386   H  HD1    . PHE A 1 37  ? 3.574   36.166 209.157 1.00 79.48  ? 56  PHE A HD1    1 
ATOM   387   H  HD2    . PHE A 1 37  ? 2.735   32.371 208.229 1.00 79.58  ? 56  PHE A HD2    1 
ATOM   388   H  HE1    . PHE A 1 37  ? 1.324   36.660 209.176 1.00 86.17  ? 56  PHE A HE1    1 
ATOM   389   H  HE2    . PHE A 1 37  ? 0.484   32.861 208.248 1.00 86.76  ? 56  PHE A HE2    1 
ATOM   390   H  HZ     . PHE A 1 37  ? -0.227  35.007 208.722 1.00 73.71  ? 56  PHE A HZ     1 
ATOM   391   N  N      . PRO A 1 38  ? 7.806   34.466 209.423 1.00 87.35  ? 57  PRO A N      1 
ATOM   392   C  CA     . PRO A 1 38  ? 9.171   33.939 209.490 1.00 101.79 ? 57  PRO A CA     1 
ATOM   393   C  C      . PRO A 1 38  ? 9.225   32.510 208.977 1.00 76.54  ? 57  PRO A C      1 
ATOM   394   O  O      . PRO A 1 38  ? 8.252   31.759 209.061 1.00 87.80  ? 57  PRO A O      1 
ATOM   395   C  CB     . PRO A 1 38  ? 9.511   34.014 210.982 1.00 81.66  ? 57  PRO A CB     1 
ATOM   396   C  CG     . PRO A 1 38  ? 8.575   35.032 211.537 1.00 93.66  ? 57  PRO A CG     1 
ATOM   397   C  CD     . PRO A 1 38  ? 7.319   34.901 210.742 1.00 104.67 ? 57  PRO A CD     1 
ATOM   398   H  HA     . PRO A 1 38  ? 9.782   34.496 208.984 1.00 122.15 ? 57  PRO A HA     1 
ATOM   399   H  HB2    . PRO A 1 38  ? 9.364   33.150 211.396 1.00 97.99  ? 57  PRO A HB2    1 
ATOM   400   H  HB3    . PRO A 1 38  ? 10.432  34.297 211.094 1.00 97.99  ? 57  PRO A HB3    1 
ATOM   401   H  HG2    . PRO A 1 38  ? 8.408   34.843 212.474 1.00 112.39 ? 57  PRO A HG2    1 
ATOM   402   H  HG3    . PRO A 1 38  ? 8.957   35.917 211.430 1.00 112.39 ? 57  PRO A HG3    1 
ATOM   403   H  HD2    . PRO A 1 38  ? 6.741   34.226 211.130 1.00 125.60 ? 57  PRO A HD2    1 
ATOM   404   H  HD3    . PRO A 1 38  ? 6.871   35.759 210.672 1.00 125.60 ? 57  PRO A HD3    1 
ATOM   405   N  N      . GLN A 1 39  ? 10.384  32.137 208.429 1.00 94.53  ? 58  GLN A N      1 
ATOM   406   C  CA     . GLN A 1 39  ? 10.545  30.779 207.924 1.00 102.67 ? 58  GLN A CA     1 
ATOM   407   C  C      . GLN A 1 39  ? 10.287  29.751 209.015 1.00 96.56  ? 58  GLN A C      1 
ATOM   408   O  O      . GLN A 1 39  ? 9.764   28.666 208.735 1.00 88.89  ? 58  GLN A O      1 
ATOM   409   C  CB     . GLN A 1 39  ? 11.947  30.593 207.342 1.00 102.35 ? 58  GLN A CB     1 
ATOM   410   C  CG     . GLN A 1 39  ? 12.198  31.365 206.054 1.00 126.74 ? 58  GLN A CG     1 
ATOM   411   C  CD     . GLN A 1 39  ? 13.599  31.150 205.506 1.00 175.95 ? 58  GLN A CD     1 
ATOM   412   O  OE1    . GLN A 1 39  ? 14.490  30.681 206.217 1.00 165.98 ? 58  GLN A OE1    1 
ATOM   413   N  NE2    . GLN A 1 39  ? 13.797  31.486 204.235 1.00 118.14 ? 58  GLN A NE2    1 
ATOM   414   H  H      . GLN A 1 39  ? 11.075  32.641 208.341 1.00 113.43 ? 58  GLN A H      1 
ATOM   415   H  HA     . GLN A 1 39  ? 9.902   30.628 207.213 1.00 123.21 ? 58  GLN A HA     1 
ATOM   416   H  HB2    . GLN A 1 39  ? 12.597  30.892 207.996 1.00 122.81 ? 58  GLN A HB2    1 
ATOM   417   H  HB3    . GLN A 1 39  ? 12.083  29.652 207.152 1.00 122.81 ? 58  GLN A HB3    1 
ATOM   418   H  HG2    . GLN A 1 39  ? 11.564  31.073 205.381 1.00 152.09 ? 58  GLN A HG2    1 
ATOM   419   H  HG3    . GLN A 1 39  ? 12.086  32.313 206.226 1.00 152.09 ? 58  GLN A HG3    1 
ATOM   420   H  HE21   . GLN A 1 39  ? 13.149  31.807 203.769 1.00 141.77 ? 58  GLN A HE21   1 
ATOM   421   H  HE22   . GLN A 1 39  ? 14.573  31.384 203.879 1.00 141.77 ? 58  GLN A HE22   1 
ATOM   422   N  N      . ASP A 1 40  ? 10.639  30.079 210.262 1.00 101.60 ? 59  ASP A N      1 
ATOM   423   C  CA     . ASP A 1 40  ? 10.441  29.146 211.366 1.00 96.55  ? 59  ASP A CA     1 
ATOM   424   C  C      . ASP A 1 40  ? 9.031   28.572 211.358 1.00 88.65  ? 59  ASP A C      1 
ATOM   425   O  O      . ASP A 1 40  ? 8.834   27.382 211.631 1.00 96.04  ? 59  ASP A O      1 
ATOM   426   C  CB     . ASP A 1 40  ? 10.713  29.842 212.703 1.00 114.06 ? 59  ASP A CB     1 
ATOM   427   C  CG     . ASP A 1 40  ? 12.139  30.340 212.829 1.00 124.13 ? 59  ASP A CG     1 
ATOM   428   O  OD1    . ASP A 1 40  ? 13.062  29.624 212.387 1.00 109.45 ? 59  ASP A OD1    1 
ATOM   429   O  OD2    . ASP A 1 40  ? 12.336  31.448 213.375 1.00 119.01 ? 59  ASP A OD2    1 
ATOM   430   H  H      . ASP A 1 40  ? 10.991  30.830 210.490 1.00 121.92 ? 59  ASP A H      1 
ATOM   431   H  HA     . ASP A 1 40  ? 11.067  28.410 211.276 1.00 115.86 ? 59  ASP A HA     1 
ATOM   432   H  HB2    . ASP A 1 40  ? 10.121  30.606 212.787 1.00 136.87 ? 59  ASP A HB2    1 
ATOM   433   H  HB3    . ASP A 1 40  ? 10.549  29.215 213.425 1.00 136.87 ? 59  ASP A HB3    1 
ATOM   434   N  N      . VAL A 1 41  ? 8.039   29.403 211.037 1.00 92.75  ? 60  VAL A N      1 
ATOM   435   C  CA     . VAL A 1 41  ? 6.640   29.002 211.136 1.00 87.34  ? 60  VAL A CA     1 
ATOM   436   C  C      . VAL A 1 41  ? 6.143   28.528 209.780 1.00 62.48  ? 60  VAL A C      1 
ATOM   437   O  O      . VAL A 1 41  ? 5.275   27.653 209.703 1.00 93.59  ? 60  VAL A O      1 
ATOM   438   C  CB     . VAL A 1 41  ? 5.764   30.150 211.677 1.00 87.12  ? 60  VAL A CB     1 
ATOM   439   C  CG1    . VAL A 1 41  ? 5.844   31.370 210.782 1.00 77.44  ? 60  VAL A CG1    1 
ATOM   440   C  CG2    . VAL A 1 41  ? 4.320   29.695 211.833 1.00 114.21 ? 60  VAL A CG2    1 
ATOM   441   H  H      . VAL A 1 41  ? 8.153   30.208 210.758 1.00 111.30 ? 60  VAL A H      1 
ATOM   442   H  HA     . VAL A 1 41  ? 6.571   28.259 211.755 1.00 104.81 ? 60  VAL A HA     1 
ATOM   443   H  HB     . VAL A 1 41  ? 6.090   30.404 212.554 1.00 104.55 ? 60  VAL A HB     1 
ATOM   444   H  HG11   . VAL A 1 41  ? 5.282   32.069 211.152 1.00 92.93  ? 60  VAL A HG11   1 
ATOM   445   H  HG12   . VAL A 1 41  ? 6.765   31.672 210.742 1.00 92.93  ? 60  VAL A HG12   1 
ATOM   446   H  HG13   . VAL A 1 41  ? 5.535   31.131 209.894 1.00 92.93  ? 60  VAL A HG13   1 
ATOM   447   H  HG21   . VAL A 1 41  ? 3.792   30.434 212.174 1.00 137.05 ? 60  VAL A HG21   1 
ATOM   448   H  HG22   . VAL A 1 41  ? 3.981   29.417 210.968 1.00 137.05 ? 60  VAL A HG22   1 
ATOM   449   H  HG23   . VAL A 1 41  ? 4.289   28.952 212.455 1.00 137.05 ? 60  VAL A HG23   1 
ATOM   450   N  N      . ILE A 1 42  ? 6.684   29.101 208.705 1.00 76.55  ? 61  ILE A N      1 
ATOM   451   C  CA     . ILE A 1 42  ? 6.233   28.732 207.364 1.00 103.39 ? 61  ILE A CA     1 
ATOM   452   C  C      . ILE A 1 42  ? 6.360   27.227 207.162 1.00 110.67 ? 61  ILE A C      1 
ATOM   453   O  O      . ILE A 1 42  ? 5.434   26.566 206.677 1.00 89.97  ? 61  ILE A O      1 
ATOM   454   C  CB     . ILE A 1 42  ? 7.018   29.514 206.294 1.00 85.06  ? 61  ILE A CB     1 
ATOM   455   C  CG1    . ILE A 1 42  ? 6.628   30.995 206.330 1.00 139.79 ? 61  ILE A CG1    1 
ATOM   456   C  CG2    . ILE A 1 42  ? 6.752   28.935 204.901 1.00 89.30  ? 61  ILE A CG2    1 
ATOM   457   C  CD1    . ILE A 1 42  ? 7.435   31.891 205.396 1.00 125.11 ? 61  ILE A CD1    1 
ATOM   458   H  H      . ILE A 1 42  ? 7.304   29.696 208.723 1.00 91.87  ? 61  ILE A H      1 
ATOM   459   H  HA     . ILE A 1 42  ? 5.296   28.965 207.275 1.00 124.06 ? 61  ILE A HA     1 
ATOM   460   H  HB     . ILE A 1 42  ? 7.966   29.438 206.486 1.00 102.07 ? 61  ILE A HB     1 
ATOM   461   H  HG12   . ILE A 1 42  ? 5.694   31.075 206.079 1.00 167.75 ? 61  ILE A HG12   1 
ATOM   462   H  HG13   . ILE A 1 42  ? 6.752   31.325 207.233 1.00 167.75 ? 61  ILE A HG13   1 
ATOM   463   H  HG21   . ILE A 1 42  ? 7.256   29.443 204.247 1.00 107.16 ? 61  ILE A HG21   1 
ATOM   464   H  HG22   . ILE A 1 42  ? 7.033   28.006 204.887 1.00 107.16 ? 61  ILE A HG22   1 
ATOM   465   H  HG23   . ILE A 1 42  ? 5.803   28.997 204.710 1.00 107.16 ? 61  ILE A HG23   1 
ATOM   466   H  HD11   . ILE A 1 42  ? 7.121   32.804 205.486 1.00 150.13 ? 61  ILE A HD11   1 
ATOM   467   H  HD12   . ILE A 1 42  ? 8.372   31.837 205.640 1.00 150.13 ? 61  ILE A HD12   1 
ATOM   468   H  HD13   . ILE A 1 42  ? 7.312   31.586 204.483 1.00 150.13 ? 61  ILE A HD13   1 
ATOM   469   N  N      . ASN A 1 43  ? 7.510   26.662 207.537 1.00 118.93 ? 62  ASN A N      1 
ATOM   470   C  CA     . ASN A 1 43  ? 7.787   25.268 207.209 1.00 88.78  ? 62  ASN A CA     1 
ATOM   471   C  C      . ASN A 1 43  ? 6.930   24.309 208.018 1.00 73.20  ? 62  ASN A C      1 
ATOM   472   O  O      . ASN A 1 43  ? 6.671   23.186 207.570 1.00 128.24 ? 62  ASN A O      1 
ATOM   473   C  CB     . ASN A 1 43  ? 9.268   24.964 207.425 1.00 82.73  ? 62  ASN A CB     1 
ATOM   474   C  CG     . ASN A 1 43  ? 10.180  25.840 206.576 1.00 128.05 ? 62  ASN A CG     1 
ATOM   475   O  OD1    . ASN A 1 43  ? 11.356  25.998 206.888 1.00 131.76 ? 62  ASN A OD1    1 
ATOM   476   N  ND2    . ASN A 1 43  ? 9.640   26.422 205.511 1.00 127.97 ? 62  ASN A ND2    1 
ATOM   477   H  H      . ASN A 1 43  ? 8.135   27.059 207.975 1.00 142.72 ? 62  ASN A H      1 
ATOM   478   H  HA     . ASN A 1 43  ? 7.588   25.123 206.271 1.00 106.54 ? 62  ASN A HA     1 
ATOM   479   H  HB2    . ASN A 1 43  ? 9.489   25.116 208.357 1.00 99.28  ? 62  ASN A HB2    1 
ATOM   480   H  HB3    . ASN A 1 43  ? 9.438   24.039 207.190 1.00 99.28  ? 62  ASN A HB3    1 
ATOM   481   H  HD21   . ASN A 1 43  ? 10.122  26.924 205.005 1.00 153.57 ? 62  ASN A HD21   1 
ATOM   482   H  HD22   . ASN A 1 43  ? 8.810   26.297 205.327 1.00 153.57 ? 62  ASN A HD22   1 
ATOM   483   N  N      . LYS A 1 44  ? 6.479   24.720 209.199 1.00 98.36  ? 63  LYS A N      1 
ATOM   484   C  CA     . LYS A 1 44  ? 5.611   23.891 210.021 1.00 91.10  ? 63  LYS A CA     1 
ATOM   485   C  C      . LYS A 1 44  ? 4.134   24.144 209.743 1.00 72.55  ? 63  LYS A C      1 
ATOM   486   O  O      . LYS A 1 44  ? 3.290   23.814 210.585 1.00 70.95  ? 63  LYS A O      1 
ATOM   487   C  CB     . LYS A 1 44  ? 5.923   24.117 211.504 1.00 110.77 ? 63  LYS A CB     1 
ATOM   488   C  CG     . LYS A 1 44  ? 7.325   23.676 211.915 1.00 97.38  ? 63  LYS A CG     1 
ATOM   489   C  CD     . LYS A 1 44  ? 7.598   23.962 213.386 1.00 112.18 ? 63  LYS A CD     1 
ATOM   490   C  CE     . LYS A 1 44  ? 9.001   23.531 213.798 1.00 119.30 ? 63  LYS A CE     1 
ATOM   491   N  NZ     . LYS A 1 44  ? 9.285   23.850 215.227 1.00 119.48 ? 63  LYS A NZ     1 
ATOM   492   H  H      . LYS A 1 44  ? 6.666   25.484 209.549 1.00 118.03 ? 63  LYS A H      1 
ATOM   493   H  HA     . LYS A 1 44  ? 5.792   22.960 209.820 1.00 109.32 ? 63  LYS A HA     1 
ATOM   494   H  HB2    . LYS A 1 44  ? 5.841   25.063 211.700 1.00 132.92 ? 63  LYS A HB2    1 
ATOM   495   H  HB3    . LYS A 1 44  ? 5.287   23.614 212.037 1.00 132.92 ? 63  LYS A HB3    1 
ATOM   496   H  HG2    . LYS A 1 44  ? 7.415   22.722 211.770 1.00 116.86 ? 63  LYS A HG2    1 
ATOM   497   H  HG3    . LYS A 1 44  ? 7.979   24.159 211.386 1.00 116.86 ? 63  LYS A HG3    1 
ATOM   498   H  HD2    . LYS A 1 44  ? 7.514   24.915 213.547 1.00 134.62 ? 63  LYS A HD2    1 
ATOM   499   H  HD3    . LYS A 1 44  ? 6.960   23.473 213.929 1.00 134.62 ? 63  LYS A HD3    1 
ATOM   500   H  HE2    . LYS A 1 44  ? 9.088   22.573 213.679 1.00 143.16 ? 63  LYS A HE2    1 
ATOM   501   H  HE3    . LYS A 1 44  ? 9.651   23.997 213.249 1.00 143.16 ? 63  LYS A HE3    1 
ATOM   502   H  HZ1    . LYS A 1 44  ? 10.109  23.588 215.439 1.00 143.38 ? 63  LYS A HZ1    1 
ATOM   503   H  HZ2    . LYS A 1 44  ? 9.217   24.727 215.362 1.00 143.38 ? 63  LYS A HZ2    1 
ATOM   504   H  HZ3    . LYS A 1 44  ? 8.704   23.430 215.754 1.00 143.38 ? 63  LYS A HZ3    1 
ATOM   505   N  N      . LEU A 1 45  ? 3.801   24.714 208.587 1.00 79.02  ? 64  LEU A N      1 
ATOM   506   C  CA     . LEU A 1 45  ? 2.415   25.036 208.278 1.00 109.85 ? 64  LEU A CA     1 
ATOM   507   C  C      . LEU A 1 45  ? 1.676   23.829 207.714 1.00 88.68  ? 64  LEU A C      1 
ATOM   508   O  O      . LEU A 1 45  ? 2.111   23.214 206.733 1.00 59.52  ? 64  LEU A O      1 
ATOM   509   C  CB     . LEU A 1 45  ? 2.344   26.194 207.286 1.00 84.55  ? 64  LEU A CB     1 
ATOM   510   C  CG     . LEU A 1 45  ? 2.793   27.568 207.797 1.00 109.80 ? 64  LEU A CG     1 
ATOM   511   C  CD1    . LEU A 1 45  ? 2.665   28.624 206.704 1.00 99.84  ? 64  LEU A CD1    1 
ATOM   512   C  CD2    . LEU A 1 45  ? 2.004   27.987 209.031 1.00 82.86  ? 64  LEU A CD2    1 
ATOM   513   H  H      . LEU A 1 45  ? 4.360   24.924 207.967 1.00 94.82  ? 64  LEU A H      1 
ATOM   514   H  HA     . LEU A 1 45  ? 1.965   25.310 209.092 1.00 131.82 ? 64  LEU A HA     1 
ATOM   515   H  HB2    . LEU A 1 45  ? 2.903   25.975 206.524 1.00 101.46 ? 64  LEU A HB2    1 
ATOM   516   H  HB3    . LEU A 1 45  ? 1.424   26.285 206.992 1.00 101.46 ? 64  LEU A HB3    1 
ATOM   517   H  HG     . LEU A 1 45  ? 3.729   27.516 208.048 1.00 131.76 ? 64  LEU A HG     1 
ATOM   518   H  HD11   . LEU A 1 45  ? 2.956   29.479 207.056 1.00 119.81 ? 64  LEU A HD11   1 
ATOM   519   H  HD12   . LEU A 1 45  ? 3.223   28.368 205.952 1.00 119.81 ? 64  LEU A HD12   1 
ATOM   520   H  HD13   . LEU A 1 45  ? 1.738   28.678 206.425 1.00 119.81 ? 64  LEU A HD13   1 
ATOM   521   H  HD21   . LEU A 1 45  ? 2.315   28.857 209.323 1.00 99.43  ? 64  LEU A HD21   1 
ATOM   522   H  HD22   . LEU A 1 45  ? 1.062   28.031 208.803 1.00 99.43  ? 64  LEU A HD22   1 
ATOM   523   H  HD23   . LEU A 1 45  ? 2.145   27.332 209.732 1.00 99.43  ? 64  LEU A HD23   1 
ATOM   524   N  N      . ASP A 1 46  ? 0.548   23.503 208.338 1.00 77.02  ? 65  ASP A N      1 
ATOM   525   C  CA     . ASP A 1 46  ? -0.347  22.493 207.800 1.00 79.24  ? 65  ASP A CA     1 
ATOM   526   C  C      . ASP A 1 46  ? -0.898  22.948 206.454 1.00 107.19 ? 65  ASP A C      1 
ATOM   527   O  O      . ASP A 1 46  ? -1.225  24.123 206.266 1.00 123.54 ? 65  ASP A O      1 
ATOM   528   C  CB     . ASP A 1 46  ? -1.490  22.239 208.785 1.00 78.02  ? 65  ASP A CB     1 
ATOM   529   C  CG     . ASP A 1 46  ? -2.516  21.263 208.248 1.00 101.62 ? 65  ASP A CG     1 
ATOM   530   O  OD1    . ASP A 1 46  ? -2.236  20.589 207.233 1.00 81.34  ? 65  ASP A OD1    1 
ATOM   531   O  OD2    . ASP A 1 46  ? -3.609  21.176 208.843 1.00 114.28 ? 65  ASP A OD2    1 
ATOM   532   H  H      . ASP A 1 46  ? 0.281   23.855 209.075 1.00 92.43  ? 65  ASP A H      1 
ATOM   533   H  HA     . ASP A 1 46  ? 0.139   21.663 207.670 1.00 95.09  ? 65  ASP A HA     1 
ATOM   534   H  HB2    . ASP A 1 46  ? -1.124  21.870 209.604 1.00 93.63  ? 65  ASP A HB2    1 
ATOM   535   H  HB3    . ASP A 1 46  ? -1.940  23.078 208.969 1.00 93.63  ? 65  ASP A HB3    1 
ATOM   536   N  N      . LYS A 1 47  ? -1.002  22.005 205.514 1.00 100.80 ? 66  LYS A N      1 
ATOM   537   C  CA     . LYS A 1 47  ? -1.451  22.342 204.167 1.00 84.62  ? 66  LYS A CA     1 
ATOM   538   C  C      . LYS A 1 47  ? -2.752  23.137 204.191 1.00 69.36  ? 66  LYS A C      1 
ATOM   539   O  O      . LYS A 1 47  ? -2.916  24.085 203.413 1.00 114.59 ? 66  LYS A O      1 
ATOM   540   C  CB     . LYS A 1 47  ? -1.609  21.069 203.332 1.00 58.84  ? 66  LYS A CB     1 
ATOM   541   C  CG     . LYS A 1 47  ? -0.281  20.368 203.035 1.00 82.83  ? 66  LYS A CG     1 
ATOM   542   C  CD     . LYS A 1 47  ? -0.461  19.121 202.176 1.00 86.12  ? 66  LYS A CD     1 
ATOM   543   C  CE     . LYS A 1 47  ? 0.883   18.474 201.853 1.00 116.38 ? 66  LYS A CE     1 
ATOM   544   N  NZ     . LYS A 1 47  ? 0.738   17.262 200.998 1.00 120.03 ? 66  LYS A NZ     1 
ATOM   545   H  H      . LYS A 1 47  ? -0.820  21.172 205.632 1.00 120.96 ? 66  LYS A H      1 
ATOM   546   H  HA     . LYS A 1 47  ? -0.775  22.893 203.742 1.00 101.55 ? 66  LYS A HA     1 
ATOM   547   H  HB2    . LYS A 1 47  ? -2.173  20.445 203.815 1.00 70.61  ? 66  LYS A HB2    1 
ATOM   548   H  HB3    . LYS A 1 47  ? -2.020  21.299 202.485 1.00 70.61  ? 66  LYS A HB3    1 
ATOM   549   H  HG2    . LYS A 1 47  ? 0.301   20.981 202.560 1.00 99.40  ? 66  LYS A HG2    1 
ATOM   550   H  HG3    . LYS A 1 47  ? 0.130   20.100 203.872 1.00 99.40  ? 66  LYS A HG3    1 
ATOM   551   H  HD2    . LYS A 1 47  ? -1.003  18.476 202.656 1.00 103.35 ? 66  LYS A HD2    1 
ATOM   552   H  HD3    . LYS A 1 47  ? -0.889  19.366 201.341 1.00 103.35 ? 66  LYS A HD3    1 
ATOM   553   H  HE2    . LYS A 1 47  ? 1.437   19.113 201.379 1.00 139.65 ? 66  LYS A HE2    1 
ATOM   554   H  HE3    . LYS A 1 47  ? 1.314   18.209 202.681 1.00 139.65 ? 66  LYS A HE3    1 
ATOM   555   H  HZ1    . LYS A 1 47  ? 1.539   16.912 200.831 1.00 144.04 ? 66  LYS A HZ1    1 
ATOM   556   H  HZ2    . LYS A 1 47  ? 0.238   16.655 201.414 1.00 144.04 ? 66  LYS A HZ2    1 
ATOM   557   H  HZ3    . LYS A 1 47  ? 0.350   17.479 200.227 1.00 144.04 ? 66  LYS A HZ3    1 
ATOM   558   N  N      . LEU A 1 48  ? -3.683  22.782 205.082 1.00 61.70  ? 67  LEU A N      1 
ATOM   559   C  CA     . LEU A 1 48  ? -4.937  23.530 205.171 1.00 58.15  ? 67  LEU A CA     1 
ATOM   560   C  C      . LEU A 1 48  ? -4.681  24.946 205.663 1.00 63.07  ? 67  LEU A C      1 
ATOM   561   O  O      . LEU A 1 48  ? -5.261  25.914 205.152 1.00 90.34  ? 67  LEU A O      1 
ATOM   562   C  CB     . LEU A 1 48  ? -5.928  22.837 206.106 1.00 61.53  ? 67  LEU A CB     1 
ATOM   563   C  CG     . LEU A 1 48  ? -6.372  21.399 205.828 1.00 87.88  ? 67  LEU A CG     1 
ATOM   564   C  CD1    . LEU A 1 48  ? -6.619  21.173 204.351 1.00 142.79 ? 67  LEU A CD1    1 
ATOM   565   C  CD2    . LEU A 1 48  ? -5.361  20.400 206.364 1.00 112.44 ? 67  LEU A CD2    1 
ATOM   566   H  H      . LEU A 1 48  ? -3.615  22.126 205.634 1.00 74.04  ? 67  LEU A H      1 
ATOM   567   H  HA     . LEU A 1 48  ? -5.339  23.584 204.290 1.00 69.78  ? 67  LEU A HA     1 
ATOM   568   H  HB2    . LEU A 1 48  ? -5.537  22.836 206.993 1.00 73.84  ? 67  LEU A HB2    1 
ATOM   569   H  HB3    . LEU A 1 48  ? -6.735  23.374 206.123 1.00 73.84  ? 67  LEU A HB3    1 
ATOM   570   H  HG     . LEU A 1 48  ? -7.210  21.242 206.291 1.00 105.46 ? 67  LEU A HG     1 
ATOM   571   H  HD11   . LEU A 1 48  ? -6.898  20.254 204.215 1.00 171.35 ? 67  LEU A HD11   1 
ATOM   572   H  HD12   . LEU A 1 48  ? -7.316  21.778 204.051 1.00 171.35 ? 67  LEU A HD12   1 
ATOM   573   H  HD13   . LEU A 1 48  ? -5.798  21.345 203.864 1.00 171.35 ? 67  LEU A HD13   1 
ATOM   574   H  HD21   . LEU A 1 48  ? -5.673  19.502 206.171 1.00 134.93 ? 67  LEU A HD21   1 
ATOM   575   H  HD22   . LEU A 1 48  ? -4.506  20.554 205.931 1.00 134.93 ? 67  LEU A HD22   1 
ATOM   576   H  HD23   . LEU A 1 48  ? -5.274  20.522 207.322 1.00 134.93 ? 67  LEU A HD23   1 
ATOM   577   N  N      . SER A 1 49  ? -3.833  25.078 206.681 1.00 103.32 ? 68  SER A N      1 
ATOM   578   C  CA     . SER A 1 49  ? -3.486  26.395 207.190 1.00 61.70  ? 68  SER A CA     1 
ATOM   579   C  C      . SER A 1 49  ? -2.944  27.276 206.077 1.00 72.48  ? 68  SER A C      1 
ATOM   580   O  O      . SER A 1 49  ? -3.302  28.459 205.975 1.00 78.40  ? 68  SER A O      1 
ATOM   581   C  CB     . SER A 1 49  ? -2.467  26.255 208.321 1.00 73.45  ? 68  SER A CB     1 
ATOM   582   O  OG     . SER A 1 49  ? -2.979  25.424 209.347 1.00 105.02 ? 68  SER A OG     1 
ATOM   583   H  H      . SER A 1 49  ? -3.449  24.425 207.088 1.00 123.99 ? 68  SER A H      1 
ATOM   584   H  HA     . SER A 1 49  ? -4.282  26.817 207.550 1.00 74.04  ? 68  SER A HA     1 
ATOM   585   H  HB2    . SER A 1 49  ? -1.654  25.860 207.969 1.00 88.14  ? 68  SER A HB2    1 
ATOM   586   H  HB3    . SER A 1 49  ? -2.278  27.133 208.689 1.00 88.14  ? 68  SER A HB3    1 
ATOM   587   H  HG     . SER A 1 49  ? -2.416  25.351 209.966 1.00 126.02 ? 68  SER A HG     1 
ATOM   588   N  N      . VAL A 1 50  ? -2.095  26.706 205.214 1.00 86.94  ? 69  VAL A N      1 
ATOM   589   C  CA     . VAL A 1 50  ? -1.546  27.462 204.088 1.00 95.91  ? 69  VAL A CA     1 
ATOM   590   C  C      . VAL A 1 50  ? -2.664  28.206 203.375 1.00 88.77  ? 69  VAL A C      1 
ATOM   591   O  O      . VAL A 1 50  ? -2.663  29.437 203.282 1.00 125.71 ? 69  VAL A O      1 
ATOM   592   C  CB     . VAL A 1 50  ? -0.799  26.534 203.114 1.00 79.75  ? 69  VAL A CB     1 
ATOM   593   C  CG1    . VAL A 1 50  ? -0.113  27.352 202.041 1.00 70.85  ? 69  VAL A CG1    1 
ATOM   594   C  CG2    . VAL A 1 50  ? 0.213   25.659 203.846 1.00 124.66 ? 69  VAL A CG2    1 
ATOM   595   H  H      . VAL A 1 50  ? -1.826  25.891 205.259 1.00 104.33 ? 69  VAL A H      1 
ATOM   596   H  HA     . VAL A 1 50  ? -0.914  28.117 204.423 1.00 115.09 ? 69  VAL A HA     1 
ATOM   597   H  HB     . VAL A 1 50  ? -1.441  25.950 202.681 1.00 95.70  ? 69  VAL A HB     1 
ATOM   598   H  HG11   . VAL A 1 50  ? 0.352   26.753 201.437 1.00 85.01  ? 69  VAL A HG11   1 
ATOM   599   H  HG12   . VAL A 1 50  ? -0.783  27.859 201.555 1.00 85.01  ? 69  VAL A HG12   1 
ATOM   600   H  HG13   . VAL A 1 50  ? 0.519   27.956 202.461 1.00 85.01  ? 69  VAL A HG13   1 
ATOM   601   H  HG21   . VAL A 1 50  ? 0.662   25.090 203.201 1.00 149.60 ? 69  VAL A HG21   1 
ATOM   602   H  HG22   . VAL A 1 50  ? 0.859   26.229 204.291 1.00 149.60 ? 69  VAL A HG22   1 
ATOM   603   H  HG23   . VAL A 1 50  ? -0.255  25.115 204.499 1.00 149.60 ? 69  VAL A HG23   1 
ATOM   604   N  N      . LEU A 1 51  ? -3.646  27.459 202.872 1.00 71.15  ? 70  LEU A N      1 
ATOM   605   C  CA     . LEU A 1 51  ? -4.782  28.078 202.201 1.00 82.71  ? 70  LEU A CA     1 
ATOM   606   C  C      . LEU A 1 51  ? -5.496  29.060 203.123 1.00 69.08  ? 70  LEU A C      1 
ATOM   607   O  O      . LEU A 1 51  ? -5.550  30.260 202.841 1.00 99.53  ? 70  LEU A O      1 
ATOM   608   C  CB     . LEU A 1 51  ? -5.744  26.997 201.705 1.00 57.60  ? 70  LEU A CB     1 
ATOM   609   C  CG     . LEU A 1 51  ? -5.219  26.119 200.564 1.00 65.21  ? 70  LEU A CG     1 
ATOM   610   C  CD1    . LEU A 1 51  ? -6.230  25.028 200.248 1.00 57.16  ? 70  LEU A CD1    1 
ATOM   611   C  CD2    . LEU A 1 51  ? -4.898  26.958 199.307 1.00 64.83  ? 70  LEU A CD2    1 
ATOM   612   H  H      . LEU A 1 51  ? -3.676  26.600 202.906 1.00 85.38  ? 70  LEU A H      1 
ATOM   613   H  HA     . LEU A 1 51  ? -4.462  28.571 201.430 1.00 99.25  ? 70  LEU A HA     1 
ATOM   614   H  HB2    . LEU A 1 51  ? -5.957  26.412 202.448 1.00 69.12  ? 70  LEU A HB2    1 
ATOM   615   H  HB3    . LEU A 1 51  ? -6.554  27.429 201.390 1.00 69.12  ? 70  LEU A HB3    1 
ATOM   616   H  HG     . LEU A 1 51  ? -4.399  25.689 200.852 1.00 78.25  ? 70  LEU A HG     1 
ATOM   617   H  HD11   . LEU A 1 51  ? -5.886  24.480 199.525 1.00 68.60  ? 70  LEU A HD11   1 
ATOM   618   H  HD12   . LEU A 1 51  ? -6.366  24.485 201.040 1.00 68.60  ? 70  LEU A HD12   1 
ATOM   619   H  HD13   . LEU A 1 51  ? -7.066  25.441 199.981 1.00 68.60  ? 70  LEU A HD13   1 
ATOM   620   H  HD21   . LEU A 1 51  ? -4.570  26.369 198.610 1.00 77.79  ? 70  LEU A HD21   1 
ATOM   621   H  HD22   . LEU A 1 51  ? -5.706  27.404 199.010 1.00 77.79  ? 70  LEU A HD22   1 
ATOM   622   H  HD23   . LEU A 1 51  ? -4.220  27.615 199.531 1.00 77.79  ? 70  LEU A HD23   1 
ATOM   623   N  N      . ARG A 1 52  ? -6.045  28.567 204.236 1.00 71.69  ? 71  ARG A N      1 
ATOM   624   C  CA     . ARG A 1 52  ? -6.831  29.395 205.149 1.00 78.97  ? 71  ARG A CA     1 
ATOM   625   C  C      . ARG A 1 52  ? -6.224  30.781 205.337 1.00 72.20  ? 71  ARG A C      1 
ATOM   626   O  O      . ARG A 1 52  ? -6.807  31.803 204.937 1.00 119.35 ? 71  ARG A O      1 
ATOM   627   C  CB     . ARG A 1 52  ? -6.956  28.707 206.508 1.00 57.66  ? 71  ARG A CB     1 
ATOM   628   H  H      . ARG A 1 52  ? -5.974  27.747 204.486 1.00 86.03  ? 71  ARG A H      1 
ATOM   629   H  HA     . ARG A 1 52  ? -7.724  29.505 204.786 1.00 94.76  ? 71  ARG A HA     1 
ATOM   630   N  N      . LEU A 1 53  ? -5.040  30.829 205.945 1.00 58.56  ? 72  LEU A N      1 
ATOM   631   C  CA     . LEU A 1 53  ? -4.426  32.126 206.193 1.00 69.78  ? 72  LEU A CA     1 
ATOM   632   C  C      . LEU A 1 53  ? -4.071  32.822 204.885 1.00 96.56  ? 72  LEU A C      1 
ATOM   633   O  O      . LEU A 1 53  ? -4.112  34.055 204.803 1.00 108.67 ? 72  LEU A O      1 
ATOM   634   C  CB     . LEU A 1 53  ? -3.193  31.958 207.083 1.00 96.51  ? 72  LEU A CB     1 
ATOM   635   C  CG     . LEU A 1 53  ? -1.996  31.265 206.442 1.00 108.12 ? 72  LEU A CG     1 
ATOM   636   C  CD1    . LEU A 1 53  ? -1.097  32.278 205.750 1.00 95.11  ? 72  LEU A CD1    1 
ATOM   637   C  CD2    . LEU A 1 53  ? -1.213  30.481 207.490 1.00 95.04  ? 72  LEU A CD2    1 
ATOM   638   H  H      . LEU A 1 53  ? -4.587  30.150 206.214 1.00 70.27  ? 72  LEU A H      1 
ATOM   639   H  HA     . LEU A 1 53  ? -5.060  32.688 206.666 1.00 83.74  ? 72  LEU A HA     1 
ATOM   640   H  HB2    . LEU A 1 53  ? -2.900  32.838 207.367 1.00 115.81 ? 72  LEU A HB2    1 
ATOM   641   H  HB3    . LEU A 1 53  ? -3.447  31.437 207.860 1.00 115.81 ? 72  LEU A HB3    1 
ATOM   642   H  HG     . LEU A 1 53  ? -2.313  30.638 205.773 1.00 129.75 ? 72  LEU A HG     1 
ATOM   643   H  HD11   . LEU A 1 53  ? -0.345  31.813 205.352 1.00 114.13 ? 72  LEU A HD11   1 
ATOM   644   H  HD12   . LEU A 1 53  ? -1.607  32.734 205.062 1.00 114.13 ? 72  LEU A HD12   1 
ATOM   645   H  HD13   . LEU A 1 53  ? -0.781  32.919 206.407 1.00 114.13 ? 72  LEU A HD13   1 
ATOM   646   H  HD21   . LEU A 1 53  ? -0.458  30.049 207.062 1.00 114.05 ? 72  LEU A HD21   1 
ATOM   647   H  HD22   . LEU A 1 53  ? -0.901  31.094 208.174 1.00 114.05 ? 72  LEU A HD22   1 
ATOM   648   H  HD23   . LEU A 1 53  ? -1.796  29.814 207.886 1.00 114.05 ? 72  LEU A HD23   1 
ATOM   649   N  N      . SER A 1 54  ? -3.728  32.054 203.849 1.00 111.85 ? 73  SER A N      1 
ATOM   650   C  CA     . SER A 1 54  ? -3.384  32.660 202.568 1.00 114.52 ? 73  SER A CA     1 
ATOM   651   C  C      . SER A 1 54  ? -4.547  33.466 202.005 1.00 92.35  ? 73  SER A C      1 
ATOM   652   O  O      . SER A 1 54  ? -4.327  34.464 201.309 1.00 104.02 ? 73  SER A O      1 
ATOM   653   C  CB     . SER A 1 54  ? -2.942  31.586 201.572 1.00 99.73  ? 73  SER A CB     1 
ATOM   654   O  OG     . SER A 1 54  ? -2.635  32.156 200.312 1.00 117.60 ? 73  SER A OG     1 
ATOM   655   H  H      . SER A 1 54  ? -3.687  31.195 203.863 1.00 134.22 ? 73  SER A H      1 
ATOM   656   H  HA     . SER A 1 54  ? -2.639  33.268 202.699 1.00 137.42 ? 73  SER A HA     1 
ATOM   657   H  HB2    . SER A 1 54  ? -2.153  31.141 201.918 1.00 119.67 ? 73  SER A HB2    1 
ATOM   658   H  HB3    . SER A 1 54  ? -3.662  30.945 201.461 1.00 119.67 ? 73  SER A HB3    1 
ATOM   659   H  HG     . SER A 1 54  ? -3.311  32.545 200.000 1.00 141.12 ? 73  SER A HG     1 
ATOM   660   N  N      . VAL A 1 55  ? -5.787  33.060 202.292 1.00 74.03  ? 74  VAL A N      1 
ATOM   661   C  CA     . VAL A 1 55  ? -6.923  33.870 201.870 1.00 70.93  ? 74  VAL A CA     1 
ATOM   662   C  C      . VAL A 1 55  ? -7.176  34.977 202.879 1.00 69.78  ? 74  VAL A C      1 
ATOM   663   O  O      . VAL A 1 55  ? -7.655  36.053 202.509 1.00 85.53  ? 74  VAL A O      1 
ATOM   664   C  CB     . VAL A 1 55  ? -8.195  33.027 201.644 1.00 72.06  ? 74  VAL A CB     1 
ATOM   665   C  CG1    . VAL A 1 55  ? -7.862  31.569 201.365 1.00 90.04  ? 74  VAL A CG1    1 
ATOM   666   C  CG2    . VAL A 1 55  ? -9.176  33.152 202.817 1.00 90.18  ? 74  VAL A CG2    1 
ATOM   667   H  H      . VAL A 1 55  ? -5.989  32.341 202.718 1.00 88.83  ? 74  VAL A H      1 
ATOM   668   H  HA     . VAL A 1 55  ? -6.701  34.292 201.025 1.00 85.12  ? 74  VAL A HA     1 
ATOM   669   H  HB     . VAL A 1 55  ? -8.647  33.370 200.857 1.00 86.47  ? 74  VAL A HB     1 
ATOM   670   H  HG11   . VAL A 1 55  ? -8.687  31.077 201.230 1.00 108.05 ? 74  VAL A HG11   1 
ATOM   671   H  HG12   . VAL A 1 55  ? -7.311  31.517 200.569 1.00 108.05 ? 74  VAL A HG12   1 
ATOM   672   H  HG13   . VAL A 1 55  ? -7.380  31.205 202.125 1.00 108.05 ? 74  VAL A HG13   1 
ATOM   673   H  HG21   . VAL A 1 55  ? -9.958  32.608 202.634 1.00 108.22 ? 74  VAL A HG21   1 
ATOM   674   H  HG22   . VAL A 1 55  ? -8.740  32.843 203.627 1.00 108.22 ? 74  VAL A HG22   1 
ATOM   675   H  HG23   . VAL A 1 55  ? -9.435  34.082 202.914 1.00 108.22 ? 74  VAL A HG23   1 
ATOM   676   N  N      . SER A 1 56  ? -6.884  34.743 204.161 1.00 100.00 ? 75  SER A N      1 
ATOM   677   C  CA     . SER A 1 56  ? -6.968  35.840 205.123 1.00 97.81  ? 75  SER A CA     1 
ATOM   678   C  C      . SER A 1 56  ? -6.145  37.036 204.645 1.00 93.25  ? 75  SER A C      1 
ATOM   679   O  O      . SER A 1 56  ? -6.612  38.185 204.660 1.00 103.27 ? 75  SER A O      1 
ATOM   680   C  CB     . SER A 1 56  ? -6.497  35.367 206.499 1.00 79.52  ? 75  SER A CB     1 
ATOM   681   O  OG     . SER A 1 56  ? -7.350  34.353 207.004 1.00 85.28  ? 75  SER A OG     1 
ATOM   682   H  H      . SER A 1 56  ? -6.643  33.986 204.488 1.00 120.00 ? 75  SER A H      1 
ATOM   683   H  HA     . SER A 1 56  ? -7.892  36.123 205.202 1.00 117.37 ? 75  SER A HA     1 
ATOM   684   H  HB2    . SER A 1 56  ? -5.597  35.013 206.420 1.00 95.42  ? 75  SER A HB2    1 
ATOM   685   H  HB3    . SER A 1 56  ? -6.504  36.120 207.111 1.00 95.42  ? 75  SER A HB3    1 
ATOM   686   H  HG     . SER A 1 56  ? -7.353  33.694 206.483 1.00 102.34 ? 75  SER A HG     1 
ATOM   687   N  N      . TYR A 1 57  ? -4.918  36.766 204.193 1.00 78.46  ? 76  TYR A N      1 
ATOM   688   C  CA     . TYR A 1 57  ? -4.045  37.790 203.627 1.00 84.06  ? 76  TYR A CA     1 
ATOM   689   C  C      . TYR A 1 57  ? -4.759  38.589 202.539 1.00 107.31 ? 76  TYR A C      1 
ATOM   690   O  O      . TYR A 1 57  ? -4.914  39.814 202.637 1.00 125.44 ? 76  TYR A O      1 
ATOM   691   C  CB     . TYR A 1 57  ? -2.789  37.104 203.077 1.00 61.82  ? 76  TYR A CB     1 
ATOM   692   C  CG     . TYR A 1 57  ? -1.687  38.020 202.590 1.00 61.28  ? 76  TYR A CG     1 
ATOM   693   C  CD1    . TYR A 1 57  ? -1.014  38.860 203.463 1.00 94.62  ? 76  TYR A CD1    1 
ATOM   694   C  CD2    . TYR A 1 57  ? -1.293  38.013 201.260 1.00 77.67  ? 76  TYR A CD2    1 
ATOM   695   C  CE1    . TYR A 1 57  ? 0.002   39.686 203.019 1.00 118.69 ? 76  TYR A CE1    1 
ATOM   696   C  CE2    . TYR A 1 57  ? -0.281  38.836 200.810 1.00 87.37  ? 76  TYR A CE2    1 
ATOM   697   C  CZ     . TYR A 1 57  ? 0.367   39.664 201.691 1.00 100.47 ? 76  TYR A CZ     1 
ATOM   698   O  OH     . TYR A 1 57  ? 1.377   40.480 201.234 1.00 111.91 ? 76  TYR A OH     1 
ATOM   699   H  H      . TYR A 1 57  ? -4.565  35.982 204.205 1.00 94.16  ? 76  TYR A H      1 
ATOM   700   H  HA     . TYR A 1 57  ? -3.775  38.404 204.328 1.00 100.87 ? 76  TYR A HA     1 
ATOM   701   H  HB2    . TYR A 1 57  ? -2.413  36.549 203.779 1.00 74.18  ? 76  TYR A HB2    1 
ATOM   702   H  HB3    . TYR A 1 57  ? -3.050  36.545 202.329 1.00 74.18  ? 76  TYR A HB3    1 
ATOM   703   H  HD1    . TYR A 1 57  ? -1.257  38.876 204.361 1.00 113.54 ? 76  TYR A HD1    1 
ATOM   704   H  HD2    . TYR A 1 57  ? -1.728  37.453 200.658 1.00 93.20  ? 76  TYR A HD2    1 
ATOM   705   H  HE1    . TYR A 1 57  ? 0.441   40.249 203.615 1.00 142.43 ? 76  TYR A HE1    1 
ATOM   706   H  HE2    . TYR A 1 57  ? -0.033  38.823 199.913 1.00 104.84 ? 76  TYR A HE2    1 
ATOM   707   H  HH     . TYR A 1 57  ? 1.491   40.362 200.410 1.00 134.29 ? 76  TYR A HH     1 
ATOM   708   N  N      . LEU A 1 58  ? -5.209  37.899 201.491 1.00 75.61  ? 77  LEU A N      1 
ATOM   709   C  CA     . LEU A 1 58  ? -5.826  38.578 200.358 1.00 82.15  ? 77  LEU A CA     1 
ATOM   710   C  C      . LEU A 1 58  ? -7.057  39.367 200.781 1.00 72.59  ? 77  LEU A C      1 
ATOM   711   O  O      . LEU A 1 58  ? -7.294  40.471 200.284 1.00 113.97 ? 77  LEU A O      1 
ATOM   712   C  CB     . LEU A 1 58  ? -6.181  37.553 199.282 1.00 97.11  ? 77  LEU A CB     1 
ATOM   713   C  CG     . LEU A 1 58  ? -5.078  37.217 198.265 1.00 108.50 ? 77  LEU A CG     1 
ATOM   714   C  CD1    . LEU A 1 58  ? -3.677  37.235 198.874 1.00 101.91 ? 77  LEU A CD1    1 
ATOM   715   C  CD2    . LEU A 1 58  ? -5.355  35.862 197.644 1.00 107.06 ? 77  LEU A CD2    1 
ATOM   716   H  H      . LEU A 1 58  ? -5.169  37.043 201.414 1.00 90.73  ? 77  LEU A H      1 
ATOM   717   H  HA     . LEU A 1 58  ? -5.187  39.201 199.979 1.00 98.58  ? 77  LEU A HA     1 
ATOM   718   H  HB2    . LEU A 1 58  ? -6.429  36.724 199.721 1.00 116.54 ? 77  LEU A HB2    1 
ATOM   719   H  HB3    . LEU A 1 58  ? -6.941  37.890 198.781 1.00 116.54 ? 77  LEU A HB3    1 
ATOM   720   H  HG     . LEU A 1 58  ? -5.099  37.877 197.555 1.00 130.20 ? 77  LEU A HG     1 
ATOM   721   H  HD11   . LEU A 1 58  ? -3.031  37.016 198.184 1.00 122.30 ? 77  LEU A HD11   1 
ATOM   722   H  HD12   . LEU A 1 58  ? -3.497  38.121 199.226 1.00 122.30 ? 77  LEU A HD12   1 
ATOM   723   H  HD13   . LEU A 1 58  ? -3.634  36.579 199.588 1.00 122.30 ? 77  LEU A HD13   1 
ATOM   724   H  HD21   . LEU A 1 58  ? -4.654  35.659 197.005 1.00 128.47 ? 77  LEU A HD21   1 
ATOM   725   H  HD22   . LEU A 1 58  ? -5.369  35.191 198.344 1.00 128.47 ? 77  LEU A HD22   1 
ATOM   726   H  HD23   . LEU A 1 58  ? -6.215  35.891 197.195 1.00 128.47 ? 77  LEU A HD23   1 
ATOM   727   N  N      . ARG A 1 59  ? -7.857  38.819 201.693 1.00 64.89  ? 78  ARG A N      1 
ATOM   728   C  CA     . ARG A 1 59  ? -9.012  39.555 202.200 1.00 93.77  ? 78  ARG A CA     1 
ATOM   729   C  C      . ARG A 1 59  ? -8.588  40.880 202.820 1.00 83.18  ? 78  ARG A C      1 
ATOM   730   O  O      . ARG A 1 59  ? -9.157  41.940 202.514 1.00 89.03  ? 78  ARG A O      1 
ATOM   731   C  CB     . ARG A 1 59  ? -9.767  38.709 203.221 1.00 83.08  ? 78  ARG A CB     1 
ATOM   732   C  CG     . ARG A 1 59  ? -10.639 37.611 202.610 1.00 87.92  ? 78  ARG A CG     1 
ATOM   733   C  CD     . ARG A 1 59  ? -11.708 37.116 203.575 1.00 102.35 ? 78  ARG A CD     1 
ATOM   734   N  NE     . ARG A 1 59  ? -12.467 38.215 204.172 1.00 150.11 ? 78  ARG A NE     1 
ATOM   735   C  CZ     . ARG A 1 59  ? -13.578 38.061 204.885 1.00 157.29 ? 78  ARG A CZ     1 
ATOM   736   N  NH1    . ARG A 1 59  ? -14.085 36.851 205.090 1.00 125.00 ? 78  ARG A NH1    1 
ATOM   737   N  NH2    . ARG A 1 59  ? -14.191 39.127 205.388 1.00 136.24 ? 78  ARG A NH2    1 
ATOM   738   H  H      . ARG A 1 59  ? -7.755  38.034 202.030 1.00 77.86  ? 78  ARG A H      1 
ATOM   739   H  HA     . ARG A 1 59  ? -9.614  39.747 201.463 1.00 112.52 ? 78  ARG A HA     1 
ATOM   740   H  HB2    . ARG A 1 59  ? -9.123  38.282 203.807 1.00 99.69  ? 78  ARG A HB2    1 
ATOM   741   H  HB3    . ARG A 1 59  ? -10.345 39.291 203.739 1.00 99.69  ? 78  ARG A HB3    1 
ATOM   742   H  HG2    . ARG A 1 59  ? -11.083 37.961 201.822 1.00 105.50 ? 78  ARG A HG2    1 
ATOM   743   H  HG3    . ARG A 1 59  ? -10.078 36.857 202.370 1.00 105.50 ? 78  ARG A HG3    1 
ATOM   744   H  HD2    . ARG A 1 59  ? -12.329 36.546 203.096 1.00 122.82 ? 78  ARG A HD2    1 
ATOM   745   H  HD3    . ARG A 1 59  ? -11.283 36.619 204.292 1.00 122.82 ? 78  ARG A HD3    1 
ATOM   746   H  HE     . ARG A 1 59  ? -12.173 39.015 204.054 1.00 180.13 ? 78  ARG A HE     1 
ATOM   747   H  HH11   . ARG A 1 59  ? -13.690 36.159 204.766 1.00 150.00 ? 78  ARG A HH11   1 
ATOM   748   H  HH12   . ARG A 1 59  ? -14.805 36.759 205.551 1.00 150.00 ? 78  ARG A HH12   1 
ATOM   749   H  HH21   . ARG A 1 59  ? -13.867 39.912 205.255 1.00 163.49 ? 78  ARG A HH21   1 
ATOM   750   H  HH22   . ARG A 1 59  ? -14.913 39.031 205.847 1.00 163.49 ? 78  ARG A HH22   1 
ATOM   751   N  N      . ALA A 1 60  ? -7.592  40.838 203.708 1.00 75.76  ? 79  ALA A N      1 
ATOM   752   C  CA     . ALA A 1 60  ? -7.086  42.073 204.297 1.00 82.29  ? 79  ALA A CA     1 
ATOM   753   C  C      . ALA A 1 60  ? -6.622  43.045 203.222 1.00 68.25  ? 79  ALA A C      1 
ATOM   754   O  O      . ALA A 1 60  ? -6.928  44.243 203.285 1.00 123.92 ? 79  ALA A O      1 
ATOM   755   C  CB     . ALA A 1 60  ? -5.950  41.761 205.268 1.00 115.48 ? 79  ALA A CB     1 
ATOM   756   H  H      . ALA A 1 60  ? -7.202  40.121 203.979 1.00 90.91  ? 79  ALA A H      1 
ATOM   757   H  HA     . ALA A 1 60  ? -7.799  42.499 204.798 1.00 98.75  ? 79  ALA A HA     1 
ATOM   758   H  HB1    . ALA A 1 60  ? -5.625  42.591 205.650 1.00 138.57 ? 79  ALA A HB1    1 
ATOM   759   H  HB2    . ALA A 1 60  ? -6.284  41.182 205.970 1.00 138.57 ? 79  ALA A HB2    1 
ATOM   760   H  HB3    . ALA A 1 60  ? -5.235  41.317 204.784 1.00 138.57 ? 79  ALA A HB3    1 
ATOM   761   N  N      . LYS A 1 61  ? -5.897  42.552 202.216 1.00 73.17  ? 80  LYS A N      1 
ATOM   762   C  CA     . LYS A 1 61  ? -5.395  43.448 201.179 1.00 99.26  ? 80  LYS A CA     1 
ATOM   763   C  C      . LYS A 1 61  ? -6.542  44.116 200.431 1.00 113.48 ? 80  LYS A C      1 
ATOM   764   O  O      . LYS A 1 61  ? -6.519  45.328 200.194 1.00 120.30 ? 80  LYS A O      1 
ATOM   765   C  CB     . LYS A 1 61  ? -4.488  42.681 200.216 1.00 77.79  ? 80  LYS A CB     1 
ATOM   766   C  CG     . LYS A 1 61  ? -3.242  42.106 200.867 1.00 117.92 ? 80  LYS A CG     1 
ATOM   767   C  CD     . LYS A 1 61  ? -2.398  43.192 201.542 1.00 116.75 ? 80  LYS A CD     1 
ATOM   768   C  CE     . LYS A 1 61  ? -1.237  42.592 202.301 1.00 142.37 ? 80  LYS A CE     1 
ATOM   769   N  NZ     . LYS A 1 61  ? -0.478  43.609 203.075 1.00 132.26 ? 80  LYS A NZ     1 
ATOM   770   H  H      . LYS A 1 61  ? -5.687  41.725 202.114 1.00 87.80  ? 80  LYS A H      1 
ATOM   771   H  HA     . LYS A 1 61  ? -4.865  44.146 201.596 1.00 119.11 ? 80  LYS A HA     1 
ATOM   772   H  HB2    . LYS A 1 61  ? -4.990  41.943 199.835 1.00 93.35  ? 80  LYS A HB2    1 
ATOM   773   H  HB3    . LYS A 1 61  ? -4.203  43.282 199.510 1.00 93.35  ? 80  LYS A HB3    1 
ATOM   774   H  HG2    . LYS A 1 61  ? -3.505  41.463 201.544 1.00 141.50 ? 80  LYS A HG2    1 
ATOM   775   H  HG3    . LYS A 1 61  ? -2.698  41.676 200.190 1.00 141.50 ? 80  LYS A HG3    1 
ATOM   776   H  HD2    . LYS A 1 61  ? -2.042  43.789 200.865 1.00 140.09 ? 80  LYS A HD2    1 
ATOM   777   H  HD3    . LYS A 1 61  ? -2.950  43.685 202.169 1.00 140.09 ? 80  LYS A HD3    1 
ATOM   778   H  HE2    . LYS A 1 61  ? -1.575  41.930 202.925 1.00 170.84 ? 80  LYS A HE2    1 
ATOM   779   H  HE3    . LYS A 1 61  ? -0.628  42.176 201.672 1.00 170.84 ? 80  LYS A HE3    1 
ATOM   780   H  HZ1    . LYS A 1 61  ? 0.196   43.221 203.508 1.00 158.72 ? 80  LYS A HZ1    1 
ATOM   781   H  HZ2    . LYS A 1 61  ? -0.150  44.227 202.525 1.00 158.72 ? 80  LYS A HZ2    1 
ATOM   782   H  HZ3    . LYS A 1 61  ? -1.014  44.003 203.667 1.00 158.72 ? 80  LYS A HZ3    1 
ATOM   783   N  N      . SER A 1 62  ? -7.555  43.339 200.048 1.00 102.93 ? 81  SER A N      1 
ATOM   784   C  CA     . SER A 1 62  ? -8.721  43.911 199.385 1.00 122.43 ? 81  SER A CA     1 
ATOM   785   C  C      . SER A 1 62  ? -9.339  45.012 200.237 1.00 102.66 ? 81  SER A C      1 
ATOM   786   O  O      . SER A 1 62  ? -9.460  46.168 199.804 1.00 122.79 ? 81  SER A O      1 
ATOM   787   C  CB     . SER A 1 62  ? -9.743  42.811 199.095 1.00 112.10 ? 81  SER A CB     1 
ATOM   788   O  OG     . SER A 1 62  ? -10.985 43.361 198.696 1.00 142.29 ? 81  SER A OG     1 
ATOM   789   H  H      . SER A 1 62  ? -7.590  42.487 200.160 1.00 123.52 ? 81  SER A H      1 
ATOM   790   H  HA     . SER A 1 62  ? -8.447  44.300 198.539 1.00 146.91 ? 81  SER A HA     1 
ATOM   791   H  HB2    . SER A 1 62  ? -9.405  42.247 198.381 1.00 134.52 ? 81  SER A HB2    1 
ATOM   792   H  HB3    . SER A 1 62  ? -9.875  42.284 199.898 1.00 134.52 ? 81  SER A HB3    1 
ATOM   793   H  HG     . SER A 1 62  ? -11.535 42.745 198.541 1.00 170.75 ? 81  SER A HG     1 
ATOM   794   N  N      . PHE A 1 63  ? -9.735  44.665 201.462 1.00 90.82  ? 82  PHE A N      1 
ATOM   795   C  CA     . PHE A 1 63  ? -10.358 45.654 202.334 1.00 101.51 ? 82  PHE A CA     1 
ATOM   796   C  C      . PHE A 1 63  ? -9.518  46.922 202.438 1.00 80.75  ? 82  PHE A C      1 
ATOM   797   O  O      . PHE A 1 63  ? -10.048 48.040 202.371 1.00 131.43 ? 82  PHE A O      1 
ATOM   798   C  CB     . PHE A 1 63  ? -10.587 45.053 203.718 1.00 81.24  ? 82  PHE A CB     1 
ATOM   799   C  CG     . PHE A 1 63  ? -11.004 46.057 204.744 1.00 70.44  ? 82  PHE A CG     1 
ATOM   800   C  CD1    . PHE A 1 63  ? -10.057 46.726 205.501 1.00 72.47  ? 82  PHE A CD1    1 
ATOM   801   C  CD2    . PHE A 1 63  ? -12.340 46.343 204.941 1.00 102.34 ? 82  PHE A CD2    1 
ATOM   802   C  CE1    . PHE A 1 63  ? -10.438 47.656 206.438 1.00 78.82  ? 82  PHE A CE1    1 
ATOM   803   C  CE2    . PHE A 1 63  ? -12.730 47.272 205.882 1.00 89.42  ? 82  PHE A CE2    1 
ATOM   804   C  CZ     . PHE A 1 63  ? -11.776 47.930 206.631 1.00 82.24  ? 82  PHE A CZ     1 
ATOM   805   H  H      . PHE A 1 63  ? -9.655  43.880 201.805 1.00 108.99 ? 82  PHE A H      1 
ATOM   806   H  HA     . PHE A 1 63  ? -11.222 45.897 201.967 1.00 121.81 ? 82  PHE A HA     1 
ATOM   807   H  HB2    . PHE A 1 63  ? -11.286 44.383 203.657 1.00 97.49  ? 82  PHE A HB2    1 
ATOM   808   H  HB3    . PHE A 1 63  ? -9.763  44.642 204.021 1.00 97.49  ? 82  PHE A HB3    1 
ATOM   809   H  HD1    . PHE A 1 63  ? -9.154  46.545 205.374 1.00 86.97  ? 82  PHE A HD1    1 
ATOM   810   H  HD2    . PHE A 1 63  ? -12.985 45.900 204.437 1.00 122.81 ? 82  PHE A HD2    1 
ATOM   811   H  HE1    . PHE A 1 63  ? -9.794  48.098 206.944 1.00 94.58  ? 82  PHE A HE1    1 
ATOM   812   H  HE2    . PHE A 1 63  ? -13.632 47.456 206.010 1.00 107.30 ? 82  PHE A HE2    1 
ATOM   813   H  HZ     . PHE A 1 63  ? -12.036 48.558 207.266 1.00 98.69  ? 82  PHE A HZ     1 
ATOM   814   N  N      . PHE A 1 64  ? -8.204  46.776 202.610 1.00 78.02  ? 83  PHE A N      1 
ATOM   815   C  CA     . PHE A 1 64  ? -7.368  47.962 202.751 1.00 110.88 ? 83  PHE A CA     1 
ATOM   816   C  C      . PHE A 1 64  ? -7.290  48.749 201.453 1.00 103.59 ? 83  PHE A C      1 
ATOM   817   O  O      . PHE A 1 64  ? -7.146  49.976 201.482 1.00 128.41 ? 83  PHE A O      1 
ATOM   818   C  CB     . PHE A 1 64  ? -5.971  47.574 203.227 1.00 109.21 ? 83  PHE A CB     1 
ATOM   819   C  CG     . PHE A 1 64  ? -5.839  47.544 204.717 1.00 112.51 ? 83  PHE A CG     1 
ATOM   820   C  CD1    . PHE A 1 64  ? -5.865  48.719 205.444 1.00 110.05 ? 83  PHE A CD1    1 
ATOM   821   C  CD2    . PHE A 1 64  ? -5.705  46.348 205.391 1.00 97.80  ? 83  PHE A CD2    1 
ATOM   822   C  CE1    . PHE A 1 64  ? -5.753  48.704 206.816 1.00 98.36  ? 83  PHE A CE1    1 
ATOM   823   C  CE2    . PHE A 1 64  ? -5.591  46.324 206.763 1.00 95.07  ? 83  PHE A CE2    1 
ATOM   824   C  CZ     . PHE A 1 64  ? -5.615  47.506 207.478 1.00 114.50 ? 83  PHE A CZ     1 
ATOM   825   H  H      . PHE A 1 64  ? -7.785  46.026 202.648 1.00 93.63  ? 83  PHE A H      1 
ATOM   826   H  HA     . PHE A 1 64  ? -7.759  48.540 203.424 1.00 133.05 ? 83  PHE A HA     1 
ATOM   827   H  HB2    . PHE A 1 64  ? -5.759  46.689 202.891 1.00 131.06 ? 83  PHE A HB2    1 
ATOM   828   H  HB3    . PHE A 1 64  ? -5.332  48.218 202.884 1.00 131.06 ? 83  PHE A HB3    1 
ATOM   829   H  HD1    . PHE A 1 64  ? -5.958  49.531 205.001 1.00 132.06 ? 83  PHE A HD1    1 
ATOM   830   H  HD2    . PHE A 1 64  ? -5.688  45.550 204.914 1.00 117.36 ? 83  PHE A HD2    1 
ATOM   831   H  HE1    . PHE A 1 64  ? -5.769  49.502 207.294 1.00 118.03 ? 83  PHE A HE1    1 
ATOM   832   H  HE2    . PHE A 1 64  ? -5.498  45.513 207.208 1.00 114.08 ? 83  PHE A HE2    1 
ATOM   833   H  HZ     . PHE A 1 64  ? -5.538  47.491 208.405 1.00 137.41 ? 83  PHE A HZ     1 
ATOM   834   N  N      . ASP A 1 65  ? -7.395  48.074 200.310 1.00 109.94 ? 84  ASP A N      1 
ATOM   835   C  CA     . ASP A 1 65  ? -7.395  48.791 199.042 1.00 130.97 ? 84  ASP A CA     1 
ATOM   836   C  C      . ASP A 1 65  ? -8.668  49.609 198.877 1.00 127.48 ? 84  ASP A C      1 
ATOM   837   O  O      . ASP A 1 65  ? -8.630  50.713 198.320 1.00 135.51 ? 84  ASP A O      1 
ATOM   838   C  CB     . ASP A 1 65  ? -7.229  47.812 197.880 1.00 130.73 ? 84  ASP A CB     1 
ATOM   839   C  CG     . ASP A 1 65  ? -5.880  47.117 197.892 1.00 156.26 ? 84  ASP A CG     1 
ATOM   840   O  OD1    . ASP A 1 65  ? -5.081  47.377 198.817 1.00 142.43 ? 84  ASP A OD1    1 
ATOM   841   O  OD2    . ASP A 1 65  ? -5.616  46.313 196.973 1.00 137.54 ? 84  ASP A OD2    1 
ATOM   842   H  H      . ASP A 1 65  ? -7.465  47.219 200.243 1.00 131.93 ? 84  ASP A H      1 
ATOM   843   H  HA     . ASP A 1 65  ? -6.642  49.403 199.026 1.00 157.16 ? 84  ASP A HA     1 
ATOM   844   H  HB2    . ASP A 1 65  ? -7.919  47.132 197.939 1.00 156.88 ? 84  ASP A HB2    1 
ATOM   845   H  HB3    . ASP A 1 65  ? -7.311  48.296 197.044 1.00 156.88 ? 84  ASP A HB3    1 
ATOM   846   N  N      . VAL A 1 66  ? -9.803  49.100 199.364 1.00 103.12 ? 85  VAL A N      1 
ATOM   847   C  CA     . VAL A 1 66  ? -11.039 49.867 199.215 1.00 105.96 ? 85  VAL A CA     1 
ATOM   848   C  C      . VAL A 1 66  ? -11.094 51.010 200.224 1.00 107.34 ? 85  VAL A C      1 
ATOM   849   O  O      . VAL A 1 66  ? -11.608 52.092 199.918 1.00 135.49 ? 85  VAL A O      1 
ATOM   850   C  CB     . VAL A 1 66  ? -12.279 48.955 199.319 1.00 99.46  ? 85  VAL A CB     1 
ATOM   851   C  CG1    . VAL A 1 66  ? -12.099 47.707 198.465 1.00 105.68 ? 85  VAL A CG1    1 
ATOM   852   C  CG2    . VAL A 1 66  ? -12.597 48.583 200.765 1.00 147.66 ? 85  VAL A CG2    1 
ATOM   853   H  H      . VAL A 1 66  ? -9.883  48.345 199.767 1.00 123.74 ? 85  VAL A H      1 
ATOM   854   H  HA     . VAL A 1 66  ? -11.046 50.263 198.330 1.00 127.15 ? 85  VAL A HA     1 
ATOM   855   H  HB     . VAL A 1 66  ? -13.044 49.438 198.969 1.00 119.35 ? 85  VAL A HB     1 
ATOM   856   H  HG11   . VAL A 1 66  ? -12.890 47.152 198.548 1.00 126.82 ? 85  VAL A HG11   1 
ATOM   857   H  HG12   . VAL A 1 66  ? -11.976 47.973 197.541 1.00 126.82 ? 85  VAL A HG12   1 
ATOM   858   H  HG13   . VAL A 1 66  ? -11.320 47.221 198.777 1.00 126.82 ? 85  VAL A HG13   1 
ATOM   859   H  HG21   . VAL A 1 66  ? -13.381 48.012 200.778 1.00 177.20 ? 85  VAL A HG21   1 
ATOM   860   H  HG22   . VAL A 1 66  ? -11.837 48.113 201.143 1.00 177.20 ? 85  VAL A HG22   1 
ATOM   861   H  HG23   . VAL A 1 66  ? -12.768 49.394 201.268 1.00 177.20 ? 85  VAL A HG23   1 
ATOM   862   N  N      . ALA A 1 67  ? -10.572 50.803 201.437 1.00 86.52  ? 86  ALA A N      1 
ATOM   863   C  CA     . ALA A 1 67  ? -10.659 51.856 202.446 1.00 110.91 ? 86  ALA A CA     1 
ATOM   864   C  C      . ALA A 1 67  ? -9.598  52.931 202.240 1.00 104.44 ? 86  ALA A C      1 
ATOM   865   O  O      . ALA A 1 67  ? -9.882  54.124 202.402 1.00 116.11 ? 86  ALA A O      1 
ATOM   866   C  CB     . ALA A 1 67  ? -10.537 51.261 203.847 1.00 96.05  ? 86  ALA A CB     1 
ATOM   867   H  H      . ALA A 1 67  ? -10.175 50.084 201.692 1.00 103.82 ? 86  ALA A H      1 
ATOM   868   H  HA     . ALA A 1 67  ? -11.528 52.281 202.379 1.00 133.09 ? 86  ALA A HA     1 
ATOM   869   H  HB1    . ALA A 1 67  ? -10.598 51.976 204.500 1.00 115.26 ? 86  ALA A HB1    1 
ATOM   870   H  HB2    . ALA A 1 67  ? -11.258 50.626 203.984 1.00 115.26 ? 86  ALA A HB2    1 
ATOM   871   H  HB3    . ALA A 1 67  ? -9.681  50.812 203.926 1.00 115.26 ? 86  ALA A HB3    1 
ATOM   872   N  N      . LEU A 1 68  ? -8.376  52.536 201.894 1.00 85.01  ? 87  LEU A N      1 
ATOM   873   C  CA     . LEU A 1 68  ? -7.287  53.481 201.690 1.00 99.08  ? 87  LEU A CA     1 
ATOM   874   C  C      . LEU A 1 68  ? -7.256  54.060 200.280 1.00 140.40 ? 87  LEU A C      1 
ATOM   875   O  O      . LEU A 1 68  ? -6.287  54.742 199.925 1.00 128.40 ? 87  LEU A O      1 
ATOM   876   C  CB     . LEU A 1 68  ? -5.948  52.806 202.005 1.00 92.48  ? 87  LEU A CB     1 
ATOM   877   C  CG     . LEU A 1 68  ? -5.717  52.510 203.488 1.00 114.59 ? 87  LEU A CG     1 
ATOM   878   C  CD1    . LEU A 1 68  ? -4.512  51.608 203.691 1.00 113.30 ? 87  LEU A CD1    1 
ATOM   879   C  CD2    . LEU A 1 68  ? -5.538  53.814 204.247 1.00 140.44 ? 87  LEU A CD2    1 
ATOM   880   H  H      . LEU A 1 68  ? -8.152  51.715 201.770 1.00 102.01 ? 87  LEU A H      1 
ATOM   881   H  HA     . LEU A 1 68  ? -7.397  54.220 202.309 1.00 118.90 ? 87  LEU A HA     1 
ATOM   882   H  HB2    . LEU A 1 68  ? -5.907  51.962 201.527 1.00 110.97 ? 87  LEU A HB2    1 
ATOM   883   H  HB3    . LEU A 1 68  ? -5.231  53.385 201.705 1.00 110.97 ? 87  LEU A HB3    1 
ATOM   884   H  HG     . LEU A 1 68  ? -6.497  52.058 203.846 1.00 137.51 ? 87  LEU A HG     1 
ATOM   885   H  HD11   . LEU A 1 68  ? -4.398  51.444 204.641 1.00 135.96 ? 87  LEU A HD11   1 
ATOM   886   H  HD12   . LEU A 1 68  ? -4.664  50.770 203.226 1.00 135.96 ? 87  LEU A HD12   1 
ATOM   887   H  HD13   . LEU A 1 68  ? -3.725  52.048 203.334 1.00 135.96 ? 87  LEU A HD13   1 
ATOM   888   H  HD21   . LEU A 1 68  ? -5.392  53.615 205.185 1.00 168.52 ? 87  LEU A HD21   1 
ATOM   889   H  HD22   . LEU A 1 68  ? -4.772  54.287 203.885 1.00 168.52 ? 87  LEU A HD22   1 
ATOM   890   H  HD23   . LEU A 1 68  ? -6.338  54.352 204.142 1.00 168.52 ? 87  LEU A HD23   1 
ATOM   891   N  N      . LYS A 1 69  ? -8.285  53.818 199.475 1.00 142.11 ? 88  LYS A N      1 
ATOM   892   C  CA     . LYS A 1 69  ? -8.333  54.354 198.126 1.00 114.98 ? 88  LYS A CA     1 
ATOM   893   C  C      . LYS A 1 69  ? -8.462  55.872 198.159 1.00 135.77 ? 88  LYS A C      1 
ATOM   894   O  O      . LYS A 1 69  ? -8.424  56.529 197.118 1.00 177.74 ? 88  LYS A O      1 
ATOM   895   C  CB     . LYS A 1 69  ? -9.497  53.742 197.348 1.00 124.69 ? 88  LYS A CB     1 
ATOM   896   H  H      . LYS A 1 69  ? -8.970  53.344 199.691 1.00 170.54 ? 88  LYS A H      1 
ATOM   897   H  HA     . LYS A 1 69  ? -7.510  54.130 197.665 1.00 137.97 ? 88  LYS A HA     1 
ATOM   898   N  N      . GLY A 1 90  ? 14.465  57.505 205.008 1.00 127.50 ? 109 GLY A N      1 
ATOM   899   C  CA     . GLY A 1 90  ? 13.039  57.264 204.901 1.00 108.91 ? 109 GLY A CA     1 
ATOM   900   C  C      . GLY A 1 90  ? 12.505  56.438 206.053 1.00 115.73 ? 109 GLY A C      1 
ATOM   901   O  O      . GLY A 1 90  ? 12.871  55.275 206.215 1.00 126.10 ? 109 GLY A O      1 
ATOM   902   H  HA2    . GLY A 1 90  ? 12.568  58.112 204.886 1.00 130.70 ? 109 GLY A HA2    1 
ATOM   903   H  HA3    . GLY A 1 90  ? 12.852  56.794 204.073 1.00 130.70 ? 109 GLY A HA3    1 
ATOM   904   N  N      . LEU A 1 91  ? 11.638  57.045 206.860 1.00 129.27 ? 110 LEU A N      1 
ATOM   905   C  CA     . LEU A 1 91  ? 11.054  56.375 208.013 1.00 115.84 ? 110 LEU A CA     1 
ATOM   906   C  C      . LEU A 1 91  ? 9.610   55.952 207.791 1.00 112.65 ? 110 LEU A C      1 
ATOM   907   O  O      . LEU A 1 91  ? 9.073   55.184 208.601 1.00 119.14 ? 110 LEU A O      1 
ATOM   908   C  CB     . LEU A 1 91  ? 11.133  57.284 209.244 1.00 107.15 ? 110 LEU A CB     1 
ATOM   909   C  CG     . LEU A 1 91  ? 12.541  57.745 209.635 1.00 120.88 ? 110 LEU A CG     1 
ATOM   910   C  CD1    . LEU A 1 91  ? 12.496  58.506 210.948 1.00 114.30 ? 110 LEU A CD1    1 
ATOM   911   C  CD2    . LEU A 1 91  ? 13.508  56.572 209.732 1.00 95.22  ? 110 LEU A CD2    1 
ATOM   912   H  H      . LEU A 1 91  ? 11.369  57.856 206.757 1.00 155.12 ? 110 LEU A H      1 
ATOM   913   H  HA     . LEU A 1 91  ? 11.570  55.575 208.203 1.00 139.01 ? 110 LEU A HA     1 
ATOM   914   H  HB2    . LEU A 1 91  ? 10.604  58.079 209.072 1.00 128.57 ? 110 LEU A HB2    1 
ATOM   915   H  HB3    . LEU A 1 91  ? 10.762  56.807 210.002 1.00 128.57 ? 110 LEU A HB3    1 
ATOM   916   H  HG     . LEU A 1 91  ? 12.874  58.349 208.952 1.00 145.06 ? 110 LEU A HG     1 
ATOM   917   H  HD11   . LEU A 1 91  ? 13.394  58.789 211.180 1.00 137.16 ? 110 LEU A HD11   1 
ATOM   918   H  HD12   . LEU A 1 91  ? 11.920  59.280 210.845 1.00 137.16 ? 110 LEU A HD12   1 
ATOM   919   H  HD13   . LEU A 1 91  ? 12.144  57.922 211.639 1.00 137.16 ? 110 LEU A HD13   1 
ATOM   920   H  HD21   . LEU A 1 91  ? 14.384  56.905 209.980 1.00 114.26 ? 110 LEU A HD21   1 
ATOM   921   H  HD22   . LEU A 1 91  ? 13.185  55.953 210.405 1.00 114.26 ? 110 LEU A HD22   1 
ATOM   922   H  HD23   . LEU A 1 91  ? 13.554  56.129 208.870 1.00 114.26 ? 110 LEU A HD23   1 
ATOM   923   N  N      . ASN A 1 92  ? 8.971   56.428 206.718 1.00 89.29  ? 111 ASN A N      1 
ATOM   924   C  CA     . ASN A 1 92  ? 7.634   55.954 206.383 1.00 88.88  ? 111 ASN A CA     1 
ATOM   925   C  C      . ASN A 1 92  ? 7.568   54.435 206.421 1.00 96.36  ? 111 ASN A C      1 
ATOM   926   O  O      . ASN A 1 92  ? 6.517   53.865 206.732 1.00 80.46  ? 111 ASN A O      1 
ATOM   927   C  CB     . ASN A 1 92  ? 7.226   56.468 205.000 1.00 104.22 ? 111 ASN A CB     1 
ATOM   928   C  CG     . ASN A 1 92  ? 7.152   57.981 204.938 1.00 142.67 ? 111 ASN A CG     1 
ATOM   929   O  OD1    . ASN A 1 92  ? 6.918   58.645 205.947 1.00 126.14 ? 111 ASN A OD1    1 
ATOM   930   N  ND2    . ASN A 1 92  ? 7.348   58.534 203.745 1.00 164.44 ? 111 ASN A ND2    1 
ATOM   931   H  H      . ASN A 1 92  ? 9.288   57.017 206.177 1.00 107.14 ? 111 ASN A H      1 
ATOM   932   H  HA     . ASN A 1 92  ? 7.002   56.300 207.032 1.00 106.65 ? 111 ASN A HA     1 
ATOM   933   H  HB2    . ASN A 1 92  ? 7.880   56.172 204.347 1.00 125.06 ? 111 ASN A HB2    1 
ATOM   934   H  HB3    . ASN A 1 92  ? 6.351   56.114 204.778 1.00 125.06 ? 111 ASN A HB3    1 
ATOM   935   H  HD21   . ASN A 1 92  ? 7.316   59.389 203.657 1.00 197.33 ? 111 ASN A HD21   1 
ATOM   936   H  HD22   . ASN A 1 92  ? 7.507   58.037 203.061 1.00 197.33 ? 111 ASN A HD22   1 
ATOM   937   N  N      . LEU A 1 93  ? 8.679   53.765 206.113 1.00 88.11  ? 112 LEU A N      1 
ATOM   938   C  CA     . LEU A 1 93  ? 8.733   52.311 206.202 1.00 120.78 ? 112 LEU A CA     1 
ATOM   939   C  C      . LEU A 1 93  ? 8.855   51.856 207.651 1.00 122.84 ? 112 LEU A C      1 
ATOM   940   O  O      . LEU A 1 93  ? 8.031   51.073 208.134 1.00 128.52 ? 112 LEU A O      1 
ATOM   941   C  CB     . LEU A 1 93  ? 9.902   51.783 205.369 1.00 96.65  ? 112 LEU A CB     1 
ATOM   942   C  CG     . LEU A 1 93  ? 9.837   52.119 203.873 1.00 105.14 ? 112 LEU A CG     1 
ATOM   943   C  CD1    . LEU A 1 93  ? 11.110  51.677 203.159 1.00 106.90 ? 112 LEU A CD1    1 
ATOM   944   C  CD2    . LEU A 1 93  ? 8.606   51.485 203.223 1.00 98.20  ? 112 LEU A CD2    1 
ATOM   945   H  H      . LEU A 1 93  ? 9.412   54.130 205.850 1.00 105.73 ? 112 LEU A H      1 
ATOM   946   H  HA     . LEU A 1 93  ? 7.914   51.941 205.839 1.00 144.94 ? 112 LEU A HA     1 
ATOM   947   H  HB2    . LEU A 1 93  ? 10.725  52.160 205.718 1.00 115.98 ? 112 LEU A HB2    1 
ATOM   948   H  HB3    . LEU A 1 93  ? 9.928   50.816 205.451 1.00 115.98 ? 112 LEU A HB3    1 
ATOM   949   H  HG     . LEU A 1 93  ? 9.761   53.081 203.773 1.00 126.16 ? 112 LEU A HG     1 
ATOM   950   H  HD11   . LEU A 1 93  ? 11.039  51.902 202.219 1.00 128.28 ? 112 LEU A HD11   1 
ATOM   951   H  HD12   . LEU A 1 93  ? 11.868  52.136 203.553 1.00 128.28 ? 112 LEU A HD12   1 
ATOM   952   H  HD13   . LEU A 1 93  ? 11.213  50.718 203.264 1.00 128.28 ? 112 LEU A HD13   1 
ATOM   953   H  HD21   . LEU A 1 93  ? 8.593   51.716 202.280 1.00 117.84 ? 112 LEU A HD21   1 
ATOM   954   H  HD22   . LEU A 1 93  ? 8.654   50.522 203.327 1.00 117.84 ? 112 LEU A HD22   1 
ATOM   955   H  HD23   . LEU A 1 93  ? 7.809   51.826 203.658 1.00 117.84 ? 112 LEU A HD23   1 
ATOM   956   N  N      . GLN A 1 94  ? 9.859   52.362 208.372 1.00 75.39  ? 113 GLN A N      1 
ATOM   957   C  CA     . GLN A 1 94  ? 10.023  52.009 209.779 1.00 75.58  ? 113 GLN A CA     1 
ATOM   958   C  C      . GLN A 1 94  ? 8.742   52.222 210.583 1.00 79.90  ? 113 GLN A C      1 
ATOM   959   O  O      . GLN A 1 94  ? 8.618   51.696 211.702 1.00 100.95 ? 113 GLN A O      1 
ATOM   960   C  CB     . GLN A 1 94  ? 11.164  52.831 210.387 1.00 115.60 ? 113 GLN A CB     1 
ATOM   961   C  CG     . GLN A 1 94  ? 12.558  52.513 209.835 1.00 134.65 ? 113 GLN A CG     1 
ATOM   962   C  CD     . GLN A 1 94  ? 13.672  53.188 210.627 1.00 203.65 ? 113 GLN A CD     1 
ATOM   963   O  OE1    . GLN A 1 94  ? 13.410  53.928 211.573 1.00 188.00 ? 113 GLN A OE1    1 
ATOM   964   N  NE2    . GLN A 1 94  ? 14.920  52.937 210.241 1.00 125.89 ? 113 GLN A NE2    1 
ATOM   965   H  H      . GLN A 1 94  ? 10.452  52.908 208.071 1.00 90.47  ? 113 GLN A H      1 
ATOM   966   H  HA     . GLN A 1 94  ? 10.263  51.071 209.842 1.00 90.70  ? 113 GLN A HA     1 
ATOM   967   H  HB2    . GLN A 1 94  ? 10.991  53.771 210.219 1.00 138.72 ? 113 GLN A HB2    1 
ATOM   968   H  HB3    . GLN A 1 94  ? 11.184  52.671 211.343 1.00 138.72 ? 113 GLN A HB3    1 
ATOM   969   H  HG2    . GLN A 1 94  ? 12.702  51.554 209.873 1.00 161.59 ? 113 GLN A HG2    1 
ATOM   970   H  HG3    . GLN A 1 94  ? 12.613  52.821 208.917 1.00 161.59 ? 113 GLN A HG3    1 
ATOM   971   H  HE21   . GLN A 1 94  ? 15.067  52.415 209.573 1.00 151.07 ? 113 GLN A HE21   1 
ATOM   972   H  HE22   . GLN A 1 94  ? 15.580  53.296 210.659 1.00 151.07 ? 113 GLN A HE22   1 
ATOM   973   N  N      . GLU A 1 95  ? 7.786   52.977 210.036 1.00 85.96  ? 114 GLU A N      1 
ATOM   974   C  CA     . GLU A 1 95  ? 6.597   53.349 210.794 1.00 73.84  ? 114 GLU A CA     1 
ATOM   975   C  C      . GLU A 1 95  ? 5.840   52.130 211.305 1.00 52.79  ? 114 GLU A C      1 
ATOM   976   O  O      . GLU A 1 95  ? 5.506   52.056 212.488 1.00 94.98  ? 114 GLU A O      1 
ATOM   977   C  CB     . GLU A 1 95  ? 5.686   54.221 209.936 1.00 33.24  ? 114 GLU A CB     1 
ATOM   978   C  CG     . GLU A 1 95  ? 4.730   55.049 210.769 1.00 49.79  ? 114 GLU A CG     1 
ATOM   979   C  CD     . GLU A 1 95  ? 3.953   56.083 209.977 1.00 65.82  ? 114 GLU A CD     1 
ATOM   980   O  OE1    . GLU A 1 95  ? 2.711   56.121 210.134 1.00 67.02  ? 114 GLU A OE1    1 
ATOM   981   O  OE2    . GLU A 1 95  ? 4.579   56.859 209.222 1.00 58.92  ? 114 GLU A OE2    1 
ATOM   982   H  H      . GLU A 1 95  ? 7.804   53.284 209.232 1.00 103.15 ? 114 GLU A H      1 
ATOM   983   H  HA     . GLU A 1 95  ? 6.870   53.872 211.564 1.00 88.61  ? 114 GLU A HA     1 
ATOM   984   H  HB2    . GLU A 1 95  ? 6.230   54.827 209.410 1.00 39.89  ? 114 GLU A HB2    1 
ATOM   985   H  HB3    . GLU A 1 95  ? 5.161   53.652 209.351 1.00 39.89  ? 114 GLU A HB3    1 
ATOM   986   H  HG2    . GLU A 1 95  ? 4.088   54.455 211.188 1.00 59.75  ? 114 GLU A HG2    1 
ATOM   987   H  HG3    . GLU A 1 95  ? 5.236   55.517 211.450 1.00 59.75  ? 114 GLU A HG3    1 
ATOM   988   N  N      . GLY A 1 96  ? 5.536   51.174 210.428 1.00 62.05  ? 115 GLY A N      1 
ATOM   989   C  CA     . GLY A 1 96  ? 4.746   50.028 210.853 1.00 69.06  ? 115 GLY A CA     1 
ATOM   990   C  C      . GLY A 1 96  ? 5.377   49.297 212.022 1.00 73.69  ? 115 GLY A C      1 
ATOM   991   O  O      . GLY A 1 96  ? 4.743   49.100 213.069 1.00 100.54 ? 115 GLY A O      1 
ATOM   992   H  H      . GLY A 1 96  ? 5.771   51.166 209.601 1.00 74.45  ? 115 GLY A H      1 
ATOM   993   H  HA2    . GLY A 1 96  ? 3.861   50.326 211.118 1.00 82.87  ? 115 GLY A HA2    1 
ATOM   994   H  HA3    . GLY A 1 96  ? 4.654   49.406 210.115 1.00 82.87  ? 115 GLY A HA3    1 
ATOM   995   N  N      . GLU A 1 97  ? 6.640   48.886 211.858 1.00 72.82  ? 116 GLU A N      1 
ATOM   996   C  CA     . GLU A 1 97  ? 7.370   48.247 212.944 1.00 98.63  ? 116 GLU A CA     1 
ATOM   997   C  C      . GLU A 1 97  ? 7.201   49.056 214.224 1.00 71.40  ? 116 GLU A C      1 
ATOM   998   O  O      . GLU A 1 97  ? 6.729   48.541 215.256 1.00 101.21 ? 116 GLU A O      1 
ATOM   999   C  CB     . GLU A 1 97  ? 8.849   48.114 212.555 1.00 104.63 ? 116 GLU A CB     1 
ATOM   1000  C  CG     . GLU A 1 97  ? 9.174   47.075 211.456 1.00 96.72  ? 116 GLU A CG     1 
ATOM   1001  C  CD     . GLU A 1 97  ? 8.483   47.353 210.124 1.00 95.11  ? 116 GLU A CD     1 
ATOM   1002  O  OE1    . GLU A 1 97  ? 8.011   48.488 209.916 1.00 115.97 ? 116 GLU A OE1    1 
ATOM   1003  O  OE2    . GLU A 1 97  ? 8.415   46.434 209.280 1.00 131.80 ? 116 GLU A OE2    1 
ATOM   1004  H  H      . GLU A 1 97  ? 7.090   48.968 211.129 1.00 87.38  ? 116 GLU A H      1 
ATOM   1005  H  HA     . GLU A 1 97  ? 7.012   47.359 213.094 1.00 118.36 ? 116 GLU A HA     1 
ATOM   1006  H  HB2    . GLU A 1 97  ? 9.159   48.976 212.238 1.00 125.56 ? 116 GLU A HB2    1 
ATOM   1007  H  HB3    . GLU A 1 97  ? 9.350   47.862 213.346 1.00 125.56 ? 116 GLU A HB3    1 
ATOM   1008  H  HG2    . GLU A 1 97  ? 10.131  47.075 211.299 1.00 116.07 ? 116 GLU A HG2    1 
ATOM   1009  H  HG3    . GLU A 1 97  ? 8.890   46.199 211.760 1.00 116.07 ? 116 GLU A HG3    1 
ATOM   1010  N  N      . PHE A 1 98  ? 7.520   50.355 214.147 1.00 49.05  ? 117 PHE A N      1 
ATOM   1011  C  CA     . PHE A 1 98  ? 7.401   51.206 215.322 1.00 59.75  ? 117 PHE A CA     1 
ATOM   1012  C  C      . PHE A 1 98  ? 5.996   51.154 215.901 1.00 56.84  ? 117 PHE A C      1 
ATOM   1013  O  O      . PHE A 1 98  ? 5.817   51.197 217.121 1.00 57.35  ? 117 PHE A O      1 
ATOM   1014  C  CB     . PHE A 1 98  ? 7.763   52.639 214.964 1.00 83.64  ? 117 PHE A CB     1 
ATOM   1015  C  CG     . PHE A 1 98  ? 9.205   52.834 214.583 1.00 65.37  ? 117 PHE A CG     1 
ATOM   1016  C  CD1    . PHE A 1 98  ? 10.163  51.868 214.861 1.00 64.50  ? 117 PHE A CD1    1 
ATOM   1017  C  CD2    . PHE A 1 98  ? 9.605   53.999 213.957 1.00 85.07  ? 117 PHE A CD2    1 
ATOM   1018  C  CE1    . PHE A 1 98  ? 11.481  52.063 214.516 1.00 98.49  ? 117 PHE A CE1    1 
ATOM   1019  C  CE2    . PHE A 1 98  ? 10.919  54.198 213.612 1.00 79.85  ? 117 PHE A CE2    1 
ATOM   1020  C  CZ     . PHE A 1 98  ? 11.860  53.230 213.892 1.00 74.62  ? 117 PHE A CZ     1 
ATOM   1021  H  H      . PHE A 1 98  ? 7.801   50.754 213.439 1.00 58.87  ? 117 PHE A H      1 
ATOM   1022  H  HA     . PHE A 1 98  ? 8.021   50.899 216.002 1.00 71.70  ? 117 PHE A HA     1 
ATOM   1023  H  HB2    . PHE A 1 98  ? 7.218   52.919 214.211 1.00 100.37 ? 117 PHE A HB2    1 
ATOM   1024  H  HB3    . PHE A 1 98  ? 7.580   53.207 215.729 1.00 100.37 ? 117 PHE A HB3    1 
ATOM   1025  H  HD1    . PHE A 1 98  ? 9.910   51.079 215.285 1.00 77.40  ? 117 PHE A HD1    1 
ATOM   1026  H  HD2    . PHE A 1 98  ? 8.976   54.657 213.767 1.00 102.08 ? 117 PHE A HD2    1 
ATOM   1027  H  HE1    . PHE A 1 98  ? 12.114  51.408 214.705 1.00 118.19 ? 117 PHE A HE1    1 
ATOM   1028  H  HE2    . PHE A 1 98  ? 11.175  54.986 213.189 1.00 95.82  ? 117 PHE A HE2    1 
ATOM   1029  H  HZ     . PHE A 1 98  ? 12.750  53.363 213.655 1.00 89.54  ? 117 PHE A HZ     1 
ATOM   1030  N  N      . LEU A 1 99  ? 4.984   51.059 215.043 1.00 56.58  ? 118 LEU A N      1 
ATOM   1031  C  CA     . LEU A 1 99  ? 3.615   51.042 215.531 1.00 78.89  ? 118 LEU A CA     1 
ATOM   1032  C  C      . LEU A 1 99  ? 3.349   49.779 216.327 1.00 88.34  ? 118 LEU A C      1 
ATOM   1033  O  O      . LEU A 1 99  ? 2.740   49.830 217.404 1.00 80.12  ? 118 LEU A O      1 
ATOM   1034  C  CB     . LEU A 1 99  ? 2.637   51.155 214.366 1.00 64.09  ? 118 LEU A CB     1 
ATOM   1035  C  CG     . LEU A 1 99  ? 2.083   52.555 214.102 1.00 88.70  ? 118 LEU A CG     1 
ATOM   1036  C  CD1    . LEU A 1 99  ? 3.152   53.435 213.503 1.00 129.91 ? 118 LEU A CD1    1 
ATOM   1037  C  CD2    . LEU A 1 99  ? 0.883   52.491 213.178 1.00 93.87  ? 118 LEU A CD2    1 
ATOM   1038  H  H      . LEU A 1 99  ? 5.063   51.003 214.189 1.00 67.89  ? 118 LEU A H      1 
ATOM   1039  H  HA     . LEU A 1 99  ? 3.476   51.803 216.116 1.00 94.67  ? 118 LEU A HA     1 
ATOM   1040  H  HB2    . LEU A 1 99  ? 3.089   50.865 213.558 1.00 76.90  ? 118 LEU A HB2    1 
ATOM   1041  H  HB3    . LEU A 1 99  ? 1.882   50.572 214.541 1.00 76.90  ? 118 LEU A HB3    1 
ATOM   1042  H  HG     . LEU A 1 99  ? 1.799   52.950 214.941 1.00 106.44 ? 118 LEU A HG     1 
ATOM   1043  H  HD11   . LEU A 1 99  ? 2.782   54.317 213.343 1.00 155.89 ? 118 LEU A HD11   1 
ATOM   1044  H  HD12   . LEU A 1 99  ? 3.895   53.495 214.124 1.00 155.89 ? 118 LEU A HD12   1 
ATOM   1045  H  HD13   . LEU A 1 99  ? 3.450   53.044 212.667 1.00 155.89 ? 118 LEU A HD13   1 
ATOM   1046  H  HD21   . LEU A 1 99  ? 0.552   53.391 213.028 1.00 112.64 ? 118 LEU A HD21   1 
ATOM   1047  H  HD22   . LEU A 1 99  ? 1.154   52.093 212.336 1.00 112.64 ? 118 LEU A HD22   1 
ATOM   1048  H  HD23   . LEU A 1 99  ? 0.194   51.950 213.593 1.00 112.64 ? 118 LEU A HD23   1 
ATOM   1049  N  N      . LEU A 1 100 ? 3.808   48.633 215.822 1.00 81.57  ? 119 LEU A N      1 
ATOM   1050  C  CA     . LEU A 1 100 ? 3.553   47.395 216.541 1.00 63.35  ? 119 LEU A CA     1 
ATOM   1051  C  C      . LEU A 1 100 ? 4.249   47.384 217.895 1.00 76.27  ? 119 LEU A C      1 
ATOM   1052  O  O      . LEU A 1 100 ? 3.649   46.974 218.898 1.00 113.46 ? 119 LEU A O      1 
ATOM   1053  C  CB     . LEU A 1 100 ? 3.980   46.201 215.700 1.00 75.56  ? 119 LEU A CB     1 
ATOM   1054  C  CG     . LEU A 1 100 ? 3.178   45.999 214.413 1.00 57.01  ? 119 LEU A CG     1 
ATOM   1055  C  CD1    . LEU A 1 100 ? 3.761   44.842 213.595 1.00 64.25  ? 119 LEU A CD1    1 
ATOM   1056  C  CD2    . LEU A 1 100 ? 1.696   45.765 214.719 1.00 44.47  ? 119 LEU A CD2    1 
ATOM   1057  H  H      . LEU A 1 100 ? 4.254   48.550 215.091 1.00 97.89  ? 119 LEU A H      1 
ATOM   1058  H  HA     . LEU A 1 100 ? 2.599   47.319 216.699 1.00 76.02  ? 119 LEU A HA     1 
ATOM   1059  H  HB2    . LEU A 1 100 ? 4.911   46.316 215.451 1.00 90.67  ? 119 LEU A HB2    1 
ATOM   1060  H  HB3    . LEU A 1 100 ? 3.884   45.397 216.234 1.00 90.67  ? 119 LEU A HB3    1 
ATOM   1061  H  HG     . LEU A 1 100 ? 3.245   46.804 213.875 1.00 68.41  ? 119 LEU A HG     1 
ATOM   1062  H  HD11   . LEU A 1 100 ? 3.238   44.733 212.786 1.00 77.09  ? 119 LEU A HD11   1 
ATOM   1063  H  HD12   . LEU A 1 100 ? 4.682   45.048 213.370 1.00 77.09  ? 119 LEU A HD12   1 
ATOM   1064  H  HD13   . LEU A 1 100 ? 3.723   44.031 214.126 1.00 77.09  ? 119 LEU A HD13   1 
ATOM   1065  H  HD21   . LEU A 1 100 ? 1.218   45.642 213.884 1.00 53.36  ? 119 LEU A HD21   1 
ATOM   1066  H  HD22   . LEU A 1 100 ? 1.610   44.972 215.271 1.00 53.36  ? 119 LEU A HD22   1 
ATOM   1067  H  HD23   . LEU A 1 100 ? 1.346   46.537 215.190 1.00 53.36  ? 119 LEU A HD23   1 
ATOM   1068  N  N      . GLN A 1 101 ? 5.510   47.833 217.960 1.00 52.39  ? 120 GLN A N      1 
ATOM   1069  C  CA     . GLN A 1 101 ? 6.196   47.736 219.249 1.00 74.98  ? 120 GLN A CA     1 
ATOM   1070  C  C      . GLN A 1 101 ? 5.773   48.837 220.215 1.00 69.65  ? 120 GLN A C      1 
ATOM   1071  O  O      . GLN A 1 101 ? 5.577   48.577 221.408 1.00 64.73  ? 120 GLN A O      1 
ATOM   1072  C  CB     . GLN A 1 101 ? 7.708   47.759 219.055 1.00 56.91  ? 120 GLN A CB     1 
ATOM   1073  C  CG     . GLN A 1 101 ? 8.291   46.420 218.621 1.00 102.06 ? 120 GLN A CG     1 
ATOM   1074  C  CD     . GLN A 1 101 ? 7.725   45.936 217.299 1.00 118.73 ? 120 GLN A CD     1 
ATOM   1075  O  OE1    . GLN A 1 101 ? 6.817   46.546 216.745 1.00 127.98 ? 120 GLN A OE1    1 
ATOM   1076  N  NE2    . GLN A 1 101 ? 8.255   44.835 216.789 1.00 97.17  ? 120 GLN A NE2    1 
ATOM   1077  H  H      . GLN A 1 101 ? 5.964   48.176 217.315 1.00 62.87  ? 120 GLN A H      1 
ATOM   1078  H  HA     . GLN A 1 101 ? 5.967   46.886 219.657 1.00 89.97  ? 120 GLN A HA     1 
ATOM   1079  H  HB2    . GLN A 1 101 ? 7.925   48.412 218.372 1.00 68.29  ? 120 GLN A HB2    1 
ATOM   1080  H  HB3    . GLN A 1 101 ? 8.127   48.008 219.893 1.00 68.29  ? 120 GLN A HB3    1 
ATOM   1081  H  HG2    . GLN A 1 101 ? 9.252   46.511 218.521 1.00 122.48 ? 120 GLN A HG2    1 
ATOM   1082  H  HG3    . GLN A 1 101 ? 8.089   45.753 219.297 1.00 122.48 ? 120 GLN A HG3    1 
ATOM   1083  H  HE21   . GLN A 1 101 ? 8.889   44.431 217.206 1.00 116.60 ? 120 GLN A HE21   1 
ATOM   1084  H  HE22   . GLN A 1 101 ? 7.966   44.525 216.042 1.00 116.60 ? 120 GLN A HE22   1 
ATOM   1085  N  N      . ALA A 1 102 ? 5.633   50.065 219.716 1.00 59.35  ? 121 ALA A N      1 
ATOM   1086  C  CA     . ALA A 1 102 ? 5.290   51.208 220.560 1.00 52.32  ? 121 ALA A CA     1 
ATOM   1087  C  C      . ALA A 1 102 ? 3.965   51.013 221.286 1.00 61.26  ? 121 ALA A C      1 
ATOM   1088  O  O      . ALA A 1 102 ? 3.781   51.533 222.392 1.00 71.92  ? 121 ALA A O      1 
ATOM   1089  C  CB     . ALA A 1 102 ? 5.235   52.481 219.710 1.00 79.61  ? 121 ALA A CB     1 
ATOM   1090  H  H      . ALA A 1 102 ? 5.733   50.263 218.885 1.00 71.21  ? 121 ALA A H      1 
ATOM   1091  H  HA     . ALA A 1 102 ? 5.983   51.325 221.228 1.00 62.78  ? 121 ALA A HA     1 
ATOM   1092  H  HB1    . ALA A 1 102 ? 5.007   53.231 220.281 1.00 95.53  ? 121 ALA A HB1    1 
ATOM   1093  H  HB2    . ALA A 1 102 ? 6.103   52.626 219.304 1.00 95.53  ? 121 ALA A HB2    1 
ATOM   1094  H  HB3    . ALA A 1 102 ? 4.561   52.371 219.022 1.00 95.53  ? 121 ALA A HB3    1 
ATOM   1095  N  N      . LEU A 1 103 ? 3.031   50.285 220.685 1.00 70.61  ? 122 LEU A N      1 
ATOM   1096  C  CA     . LEU A 1 103 ? 1.748   50.036 221.327 1.00 73.46  ? 122 LEU A CA     1 
ATOM   1097  C  C      . LEU A 1 103 ? 1.913   49.011 222.443 1.00 60.95  ? 122 LEU A C      1 
ATOM   1098  O  O      . LEU A 1 103 ? 2.537   47.962 222.250 1.00 67.69  ? 122 LEU A O      1 
ATOM   1099  C  CB     . LEU A 1 103 ? 0.731   49.540 220.300 1.00 51.86  ? 122 LEU A CB     1 
ATOM   1100  C  CG     . LEU A 1 103 ? -0.675  49.288 220.846 1.00 62.09  ? 122 LEU A CG     1 
ATOM   1101  C  CD1    . LEU A 1 103 ? -1.330  50.596 221.254 1.00 67.96  ? 122 LEU A CD1    1 
ATOM   1102  C  CD2    . LEU A 1 103 ? -1.516  48.543 219.822 1.00 49.79  ? 122 LEU A CD2    1 
ATOM   1103  H  H      . LEU A 1 103 ? 3.115   49.926 219.908 1.00 84.73  ? 122 LEU A H      1 
ATOM   1104  H  HA     . LEU A 1 103 ? 1.415   50.861 221.715 1.00 88.15  ? 122 LEU A HA     1 
ATOM   1105  H  HB2    . LEU A 1 103 ? 0.656   50.203 219.596 1.00 62.24  ? 122 LEU A HB2    1 
ATOM   1106  H  HB3    . LEU A 1 103 ? 1.053   48.705 219.927 1.00 62.24  ? 122 LEU A HB3    1 
ATOM   1107  H  HG     . LEU A 1 103 ? -0.608  48.730 221.636 1.00 74.51  ? 122 LEU A HG     1 
ATOM   1108  H  HD11   . LEU A 1 103 ? -2.218  50.410 221.596 1.00 81.56  ? 122 LEU A HD11   1 
ATOM   1109  H  HD12   . LEU A 1 103 ? -0.791  51.016 221.943 1.00 81.56  ? 122 LEU A HD12   1 
ATOM   1110  H  HD13   . LEU A 1 103 ? -1.388  51.175 220.479 1.00 81.56  ? 122 LEU A HD13   1 
ATOM   1111  H  HD21   . LEU A 1 103 ? -2.401  48.394 220.189 1.00 59.75  ? 122 LEU A HD21   1 
ATOM   1112  H  HD22   . LEU A 1 103 ? -1.577  49.078 219.015 1.00 59.75  ? 122 LEU A HD22   1 
ATOM   1113  H  HD23   . LEU A 1 103 ? -1.092  47.693 219.624 1.00 59.75  ? 122 LEU A HD23   1 
ATOM   1114  N  N      . ASN A 1 104 ? 1.335   49.309 223.610 1.00 59.65  ? 123 ASN A N      1 
ATOM   1115  C  CA     . ASN A 1 104 ? 1.427   48.441 224.791 1.00 72.65  ? 123 ASN A CA     1 
ATOM   1116  C  C      . ASN A 1 104 ? 0.662   47.141 224.636 1.00 68.96  ? 123 ASN A C      1 
ATOM   1117  O  O      . ASN A 1 104 ? 0.582   46.379 225.609 1.00 98.32  ? 123 ASN A O      1 
ATOM   1118  C  CB     . ASN A 1 104 ? 0.926   49.189 226.030 1.00 53.63  ? 123 ASN A CB     1 
ATOM   1119  C  CG     . ASN A 1 104 ? -0.530  49.620 225.913 1.00 88.23  ? 123 ASN A CG     1 
ATOM   1120  O  OD1    . ASN A 1 104 ? -1.302  49.048 225.142 1.00 80.74  ? 123 ASN A OD1    1 
ATOM   1121  N  ND2    . ASN A 1 104 ? -0.911  50.632 226.689 1.00 72.30  ? 123 ASN A ND2    1 
ATOM   1122  H  H      . ASN A 1 104 ? 0.875   50.023 223.746 1.00 71.58  ? 123 ASN A H      1 
ATOM   1123  H  HA     . ASN A 1 104 ? 2.359   48.218 224.939 1.00 87.18  ? 123 ASN A HA     1 
ATOM   1124  H  HB2    . ASN A 1 104 ? 1.006   48.608 226.802 1.00 64.35  ? 123 ASN A HB2    1 
ATOM   1125  H  HB3    . ASN A 1 104 ? 1.465   49.985 226.157 1.00 64.35  ? 123 ASN A HB3    1 
ATOM   1126  H  HD21   . ASN A 1 104 ? -1.723  50.913 226.660 1.00 86.76  ? 123 ASN A HD21   1 
ATOM   1127  H  HD22   . ASN A 1 104 ? -0.345  51.004 227.219 1.00 86.76  ? 123 ASN A HD22   1 
ATOM   1128  N  N      . GLY A 1 105 ? 0.103   46.883 223.459 1.00 68.79  ? 124 GLY A N      1 
ATOM   1129  C  CA     . GLY A 1 105 ? -0.675  45.682 223.224 1.00 89.96  ? 124 GLY A CA     1 
ATOM   1130  C  C      . GLY A 1 105 ? -0.672  45.301 221.757 1.00 68.53  ? 124 GLY A C      1 
ATOM   1131  O  O      . GLY A 1 105 ? 0.248   45.669 221.016 1.00 75.52  ? 124 GLY A O      1 
ATOM   1132  H  H      . GLY A 1 105 ? 0.164   47.398 222.773 1.00 82.55  ? 124 GLY A H      1 
ATOM   1133  H  HA2    . GLY A 1 105 ? -0.304  44.946 223.736 1.00 107.96 ? 124 GLY A HA2    1 
ATOM   1134  H  HA3    . GLY A 1 105 ? -1.592  45.826 223.506 1.00 107.96 ? 124 GLY A HA3    1 
ATOM   1135  N  N      . PHE A 1 106 ? -1.698  44.579 221.317 1.00 33.21  ? 125 PHE A N      1 
ATOM   1136  C  CA     . PHE A 1 106 ? -1.777  44.131 219.936 1.00 77.32  ? 125 PHE A CA     1 
ATOM   1137  C  C      . PHE A 1 106 ? -3.100  44.577 219.329 1.00 95.11  ? 125 PHE A C      1 
ATOM   1138  O  O      . PHE A 1 106 ? -4.007  45.037 220.027 1.00 88.53  ? 125 PHE A O      1 
ATOM   1139  C  CB     . PHE A 1 106 ? -1.624  42.610 219.841 1.00 76.90  ? 125 PHE A CB     1 
ATOM   1140  C  CG     . PHE A 1 106 ? -2.627  41.858 220.652 1.00 64.11  ? 125 PHE A CG     1 
ATOM   1141  C  CD1    . PHE A 1 106 ? -3.872  41.559 220.127 1.00 48.34  ? 125 PHE A CD1    1 
ATOM   1142  C  CD2    . PHE A 1 106 ? -2.328  41.453 221.940 1.00 71.19  ? 125 PHE A CD2    1 
ATOM   1143  C  CE1    . PHE A 1 106 ? -4.804  40.866 220.871 1.00 68.31  ? 125 PHE A CE1    1 
ATOM   1144  C  CE2    . PHE A 1 106 ? -3.257  40.757 222.691 1.00 64.97  ? 125 PHE A CE2    1 
ATOM   1145  C  CZ     . PHE A 1 106 ? -4.498  40.464 222.156 1.00 59.49  ? 125 PHE A CZ     1 
ATOM   1146  H  H      . PHE A 1 106 ? -2.363  44.335 221.804 1.00 39.86  ? 125 PHE A H      1 
ATOM   1147  H  HA     . PHE A 1 106 ? -1.059  44.539 219.427 1.00 92.78  ? 125 PHE A HA     1 
ATOM   1148  H  HB2    . PHE A 1 106 ? -1.729  42.342 218.915 1.00 92.28  ? 125 PHE A HB2    1 
ATOM   1149  H  HB3    . PHE A 1 106 ? -0.741  42.364 220.158 1.00 92.28  ? 125 PHE A HB3    1 
ATOM   1150  H  HD1    . PHE A 1 106 ? -4.083  41.828 219.263 1.00 58.01  ? 125 PHE A HD1    1 
ATOM   1151  H  HD2    . PHE A 1 106 ? -1.494  41.648 222.304 1.00 85.42  ? 125 PHE A HD2    1 
ATOM   1152  H  HE1    . PHE A 1 106 ? -5.637  40.670 220.508 1.00 81.97  ? 125 PHE A HE1    1 
ATOM   1153  H  HE2    . PHE A 1 106 ? -3.049  40.487 223.557 1.00 77.96  ? 125 PHE A HE2    1 
ATOM   1154  H  HZ     . PHE A 1 106 ? -5.124  39.996 222.660 1.00 71.39  ? 125 PHE A HZ     1 
ATOM   1155  N  N      . VAL A 1 107 ? -3.200  44.430 218.007 1.00 49.03  ? 126 VAL A N      1 
ATOM   1156  C  CA     . VAL A 1 107 ? -4.365  44.874 217.251 1.00 43.19  ? 126 VAL A CA     1 
ATOM   1157  C  C      . VAL A 1 107 ? -5.205  43.662 216.900 1.00 45.10  ? 126 VAL A C      1 
ATOM   1158  O  O      . VAL A 1 107 ? -4.668  42.596 216.567 1.00 57.22  ? 126 VAL A O      1 
ATOM   1159  C  CB     . VAL A 1 107 ? -3.958  45.626 215.973 1.00 67.90  ? 126 VAL A CB     1 
ATOM   1160  C  CG1    . VAL A 1 107 ? -5.194  46.189 215.297 1.00 54.45  ? 126 VAL A CG1    1 
ATOM   1161  C  CG2    . VAL A 1 107 ? -2.960  46.725 216.283 1.00 50.57  ? 126 VAL A CG2    1 
ATOM   1162  H  H      . VAL A 1 107 ? -2.591  44.069 217.519 1.00 58.83  ? 126 VAL A H      1 
ATOM   1163  H  HA     . VAL A 1 107 ? -4.899  45.469 217.800 1.00 51.83  ? 126 VAL A HA     1 
ATOM   1164  H  HB     . VAL A 1 107 ? -3.538  45.003 215.359 1.00 81.48  ? 126 VAL A HB     1 
ATOM   1165  H  HG11   . VAL A 1 107 ? -4.926  46.661 214.493 1.00 65.34  ? 126 VAL A HG11   1 
ATOM   1166  H  HG12   . VAL A 1 107 ? -5.789  45.458 215.069 1.00 65.34  ? 126 VAL A HG12   1 
ATOM   1167  H  HG13   . VAL A 1 107 ? -5.637  46.799 215.908 1.00 65.34  ? 126 VAL A HG13   1 
ATOM   1168  H  HG21   . VAL A 1 107 ? -2.724  47.178 215.458 1.00 60.68  ? 126 VAL A HG21   1 
ATOM   1169  H  HG22   . VAL A 1 107 ? -3.364  47.352 216.902 1.00 60.68  ? 126 VAL A HG22   1 
ATOM   1170  H  HG23   . VAL A 1 107 ? -2.169  46.329 216.681 1.00 60.68  ? 126 VAL A HG23   1 
ATOM   1171  N  N      . LEU A 1 108 ? -6.524  43.823 216.954 1.00 38.20  ? 127 LEU A N      1 
ATOM   1172  C  CA     . LEU A 1 108 ? -7.416  42.724 216.630 1.00 47.37  ? 127 LEU A CA     1 
ATOM   1173  C  C      . LEU A 1 108 ? -8.526  43.206 215.716 1.00 64.43  ? 127 LEU A C      1 
ATOM   1174  O  O      . LEU A 1 108 ? -9.082  44.292 215.905 1.00 84.83  ? 127 LEU A O      1 
ATOM   1175  C  CB     . LEU A 1 108 ? -8.029  42.089 217.885 1.00 53.30  ? 127 LEU A CB     1 
ATOM   1176  C  CG     . LEU A 1 108 ? -7.423  40.752 218.335 1.00 68.96  ? 127 LEU A CG     1 
ATOM   1177  C  CD1    . LEU A 1 108 ? -8.124  40.270 219.586 1.00 58.31  ? 127 LEU A CD1    1 
ATOM   1178  C  CD2    . LEU A 1 108 ? -7.511  39.683 217.264 1.00 77.25  ? 127 LEU A CD2    1 
ATOM   1179  H  H      . LEU A 1 108 ? -6.921  44.553 217.174 1.00 45.84  ? 127 LEU A H      1 
ATOM   1180  H  HA     . LEU A 1 108 ? -6.916  42.038 216.160 1.00 56.85  ? 127 LEU A HA     1 
ATOM   1181  H  HB2    . LEU A 1 108 ? -7.929  42.713 218.621 1.00 63.96  ? 127 LEU A HB2    1 
ATOM   1182  H  HB3    . LEU A 1 108 ? -8.972  41.936 217.719 1.00 63.96  ? 127 LEU A HB3    1 
ATOM   1183  H  HG     . LEU A 1 108 ? -6.487  40.886 218.549 1.00 82.75  ? 127 LEU A HG     1 
ATOM   1184  H  HD11   . LEU A 1 108 ? -7.733  39.426 219.861 1.00 69.97  ? 127 LEU A HD11   1 
ATOM   1185  H  HD12   . LEU A 1 108 ? -8.009  40.932 220.286 1.00 69.97  ? 127 LEU A HD12   1 
ATOM   1186  H  HD13   . LEU A 1 108 ? -9.067  40.152 219.394 1.00 69.97  ? 127 LEU A HD13   1 
ATOM   1187  H  HD21   . LEU A 1 108 ? -7.115  38.864 217.602 1.00 92.70  ? 127 LEU A HD21   1 
ATOM   1188  H  HD22   . LEU A 1 108 ? -8.443  39.533 217.043 1.00 92.70  ? 127 LEU A HD22   1 
ATOM   1189  H  HD23   . LEU A 1 108 ? -7.028  39.983 216.478 1.00 92.70  ? 127 LEU A HD23   1 
ATOM   1190  N  N      . VAL A 1 109 ? -8.833  42.381 214.722 1.00 68.81  ? 128 VAL A N      1 
ATOM   1191  C  CA     . VAL A 1 109 ? -9.950  42.600 213.820 1.00 81.83  ? 128 VAL A CA     1 
ATOM   1192  C  C      . VAL A 1 109 ? -10.749 41.309 213.788 1.00 57.33  ? 128 VAL A C      1 
ATOM   1193  O  O      . VAL A 1 109 ? -10.222 40.261 213.392 1.00 62.19  ? 128 VAL A O      1 
ATOM   1194  C  CB     . VAL A 1 109 ? -9.489  42.992 212.407 1.00 91.48  ? 128 VAL A CB     1 
ATOM   1195  C  CG1    . VAL A 1 109 ? -10.678 43.416 211.564 1.00 68.36  ? 128 VAL A CG1    1 
ATOM   1196  C  CG2    . VAL A 1 109 ? -8.455  44.109 212.469 1.00 78.46  ? 128 VAL A CG2    1 
ATOM   1197  H  H      . VAL A 1 109 ? -8.392  41.664 214.547 1.00 82.57  ? 128 VAL A H      1 
ATOM   1198  H  HA     . VAL A 1 109 ? -10.516 43.307 214.168 1.00 98.19  ? 128 VAL A HA     1 
ATOM   1199  H  HB     . VAL A 1 109 ? -9.077  42.223 211.983 1.00 109.78 ? 128 VAL A HB     1 
ATOM   1200  H  HG11   . VAL A 1 109 ? -10.366 43.658 210.678 1.00 82.03  ? 128 VAL A HG11   1 
ATOM   1201  H  HG12   . VAL A 1 109 ? -11.302 42.676 211.504 1.00 82.03  ? 128 VAL A HG12   1 
ATOM   1202  H  HG13   . VAL A 1 109 ? -11.107 44.178 211.984 1.00 82.03  ? 128 VAL A HG13   1 
ATOM   1203  H  HG21   . VAL A 1 109 ? -8.182  44.336 211.567 1.00 94.15  ? 128 VAL A HG21   1 
ATOM   1204  H  HG22   . VAL A 1 109 ? -8.852  44.882 212.900 1.00 94.15  ? 128 VAL A HG22   1 
ATOM   1205  H  HG23   . VAL A 1 109 ? -7.690  43.802 212.980 1.00 94.15  ? 128 VAL A HG23   1 
ATOM   1206  N  N      . VAL A 1 110 ? -12.010 41.387 214.210 1.00 66.84  ? 129 VAL A N      1 
ATOM   1207  C  CA     . VAL A 1 110 ? -12.921 40.251 214.246 1.00 72.83  ? 129 VAL A CA     1 
ATOM   1208  C  C      . VAL A 1 110 ? -14.121 40.559 213.363 1.00 106.44 ? 129 VAL A C      1 
ATOM   1209  O  O      . VAL A 1 110 ? -14.479 41.722 213.157 1.00 128.37 ? 129 VAL A O      1 
ATOM   1210  C  CB     . VAL A 1 110 ? -13.370 39.948 215.692 1.00 90.41  ? 129 VAL A CB     1 
ATOM   1211  C  CG1    . VAL A 1 110 ? -14.378 38.804 215.724 1.00 113.15 ? 129 VAL A CG1    1 
ATOM   1212  C  CG2    . VAL A 1 110 ? -12.160 39.640 216.564 1.00 72.70  ? 129 VAL A CG2    1 
ATOM   1213  H  H      . VAL A 1 110 ? -12.370 42.116 214.489 1.00 80.20  ? 129 VAL A H      1 
ATOM   1214  H  HA     . VAL A 1 110 ? -12.473 39.467 213.893 1.00 87.40  ? 129 VAL A HA     1 
ATOM   1215  H  HB     . VAL A 1 110 ? -13.804 40.736 216.055 1.00 108.49 ? 129 VAL A HB     1 
ATOM   1216  H  HG11   . VAL A 1 110 ? -14.639 38.640 216.644 1.00 135.78 ? 129 VAL A HG11   1 
ATOM   1217  H  HG12   . VAL A 1 110 ? -15.155 39.054 215.199 1.00 135.78 ? 129 VAL A HG12   1 
ATOM   1218  H  HG13   . VAL A 1 110 ? -13.966 38.010 215.349 1.00 135.78 ? 129 VAL A HG13   1 
ATOM   1219  H  HG21   . VAL A 1 110 ? -12.461 39.452 217.467 1.00 87.25  ? 129 VAL A HG21   1 
ATOM   1220  H  HG22   . VAL A 1 110 ? -11.698 38.867 216.202 1.00 87.25  ? 129 VAL A HG22   1 
ATOM   1221  H  HG23   . VAL A 1 110 ? -11.568 40.408 216.566 1.00 87.25  ? 129 VAL A HG23   1 
ATOM   1222  N  N      . THR A 1 111 ? -14.745 39.508 212.840 1.00 123.82 ? 130 THR A N      1 
ATOM   1223  C  CA     . THR A 1 111 ? -15.955 39.629 212.041 1.00 94.12  ? 130 THR A CA     1 
ATOM   1224  C  C      . THR A 1 111 ? -17.157 39.155 212.850 1.00 95.79  ? 130 THR A C      1 
ATOM   1225  O  O      . THR A 1 111 ? -17.015 38.488 213.877 1.00 101.29 ? 130 THR A O      1 
ATOM   1226  C  CB     . THR A 1 111 ? -15.848 38.815 210.744 1.00 98.83  ? 130 THR A CB     1 
ATOM   1227  O  OG1    . THR A 1 111 ? -15.975 37.417 211.036 1.00 96.79  ? 130 THR A OG1    1 
ATOM   1228  C  CG2    . THR A 1 111 ? -14.507 39.063 210.055 1.00 122.66 ? 130 THR A CG2    1 
ATOM   1229  H  H      . THR A 1 111 ? -14.478 38.696 212.937 1.00 148.58 ? 130 THR A H      1 
ATOM   1230  H  HA     . THR A 1 111 ? -16.093 40.560 211.806 1.00 112.94 ? 130 THR A HA     1 
ATOM   1231  H  HB     . THR A 1 111 ? -16.557 39.082 210.137 1.00 118.60 ? 130 THR A HB     1 
ATOM   1232  H  HG1    . THR A 1 111 ? -15.917 36.969 210.328 1.00 116.15 ? 130 THR A HG1    1 
ATOM   1233  H  HG21   . THR A 1 111 ? -14.453 38.543 209.238 1.00 147.19 ? 130 THR A HG21   1 
ATOM   1234  H  HG22   . THR A 1 111 ? -14.415 40.004 209.837 1.00 147.19 ? 130 THR A HG22   1 
ATOM   1235  H  HG23   . THR A 1 111 ? -13.780 38.803 210.643 1.00 147.19 ? 130 THR A HG23   1 
ATOM   1236  N  N      . THR A 1 112 ? -18.356 39.511 212.376 1.00 115.28 ? 131 THR A N      1 
ATOM   1237  C  CA     . THR A 1 112 ? -19.572 39.034 213.029 1.00 118.99 ? 131 THR A CA     1 
ATOM   1238  C  C      . THR A 1 112 ? -19.608 37.514 213.077 1.00 115.61 ? 131 THR A C      1 
ATOM   1239  O  O      . THR A 1 112 ? -20.156 36.933 214.021 1.00 127.00 ? 131 THR A O      1 
ATOM   1240  C  CB     . THR A 1 112 ? -20.814 39.565 212.314 1.00 154.14 ? 131 THR A CB     1 
ATOM   1241  O  OG1    . THR A 1 112 ? -20.689 39.352 210.902 1.00 187.62 ? 131 THR A OG1    1 
ATOM   1242  C  CG2    . THR A 1 112 ? -21.006 41.049 212.597 1.00 143.37 ? 131 THR A CG2    1 
ATOM   1243  H  H      . THR A 1 112 ? -18.487 40.017 211.693 1.00 138.34 ? 131 THR A H      1 
ATOM   1244  H  HA     . THR A 1 112 ? -19.589 39.362 213.942 1.00 142.78 ? 131 THR A HA     1 
ATOM   1245  H  HB     . THR A 1 112 ? -21.596 39.092 212.639 1.00 184.97 ? 131 THR A HB     1 
ATOM   1246  H  HG1    . THR A 1 112 ? -21.371 39.643 210.506 1.00 225.14 ? 131 THR A HG1    1 
ATOM   1247  H  HG21   . THR A 1 112 ? -21.797 41.374 212.138 1.00 172.05 ? 131 THR A HG21   1 
ATOM   1248  H  HG22   . THR A 1 112 ? -21.113 41.193 213.550 1.00 172.05 ? 131 THR A HG22   1 
ATOM   1249  H  HG23   . THR A 1 112 ? -20.234 41.548 212.288 1.00 172.05 ? 131 THR A HG23   1 
ATOM   1250  N  N      . ASP A 1 113 ? -19.023 36.852 212.076 1.00 128.88 ? 132 ASP A N      1 
ATOM   1251  C  CA     . ASP A 1 113 ? -18.787 35.418 212.176 1.00 135.08 ? 132 ASP A CA     1 
ATOM   1252  C  C      . ASP A 1 113 ? -17.883 35.066 213.350 1.00 129.93 ? 132 ASP A C      1 
ATOM   1253  O  O      . ASP A 1 113 ? -17.696 33.876 213.628 1.00 165.83 ? 132 ASP A O      1 
ATOM   1254  C  CB     . ASP A 1 113 ? -18.176 34.897 210.873 1.00 40.33  ? 132 ASP A CB     1 
ATOM   1255  H  H      . ASP A 1 113 ? -18.759 37.208 211.339 1.00 154.65 ? 132 ASP A H      1 
ATOM   1256  H  HA     . ASP A 1 113 ? -19.636 34.968 212.308 1.00 162.10 ? 132 ASP A HA     1 
ATOM   1257  N  N      . ALA A 1 114 ? -17.321 36.065 214.039 1.00 118.29 ? 133 ALA A N      1 
ATOM   1258  C  CA     . ALA A 1 114 ? -16.499 35.846 215.228 1.00 94.47  ? 133 ALA A CA     1 
ATOM   1259  C  C      . ALA A 1 114 ? -15.222 35.088 214.863 1.00 91.91  ? 133 ALA A C      1 
ATOM   1260  O  O      . ALA A 1 114 ? -14.858 34.095 215.494 1.00 130.68 ? 133 ALA A O      1 
ATOM   1261  C  CB     . ALA A 1 114 ? -17.283 35.118 216.323 1.00 137.84 ? 133 ALA A CB     1 
ATOM   1262  H  H      . ALA A 1 114 ? -17.405 36.895 213.830 1.00 141.94 ? 133 ALA A H      1 
ATOM   1263  H  HA     . ALA A 1 114 ? -16.235 36.709 215.583 1.00 113.36 ? 133 ALA A HA     1 
ATOM   1264  H  HB1    . ALA A 1 114 ? -16.706 34.992 217.093 1.00 165.41 ? 133 ALA A HB1    1 
ATOM   1265  H  HB2    . ALA A 1 114 ? -18.052 35.655 216.570 1.00 165.41 ? 133 ALA A HB2    1 
ATOM   1266  H  HB3    . ALA A 1 114 ? -17.575 34.258 215.983 1.00 165.41 ? 133 ALA A HB3    1 
ATOM   1267  N  N      . LEU A 1 115 ? -14.543 35.573 213.827 1.00 92.06  ? 134 LEU A N      1 
ATOM   1268  C  CA     . LEU A 1 115 ? -13.316 34.976 213.326 1.00 97.99  ? 134 LEU A CA     1 
ATOM   1269  C  C      . LEU A 1 115 ? -12.269 36.066 213.181 1.00 72.63  ? 134 LEU A C      1 
ATOM   1270  O  O      . LEU A 1 115 ? -12.533 37.101 212.559 1.00 78.94  ? 134 LEU A O      1 
ATOM   1271  C  CB     . LEU A 1 115 ? -13.555 34.281 211.984 1.00 95.69  ? 134 LEU A CB     1 
ATOM   1272  C  CG     . LEU A 1 115 ? -13.734 32.767 212.077 1.00 136.26 ? 134 LEU A CG     1 
ATOM   1273  C  CD1    . LEU A 1 115 ? -14.287 32.177 210.791 1.00 153.02 ? 134 LEU A CD1    1 
ATOM   1274  C  CD2    . LEU A 1 115 ? -12.400 32.145 212.394 1.00 117.89 ? 134 LEU A CD2    1 
ATOM   1275  H  H      . LEU A 1 115 ? -14.786 36.270 213.385 1.00 110.47 ? 134 LEU A H      1 
ATOM   1276  H  HA     . LEU A 1 115 ? -12.991 34.318 213.961 1.00 117.59 ? 134 LEU A HA     1 
ATOM   1277  H  HB2    . LEU A 1 115 ? -14.358 34.648 211.583 1.00 114.83 ? 134 LEU A HB2    1 
ATOM   1278  H  HB3    . LEU A 1 115 ? -12.794 34.452 211.406 1.00 114.83 ? 134 LEU A HB3    1 
ATOM   1279  H  HG     . LEU A 1 115 ? -14.348 32.558 212.799 1.00 163.52 ? 134 LEU A HG     1 
ATOM   1280  H  HD11   . LEU A 1 115 ? -14.382 31.218 210.899 1.00 183.62 ? 134 LEU A HD11   1 
ATOM   1281  H  HD12   . LEU A 1 115 ? -15.151 32.577 210.607 1.00 183.62 ? 134 LEU A HD12   1 
ATOM   1282  H  HD13   . LEU A 1 115 ? -13.671 32.369 210.066 1.00 183.62 ? 134 LEU A HD13   1 
ATOM   1283  H  HD21   . LEU A 1 115 ? -12.507 31.183 212.455 1.00 141.46 ? 134 LEU A HD21   1 
ATOM   1284  H  HD22   . LEU A 1 115 ? -11.774 32.365 211.687 1.00 141.46 ? 134 LEU A HD22   1 
ATOM   1285  H  HD23   . LEU A 1 115 ? -12.082 32.497 213.240 1.00 141.46 ? 134 LEU A HD23   1 
ATOM   1286  N  N      . VAL A 1 116 ? -11.087 35.844 213.757 1.00 69.65  ? 135 VAL A N      1 
ATOM   1287  C  CA     . VAL A 1 116 ? -10.063 36.879 213.761 1.00 80.32  ? 135 VAL A CA     1 
ATOM   1288  C  C      . VAL A 1 116 ? -9.685  37.196 212.321 1.00 79.11  ? 135 VAL A C      1 
ATOM   1289  O  O      . VAL A 1 116 ? -8.906  36.469 211.690 1.00 63.52  ? 135 VAL A O      1 
ATOM   1290  C  CB     . VAL A 1 116 ? -8.816  36.475 214.568 1.00 63.76  ? 135 VAL A CB     1 
ATOM   1291  C  CG1    . VAL A 1 116 ? -7.866  37.663 214.644 1.00 101.74 ? 135 VAL A CG1    1 
ATOM   1292  C  CG2    . VAL A 1 116 ? -9.196  36.023 215.966 1.00 79.41  ? 135 VAL A CG2    1 
ATOM   1293  H  H      . VAL A 1 116 ? -10.859 35.112 214.147 1.00 83.58  ? 135 VAL A H      1 
ATOM   1294  H  HA     . VAL A 1 116 ? -10.429 37.684 214.159 1.00 96.38  ? 135 VAL A HA     1 
ATOM   1295  H  HB     . VAL A 1 116 ? -8.362  35.744 214.120 1.00 76.51  ? 135 VAL A HB     1 
ATOM   1296  H  HG11   . VAL A 1 116 ? -7.081  37.406 215.154 1.00 122.09 ? 135 VAL A HG11   1 
ATOM   1297  H  HG12   . VAL A 1 116 ? -7.609  37.918 213.745 1.00 122.09 ? 135 VAL A HG12   1 
ATOM   1298  H  HG13   . VAL A 1 116 ? -8.319  38.401 215.082 1.00 122.09 ? 135 VAL A HG13   1 
ATOM   1299  H  HG21   . VAL A 1 116 ? -8.391  35.776 216.447 1.00 95.29  ? 135 VAL A HG21   1 
ATOM   1300  H  HG22   . VAL A 1 116 ? -9.644  36.752 216.422 1.00 95.29  ? 135 VAL A HG22   1 
ATOM   1301  H  HG23   . VAL A 1 116 ? -9.790  35.259 215.900 1.00 95.29  ? 135 VAL A HG23   1 
ATOM   1302  N  N      . PHE A 1 117 ? -10.241 38.284 211.788 1.00 101.30 ? 136 PHE A N      1 
ATOM   1303  C  CA     . PHE A 1 117 ? -9.756  38.794 210.515 1.00 84.51  ? 136 PHE A CA     1 
ATOM   1304  C  C      . PHE A 1 117 ? -8.283  39.161 210.601 1.00 81.66  ? 136 PHE A C      1 
ATOM   1305  O  O      . PHE A 1 117 ? -7.540  38.971 209.631 1.00 71.08  ? 136 PHE A O      1 
ATOM   1306  C  CB     . PHE A 1 117 ? -10.594 39.998 210.095 1.00 113.88 ? 136 PHE A CB     1 
ATOM   1307  C  CG     . PHE A 1 117 ? -10.285 40.500 208.721 1.00 113.37 ? 136 PHE A CG     1 
ATOM   1308  C  CD1    . PHE A 1 117 ? -10.591 39.738 207.612 1.00 105.06 ? 136 PHE A CD1    1 
ATOM   1309  C  CD2    . PHE A 1 117 ? -9.709  41.742 208.539 1.00 84.59  ? 136 PHE A CD2    1 
ATOM   1310  C  CE1    . PHE A 1 117 ? -10.316 40.195 206.350 1.00 149.22 ? 136 PHE A CE1    1 
ATOM   1311  C  CE2    . PHE A 1 117 ? -9.431  42.207 207.280 1.00 74.59  ? 136 PHE A CE2    1 
ATOM   1312  C  CZ     . PHE A 1 117 ? -9.738  41.432 206.181 1.00 124.67 ? 136 PHE A CZ     1 
ATOM   1313  H  H      . PHE A 1 117 ? -10.885 38.733 212.137 1.00 121.56 ? 136 PHE A H      1 
ATOM   1314  H  HA     . PHE A 1 117 ? -9.856  38.107 209.838 1.00 101.41 ? 136 PHE A HA     1 
ATOM   1315  H  HB2    . PHE A 1 117 ? -11.531 39.748 210.115 1.00 136.66 ? 136 PHE A HB2    1 
ATOM   1316  H  HB3    . PHE A 1 117 ? -10.433 40.723 210.718 1.00 136.66 ? 136 PHE A HB3    1 
ATOM   1317  H  HD1    . PHE A 1 117 ? -10.982 38.901 207.723 1.00 126.08 ? 136 PHE A HD1    1 
ATOM   1318  H  HD2    . PHE A 1 117 ? -9.501  42.266 209.279 1.00 101.51 ? 136 PHE A HD2    1 
ATOM   1319  H  HE1    . PHE A 1 117 ? -10.523 39.672 205.609 1.00 179.07 ? 136 PHE A HE1    1 
ATOM   1320  H  HE2    . PHE A 1 117 ? -9.039  43.043 207.167 1.00 89.51  ? 136 PHE A HE2    1 
ATOM   1321  H  HZ     . PHE A 1 117 ? -9.550  41.745 205.325 1.00 149.60 ? 136 PHE A HZ     1 
ATOM   1322  N  N      . TYR A 1 118 ? -7.833  39.663 211.751 1.00 82.51  ? 137 TYR A N      1 
ATOM   1323  C  CA     . TYR A 1 118 ? -6.439  40.063 211.871 1.00 60.29  ? 137 TYR A CA     1 
ATOM   1324  C  C      . TYR A 1 118 ? -6.008  40.039 213.327 1.00 67.51  ? 137 TYR A C      1 
ATOM   1325  O  O      . TYR A 1 118 ? -6.762  40.448 214.212 1.00 67.74  ? 137 TYR A O      1 
ATOM   1326  C  CB     . TYR A 1 118 ? -6.204  41.461 211.293 1.00 55.00  ? 137 TYR A CB     1 
ATOM   1327  C  CG     . TYR A 1 118 ? -4.791  41.967 211.482 1.00 45.49  ? 137 TYR A CG     1 
ATOM   1328  C  CD1    . TYR A 1 118 ? -3.704  41.238 211.020 1.00 89.16  ? 137 TYR A CD1    1 
ATOM   1329  C  CD2    . TYR A 1 118 ? -4.542  43.177 212.111 1.00 61.92  ? 137 TYR A CD2    1 
ATOM   1330  C  CE1    . TYR A 1 118 ? -2.408  41.697 211.186 1.00 89.53  ? 137 TYR A CE1    1 
ATOM   1331  C  CE2    . TYR A 1 118 ? -3.246  43.646 212.279 1.00 60.19  ? 137 TYR A CE2    1 
ATOM   1332  C  CZ     . TYR A 1 118 ? -2.184  42.901 211.814 1.00 60.21  ? 137 TYR A CZ     1 
ATOM   1333  O  OH     . TYR A 1 118 ? -0.893  43.352 211.973 1.00 62.07  ? 137 TYR A OH     1 
ATOM   1334  H  H      . TYR A 1 118 ? -8.306  39.779 212.460 1.00 99.02  ? 137 TYR A H      1 
ATOM   1335  H  HA     . TYR A 1 118 ? -5.884  39.436 211.381 1.00 72.35  ? 137 TYR A HA     1 
ATOM   1336  H  HB2    . TYR A 1 118 ? -6.388  41.440 210.341 1.00 66.01  ? 137 TYR A HB2    1 
ATOM   1337  H  HB3    . TYR A 1 118 ? -6.804  42.085 211.731 1.00 66.01  ? 137 TYR A HB3    1 
ATOM   1338  H  HD1    . TYR A 1 118 ? -3.848  40.424 210.594 1.00 106.99 ? 137 TYR A HD1    1 
ATOM   1339  H  HD2    . TYR A 1 118 ? -5.256  43.684 212.426 1.00 74.31  ? 137 TYR A HD2    1 
ATOM   1340  H  HE1    . TYR A 1 118 ? -1.691  41.195 210.871 1.00 107.44 ? 137 TYR A HE1    1 
ATOM   1341  H  HE2    . TYR A 1 118 ? -3.095  44.459 212.705 1.00 72.23  ? 137 TYR A HE2    1 
ATOM   1342  H  HH     . TYR A 1 118 ? -0.894  44.094 212.368 1.00 74.48  ? 137 TYR A HH     1 
ATOM   1343  N  N      . ALA A 1 119 ? -4.786  39.561 213.553 1.00 71.84  ? 138 ALA A N      1 
ATOM   1344  C  CA     . ALA A 1 119 ? -4.130  39.631 214.852 1.00 43.10  ? 138 ALA A CA     1 
ATOM   1345  C  C      . ALA A 1 119 ? -2.683  40.021 214.606 1.00 67.27  ? 138 ALA A C      1 
ATOM   1346  O  O      . ALA A 1 119 ? -1.947  39.286 213.940 1.00 86.19  ? 138 ALA A O      1 
ATOM   1347  C  CB     . ALA A 1 119 ? -4.217  38.297 215.600 1.00 50.15  ? 138 ALA A CB     1 
ATOM   1348  H  H      . ALA A 1 119 ? -4.305  39.182 212.949 1.00 86.21  ? 138 ALA A H      1 
ATOM   1349  H  HA     . ALA A 1 119 ? -4.549  40.318 215.393 1.00 51.72  ? 138 ALA A HA     1 
ATOM   1350  H  HB1    . ALA A 1 119 ? -3.770  38.386 216.456 1.00 60.18  ? 138 ALA A HB1    1 
ATOM   1351  H  HB2    . ALA A 1 119 ? -5.150  38.072 215.736 1.00 60.18  ? 138 ALA A HB2    1 
ATOM   1352  H  HB3    . ALA A 1 119 ? -3.784  37.610 215.070 1.00 60.18  ? 138 ALA A HB3    1 
ATOM   1353  N  N      . SER A 1 120 ? -2.281  41.178 215.121 1.00 54.27  ? 139 SER A N      1 
ATOM   1354  C  CA     . SER A 1 120 ? -0.950  41.685 214.835 1.00 73.62  ? 139 SER A CA     1 
ATOM   1355  C  C      . SER A 1 120 ? 0.115   40.752 215.405 1.00 62.79  ? 139 SER A C      1 
ATOM   1356  O  O      . SER A 1 120 ? -0.131  39.958 216.315 1.00 58.60  ? 139 SER A O      1 
ATOM   1357  C  CB     . SER A 1 120 ? -0.780  43.091 215.405 1.00 60.43  ? 139 SER A CB     1 
ATOM   1358  O  OG     . SER A 1 120 ? -1.065  43.113 216.789 1.00 74.28  ? 139 SER A OG     1 
ATOM   1359  H  H      . SER A 1 120 ? -2.756  41.681 215.632 1.00 65.12  ? 139 SER A H      1 
ATOM   1360  H  HA     . SER A 1 120 ? -0.827  41.732 213.874 1.00 88.35  ? 139 SER A HA     1 
ATOM   1361  H  HB2    . SER A 1 120 ? 0.136   43.379 215.267 1.00 72.51  ? 139 SER A HB2    1 
ATOM   1362  H  HB3    . SER A 1 120 ? -1.389  43.692 214.948 1.00 72.51  ? 139 SER A HB3    1 
ATOM   1363  H  HG     . SER A 1 120 ? -0.544  42.596 217.198 1.00 89.13  ? 139 SER A HG     1 
ATOM   1364  N  N      . SER A 1 121 ? 1.318   40.854 214.838 1.00 84.52  ? 140 SER A N      1 
ATOM   1365  C  CA     . SER A 1 121 ? 2.432   40.022 215.280 1.00 53.46  ? 140 SER A CA     1 
ATOM   1366  C  C      . SER A 1 121 ? 2.638   40.100 216.785 1.00 88.24  ? 140 SER A C      1 
ATOM   1367  O  O      . SER A 1 121 ? 3.036   39.110 217.410 1.00 106.61 ? 140 SER A O      1 
ATOM   1368  C  CB     . SER A 1 121 ? 3.712   40.449 214.559 1.00 41.05  ? 140 SER A CB     1 
ATOM   1369  O  OG     . SER A 1 121 ? 4.854   39.850 215.146 1.00 72.49  ? 140 SER A OG     1 
ATOM   1370  H  H      . SER A 1 121 ? 1.513   41.395 214.199 1.00 101.43 ? 140 SER A H      1 
ATOM   1371  H  HA     . SER A 1 121 ? 2.249   39.098 215.048 1.00 64.15  ? 140 SER A HA     1 
ATOM   1372  H  HB2    . SER A 1 121 ? 3.656   40.177 213.630 1.00 49.26  ? 140 SER A HB2    1 
ATOM   1373  H  HB3    . SER A 1 121 ? 3.798   41.414 214.616 1.00 49.26  ? 140 SER A HB3    1 
ATOM   1374  H  HG     . SER A 1 121 ? 5.547   40.094 214.739 1.00 86.98  ? 140 SER A HG     1 
ATOM   1375  N  N      . THR A 1 122 ? 2.379   41.261 217.383 1.00 51.02  ? 141 THR A N      1 
ATOM   1376  C  CA     . THR A 1 122 ? 2.649   41.458 218.800 1.00 56.26  ? 141 THR A CA     1 
ATOM   1377  C  C      . THR A 1 122 ? 1.734   40.642 219.709 1.00 49.60  ? 141 THR A C      1 
ATOM   1378  O  O      . THR A 1 122 ? 1.936   40.661 220.929 1.00 74.38  ? 141 THR A O      1 
ATOM   1379  C  CB     . THR A 1 122 ? 2.537   42.946 219.144 1.00 80.14  ? 141 THR A CB     1 
ATOM   1380  O  OG1    . THR A 1 122 ? 1.356   43.499 218.549 1.00 78.18  ? 141 THR A OG1    1 
ATOM   1381  C  CG2    . THR A 1 122 ? 3.751   43.691 218.633 1.00 57.98  ? 141 THR A CG2    1 
ATOM   1382  H  H      . THR A 1 122 ? 2.046   41.949 216.988 1.00 61.22  ? 141 THR A H      1 
ATOM   1383  H  HA     . THR A 1 122 ? 3.561   41.183 218.981 1.00 67.51  ? 141 THR A HA     1 
ATOM   1384  H  HB     . THR A 1 122 ? 2.494   43.053 220.107 1.00 96.16  ? 141 THR A HB     1 
ATOM   1385  H  HG1    . THR A 1 122 ? 1.294   44.316 218.738 1.00 93.81  ? 141 THR A HG1    1 
ATOM   1386  H  HG21   . THR A 1 122 ? 3.678   44.633 218.852 1.00 69.57  ? 141 THR A HG21   1 
ATOM   1387  H  HG22   . THR A 1 122 ? 4.555   43.334 219.041 1.00 69.57  ? 141 THR A HG22   1 
ATOM   1388  H  HG23   . THR A 1 122 ? 3.817   43.595 217.670 1.00 69.57  ? 141 THR A HG23   1 
ATOM   1389  N  N      . ILE A 1 123 ? 0.740   39.933 219.167 1.00 31.35  ? 142 ILE A N      1 
ATOM   1390  C  CA     . ILE A 1 123 ? -0.079  39.065 220.007 1.00 56.76  ? 142 ILE A CA     1 
ATOM   1391  C  C      . ILE A 1 123 ? 0.796   38.043 220.713 1.00 29.76  ? 142 ILE A C      1 
ATOM   1392  O  O      . ILE A 1 123 ? 0.517   37.646 221.850 1.00 47.75  ? 142 ILE A O      1 
ATOM   1393  C  CB     . ILE A 1 123 ? -1.177  38.376 219.173 1.00 42.70  ? 142 ILE A CB     1 
ATOM   1394  C  CG1    . ILE A 1 123 ? -2.085  37.553 220.085 1.00 40.75  ? 142 ILE A CG1    1 
ATOM   1395  C  CG2    . ILE A 1 123 ? -0.561  37.462 218.120 1.00 76.72  ? 142 ILE A CG2    1 
ATOM   1396  C  CD1    . ILE A 1 123 ? -3.373  37.113 219.442 1.00 57.25  ? 142 ILE A CD1    1 
ATOM   1397  H  H      . ILE A 1 123 ? 0.526   39.937 218.334 1.00 37.62  ? 142 ILE A H      1 
ATOM   1398  H  HA     . ILE A 1 123 ? -0.515  39.605 220.686 1.00 68.11  ? 142 ILE A HA     1 
ATOM   1399  H  HB     . ILE A 1 123 ? -1.709  39.055 218.728 1.00 51.25  ? 142 ILE A HB     1 
ATOM   1400  H  HG12   . ILE A 1 123 ? -1.607  36.756 220.362 1.00 48.90  ? 142 ILE A HG12   1 
ATOM   1401  H  HG13   . ILE A 1 123 ? -2.311  38.087 220.863 1.00 48.90  ? 142 ILE A HG13   1 
ATOM   1402  H  HG21   . ILE A 1 123 ? -1.272  37.043 217.611 1.00 92.07  ? 142 ILE A HG21   1 
ATOM   1403  H  HG22   . ILE A 1 123 ? -0.000  37.992 217.531 1.00 92.07  ? 142 ILE A HG22   1 
ATOM   1404  H  HG23   . ILE A 1 123 ? -0.027  36.785 218.564 1.00 92.07  ? 142 ILE A HG23   1 
ATOM   1405  H  HD11   . ILE A 1 123 ? -3.887  36.600 220.085 1.00 68.70  ? 142 ILE A HD11   1 
ATOM   1406  H  HD12   . ILE A 1 123 ? -3.873  37.898 219.169 1.00 68.70  ? 142 ILE A HD12   1 
ATOM   1407  H  HD13   . ILE A 1 123 ? -3.168  36.565 218.668 1.00 68.70  ? 142 ILE A HD13   1 
ATOM   1408  N  N      . GLN A 1 124 ? 1.859   37.595 220.052 1.00 60.62  ? 143 GLN A N      1 
ATOM   1409  C  CA     . GLN A 1 124 ? 2.789   36.670 220.682 1.00 66.13  ? 143 GLN A CA     1 
ATOM   1410  C  C      . GLN A 1 124 ? 3.448   37.299 221.899 1.00 38.40  ? 143 GLN A C      1 
ATOM   1411  O  O      . GLN A 1 124 ? 3.686   36.615 222.899 1.00 51.64  ? 143 GLN A O      1 
ATOM   1412  C  CB     . GLN A 1 124 ? 3.838   36.239 219.657 1.00 61.34  ? 143 GLN A CB     1 
ATOM   1413  C  CG     . GLN A 1 124 ? 4.797   35.175 220.127 1.00 60.90  ? 143 GLN A CG     1 
ATOM   1414  C  CD     . GLN A 1 124 ? 6.073   35.159 219.308 1.00 102.00 ? 143 GLN A CD     1 
ATOM   1415  O  OE1    . GLN A 1 124 ? 6.406   34.156 218.677 1.00 74.05  ? 143 GLN A OE1    1 
ATOM   1416  N  NE2    . GLN A 1 124 ? 6.798   36.274 219.317 1.00 98.08  ? 143 GLN A NE2    1 
ATOM   1417  H  H      . GLN A 1 124 ? 2.062   37.809 219.244 1.00 72.74  ? 143 GLN A H      1 
ATOM   1418  H  HA     . GLN A 1 124 ? 2.307   35.880 220.972 1.00 79.35  ? 143 GLN A HA     1 
ATOM   1419  H  HB2    . GLN A 1 124 ? 3.380   35.895 218.875 1.00 73.60  ? 143 GLN A HB2    1 
ATOM   1420  H  HB3    . GLN A 1 124 ? 4.363   37.016 219.410 1.00 73.60  ? 143 GLN A HB3    1 
ATOM   1421  H  HG2    . GLN A 1 124 ? 5.034   35.344 221.052 1.00 73.08  ? 143 GLN A HG2    1 
ATOM   1422  H  HG3    . GLN A 1 124 ? 4.374   34.306 220.044 1.00 73.08  ? 143 GLN A HG3    1 
ATOM   1423  H  HE21   . GLN A 1 124 ? 6.534   36.954 219.772 1.00 117.69 ? 143 GLN A HE21   1 
ATOM   1424  H  HE22   . GLN A 1 124 ? 7.530   36.314 218.868 1.00 117.69 ? 143 GLN A HE22   1 
ATOM   1425  N  N      . ASP A 1 125 ? 3.723   38.605 221.843 1.00 76.14  ? 144 ASP A N      1 
ATOM   1426  C  CA     . ASP A 1 125 ? 4.494   39.260 222.894 1.00 95.05  ? 144 ASP A CA     1 
ATOM   1427  C  C      . ASP A 1 125 ? 3.723   39.387 224.202 1.00 69.79  ? 144 ASP A C      1 
ATOM   1428  O  O      . ASP A 1 125 ? 4.347   39.508 225.262 1.00 86.05  ? 144 ASP A O      1 
ATOM   1429  C  CB     . ASP A 1 125 ? 4.944   40.645 222.426 1.00 51.77  ? 144 ASP A CB     1 
ATOM   1430  C  CG     . ASP A 1 125 ? 5.882   40.583 221.230 1.00 74.48  ? 144 ASP A CG     1 
ATOM   1431  O  OD1    . ASP A 1 125 ? 6.117   39.468 220.715 1.00 92.57  ? 144 ASP A OD1    1 
ATOM   1432  O  OD2    . ASP A 1 125 ? 6.388   41.646 220.810 1.00 87.91  ? 144 ASP A OD2    1 
ATOM   1433  H  H      . ASP A 1 125 ? 3.474   39.129 221.208 1.00 91.37  ? 144 ASP A H      1 
ATOM   1434  H  HA     . ASP A 1 125 ? 5.290   38.734 223.070 1.00 114.06 ? 144 ASP A HA     1 
ATOM   1435  H  HB2    . ASP A 1 125 ? 4.164   41.161 222.169 1.00 62.13  ? 144 ASP A HB2    1 
ATOM   1436  H  HB3    . ASP A 1 125 ? 5.411   41.088 223.151 1.00 62.13  ? 144 ASP A HB3    1 
ATOM   1437  N  N      . TYR A 1 126 ? 2.390   39.364 224.156 1.00 56.00  ? 145 TYR A N      1 
ATOM   1438  C  CA     . TYR A 1 126 ? 1.577   39.522 225.353 1.00 42.23  ? 145 TYR A CA     1 
ATOM   1439  C  C      . TYR A 1 126 ? 0.735   38.299 225.702 1.00 41.11  ? 145 TYR A C      1 
ATOM   1440  O  O      . TYR A 1 126 ? 0.370   38.146 226.875 1.00 101.60 ? 145 TYR A O      1 
ATOM   1441  C  CB     . TYR A 1 126 ? 0.647   40.741 225.210 1.00 44.88  ? 145 TYR A CB     1 
ATOM   1442  C  CG     . TYR A 1 126 ? 1.379   42.067 225.084 1.00 70.04  ? 145 TYR A CG     1 
ATOM   1443  C  CD1    . TYR A 1 126 ? 1.984   42.661 226.185 1.00 93.65  ? 145 TYR A CD1    1 
ATOM   1444  C  CD2    . TYR A 1 126 ? 1.457   42.725 223.866 1.00 69.16  ? 145 TYR A CD2    1 
ATOM   1445  C  CE1    . TYR A 1 126 ? 2.653   43.867 226.072 1.00 101.84 ? 145 TYR A CE1    1 
ATOM   1446  C  CE2    . TYR A 1 126 ? 2.126   43.933 223.745 1.00 52.73  ? 145 TYR A CE2    1 
ATOM   1447  C  CZ     . TYR A 1 126 ? 2.719   44.498 224.848 1.00 64.88  ? 145 TYR A CZ     1 
ATOM   1448  O  OH     . TYR A 1 126 ? 3.381   45.700 224.721 1.00 68.43  ? 145 TYR A OH     1 
ATOM   1449  H  H      . TYR A 1 126 ? 1.933   39.258 223.436 1.00 67.20  ? 145 TYR A H      1 
ATOM   1450  H  HA     . TYR A 1 126 ? 2.167   39.692 226.103 1.00 50.68  ? 145 TYR A HA     1 
ATOM   1451  H  HB2    . TYR A 1 126 ? 0.103   40.627 224.415 1.00 53.86  ? 145 TYR A HB2    1 
ATOM   1452  H  HB3    . TYR A 1 126 ? 0.077   40.792 225.993 1.00 53.86  ? 145 TYR A HB3    1 
ATOM   1453  H  HD1    . TYR A 1 126 ? 1.944   42.237 227.012 1.00 112.38 ? 145 TYR A HD1    1 
ATOM   1454  H  HD2    . TYR A 1 126 ? 1.059   42.345 223.116 1.00 82.99  ? 145 TYR A HD2    1 
ATOM   1455  H  HE1    . TYR A 1 126 ? 3.055   44.250 226.818 1.00 122.21 ? 145 TYR A HE1    1 
ATOM   1456  H  HE2    . TYR A 1 126 ? 2.171   44.360 222.920 1.00 63.28  ? 145 TYR A HE2    1 
ATOM   1457  H  HH     . TYR A 1 126 ? 3.342   45.967 223.926 1.00 82.12  ? 145 TYR A HH     1 
ATOM   1458  N  N      . LEU A 1 127 ? 0.427   37.426 224.741 1.00 55.74  ? 146 LEU A N      1 
ATOM   1459  C  CA     . LEU A 1 127 ? -0.362  36.230 225.006 1.00 53.84  ? 146 LEU A CA     1 
ATOM   1460  C  C      . LEU A 1 127 ? 0.351   34.936 224.646 1.00 66.60  ? 146 LEU A C      1 
ATOM   1461  O  O      . LEU A 1 127 ? -0.209  33.856 224.874 1.00 64.33  ? 146 LEU A O      1 
ATOM   1462  C  CB     . LEU A 1 127 ? -1.687  36.283 224.238 1.00 44.85  ? 146 LEU A CB     1 
ATOM   1463  C  CG     . LEU A 1 127 ? -2.672  37.389 224.598 1.00 44.69  ? 146 LEU A CG     1 
ATOM   1464  C  CD1    . LEU A 1 127 ? -3.930  37.209 223.754 1.00 56.86  ? 146 LEU A CD1    1 
ATOM   1465  C  CD2    . LEU A 1 127 ? -3.000  37.374 226.090 1.00 75.73  ? 146 LEU A CD2    1 
ATOM   1466  H  H      . LEU A 1 127 ? 0.667   37.508 223.919 1.00 66.88  ? 146 LEU A H      1 
ATOM   1467  H  HA     . LEU A 1 127 ? -0.570  36.199 225.953 1.00 64.60  ? 146 LEU A HA     1 
ATOM   1468  H  HB2    . LEU A 1 127 ? -1.482  36.382 223.295 1.00 53.82  ? 146 LEU A HB2    1 
ATOM   1469  H  HB3    . LEU A 1 127 ? -2.146  35.440 224.376 1.00 53.82  ? 146 LEU A HB3    1 
ATOM   1470  H  HG     . LEU A 1 127 ? -2.280  38.250 224.381 1.00 53.63  ? 146 LEU A HG     1 
ATOM   1471  H  HD11   . LEU A 1 127 ? -4.563  37.909 223.977 1.00 68.24  ? 146 LEU A HD11   1 
ATOM   1472  H  HD12   . LEU A 1 127 ? -3.691  37.264 222.815 1.00 68.24  ? 146 LEU A HD12   1 
ATOM   1473  H  HD13   . LEU A 1 127 ? -4.317  36.340 223.946 1.00 68.24  ? 146 LEU A HD13   1 
ATOM   1474  H  HD21   . LEU A 1 127 ? -3.627  38.088 226.283 1.00 90.88  ? 146 LEU A HD21   1 
ATOM   1475  H  HD22   . LEU A 1 127 ? -3.394  36.517 226.317 1.00 90.88  ? 146 LEU A HD22   1 
ATOM   1476  H  HD23   . LEU A 1 127 ? -2.182  37.506 226.594 1.00 90.88  ? 146 LEU A HD23   1 
ATOM   1477  N  N      . GLY A 1 128 ? 1.555   35.001 224.086 1.00 37.69  ? 147 GLY A N      1 
ATOM   1478  C  CA     . GLY A 1 128 ? 2.247   33.781 223.725 1.00 69.79  ? 147 GLY A CA     1 
ATOM   1479  C  C      . GLY A 1 128 ? 1.616   32.997 222.598 1.00 62.71  ? 147 GLY A C      1 
ATOM   1480  O  O      . GLY A 1 128 ? 1.928   31.814 222.440 1.00 101.33 ? 147 GLY A O      1 
ATOM   1481  H  H      . GLY A 1 128 ? 1.982   35.726 223.910 1.00 45.23  ? 147 GLY A H      1 
ATOM   1482  H  HA2    . GLY A 1 128 ? 3.155   34.000 223.464 1.00 83.75  ? 147 GLY A HA2    1 
ATOM   1483  H  HA3    . GLY A 1 128 ? 2.291   33.202 224.502 1.00 83.75  ? 147 GLY A HA3    1 
ATOM   1484  N  N      . PHE A 1 129 ? 0.727   33.609 221.821 1.00 79.14  ? 148 PHE A N      1 
ATOM   1485  C  CA     . PHE A 1 129 ? 0.182   32.995 220.619 1.00 47.21  ? 148 PHE A CA     1 
ATOM   1486  C  C      . PHE A 1 129 ? 0.872   33.569 219.390 1.00 70.85  ? 148 PHE A C      1 
ATOM   1487  O  O      . PHE A 1 129 ? 1.104   34.778 219.302 1.00 85.67  ? 148 PHE A O      1 
ATOM   1488  C  CB     . PHE A 1 129 ? -1.326  33.227 220.507 1.00 75.93  ? 148 PHE A CB     1 
ATOM   1489  C  CG     . PHE A 1 129 ? -2.155  32.268 221.312 1.00 47.10  ? 148 PHE A CG     1 
ATOM   1490  C  CD1    . PHE A 1 129 ? -2.091  30.908 221.073 1.00 48.70  ? 148 PHE A CD1    1 
ATOM   1491  C  CD2    . PHE A 1 129 ? -3.020  32.730 222.291 1.00 85.47  ? 148 PHE A CD2    1 
ATOM   1492  C  CE1    . PHE A 1 129 ? -2.858  30.024 221.807 1.00 90.47  ? 148 PHE A CE1    1 
ATOM   1493  C  CE2    . PHE A 1 129 ? -3.794  31.850 223.027 1.00 51.31  ? 148 PHE A CE2    1 
ATOM   1494  C  CZ     . PHE A 1 129 ? -3.713  30.495 222.782 1.00 58.47  ? 148 PHE A CZ     1 
ATOM   1495  H  H      . PHE A 1 129 ? 0.418   34.397 221.974 1.00 94.97  ? 148 PHE A H      1 
ATOM   1496  H  HA     . PHE A 1 129 ? 0.345   32.039 220.643 1.00 56.65  ? 148 PHE A HA     1 
ATOM   1497  H  HB2    . PHE A 1 129 ? -1.527  34.124 220.817 1.00 91.11  ? 148 PHE A HB2    1 
ATOM   1498  H  HB3    . PHE A 1 129 ? -1.587  33.135 219.577 1.00 91.11  ? 148 PHE A HB3    1 
ATOM   1499  H  HD1    . PHE A 1 129 ? -1.517  30.584 220.417 1.00 58.44  ? 148 PHE A HD1    1 
ATOM   1500  H  HD2    . PHE A 1 129 ? -3.078  33.643 222.459 1.00 102.56 ? 148 PHE A HD2    1 
ATOM   1501  H  HE1    . PHE A 1 129 ? -2.802  29.110 221.639 1.00 108.56 ? 148 PHE A HE1    1 
ATOM   1502  H  HE2    . PHE A 1 129 ? -4.367  32.171 223.685 1.00 61.57  ? 148 PHE A HE2    1 
ATOM   1503  H  HZ     . PHE A 1 129 ? -4.230  29.900 223.276 1.00 70.17  ? 148 PHE A HZ     1 
ATOM   1504  N  N      . GLN A 1 130 ? 1.200   32.696 218.444 1.00 75.11  ? 149 GLN A N      1 
ATOM   1505  C  CA     . GLN A 1 130 ? 1.742   33.132 217.166 1.00 80.47  ? 149 GLN A CA     1 
ATOM   1506  C  C      . GLN A 1 130 ? 0.592   33.511 216.238 1.00 55.11  ? 149 GLN A C      1 
ATOM   1507  O  O      . GLN A 1 130 ? -0.327  32.714 216.021 1.00 101.55 ? 149 GLN A O      1 
ATOM   1508  C  CB     . GLN A 1 130 ? 2.604   32.023 216.554 1.00 57.92  ? 149 GLN A CB     1 
ATOM   1509  C  CG     . GLN A 1 130 ? 3.149   32.311 215.152 1.00 124.44 ? 149 GLN A CG     1 
ATOM   1510  C  CD     . GLN A 1 130 ? 4.055   33.529 215.091 1.00 128.47 ? 149 GLN A CD     1 
ATOM   1511  O  OE1    . GLN A 1 130 ? 3.953   34.347 214.175 1.00 108.74 ? 149 GLN A OE1    1 
ATOM   1512  N  NE2    . GLN A 1 130 ? 4.962   33.644 216.057 1.00 127.23 ? 149 GLN A NE2    1 
ATOM   1513  H  H      . GLN A 1 130 ? 1.118   31.843 218.519 1.00 90.13  ? 149 GLN A H      1 
ATOM   1514  H  HA     . GLN A 1 130 ? 2.299   33.915 217.302 1.00 96.56  ? 149 GLN A HA     1 
ATOM   1515  H  HB2    . GLN A 1 130 ? 3.365   31.870 217.136 1.00 69.51  ? 149 GLN A HB2    1 
ATOM   1516  H  HB3    . GLN A 1 130 ? 2.071   31.215 216.499 1.00 69.51  ? 149 GLN A HB3    1 
ATOM   1517  H  HG2    . GLN A 1 130 ? 3.660   31.544 214.851 1.00 149.33 ? 149 GLN A HG2    1 
ATOM   1518  H  HG3    . GLN A 1 130 ? 2.402   32.466 214.552 1.00 149.33 ? 149 GLN A HG3    1 
ATOM   1519  H  HE21   . GLN A 1 130 ? 5.013   33.046 216.672 1.00 152.67 ? 149 GLN A HE21   1 
ATOM   1520  H  HE22   . GLN A 1 130 ? 5.498   34.316 216.065 1.00 152.67 ? 149 GLN A HE22   1 
ATOM   1521  N  N      . GLN A 1 131 ? 0.635   34.736 215.701 1.00 62.44  ? 150 GLN A N      1 
ATOM   1522  C  CA     . GLN A 1 131 ? -0.424  35.194 214.803 1.00 88.72  ? 150 GLN A CA     1 
ATOM   1523  C  C      . GLN A 1 131 ? -0.752  34.155 213.745 1.00 58.00  ? 150 GLN A C      1 
ATOM   1524  O  O      . GLN A 1 131 ? -1.911  34.029 213.334 1.00 55.60  ? 150 GLN A O      1 
ATOM   1525  C  CB     . GLN A 1 131 ? -0.019  36.503 214.119 1.00 56.75  ? 150 GLN A CB     1 
ATOM   1526  C  CG     . GLN A 1 131 ? 1.215   36.389 213.231 1.00 62.60  ? 150 GLN A CG     1 
ATOM   1527  C  CD     . GLN A 1 131 ? 1.541   37.686 212.522 1.00 63.06  ? 150 GLN A CD     1 
ATOM   1528  O  OE1    . GLN A 1 131 ? 0.753   38.631 212.542 1.00 64.55  ? 150 GLN A OE1    1 
ATOM   1529  N  NE2    . GLN A 1 131 ? 2.706   37.736 211.886 1.00 77.06  ? 150 GLN A NE2    1 
ATOM   1530  H  H      . GLN A 1 131 ? 1.259   35.311 215.840 1.00 74.92  ? 150 GLN A H      1 
ATOM   1531  H  HA     . GLN A 1 131 ? -1.228  35.361 215.321 1.00 106.46 ? 150 GLN A HA     1 
ATOM   1532  H  HB2    . GLN A 1 131 ? -0.755  36.804 213.564 1.00 68.10  ? 150 GLN A HB2    1 
ATOM   1533  H  HB3    . GLN A 1 131 ? 0.168   37.166 214.802 1.00 68.10  ? 150 GLN A HB3    1 
ATOM   1534  H  HG2    . GLN A 1 131 ? 1.978   36.146 213.779 1.00 75.12  ? 150 GLN A HG2    1 
ATOM   1535  H  HG3    . GLN A 1 131 ? 1.059   35.709 212.557 1.00 75.12  ? 150 GLN A HG3    1 
ATOM   1536  H  HE21   . GLN A 1 131 ? 3.230   37.054 211.893 1.00 92.48  ? 150 GLN A HE21   1 
ATOM   1537  H  HE22   . GLN A 1 131 ? 2.937   38.451 211.468 1.00 92.48  ? 150 GLN A HE22   1 
ATOM   1538  N  N      . SER A 1 132 ? 0.258   33.414 213.287 1.00 43.00  ? 151 SER A N      1 
ATOM   1539  C  CA     . SER A 1 132 ? 0.045   32.391 212.273 1.00 42.77  ? 151 SER A CA     1 
ATOM   1540  C  C      . SER A 1 132 ? -1.125  31.483 212.631 1.00 56.13  ? 151 SER A C      1 
ATOM   1541  O  O      . SER A 1 132 ? -1.948  31.147 211.770 1.00 118.40 ? 151 SER A O      1 
ATOM   1542  C  CB     . SER A 1 132 ? 1.325   31.573 212.097 1.00 63.88  ? 151 SER A CB     1 
ATOM   1543  O  OG     . SER A 1 132 ? 1.149   30.546 211.139 1.00 136.47 ? 151 SER A OG     1 
ATOM   1544  H  H      . SER A 1 132 ? 1.074   33.486 213.549 1.00 51.60  ? 151 SER A H      1 
ATOM   1545  H  HA     . SER A 1 132 ? -0.156  32.821 211.427 1.00 51.33  ? 151 SER A HA     1 
ATOM   1546  H  HB2    . SER A 1 132 ? 2.036   32.162 211.800 1.00 76.65  ? 151 SER A HB2    1 
ATOM   1547  H  HB3    . SER A 1 132 ? 1.561   31.172 212.948 1.00 76.65  ? 151 SER A HB3    1 
ATOM   1548  H  HG     . SER A 1 132 ? 1.860   30.107 211.054 1.00 163.76 ? 151 SER A HG     1 
ATOM   1549  N  N      . ASP A 1 133 ? -1.224  31.085 213.898 1.00 60.11  ? 152 ASP A N      1 
ATOM   1550  C  CA     . ASP A 1 133 ? -2.221  30.116 214.337 1.00 74.63  ? 152 ASP A CA     1 
ATOM   1551  C  C      . ASP A 1 133 ? -3.420  30.764 215.023 1.00 56.01  ? 152 ASP A C      1 
ATOM   1552  O  O      . ASP A 1 133 ? -4.256  30.051 215.587 1.00 56.94  ? 152 ASP A O      1 
ATOM   1553  C  CB     . ASP A 1 133 ? -1.576  29.086 215.267 1.00 86.39  ? 152 ASP A CB     1 
ATOM   1554  C  CG     . ASP A 1 133 ? -0.796  29.725 216.402 1.00 120.18 ? 152 ASP A CG     1 
ATOM   1555  O  OD1    . ASP A 1 133 ? -1.397  30.492 217.184 1.00 146.45 ? 152 ASP A OD1    1 
ATOM   1556  O  OD2    . ASP A 1 133 ? 0.420   29.452 216.514 1.00 83.65  ? 152 ASP A OD2    1 
ATOM   1557  H  H      . ASP A 1 133 ? -0.716  31.369 214.532 1.00 72.13  ? 152 ASP A H      1 
ATOM   1558  H  HA     . ASP A 1 133 ? -2.552  29.642 213.558 1.00 89.55  ? 152 ASP A HA     1 
ATOM   1559  H  HB2    . ASP A 1 133 ? -2.272  28.532 215.656 1.00 103.66 ? 152 ASP A HB2    1 
ATOM   1560  H  HB3    . ASP A 1 133 ? -0.963  28.536 214.754 1.00 103.66 ? 152 ASP A HB3    1 
ATOM   1561  N  N      . VAL A 1 134 ? -3.530  32.089 214.981 1.00 56.12  ? 153 VAL A N      1 
ATOM   1562  C  CA     . VAL A 1 134 ? -4.658  32.789 215.585 1.00 56.36  ? 153 VAL A CA     1 
ATOM   1563  C  C      . VAL A 1 134 ? -5.633  33.222 214.500 1.00 81.62  ? 153 VAL A C      1 
ATOM   1564  O  O      . VAL A 1 134 ? -6.849  33.248 214.715 1.00 78.69  ? 153 VAL A O      1 
ATOM   1565  C  CB     . VAL A 1 134 ? -4.178  34.005 216.397 1.00 84.15  ? 153 VAL A CB     1 
ATOM   1566  C  CG1    . VAL A 1 134 ? -5.358  34.713 217.042 1.00 57.47  ? 153 VAL A CG1    1 
ATOM   1567  C  CG2    . VAL A 1 134 ? -3.174  33.570 217.447 1.00 108.52 ? 153 VAL A CG2    1 
ATOM   1568  H  H      . VAL A 1 134 ? -2.959  32.610 214.604 1.00 67.34  ? 153 VAL A H      1 
ATOM   1569  H  HA     . VAL A 1 134 ? -5.123  32.187 216.187 1.00 67.63  ? 153 VAL A HA     1 
ATOM   1570  H  HB     . VAL A 1 134 ? -3.739  34.632 215.801 1.00 100.98 ? 153 VAL A HB     1 
ATOM   1571  H  HG11   . VAL A 1 134 ? -5.031  35.474 217.548 1.00 68.96  ? 153 VAL A HG11   1 
ATOM   1572  H  HG12   . VAL A 1 134 ? -5.964  35.013 216.347 1.00 68.96  ? 153 VAL A HG12   1 
ATOM   1573  H  HG13   . VAL A 1 134 ? -5.813  34.093 217.634 1.00 68.96  ? 153 VAL A HG13   1 
ATOM   1574  H  HG21   . VAL A 1 134 ? -2.884  34.349 217.948 1.00 130.22 ? 153 VAL A HG21   1 
ATOM   1575  H  HG22   . VAL A 1 134 ? -3.597  32.932 218.043 1.00 130.22 ? 153 VAL A HG22   1 
ATOM   1576  H  HG23   . VAL A 1 134 ? -2.415  33.158 217.006 1.00 130.22 ? 153 VAL A HG23   1 
ATOM   1577  N  N      . ILE A 1 135 ? -5.103  33.576 213.329 1.00 89.61  ? 154 ILE A N      1 
ATOM   1578  C  CA     . ILE A 1 135 ? -5.926  34.141 212.269 1.00 73.05  ? 154 ILE A CA     1 
ATOM   1579  C  C      . ILE A 1 135 ? -6.888  33.089 211.732 1.00 82.18  ? 154 ILE A C      1 
ATOM   1580  O  O      . ILE A 1 135 ? -6.566  31.897 211.644 1.00 82.79  ? 154 ILE A O      1 
ATOM   1581  C  CB     . ILE A 1 135 ? -5.036  34.702 211.145 1.00 61.58  ? 154 ILE A CB     1 
ATOM   1582  C  CG1    . ILE A 1 135 ? -4.181  35.854 211.685 1.00 57.76  ? 154 ILE A CG1    1 
ATOM   1583  C  CG2    . ILE A 1 135 ? -5.887  35.163 209.969 1.00 61.45  ? 154 ILE A CG2    1 
ATOM   1584  C  CD1    . ILE A 1 135 ? -3.141  36.362 210.716 1.00 66.76  ? 154 ILE A CD1    1 
ATOM   1585  H  H      . ILE A 1 135 ? -4.270  33.498 213.127 1.00 107.53 ? 154 ILE A H      1 
ATOM   1586  H  HA     . ILE A 1 135 ? -6.450  34.872 212.631 1.00 87.66  ? 154 ILE A HA     1 
ATOM   1587  H  HB     . ILE A 1 135 ? -4.444  33.997 210.840 1.00 73.89  ? 154 ILE A HB     1 
ATOM   1588  H  HG12   . ILE A 1 135 ? -4.764  36.596 211.907 1.00 69.31  ? 154 ILE A HG12   1 
ATOM   1589  H  HG13   . ILE A 1 135 ? -3.719  35.551 212.482 1.00 69.31  ? 154 ILE A HG13   1 
ATOM   1590  H  HG21   . ILE A 1 135 ? -5.305  35.511 209.276 1.00 73.75  ? 154 ILE A HG21   1 
ATOM   1591  H  HG22   . ILE A 1 135 ? -6.390  34.406 209.629 1.00 73.75  ? 154 ILE A HG22   1 
ATOM   1592  H  HG23   . ILE A 1 135 ? -6.494  35.856 210.271 1.00 73.75  ? 154 ILE A HG23   1 
ATOM   1593  H  HD11   . ILE A 1 135 ? -2.648  37.085 211.134 1.00 80.11  ? 154 ILE A HD11   1 
ATOM   1594  H  HD12   . ILE A 1 135 ? -2.538  35.636 210.492 1.00 80.11  ? 154 ILE A HD12   1 
ATOM   1595  H  HD13   . ILE A 1 135 ? -3.585  36.683 209.916 1.00 80.11  ? 154 ILE A HD13   1 
ATOM   1596  N  N      . HIS A 1 136 ? -8.083  33.543 211.357 1.00 68.15  ? 155 HIS A N      1 
ATOM   1597  C  CA     . HIS A 1 136 ? -9.110  32.671 210.797 1.00 70.38  ? 155 HIS A CA     1 
ATOM   1598  C  C      . HIS A 1 136 ? -9.382  31.487 211.722 1.00 75.37  ? 155 HIS A C      1 
ATOM   1599  O  O      . HIS A 1 136 ? -9.578  30.353 211.280 1.00 130.90 ? 155 HIS A O      1 
ATOM   1600  C  CB     . HIS A 1 136 ? -8.716  32.197 209.399 1.00 118.01 ? 155 HIS A CB     1 
ATOM   1601  C  CG     . HIS A 1 136 ? -9.873  31.737 208.566 1.00 146.77 ? 155 HIS A CG     1 
ATOM   1602  N  ND1    . HIS A 1 136 ? -10.940 32.553 208.258 1.00 92.26  ? 155 HIS A ND1    1 
ATOM   1603  C  CD2    . HIS A 1 136 ? -10.125 30.548 207.968 1.00 143.70 ? 155 HIS A CD2    1 
ATOM   1604  C  CE1    . HIS A 1 136 ? -11.803 31.886 207.512 1.00 116.48 ? 155 HIS A CE1    1 
ATOM   1605  N  NE2    . HIS A 1 136 ? -11.332 30.667 207.321 1.00 135.28 ? 155 HIS A NE2    1 
ATOM   1606  H  H      . HIS A 1 136 ? -8.325  34.366 211.418 1.00 81.79  ? 155 HIS A H      1 
ATOM   1607  H  HA     . HIS A 1 136 ? -9.935  33.176 210.716 1.00 84.46  ? 155 HIS A HA     1 
ATOM   1608  H  HB2    . HIS A 1 136 ? -8.286  32.929 208.931 1.00 141.61 ? 155 HIS A HB2    1 
ATOM   1609  H  HB3    . HIS A 1 136 ? -8.099  31.454 209.484 1.00 141.61 ? 155 HIS A HB3    1 
ATOM   1610  H  HD2    . HIS A 1 136 ? -9.584  29.792 207.994 1.00 172.44 ? 155 HIS A HD2    1 
ATOM   1611  H  HE1    . HIS A 1 136 ? -12.604 32.218 207.177 1.00 139.78 ? 155 HIS A HE1    1 
ATOM   1612  H  HE2    . HIS A 1 136 ? -11.717 30.048 206.866 1.00 162.34 ? 155 HIS A HE2    1 
ATOM   1613  N  N      . GLN A 1 137 ? -9.390  31.759 213.026 1.00 86.18  ? 156 GLN A N      1 
ATOM   1614  C  CA     . GLN A 1 137 ? -9.765  30.784 214.041 1.00 79.21  ? 156 GLN A CA     1 
ATOM   1615  C  C      . GLN A 1 137 ? -10.715 31.443 215.028 1.00 72.16  ? 156 GLN A C      1 
ATOM   1616  O  O      . GLN A 1 137 ? -10.528 32.605 215.402 1.00 85.02  ? 156 GLN A O      1 
ATOM   1617  C  CB     . GLN A 1 137 ? -8.543  30.234 214.784 1.00 105.86 ? 156 GLN A CB     1 
ATOM   1618  C  CG     . GLN A 1 137 ? -7.641  29.368 213.929 1.00 110.16 ? 156 GLN A CG     1 
ATOM   1619  C  CD     . GLN A 1 137 ? -8.373  28.178 213.347 1.00 103.35 ? 156 GLN A CD     1 
ATOM   1620  O  OE1    . GLN A 1 137 ? -9.370  27.716 213.906 1.00 120.76 ? 156 GLN A OE1    1 
ATOM   1621  N  NE2    . GLN A 1 137 ? -7.891  27.682 212.214 1.00 110.42 ? 156 GLN A NE2    1 
ATOM   1622  H  H      . GLN A 1 137 ? -9.175  32.524 213.353 1.00 103.42 ? 156 GLN A H      1 
ATOM   1623  H  HA     . GLN A 1 137 ? -10.227 30.042 213.620 1.00 95.06  ? 156 GLN A HA     1 
ATOM   1624  H  HB2    . GLN A 1 137 ? -8.015  30.979 215.111 1.00 127.03 ? 156 GLN A HB2    1 
ATOM   1625  H  HB3    . GLN A 1 137 ? -8.848  29.696 215.531 1.00 127.03 ? 156 GLN A HB3    1 
ATOM   1626  H  HG2    . GLN A 1 137 ? -7.296  29.899 213.194 1.00 132.19 ? 156 GLN A HG2    1 
ATOM   1627  H  HG3    . GLN A 1 137 ? -6.910  29.036 214.473 1.00 132.19 ? 156 GLN A HG3    1 
ATOM   1628  H  HE21   . GLN A 1 137 ? -7.198  28.037 211.850 1.00 132.50 ? 156 GLN A HE21   1 
ATOM   1629  H  HE22   . GLN A 1 137 ? -8.272  27.005 211.845 1.00 132.50 ? 156 GLN A HE22   1 
ATOM   1630  N  N      . SER A 1 138 ? -11.742 30.699 215.430 1.00 79.10  ? 157 SER A N      1 
ATOM   1631  C  CA     . SER A 1 138 ? -12.787 31.219 216.301 1.00 81.83  ? 157 SER A CA     1 
ATOM   1632  C  C      . SER A 1 138 ? -12.190 32.044 217.429 1.00 80.32  ? 157 SER A C      1 
ATOM   1633  O  O      . SER A 1 138 ? -11.415 31.535 218.248 1.00 100.36 ? 157 SER A O      1 
ATOM   1634  C  CB     . SER A 1 138 ? -13.614 30.067 216.876 1.00 100.02 ? 157 SER A CB     1 
ATOM   1635  O  OG     . SER A 1 138 ? -14.217 29.302 215.847 1.00 164.17 ? 157 SER A OG     1 
ATOM   1636  H  H      . SER A 1 138 ? -11.856 29.877 215.208 1.00 94.92  ? 157 SER A H      1 
ATOM   1637  H  HA     . SER A 1 138 ? -13.379 31.790 215.786 1.00 98.20  ? 157 SER A HA     1 
ATOM   1638  H  HB2    . SER A 1 138 ? -13.031 29.491 217.395 1.00 120.03 ? 157 SER A HB2    1 
ATOM   1639  H  HB3    . SER A 1 138 ? -14.309 30.432 217.445 1.00 120.03 ? 157 SER A HB3    1 
ATOM   1640  H  HG     . SER A 1 138 ? -14.666 28.675 216.180 1.00 197.00 ? 157 SER A HG     1 
ATOM   1641  N  N      . VAL A 1 139 ? -12.553 33.326 217.471 1.00 91.59  ? 158 VAL A N      1 
ATOM   1642  C  CA     . VAL A 1 139 ? -12.066 34.197 218.534 1.00 78.92  ? 158 VAL A CA     1 
ATOM   1643  C  C      . VAL A 1 139 ? -12.380 33.599 219.891 1.00 72.52  ? 158 VAL A C      1 
ATOM   1644  O  O      . VAL A 1 139 ? -11.653 33.825 220.866 1.00 104.08 ? 158 VAL A O      1 
ATOM   1645  C  CB     . VAL A 1 139 ? -12.682 35.604 218.396 1.00 75.68  ? 158 VAL A CB     1 
ATOM   1646  C  CG1    . VAL A 1 139 ? -12.011 36.563 219.348 1.00 71.52  ? 158 VAL A CG1    1 
ATOM   1647  C  CG2    . VAL A 1 139 ? -12.569 36.119 216.970 1.00 129.89 ? 158 VAL A CG2    1 
ATOM   1648  H  H      . VAL A 1 139 ? -13.073 33.709 216.903 1.00 109.91 ? 158 VAL A H      1 
ATOM   1649  H  HA     . VAL A 1 139 ? -11.103 34.282 218.459 1.00 94.70  ? 158 VAL A HA     1 
ATOM   1650  H  HB     . VAL A 1 139 ? -13.624 35.562 218.626 1.00 90.82  ? 158 VAL A HB     1 
ATOM   1651  H  HG11   . VAL A 1 139 ? -12.412 37.440 219.247 1.00 85.82  ? 158 VAL A HG11   1 
ATOM   1652  H  HG12   . VAL A 1 139 ? -12.137 36.245 220.256 1.00 85.82  ? 158 VAL A HG12   1 
ATOM   1653  H  HG13   . VAL A 1 139 ? -11.065 36.604 219.140 1.00 85.82  ? 158 VAL A HG13   1 
ATOM   1654  H  HG21   . VAL A 1 139 ? -12.966 37.003 216.921 1.00 155.87 ? 158 VAL A HG21   1 
ATOM   1655  H  HG22   . VAL A 1 139 ? -11.632 36.162 216.724 1.00 155.87 ? 158 VAL A HG22   1 
ATOM   1656  H  HG23   . VAL A 1 139 ? -13.040 35.512 216.377 1.00 155.87 ? 158 VAL A HG23   1 
ATOM   1657  N  N      . TYR A 1 140 ? -13.469 32.841 219.981 1.00 95.35  ? 159 TYR A N      1 
ATOM   1658  C  CA     . TYR A 1 140 ? -13.915 32.278 221.246 1.00 109.97 ? 159 TYR A CA     1 
ATOM   1659  C  C      . TYR A 1 140 ? -12.950 31.243 221.812 1.00 87.97  ? 159 TYR A C      1 
ATOM   1660  O  O      . TYR A 1 140 ? -13.064 30.899 222.995 1.00 87.59  ? 159 TYR A O      1 
ATOM   1661  C  CB     . TYR A 1 140 ? -15.310 31.670 221.054 1.00 103.18 ? 159 TYR A CB     1 
ATOM   1662  C  CG     . TYR A 1 140 ? -16.377 32.709 220.786 1.00 92.33  ? 159 TYR A CG     1 
ATOM   1663  C  CD1    . TYR A 1 140 ? -16.357 33.938 221.435 1.00 87.12  ? 159 TYR A CD1    1 
ATOM   1664  C  CD2    . TYR A 1 140 ? -17.395 32.469 219.875 1.00 116.94 ? 159 TYR A CD2    1 
ATOM   1665  C  CE1    . TYR A 1 140 ? -17.321 34.890 221.195 1.00 93.52  ? 159 TYR A CE1    1 
ATOM   1666  C  CE2    . TYR A 1 140 ? -18.367 33.420 219.627 1.00 125.44 ? 159 TYR A CE2    1 
ATOM   1667  C  CZ     . TYR A 1 140 ? -18.322 34.627 220.290 1.00 98.49  ? 159 TYR A CZ     1 
ATOM   1668  O  OH     . TYR A 1 140 ? -19.278 35.579 220.051 1.00 114.84 ? 159 TYR A OH     1 
ATOM   1669  H  H      . TYR A 1 140 ? -13.972 32.637 219.314 1.00 114.42 ? 159 TYR A H      1 
ATOM   1670  H  HA     . TYR A 1 140 ? -13.991 32.994 221.896 1.00 131.96 ? 159 TYR A HA     1 
ATOM   1671  H  HB2    . TYR A 1 140 ? -15.287 31.063 220.298 1.00 123.82 ? 159 TYR A HB2    1 
ATOM   1672  H  HB3    . TYR A 1 140 ? -15.557 31.188 221.859 1.00 123.82 ? 159 TYR A HB3    1 
ATOM   1673  H  HD1    . TYR A 1 140 ? -15.682 34.118 222.048 1.00 104.54 ? 159 TYR A HD1    1 
ATOM   1674  H  HD2    . TYR A 1 140 ? -17.427 31.655 219.428 1.00 140.33 ? 159 TYR A HD2    1 
ATOM   1675  H  HE1    . TYR A 1 140 ? -17.294 35.706 221.640 1.00 112.23 ? 159 TYR A HE1    1 
ATOM   1676  H  HE2    . TYR A 1 140 ? -19.046 33.247 219.016 1.00 150.53 ? 159 TYR A HE2    1 
ATOM   1677  H  HH     . TYR A 1 140 ? -19.828 35.297 219.482 1.00 137.81 ? 159 TYR A HH     1 
ATOM   1678  N  N      . GLU A 1 141 ? -12.008 30.751 221.013 1.00 67.31  ? 160 GLU A N      1 
ATOM   1679  C  CA     . GLU A 1 141 ? -10.961 29.880 221.527 1.00 85.31  ? 160 GLU A CA     1 
ATOM   1680  C  C      . GLU A 1 141 ? -9.862  30.648 222.247 1.00 53.83  ? 160 GLU A C      1 
ATOM   1681  O  O      . GLU A 1 141 ? -8.865  30.040 222.647 1.00 131.28 ? 160 GLU A O      1 
ATOM   1682  C  CB     . GLU A 1 141 ? -10.355 29.057 220.386 1.00 110.15 ? 160 GLU A CB     1 
ATOM   1683  C  CG     . GLU A 1 141 ? -11.259 27.933 219.898 1.00 95.83  ? 160 GLU A CG     1 
ATOM   1684  C  CD     . GLU A 1 141 ? -10.597 27.062 218.847 1.00 77.83  ? 160 GLU A CD     1 
ATOM   1685  O  OE1    . GLU A 1 141 ? -9.502  27.428 218.367 1.00 94.07  ? 160 GLU A OE1    1 
ATOM   1686  O  OE2    . GLU A 1 141 ? -11.171 26.006 218.507 1.00 116.44 ? 160 GLU A OE2    1 
ATOM   1687  H  H      . GLU A 1 141 ? -11.954 30.907 220.169 1.00 80.77  ? 160 GLU A H      1 
ATOM   1688  H  HA     . GLU A 1 141 ? -11.354 29.261 222.162 1.00 102.38 ? 160 GLU A HA     1 
ATOM   1689  H  HB2    . GLU A 1 141 ? -10.179 29.645 219.635 1.00 132.18 ? 160 GLU A HB2    1 
ATOM   1690  H  HB3    . GLU A 1 141 ? -9.526  28.658 220.694 1.00 132.18 ? 160 GLU A HB3    1 
ATOM   1691  H  HG2    . GLU A 1 141 ? -11.496 27.369 220.650 1.00 114.99 ? 160 GLU A HG2    1 
ATOM   1692  H  HG3    . GLU A 1 141 ? -12.059 28.319 219.507 1.00 114.99 ? 160 GLU A HG3    1 
ATOM   1693  N  N      . LEU A 1 142 ? -10.017 31.963 222.415 1.00 57.46  ? 161 LEU A N      1 
ATOM   1694  C  CA     . LEU A 1 142 ? -9.082  32.778 223.176 1.00 70.92  ? 161 LEU A CA     1 
ATOM   1695  C  C      . LEU A 1 142 ? -9.716  33.453 224.379 1.00 83.05  ? 161 LEU A C      1 
ATOM   1696  O  O      . LEU A 1 142 ? -8.997  34.085 225.161 1.00 74.83  ? 161 LEU A O      1 
ATOM   1697  C  CB     . LEU A 1 142 ? -8.466  33.870 222.287 1.00 71.40  ? 161 LEU A CB     1 
ATOM   1698  C  CG     . LEU A 1 142 ? -7.817  33.414 220.983 1.00 71.71  ? 161 LEU A CG     1 
ATOM   1699  C  CD1    . LEU A 1 142 ? -7.483  34.620 220.127 1.00 63.11  ? 161 LEU A CD1    1 
ATOM   1700  C  CD2    . LEU A 1 142 ? -6.573  32.588 221.257 1.00 62.07  ? 161 LEU A CD2    1 
ATOM   1701  H  H      . LEU A 1 142 ? -10.674 32.411 222.088 1.00 68.95  ? 161 LEU A H      1 
ATOM   1702  H  HA     . LEU A 1 142 ? -8.361  32.213 223.496 1.00 85.11  ? 161 LEU A HA     1 
ATOM   1703  H  HB2    . LEU A 1 142 ? -9.167  34.499 222.052 1.00 85.68  ? 161 LEU A HB2    1 
ATOM   1704  H  HB3    . LEU A 1 142 ? -7.784  34.330 222.801 1.00 85.68  ? 161 LEU A HB3    1 
ATOM   1705  H  HG     . LEU A 1 142 ? -8.444  32.860 220.493 1.00 86.05  ? 161 LEU A HG     1 
ATOM   1706  H  HD11   . LEU A 1 142 ? -7.072  34.317 219.302 1.00 75.73  ? 161 LEU A HD11   1 
ATOM   1707  H  HD12   . LEU A 1 142 ? -8.301  35.103 219.930 1.00 75.73  ? 161 LEU A HD12   1 
ATOM   1708  H  HD13   . LEU A 1 142 ? -6.869  35.192 220.613 1.00 75.73  ? 161 LEU A HD13   1 
ATOM   1709  H  HD21   . LEU A 1 142 ? -6.184  32.313 220.412 1.00 74.48  ? 161 LEU A HD21   1 
ATOM   1710  H  HD22   . LEU A 1 142 ? -5.939  33.128 221.754 1.00 74.48  ? 161 LEU A HD22   1 
ATOM   1711  H  HD23   . LEU A 1 142 ? -6.821  31.807 221.777 1.00 74.48  ? 161 LEU A HD23   1 
ATOM   1712  N  N      . ILE A 1 143 ? -11.029 33.343 224.550 1.00 79.04  ? 162 ILE A N      1 
ATOM   1713  C  CA     . ILE A 1 143 ? -11.756 34.114 225.546 1.00 79.89  ? 162 ILE A CA     1 
ATOM   1714  C  C      . ILE A 1 143 ? -12.240 33.183 226.647 1.00 108.07 ? 162 ILE A C      1 
ATOM   1715  O  O      . ILE A 1 143 ? -12.601 32.025 226.406 1.00 89.44  ? 162 ILE A O      1 
ATOM   1716  C  CB     . ILE A 1 143 ? -12.939 34.871 224.907 1.00 100.26 ? 162 ILE A CB     1 
ATOM   1717  C  CG1    . ILE A 1 143 ? -12.426 35.835 223.837 1.00 80.84  ? 162 ILE A CG1    1 
ATOM   1718  C  CG2    . ILE A 1 143 ? -13.734 35.626 225.974 1.00 107.96 ? 162 ILE A CG2    1 
ATOM   1719  C  CD1    . ILE A 1 143 ? -13.518 36.472 223.004 1.00 105.91 ? 162 ILE A CD1    1 
ATOM   1720  H  H      . ILE A 1 143 ? -11.529 32.816 224.090 1.00 94.85  ? 162 ILE A H      1 
ATOM   1721  H  HA     . ILE A 1 143 ? -11.158 34.767 225.943 1.00 95.86  ? 162 ILE A HA     1 
ATOM   1722  H  HB     . ILE A 1 143 ? -13.526 34.224 224.484 1.00 120.31 ? 162 ILE A HB     1 
ATOM   1723  H  HG12   . ILE A 1 143 ? -11.931 36.547 224.270 1.00 97.01  ? 162 ILE A HG12   1 
ATOM   1724  H  HG13   . ILE A 1 143 ? -11.841 35.349 223.234 1.00 97.01  ? 162 ILE A HG13   1 
ATOM   1725  H  HG21   . ILE A 1 143 ? -14.470 36.092 225.548 1.00 129.56 ? 162 ILE A HG21   1 
ATOM   1726  H  HG22   . ILE A 1 143 ? -14.075 34.989 226.622 1.00 129.56 ? 162 ILE A HG22   1 
ATOM   1727  H  HG23   . ILE A 1 143 ? -13.148 36.262 226.413 1.00 129.56 ? 162 ILE A HG23   1 
ATOM   1728  H  HD11   . ILE A 1 143 ? -13.112 37.066 222.353 1.00 127.09 ? 162 ILE A HD11   1 
ATOM   1729  H  HD12   . ILE A 1 143 ? -14.017 35.775 222.551 1.00 127.09 ? 162 ILE A HD12   1 
ATOM   1730  H  HD13   . ILE A 1 143 ? -14.107 36.975 223.588 1.00 127.09 ? 162 ILE A HD13   1 
ATOM   1731  N  N      . HIS A 1 144 ? -12.246 33.706 227.867 1.00 100.03 ? 163 HIS A N      1 
ATOM   1732  C  CA     . HIS A 1 144 ? -12.761 32.961 229.003 1.00 75.49  ? 163 HIS A CA     1 
ATOM   1733  C  C      . HIS A 1 144 ? -14.268 32.770 228.870 1.00 103.72 ? 163 HIS A C      1 
ATOM   1734  O  O      . HIS A 1 144 ? -14.982 33.653 228.388 1.00 142.29 ? 163 HIS A O      1 
ATOM   1735  C  CB     . HIS A 1 144 ? -12.430 33.703 230.296 1.00 101.99 ? 163 HIS A CB     1 
ATOM   1736  C  CG     . HIS A 1 144 ? -12.600 32.877 231.531 1.00 93.91  ? 163 HIS A CG     1 
ATOM   1737  N  ND1    . HIS A 1 144 ? -13.006 31.561 231.498 1.00 111.13 ? 163 HIS A ND1    1 
ATOM   1738  C  CD2    . HIS A 1 144 ? -12.414 33.180 232.838 1.00 71.09  ? 163 HIS A CD2    1 
ATOM   1739  C  CE1    . HIS A 1 144 ? -13.068 31.090 232.731 1.00 117.57 ? 163 HIS A CE1    1 
ATOM   1740  N  NE2    . HIS A 1 144 ? -12.712 32.052 233.562 1.00 79.53  ? 163 HIS A NE2    1 
ATOM   1741  H  H      . HIS A 1 144 ? -11.956 34.492 228.062 1.00 120.03 ? 163 HIS A H      1 
ATOM   1742  H  HA     . HIS A 1 144 ? -12.342 32.087 229.034 1.00 90.58  ? 163 HIS A HA     1 
ATOM   1743  H  HB2    . HIS A 1 144 ? -11.506 33.996 230.260 1.00 122.39 ? 163 HIS A HB2    1 
ATOM   1744  H  HB3    . HIS A 1 144 ? -13.015 34.473 230.372 1.00 122.39 ? 163 HIS A HB3    1 
ATOM   1745  H  HD2    . HIS A 1 144 ? -12.138 33.999 233.180 1.00 85.31  ? 163 HIS A HD2    1 
ATOM   1746  H  HE1    . HIS A 1 144 ? -13.316 30.227 232.972 1.00 141.09 ? 163 HIS A HE1    1 
ATOM   1747  H  HE2    . HIS A 1 144 ? -12.673 31.984 234.419 1.00 95.43  ? 163 HIS A HE2    1 
ATOM   1748  N  N      . THR A 1 145 ? -14.748 31.600 229.297 1.00 69.64  ? 164 THR A N      1 
ATOM   1749  C  CA     . THR A 1 145 ? -16.169 31.286 229.188 1.00 82.08  ? 164 THR A CA     1 
ATOM   1750  C  C      . THR A 1 145 ? -17.036 32.395 229.771 1.00 95.53  ? 164 THR A C      1 
ATOM   1751  O  O      . THR A 1 145 ? -18.052 32.776 229.178 1.00 117.77 ? 164 THR A O      1 
ATOM   1752  C  CB     . THR A 1 145 ? -16.460 29.958 229.890 1.00 115.80 ? 164 THR A CB     1 
ATOM   1753  O  OG1    . THR A 1 145 ? -15.621 28.931 229.348 1.00 84.51  ? 164 THR A OG1    1 
ATOM   1754  C  CG2    . THR A 1 145 ? -17.923 29.561 229.716 1.00 124.20 ? 164 THR A CG2    1 
ATOM   1755  H  H      . THR A 1 145 ? -14.273 30.977 229.652 1.00 83.57  ? 164 THR A H      1 
ATOM   1756  H  HA     . THR A 1 145 ? -16.399 31.187 228.251 1.00 98.49  ? 164 THR A HA     1 
ATOM   1757  H  HB     . THR A 1 145 ? -16.281 30.052 230.839 1.00 138.96 ? 164 THR A HB     1 
ATOM   1758  H  HG1    . THR A 1 145 ? -15.777 28.200 229.731 1.00 101.42 ? 164 THR A HG1    1 
ATOM   1759  H  HG21   . THR A 1 145 ? -18.093 28.718 230.166 1.00 149.04 ? 164 THR A HG21   1 
ATOM   1760  H  HG22   . THR A 1 145 ? -18.499 30.243 230.096 1.00 149.04 ? 164 THR A HG22   1 
ATOM   1761  H  HG23   . THR A 1 145 ? -18.130 29.462 228.774 1.00 149.04 ? 164 THR A HG23   1 
ATOM   1762  N  N      . GLU A 1 146 ? -16.652 32.925 230.933 1.00 80.47  ? 165 GLU A N      1 
ATOM   1763  C  CA     . GLU A 1 146 ? -17.453 33.961 231.576 1.00 111.31 ? 165 GLU A CA     1 
ATOM   1764  C  C      . GLU A 1 146 ? -17.547 35.203 230.700 1.00 116.86 ? 165 GLU A C      1 
ATOM   1765  O  O      . GLU A 1 146 ? -18.636 35.748 230.488 1.00 108.63 ? 165 GLU A O      1 
ATOM   1766  C  CB     . GLU A 1 146 ? -16.854 34.309 232.939 1.00 116.61 ? 165 GLU A CB     1 
ATOM   1767  C  CG     . GLU A 1 146 ? -16.919 33.180 233.954 1.00 124.56 ? 165 GLU A CG     1 
ATOM   1768  C  CD     . GLU A 1 146 ? -15.972 33.394 235.119 1.00 136.72 ? 165 GLU A CD     1 
ATOM   1769  O  OE1    . GLU A 1 146 ? -15.217 32.458 235.458 1.00 133.74 ? 165 GLU A OE1    1 
ATOM   1770  O  OE2    . GLU A 1 146 ? -15.972 34.509 235.683 1.00 159.28 ? 165 GLU A OE2    1 
ATOM   1771  H  H      . GLU A 1 146 ? -15.941 32.704 231.363 1.00 96.56  ? 165 GLU A H      1 
ATOM   1772  H  HA     . GLU A 1 146 ? -18.352 33.625 231.719 1.00 133.57 ? 165 GLU A HA     1 
ATOM   1773  H  HB2    . GLU A 1 146 ? -15.921 34.544 232.817 1.00 139.93 ? 165 GLU A HB2    1 
ATOM   1774  H  HB3    . GLU A 1 146 ? -17.337 35.065 233.307 1.00 139.93 ? 165 GLU A HB3    1 
ATOM   1775  H  HG2    . GLU A 1 146 ? -17.821 33.120 234.306 1.00 149.47 ? 165 GLU A HG2    1 
ATOM   1776  H  HG3    . GLU A 1 146 ? -16.676 32.347 233.519 1.00 149.47 ? 165 GLU A HG3    1 
ATOM   1777  N  N      . ASP A 1 147 ? -16.409 35.666 230.181 1.00 103.70 ? 166 ASP A N      1 
ATOM   1778  C  CA     . ASP A 1 147 ? -16.383 36.857 229.342 1.00 96.40  ? 166 ASP A CA     1 
ATOM   1779  C  C      . ASP A 1 147 ? -16.812 36.570 227.908 1.00 92.17  ? 166 ASP A C      1 
ATOM   1780  O  O      . ASP A 1 147 ? -17.175 37.503 227.179 1.00 125.25 ? 166 ASP A O      1 
ATOM   1781  C  CB     . ASP A 1 147 ? -14.979 37.460 229.361 1.00 90.19  ? 166 ASP A CB     1 
ATOM   1782  C  CG     . ASP A 1 147 ? -14.461 37.683 230.771 1.00 111.63 ? 166 ASP A CG     1 
ATOM   1783  O  OD1    . ASP A 1 147 ? -15.234 38.166 231.625 1.00 116.91 ? 166 ASP A OD1    1 
ATOM   1784  O  OD2    . ASP A 1 147 ? -13.283 37.365 231.029 1.00 102.86 ? 166 ASP A OD2    1 
ATOM   1785  H  H      . ASP A 1 147 ? -15.638 35.305 230.302 1.00 124.44 ? 166 ASP A H      1 
ATOM   1786  H  HA     . ASP A 1 147 ? -16.995 37.513 229.710 1.00 115.68 ? 166 ASP A HA     1 
ATOM   1787  H  HB2    . ASP A 1 147 ? -14.369 36.856 228.908 1.00 108.23 ? 166 ASP A HB2    1 
ATOM   1788  H  HB3    . ASP A 1 147 ? -14.996 38.317 228.907 1.00 108.23 ? 166 ASP A HB3    1 
ATOM   1789  N  N      . ARG A 1 148 ? -16.780 35.301 227.496 1.00 82.95  ? 167 ARG A N      1 
ATOM   1790  C  CA     . ARG A 1 148 ? -17.221 34.922 226.158 1.00 95.48  ? 167 ARG A CA     1 
ATOM   1791  C  C      . ARG A 1 148 ? -18.578 35.532 225.827 1.00 93.40  ? 167 ARG A C      1 
ATOM   1792  O  O      . ARG A 1 148 ? -18.786 36.050 224.722 1.00 115.04 ? 167 ARG A O      1 
ATOM   1793  C  CB     . ARG A 1 148 ? -17.270 33.394 226.060 1.00 108.02 ? 167 ARG A CB     1 
ATOM   1794  C  CG     . ARG A 1 148 ? -17.512 32.844 224.664 1.00 88.42  ? 167 ARG A CG     1 
ATOM   1795  C  CD     . ARG A 1 148 ? -17.382 31.323 224.631 1.00 136.11 ? 167 ARG A CD     1 
ATOM   1796  N  NE     . ARG A 1 148 ? -16.001 30.885 224.410 1.00 142.91 ? 167 ARG A NE     1 
ATOM   1797  C  CZ     . ARG A 1 148 ? -15.269 30.158 225.252 1.00 121.37 ? 167 ARG A CZ     1 
ATOM   1798  N  NH1    . ARG A 1 148 ? -15.758 29.741 226.415 1.00 122.39 ? 167 ARG A NH1    1 
ATOM   1799  N  NH2    . ARG A 1 148 ? -14.028 29.828 224.920 1.00 97.94  ? 167 ARG A NH2    1 
ATOM   1800  H  H      . ARG A 1 148 ? -16.506 34.642 227.976 1.00 99.54  ? 167 ARG A H      1 
ATOM   1801  H  HA     . ARG A 1 148 ? -16.578 35.246 225.508 1.00 114.58 ? 167 ARG A HA     1 
ATOM   1802  H  HB2    . ARG A 1 148 ? -16.423 33.039 226.371 1.00 129.63 ? 167 ARG A HB2    1 
ATOM   1803  H  HB3    . ARG A 1 148 ? -17.986 33.072 226.629 1.00 129.63 ? 167 ARG A HB3    1 
ATOM   1804  H  HG2    . ARG A 1 148 ? -18.409 33.079 224.378 1.00 106.10 ? 167 ARG A HG2    1 
ATOM   1805  H  HG3    . ARG A 1 148 ? -16.857 33.218 224.054 1.00 106.10 ? 167 ARG A HG3    1 
ATOM   1806  H  HD2    . ARG A 1 148 ? -17.680 30.961 225.481 1.00 163.34 ? 167 ARG A HD2    1 
ATOM   1807  H  HD3    . ARG A 1 148 ? -17.928 30.973 223.910 1.00 163.34 ? 167 ARG A HD3    1 
ATOM   1808  H  HE     . ARG A 1 148 ? -15.630 31.118 223.670 1.00 171.50 ? 167 ARG A HE     1 
ATOM   1809  H  HH11   . ARG A 1 148 ? -16.562 29.946 226.641 1.00 146.87 ? 167 ARG A HH11   1 
ATOM   1810  H  HH12   . ARG A 1 148 ? -15.269 29.271 226.943 1.00 146.87 ? 167 ARG A HH12   1 
ATOM   1811  H  HH21   . ARG A 1 148 ? -13.700 30.090 224.170 1.00 117.53 ? 167 ARG A HH21   1 
ATOM   1812  H  HH22   . ARG A 1 148 ? -13.549 29.358 225.458 1.00 117.53 ? 167 ARG A HH22   1 
ATOM   1813  N  N      . ALA A 1 149 ? -19.511 35.492 226.779 1.00 107.08 ? 168 ALA A N      1 
ATOM   1814  C  CA     . ALA A 1 149 ? -20.843 36.040 226.548 1.00 111.83 ? 168 ALA A CA     1 
ATOM   1815  C  C      . ALA A 1 149 ? -20.777 37.535 226.268 1.00 114.34 ? 168 ALA A C      1 
ATOM   1816  O  O      . ALA A 1 149 ? -21.247 38.010 225.226 1.00 114.01 ? 168 ALA A O      1 
ATOM   1817  C  CB     . ALA A 1 149 ? -21.736 35.757 227.757 1.00 148.20 ? 168 ALA A CB     1 
ATOM   1818  H  H      . ALA A 1 149 ? -19.397 35.155 227.562 1.00 128.49 ? 168 ALA A H      1 
ATOM   1819  H  HA     . ALA A 1 149 ? -21.236 35.605 225.775 1.00 134.20 ? 168 ALA A HA     1 
ATOM   1820  H  HB1    . ALA A 1 149 ? -22.618 36.126 227.591 1.00 177.84 ? 168 ALA A HB1    1 
ATOM   1821  H  HB2    . ALA A 1 149 ? -21.797 34.798 227.887 1.00 177.84 ? 168 ALA A HB2    1 
ATOM   1822  H  HB3    . ALA A 1 149 ? -21.346 36.174 228.542 1.00 177.84 ? 168 ALA A HB3    1 
ATOM   1823  N  N      . GLU A 1 150 ? -20.201 38.297 227.201 1.00 146.46 ? 169 GLU A N      1 
ATOM   1824  C  CA     . GLU A 1 150 ? -20.097 39.741 227.019 1.00 133.98 ? 169 GLU A CA     1 
ATOM   1825  C  C      . GLU A 1 150 ? -19.487 40.079 225.669 1.00 96.48  ? 169 GLU A C      1 
ATOM   1826  O  O      . GLU A 1 150 ? -19.977 40.966 224.962 1.00 122.13 ? 169 GLU A O      1 
ATOM   1827  C  CB     . GLU A 1 150 ? -19.264 40.357 228.142 1.00 135.45 ? 169 GLU A CB     1 
ATOM   1828  C  CG     . GLU A 1 150 ? -19.135 41.870 228.050 1.00 102.68 ? 169 GLU A CG     1 
ATOM   1829  C  CD     . GLU A 1 150 ? -18.297 42.451 229.169 1.00 135.87 ? 169 GLU A CD     1 
ATOM   1830  O  OE1    . GLU A 1 150 ? -17.840 41.677 230.038 1.00 138.70 ? 169 GLU A OE1    1 
ATOM   1831  O  OE2    . GLU A 1 150 ? -18.093 43.684 229.176 1.00 145.09 ? 169 GLU A OE2    1 
ATOM   1832  H  H      . GLU A 1 150 ? -19.867 38.005 227.938 1.00 175.75 ? 169 GLU A H      1 
ATOM   1833  H  HA     . GLU A 1 150 ? -20.985 40.130 227.055 1.00 160.78 ? 169 GLU A HA     1 
ATOM   1834  H  HB2    . GLU A 1 150 ? -19.680 40.146 228.992 1.00 162.54 ? 169 GLU A HB2    1 
ATOM   1835  H  HB3    . GLU A 1 150 ? -18.370 39.981 228.111 1.00 162.54 ? 169 GLU A HB3    1 
ATOM   1836  H  HG2    . GLU A 1 150 ? -18.714 42.101 227.207 1.00 123.22 ? 169 GLU A HG2    1 
ATOM   1837  H  HG3    . GLU A 1 150 ? -20.019 42.267 228.099 1.00 123.22 ? 169 GLU A HG3    1 
ATOM   1838  N  N      . PHE A 1 151 ? -18.418 39.379 225.289 1.00 86.23  ? 170 PHE A N      1 
ATOM   1839  C  CA     . PHE A 1 151 ? -17.813 39.613 223.983 1.00 103.41 ? 170 PHE A CA     1 
ATOM   1840  C  C      . PHE A 1 151 ? -18.818 39.371 222.863 1.00 103.58 ? 170 PHE A C      1 
ATOM   1841  O  O      . PHE A 1 151 ? -18.973 40.203 221.959 1.00 103.94 ? 170 PHE A O      1 
ATOM   1842  C  CB     . PHE A 1 151 ? -16.591 38.715 223.812 1.00 116.26 ? 170 PHE A CB     1 
ATOM   1843  C  CG     . PHE A 1 151 ? -15.692 39.132 222.691 1.00 84.32  ? 170 PHE A CG     1 
ATOM   1844  C  CD1    . PHE A 1 151 ? -15.900 38.661 221.409 1.00 80.94  ? 170 PHE A CD1    1 
ATOM   1845  C  CD2    . PHE A 1 151 ? -14.636 39.997 222.920 1.00 88.05  ? 170 PHE A CD2    1 
ATOM   1846  C  CE1    . PHE A 1 151 ? -15.070 39.042 220.375 1.00 84.77  ? 170 PHE A CE1    1 
ATOM   1847  C  CE2    . PHE A 1 151 ? -13.803 40.380 221.894 1.00 77.66  ? 170 PHE A CE2    1 
ATOM   1848  C  CZ     . PHE A 1 151 ? -14.020 39.903 220.617 1.00 95.86  ? 170 PHE A CZ     1 
ATOM   1849  H  H      . PHE A 1 151 ? -18.032 38.773 225.762 1.00 103.47 ? 170 PHE A H      1 
ATOM   1850  H  HA     . PHE A 1 151 ? -17.519 40.536 223.930 1.00 124.09 ? 170 PHE A HA     1 
ATOM   1851  H  HB2    . PHE A 1 151 ? -16.072 38.733 224.631 1.00 139.51 ? 170 PHE A HB2    1 
ATOM   1852  H  HB3    . PHE A 1 151 ? -16.890 37.810 223.631 1.00 139.51 ? 170 PHE A HB3    1 
ATOM   1853  H  HD1    . PHE A 1 151 ? -16.606 38.080 221.241 1.00 97.12  ? 170 PHE A HD1    1 
ATOM   1854  H  HD2    . PHE A 1 151 ? -14.485 40.320 223.779 1.00 105.66 ? 170 PHE A HD2    1 
ATOM   1855  H  HE1    . PHE A 1 151 ? -15.219 38.720 219.516 1.00 101.72 ? 170 PHE A HE1    1 
ATOM   1856  H  HE2    . PHE A 1 151 ? -13.097 40.962 222.059 1.00 93.19  ? 170 PHE A HE2    1 
ATOM   1857  H  HZ     . PHE A 1 151 ? -13.460 40.162 219.921 1.00 115.04 ? 170 PHE A HZ     1 
ATOM   1858  N  N      . GLN A 1 152 ? -19.512 38.230 222.905 1.00 114.19 ? 171 GLN A N      1 
ATOM   1859  C  CA     . GLN A 1 152 ? -20.536 37.954 221.902 1.00 100.90 ? 171 GLN A CA     1 
ATOM   1860  C  C      . GLN A 1 152 ? -21.519 39.110 221.799 1.00 108.14 ? 171 GLN A C      1 
ATOM   1861  O  O      . GLN A 1 152 ? -21.976 39.452 220.703 1.00 127.88 ? 171 GLN A O      1 
ATOM   1862  C  CB     . GLN A 1 152 ? -21.276 36.660 222.242 1.00 130.98 ? 171 GLN A CB     1 
ATOM   1863  C  CG     . GLN A 1 152 ? -21.834 35.930 221.020 1.00 136.50 ? 171 GLN A CG     1 
ATOM   1864  C  CD     . GLN A 1 152 ? -23.327 35.678 221.081 1.00 128.50 ? 171 GLN A CD     1 
ATOM   1865  O  OE1    . GLN A 1 152 ? -23.987 35.986 222.072 1.00 142.21 ? 171 GLN A OE1    1 
ATOM   1866  N  NE2    . GLN A 1 152 ? -23.867 35.103 220.013 1.00 157.56 ? 171 GLN A NE2    1 
ATOM   1867  H  H      . GLN A 1 152 ? -19.410 37.612 223.494 1.00 137.02 ? 171 GLN A H      1 
ATOM   1868  H  HA     . GLN A 1 152 ? -20.111 37.842 221.038 1.00 121.08 ? 171 GLN A HA     1 
ATOM   1869  H  HB2    . GLN A 1 152 ? -20.663 36.058 222.692 1.00 157.18 ? 171 GLN A HB2    1 
ATOM   1870  H  HB3    . GLN A 1 152 ? -22.020 36.870 222.827 1.00 157.18 ? 171 GLN A HB3    1 
ATOM   1871  H  HG2    . GLN A 1 152 ? -21.657 36.463 220.230 1.00 163.81 ? 171 GLN A HG2    1 
ATOM   1872  H  HG3    . GLN A 1 152 ? -21.392 35.070 220.941 1.00 163.81 ? 171 GLN A HG3    1 
ATOM   1873  H  HE21   . GLN A 1 152 ? -23.373 34.897 219.339 1.00 189.07 ? 171 GLN A HE21   1 
ATOM   1874  H  HE22   . GLN A 1 152 ? -24.711 34.937 219.994 1.00 189.07 ? 171 GLN A HE22   1 
ATOM   1875  N  N      . ARG A 1 153 ? -21.860 39.726 222.934 1.00 123.98 ? 172 ARG A N      1 
ATOM   1876  C  CA     . ARG A 1 153 ? -22.739 40.890 222.902 1.00 130.23 ? 172 ARG A CA     1 
ATOM   1877  C  C      . ARG A 1 153 ? -22.048 42.100 222.286 1.00 121.44 ? 172 ARG A C      1 
ATOM   1878  O  O      . ARG A 1 153 ? -22.706 42.926 221.643 1.00 155.70 ? 172 ARG A O      1 
ATOM   1879  C  CB     . ARG A 1 153 ? -23.226 41.228 224.311 1.00 147.26 ? 172 ARG A CB     1 
ATOM   1880  C  CG     . ARG A 1 153 ? -24.198 42.402 224.363 1.00 140.70 ? 172 ARG A CG     1 
ATOM   1881  C  CD     . ARG A 1 153 ? -24.637 42.705 225.784 1.00 128.58 ? 172 ARG A CD     1 
ATOM   1882  N  NE     . ARG A 1 153 ? -23.508 43.051 226.641 1.00 120.66 ? 172 ARG A NE     1 
ATOM   1883  C  CZ     . ARG A 1 153 ? -22.989 44.269 226.753 1.00 118.87 ? 172 ARG A CZ     1 
ATOM   1884  N  NH1    . ARG A 1 153 ? -23.489 45.283 226.058 1.00 125.00 ? 172 ARG A NH1    1 
ATOM   1885  N  NH2    . ARG A 1 153 ? -21.961 44.476 227.564 1.00 113.12 ? 172 ARG A NH2    1 
ATOM   1886  H  H      . ARG A 1 153 ? -21.599 39.493 223.720 1.00 148.78 ? 172 ARG A H      1 
ATOM   1887  H  HA     . ARG A 1 153 ? -23.516 40.682 222.359 1.00 156.27 ? 172 ARG A HA     1 
ATOM   1888  H  HB2    . ARG A 1 153 ? -23.677 40.453 224.680 1.00 176.71 ? 172 ARG A HB2    1 
ATOM   1889  H  HB3    . ARG A 1 153 ? -22.459 41.454 224.860 1.00 176.71 ? 172 ARG A HB3    1 
ATOM   1890  H  HG2    . ARG A 1 153 ? -23.764 43.192 224.005 1.00 168.84 ? 172 ARG A HG2    1 
ATOM   1891  H  HG3    . ARG A 1 153 ? -24.987 42.187 223.842 1.00 168.84 ? 172 ARG A HG3    1 
ATOM   1892  H  HD2    . ARG A 1 153 ? -25.251 43.456 225.774 1.00 154.29 ? 172 ARG A HD2    1 
ATOM   1893  H  HD3    . ARG A 1 153 ? -25.072 41.923 226.157 1.00 154.29 ? 172 ARG A HD3    1 
ATOM   1894  H  HE     . ARG A 1 153 ? -23.153 42.421 227.108 1.00 144.79 ? 172 ARG A HE     1 
ATOM   1895  H  HH11   . ARG A 1 153 ? -24.156 45.155 225.530 1.00 150.00 ? 172 ARG A HH11   1 
ATOM   1896  H  HH12   . ARG A 1 153 ? -23.147 46.068 226.136 1.00 150.00 ? 172 ARG A HH12   1 
ATOM   1897  H  HH21   . ARG A 1 153 ? -21.633 43.822 228.017 1.00 135.75 ? 172 ARG A HH21   1 
ATOM   1898  H  HH22   . ARG A 1 153 ? -21.623 45.263 227.638 1.00 135.75 ? 172 ARG A HH22   1 
ATOM   1899  N  N      . GLN A 1 154 ? -20.731 42.229 222.470 1.00 118.24 ? 173 GLN A N      1 
ATOM   1900  C  CA     . GLN A 1 154 ? -20.018 43.365 221.898 1.00 100.45 ? 173 GLN A CA     1 
ATOM   1901  C  C      . GLN A 1 154 ? -19.913 43.255 220.386 1.00 96.08  ? 173 GLN A C      1 
ATOM   1902  O  O      . GLN A 1 154 ? -19.797 44.277 219.700 1.00 101.19 ? 173 GLN A O      1 
ATOM   1903  C  CB     . GLN A 1 154 ? -18.624 43.480 222.511 1.00 109.44 ? 173 GLN A CB     1 
ATOM   1904  C  CG     . GLN A 1 154 ? -18.630 43.745 224.002 1.00 107.92 ? 173 GLN A CG     1 
ATOM   1905  C  CD     . GLN A 1 154 ? -19.335 45.036 224.360 1.00 109.40 ? 173 GLN A CD     1 
ATOM   1906  O  OE1    . GLN A 1 154 ? -20.304 45.038 225.116 1.00 154.85 ? 173 GLN A OE1    1 
ATOM   1907  N  NE2    . GLN A 1 154 ? -18.852 46.145 223.816 1.00 109.26 ? 173 GLN A NE2    1 
ATOM   1908  H  H      . GLN A 1 154 ? -20.239 41.681 222.914 1.00 141.89 ? 173 GLN A H      1 
ATOM   1909  H  HA     . GLN A 1 154 ? -20.504 44.179 222.105 1.00 120.54 ? 173 GLN A HA     1 
ATOM   1910  H  HB2    . GLN A 1 154 ? -18.147 42.649 222.360 1.00 131.33 ? 173 GLN A HB2    1 
ATOM   1911  H  HB3    . GLN A 1 154 ? -18.153 44.212 222.082 1.00 131.33 ? 173 GLN A HB3    1 
ATOM   1912  H  HG2    . GLN A 1 154 ? -19.090 43.018 224.450 1.00 129.50 ? 173 GLN A HG2    1 
ATOM   1913  H  HG3    . GLN A 1 154 ? -17.715 43.804 224.316 1.00 129.50 ? 173 GLN A HG3    1 
ATOM   1914  H  HE21   . GLN A 1 154 ? -18.173 46.105 223.290 1.00 131.12 ? 173 GLN A HE21   1 
ATOM   1915  H  HE22   . GLN A 1 154 ? -19.218 46.903 223.989 1.00 131.12 ? 173 GLN A HE22   1 
ATOM   1916  N  N      . LEU A 1 155 ? -19.943 42.035 219.846 1.00 122.53 ? 174 LEU A N      1 
ATOM   1917  C  CA     . LEU A 1 155 ? -19.924 41.878 218.395 1.00 109.00 ? 174 LEU A CA     1 
ATOM   1918  C  C      . LEU A 1 155 ? -21.159 42.507 217.760 1.00 123.97 ? 174 LEU A C      1 
ATOM   1919  O  O      . LEU A 1 155 ? -21.051 43.335 216.849 1.00 125.61 ? 174 LEU A O      1 
ATOM   1920  C  CB     . LEU A 1 155 ? -19.826 40.397 218.025 1.00 109.03 ? 174 LEU A CB     1 
ATOM   1921  C  CG     . LEU A 1 155 ? -18.500 39.696 218.330 1.00 90.43  ? 174 LEU A CG     1 
ATOM   1922  C  CD1    . LEU A 1 155 ? -18.588 38.217 217.991 1.00 111.96 ? 174 LEU A CD1    1 
ATOM   1923  C  CD2    . LEU A 1 155 ? -17.359 40.340 217.570 1.00 81.91  ? 174 LEU A CD2    1 
ATOM   1924  H  H      . LEU A 1 155 ? -19.974 41.298 220.289 1.00 147.04 ? 174 LEU A H      1 
ATOM   1925  H  HA     . LEU A 1 155 ? -19.142 42.328 218.038 1.00 130.80 ? 174 LEU A HA     1 
ATOM   1926  H  HB2    . LEU A 1 155 ? -20.520 39.919 218.506 1.00 130.84 ? 174 LEU A HB2    1 
ATOM   1927  H  HB3    . LEU A 1 155 ? -19.982 40.312 217.071 1.00 130.84 ? 174 LEU A HB3    1 
ATOM   1928  H  HG     . LEU A 1 155 ? -18.311 39.775 219.278 1.00 108.52 ? 174 LEU A HG     1 
ATOM   1929  H  HD11   . LEU A 1 155 ? -17.737 37.797 218.192 1.00 134.35 ? 174 LEU A HD11   1 
ATOM   1930  H  HD12   . LEU A 1 155 ? -19.291 37.813 218.522 1.00 134.35 ? 174 LEU A HD12   1 
ATOM   1931  H  HD13   . LEU A 1 155 ? -18.789 38.122 217.047 1.00 134.35 ? 174 LEU A HD13   1 
ATOM   1932  H  HD21   . LEU A 1 155 ? -16.535 39.875 217.785 1.00 98.29  ? 174 LEU A HD21   1 
ATOM   1933  H  HD22   . LEU A 1 155 ? -17.538 40.276 216.619 1.00 98.29  ? 174 LEU A HD22   1 
ATOM   1934  H  HD23   . LEU A 1 155 ? -17.291 41.271 217.833 1.00 98.29  ? 174 LEU A HD23   1 
ATOM   1935  N  N      . HIS A 1 156 ? -22.344 42.125 218.229 1.00 122.74 ? 175 HIS A N      1 
ATOM   1936  C  CA     . HIS A 1 156 ? -23.601 42.596 217.664 1.00 154.15 ? 175 HIS A CA     1 
ATOM   1937  C  C      . HIS A 1 156 ? -24.211 43.656 218.570 1.00 153.71 ? 175 HIS A C      1 
ATOM   1938  O  O      . HIS A 1 156 ? -24.407 43.420 219.766 1.00 160.82 ? 175 HIS A O      1 
ATOM   1939  C  CB     . HIS A 1 156 ? -24.582 41.436 217.479 1.00 155.97 ? 175 HIS A CB     1 
ATOM   1940  C  CG     . HIS A 1 156 ? -25.882 41.836 216.850 1.00 171.30 ? 175 HIS A CG     1 
ATOM   1941  N  ND1    . HIS A 1 156 ? -25.962 42.365 215.579 1.00 165.05 ? 175 HIS A ND1    1 
ATOM   1942  C  CD2    . HIS A 1 156 ? -27.153 41.783 217.315 1.00 169.38 ? 175 HIS A CD2    1 
ATOM   1943  C  CE1    . HIS A 1 156 ? -27.225 42.622 215.290 1.00 159.45 ? 175 HIS A CE1    1 
ATOM   1944  N  NE2    . HIS A 1 156 ? -27.968 42.278 216.326 1.00 167.41 ? 175 HIS A NE2    1 
ATOM   1945  H  H      . HIS A 1 156 ? -22.445 41.581 218.888 1.00 147.29 ? 175 HIS A H      1 
ATOM   1946  H  HA     . HIS A 1 156 ? -23.434 42.996 216.796 1.00 184.98 ? 175 HIS A HA     1 
ATOM   1947  H  HB2    . HIS A 1 156 ? -24.171 40.767 216.910 1.00 187.16 ? 175 HIS A HB2    1 
ATOM   1948  H  HB3    . HIS A 1 156 ? -24.779 41.052 218.348 1.00 187.16 ? 175 HIS A HB3    1 
ATOM   1949  H  HD2    . HIS A 1 156 ? -27.423 41.471 218.149 1.00 203.26 ? 175 HIS A HD2    1 
ATOM   1950  H  HE1    . HIS A 1 156 ? -27.538 42.983 214.492 1.00 191.34 ? 175 HIS A HE1    1 
ATOM   1951  H  HE2    . HIS A 1 156 ? -28.824 42.352 216.374 1.00 200.89 ? 175 HIS A HE2    1 
ATOM   1952  N  N      . TRP A 1 157 ? -24.516 44.814 217.997 1.00 131.11 ? 176 TRP A N      1 
ATOM   1953  C  CA     . TRP A 1 157 ? -25.140 45.899 218.745 1.00 155.69 ? 176 TRP A CA     1 
ATOM   1954  C  C      . TRP A 1 157 ? -26.524 45.499 219.240 1.00 154.67 ? 176 TRP A C      1 
ATOM   1955  O  O      . TRP A 1 157 ? -27.048 46.085 220.190 1.00 141.89 ? 176 TRP A O      1 
ATOM   1956  C  CB     . TRP A 1 157 ? -25.240 47.154 217.878 1.00 156.36 ? 176 TRP A CB     1 
ATOM   1957  C  CG     . TRP A 1 157 ? -26.340 47.093 216.870 1.00 148.02 ? 176 TRP A CG     1 
ATOM   1958  C  CD1    . TRP A 1 157 ? -27.580 47.649 216.979 1.00 159.81 ? 176 TRP A CD1    1 
ATOM   1959  C  CD2    . TRP A 1 157 ? -26.307 46.431 215.601 1.00 162.76 ? 176 TRP A CD2    1 
ATOM   1960  N  NE1    . TRP A 1 157 ? -28.321 47.377 215.856 1.00 190.29 ? 176 TRP A NE1    1 
ATOM   1961  C  CE2    . TRP A 1 157 ? -27.563 46.630 214.994 1.00 189.39 ? 176 TRP A CE2    1 
ATOM   1962  C  CE3    . TRP A 1 157 ? -25.338 45.690 214.918 1.00 137.81 ? 176 TRP A CE3    1 
ATOM   1963  C  CZ2    . TRP A 1 157 ? -27.875 46.116 213.737 1.00 172.87 ? 176 TRP A CZ2    1 
ATOM   1964  C  CZ3    . TRP A 1 157 ? -25.649 45.180 213.672 1.00 148.41 ? 176 TRP A CZ3    1 
ATOM   1965  C  CH2    . TRP A 1 157 ? -26.907 45.396 213.094 1.00 178.20 ? 176 TRP A CH2    1 
ATOM   1966  H  H      . TRP A 1 157 ? -24.372 44.999 217.169 1.00 157.33 ? 176 TRP A H      1 
ATOM   1967  H  HA     . TRP A 1 157 ? -24.591 46.108 219.518 1.00 186.82 ? 176 TRP A HA     1 
ATOM   1968  H  HB2    . TRP A 1 157 ? -25.403 47.920 218.451 1.00 187.64 ? 176 TRP A HB2    1 
ATOM   1969  H  HB3    . TRP A 1 157 ? -24.404 47.273 217.399 1.00 187.64 ? 176 TRP A HB3    1 
ATOM   1970  H  HD1    . TRP A 1 157 ? -27.880 48.142 217.709 1.00 191.78 ? 176 TRP A HD1    1 
ATOM   1971  H  HE1    . TRP A 1 157 ? -29.130 47.634 215.716 1.00 228.35 ? 176 TRP A HE1    1 
ATOM   1972  H  HE3    . TRP A 1 157 ? -24.501 45.542 215.295 1.00 165.37 ? 176 TRP A HE3    1 
ATOM   1973  H  HZ2    . TRP A 1 157 ? -28.709 46.258 213.351 1.00 207.44 ? 176 TRP A HZ2    1 
ATOM   1974  H  HZ3    . TRP A 1 157 ? -25.012 44.686 213.208 1.00 178.09 ? 176 TRP A HZ3    1 
ATOM   1975  H  HH2    . TRP A 1 157 ? -27.088 45.041 212.253 1.00 213.84 ? 176 TRP A HH2    1 
ATOM   1976  N  N      . PRO A 1 190 ? -27.512 50.892 211.295 1.00 147.61 ? 209 PRO A N      1 
ATOM   1977  C  CA     . PRO A 1 190 ? -26.217 51.416 211.746 1.00 155.37 ? 209 PRO A CA     1 
ATOM   1978  C  C      . PRO A 1 190 ? -25.408 52.049 210.611 1.00 148.84 ? 209 PRO A C      1 
ATOM   1979  O  O      . PRO A 1 190 ? -25.012 51.332 209.689 1.00 149.73 ? 209 PRO A O      1 
ATOM   1980  C  CB     . PRO A 1 190 ? -25.510 50.174 212.283 1.00 165.21 ? 209 PRO A CB     1 
ATOM   1981  C  CG     . PRO A 1 190 ? -26.101 49.049 211.518 1.00 179.69 ? 209 PRO A CG     1 
ATOM   1982  C  CD     . PRO A 1 190 ? -27.536 49.419 211.286 1.00 151.74 ? 209 PRO A CD     1 
ATOM   1983  H  HA     . PRO A 1 190 ? -26.338 52.059 212.462 1.00 186.44 ? 209 PRO A HA     1 
ATOM   1984  H  HB2    . PRO A 1 190 ? -24.557 50.241 212.116 1.00 198.25 ? 209 PRO A HB2    1 
ATOM   1985  H  HB3    . PRO A 1 190 ? -25.689 50.078 213.231 1.00 198.25 ? 209 PRO A HB3    1 
ATOM   1986  H  HG2    . PRO A 1 190 ? -25.634 48.949 210.674 1.00 215.63 ? 209 PRO A HG2    1 
ATOM   1987  H  HG3    . PRO A 1 190 ? -26.040 48.234 212.041 1.00 215.63 ? 209 PRO A HG3    1 
ATOM   1988  H  HD2    . PRO A 1 190 ? -27.835 49.091 210.423 1.00 182.09 ? 209 PRO A HD2    1 
ATOM   1989  H  HD3    . PRO A 1 190 ? -28.093 49.085 212.006 1.00 182.09 ? 209 PRO A HD3    1 
ATOM   1990  N  N      . PRO A 1 191 ? -25.163 53.361 210.670 1.00 138.96 ? 210 PRO A N      1 
ATOM   1991  C  CA     . PRO A 1 191 ? -24.382 54.004 209.605 1.00 155.54 ? 210 PRO A CA     1 
ATOM   1992  C  C      . PRO A 1 191 ? -22.888 53.750 209.739 1.00 137.19 ? 210 PRO A C      1 
ATOM   1993  O  O      . PRO A 1 191 ? -22.457 52.974 210.596 1.00 131.05 ? 210 PRO A O      1 
ATOM   1994  C  CB     . PRO A 1 191 ? -24.723 55.489 209.772 1.00 163.56 ? 210 PRO A CB     1 
ATOM   1995  C  CG     . PRO A 1 191 ? -25.010 55.638 211.205 1.00 161.72 ? 210 PRO A CG     1 
ATOM   1996  C  CD     . PRO A 1 191 ? -25.637 54.339 211.662 1.00 152.76 ? 210 PRO A CD     1 
ATOM   1997  H  HA     . PRO A 1 191 ? -24.683 53.700 208.734 1.00 186.65 ? 210 PRO A HA     1 
ATOM   1998  H  HB2    . PRO A 1 191 ? -23.963 56.033 209.513 1.00 196.27 ? 210 PRO A HB2    1 
ATOM   1999  H  HB3    . PRO A 1 191 ? -25.503 55.709 209.239 1.00 196.27 ? 210 PRO A HB3    1 
ATOM   2000  H  HG2    . PRO A 1 191 ? -24.183 55.801 211.684 1.00 194.06 ? 210 PRO A HG2    1 
ATOM   2001  H  HG3    . PRO A 1 191 ? -25.627 56.375 211.335 1.00 194.06 ? 210 PRO A HG3    1 
ATOM   2002  H  HD2    . PRO A 1 191 ? -25.319 54.103 212.548 1.00 183.32 ? 210 PRO A HD2    1 
ATOM   2003  H  HD3    . PRO A 1 191 ? -26.605 54.403 211.638 1.00 183.32 ? 210 PRO A HD3    1 
ATOM   2004  N  N      . GLU A 1 192 ? -22.091 54.409 208.897 1.00 171.92 ? 211 GLU A N      1 
ATOM   2005  C  CA     . GLU A 1 192 ? -20.662 54.119 208.832 1.00 161.13 ? 211 GLU A CA     1 
ATOM   2006  C  C      . GLU A 1 192 ? -19.960 54.500 210.129 1.00 125.32 ? 211 GLU A C      1 
ATOM   2007  O  O      . GLU A 1 192 ? -19.422 53.640 210.836 1.00 141.75 ? 211 GLU A O      1 
ATOM   2008  C  CB     . GLU A 1 192 ? -20.037 54.853 207.644 1.00 134.29 ? 211 GLU A CB     1 
ATOM   2009  H  H      . GLU A 1 192 ? -22.353 55.025 208.357 1.00 206.31 ? 211 GLU A H      1 
ATOM   2010  H  HA     . GLU A 1 192 ? -20.539 53.166 208.694 1.00 193.36 ? 211 GLU A HA     1 
ATOM   2011  N  N      . ASN A 1 193 ? -19.953 55.790 210.458 1.00 122.81 ? 212 ASN A N      1 
ATOM   2012  C  CA     . ASN A 1 193 ? -19.248 56.270 211.639 1.00 127.40 ? 212 ASN A CA     1 
ATOM   2013  C  C      . ASN A 1 193 ? -20.245 56.808 212.655 1.00 136.57 ? 212 ASN A C      1 
ATOM   2014  O  O      . ASN A 1 193 ? -20.171 57.972 213.061 1.00 145.72 ? 212 ASN A O      1 
ATOM   2015  C  CB     . ASN A 1 193 ? -18.230 57.342 211.253 1.00 138.75 ? 212 ASN A CB     1 
ATOM   2016  C  CG     . ASN A 1 193 ? -17.419 57.833 212.436 1.00 136.95 ? 212 ASN A CG     1 
ATOM   2017  O  OD1    . ASN A 1 193 ? -17.582 57.355 213.557 1.00 127.84 ? 212 ASN A OD1    1 
ATOM   2018  N  ND2    . ASN A 1 193 ? -16.525 58.785 212.186 1.00 116.56 ? 212 ASN A ND2    1 
ATOM   2019  H  H      . ASN A 1 193 ? -20.351 56.408 210.011 1.00 147.37 ? 212 ASN A H      1 
ATOM   2020  H  HA     . ASN A 1 193 ? -18.769 55.532 212.046 1.00 152.88 ? 212 ASN A HA     1 
ATOM   2021  H  HB2    . ASN A 1 193 ? -17.615 56.974 210.600 1.00 166.50 ? 212 ASN A HB2    1 
ATOM   2022  H  HB3    . ASN A 1 193 ? -18.700 58.102 210.875 1.00 166.50 ? 212 ASN A HB3    1 
ATOM   2023  H  HD21   . ASN A 1 193 ? -16.040 59.098 212.824 1.00 139.87 ? 212 ASN A HD21   1 
ATOM   2024  H  HD22   . ASN A 1 193 ? -16.431 59.088 211.387 1.00 139.87 ? 212 ASN A HD22   1 
ATOM   2025  N  N      . SER A 1 194 ? -21.188 55.963 213.065 1.00 135.62 ? 213 SER A N      1 
ATOM   2026  C  CA     . SER A 1 194 ? -22.172 56.362 214.051 1.00 130.50 ? 213 SER A CA     1 
ATOM   2027  C  C      . SER A 1 194 ? -21.497 56.751 215.365 1.00 125.03 ? 213 SER A C      1 
ATOM   2028  O  O      . SER A 1 194 ? -20.328 56.432 215.597 1.00 107.88 ? 213 SER A O      1 
ATOM   2029  C  CB     . SER A 1 194 ? -23.153 55.223 214.311 1.00 152.97 ? 213 SER A CB     1 
ATOM   2030  O  OG     . SER A 1 194 ? -22.460 54.020 214.583 1.00 160.92 ? 213 SER A OG     1 
ATOM   2031  H  H      . SER A 1 194 ? -21.275 55.155 212.785 1.00 162.75 ? 213 SER A H      1 
ATOM   2032  H  HA     . SER A 1 194 ? -22.668 57.127 213.722 1.00 156.60 ? 213 SER A HA     1 
ATOM   2033  H  HB2    . SER A 1 194 ? -23.706 55.450 215.075 1.00 183.57 ? 213 SER A HB2    1 
ATOM   2034  H  HB3    . SER A 1 194 ? -23.707 55.098 213.525 1.00 183.57 ? 213 SER A HB3    1 
ATOM   2035  H  HG     . SER A 1 194 ? -21.976 53.812 213.929 1.00 193.10 ? 213 SER A HG     1 
ATOM   2036  N  N      . PRO A 1 195 ? -22.218 57.458 216.241 1.00 150.17 ? 214 PRO A N      1 
ATOM   2037  C  CA     . PRO A 1 195 ? -21.768 57.524 217.641 1.00 124.89 ? 214 PRO A CA     1 
ATOM   2038  C  C      . PRO A 1 195 ? -21.876 56.180 218.333 1.00 113.22 ? 214 PRO A C      1 
ATOM   2039  O  O      . PRO A 1 195 ? -21.001 55.821 219.131 1.00 119.10 ? 214 PRO A O      1 
ATOM   2040  C  CB     . PRO A 1 195 ? -22.709 58.563 218.275 1.00 123.79 ? 214 PRO A CB     1 
ATOM   2041  C  CG     . PRO A 1 195 ? -23.422 59.227 217.132 1.00 137.17 ? 214 PRO A CG     1 
ATOM   2042  C  CD     . PRO A 1 195 ? -23.455 58.224 216.029 1.00 138.81 ? 214 PRO A CD     1 
ATOM   2043  H  HA     . PRO A 1 195 ? -20.853 57.843 217.690 1.00 149.86 ? 214 PRO A HA     1 
ATOM   2044  H  HB2    . PRO A 1 195 ? -23.343 58.114 218.857 1.00 148.55 ? 214 PRO A HB2    1 
ATOM   2045  H  HB3    . PRO A 1 195 ? -22.188 59.211 218.774 1.00 148.55 ? 214 PRO A HB3    1 
ATOM   2046  H  HG2    . PRO A 1 195 ? -24.322 59.463 217.404 1.00 164.60 ? 214 PRO A HG2    1 
ATOM   2047  H  HG3    . PRO A 1 195 ? -22.930 60.017 216.858 1.00 164.60 ? 214 PRO A HG3    1 
ATOM   2048  H  HD2    . PRO A 1 195 ? -24.231 57.648 216.117 1.00 166.57 ? 214 PRO A HD2    1 
ATOM   2049  H  HD3    . PRO A 1 195 ? -23.436 58.668 215.166 1.00 166.57 ? 214 PRO A HD3    1 
ATOM   2050  N  N      . LEU A 1 196 ? -22.939 55.428 218.042 1.00 118.11 ? 215 LEU A N      1 
ATOM   2051  C  CA     . LEU A 1 196 ? -23.132 54.089 218.584 1.00 110.79 ? 215 LEU A CA     1 
ATOM   2052  C  C      . LEU A 1 196 ? -21.964 53.181 218.230 1.00 120.82 ? 215 LEU A C      1 
ATOM   2053  O  O      . LEU A 1 196 ? -21.049 53.593 217.509 1.00 156.41 ? 215 LEU A O      1 
ATOM   2054  C  CB     . LEU A 1 196 ? -24.438 53.480 218.055 1.00 141.21 ? 215 LEU A CB     1 
ATOM   2055  C  CG     . LEU A 1 196 ? -25.737 54.255 218.263 1.00 130.89 ? 215 LEU A CG     1 
ATOM   2056  C  CD1    . LEU A 1 196 ? -26.713 53.926 217.147 1.00 143.25 ? 215 LEU A CD1    1 
ATOM   2057  C  CD2    . LEU A 1 196 ? -26.343 53.929 219.613 1.00 133.44 ? 215 LEU A CD2    1 
ATOM   2058  H  H      . LEU A 1 196 ? -23.575 55.681 217.522 1.00 141.73 ? 215 LEU A H      1 
ATOM   2059  H  HA     . LEU A 1 196 ? -23.192 54.141 219.551 1.00 132.95 ? 215 LEU A HA     1 
ATOM   2060  H  HB2    . LEU A 1 196 ? -24.339 53.350 217.099 1.00 169.45 ? 215 LEU A HB2    1 
ATOM   2061  H  HB3    . LEU A 1 196 ? -24.556 52.616 218.480 1.00 169.45 ? 215 LEU A HB3    1 
ATOM   2062  H  HG     . LEU A 1 196 ? -25.550 55.207 218.234 1.00 157.07 ? 215 LEU A HG     1 
ATOM   2063  H  HD11   . LEU A 1 196 ? -27.534 54.424 217.289 1.00 171.90 ? 215 LEU A HD11   1 
ATOM   2064  H  HD12   . LEU A 1 196 ? -26.317 54.176 216.297 1.00 171.90 ? 215 LEU A HD12   1 
ATOM   2065  H  HD13   . LEU A 1 196 ? -26.897 52.974 217.160 1.00 171.90 ? 215 LEU A HD13   1 
ATOM   2066  H  HD21   . LEU A 1 196 ? -27.165 54.433 219.720 1.00 160.13 ? 215 LEU A HD21   1 
ATOM   2067  H  HD22   . LEU A 1 196 ? -26.530 52.978 219.653 1.00 160.13 ? 215 LEU A HD22   1 
ATOM   2068  H  HD23   . LEU A 1 196 ? -25.713 54.171 220.309 1.00 160.13 ? 215 LEU A HD23   1 
ATOM   2069  N  N      . MET A 1 197 ? -22.013 51.938 218.699 1.00 105.49 ? 216 MET A N      1 
ATOM   2070  C  CA     . MET A 1 197 ? -21.014 50.921 218.374 1.00 126.37 ? 216 MET A CA     1 
ATOM   2071  C  C      . MET A 1 197 ? -19.602 51.504 218.349 1.00 115.88 ? 216 MET A C      1 
ATOM   2072  O  O      . MET A 1 197 ? -18.807 51.274 217.435 1.00 148.17 ? 216 MET A O      1 
ATOM   2073  C  CB     . MET A 1 197 ? -21.353 50.204 217.058 1.00 68.89  ? 216 MET A CB     1 
ATOM   2074  C  CG     . MET A 1 197 ? -22.183 50.985 216.021 1.00 50.59  ? 216 MET A CG     1 
ATOM   2075  S  SD     . MET A 1 197 ? -21.164 51.846 214.809 1.00 86.35  ? 216 MET A SD     1 
ATOM   2076  C  CE     . MET A 1 197 ? -21.684 50.956 213.333 1.00 45.08  ? 216 MET A CE     1 
ATOM   2077  H  H      . MET A 1 197 ? -22.633 51.651 219.222 1.00 126.58 ? 216 MET A H      1 
ATOM   2078  H  HA     . MET A 1 197 ? -21.042 50.248 219.072 1.00 151.65 ? 216 MET A HA     1 
ATOM   2079  H  HB2    . MET A 1 197 ? -20.519 49.958 216.627 1.00 82.66  ? 216 MET A HB2    1 
ATOM   2080  H  HB3    . MET A 1 197 ? -21.850 49.400 217.273 1.00 82.66  ? 216 MET A HB3    1 
ATOM   2081  H  HG2    . MET A 1 197 ? -22.755 50.364 215.543 1.00 60.71  ? 216 MET A HG2    1 
ATOM   2082  H  HG3    . MET A 1 197 ? -22.722 51.646 216.482 1.00 60.71  ? 216 MET A HG3    1 
ATOM   2083  H  HE1    . MET A 1 197 ? -21.210 51.313 212.566 1.00 54.09  ? 216 MET A HE1    1 
ATOM   2084  H  HE2    . MET A 1 197 ? -21.475 50.015 213.443 1.00 54.09  ? 216 MET A HE2    1 
ATOM   2085  H  HE3    . MET A 1 197 ? -22.640 51.072 213.215 1.00 54.09  ? 216 MET A HE3    1 
ATOM   2086  N  N      . GLU A 1 198 ? -19.305 52.290 219.376 1.00 107.12 ? 217 GLU A N      1 
ATOM   2087  C  CA     . GLU A 1 198 ? -17.945 52.505 219.842 1.00 90.52  ? 217 GLU A CA     1 
ATOM   2088  C  C      . GLU A 1 198 ? -17.774 51.597 221.052 1.00 115.19 ? 217 GLU A C      1 
ATOM   2089  O  O      . GLU A 1 198 ? -18.458 51.777 222.066 1.00 149.36 ? 217 GLU A O      1 
ATOM   2090  C  CB     . GLU A 1 198 ? -17.698 53.967 220.217 1.00 99.94  ? 217 GLU A CB     1 
ATOM   2091  C  CG     . GLU A 1 198 ? -16.445 54.574 219.605 1.00 120.79 ? 217 GLU A CG     1 
ATOM   2092  C  CD     . GLU A 1 198 ? -16.698 55.172 218.233 1.00 129.55 ? 217 GLU A CD     1 
ATOM   2093  O  OE1    . GLU A 1 198 ? -17.492 54.591 217.466 1.00 127.13 ? 217 GLU A OE1    1 
ATOM   2094  O  OE2    . GLU A 1 198 ? -16.108 56.230 217.923 1.00 134.50 ? 217 GLU A OE2    1 
ATOM   2095  H  H      . GLU A 1 198 ? -19.894 52.722 219.831 1.00 128.54 ? 217 GLU A H      1 
ATOM   2096  H  HA     . GLU A 1 198 ? -17.312 52.241 219.156 1.00 108.62 ? 217 GLU A HA     1 
ATOM   2097  H  HB2    . GLU A 1 198 ? -18.455 54.495 219.920 1.00 119.92 ? 217 GLU A HB2    1 
ATOM   2098  H  HB3    . GLU A 1 198 ? -17.614 54.029 221.181 1.00 119.92 ? 217 GLU A HB3    1 
ATOM   2099  H  HG2    . GLU A 1 198 ? -16.120 55.280 220.185 1.00 144.95 ? 217 GLU A HG2    1 
ATOM   2100  H  HG3    . GLU A 1 198 ? -15.771 53.883 219.512 1.00 144.95 ? 217 GLU A HG3    1 
ATOM   2101  N  N      . ARG A 1 199 ? -16.900 50.603 220.940 1.00 105.28 ? 218 ARG A N      1 
ATOM   2102  C  CA     . ARG A 1 199 ? -16.773 49.578 221.965 1.00 74.07  ? 218 ARG A CA     1 
ATOM   2103  C  C      . ARG A 1 199 ? -15.535 49.847 222.809 1.00 75.63  ? 218 ARG A C      1 
ATOM   2104  O  O      . ARG A 1 199 ? -14.464 50.143 222.274 1.00 85.58  ? 218 ARG A O      1 
ATOM   2105  C  CB     . ARG A 1 199 ? -16.702 48.188 221.336 1.00 73.83  ? 218 ARG A CB     1 
ATOM   2106  C  CG     . ARG A 1 199 ? -17.795 47.902 220.320 1.00 82.22  ? 218 ARG A CG     1 
ATOM   2107  C  CD     . ARG A 1 199 ? -19.172 48.281 220.826 1.00 104.39 ? 218 ARG A CD     1 
ATOM   2108  N  NE     . ARG A 1 199 ? -20.215 47.629 220.041 1.00 112.20 ? 218 ARG A NE     1 
ATOM   2109  C  CZ     . ARG A 1 199 ? -21.501 47.955 220.081 1.00 107.47 ? 218 ARG A CZ     1 
ATOM   2110  N  NH1    . ARG A 1 199 ? -21.922 48.940 220.863 1.00 113.53 ? 218 ARG A NH1    1 
ATOM   2111  N  NH2    . ARG A 1 199 ? -22.368 47.300 219.326 1.00 112.59 ? 218 ARG A NH2    1 
ATOM   2112  H  H      . ARG A 1 199 ? -16.365 50.501 220.274 1.00 126.34 ? 218 ARG A H      1 
ATOM   2113  H  HA     . ARG A 1 199 ? -17.550 49.609 222.546 1.00 88.88  ? 218 ARG A HA     1 
ATOM   2114  H  HB2    . ARG A 1 199 ? -15.849 48.094 220.885 1.00 88.60  ? 218 ARG A HB2    1 
ATOM   2115  H  HB3    . ARG A 1 199 ? -16.774 47.524 222.040 1.00 88.60  ? 218 ARG A HB3    1 
ATOM   2116  H  HG2    . ARG A 1 199 ? -17.620 48.413 219.515 1.00 98.67  ? 218 ARG A HG2    1 
ATOM   2117  H  HG3    . ARG A 1 199 ? -17.799 46.954 220.118 1.00 98.67  ? 218 ARG A HG3    1 
ATOM   2118  H  HD2    . ARG A 1 199 ? -19.264 48.000 221.750 1.00 125.27 ? 218 ARG A HD2    1 
ATOM   2119  H  HD3    . ARG A 1 199 ? -19.289 49.241 220.753 1.00 125.27 ? 218 ARG A HD3    1 
ATOM   2120  H  HE     . ARG A 1 199 ? -19.980 46.991 219.515 1.00 134.64 ? 218 ARG A HE     1 
ATOM   2121  H  HH11   . ARG A 1 199 ? -21.362 49.369 221.354 1.00 136.23 ? 218 ARG A HH11   1 
ATOM   2122  H  HH12   . ARG A 1 199 ? -22.757 49.147 220.882 1.00 136.23 ? 218 ARG A HH12   1 
ATOM   2123  H  HH21   . ARG A 1 199 ? -22.099 46.662 218.816 1.00 135.11 ? 218 ARG A HH21   1 
ATOM   2124  H  HH22   . ARG A 1 199 ? -23.202 47.510 219.347 1.00 135.11 ? 218 ARG A HH22   1 
ATOM   2125  N  N      . CYS A 1 200 ? -15.697 49.766 224.136 1.00 76.43  ? 219 CYS A N      1 
ATOM   2126  C  CA     . CYS A 1 200 ? -14.584 49.895 225.076 1.00 73.19  ? 219 CYS A CA     1 
ATOM   2127  C  C      . CYS A 1 200 ? -14.942 49.037 226.293 1.00 109.71 ? 219 CYS A C      1 
ATOM   2128  O  O      . CYS A 1 200 ? -15.464 49.516 227.302 1.00 112.48 ? 219 CYS A O      1 
ATOM   2129  C  CB     . CYS A 1 200 ? -14.321 51.349 225.464 1.00 75.14  ? 219 CYS A CB     1 
ATOM   2130  S  SG     . CYS A 1 200 ? -13.057 51.547 226.742 1.00 122.52 ? 219 CYS A SG     1 
ATOM   2131  H  H      . CYS A 1 200 ? -16.455 49.634 224.518 1.00 91.71  ? 219 CYS A H      1 
ATOM   2132  H  HA     . CYS A 1 200 ? -13.778 49.535 224.673 1.00 87.82  ? 219 CYS A HA     1 
ATOM   2133  H  HB2    . CYS A 1 200 ? -14.025 51.833 224.677 1.00 90.17  ? 219 CYS A HB2    1 
ATOM   2134  H  HB3    . CYS A 1 200 ? -15.144 51.736 225.799 1.00 90.17  ? 219 CYS A HB3    1 
ATOM   2135  H  HG     . CYS A 1 200 ? -12.921 52.716 226.979 1.00 147.02 ? 219 CYS A HG     1 
ATOM   2136  N  N      . PHE A 1 201 ? -14.653 47.742 226.185 1.00 109.08 ? 220 PHE A N      1 
ATOM   2137  C  CA     . PHE A 1 201 ? -15.068 46.762 227.177 1.00 77.26  ? 220 PHE A CA     1 
ATOM   2138  C  C      . PHE A 1 201 ? -13.858 45.987 227.668 1.00 83.69  ? 220 PHE A C      1 
ATOM   2139  O  O      . PHE A 1 201 ? -12.826 45.927 227.001 1.00 76.04  ? 220 PHE A O      1 
ATOM   2140  C  CB     . PHE A 1 201 ? -16.100 45.786 226.598 1.00 81.48  ? 220 PHE A CB     1 
ATOM   2141  C  CG     . PHE A 1 201 ? -15.582 44.973 225.455 1.00 61.10  ? 220 PHE A CG     1 
ATOM   2142  C  CD1    . PHE A 1 201 ? -15.510 45.511 224.186 1.00 74.81  ? 220 PHE A CD1    1 
ATOM   2143  C  CD2    . PHE A 1 201 ? -15.173 43.668 225.646 1.00 90.79  ? 220 PHE A CD2    1 
ATOM   2144  C  CE1    . PHE A 1 201 ? -15.033 44.765 223.126 1.00 81.28  ? 220 PHE A CE1    1 
ATOM   2145  C  CE2    . PHE A 1 201 ? -14.695 42.915 224.588 1.00 109.23 ? 220 PHE A CE2    1 
ATOM   2146  C  CZ     . PHE A 1 201 ? -14.625 43.466 223.326 1.00 65.47  ? 220 PHE A CZ     1 
ATOM   2147  H  H      . PHE A 1 201 ? -14.209 47.402 225.531 1.00 130.90 ? 220 PHE A H      1 
ATOM   2148  H  HA     . PHE A 1 201 ? -15.468 47.219 227.933 1.00 92.71  ? 220 PHE A HA     1 
ATOM   2149  H  HB2    . PHE A 1 201 ? -16.378 45.174 227.297 1.00 97.77  ? 220 PHE A HB2    1 
ATOM   2150  H  HB3    . PHE A 1 201 ? -16.865 46.292 226.281 1.00 97.77  ? 220 PHE A HB3    1 
ATOM   2151  H  HD1    . PHE A 1 201 ? -15.783 46.388 224.044 1.00 89.77  ? 220 PHE A HD1    1 
ATOM   2152  H  HD2    . PHE A 1 201 ? -15.217 43.292 226.495 1.00 108.94 ? 220 PHE A HD2    1 
ATOM   2153  H  HE1    . PHE A 1 201 ? -14.988 45.140 222.277 1.00 97.54  ? 220 PHE A HE1    1 
ATOM   2154  H  HE2    . PHE A 1 201 ? -14.420 42.038 224.729 1.00 131.07 ? 220 PHE A HE2    1 
ATOM   2155  H  HZ     . PHE A 1 201 ? -14.304 42.962 222.613 1.00 78.56  ? 220 PHE A HZ     1 
ATOM   2156  N  N      . ILE A 1 202 ? -13.997 45.381 228.843 1.00 116.37 ? 221 ILE A N      1 
ATOM   2157  C  CA     . ILE A 1 202 ? -12.927 44.602 229.453 1.00 77.07  ? 221 ILE A CA     1 
ATOM   2158  C  C      . ILE A 1 202 ? -13.214 43.124 229.240 1.00 77.38  ? 221 ILE A C      1 
ATOM   2159  O  O      . ILE A 1 202 ? -14.372 42.688 229.291 1.00 87.70  ? 221 ILE A O      1 
ATOM   2160  C  CB     . ILE A 1 202 ? -12.780 44.923 230.952 1.00 63.96  ? 221 ILE A CB     1 
ATOM   2161  C  CG1    . ILE A 1 202 ? -12.432 46.402 231.162 1.00 82.64  ? 221 ILE A CG1    1 
ATOM   2162  C  CG2    . ILE A 1 202 ? -11.696 44.054 231.576 1.00 66.13  ? 221 ILE A CG2    1 
ATOM   2163  C  CD1    . ILE A 1 202 ? -13.630 47.336 231.203 1.00 110.17 ? 221 ILE A CD1    1 
ATOM   2164  H  H      . ILE A 1 202 ? -14.716 45.408 229.314 1.00 139.64 ? 221 ILE A H      1 
ATOM   2165  H  HA     . ILE A 1 202 ? -12.088 44.814 229.015 1.00 92.49  ? 221 ILE A HA     1 
ATOM   2166  H  HB     . ILE A 1 202 ? -13.623 44.736 231.395 1.00 76.75  ? 221 ILE A HB     1 
ATOM   2167  H  HG12   . ILE A 1 202 ? -11.959 46.493 232.004 1.00 99.17  ? 221 ILE A HG12   1 
ATOM   2168  H  HG13   . ILE A 1 202 ? -11.859 46.691 230.434 1.00 99.17  ? 221 ILE A HG13   1 
ATOM   2169  H  HG21   . ILE A 1 202 ? -11.620 44.273 232.519 1.00 79.36  ? 221 ILE A HG21   1 
ATOM   2170  H  HG22   . ILE A 1 202 ? -11.940 43.121 231.471 1.00 79.36  ? 221 ILE A HG22   1 
ATOM   2171  H  HG23   . ILE A 1 202 ? -10.854 44.229 231.127 1.00 79.36  ? 221 ILE A HG23   1 
ATOM   2172  H  HD11   . ILE A 1 202 ? -13.318 48.245 231.338 1.00 132.21 ? 221 ILE A HD11   1 
ATOM   2173  H  HD12   . ILE A 1 202 ? -14.109 47.272 230.362 1.00 132.21 ? 221 ILE A HD12   1 
ATOM   2174  H  HD13   . ILE A 1 202 ? -14.210 47.073 231.935 1.00 132.21 ? 221 ILE A HD13   1 
ATOM   2175  N  N      . CYS A 1 203 ? -12.157 42.350 229.011 1.00 91.96  ? 222 CYS A N      1 
ATOM   2176  C  CA     . CYS A 1 203 ? -12.297 40.926 228.758 1.00 82.80  ? 222 CYS A CA     1 
ATOM   2177  C  C      . CYS A 1 203 ? -10.989 40.225 229.112 1.00 60.64  ? 222 CYS A C      1 
ATOM   2178  O  O      . CYS A 1 203 ? -9.908  40.819 229.047 1.00 116.51 ? 222 CYS A O      1 
ATOM   2179  C  CB     . CYS A 1 203 ? -12.681 40.674 227.297 1.00 57.94  ? 222 CYS A CB     1 
ATOM   2180  S  SG     . CYS A 1 203 ? -13.113 38.978 226.909 1.00 99.67  ? 222 CYS A SG     1 
ATOM   2181  H  H      . CYS A 1 203 ? -11.345 42.630 228.996 1.00 110.35 ? 222 CYS A H      1 
ATOM   2182  H  HA     . CYS A 1 203 ? -12.998 40.566 229.324 1.00 99.37  ? 222 CYS A HA     1 
ATOM   2183  H  HB2    . CYS A 1 203 ? -13.447 41.228 227.080 1.00 69.53  ? 222 CYS A HB2    1 
ATOM   2184  H  HB3    . CYS A 1 203 ? -11.931 40.921 226.734 1.00 69.53  ? 222 CYS A HB3    1 
ATOM   2185  H  HG     . CYS A 1 203 ? -13.393 38.903 225.745 1.00 119.60 ? 222 CYS A HG     1 
ATOM   2186  N  N      . ARG A 1 204 ? -11.106 38.960 229.500 1.00 59.58  ? 223 ARG A N      1 
ATOM   2187  C  CA     . ARG A 1 204 ? -9.955  38.130 229.826 1.00 68.53  ? 223 ARG A CA     1 
ATOM   2188  C  C      . ARG A 1 204 ? -9.703  37.158 228.685 1.00 68.62  ? 223 ARG A C      1 
ATOM   2189  O  O      . ARG A 1 204 ? -10.618 36.451 228.248 1.00 75.94  ? 223 ARG A O      1 
ATOM   2190  C  CB     . ARG A 1 204 ? -10.176 37.360 231.126 1.00 80.86  ? 223 ARG A CB     1 
ATOM   2191  C  CG     . ARG A 1 204 ? -10.299 38.242 232.346 1.00 90.44  ? 223 ARG A CG     1 
ATOM   2192  C  CD     . ARG A 1 204 ? -10.599 37.421 233.581 1.00 94.26  ? 223 ARG A CD     1 
ATOM   2193  N  NE     . ARG A 1 204 ? -11.962 36.901 233.560 1.00 105.42 ? 223 ARG A NE     1 
ATOM   2194  C  CZ     . ARG A 1 204 ? -12.470 36.092 234.482 1.00 91.20  ? 223 ARG A CZ     1 
ATOM   2195  N  NH1    . ARG A 1 204 ? -11.726 35.692 235.506 1.00 116.89 ? 223 ARG A NH1    1 
ATOM   2196  N  NH2    . ARG A 1 204 ? -13.725 35.677 234.376 1.00 61.79  ? 223 ARG A NH2    1 
ATOM   2197  H  H      . ARG A 1 204 ? -11.858 38.552 229.585 1.00 71.49  ? 223 ARG A H      1 
ATOM   2198  H  HA     . ARG A 1 204 ? -9.171  38.691 229.930 1.00 82.24  ? 223 ARG A HA     1 
ATOM   2199  H  HB2    . ARG A 1 204 ? -10.995 36.846 231.049 1.00 97.03  ? 223 ARG A HB2    1 
ATOM   2200  H  HB3    . ARG A 1 204 ? -9.425  36.762 231.267 1.00 97.03  ? 223 ARG A HB3    1 
ATOM   2201  H  HG2    . ARG A 1 204 ? -9.463  38.713 232.488 1.00 108.53 ? 223 ARG A HG2    1 
ATOM   2202  H  HG3    . ARG A 1 204 ? -11.023 38.874 232.216 1.00 108.53 ? 223 ARG A HG3    1 
ATOM   2203  H  HD2    . ARG A 1 204 ? -9.988  36.669 233.621 1.00 113.12 ? 223 ARG A HD2    1 
ATOM   2204  H  HD3    . ARG A 1 204 ? -10.499 37.978 234.368 1.00 113.12 ? 223 ARG A HD3    1 
ATOM   2205  H  HE     . ARG A 1 204 ? -12.471 37.135 232.907 1.00 126.51 ? 223 ARG A HE     1 
ATOM   2206  H  HH11   . ARG A 1 204 ? -10.912 35.961 235.577 1.00 140.27 ? 223 ARG A HH11   1 
ATOM   2207  H  HH12   . ARG A 1 204 ? -12.058 35.167 236.101 1.00 140.27 ? 223 ARG A HH12   1 
ATOM   2208  H  HH21   . ARG A 1 204 ? -14.208 35.933 233.712 1.00 74.14  ? 223 ARG A HH21   1 
ATOM   2209  H  HH22   . ARG A 1 204 ? -14.056 35.150 234.970 1.00 74.14  ? 223 ARG A HH22   1 
ATOM   2210  N  N      . LEU A 1 205 ? -8.467  37.127 228.206 1.00 57.21  ? 224 LEU A N      1 
ATOM   2211  C  CA     . LEU A 1 205 ? -8.088  36.276 227.093 1.00 70.69  ? 224 LEU A CA     1 
ATOM   2212  C  C      . LEU A 1 205 ? -7.019  35.294 227.541 1.00 60.40  ? 224 LEU A C      1 
ATOM   2213  O  O      . LEU A 1 205 ? -6.095  35.659 228.269 1.00 43.76  ? 224 LEU A O      1 
ATOM   2214  C  CB     . LEU A 1 205 ? -7.572  37.103 225.918 1.00 77.82  ? 224 LEU A CB     1 
ATOM   2215  C  CG     . LEU A 1 205 ? -8.641  37.491 224.897 1.00 88.88  ? 224 LEU A CG     1 
ATOM   2216  C  CD1    . LEU A 1 205 ? -9.663  38.439 225.502 1.00 81.73  ? 224 LEU A CD1    1 
ATOM   2217  C  CD2    . LEU A 1 205 ? -7.995  38.108 223.676 1.00 81.74  ? 224 LEU A CD2    1 
ATOM   2218  H  H      . LEU A 1 205 ? -7.820  37.601 228.516 1.00 68.66  ? 224 LEU A H      1 
ATOM   2219  H  HA     . LEU A 1 205 ? -8.861  35.771 226.796 1.00 84.82  ? 224 LEU A HA     1 
ATOM   2220  H  HB2    . LEU A 1 205 ? -7.183  37.922 226.263 1.00 93.38  ? 224 LEU A HB2    1 
ATOM   2221  H  HB3    . LEU A 1 205 ? -6.893  36.590 225.452 1.00 93.38  ? 224 LEU A HB3    1 
ATOM   2222  H  HG     . LEU A 1 205 ? -9.110  36.691 224.614 1.00 106.66 ? 224 LEU A HG     1 
ATOM   2223  H  HD11   . LEU A 1 205 ? -10.323 38.663 224.828 1.00 98.08  ? 224 LEU A HD11   1 
ATOM   2224  H  HD12   . LEU A 1 205 ? -10.092 38.002 226.254 1.00 98.08  ? 224 LEU A HD12   1 
ATOM   2225  H  HD13   . LEU A 1 205 ? -9.209  39.243 225.801 1.00 98.08  ? 224 LEU A HD13   1 
ATOM   2226  H  HD21   . LEU A 1 205 ? -8.687  38.347 223.040 1.00 98.08  ? 224 LEU A HD21   1 
ATOM   2227  H  HD22   . LEU A 1 205 ? -7.503  38.900 223.945 1.00 98.08  ? 224 LEU A HD22   1 
ATOM   2228  H  HD23   . LEU A 1 205 ? -7.390  37.461 223.279 1.00 98.08  ? 224 LEU A HD23   1 
ATOM   2229  N  N      . ARG A 1 206 ? -7.156  34.049 227.097 1.00 70.95  ? 225 ARG A N      1 
ATOM   2230  C  CA     . ARG A 1 206 ? -6.169  33.018 227.382 1.00 60.61  ? 225 ARG A CA     1 
ATOM   2231  C  C      . ARG A 1 206 ? -4.755  33.556 227.203 1.00 59.92  ? 225 ARG A C      1 
ATOM   2232  O  O      . ARG A 1 206 ? -4.486  34.345 226.294 1.00 69.58  ? 225 ARG A O      1 
ATOM   2233  C  CB     . ARG A 1 206 ? -6.397  31.825 226.450 1.00 90.59  ? 225 ARG A CB     1 
ATOM   2234  C  CG     . ARG A 1 206 ? -5.577  30.602 226.794 1.00 85.81  ? 225 ARG A CG     1 
ATOM   2235  C  CD     . ARG A 1 206 ? -6.266  29.739 227.839 1.00 110.94 ? 225 ARG A CD     1 
ATOM   2236  N  NE     . ARG A 1 206 ? -5.351  29.362 228.911 1.00 103.32 ? 225 ARG A NE     1 
ATOM   2237  C  CZ     . ARG A 1 206 ? -4.310  28.549 228.756 1.00 95.63  ? 225 ARG A CZ     1 
ATOM   2238  N  NH1    . ARG A 1 206 ? -4.039  28.028 227.566 1.00 107.81 ? 225 ARG A NH1    1 
ATOM   2239  N  NH2    . ARG A 1 206 ? -3.532  28.264 229.790 1.00 89.78  ? 225 ARG A NH2    1 
ATOM   2240  H  H      . ARG A 1 206 ? -7.820  33.774 226.624 1.00 85.14  ? 225 ARG A H      1 
ATOM   2241  H  HA     . ARG A 1 206 ? -6.270  32.717 228.298 1.00 72.73  ? 225 ARG A HA     1 
ATOM   2242  H  HB2    . ARG A 1 206 ? -7.333  31.573 226.491 1.00 108.70 ? 225 ARG A HB2    1 
ATOM   2243  H  HB3    . ARG A 1 206 ? -6.169  32.088 225.545 1.00 108.70 ? 225 ARG A HB3    1 
ATOM   2244  H  HG2    . ARG A 1 206 ? -5.450  30.067 225.995 1.00 102.97 ? 225 ARG A HG2    1 
ATOM   2245  H  HG3    . ARG A 1 206 ? -4.719  30.882 227.150 1.00 102.97 ? 225 ARG A HG3    1 
ATOM   2246  H  HD2    . ARG A 1 206 ? -7.002  30.237 228.230 1.00 133.12 ? 225 ARG A HD2    1 
ATOM   2247  H  HD3    . ARG A 1 206 ? -6.594  28.929 227.420 1.00 133.12 ? 225 ARG A HD3    1 
ATOM   2248  H  HE     . ARG A 1 206 ? -5.500  29.677 229.697 1.00 123.99 ? 225 ARG A HE     1 
ATOM   2249  H  HH11   . ARG A 1 206 ? -4.540  28.211 226.892 1.00 129.37 ? 225 ARG A HH11   1 
ATOM   2250  H  HH12   . ARG A 1 206 ? -3.364  27.504 227.470 1.00 129.37 ? 225 ARG A HH12   1 
ATOM   2251  H  HH21   . ARG A 1 206 ? -3.703  28.601 230.563 1.00 107.74 ? 225 ARG A HH21   1 
ATOM   2252  H  HH22   . ARG A 1 206 ? -2.858  27.740 229.689 1.00 107.74 ? 225 ARG A HH22   1 
ATOM   2253  N  N      . CYS A 1 207 ? -3.851  33.127 228.082 1.00 81.30  ? 226 CYS A N      1 
ATOM   2254  C  CA     . CYS A 1 207 ? -2.444  33.491 227.982 1.00 54.44  ? 226 CYS A CA     1 
ATOM   2255  C  C      . CYS A 1 207 ? -1.577  32.273 228.254 1.00 85.44  ? 226 CYS A C      1 
ATOM   2256  O  O      . CYS A 1 207 ? -1.919  31.416 229.073 1.00 115.25 ? 226 CYS A O      1 
ATOM   2257  C  CB     . CYS A 1 207 ? -2.061  34.602 228.958 1.00 61.62  ? 226 CYS A CB     1 
ATOM   2258  S  SG     . CYS A 1 207 ? -0.279  34.933 228.980 1.00 89.35  ? 226 CYS A SG     1 
ATOM   2259  H  H      . CYS A 1 207 ? -4.031  32.618 228.752 1.00 97.56  ? 226 CYS A H      1 
ATOM   2260  H  HA     . CYS A 1 207 ? -2.259  33.801 227.082 1.00 65.33  ? 226 CYS A HA     1 
ATOM   2261  H  HB2    . CYS A 1 207 ? -2.514  35.419 228.700 1.00 73.95  ? 226 CYS A HB2    1 
ATOM   2262  H  HB3    . CYS A 1 207 ? -2.329  34.342 229.853 1.00 73.95  ? 226 CYS A HB3    1 
ATOM   2263  H  HG     . CYS A 1 207 ? -0.055  35.812 229.765 1.00 107.22 ? 226 CYS A HG     1 
ATOM   2264  N  N      . LEU A 1 208 ? -0.437  32.221 227.565 1.00 52.01  ? 227 LEU A N      1 
ATOM   2265  C  CA     . LEU A 1 208 ? 0.460   31.074 227.600 1.00 61.67  ? 227 LEU A CA     1 
ATOM   2266  C  C      . LEU A 1 208 ? 1.800   31.389 228.255 1.00 48.17  ? 227 LEU A C      1 
ATOM   2267  O  O      . LEU A 1 208 ? 2.731   30.581 228.159 1.00 109.67 ? 227 LEU A O      1 
ATOM   2268  C  CB     . LEU A 1 208 ? 0.691   30.552 226.179 1.00 83.87  ? 227 LEU A CB     1 
ATOM   2269  C  CG     . LEU A 1 208 ? -0.393  29.667 225.556 1.00 65.02  ? 227 LEU A CG     1 
ATOM   2270  C  CD1    . LEU A 1 208 ? -1.751  30.349 225.507 1.00 56.78  ? 227 LEU A CD1    1 
ATOM   2271  C  CD2    . LEU A 1 208 ? 0.043   29.253 224.156 1.00 82.68  ? 227 LEU A CD2    1 
ATOM   2272  H  H      . LEU A 1 208 ? -0.157  32.857 227.058 1.00 62.41  ? 227 LEU A H      1 
ATOM   2273  H  HA     . LEU A 1 208 ? 0.040   30.365 228.111 1.00 74.00  ? 227 LEU A HA     1 
ATOM   2274  H  HB2    . LEU A 1 208 ? 0.802   31.317 225.594 1.00 100.65 ? 227 LEU A HB2    1 
ATOM   2275  H  HB3    . LEU A 1 208 ? 1.512   30.034 226.181 1.00 100.65 ? 227 LEU A HB3    1 
ATOM   2276  H  HG     . LEU A 1 208 ? -0.484  28.862 226.089 1.00 78.02  ? 227 LEU A HG     1 
ATOM   2277  H  HD11   . LEU A 1 208 ? -2.394  29.744 225.105 1.00 68.13  ? 227 LEU A HD11   1 
ATOM   2278  H  HD12   . LEU A 1 208 ? -2.026  30.570 226.411 1.00 68.13  ? 227 LEU A HD12   1 
ATOM   2279  H  HD13   . LEU A 1 208 ? -1.679  31.157 224.976 1.00 68.13  ? 227 LEU A HD13   1 
ATOM   2280  H  HD21   . LEU A 1 208 ? -0.646  28.693 223.764 1.00 99.21  ? 227 LEU A HD21   1 
ATOM   2281  H  HD22   . LEU A 1 208 ? 0.168   30.049 223.616 1.00 99.21  ? 227 LEU A HD22   1 
ATOM   2282  H  HD23   . LEU A 1 208 ? 0.875   28.760 224.218 1.00 99.21  ? 227 LEU A HD23   1 
ATOM   2283  N  N      . LEU A 1 209 ? 1.923   32.531 228.917 1.00 55.84  ? 228 LEU A N      1 
ATOM   2284  C  CA     . LEU A 1 209 ? 3.184   32.945 229.512 1.00 90.68  ? 228 LEU A CA     1 
ATOM   2285  C  C      . LEU A 1 209 ? 3.241   32.564 230.986 1.00 109.13 ? 228 LEU A C      1 
ATOM   2286  O  O      . LEU A 1 209 ? 2.220   32.307 231.628 1.00 98.23  ? 228 LEU A O      1 
ATOM   2287  C  CB     . LEU A 1 209 ? 3.383   34.454 229.356 1.00 100.59 ? 228 LEU A CB     1 
ATOM   2288  C  CG     . LEU A 1 209 ? 3.945   34.902 228.007 1.00 85.07  ? 228 LEU A CG     1 
ATOM   2289  C  CD1    . LEU A 1 209 ? 3.166   34.286 226.851 1.00 82.27  ? 228 LEU A CD1    1 
ATOM   2290  C  CD2    . LEU A 1 209 ? 3.928   36.423 227.920 1.00 90.33  ? 228 LEU A CD2    1 
ATOM   2291  H  H      . LEU A 1 209 ? 1.282   33.091 229.036 1.00 67.01  ? 228 LEU A H      1 
ATOM   2292  H  HA     . LEU A 1 209 ? 3.913   32.496 229.056 1.00 108.82 ? 228 LEU A HA     1 
ATOM   2293  H  HB2    . LEU A 1 209 ? 2.526   34.892 229.474 1.00 120.71 ? 228 LEU A HB2    1 
ATOM   2294  H  HB3    . LEU A 1 209 ? 3.999   34.756 230.042 1.00 120.71 ? 228 LEU A HB3    1 
ATOM   2295  H  HG     . LEU A 1 209 ? 4.867   34.608 227.937 1.00 102.08 ? 228 LEU A HG     1 
ATOM   2296  H  HD11   . LEU A 1 209 ? 3.549   34.591 226.014 1.00 98.72  ? 228 LEU A HD11   1 
ATOM   2297  H  HD12   . LEU A 1 209 ? 3.225   33.319 226.910 1.00 98.72  ? 228 LEU A HD12   1 
ATOM   2298  H  HD13   . LEU A 1 209 ? 2.239   34.564 226.912 1.00 98.72  ? 228 LEU A HD13   1 
ATOM   2299  H  HD21   . LEU A 1 209 ? 4.287   36.694 227.060 1.00 108.40 ? 228 LEU A HD21   1 
ATOM   2300  H  HD22   . LEU A 1 209 ? 3.014   36.734 228.010 1.00 108.40 ? 228 LEU A HD22   1 
ATOM   2301  H  HD23   . LEU A 1 209 ? 4.474   36.786 228.636 1.00 108.40 ? 228 LEU A HD23   1 
ATOM   2302  N  N      . ASP A 1 210 ? 4.460   32.532 231.515 1.00 79.79  ? 229 ASP A N      1 
ATOM   2303  C  CA     . ASP A 1 210 ? 4.679   32.239 232.925 1.00 105.30 ? 229 ASP A CA     1 
ATOM   2304  C  C      . ASP A 1 210 ? 4.257   33.425 233.793 1.00 103.08 ? 229 ASP A C      1 
ATOM   2305  O  O      . ASP A 1 210 ? 4.222   34.569 233.333 1.00 80.88  ? 229 ASP A O      1 
ATOM   2306  C  CB     . ASP A 1 210 ? 6.148   31.896 233.177 1.00 113.56 ? 229 ASP A CB     1 
ATOM   2307  H  H      . ASP A 1 210 ? 5.183   32.678 231.072 1.00 95.74  ? 229 ASP A H      1 
ATOM   2308  H  HA     . ASP A 1 210 ? 4.142   31.473 233.178 1.00 126.36 ? 229 ASP A HA     1 
ATOM   2309  N  N      . SER A 1 212 ? 0.827   34.653 234.524 1.00 98.91  ? 231 SER A N      1 
ATOM   2310  C  CA     . SER A 1 212 ? -0.376  34.510 233.710 1.00 99.66  ? 231 SER A CA     1 
ATOM   2311  C  C      . SER A 1 212 ? -1.458  33.746 234.457 1.00 89.85  ? 231 SER A C      1 
ATOM   2312  O  O      . SER A 1 212 ? -2.573  34.243 234.629 1.00 126.11 ? 231 SER A O      1 
ATOM   2313  C  CB     . SER A 1 212 ? -0.060  33.792 232.394 1.00 100.84 ? 231 SER A CB     1 
ATOM   2314  O  OG     . SER A 1 212 ? 0.350   32.456 232.625 1.00 69.88  ? 231 SER A OG     1 
ATOM   2315  H  H      . SER A 1 212 ? 1.008   35.465 234.742 1.00 118.69 ? 231 SER A H      1 
ATOM   2316  H  HA     . SER A 1 212 ? -0.721  35.392 233.497 1.00 119.59 ? 231 SER A HA     1 
ATOM   2317  H  HB2    . SER A 1 212 ? -0.857  33.786 231.840 1.00 121.01 ? 231 SER A HB2    1 
ATOM   2318  H  HB3    . SER A 1 212 ? 0.654   34.266 231.940 1.00 121.01 ? 231 SER A HB3    1 
ATOM   2319  H  HG     . SER A 1 212 ? 1.040   32.446 233.104 1.00 83.86  ? 231 SER A HG     1 
ATOM   2320  N  N      . SER A 1 213 ? -1.122  32.536 234.907 1.00 86.98  ? 232 SER A N      1 
ATOM   2321  C  CA     . SER A 1 213 ? -2.120  31.610 235.442 1.00 110.38 ? 232 SER A CA     1 
ATOM   2322  C  C      . SER A 1 213 ? -3.258  31.431 234.444 1.00 116.96 ? 232 SER A C      1 
ATOM   2323  O  O      . SER A 1 213 ? -4.419  31.253 234.826 1.00 61.71  ? 232 SER A O      1 
ATOM   2324  C  CB     . SER A 1 213 ? -2.656  32.088 236.796 1.00 105.61 ? 232 SER A CB     1 
ATOM   2325  O  OG     . SER A 1 213 ? -3.394  33.293 236.658 1.00 101.95 ? 232 SER A OG     1 
ATOM   2326  H  H      . SER A 1 213 ? -0.319  32.226 234.912 1.00 104.38 ? 232 SER A H      1 
ATOM   2327  H  HA     . SER A 1 213 ? -1.703  30.744 235.577 1.00 132.45 ? 232 SER A HA     1 
ATOM   2328  H  HB2    . SER A 1 213 ? -3.236  31.404 237.164 1.00 126.73 ? 232 SER A HB2    1 
ATOM   2329  H  HB3    . SER A 1 213 ? -1.908  32.244 237.393 1.00 126.73 ? 232 SER A HB3    1 
ATOM   2330  H  HG     . SER A 1 213 ? -4.047  33.173 236.143 1.00 122.34 ? 232 SER A HG     1 
ATOM   2331  N  N      . GLY A 1 214 ? -2.917  31.493 233.153 1.00 123.15 ? 233 GLY A N      1 
ATOM   2332  C  CA     . GLY A 1 214 ? -3.897  31.532 232.085 1.00 71.62  ? 233 GLY A CA     1 
ATOM   2333  C  C      . GLY A 1 214 ? -4.777  32.754 232.218 1.00 77.13  ? 233 GLY A C      1 
ATOM   2334  O  O      . GLY A 1 214 ? -4.646  33.512 233.184 1.00 116.88 ? 233 GLY A O      1 
ATOM   2335  H  H      . GLY A 1 214 ? -2.104  31.513 232.873 1.00 147.78 ? 233 GLY A H      1 
ATOM   2336  H  HA2    . GLY A 1 214 ? -3.448  31.560 231.226 1.00 85.95  ? 233 GLY A HA2    1 
ATOM   2337  H  HA3    . GLY A 1 214 ? -4.455  30.739 232.121 1.00 85.95  ? 233 GLY A HA3    1 
ATOM   2338  N  N      . PHE A 1 215 ? -5.672  32.960 231.258 1.00 64.92  ? 234 PHE A N      1 
ATOM   2339  C  CA     . PHE A 1 215 ? -6.666  34.029 231.327 1.00 87.24  ? 234 PHE A CA     1 
ATOM   2340  C  C      . PHE A 1 215 ? -6.043  35.336 231.830 1.00 72.51  ? 234 PHE A C      1 
ATOM   2341  O  O      . PHE A 1 215 ? -6.283  35.793 232.947 1.00 99.91  ? 234 PHE A O      1 
ATOM   2342  C  CB     . PHE A 1 215 ? -7.832  33.614 232.227 1.00 99.86  ? 234 PHE A CB     1 
ATOM   2343  C  CG     . PHE A 1 215 ? -8.538  32.375 231.775 1.00 80.76  ? 234 PHE A CG     1 
ATOM   2344  C  CD1    . PHE A 1 215 ? -9.366  32.400 230.666 1.00 82.23  ? 234 PHE A CD1    1 
ATOM   2345  C  CD2    . PHE A 1 215 ? -8.388  31.186 232.468 1.00 94.14  ? 234 PHE A CD2    1 
ATOM   2346  C  CE1    . PHE A 1 215 ? -10.024 31.258 230.252 1.00 98.60  ? 234 PHE A CE1    1 
ATOM   2347  C  CE2    . PHE A 1 215 ? -9.045  30.042 232.060 1.00 120.91 ? 234 PHE A CE2    1 
ATOM   2348  C  CZ     . PHE A 1 215 ? -9.863  30.079 230.951 1.00 123.73 ? 234 PHE A CZ     1 
ATOM   2349  H  H      . PHE A 1 215 ? -5.725  32.486 230.543 1.00 77.90  ? 234 PHE A H      1 
ATOM   2350  H  HA     . PHE A 1 215 ? -7.017  34.189 230.437 1.00 104.69 ? 234 PHE A HA     1 
ATOM   2351  H  HB2    . PHE A 1 215 ? -7.494  33.452 233.122 1.00 119.84 ? 234 PHE A HB2    1 
ATOM   2352  H  HB3    . PHE A 1 215 ? -8.482  34.334 232.248 1.00 119.84 ? 234 PHE A HB3    1 
ATOM   2353  H  HD1    . PHE A 1 215 ? -9.477  33.193 230.193 1.00 98.68  ? 234 PHE A HD1    1 
ATOM   2354  H  HD2    . PHE A 1 215 ? -7.837  31.158 233.217 1.00 112.97 ? 234 PHE A HD2    1 
ATOM   2355  H  HE1    . PHE A 1 215 ? -10.575 31.284 229.504 1.00 118.32 ? 234 PHE A HE1    1 
ATOM   2356  H  HE2    . PHE A 1 215 ? -8.934  29.248 232.532 1.00 145.10 ? 234 PHE A HE2    1 
ATOM   2357  H  HZ     . PHE A 1 215 ? -10.305 29.309 230.673 1.00 148.48 ? 234 PHE A HZ     1 
ATOM   2358  N  N      . LEU A 1 216 ? -5.213  35.915 230.972 1.00 69.38  ? 235 LEU A N      1 
ATOM   2359  C  CA     . LEU A 1 216 ? -4.706  37.257 231.215 1.00 74.09  ? 235 LEU A CA     1 
ATOM   2360  C  C      . LEU A 1 216 ? -5.804  38.286 230.954 1.00 66.17  ? 235 LEU A C      1 
ATOM   2361  O  O      . LEU A 1 216 ? -6.407  38.319 229.877 1.00 25.20  ? 235 LEU A O      1 
ATOM   2362  C  CB     . LEU A 1 216 ? -3.492  37.527 230.327 1.00 83.60  ? 235 LEU A CB     1 
ATOM   2363  C  CG     . LEU A 1 216 ? -2.621  38.762 230.589 1.00 74.17  ? 235 LEU A CG     1 
ATOM   2364  C  CD1    . LEU A 1 216 ? -3.298  40.055 230.144 1.00 31.44  ? 235 LEU A CD1    1 
ATOM   2365  C  CD2    . LEU A 1 216 ? -2.217  38.832 232.061 1.00 125.14 ? 235 LEU A CD2    1 
ATOM   2366  H  H      . LEU A 1 216 ? -4.929  35.554 230.245 1.00 83.26  ? 235 LEU A H      1 
ATOM   2367  H  HA     . LEU A 1 216 ? -4.430  37.333 232.142 1.00 88.91  ? 235 LEU A HA     1 
ATOM   2368  H  HB2    . LEU A 1 216 ? -2.906  36.757 230.391 1.00 100.32 ? 235 LEU A HB2    1 
ATOM   2369  H  HB3    . LEU A 1 216 ? -3.810  37.602 229.413 1.00 100.32 ? 235 LEU A HB3    1 
ATOM   2370  H  HG     . LEU A 1 216 ? -1.806  38.672 230.072 1.00 89.00  ? 235 LEU A HG     1 
ATOM   2371  H  HD11   . LEU A 1 216 ? -2.707  40.801 230.332 1.00 37.73  ? 235 LEU A HD11   1 
ATOM   2372  H  HD12   . LEU A 1 216 ? -3.476  40.006 229.192 1.00 37.73  ? 235 LEU A HD12   1 
ATOM   2373  H  HD13   . LEU A 1 216 ? -4.129  40.161 230.632 1.00 37.73  ? 235 LEU A HD13   1 
ATOM   2374  H  HD21   . LEU A 1 216 ? -1.668  39.620 232.200 1.00 150.17 ? 235 LEU A HD21   1 
ATOM   2375  H  HD22   . LEU A 1 216 ? -3.017  38.886 232.606 1.00 150.17 ? 235 LEU A HD22   1 
ATOM   2376  H  HD23   . LEU A 1 216 ? -1.714  38.034 232.289 1.00 150.17 ? 235 LEU A HD23   1 
ATOM   2377  N  N      . ALA A 1 217 ? -6.063  39.128 231.947 1.00 113.35 ? 236 ALA A N      1 
ATOM   2378  C  CA     . ALA A 1 217 ? -7.118  40.124 231.840 1.00 79.73  ? 236 ALA A CA     1 
ATOM   2379  C  C      . ALA A 1 217 ? -6.605  41.362 231.118 1.00 68.64  ? 236 ALA A C      1 
ATOM   2380  O  O      . ALA A 1 217 ? -5.547  41.898 231.465 1.00 91.68  ? 236 ALA A O      1 
ATOM   2381  C  CB     . ALA A 1 217 ? -7.628  40.504 233.230 1.00 97.13  ? 236 ALA A CB     1 
ATOM   2382  H  H      . ALA A 1 217 ? -5.640  39.142 232.696 1.00 136.01 ? 236 ALA A H      1 
ATOM   2383  H  HA     . ALA A 1 217 ? -7.858  39.757 231.331 1.00 95.67  ? 236 ALA A HA     1 
ATOM   2384  H  HB1    . ALA A 1 217 ? -8.329  41.168 233.138 1.00 116.56 ? 236 ALA A HB1    1 
ATOM   2385  H  HB2    . ALA A 1 217 ? -7.977  39.711 233.665 1.00 116.56 ? 236 ALA A HB2    1 
ATOM   2386  H  HB3    . ALA A 1 217 ? -6.892  40.869 233.746 1.00 116.56 ? 236 ALA A HB3    1 
ATOM   2387  N  N      . MET A 1 218 ? -7.356  41.822 230.118 1.00 71.19  ? 237 MET A N      1 
ATOM   2388  C  CA     . MET A 1 218 ? -7.032  43.081 229.459 1.00 93.10  ? 237 MET A CA     1 
ATOM   2389  C  C      . MET A 1 218 ? -8.303  43.687 228.876 1.00 49.46  ? 237 MET A C      1 
ATOM   2390  O  O      . MET A 1 218 ? -9.403  43.160 229.045 1.00 76.88  ? 237 MET A O      1 
ATOM   2391  C  CB     . MET A 1 218 ? -5.959  42.891 228.393 1.00 95.47  ? 237 MET A CB     1 
ATOM   2392  C  CG     . MET A 1 218 ? -6.260  41.841 227.371 1.00 89.74  ? 237 MET A CG     1 
ATOM   2393  S  SD     . MET A 1 218 ? -4.830  41.601 226.304 1.00 80.84  ? 237 MET A SD     1 
ATOM   2394  C  CE     . MET A 1 218 ? -5.352  40.121 225.457 1.00 92.88  ? 237 MET A CE     1 
ATOM   2395  H  H      . MET A 1 218 ? -8.053  41.426 229.806 1.00 85.43  ? 237 MET A H      1 
ATOM   2396  H  HA     . MET A 1 218 ? -6.677  43.692 230.123 1.00 111.72 ? 237 MET A HA     1 
ATOM   2397  H  HB2    . MET A 1 218 ? -5.839  43.731 227.922 1.00 114.57 ? 237 MET A HB2    1 
ATOM   2398  H  HB3    . MET A 1 218 ? -5.129  42.643 228.830 1.00 114.57 ? 237 MET A HB3    1 
ATOM   2399  H  HG2    . MET A 1 218 ? -6.460  41.002 227.815 1.00 107.68 ? 237 MET A HG2    1 
ATOM   2400  H  HG3    . MET A 1 218 ? -7.010  42.124 226.824 1.00 107.68 ? 237 MET A HG3    1 
ATOM   2401  H  HE1    . MET A 1 218 ? -4.663  39.858 224.827 1.00 111.46 ? 237 MET A HE1    1 
ATOM   2402  H  HE2    . MET A 1 218 ? -5.491  39.417 226.109 1.00 111.46 ? 237 MET A HE2    1 
ATOM   2403  H  HE3    . MET A 1 218 ? -6.180  40.303 224.985 1.00 111.46 ? 237 MET A HE3    1 
ATOM   2404  N  N      . ASN A 1 219 ? -8.140  44.814 228.187 1.00 40.46  ? 238 ASN A N      1 
ATOM   2405  C  CA     . ASN A 1 219 ? -9.242  45.733 227.912 1.00 82.46  ? 238 ASN A CA     1 
ATOM   2406  C  C      . ASN A 1 219 ? -9.248  46.126 226.439 1.00 74.74  ? 238 ASN A C      1 
ATOM   2407  O  O      . ASN A 1 219 ? -8.341  46.820 225.971 1.00 82.97  ? 238 ASN A O      1 
ATOM   2408  C  CB     . ASN A 1 219 ? -9.124  46.964 228.814 1.00 110.34 ? 238 ASN A CB     1 
ATOM   2409  C  CG     . ASN A 1 219 ? -9.910  48.152 228.302 1.00 93.29  ? 238 ASN A CG     1 
ATOM   2410  O  OD1    . ASN A 1 219 ? -10.964 48.001 227.682 1.00 90.22  ? 238 ASN A OD1    1 
ATOM   2411  N  ND2    . ASN A 1 219 ? -9.401  49.348 228.569 1.00 79.26  ? 238 ASN A ND2    1 
ATOM   2412  H  H      . ASN A 1 219 ? -7.387  45.073 227.863 1.00 48.55  ? 238 ASN A H      1 
ATOM   2413  H  HA     . ASN A 1 219 ? -10.082 45.291 228.111 1.00 98.95  ? 238 ASN A HA     1 
ATOM   2414  H  HB2    . ASN A 1 219 ? -9.460  46.742 229.696 1.00 132.41 ? 238 ASN A HB2    1 
ATOM   2415  H  HB3    . ASN A 1 219 ? -8.192  47.225 228.870 1.00 132.41 ? 238 ASN A HB3    1 
ATOM   2416  H  HD21   . ASN A 1 219 ? -9.807  50.057 228.302 1.00 95.11  ? 238 ASN A HD21   1 
ATOM   2417  H  HD22   . ASN A 1 219 ? -8.666  49.414 229.010 1.00 95.11  ? 238 ASN A HD22   1 
ATOM   2418  N  N      . PHE A 1 220 ? -10.286 45.701 225.720 1.00 77.62  ? 239 PHE A N      1 
ATOM   2419  C  CA     . PHE A 1 220 ? -10.458 46.048 224.313 1.00 66.54  ? 239 PHE A CA     1 
ATOM   2420  C  C      . PHE A 1 220 ? -11.042 47.448 224.178 1.00 52.88  ? 239 PHE A C      1 
ATOM   2421  O  O      . PHE A 1 220 ? -12.182 47.695 224.592 1.00 89.79  ? 239 PHE A O      1 
ATOM   2422  C  CB     . PHE A 1 220 ? -11.370 45.037 223.623 1.00 64.38  ? 239 PHE A CB     1 
ATOM   2423  C  CG     . PHE A 1 220 ? -10.792 43.658 223.552 1.00 53.79  ? 239 PHE A CG     1 
ATOM   2424  C  CD1    . PHE A 1 220 ? -9.841  43.344 222.600 1.00 71.53  ? 239 PHE A CD1    1 
ATOM   2425  C  CD2    . PHE A 1 220 ? -11.188 42.680 224.442 1.00 77.00  ? 239 PHE A CD2    1 
ATOM   2426  C  CE1    . PHE A 1 220 ? -9.302  42.081 222.534 1.00 75.23  ? 239 PHE A CE1    1 
ATOM   2427  C  CE2    . PHE A 1 220 ? -10.652 41.415 224.380 1.00 83.96  ? 239 PHE A CE2    1 
ATOM   2428  C  CZ     . PHE A 1 220 ? -9.707  41.114 223.425 1.00 66.57  ? 239 PHE A CZ     1 
ATOM   2429  H  H      . PHE A 1 220 ? -10.914 45.203 226.031 1.00 93.15  ? 239 PHE A H      1 
ATOM   2430  H  HA     . PHE A 1 220 ? -9.595  46.033 223.871 1.00 79.85  ? 239 PHE A HA     1 
ATOM   2431  H  HB2    . PHE A 1 220 ? -12.205 44.984 224.112 1.00 77.26  ? 239 PHE A HB2    1 
ATOM   2432  H  HB3    . PHE A 1 220 ? -11.538 45.336 222.715 1.00 77.26  ? 239 PHE A HB3    1 
ATOM   2433  H  HD1    . PHE A 1 220 ? -9.564  43.994 221.995 1.00 85.84  ? 239 PHE A HD1    1 
ATOM   2434  H  HD2    . PHE A 1 220 ? -11.826 42.879 225.089 1.00 92.40  ? 239 PHE A HD2    1 
ATOM   2435  H  HE1    . PHE A 1 220 ? -8.665  41.881 221.887 1.00 90.28  ? 239 PHE A HE1    1 
ATOM   2436  H  HE2    . PHE A 1 220 ? -10.927 40.763 224.983 1.00 100.75 ? 239 PHE A HE2    1 
ATOM   2437  H  HZ     . PHE A 1 220 ? -9.345  40.259 223.381 1.00 79.89  ? 239 PHE A HZ     1 
ATOM   2438  N  N      . GLN A 1 221 ? -10.262 48.360 223.597 1.00 57.48  ? 240 GLN A N      1 
ATOM   2439  C  CA     . GLN A 1 221 ? -10.740 49.683 223.208 1.00 87.66  ? 240 GLN A CA     1 
ATOM   2440  C  C      . GLN A 1 221 ? -10.700 49.750 221.686 1.00 88.81  ? 240 GLN A C      1 
ATOM   2441  O  O      . GLN A 1 221 ? -9.623  49.690 221.078 1.00 85.05  ? 240 GLN A O      1 
ATOM   2442  C  CB     . GLN A 1 221 ? -9.897  50.790 223.838 1.00 108.06 ? 240 GLN A CB     1 
ATOM   2443  C  CG     . GLN A 1 221 ? -10.538 52.183 223.756 1.00 85.88  ? 240 GLN A CG     1 
ATOM   2444  C  CD     . GLN A 1 221 ? -9.942  53.061 222.667 1.00 72.87  ? 240 GLN A CD     1 
ATOM   2445  O  OE1    . GLN A 1 221 ? -8.772  52.928 222.313 1.00 113.12 ? 240 GLN A OE1    1 
ATOM   2446  N  NE2    . GLN A 1 221 ? -10.749 53.970 222.135 1.00 103.32 ? 240 GLN A NE2    1 
ATOM   2447  H  H      . GLN A 1 221 ? -9.432  48.230 223.413 1.00 68.97  ? 240 GLN A H      1 
ATOM   2448  H  HA     . GLN A 1 221 ? -11.659 49.794 223.498 1.00 105.20 ? 240 GLN A HA     1 
ATOM   2449  H  HB2    . GLN A 1 221 ? -9.759  50.583 224.775 1.00 129.67 ? 240 GLN A HB2    1 
ATOM   2450  H  HB3    . GLN A 1 221 ? -9.042  50.831 223.381 1.00 129.67 ? 240 GLN A HB3    1 
ATOM   2451  H  HG2    . GLN A 1 221 ? -11.485 52.082 223.572 1.00 103.05 ? 240 GLN A HG2    1 
ATOM   2452  H  HG3    . GLN A 1 221 ? -10.414 52.636 224.605 1.00 103.05 ? 240 GLN A HG3    1 
ATOM   2453  H  HE21   . GLN A 1 221 ? -11.561 54.038 222.410 1.00 123.99 ? 240 GLN A HE21   1 
ATOM   2454  H  HE22   . GLN A 1 221 ? -10.460 54.492 221.515 1.00 123.99 ? 240 GLN A HE22   1 
ATOM   2455  N  N      . GLY A 1 222 ? -11.871 49.857 221.071 1.00 96.70  ? 241 GLY A N      1 
ATOM   2456  C  CA     . GLY A 1 222 ? -11.953 49.819 219.625 1.00 96.38  ? 241 GLY A CA     1 
ATOM   2457  C  C      . GLY A 1 222 ? -13.244 50.413 219.113 1.00 101.11 ? 241 GLY A C      1 
ATOM   2458  O  O      . GLY A 1 222 ? -14.160 50.755 219.867 1.00 82.71  ? 241 GLY A O      1 
ATOM   2459  H  H      . GLY A 1 222 ? -12.628 49.953 221.469 1.00 116.03 ? 241 GLY A H      1 
ATOM   2460  H  HA2    . GLY A 1 222 ? -11.212 50.316 219.245 1.00 115.66 ? 241 GLY A HA2    1 
ATOM   2461  H  HA3    . GLY A 1 222 ? -11.895 48.899 219.321 1.00 115.66 ? 241 GLY A HA3    1 
ATOM   2462  N  N      . LYS A 1 223 ? -13.300 50.510 217.790 1.00 101.63 ? 242 LYS A N      1 
ATOM   2463  C  CA     . LYS A 1 223 ? -14.412 51.130 217.084 1.00 112.43 ? 242 LYS A CA     1 
ATOM   2464  C  C      . LYS A 1 223 ? -14.918 50.143 216.041 1.00 80.58  ? 242 LYS A C      1 
ATOM   2465  O  O      . LYS A 1 223 ? -14.233 49.874 215.049 1.00 122.26 ? 242 LYS A O      1 
ATOM   2466  C  CB     . LYS A 1 223 ? -13.970 52.443 216.441 1.00 130.07 ? 242 LYS A CB     1 
ATOM   2467  C  CG     . LYS A 1 223 ? -15.031 53.155 215.634 1.00 121.25 ? 242 LYS A CG     1 
ATOM   2468  C  CD     . LYS A 1 223 ? -14.456 54.430 215.058 1.00 126.57 ? 242 LYS A CD     1 
ATOM   2469  C  CE     . LYS A 1 223 ? -15.509 55.293 214.402 1.00 142.98 ? 242 LYS A CE     1 
ATOM   2470  N  NZ     . LYS A 1 223 ? -14.921 56.611 214.046 1.00 162.86 ? 242 LYS A NZ     1 
ATOM   2471  H  H      . LYS A 1 223 ? -12.687 50.214 217.265 1.00 121.95 ? 242 LYS A H      1 
ATOM   2472  H  HA     . LYS A 1 223 ? -15.131 51.317 217.708 1.00 134.92 ? 242 LYS A HA     1 
ATOM   2473  H  HB2    . LYS A 1 223 ? -13.683 53.047 217.143 1.00 156.08 ? 242 LYS A HB2    1 
ATOM   2474  H  HB3    . LYS A 1 223 ? -13.226 52.259 215.847 1.00 156.08 ? 242 LYS A HB3    1 
ATOM   2475  H  HG2    . LYS A 1 223 ? -15.321 52.587 214.903 1.00 145.50 ? 242 LYS A HG2    1 
ATOM   2476  H  HG3    . LYS A 1 223 ? -15.779 53.383 216.208 1.00 145.50 ? 242 LYS A HG3    1 
ATOM   2477  H  HD2    . LYS A 1 223 ? -14.048 54.945 215.772 1.00 151.89 ? 242 LYS A HD2    1 
ATOM   2478  H  HD3    . LYS A 1 223 ? -13.792 54.204 214.388 1.00 151.89 ? 242 LYS A HD3    1 
ATOM   2479  H  HE2    . LYS A 1 223 ? -15.823 54.865 213.590 1.00 171.57 ? 242 LYS A HE2    1 
ATOM   2480  H  HE3    . LYS A 1 223 ? -16.244 55.438 215.019 1.00 171.57 ? 242 LYS A HE3    1 
ATOM   2481  H  HZ1    . LYS A 1 223 ? -15.537 57.125 213.660 1.00 195.43 ? 242 LYS A HZ1    1 
ATOM   2482  H  HZ2    . LYS A 1 223 ? -14.624 57.019 214.779 1.00 195.43 ? 242 LYS A HZ2    1 
ATOM   2483  H  HZ3    . LYS A 1 223 ? -14.242 56.499 213.482 1.00 195.43 ? 242 LYS A HZ3    1 
ATOM   2484  N  N      . LEU A 1 224 ? -16.105 49.599 216.273 1.00 71.69  ? 243 LEU A N      1 
ATOM   2485  C  CA     . LEU A 1 224 ? -16.725 48.702 215.311 1.00 79.70  ? 243 LEU A CA     1 
ATOM   2486  C  C      . LEU A 1 224 ? -17.117 49.478 214.059 1.00 83.99  ? 243 LEU A C      1 
ATOM   2487  O  O      . LEU A 1 224 ? -17.753 50.534 214.147 1.00 154.23 ? 243 LEU A O      1 
ATOM   2488  C  CB     . LEU A 1 224 ? -17.945 48.037 215.950 1.00 127.34 ? 243 LEU A CB     1 
ATOM   2489  C  CG     . LEU A 1 224 ? -18.785 47.059 215.129 1.00 114.16 ? 243 LEU A CG     1 
ATOM   2490  C  CD1    . LEU A 1 224 ? -19.469 46.061 216.047 1.00 95.37  ? 243 LEU A CD1    1 
ATOM   2491  C  CD2    . LEU A 1 224 ? -19.826 47.788 214.308 1.00 134.46 ? 243 LEU A CD2    1 
ATOM   2492  H  H      . LEU A 1 224 ? -16.573 49.734 216.982 1.00 86.02  ? 243 LEU A H      1 
ATOM   2493  H  HA     . LEU A 1 224 ? -16.093 48.010 215.059 1.00 95.64  ? 243 LEU A HA     1 
ATOM   2494  H  HB2    . LEU A 1 224 ? -17.637 47.550 216.731 1.00 152.80 ? 243 LEU A HB2    1 
ATOM   2495  H  HB3    . LEU A 1 224 ? -18.544 48.742 216.240 1.00 152.80 ? 243 LEU A HB3    1 
ATOM   2496  H  HG     . LEU A 1 224 ? -18.208 46.569 214.523 1.00 137.00 ? 243 LEU A HG     1 
ATOM   2497  H  HD11   . LEU A 1 224 ? -19.997 45.450 215.511 1.00 114.44 ? 243 LEU A HD11   1 
ATOM   2498  H  HD12   . LEU A 1 224 ? -18.792 45.571 216.539 1.00 114.44 ? 243 LEU A HD12   1 
ATOM   2499  H  HD13   . LEU A 1 224 ? -20.043 46.542 216.663 1.00 114.44 ? 243 LEU A HD13   1 
ATOM   2500  H  HD21   . LEU A 1 224 ? -20.340 47.140 213.801 1.00 161.35 ? 243 LEU A HD21   1 
ATOM   2501  H  HD22   . LEU A 1 224 ? -20.411 48.280 214.906 1.00 161.35 ? 243 LEU A HD22   1 
ATOM   2502  H  HD23   . LEU A 1 224 ? -19.379 48.402 213.704 1.00 161.35 ? 243 LEU A HD23   1 
ATOM   2503  N  N      . LYS A 1 225 ? -16.738 48.960 212.890 1.00 88.68  ? 244 LYS A N      1 
ATOM   2504  C  CA     . LYS A 1 225 ? -17.054 49.606 211.622 1.00 137.74 ? 244 LYS A CA     1 
ATOM   2505  C  C      . LYS A 1 225 ? -17.355 48.551 210.564 1.00 92.81  ? 244 LYS A C      1 
ATOM   2506  O  O      . LYS A 1 225 ? -17.130 47.355 210.761 1.00 90.24  ? 244 LYS A O      1 
ATOM   2507  C  CB     . LYS A 1 225 ? -15.915 50.521 211.153 1.00 136.82 ? 244 LYS A CB     1 
ATOM   2508  C  CG     . LYS A 1 225 ? -14.632 49.797 210.793 1.00 84.82  ? 244 LYS A CG     1 
ATOM   2509  C  CD     . LYS A 1 225 ? -13.495 50.775 210.527 1.00 115.41 ? 244 LYS A CD     1 
ATOM   2510  C  CE     . LYS A 1 225 ? -13.782 51.669 209.328 1.00 108.56 ? 244 LYS A CE     1 
ATOM   2511  N  NZ     . LYS A 1 225 ? -12.659 52.602 209.056 1.00 122.52 ? 244 LYS A NZ     1 
ATOM   2512  H  H      . LYS A 1 225 ? -16.293 48.228 212.807 1.00 106.42 ? 244 LYS A H      1 
ATOM   2513  H  HA     . LYS A 1 225 ? -17.849 50.151 211.735 1.00 165.29 ? 244 LYS A HA     1 
ATOM   2514  H  HB2    . LYS A 1 225 ? -16.210 51.006 210.367 1.00 164.18 ? 244 LYS A HB2    1 
ATOM   2515  H  HB3    . LYS A 1 225 ? -15.709 51.148 211.865 1.00 164.18 ? 244 LYS A HB3    1 
ATOM   2516  H  HG2    . LYS A 1 225 ? -14.372 49.221 211.528 1.00 101.78 ? 244 LYS A HG2    1 
ATOM   2517  H  HG3    . LYS A 1 225 ? -14.775 49.273 209.990 1.00 101.78 ? 244 LYS A HG3    1 
ATOM   2518  H  HD2    . LYS A 1 225 ? -13.373 51.341 211.305 1.00 138.49 ? 244 LYS A HD2    1 
ATOM   2519  H  HD3    . LYS A 1 225 ? -12.682 50.277 210.346 1.00 138.49 ? 244 LYS A HD3    1 
ATOM   2520  H  HE2    . LYS A 1 225 ? -13.914 51.116 208.542 1.00 130.27 ? 244 LYS A HE2    1 
ATOM   2521  H  HE3    . LYS A 1 225 ? -14.577 52.195 209.506 1.00 130.27 ? 244 LYS A HE3    1 
ATOM   2522  H  HZ1    . LYS A 1 225 ? -12.851 53.111 208.352 1.00 147.02 ? 244 LYS A HZ1    1 
ATOM   2523  H  HZ2    . LYS A 1 225 ? -12.519 53.124 209.762 1.00 147.02 ? 244 LYS A HZ2    1 
ATOM   2524  H  HZ3    . LYS A 1 225 ? -11.916 52.142 208.885 1.00 147.02 ? 244 LYS A HZ3    1 
ATOM   2525  N  N      . TYR A 1 226 ? -17.866 49.014 209.424 1.00 131.72 ? 245 TYR A N      1 
ATOM   2526  C  CA     . TYR A 1 226 ? -18.329 48.110 208.379 1.00 130.49 ? 245 TYR A CA     1 
ATOM   2527  C  C      . TYR A 1 226 ? -17.155 47.502 207.622 1.00 107.35 ? 245 TYR A C      1 
ATOM   2528  O  O      . TYR A 1 226 ? -16.204 48.195 207.251 1.00 104.23 ? 245 TYR A O      1 
ATOM   2529  C  CB     . TYR A 1 226 ? -19.253 48.846 207.406 1.00 138.34 ? 245 TYR A CB     1 
ATOM   2530  C  CG     . TYR A 1 226 ? -20.713 48.478 207.555 1.00 118.10 ? 245 TYR A CG     1 
ATOM   2531  C  CD1    . TYR A 1 226 ? -21.207 47.297 207.020 1.00 121.93 ? 245 TYR A CD1    1 
ATOM   2532  C  CD2    . TYR A 1 226 ? -21.598 49.311 208.228 1.00 125.80 ? 245 TYR A CD2    1 
ATOM   2533  C  CE1    . TYR A 1 226 ? -22.540 46.953 207.154 1.00 138.67 ? 245 TYR A CE1    1 
ATOM   2534  C  CE2    . TYR A 1 226 ? -22.933 48.976 208.367 1.00 133.85 ? 245 TYR A CE2    1 
ATOM   2535  C  CZ     . TYR A 1 226 ? -23.398 47.797 207.828 1.00 157.16 ? 245 TYR A CZ     1 
ATOM   2536  O  OH     . TYR A 1 226 ? -24.727 47.464 207.966 1.00 178.95 ? 245 TYR A OH     1 
ATOM   2537  H  H      . TYR A 1 226 ? -17.955 49.848 209.233 1.00 158.07 ? 245 TYR A H      1 
ATOM   2538  H  HA     . TYR A 1 226 ? -18.832 47.387 208.784 1.00 156.59 ? 245 TYR A HA     1 
ATOM   2539  H  HB2    . TYR A 1 226 ? -19.170 49.800 207.558 1.00 166.01 ? 245 TYR A HB2    1 
ATOM   2540  H  HB3    . TYR A 1 226 ? -18.984 48.633 206.498 1.00 166.01 ? 245 TYR A HB3    1 
ATOM   2541  H  HD1    . TYR A 1 226 ? -20.631 46.725 206.566 1.00 146.32 ? 245 TYR A HD1    1 
ATOM   2542  H  HD2    . TYR A 1 226 ? -21.286 50.107 208.594 1.00 150.96 ? 245 TYR A HD2    1 
ATOM   2543  H  HE1    . TYR A 1 226 ? -22.856 46.158 206.790 1.00 166.41 ? 245 TYR A HE1    1 
ATOM   2544  H  HE2    . TYR A 1 226 ? -23.513 49.544 208.821 1.00 160.61 ? 245 TYR A HE2    1 
ATOM   2545  H  HH     . TYR A 1 226 ? -25.130 48.063 208.394 1.00 214.74 ? 245 TYR A HH     1 
ATOM   2546  N  N      . LEU A 1 227 ? -17.240 46.197 207.380 1.00 122.79 ? 246 LEU A N      1 
ATOM   2547  C  CA     . LEU A 1 227 ? -16.180 45.432 206.733 1.00 107.47 ? 246 LEU A CA     1 
ATOM   2548  C  C      . LEU A 1 227 ? -16.586 45.156 205.290 1.00 118.36 ? 246 LEU A C      1 
ATOM   2549  O  O      . LEU A 1 227 ? -17.647 44.574 205.041 1.00 155.55 ? 246 LEU A O      1 
ATOM   2550  C  CB     . LEU A 1 227 ? -15.932 44.127 207.495 1.00 134.45 ? 246 LEU A CB     1 
ATOM   2551  C  CG     . LEU A 1 227 ? -14.718 43.231 207.195 1.00 107.35 ? 246 LEU A CG     1 
ATOM   2552  C  CD1    . LEU A 1 227 ? -14.754 42.650 205.790 1.00 119.70 ? 246 LEU A CD1    1 
ATOM   2553  C  CD2    . LEU A 1 227 ? -13.408 43.962 207.434 1.00 106.65 ? 246 LEU A CD2    1 
ATOM   2554  H  H      . LEU A 1 227 ? -17.923 45.719 207.589 1.00 147.34 ? 246 LEU A H      1 
ATOM   2555  H  HA     . LEU A 1 227 ? -15.360 45.950 206.731 1.00 128.96 ? 246 LEU A HA     1 
ATOM   2556  H  HB2    . LEU A 1 227 ? -15.871 44.355 208.436 1.00 161.34 ? 246 LEU A HB2    1 
ATOM   2557  H  HB3    . LEU A 1 227 ? -16.715 43.570 207.366 1.00 161.34 ? 246 LEU A HB3    1 
ATOM   2558  H  HG     . LEU A 1 227 ? -14.740 42.482 207.811 1.00 128.82 ? 246 LEU A HG     1 
ATOM   2559  H  HD11   . LEU A 1 227 ? -13.969 42.097 205.657 1.00 143.64 ? 246 LEU A HD11   1 
ATOM   2560  H  HD12   . LEU A 1 227 ? -15.557 42.115 205.691 1.00 143.64 ? 246 LEU A HD12   1 
ATOM   2561  H  HD13   . LEU A 1 227 ? -14.760 43.378 205.148 1.00 143.64 ? 246 LEU A HD13   1 
ATOM   2562  H  HD21   . LEU A 1 227 ? -12.672 43.363 207.233 1.00 127.98 ? 246 LEU A HD21   1 
ATOM   2563  H  HD22   . LEU A 1 227 ? -13.370 44.739 206.854 1.00 127.98 ? 246 LEU A HD22   1 
ATOM   2564  H  HD23   . LEU A 1 227 ? -13.366 44.239 208.362 1.00 127.98 ? 246 LEU A HD23   1 
ATOM   2565  N  N      . HIS A 1 228 ? -15.747 45.576 204.348 1.00 151.70 ? 247 HIS A N      1 
ATOM   2566  C  CA     . HIS A 1 228 ? -15.992 45.388 202.924 1.00 124.68 ? 247 HIS A CA     1 
ATOM   2567  C  C      . HIS A 1 228 ? -14.890 44.521 202.324 1.00 122.16 ? 247 HIS A C      1 
ATOM   2568  O  O      . HIS A 1 228 ? -13.991 44.045 203.021 1.00 132.15 ? 247 HIS A O      1 
ATOM   2569  C  CB     . HIS A 1 228 ? -16.066 46.733 202.195 1.00 115.98 ? 247 HIS A CB     1 
ATOM   2570  C  CG     . HIS A 1 228 ? -16.779 47.802 202.963 1.00 132.86 ? 247 HIS A CG     1 
ATOM   2571  N  ND1    . HIS A 1 228 ? -16.115 48.837 203.584 1.00 159.77 ? 247 HIS A ND1    1 
ATOM   2572  C  CD2    . HIS A 1 228 ? -18.096 47.999 203.209 1.00 138.33 ? 247 HIS A CD2    1 
ATOM   2573  C  CE1    . HIS A 1 228 ? -16.992 49.626 204.180 1.00 148.28 ? 247 HIS A CE1    1 
ATOM   2574  N  NE2    . HIS A 1 228 ? -18.201 49.139 203.968 1.00 158.97 ? 247 HIS A NE2    1 
ATOM   2575  H  H      . HIS A 1 228 ? -15.010 45.985 204.515 1.00 182.03 ? 247 HIS A H      1 
ATOM   2576  H  HA     . HIS A 1 228 ? -16.838 44.930 202.803 1.00 149.62 ? 247 HIS A HA     1 
ATOM   2577  H  HB2    . HIS A 1 228 ? -15.164 47.044 202.023 1.00 139.18 ? 247 HIS A HB2    1 
ATOM   2578  H  HB3    . HIS A 1 228 ? -16.536 46.607 201.356 1.00 139.18 ? 247 HIS A HB3    1 
ATOM   2579  H  HD2    . HIS A 1 228 ? -18.798 47.462 202.918 1.00 165.99 ? 247 HIS A HD2    1 
ATOM   2580  H  HE1    . HIS A 1 228 ? -16.791 50.392 204.666 1.00 177.94 ? 247 HIS A HE1    1 
ATOM   2581  H  HE2    . HIS A 1 228 ? -18.935 49.480 204.257 1.00 190.76 ? 247 HIS A HE2    1 
ATOM   2582  N  N      . GLY A 1 229 ? -14.968 44.323 201.008 1.00 81.14  ? 248 GLY A N      1 
ATOM   2583  C  CA     . GLY A 1 229 ? -13.993 43.531 200.289 1.00 80.40  ? 248 GLY A CA     1 
ATOM   2584  C  C      . GLY A 1 229 ? -14.240 42.041 200.317 1.00 83.16  ? 248 GLY A C      1 
ATOM   2585  O  O      . GLY A 1 229 ? -13.546 41.299 199.602 1.00 43.93  ? 248 GLY A O      1 
ATOM   2586  H  H      . GLY A 1 229 ? -15.589 44.646 200.508 1.00 97.36  ? 248 GLY A H      1 
ATOM   2587  H  HA2    . GLY A 1 229 ? -13.980 43.814 199.361 1.00 96.48  ? 248 GLY A HA2    1 
ATOM   2588  H  HA3    . GLY A 1 229 ? -13.114 43.695 200.666 1.00 96.48  ? 248 GLY A HA3    1 
ATOM   2589  N  N      . GLN A 1 230 ? -15.204 41.576 201.109 1.00 86.59  ? 249 GLN A N      1 
ATOM   2590  C  CA     . GLN A 1 230 ? -15.501 40.160 201.253 1.00 89.55  ? 249 GLN A CA     1 
ATOM   2591  C  C      . GLN A 1 230 ? -16.807 39.839 200.539 1.00 92.72  ? 249 GLN A C      1 
ATOM   2592  O  O      . GLN A 1 230 ? -17.739 40.650 200.534 1.00 86.95  ? 249 GLN A O      1 
ATOM   2593  C  CB     . GLN A 1 230 ? -15.596 39.770 202.735 1.00 39.92  ? 249 GLN A CB     1 
ATOM   2594  H  H      . GLN A 1 230 ? -15.712 42.081 201.585 1.00 103.90 ? 249 GLN A H      1 
ATOM   2595  H  HA     . GLN A 1 230 ? -14.793 39.639 200.844 1.00 107.46 ? 249 GLN A HA     1 
ATOM   2596  N  N      . LYS A 1 231 ? -16.861 38.659 199.927 1.00 83.61  ? 250 LYS A N      1 
ATOM   2597  C  CA     . LYS A 1 231 ? -18.067 38.205 199.241 1.00 83.04  ? 250 LYS A CA     1 
ATOM   2598  C  C      . LYS A 1 231 ? -17.920 36.754 198.795 1.00 68.64  ? 250 LYS A C      1 
ATOM   2599  O  O      . LYS A 1 231 ? -18.810 35.934 199.019 1.00 76.55  ? 250 LYS A O      1 
ATOM   2600  C  CB     . LYS A 1 231 ? -18.369 39.101 198.038 1.00 64.25  ? 250 LYS A CB     1 
ATOM   2601  H  H      . LYS A 1 231 ? -16.209 38.100 199.894 1.00 100.33 ? 250 LYS A H      1 
ATOM   2602  H  HA     . LYS A 1 231 ? -18.818 38.258 199.852 1.00 99.65  ? 250 LYS A HA     1 
ATOM   2603  N  N      . PRO A 1 242 ? -21.198 42.286 202.540 1.00 173.57 ? 261 PRO A N      1 
ATOM   2604  C  CA     . PRO A 1 242 ? -21.329 43.493 203.364 1.00 171.00 ? 261 PRO A CA     1 
ATOM   2605  C  C      . PRO A 1 242 ? -21.585 43.181 204.839 1.00 174.27 ? 261 PRO A C      1 
ATOM   2606  O  O      . PRO A 1 242 ? -22.702 43.362 205.323 1.00 189.34 ? 261 PRO A O      1 
ATOM   2607  C  CB     . PRO A 1 242 ? -22.527 44.212 202.738 1.00 160.84 ? 261 PRO A CB     1 
ATOM   2608  C  CG     . PRO A 1 242 ? -23.338 43.121 202.131 1.00 163.06 ? 261 PRO A CG     1 
ATOM   2609  C  CD     . PRO A 1 242 ? -22.347 42.109 201.635 1.00 165.20 ? 261 PRO A CD     1 
ATOM   2610  H  HA     . PRO A 1 242 ? -20.538 44.049 203.282 1.00 205.20 ? 261 PRO A HA     1 
ATOM   2611  H  HB2    . PRO A 1 242 ? -23.031 44.674 203.426 1.00 193.01 ? 261 PRO A HB2    1 
ATOM   2612  H  HB3    . PRO A 1 242 ? -22.220 44.833 202.058 1.00 193.01 ? 261 PRO A HB3    1 
ATOM   2613  H  HG2    . PRO A 1 242 ? -23.916 42.731 202.805 1.00 195.68 ? 261 PRO A HG2    1 
ATOM   2614  H  HG3    . PRO A 1 242 ? -23.861 43.475 201.395 1.00 195.68 ? 261 PRO A HG3    1 
ATOM   2615  H  HD2    . PRO A 1 242 ? -22.709 41.212 201.719 1.00 198.24 ? 261 PRO A HD2    1 
ATOM   2616  H  HD3    . PRO A 1 242 ? -22.091 42.305 200.721 1.00 198.24 ? 261 PRO A HD3    1 
ATOM   2617  N  N      . GLN A 1 243 ? -20.556 42.715 205.539 1.00 141.98 ? 262 GLN A N      1 
ATOM   2618  C  CA     . GLN A 1 243 ? -20.647 42.384 206.953 1.00 128.53 ? 262 GLN A CA     1 
ATOM   2619  C  C      . GLN A 1 243 ? -19.942 43.444 207.789 1.00 136.16 ? 262 GLN A C      1 
ATOM   2620  O  O      . GLN A 1 243 ? -19.111 44.211 207.294 1.00 149.85 ? 262 GLN A O      1 
ATOM   2621  C  CB     . GLN A 1 243 ? -20.034 41.007 207.237 1.00 145.58 ? 262 GLN A CB     1 
ATOM   2622  C  CG     . GLN A 1 243 ? -20.824 39.838 206.668 1.00 164.74 ? 262 GLN A CG     1 
ATOM   2623  C  CD     . GLN A 1 243 ? -20.197 38.496 206.999 1.00 166.67 ? 262 GLN A CD     1 
ATOM   2624  O  OE1    . GLN A 1 243 ? -19.054 38.426 207.454 1.00 149.95 ? 262 GLN A OE1    1 
ATOM   2625  N  NE2    . GLN A 1 243 ? -20.945 37.421 206.773 1.00 167.50 ? 262 GLN A NE2    1 
ATOM   2626  H  H      . GLN A 1 243 ? -19.774 42.579 205.206 1.00 170.37 ? 262 GLN A H      1 
ATOM   2627  H  HA     . GLN A 1 243 ? -21.580 42.362 207.216 1.00 154.24 ? 262 GLN A HA     1 
ATOM   2628  H  HB2    . GLN A 1 243 ? -19.145 40.977 206.851 1.00 174.69 ? 262 GLN A HB2    1 
ATOM   2629  H  HB3    . GLN A 1 243 ? -19.978 40.884 208.197 1.00 174.69 ? 262 GLN A HB3    1 
ATOM   2630  H  HG2    . GLN A 1 243 ? -21.720 39.851 207.039 1.00 197.69 ? 262 GLN A HG2    1 
ATOM   2631  H  HG3    . GLN A 1 243 ? -20.863 39.922 205.703 1.00 197.69 ? 262 GLN A HG3    1 
ATOM   2632  H  HE21   . GLN A 1 243 ? -21.740 37.509 206.456 1.00 201.00 ? 262 GLN A HE21   1 
ATOM   2633  H  HE22   . GLN A 1 243 ? -20.635 36.637 206.943 1.00 201.00 ? 262 GLN A HE22   1 
ATOM   2634  N  N      . LEU A 1 244 ? -20.292 43.481 209.074 1.00 137.85 ? 263 LEU A N      1 
ATOM   2635  C  CA     . LEU A 1 244 ? -19.655 44.374 210.028 1.00 126.16 ? 263 LEU A CA     1 
ATOM   2636  C  C      . LEU A 1 244 ? -18.415 43.699 210.612 1.00 130.88 ? 263 LEU A C      1 
ATOM   2637  O  O      . LEU A 1 244 ? -18.064 42.573 210.253 1.00 117.96 ? 263 LEU A O      1 
ATOM   2638  C  CB     . LEU A 1 244 ? -20.644 44.771 211.125 1.00 122.40 ? 263 LEU A CB     1 
ATOM   2639  C  CG     . LEU A 1 244 ? -21.802 45.668 210.680 1.00 160.61 ? 263 LEU A CG     1 
ATOM   2640  C  CD1    . LEU A 1 244 ? -23.139 45.024 211.014 1.00 161.94 ? 263 LEU A CD1    1 
ATOM   2641  C  CD2    . LEU A 1 244 ? -21.699 47.042 211.327 1.00 140.99 ? 263 LEU A CD2    1 
ATOM   2642  H  H      . LEU A 1 244 ? -20.906 42.988 209.419 1.00 165.42 ? 263 LEU A H      1 
ATOM   2643  H  HA     . LEU A 1 244 ? -19.373 45.180 209.570 1.00 151.39 ? 263 LEU A HA     1 
ATOM   2644  H  HB2    . LEU A 1 244 ? -21.030 43.962 211.496 1.00 146.89 ? 263 LEU A HB2    1 
ATOM   2645  H  HB3    . LEU A 1 244 ? -20.158 45.245 211.817 1.00 146.89 ? 263 LEU A HB3    1 
ATOM   2646  H  HG     . LEU A 1 244 ? -21.759 45.786 209.718 1.00 192.73 ? 263 LEU A HG     1 
ATOM   2647  H  HD11   . LEU A 1 244 ? -23.854 45.611 210.723 1.00 194.32 ? 263 LEU A HD11   1 
ATOM   2648  H  HD12   . LEU A 1 244 ? -23.202 44.172 210.554 1.00 194.32 ? 263 LEU A HD12   1 
ATOM   2649  H  HD13   . LEU A 1 244 ? -23.192 44.887 211.973 1.00 194.32 ? 263 LEU A HD13   1 
ATOM   2650  H  HD21   . LEU A 1 244 ? -22.444 47.588 211.028 1.00 169.19 ? 263 LEU A HD21   1 
ATOM   2651  H  HD22   . LEU A 1 244 ? -21.729 46.940 212.291 1.00 169.19 ? 263 LEU A HD22   1 
ATOM   2652  H  HD23   . LEU A 1 244 ? -20.861 47.453 211.063 1.00 169.19 ? 263 LEU A HD23   1 
ATOM   2653  N  N      . ALA A 1 245 ? -17.740 44.392 211.527 1.00 142.54 ? 264 ALA A N      1 
ATOM   2654  C  CA     . ALA A 1 245 ? -16.522 43.865 212.127 1.00 100.61 ? 264 ALA A CA     1 
ATOM   2655  C  C      . ALA A 1 245 ? -16.074 44.795 213.241 1.00 84.67  ? 264 ALA A C      1 
ATOM   2656  O  O      . ALA A 1 245 ? -16.305 46.006 213.186 1.00 129.32 ? 264 ALA A O      1 
ATOM   2657  C  CB     . ALA A 1 245 ? -15.404 43.713 211.087 1.00 92.89  ? 264 ALA A CB     1 
ATOM   2658  H  H      . ALA A 1 245 ? -17.968 45.169 211.817 1.00 171.05 ? 264 ALA A H      1 
ATOM   2659  H  HA     . ALA A 1 245 ? -16.703 42.992 212.510 1.00 120.73 ? 264 ALA A HA     1 
ATOM   2660  H  HB1    . ALA A 1 245 ? -14.613 43.361 211.524 1.00 111.47 ? 264 ALA A HB1    1 
ATOM   2661  H  HB2    . ALA A 1 245 ? -15.699 43.102 210.394 1.00 111.47 ? 264 ALA A HB2    1 
ATOM   2662  H  HB3    . ALA A 1 245 ? -15.211 44.582 210.703 1.00 111.47 ? 264 ALA A HB3    1 
ATOM   2663  N  N      . LEU A 1 246 ? -15.429 44.213 214.248 1.00 83.18  ? 265 LEU A N      1 
ATOM   2664  C  CA     . LEU A 1 246 ? -14.830 44.965 215.344 1.00 115.15 ? 265 LEU A CA     1 
ATOM   2665  C  C      . LEU A 1 246 ? -13.340 45.141 215.074 1.00 104.26 ? 265 LEU A C      1 
ATOM   2666  O  O      . LEU A 1 246 ? -12.598 44.155 214.979 1.00 74.78  ? 265 LEU A O      1 
ATOM   2667  C  CB     . LEU A 1 246 ? -15.052 44.257 216.683 1.00 105.66 ? 265 LEU A CB     1 
ATOM   2668  C  CG     . LEU A 1 246 ? -14.453 44.937 217.918 1.00 75.04  ? 265 LEU A CG     1 
ATOM   2669  C  CD1    . LEU A 1 246 ? -15.060 46.313 218.140 1.00 111.45 ? 265 LEU A CD1    1 
ATOM   2670  C  CD2    . LEU A 1 246 ? -14.650 44.069 219.142 1.00 67.25  ? 265 LEU A CD2    1 
ATOM   2671  H  H      . LEU A 1 246 ? -15.323 43.363 214.319 1.00 99.81  ? 265 LEU A H      1 
ATOM   2672  H  HA     . LEU A 1 246 ? -15.238 45.843 215.392 1.00 138.18 ? 265 LEU A HA     1 
ATOM   2673  H  HB2    . LEU A 1 246 ? -16.007 44.180 216.831 1.00 126.80 ? 265 LEU A HB2    1 
ATOM   2674  H  HB3    . LEU A 1 246 ? -14.663 43.370 216.625 1.00 126.80 ? 265 LEU A HB3    1 
ATOM   2675  H  HG     . LEU A 1 246 ? -13.499 45.050 217.784 1.00 90.04  ? 265 LEU A HG     1 
ATOM   2676  H  HD11   . LEU A 1 246 ? -14.658 46.712 218.928 1.00 133.74 ? 265 LEU A HD11   1 
ATOM   2677  H  HD12   . LEU A 1 246 ? -14.883 46.865 217.363 1.00 133.74 ? 265 LEU A HD12   1 
ATOM   2678  H  HD13   . LEU A 1 246 ? -16.017 46.219 218.268 1.00 133.74 ? 265 LEU A HD13   1 
ATOM   2679  H  HD21   . LEU A 1 246 ? -14.264 44.516 219.911 1.00 80.71  ? 265 LEU A HD21   1 
ATOM   2680  H  HD22   . LEU A 1 246 ? -15.600 43.930 219.280 1.00 80.71  ? 265 LEU A HD22   1 
ATOM   2681  H  HD23   . LEU A 1 246 ? -14.209 43.217 218.998 1.00 80.71  ? 265 LEU A HD23   1 
ATOM   2682  N  N      . PHE A 1 247 ? -12.915 46.394 214.932 1.00 90.10  ? 266 PHE A N      1 
ATOM   2683  C  CA     . PHE A 1 247 ? -11.507 46.762 214.847 1.00 79.84  ? 266 PHE A CA     1 
ATOM   2684  C  C      . PHE A 1 247 ? -11.127 47.399 216.172 1.00 99.00  ? 266 PHE A C      1 
ATOM   2685  O  O      . PHE A 1 247 ? -11.692 48.432 216.548 1.00 102.08 ? 266 PHE A O      1 
ATOM   2686  C  CB     . PHE A 1 247 ? -11.253 47.742 213.705 1.00 86.96  ? 266 PHE A CB     1 
ATOM   2687  C  CG     . PHE A 1 247 ? -11.595 47.203 212.351 1.00 96.81  ? 266 PHE A CG     1 
ATOM   2688  C  CD1    . PHE A 1 247 ? -12.911 47.011 211.981 1.00 101.31 ? 266 PHE A CD1    1 
ATOM   2689  C  CD2    . PHE A 1 247 ? -10.600 46.906 211.445 1.00 74.44  ? 266 PHE A CD2    1 
ATOM   2690  C  CE1    . PHE A 1 247 ? -13.225 46.522 210.737 1.00 78.35  ? 266 PHE A CE1    1 
ATOM   2691  C  CE2    . PHE A 1 247 ? -10.904 46.420 210.204 1.00 84.90  ? 266 PHE A CE2    1 
ATOM   2692  C  CZ     . PHE A 1 247 ? -12.219 46.226 209.846 1.00 92.83  ? 266 PHE A CZ     1 
ATOM   2693  H  H      . PHE A 1 247 ? -13.444 47.070 214.882 1.00 108.12 ? 266 PHE A H      1 
ATOM   2694  H  HA     . PHE A 1 247 ? -10.965 45.969 214.711 1.00 95.80  ? 266 PHE A HA     1 
ATOM   2695  H  HB2    . PHE A 1 247 ? -11.789 48.537 213.851 1.00 104.35 ? 266 PHE A HB2    1 
ATOM   2696  H  HB3    . PHE A 1 247 ? -10.312 47.977 213.700 1.00 104.35 ? 266 PHE A HB3    1 
ATOM   2697  H  HD1    . PHE A 1 247 ? -13.591 47.210 212.583 1.00 121.57 ? 266 PHE A HD1    1 
ATOM   2698  H  HD2    . PHE A 1 247 ? -9.710  47.034 211.683 1.00 89.33  ? 266 PHE A HD2    1 
ATOM   2699  H  HE1    . PHE A 1 247 ? -14.115 46.393 210.498 1.00 94.02  ? 266 PHE A HE1    1 
ATOM   2700  H  HE2    . PHE A 1 247 ? -10.224 46.220 209.603 1.00 101.87 ? 266 PHE A HE2    1 
ATOM   2701  H  HZ     . PHE A 1 247 ? -12.428 45.895 209.003 1.00 111.40 ? 266 PHE A HZ     1 
ATOM   2702  N  N      . ALA A 1 248 ? -10.183 46.789 216.881 1.00 56.13  ? 267 ALA A N      1 
ATOM   2703  C  CA     . ALA A 1 248 ? -9.920  47.215 218.244 1.00 89.99  ? 267 ALA A CA     1 
ATOM   2704  C  C      . ALA A 1 248 ? -8.452  47.037 218.586 1.00 68.71  ? 267 ALA A C      1 
ATOM   2705  O  O      . ALA A 1 248 ? -7.687  46.371 217.875 1.00 57.51  ? 267 ALA A O      1 
ATOM   2706  C  CB     . ALA A 1 248 ? -10.783 46.446 219.247 1.00 86.54  ? 267 ALA A CB     1 
ATOM   2707  H  H      . ALA A 1 248 ? -9.692  46.141 216.601 1.00 67.35  ? 267 ALA A H      1 
ATOM   2708  H  HA     . ALA A 1 248 ? -10.134 48.158 218.327 1.00 107.99 ? 267 ALA A HA     1 
ATOM   2709  H  HB1    . ALA A 1 248 ? -10.579 46.757 220.143 1.00 103.85 ? 267 ALA A HB1    1 
ATOM   2710  H  HB2    . ALA A 1 248 ? -11.718 46.605 219.046 1.00 103.85 ? 267 ALA A HB2    1 
ATOM   2711  H  HB3    . ALA A 1 248 ? -10.585 45.499 219.173 1.00 103.85 ? 267 ALA A HB3    1 
ATOM   2712  N  N      . ILE A 1 249 ? -8.083  47.651 219.706 1.00 50.64  ? 268 ILE A N      1 
ATOM   2713  C  CA     . ILE A 1 249 ? -6.762  47.531 220.302 1.00 69.97  ? 268 ILE A CA     1 
ATOM   2714  C  C      . ILE A 1 249 ? -6.914  46.865 221.665 1.00 83.12  ? 268 ILE A C      1 
ATOM   2715  O  O      . ILE A 1 249 ? -7.884  47.121 222.390 1.00 100.37 ? 268 ILE A O      1 
ATOM   2716  C  CB     . ILE A 1 249 ? -6.080  48.913 220.411 1.00 34.26  ? 268 ILE A CB     1 
ATOM   2717  C  CG1    . ILE A 1 249 ? -5.185  49.129 219.191 1.00 56.24  ? 268 ILE A CG1    1 
ATOM   2718  C  CG2    . ILE A 1 249 ? -5.273  49.044 221.706 1.00 93.97  ? 268 ILE A CG2    1 
ATOM   2719  C  CD1    . ILE A 1 249 ? -4.444  50.451 219.177 1.00 105.02 ? 268 ILE A CD1    1 
ATOM   2720  H  H      . ILE A 1 249 ? -8.606  48.165 220.156 1.00 60.77  ? 268 ILE A H      1 
ATOM   2721  H  HA     . ILE A 1 249 ? -6.210  46.961 219.745 1.00 83.97  ? 268 ILE A HA     1 
ATOM   2722  H  HB     . ILE A 1 249 ? -6.769  49.595 220.410 1.00 41.11  ? 268 ILE A HB     1 
ATOM   2723  H  HG12   . ILE A 1 249 ? -4.523  48.421 219.163 1.00 67.49  ? 268 ILE A HG12   1 
ATOM   2724  H  HG13   . ILE A 1 249 ? -5.735  49.092 218.393 1.00 67.49  ? 268 ILE A HG13   1 
ATOM   2725  H  HG21   . ILE A 1 249 ? -4.863  49.923 221.734 1.00 112.76 ? 268 ILE A HG21   1 
ATOM   2726  H  HG22   . ILE A 1 249 ? -5.870  48.934 222.462 1.00 112.76 ? 268 ILE A HG22   1 
ATOM   2727  H  HG23   . ILE A 1 249 ? -4.588  48.358 221.722 1.00 112.76 ? 268 ILE A HG23   1 
ATOM   2728  H  HD11   . ILE A 1 249 ? -3.905  50.502 218.372 1.00 126.02 ? 268 ILE A HD11   1 
ATOM   2729  H  HD12   . ILE A 1 249 ? -5.090  51.174 219.189 1.00 126.02 ? 268 ILE A HD12   1 
ATOM   2730  H  HD13   . ILE A 1 249 ? -3.875  50.501 219.961 1.00 126.02 ? 268 ILE A HD13   1 
ATOM   2731  N  N      . ALA A 1 250 ? -5.958  46.001 222.002 1.00 58.33  ? 269 ALA A N      1 
ATOM   2732  C  CA     . ALA A 1 250 ? -5.931  45.308 223.284 1.00 58.20  ? 269 ALA A CA     1 
ATOM   2733  C  C      . ALA A 1 250 ? -4.996  46.044 224.240 1.00 96.03  ? 269 ALA A C      1 
ATOM   2734  O  O      . ALA A 1 250 ? -3.793  46.153 223.979 1.00 74.67  ? 269 ALA A O      1 
ATOM   2735  C  CB     . ALA A 1 250 ? -5.478  43.860 223.104 1.00 69.35  ? 269 ALA A CB     1 
ATOM   2736  H  H      . ALA A 1 250 ? -5.298  45.796 221.490 1.00 69.99  ? 269 ALA A H      1 
ATOM   2737  H  HA     . ALA A 1 250 ? -6.821  45.306 223.668 1.00 69.84  ? 269 ALA A HA     1 
ATOM   2738  H  HB1    . ALA A 1 250 ? -5.469  43.423 223.970 1.00 83.22  ? 269 ALA A HB1    1 
ATOM   2739  H  HB2    . ALA A 1 250 ? -6.098  43.408 222.511 1.00 83.22  ? 269 ALA A HB2    1 
ATOM   2740  H  HB3    . ALA A 1 250 ? -4.588  43.854 222.720 1.00 83.22  ? 269 ALA A HB3    1 
ATOM   2741  N  N      . THR A 1 251 ? -5.547  46.532 225.348 1.00 90.18  ? 270 THR A N      1 
ATOM   2742  C  CA     . THR A 1 251 ? -4.773  47.267 226.343 1.00 77.27  ? 270 THR A CA     1 
ATOM   2743  C  C      . THR A 1 251 ? -4.599  46.400 227.584 1.00 94.43  ? 270 THR A C      1 
ATOM   2744  O  O      . THR A 1 251 ? -5.579  46.168 228.310 1.00 99.65  ? 270 THR A O      1 
ATOM   2745  C  CB     . THR A 1 251 ? -5.466  48.583 226.710 1.00 109.62 ? 270 THR A CB     1 
ATOM   2746  O  OG1    . THR A 1 251 ? -6.739  48.308 227.309 1.00 130.87 ? 270 THR A OG1    1 
ATOM   2747  C  CG2    . THR A 1 251 ? -5.663  49.459 225.474 1.00 70.95  ? 270 THR A CG2    1 
ATOM   2748  H  H      . THR A 1 251 ? -6.379  46.450 225.548 1.00 108.22 ? 270 THR A H      1 
ATOM   2749  H  HA     . THR A 1 251 ? -3.895  47.472 225.985 1.00 92.72  ? 270 THR A HA     1 
ATOM   2750  H  HB     . THR A 1 251 ? -4.914  49.070 227.342 1.00 131.55 ? 270 THR A HB     1 
ATOM   2751  H  HG1    . THR A 1 251 ? -7.224  47.883 226.771 1.00 157.05 ? 270 THR A HG1    1 
ATOM   2752  H  HG21   . THR A 1 251 ? -6.102  50.287 225.722 1.00 85.14  ? 270 THR A HG21   1 
ATOM   2753  H  HG22   . THR A 1 251 ? -4.803  49.664 225.074 1.00 85.14  ? 270 THR A HG22   1 
ATOM   2754  H  HG23   . THR A 1 251 ? -6.211  48.994 224.823 1.00 85.14  ? 270 THR A HG23   1 
ATOM   2755  N  N      . PRO A 1 252 ? -3.398  45.902 227.879 1.00 75.66  ? 271 PRO A N      1 
ATOM   2756  C  CA     . PRO A 1 252 ? -3.238  45.036 229.053 1.00 44.58  ? 271 PRO A CA     1 
ATOM   2757  C  C      . PRO A 1 252 ? -3.061  45.815 230.342 1.00 61.92  ? 271 PRO A C      1 
ATOM   2758  O  O      . PRO A 1 252 ? -1.967  46.317 230.622 1.00 106.23 ? 271 PRO A O      1 
ATOM   2759  C  CB     . PRO A 1 252 ? -1.981  44.229 228.712 1.00 65.67  ? 271 PRO A CB     1 
ATOM   2760  C  CG     . PRO A 1 252 ? -1.159  45.181 227.908 1.00 72.80  ? 271 PRO A CG     1 
ATOM   2761  C  CD     . PRO A 1 252 ? -2.139  46.034 227.123 1.00 90.75  ? 271 PRO A CD     1 
ATOM   2762  H  HA     . PRO A 1 252 ? -3.995  44.435 229.138 1.00 53.49  ? 271 PRO A HA     1 
ATOM   2763  H  HB2    . PRO A 1 252 ? -1.520  43.974 229.526 1.00 78.80  ? 271 PRO A HB2    1 
ATOM   2764  H  HB3    . PRO A 1 252 ? -2.220  43.449 228.187 1.00 78.80  ? 271 PRO A HB3    1 
ATOM   2765  H  HG2    . PRO A 1 252 ? -0.629  45.734 228.504 1.00 87.37  ? 271 PRO A HG2    1 
ATOM   2766  H  HG3    . PRO A 1 252 ? -0.584  44.683 227.306 1.00 87.37  ? 271 PRO A HG3    1 
ATOM   2767  H  HD2    . PRO A 1 252 ? -1.848  46.959 227.111 1.00 108.90 ? 271 PRO A HD2    1 
ATOM   2768  H  HD3    . PRO A 1 252 ? -2.247  45.684 226.225 1.00 108.90 ? 271 PRO A HD3    1 
ATOM   2769  N  N      . LEU A 1 253 ? -4.127  45.915 231.131 1.00 70.41  ? 272 LEU A N      1 
ATOM   2770  C  CA     . LEU A 1 253 ? -4.054  46.494 232.471 1.00 81.31  ? 272 LEU A CA     1 
ATOM   2771  C  C      . LEU A 1 253 ? -5.418  46.417 233.151 1.00 74.61  ? 272 LEU A C      1 
ATOM   2772  O  O      . LEU A 1 253 ? -6.207  45.505 232.895 1.00 77.54  ? 272 LEU A O      1 
ATOM   2773  C  CB     . LEU A 1 253 ? -3.570  47.949 232.420 1.00 111.50 ? 272 LEU A CB     1 
ATOM   2774  C  CG     . LEU A 1 253 ? -3.313  48.630 233.769 1.00 128.17 ? 272 LEU A CG     1 
ATOM   2775  C  CD1    . LEU A 1 253 ? -2.269  47.870 234.597 1.00 84.54  ? 272 LEU A CD1    1 
ATOM   2776  C  CD2    . LEU A 1 253 ? -2.875  50.075 233.542 1.00 104.56 ? 272 LEU A CD2    1 
ATOM   2777  H  H      . LEU A 1 253 ? -4.915  45.651 230.911 1.00 84.50  ? 272 LEU A H      1 
ATOM   2778  H  HA     . LEU A 1 253 ? -3.422  45.985 233.003 1.00 97.58  ? 272 LEU A HA     1 
ATOM   2779  H  HB2    . LEU A 1 253 ? -2.739  47.975 231.921 1.00 133.80 ? 272 LEU A HB2    1 
ATOM   2780  H  HB3    . LEU A 1 253 ? -4.240  48.475 231.955 1.00 133.80 ? 272 LEU A HB3    1 
ATOM   2781  H  HG     . LEU A 1 253 ? -4.141  48.646 234.275 1.00 153.81 ? 272 LEU A HG     1 
ATOM   2782  H  HD11   . LEU A 1 253 ? -2.137  48.333 235.440 1.00 101.45 ? 272 LEU A HD11   1 
ATOM   2783  H  HD12   . LEU A 1 253 ? -2.591  46.970 234.761 1.00 101.45 ? 272 LEU A HD12   1 
ATOM   2784  H  HD13   . LEU A 1 253 ? -1.436  47.838 234.102 1.00 101.45 ? 272 LEU A HD13   1 
ATOM   2785  H  HD21   . LEU A 1 253 ? -2.716  50.494 234.402 1.00 125.47 ? 272 LEU A HD21   1 
ATOM   2786  H  HD22   . LEU A 1 253 ? -2.060  50.078 233.016 1.00 125.47 ? 272 LEU A HD22   1 
ATOM   2787  H  HD23   . LEU A 1 253 ? -3.577  50.547 233.068 1.00 125.47 ? 272 LEU A HD23   1 
ATOM   2788  N  N      . ASP B 2 7   ? -17.285 -5.628 217.470 1.00 102.22 ? 85  ASP B N      1 
ATOM   2789  C  CA     . ASP B 2 7   ? -16.730 -5.847 216.139 1.00 107.42 ? 85  ASP B CA     1 
ATOM   2790  C  C      . ASP B 2 7   ? -17.387 -4.936 215.111 1.00 115.92 ? 85  ASP B C      1 
ATOM   2791  O  O      . ASP B 2 7   ? -17.433 -5.254 213.922 1.00 100.89 ? 85  ASP B O      1 
ATOM   2792  C  CB     . ASP B 2 7   ? -16.891 -7.311 215.730 1.00 101.81 ? 85  ASP B CB     1 
ATOM   2793  C  CG     . ASP B 2 7   ? -15.995 -8.237 216.528 1.00 133.05 ? 85  ASP B CG     1 
ATOM   2794  O  OD1    . ASP B 2 7   ? -15.261 -7.740 217.410 1.00 129.39 ? 85  ASP B OD1    1 
ATOM   2795  O  OD2    . ASP B 2 7   ? -16.020 -9.460 216.273 1.00 134.81 ? 85  ASP B OD2    1 
ATOM   2796  H  HA     . ASP B 2 7   ? -15.781 -5.644 216.156 1.00 128.91 ? 85  ASP B HA     1 
ATOM   2797  H  HB2    . ASP B 2 7   ? -17.811 -7.581 215.877 1.00 122.18 ? 85  ASP B HB2    1 
ATOM   2798  H  HB3    . ASP B 2 7   ? -16.663 -7.405 214.792 1.00 122.18 ? 85  ASP B HB3    1 
ATOM   2799  N  N      . LYS B 2 8   ? -17.900 -3.799 215.581 1.00 115.81 ? 86  LYS B N      1 
ATOM   2800  C  CA     . LYS B 2 8   ? -18.431 -2.757 214.714 1.00 116.45 ? 86  LYS B CA     1 
ATOM   2801  C  C      . LYS B 2 8   ? -17.417 -1.646 214.469 1.00 112.75 ? 86  LYS B C      1 
ATOM   2802  O  O      . LYS B 2 8   ? -17.805 -0.529 214.110 1.00 122.78 ? 86  LYS B O      1 
ATOM   2803  C  CB     . LYS B 2 8   ? -19.708 -2.168 215.312 1.00 108.16 ? 86  LYS B CB     1 
ATOM   2804  C  CG     . LYS B 2 8   ? -20.818 -3.169 215.554 1.00 117.08 ? 86  LYS B CG     1 
ATOM   2805  C  CD     . LYS B 2 8   ? -21.981 -2.510 216.277 1.00 116.69 ? 86  LYS B CD     1 
ATOM   2806  C  CE     . LYS B 2 8   ? -23.104 -3.496 216.553 1.00 127.37 ? 86  LYS B CE     1 
ATOM   2807  N  NZ     . LYS B 2 8   ? -24.173 -2.894 217.400 1.00 135.13 ? 86  LYS B NZ     1 
ATOM   2808  H  H      . LYS B 2 8   ? -17.951 -3.608 216.418 1.00 138.97 ? 86  LYS B H      1 
ATOM   2809  H  HA     . LYS B 2 8   ? -18.657 -3.149 213.856 1.00 139.74 ? 86  LYS B HA     1 
ATOM   2810  H  HB2    . LYS B 2 8   ? -19.491 -1.760 216.165 1.00 129.79 ? 86  LYS B HB2    1 
ATOM   2811  H  HB3    . LYS B 2 8   ? -20.050 -1.493 214.706 1.00 129.79 ? 86  LYS B HB3    1 
ATOM   2812  H  HG2    . LYS B 2 8   ? -21.139 -3.509 214.704 1.00 140.50 ? 86  LYS B HG2    1 
ATOM   2813  H  HG3    . LYS B 2 8   ? -20.485 -3.894 216.105 1.00 140.50 ? 86  LYS B HG3    1 
ATOM   2814  H  HD2    . LYS B 2 8   ? -21.671 -2.158 217.127 1.00 140.03 ? 86  LYS B HD2    1 
ATOM   2815  H  HD3    . LYS B 2 8   ? -22.335 -1.793 215.727 1.00 140.03 ? 86  LYS B HD3    1 
ATOM   2816  H  HE2    . LYS B 2 8   ? -23.501 -3.770 215.711 1.00 152.85 ? 86  LYS B HE2    1 
ATOM   2817  H  HE3    . LYS B 2 8   ? -22.744 -4.266 217.020 1.00 152.85 ? 86  LYS B HE3    1 
ATOM   2818  H  HZ1    . LYS B 2 8   ? -24.817 -3.491 217.546 1.00 162.16 ? 86  LYS B HZ1    1 
ATOM   2819  H  HZ2    . LYS B 2 8   ? -23.834 -2.638 218.181 1.00 162.16 ? 86  LYS B HZ2    1 
ATOM   2820  H  HZ3    . LYS B 2 8   ? -24.523 -2.186 216.990 1.00 162.16 ? 86  LYS B HZ3    1 
ATOM   2821  N  N      . GLU B 2 9   ? -16.126 -1.932 214.661 1.00 219.11 ? 87  GLU B N      1 
ATOM   2822  C  CA     . GLU B 2 9   ? -15.098 -0.910 214.496 1.00 225.05 ? 87  GLU B CA     1 
ATOM   2823  C  C      . GLU B 2 9   ? -15.251 -0.165 213.182 1.00 217.76 ? 87  GLU B C      1 
ATOM   2824  O  O      . GLU B 2 9   ? -14.892 1.014  213.091 1.00 197.15 ? 87  GLU B O      1 
ATOM   2825  C  CB     . GLU B 2 9   ? -13.712 -1.548 214.567 1.00 118.23 ? 87  GLU B CB     1 
ATOM   2826  C  CG     . GLU B 2 9   ? -13.385 -2.440 213.380 1.00 117.35 ? 87  GLU B CG     1 
ATOM   2827  C  CD     . GLU B 2 9   ? -12.068 -3.161 213.559 1.00 113.38 ? 87  GLU B CD     1 
ATOM   2828  O  OE1    . GLU B 2 9   ? -11.169 -2.563 214.186 1.00 112.44 ? 87  GLU B OE1    1 
ATOM   2829  O  OE2    . GLU B 2 9   ? -11.933 -4.314 213.090 1.00 118.18 ? 87  GLU B OE2    1 
ATOM   2830  H  H      . GLU B 2 9   ? -15.825 -2.705 214.887 1.00 262.93 ? 87  GLU B H      1 
ATOM   2831  H  HA     . GLU B 2 9   ? -15.171 -0.267 215.218 1.00 270.06 ? 87  GLU B HA     1 
ATOM   2832  H  HB2    . GLU B 2 9   ? -13.046 -0.844 214.601 1.00 141.87 ? 87  GLU B HB2    1 
ATOM   2833  H  HB3    . GLU B 2 9   ? -13.658 -2.090 215.370 1.00 141.87 ? 87  GLU B HB3    1 
ATOM   2834  H  HG2    . GLU B 2 9   ? -14.083 -3.106 213.280 1.00 140.82 ? 87  GLU B HG2    1 
ATOM   2835  H  HG3    . GLU B 2 9   ? -13.326 -1.896 212.579 1.00 140.82 ? 87  GLU B HG3    1 
ATOM   2836  N  N      . ARG B 2 10  ? -15.768 -0.836 212.150 1.00 212.59 ? 88  ARG B N      1 
ATOM   2837  C  CA     . ARG B 2 10  ? -16.021 -0.158 210.887 1.00 205.83 ? 88  ARG B CA     1 
ATOM   2838  C  C      . ARG B 2 10  ? -16.803 1.129  211.096 1.00 200.55 ? 88  ARG B C      1 
ATOM   2839  O  O      . ARG B 2 10  ? -16.589 2.109  210.375 1.00 197.97 ? 88  ARG B O      1 
ATOM   2840  C  CB     . ARG B 2 10  ? -16.776 -1.086 209.929 1.00 97.37  ? 88  ARG B CB     1 
ATOM   2841  C  CG     . ARG B 2 10  ? -15.892 -2.038 209.124 1.00 100.18 ? 88  ARG B CG     1 
ATOM   2842  C  CD     . ARG B 2 10  ? -14.879 -1.273 208.283 1.00 95.88  ? 88  ARG B CD     1 
ATOM   2843  N  NE     . ARG B 2 10  ? -13.590 -1.161 208.962 1.00 98.74  ? 88  ARG B NE     1 
ATOM   2844  C  CZ     . ARG B 2 10  ? -12.647 -0.277 208.648 1.00 98.32  ? 88  ARG B CZ     1 
ATOM   2845  N  NH1    . ARG B 2 10  ? -12.843 0.597  207.667 1.00 84.22  ? 88  ARG B NH1    1 
ATOM   2846  N  NH2    . ARG B 2 10  ? -11.505 -0.263 209.326 1.00 96.30  ? 88  ARG B NH2    1 
ATOM   2847  H  H      . ARG B 2 10  ? -15.977 -1.671 212.159 1.00 255.10 ? 88  ARG B H      1 
ATOM   2848  H  HA     . ARG B 2 10  ? -15.172 0.070  210.476 1.00 247.00 ? 88  ARG B HA     1 
ATOM   2849  H  HB2    . ARG B 2 10  ? -17.394 -1.627 210.446 1.00 116.85 ? 88  ARG B HB2    1 
ATOM   2850  H  HB3    . ARG B 2 10  ? -17.271 -0.541 209.298 1.00 116.85 ? 88  ARG B HB3    1 
ATOM   2851  H  HG2    . ARG B 2 10  ? -15.408 -2.617 209.733 1.00 120.21 ? 88  ARG B HG2    1 
ATOM   2852  H  HG3    . ARG B 2 10  ? -16.448 -2.564 208.528 1.00 120.21 ? 88  ARG B HG3    1 
ATOM   2853  H  HD2    . ARG B 2 10  ? -14.741 -1.742 207.445 1.00 115.06 ? 88  ARG B HD2    1 
ATOM   2854  H  HD3    . ARG B 2 10  ? -15.213 -0.378 208.116 1.00 115.06 ? 88  ARG B HD3    1 
ATOM   2855  H  HE     . ARG B 2 10  ? -13.430 -1.704 209.609 1.00 118.48 ? 88  ARG B HE     1 
ATOM   2856  H  HH11   . ARG B 2 10  ? -13.581 0.589  207.226 1.00 101.07 ? 88  ARG B HH11   1 
ATOM   2857  H  HH12   . ARG B 2 10  ? -12.231 1.167  207.470 1.00 101.07 ? 88  ARG B HH12   1 
ATOM   2858  H  HH21   . ARG B 2 10  ? -11.376 -0.825 209.964 1.00 115.56 ? 88  ARG B HH21   1 
ATOM   2859  H  HH22   . ARG B 2 10  ? -10.895 0.311  209.129 1.00 115.56 ? 88  ARG B HH22   1 
ATOM   2860  N  N      . LEU B 2 11  ? -17.703 1.154  212.080 1.00 197.04 ? 89  LEU B N      1 
ATOM   2861  C  CA     . LEU B 2 11  ? -18.458 2.372  212.353 1.00 182.08 ? 89  LEU B CA     1 
ATOM   2862  C  C      . LEU B 2 11  ? -17.527 3.497  212.784 1.00 178.23 ? 89  LEU B C      1 
ATOM   2863  O  O      . LEU B 2 11  ? -17.588 4.609  212.247 1.00 204.77 ? 89  LEU B O      1 
ATOM   2864  C  CB     . LEU B 2 11  ? -19.528 2.103  213.416 1.00 201.55 ? 89  LEU B CB     1 
ATOM   2865  C  CG     . LEU B 2 11  ? -19.205 2.283  214.907 1.00 206.09 ? 89  LEU B CG     1 
ATOM   2866  C  CD1    . LEU B 2 11  ? -19.301 3.745  215.355 1.00 180.85 ? 89  LEU B CD1    1 
ATOM   2867  C  CD2    . LEU B 2 11  ? -20.138 1.431  215.740 1.00 219.97 ? 89  LEU B CD2    1 
ATOM   2868  H  H      . LEU B 2 11  ? -17.891 0.491  212.595 1.00 236.45 ? 89  LEU B H      1 
ATOM   2869  H  HA     . LEU B 2 11  ? -18.909 2.652  211.541 1.00 218.50 ? 89  LEU B HA     1 
ATOM   2870  H  HB2    . LEU B 2 11  ? -20.278 2.689  213.227 1.00 241.86 ? 89  LEU B HB2    1 
ATOM   2871  H  HB3    . LEU B 2 11  ? -19.819 1.184  213.309 1.00 241.86 ? 89  LEU B HB3    1 
ATOM   2872  H  HG     . LEU B 2 11  ? -18.299 1.980  215.070 1.00 247.31 ? 89  LEU B HG     1 
ATOM   2873  H  HD11   . LEU B 2 11  ? -19.088 3.800  216.299 1.00 217.02 ? 89  LEU B HD11   1 
ATOM   2874  H  HD12   . LEU B 2 11  ? -18.670 4.274  214.842 1.00 217.02 ? 89  LEU B HD12   1 
ATOM   2875  H  HD13   . LEU B 2 11  ? -20.204 4.064  215.199 1.00 217.02 ? 89  LEU B HD13   1 
ATOM   2876  H  HD21   . LEU B 2 11  ? -19.924 1.553  216.678 1.00 263.96 ? 89  LEU B HD21   1 
ATOM   2877  H  HD22   . LEU B 2 11  ? -21.053 1.706  215.571 1.00 263.96 ? 89  LEU B HD22   1 
ATOM   2878  H  HD23   . LEU B 2 11  ? -20.021 0.500  215.492 1.00 263.96 ? 89  LEU B HD23   1 
ATOM   2879  N  N      . ALA B 2 12  ? -16.645 3.225  213.749 1.00 200.94 ? 90  ALA B N      1 
ATOM   2880  C  CA     . ALA B 2 12  ? -15.723 4.255  214.213 1.00 194.66 ? 90  ALA B CA     1 
ATOM   2881  C  C      . ALA B 2 12  ? -14.711 4.608  213.135 1.00 181.72 ? 90  ALA B C      1 
ATOM   2882  O  O      . ALA B 2 12  ? -14.244 5.750  213.072 1.00 183.95 ? 90  ALA B O      1 
ATOM   2883  C  CB     . ALA B 2 12  ? -15.015 3.797  215.486 1.00 209.60 ? 90  ALA B CB     1 
ATOM   2884  H  H      . ALA B 2 12  ? -16.563 2.465  214.144 1.00 241.13 ? 90  ALA B H      1 
ATOM   2885  H  HA     . ALA B 2 12  ? -16.227 5.057  214.423 1.00 233.59 ? 90  ALA B HA     1 
ATOM   2886  H  HB1    . ALA B 2 12  ? -14.408 4.495  215.778 1.00 251.51 ? 90  ALA B HB1    1 
ATOM   2887  H  HB2    . ALA B 2 12  ? -15.679 3.628  216.173 1.00 251.51 ? 90  ALA B HB2    1 
ATOM   2888  H  HB3    . ALA B 2 12  ? -14.520 2.985  215.297 1.00 251.51 ? 90  ALA B HB3    1 
ATOM   2889  N  N      . ARG B 2 13  ? -14.356 3.643  212.287 1.00 191.34 ? 91  ARG B N      1 
ATOM   2890  C  CA     . ARG B 2 13  ? -13.593 3.939  211.083 1.00 208.32 ? 91  ARG B CA     1 
ATOM   2891  C  C      . ARG B 2 13  ? -14.470 4.552  210.000 1.00 172.82 ? 91  ARG B C      1 
ATOM   2892  O  O      . ARG B 2 13  ? -13.944 5.147  209.054 1.00 164.35 ? 91  ARG B O      1 
ATOM   2893  C  CB     . ARG B 2 13  ? -12.919 2.667  210.562 1.00 211.47 ? 91  ARG B CB     1 
ATOM   2894  C  CG     . ARG B 2 13  ? -12.086 1.926  211.615 1.00 214.80 ? 91  ARG B CG     1 
ATOM   2895  C  CD     . ARG B 2 13  ? -10.591 2.139  211.418 1.00 197.33 ? 91  ARG B CD     1 
ATOM   2896  N  NE     . ARG B 2 13  ? -9.838  1.933  212.658 1.00 186.61 ? 91  ARG B NE     1 
ATOM   2897  C  CZ     . ARG B 2 13  ? -9.059  0.887  212.927 1.00 197.76 ? 91  ARG B CZ     1 
ATOM   2898  N  NH1    . ARG B 2 13  ? -8.891  -0.092 212.048 1.00 203.61 ? 91  ARG B NH1    1 
ATOM   2899  N  NH2    . ARG B 2 13  ? -8.431  0.823  214.093 1.00 191.43 ? 91  ARG B NH2    1 
ATOM   2900  H  H      . ARG B 2 13  ? -14.547 2.810  212.388 1.00 229.61 ? 91  ARG B H      1 
ATOM   2901  H  HA     . ARG B 2 13  ? -12.897 4.578  211.302 1.00 249.99 ? 91  ARG B HA     1 
ATOM   2902  H  HB2    . ARG B 2 13  ? -13.605 2.058  210.245 1.00 253.77 ? 91  ARG B HB2    1 
ATOM   2903  H  HB3    . ARG B 2 13  ? -12.328 2.904  209.830 1.00 253.77 ? 91  ARG B HB3    1 
ATOM   2904  H  HG2    . ARG B 2 13  ? -12.324 2.253  212.497 1.00 257.77 ? 91  ARG B HG2    1 
ATOM   2905  H  HG3    . ARG B 2 13  ? -12.266 0.974  211.552 1.00 257.77 ? 91  ARG B HG3    1 
ATOM   2906  H  HD2    . ARG B 2 13  ? -10.263 1.509  210.757 1.00 236.80 ? 91  ARG B HD2    1 
ATOM   2907  H  HD3    . ARG B 2 13  ? -10.436 3.049  211.118 1.00 236.80 ? 91  ARG B HD3    1 
ATOM   2908  H  HE     . ARG B 2 13  ? -9.905  2.540  213.264 1.00 223.93 ? 91  ARG B HE     1 
ATOM   2909  H  HH11   . ARG B 2 13  ? -9.293  -0.062 211.288 1.00 244.33 ? 91  ARG B HH11   1 
ATOM   2910  H  HH12   . ARG B 2 13  ? -8.383  -0.759 212.240 1.00 244.33 ? 91  ARG B HH12   1 
ATOM   2911  H  HH21   . ARG B 2 13  ? -8.531  1.453  214.670 1.00 229.72 ? 91  ARG B HH21   1 
ATOM   2912  H  HH22   . ARG B 2 13  ? -7.925  0.151  214.273 1.00 229.72 ? 91  ARG B HH22   1 
ATOM   2913  N  N      . GLU B 2 14  ? -15.793 4.414  210.119 1.00 158.93 ? 92  GLU B N      1 
ATOM   2914  C  CA     . GLU B 2 14  ? -16.708 5.183  209.285 1.00 161.10 ? 92  GLU B CA     1 
ATOM   2915  C  C      . GLU B 2 14  ? -16.832 6.615  209.783 1.00 157.01 ? 92  GLU B C      1 
ATOM   2916  O  O      . GLU B 2 14  ? -17.079 7.526  208.985 1.00 175.69 ? 92  GLU B O      1 
ATOM   2917  C  CB     . GLU B 2 14  ? -18.081 4.500  209.238 1.00 203.07 ? 92  GLU B CB     1 
ATOM   2918  C  CG     . GLU B 2 14  ? -19.277 5.385  209.574 1.00 185.71 ? 92  GLU B CG     1 
ATOM   2919  C  CD     . GLU B 2 14  ? -20.590 4.631  209.491 1.00 203.05 ? 92  GLU B CD     1 
ATOM   2920  O  OE1    . GLU B 2 14  ? -20.647 3.614  208.764 1.00 202.01 ? 92  GLU B OE1    1 
ATOM   2921  O  OE2    . GLU B 2 14  ? -21.560 5.050  210.160 1.00 201.54 ? 92  GLU B OE2    1 
ATOM   2922  H  H      . GLU B 2 14  ? -16.181 3.883  210.673 1.00 190.72 ? 92  GLU B H      1 
ATOM   2923  H  HA     . GLU B 2 14  ? -16.359 5.212  208.380 1.00 193.32 ? 92  GLU B HA     1 
ATOM   2924  H  HB2    . GLU B 2 14  ? -18.220 4.154  208.343 1.00 243.68 ? 92  GLU B HB2    1 
ATOM   2925  H  HB3    . GLU B 2 14  ? -18.079 3.765  209.871 1.00 243.68 ? 92  GLU B HB3    1 
ATOM   2926  H  HG2    . GLU B 2 14  ? -19.179 5.721  210.478 1.00 222.85 ? 92  GLU B HG2    1 
ATOM   2927  H  HG3    . GLU B 2 14  ? -19.312 6.123  208.946 1.00 222.85 ? 92  GLU B HG3    1 
ATOM   2928  N  N      . ASN B 2 15  ? -16.662 6.833  211.090 1.00 171.16 ? 93  ASN B N      1 
ATOM   2929  C  CA     . ASN B 2 15  ? -16.523 8.193  211.594 1.00 156.02 ? 93  ASN B CA     1 
ATOM   2930  C  C      . ASN B 2 15  ? -15.185 8.790  211.182 1.00 134.53 ? 93  ASN B C      1 
ATOM   2931  O  O      . ASN B 2 15  ? -15.070 10.010 211.027 1.00 131.82 ? 93  ASN B O      1 
ATOM   2932  C  CB     . ASN B 2 15  ? -16.668 8.216  213.116 1.00 160.03 ? 93  ASN B CB     1 
ATOM   2933  C  CG     . ASN B 2 15  ? -16.734 9.625  213.670 1.00 182.37 ? 93  ASN B CG     1 
ATOM   2934  O  OD1    . ASN B 2 15  ? -17.136 10.557 212.975 1.00 193.67 ? 93  ASN B OD1    1 
ATOM   2935  N  ND2    . ASN B 2 15  ? -16.336 9.790  214.926 1.00 159.93 ? 93  ASN B ND2    1 
ATOM   2936  H  H      . ASN B 2 15  ? -16.624 6.220  211.692 1.00 205.40 ? 93  ASN B H      1 
ATOM   2937  H  HA     . ASN B 2 15  ? -17.227 8.744  211.217 1.00 187.23 ? 93  ASN B HA     1 
ATOM   2938  H  HB2    . ASN B 2 15  ? -17.485 7.757  213.363 1.00 192.04 ? 93  ASN B HB2    1 
ATOM   2939  H  HB3    . ASN B 2 15  ? -15.902 7.772  213.513 1.00 192.04 ? 93  ASN B HB3    1 
ATOM   2940  H  HD21   . ASN B 2 15  ? -16.356 10.571 215.285 1.00 191.92 ? 93  ASN B HD21   1 
ATOM   2941  H  HD22   . ASN B 2 15  ? -16.058 9.115  215.381 1.00 191.92 ? 93  ASN B HD22   1 
ATOM   2942  N  N      . HIS B 2 16  ? -14.167 7.946  211.001 1.00 135.82 ? 94  HIS B N      1 
ATOM   2943  C  CA     . HIS B 2 16  ? -12.903 8.417  210.448 1.00 135.82 ? 94  HIS B CA     1 
ATOM   2944  C  C      . HIS B 2 16  ? -13.104 8.982  209.048 1.00 175.55 ? 94  HIS B C      1 
ATOM   2945  O  O      . HIS B 2 16  ? -12.523 10.016 208.698 1.00 146.18 ? 94  HIS B O      1 
ATOM   2946  C  CB     . HIS B 2 16  ? -11.887 7.273  210.432 1.00 142.69 ? 94  HIS B CB     1 
ATOM   2947  C  CG     . HIS B 2 16  ? -10.578 7.630  209.801 1.00 129.70 ? 94  HIS B CG     1 
ATOM   2948  N  ND1    . HIS B 2 16  ? -10.194 8.932  209.562 1.00 119.57 ? 94  HIS B ND1    1 
ATOM   2949  C  CD2    . HIS B 2 16  ? -9.562  6.852  209.358 1.00 156.79 ? 94  HIS B CD2    1 
ATOM   2950  C  CE1    . HIS B 2 16  ? -8.998  8.941  209.000 1.00 131.51 ? 94  HIS B CE1    1 
ATOM   2951  N  NE2    . HIS B 2 16  ? -8.592  7.692  208.865 1.00 165.67 ? 94  HIS B NE2    1 
ATOM   2952  H  H      . HIS B 2 16  ? -14.185 7.107  211.190 1.00 162.98 ? 94  HIS B H      1 
ATOM   2953  H  HA     . HIS B 2 16  ? -12.553 9.124  211.011 1.00 162.98 ? 94  HIS B HA     1 
ATOM   2954  H  HB2    . HIS B 2 16  ? -11.711 7.001  211.346 1.00 171.23 ? 94  HIS B HB2    1 
ATOM   2955  H  HB3    . HIS B 2 16  ? -12.263 6.530  209.935 1.00 171.23 ? 94  HIS B HB3    1 
ATOM   2956  H  HD1    . HIS B 2 16  ? -10.660 9.630  209.750 1.00 143.48 ? 94  HIS B HD1    1 
ATOM   2957  H  HD2    . HIS B 2 16  ? -9.527  5.923  209.384 1.00 188.15 ? 94  HIS B HD2    1 
ATOM   2958  H  HE1    . HIS B 2 16  ? -8.524  9.698  208.743 1.00 157.81 ? 94  HIS B HE1    1 
ATOM   2959  N  N      . SER B 2 17  ? -13.924 8.316  208.233 1.00 166.20 ? 95  SER B N      1 
ATOM   2960  C  CA     . SER B 2 17  ? -14.236 8.839  206.907 1.00 136.89 ? 95  SER B CA     1 
ATOM   2961  C  C      . SER B 2 17  ? -14.829 10.239 207.002 1.00 132.12 ? 95  SER B C      1 
ATOM   2962  O  O      . SER B 2 17  ? -14.376 11.165 206.321 1.00 148.14 ? 95  SER B O      1 
ATOM   2963  C  CB     . SER B 2 17  ? -15.195 7.892  206.185 1.00 176.75 ? 95  SER B CB     1 
ATOM   2964  O  OG     . SER B 2 17  ? -16.222 7.445  207.052 1.00 174.98 ? 95  SER B OG     1 
ATOM   2965  H  H      . SER B 2 17  ? -14.306 7.570  208.422 1.00 199.44 ? 95  SER B H      1 
ATOM   2966  H  HA     . SER B 2 17  ? -13.418 8.893  206.388 1.00 164.26 ? 95  SER B HA     1 
ATOM   2967  H  HB2    . SER B 2 17  ? -15.596 8.361  205.437 1.00 212.10 ? 95  SER B HB2    1 
ATOM   2968  H  HB3    . SER B 2 17  ? -14.697 7.124  205.865 1.00 212.10 ? 95  SER B HB3    1 
ATOM   2969  H  HG     . SER B 2 17  ? -16.663 8.100  207.337 1.00 209.97 ? 95  SER B HG     1 
ATOM   2970  N  N      . GLU B 2 18  ? -15.844 10.411 207.853 1.00 144.67 ? 96  GLU B N      1 
ATOM   2971  C  CA     . GLU B 2 18  ? -16.471 11.720 208.018 1.00 124.46 ? 96  GLU B CA     1 
ATOM   2972  C  C      . GLU B 2 18  ? -15.436 12.796 208.315 1.00 122.70 ? 96  GLU B C      1 
ATOM   2973  O  O      . GLU B 2 18  ? -15.527 13.917 207.803 1.00 119.09 ? 96  GLU B O      1 
ATOM   2974  C  CB     . GLU B 2 18  ? -17.506 11.664 209.142 1.00 148.73 ? 96  GLU B CB     1 
ATOM   2975  C  CG     . GLU B 2 18  ? -18.632 10.670 208.910 1.00 186.34 ? 96  GLU B CG     1 
ATOM   2976  C  CD     . GLU B 2 18  ? -19.429 10.398 210.168 1.00 187.80 ? 96  GLU B CD     1 
ATOM   2977  O  OE1    . GLU B 2 18  ? -20.029 9.307  210.271 1.00 191.68 ? 96  GLU B OE1    1 
ATOM   2978  O  OE2    . GLU B 2 18  ? -19.448 11.272 211.061 1.00 146.52 ? 96  GLU B OE2    1 
ATOM   2979  H  H      . GLU B 2 18  ? -16.183 9.791  208.342 1.00 173.61 ? 96  GLU B H      1 
ATOM   2980  H  HA     . GLU B 2 18  ? -16.929 11.959 207.197 1.00 149.35 ? 96  GLU B HA     1 
ATOM   2981  H  HB2    . GLU B 2 18  ? -17.057 11.414 209.965 1.00 178.47 ? 96  GLU B HB2    1 
ATOM   2982  H  HB3    . GLU B 2 18  ? -17.904 12.543 209.240 1.00 178.47 ? 96  GLU B HB3    1 
ATOM   2983  H  HG2    . GLU B 2 18  ? -19.237 11.027 208.241 1.00 223.61 ? 96  GLU B HG2    1 
ATOM   2984  H  HG3    . GLU B 2 18  ? -18.255 9.830  208.604 1.00 223.61 ? 96  GLU B HG3    1 
ATOM   2985  N  N      . ILE B 2 19  ? -14.444 12.474 209.143 1.00 131.83 ? 97  ILE B N      1 
ATOM   2986  C  CA     . ILE B 2 19  ? -13.407 13.445 209.484 1.00 146.01 ? 97  ILE B CA     1 
ATOM   2987  C  C      . ILE B 2 19  ? -12.587 13.790 208.247 1.00 123.17 ? 97  ILE B C      1 
ATOM   2988  O  O      . ILE B 2 19  ? -12.451 14.961 207.875 1.00 96.69  ? 97  ILE B O      1 
ATOM   2989  C  CB     . ILE B 2 19  ? -12.517 12.907 210.619 1.00 110.33 ? 97  ILE B CB     1 
ATOM   2990  C  CG1    . ILE B 2 19  ? -13.359 12.647 211.872 1.00 116.78 ? 97  ILE B CG1    1 
ATOM   2991  C  CG2    . ILE B 2 19  ? -11.398 13.898 210.939 1.00 109.73 ? 97  ILE B CG2    1 
ATOM   2992  C  CD1    . ILE B 2 19  ? -12.623 11.925 212.983 1.00 154.66 ? 97  ILE B CD1    1 
ATOM   2993  H  H      . ILE B 2 19  ? -14.350 11.707 209.519 1.00 158.20 ? 97  ILE B H      1 
ATOM   2994  H  HA     . ILE B 2 19  ? -13.830 14.259 209.798 1.00 175.22 ? 97  ILE B HA     1 
ATOM   2995  H  HB     . ILE B 2 19  ? -12.118 12.070 210.332 1.00 132.39 ? 97  ILE B HB     1 
ATOM   2996  H  HG12   . ILE B 2 19  ? -13.662 13.498 212.224 1.00 140.14 ? 97  ILE B HG12   1 
ATOM   2997  H  HG13   . ILE B 2 19  ? -14.124 12.104 211.625 1.00 140.14 ? 97  ILE B HG13   1 
ATOM   2998  H  HG21   . ILE B 2 19  ? -10.852 13.537 211.656 1.00 131.67 ? 97  ILE B HG21   1 
ATOM   2999  H  HG22   . ILE B 2 19  ? -10.857 14.030 210.145 1.00 131.67 ? 97  ILE B HG22   1 
ATOM   3000  H  HG23   . ILE B 2 19  ? -11.792 14.740 211.216 1.00 131.67 ? 97  ILE B HG23   1 
ATOM   3001  H  HD11   . ILE B 2 19  ? -13.226 11.802 213.733 1.00 185.59 ? 97  ILE B HD11   1 
ATOM   3002  H  HD12   . ILE B 2 19  ? -12.323 11.063 212.655 1.00 185.59 ? 97  ILE B HD12   1 
ATOM   3003  H  HD13   . ILE B 2 19  ? -11.860 12.459 213.256 1.00 185.59 ? 97  ILE B HD13   1 
ATOM   3004  N  N      . GLU B 2 20  ? -12.024 12.771 207.593 1.00 157.10 ? 98  GLU B N      1 
ATOM   3005  C  CA     . GLU B 2 20  ? -11.240 13.010 206.386 1.00 142.36 ? 98  GLU B CA     1 
ATOM   3006  C  C      . GLU B 2 20  ? -12.059 13.732 205.329 1.00 117.68 ? 98  GLU B C      1 
ATOM   3007  O  O      . GLU B 2 20  ? -11.496 14.434 204.485 1.00 123.61 ? 98  GLU B O      1 
ATOM   3008  C  CB     . GLU B 2 20  ? -10.703 11.686 205.835 1.00 130.80 ? 98  GLU B CB     1 
ATOM   3009  C  CG     . GLU B 2 20  ? -10.023 11.783 204.468 1.00 139.31 ? 98  GLU B CG     1 
ATOM   3010  C  CD     . GLU B 2 20  ? -8.795  12.668 204.480 1.00 121.39 ? 98  GLU B CD     1 
ATOM   3011  O  OE1    . GLU B 2 20  ? -8.306  12.992 205.579 1.00 112.72 ? 98  GLU B OE1    1 
ATOM   3012  O  OE2    . GLU B 2 20  ? -8.308  13.034 203.390 1.00 148.95 ? 98  GLU B OE2    1 
ATOM   3013  H  H      . GLU B 2 20  ? -12.082 11.945 207.826 1.00 188.52 ? 98  GLU B H      1 
ATOM   3014  H  HA     . GLU B 2 20  ? -10.481 13.571 206.610 1.00 170.83 ? 98  GLU B HA     1 
ATOM   3015  H  HB2    . GLU B 2 20  ? -10.052 11.333 206.461 1.00 156.96 ? 98  GLU B HB2    1 
ATOM   3016  H  HB3    . GLU B 2 20  ? -11.443 11.064 205.751 1.00 156.96 ? 98  GLU B HB3    1 
ATOM   3017  H  HG2    . GLU B 2 20  ? -9.751  10.896 204.187 1.00 167.17 ? 98  GLU B HG2    1 
ATOM   3018  H  HG3    . GLU B 2 20  ? -10.653 12.154 203.829 1.00 167.17 ? 98  GLU B HG3    1 
ATOM   3019  N  N      . ARG B 2 21  ? -13.381 13.571 205.353 1.00 125.77 ? 99  ARG B N      1 
ATOM   3020  C  CA     . ARG B 2 21  ? -14.224 14.264 204.387 1.00 116.37 ? 99  ARG B CA     1 
ATOM   3021  C  C      . ARG B 2 21  ? -14.186 15.768 204.617 1.00 132.05 ? 99  ARG B C      1 
ATOM   3022  O  O      . ARG B 2 21  ? -13.969 16.543 203.679 1.00 149.42 ? 99  ARG B O      1 
ATOM   3023  C  CB     . ARG B 2 21  ? -15.656 13.743 204.475 1.00 146.78 ? 99  ARG B CB     1 
ATOM   3024  C  CG     . ARG B 2 21  ? -16.589 14.320 203.414 1.00 144.98 ? 99  ARG B CG     1 
ATOM   3025  C  CD     . ARG B 2 21  ? -17.922 14.771 203.995 1.00 149.56 ? 99  ARG B CD     1 
ATOM   3026  N  NE     . ARG B 2 21  ? -19.038 14.001 203.458 1.00 158.45 ? 99  ARG B NE     1 
ATOM   3027  C  CZ     . ARG B 2 21  ? -19.325 12.751 203.809 1.00 159.25 ? 99  ARG B CZ     1 
ATOM   3028  N  NH1    . ARG B 2 21  ? -18.570 12.114 204.695 1.00 172.19 ? 99  ARG B NH1    1 
ATOM   3029  N  NH2    . ARG B 2 21  ? -20.365 12.134 203.268 1.00 164.85 ? 99  ARG B NH2    1 
ATOM   3030  H  H      . ARG B 2 21  ? -13.808 13.073 205.909 1.00 150.93 ? 99  ARG B H      1 
ATOM   3031  H  HA     . ARG B 2 21  ? -13.893 14.088 203.493 1.00 139.64 ? 99  ARG B HA     1 
ATOM   3032  H  HB2    . ARG B 2 21  ? -15.644 12.779 204.367 1.00 176.13 ? 99  ARG B HB2    1 
ATOM   3033  H  HB3    . ARG B 2 21  ? -16.019 13.971 205.345 1.00 176.13 ? 99  ARG B HB3    1 
ATOM   3034  H  HG2    . ARG B 2 21  ? -16.164 15.089 203.003 1.00 173.97 ? 99  ARG B HG2    1 
ATOM   3035  H  HG3    . ARG B 2 21  ? -16.766 13.640 202.745 1.00 173.97 ? 99  ARG B HG3    1 
ATOM   3036  H  HD2    . ARG B 2 21  ? -17.907 14.651 204.957 1.00 179.47 ? 99  ARG B HD2    1 
ATOM   3037  H  HD3    . ARG B 2 21  ? -18.065 15.705 203.776 1.00 179.47 ? 99  ARG B HD3    1 
ATOM   3038  H  HE     . ARG B 2 21  ? -19.547 14.382 202.879 1.00 190.14 ? 99  ARG B HE     1 
ATOM   3039  H  HH11   . ARG B 2 21  ? -17.894 12.511 205.049 1.00 206.63 ? 99  ARG B HH11   1 
ATOM   3040  H  HH12   . ARG B 2 21  ? -18.758 11.305 204.918 1.00 206.63 ? 99  ARG B HH12   1 
ATOM   3041  H  HH21   . ARG B 2 21  ? -20.855 12.543 202.691 1.00 197.82 ? 99  ARG B HH21   1 
ATOM   3042  H  HH22   . ARG B 2 21  ? -20.549 11.325 203.492 1.00 197.82 ? 99  ARG B HH22   1 
ATOM   3043  N  N      . ARG B 2 22  ? -14.405 16.202 205.862 1.00 142.15 ? 100 ARG B N      1 
ATOM   3044  C  CA     . ARG B 2 22  ? -14.361 17.629 206.165 1.00 107.50 ? 100 ARG B CA     1 
ATOM   3045  C  C      . ARG B 2 22  ? -13.045 18.246 205.718 1.00 97.54  ? 100 ARG B C      1 
ATOM   3046  O  O      . ARG B 2 22  ? -13.010 19.394 205.262 1.00 126.33 ? 100 ARG B O      1 
ATOM   3047  C  CB     . ARG B 2 22  ? -14.570 17.861 207.662 1.00 128.99 ? 100 ARG B CB     1 
ATOM   3048  C  CG     . ARG B 2 22  ? -15.957 18.365 208.027 1.00 143.96 ? 100 ARG B CG     1 
ATOM   3049  C  CD     . ARG B 2 22  ? -16.818 17.260 208.603 1.00 156.69 ? 100 ARG B CD     1 
ATOM   3050  N  NE     . ARG B 2 22  ? -18.216 17.666 208.711 1.00 164.51 ? 100 ARG B NE     1 
ATOM   3051  C  CZ     . ARG B 2 22  ? -19.168 16.940 209.288 1.00 154.98 ? 100 ARG B CZ     1 
ATOM   3052  N  NH1    . ARG B 2 22  ? -18.880 15.760 209.822 1.00 145.22 ? 100 ARG B NH1    1 
ATOM   3053  N  NH2    . ARG B 2 22  ? -20.412 17.398 209.336 1.00 149.42 ? 100 ARG B NH2    1 
ATOM   3054  H  H      . ARG B 2 22  ? -14.579 15.697 206.536 1.00 170.58 ? 100 ARG B H      1 
ATOM   3055  H  HA     . ARG B 2 22  ? -15.079 18.076 205.689 1.00 129.00 ? 100 ARG B HA     1 
ATOM   3056  H  HB2    . ARG B 2 22  ? -14.429 17.023 208.129 1.00 154.78 ? 100 ARG B HB2    1 
ATOM   3057  H  HB3    . ARG B 2 22  ? -13.927 18.519 207.968 1.00 154.78 ? 100 ARG B HB3    1 
ATOM   3058  H  HG2    . ARG B 2 22  ? -15.877 19.066 208.692 1.00 172.75 ? 100 ARG B HG2    1 
ATOM   3059  H  HG3    . ARG B 2 22  ? -16.393 18.706 207.230 1.00 172.75 ? 100 ARG B HG3    1 
ATOM   3060  H  HD2    . ARG B 2 22  ? -16.772 16.483 208.024 1.00 188.02 ? 100 ARG B HD2    1 
ATOM   3061  H  HD3    . ARG B 2 22  ? -16.498 17.035 209.491 1.00 188.02 ? 100 ARG B HD3    1 
ATOM   3062  H  HE     . ARG B 2 22  ? -18.439 18.427 208.378 1.00 197.41 ? 100 ARG B HE     1 
ATOM   3063  H  HH11   . ARG B 2 22  ? -18.074 15.460 209.793 1.00 174.26 ? 100 ARG B HH11   1 
ATOM   3064  H  HH12   . ARG B 2 22  ? -19.499 15.294 210.195 1.00 174.26 ? 100 ARG B HH12   1 
ATOM   3065  H  HH21   . ARG B 2 22  ? -20.602 18.163 208.992 1.00 179.30 ? 100 ARG B HH21   1 
ATOM   3066  H  HH22   . ARG B 2 22  ? -21.028 16.929 209.710 1.00 179.30 ? 100 ARG B HH22   1 
ATOM   3067  N  N      . ARG B 2 23  ? -11.948 17.501 205.845 1.00 109.82 ? 101 ARG B N      1 
ATOM   3068  C  CA     . ARG B 2 23  ? -10.677 17.970 205.309 1.00 129.64 ? 101 ARG B CA     1 
ATOM   3069  C  C      . ARG B 2 23  ? -10.809 18.357 203.845 1.00 113.30 ? 101 ARG B C      1 
ATOM   3070  O  O      . ARG B 2 23  ? -10.203 19.336 203.396 1.00 105.33 ? 101 ARG B O      1 
ATOM   3071  C  CB     . ARG B 2 23  ? -9.610  16.893 205.472 1.00 123.09 ? 101 ARG B CB     1 
ATOM   3072  C  CG     . ARG B 2 23  ? -8.938  16.877 206.823 1.00 103.83 ? 101 ARG B CG     1 
ATOM   3073  C  CD     . ARG B 2 23  ? -7.913  15.773 206.869 1.00 120.62 ? 101 ARG B CD     1 
ATOM   3074  N  NE     . ARG B 2 23  ? -7.044  15.818 205.694 1.00 122.19 ? 101 ARG B NE     1 
ATOM   3075  C  CZ     . ARG B 2 23  ? -5.952  16.566 205.595 1.00 133.65 ? 101 ARG B CZ     1 
ATOM   3076  N  NH1    . ARG B 2 23  ? -5.575  17.329 206.607 1.00 115.67 ? 101 ARG B NH1    1 
ATOM   3077  N  NH2    . ARG B 2 23  ? -5.226  16.546 204.484 1.00 103.69 ? 101 ARG B NH2    1 
ATOM   3078  H  H      . ARG B 2 23  ? -11.915 16.733 206.230 1.00 131.78 ? 101 ARG B H      1 
ATOM   3079  H  HA     . ARG B 2 23  ? -10.393 18.754 205.805 1.00 155.57 ? 101 ARG B HA     1 
ATOM   3080  H  HB2    . ARG B 2 23  ? -10.023 16.026 205.338 1.00 147.70 ? 101 ARG B HB2    1 
ATOM   3081  H  HB3    . ARG B 2 23  ? -8.922  17.035 204.803 1.00 147.70 ? 101 ARG B HB3    1 
ATOM   3082  H  HG2    . ARG B 2 23  ? -8.489  17.723 206.974 1.00 124.59 ? 101 ARG B HG2    1 
ATOM   3083  H  HG3    . ARG B 2 23  ? -9.599  16.713 207.514 1.00 124.59 ? 101 ARG B HG3    1 
ATOM   3084  H  HD2    . ARG B 2 23  ? -7.362  15.878 207.660 1.00 144.75 ? 101 ARG B HD2    1 
ATOM   3085  H  HD3    . ARG B 2 23  ? -8.365  14.915 206.882 1.00 144.75 ? 101 ARG B HD3    1 
ATOM   3086  H  HE     . ARG B 2 23  ? -7.255  15.326 205.021 1.00 146.62 ? 101 ARG B HE     1 
ATOM   3087  H  HH11   . ARG B 2 23  ? -6.042  17.347 207.329 1.00 138.81 ? 101 ARG B HH11   1 
ATOM   3088  H  HH12   . ARG B 2 23  ? -4.866  17.811 206.542 1.00 138.81 ? 101 ARG B HH12   1 
ATOM   3089  H  HH21   . ARG B 2 23  ? -5.464  16.049 203.823 1.00 124.43 ? 101 ARG B HH21   1 
ATOM   3090  H  HH22   . ARG B 2 23  ? -4.516  17.028 204.425 1.00 124.43 ? 101 ARG B HH22   1 
ATOM   3091  N  N      . ARG B 2 24  ? -11.586 17.589 203.079 1.00 119.09 ? 102 ARG B N      1 
ATOM   3092  C  CA     . ARG B 2 24  ? -11.841 17.949 201.690 1.00 112.81 ? 102 ARG B CA     1 
ATOM   3093  C  C      . ARG B 2 24  ? -12.674 19.221 201.614 1.00 122.45 ? 102 ARG B C      1 
ATOM   3094  O  O      . ARG B 2 24  ? -12.239 20.231 201.051 1.00 138.46 ? 102 ARG B O      1 
ATOM   3095  C  CB     . ARG B 2 24  ? -12.540 16.798 200.964 1.00 122.61 ? 102 ARG B CB     1 
ATOM   3096  C  CG     . ARG B 2 24  ? -11.883 15.440 201.177 1.00 127.54 ? 102 ARG B CG     1 
ATOM   3097  C  CD     . ARG B 2 24  ? -12.358 14.409 200.159 1.00 125.21 ? 102 ARG B CD     1 
ATOM   3098  N  NE     . ARG B 2 24  ? -13.258 13.413 200.739 1.00 126.30 ? 102 ARG B NE     1 
ATOM   3099  C  CZ     . ARG B 2 24  ? -12.869 12.264 201.286 1.00 153.14 ? 102 ARG B CZ     1 
ATOM   3100  N  NH1    . ARG B 2 24  ? -11.582 11.945 201.345 1.00 162.58 ? 102 ARG B NH1    1 
ATOM   3101  N  NH2    . ARG B 2 24  ? -13.771 11.428 201.781 1.00 145.03 ? 102 ARG B NH2    1 
ATOM   3102  H  H      . ARG B 2 24  ? -11.971 16.866 203.339 1.00 142.90 ? 102 ARG B H      1 
ATOM   3103  H  HA     . ARG B 2 24  ? -10.995 18.116 201.245 1.00 135.37 ? 102 ARG B HA     1 
ATOM   3104  H  HB2    . ARG B 2 24  ? -13.454 16.738 201.283 1.00 147.13 ? 102 ARG B HB2    1 
ATOM   3105  H  HB3    . ARG B 2 24  ? -12.537 16.982 200.012 1.00 147.13 ? 102 ARG B HB3    1 
ATOM   3106  H  HG2    . ARG B 2 24  ? -10.922 15.533 201.087 1.00 153.05 ? 102 ARG B HG2    1 
ATOM   3107  H  HG3    . ARG B 2 24  ? -12.105 15.114 202.063 1.00 153.05 ? 102 ARG B HG3    1 
ATOM   3108  H  HD2    . ARG B 2 24  ? -12.835 14.865 199.447 1.00 150.26 ? 102 ARG B HD2    1 
ATOM   3109  H  HD3    . ARG B 2 24  ? -11.588 13.944 199.798 1.00 150.26 ? 102 ARG B HD3    1 
ATOM   3110  H  HE     . ARG B 2 24  ? -14.102 13.581 200.724 1.00 151.57 ? 102 ARG B HE     1 
ATOM   3111  H  HH11   . ARG B 2 24  ? -10.990 12.482 201.026 1.00 195.09 ? 102 ARG B HH11   1 
ATOM   3112  H  HH12   . ARG B 2 24  ? -11.339 11.201 201.702 1.00 195.09 ? 102 ARG B HH12   1 
ATOM   3113  H  HH21   . ARG B 2 24  ? -14.607 11.628 201.747 1.00 174.03 ? 102 ARG B HH21   1 
ATOM   3114  H  HH22   . ARG B 2 24  ? -13.520 10.686 202.137 1.00 174.03 ? 102 ARG B HH22   1 
ATOM   3115  N  N      . ASN B 2 25  ? -13.874 19.195 202.196 1.00 108.72 ? 103 ASN B N      1 
ATOM   3116  C  CA     . ASN B 2 25  ? -14.729 20.377 202.200 1.00 124.77 ? 103 ASN B CA     1 
ATOM   3117  C  C      . ASN B 2 25  ? -13.957 21.613 202.645 1.00 93.17  ? 103 ASN B C      1 
ATOM   3118  O  O      . ASN B 2 25  ? -13.987 22.652 201.978 1.00 121.00 ? 103 ASN B O      1 
ATOM   3119  C  CB     . ASN B 2 25  ? -15.938 20.144 203.105 1.00 130.45 ? 103 ASN B CB     1 
ATOM   3120  C  CG     . ASN B 2 25  ? -16.802 18.990 202.635 1.00 126.14 ? 103 ASN B CG     1 
ATOM   3121  O  OD1    . ASN B 2 25  ? -16.382 18.186 201.802 1.00 110.73 ? 103 ASN B OD1    1 
ATOM   3122  N  ND2    . ASN B 2 25  ? -18.015 18.902 203.170 1.00 131.60 ? 103 ASN B ND2    1 
ATOM   3123  H  H      . ASN B 2 25  ? -14.212 18.510 202.592 1.00 130.47 ? 103 ASN B H      1 
ATOM   3124  H  HA     . ASN B 2 25  ? -15.055 20.535 201.300 1.00 149.73 ? 103 ASN B HA     1 
ATOM   3125  H  HB2    . ASN B 2 25  ? -15.628 19.941 204.002 1.00 156.53 ? 103 ASN B HB2    1 
ATOM   3126  H  HB3    . ASN B 2 25  ? -16.486 20.944 203.116 1.00 156.53 ? 103 ASN B HB3    1 
ATOM   3127  H  HD21   . ASN B 2 25  ? -18.543 18.264 202.935 1.00 157.92 ? 103 ASN B HD21   1 
ATOM   3128  H  HD22   . ASN B 2 25  ? -18.272 19.481 203.750 1.00 157.92 ? 103 ASN B HD22   1 
ATOM   3129  N  N      . LYS B 2 26  ? -13.255 21.519 203.775 1.00 100.19 ? 104 LYS B N      1 
ATOM   3130  C  CA     . LYS B 2 26  ? -12.406 22.628 204.200 1.00 113.88 ? 104 LYS B CA     1 
ATOM   3131  C  C      . LYS B 2 26  ? -11.354 22.939 203.145 1.00 111.27 ? 104 LYS B C      1 
ATOM   3132  O  O      . LYS B 2 26  ? -11.073 24.109 202.862 1.00 109.19 ? 104 LYS B O      1 
ATOM   3133  C  CB     . LYS B 2 26  ? -11.741 22.304 205.538 1.00 137.48 ? 104 LYS B CB     1 
ATOM   3134  C  CG     . LYS B 2 26  ? -12.696 22.279 206.721 1.00 128.36 ? 104 LYS B CG     1 
ATOM   3135  C  CD     . LYS B 2 26  ? -11.968 21.958 208.017 1.00 104.17 ? 104 LYS B CD     1 
ATOM   3136  C  CE     . LYS B 2 26  ? -12.933 21.850 209.185 1.00 113.40 ? 104 LYS B CE     1 
ATOM   3137  N  NZ     . LYS B 2 26  ? -12.248 21.422 210.436 1.00 138.82 ? 104 LYS B NZ     1 
ATOM   3138  H  H      . LYS B 2 26  ? -13.252 20.839 204.301 1.00 120.22 ? 104 LYS B H      1 
ATOM   3139  H  HA     . LYS B 2 26  ? -12.955 23.418 204.321 1.00 136.66 ? 104 LYS B HA     1 
ATOM   3140  H  HB2    . LYS B 2 26  ? -11.326 21.429 205.476 1.00 164.97 ? 104 LYS B HB2    1 
ATOM   3141  H  HB3    . LYS B 2 26  ? -11.064 22.975 205.720 1.00 164.97 ? 104 LYS B HB3    1 
ATOM   3142  H  HG2    . LYS B 2 26  ? -13.114 23.149 206.813 1.00 154.04 ? 104 LYS B HG2    1 
ATOM   3143  H  HG3    . LYS B 2 26  ? -13.370 21.597 206.573 1.00 154.04 ? 104 LYS B HG3    1 
ATOM   3144  H  HD2    . LYS B 2 26  ? -11.507 21.110 207.924 1.00 125.00 ? 104 LYS B HD2    1 
ATOM   3145  H  HD3    . LYS B 2 26  ? -11.334 22.666 208.212 1.00 125.00 ? 104 LYS B HD3    1 
ATOM   3146  H  HE2    . LYS B 2 26  ? -13.339 22.716 209.344 1.00 136.08 ? 104 LYS B HE2    1 
ATOM   3147  H  HE3    . LYS B 2 26  ? -13.616 21.194 208.974 1.00 136.08 ? 104 LYS B HE3    1 
ATOM   3148  H  HZ1    . LYS B 2 26  ? -12.836 21.367 211.101 1.00 166.59 ? 104 LYS B HZ1    1 
ATOM   3149  H  HZ2    . LYS B 2 26  ? -11.869 20.625 210.317 1.00 166.59 ? 104 LYS B HZ2    1 
ATOM   3150  H  HZ3    . LYS B 2 26  ? -11.618 22.011 210.654 1.00 166.59 ? 104 LYS B HZ3    1 
ATOM   3151  N  N      . MET B 2 27  ? -10.753 21.903 202.560 1.00 103.00 ? 105 MET B N      1 
ATOM   3152  C  CA     . MET B 2 27  ? -9.826  22.112 201.455 1.00 94.58  ? 105 MET B CA     1 
ATOM   3153  C  C      . MET B 2 27  ? -10.523 22.818 200.301 1.00 111.00 ? 105 MET B C      1 
ATOM   3154  O  O      . MET B 2 27  ? -10.130 23.917 199.895 1.00 114.61 ? 105 MET B O      1 
ATOM   3155  C  CB     . MET B 2 27  ? -9.242  20.771 200.999 1.00 116.96 ? 105 MET B CB     1 
ATOM   3156  C  CG     . MET B 2 27  ? -8.309  20.862 199.801 1.00 109.64 ? 105 MET B CG     1 
ATOM   3157  S  SD     . MET B 2 27  ? -6.766  21.702 200.198 1.00 184.71 ? 105 MET B SD     1 
ATOM   3158  C  CE     . MET B 2 27  ? -5.955  20.434 201.168 1.00 124.42 ? 105 MET B CE     1 
ATOM   3159  H  H      . MET B 2 27  ? -10.866 21.080 202.781 1.00 123.59 ? 105 MET B H      1 
ATOM   3160  H  HA     . MET B 2 27  ? -9.092  22.666 201.763 1.00 113.50 ? 105 MET B HA     1 
ATOM   3161  H  HB2    . MET B 2 27  ? -8.740  20.386 201.734 1.00 140.35 ? 105 MET B HB2    1 
ATOM   3162  H  HB3    . MET B 2 27  ? -9.974  20.181 200.759 1.00 140.35 ? 105 MET B HB3    1 
ATOM   3163  H  HG2    . MET B 2 27  ? -8.095  19.967 199.496 1.00 131.57 ? 105 MET B HG2    1 
ATOM   3164  H  HG3    . MET B 2 27  ? -8.749  21.359 199.093 1.00 131.57 ? 105 MET B HG3    1 
ATOM   3165  H  HE1    . MET B 2 27  ? -5.089  20.762 201.456 1.00 149.30 ? 105 MET B HE1    1 
ATOM   3166  H  HE2    . MET B 2 27  ? -6.505  20.229 201.941 1.00 149.30 ? 105 MET B HE2    1 
ATOM   3167  H  HE3    . MET B 2 27  ? -5.845  19.641 200.621 1.00 149.30 ? 105 MET B HE3    1 
ATOM   3168  N  N      . THR B 2 28  ? -11.580 22.201 199.768 1.00 134.63 ? 106 THR B N      1 
ATOM   3169  C  CA     . THR B 2 28  ? -12.262 22.775 198.614 1.00 111.24 ? 106 THR B CA     1 
ATOM   3170  C  C      . THR B 2 28  ? -12.845 24.142 198.949 1.00 105.58 ? 106 THR B C      1 
ATOM   3171  O  O      . THR B 2 28  ? -12.706 25.094 198.171 1.00 157.65 ? 106 THR B O      1 
ATOM   3172  C  CB     . THR B 2 28  ? -13.367 21.836 198.126 1.00 114.12 ? 106 THR B CB     1 
ATOM   3173  O  OG1    . THR B 2 28  ? -14.470 21.877 199.041 1.00 124.94 ? 106 THR B OG1    1 
ATOM   3174  C  CG2    . THR B 2 28  ? -12.862 20.400 198.002 1.00 127.93 ? 106 THR B CG2    1 
ATOM   3175  H  H      . THR B 2 28  ? -11.916 21.462 200.053 1.00 161.56 ? 106 THR B H      1 
ATOM   3176  H  HA     . THR B 2 28  ? -11.623 22.889 197.893 1.00 133.49 ? 106 THR B HA     1 
ATOM   3177  H  HB     . THR B 2 28  ? -13.668 22.127 197.252 1.00 136.94 ? 106 THR B HB     1 
ATOM   3178  H  HG1    . THR B 2 28  ? -15.080 21.363 198.779 1.00 149.92 ? 106 THR B HG1    1 
ATOM   3179  H  HG21   . THR B 2 28  ? -13.577 19.824 197.692 1.00 153.52 ? 106 THR B HG21   1 
ATOM   3180  H  HG22   . THR B 2 28  ? -12.128 20.361 197.369 1.00 153.52 ? 106 THR B HG22   1 
ATOM   3181  H  HG23   . THR B 2 28  ? -12.552 20.082 198.864 1.00 153.52 ? 106 THR B HG23   1 
ATOM   3182  N  N      . ALA B 2 29  ? -13.499 24.260 200.108 1.00 99.52  ? 107 ALA B N      1 
ATOM   3183  C  CA     . ALA B 2 29  ? -14.115 25.527 200.490 1.00 96.03  ? 107 ALA B CA     1 
ATOM   3184  C  C      . ALA B 2 29  ? -13.110 26.669 200.440 1.00 87.17  ? 107 ALA B C      1 
ATOM   3185  O  O      . ALA B 2 29  ? -13.451 27.790 200.045 1.00 110.67 ? 107 ALA B O      1 
ATOM   3186  C  CB     . ALA B 2 29  ? -14.724 25.412 201.887 1.00 131.06 ? 107 ALA B CB     1 
ATOM   3187  H  H      . ALA B 2 29  ? -13.598 23.628 200.682 1.00 119.42 ? 107 ALA B H      1 
ATOM   3188  H  HA     . ALA B 2 29  ? -14.830 25.730 199.867 1.00 115.23 ? 107 ALA B HA     1 
ATOM   3189  H  HB1    . ALA B 2 29  ? -15.129 26.261 202.125 1.00 157.27 ? 107 ALA B HB1    1 
ATOM   3190  H  HB2    . ALA B 2 29  ? -15.398 24.715 201.881 1.00 157.27 ? 107 ALA B HB2    1 
ATOM   3191  H  HB3    . ALA B 2 29  ? -14.023 25.191 202.520 1.00 157.27 ? 107 ALA B HB3    1 
ATOM   3192  N  N      . TYR B 2 30  ? -11.863 26.407 200.839 1.00 108.65 ? 108 TYR B N      1 
ATOM   3193  C  CA     . TYR B 2 30  ? -10.838 27.442 200.766 1.00 90.21  ? 108 TYR B CA     1 
ATOM   3194  C  C      . TYR B 2 30  ? -10.508 27.785 199.322 1.00 103.38 ? 108 TYR B C      1 
ATOM   3195  O  O      . TYR B 2 30  ? -10.309 28.959 198.987 1.00 136.12 ? 108 TYR B O      1 
ATOM   3196  C  CB     . TYR B 2 30  ? -9.573  26.994 201.501 1.00 112.05 ? 108 TYR B CB     1 
ATOM   3197  C  CG     . TYR B 2 30  ? -9.706  26.884 203.009 1.00 122.50 ? 108 TYR B CG     1 
ATOM   3198  C  CD1    . TYR B 2 30  ? -10.924 27.096 203.646 1.00 110.35 ? 108 TYR B CD1    1 
ATOM   3199  C  CD2    . TYR B 2 30  ? -8.604  26.579 203.795 1.00 114.01 ? 108 TYR B CD2    1 
ATOM   3200  C  CE1    . TYR B 2 30  ? -11.038 26.997 205.019 1.00 114.39 ? 108 TYR B CE1    1 
ATOM   3201  C  CE2    . TYR B 2 30  ? -8.709  26.479 205.165 1.00 86.15  ? 108 TYR B CE2    1 
ATOM   3202  C  CZ     . TYR B 2 30  ? -9.925  26.690 205.773 1.00 91.65  ? 108 TYR B CZ     1 
ATOM   3203  O  OH     . TYR B 2 30  ? -10.031 26.591 207.142 1.00 109.68 ? 108 TYR B OH     1 
ATOM   3204  H  H      . TYR B 2 30  ? -11.592 25.652 201.149 1.00 130.38 ? 108 TYR B H      1 
ATOM   3205  H  HA     . TYR B 2 30  ? -11.168 28.245 201.199 1.00 108.25 ? 108 TYR B HA     1 
ATOM   3206  H  HB2    . TYR B 2 30  ? -9.315  26.121 201.166 1.00 134.46 ? 108 TYR B HB2    1 
ATOM   3207  H  HB3    . TYR B 2 30  ? -8.867  27.633 201.316 1.00 134.46 ? 108 TYR B HB3    1 
ATOM   3208  H  HD1    . TYR B 2 30  ? -11.675 27.304 203.139 1.00 132.43 ? 108 TYR B HD1    1 
ATOM   3209  H  HD2    . TYR B 2 30  ? -7.780  26.435 203.389 1.00 136.81 ? 108 TYR B HD2    1 
ATOM   3210  H  HE1    . TYR B 2 30  ? -11.858 27.140 205.433 1.00 137.26 ? 108 TYR B HE1    1 
ATOM   3211  H  HE2    . TYR B 2 30  ? -7.960  26.271 205.676 1.00 103.38 ? 108 TYR B HE2    1 
ATOM   3212  H  HH     . TYR B 2 30  ? -9.284  26.401 207.475 1.00 131.61 ? 108 TYR B HH     1 
ATOM   3213  N  N      . ILE B 2 31  ? -10.435 26.777 198.452 1.00 101.94 ? 109 ILE B N      1 
ATOM   3214  C  CA     . ILE B 2 31  ? -10.177 27.039 197.039 1.00 98.90  ? 109 ILE B CA     1 
ATOM   3215  C  C      . ILE B 2 31  ? -11.208 28.019 196.496 1.00 98.93  ? 109 ILE B C      1 
ATOM   3216  O  O      . ILE B 2 31  ? -10.869 28.999 195.824 1.00 102.86 ? 109 ILE B O      1 
ATOM   3217  C  CB     . ILE B 2 31  ? -10.170 25.724 196.241 1.00 116.49 ? 109 ILE B CB     1 
ATOM   3218  C  CG1    . ILE B 2 31  ? -9.118  24.754 196.793 1.00 107.66 ? 109 ILE B CG1    1 
ATOM   3219  C  CG2    . ILE B 2 31  ? -9.917  25.995 194.761 1.00 132.71 ? 109 ILE B CG2    1 
ATOM   3220  C  CD1    . ILE B 2 31  ? -7.689  25.250 196.694 1.00 98.86  ? 109 ILE B CD1    1 
ATOM   3221  H  H      . ILE B 2 31  ? -10.531 25.946 198.651 1.00 122.33 ? 109 ILE B H      1 
ATOM   3222  H  HA     . ILE B 2 31  ? -9.301  27.448 196.950 1.00 118.68 ? 109 ILE B HA     1 
ATOM   3223  H  HB     . ILE B 2 31  ? -11.042 25.309 196.329 1.00 139.79 ? 109 ILE B HB     1 
ATOM   3224  H  HG12   . ILE B 2 31  ? -9.309  24.591 197.730 1.00 129.19 ? 109 ILE B HG12   1 
ATOM   3225  H  HG13   . ILE B 2 31  ? -9.175  23.921 196.299 1.00 129.19 ? 109 ILE B HG13   1 
ATOM   3226  H  HG21   . ILE B 2 31  ? -9.917  25.152 194.281 1.00 159.26 ? 109 ILE B HG21   1 
ATOM   3227  H  HG22   . ILE B 2 31  ? -10.620 26.570 194.421 1.00 159.26 ? 109 ILE B HG22   1 
ATOM   3228  H  HG23   . ILE B 2 31  ? -9.056  26.431 194.663 1.00 159.26 ? 109 ILE B HG23   1 
ATOM   3229  H  HD11   . ILE B 2 31  ? -7.095  24.578 197.065 1.00 118.64 ? 109 ILE B HD11   1 
ATOM   3230  H  HD12   . ILE B 2 31  ? -7.473  25.405 195.761 1.00 118.64 ? 109 ILE B HD12   1 
ATOM   3231  H  HD13   . ILE B 2 31  ? -7.607  26.077 197.195 1.00 118.64 ? 109 ILE B HD13   1 
ATOM   3232  N  N      . THR B 2 32  ? -12.486 27.772 196.790 1.00 98.91  ? 110 THR B N      1 
ATOM   3233  C  CA     . THR B 2 32  ? -13.532 28.705 196.389 1.00 106.38 ? 110 THR B CA     1 
ATOM   3234  C  C      . THR B 2 32  ? -13.286 30.081 196.993 1.00 99.40  ? 110 THR B C      1 
ATOM   3235  O  O      . THR B 2 32  ? -13.307 31.097 196.288 1.00 137.74 ? 110 THR B O      1 
ATOM   3236  C  CB     . THR B 2 32  ? -14.903 28.171 196.807 1.00 118.26 ? 110 THR B CB     1 
ATOM   3237  O  OG1    . THR B 2 32  ? -15.130 26.899 196.190 1.00 122.49 ? 110 THR B OG1    1 
ATOM   3238  C  CG2    . THR B 2 32  ? -16.011 29.136 196.394 1.00 111.08 ? 110 THR B CG2    1 
ATOM   3239  H  H      . THR B 2 32  ? -12.768 27.080 197.216 1.00 118.69 ? 110 THR B H      1 
ATOM   3240  H  HA     . THR B 2 32  ? -13.525 28.794 195.423 1.00 127.66 ? 110 THR B HA     1 
ATOM   3241  H  HB     . THR B 2 32  ? -14.929 28.070 197.771 1.00 141.92 ? 110 THR B HB     1 
ATOM   3242  H  HG1    . THR B 2 32  ? -15.882 26.600 196.416 1.00 146.98 ? 110 THR B HG1    1 
ATOM   3243  H  HG21   . THR B 2 32  ? -16.874 28.785 196.665 1.00 133.30 ? 110 THR B HG21   1 
ATOM   3244  H  HG22   . THR B 2 32  ? -15.874 29.998 196.817 1.00 133.30 ? 110 THR B HG22   1 
ATOM   3245  H  HG23   . THR B 2 32  ? -16.007 29.253 195.431 1.00 133.30 ? 110 THR B HG23   1 
ATOM   3246  N  N      . GLU B 2 33  ? -13.062 30.136 198.306 1.00 100.39 ? 111 GLU B N      1 
ATOM   3247  C  CA     . GLU B 2 33  ? -12.686 31.396 198.934 1.00 99.67  ? 111 GLU B CA     1 
ATOM   3248  C  C      . GLU B 2 33  ? -11.480 32.000 198.229 1.00 92.37  ? 111 GLU B C      1 
ATOM   3249  O  O      . GLU B 2 33  ? -11.475 33.185 197.875 1.00 78.06  ? 111 GLU B O      1 
ATOM   3250  C  CB     . GLU B 2 33  ? -12.393 31.176 200.422 1.00 92.58  ? 111 GLU B CB     1 
ATOM   3251  C  CG     . GLU B 2 33  ? -13.615 30.781 201.248 1.00 120.00 ? 111 GLU B CG     1 
ATOM   3252  C  CD     . GLU B 2 33  ? -13.284 30.503 202.706 1.00 145.21 ? 111 GLU B CD     1 
ATOM   3253  O  OE1    . GLU B 2 33  ? -12.086 30.519 203.064 1.00 136.88 ? 111 GLU B OE1    1 
ATOM   3254  O  OE2    . GLU B 2 33  ? -14.224 30.268 203.496 1.00 136.18 ? 111 GLU B OE2    1 
ATOM   3255  H  H      . GLU B 2 33  ? -13.119 29.468 198.845 1.00 120.47 ? 111 GLU B H      1 
ATOM   3256  H  HA     . GLU B 2 33  ? -13.425 32.021 198.861 1.00 119.61 ? 111 GLU B HA     1 
ATOM   3257  H  HB2    . GLU B 2 33  ? -11.736 30.467 200.508 1.00 111.09 ? 111 GLU B HB2    1 
ATOM   3258  H  HB3    . GLU B 2 33  ? -12.038 31.999 200.794 1.00 111.09 ? 111 GLU B HB3    1 
ATOM   3259  H  HG2    . GLU B 2 33  ? -14.261 31.505 201.221 1.00 144.00 ? 111 GLU B HG2    1 
ATOM   3260  H  HG3    . GLU B 2 33  ? -14.004 29.977 200.871 1.00 144.00 ? 111 GLU B HG3    1 
ATOM   3261  N  N      . LEU B 2 34  ? -10.449 31.186 197.998 1.00 83.30  ? 112 LEU B N      1 
ATOM   3262  C  CA     . LEU B 2 34  ? -9.245  31.665 197.338 1.00 87.10  ? 112 LEU B CA     1 
ATOM   3263  C  C      . LEU B 2 34  ? -9.471  31.971 195.864 1.00 123.57 ? 112 LEU B C      1 
ATOM   3264  O  O      . LEU B 2 34  ? -8.558  32.483 195.207 1.00 139.83 ? 112 LEU B O      1 
ATOM   3265  C  CB     . LEU B 2 34  ? -8.123  30.634 197.503 1.00 86.46  ? 112 LEU B CB     1 
ATOM   3266  C  CG     . LEU B 2 34  ? -6.722  31.028 197.024 1.00 86.48  ? 112 LEU B CG     1 
ATOM   3267  C  CD1    . LEU B 2 34  ? -6.266  32.337 197.652 1.00 94.70  ? 112 LEU B CD1    1 
ATOM   3268  C  CD2    . LEU B 2 34  ? -5.732  29.918 197.340 1.00 83.73  ? 112 LEU B CD2    1 
ATOM   3269  H  H      . LEU B 2 34  ? -10.426 30.355 198.216 1.00 99.96  ? 112 LEU B H      1 
ATOM   3270  H  HA     . LEU B 2 34  ? -8.958  32.486 197.769 1.00 104.52 ? 112 LEU B HA     1 
ATOM   3271  H  HB2    . LEU B 2 34  ? -8.051  30.418 198.446 1.00 103.75 ? 112 LEU B HB2    1 
ATOM   3272  H  HB3    . LEU B 2 34  ? -8.376  29.836 197.013 1.00 103.75 ? 112 LEU B HB3    1 
ATOM   3273  H  HG     . LEU B 2 34  ? -6.741  31.148 196.062 1.00 103.78 ? 112 LEU B HG     1 
ATOM   3274  H  HD11   . LEU B 2 34  ? -5.378  32.550 197.324 1.00 113.63 ? 112 LEU B HD11   1 
ATOM   3275  H  HD12   . LEU B 2 34  ? -6.888  33.039 197.404 1.00 113.63 ? 112 LEU B HD12   1 
ATOM   3276  H  HD13   . LEU B 2 34  ? -6.248  32.235 198.616 1.00 113.63 ? 112 LEU B HD13   1 
ATOM   3277  H  HD21   . LEU B 2 34  ? -4.851  30.183 197.031 1.00 100.47 ? 112 LEU B HD21   1 
ATOM   3278  H  HD22   . LEU B 2 34  ? -5.716  29.772 198.299 1.00 100.47 ? 112 LEU B HD22   1 
ATOM   3279  H  HD23   . LEU B 2 34  ? -6.011  29.107 196.886 1.00 100.47 ? 112 LEU B HD23   1 
ATOM   3280  N  N      . SER B 2 35  ? -10.654 31.668 195.330 1.00 120.05 ? 113 SER B N      1 
ATOM   3281  C  CA     . SER B 2 35  ? -11.016 32.034 193.968 1.00 125.68 ? 113 SER B CA     1 
ATOM   3282  C  C      . SER B 2 35  ? -11.883 33.283 193.909 1.00 101.55 ? 113 SER B C      1 
ATOM   3283  O  O      . SER B 2 35  ? -12.223 33.732 192.811 1.00 146.20 ? 113 SER B O      1 
ATOM   3284  C  CB     . SER B 2 35  ? -11.747 30.877 193.283 1.00 126.77 ? 113 SER B CB     1 
ATOM   3285  O  OG     . SER B 2 35  ? -13.112 30.845 193.661 1.00 122.51 ? 113 SER B OG     1 
ATOM   3286  H  H      . SER B 2 35  ? -11.274 31.243 195.748 1.00 144.05 ? 113 SER B H      1 
ATOM   3287  H  HA     . SER B 2 35  ? -10.205 32.212 193.466 1.00 150.81 ? 113 SER B HA     1 
ATOM   3288  H  HB2    . SER B 2 35  ? -11.689 30.991 192.322 1.00 152.12 ? 113 SER B HB2    1 
ATOM   3289  H  HB3    . SER B 2 35  ? -11.329 30.041 193.543 1.00 152.12 ? 113 SER B HB3    1 
ATOM   3290  H  HG     . SER B 2 35  ? -13.177 30.746 194.493 1.00 147.01 ? 113 SER B HG     1 
ATOM   3291  N  N      . ASP B 2 36  ? -12.251 33.851 195.056 1.00 95.96  ? 114 ASP B N      1 
ATOM   3292  C  CA     . ASP B 2 36  ? -13.016 35.088 195.099 1.00 109.46 ? 114 ASP B CA     1 
ATOM   3293  C  C      . ASP B 2 36  ? -12.148 36.313 195.364 1.00 129.73 ? 114 ASP B C      1 
ATOM   3294  O  O      . ASP B 2 36  ? -12.650 37.440 195.274 1.00 105.34 ? 114 ASP B O      1 
ATOM   3295  C  CB     . ASP B 2 36  ? -14.109 34.992 196.172 1.00 137.66 ? 114 ASP B CB     1 
ATOM   3296  C  CG     . ASP B 2 36  ? -14.997 33.776 195.987 1.00 135.17 ? 114 ASP B CG     1 
ATOM   3297  O  OD1    . ASP B 2 36  ? -15.040 33.238 194.860 1.00 121.33 ? 114 ASP B OD1    1 
ATOM   3298  O  OD2    . ASP B 2 36  ? -15.652 33.359 196.967 1.00 133.99 ? 114 ASP B OD2    1 
ATOM   3299  H  H      . ASP B 2 36  ? -12.066 33.531 195.832 1.00 115.15 ? 114 ASP B H      1 
ATOM   3300  H  HA     . ASP B 2 36  ? -13.453 35.215 194.242 1.00 131.35 ? 114 ASP B HA     1 
ATOM   3301  H  HB2    . ASP B 2 36  ? -13.691 34.929 197.045 1.00 165.19 ? 114 ASP B HB2    1 
ATOM   3302  H  HB3    . ASP B 2 36  ? -14.668 35.783 196.127 1.00 165.19 ? 114 ASP B HB3    1 
ATOM   3303  N  N      . MET B 2 37  ? -10.870 36.122 195.688 1.00 141.35 ? 115 MET B N      1 
ATOM   3304  C  CA     . MET B 2 37  ? -9.923  37.210 195.904 1.00 121.70 ? 115 MET B CA     1 
ATOM   3305  C  C      . MET B 2 37  ? -8.891  37.248 194.780 1.00 94.73  ? 115 MET B C      1 
ATOM   3306  O  O      . MET B 2 37  ? -7.712  37.534 195.000 1.00 107.05 ? 115 MET B O      1 
ATOM   3307  C  CB     . MET B 2 37  ? -9.229  37.066 197.257 1.00 98.30  ? 115 MET B CB     1 
ATOM   3308  C  CG     . MET B 2 37  ? -10.159 36.711 198.413 1.00 80.59  ? 115 MET B CG     1 
ATOM   3309  S  SD     . MET B 2 37  ? -11.442 37.947 198.712 1.00 100.31 ? 115 MET B SD     1 
ATOM   3310  C  CE     . MET B 2 37  ? -12.632 36.976 199.633 1.00 88.20  ? 115 MET B CE     1 
ATOM   3311  H  H      . MET B 2 37  ? -10.520 35.343 195.793 1.00 169.62 ? 115 MET B H      1 
ATOM   3312  H  HA     . MET B 2 37  ? -10.409 38.050 195.909 1.00 146.04 ? 115 MET B HA     1 
ATOM   3313  H  HB2    . MET B 2 37  ? -8.562  36.365 197.190 1.00 117.96 ? 115 MET B HB2    1 
ATOM   3314  H  HB3    . MET B 2 37  ? -8.797  37.907 197.475 1.00 117.96 ? 115 MET B HB3    1 
ATOM   3315  H  HG2    . MET B 2 37  ? -10.597 35.869 198.215 1.00 96.70  ? 115 MET B HG2    1 
ATOM   3316  H  HG3    . MET B 2 37  ? -9.633  36.626 199.224 1.00 96.70  ? 115 MET B HG3    1 
ATOM   3317  H  HE1    . MET B 2 37  ? -13.390 37.538 199.860 1.00 105.84 ? 115 MET B HE1    1 
ATOM   3318  H  HE2    . MET B 2 37  ? -12.925 36.232 199.084 1.00 105.84 ? 115 MET B HE2    1 
ATOM   3319  H  HE3    . MET B 2 37  ? -12.211 36.645 200.442 1.00 105.84 ? 115 MET B HE3    1 
ATOM   3320  N  N      . VAL B 2 38  ? -9.332  36.956 193.561 1.00 99.91  ? 116 VAL B N      1 
ATOM   3321  C  CA     . VAL B 2 38  ? -8.439  36.783 192.417 1.00 122.84 ? 116 VAL B CA     1 
ATOM   3322  C  C      . VAL B 2 38  ? -9.118  37.378 191.186 1.00 137.72 ? 116 VAL B C      1 
ATOM   3323  O  O      . VAL B 2 38  ? -10.313 37.701 191.247 1.00 127.74 ? 116 VAL B O      1 
ATOM   3324  C  CB     . VAL B 2 38  ? -8.096  35.297 192.221 1.00 99.53  ? 116 VAL B CB     1 
ATOM   3325  C  CG1    . VAL B 2 38  ? -7.377  34.758 193.443 1.00 89.88  ? 116 VAL B CG1    1 
ATOM   3326  C  CG2    . VAL B 2 38  ? -9.358  34.503 191.965 1.00 119.55 ? 116 VAL B CG2    1 
ATOM   3327  H  H      . VAL B 2 38  ? -10.163 36.850 193.366 1.00 119.89 ? 116 VAL B H      1 
ATOM   3328  H  HA     . VAL B 2 38  ? -7.615  37.268 192.577 1.00 147.41 ? 116 VAL B HA     1 
ATOM   3329  H  HB     . VAL B 2 38  ? -7.512  35.199 191.453 1.00 119.43 ? 116 VAL B HB     1 
ATOM   3330  H  HG11   . VAL B 2 38  ? -7.170  33.821 193.300 1.00 107.85 ? 116 VAL B HG11   1 
ATOM   3331  H  HG12   . VAL B 2 38  ? -6.559  35.262 193.575 1.00 107.85 ? 116 VAL B HG12   1 
ATOM   3332  H  HG13   . VAL B 2 38  ? -7.954  34.855 194.217 1.00 107.85 ? 116 VAL B HG13   1 
ATOM   3333  H  HG21   . VAL B 2 38  ? -9.124  33.570 191.843 1.00 143.46 ? 116 VAL B HG21   1 
ATOM   3334  H  HG22   . VAL B 2 38  ? -9.951  34.600 192.726 1.00 143.46 ? 116 VAL B HG22   1 
ATOM   3335  H  HG23   . VAL B 2 38  ? -9.787  34.844 191.164 1.00 143.46 ? 116 VAL B HG23   1 
ATOM   3336  N  N      . PRO B 2 39  ? -8.414  37.555 190.052 1.00 129.59 ? 117 PRO B N      1 
ATOM   3337  C  CA     . PRO B 2 39  ? -9.064  38.125 188.854 1.00 125.68 ? 117 PRO B CA     1 
ATOM   3338  C  C      . PRO B 2 39  ? -9.978  37.127 188.147 1.00 116.18 ? 117 PRO B C      1 
ATOM   3339  O  O      . PRO B 2 39  ? -9.794  36.795 186.973 1.00 112.25 ? 117 PRO B O      1 
ATOM   3340  C  CB     . PRO B 2 39  ? -7.860  38.536 187.995 1.00 129.36 ? 117 PRO B CB     1 
ATOM   3341  C  CG     . PRO B 2 39  ? -6.803  37.574 188.359 1.00 125.14 ? 117 PRO B CG     1 
ATOM   3342  C  CD     . PRO B 2 39  ? -6.971  37.336 189.832 1.00 125.00 ? 117 PRO B CD     1 
ATOM   3343  H  HA     . PRO B 2 39  ? -9.574  38.915 189.091 1.00 150.82 ? 117 PRO B HA     1 
ATOM   3344  H  HB2    . PRO B 2 39  ? -8.086  38.461 187.055 1.00 155.24 ? 117 PRO B HB2    1 
ATOM   3345  H  HB3    . PRO B 2 39  ? -7.592  39.442 188.216 1.00 155.24 ? 117 PRO B HB3    1 
ATOM   3346  H  HG2    . PRO B 2 39  ? -6.927  36.750 187.863 1.00 150.17 ? 117 PRO B HG2    1 
ATOM   3347  H  HG3    . PRO B 2 39  ? -5.933  37.959 188.172 1.00 150.17 ? 117 PRO B HG3    1 
ATOM   3348  H  HD2    . PRO B 2 39  ? -6.730  36.424 190.057 1.00 150.00 ? 117 PRO B HD2    1 
ATOM   3349  H  HD3    . PRO B 2 39  ? -6.451  37.978 190.340 1.00 150.00 ? 117 PRO B HD3    1 
ATOM   3350  N  N      . THR B 2 40  ? -10.977 36.633 188.874 1.00 139.78 ? 118 THR B N      1 
ATOM   3351  C  CA     . THR B 2 40  ? -11.996 35.751 188.310 1.00 151.40 ? 118 THR B CA     1 
ATOM   3352  C  C      . THR B 2 40  ? -13.287 35.951 189.099 1.00 154.50 ? 118 THR B C      1 
ATOM   3353  O  O      . THR B 2 40  ? -13.371 36.813 189.980 1.00 137.75 ? 118 THR B O      1 
ATOM   3354  C  CB     . THR B 2 40  ? -11.553 34.280 188.333 1.00 144.54 ? 118 THR B CB     1 
ATOM   3355  O  OG1    . THR B 2 40  ? -11.282 33.877 189.681 1.00 126.61 ? 118 THR B OG1    1 
ATOM   3356  C  CG2    . THR B 2 40  ? -10.316 34.054 187.472 1.00 147.87 ? 118 THR B CG2    1 
ATOM   3357  H  H      . THR B 2 40  ? -11.088 36.797 189.711 1.00 167.73 ? 118 THR B H      1 
ATOM   3358  H  HA     . THR B 2 40  ? -12.161 36.003 187.388 1.00 181.68 ? 118 THR B HA     1 
ATOM   3359  H  HB     . THR B 2 40  ? -12.269 33.730 187.978 1.00 173.45 ? 118 THR B HB     1 
ATOM   3360  H  HG1    . THR B 2 40  ? -11.040 33.073 189.697 1.00 151.93 ? 118 THR B HG1    1 
ATOM   3361  H  HG21   . THR B 2 40  ? -10.057 33.120 187.503 1.00 177.45 ? 118 THR B HG21   1 
ATOM   3362  H  HG22   . THR B 2 40  ? -10.503 34.299 186.553 1.00 177.45 ? 118 THR B HG22   1 
ATOM   3363  H  HG23   . THR B 2 40  ? -9.581  34.596 187.800 1.00 177.45 ? 118 THR B HG23   1 
ATOM   3364  N  N      . CYS B 2 41  ? -14.295 35.141 188.785 1.00 153.72 ? 119 CYS B N      1 
ATOM   3365  C  CA     . CYS B 2 41  ? -15.595 35.227 189.445 1.00 146.78 ? 119 CYS B CA     1 
ATOM   3366  C  C      . CYS B 2 41  ? -15.453 35.144 190.961 1.00 120.87 ? 119 CYS B C      1 
ATOM   3367  O  O      . CYS B 2 41  ? -14.379 34.839 191.476 1.00 126.56 ? 119 CYS B O      1 
ATOM   3368  C  CB     . CYS B 2 41  ? -16.521 34.113 188.949 1.00 162.90 ? 119 CYS B CB     1 
ATOM   3369  S  SG     . CYS B 2 41  ? -16.884 34.160 187.170 1.00 129.53 ? 119 CYS B SG     1 
ATOM   3370  H  H      . CYS B 2 41  ? -14.250 34.526 188.186 1.00 184.46 ? 119 CYS B H      1 
ATOM   3371  H  HA     . CYS B 2 41  ? -16.005 36.078 189.227 1.00 176.14 ? 119 CYS B HA     1 
ATOM   3372  H  HB2    . CYS B 2 41  ? -16.106 33.257 189.140 1.00 195.48 ? 119 CYS B HB2    1 
ATOM   3373  H  HB3    . CYS B 2 41  ? -17.365 34.178 189.422 1.00 195.48 ? 119 CYS B HB3    1 
ATOM   3374  H  HG     . CYS B 2 41  ? -17.613 33.247 186.896 1.00 155.43 ? 119 CYS B HG     1 
ATOM   3375  N  N      . PRO B 2 48  ? -14.237 26.206 187.564 1.00 144.44 ? 126 PRO B N      1 
ATOM   3376  C  CA     . PRO B 2 48  ? -12.813 26.323 187.229 1.00 147.97 ? 126 PRO B CA     1 
ATOM   3377  C  C      . PRO B 2 48  ? -11.946 25.293 187.949 1.00 164.94 ? 126 PRO B C      1 
ATOM   3378  O  O      . PRO B 2 48  ? -12.198 24.985 189.115 1.00 139.24 ? 126 PRO B O      1 
ATOM   3379  C  CB     . PRO B 2 48  ? -12.463 27.741 187.685 1.00 134.56 ? 126 PRO B CB     1 
ATOM   3380  C  CG     . PRO B 2 48  ? -13.452 28.047 188.752 1.00 134.43 ? 126 PRO B CG     1 
ATOM   3381  C  CD     . PRO B 2 48  ? -14.716 27.353 188.353 1.00 135.83 ? 126 PRO B CD     1 
ATOM   3382  H  HA     . PRO B 2 48  ? -12.680 26.247 186.272 1.00 177.56 ? 126 PRO B HA     1 
ATOM   3383  H  HB2    . PRO B 2 48  ? -11.559 27.760 188.036 1.00 161.48 ? 126 PRO B HB2    1 
ATOM   3384  H  HB3    . PRO B 2 48  ? -12.558 28.357 186.941 1.00 161.48 ? 126 PRO B HB3    1 
ATOM   3385  H  HG2    . PRO B 2 48  ? -13.129 27.706 189.601 1.00 161.31 ? 126 PRO B HG2    1 
ATOM   3386  H  HG3    . PRO B 2 48  ? -13.590 29.006 188.801 1.00 161.31 ? 126 PRO B HG3    1 
ATOM   3387  H  HD2    . PRO B 2 48  ? -15.196 27.047 189.138 1.00 163.00 ? 126 PRO B HD2    1 
ATOM   3388  H  HD3    . PRO B 2 48  ? -15.263 27.936 187.804 1.00 163.00 ? 126 PRO B HD3    1 
ATOM   3389  N  N      . ASP B 2 49  ? -10.937 24.769 187.257 1.00 158.13 ? 127 ASP B N      1 
ATOM   3390  C  CA     . ASP B 2 49  ? -10.045 23.793 187.866 1.00 151.46 ? 127 ASP B CA     1 
ATOM   3391  C  C      . ASP B 2 49  ? -9.371  24.390 189.093 1.00 153.50 ? 127 ASP B C      1 
ATOM   3392  O  O      . ASP B 2 49  ? -8.931  25.542 189.083 1.00 150.52 ? 127 ASP B O      1 
ATOM   3393  C  CB     . ASP B 2 49  ? -8.987  23.333 186.862 1.00 154.66 ? 127 ASP B CB     1 
ATOM   3394  C  CG     . ASP B 2 49  ? -9.576  22.548 185.708 1.00 175.47 ? 127 ASP B CG     1 
ATOM   3395  O  OD1    . ASP B 2 49  ? -10.601 21.865 185.915 1.00 174.62 ? 127 ASP B OD1    1 
ATOM   3396  O  OD2    . ASP B 2 49  ? -9.012  22.611 184.596 1.00 182.92 ? 127 ASP B OD2    1 
ATOM   3397  H  H      . ASP B 2 49  ? -10.751 24.961 186.440 1.00 189.75 ? 127 ASP B H      1 
ATOM   3398  H  HA     . ASP B 2 49  ? -10.558 23.018 188.145 1.00 181.75 ? 127 ASP B HA     1 
ATOM   3399  H  HB2    . ASP B 2 49  ? -8.539  24.112 186.496 1.00 185.59 ? 127 ASP B HB2    1 
ATOM   3400  H  HB3    . ASP B 2 49  ? -8.346  22.764 187.316 1.00 185.59 ? 127 ASP B HB3    1 
ATOM   3401  N  N      . LYS B 2 50  ? -9.292  23.595 190.160 1.00 164.18 ? 128 LYS B N      1 
ATOM   3402  C  CA     . LYS B 2 50  ? -8.658  24.068 191.385 1.00 140.93 ? 128 LYS B CA     1 
ATOM   3403  C  C      . LYS B 2 50  ? -7.191  24.392 191.151 1.00 130.62 ? 128 LYS B C      1 
ATOM   3404  O  O      . LYS B 2 50  ? -6.725  25.489 191.476 1.00 139.47 ? 128 LYS B O      1 
ATOM   3405  C  CB     . LYS B 2 50  ? -8.793  23.020 192.481 1.00 131.58 ? 128 LYS B CB     1 
ATOM   3406  C  CG     . LYS B 2 50  ? -10.210 22.631 192.786 1.00 135.97 ? 128 LYS B CG     1 
ATOM   3407  C  CD     . LYS B 2 50  ? -10.212 21.529 193.803 1.00 140.14 ? 128 LYS B CD     1 
ATOM   3408  C  CE     . LYS B 2 50  ? -11.606 21.110 194.162 1.00 158.52 ? 128 LYS B CE     1 
ATOM   3409  N  NZ     . LYS B 2 50  ? -11.531 19.954 195.075 1.00 155.41 ? 128 LYS B NZ     1 
ATOM   3410  H  H      . LYS B 2 50  ? -9.593  22.791 190.199 1.00 197.02 ? 128 LYS B H      1 
ATOM   3411  H  HA     . LYS B 2 50  ? -9.103  24.877 191.683 1.00 169.12 ? 128 LYS B HA     1 
ATOM   3412  H  HB2    . LYS B 2 50  ? -8.320  22.219 192.206 1.00 157.89 ? 128 LYS B HB2    1 
ATOM   3413  H  HB3    . LYS B 2 50  ? -8.401  23.369 193.297 1.00 157.89 ? 128 LYS B HB3    1 
ATOM   3414  H  HG2    . LYS B 2 50  ? -10.687 23.392 193.151 1.00 163.16 ? 128 LYS B HG2    1 
ATOM   3415  H  HG3    . LYS B 2 50  ? -10.642 22.310 191.979 1.00 163.16 ? 128 LYS B HG3    1 
ATOM   3416  H  HD2    . LYS B 2 50  ? -9.747  20.759 193.441 1.00 168.16 ? 128 LYS B HD2    1 
ATOM   3417  H  HD3    . LYS B 2 50  ? -9.770  21.838 194.610 1.00 168.16 ? 128 LYS B HD3    1 
ATOM   3418  H  HE2    . LYS B 2 50  ? -12.062 21.836 194.614 1.00 190.22 ? 128 LYS B HE2    1 
ATOM   3419  H  HE3    . LYS B 2 50  ? -12.087 20.846 193.362 1.00 190.22 ? 128 LYS B HE3    1 
ATOM   3420  H  HZ1    . LYS B 2 50  ? -12.351 19.693 195.302 1.00 186.49 ? 128 LYS B HZ1    1 
ATOM   3421  H  HZ2    . LYS B 2 50  ? -11.112 19.278 194.676 1.00 186.49 ? 128 LYS B HZ2    1 
ATOM   3422  H  HZ3    . LYS B 2 50  ? -11.085 20.177 195.812 1.00 186.49 ? 128 LYS B HZ3    1 
ATOM   3423  N  N      . LEU B 2 51  ? -6.443  23.433 190.604 1.00 125.86 ? 129 LEU B N      1 
ATOM   3424  C  CA     . LEU B 2 51  ? -5.027  23.644 190.327 1.00 117.13 ? 129 LEU B CA     1 
ATOM   3425  C  C      . LEU B 2 51  ? -4.793  25.000 189.677 1.00 117.49 ? 129 LEU B C      1 
ATOM   3426  O  O      . LEU B 2 51  ? -3.929  25.773 190.107 1.00 114.03 ? 129 LEU B O      1 
ATOM   3427  C  CB     . LEU B 2 51  ? -4.517  22.517 189.428 1.00 126.49 ? 129 LEU B CB     1 
ATOM   3428  C  CG     . LEU B 2 51  ? -3.004  22.317 189.350 1.00 124.78 ? 129 LEU B CG     1 
ATOM   3429  C  CD1    . LEU B 2 51  ? -2.693  21.010 188.648 1.00 135.74 ? 129 LEU B CD1    1 
ATOM   3430  C  CD2    . LEU B 2 51  ? -2.320  23.451 188.625 1.00 125.58 ? 129 LEU B CD2    1 
ATOM   3431  H  H      . LEU B 2 51  ? -6.733  22.653 190.385 1.00 151.03 ? 129 LEU B H      1 
ATOM   3432  H  HA     . LEU B 2 51  ? -4.531  23.616 191.160 1.00 140.56 ? 129 LEU B HA     1 
ATOM   3433  H  HB2    . LEU B 2 51  ? -4.898  21.684 189.745 1.00 151.79 ? 129 LEU B HB2    1 
ATOM   3434  H  HB3    . LEU B 2 51  ? -4.829  22.688 188.526 1.00 151.79 ? 129 LEU B HB3    1 
ATOM   3435  H  HG     . LEU B 2 51  ? -2.642  22.271 190.249 1.00 149.73 ? 129 LEU B HG     1 
ATOM   3436  H  HD11   . LEU B 2 51  ? -1.730  20.896 188.605 1.00 162.89 ? 129 LEU B HD11   1 
ATOM   3437  H  HD12   . LEU B 2 51  ? -3.091  20.280 189.148 1.00 162.89 ? 129 LEU B HD12   1 
ATOM   3438  H  HD13   . LEU B 2 51  ? -3.063  21.037 187.752 1.00 162.89 ? 129 LEU B HD13   1 
ATOM   3439  H  HD21   . LEU B 2 51  ? -1.366  23.280 188.601 1.00 150.70 ? 129 LEU B HD21   1 
ATOM   3440  H  HD22   . LEU B 2 51  ? -2.670  23.505 187.722 1.00 150.70 ? 129 LEU B HD22   1 
ATOM   3441  H  HD23   . LEU B 2 51  ? -2.496  24.280 189.098 1.00 150.70 ? 129 LEU B HD23   1 
ATOM   3442  N  N      . THR B 2 52  ? -5.561  25.305 188.631 1.00 140.42 ? 130 THR B N      1 
ATOM   3443  C  CA     . THR B 2 52  ? -5.440  26.607 187.988 1.00 150.81 ? 130 THR B CA     1 
ATOM   3444  C  C      . THR B 2 52  ? -5.646  27.731 188.996 1.00 125.47 ? 130 THR B C      1 
ATOM   3445  O  O      . THR B 2 52  ? -4.911  28.725 188.986 1.00 129.09 ? 130 THR B O      1 
ATOM   3446  C  CB     . THR B 2 52  ? -6.439  26.720 186.836 1.00 136.72 ? 130 THR B CB     1 
ATOM   3447  O  OG1    . THR B 2 52  ? -7.776  26.624 187.342 1.00 154.98 ? 130 THR B OG1    1 
ATOM   3448  C  CG2    . THR B 2 52  ? -6.206  25.611 185.813 1.00 137.37 ? 130 THR B CG2    1 
ATOM   3449  H  H      . THR B 2 52  ? -6.149  24.784 188.281 1.00 168.50 ? 130 THR B H      1 
ATOM   3450  H  HA     . THR B 2 52  ? -4.547  26.695 187.620 1.00 180.97 ? 130 THR B HA     1 
ATOM   3451  H  HB     . THR B 2 52  ? -6.324  27.574 186.392 1.00 164.06 ? 130 THR B HB     1 
ATOM   3452  H  HG1    . THR B 2 52  ? -7.885  25.886 187.728 1.00 185.97 ? 130 THR B HG1    1 
ATOM   3453  H  HG21   . THR B 2 52  ? -6.844  25.691 185.087 1.00 164.84 ? 130 THR B HG21   1 
ATOM   3454  H  HG22   . THR B 2 52  ? -5.308  25.677 185.453 1.00 164.84 ? 130 THR B HG22   1 
ATOM   3455  H  HG23   . THR B 2 52  ? -6.314  24.744 186.234 1.00 164.84 ? 130 THR B HG23   1 
ATOM   3456  N  N      . ILE B 2 53  ? -6.627  27.583 189.891 1.00 120.98 ? 131 ILE B N      1 
ATOM   3457  C  CA     . ILE B 2 53  ? -6.866  28.605 190.908 1.00 111.85 ? 131 ILE B CA     1 
ATOM   3458  C  C      . ILE B 2 53  ? -5.651  28.766 191.809 1.00 98.74  ? 131 ILE B C      1 
ATOM   3459  O  O      . ILE B 2 53  ? -5.362  29.870 192.286 1.00 87.06  ? 131 ILE B O      1 
ATOM   3460  C  CB     . ILE B 2 53  ? -8.127  28.263 191.727 1.00 110.62 ? 131 ILE B CB     1 
ATOM   3461  C  CG1    . ILE B 2 53  ? -9.364  28.286 190.825 1.00 118.62 ? 131 ILE B CG1    1 
ATOM   3462  C  CG2    . ILE B 2 53  ? -8.296  29.243 192.895 1.00 110.61 ? 131 ILE B CG2    1 
ATOM   3463  C  CD1    . ILE B 2 53  ? -10.622 27.768 191.486 1.00 117.34 ? 131 ILE B CD1    1 
ATOM   3464  H  H      . ILE B 2 53  ? -7.161  26.910 189.929 1.00 145.18 ? 131 ILE B H      1 
ATOM   3465  H  HA     . ILE B 2 53  ? -7.021  29.455 190.466 1.00 134.22 ? 131 ILE B HA     1 
ATOM   3466  H  HB     . ILE B 2 53  ? -8.026  27.369 192.088 1.00 132.74 ? 131 ILE B HB     1 
ATOM   3467  H  HG12   . ILE B 2 53  ? -9.530  29.201 190.549 1.00 142.34 ? 131 ILE B HG12   1 
ATOM   3468  H  HG13   . ILE B 2 53  ? -9.191  27.735 190.046 1.00 142.34 ? 131 ILE B HG13   1 
ATOM   3469  H  HG21   . ILE B 2 53  ? -9.094  29.006 193.392 1.00 132.73 ? 131 ILE B HG21   1 
ATOM   3470  H  HG22   . ILE B 2 53  ? -7.517  29.185 193.470 1.00 132.73 ? 131 ILE B HG22   1 
ATOM   3471  H  HG23   . ILE B 2 53  ? -8.380  30.143 192.542 1.00 132.73 ? 131 ILE B HG23   1 
ATOM   3472  H  HD11   . ILE B 2 53  ? -11.354 27.816 190.852 1.00 140.81 ? 131 ILE B HD11   1 
ATOM   3473  H  HD12   . ILE B 2 53  ? -10.479 26.848 191.759 1.00 140.81 ? 131 ILE B HD12   1 
ATOM   3474  H  HD13   . ILE B 2 53  ? -10.819 28.316 192.262 1.00 140.81 ? 131 ILE B HD13   1 
ATOM   3475  N  N      . LEU B 2 54  ? -4.929  27.679 192.071 1.00 119.39 ? 132 LEU B N      1 
ATOM   3476  C  CA     . LEU B 2 54  ? -3.763  27.771 192.941 1.00 101.49 ? 132 LEU B CA     1 
ATOM   3477  C  C      . LEU B 2 54  ? -2.598  28.441 192.226 1.00 105.13 ? 132 LEU B C      1 
ATOM   3478  O  O      . LEU B 2 54  ? -1.887  29.255 192.823 1.00 101.88 ? 132 LEU B O      1 
ATOM   3479  C  CB     . LEU B 2 54  ? -3.370  26.381 193.441 1.00 110.98 ? 132 LEU B CB     1 
ATOM   3480  C  CG     . LEU B 2 54  ? -4.406  25.706 194.348 1.00 108.13 ? 132 LEU B CG     1 
ATOM   3481  C  CD1    . LEU B 2 54  ? -4.080  24.236 194.537 1.00 113.52 ? 132 LEU B CD1    1 
ATOM   3482  C  CD2    . LEU B 2 54  ? -4.499  26.408 195.697 1.00 101.45 ? 132 LEU B CD2    1 
ATOM   3483  H  H      . LEU B 2 54  ? -5.090  26.892 191.764 1.00 143.27 ? 132 LEU B H      1 
ATOM   3484  H  HA     . LEU B 2 54  ? -3.990  28.313 193.713 1.00 121.79 ? 132 LEU B HA     1 
ATOM   3485  H  HB2    . LEU B 2 54  ? -3.232  25.804 192.674 1.00 133.18 ? 132 LEU B HB2    1 
ATOM   3486  H  HB3    . LEU B 2 54  ? -2.544  26.455 193.945 1.00 133.18 ? 132 LEU B HB3    1 
ATOM   3487  H  HG     . LEU B 2 54  ? -5.277  25.764 193.923 1.00 129.76 ? 132 LEU B HG     1 
ATOM   3488  H  HD11   . LEU B 2 54  ? -4.750  23.836 195.113 1.00 136.22 ? 132 LEU B HD11   1 
ATOM   3489  H  HD12   . LEU B 2 54  ? -4.083  23.798 193.672 1.00 136.22 ? 132 LEU B HD12   1 
ATOM   3490  H  HD13   . LEU B 2 54  ? -3.203  24.158 194.945 1.00 136.22 ? 132 LEU B HD13   1 
ATOM   3491  H  HD21   . LEU B 2 54  ? -5.161  25.956 196.242 1.00 121.74 ? 132 LEU B HD21   1 
ATOM   3492  H  HD22   . LEU B 2 54  ? -3.632  26.372 196.131 1.00 121.74 ? 132 LEU B HD22   1 
ATOM   3493  H  HD23   . LEU B 2 54  ? -4.760  27.331 195.555 1.00 121.74 ? 132 LEU B HD23   1 
ATOM   3494  N  N      . ARG B 2 55  ? -2.388  28.121 190.946 1.00 163.64 ? 133 ARG B N      1 
ATOM   3495  C  CA     . ARG B 2 55  ? -1.345  28.804 190.185 1.00 133.92 ? 133 ARG B CA     1 
ATOM   3496  C  C      . ARG B 2 55  ? -1.644  30.291 190.065 1.00 110.24 ? 133 ARG B C      1 
ATOM   3497  O  O      . ARG B 2 55  ? -0.744  31.131 190.203 1.00 102.71 ? 133 ARG B O      1 
ATOM   3498  C  CB     . ARG B 2 55  ? -1.204  28.177 188.800 1.00 123.60 ? 133 ARG B CB     1 
ATOM   3499  C  CG     . ARG B 2 55  ? -0.649  26.772 188.822 1.00 135.01 ? 133 ARG B CG     1 
ATOM   3500  C  CD     . ARG B 2 55  ? -0.438  26.225 187.424 1.00 152.38 ? 133 ARG B CD     1 
ATOM   3501  N  NE     . ARG B 2 55  ? 0.082   24.861 187.457 1.00 145.40 ? 133 ARG B NE     1 
ATOM   3502  C  CZ     . ARG B 2 55  ? 0.067   24.024 186.424 1.00 155.51 ? 133 ARG B CZ     1 
ATOM   3503  N  NH1    . ARG B 2 55  ? -0.447  24.400 185.261 1.00 172.91 ? 133 ARG B NH1    1 
ATOM   3504  N  NH2    . ARG B 2 55  ? 0.564   22.801 186.560 1.00 152.87 ? 133 ARG B NH2    1 
ATOM   3505  H  H      . ARG B 2 55  ? -2.826  27.526 190.506 1.00 196.37 ? 133 ARG B H      1 
ATOM   3506  H  HA     . ARG B 2 55  ? -0.498  28.703 190.648 1.00 160.70 ? 133 ARG B HA     1 
ATOM   3507  H  HB2    . ARG B 2 55  ? -2.079  28.144 188.381 1.00 148.32 ? 133 ARG B HB2    1 
ATOM   3508  H  HB3    . ARG B 2 55  ? -0.605  28.724 188.268 1.00 148.32 ? 133 ARG B HB3    1 
ATOM   3509  H  HG2    . ARG B 2 55  ? 0.206   26.775 189.278 1.00 162.01 ? 133 ARG B HG2    1 
ATOM   3510  H  HG3    . ARG B 2 55  ? -1.273  26.190 189.284 1.00 162.01 ? 133 ARG B HG3    1 
ATOM   3511  H  HD2    . ARG B 2 55  ? -1.286  26.215 186.952 1.00 182.85 ? 133 ARG B HD2    1 
ATOM   3512  H  HD3    . ARG B 2 55  ? 0.201   26.783 186.955 1.00 182.85 ? 133 ARG B HD3    1 
ATOM   3513  H  HE     . ARG B 2 55  ? 0.422   24.580 188.195 1.00 174.48 ? 133 ARG B HE     1 
ATOM   3514  H  HH11   . ARG B 2 55  ? -0.772  25.191 185.169 1.00 207.50 ? 133 ARG B HH11   1 
ATOM   3515  H  HH12   . ARG B 2 55  ? -0.454  23.853 184.597 1.00 207.50 ? 133 ARG B HH12   1 
ATOM   3516  H  HH21   . ARG B 2 55  ? 0.898   22.554 187.312 1.00 183.45 ? 133 ARG B HH21   1 
ATOM   3517  H  HH22   . ARG B 2 55  ? 0.556   22.258 185.893 1.00 183.45 ? 133 ARG B HH22   1 
ATOM   3518  N  N      . MET B 2 56  ? -2.905  30.637 189.805 1.00 100.81 ? 134 MET B N      1 
ATOM   3519  C  CA     . MET B 2 56  ? -3.286  32.042 189.753 1.00 97.37  ? 134 MET B CA     1 
ATOM   3520  C  C      . MET B 2 56  ? -3.097  32.706 191.109 1.00 109.80 ? 134 MET B C      1 
ATOM   3521  O  O      . MET B 2 56  ? -2.707  33.876 191.187 1.00 125.24 ? 134 MET B O      1 
ATOM   3522  C  CB     . MET B 2 56  ? -4.739  32.175 189.292 1.00 134.64 ? 134 MET B CB     1 
ATOM   3523  C  CG     . MET B 2 56  ? -4.985  31.756 187.846 1.00 143.60 ? 134 MET B CG     1 
ATOM   3524  S  SD     . MET B 2 56  ? -4.032  32.706 186.642 1.00 153.75 ? 134 MET B SD     1 
ATOM   3525  C  CE     . MET B 2 56  ? -4.606  34.374 186.965 1.00 138.71 ? 134 MET B CE     1 
ATOM   3526  H  H      . MET B 2 56  ? -3.548  30.085 189.658 1.00 120.97 ? 134 MET B H      1 
ATOM   3527  H  HA     . MET B 2 56  ? -2.726  32.494 189.103 1.00 116.84 ? 134 MET B HA     1 
ATOM   3528  H  HB2    . MET B 2 56  ? -5.296  31.618 189.859 1.00 161.57 ? 134 MET B HB2    1 
ATOM   3529  H  HB3    . MET B 2 56  ? -5.009  33.102 189.380 1.00 161.57 ? 134 MET B HB3    1 
ATOM   3530  H  HG2    . MET B 2 56  ? -4.743  30.822 187.745 1.00 172.32 ? 134 MET B HG2    1 
ATOM   3531  H  HG3    . MET B 2 56  ? -5.925  31.876 187.641 1.00 172.32 ? 134 MET B HG3    1 
ATOM   3532  H  HE1    . MET B 2 56  ? -4.152  34.986 186.364 1.00 166.45 ? 134 MET B HE1    1 
ATOM   3533  H  HE2    . MET B 2 56  ? -5.563  34.413 186.816 1.00 166.45 ? 134 MET B HE2    1 
ATOM   3534  H  HE3    . MET B 2 56  ? -4.404  34.604 187.886 1.00 166.45 ? 134 MET B HE3    1 
ATOM   3535  N  N      . ALA B 2 57  ? -3.373  31.976 192.190 1.00 140.03 ? 135 ALA B N      1 
ATOM   3536  C  CA     . ALA B 2 57  ? -3.170  32.531 193.523 1.00 108.95 ? 135 ALA B CA     1 
ATOM   3537  C  C      . ALA B 2 57  ? -1.696  32.817 193.773 1.00 90.56  ? 135 ALA B C      1 
ATOM   3538  O  O      . ALA B 2 57  ? -1.342  33.879 194.297 1.00 90.00  ? 135 ALA B O      1 
ATOM   3539  C  CB     . ALA B 2 57  ? -3.721  31.573 194.578 1.00 101.44 ? 135 ALA B CB     1 
ATOM   3540  H  H      . ALA B 2 57  ? -3.673  31.170 192.178 1.00 168.04 ? 135 ALA B H      1 
ATOM   3541  H  HA     . ALA B 2 57  ? -3.655  33.368 193.595 1.00 130.74 ? 135 ALA B HA     1 
ATOM   3542  H  HB1    . ALA B 2 57  ? -3.578  31.957 195.458 1.00 121.73 ? 135 ALA B HB1    1 
ATOM   3543  H  HB2    . ALA B 2 57  ? -4.670  31.445 194.423 1.00 121.73 ? 135 ALA B HB2    1 
ATOM   3544  H  HB3    . ALA B 2 57  ? -3.256  30.725 194.507 1.00 121.73 ? 135 ALA B HB3    1 
ATOM   3545  N  N      . VAL B 2 58  ? -0.819  31.883 193.399 1.00 81.68  ? 136 VAL B N      1 
ATOM   3546  C  CA     . VAL B 2 58  ? 0.617   32.132 193.487 1.00 78.84  ? 136 VAL B CA     1 
ATOM   3547  C  C      . VAL B 2 58  ? 0.977   33.382 192.697 1.00 92.20  ? 136 VAL B C      1 
ATOM   3548  O  O      . VAL B 2 58  ? 1.728   34.243 193.167 1.00 79.21  ? 136 VAL B O      1 
ATOM   3549  C  CB     . VAL B 2 58  ? 1.407   30.907 192.990 1.00 88.02  ? 136 VAL B CB     1 
ATOM   3550  C  CG1    . VAL B 2 58  ? 2.908   31.191 193.001 1.00 94.90  ? 136 VAL B CG1    1 
ATOM   3551  C  CG2    . VAL B 2 58  ? 1.101   29.695 193.846 1.00 108.44 ? 136 VAL B CG2    1 
ATOM   3552  H  H      . VAL B 2 58  ? -1.029  31.106 193.096 1.00 98.01  ? 136 VAL B H      1 
ATOM   3553  H  HA     . VAL B 2 58  ? 0.855   32.285 194.415 1.00 94.60  ? 136 VAL B HA     1 
ATOM   3554  H  HB     . VAL B 2 58  ? 1.144   30.707 192.078 1.00 105.62 ? 136 VAL B HB     1 
ATOM   3555  H  HG11   . VAL B 2 58  ? 3.380   30.405 192.684 1.00 113.88 ? 136 VAL B HG11   1 
ATOM   3556  H  HG12   . VAL B 2 58  ? 3.090   31.944 192.417 1.00 113.88 ? 136 VAL B HG12   1 
ATOM   3557  H  HG13   . VAL B 2 58  ? 3.183   31.400 193.907 1.00 113.88 ? 136 VAL B HG13   1 
ATOM   3558  H  HG21   . VAL B 2 58  ? 1.608   28.938 193.515 1.00 130.13 ? 136 VAL B HG21   1 
ATOM   3559  H  HG22   . VAL B 2 58  ? 1.351   29.886 194.764 1.00 130.13 ? 136 VAL B HG22   1 
ATOM   3560  H  HG23   . VAL B 2 58  ? 0.151   29.505 193.795 1.00 130.13 ? 136 VAL B HG23   1 
ATOM   3561  N  N      . SER B 2 59  ? 0.446   33.496 191.476 1.00 133.94 ? 137 SER B N      1 
ATOM   3562  C  CA     . SER B 2 59  ? 0.704   34.681 190.665 1.00 122.78 ? 137 SER B CA     1 
ATOM   3563  C  C      . SER B 2 59  ? 0.323   35.949 191.420 1.00 114.30 ? 137 SER B C      1 
ATOM   3564  O  O      . SER B 2 59  ? 1.123   36.884 191.542 1.00 122.96 ? 137 SER B O      1 
ATOM   3565  C  CB     . SER B 2 59  ? -0.065  34.589 189.347 1.00 106.45 ? 137 SER B CB     1 
ATOM   3566  O  OG     . SER B 2 59  ? 0.098   35.773 188.588 1.00 130.48 ? 137 SER B OG     1 
ATOM   3567  H  H      . SER B 2 59  ? -0.059  32.908 191.103 1.00 160.73 ? 137 SER B H      1 
ATOM   3568  H  HA     . SER B 2 59  ? 1.651   34.726 190.459 1.00 147.33 ? 137 SER B HA     1 
ATOM   3569  H  HB2    . SER B 2 59  ? 0.272   33.837 188.837 1.00 127.74 ? 137 SER B HB2    1 
ATOM   3570  H  HB3    . SER B 2 59  ? -1.008  34.465 189.540 1.00 127.74 ? 137 SER B HB3    1 
ATOM   3571  H  HG     . SER B 2 59  ? -0.328  35.712 187.867 1.00 156.58 ? 137 SER B HG     1 
ATOM   3572  N  N      . HIS B 2 60  ? -0.906  35.994 191.935 1.00 112.74 ? 138 HIS B N      1 
ATOM   3573  C  CA     . HIS B 2 60  ? -1.353  37.129 192.732 1.00 108.58 ? 138 HIS B CA     1 
ATOM   3574  C  C      . HIS B 2 60  ? -0.356  37.440 193.843 1.00 116.09 ? 138 HIS B C      1 
ATOM   3575  O  O      . HIS B 2 60  ? 0.116   38.576 193.981 1.00 113.67 ? 138 HIS B O      1 
ATOM   3576  C  CB     . HIS B 2 60  ? -2.737  36.820 193.311 1.00 112.78 ? 138 HIS B CB     1 
ATOM   3577  C  CG     . HIS B 2 60  ? -3.584  38.031 193.549 1.00 117.87 ? 138 HIS B CG     1 
ATOM   3578  N  ND1    . HIS B 2 60  ? -3.059  39.299 193.667 1.00 113.15 ? 138 HIS B ND1    1 
ATOM   3579  C  CD2    . HIS B 2 60  ? -4.924  38.163 193.686 1.00 123.18 ? 138 HIS B CD2    1 
ATOM   3580  C  CE1    . HIS B 2 60  ? -4.040  40.161 193.870 1.00 125.06 ? 138 HIS B CE1    1 
ATOM   3581  N  NE2    . HIS B 2 60  ? -5.182  39.497 193.887 1.00 122.17 ? 138 HIS B NE2    1 
ATOM   3582  H  H      . HIS B 2 60  ? -1.498  35.378 191.835 1.00 135.29 ? 138 HIS B H      1 
ATOM   3583  H  HA     . HIS B 2 60  ? -1.429  37.911 192.163 1.00 130.29 ? 138 HIS B HA     1 
ATOM   3584  H  HB2    . HIS B 2 60  ? -3.212  36.244 192.692 1.00 135.34 ? 138 HIS B HB2    1 
ATOM   3585  H  HB3    . HIS B 2 60  ? -2.625  36.367 194.161 1.00 135.34 ? 138 HIS B HB3    1 
ATOM   3586  H  HD2    . HIS B 2 60  ? -5.553  37.479 193.654 1.00 147.81 ? 138 HIS B HD2    1 
ATOM   3587  H  HE1    . HIS B 2 60  ? -3.943  41.079 193.982 1.00 150.07 ? 138 HIS B HE1    1 
ATOM   3588  H  HE2    . HIS B 2 60  ? -5.960  39.844 194.003 1.00 146.61 ? 138 HIS B HE2    1 
ATOM   3589  N  N      . MET B 2 61  ? -0.014  36.426 194.640 1.00 126.87 ? 139 MET B N      1 
ATOM   3590  C  CA     . MET B 2 61  ? 0.910   36.615 195.753 1.00 106.83 ? 139 MET B CA     1 
ATOM   3591  C  C      . MET B 2 61  ? 2.209   37.259 195.292 1.00 108.81 ? 139 MET B C      1 
ATOM   3592  O  O      . MET B 2 61  ? 2.656   38.263 195.859 1.00 101.72 ? 139 MET B O      1 
ATOM   3593  C  CB     . MET B 2 61  ? 1.186   35.267 196.421 1.00 108.51 ? 139 MET B CB     1 
ATOM   3594  C  CG     . MET B 2 61  ? 0.020   34.743 197.242 1.00 109.80 ? 139 MET B CG     1 
ATOM   3595  S  SD     . MET B 2 61  ? 0.384   34.672 199.009 1.00 150.17 ? 139 MET B SD     1 
ATOM   3596  C  CE     . MET B 2 61  ? 0.894   36.356 199.309 1.00 106.67 ? 139 MET B CE     1 
ATOM   3597  H  H      . MET B 2 61  ? -0.303  35.620 194.554 1.00 152.24 ? 139 MET B H      1 
ATOM   3598  H  HA     . MET B 2 61  ? 0.491   37.192 196.411 1.00 128.20 ? 139 MET B HA     1 
ATOM   3599  H  HB2    . MET B 2 61  ? 1.384   34.612 195.734 1.00 130.21 ? 139 MET B HB2    1 
ATOM   3600  H  HB3    . MET B 2 61  ? 1.948   35.363 197.014 1.00 130.21 ? 139 MET B HB3    1 
ATOM   3601  H  HG2    . MET B 2 61  ? -0.743  35.328 197.116 1.00 131.76 ? 139 MET B HG2    1 
ATOM   3602  H  HG3    . MET B 2 61  ? -0.197  33.846 196.945 1.00 131.76 ? 139 MET B HG3    1 
ATOM   3603  H  HE1    . MET B 2 61  ? 1.122   36.454 200.247 1.00 128.00 ? 139 MET B HE1    1 
ATOM   3604  H  HE2    . MET B 2 61  ? 1.666   36.555 198.757 1.00 128.00 ? 139 MET B HE2    1 
ATOM   3605  H  HE3    . MET B 2 61  ? 0.163   36.952 199.082 1.00 128.00 ? 139 MET B HE3    1 
ATOM   3606  N  N      . LYS B 2 62  ? 2.835   36.691 194.257 1.00 107.36 ? 140 LYS B N      1 
ATOM   3607  C  CA     . LYS B 2 62  ? 4.099   37.245 193.788 1.00 95.48  ? 140 LYS B CA     1 
ATOM   3608  C  C      . LYS B 2 62  ? 3.915   38.664 193.269 1.00 117.73 ? 140 LYS B C      1 
ATOM   3609  O  O      . LYS B 2 62  ? 4.848   39.474 193.337 1.00 137.54 ? 140 LYS B O      1 
ATOM   3610  C  CB     . LYS B 2 62  ? 4.719   36.343 192.715 1.00 88.68  ? 140 LYS B CB     1 
ATOM   3611  C  CG     . LYS B 2 62  ? 3.858   36.105 191.494 1.00 111.29 ? 140 LYS B CG     1 
ATOM   3612  C  CD     . LYS B 2 62  ? 4.575   35.220 190.479 1.00 133.07 ? 140 LYS B CD     1 
ATOM   3613  C  CE     . LYS B 2 62  ? 4.210   35.571 189.043 1.00 114.72 ? 140 LYS B CE     1 
ATOM   3614  N  NZ     . LYS B 2 62  ? 5.269   35.137 188.088 1.00 113.26 ? 140 LYS B NZ     1 
ATOM   3615  H  H      . LYS B 2 62  ? 2.555   36.004 193.823 1.00 128.83 ? 140 LYS B H      1 
ATOM   3616  H  HA     . LYS B 2 62  ? 4.717   37.283 194.535 1.00 114.57 ? 140 LYS B HA     1 
ATOM   3617  H  HB2    . LYS B 2 62  ? 5.547   36.749 192.413 1.00 106.42 ? 140 LYS B HB2    1 
ATOM   3618  H  HB3    . LYS B 2 62  ? 4.908   35.478 193.111 1.00 106.42 ? 140 LYS B HB3    1 
ATOM   3619  H  HG2    . LYS B 2 62  ? 3.038   35.661 191.761 1.00 133.55 ? 140 LYS B HG2    1 
ATOM   3620  H  HG3    . LYS B 2 62  ? 3.659   36.955 191.071 1.00 133.55 ? 140 LYS B HG3    1 
ATOM   3621  H  HD2    . LYS B 2 62  ? 5.533   35.332 190.582 1.00 159.68 ? 140 LYS B HD2    1 
ATOM   3622  H  HD3    . LYS B 2 62  ? 4.329   34.295 190.635 1.00 159.68 ? 140 LYS B HD3    1 
ATOM   3623  H  HE2    . LYS B 2 62  ? 3.384   35.122 188.805 1.00 137.67 ? 140 LYS B HE2    1 
ATOM   3624  H  HE3    . LYS B 2 62  ? 4.106   36.532 188.965 1.00 137.67 ? 140 LYS B HE3    1 
ATOM   3625  H  HZ1    . LYS B 2 62  ? 5.035   35.351 187.257 1.00 135.92 ? 140 LYS B HZ1    1 
ATOM   3626  H  HZ2    . LYS B 2 62  ? 6.039   35.538 188.285 1.00 135.92 ? 140 LYS B HZ2    1 
ATOM   3627  H  HZ3    . LYS B 2 62  ? 5.381   34.255 188.139 1.00 135.92 ? 140 LYS B HZ3    1 
ATOM   3628  N  N      . SER B 2 63  ? 2.722   38.993 192.767 1.00 139.87 ? 141 SER B N      1 
ATOM   3629  C  CA     . SER B 2 63  ? 2.463   40.373 192.367 1.00 137.52 ? 141 SER B CA     1 
ATOM   3630  C  C      . SER B 2 63  ? 2.449   41.299 193.580 1.00 119.90 ? 141 SER B C      1 
ATOM   3631  O  O      . SER B 2 63  ? 3.024   42.394 193.538 1.00 129.80 ? 141 SER B O      1 
ATOM   3632  C  CB     . SER B 2 63  ? 1.143   40.471 191.600 1.00 108.66 ? 141 SER B CB     1 
ATOM   3633  O  OG     . SER B 2 63  ? 0.053   40.664 192.485 1.00 103.91 ? 141 SER B OG     1 
ATOM   3634  H  H      . SER B 2 63  ? 2.064   38.451 192.651 1.00 167.85 ? 141 SER B H      1 
ATOM   3635  H  HA     . SER B 2 63  ? 3.174   40.667 191.776 1.00 165.03 ? 141 SER B HA     1 
ATOM   3636  H  HB2    . SER B 2 63  ? 1.189   41.222 190.988 1.00 130.39 ? 141 SER B HB2    1 
ATOM   3637  H  HB3    . SER B 2 63  ? 1.005   39.648 191.105 1.00 130.39 ? 141 SER B HB3    1 
ATOM   3638  H  HG     . SER B 2 63  ? 0.001   40.020 193.022 1.00 124.70 ? 141 SER B HG     1 
ATOM   3639  N  N      . LEU B 2 64  ? 1.792   40.886 194.666 1.00 99.77  ? 142 LEU B N      1 
ATOM   3640  C  CA     . LEU B 2 64  ? 1.814   41.691 195.885 1.00 77.79  ? 142 LEU B CA     1 
ATOM   3641  C  C      . LEU B 2 64  ? 3.226   41.895 196.429 1.00 96.98  ? 142 LEU B C      1 
ATOM   3642  O  O      . LEU B 2 64  ? 3.462   42.862 197.163 1.00 88.70  ? 142 LEU B O      1 
ATOM   3643  C  CB     . LEU B 2 64  ? 0.952   41.043 196.974 1.00 76.76  ? 142 LEU B CB     1 
ATOM   3644  C  CG     . LEU B 2 64  ? -0.571  41.203 196.914 1.00 79.81  ? 142 LEU B CG     1 
ATOM   3645  C  CD1    . LEU B 2 64  ? -0.988  42.672 196.863 1.00 88.47  ? 142 LEU B CD1    1 
ATOM   3646  C  CD2    . LEU B 2 64  ? -1.169  40.430 195.746 1.00 80.28  ? 142 LEU B CD2    1 
ATOM   3647  H  H      . LEU B 2 64  ? 1.336   40.159 194.722 1.00 119.73 ? 142 LEU B H      1 
ATOM   3648  H  HA     . LEU B 2 64  ? 1.441   42.565 195.690 1.00 93.34  ? 142 LEU B HA     1 
ATOM   3649  H  HB2    . LEU B 2 64  ? 1.132   40.090 196.964 1.00 92.11  ? 142 LEU B HB2    1 
ATOM   3650  H  HB3    . LEU B 2 64  ? 1.236   41.406 197.828 1.00 92.11  ? 142 LEU B HB3    1 
ATOM   3651  H  HG     . LEU B 2 64  ? -0.946  40.828 197.726 1.00 95.77  ? 142 LEU B HG     1 
ATOM   3652  H  HD11   . LEU B 2 64  ? -1.956  42.724 196.825 1.00 106.16 ? 142 LEU B HD11   1 
ATOM   3653  H  HD12   . LEU B 2 64  ? -0.662  43.120 197.659 1.00 106.16 ? 142 LEU B HD12   1 
ATOM   3654  H  HD13   . LEU B 2 64  ? -0.603  43.082 196.072 1.00 106.16 ? 142 LEU B HD13   1 
ATOM   3655  H  HD21   . LEU B 2 64  ? -2.131  40.557 195.744 1.00 96.34  ? 142 LEU B HD21   1 
ATOM   3656  H  HD22   . LEU B 2 64  ? -0.788  40.764 194.919 1.00 96.34  ? 142 LEU B HD22   1 
ATOM   3657  H  HD23   . LEU B 2 64  ? -0.959  39.489 195.852 1.00 96.34  ? 142 LEU B HD23   1 
ATOM   3658  N  N      . ARG B 2 65  ? 4.160   41.008 196.100 1.00 121.42 ? 143 ARG B N      1 
ATOM   3659  C  CA     . ARG B 2 65  ? 5.532   41.118 196.584 1.00 127.07 ? 143 ARG B CA     1 
ATOM   3660  C  C      . ARG B 2 65  ? 6.353   39.907 196.145 1.00 125.83 ? 143 ARG B C      1 
ATOM   3661  O  O      . ARG B 2 65  ? 6.888   39.870 195.036 1.00 98.09  ? 143 ARG B O      1 
ATOM   3662  C  CB     . ARG B 2 65  ? 5.554   41.249 198.109 1.00 70.47  ? 143 ARG B CB     1 
ATOM   3663  H  H      . ARG B 2 65  ? 4.023   40.327 195.593 1.00 145.71 ? 143 ARG B H      1 
ATOM   3664  H  HA     . ARG B 2 65  ? 5.940   41.912 196.207 1.00 152.48 ? 143 ARG B HA     1 
ATOM   3665  N  N      . GLY B 2 74  ? 20.584  38.832 203.988 1.00 47.39  ? 152 GLY B N      1 
ATOM   3666  C  CA     . GLY B 2 74  ? 20.475  39.810 205.056 1.00 79.31  ? 152 GLY B CA     1 
ATOM   3667  C  C      . GLY B 2 74  ? 19.059  39.946 205.588 1.00 88.19  ? 152 GLY B C      1 
ATOM   3668  O  O      . GLY B 2 74  ? 18.122  39.363 205.037 1.00 89.27  ? 152 GLY B O      1 
ATOM   3669  H  HA2    . GLY B 2 74  ? 21.055  39.551 205.790 1.00 95.17  ? 152 GLY B HA2    1 
ATOM   3670  H  HA3    . GLY B 2 74  ? 20.764  40.677 204.729 1.00 95.17  ? 152 GLY B HA3    1 
ATOM   3671  N  N      . SER B 2 75  ? 18.903  40.721 206.662 1.00 65.45  ? 153 SER B N      1 
ATOM   3672  C  CA     . SER B 2 75  ? 17.613  40.827 207.335 1.00 71.69  ? 153 SER B CA     1 
ATOM   3673  C  C      . SER B 2 75  ? 16.619  41.644 206.515 1.00 67.76  ? 153 SER B C      1 
ATOM   3674  O  O      . SER B 2 75  ? 16.972  42.657 205.902 1.00 70.69  ? 153 SER B O      1 
ATOM   3675  C  CB     . SER B 2 75  ? 17.784  41.466 208.715 1.00 65.65  ? 153 SER B CB     1 
ATOM   3676  O  OG     . SER B 2 75  ? 18.219  42.814 208.601 1.00 76.91  ? 153 SER B OG     1 
ATOM   3677  H  H      . SER B 2 75  ? 19.528  41.193 207.018 1.00 78.54  ? 153 SER B H      1 
ATOM   3678  H  HA     . SER B 2 75  ? 17.245  39.938 207.457 1.00 86.02  ? 153 SER B HA     1 
ATOM   3679  H  HB2    . SER B 2 75  ? 16.932  41.448 209.178 1.00 78.78  ? 153 SER B HB2    1 
ATOM   3680  H  HB3    . SER B 2 75  ? 18.444  40.963 209.216 1.00 78.78  ? 153 SER B HB3    1 
ATOM   3681  H  HG     . SER B 2 75  ? 18.308  43.152 209.365 1.00 92.29  ? 153 SER B HG     1 
ATOM   3682  N  N      . TYR B 2 76  ? 15.365  41.196 206.519 1.00 150.58 ? 154 TYR B N      1 
ATOM   3683  C  CA     . TYR B 2 76  ? 14.258  41.934 205.929 1.00 140.63 ? 154 TYR B CA     1 
ATOM   3684  C  C      . TYR B 2 76  ? 12.982  41.511 206.639 1.00 132.26 ? 154 TYR B C      1 
ATOM   3685  O  O      . TYR B 2 76  ? 12.803  40.332 206.955 1.00 132.39 ? 154 TYR B O      1 
ATOM   3686  C  CB     . TYR B 2 76  ? 14.141  41.678 204.424 1.00 49.64  ? 154 TYR B CB     1 
ATOM   3687  H  H      . TYR B 2 76  ? 15.127  40.447 206.868 1.00 180.70 ? 154 TYR B H      1 
ATOM   3688  H  HA     . TYR B 2 76  ? 14.389  42.884 206.071 1.00 168.76 ? 154 TYR B HA     1 
ATOM   3689  N  N      . LYS B 2 77  ? 12.097  42.475 206.884 1.00 143.61 ? 155 LYS B N      1 
ATOM   3690  C  CA     . LYS B 2 77  ? 10.929  42.234 207.716 1.00 137.83 ? 155 LYS B CA     1 
ATOM   3691  C  C      . LYS B 2 77  ? 9.702   42.019 206.844 1.00 138.35 ? 155 LYS B C      1 
ATOM   3692  O  O      . LYS B 2 77  ? 9.244   42.974 206.202 1.00 161.42 ? 155 LYS B O      1 
ATOM   3693  C  CB     . LYS B 2 77  ? 10.701  43.411 208.665 1.00 114.80 ? 155 LYS B CB     1 
ATOM   3694  H  H      . LYS B 2 77  ? 12.154  43.278 206.580 1.00 172.34 ? 155 LYS B H      1 
ATOM   3695  H  HA     . LYS B 2 77  ? 11.071  41.435 208.248 1.00 165.40 ? 155 LYS B HA     1 
ATOM   3696  N  N      . PRO B 2 78  ? 9.133   40.817 206.782 1.00 92.68  ? 156 PRO B N      1 
ATOM   3697  C  CA     . PRO B 2 78  ? 7.829   40.652 206.138 1.00 83.38  ? 156 PRO B CA     1 
ATOM   3698  C  C      . PRO B 2 78  ? 6.731   41.207 207.033 1.00 102.21 ? 156 PRO B C      1 
ATOM   3699  O  O      . PRO B 2 78  ? 6.923   41.453 208.224 1.00 129.61 ? 156 PRO B O      1 
ATOM   3700  C  CB     . PRO B 2 78  ? 7.705   39.138 205.968 1.00 113.15 ? 156 PRO B CB     1 
ATOM   3701  C  CG     . PRO B 2 78  ? 8.455   38.595 207.120 1.00 129.17 ? 156 PRO B CG     1 
ATOM   3702  C  CD     . PRO B 2 78  ? 9.609   39.548 207.361 1.00 105.08 ? 156 PRO B CD     1 
ATOM   3703  H  HA     . PRO B 2 78  ? 7.810   41.089 205.272 1.00 100.05 ? 156 PRO B HA     1 
ATOM   3704  H  HB2    . PRO B 2 78  ? 6.771   38.876 206.007 1.00 135.78 ? 156 PRO B HB2    1 
ATOM   3705  H  HB3    . PRO B 2 78  ? 8.109   38.864 205.130 1.00 135.78 ? 156 PRO B HB3    1 
ATOM   3706  H  HG2    . PRO B 2 78  ? 7.875   38.560 207.897 1.00 155.01 ? 156 PRO B HG2    1 
ATOM   3707  H  HG3    . PRO B 2 78  ? 8.786   37.709 206.903 1.00 155.01 ? 156 PRO B HG3    1 
ATOM   3708  H  HD2    . PRO B 2 78  ? 9.770   39.650 208.312 1.00 126.10 ? 156 PRO B HD2    1 
ATOM   3709  H  HD3    . PRO B 2 78  ? 10.403  39.242 206.897 1.00 126.10 ? 156 PRO B HD3    1 
ATOM   3710  N  N      . SER B 2 79  ? 5.562   41.407 206.434 1.00 83.85  ? 157 SER B N      1 
ATOM   3711  C  CA     . SER B 2 79  ? 4.455   42.024 207.150 1.00 61.51  ? 157 SER B CA     1 
ATOM   3712  C  C      . SER B 2 79  ? 3.142   41.583 206.534 1.00 72.00  ? 157 SER B C      1 
ATOM   3713  O  O      . SER B 2 79  ? 2.965   41.666 205.315 1.00 119.59 ? 157 SER B O      1 
ATOM   3714  C  CB     . SER B 2 79  ? 4.555   43.553 207.114 1.00 107.28 ? 157 SER B CB     1 
ATOM   3715  O  OG     . SER B 2 79  ? 5.661   44.021 207.865 1.00 140.45 ? 157 SER B OG     1 
ATOM   3716  H  H      . SER B 2 79  ? 5.386   41.195 205.619 1.00 100.62 ? 157 SER B H      1 
ATOM   3717  H  HA     . SER B 2 79  ? 4.471   41.737 208.077 1.00 73.81  ? 157 SER B HA     1 
ATOM   3718  H  HB2    . SER B 2 79  ? 4.658   43.838 206.193 1.00 128.74 ? 157 SER B HB2    1 
ATOM   3719  H  HB3    . SER B 2 79  ? 3.742   43.929 207.486 1.00 128.74 ? 157 SER B HB3    1 
ATOM   3720  H  HG     . SER B 2 79  ? 5.697   44.859 207.832 1.00 168.54 ? 157 SER B HG     1 
ATOM   3721  N  N      . PHE B 2 80  ? 2.231   41.110 207.381 1.00 73.84  ? 158 PHE B N      1 
ATOM   3722  C  CA     . PHE B 2 80  ? 0.855   40.918 206.946 1.00 58.33  ? 158 PHE B CA     1 
ATOM   3723  C  C      . PHE B 2 80  ? 0.287   42.214 206.378 1.00 85.95  ? 158 PHE B C      1 
ATOM   3724  O  O      . PHE B 2 80  ? -0.418  42.202 205.362 1.00 103.41 ? 158 PHE B O      1 
ATOM   3725  C  CB     . PHE B 2 80  ? 0.014   40.426 208.124 1.00 61.98  ? 158 PHE B CB     1 
ATOM   3726  C  CG     . PHE B 2 80  ? -1.126  39.530 207.736 1.00 60.25  ? 158 PHE B CG     1 
ATOM   3727  C  CD1    . PHE B 2 80  ? -0.888  38.297 207.154 1.00 83.46  ? 158 PHE B CD1    1 
ATOM   3728  C  CD2    . PHE B 2 80  ? -2.436  39.906 207.987 1.00 69.98  ? 158 PHE B CD2    1 
ATOM   3729  C  CE1    . PHE B 2 80  ? -1.936  37.464 206.808 1.00 87.18  ? 158 PHE B CE1    1 
ATOM   3730  C  CE2    . PHE B 2 80  ? -3.488  39.078 207.646 1.00 77.87  ? 158 PHE B CE2    1 
ATOM   3731  C  CZ     . PHE B 2 80  ? -3.238  37.854 207.056 1.00 92.31  ? 158 PHE B CZ     1 
ATOM   3732  H  H      . PHE B 2 80  ? 2.382   40.896 208.200 1.00 88.61  ? 158 PHE B H      1 
ATOM   3733  H  HA     . PHE B 2 80  ? 0.829   40.243 206.250 1.00 70.00  ? 158 PHE B HA     1 
ATOM   3734  H  HB2    . PHE B 2 80  ? 0.587   39.930 208.729 1.00 74.38  ? 158 PHE B HB2    1 
ATOM   3735  H  HB3    . PHE B 2 80  ? -0.358  41.196 208.583 1.00 74.38  ? 158 PHE B HB3    1 
ATOM   3736  H  HD1    . PHE B 2 80  ? -0.014  38.030 206.984 1.00 100.15 ? 158 PHE B HD1    1 
ATOM   3737  H  HD2    . PHE B 2 80  ? -2.609  40.729 208.384 1.00 83.98  ? 158 PHE B HD2    1 
ATOM   3738  H  HE1    . PHE B 2 80  ? -1.764  36.640 206.411 1.00 104.62 ? 158 PHE B HE1    1 
ATOM   3739  H  HE2    . PHE B 2 80  ? -4.364  39.344 207.813 1.00 93.44  ? 158 PHE B HE2    1 
ATOM   3740  H  HZ     . PHE B 2 80  ? -3.944  37.296 206.824 1.00 110.78 ? 158 PHE B HZ     1 
ATOM   3741  N  N      . LEU B 2 81  ? 0.609   43.344 207.011 1.00 58.08  ? 159 LEU B N      1 
ATOM   3742  C  CA     . LEU B 2 81  ? 0.063   44.650 206.669 1.00 55.93  ? 159 LEU B CA     1 
ATOM   3743  C  C      . LEU B 2 81  ? 1.190   45.669 206.553 1.00 69.75  ? 159 LEU B C      1 
ATOM   3744  O  O      . LEU B 2 81  ? 2.128   45.659 207.354 1.00 81.23  ? 159 LEU B O      1 
ATOM   3745  C  CB     . LEU B 2 81  ? -0.937  45.109 207.734 1.00 59.12  ? 159 LEU B CB     1 
ATOM   3746  C  CG     . LEU B 2 81  ? -2.409  44.701 207.609 1.00 63.69  ? 159 LEU B CG     1 
ATOM   3747  C  CD1    . LEU B 2 81  ? -2.591  43.223 207.347 1.00 86.63  ? 159 LEU B CD1    1 
ATOM   3748  C  CD2    . LEU B 2 81  ? -3.152  45.094 208.881 1.00 100.32 ? 159 LEU B CD2    1 
ATOM   3749  H  H      . LEU B 2 81  ? 1.164   43.375 207.667 1.00 69.70  ? 159 LEU B H      1 
ATOM   3750  H  HA     . LEU B 2 81  ? -0.396  44.598 205.816 1.00 67.11  ? 159 LEU B HA     1 
ATOM   3751  H  HB2    . LEU B 2 81  ? -0.628  44.774 208.590 1.00 70.95  ? 159 LEU B HB2    1 
ATOM   3752  H  HB3    . LEU B 2 81  ? -0.920  46.079 207.753 1.00 70.95  ? 159 LEU B HB3    1 
ATOM   3753  H  HG     . LEU B 2 81  ? -2.808  45.185 206.870 1.00 76.43  ? 159 LEU B HG     1 
ATOM   3754  H  HD11   . LEU B 2 81  ? -3.539  43.029 207.279 1.00 103.96 ? 159 LEU B HD11   1 
ATOM   3755  H  HD12   . LEU B 2 81  ? -2.146  42.993 206.517 1.00 103.96 ? 159 LEU B HD12   1 
ATOM   3756  H  HD13   . LEU B 2 81  ? -2.203  42.722 208.081 1.00 103.96 ? 159 LEU B HD13   1 
ATOM   3757  H  HD21   . LEU B 2 81  ? -4.082  44.833 208.797 1.00 120.38 ? 159 LEU B HD21   1 
ATOM   3758  H  HD22   . LEU B 2 81  ? -2.747  44.639 209.636 1.00 120.38 ? 159 LEU B HD22   1 
ATOM   3759  H  HD23   . LEU B 2 81  ? -3.087  46.054 209.000 1.00 120.38 ? 159 LEU B HD23   1 
ATOM   3760  N  N      . THR B 2 82  ? 1.090   46.559 205.565 1.00 86.38  ? 160 THR B N      1 
ATOM   3761  C  CA     . THR B 2 82  ? 2.129   47.555 205.350 1.00 110.17 ? 160 THR B CA     1 
ATOM   3762  C  C      . THR B 2 82  ? 1.973   48.708 206.340 1.00 97.12  ? 160 THR B C      1 
ATOM   3763  O  O      . THR B 2 82  ? 1.024   48.771 207.126 1.00 103.18 ? 160 THR B O      1 
ATOM   3764  C  CB     . THR B 2 82  ? 2.094   48.089 203.918 1.00 105.13 ? 160 THR B CB     1 
ATOM   3765  O  OG1    . THR B 2 82  ? 1.011   49.017 203.771 1.00 108.27 ? 160 THR B OG1    1 
ATOM   3766  C  CG2    . THR B 2 82  ? 1.941   46.960 202.912 1.00 103.62 ? 160 THR B CG2    1 
ATOM   3767  H  H      . THR B 2 82  ? 0.433   46.604 205.012 1.00 103.65 ? 160 THR B H      1 
ATOM   3768  H  HA     . THR B 2 82  ? 2.996   47.146 205.498 1.00 132.21 ? 160 THR B HA     1 
ATOM   3769  H  HB     . THR B 2 82  ? 2.929   48.546 203.731 1.00 126.15 ? 160 THR B HB     1 
ATOM   3770  H  HG1    . THR B 2 82  ? 0.990   49.312 202.984 1.00 129.93 ? 160 THR B HG1    1 
ATOM   3771  H  HG21   . THR B 2 82  ? 1.921   47.319 202.011 1.00 124.34 ? 160 THR B HG21   1 
ATOM   3772  H  HG22   . THR B 2 82  ? 2.686   46.344 202.990 1.00 124.34 ? 160 THR B HG22   1 
ATOM   3773  H  HG23   . THR B 2 82  ? 1.115   46.478 203.078 1.00 124.34 ? 160 THR B HG23   1 
ATOM   3774  N  N      . ASP B 2 83  ? 2.923   49.646 206.287 1.00 83.66  ? 161 ASP B N      1 
ATOM   3775  C  CA     . ASP B 2 83  ? 2.876   50.798 207.181 1.00 71.24  ? 161 ASP B CA     1 
ATOM   3776  C  C      . ASP B 2 83  ? 1.602   51.602 206.972 1.00 82.65  ? 161 ASP B C      1 
ATOM   3777  O  O      . ASP B 2 83  ? 1.041   52.150 207.926 1.00 95.50  ? 161 ASP B O      1 
ATOM   3778  C  CB     . ASP B 2 83  ? 4.093   51.692 206.961 1.00 87.10  ? 161 ASP B CB     1 
ATOM   3779  C  CG     . ASP B 2 83  ? 5.373   50.911 206.830 1.00 96.19  ? 161 ASP B CG     1 
ATOM   3780  O  OD1    . ASP B 2 83  ? 5.581   50.303 205.759 1.00 119.85 ? 161 ASP B OD1    1 
ATOM   3781  O  OD2    . ASP B 2 83  ? 6.168   50.925 207.793 1.00 125.94 ? 161 ASP B OD2    1 
ATOM   3782  H  H      . ASP B 2 83  ? 3.594   49.637 205.750 1.00 100.39 ? 161 ASP B H      1 
ATOM   3783  H  HA     . ASP B 2 83  ? 2.890   50.488 208.100 1.00 85.49  ? 161 ASP B HA     1 
ATOM   3784  H  HB2    . ASP B 2 83  ? 3.967   52.201 206.145 1.00 104.52 ? 161 ASP B HB2    1 
ATOM   3785  H  HB3    . ASP B 2 83  ? 4.184   52.293 207.717 1.00 104.52 ? 161 ASP B HB3    1 
ATOM   3786  N  N      . GLN B 2 84  ? 1.141   51.705 205.727 1.00 94.69  ? 162 GLN B N      1 
ATOM   3787  C  CA     . GLN B 2 84  ? -0.095  52.430 205.462 1.00 90.67  ? 162 GLN B CA     1 
ATOM   3788  C  C      . GLN B 2 84  ? -1.285  51.727 206.098 1.00 71.55  ? 162 GLN B C      1 
ATOM   3789  O  O      . GLN B 2 84  ? -2.193  52.376 206.635 1.00 60.41  ? 162 GLN B O      1 
ATOM   3790  C  CB     . GLN B 2 84  ? -0.293  52.570 203.953 1.00 114.97 ? 162 GLN B CB     1 
ATOM   3791  C  CG     . GLN B 2 84  ? 0.844   53.291 203.249 1.00 128.73 ? 162 GLN B CG     1 
ATOM   3792  C  CD     . GLN B 2 84  ? 0.718   53.235 201.740 1.00 132.47 ? 162 GLN B CD     1 
ATOM   3793  O  OE1    . GLN B 2 84  ? 0.091   52.328 201.192 1.00 109.38 ? 162 GLN B OE1    1 
ATOM   3794  N  NE2    . GLN B 2 84  ? 1.313   54.210 201.060 1.00 137.57 ? 162 GLN B NE2    1 
ATOM   3795  H  H      . GLN B 2 84  ? 1.519   51.369 205.031 1.00 113.62 ? 162 GLN B H      1 
ATOM   3796  H  HA     . GLN B 2 84  ? -0.030  53.320 205.843 1.00 108.81 ? 162 GLN B HA     1 
ATOM   3797  H  HB2    . GLN B 2 84  ? -0.369  51.684 203.565 1.00 137.97 ? 162 GLN B HB2    1 
ATOM   3798  H  HB3    . GLN B 2 84  ? -1.108  53.071 203.790 1.00 137.97 ? 162 GLN B HB3    1 
ATOM   3799  H  HG2    . GLN B 2 84  ? 0.842   54.223 203.517 1.00 154.47 ? 162 GLN B HG2    1 
ATOM   3800  H  HG3    . GLN B 2 84  ? 1.684   52.874 203.497 1.00 154.47 ? 162 GLN B HG3    1 
ATOM   3801  H  HE21   . GLN B 2 84  ? 1.741   54.828 201.479 1.00 165.09 ? 162 GLN B HE21   1 
ATOM   3802  H  HE22   . GLN B 2 84  ? 1.271   54.223 200.201 1.00 165.09 ? 162 GLN B HE22   1 
ATOM   3803  N  N      . GLU B 2 85  ? -1.281  50.396 206.064 1.00 59.14  ? 163 GLU B N      1 
ATOM   3804  C  CA     . GLU B 2 85  ? -2.412  49.629 206.567 1.00 68.44  ? 163 GLU B CA     1 
ATOM   3805  C  C      . GLU B 2 85  ? -2.438  49.625 208.092 1.00 90.13  ? 163 GLU B C      1 
ATOM   3806  O  O      . GLU B 2 85  ? -3.510  49.740 208.699 1.00 88.86  ? 163 GLU B O      1 
ATOM   3807  C  CB     . GLU B 2 85  ? -2.356  48.203 206.007 1.00 91.59  ? 163 GLU B CB     1 
ATOM   3808  C  CG     . GLU B 2 85  ? -1.897  48.144 204.556 1.00 99.15  ? 163 GLU B CG     1 
ATOM   3809  C  CD     . GLU B 2 85  ? -2.180  46.815 203.880 1.00 107.98 ? 163 GLU B CD     1 
ATOM   3810  O  OE1    . GLU B 2 85  ? -1.325  45.913 203.974 1.00 109.02 ? 163 GLU B OE1    1 
ATOM   3811  O  OE2    . GLU B 2 85  ? -3.253  46.676 203.253 1.00 83.47  ? 163 GLU B OE2    1 
ATOM   3812  H  H      . GLU B 2 85  ? -0.637  49.917 205.755 1.00 70.97  ? 163 GLU B H      1 
ATOM   3813  H  HA     . GLU B 2 85  ? -3.233  50.040 206.256 1.00 82.13  ? 163 GLU B HA     1 
ATOM   3814  H  HB2    . GLU B 2 85  ? -1.735  47.681 206.538 1.00 109.91 ? 163 GLU B HB2    1 
ATOM   3815  H  HB3    . GLU B 2 85  ? -3.242  47.811 206.056 1.00 109.91 ? 163 GLU B HB3    1 
ATOM   3816  H  HG2    . GLU B 2 85  ? -2.356  48.836 204.055 1.00 118.98 ? 163 GLU B HG2    1 
ATOM   3817  H  HG3    . GLU B 2 85  ? -0.940  48.295 204.525 1.00 118.98 ? 163 GLU B HG3    1 
ATOM   3818  N  N      . LEU B 2 86  ? -1.271  49.509 208.728 1.00 76.01  ? 164 LEU B N      1 
ATOM   3819  C  CA     . LEU B 2 86  ? -1.206  49.636 210.179 1.00 64.07  ? 164 LEU B CA     1 
ATOM   3820  C  C      . LEU B 2 86  ? -1.551  51.055 210.611 1.00 74.49  ? 164 LEU B C      1 
ATOM   3821  O  O      . LEU B 2 86  ? -2.502  51.272 211.368 1.00 93.42  ? 164 LEU B O      1 
ATOM   3822  C  CB     . LEU B 2 86  ? 0.185   49.246 210.683 1.00 78.70  ? 164 LEU B CB     1 
ATOM   3823  C  CG     . LEU B 2 86  ? 0.517   47.755 210.687 1.00 62.34  ? 164 LEU B CG     1 
ATOM   3824  C  CD1    . LEU B 2 86  ? 1.971   47.534 211.101 1.00 64.27  ? 164 LEU B CD1    1 
ATOM   3825  C  CD2    . LEU B 2 86  ? -0.432  46.996 211.606 1.00 64.55  ? 164 LEU B CD2    1 
ATOM   3826  H  H      . LEU B 2 86  ? -0.515  49.359 208.346 1.00 91.22  ? 164 LEU B H      1 
ATOM   3827  H  HA     . LEU B 2 86  ? -1.852  49.033 210.580 1.00 76.89  ? 164 LEU B HA     1 
ATOM   3828  H  HB2    . LEU B 2 86  ? 0.845   49.685 210.123 1.00 94.44  ? 164 LEU B HB2    1 
ATOM   3829  H  HB3    . LEU B 2 86  ? 0.277   49.563 211.595 1.00 94.44  ? 164 LEU B HB3    1 
ATOM   3830  H  HG     . LEU B 2 86  ? 0.406   47.405 209.789 1.00 74.81  ? 164 LEU B HG     1 
ATOM   3831  H  HD11   . LEU B 2 86  ? 2.159   46.583 211.096 1.00 77.13  ? 164 LEU B HD11   1 
ATOM   3832  H  HD12   . LEU B 2 86  ? 2.551   47.990 210.470 1.00 77.13  ? 164 LEU B HD12   1 
ATOM   3833  H  HD13   . LEU B 2 86  ? 2.103   47.894 211.992 1.00 77.13  ? 164 LEU B HD13   1 
ATOM   3834  H  HD21   . LEU B 2 86  ? -0.201  46.054 211.590 1.00 77.46  ? 164 LEU B HD21   1 
ATOM   3835  H  HD22   . LEU B 2 86  ? -0.344  47.344 212.507 1.00 77.46  ? 164 LEU B HD22   1 
ATOM   3836  H  HD23   . LEU B 2 86  ? -1.341  47.119 211.291 1.00 77.46  ? 164 LEU B HD23   1 
ATOM   3837  N  N      . LYS B 2 87  ? -0.773  52.034 210.147 1.00 63.31  ? 165 LYS B N      1 
ATOM   3838  C  CA     . LYS B 2 87  ? -1.067  53.441 210.394 1.00 81.18  ? 165 LYS B CA     1 
ATOM   3839  C  C      . LYS B 2 87  ? -2.566  53.695 210.358 1.00 72.46  ? 165 LYS B C      1 
ATOM   3840  O  O      . LYS B 2 87  ? -3.163  54.183 211.325 1.00 73.00  ? 165 LYS B O      1 
ATOM   3841  C  CB     . LYS B 2 87  ? -0.344  54.302 209.350 1.00 74.36  ? 165 LYS B CB     1 
ATOM   3842  C  CG     . LYS B 2 87  ? -0.692  55.787 209.408 1.00 110.33 ? 165 LYS B CG     1 
ATOM   3843  C  CD     . LYS B 2 87  ? 0.190   56.613 208.482 1.00 97.67  ? 165 LYS B CD     1 
ATOM   3844  C  CE     . LYS B 2 87  ? -0.097  56.361 207.011 1.00 106.87 ? 165 LYS B CE     1 
ATOM   3845  N  NZ     . LYS B 2 87  ? -1.402  56.928 206.591 1.00 104.12 ? 165 LYS B NZ     1 
ATOM   3846  H  H      . LYS B 2 87  ? -0.061  51.905 209.682 1.00 75.97  ? 165 LYS B H      1 
ATOM   3847  H  HA     . LYS B 2 87  ? -0.738  53.687 211.273 1.00 97.42  ? 165 LYS B HA     1 
ATOM   3848  H  HB2    . LYS B 2 87  ? 0.613   54.218 209.486 1.00 89.23  ? 165 LYS B HB2    1 
ATOM   3849  H  HB3    . LYS B 2 87  ? -0.578  53.979 208.465 1.00 89.23  ? 165 LYS B HB3    1 
ATOM   3850  H  HG2    . LYS B 2 87  ? -1.615  55.909 209.136 1.00 132.39 ? 165 LYS B HG2    1 
ATOM   3851  H  HG3    . LYS B 2 87  ? -0.565  56.108 210.314 1.00 132.39 ? 165 LYS B HG3    1 
ATOM   3852  H  HD2    . LYS B 2 87  ? 0.038   57.555 208.659 1.00 117.21 ? 165 LYS B HD2    1 
ATOM   3853  H  HD3    . LYS B 2 87  ? 1.119   56.390 208.649 1.00 117.21 ? 165 LYS B HD3    1 
ATOM   3854  H  HE2    . LYS B 2 87  ? 0.598   56.774 206.475 1.00 128.25 ? 165 LYS B HE2    1 
ATOM   3855  H  HE3    . LYS B 2 87  ? -0.118  55.404 206.850 1.00 128.25 ? 165 LYS B HE3    1 
ATOM   3856  H  HZ1    . LYS B 2 87  ? -1.541  56.764 205.727 1.00 124.95 ? 165 LYS B HZ1    1 
ATOM   3857  H  HZ2    . LYS B 2 87  ? -2.060  56.560 207.064 1.00 124.95 ? 165 LYS B HZ2    1 
ATOM   3858  H  HZ3    . LYS B 2 87  ? -1.407  57.808 206.723 1.00 124.95 ? 165 LYS B HZ3    1 
ATOM   3859  N  N      . HIS B 2 88  ? -3.190  53.345 209.236 1.00 93.55  ? 166 HIS B N      1 
ATOM   3860  C  CA     . HIS B 2 88  ? -4.628  53.516 209.110 1.00 91.01  ? 166 HIS B CA     1 
ATOM   3861  C  C      . HIS B 2 88  ? -5.361  52.799 210.235 1.00 66.21  ? 166 HIS B C      1 
ATOM   3862  O  O      . HIS B 2 88  ? -6.143  53.406 210.972 1.00 80.94  ? 166 HIS B O      1 
ATOM   3863  C  CB     . HIS B 2 88  ? -5.095  53.000 207.753 1.00 95.67  ? 166 HIS B CB     1 
ATOM   3864  C  CG     . HIS B 2 88  ? -6.572  53.126 207.544 1.00 88.70  ? 166 HIS B CG     1 
ATOM   3865  N  ND1    . HIS B 2 88  ? -7.170  54.303 207.151 1.00 86.02  ? 166 HIS B ND1    1 
ATOM   3866  C  CD2    . HIS B 2 88  ? -7.575  52.229 207.698 1.00 82.63  ? 166 HIS B CD2    1 
ATOM   3867  C  CE1    . HIS B 2 88  ? -8.476  54.123 207.058 1.00 102.83 ? 166 HIS B CE1    1 
ATOM   3868  N  NE2    . HIS B 2 88  ? -8.747  52.873 207.385 1.00 88.67  ? 166 HIS B NE2    1 
ATOM   3869  H  H      . HIS B 2 88  ? -2.806  53.010 208.543 1.00 112.26 ? 166 HIS B H      1 
ATOM   3870  H  HA     . HIS B 2 88  ? -4.842  54.461 209.164 1.00 109.22 ? 166 HIS B HA     1 
ATOM   3871  H  HB2    . HIS B 2 88  ? -4.652  53.506 207.055 1.00 114.81 ? 166 HIS B HB2    1 
ATOM   3872  H  HB3    . HIS B 2 88  ? -4.863  52.061 207.678 1.00 114.81 ? 166 HIS B HB3    1 
ATOM   3873  H  HD2    . HIS B 2 88  ? -7.486  51.341 207.960 1.00 99.16  ? 166 HIS B HD2    1 
ATOM   3874  H  HE1    . HIS B 2 88  ? -9.097  54.767 206.806 1.00 123.40 ? 166 HIS B HE1    1 
ATOM   3875  H  HE2    . HIS B 2 88  ? -9.531  52.519 207.400 1.00 106.41 ? 166 HIS B HE2    1 
ATOM   3876  N  N      . LEU B 2 89  ? -5.110  51.498 210.383 1.00 67.56  ? 167 LEU B N      1 
ATOM   3877  C  CA     . LEU B 2 89  ? -5.880  50.679 211.314 1.00 65.78  ? 167 LEU B CA     1 
ATOM   3878  C  C      . LEU B 2 89  ? -5.842  51.255 212.727 1.00 80.33  ? 167 LEU B C      1 
ATOM   3879  O  O      . LEU B 2 89  ? -6.886  51.506 213.343 1.00 70.40  ? 167 LEU B O      1 
ATOM   3880  C  CB     . LEU B 2 89  ? -5.337  49.251 211.289 1.00 89.56  ? 167 LEU B CB     1 
ATOM   3881  C  CG     . LEU B 2 89  ? -6.088  48.205 212.107 1.00 63.40  ? 167 LEU B CG     1 
ATOM   3882  C  CD1    . LEU B 2 89  ? -7.539  48.155 211.728 1.00 42.76  ? 167 LEU B CD1    1 
ATOM   3883  C  CD2    . LEU B 2 89  ? -5.448  46.841 211.902 1.00 105.69 ? 167 LEU B CD2    1 
ATOM   3884  H  H      . LEU B 2 89  ? -4.500  51.068 209.957 1.00 81.07  ? 167 LEU B H      1 
ATOM   3885  H  HA     . LEU B 2 89  ? -6.806  50.654 211.024 1.00 78.93  ? 167 LEU B HA     1 
ATOM   3886  H  HB2    . LEU B 2 89  ? -5.336  48.946 210.368 1.00 107.47 ? 167 LEU B HB2    1 
ATOM   3887  H  HB3    . LEU B 2 89  ? -4.425  49.270 211.619 1.00 107.47 ? 167 LEU B HB3    1 
ATOM   3888  H  HG     . LEU B 2 89  ? -6.027  48.431 213.048 1.00 76.08  ? 167 LEU B HG     1 
ATOM   3889  H  HD11   . LEU B 2 89  ? -7.982  47.481 212.267 1.00 51.31  ? 167 LEU B HD11   1 
ATOM   3890  H  HD12   . LEU B 2 89  ? -7.938  49.024 211.890 1.00 51.31  ? 167 LEU B HD12   1 
ATOM   3891  H  HD13   . LEU B 2 89  ? -7.612  47.927 210.788 1.00 51.31  ? 167 LEU B HD13   1 
ATOM   3892  H  HD21   . LEU B 2 89  ? -5.933  46.184 212.426 1.00 126.83 ? 167 LEU B HD21   1 
ATOM   3893  H  HD22   . LEU B 2 89  ? -5.491  46.611 210.961 1.00 126.83 ? 167 LEU B HD22   1 
ATOM   3894  H  HD23   . LEU B 2 89  ? -4.524  46.880 212.193 1.00 126.83 ? 167 LEU B HD23   1 
ATOM   3895  N  N      . ILE B 2 90  ? -4.636  51.449 213.266 1.00 80.54  ? 168 ILE B N      1 
ATOM   3896  C  CA     . ILE B 2 90  ? -4.488  52.081 214.576 1.00 70.36  ? 168 ILE B CA     1 
ATOM   3897  C  C      . ILE B 2 90  ? -5.264  53.386 214.610 1.00 82.19  ? 168 ILE B C      1 
ATOM   3898  O  O      . ILE B 2 90  ? -5.993  53.677 215.566 1.00 112.24 ? 168 ILE B O      1 
ATOM   3899  C  CB     . ILE B 2 90  ? -3.001  52.319 214.894 1.00 56.72  ? 168 ILE B CB     1 
ATOM   3900  C  CG1    . ILE B 2 90  ? -2.207  51.011 214.813 1.00 67.62  ? 168 ILE B CG1    1 
ATOM   3901  C  CG2    . ILE B 2 90  ? -2.843  52.979 216.268 1.00 47.26  ? 168 ILE B CG2    1 
ATOM   3902  C  CD1    . ILE B 2 90  ? -2.620  49.963 215.812 1.00 87.82  ? 168 ILE B CD1    1 
ATOM   3903  H  H      . ILE B 2 90  ? -3.893  51.225 212.896 1.00 96.65  ? 168 ILE B H      1 
ATOM   3904  H  HA     . ILE B 2 90  ? -4.853  51.494 215.257 1.00 84.44  ? 168 ILE B HA     1 
ATOM   3905  H  HB     . ILE B 2 90  ? -2.645  52.927 214.227 1.00 68.06  ? 168 ILE B HB     1 
ATOM   3906  H  HG12   . ILE B 2 90  ? -2.321  50.634 213.927 1.00 81.14  ? 168 ILE B HG12   1 
ATOM   3907  H  HG13   . ILE B 2 90  ? -1.270  51.209 214.965 1.00 81.14  ? 168 ILE B HG13   1 
ATOM   3908  H  HG21   . ILE B 2 90  ? -1.899  53.118 216.445 1.00 56.72  ? 168 ILE B HG21   1 
ATOM   3909  H  HG22   . ILE B 2 90  ? -3.307  53.831 216.264 1.00 56.72  ? 168 ILE B HG22   1 
ATOM   3910  H  HG23   . ILE B 2 90  ? -3.224  52.397 216.944 1.00 56.72  ? 168 ILE B HG23   1 
ATOM   3911  H  HD11   . ILE B 2 90  ? -2.068  49.175 215.688 1.00 105.38 ? 168 ILE B HD11   1 
ATOM   3912  H  HD12   . ILE B 2 90  ? -2.499  50.315 216.707 1.00 105.38 ? 168 ILE B HD12   1 
ATOM   3913  H  HD13   . ILE B 2 90  ? -3.553  49.740 215.667 1.00 105.38 ? 168 ILE B HD13   1 
ATOM   3914  N  N      . LEU B 2 91  ? -5.114  54.194 213.560 1.00 81.38  ? 169 LEU B N      1 
ATOM   3915  C  CA     . LEU B 2 91  ? -5.812  55.470 213.506 1.00 72.93  ? 169 LEU B CA     1 
ATOM   3916  C  C      . LEU B 2 91  ? -7.323  55.303 213.561 1.00 73.46  ? 169 LEU B C      1 
ATOM   3917  O  O      . LEU B 2 91  ? -8.024  56.239 213.960 1.00 78.23  ? 169 LEU B O      1 
ATOM   3918  C  CB     . LEU B 2 91  ? -5.412  56.215 212.239 1.00 103.90 ? 169 LEU B CB     1 
ATOM   3919  C  CG     . LEU B 2 91  ? -6.186  57.491 211.921 1.00 71.10  ? 169 LEU B CG     1 
ATOM   3920  C  CD1    . LEU B 2 91  ? -6.096  58.487 213.071 1.00 111.78 ? 169 LEU B CD1    1 
ATOM   3921  C  CD2    . LEU B 2 91  ? -5.635  58.073 210.632 1.00 82.16  ? 169 LEU B CD2    1 
ATOM   3922  H  H      . LEU B 2 91  ? -4.620  54.027 212.876 1.00 97.65  ? 169 LEU B H      1 
ATOM   3923  H  HA     . LEU B 2 91  ? -5.543  56.008 214.268 1.00 87.52  ? 169 LEU B HA     1 
ATOM   3924  H  HB2    . LEU B 2 91  ? -4.476  56.459 212.313 1.00 124.68 ? 169 LEU B HB2    1 
ATOM   3925  H  HB3    . LEU B 2 91  ? -5.528  55.615 211.486 1.00 124.68 ? 169 LEU B HB3    1 
ATOM   3926  H  HG     . LEU B 2 91  ? -7.121  57.272 211.781 1.00 85.33  ? 169 LEU B HG     1 
ATOM   3927  H  HD11   . LEU B 2 91  ? -6.597  59.284 212.838 1.00 134.14 ? 169 LEU B HD11   1 
ATOM   3928  H  HD12   . LEU B 2 91  ? -6.470  58.082 213.869 1.00 134.14 ? 169 LEU B HD12   1 
ATOM   3929  H  HD13   . LEU B 2 91  ? -5.165  58.713 213.220 1.00 134.14 ? 169 LEU B HD13   1 
ATOM   3930  H  HD21   . LEU B 2 91  ? -6.121  58.885 210.420 1.00 98.60  ? 169 LEU B HD21   1 
ATOM   3931  H  HD22   . LEU B 2 91  ? -4.694  58.271 210.753 1.00 98.60  ? 169 LEU B HD22   1 
ATOM   3932  H  HD23   . LEU B 2 91  ? -5.748  57.424 209.920 1.00 98.60  ? 169 LEU B HD23   1 
ATOM   3933  N  N      . GLU B 2 92  ? -7.841  54.141 213.171 1.00 82.66  ? 170 GLU B N      1 
ATOM   3934  C  CA     . GLU B 2 92  ? -9.278  53.901 213.187 1.00 74.32  ? 170 GLU B CA     1 
ATOM   3935  C  C      . GLU B 2 92  ? -9.753  53.377 214.535 1.00 77.98  ? 170 GLU B C      1 
ATOM   3936  O  O      . GLU B 2 92  ? -10.730 53.884 215.092 1.00 61.93  ? 170 GLU B O      1 
ATOM   3937  C  CB     . GLU B 2 92  ? -9.660  52.906 212.084 1.00 56.50  ? 170 GLU B CB     1 
ATOM   3938  C  CG     . GLU B 2 92  ? -9.419  53.406 210.673 1.00 77.17  ? 170 GLU B CG     1 
ATOM   3939  C  CD     . GLU B 2 92  ? -10.441 54.442 210.229 1.00 104.48 ? 170 GLU B CD     1 
ATOM   3940  O  OE1    . GLU B 2 92  ? -10.795 55.332 211.031 1.00 98.22  ? 170 GLU B OE1    1 
ATOM   3941  O  OE2    . GLU B 2 92  ? -10.900 54.361 209.072 1.00 143.04 ? 170 GLU B OE2    1 
ATOM   3942  H  H      . GLU B 2 92  ? -7.377  53.473 212.891 1.00 99.20  ? 170 GLU B H      1 
ATOM   3943  H  HA     . GLU B 2 92  ? -9.739  54.736 213.011 1.00 89.19  ? 170 GLU B HA     1 
ATOM   3944  H  HB2    . GLU B 2 92  ? -9.138  52.097 212.202 1.00 67.80  ? 170 GLU B HB2    1 
ATOM   3945  H  HB3    . GLU B 2 92  ? -10.604 52.701 212.165 1.00 67.80  ? 170 GLU B HB3    1 
ATOM   3946  H  HG2    . GLU B 2 92  ? -8.540  53.814 210.628 1.00 92.60  ? 170 GLU B HG2    1 
ATOM   3947  H  HG3    . GLU B 2 92  ? -9.467  52.656 210.059 1.00 92.60  ? 170 GLU B HG3    1 
ATOM   3948  N  N      . ALA B 2 93  ? -9.074  52.363 215.068 1.00 79.50  ? 171 ALA B N      1 
ATOM   3949  C  CA     . ALA B 2 93  ? -9.566  51.707 216.272 1.00 77.12  ? 171 ALA B CA     1 
ATOM   3950  C  C      . ALA B 2 93  ? -9.354  52.560 217.516 1.00 78.05  ? 171 ALA B C      1 
ATOM   3951  O  O      . ALA B 2 93  ? -10.141 52.467 218.466 1.00 56.78  ? 171 ALA B O      1 
ATOM   3952  C  CB     . ALA B 2 93  ? -8.883  50.348 216.439 1.00 75.57  ? 171 ALA B CB     1 
ATOM   3953  H  H      . ALA B 2 93  ? -8.339  52.041 214.756 1.00 95.40  ? 171 ALA B H      1 
ATOM   3954  H  HA     . ALA B 2 93  ? -10.519 51.552 216.177 1.00 92.54  ? 171 ALA B HA     1 
ATOM   3955  H  HB1    . ALA B 2 93  ? -9.219  49.923 217.244 1.00 90.68  ? 171 ALA B HB1    1 
ATOM   3956  H  HB2    . ALA B 2 93  ? -9.082  49.798 215.666 1.00 90.68  ? 171 ALA B HB2    1 
ATOM   3957  H  HB3    . ALA B 2 93  ? -7.925  50.483 216.511 1.00 90.68  ? 171 ALA B HB3    1 
ATOM   3958  N  N      . ALA B 2 94  ? -8.319  53.401 217.527 1.00 83.31  ? 172 ALA B N      1 
ATOM   3959  C  CA     . ALA B 2 94  ? -7.893  54.069 218.749 1.00 56.60  ? 172 ALA B CA     1 
ATOM   3960  C  C      . ALA B 2 94  ? -7.592  55.552 218.602 1.00 63.58  ? 172 ALA B C      1 
ATOM   3961  O  O      . ALA B 2 94  ? -7.391  56.217 219.624 1.00 68.10  ? 172 ALA B O      1 
ATOM   3962  C  CB     . ALA B 2 94  ? -6.642  53.383 219.313 1.00 57.78  ? 172 ALA B CB     1 
ATOM   3963  H  H      . ALA B 2 94  ? -7.847  53.600 216.836 1.00 99.97  ? 172 ALA B H      1 
ATOM   3964  H  HA     . ALA B 2 94  ? -8.598  53.979 219.409 1.00 67.93  ? 172 ALA B HA     1 
ATOM   3965  H  HB1    . ALA B 2 94  ? -6.372  53.840 220.126 1.00 69.34  ? 172 ALA B HB1    1 
ATOM   3966  H  HB2    . ALA B 2 94  ? -6.851  52.456 219.508 1.00 69.34  ? 172 ALA B HB2    1 
ATOM   3967  H  HB3    . ALA B 2 94  ? -5.932  53.432 218.654 1.00 69.34  ? 172 ALA B HB3    1 
ATOM   3968  N  N      . ASP B 2 95  ? -7.542  56.094 217.388 1.00 59.38  ? 173 ASP B N      1 
ATOM   3969  C  CA     . ASP B 2 95  ? -7.166  57.491 217.189 1.00 79.82  ? 173 ASP B CA     1 
ATOM   3970  C  C      . ASP B 2 95  ? -5.748  57.735 217.697 1.00 90.55  ? 173 ASP B C      1 
ATOM   3971  O  O      . ASP B 2 95  ? -5.483  58.680 218.444 1.00 67.92  ? 173 ASP B O      1 
ATOM   3972  C  CB     . ASP B 2 95  ? -8.160  58.436 217.871 1.00 54.68  ? 173 ASP B CB     1 
ATOM   3973  C  CG     . ASP B 2 95  ? -9.589  58.163 217.461 1.00 102.97 ? 173 ASP B CG     1 
ATOM   3974  O  OD1    . ASP B 2 95  ? -9.778  57.623 216.355 1.00 125.79 ? 173 ASP B OD1    1 
ATOM   3975  O  OD2    . ASP B 2 95  ? -10.514 58.480 218.235 1.00 94.14  ? 173 ASP B OD2    1 
ATOM   3976  H  H      . ASP B 2 95  ? -7.723  55.672 216.660 1.00 71.26  ? 173 ASP B H      1 
ATOM   3977  H  HA     . ASP B 2 95  ? -7.178  57.685 216.238 1.00 95.78  ? 173 ASP B HA     1 
ATOM   3978  H  HB2    . ASP B 2 95  ? -8.095  58.322 218.833 1.00 65.61  ? 173 ASP B HB2    1 
ATOM   3979  H  HB3    . ASP B 2 95  ? -7.946  59.350 217.629 1.00 65.61  ? 173 ASP B HB3    1 
ATOM   3980  N  N      . GLY B 2 96  ? -4.835  56.860 217.296 1.00 76.08  ? 174 GLY B N      1 
ATOM   3981  C  CA     . GLY B 2 96  ? -3.438  56.944 217.694 1.00 85.55  ? 174 GLY B CA     1 
ATOM   3982  C  C      . GLY B 2 96  ? -2.575  57.397 216.530 1.00 91.14  ? 174 GLY B C      1 
ATOM   3983  O  O      . GLY B 2 96  ? -2.806  57.000 215.384 1.00 84.72  ? 174 GLY B O      1 
ATOM   3984  H  H      . GLY B 2 96  ? -5.005  56.193 216.780 1.00 91.29  ? 174 GLY B H      1 
ATOM   3985  H  HA2    . GLY B 2 96  ? -3.341  57.578 218.421 1.00 102.65 ? 174 GLY B HA2    1 
ATOM   3986  H  HA3    . GLY B 2 96  ? -3.129  56.074 217.993 1.00 102.65 ? 174 GLY B HA3    1 
ATOM   3987  N  N      . PHE B 2 97  ? -1.580  58.231 216.835 1.00 72.87  ? 175 PHE B N      1 
ATOM   3988  C  CA     . PHE B 2 97  ? -0.590  58.654 215.858 1.00 53.63  ? 175 PHE B CA     1 
ATOM   3989  C  C      . PHE B 2 97  ? 0.799   58.356 216.397 1.00 58.40  ? 175 PHE B C      1 
ATOM   3990  O  O      . PHE B 2 97  ? 1.027   58.378 217.608 1.00 82.40  ? 175 PHE B O      1 
ATOM   3991  C  CB     . PHE B 2 97  ? -0.707  60.145 215.533 1.00 63.11  ? 175 PHE B CB     1 
ATOM   3992  C  CG     . PHE B 2 97  ? -0.469  61.039 216.713 1.00 102.65 ? 175 PHE B CG     1 
ATOM   3993  C  CD1    . PHE B 2 97  ? 0.804   61.498 217.008 1.00 99.93  ? 175 PHE B CD1    1 
ATOM   3994  C  CD2    . PHE B 2 97  ? -1.519  61.417 217.530 1.00 79.26  ? 175 PHE B CD2    1 
ATOM   3995  C  CE1    . PHE B 2 97  ? 1.024   62.320 218.093 1.00 90.84  ? 175 PHE B CE1    1 
ATOM   3996  C  CE2    . PHE B 2 97  ? -1.307  62.237 218.615 1.00 68.27  ? 175 PHE B CE2    1 
ATOM   3997  C  CZ     . PHE B 2 97  ? -0.034  62.689 218.898 1.00 100.10 ? 175 PHE B CZ     1 
ATOM   3998  H  H      . PHE B 2 97  ? -1.460  58.569 217.617 1.00 87.44  ? 175 PHE B H      1 
ATOM   3999  H  HA     . PHE B 2 97  ? -0.714  58.152 215.037 1.00 64.35  ? 175 PHE B HA     1 
ATOM   4000  H  HB2    . PHE B 2 97  ? -0.051  60.369 214.854 1.00 75.73  ? 175 PHE B HB2    1 
ATOM   4001  H  HB3    . PHE B 2 97  ? -1.600  60.324 215.200 1.00 75.73  ? 175 PHE B HB3    1 
ATOM   4002  H  HD1    . PHE B 2 97  ? 1.518   61.250 216.466 1.00 119.92 ? 175 PHE B HD1    1 
ATOM   4003  H  HD2    . PHE B 2 97  ? -2.379  61.115 217.343 1.00 95.11  ? 175 PHE B HD2    1 
ATOM   4004  H  HE1    . PHE B 2 97  ? 1.882   62.624 218.283 1.00 109.00 ? 175 PHE B HE1    1 
ATOM   4005  H  HE2    . PHE B 2 97  ? -2.020  62.486 219.157 1.00 81.92  ? 175 PHE B HE2    1 
ATOM   4006  H  HZ     . PHE B 2 97  ? 0.110   63.243 219.631 1.00 120.12 ? 175 PHE B HZ     1 
ATOM   4007  N  N      . LEU B 2 98  ? 1.724   58.070 215.489 1.00 55.64  ? 176 LEU B N      1 
ATOM   4008  C  CA     . LEU B 2 98  ? 3.100   57.784 215.864 1.00 70.47  ? 176 LEU B CA     1 
ATOM   4009  C  C      . LEU B 2 98  ? 3.910   59.068 215.947 1.00 75.60  ? 176 LEU B C      1 
ATOM   4010  O  O      . LEU B 2 98  ? 3.658   60.035 215.225 1.00 74.37  ? 176 LEU B O      1 
ATOM   4011  C  CB     . LEU B 2 98  ? 3.765   56.842 214.861 1.00 76.85  ? 176 LEU B CB     1 
ATOM   4012  C  CG     . LEU B 2 98  ? 5.247   56.546 215.125 1.00 76.09  ? 176 LEU B CG     1 
ATOM   4013  C  CD1    . LEU B 2 98  ? 5.405   55.661 216.353 1.00 86.23  ? 176 LEU B CD1    1 
ATOM   4014  C  CD2    . LEU B 2 98  ? 5.904   55.923 213.922 1.00 96.79  ? 176 LEU B CD2    1 
ATOM   4015  H  H      . LEU B 2 98  ? 1.577   58.035 214.642 1.00 66.77  ? 176 LEU B H      1 
ATOM   4016  H  HA     . LEU B 2 98  ? 3.113   57.359 216.736 1.00 84.56  ? 176 LEU B HA     1 
ATOM   4017  H  HB2    . LEU B 2 98  ? 3.292   55.996 214.873 1.00 92.22  ? 176 LEU B HB2    1 
ATOM   4018  H  HB3    . LEU B 2 98  ? 3.700   57.238 213.977 1.00 92.22  ? 176 LEU B HB3    1 
ATOM   4019  H  HG     . LEU B 2 98  ? 5.702   57.383 215.307 1.00 91.30  ? 176 LEU B HG     1 
ATOM   4020  H  HD11   . LEU B 2 98  ? 6.349   55.489 216.498 1.00 103.48 ? 176 LEU B HD11   1 
ATOM   4021  H  HD12   . LEU B 2 98  ? 5.030   56.119 217.121 1.00 103.48 ? 176 LEU B HD12   1 
ATOM   4022  H  HD13   . LEU B 2 98  ? 4.935   54.826 216.202 1.00 103.48 ? 176 LEU B HD13   1 
ATOM   4023  H  HD21   . LEU B 2 98  ? 6.837   55.750 214.126 1.00 116.15 ? 176 LEU B HD21   1 
ATOM   4024  H  HD22   . LEU B 2 98  ? 5.452   55.091 213.711 1.00 116.15 ? 176 LEU B HD22   1 
ATOM   4025  H  HD23   . LEU B 2 98  ? 5.837   56.536 213.173 1.00 116.15 ? 176 LEU B HD23   1 
ATOM   4026  N  N      . PHE B 2 99  ? 4.891   59.065 216.845 1.00 80.29  ? 177 PHE B N      1 
ATOM   4027  C  CA     . PHE B 2 99  ? 5.889   60.120 216.876 1.00 87.36  ? 177 PHE B CA     1 
ATOM   4028  C  C      . PHE B 2 99  ? 7.158   59.588 217.527 1.00 85.73  ? 177 PHE B C      1 
ATOM   4029  O  O      . PHE B 2 99  ? 7.101   58.797 218.478 1.00 76.66  ? 177 PHE B O      1 
ATOM   4030  C  CB     . PHE B 2 99  ? 5.379   61.369 217.610 1.00 93.93  ? 177 PHE B CB     1 
ATOM   4031  C  CG     . PHE B 2 99  ? 5.084   61.153 219.064 1.00 72.53  ? 177 PHE B CG     1 
ATOM   4032  C  CD1    . PHE B 2 99  ? 3.899   60.565 219.464 1.00 75.46  ? 177 PHE B CD1    1 
ATOM   4033  C  CD2    . PHE B 2 99  ? 5.981   61.564 220.030 1.00 81.36  ? 177 PHE B CD2    1 
ATOM   4034  C  CE1    . PHE B 2 99  ? 3.622   60.376 220.804 1.00 77.93  ? 177 PHE B CE1    1 
ATOM   4035  C  CE2    . PHE B 2 99  ? 5.711   61.378 221.369 1.00 78.91  ? 177 PHE B CE2    1 
ATOM   4036  C  CZ     . PHE B 2 99  ? 4.528   60.783 221.757 1.00 76.67  ? 177 PHE B CZ     1 
ATOM   4037  H  H      . PHE B 2 99  ? 4.999   58.460 217.448 1.00 96.35  ? 177 PHE B H      1 
ATOM   4038  H  HA     . PHE B 2 99  ? 6.105   60.375 215.965 1.00 104.83 ? 177 PHE B HA     1 
ATOM   4039  H  HB2    . PHE B 2 99  ? 6.054   62.063 217.546 1.00 112.72 ? 177 PHE B HB2    1 
ATOM   4040  H  HB3    . PHE B 2 99  ? 4.561   61.667 217.184 1.00 112.72 ? 177 PHE B HB3    1 
ATOM   4041  H  HD1    . PHE B 2 99  ? 3.285   60.287 218.824 1.00 90.55  ? 177 PHE B HD1    1 
ATOM   4042  H  HD2    . PHE B 2 99  ? 6.780   61.965 219.774 1.00 97.63  ? 177 PHE B HD2    1 
ATOM   4043  H  HE1    . PHE B 2 99  ? 2.824   59.974 221.061 1.00 93.51  ? 177 PHE B HE1    1 
ATOM   4044  H  HE2    . PHE B 2 99  ? 6.325   61.655 222.010 1.00 94.70  ? 177 PHE B HE2    1 
ATOM   4045  H  HZ     . PHE B 2 99  ? 4.344   60.657 222.660 1.00 92.00  ? 177 PHE B HZ     1 
ATOM   4046  N  N      . ILE B 2 100 ? 8.293   60.006 216.972 1.00 84.92  ? 178 ILE B N      1 
ATOM   4047  C  CA     . ILE B 2 100 ? 9.616   59.732 217.518 1.00 84.63  ? 178 ILE B CA     1 
ATOM   4048  C  C      . ILE B 2 100 ? 10.226  61.074 217.888 1.00 107.38 ? 178 ILE B C      1 
ATOM   4049  O  O      . ILE B 2 100 ? 10.304  61.976 217.043 1.00 118.60 ? 178 ILE B O      1 
ATOM   4050  C  CB     . ILE B 2 100 ? 10.512  58.983 216.517 1.00 94.58  ? 178 ILE B CB     1 
ATOM   4051  C  CG1    . ILE B 2 100 ? 9.937   57.604 216.194 1.00 102.54 ? 178 ILE B CG1    1 
ATOM   4052  C  CG2    . ILE B 2 100 ? 11.928  58.826 217.066 1.00 124.39 ? 178 ILE B CG2    1 
ATOM   4053  C  CD1    . ILE B 2 100 ? 8.904   57.601 215.095 1.00 125.36 ? 178 ILE B CD1    1 
ATOM   4054  H  H      . ILE B 2 100 ? 8.321   60.469 216.248 1.00 101.90 ? 178 ILE B H      1 
ATOM   4055  H  HA     . ILE B 2 100 ? 9.533   59.195 218.322 1.00 101.56 ? 178 ILE B HA     1 
ATOM   4056  H  HB     . ILE B 2 100 ? 10.555  59.499 215.697 1.00 113.49 ? 178 ILE B HB     1 
ATOM   4057  H  HG12   . ILE B 2 100 ? 10.663  57.022 215.918 1.00 123.04 ? 178 ILE B HG12   1 
ATOM   4058  H  HG13   . ILE B 2 100 ? 9.518   57.248 216.993 1.00 123.04 ? 178 ILE B HG13   1 
ATOM   4059  H  HG21   . ILE B 2 100 ? 12.468  58.352 216.415 1.00 149.27 ? 178 ILE B HG21   1 
ATOM   4060  H  HG22   . ILE B 2 100 ? 12.302  59.706 217.230 1.00 149.27 ? 178 ILE B HG22   1 
ATOM   4061  H  HG23   . ILE B 2 100 ? 11.891  58.323 217.895 1.00 149.27 ? 178 ILE B HG23   1 
ATOM   4062  H  HD11   . ILE B 2 100 ? 8.594   56.693 214.956 1.00 150.44 ? 178 ILE B HD11   1 
ATOM   4063  H  HD12   . ILE B 2 100 ? 8.162   58.167 215.359 1.00 150.44 ? 178 ILE B HD12   1 
ATOM   4064  H  HD13   . ILE B 2 100 ? 9.308   57.942 214.282 1.00 150.44 ? 178 ILE B HD13   1 
ATOM   4065  N  N      . VAL B 2 101 ? 10.653  61.209 219.146 1.00 121.33 ? 179 VAL B N      1 
ATOM   4066  C  CA     . VAL B 2 101 ? 11.271  62.437 219.627 1.00 110.30 ? 179 VAL B CA     1 
ATOM   4067  C  C      . VAL B 2 101 ? 12.619  62.089 220.244 1.00 110.06 ? 179 VAL B C      1 
ATOM   4068  O  O      . VAL B 2 101 ? 12.869  60.950 220.636 1.00 120.94 ? 179 VAL B O      1 
ATOM   4069  C  CB     . VAL B 2 101 ? 10.372  63.171 220.640 1.00 115.22 ? 179 VAL B CB     1 
ATOM   4070  C  CG1    . VAL B 2 101 ? 9.054   63.552 219.980 1.00 132.55 ? 179 VAL B CG1    1 
ATOM   4071  C  CG2    . VAL B 2 101 ? 10.120  62.299 221.859 1.00 106.52 ? 179 VAL B CG2    1 
ATOM   4072  H  H      . VAL B 2 101 ? 10.594  60.593 219.743 1.00 145.60 ? 179 VAL B H      1 
ATOM   4073  H  HA     . VAL B 2 101 ? 11.427  63.031 218.876 1.00 132.36 ? 179 VAL B HA     1 
ATOM   4074  H  HB     . VAL B 2 101 ? 10.814  63.984 220.932 1.00 138.26 ? 179 VAL B HB     1 
ATOM   4075  H  HG11   . VAL B 2 101 ? 8.499   64.013 220.628 1.00 159.06 ? 179 VAL B HG11   1 
ATOM   4076  H  HG12   . VAL B 2 101 ? 9.236   64.134 219.226 1.00 159.06 ? 179 VAL B HG12   1 
ATOM   4077  H  HG13   . VAL B 2 101 ? 8.609   62.746 219.677 1.00 159.06 ? 179 VAL B HG13   1 
ATOM   4078  H  HG21   . VAL B 2 101 ? 9.553   62.782 222.481 1.00 127.82 ? 179 VAL B HG21   1 
ATOM   4079  H  HG22   . VAL B 2 101 ? 9.681   61.482 221.577 1.00 127.82 ? 179 VAL B HG22   1 
ATOM   4080  H  HG23   . VAL B 2 101 ? 10.969  62.090 222.279 1.00 127.82 ? 179 VAL B HG23   1 
ATOM   4081  N  N      . SER B 2 102 ? 13.499  63.085 220.316 1.00 109.03 ? 180 SER B N      1 
ATOM   4082  C  CA     . SER B 2 102 ? 14.857  62.851 220.791 1.00 116.01 ? 180 SER B CA     1 
ATOM   4083  C  C      . SER B 2 102 ? 14.868  62.761 222.314 1.00 116.66 ? 180 SER B C      1 
ATOM   4084  O  O      . SER B 2 102 ? 14.263  63.589 223.003 1.00 118.53 ? 180 SER B O      1 
ATOM   4085  C  CB     . SER B 2 102 ? 15.798  63.951 220.303 1.00 142.06 ? 180 SER B CB     1 
ATOM   4086  O  OG     . SER B 2 102 ? 16.894  63.386 219.602 1.00 157.33 ? 180 SER B OG     1 
ATOM   4087  H  H      . SER B 2 102 ? 13.335  63.900 220.097 1.00 130.83 ? 180 SER B H      1 
ATOM   4088  H  HA     . SER B 2 102 ? 15.175  62.005 220.438 1.00 139.22 ? 180 SER B HA     1 
ATOM   4089  H  HB2    . SER B 2 102 ? 15.312  64.544 219.709 1.00 170.47 ? 180 SER B HB2    1 
ATOM   4090  H  HB3    . SER B 2 102 ? 16.131  64.446 221.068 1.00 170.47 ? 180 SER B HB3    1 
ATOM   4091  H  HG     . SER B 2 102 ? 17.409  63.993 219.335 1.00 188.80 ? 180 SER B HG     1 
ATOM   4092  N  N      . CYS B 2 103 ? 15.572  61.752 222.836 1.00 131.17 ? 181 CYS B N      1 
ATOM   4093  C  CA     . CYS B 2 103 ? 15.360  61.308 224.210 1.00 121.38 ? 181 CYS B CA     1 
ATOM   4094  C  C      . CYS B 2 103 ? 15.701  62.351 225.260 1.00 125.47 ? 181 CYS B C      1 
ATOM   4095  O  O      . CYS B 2 103 ? 15.332  62.166 226.422 1.00 137.33 ? 181 CYS B O      1 
ATOM   4096  C  CB     . CYS B 2 103 ? 16.179  60.056 224.502 1.00 134.80 ? 181 CYS B CB     1 
ATOM   4097  S  SG     . CYS B 2 103 ? 15.218  58.535 224.378 1.00 159.52 ? 181 CYS B SG     1 
ATOM   4098  H  H      . CYS B 2 103 ? 16.176  61.311 222.412 1.00 157.40 ? 181 CYS B H      1 
ATOM   4099  H  HA     . CYS B 2 103 ? 14.424  61.079 224.319 1.00 145.65 ? 181 CYS B HA     1 
ATOM   4100  H  HB2    . CYS B 2 103 ? 16.908  60.001 223.865 1.00 161.76 ? 181 CYS B HB2    1 
ATOM   4101  H  HB3    . CYS B 2 103 ? 16.531  60.114 225.404 1.00 161.76 ? 181 CYS B HB3    1 
ATOM   4102  H  HG     . CYS B 2 103 ? 15.931  57.601 224.624 1.00 191.42 ? 181 CYS B HG     1 
ATOM   4103  N  N      . GLU B 2 104 ? 16.431  63.405 224.909 1.00 141.35 ? 182 GLU B N      1 
ATOM   4104  C  CA     . GLU B 2 104 ? 16.718  64.461 225.875 1.00 151.23 ? 182 GLU B CA     1 
ATOM   4105  C  C      . GLU B 2 104 ? 16.313  65.816 225.321 1.00 159.59 ? 182 GLU B C      1 
ATOM   4106  O  O      . GLU B 2 104 ? 15.291  66.366 225.741 1.00 174.97 ? 182 GLU B O      1 
ATOM   4107  C  CB     . GLU B 2 104 ? 18.198  64.467 226.272 1.00 170.98 ? 182 GLU B CB     1 
ATOM   4108  C  CG     . GLU B 2 104 ? 18.617  65.669 227.133 1.00 172.74 ? 182 GLU B CG     1 
ATOM   4109  C  CD     . GLU B 2 104 ? 17.864  65.757 228.456 1.00 175.85 ? 182 GLU B CD     1 
ATOM   4110  O  OE1    . GLU B 2 104 ? 16.869  65.021 228.657 1.00 159.56 ? 182 GLU B OE1    1 
ATOM   4111  O  OE2    . GLU B 2 104 ? 18.275  66.571 229.310 1.00 162.76 ? 182 GLU B OE2    1 
ATOM   4112  H  H      . GLU B 2 104 ? 16.769  63.533 224.129 1.00 169.63 ? 182 GLU B H      1 
ATOM   4113  H  HA     . GLU B 2 104 ? 16.196  64.301 226.677 1.00 181.48 ? 182 GLU B HA     1 
ATOM   4114  H  HB2    . GLU B 2 104 ? 18.387  63.661 226.779 1.00 205.18 ? 182 GLU B HB2    1 
ATOM   4115  H  HB3    . GLU B 2 104 ? 18.736  64.480 225.466 1.00 205.18 ? 182 GLU B HB3    1 
ATOM   4116  H  HG2    . GLU B 2 104 ? 19.563  65.597 227.333 1.00 207.29 ? 182 GLU B HG2    1 
ATOM   4117  H  HG3    . GLU B 2 104 ? 18.445  66.485 226.637 1.00 207.29 ? 182 GLU B HG3    1 
ATOM   4118  N  N      . THR B 2 105 ? 17.113  66.391 224.425 1.00 146.85 ? 183 THR B N      1 
ATOM   4119  C  CA     . THR B 2 105 ? 16.691  67.624 223.785 1.00 149.35 ? 183 THR B CA     1 
ATOM   4120  C  C      . THR B 2 105 ? 15.286  67.467 223.242 1.00 130.47 ? 183 THR B C      1 
ATOM   4121  O  O      . THR B 2 105 ? 15.007  66.549 222.467 1.00 134.60 ? 183 THR B O      1 
ATOM   4122  C  CB     . THR B 2 105 ? 17.644  67.998 222.661 1.00 153.01 ? 183 THR B CB     1 
ATOM   4123  O  OG1    . THR B 2 105 ? 18.943  68.224 223.218 1.00 190.25 ? 183 THR B OG1    1 
ATOM   4124  C  CG2    . THR B 2 105 ? 17.165  69.265 221.959 1.00 134.10 ? 183 THR B CG2    1 
ATOM   4125  H  H      . THR B 2 105 ? 17.881  66.094 224.179 1.00 176.22 ? 183 THR B H      1 
ATOM   4126  H  HA     . THR B 2 105 ? 16.689  68.342 224.438 1.00 179.22 ? 183 THR B HA     1 
ATOM   4127  H  HB     . THR B 2 105 ? 17.685  67.278 222.012 1.00 183.61 ? 183 THR B HB     1 
ATOM   4128  H  HG1    . THR B 2 105 ? 19.485  68.432 222.610 1.00 228.30 ? 183 THR B HG1    1 
ATOM   4129  H  HG21   . THR B 2 105 ? 17.776  69.499 221.243 1.00 160.92 ? 183 THR B HG21   1 
ATOM   4130  H  HG22   . THR B 2 105 ? 16.281  69.123 221.586 1.00 160.92 ? 183 THR B HG22   1 
ATOM   4131  H  HG23   . THR B 2 105 ? 17.125  69.999 222.592 1.00 160.92 ? 183 THR B HG23   1 
ATOM   4132  N  N      . GLY B 2 106 ? 14.393  68.346 223.671 1.00 126.34 ? 184 GLY B N      1 
ATOM   4133  C  CA     . GLY B 2 106 ? 13.057  68.257 223.148 1.00 130.16 ? 184 GLY B CA     1 
ATOM   4134  C  C      . GLY B 2 106 ? 13.123  68.464 221.654 1.00 122.62 ? 184 GLY B C      1 
ATOM   4135  O  O      . GLY B 2 106 ? 12.907  69.582 221.186 1.00 137.90 ? 184 GLY B O      1 
ATOM   4136  H  H      . GLY B 2 106 ? 14.533  68.975 224.240 1.00 151.61 ? 184 GLY B H      1 
ATOM   4137  H  HA2    . GLY B 2 106 ? 12.679  67.383 223.335 1.00 156.19 ? 184 GLY B HA2    1 
ATOM   4138  H  HA3    . GLY B 2 106 ? 12.494  68.942 223.543 1.00 156.19 ? 184 GLY B HA3    1 
ATOM   4139  N  N      . ARG B 2 107 ? 13.474  67.438 220.883 1.00 122.47 ? 185 ARG B N      1 
ATOM   4140  C  CA     . ARG B 2 107 ? 13.494  67.574 219.435 1.00 117.00 ? 185 ARG B CA     1 
ATOM   4141  C  C      . ARG B 2 107 ? 12.642  66.472 218.829 1.00 117.53 ? 185 ARG B C      1 
ATOM   4142  O  O      . ARG B 2 107 ? 12.908  65.283 219.045 1.00 140.45 ? 185 ARG B O      1 
ATOM   4143  C  CB     . ARG B 2 107 ? 14.920  67.536 218.886 1.00 122.56 ? 185 ARG B CB     1 
ATOM   4144  C  CG     . ARG B 2 107 ? 15.036  68.165 217.509 1.00 141.10 ? 185 ARG B CG     1 
ATOM   4145  C  CD     . ARG B 2 107 ? 16.476  68.249 217.048 1.00 167.37 ? 185 ARG B CD     1 
ATOM   4146  N  NE     . ARG B 2 107 ? 17.107  66.933 217.001 1.00 188.76 ? 185 ARG B NE     1 
ATOM   4147  C  CZ     . ARG B 2 107 ? 16.916  66.042 216.033 1.00 159.03 ? 185 ARG B CZ     1 
ATOM   4148  N  NH1    . ARG B 2 107 ? 16.100  66.313 215.023 1.00 145.35 ? 185 ARG B NH1    1 
ATOM   4149  N  NH2    . ARG B 2 107 ? 17.538  64.871 216.079 1.00 135.79 ? 185 ARG B NH2    1 
ATOM   4150  H  H      . ARG B 2 107 ? 13.703  66.661 221.173 1.00 146.97 ? 185 ARG B H      1 
ATOM   4151  H  HA     . ARG B 2 107 ? 13.101  68.426 219.192 1.00 140.39 ? 185 ARG B HA     1 
ATOM   4152  H  HB2    . ARG B 2 107 ? 15.504  68.024 219.489 1.00 147.07 ? 185 ARG B HB2    1 
ATOM   4153  H  HB3    . ARG B 2 107 ? 15.209  66.613 218.820 1.00 147.07 ? 185 ARG B HB3    1 
ATOM   4154  H  HG2    . ARG B 2 107 ? 14.544  67.626 216.870 1.00 169.32 ? 185 ARG B HG2    1 
ATOM   4155  H  HG3    . ARG B 2 107 ? 14.674  69.064 217.538 1.00 169.32 ? 185 ARG B HG3    1 
ATOM   4156  H  HD2    . ARG B 2 107 ? 16.505  68.631 216.157 1.00 200.85 ? 185 ARG B HD2    1 
ATOM   4157  H  HD3    . ARG B 2 107 ? 16.978  68.803 217.667 1.00 200.85 ? 185 ARG B HD3    1 
ATOM   4158  H  HE     . ARG B 2 107 ? 17.639  66.720 217.643 1.00 226.52 ? 185 ARG B HE     1 
ATOM   4159  H  HH11   . ARG B 2 107 ? 15.694  67.070 214.989 1.00 174.42 ? 185 ARG B HH11   1 
ATOM   4160  H  HH12   . ARG B 2 107 ? 15.979  65.732 214.400 1.00 174.42 ? 185 ARG B HH12   1 
ATOM   4161  H  HH21   . ARG B 2 107 ? 18.067  64.690 216.733 1.00 162.95 ? 185 ARG B HH21   1 
ATOM   4162  H  HH22   . ARG B 2 107 ? 17.413  64.293 215.455 1.00 162.95 ? 185 ARG B HH22   1 
ATOM   4163  N  N      . VAL B 2 108 ? 11.601  66.869 218.101 1.00 119.81 ? 186 VAL B N      1 
ATOM   4164  C  CA     . VAL B 2 108 ? 10.818  65.899 217.357 1.00 104.09 ? 186 VAL B CA     1 
ATOM   4165  C  C      . VAL B 2 108 ? 11.665  65.317 216.235 1.00 133.20 ? 186 VAL B C      1 
ATOM   4166  O  O      . VAL B 2 108 ? 12.458  66.025 215.599 1.00 141.53 ? 186 VAL B O      1 
ATOM   4167  C  CB     . VAL B 2 108 ? 9.549   66.564 216.809 1.00 93.38  ? 186 VAL B CB     1 
ATOM   4168  C  CG1    . VAL B 2 108 ? 9.921   67.593 215.754 1.00 119.85 ? 186 VAL B CG1    1 
ATOM   4169  C  CG2    . VAL B 2 108 ? 8.601   65.525 216.256 1.00 89.86  ? 186 VAL B CG2    1 
ATOM   4170  H  H      . VAL B 2 108 ? 11.333  67.683 218.024 1.00 143.78 ? 186 VAL B H      1 
ATOM   4171  H  HA     . VAL B 2 108 ? 10.554  65.177 217.948 1.00 124.91 ? 186 VAL B HA     1 
ATOM   4172  H  HB     . VAL B 2 108 ? 9.098   67.026 217.532 1.00 112.05 ? 186 VAL B HB     1 
ATOM   4173  H  HG11   . VAL B 2 108 ? 9.111   68.005 215.416 1.00 143.82 ? 186 VAL B HG11   1 
ATOM   4174  H  HG12   . VAL B 2 108 ? 10.492  68.265 216.157 1.00 143.82 ? 186 VAL B HG12   1 
ATOM   4175  H  HG13   . VAL B 2 108 ? 10.392  67.148 215.032 1.00 143.82 ? 186 VAL B HG13   1 
ATOM   4176  H  HG21   . VAL B 2 108 ? 7.809   65.970 215.917 1.00 107.83 ? 186 VAL B HG21   1 
ATOM   4177  H  HG22   . VAL B 2 108 ? 9.044   65.044 215.539 1.00 107.83 ? 186 VAL B HG22   1 
ATOM   4178  H  HG23   . VAL B 2 108 ? 8.358   64.911 216.966 1.00 107.83 ? 186 VAL B HG23   1 
ATOM   4179  N  N      . VAL B 2 109 ? 11.502  64.019 215.987 1.00 136.70 ? 187 VAL B N      1 
ATOM   4180  C  CA     . VAL B 2 109 ? 12.196  63.336 214.907 1.00 120.68 ? 187 VAL B CA     1 
ATOM   4181  C  C      . VAL B 2 109 ? 11.237  62.920 213.800 1.00 127.80 ? 187 VAL B C      1 
ATOM   4182  O  O      . VAL B 2 109 ? 11.581  62.998 212.618 1.00 114.83 ? 187 VAL B O      1 
ATOM   4183  C  CB     . VAL B 2 109 ? 12.982  62.117 215.439 1.00 110.47 ? 187 VAL B CB     1 
ATOM   4184  C  CG1    . VAL B 2 109 ? 13.790  61.469 214.316 1.00 112.70 ? 187 VAL B CG1    1 
ATOM   4185  C  CG2    . VAL B 2 109 ? 13.896  62.531 216.583 1.00 158.74 ? 187 VAL B CG2    1 
ATOM   4186  H  H      . VAL B 2 109 ? 10.983  63.506 216.442 1.00 164.04 ? 187 VAL B H      1 
ATOM   4187  H  HA     . VAL B 2 109 ? 12.839  63.950 214.519 1.00 144.81 ? 187 VAL B HA     1 
ATOM   4188  H  HB     . VAL B 2 109 ? 12.355  61.459 215.777 1.00 132.57 ? 187 VAL B HB     1 
ATOM   4189  H  HG11   . VAL B 2 109 ? 14.273  60.708 214.674 1.00 135.24 ? 187 VAL B HG11   1 
ATOM   4190  H  HG12   . VAL B 2 109 ? 13.182  61.177 213.618 1.00 135.24 ? 187 VAL B HG12   1 
ATOM   4191  H  HG13   . VAL B 2 109 ? 14.414  62.120 213.960 1.00 135.24 ? 187 VAL B HG13   1 
ATOM   4192  H  HG21   . VAL B 2 109 ? 14.378  61.750 216.899 1.00 190.49 ? 187 VAL B HG21   1 
ATOM   4193  H  HG22   . VAL B 2 109 ? 14.522  63.198 216.261 1.00 190.49 ? 187 VAL B HG22   1 
ATOM   4194  H  HG23   . VAL B 2 109 ? 13.357  62.900 217.299 1.00 190.49 ? 187 VAL B HG23   1 
ATOM   4195  N  N      . TYR B 2 110 ? 10.036  62.470 214.156 1.00 130.06 ? 188 TYR B N      1 
ATOM   4196  C  CA     . TYR B 2 110 ? 9.081   62.045 213.143 1.00 97.80  ? 188 TYR B CA     1 
ATOM   4197  C  C      . TYR B 2 110 ? 7.674   62.096 213.715 1.00 93.15  ? 188 TYR B C      1 
ATOM   4198  O  O      . TYR B 2 110 ? 7.469   61.878 214.912 1.00 107.38 ? 188 TYR B O      1 
ATOM   4199  C  CB     . TYR B 2 110 ? 9.388   60.631 212.641 1.00 115.59 ? 188 TYR B CB     1 
ATOM   4200  C  CG     . TYR B 2 110 ? 8.378   60.121 211.639 1.00 111.81 ? 188 TYR B CG     1 
ATOM   4201  C  CD1    . TYR B 2 110 ? 8.496   60.426 210.292 1.00 121.90 ? 188 TYR B CD1    1 
ATOM   4202  C  CD2    . TYR B 2 110 ? 7.301   59.345 212.044 1.00 98.96  ? 188 TYR B CD2    1 
ATOM   4203  C  CE1    . TYR B 2 110 ? 7.573   59.969 209.372 1.00 127.80 ? 188 TYR B CE1    1 
ATOM   4204  C  CE2    . TYR B 2 110 ? 6.371   58.883 211.135 1.00 98.57  ? 188 TYR B CE2    1 
ATOM   4205  C  CZ     . TYR B 2 110 ? 6.512   59.198 209.802 1.00 97.86  ? 188 TYR B CZ     1 
ATOM   4206  O  OH     . TYR B 2 110 ? 5.588   58.738 208.893 1.00 90.88  ? 188 TYR B OH     1 
ATOM   4207  H  H      . TYR B 2 110 ? 9.755   62.403 214.966 1.00 156.07 ? 188 TYR B H      1 
ATOM   4208  H  HA     . TYR B 2 110 ? 9.125   62.652 212.388 1.00 117.36 ? 188 TYR B HA     1 
ATOM   4209  H  HB2    . TYR B 2 110 ? 10.258  60.631 212.213 1.00 138.71 ? 188 TYR B HB2    1 
ATOM   4210  H  HB3    . TYR B 2 110 ? 9.392   60.023 213.396 1.00 138.71 ? 188 TYR B HB3    1 
ATOM   4211  H  HD1    . TYR B 2 110 ? 9.210   60.947 210.002 1.00 146.28 ? 188 TYR B HD1    1 
ATOM   4212  H  HD2    . TYR B 2 110 ? 7.204   59.132 212.945 1.00 118.75 ? 188 TYR B HD2    1 
ATOM   4213  H  HE1    . TYR B 2 110 ? 7.665   60.180 208.471 1.00 153.37 ? 188 TYR B HE1    1 
ATOM   4214  H  HE2    . TYR B 2 110 ? 5.655   58.362 211.421 1.00 118.28 ? 188 TYR B HE2    1 
ATOM   4215  H  HH     . TYR B 2 110 ? 4.999   58.285 209.286 1.00 109.05 ? 188 TYR B HH     1 
ATOM   4216  N  N      . VAL B 2 111 ? 6.711   62.391 212.840 1.00 104.88 ? 189 VAL B N      1 
ATOM   4217  C  CA     . VAL B 2 111 ? 5.291   62.354 213.180 1.00 93.99  ? 189 VAL B CA     1 
ATOM   4218  C  C      . VAL B 2 111 ? 4.511   61.883 211.960 1.00 75.66  ? 189 VAL B C      1 
ATOM   4219  O  O      . VAL B 2 111 ? 4.588   62.491 210.888 1.00 99.37  ? 189 VAL B O      1 
ATOM   4220  C  CB     . VAL B 2 111 ? 4.782   63.726 213.662 1.00 83.07  ? 189 VAL B CB     1 
ATOM   4221  C  CG1    . VAL B 2 111 ? 5.416   64.096 214.987 1.00 109.03 ? 189 VAL B CG1    1 
ATOM   4222  C  CG2    . VAL B 2 111 ? 5.055   64.811 212.624 1.00 111.22 ? 189 VAL B CG2    1 
ATOM   4223  H  H      . VAL B 2 111 ? 6.861   62.621 212.025 1.00 125.86 ? 189 VAL B H      1 
ATOM   4224  H  HA     . VAL B 2 111 ? 5.152   61.713 213.895 1.00 112.79 ? 189 VAL B HA     1 
ATOM   4225  H  HB     . VAL B 2 111 ? 3.822   63.676 213.794 1.00 99.68  ? 189 VAL B HB     1 
ATOM   4226  H  HG11   . VAL B 2 111 ? 5.079   64.961 215.267 1.00 130.84 ? 189 VAL B HG11   1 
ATOM   4227  H  HG12   . VAL B 2 111 ? 5.186   63.421 215.645 1.00 130.84 ? 189 VAL B HG12   1 
ATOM   4228  H  HG13   . VAL B 2 111 ? 6.379   64.135 214.876 1.00 130.84 ? 189 VAL B HG13   1 
ATOM   4229  H  HG21   . VAL B 2 111 ? 4.722   65.659 212.959 1.00 133.46 ? 189 VAL B HG21   1 
ATOM   4230  H  HG22   . VAL B 2 111 ? 6.011   64.868 212.471 1.00 133.46 ? 189 VAL B HG22   1 
ATOM   4231  H  HG23   . VAL B 2 111 ? 4.600   64.580 211.799 1.00 133.46 ? 189 VAL B HG23   1 
ATOM   4232  N  N      . SER B 2 112 ? 3.758   60.797 212.112 1.00 73.54  ? 190 SER B N      1 
ATOM   4233  C  CA     . SER B 2 112 ? 2.972   60.285 211.003 1.00 97.76  ? 190 SER B CA     1 
ATOM   4234  C  C      . SER B 2 112 ? 1.925   61.313 210.583 1.00 105.61 ? 190 SER B C      1 
ATOM   4235  O  O      . SER B 2 112 ? 1.658   62.294 211.277 1.00 86.21  ? 190 SER B O      1 
ATOM   4236  C  CB     . SER B 2 112 ? 2.290   58.971 211.382 1.00 94.02  ? 190 SER B CB     1 
ATOM   4237  O  OG     . SER B 2 112 ? 1.225   59.188 212.292 1.00 100.38 ? 190 SER B OG     1 
ATOM   4238  H  H      . SER B 2 112 ? 3.687   60.345 212.840 1.00 88.25  ? 190 SER B H      1 
ATOM   4239  H  HA     . SER B 2 112 ? 3.556   60.118 210.246 1.00 117.31 ? 190 SER B HA     1 
ATOM   4240  H  HB2    . SER B 2 112 ? 1.937   58.556 210.579 1.00 112.83 ? 190 SER B HB2    1 
ATOM   4241  H  HB3    . SER B 2 112 ? 2.943   58.385 211.796 1.00 112.83 ? 190 SER B HB3    1 
ATOM   4242  H  HG     . SER B 2 112 ? 0.862   58.457 212.490 1.00 120.46 ? 190 SER B HG     1 
ATOM   4243  N  N      . ASP B 2 113 ? 1.328   61.077 209.416 1.00 104.79 ? 191 ASP B N      1 
ATOM   4244  C  CA     . ASP B 2 113 ? 0.231   61.924 208.968 1.00 82.58  ? 191 ASP B CA     1 
ATOM   4245  C  C      . ASP B 2 113 ? -1.047  61.699 209.768 1.00 103.58 ? 191 ASP B C      1 
ATOM   4246  O  O      . ASP B 2 113 ? -2.038  62.391 209.514 1.00 127.43 ? 191 ASP B O      1 
ATOM   4247  C  CB     . ASP B 2 113 ? -0.040  61.686 207.481 1.00 101.94 ? 191 ASP B CB     1 
ATOM   4248  C  CG     . ASP B 2 113 ? -0.412  60.246 207.181 1.00 132.79 ? 191 ASP B CG     1 
ATOM   4249  O  OD1    . ASP B 2 113 ? 0.465   59.368 207.314 1.00 127.30 ? 191 ASP B OD1    1 
ATOM   4250  O  OD2    . ASP B 2 113 ? -1.580  59.991 206.819 1.00 145.45 ? 191 ASP B OD2    1 
ATOM   4251  H  H      . ASP B 2 113 ? 1.537   60.442 208.875 1.00 125.75 ? 191 ASP B H      1 
ATOM   4252  H  HA     . ASP B 2 113 ? 0.489   62.852 209.078 1.00 99.10  ? 191 ASP B HA     1 
ATOM   4253  H  HB2    . ASP B 2 113 ? -0.776  62.251 207.199 1.00 122.33 ? 191 ASP B HB2    1 
ATOM   4254  H  HB3    . ASP B 2 113 ? 0.759   61.902 206.975 1.00 122.33 ? 191 ASP B HB3    1 
ATOM   4255  N  N      . SER B 2 114 ? -1.059  60.750 210.705 1.00 87.54  ? 192 SER B N      1 
ATOM   4256  C  CA     . SER B 2 114 ? -2.244  60.484 211.515 1.00 95.97  ? 192 SER B CA     1 
ATOM   4257  C  C      . SER B 2 114 ? -2.494  61.553 212.579 1.00 95.89  ? 192 SER B C      1 
ATOM   4258  O  O      . SER B 2 114 ? -3.414  61.381 213.392 1.00 108.95 ? 192 SER B O      1 
ATOM   4259  C  CB     . SER B 2 114 ? -2.118  59.109 212.181 1.00 104.08 ? 192 SER B CB     1 
ATOM   4260  O  OG     . SER B 2 114 ? -2.170  58.064 211.228 1.00 102.42 ? 192 SER B OG     1 
ATOM   4261  H  H      . SER B 2 114 ? -0.388  60.244 210.889 1.00 105.05 ? 192 SER B H      1 
ATOM   4262  H  HA     . SER B 2 114 ? -3.019  60.460 210.933 1.00 115.16 ? 192 SER B HA     1 
ATOM   4263  H  HB2    . SER B 2 114 ? -1.271  59.064 212.651 1.00 124.89 ? 192 SER B HB2    1 
ATOM   4264  H  HB3    . SER B 2 114 ? -2.849  58.996 212.809 1.00 124.89 ? 192 SER B HB3    1 
ATOM   4265  H  HG     . SER B 2 114 ? -2.099  57.321 211.613 1.00 122.90 ? 192 SER B HG     1 
ATOM   4266  N  N      . VAL B 2 115 ? -1.737  62.652 212.571 1.00 94.09  ? 193 VAL B N      1 
ATOM   4267  C  CA     . VAL B 2 115 ? -1.861  63.719 213.560 1.00 91.64  ? 193 VAL B CA     1 
ATOM   4268  C  C      . VAL B 2 115 ? -2.944  64.678 213.071 1.00 96.99  ? 193 VAL B C      1 
ATOM   4269  O  O      . VAL B 2 115 ? -3.182  65.731 213.671 1.00 119.80 ? 193 VAL B O      1 
ATOM   4270  C  CB     . VAL B 2 115 ? -0.521  64.453 213.767 1.00 73.87  ? 193 VAL B CB     1 
ATOM   4271  C  CG1    . VAL B 2 115 ? -0.605  65.416 214.940 1.00 80.50  ? 193 VAL B CG1    1 
ATOM   4272  C  CG2    . VAL B 2 115 ? 0.604   63.456 214.017 1.00 134.25 ? 193 VAL B CG2    1 
ATOM   4273  H  H      . VAL B 2 115 ? -1.128  62.804 211.984 1.00 112.90 ? 193 VAL B H      1 
ATOM   4274  H  HA     . VAL B 2 115 ? -2.141  63.344 214.410 1.00 109.96 ? 193 VAL B HA     1 
ATOM   4275  H  HB     . VAL B 2 115 ? -0.307  64.962 212.969 1.00 88.65  ? 193 VAL B HB     1 
ATOM   4276  H  HG11   . VAL B 2 115 ? 0.251   65.861 215.044 1.00 96.60  ? 193 VAL B HG11   1 
ATOM   4277  H  HG12   . VAL B 2 115 ? -1.299  66.070 214.762 1.00 96.60  ? 193 VAL B HG12   1 
ATOM   4278  H  HG13   . VAL B 2 115 ? -0.818  64.916 215.743 1.00 96.60  ? 193 VAL B HG13   1 
ATOM   4279  H  HG21   . VAL B 2 115 ? 1.434   63.943 214.143 1.00 161.11 ? 193 VAL B HG21   1 
ATOM   4280  H  HG22   . VAL B 2 115 ? 0.398   62.941 214.812 1.00 161.11 ? 193 VAL B HG22   1 
ATOM   4281  H  HG23   . VAL B 2 115 ? 0.679   62.867 213.250 1.00 161.11 ? 193 VAL B HG23   1 
ATOM   4282  N  N      . THR B 2 116 ? -3.603  64.341 211.958 1.00 113.66 ? 194 THR B N      1 
ATOM   4283  C  CA     . THR B 2 116 ? -4.620  65.237 211.403 1.00 112.98 ? 194 THR B CA     1 
ATOM   4284  C  C      . THR B 2 116 ? -6.021  64.900 211.908 1.00 107.12 ? 194 THR B C      1 
ATOM   4285  O  O      . THR B 2 116 ? -6.791  65.813 212.220 1.00 111.64 ? 194 THR B O      1 
ATOM   4286  C  CB     . THR B 2 116 ? -4.620  65.205 209.871 1.00 136.64 ? 194 THR B CB     1 
ATOM   4287  O  OG1    . THR B 2 116 ? -3.277  65.281 209.366 1.00 110.99 ? 194 THR B OG1    1 
ATOM   4288  C  CG2    . THR B 2 116 ? -5.445  66.380 209.310 1.00 129.12 ? 194 THR B CG2    1 
ATOM   4289  H  H      . THR B 2 116 ? -3.483  63.615 211.514 1.00 136.39 ? 194 THR B H      1 
ATOM   4290  H  HA     . THR B 2 116 ? -4.418  66.144 211.679 1.00 135.58 ? 194 THR B HA     1 
ATOM   4291  H  HB     . THR B 2 116 ? -5.026  64.377 209.569 1.00 163.97 ? 194 THR B HB     1 
ATOM   4292  H  HG1    . THR B 2 116 ? -2.826  64.632 209.649 1.00 133.19 ? 194 THR B HG1    1 
ATOM   4293  H  HG21   . THR B 2 116 ? -5.442  66.354 208.340 1.00 154.94 ? 194 THR B HG21   1 
ATOM   4294  H  HG22   . THR B 2 116 ? -6.362  66.320 209.623 1.00 154.94 ? 194 THR B HG22   1 
ATOM   4295  H  HG23   . THR B 2 116 ? -5.066  67.222 209.605 1.00 154.94 ? 194 THR B HG23   1 
ATOM   4296  N  N      . PRO B 2 117 ? -6.396  63.624 212.013 1.00 77.17  ? 195 PRO B N      1 
ATOM   4297  C  CA     . PRO B 2 117 ? -7.733  63.299 212.533 1.00 86.51  ? 195 PRO B CA     1 
ATOM   4298  C  C      . PRO B 2 117 ? -7.793  63.281 214.055 1.00 85.91  ? 195 PRO B C      1 
ATOM   4299  O  O      . PRO B 2 117 ? -8.833  63.583 214.651 1.00 114.11 ? 195 PRO B O      1 
ATOM   4300  C  CB     . PRO B 2 117 ? -8.009  61.908 211.940 1.00 100.32 ? 195 PRO B CB     1 
ATOM   4301  C  CG     . PRO B 2 117 ? -6.941  61.703 210.891 1.00 111.91 ? 195 PRO B CG     1 
ATOM   4302  C  CD     . PRO B 2 117 ? -5.766  62.445 211.405 1.00 96.85  ? 195 PRO B CD     1 
ATOM   4303  H  HA     . PRO B 2 117 ? -8.389  63.928 212.193 1.00 103.81 ? 195 PRO B HA     1 
ATOM   4304  H  HB2    . PRO B 2 117 ? -7.938  61.236 212.637 1.00 120.38 ? 195 PRO B HB2    1 
ATOM   4305  H  HB3    . PRO B 2 117 ? -8.892  61.893 211.539 1.00 120.38 ? 195 PRO B HB3    1 
ATOM   4306  H  HG2    . PRO B 2 117 ? -6.742  60.758 210.806 1.00 134.29 ? 195 PRO B HG2    1 
ATOM   4307  H  HG3    . PRO B 2 117 ? -7.238  62.071 210.044 1.00 134.29 ? 195 PRO B HG3    1 
ATOM   4308  H  HD2    . PRO B 2 117 ? -5.297  61.924 212.075 1.00 116.22 ? 195 PRO B HD2    1 
ATOM   4309  H  HD3    . PRO B 2 117 ? -5.181  62.707 210.676 1.00 116.22 ? 195 PRO B HD3    1 
ATOM   4310  N  N      . VAL B 2 118 ? -6.682  62.918 214.694 1.00 85.07  ? 196 VAL B N      1 
ATOM   4311  C  CA     . VAL B 2 118 ? -6.597  62.936 216.149 1.00 97.96  ? 196 VAL B CA     1 
ATOM   4312  C  C      . VAL B 2 118 ? -6.615  64.390 216.591 1.00 91.91  ? 196 VAL B C      1 
ATOM   4313  O  O      . VAL B 2 118 ? -7.570  64.852 217.225 1.00 93.23  ? 196 VAL B O      1 
ATOM   4314  C  CB     . VAL B 2 118 ? -5.331  62.222 216.658 1.00 86.87  ? 196 VAL B CB     1 
ATOM   4315  C  CG1    . VAL B 2 118 ? -5.344  62.146 218.181 1.00 66.67  ? 196 VAL B CG1    1 
ATOM   4316  C  CG2    . VAL B 2 118 ? -5.201  60.830 216.044 1.00 78.82  ? 196 VAL B CG2    1 
ATOM   4317  H  H      . VAL B 2 118 ? -5.962  62.657 214.304 1.00 102.09 ? 196 VAL B H      1 
ATOM   4318  H  HA     . VAL B 2 118 ? -7.373  62.491 216.524 1.00 117.55 ? 196 VAL B HA     1 
ATOM   4319  H  HB     . VAL B 2 118 ? -4.553  62.737 216.394 1.00 104.25 ? 196 VAL B HB     1 
ATOM   4320  H  HG11   . VAL B 2 118 ? -4.540  61.693 218.481 1.00 80.01  ? 196 VAL B HG11   1 
ATOM   4321  H  HG12   . VAL B 2 118 ? -5.372  63.046 218.542 1.00 80.01  ? 196 VAL B HG12   1 
ATOM   4322  H  HG13   . VAL B 2 118 ? -6.128  61.650 218.465 1.00 80.01  ? 196 VAL B HG13   1 
ATOM   4323  H  HG21   . VAL B 2 118 ? -4.397  60.408 216.384 1.00 94.58  ? 196 VAL B HG21   1 
ATOM   4324  H  HG22   . VAL B 2 118 ? -5.979  60.304 216.287 1.00 94.58  ? 196 VAL B HG22   1 
ATOM   4325  H  HG23   . VAL B 2 118 ? -5.148  60.915 215.079 1.00 94.58  ? 196 VAL B HG23   1 
ATOM   4326  N  N      . LEU B 2 119 ? -5.556  65.111 216.251 1.00 96.53  ? 197 LEU B N      1 
ATOM   4327  C  CA     . LEU B 2 119 ? -5.415  66.534 216.513 1.00 86.00  ? 197 LEU B CA     1 
ATOM   4328  C  C      . LEU B 2 119 ? -5.355  67.264 215.175 1.00 120.75 ? 197 LEU B C      1 
ATOM   4329  O  O      . LEU B 2 119 ? -5.467  66.656 214.110 1.00 149.51 ? 197 LEU B O      1 
ATOM   4330  C  CB     . LEU B 2 119 ? -4.164  66.802 217.354 1.00 79.80  ? 197 LEU B CB     1 
ATOM   4331  C  CG     . LEU B 2 119 ? -3.883  65.752 218.433 1.00 87.05  ? 197 LEU B CG     1 
ATOM   4332  C  CD1    . LEU B 2 119 ? -2.555  66.027 219.115 1.00 87.28  ? 197 LEU B CD1    1 
ATOM   4333  C  CD2    . LEU B 2 119 ? -5.019  65.705 219.448 1.00 105.73 ? 197 LEU B CD2    1 
ATOM   4334  H  H      . LEU B 2 119 ? -4.874  64.779 215.847 1.00 115.84 ? 197 LEU B H      1 
ATOM   4335  H  HA     . LEU B 2 119 ? -6.190  66.852 217.002 1.00 103.20 ? 197 LEU B HA     1 
ATOM   4336  H  HB2    . LEU B 2 119 ? -3.394  66.829 216.764 1.00 95.76  ? 197 LEU B HB2    1 
ATOM   4337  H  HB3    . LEU B 2 119 ? -4.266  67.658 217.797 1.00 95.76  ? 197 LEU B HB3    1 
ATOM   4338  H  HG     . LEU B 2 119 ? -3.826  64.880 218.013 1.00 104.46 ? 197 LEU B HG     1 
ATOM   4339  H  HD11   . LEU B 2 119 ? -2.402  65.350 219.792 1.00 104.74 ? 197 LEU B HD11   1 
ATOM   4340  H  HD12   . LEU B 2 119 ? -1.848  65.998 218.451 1.00 104.74 ? 197 LEU B HD12   1 
ATOM   4341  H  HD13   . LEU B 2 119 ? -2.587  66.905 219.526 1.00 104.74 ? 197 LEU B HD13   1 
ATOM   4342  H  HD21   . LEU B 2 119 ? -4.815  65.033 220.118 1.00 126.87 ? 197 LEU B HD21   1 
ATOM   4343  H  HD22   . LEU B 2 119 ? -5.104  66.575 219.867 1.00 126.87 ? 197 LEU B HD22   1 
ATOM   4344  H  HD23   . LEU B 2 119 ? -5.843  65.476 218.989 1.00 126.87 ? 197 LEU B HD23   1 
ATOM   4345  N  N      . ASN B 2 120 ? -5.175  68.575 215.226 1.00 108.84 ? 198 ASN B N      1 
ATOM   4346  C  CA     . ASN B 2 120 ? -5.030  69.368 214.017 1.00 97.28  ? 198 ASN B CA     1 
ATOM   4347  C  C      . ASN B 2 120 ? -3.589  69.875 213.907 1.00 107.18 ? 198 ASN B C      1 
ATOM   4348  O  O      . ASN B 2 120 ? -2.691  69.390 214.600 1.00 89.15  ? 198 ASN B O      1 
ATOM   4349  C  CB     . ASN B 2 120 ? -6.077  70.483 214.021 1.00 121.35 ? 198 ASN B CB     1 
ATOM   4350  C  CG     . ASN B 2 120 ? -7.490  69.940 214.170 1.00 121.46 ? 198 ASN B CG     1 
ATOM   4351  O  OD1    . ASN B 2 120 ? -7.732  69.034 214.967 1.00 94.57  ? 198 ASN B OD1    1 
ATOM   4352  N  ND2    . ASN B 2 120 ? -8.421  70.470 213.386 1.00 141.77 ? 198 ASN B ND2    1 
ATOM   4353  H  H      . ASN B 2 120 ? -5.133  69.032 215.953 1.00 130.61 ? 198 ASN B H      1 
ATOM   4354  H  HA     . ASN B 2 120 ? -5.204  68.801 213.249 1.00 116.73 ? 198 ASN B HA     1 
ATOM   4355  H  HB2    . ASN B 2 120 ? -5.903  71.081 214.765 1.00 145.62 ? 198 ASN B HB2    1 
ATOM   4356  H  HB3    . ASN B 2 120 ? -6.027  70.969 213.183 1.00 145.62 ? 198 ASN B HB3    1 
ATOM   4357  H  HD21   . ASN B 2 120 ? -9.234  70.193 213.436 1.00 170.13 ? 198 ASN B HD21   1 
ATOM   4358  H  HD22   . ASN B 2 120 ? -8.212  71.089 212.827 1.00 170.13 ? 198 ASN B HD22   1 
ATOM   4359  N  N      . GLN B 2 121 ? -3.371  70.834 213.003 1.00 153.30 ? 199 GLN B N      1 
ATOM   4360  C  CA     . GLN B 2 121 ? -2.070  71.423 212.683 1.00 162.00 ? 199 GLN B CA     1 
ATOM   4361  C  C      . GLN B 2 121 ? -1.019  70.385 212.282 1.00 126.64 ? 199 GLN B C      1 
ATOM   4362  O  O      . GLN B 2 121 ? 0.127   70.467 212.742 1.00 133.21 ? 199 GLN B O      1 
ATOM   4363  C  CB     . GLN B 2 121 ? -1.565  72.254 213.874 1.00 135.90 ? 199 GLN B CB     1 
ATOM   4364  C  CG     . GLN B 2 121 ? -0.959  71.465 215.059 1.00 119.97 ? 199 GLN B CG     1 
ATOM   4365  C  CD     . GLN B 2 121 ? -1.780  71.567 216.328 1.00 123.74 ? 199 GLN B CD     1 
ATOM   4366  O  OE1    . GLN B 2 121 ? -2.628  72.447 216.472 1.00 86.88  ? 199 GLN B OE1    1 
ATOM   4367  N  NE2    . GLN B 2 121 ? -1.522  70.665 217.263 1.00 80.47  ? 199 GLN B NE2    1 
ATOM   4368  H  H      . GLN B 2 121 ? -4.005  71.178 212.535 1.00 183.96 ? 199 GLN B H      1 
ATOM   4369  H  HA     . GLN B 2 121 ? -2.183  72.027 211.933 1.00 194.40 ? 199 GLN B HA     1 
ATOM   4370  H  HB2    . GLN B 2 121 ? -0.879  72.859 213.551 1.00 163.08 ? 199 GLN B HB2    1 
ATOM   4371  H  HB3    . GLN B 2 121 ? -2.309  72.769 214.222 1.00 163.08 ? 199 GLN B HB3    1 
ATOM   4372  H  HG2    . GLN B 2 121 ? -0.901  70.528 214.815 1.00 143.96 ? 199 GLN B HG2    1 
ATOM   4373  H  HG3    . GLN B 2 121 ? -0.074  71.813 215.247 1.00 143.96 ? 199 GLN B HG3    1 
ATOM   4374  H  HE21   . GLN B 2 121 ? -0.919  70.067 217.129 1.00 96.57  ? 199 GLN B HE21   1 
ATOM   4375  H  HE22   . GLN B 2 121 ? -1.959  70.677 218.004 1.00 96.57  ? 199 GLN B HE22   1 
ATOM   4376  N  N      . PRO B 2 122 ? -1.334  69.427 211.411 1.00 130.89 ? 200 PRO B N      1 
ATOM   4377  C  CA     . PRO B 2 122 ? -0.327  68.419 211.053 1.00 148.74 ? 200 PRO B CA     1 
ATOM   4378  C  C      . PRO B 2 122 ? 0.943   69.018 210.463 1.00 124.07 ? 200 PRO B C      1 
ATOM   4379  O  O      . PRO B 2 122 ? 0.911   70.025 209.754 1.00 115.27 ? 200 PRO B O      1 
ATOM   4380  C  CB     . PRO B 2 122 ? -1.048  67.552 210.018 1.00 132.80 ? 200 PRO B CB     1 
ATOM   4381  C  CG     . PRO B 2 122 ? -2.457  67.751 210.280 1.00 124.83 ? 200 PRO B CG     1 
ATOM   4382  C  CD     . PRO B 2 122 ? -2.629  69.138 210.769 1.00 135.19 ? 200 PRO B CD     1 
ATOM   4383  H  HA     . PRO B 2 122 ? -0.100  67.878 211.826 1.00 178.49 ? 200 PRO B HA     1 
ATOM   4384  H  HB2    . PRO B 2 122 ? -0.820  67.851 209.124 1.00 159.35 ? 200 PRO B HB2    1 
ATOM   4385  H  HB3    . PRO B 2 122 ? -0.804  66.621 210.142 1.00 159.35 ? 200 PRO B HB3    1 
ATOM   4386  H  HG2    . PRO B 2 122 ? -2.956  67.620 209.459 1.00 149.79 ? 200 PRO B HG2    1 
ATOM   4387  H  HG3    . PRO B 2 122 ? -2.749  67.118 210.955 1.00 149.79 ? 200 PRO B HG3    1 
ATOM   4388  H  HD2    . PRO B 2 122 ? -2.782  69.743 210.027 1.00 162.23 ? 200 PRO B HD2    1 
ATOM   4389  H  HD3    . PRO B 2 122 ? -3.347  69.182 211.420 1.00 162.23 ? 200 PRO B HD3    1 
ATOM   4390  N  N      . GLN B 2 123 ? 2.073   68.383 210.789 1.00 96.48  ? 201 GLN B N      1 
ATOM   4391  C  CA     . GLN B 2 123 ? 3.301   68.467 209.992 1.00 120.77 ? 201 GLN B CA     1 
ATOM   4392  C  C      . GLN B 2 123 ? 3.695   69.905 209.661 1.00 130.25 ? 201 GLN B C      1 
ATOM   4393  O  O      . GLN B 2 123 ? 4.245   70.181 208.592 1.00 124.56 ? 201 GLN B O      1 
ATOM   4394  C  CB     . GLN B 2 123 ? 3.156   67.644 208.710 1.00 130.74 ? 201 GLN B CB     1 
ATOM   4395  C  CG     . GLN B 2 123 ? 3.184   66.144 208.947 1.00 120.01 ? 201 GLN B CG     1 
ATOM   4396  C  CD     . GLN B 2 123 ? 2.681   65.349 207.757 1.00 133.22 ? 201 GLN B CD     1 
ATOM   4397  O  OE1    . GLN B 2 123 ? 1.646   65.672 207.173 1.00 149.47 ? 201 GLN B OE1    1 
ATOM   4398  N  NE2    . GLN B 2 123 ? 3.415   64.304 207.389 1.00 110.26 ? 201 GLN B NE2    1 
ATOM   4399  H  H      . GLN B 2 123 ? 2.154   67.885 211.485 1.00 115.77 ? 201 GLN B H      1 
ATOM   4400  H  HA     . GLN B 2 123 ? 4.026   68.079 210.506 1.00 144.93 ? 201 GLN B HA     1 
ATOM   4401  H  HB2    . GLN B 2 123 ? 2.309   67.863 208.290 1.00 156.89 ? 201 GLN B HB2    1 
ATOM   4402  H  HB3    . GLN B 2 123 ? 3.886   67.864 208.111 1.00 156.89 ? 201 GLN B HB3    1 
ATOM   4403  H  HG2    . GLN B 2 123 ? 4.097   65.870 209.126 1.00 144.01 ? 201 GLN B HG2    1 
ATOM   4404  H  HG3    . GLN B 2 123 ? 2.619   65.934 209.707 1.00 144.01 ? 201 GLN B HG3    1 
ATOM   4405  H  HE21   . GLN B 2 123 ? 4.133   64.110 207.821 1.00 132.31 ? 201 GLN B HE21   1 
ATOM   4406  H  HE22   . GLN B 2 123 ? 3.171   63.822 206.720 1.00 132.31 ? 201 GLN B HE22   1 
ATOM   4407  N  N      . SER B 2 124 ? 3.422   70.832 210.573 1.00 130.81 ? 202 SER B N      1 
ATOM   4408  C  CA     . SER B 2 124 ? 3.955   72.184 210.459 1.00 129.88 ? 202 SER B CA     1 
ATOM   4409  C  C      . SER B 2 124 ? 4.577   72.589 211.786 1.00 153.33 ? 202 SER B C      1 
ATOM   4410  O  O      . SER B 2 124 ? 5.806   72.627 211.916 1.00 136.00 ? 202 SER B O      1 
ATOM   4411  C  CB     . SER B 2 124 ? 2.865   73.174 210.044 1.00 148.31 ? 202 SER B CB     1 
ATOM   4412  O  OG     . SER B 2 124 ? 3.361   74.503 210.046 1.00 148.49 ? 202 SER B OG     1 
ATOM   4413  H  H      . SER B 2 124 ? 2.931   70.704 211.268 1.00 156.97 ? 202 SER B H      1 
ATOM   4414  H  HA     . SER B 2 124 ? 4.649   72.197 209.781 1.00 155.85 ? 202 SER B HA     1 
ATOM   4415  H  HB2    . SER B 2 124 ? 2.560   72.952 209.150 1.00 177.97 ? 202 SER B HB2    1 
ATOM   4416  H  HB3    . SER B 2 124 ? 2.127   73.112 210.671 1.00 177.97 ? 202 SER B HB3    1 
ATOM   4417  H  HG     . SER B 2 124 ? 2.755   75.037 209.817 1.00 178.19 ? 202 SER B HG     1 
ATOM   4418  N  N      . GLU B 2 125 ? 3.740   72.879 212.778 1.00 144.28 ? 203 GLU B N      1 
ATOM   4419  C  CA     . GLU B 2 125 ? 4.225   73.191 214.115 1.00 145.02 ? 203 GLU B CA     1 
ATOM   4420  C  C      . GLU B 2 125 ? 4.549   71.940 214.923 1.00 126.70 ? 203 GLU B C      1 
ATOM   4421  O  O      . GLU B 2 125 ? 4.848   72.046 216.117 1.00 151.40 ? 203 GLU B O      1 
ATOM   4422  C  CB     . GLU B 2 125 ? 3.205   74.060 214.857 1.00 161.13 ? 203 GLU B CB     1 
ATOM   4423  C  CG     . GLU B 2 125 ? 1.832   73.457 215.036 1.00 142.97 ? 203 GLU B CG     1 
ATOM   4424  C  CD     . GLU B 2 125 ? 0.877   74.403 215.749 1.00 169.25 ? 203 GLU B CD     1 
ATOM   4425  O  OE1    . GLU B 2 125 ? 1.341   75.444 216.256 1.00 188.53 ? 203 GLU B OE1    1 
ATOM   4426  O  OE2    . GLU B 2 125 ? -0.336  74.114 215.803 1.00 155.06 ? 203 GLU B OE2    1 
ATOM   4427  H  H      . GLU B 2 125 ? 2.884   72.902 212.701 1.00 173.14 ? 203 GLU B H      1 
ATOM   4428  H  HA     . GLU B 2 125 ? 5.043   73.705 214.034 1.00 174.03 ? 203 GLU B HA     1 
ATOM   4429  H  HB2    . GLU B 2 125 ? 3.554   74.254 215.741 1.00 193.36 ? 203 GLU B HB2    1 
ATOM   4430  H  HB3    . GLU B 2 125 ? 3.095   74.889 214.365 1.00 193.36 ? 203 GLU B HB3    1 
ATOM   4431  H  HG2    . GLU B 2 125 ? 1.458   73.252 214.165 1.00 171.56 ? 203 GLU B HG2    1 
ATOM   4432  H  HG3    . GLU B 2 125 ? 1.906   72.648 215.566 1.00 171.56 ? 203 GLU B HG3    1 
ATOM   4433  N  N      . TRP B 2 126 ? 4.486   70.765 214.294 1.00 121.43 ? 204 TRP B N      1 
ATOM   4434  C  CA     . TRP B 2 126 ? 5.029   69.537 214.852 1.00 112.81 ? 204 TRP B CA     1 
ATOM   4435  C  C      . TRP B 2 126 ? 6.272   69.063 214.116 1.00 98.45  ? 204 TRP B C      1 
ATOM   4436  O  O      . TRP B 2 126 ? 6.970   68.179 214.621 1.00 121.57 ? 204 TRP B O      1 
ATOM   4437  C  CB     . TRP B 2 126 ? 3.977   68.417 214.813 1.00 115.50 ? 204 TRP B CB     1 
ATOM   4438  C  CG     . TRP B 2 126 ? 3.110   68.312 216.039 1.00 123.12 ? 204 TRP B CG     1 
ATOM   4439  C  CD1    . TRP B 2 126 ? 2.010   69.065 216.334 1.00 138.85 ? 204 TRP B CD1    1 
ATOM   4440  C  CD2    . TRP B 2 126 ? 3.260   67.382 217.119 1.00 92.86  ? 204 TRP B CD2    1 
ATOM   4441  N  NE1    . TRP B 2 126 ? 1.472   68.666 217.535 1.00 115.78 ? 204 TRP B NE1    1 
ATOM   4442  C  CE2    . TRP B 2 126 ? 2.221   67.634 218.036 1.00 106.56 ? 204 TRP B CE2    1 
ATOM   4443  C  CE3    . TRP B 2 126 ? 4.175   66.364 217.401 1.00 90.05  ? 204 TRP B CE3    1 
ATOM   4444  C  CZ2    . TRP B 2 126 ? 2.074   66.908 219.216 1.00 112.15 ? 204 TRP B CZ2    1 
ATOM   4445  C  CZ3    . TRP B 2 126 ? 4.028   65.645 218.571 1.00 96.06  ? 204 TRP B CZ3    1 
ATOM   4446  C  CH2    . TRP B 2 126 ? 2.985   65.919 219.464 1.00 100.63 ? 204 TRP B CH2    1 
ATOM   4447  H  H      . TRP B 2 126 ? 4.122   70.657 213.522 1.00 145.72 ? 204 TRP B H      1 
ATOM   4448  H  HA     . TRP B 2 126 ? 5.270   69.691 215.779 1.00 135.37 ? 204 TRP B HA     1 
ATOM   4449  H  HB2    . TRP B 2 126 ? 3.392   68.570 214.054 1.00 138.60 ? 204 TRP B HB2    1 
ATOM   4450  H  HB3    . TRP B 2 126 ? 4.434   67.569 214.705 1.00 138.60 ? 204 TRP B HB3    1 
ATOM   4451  H  HD1    . TRP B 2 126 ? 1.674   69.749 215.801 1.00 166.62 ? 204 TRP B HD1    1 
ATOM   4452  H  HE1    . TRP B 2 126 ? 0.778   69.009 217.911 1.00 138.94 ? 204 TRP B HE1    1 
ATOM   4453  H  HE3    . TRP B 2 126 ? 4.871   66.175 216.813 1.00 108.05 ? 204 TRP B HE3    1 
ATOM   4454  H  HZ2    . TRP B 2 126 ? 1.382   67.089 219.811 1.00 134.58 ? 204 TRP B HZ2    1 
ATOM   4455  H  HZ3    . TRP B 2 126 ? 4.631   64.965 218.768 1.00 115.27 ? 204 TRP B HZ3    1 
ATOM   4456  H  HH2    . TRP B 2 126 ? 2.910   65.418 220.244 1.00 120.76 ? 204 TRP B HH2    1 
ATOM   4457  N  N      . PHE B 2 127 ? 6.570   69.632 212.946 1.00 123.92 ? 205 PHE B N      1 
ATOM   4458  C  CA     . PHE B 2 127 ? 7.627   69.099 212.092 1.00 137.00 ? 205 PHE B CA     1 
ATOM   4459  C  C      . PHE B 2 127 ? 9.000   69.269 212.729 1.00 128.25 ? 205 PHE B C      1 
ATOM   4460  O  O      . PHE B 2 127 ? 9.751   68.298 212.877 1.00 138.91 ? 205 PHE B O      1 
ATOM   4461  C  CB     . PHE B 2 127 ? 7.581   69.785 210.726 1.00 70.25  ? 205 PHE B CB     1 
ATOM   4462  H  H      . PHE B 2 127 ? 6.175   70.326 212.627 1.00 148.71 ? 205 PHE B H      1 
ATOM   4463  H  HA     . PHE B 2 127 ? 7.475   68.150 211.957 1.00 164.40 ? 205 PHE B HA     1 
ATOM   4464  N  N      . GLY B 2 128 ? 9.354   70.498 213.095 1.00 137.19 ? 206 GLY B N      1 
ATOM   4465  C  CA     . GLY B 2 128 ? 10.662  70.774 213.660 1.00 147.65 ? 206 GLY B CA     1 
ATOM   4466  C  C      . GLY B 2 128 ? 10.591  71.293 215.079 1.00 130.30 ? 206 GLY B C      1 
ATOM   4467  O  O      . GLY B 2 128 ? 11.620  71.590 215.693 1.00 130.01 ? 206 GLY B O      1 
ATOM   4468  H  H      . GLY B 2 128 ? 8.849   71.191 213.024 1.00 164.62 ? 206 GLY B H      1 
ATOM   4469  H  HA2    . GLY B 2 128 ? 11.191  69.962 213.657 1.00 177.18 ? 206 GLY B HA2    1 
ATOM   4470  H  HA3    . GLY B 2 128 ? 11.114  71.437 213.115 1.00 177.18 ? 206 GLY B HA3    1 
ATOM   4471  N  N      . SER B 2 129 ? 9.380   71.403 215.613 1.00 139.27 ? 207 SER B N      1 
ATOM   4472  C  CA     . SER B 2 129 ? 9.196   71.951 216.944 1.00 139.12 ? 207 SER B CA     1 
ATOM   4473  C  C      . SER B 2 129 ? 9.545   70.916 218.005 1.00 112.84 ? 207 SER B C      1 
ATOM   4474  O  O      . SER B 2 129 ? 9.521   69.705 217.770 1.00 122.80 ? 207 SER B O      1 
ATOM   4475  C  CB     . SER B 2 129 ? 7.758   72.427 217.139 1.00 121.54 ? 207 SER B CB     1 
ATOM   4476  O  OG     . SER B 2 129 ? 7.580   72.973 218.432 1.00 132.58 ? 207 SER B OG     1 
ATOM   4477  H  H      . SER B 2 129 ? 8.650   71.166 215.224 1.00 167.12 ? 207 SER B H      1 
ATOM   4478  H  HA     . SER B 2 129 ? 9.786   72.713 217.059 1.00 166.95 ? 207 SER B HA     1 
ATOM   4479  H  HB2    . SER B 2 129 ? 7.558   73.108 216.478 1.00 145.84 ? 207 SER B HB2    1 
ATOM   4480  H  HB3    . SER B 2 129 ? 7.158   71.672 217.030 1.00 145.84 ? 207 SER B HB3    1 
ATOM   4481  H  HG     . SER B 2 129 ? 6.786   73.231 218.528 1.00 159.10 ? 207 SER B HG     1 
ATOM   4482  N  N      . THR B 2 130 ? 9.887   71.417 219.185 1.00 125.49 ? 208 THR B N      1 
ATOM   4483  C  CA     . THR B 2 130 ? 10.191  70.554 220.314 1.00 126.75 ? 208 THR B CA     1 
ATOM   4484  C  C      . THR B 2 130 ? 8.910   69.969 220.897 1.00 110.27 ? 208 THR B C      1 
ATOM   4485  O  O      . THR B 2 130 ? 7.869   70.630 220.934 1.00 122.04 ? 208 THR B O      1 
ATOM   4486  C  CB     . THR B 2 130 ? 10.960  71.331 221.389 1.00 146.73 ? 208 THR B CB     1 
ATOM   4487  O  OG1    . THR B 2 130 ? 11.160  70.498 222.537 1.00 148.85 ? 208 THR B OG1    1 
ATOM   4488  C  CG2    . THR B 2 130 ? 10.244  72.574 221.819 1.00 136.11 ? 208 THR B CG2    1 
ATOM   4489  H  H      . THR B 2 130 ? 9.950   72.257 219.357 1.00 150.58 ? 208 THR B H      1 
ATOM   4490  H  HA     . THR B 2 130 ? 10.749  69.820 220.013 1.00 152.10 ? 208 THR B HA     1 
ATOM   4491  H  HB     . THR B 2 130 ? 11.824  71.591 221.034 1.00 176.08 ? 208 THR B HB     1 
ATOM   4492  H  HG1    . THR B 2 130 ? 11.581  70.920 223.128 1.00 178.62 ? 208 THR B HG1    1 
ATOM   4493  H  HG21   . THR B 2 130 ? 10.761  73.036 222.498 1.00 163.34 ? 208 THR B HG21   1 
ATOM   4494  H  HG22   . THR B 2 130 ? 10.122  73.165 221.060 1.00 163.34 ? 208 THR B HG22   1 
ATOM   4495  H  HG23   . THR B 2 130 ? 9.375   72.346 222.185 1.00 163.34 ? 208 THR B HG23   1 
ATOM   4496  N  N      . LEU B 2 131 ? 8.984   68.713 221.346 1.00 112.88 ? 209 LEU B N      1 
ATOM   4497  C  CA     . LEU B 2 131 ? 7.812   68.090 221.952 1.00 123.35 ? 209 LEU B CA     1 
ATOM   4498  C  C      . LEU B 2 131 ? 7.345   68.863 223.177 1.00 124.39 ? 209 LEU B C      1 
ATOM   4499  O  O      . LEU B 2 131 ? 6.154   68.844 223.506 1.00 119.41 ? 209 LEU B O      1 
ATOM   4500  C  CB     . LEU B 2 131 ? 8.105   66.635 222.329 1.00 126.72 ? 209 LEU B CB     1 
ATOM   4501  C  CG     . LEU B 2 131 ? 6.963   65.905 223.051 1.00 86.52  ? 209 LEU B CG     1 
ATOM   4502  C  CD1    . LEU B 2 131 ? 5.688   65.902 222.221 1.00 83.97  ? 209 LEU B CD1    1 
ATOM   4503  C  CD2    . LEU B 2 131 ? 7.362   64.484 223.399 1.00 92.26  ? 209 LEU B CD2    1 
ATOM   4504  H  H      . LEU B 2 131 ? 9.684   68.214 221.311 1.00 135.46 ? 209 LEU B H      1 
ATOM   4505  H  HA     . LEU B 2 131 ? 7.088   68.090 221.307 1.00 148.02 ? 209 LEU B HA     1 
ATOM   4506  H  HB2    . LEU B 2 131 ? 8.302   66.140 221.518 1.00 152.06 ? 209 LEU B HB2    1 
ATOM   4507  H  HB3    . LEU B 2 131 ? 8.878   66.618 222.915 1.00 152.06 ? 209 LEU B HB3    1 
ATOM   4508  H  HG     . LEU B 2 131 ? 6.773   66.369 223.881 1.00 103.83 ? 209 LEU B HG     1 
ATOM   4509  H  HD11   . LEU B 2 131 ? 4.994   65.433 222.710 1.00 100.76 ? 209 LEU B HD11   1 
ATOM   4510  H  HD12   . LEU B 2 131 ? 5.417   66.819 222.057 1.00 100.76 ? 209 LEU B HD12   1 
ATOM   4511  H  HD13   . LEU B 2 131 ? 5.862   65.452 221.379 1.00 100.76 ? 209 LEU B HD13   1 
ATOM   4512  H  HD21   . LEU B 2 131 ? 6.622   64.050 223.852 1.00 110.71 ? 209 LEU B HD21   1 
ATOM   4513  H  HD22   . LEU B 2 131 ? 7.575   64.007 222.581 1.00 110.71 ? 209 LEU B HD22   1 
ATOM   4514  H  HD23   . LEU B 2 131 ? 8.139   64.508 223.980 1.00 110.71 ? 209 LEU B HD23   1 
ATOM   4515  N  N      . TYR B 2 132 ? 8.261   69.546 223.868 1.00 122.26 ? 210 TYR B N      1 
ATOM   4516  C  CA     . TYR B 2 132 ? 7.865   70.358 225.010 1.00 114.00 ? 210 TYR B CA     1 
ATOM   4517  C  C      . TYR B 2 132 ? 6.997   71.540 224.596 1.00 116.88 ? 210 TYR B C      1 
ATOM   4518  O  O      . TYR B 2 132 ? 6.221   72.041 225.418 1.00 114.18 ? 210 TYR B O      1 
ATOM   4519  C  CB     . TYR B 2 132 ? 9.104   70.848 225.764 1.00 116.13 ? 210 TYR B CB     1 
ATOM   4520  C  CG     . TYR B 2 132 ? 9.893   69.739 226.427 1.00 116.63 ? 210 TYR B CG     1 
ATOM   4521  C  CD1    . TYR B 2 132 ? 9.471   69.179 227.627 1.00 147.85 ? 210 TYR B CD1    1 
ATOM   4522  C  CD2    . TYR B 2 132 ? 11.058  69.251 225.855 1.00 105.94 ? 210 TYR B CD2    1 
ATOM   4523  C  CE1    . TYR B 2 132 ? 10.188  68.164 228.237 1.00 126.62 ? 210 TYR B CE1    1 
ATOM   4524  C  CE2    . TYR B 2 132 ? 11.782  68.236 226.457 1.00 124.56 ? 210 TYR B CE2    1 
ATOM   4525  C  CZ     . TYR B 2 132 ? 11.343  67.695 227.647 1.00 130.33 ? 210 TYR B CZ     1 
ATOM   4526  O  OH     . TYR B 2 132 ? 12.060  66.684 228.245 1.00 142.08 ? 210 TYR B OH     1 
ATOM   4527  H  H      . TYR B 2 132 ? 9.103   69.554 223.696 1.00 146.71 ? 210 TYR B H      1 
ATOM   4528  H  HA     . TYR B 2 132 ? 7.346   69.809 225.619 1.00 136.80 ? 210 TYR B HA     1 
ATOM   4529  H  HB2    . TYR B 2 132 ? 9.693   71.298 225.138 1.00 139.36 ? 210 TYR B HB2    1 
ATOM   4530  H  HB3    . TYR B 2 132 ? 8.825   71.468 226.455 1.00 139.36 ? 210 TYR B HB3    1 
ATOM   4531  H  HD1    . TYR B 2 132 ? 8.692   69.492 228.027 1.00 177.42 ? 210 TYR B HD1    1 
ATOM   4532  H  HD2    . TYR B 2 132 ? 11.358  69.611 225.052 1.00 127.13 ? 210 TYR B HD2    1 
ATOM   4533  H  HE1    . TYR B 2 132 ? 9.892   67.799 229.039 1.00 151.94 ? 210 TYR B HE1    1 
ATOM   4534  H  HE2    . TYR B 2 132 ? 12.561  67.919 226.059 1.00 149.47 ? 210 TYR B HE2    1 
ATOM   4535  H  HH     . TYR B 2 132 ? 12.736  66.498 227.782 1.00 170.49 ? 210 TYR B HH     1 
ATOM   4536  N  N      . ASP B 2 133 ? 7.101   71.988 223.342 1.00 135.37 ? 211 ASP B N      1 
ATOM   4537  C  CA     . ASP B 2 133 ? 6.255   73.067 222.847 1.00 126.14 ? 211 ASP B CA     1 
ATOM   4538  C  C      . ASP B 2 133 ? 4.831   72.609 222.571 1.00 120.15 ? 211 ASP B C      1 
ATOM   4539  O  O      . ASP B 2 133 ? 3.917   73.440 222.559 1.00 145.86 ? 211 ASP B O      1 
ATOM   4540  C  CB     . ASP B 2 133 ? 6.843   73.668 221.565 1.00 130.03 ? 211 ASP B CB     1 
ATOM   4541  C  CG     . ASP B 2 133 ? 8.000   74.607 221.833 1.00 144.15 ? 211 ASP B CG     1 
ATOM   4542  O  OD1    . ASP B 2 133 ? 8.405   74.737 223.008 1.00 144.21 ? 211 ASP B OD1    1 
ATOM   4543  O  OD2    . ASP B 2 133 ? 8.512   75.209 220.864 1.00 148.67 ? 211 ASP B OD2    1 
ATOM   4544  H  H      . ASP B 2 133 ? 7.655   71.681 222.760 1.00 162.44 ? 211 ASP B H      1 
ATOM   4545  H  HA     . ASP B 2 133 ? 6.218   73.769 223.516 1.00 151.37 ? 211 ASP B HA     1 
ATOM   4546  H  HB2    . ASP B 2 133 ? 7.165   72.949 220.999 1.00 156.03 ? 211 ASP B HB2    1 
ATOM   4547  H  HB3    . ASP B 2 133 ? 6.151   74.168 221.105 1.00 156.03 ? 211 ASP B HB3    1 
ATOM   4548  N  N      . GLN B 2 134 ? 4.624   71.316 222.346 1.00 101.21 ? 212 GLN B N      1 
ATOM   4549  C  CA     . GLN B 2 134 ? 3.312   70.788 222.007 1.00 94.53  ? 212 GLN B CA     1 
ATOM   4550  C  C      . GLN B 2 134 ? 2.506   70.362 223.226 1.00 106.15 ? 212 GLN B C      1 
ATOM   4551  O  O      . GLN B 2 134 ? 1.351   69.954 223.072 1.00 114.44 ? 212 GLN B O      1 
ATOM   4552  C  CB     . GLN B 2 134 ? 3.465   69.602 221.052 1.00 100.90 ? 212 GLN B CB     1 
ATOM   4553  C  CG     . GLN B 2 134 ? 4.036   69.987 219.701 1.00 114.76 ? 212 GLN B CG     1 
ATOM   4554  C  CD     . GLN B 2 134 ? 3.138   70.955 218.954 1.00 135.88 ? 212 GLN B CD     1 
ATOM   4555  O  OE1    . GLN B 2 134 ? 1.970   71.135 219.303 1.00 127.05 ? 212 GLN B OE1    1 
ATOM   4556  N  NE2    . GLN B 2 134 ? 3.683   71.593 217.928 1.00 132.09 ? 212 GLN B NE2    1 
ATOM   4557  H  H      . GLN B 2 134 ? 5.238   70.716 222.386 1.00 121.45 ? 212 GLN B H      1 
ATOM   4558  H  HA     . GLN B 2 134 ? 2.808   71.477 221.546 1.00 113.44 ? 212 GLN B HA     1 
ATOM   4559  H  HB2    . GLN B 2 134 ? 4.062   68.951 221.453 1.00 121.08 ? 212 GLN B HB2    1 
ATOM   4560  H  HB3    . GLN B 2 134 ? 2.593   69.203 220.904 1.00 121.08 ? 212 GLN B HB3    1 
ATOM   4561  H  HG2    . GLN B 2 134 ? 4.897   70.414 219.830 1.00 137.71 ? 212 GLN B HG2    1 
ATOM   4562  H  HG3    . GLN B 2 134 ? 4.137   69.189 219.160 1.00 137.71 ? 212 GLN B HG3    1 
ATOM   4563  H  HE21   . GLN B 2 134 ? 4.505   71.448 217.719 1.00 158.50 ? 212 GLN B HE21   1 
ATOM   4564  H  HE22   . GLN B 2 134 ? 3.216   72.151 217.471 1.00 158.50 ? 212 GLN B HE22   1 
ATOM   4565  N  N      . VAL B 2 135 ? 3.078   70.456 224.425 1.00 114.70 ? 213 VAL B N      1 
ATOM   4566  C  CA     . VAL B 2 135 ? 2.398   70.019 225.640 1.00 103.28 ? 213 VAL B CA     1 
ATOM   4567  C  C      . VAL B 2 135 ? 2.025   71.227 226.488 1.00 117.44 ? 213 VAL B C      1 
ATOM   4568  O  O      . VAL B 2 135 ? 2.258   72.378 226.097 1.00 142.62 ? 213 VAL B O      1 
ATOM   4569  C  CB     . VAL B 2 135 ? 3.273   69.041 226.446 1.00 121.16 ? 213 VAL B CB     1 
ATOM   4570  C  CG1    . VAL B 2 135 ? 3.511   67.768 225.656 1.00 114.65 ? 213 VAL B CG1    1 
ATOM   4571  C  CG2    . VAL B 2 135 ? 4.600   69.695 226.832 1.00 152.03 ? 213 VAL B CG2    1 
ATOM   4572  H  H      . VAL B 2 135 ? 3.866   70.772 224.562 1.00 137.64 ? 213 VAL B H      1 
ATOM   4573  H  HA     . VAL B 2 135 ? 1.580   69.559 225.396 1.00 123.93 ? 213 VAL B HA     1 
ATOM   4574  H  HB     . VAL B 2 135 ? 2.808   68.803 227.263 1.00 145.40 ? 213 VAL B HB     1 
ATOM   4575  H  HG11   . VAL B 2 135 ? 4.063   67.169 226.182 1.00 137.58 ? 213 VAL B HG11   1 
ATOM   4576  H  HG12   . VAL B 2 135 ? 2.657   67.351 225.465 1.00 137.58 ? 213 VAL B HG12   1 
ATOM   4577  H  HG13   . VAL B 2 135 ? 3.963   67.992 224.827 1.00 137.58 ? 213 VAL B HG13   1 
ATOM   4578  H  HG21   . VAL B 2 135 ? 5.129   69.058 227.337 1.00 182.44 ? 213 VAL B HG21   1 
ATOM   4579  H  HG22   . VAL B 2 135 ? 5.072   69.951 226.024 1.00 182.44 ? 213 VAL B HG22   1 
ATOM   4580  H  HG23   . VAL B 2 135 ? 4.419   70.479 227.373 1.00 182.44 ? 213 VAL B HG23   1 
ATOM   4581  N  N      . HIS B 2 136 ? 1.437   70.965 227.652 1.00 113.62 ? 214 HIS B N      1 
ATOM   4582  C  CA     . HIS B 2 136 ? 1.111   72.021 228.592 1.00 115.67 ? 214 HIS B CA     1 
ATOM   4583  C  C      . HIS B 2 136 ? 2.390   72.540 229.250 1.00 135.58 ? 214 HIS B C      1 
ATOM   4584  O  O      . HIS B 2 136 ? 3.372   71.805 229.376 1.00 132.42 ? 214 HIS B O      1 
ATOM   4585  C  CB     . HIS B 2 136 ? 0.159   71.492 229.663 1.00 109.82 ? 214 HIS B CB     1 
ATOM   4586  C  CG     . HIS B 2 136 ? -0.600  72.560 230.388 1.00 132.04 ? 214 HIS B CG     1 
ATOM   4587  N  ND1    . HIS B 2 136 ? -1.406  73.475 229.745 1.00 132.38 ? 214 HIS B ND1    1 
ATOM   4588  C  CD2    . HIS B 2 136 ? -0.686  72.848 231.708 1.00 121.15 ? 214 HIS B CD2    1 
ATOM   4589  C  CE1    . HIS B 2 136 ? -1.946  74.287 230.637 1.00 116.77 ? 214 HIS B CE1    1 
ATOM   4590  N  NE2    . HIS B 2 136 ? -1.527  73.925 231.836 1.00 121.81 ? 214 HIS B NE2    1 
ATOM   4591  H  H      . HIS B 2 136 ? 1.217   70.178 227.918 1.00 136.35 ? 214 HIS B H      1 
ATOM   4592  H  HA     . HIS B 2 136 ? 0.681   72.754 228.125 1.00 138.80 ? 214 HIS B HA     1 
ATOM   4593  H  HB2    . HIS B 2 136 ? -0.488  70.904 229.242 1.00 131.78 ? 214 HIS B HB2    1 
ATOM   4594  H  HB3    . HIS B 2 136 ? 0.672   70.997 230.320 1.00 131.78 ? 214 HIS B HB3    1 
ATOM   4595  H  HD1    . HIS B 2 136 ? -1.532  73.515 228.895 1.00 158.85 ? 214 HIS B HD1    1 
ATOM   4596  H  HD2    . HIS B 2 136 ? -0.252  72.401 232.399 1.00 145.38 ? 214 HIS B HD2    1 
ATOM   4597  H  HE1    . HIS B 2 136 ? -2.527  74.989 230.452 1.00 140.12 ? 214 HIS B HE1    1 
ATOM   4598  N  N      . PRO B 2 137 ? 2.412   73.807 229.673 1.00 128.26 ? 215 PRO B N      1 
ATOM   4599  C  CA     . PRO B 2 137 ? 3.549   74.258 230.497 1.00 126.01 ? 215 PRO B CA     1 
ATOM   4600  C  C      . PRO B 2 137 ? 3.728   73.433 231.762 1.00 130.36 ? 215 PRO B C      1 
ATOM   4601  O  O      . PRO B 2 137 ? 4.851   73.014 232.076 1.00 107.39 ? 215 PRO B O      1 
ATOM   4602  C  CB     . PRO B 2 137 ? 3.201   75.727 230.798 1.00 138.23 ? 215 PRO B CB     1 
ATOM   4603  C  CG     . PRO B 2 137 ? 1.761   75.899 230.394 1.00 143.42 ? 215 PRO B CG     1 
ATOM   4604  C  CD     . PRO B 2 137 ? 1.551   74.935 229.284 1.00 130.35 ? 215 PRO B CD     1 
ATOM   4605  H  HA     . PRO B 2 137 ? 4.369   74.227 229.979 1.00 151.21 ? 215 PRO B HA     1 
ATOM   4606  H  HB2    . PRO B 2 137 ? 3.312   75.899 231.746 1.00 165.87 ? 215 PRO B HB2    1 
ATOM   4607  H  HB3    . PRO B 2 137 ? 3.773   76.310 230.276 1.00 165.87 ? 215 PRO B HB3    1 
ATOM   4608  H  HG2    . PRO B 2 137 ? 1.184   75.688 231.145 1.00 172.10 ? 215 PRO B HG2    1 
ATOM   4609  H  HG3    . PRO B 2 137 ? 1.613   76.808 230.091 1.00 172.10 ? 215 PRO B HG3    1 
ATOM   4610  H  HD2    . PRO B 2 137 ? 0.623   74.657 229.245 1.00 156.42 ? 215 PRO B HD2    1 
ATOM   4611  H  HD3    . PRO B 2 137 ? 1.847   75.315 228.442 1.00 156.42 ? 215 PRO B HD3    1 
ATOM   4612  N  N      . ASP B 2 138 ? 2.644   73.171 232.494 1.00 128.37 ? 216 ASP B N      1 
ATOM   4613  C  CA     . ASP B 2 138 ? 2.735   72.423 233.747 1.00 119.41 ? 216 ASP B CA     1 
ATOM   4614  C  C      . ASP B 2 138 ? 3.020   70.931 233.539 1.00 128.97 ? 216 ASP B C      1 
ATOM   4615  O  O      . ASP B 2 138 ? 2.951   70.184 234.523 1.00 144.69 ? 216 ASP B O      1 
ATOM   4616  C  CB     . ASP B 2 138 ? 1.447   72.594 234.556 1.00 129.03 ? 216 ASP B CB     1 
ATOM   4617  C  CG     . ASP B 2 138 ? 1.132   74.048 234.854 1.00 135.36 ? 216 ASP B CG     1 
ATOM   4618  O  OD1    . ASP B 2 138 ? 1.976   74.918 234.549 1.00 145.87 ? 216 ASP B OD1    1 
ATOM   4619  O  OD2    . ASP B 2 138 ? 0.040   74.322 235.396 1.00 122.87 ? 216 ASP B OD2    1 
ATOM   4620  H  H      . ASP B 2 138 ? 1.845   73.414 232.286 1.00 154.04 ? 216 ASP B H      1 
ATOM   4621  H  HA     . ASP B 2 138 ? 3.463   72.790 234.273 1.00 143.29 ? 216 ASP B HA     1 
ATOM   4622  H  HB2    . ASP B 2 138 ? 0.705   72.224 234.052 1.00 154.84 ? 216 ASP B HB2    1 
ATOM   4623  H  HB3    . ASP B 2 138 ? 1.539   72.127 235.401 1.00 154.84 ? 216 ASP B HB3    1 
ATOM   4624  N  N      . ASP B 2 139 ? 3.328   70.476 232.324 1.00 131.63 ? 217 ASP B N      1 
ATOM   4625  C  CA     . ASP B 2 139 ? 3.696   69.088 232.078 1.00 109.20 ? 217 ASP B CA     1 
ATOM   4626  C  C      . ASP B 2 139 ? 5.162   68.909 231.716 1.00 118.15 ? 217 ASP B C      1 
ATOM   4627  O  O      . ASP B 2 139 ? 5.624   67.767 231.626 1.00 117.45 ? 217 ASP B O      1 
ATOM   4628  C  CB     . ASP B 2 139 ? 2.830   68.506 230.953 1.00 99.94  ? 217 ASP B CB     1 
ATOM   4629  C  CG     . ASP B 2 139 ? 1.461   68.075 231.436 1.00 109.31 ? 217 ASP B CG     1 
ATOM   4630  O  OD1    . ASP B 2 139 ? 1.362   67.570 232.574 1.00 104.36 ? 217 ASP B OD1    1 
ATOM   4631  O  OD2    . ASP B 2 139 ? 0.482   68.248 230.680 1.00 127.88 ? 217 ASP B OD2    1 
ATOM   4632  H  H      . ASP B 2 139 ? 3.331   70.964 231.616 1.00 157.95 ? 217 ASP B H      1 
ATOM   4633  H  HA     . ASP B 2 139 ? 3.524   68.573 232.882 1.00 131.04 ? 217 ASP B HA     1 
ATOM   4634  H  HB2    . ASP B 2 139 ? 2.708   69.179 230.266 1.00 119.93 ? 217 ASP B HB2    1 
ATOM   4635  H  HB3    . ASP B 2 139 ? 3.275   67.728 230.581 1.00 119.93 ? 217 ASP B HB3    1 
ATOM   4636  N  N      . VAL B 2 140 ? 5.902   69.998 231.508 1.00 113.88 ? 218 VAL B N      1 
ATOM   4637  C  CA     . VAL B 2 140 ? 7.306   69.887 231.122 1.00 114.34 ? 218 VAL B CA     1 
ATOM   4638  C  C      . VAL B 2 140 ? 8.092   69.144 232.194 1.00 105.48 ? 218 VAL B C      1 
ATOM   4639  O  O      . VAL B 2 140 ? 8.790   68.163 231.910 1.00 115.13 ? 218 VAL B O      1 
ATOM   4640  C  CB     . VAL B 2 140 ? 7.894   71.284 230.854 1.00 136.69 ? 218 VAL B CB     1 
ATOM   4641  C  CG1    . VAL B 2 140 ? 9.405   71.212 230.633 1.00 128.97 ? 218 VAL B CG1    1 
ATOM   4642  C  CG2    . VAL B 2 140 ? 7.201   71.920 229.657 1.00 123.89 ? 218 VAL B CG2    1 
ATOM   4643  H  H      . VAL B 2 140 ? 5.617   70.806 231.583 1.00 136.66 ? 218 VAL B H      1 
ATOM   4644  H  HA     . VAL B 2 140 ? 7.367   69.375 230.300 1.00 137.21 ? 218 VAL B HA     1 
ATOM   4645  H  HB     . VAL B 2 140 ? 7.731   71.848 231.627 1.00 164.03 ? 218 VAL B HB     1 
ATOM   4646  H  HG11   . VAL B 2 140 ? 9.742   72.107 230.467 1.00 154.76 ? 218 VAL B HG11   1 
ATOM   4647  H  HG12   . VAL B 2 140 ? 9.822   70.842 231.426 1.00 154.76 ? 218 VAL B HG12   1 
ATOM   4648  H  HG13   . VAL B 2 140 ? 9.584   70.644 229.868 1.00 154.76 ? 218 VAL B HG13   1 
ATOM   4649  H  HG21   . VAL B 2 140 ? 7.582   72.798 229.502 1.00 148.67 ? 218 VAL B HG21   1 
ATOM   4650  H  HG22   . VAL B 2 140 ? 7.338   71.357 228.879 1.00 148.67 ? 218 VAL B HG22   1 
ATOM   4651  H  HG23   . VAL B 2 140 ? 6.253   71.998 229.846 1.00 148.67 ? 218 VAL B HG23   1 
ATOM   4652  N  N      . ASP B 2 141 ? 7.996   69.606 233.443 1.00 127.12 ? 219 ASP B N      1 
ATOM   4653  C  CA     . ASP B 2 141 ? 8.754   68.980 234.521 1.00 138.21 ? 219 ASP B CA     1 
ATOM   4654  C  C      . ASP B 2 141 ? 8.379   67.513 234.675 1.00 129.06 ? 219 ASP B C      1 
ATOM   4655  O  O      . ASP B 2 141 ? 9.248   66.664 234.906 1.00 129.25 ? 219 ASP B O      1 
ATOM   4656  C  CB     . ASP B 2 141 ? 8.528   69.733 235.832 1.00 145.09 ? 219 ASP B CB     1 
ATOM   4657  C  CG     . ASP B 2 141 ? 9.215   71.083 235.856 1.00 138.09 ? 219 ASP B CG     1 
ATOM   4658  O  OD1    . ASP B 2 141 ? 9.848   71.447 234.842 1.00 138.57 ? 219 ASP B OD1    1 
ATOM   4659  O  OD2    . ASP B 2 141 ? 9.126   71.778 236.889 1.00 131.64 ? 219 ASP B OD2    1 
ATOM   4660  H  H      . ASP B 2 141 ? 7.507   70.270 233.687 1.00 152.55 ? 219 ASP B H      1 
ATOM   4661  H  HA     . ASP B 2 141 ? 9.700   69.026 234.309 1.00 165.85 ? 219 ASP B HA     1 
ATOM   4662  H  HB2    . ASP B 2 141 ? 7.576   69.878 235.953 1.00 174.11 ? 219 ASP B HB2    1 
ATOM   4663  H  HB3    . ASP B 2 141 ? 8.879   69.204 236.565 1.00 174.11 ? 219 ASP B HB3    1 
ATOM   4664  N  N      . LYS B 2 142 ? 7.089   67.193 234.542 1.00 121.46 ? 220 LYS B N      1 
ATOM   4665  C  CA     . LYS B 2 142 ? 6.646   65.810 234.654 1.00 112.49 ? 220 LYS B CA     1 
ATOM   4666  C  C      . LYS B 2 142 ? 7.067   64.974 233.455 1.00 102.31 ? 220 LYS B C      1 
ATOM   4667  O  O      . LYS B 2 142 ? 7.021   63.742 233.528 1.00 94.41  ? 220 LYS B O      1 
ATOM   4668  C  CB     . LYS B 2 142 ? 5.128   65.755 234.807 1.00 120.48 ? 220 LYS B CB     1 
ATOM   4669  C  CG     . LYS B 2 142 ? 4.616   66.350 236.106 1.00 123.10 ? 220 LYS B CG     1 
ATOM   4670  C  CD     . LYS B 2 142 ? 3.102   66.253 236.193 1.00 114.34 ? 220 LYS B CD     1 
ATOM   4671  C  CE     . LYS B 2 142 ? 2.589   66.758 237.529 1.00 123.27 ? 220 LYS B CE     1 
ATOM   4672  N  NZ     . LYS B 2 142 ? 1.106   66.673 237.627 1.00 123.61 ? 220 LYS B NZ     1 
ATOM   4673  H  H      . LYS B 2 142 ? 6.458   67.757 234.388 1.00 145.76 ? 220 LYS B H      1 
ATOM   4674  H  HA     . LYS B 2 142 ? 7.042   65.415 235.447 1.00 134.99 ? 220 LYS B HA     1 
ATOM   4675  H  HB2    . LYS B 2 142 ? 4.723   66.247 234.076 1.00 144.58 ? 220 LYS B HB2    1 
ATOM   4676  H  HB3    . LYS B 2 142 ? 4.845   64.827 234.775 1.00 144.58 ? 220 LYS B HB3    1 
ATOM   4677  H  HG2    . LYS B 2 142 ? 4.996   65.865 236.855 1.00 147.72 ? 220 LYS B HG2    1 
ATOM   4678  H  HG3    . LYS B 2 142 ? 4.864   67.287 236.151 1.00 147.72 ? 220 LYS B HG3    1 
ATOM   4679  H  HD2    . LYS B 2 142 ? 2.706   66.792 235.491 1.00 137.21 ? 220 LYS B HD2    1 
ATOM   4680  H  HD3    . LYS B 2 142 ? 2.835   65.325 236.095 1.00 137.21 ? 220 LYS B HD3    1 
ATOM   4681  H  HE2    . LYS B 2 142 ? 2.970   66.220 238.241 1.00 147.92 ? 220 LYS B HE2    1 
ATOM   4682  H  HE3    . LYS B 2 142 ? 2.846   67.687 237.638 1.00 147.92 ? 220 LYS B HE3    1 
ATOM   4683  H  HZ1    . LYS B 2 142 ? 0.835   66.976 238.419 1.00 148.33 ? 220 LYS B HZ1    1 
ATOM   4684  H  HZ2    . LYS B 2 142 ? 0.730   67.164 236.986 1.00 148.33 ? 220 LYS B HZ2    1 
ATOM   4685  H  HZ3    . LYS B 2 142 ? 0.843   65.828 237.535 1.00 148.33 ? 220 LYS B HZ3    1 
ATOM   4686  N  N      . LEU B 2 143 ? 7.476   65.612 232.359 1.00 133.63 ? 221 LEU B N      1 
ATOM   4687  C  CA     . LEU B 2 143 ? 7.889   64.898 231.158 1.00 103.72 ? 221 LEU B CA     1 
ATOM   4688  C  C      . LEU B 2 143 ? 9.389   64.614 231.153 1.00 106.48 ? 221 LEU B C      1 
ATOM   4689  O  O      . LEU B 2 143 ? 9.811   63.496 230.845 1.00 100.66 ? 221 LEU B O      1 
ATOM   4690  C  CB     . LEU B 2 143 ? 7.490   65.704 229.920 1.00 94.41  ? 221 LEU B CB     1 
ATOM   4691  C  CG     . LEU B 2 143 ? 8.034   65.213 228.579 1.00 114.54 ? 221 LEU B CG     1 
ATOM   4692  C  CD1    . LEU B 2 143 ? 7.713   63.742 228.360 1.00 125.53 ? 221 LEU B CD1    1 
ATOM   4693  C  CD2    . LEU B 2 143 ? 7.462   66.060 227.458 1.00 126.62 ? 221 LEU B CD2    1 
ATOM   4694  H  H      . LEU B 2 143 ? 7.523   66.468 232.288 1.00 160.36 ? 221 LEU B H      1 
ATOM   4695  H  HA     . LEU B 2 143 ? 7.425   64.047 231.123 1.00 124.47 ? 221 LEU B HA     1 
ATOM   4696  H  HB2    . LEU B 2 143 ? 6.522   65.700 229.856 1.00 113.30 ? 221 LEU B HB2    1 
ATOM   4697  H  HB3    . LEU B 2 143 ? 7.800   66.615 230.039 1.00 113.30 ? 221 LEU B HB3    1 
ATOM   4698  H  HG     . LEU B 2 143 ? 8.998   65.315 228.571 1.00 137.45 ? 221 LEU B HG     1 
ATOM   4699  H  HD11   . LEU B 2 143 ? 8.071   63.465 227.502 1.00 150.63 ? 221 LEU B HD11   1 
ATOM   4700  H  HD12   . LEU B 2 143 ? 8.117   63.222 229.071 1.00 150.63 ? 221 LEU B HD12   1 
ATOM   4701  H  HD13   . LEU B 2 143 ? 6.750   63.624 228.370 1.00 150.63 ? 221 LEU B HD13   1 
ATOM   4702  H  HD21   . LEU B 2 143 ? 7.813   65.741 226.612 1.00 151.95 ? 221 LEU B HD21   1 
ATOM   4703  H  HD22   . LEU B 2 143 ? 6.495   65.983 227.466 1.00 151.95 ? 221 LEU B HD22   1 
ATOM   4704  H  HD23   . LEU B 2 143 ? 7.722   66.984 227.597 1.00 151.95 ? 221 LEU B HD23   1 
ATOM   4705  N  N      . ARG B 2 144 ? 10.204  65.615 231.495 1.00 132.61 ? 222 ARG B N      1 
ATOM   4706  C  CA     . ARG B 2 144 ? 11.648  65.410 231.552 1.00 127.91 ? 222 ARG B CA     1 
ATOM   4707  C  C      . ARG B 2 144 ? 12.014  64.249 232.467 1.00 133.50 ? 222 ARG B C      1 
ATOM   4708  O  O      . ARG B 2 144 ? 13.060  63.618 232.278 1.00 131.04 ? 222 ARG B O      1 
ATOM   4709  C  CB     . ARG B 2 144 ? 12.339  66.692 232.019 1.00 132.20 ? 222 ARG B CB     1 
ATOM   4710  C  CG     . ARG B 2 144 ? 12.219  67.844 231.036 1.00 144.48 ? 222 ARG B CG     1 
ATOM   4711  C  CD     . ARG B 2 144 ? 12.845  69.124 231.561 1.00 158.63 ? 222 ARG B CD     1 
ATOM   4712  N  NE     . ARG B 2 144 ? 12.828  70.181 230.553 1.00 147.70 ? 222 ARG B NE     1 
ATOM   4713  C  CZ     . ARG B 2 144 ? 13.366  71.386 230.717 1.00 143.61 ? 222 ARG B CZ     1 
ATOM   4714  N  NH1    . ARG B 2 144 ? 13.971  71.701 231.854 1.00 155.76 ? 222 ARG B NH1    1 
ATOM   4715  N  NH2    . ARG B 2 144 ? 13.300  72.279 229.739 1.00 128.53 ? 222 ARG B NH2    1 
ATOM   4716  H  H      . ARG B 2 144 ? 9.947   66.411 231.695 1.00 159.13 ? 222 ARG B H      1 
ATOM   4717  H  HA     . ARG B 2 144 ? 11.972  65.203 230.662 1.00 153.49 ? 222 ARG B HA     1 
ATOM   4718  H  HB2    . ARG B 2 144 ? 11.940  66.974 232.858 1.00 158.64 ? 222 ARG B HB2    1 
ATOM   4719  H  HB3    . ARG B 2 144 ? 13.283  66.509 232.149 1.00 158.64 ? 222 ARG B HB3    1 
ATOM   4720  H  HG2    . ARG B 2 144 ? 12.670  67.605 230.211 1.00 173.38 ? 222 ARG B HG2    1 
ATOM   4721  H  HG3    . ARG B 2 144 ? 11.280  68.017 230.863 1.00 173.38 ? 222 ARG B HG3    1 
ATOM   4722  H  HD2    . ARG B 2 144 ? 12.344  69.431 232.333 1.00 190.36 ? 222 ARG B HD2    1 
ATOM   4723  H  HD3    . ARG B 2 144 ? 13.767  68.952 231.806 1.00 190.36 ? 222 ARG B HD3    1 
ATOM   4724  H  HE     . ARG B 2 144 ? 12.443  70.013 229.802 1.00 177.24 ? 222 ARG B HE     1 
ATOM   4725  H  HH11   . ARG B 2 144 ? 14.017  71.125 232.491 1.00 186.92 ? 222 ARG B HH11   1 
ATOM   4726  H  HH12   . ARG B 2 144 ? 14.318  72.482 231.955 1.00 186.92 ? 222 ARG B HH12   1 
ATOM   4727  H  HH21   . ARG B 2 144 ? 12.908  72.079 229.000 1.00 154.23 ? 222 ARG B HH21   1 
ATOM   4728  H  HH22   . ARG B 2 144 ? 13.647  73.059 229.844 1.00 154.23 ? 222 ARG B HH22   1 
ATOM   4729  N  N      . GLU B 2 145 ? 11.170  63.951 233.459 1.00 149.38 ? 223 GLU B N      1 
ATOM   4730  C  CA     . GLU B 2 145 ? 11.428  62.800 234.319 1.00 123.09 ? 223 GLU B CA     1 
ATOM   4731  C  C      . GLU B 2 145 ? 11.411  61.515 233.507 1.00 110.11 ? 223 GLU B C      1 
ATOM   4732  O  O      . GLU B 2 145 ? 12.222  60.610 233.738 1.00 127.98 ? 223 GLU B O      1 
ATOM   4733  C  CB     . GLU B 2 145 ? 10.399  62.726 235.450 1.00 122.40 ? 223 GLU B CB     1 
ATOM   4734  C  CG     . GLU B 2 145 ? 9.933   64.076 235.976 1.00 134.21 ? 223 GLU B CG     1 
ATOM   4735  C  CD     . GLU B 2 145 ? 9.309   63.997 237.356 1.00 137.56 ? 223 GLU B CD     1 
ATOM   4736  O  OE1    . GLU B 2 145 ? 9.289   62.895 237.942 1.00 132.45 ? 223 GLU B OE1    1 
ATOM   4737  O  OE2    . GLU B 2 145 ? 8.830   65.041 237.851 1.00 126.73 ? 223 GLU B OE2    1 
ATOM   4738  H  H      . GLU B 2 145 ? 10.457  64.391 233.651 1.00 179.26 ? 223 GLU B H      1 
ATOM   4739  H  HA     . GLU B 2 145 ? 12.308  62.893 234.718 1.00 147.70 ? 223 GLU B HA     1 
ATOM   4740  H  HB2    . GLU B 2 145 ? 9.618   62.251 235.127 1.00 146.89 ? 223 GLU B HB2    1 
ATOM   4741  H  HB3    . GLU B 2 145 ? 10.791  62.242 236.193 1.00 146.89 ? 223 GLU B HB3    1 
ATOM   4742  H  HG2    . GLU B 2 145 ? 10.695  64.674 236.026 1.00 161.05 ? 223 GLU B HG2    1 
ATOM   4743  H  HG3    . GLU B 2 145 ? 9.269   64.438 235.368 1.00 161.05 ? 223 GLU B HG3    1 
ATOM   4744  N  N      . GLN B 2 146 ? 10.493  61.423 232.541 1.00 119.95 ? 224 GLN B N      1 
ATOM   4745  C  CA     . GLN B 2 146 ? 10.434  60.251 231.675 1.00 133.12 ? 224 GLN B CA     1 
ATOM   4746  C  C      . GLN B 2 146 ? 11.704  60.103 230.851 1.00 150.46 ? 224 GLN B C      1 
ATOM   4747  O  O      . GLN B 2 146 ? 12.073  58.987 230.475 1.00 154.28 ? 224 GLN B O      1 
ATOM   4748  C  CB     . GLN B 2 146 ? 9.222   60.342 230.745 1.00 108.98 ? 224 GLN B CB     1 
ATOM   4749  C  CG     . GLN B 2 146 ? 8.225   59.212 230.892 1.00 116.53 ? 224 GLN B CG     1 
ATOM   4750  C  CD     . GLN B 2 146 ? 7.391   59.322 232.152 1.00 120.99 ? 224 GLN B CD     1 
ATOM   4751  O  OE1    . GLN B 2 146 ? 7.057   60.419 232.596 1.00 106.55 ? 224 GLN B OE1    1 
ATOM   4752  N  NE2    . GLN B 2 146 ? 7.048   58.177 232.737 1.00 117.19 ? 224 GLN B NE2    1 
ATOM   4753  H  H      . GLN B 2 146 ? 9.900   62.022 232.370 1.00 143.94 ? 224 GLN B H      1 
ATOM   4754  H  HA     . GLN B 2 146 ? 10.335  59.457 232.223 1.00 159.75 ? 224 GLN B HA     1 
ATOM   4755  H  HB2    . GLN B 2 146 ? 8.753   61.172 230.927 1.00 130.77 ? 224 GLN B HB2    1 
ATOM   4756  H  HB3    . GLN B 2 146 ? 9.535   60.339 229.827 1.00 130.77 ? 224 GLN B HB3    1 
ATOM   4757  H  HG2    . GLN B 2 146 ? 7.623   59.222 230.133 1.00 139.83 ? 224 GLN B HG2    1 
ATOM   4758  H  HG3    . GLN B 2 146 ? 8.706   58.370 230.924 1.00 139.83 ? 224 GLN B HG3    1 
ATOM   4759  H  HE21   . GLN B 2 146 ? 7.299   57.428 232.396 1.00 140.63 ? 224 GLN B HE21   1 
ATOM   4760  H  HE22   . GLN B 2 146 ? 6.574   58.186 233.455 1.00 140.63 ? 224 GLN B HE22   1 
ATOM   4761  N  N      . LEU B 2 147 ? 12.390  61.206 230.566 1.00 169.08 ? 225 LEU B N      1 
ATOM   4762  C  CA     . LEU B 2 147 ? 13.533  61.210 229.655 1.00 139.32 ? 225 LEU B CA     1 
ATOM   4763  C  C      . LEU B 2 147 ? 14.861  61.262 230.402 1.00 136.81 ? 225 LEU B C      1 
ATOM   4764  O  O      . LEU B 2 147 ? 15.801  61.938 229.974 1.00 139.01 ? 225 LEU B O      1 
ATOM   4765  C  CB     . LEU B 2 147 ? 13.408  62.382 228.687 1.00 119.27 ? 225 LEU B CB     1 
ATOM   4766  C  CG     . LEU B 2 147 ? 12.407  62.190 227.539 1.00 112.75 ? 225 LEU B CG     1 
ATOM   4767  C  CD1    . LEU B 2 147 ? 10.989  62.017 228.055 1.00 97.93  ? 225 LEU B CD1    1 
ATOM   4768  C  CD2    . LEU B 2 147 ? 12.464  63.350 226.555 1.00 124.33 ? 225 LEU B CD2    1 
ATOM   4769  H  H      . LEU B 2 147 ? 12.209  61.981 230.893 1.00 202.90 ? 225 LEU B H      1 
ATOM   4770  H  HA     . LEU B 2 147 ? 13.519  60.392 229.134 1.00 167.19 ? 225 LEU B HA     1 
ATOM   4771  H  HB2    . LEU B 2 147 ? 13.129  63.165 229.187 1.00 143.13 ? 225 LEU B HB2    1 
ATOM   4772  H  HB3    . LEU B 2 147 ? 14.277  62.545 228.289 1.00 143.13 ? 225 LEU B HB3    1 
ATOM   4773  H  HG     . LEU B 2 147 ? 12.643  61.384 227.054 1.00 135.30 ? 225 LEU B HG     1 
ATOM   4774  H  HD11   . LEU B 2 147 ? 10.391  61.899 227.300 1.00 117.52 ? 225 LEU B HD11   1 
ATOM   4775  H  HD12   . LEU B 2 147 ? 10.956  61.235 228.628 1.00 117.52 ? 225 LEU B HD12   1 
ATOM   4776  H  HD13   . LEU B 2 147 ? 10.737  62.807 228.557 1.00 117.52 ? 225 LEU B HD13   1 
ATOM   4777  H  HD21   . LEU B 2 147 ? 11.820  63.195 225.847 1.00 149.20 ? 225 LEU B HD21   1 
ATOM   4778  H  HD22   . LEU B 2 147 ? 12.249  64.172 227.024 1.00 149.20 ? 225 LEU B HD22   1 
ATOM   4779  H  HD23   . LEU B 2 147 ? 13.358  63.405 226.184 1.00 149.20 ? 225 LEU B HD23   1 
ATOM   4780  N  N      . SER B 2 148 ? 14.969  60.543 231.521 1.00 147.32 ? 226 SER B N      1 
ATOM   4781  C  CA     . SER B 2 148 ? 16.191  60.577 232.317 1.00 161.33 ? 226 SER B CA     1 
ATOM   4782  C  C      . SER B 2 148 ? 17.302  59.757 231.673 1.00 173.09 ? 226 SER B C      1 
ATOM   4783  O  O      . SER B 2 148 ? 18.454  60.203 231.619 1.00 193.60 ? 226 SER B O      1 
ATOM   4784  C  CB     . SER B 2 148 ? 15.914  60.064 233.730 1.00 159.61 ? 226 SER B CB     1 
ATOM   4785  O  OG     . SER B 2 148 ? 15.546  58.696 233.710 1.00 157.38 ? 226 SER B OG     1 
ATOM   4786  H  H      . SER B 2 148 ? 14.352  60.034 231.838 1.00 176.79 ? 226 SER B H      1 
ATOM   4787  H  HA     . SER B 2 148 ? 16.498  61.495 232.386 1.00 193.60 ? 226 SER B HA     1 
ATOM   4788  H  HB2    . SER B 2 148 ? 16.715  60.167 234.266 1.00 191.53 ? 226 SER B HB2    1 
ATOM   4789  H  HB3    . SER B 2 148 ? 15.188  60.580 234.116 1.00 191.53 ? 226 SER B HB3    1 
ATOM   4790  H  HG     . SER B 2 148 ? 15.396  58.427 234.492 1.00 188.86 ? 226 SER B HG     1 
ATOM   4791  N  N      . THR B 2 149 ? 16.977  58.562 231.184 1.00 162.37 ? 227 THR B N      1 
ATOM   4792  C  CA     . THR B 2 149 ? 17.953  57.688 230.535 1.00 164.55 ? 227 THR B CA     1 
ATOM   4793  C  C      . THR B 2 149 ? 19.077  57.295 231.490 1.00 176.27 ? 227 THR B C      1 
ATOM   4794  O  O      . THR B 2 149 ? 20.209  57.046 231.065 1.00 171.27 ? 227 THR B O      1 
ATOM   4795  C  CB     . THR B 2 149 ? 18.538  58.341 229.276 1.00 139.27 ? 227 THR B CB     1 
ATOM   4796  O  OG1    . THR B 2 149 ? 19.513  59.328 229.644 1.00 140.50 ? 227 THR B OG1    1 
ATOM   4797  C  CG2    . THR B 2 149 ? 17.438  58.997 228.444 1.00 137.18 ? 227 THR B CG2    1 
ATOM   4798  H  H      . THR B 2 149 ? 16.184  58.229 231.217 1.00 194.84 ? 227 THR B H      1 
ATOM   4799  H  HA     . THR B 2 149 ? 17.504  56.874 230.260 1.00 197.46 ? 227 THR B HA     1 
ATOM   4800  H  HB     . THR B 2 149 ? 18.964  57.660 228.733 1.00 167.13 ? 227 THR B HB     1 
ATOM   4801  H  HG1    . THR B 2 149 ? 19.156  59.921 230.119 1.00 168.60 ? 227 THR B HG1    1 
ATOM   4802  H  HG21   . THR B 2 149 ? 17.821  59.405 227.652 1.00 164.61 ? 227 THR B HG21   1 
ATOM   4803  H  HG22   . THR B 2 149 ? 16.788  58.331 228.172 1.00 164.61 ? 227 THR B HG22   1 
ATOM   4804  H  HG23   . THR B 2 149 ? 16.991  59.680 228.967 1.00 164.61 ? 227 THR B HG23   1 
ATOM   4805  N  N      . SER B 2 150 ? 18.779  57.234 232.783 1.00 162.36 ? 228 SER B N      1 
ATOM   4806  C  CA     . SER B 2 150 ? 19.787  56.909 233.784 1.00 156.64 ? 228 SER B CA     1 
ATOM   4807  C  C      . SER B 2 150 ? 20.132  55.425 233.747 1.00 151.63 ? 228 SER B C      1 
ATOM   4808  O  O      . SER B 2 150 ? 21.200  55.016 234.206 1.00 144.77 ? 228 SER B O      1 
ATOM   4809  C  CB     . SER B 2 150 ? 19.299  57.298 235.179 1.00 154.81 ? 228 SER B CB     1 
ATOM   4810  O  OG     . SER B 2 150 ? 18.096  56.622 235.502 1.00 159.65 ? 228 SER B OG     1 
ATOM   4811  H  H      . SER B 2 150 ? 17.996  57.378 233.108 1.00 194.83 ? 228 SER B H      1 
ATOM   4812  H  HA     . SER B 2 150 ? 20.595  57.411 233.596 1.00 187.96 ? 228 SER B HA     1 
ATOM   4813  H  HB2    . SER B 2 150 ? 19.979  57.060 235.829 1.00 185.77 ? 228 SER B HB2    1 
ATOM   4814  H  HB3    . SER B 2 150 ? 19.140  58.254 235.202 1.00 185.77 ? 228 SER B HB3    1 
ATOM   4815  H  HG     . SER B 2 150 ? 17.839  56.845 236.270 1.00 191.58 ? 228 SER B HG     1 
ATOM   4816  N  N      . SER B 2 181 ? 13.251  50.785 230.271 1.00 134.39 ? 259 SER B N      1 
ATOM   4817  C  CA     . SER B 2 181 ? 13.419  50.455 228.860 1.00 137.47 ? 259 SER B CA     1 
ATOM   4818  C  C      . SER B 2 181 ? 12.156  50.783 228.074 1.00 92.64  ? 259 SER B C      1 
ATOM   4819  O  O      . SER B 2 181 ? 12.208  51.031 226.872 1.00 93.67  ? 259 SER B O      1 
ATOM   4820  C  CB     . SER B 2 181 ? 13.770  48.975 228.688 1.00 161.77 ? 259 SER B CB     1 
ATOM   4821  O  OG     . SER B 2 181 ? 12.675  48.145 229.043 1.00 144.03 ? 259 SER B OG     1 
ATOM   4822  H  H      . SER B 2 181 ? 13.123  50.101 230.777 1.00 161.27 ? 259 SER B H      1 
ATOM   4823  H  HA     . SER B 2 181 ? 14.147  50.982 228.495 1.00 164.97 ? 259 SER B HA     1 
ATOM   4824  H  HB2    . SER B 2 181 ? 14.001  48.812 227.760 1.00 194.12 ? 259 SER B HB2    1 
ATOM   4825  H  HB3    . SER B 2 181 ? 14.524  48.762 229.259 1.00 194.12 ? 259 SER B HB3    1 
ATOM   4826  H  HG     . SER B 2 181 ? 12.464  48.275 229.845 1.00 172.84 ? 259 SER B HG     1 
ATOM   4827  N  N      . ARG B 2 182 ? 11.019  50.772 228.763 1.00 86.92  ? 260 ARG B N      1 
ATOM   4828  C  CA     . ARG B 2 182 ? 9.733   51.097 228.164 1.00 79.93  ? 260 ARG B CA     1 
ATOM   4829  C  C      . ARG B 2 182 ? 9.008   52.077 229.071 1.00 81.10  ? 260 ARG B C      1 
ATOM   4830  O  O      . ARG B 2 182 ? 8.933   51.861 230.285 1.00 127.03 ? 260 ARG B O      1 
ATOM   4831  C  CB     . ARG B 2 182 ? 8.883   49.841 227.957 1.00 83.71  ? 260 ARG B CB     1 
ATOM   4832  C  CG     . ARG B 2 182 ? 7.531   50.128 227.340 1.00 99.15  ? 260 ARG B CG     1 
ATOM   4833  C  CD     . ARG B 2 182 ? 6.768   48.864 227.006 1.00 103.60 ? 260 ARG B CD     1 
ATOM   4834  N  NE     . ARG B 2 182 ? 5.571   49.176 226.234 1.00 75.47  ? 260 ARG B NE     1 
ATOM   4835  C  CZ     . ARG B 2 182 ? 5.563   49.403 224.925 1.00 72.62  ? 260 ARG B CZ     1 
ATOM   4836  N  NH1    . ARG B 2 182 ? 6.689   49.348 224.226 1.00 88.17  ? 260 ARG B NH1    1 
ATOM   4837  N  NH2    . ARG B 2 182 ? 4.425   49.686 224.308 1.00 111.35 ? 260 ARG B NH2    1 
ATOM   4838  H  H      . ARG B 2 182 ? 10.968  50.574 229.598 1.00 104.31 ? 260 ARG B H      1 
ATOM   4839  H  HA     . ARG B 2 182 ? 9.873   51.519 227.303 1.00 95.92  ? 260 ARG B HA     1 
ATOM   4840  H  HB2    . ARG B 2 182 ? 9.358   49.235 227.367 1.00 100.45 ? 260 ARG B HB2    1 
ATOM   4841  H  HB3    . ARG B 2 182 ? 8.735   49.417 228.817 1.00 100.45 ? 260 ARG B HB3    1 
ATOM   4842  H  HG2    . ARG B 2 182 ? 6.999   50.643 227.967 1.00 118.97 ? 260 ARG B HG2    1 
ATOM   4843  H  HG3    . ARG B 2 182 ? 7.656   50.629 226.519 1.00 118.97 ? 260 ARG B HG3    1 
ATOM   4844  H  HD2    . ARG B 2 182 ? 7.331   48.278 226.476 1.00 124.32 ? 260 ARG B HD2    1 
ATOM   4845  H  HD3    . ARG B 2 182 ? 6.498   48.423 227.826 1.00 124.32 ? 260 ARG B HD3    1 
ATOM   4846  H  HE     . ARG B 2 182 ? 4.820   49.208 226.652 1.00 90.57  ? 260 ARG B HE     1 
ATOM   4847  H  HH11   . ARG B 2 182 ? 7.431   49.166 224.620 1.00 105.81 ? 260 ARG B HH11   1 
ATOM   4848  H  HH12   . ARG B 2 182 ? 6.677   49.495 223.379 1.00 105.81 ? 260 ARG B HH12   1 
ATOM   4849  H  HH21   . ARG B 2 182 ? 3.691   49.721 224.755 1.00 133.62 ? 260 ARG B HH21   1 
ATOM   4850  H  HH22   . ARG B 2 182 ? 4.419   49.830 223.461 1.00 133.62 ? 260 ARG B HH22   1 
ATOM   4851  N  N      . ARG B 2 183 ? 8.471   53.144 228.486 1.00 84.97  ? 261 ARG B N      1 
ATOM   4852  C  CA     . ARG B 2 183 ? 7.835   54.207 229.248 1.00 105.52 ? 261 ARG B CA     1 
ATOM   4853  C  C      . ARG B 2 183 ? 6.450   54.509 228.700 1.00 93.66  ? 261 ARG B C      1 
ATOM   4854  O  O      . ARG B 2 183 ? 6.223   54.456 227.487 1.00 106.75 ? 261 ARG B O      1 
ATOM   4855  C  CB     . ARG B 2 183 ? 8.687   55.470 229.225 1.00 74.74  ? 261 ARG B CB     1 
ATOM   4856  C  CG     . ARG B 2 183 ? 9.895   55.385 230.129 1.00 100.25 ? 261 ARG B CG     1 
ATOM   4857  C  CD     . ARG B 2 183 ? 10.814  56.557 229.930 1.00 97.11  ? 261 ARG B CD     1 
ATOM   4858  N  NE     . ARG B 2 183 ? 12.204  56.118 229.793 1.00 84.35  ? 261 ARG B NE     1 
ATOM   4859  C  CZ     . ARG B 2 183 ? 13.193  56.405 230.639 1.00 116.98 ? 261 ARG B CZ     1 
ATOM   4860  N  NH1    . ARG B 2 183 ? 12.986  57.156 231.717 1.00 137.21 ? 261 ARG B NH1    1 
ATOM   4861  N  NH2    . ARG B 2 183 ? 14.414  55.945 230.395 1.00 108.81 ? 261 ARG B NH2    1 
ATOM   4862  H  H      . ARG B 2 183 ? 8.464   53.274 227.636 1.00 101.96 ? 261 ARG B H      1 
ATOM   4863  H  HA     . ARG B 2 183 ? 7.739   53.924 230.170 1.00 126.63 ? 261 ARG B HA     1 
ATOM   4864  H  HB2    . ARG B 2 183 ? 9.001   55.622 228.319 1.00 89.68  ? 261 ARG B HB2    1 
ATOM   4865  H  HB3    . ARG B 2 183 ? 8.146   56.220 229.518 1.00 89.68  ? 261 ARG B HB3    1 
ATOM   4866  H  HG2    . ARG B 2 183 ? 9.603   55.382 231.054 1.00 120.30 ? 261 ARG B HG2    1 
ATOM   4867  H  HG3    . ARG B 2 183 ? 10.388  54.574 229.929 1.00 120.30 ? 261 ARG B HG3    1 
ATOM   4868  H  HD2    . ARG B 2 183 ? 10.562  57.030 229.121 1.00 116.53 ? 261 ARG B HD2    1 
ATOM   4869  H  HD3    . ARG B 2 183 ? 10.754  57.147 230.697 1.00 116.53 ? 261 ARG B HD3    1 
ATOM   4870  H  HE     . ARG B 2 183 ? 12.400  55.636 229.108 1.00 101.22 ? 261 ARG B HE     1 
ATOM   4871  H  HH11   . ARG B 2 183 ? 12.199  57.461 231.884 1.00 164.65 ? 261 ARG B HH11   1 
ATOM   4872  H  HH12   . ARG B 2 183 ? 13.637  57.332 232.251 1.00 164.65 ? 261 ARG B HH12   1 
ATOM   4873  H  HH21   . ARG B 2 183 ? 14.560  55.460 229.700 1.00 130.57 ? 261 ARG B HH21   1 
ATOM   4874  H  HH22   . ARG B 2 183 ? 15.058  56.127 230.936 1.00 130.57 ? 261 ARG B HH22   1 
ATOM   4875  N  N      . SER B 2 184 ? 5.532   54.831 229.608 1.00 99.66  ? 262 SER B N      1 
ATOM   4876  C  CA     . SER B 2 184 ? 4.162   55.175 229.267 1.00 89.15  ? 262 SER B CA     1 
ATOM   4877  C  C      . SER B 2 184 ? 3.688   56.259 230.218 1.00 113.44 ? 262 SER B C      1 
ATOM   4878  O  O      . SER B 2 184 ? 4.012   56.230 231.410 1.00 111.72 ? 262 SER B O      1 
ATOM   4879  C  CB     . SER B 2 184 ? 3.233   53.961 229.366 1.00 86.68  ? 262 SER B CB     1 
ATOM   4880  O  OG     . SER B 2 184 ? 1.874   54.365 229.362 1.00 84.27  ? 262 SER B OG     1 
ATOM   4881  H  H      . SER B 2 184 ? 5.689   54.857 230.453 1.00 119.59 ? 262 SER B H      1 
ATOM   4882  H  HA     . SER B 2 184 ? 4.127   55.520 228.361 1.00 106.98 ? 262 SER B HA     1 
ATOM   4883  H  HB2    . SER B 2 184 ? 3.391   53.380 228.605 1.00 104.01 ? 262 SER B HB2    1 
ATOM   4884  H  HB3    . SER B 2 184 ? 3.419   53.487 230.191 1.00 104.01 ? 262 SER B HB3    1 
ATOM   4885  H  HG     . SER B 2 184 ? 1.374   53.692 229.416 1.00 101.12 ? 262 SER B HG     1 
ATOM   4886  N  N      . PHE B 2 185 ? 2.921   57.211 229.698 1.00 99.96  ? 263 PHE B N      1 
ATOM   4887  C  CA     . PHE B 2 185 ? 2.437   58.303 230.530 1.00 88.99  ? 263 PHE B CA     1 
ATOM   4888  C  C      . PHE B 2 185 ? 1.241   58.945 229.844 1.00 71.23  ? 263 PHE B C      1 
ATOM   4889  O  O      . PHE B 2 185 ? 0.783   58.492 228.793 1.00 92.31  ? 263 PHE B O      1 
ATOM   4890  C  CB     . PHE B 2 185 ? 3.546   59.327 230.796 1.00 88.22  ? 263 PHE B CB     1 
ATOM   4891  C  CG     . PHE B 2 185 ? 4.107   59.944 229.554 1.00 70.50  ? 263 PHE B CG     1 
ATOM   4892  C  CD1    . PHE B 2 185 ? 5.166   59.350 228.889 1.00 88.79  ? 263 PHE B CD1    1 
ATOM   4893  C  CD2    . PHE B 2 185 ? 3.578   61.119 229.049 1.00 76.67  ? 263 PHE B CD2    1 
ATOM   4894  C  CE1    . PHE B 2 185 ? 5.688   59.915 227.744 1.00 97.88  ? 263 PHE B CE1    1 
ATOM   4895  C  CE2    . PHE B 2 185 ? 4.096   61.688 227.902 1.00 109.86 ? 263 PHE B CE2    1 
ATOM   4896  C  CZ     . PHE B 2 185 ? 5.153   61.085 227.249 1.00 96.52  ? 263 PHE B CZ     1 
ATOM   4897  H  H      . PHE B 2 185 ? 2.669   57.247 228.876 1.00 119.95 ? 263 PHE B H      1 
ATOM   4898  H  HA     . PHE B 2 185 ? 2.142   57.948 231.383 1.00 106.78 ? 263 PHE B HA     1 
ATOM   4899  H  HB2    . PHE B 2 185 ? 3.187   60.041 231.346 1.00 105.86 ? 263 PHE B HB2    1 
ATOM   4900  H  HB3    . PHE B 2 185 ? 4.273   58.886 231.263 1.00 105.86 ? 263 PHE B HB3    1 
ATOM   4901  H  HD1    . PHE B 2 185 ? 5.530   58.561 229.219 1.00 106.55 ? 263 PHE B HD1    1 
ATOM   4902  H  HD2    . PHE B 2 185 ? 2.866   61.528 229.485 1.00 92.00  ? 263 PHE B HD2    1 
ATOM   4903  H  HE1    . PHE B 2 185 ? 6.399   59.506 227.307 1.00 117.45 ? 263 PHE B HE1    1 
ATOM   4904  H  HE2    . PHE B 2 185 ? 3.734   62.478 227.570 1.00 131.84 ? 263 PHE B HE2    1 
ATOM   4905  H  HZ     . PHE B 2 185 ? 5.503   61.467 226.477 1.00 115.83 ? 263 PHE B HZ     1 
ATOM   4906  N  N      . ILE B 2 186 ? 0.732   60.005 230.461 1.00 78.10  ? 264 ILE B N      1 
ATOM   4907  C  CA     . ILE B 2 186 ? -0.387  60.769 229.929 1.00 75.24  ? 264 ILE B CA     1 
ATOM   4908  C  C      . ILE B 2 186 ? -0.047  62.244 230.068 1.00 89.45  ? 264 ILE B C      1 
ATOM   4909  O  O      . ILE B 2 186 ? 0.574   62.657 231.053 1.00 110.05 ? 264 ILE B O      1 
ATOM   4910  C  CB     . ILE B 2 186 ? -1.706  60.425 230.653 1.00 70.54  ? 264 ILE B CB     1 
ATOM   4911  C  CG1    . ILE B 2 186 ? -2.047  58.946 230.431 1.00 93.16  ? 264 ILE B CG1    1 
ATOM   4912  C  CG2    . ILE B 2 186 ? -2.842  61.329 230.166 1.00 74.52  ? 264 ILE B CG2    1 
ATOM   4913  C  CD1    . ILE B 2 186 ? -3.312  58.473 231.126 1.00 94.56  ? 264 ILE B CD1    1 
ATOM   4914  H  H      . ILE B 2 186 ? 1.027   60.309 231.210 1.00 93.72  ? 264 ILE B H      1 
ATOM   4915  H  HA     . ILE B 2 186 ? -0.494  60.568 228.986 1.00 90.29  ? 264 ILE B HA     1 
ATOM   4916  H  HB     . ILE B 2 186 ? -1.582  60.572 231.604 1.00 84.65  ? 264 ILE B HB     1 
ATOM   4917  H  HG12   . ILE B 2 186 ? -2.161  58.795 229.480 1.00 111.79 ? 264 ILE B HG12   1 
ATOM   4918  H  HG13   . ILE B 2 186 ? -1.312  58.407 230.761 1.00 111.79 ? 264 ILE B HG13   1 
ATOM   4919  H  HG21   . ILE B 2 186 ? -3.657  61.092 230.636 1.00 89.42  ? 264 ILE B HG21   1 
ATOM   4920  H  HG22   . ILE B 2 186 ? -2.610  62.253 230.349 1.00 89.42  ? 264 ILE B HG22   1 
ATOM   4921  H  HG23   . ILE B 2 186 ? -2.960  61.200 229.212 1.00 89.42  ? 264 ILE B HG23   1 
ATOM   4922  H  HD11   . ILE B 2 186 ? -3.446  57.532 230.929 1.00 113.47 ? 264 ILE B HD11   1 
ATOM   4923  H  HD12   . ILE B 2 186 ? -3.213  58.601 232.082 1.00 113.47 ? 264 ILE B HD12   1 
ATOM   4924  H  HD13   . ILE B 2 186 ? -4.064  58.990 230.798 1.00 113.47 ? 264 ILE B HD13   1 
ATOM   4925  N  N      . CYS B 2 187 ? -0.440  63.038 229.076 1.00 99.58  ? 265 CYS B N      1 
ATOM   4926  C  CA     . CYS B 2 187 ? -0.161  64.465 229.103 1.00 85.06  ? 265 CYS B CA     1 
ATOM   4927  C  C      . CYS B 2 187 ? -1.270  65.195 228.360 1.00 103.52 ? 265 CYS B C      1 
ATOM   4928  O  O      . CYS B 2 187 ? -2.194  64.580 227.820 1.00 107.36 ? 265 CYS B O      1 
ATOM   4929  C  CB     . CYS B 2 187 ? 1.215   64.768 228.503 1.00 115.09 ? 265 CYS B CB     1 
ATOM   4930  S  SG     . CYS B 2 187 ? 1.405   64.263 226.779 1.00 144.56 ? 265 CYS B SG     1 
ATOM   4931  H  H      . CYS B 2 187 ? -0.867  62.774 228.378 1.00 119.50 ? 265 CYS B H      1 
ATOM   4932  H  HA     . CYS B 2 187 ? -0.162  64.772 230.024 1.00 102.08 ? 265 CYS B HA     1 
ATOM   4933  H  HB2    . CYS B 2 187 ? 1.370   65.724 228.548 1.00 138.10 ? 265 CYS B HB2    1 
ATOM   4934  H  HB3    . CYS B 2 187 ? 1.889   64.302 229.022 1.00 138.10 ? 265 CYS B HB3    1 
ATOM   4935  H  HG     . CYS B 2 187 ? 2.511   64.544 226.410 1.00 173.47 ? 265 CYS B HG     1 
ATOM   4936  N  N      . ARG B 2 188 ? -1.167  66.520 228.339 1.00 103.43 ? 266 ARG B N      1 
ATOM   4937  C  CA     . ARG B 2 188 ? -2.151  67.389 227.705 1.00 111.23 ? 266 ARG B CA     1 
ATOM   4938  C  C      . ARG B 2 188 ? -1.517  68.021 226.472 1.00 120.16 ? 266 ARG B C      1 
ATOM   4939  O  O      . ARG B 2 188 ? -0.485  68.694 226.577 1.00 124.64 ? 266 ARG B O      1 
ATOM   4940  C  CB     . ARG B 2 188 ? -2.630  68.461 228.683 1.00 83.17  ? 266 ARG B CB     1 
ATOM   4941  C  CG     . ARG B 2 188 ? -3.264  67.905 229.946 1.00 95.72  ? 266 ARG B CG     1 
ATOM   4942  C  CD     . ARG B 2 188 ? -3.293  68.937 231.063 1.00 127.11 ? 266 ARG B CD     1 
ATOM   4943  N  NE     . ARG B 2 188 ? -1.984  69.102 231.690 1.00 132.37 ? 266 ARG B NE     1 
ATOM   4944  C  CZ     . ARG B 2 188 ? -1.744  69.898 232.727 1.00 136.11 ? 266 ARG B CZ     1 
ATOM   4945  N  NH1    . ARG B 2 188 ? -0.520  69.980 233.231 1.00 142.64 ? 266 ARG B NH1    1 
ATOM   4946  N  NH2    . ARG B 2 188 ? -2.724  70.614 233.263 1.00 129.62 ? 266 ARG B NH2    1 
ATOM   4947  H  H      . ARG B 2 188 ? -0.515  66.951 228.696 1.00 124.12 ? 266 ARG B H      1 
ATOM   4948  H  HA     . ARG B 2 188 ? -2.916  66.863 227.424 1.00 133.47 ? 266 ARG B HA     1 
ATOM   4949  H  HB2    . ARG B 2 188 ? -1.871  69.004 228.947 1.00 99.80  ? 266 ARG B HB2    1 
ATOM   4950  H  HB3    . ARG B 2 188 ? -3.292  69.014 228.239 1.00 99.80  ? 266 ARG B HB3    1 
ATOM   4951  H  HG2    . ARG B 2 188 ? -4.177  67.639 229.754 1.00 114.87 ? 266 ARG B HG2    1 
ATOM   4952  H  HG3    . ARG B 2 188 ? -2.750  67.141 230.251 1.00 114.87 ? 266 ARG B HG3    1 
ATOM   4953  H  HD2    . ARG B 2 188 ? -3.563  69.794 230.698 1.00 152.53 ? 266 ARG B HD2    1 
ATOM   4954  H  HD3    . ARG B 2 188 ? -3.921  68.651 231.745 1.00 152.53 ? 266 ARG B HD3    1 
ATOM   4955  H  HE     . ARG B 2 188 ? -1.325  68.653 231.367 1.00 158.84 ? 266 ARG B HE     1 
ATOM   4956  H  HH11   . ARG B 2 188 ? 0.119   69.519 232.887 1.00 171.17 ? 266 ARG B HH11   1 
ATOM   4957  H  HH12   . ARG B 2 188 ? -0.365  70.496 233.902 1.00 171.17 ? 266 ARG B HH12   1 
ATOM   4958  H  HH21   . ARG B 2 188 ? -3.519  70.564 232.941 1.00 155.54 ? 266 ARG B HH21   1 
ATOM   4959  H  HH22   . ARG B 2 188 ? -2.563  71.128 233.934 1.00 155.54 ? 266 ARG B HH22   1 
ATOM   4960  N  N      . MET B 2 189 ? -2.130  67.803 225.310 1.00 84.73  ? 267 MET B N      1 
ATOM   4961  C  CA     . MET B 2 189 ? -1.563  68.238 224.043 1.00 89.79  ? 267 MET B CA     1 
ATOM   4962  C  C      . MET B 2 189 ? -2.387  69.361 223.428 1.00 98.20  ? 267 MET B C      1 
ATOM   4963  O  O      . MET B 2 189 ? -3.553  69.577 223.772 1.00 145.53 ? 267 MET B O      1 
ATOM   4964  C  CB     . MET B 2 189 ? -1.464  67.070 223.060 1.00 111.62 ? 267 MET B CB     1 
ATOM   4965  C  CG     . MET B 2 189 ? -0.298  66.145 223.347 1.00 111.86 ? 267 MET B CG     1 
ATOM   4966  S  SD     . MET B 2 189 ? 0.057   65.046 221.970 1.00 87.59  ? 267 MET B SD     1 
ATOM   4967  C  CE     . MET B 2 189 ? 1.476   64.166 222.613 1.00 106.00 ? 267 MET B CE     1 
ATOM   4968  H  H      . MET B 2 189 ? -2.885  67.399 225.232 1.00 101.68 ? 267 MET B H      1 
ATOM   4969  H  HA     . MET B 2 189 ? -0.664  68.565 224.203 1.00 107.75 ? 267 MET B HA     1 
ATOM   4970  H  HB2    . MET B 2 189 ? -2.279  66.547 223.110 1.00 133.94 ? 267 MET B HB2    1 
ATOM   4971  H  HB3    . MET B 2 189 ? -1.352  67.423 222.164 1.00 133.94 ? 267 MET B HB3    1 
ATOM   4972  H  HG2    . MET B 2 189 ? 0.494   66.677 223.520 1.00 134.23 ? 267 MET B HG2    1 
ATOM   4973  H  HG3    . MET B 2 189 ? -0.509  65.600 224.121 1.00 134.23 ? 267 MET B HG3    1 
ATOM   4974  H  HE1    . MET B 2 189 ? 1.775   63.524 221.950 1.00 127.20 ? 267 MET B HE1    1 
ATOM   4975  H  HE2    . MET B 2 189 ? 2.183   64.803 222.801 1.00 127.20 ? 267 MET B HE2    1 
ATOM   4976  H  HE3    . MET B 2 189 ? 1.219   63.706 223.427 1.00 127.20 ? 267 MET B HE3    1 
ATOM   4977  N  N      . ARG B 2 190 ? -1.754  70.053 222.480 1.00 90.87  ? 268 ARG B N      1 
ATOM   4978  C  CA     . ARG B 2 190 ? -2.256  71.306 221.932 1.00 91.16  ? 268 ARG B CA     1 
ATOM   4979  C  C      . ARG B 2 190 ? -3.211  71.030 220.776 1.00 106.41 ? 268 ARG B C      1 
ATOM   4980  O  O      . ARG B 2 190 ? -2.802  70.500 219.737 1.00 108.35 ? 268 ARG B O      1 
ATOM   4981  C  CB     . ARG B 2 190 ? -1.083  72.177 221.480 1.00 124.29 ? 268 ARG B CB     1 
ATOM   4982  C  CG     . ARG B 2 190 ? -1.443  73.278 220.494 1.00 142.24 ? 268 ARG B CG     1 
ATOM   4983  C  CD     . ARG B 2 190 ? -0.409  74.394 220.495 1.00 138.21 ? 268 ARG B CD     1 
ATOM   4984  N  NE     . ARG B 2 190 ? -0.464  75.178 221.730 1.00 139.68 ? 268 ARG B NE     1 
ATOM   4985  C  CZ     . ARG B 2 190 ? 0.396   75.090 222.743 1.00 131.67 ? 268 ARG B CZ     1 
ATOM   4986  N  NH1    . ARG B 2 190 ? 1.423   74.250 222.702 1.00 125.47 ? 268 ARG B NH1    1 
ATOM   4987  N  NH2    . ARG B 2 190 ? 0.230   75.859 223.812 1.00 141.79 ? 268 ARG B NH2    1 
ATOM   4988  H  H      . ARG B 2 190 ? -1.008  69.806 222.130 1.00 109.05 ? 268 ARG B H      1 
ATOM   4989  H  HA     . ARG B 2 190 ? -2.743  71.785 222.621 1.00 109.39 ? 268 ARG B HA     1 
ATOM   4990  H  HB2    . ARG B 2 190 ? -0.694  72.600 222.261 1.00 149.15 ? 268 ARG B HB2    1 
ATOM   4991  H  HB3    . ARG B 2 190 ? -0.423  71.608 221.054 1.00 149.15 ? 268 ARG B HB3    1 
ATOM   4992  H  HG2    . ARG B 2 190 ? -1.485  72.905 219.599 1.00 170.69 ? 268 ARG B HG2    1 
ATOM   4993  H  HG3    . ARG B 2 190 ? -2.301  73.659 220.739 1.00 170.69 ? 268 ARG B HG3    1 
ATOM   4994  H  HD2    . ARG B 2 190 ? 0.478   74.008 220.420 1.00 165.86 ? 268 ARG B HD2    1 
ATOM   4995  H  HD3    . ARG B 2 190 ? -0.580  74.989 219.749 1.00 165.86 ? 268 ARG B HD3    1 
ATOM   4996  H  HE     . ARG B 2 190 ? -1.107  75.745 221.808 1.00 167.62 ? 268 ARG B HE     1 
ATOM   4997  H  HH11   . ARG B 2 190 ? 1.539   73.747 222.014 1.00 150.57 ? 268 ARG B HH11   1 
ATOM   4998  H  HH12   . ARG B 2 190 ? 1.970   74.207 223.364 1.00 150.57 ? 268 ARG B HH12   1 
ATOM   4999  H  HH21   . ARG B 2 190 ? -0.431  76.408 223.848 1.00 170.15 ? 268 ARG B HH21   1 
ATOM   5000  H  HH22   . ARG B 2 190 ? 0.784   75.808 224.468 1.00 170.15 ? 268 ARG B HH22   1 
ATOM   5001  N  N      . CYS B 2 191 ? -4.479  71.395 220.960 1.00 118.07 ? 269 CYS B N      1 
ATOM   5002  C  CA     . CYS B 2 191 ? -5.495  71.290 219.915 1.00 101.82 ? 269 CYS B CA     1 
ATOM   5003  C  C      . CYS B 2 191 ? -5.559  69.883 219.339 1.00 85.95  ? 269 CYS B C      1 
ATOM   5004  O  O      . CYS B 2 191 ? -5.419  69.693 218.133 1.00 136.29 ? 269 CYS B O      1 
ATOM   5005  C  CB     . CYS B 2 191 ? -5.220  72.303 218.798 1.00 126.77 ? 269 CYS B CB     1 
ATOM   5006  S  SG     . CYS B 2 191 ? -6.526  72.426 217.546 1.00 125.30 ? 269 CYS B SG     1 
ATOM   5007  H  H      . CYS B 2 191 ? -4.781  71.714 221.700 1.00 141.69 ? 269 CYS B H      1 
ATOM   5008  H  HA     . CYS B 2 191 ? -6.362  71.495 220.298 1.00 122.19 ? 269 CYS B HA     1 
ATOM   5009  H  HB2    . CYS B 2 191 ? -5.112  73.181 219.197 1.00 152.13 ? 269 CYS B HB2    1 
ATOM   5010  H  HB3    . CYS B 2 191 ? -4.402  72.048 218.344 1.00 152.13 ? 269 CYS B HB3    1 
ATOM   5011  H  HG     . CYS B 2 191 ? -6.668  71.356 217.022 1.00 150.36 ? 269 CYS B HG     1 
ATOM   5012  N  N      . HIS B 2 196 ? -8.661  73.658 222.538 1.00 108.10 ? 302 HIS B N      1 
ATOM   5013  C  CA     . HIS B 2 196 ? -7.340  74.183 222.862 1.00 118.59 ? 302 HIS B CA     1 
ATOM   5014  C  C      . HIS B 2 196 ? -6.403  73.048 223.263 1.00 123.33 ? 302 HIS B C      1 
ATOM   5015  O  O      . HIS B 2 196 ? -5.283  72.952 222.759 1.00 121.43 ? 302 HIS B O      1 
ATOM   5016  C  CB     . HIS B 2 196 ? -7.435  75.218 223.990 1.00 133.74 ? 302 HIS B CB     1 
ATOM   5017  C  CG     . HIS B 2 196 ? -6.611  76.450 223.761 1.00 147.87 ? 302 HIS B CG     1 
ATOM   5018  N  ND1    . HIS B 2 196 ? -6.616  77.141 222.569 1.00 160.36 ? 302 HIS B ND1    1 
ATOM   5019  C  CD2    . HIS B 2 196 ? -5.767  77.121 224.580 1.00 149.47 ? 302 HIS B CD2    1 
ATOM   5020  C  CE1    . HIS B 2 196 ? -5.805  78.180 222.660 1.00 158.24 ? 302 HIS B CE1    1 
ATOM   5021  N  NE2    . HIS B 2 196 ? -5.277  78.190 223.871 1.00 150.22 ? 302 HIS B NE2    1 
ATOM   5022  H  HA     . HIS B 2 196 ? -6.969  74.620 222.079 1.00 142.31 ? 302 HIS B HA     1 
ATOM   5023  H  HB2    . HIS B 2 196 ? -8.360  75.494 224.082 1.00 160.49 ? 302 HIS B HB2    1 
ATOM   5024  H  HB3    . HIS B 2 196 ? -7.131  74.808 224.815 1.00 160.49 ? 302 HIS B HB3    1 
ATOM   5025  H  HD2    . HIS B 2 196 ? -5.555  76.897 225.458 1.00 179.36 ? 302 HIS B HD2    1 
ATOM   5026  H  HE1    . HIS B 2 196 ? -5.634  78.799 221.987 1.00 189.89 ? 302 HIS B HE1    1 
ATOM   5027  H  HE2    . HIS B 2 196 ? -4.718  78.772 224.168 1.00 180.26 ? 302 HIS B HE2    1 
ATOM   5028  N  N      . PHE B 2 197 ? -6.874  72.182 224.162 1.00 120.97 ? 303 PHE B N      1 
ATOM   5029  C  CA     . PHE B 2 197 ? -6.057  71.118 224.730 1.00 99.76  ? 303 PHE B CA     1 
ATOM   5030  C  C      . PHE B 2 197 ? -6.878  69.840 224.840 1.00 81.16  ? 303 PHE B C      1 
ATOM   5031  O  O      . PHE B 2 197 ? -8.094  69.887 225.041 1.00 117.84 ? 303 PHE B O      1 
ATOM   5032  C  CB     . PHE B 2 197 ? -5.520  71.512 226.115 1.00 118.23 ? 303 PHE B CB     1 
ATOM   5033  C  CG     . PHE B 2 197 ? -4.101  72.013 226.101 1.00 122.17 ? 303 PHE B CG     1 
ATOM   5034  C  CD1    . PHE B 2 197 ? -3.707  73.023 225.240 1.00 117.01 ? 303 PHE B CD1    1 
ATOM   5035  C  CD2    . PHE B 2 197 ? -3.165  71.480 226.965 1.00 128.98 ? 303 PHE B CD2    1 
ATOM   5036  C  CE1    . PHE B 2 197 ? -2.401  73.481 225.235 1.00 121.09 ? 303 PHE B CE1    1 
ATOM   5037  C  CE2    . PHE B 2 197 ? -1.862  71.934 226.965 1.00 130.55 ? 303 PHE B CE2    1 
ATOM   5038  C  CZ     . PHE B 2 197 ? -1.479  72.935 226.102 1.00 117.63 ? 303 PHE B CZ     1 
ATOM   5039  H  H      . PHE B 2 197 ? -7.681  72.193 224.461 1.00 145.17 ? 303 PHE B H      1 
ATOM   5040  H  HA     . PHE B 2 197 ? -5.301  70.946 224.147 1.00 119.71 ? 303 PHE B HA     1 
ATOM   5041  H  HB2    . PHE B 2 197 ? -6.079  72.217 226.478 1.00 141.88 ? 303 PHE B HB2    1 
ATOM   5042  H  HB3    . PHE B 2 197 ? -5.554  70.735 226.695 1.00 141.88 ? 303 PHE B HB3    1 
ATOM   5043  H  HD1    . PHE B 2 197 ? -4.325  73.394 224.653 1.00 140.42 ? 303 PHE B HD1    1 
ATOM   5044  H  HD2    . PHE B 2 197 ? -3.415  70.803 227.551 1.00 154.77 ? 303 PHE B HD2    1 
ATOM   5045  H  HE1    . PHE B 2 197 ? -2.147  74.158 224.650 1.00 145.31 ? 303 PHE B HE1    1 
ATOM   5046  H  HE2    . PHE B 2 197 ? -1.242  71.563 227.551 1.00 156.66 ? 303 PHE B HE2    1 
ATOM   5047  H  HZ     . PHE B 2 197 ? -0.600  73.241 226.102 1.00 141.16 ? 303 PHE B HZ     1 
ATOM   5048  N  N      . VAL B 2 198 ? -6.204  68.691 224.709 1.00 104.04 ? 304 VAL B N      1 
ATOM   5049  C  CA     . VAL B 2 198 ? -6.856  67.390 224.840 1.00 100.65 ? 304 VAL B CA     1 
ATOM   5050  C  C      . VAL B 2 198 ? -5.968  66.449 225.643 1.00 87.15  ? 304 VAL B C      1 
ATOM   5051  O  O      . VAL B 2 198 ? -4.746  66.604 225.705 1.00 84.92  ? 304 VAL B O      1 
ATOM   5052  C  CB     . VAL B 2 198 ? -7.190  66.739 223.477 1.00 67.47  ? 304 VAL B CB     1 
ATOM   5053  C  CG1    . VAL B 2 198 ? -8.148  67.610 222.686 1.00 94.22  ? 304 VAL B CG1    1 
ATOM   5054  C  CG2    . VAL B 2 198 ? -5.922  66.470 222.684 1.00 67.78  ? 304 VAL B CG2    1 
ATOM   5055  H  H      . VAL B 2 198 ? -5.362  68.642 224.542 1.00 124.85 ? 304 VAL B H      1 
ATOM   5056  H  HA     . VAL B 2 198 ? -7.687  67.504 225.327 1.00 120.78 ? 304 VAL B HA     1 
ATOM   5057  H  HB     . VAL B 2 198 ? -7.626  65.887 223.636 1.00 80.97  ? 304 VAL B HB     1 
ATOM   5058  H  HG11   . VAL B 2 198 ? -8.339  67.179 221.839 1.00 113.06 ? 304 VAL B HG11   1 
ATOM   5059  H  HG12   . VAL B 2 198 ? -8.966  67.721 223.195 1.00 113.06 ? 304 VAL B HG12   1 
ATOM   5060  H  HG13   . VAL B 2 198 ? -7.734  68.474 222.533 1.00 113.06 ? 304 VAL B HG13   1 
ATOM   5061  H  HG21   . VAL B 2 198 ? -6.160  66.063 221.837 1.00 81.33  ? 304 VAL B HG21   1 
ATOM   5062  H  HG22   . VAL B 2 198 ? -5.462  67.310 222.530 1.00 81.33  ? 304 VAL B HG22   1 
ATOM   5063  H  HG23   . VAL B 2 198 ? -5.354  65.870 223.192 1.00 81.33  ? 304 VAL B HG23   1 
ATOM   5064  N  N      . VAL B 2 199 ? -6.606  65.449 226.243 1.00 88.24  ? 305 VAL B N      1 
ATOM   5065  C  CA     . VAL B 2 199 ? -5.916  64.452 227.053 1.00 116.86 ? 305 VAL B CA     1 
ATOM   5066  C  C      . VAL B 2 199 ? -5.385  63.363 226.129 1.00 111.82 ? 305 VAL B C      1 
ATOM   5067  O  O      . VAL B 2 199 ? -6.161  62.644 225.489 1.00 78.71  ? 305 VAL B O      1 
ATOM   5068  C  CB     . VAL B 2 199 ? -6.848  63.861 228.121 1.00 91.70  ? 305 VAL B CB     1 
ATOM   5069  C  CG1    . VAL B 2 199 ? -6.083  62.908 229.029 1.00 77.78  ? 305 VAL B CG1    1 
ATOM   5070  C  CG2    . VAL B 2 199 ? -7.492  64.969 228.937 1.00 97.28  ? 305 VAL B CG2    1 
ATOM   5071  H  H      . VAL B 2 199 ? -7.455  65.325 226.195 1.00 105.89 ? 305 VAL B H      1 
ATOM   5072  H  HA     . VAL B 2 199 ? -5.162  64.867 227.501 1.00 140.24 ? 305 VAL B HA     1 
ATOM   5073  H  HB     . VAL B 2 199 ? -7.554  63.360 227.684 1.00 110.04 ? 305 VAL B HB     1 
ATOM   5074  H  HG11   . VAL B 2 199 ? -6.692  62.548 229.693 1.00 93.34  ? 305 VAL B HG11   1 
ATOM   5075  H  HG12   . VAL B 2 199 ? -5.716  62.188 228.492 1.00 93.34  ? 305 VAL B HG12   1 
ATOM   5076  H  HG13   . VAL B 2 199 ? -5.366  63.394 229.465 1.00 93.34  ? 305 VAL B HG13   1 
ATOM   5077  H  HG21   . VAL B 2 199 ? -8.075  64.573 229.603 1.00 116.74 ? 305 VAL B HG21   1 
ATOM   5078  H  HG22   . VAL B 2 199 ? -6.796  65.487 229.371 1.00 116.74 ? 305 VAL B HG22   1 
ATOM   5079  H  HG23   . VAL B 2 199 ? -8.006  65.539 228.344 1.00 116.74 ? 305 VAL B HG23   1 
ATOM   5080  N  N      . VAL B 2 200 ? -4.062  63.235 226.069 1.00 88.28  ? 306 VAL B N      1 
ATOM   5081  C  CA     . VAL B 2 200 ? -3.396  62.265 225.210 1.00 85.05  ? 306 VAL B CA     1 
ATOM   5082  C  C      . VAL B 2 200 ? -2.691  61.242 226.087 1.00 75.89  ? 306 VAL B C      1 
ATOM   5083  O  O      . VAL B 2 200 ? -1.887  61.602 226.958 1.00 85.33  ? 306 VAL B O      1 
ATOM   5084  C  CB     . VAL B 2 200 ? -2.404  62.947 224.252 1.00 89.91  ? 306 VAL B CB     1 
ATOM   5085  C  CG1    . VAL B 2 200 ? -1.639  61.912 223.438 1.00 80.87  ? 306 VAL B CG1    1 
ATOM   5086  C  CG2    . VAL B 2 200 ? -3.141  63.893 223.327 1.00 88.00  ? 306 VAL B CG2    1 
ATOM   5087  H  H      . VAL B 2 200 ? -3.516  63.713 226.530 1.00 105.94 ? 306 VAL B H      1 
ATOM   5088  H  HA     . VAL B 2 200 ? -4.061  61.801 224.677 1.00 102.05 ? 306 VAL B HA     1 
ATOM   5089  H  HB     . VAL B 2 200 ? -1.764  63.462 224.768 1.00 107.89 ? 306 VAL B HB     1 
ATOM   5090  H  HG11   . VAL B 2 200 ? -1.023  62.370 222.845 1.00 97.04  ? 306 VAL B HG11   1 
ATOM   5091  H  HG12   . VAL B 2 200 ? -1.149  61.334 224.043 1.00 97.04  ? 306 VAL B HG12   1 
ATOM   5092  H  HG13   . VAL B 2 200 ? -2.271  61.390 222.920 1.00 97.04  ? 306 VAL B HG13   1 
ATOM   5093  H  HG21   . VAL B 2 200 ? -2.501  64.314 222.732 1.00 105.60 ? 306 VAL B HG21   1 
ATOM   5094  H  HG22   . VAL B 2 200 ? -3.790  63.389 222.813 1.00 105.60 ? 306 VAL B HG22   1 
ATOM   5095  H  HG23   . VAL B 2 200 ? -3.591  64.567 223.860 1.00 105.60 ? 306 VAL B HG23   1 
ATOM   5096  N  N      . HIS B 2 201 ? -3.004  59.970 225.857 1.00 77.05  ? 307 HIS B N      1 
ATOM   5097  C  CA     . HIS B 2 201 ? -2.299  58.850 226.462 1.00 68.74  ? 307 HIS B CA     1 
ATOM   5098  C  C      . HIS B 2 201 ? -1.192  58.406 225.512 1.00 70.80  ? 307 HIS B C      1 
ATOM   5099  O  O      . HIS B 2 201 ? -1.459  58.080 224.349 1.00 119.40 ? 307 HIS B O      1 
ATOM   5100  C  CB     . HIS B 2 201 ? -3.275  57.709 226.744 1.00 90.12  ? 307 HIS B CB     1 
ATOM   5101  C  CG     . HIS B 2 201 ? -2.659  56.531 227.435 1.00 94.14  ? 307 HIS B CG     1 
ATOM   5102  N  ND1    . HIS B 2 201 ? -1.360  56.528 227.895 1.00 119.76 ? 307 HIS B ND1    1 
ATOM   5103  C  CD2    . HIS B 2 201 ? -3.171  55.315 227.747 1.00 65.72  ? 307 HIS B CD2    1 
ATOM   5104  C  CE1    . HIS B 2 201 ? -1.096  55.362 228.458 1.00 92.44  ? 307 HIS B CE1    1 
ATOM   5105  N  NE2    . HIS B 2 201 ? -2.178  54.608 228.381 1.00 86.01  ? 307 HIS B NE2    1 
ATOM   5106  H  H      . HIS B 2 201 ? -3.643  59.726 225.336 1.00 92.46  ? 307 HIS B H      1 
ATOM   5107  H  HA     . HIS B 2 201 ? -1.897  59.130 227.299 1.00 82.49  ? 307 HIS B HA     1 
ATOM   5108  H  HB2    . HIS B 2 201 ? -3.989  58.042 227.309 1.00 108.15 ? 307 HIS B HB2    1 
ATOM   5109  H  HB3    . HIS B 2 201 ? -3.642  57.398 225.901 1.00 108.15 ? 307 HIS B HB3    1 
ATOM   5110  H  HD2    . HIS B 2 201 ? -4.032  55.015 227.564 1.00 78.86  ? 307 HIS B HD2    1 
ATOM   5111  H  HE1    . HIS B 2 201 ? -0.287  55.114 228.843 1.00 110.93 ? 307 HIS B HE1    1 
ATOM   5112  H  HE2    . HIS B 2 201 ? -2.250  53.805 228.680 1.00 103.22 ? 307 HIS B HE2    1 
ATOM   5113  N  N      . CYS B 2 202 ? 0.042   58.397 226.004 1.00 67.01  ? 308 CYS B N      1 
ATOM   5114  C  CA     . CYS B 2 202 ? 1.212   58.073 225.200 1.00 75.11  ? 308 CYS B CA     1 
ATOM   5115  C  C      . CYS B 2 202 ? 1.843   56.779 225.694 1.00 67.99  ? 308 CYS B C      1 
ATOM   5116  O  O      . CYS B 2 202 ? 2.166   56.653 226.883 1.00 94.06  ? 308 CYS B O      1 
ATOM   5117  C  CB     . CYS B 2 202 ? 2.233   59.209 225.255 1.00 75.13  ? 308 CYS B CB     1 
ATOM   5118  S  SG     . CYS B 2 202 ? 1.601   60.774 224.627 1.00 105.43 ? 308 CYS B SG     1 
ATOM   5119  H  H      . CYS B 2 202 ? 0.230   58.581 226.822 1.00 80.41  ? 308 CYS B H      1 
ATOM   5120  H  HA     . CYS B 2 202 ? 0.943   57.949 224.277 1.00 90.13  ? 308 CYS B HA     1 
ATOM   5121  H  HB2    . CYS B 2 202 ? 2.501   59.346 226.177 1.00 90.16  ? 308 CYS B HB2    1 
ATOM   5122  H  HB3    . CYS B 2 202 ? 3.004   58.964 224.720 1.00 90.16  ? 308 CYS B HB3    1 
ATOM   5123  H  HG     . CYS B 2 202 ? 2.464   61.604 224.708 1.00 126.52 ? 308 CYS B HG     1 
ATOM   5124  N  N      . THR B 2 203 ? 2.027   55.828 224.774 1.00 84.62  ? 309 THR B N      1 
ATOM   5125  C  CA     . THR B 2 203 ? 2.684   54.562 225.070 1.00 68.64  ? 309 THR B CA     1 
ATOM   5126  C  C      . THR B 2 203 ? 3.742   54.285 224.013 1.00 71.25  ? 309 THR B C      1 
ATOM   5127  O  O      . THR B 2 203 ? 3.500   54.479 222.819 1.00 96.88  ? 309 THR B O      1 
ATOM   5128  C  CB     . THR B 2 203 ? 1.682   53.399 225.113 1.00 97.41  ? 309 THR B CB     1 
ATOM   5129  O  OG1    . THR B 2 203 ? 1.060   53.248 223.831 1.00 68.69  ? 309 THR B OG1    1 
ATOM   5130  C  CG2    . THR B 2 203 ? 0.611   53.652 226.163 1.00 114.03 ? 309 THR B CG2    1 
ATOM   5131  H  H      . THR B 2 203 ? 1.773   55.899 223.956 1.00 101.54 ? 309 THR B H      1 
ATOM   5132  H  HA     . THR B 2 203 ? 3.122   54.621 225.934 1.00 82.37  ? 309 THR B HA     1 
ATOM   5133  H  HB     . THR B 2 203 ? 2.148   52.580 225.343 1.00 116.90 ? 309 THR B HB     1 
ATOM   5134  H  HG1    . THR B 2 203 ? 0.511   52.613 223.851 1.00 82.43  ? 309 THR B HG1    1 
ATOM   5135  H  HG21   . THR B 2 203 ? -0.016  52.912 226.181 1.00 136.83 ? 309 THR B HG21   1 
ATOM   5136  H  HG22   . THR B 2 203 ? 1.020   53.740 227.038 1.00 136.83 ? 309 THR B HG22   1 
ATOM   5137  H  HG23   . THR B 2 203 ? 0.130   54.468 225.956 1.00 136.83 ? 309 THR B HG23   1 
ATOM   5138  N  N      . GLY B 2 204 ? 4.910   53.833 224.451 1.00 71.31  ? 310 GLY B N      1 
ATOM   5139  C  CA     . GLY B 2 204 ? 5.979   53.536 223.517 1.00 94.48  ? 310 GLY B CA     1 
ATOM   5140  C  C      . GLY B 2 204 ? 7.185   52.964 224.227 1.00 84.48  ? 310 GLY B C      1 
ATOM   5141  O  O      . GLY B 2 204 ? 7.125   52.602 225.403 1.00 82.72  ? 310 GLY B O      1 
ATOM   5142  H  H      . GLY B 2 204 ? 5.106   53.691 225.277 1.00 85.58  ? 310 GLY B H      1 
ATOM   5143  H  HA2    . GLY B 2 204 ? 5.670   52.892 222.860 1.00 113.37 ? 310 GLY B HA2    1 
ATOM   5144  H  HA3    . GLY B 2 204 ? 6.245   54.347 223.056 1.00 113.37 ? 310 GLY B HA3    1 
ATOM   5145  N  N      . TYR B 2 205 ? 8.292   52.887 223.487 1.00 84.91  ? 311 TYR B N      1 
ATOM   5146  C  CA     . TYR B 2 205 ? 9.538   52.352 224.015 1.00 75.24  ? 311 TYR B CA     1 
ATOM   5147  C  C      . TYR B 2 205 ? 10.692  53.236 223.570 1.00 85.93  ? 311 TYR B C      1 
ATOM   5148  O  O      . TYR B 2 205 ? 10.532  54.145 222.750 1.00 130.34 ? 311 TYR B O      1 
ATOM   5149  C  CB     . TYR B 2 205 ? 9.762   50.895 223.575 1.00 106.23 ? 311 TYR B CB     1 
ATOM   5150  C  CG     . TYR B 2 205 ? 10.228  50.703 222.143 1.00 81.65  ? 311 TYR B CG     1 
ATOM   5151  C  CD1    . TYR B 2 205 ? 9.698   51.454 221.104 1.00 77.93  ? 311 TYR B CD1    1 
ATOM   5152  C  CD2    . TYR B 2 205 ? 11.198  49.758 221.834 1.00 120.72 ? 311 TYR B CD2    1 
ATOM   5153  C  CE1    . TYR B 2 205 ? 10.125  51.274 219.801 1.00 107.58 ? 311 TYR B CE1    1 
ATOM   5154  C  CE2    . TYR B 2 205 ? 11.630  49.571 220.534 1.00 124.99 ? 311 TYR B CE2    1 
ATOM   5155  C  CZ     . TYR B 2 205 ? 11.091  50.332 219.523 1.00 102.06 ? 311 TYR B CZ     1 
ATOM   5156  O  OH     . TYR B 2 205 ? 11.519  50.148 218.229 1.00 130.46 ? 311 TYR B OH     1 
ATOM   5157  H  H      . TYR B 2 205 ? 8.344   53.144 222.668 1.00 101.89 ? 311 TYR B H      1 
ATOM   5158  H  HA     . TYR B 2 205 ? 9.503   52.369 224.984 1.00 90.29  ? 311 TYR B HA     1 
ATOM   5159  H  HB2    . TYR B 2 205 ? 10.433  50.500 224.153 1.00 127.47 ? 311 TYR B HB2    1 
ATOM   5160  H  HB3    . TYR B 2 205 ? 8.925   50.413 223.674 1.00 127.47 ? 311 TYR B HB3    1 
ATOM   5161  H  HD1    . TYR B 2 205 ? 9.047   52.092 221.287 1.00 93.51  ? 311 TYR B HD1    1 
ATOM   5162  H  HD2    . TYR B 2 205 ? 11.565  49.243 222.516 1.00 144.86 ? 311 TYR B HD2    1 
ATOM   5163  H  HE1    . TYR B 2 205 ? 9.762   51.787 219.116 1.00 129.10 ? 311 TYR B HE1    1 
ATOM   5164  H  HE2    . TYR B 2 205 ? 12.282  48.935 220.345 1.00 149.98 ? 311 TYR B HE2    1 
ATOM   5165  H  HH     . TYR B 2 205 ? 12.106  49.547 218.203 1.00 156.56 ? 311 TYR B HH     1 
ATOM   5166  N  N      . ILE B 2 206 ? 11.867  52.963 224.129 1.00 103.07 ? 312 ILE B N      1 
ATOM   5167  C  CA     . ILE B 2 206 ? 13.076  53.722 223.836 1.00 115.96 ? 312 ILE B CA     1 
ATOM   5168  C  C      . ILE B 2 206 ? 13.897  52.964 222.805 1.00 113.86 ? 312 ILE B C      1 
ATOM   5169  O  O      . ILE B 2 206 ? 14.189  51.775 222.982 1.00 118.75 ? 312 ILE B O      1 
ATOM   5170  C  CB     . ILE B 2 206 ? 13.899  53.973 225.112 1.00 86.21  ? 312 ILE B CB     1 
ATOM   5171  C  CG1    . ILE B 2 206 ? 13.190  55.012 225.987 1.00 100.52 ? 312 ILE B CG1    1 
ATOM   5172  C  CG2    . ILE B 2 206 ? 15.327  54.425 224.756 1.00 102.05 ? 312 ILE B CG2    1 
ATOM   5173  C  CD1    . ILE B 2 206 ? 13.979  55.464 227.199 1.00 120.30 ? 312 ILE B CD1    1 
ATOM   5174  H  H      . ILE B 2 206 ? 11.991  52.327 224.694 1.00 123.69 ? 312 ILE B H      1 
ATOM   5175  H  HA     . ILE B 2 206 ? 12.831  54.582 223.459 1.00 139.15 ? 312 ILE B HA     1 
ATOM   5176  H  HB     . ILE B 2 206 ? 13.956  53.142 225.608 1.00 103.45 ? 312 ILE B HB     1 
ATOM   5177  H  HG12   . ILE B 2 206 ? 13.006  55.797 225.448 1.00 120.62 ? 312 ILE B HG12   1 
ATOM   5178  H  HG13   . ILE B 2 206 ? 12.356  54.631 226.305 1.00 120.62 ? 312 ILE B HG13   1 
ATOM   5179  H  HG21   . ILE B 2 206 ? 15.823  54.576 225.576 1.00 122.46 ? 312 ILE B HG21   1 
ATOM   5180  H  HG22   . ILE B 2 206 ? 15.756  53.731 224.232 1.00 122.46 ? 312 ILE B HG22   1 
ATOM   5181  H  HG23   . ILE B 2 206 ? 15.278  55.247 224.243 1.00 122.46 ? 312 ILE B HG23   1 
ATOM   5182  H  HD11   . ILE B 2 206 ? 13.456  56.116 227.690 1.00 144.35 ? 312 ILE B HD11   1 
ATOM   5183  H  HD12   . ILE B 2 206 ? 14.162  54.695 227.761 1.00 144.35 ? 312 ILE B HD12   1 
ATOM   5184  H  HD13   . ILE B 2 206 ? 14.812  55.862 226.903 1.00 144.35 ? 312 ILE B HD13   1 
ATOM   5185  N  N      . LYS B 2 207 ? 14.280  53.657 221.734 1.00 115.85 ? 313 LYS B N      1 
ATOM   5186  C  CA     . LYS B 2 207 ? 15.211  53.120 220.754 1.00 113.36 ? 313 LYS B CA     1 
ATOM   5187  C  C      . LYS B 2 207 ? 16.219  54.202 220.406 1.00 110.11 ? 313 LYS B C      1 
ATOM   5188  O  O      . LYS B 2 207 ? 15.866  55.379 220.318 1.00 136.99 ? 313 LYS B O      1 
ATOM   5189  C  CB     . LYS B 2 207 ? 14.493  52.637 219.487 1.00 113.42 ? 313 LYS B CB     1 
ATOM   5190  C  CG     . LYS B 2 207 ? 15.441  52.322 218.341 1.00 119.90 ? 313 LYS B CG     1 
ATOM   5191  C  CD     . LYS B 2 207 ? 14.917  51.214 217.445 1.00 115.37 ? 313 LYS B CD     1 
ATOM   5192  C  CE     . LYS B 2 207 ? 15.990  50.764 216.464 1.00 117.74 ? 313 LYS B CE     1 
ATOM   5193  N  NZ     . LYS B 2 207 ? 15.660  49.471 215.805 1.00 146.52 ? 313 LYS B NZ     1 
ATOM   5194  H  H      . LYS B 2 207 ? 14.009  54.453 221.554 1.00 139.02 ? 313 LYS B H      1 
ATOM   5195  H  HA     . LYS B 2 207 ? 15.688  52.369 221.140 1.00 136.03 ? 313 LYS B HA     1 
ATOM   5196  H  HB2    . LYS B 2 207 ? 13.998  51.830 219.695 1.00 136.10 ? 313 LYS B HB2    1 
ATOM   5197  H  HB3    . LYS B 2 207 ? 13.884  53.331 219.187 1.00 136.10 ? 313 LYS B HB3    1 
ATOM   5198  H  HG2    . LYS B 2 207 ? 15.559  53.118 217.799 1.00 143.88 ? 313 LYS B HG2    1 
ATOM   5199  H  HG3    . LYS B 2 207 ? 16.294  52.038 218.705 1.00 143.88 ? 313 LYS B HG3    1 
ATOM   5200  H  HD2    . LYS B 2 207 ? 14.660  50.453 217.989 1.00 138.45 ? 313 LYS B HD2    1 
ATOM   5201  H  HD3    . LYS B 2 207 ? 14.156  51.541 216.939 1.00 138.45 ? 313 LYS B HD3    1 
ATOM   5202  H  HE2    . LYS B 2 207 ? 16.088  51.437 215.772 1.00 141.29 ? 313 LYS B HE2    1 
ATOM   5203  H  HE3    . LYS B 2 207 ? 16.827  50.653 216.941 1.00 141.29 ? 313 LYS B HE3    1 
ATOM   5204  H  HZ1    . LYS B 2 207 ? 16.310  49.244 215.241 1.00 175.83 ? 313 LYS B HZ1    1 
ATOM   5205  H  HZ2    . LYS B 2 207 ? 15.572  48.832 216.417 1.00 175.83 ? 313 LYS B HZ2    1 
ATOM   5206  H  HZ3    . LYS B 2 207 ? 14.898  49.547 215.352 1.00 175.83 ? 313 LYS B HZ3    1 
ATOM   5207  N  N      . ALA B 2 208 ? 17.470  53.801 220.207 1.00 114.41 ? 314 ALA B N      1 
ATOM   5208  C  CA     . ALA B 2 208 ? 18.524  54.756 219.907 1.00 130.52 ? 314 ALA B CA     1 
ATOM   5209  C  C      . ALA B 2 208 ? 18.561  55.080 218.416 1.00 151.97 ? 314 ALA B C      1 
ATOM   5210  O  O      . ALA B 2 208 ? 18.019  54.354 217.578 1.00 173.16 ? 314 ALA B O      1 
ATOM   5211  C  CB     . ALA B 2 208 ? 19.881  54.215 220.353 1.00 152.68 ? 314 ALA B CB     1 
ATOM   5212  H  H      . ALA B 2 208 ? 17.732  52.982 220.240 1.00 137.29 ? 314 ALA B H      1 
ATOM   5213  H  HA     . ALA B 2 208 ? 18.353  55.579 220.391 1.00 156.62 ? 314 ALA B HA     1 
ATOM   5214  H  HB1    . ALA B 2 208 ? 20.566  54.869 220.143 1.00 183.21 ? 314 ALA B HB1    1 
ATOM   5215  H  HB2    . ALA B 2 208 ? 19.858  54.055 221.309 1.00 183.21 ? 314 ALA B HB2    1 
ATOM   5216  H  HB3    . ALA B 2 208 ? 20.059  53.385 219.882 1.00 183.21 ? 314 ALA B HB3    1 
ATOM   5217  N  N      . TRP B 2 209 ? 19.221  56.186 218.093 1.00 155.10 ? 315 TRP B N      1 
ATOM   5218  C  CA     . TRP B 2 209 ? 19.434  56.600 216.705 1.00 153.44 ? 315 TRP B CA     1 
ATOM   5219  C  C      . TRP B 2 209 ? 20.907  56.930 216.518 1.00 146.59 ? 315 TRP B C      1 
ATOM   5220  O  O      . TRP B 2 209 ? 21.365  57.986 217.002 1.00 153.31 ? 315 TRP B O      1 
ATOM   5221  C  CB     . TRP B 2 209 ? 18.564  57.799 216.342 1.00 151.07 ? 315 TRP B CB     1 
ATOM   5222  C  CG     . TRP B 2 209 ? 17.138  57.421 216.168 1.00 145.03 ? 315 TRP B CG     1 
ATOM   5223  C  CD1    . TRP B 2 209 ? 16.251  57.139 217.155 1.00 147.56 ? 315 TRP B CD1    1 
ATOM   5224  C  CD2    . TRP B 2 209 ? 16.427  57.269 214.933 1.00 132.51 ? 315 TRP B CD2    1 
ATOM   5225  N  NE1    . TRP B 2 209 ? 15.026  56.827 216.621 1.00 160.78 ? 315 TRP B NE1    1 
ATOM   5226  C  CE2    . TRP B 2 209 ? 15.108  56.898 215.256 1.00 140.23 ? 315 TRP B CE2    1 
ATOM   5227  C  CE3    . TRP B 2 209 ? 16.777  57.411 213.587 1.00 147.33 ? 315 TRP B CE3    1 
ATOM   5228  C  CZ2    . TRP B 2 209 ? 14.136  56.670 214.286 1.00 138.59 ? 315 TRP B CZ2    1 
ATOM   5229  C  CZ3    . TRP B 2 209 ? 15.809  57.183 212.624 1.00 146.38 ? 315 TRP B CZ3    1 
ATOM   5230  C  CH2    . TRP B 2 209 ? 14.506  56.817 212.978 1.00 133.18 ? 315 TRP B CH2    1 
ATOM   5231  H  H      . TRP B 2 209 ? 19.562  56.726 218.669 1.00 186.12 ? 315 TRP B H      1 
ATOM   5232  H  HA     . TRP B 2 209 ? 19.207  55.867 216.112 1.00 184.13 ? 315 TRP B HA     1 
ATOM   5233  H  HB2    . TRP B 2 209 ? 18.618  58.458 217.051 1.00 181.28 ? 315 TRP B HB2    1 
ATOM   5234  H  HB3    . TRP B 2 209 ? 18.880  58.179 215.507 1.00 181.28 ? 315 TRP B HB3    1 
ATOM   5235  H  HD1    . TRP B 2 209 ? 16.445  57.160 218.064 1.00 177.07 ? 315 TRP B HD1    1 
ATOM   5236  H  HE1    . TRP B 2 209 ? 14.323  56.619 217.070 1.00 192.94 ? 315 TRP B HE1    1 
ATOM   5237  H  HE3    . TRP B 2 209 ? 17.641  57.656 213.345 1.00 176.80 ? 315 TRP B HE3    1 
ATOM   5238  H  HZ2    . TRP B 2 209 ? 13.270  56.425 214.518 1.00 166.30 ? 315 TRP B HZ2    1 
ATOM   5239  H  HZ3    . TRP B 2 209 ? 16.029  57.276 211.725 1.00 175.66 ? 315 TRP B HZ3    1 
ATOM   5240  H  HH2    . TRP B 2 209 ? 13.877  56.670 212.309 1.00 159.81 ? 315 TRP B HH2    1 
ATOM   5241  N  N      . PRO B 2 210 ? 21.688  56.082 215.832 1.00 150.39 ? 316 PRO B N      1 
ATOM   5242  C  CA     . PRO B 2 210 ? 23.120  56.345 215.678 1.00 169.54 ? 316 PRO B CA     1 
ATOM   5243  C  C      . PRO B 2 210 ? 23.437  57.244 214.486 1.00 174.24 ? 316 PRO B C      1 
ATOM   5244  O  O      . PRO B 2 210 ? 22.680  57.235 213.516 1.00 173.25 ? 316 PRO B O      1 
ATOM   5245  C  CB     . PRO B 2 210 ? 23.706  54.944 215.479 1.00 182.94 ? 316 PRO B CB     1 
ATOM   5246  C  CG     . PRO B 2 210 ? 22.562  54.108 214.932 1.00 184.68 ? 316 PRO B CG     1 
ATOM   5247  C  CD     . PRO B 2 210 ? 21.280  54.881 215.085 1.00 170.21 ? 316 PRO B CD     1 
ATOM   5248  H  HA     . PRO B 2 210 ? 23.484  56.737 216.488 1.00 203.45 ? 316 PRO B HA     1 
ATOM   5249  H  HB2    . PRO B 2 210 ? 24.437  54.984 214.842 1.00 219.52 ? 316 PRO B HB2    1 
ATOM   5250  H  HB3    . PRO B 2 210 ? 24.011  54.593 216.330 1.00 219.52 ? 316 PRO B HB3    1 
ATOM   5251  H  HG2    . PRO B 2 210 ? 22.727  53.922 213.994 1.00 221.62 ? 316 PRO B HG2    1 
ATOM   5252  H  HG3    . PRO B 2 210 ? 22.510  53.278 215.431 1.00 221.62 ? 316 PRO B HG3    1 
ATOM   5253  H  HD2    . PRO B 2 210 ? 20.929  55.128 214.215 1.00 204.25 ? 316 PRO B HD2    1 
ATOM   5254  H  HD3    . PRO B 2 210 ? 20.636  54.368 215.597 1.00 204.25 ? 316 PRO B HD3    1 
ATOM   5255  N  N      . ASP B 2 218 ? 21.236  42.771 213.817 1.00 95.59  ? 324 ASP B N      1 
ATOM   5256  C  CA     . ASP B 2 218 ? 21.025  41.833 214.914 1.00 123.92 ? 324 ASP B CA     1 
ATOM   5257  C  C      . ASP B 2 218 ? 22.347  41.430 215.561 1.00 113.01 ? 324 ASP B C      1 
ATOM   5258  O  O      . ASP B 2 218 ? 23.097  40.642 214.993 1.00 119.63 ? 324 ASP B O      1 
ATOM   5259  C  CB     . ASP B 2 218 ? 20.300  40.592 214.401 1.00 70.31  ? 324 ASP B CB     1 
ATOM   5260  H  H      . ASP B 2 218 ? 21.419  42.395 213.066 1.00 114.70 ? 324 ASP B H      1 
ATOM   5261  H  HA     . ASP B 2 218 ? 20.470  42.252 215.590 1.00 148.70 ? 324 ASP B HA     1 
ATOM   5262  N  N      . ASP B 2 219 ? 22.639  41.972 216.739 1.00 146.29 ? 325 ASP B N      1 
ATOM   5263  C  CA     . ASP B 2 219 ? 23.887  41.662 217.423 1.00 158.13 ? 325 ASP B CA     1 
ATOM   5264  C  C      . ASP B 2 219 ? 23.706  40.492 218.378 1.00 158.99 ? 325 ASP B C      1 
ATOM   5265  O  O      . ASP B 2 219 ? 22.598  40.003 218.611 1.00 165.10 ? 325 ASP B O      1 
ATOM   5266  C  CB     . ASP B 2 219 ? 24.406  42.874 218.198 1.00 24.44  ? 325 ASP B CB     1 
ATOM   5267  H  H      . ASP B 2 219 ? 22.132  42.523 217.162 1.00 175.55 ? 325 ASP B H      1 
ATOM   5268  H  HA     . ASP B 2 219 ? 24.556  41.414 216.766 1.00 189.75 ? 325 ASP B HA     1 
ATOM   5269  N  N      . ASP B 2 220 ? 24.809  40.076 218.969 1.00 162.40 ? 326 ASP B N      1 
ATOM   5270  C  CA     . ASP B 2 220 ? 24.728  38.963 219.902 1.00 159.67 ? 326 ASP B CA     1 
ATOM   5271  C  C      . ASP B 2 220 ? 24.398  39.415 221.326 1.00 142.98 ? 326 ASP B C      1 
ATOM   5272  O  O      . ASP B 2 220 ? 23.628  38.727 222.001 1.00 148.94 ? 326 ASP B O      1 
ATOM   5273  C  CB     . ASP B 2 220 ? 26.014  38.125 219.898 1.00 92.11  ? 326 ASP B CB     1 
ATOM   5274  C  CG     . ASP B 2 220 ? 27.291  38.962 219.827 1.00 96.02  ? 326 ASP B CG     1 
ATOM   5275  O  OD1    . ASP B 2 220 ? 27.529  39.635 218.803 1.00 57.41  ? 326 ASP B OD1    1 
ATOM   5276  O  OD2    . ASP B 2 220 ? 28.054  38.950 220.820 1.00 101.70 ? 326 ASP B OD2    1 
ATOM   5277  H  H      . ASP B 2 220 ? 25.595  40.406 218.855 1.00 194.88 ? 326 ASP B H      1 
ATOM   5278  H  HA     . ASP B 2 220 ? 24.007  38.381 219.613 1.00 191.60 ? 326 ASP B HA     1 
ATOM   5279  H  HB2    . ASP B 2 220 ? 26.048  37.600 220.713 1.00 110.53 ? 326 ASP B HB2    1 
ATOM   5280  H  HB3    . ASP B 2 220 ? 26.002  37.536 219.127 1.00 110.53 ? 326 ASP B HB3    1 
ATOM   5281  N  N      . PRO B 2 221 ? 24.914  40.555 221.827 1.00 145.63 ? 327 PRO B N      1 
ATOM   5282  C  CA     . PRO B 2 221 ? 24.647  40.917 223.226 1.00 175.04 ? 327 PRO B CA     1 
ATOM   5283  C  C      . PRO B 2 221 ? 23.661  42.066 223.401 1.00 167.94 ? 327 PRO B C      1 
ATOM   5284  O  O      . PRO B 2 221 ? 22.583  41.878 223.973 1.00 142.44 ? 327 PRO B O      1 
ATOM   5285  C  CB     . PRO B 2 221 ? 26.042  41.289 223.734 1.00 88.00  ? 327 PRO B CB     1 
ATOM   5286  C  CG     . PRO B 2 221 ? 26.751  41.856 222.487 1.00 78.96  ? 327 PRO B CG     1 
ATOM   5287  C  CD     . PRO B 2 221 ? 25.885  41.496 221.256 1.00 52.66  ? 327 PRO B CD     1 
ATOM   5288  H  HA     . PRO B 2 221 ? 24.325  40.144 223.715 1.00 210.04 ? 327 PRO B HA     1 
ATOM   5289  H  HB2    . PRO B 2 221 ? 25.972  41.962 224.429 1.00 105.61 ? 327 PRO B HB2    1 
ATOM   5290  H  HB3    . PRO B 2 221 ? 26.497  40.497 224.061 1.00 105.61 ? 327 PRO B HB3    1 
ATOM   5291  H  HG2    . PRO B 2 221 ? 26.829  42.819 222.573 1.00 94.76  ? 327 PRO B HG2    1 
ATOM   5292  H  HG3    . PRO B 2 221 ? 27.630  41.454 222.408 1.00 94.76  ? 327 PRO B HG3    1 
ATOM   5293  H  HD2    . PRO B 2 221 ? 25.436  42.284 220.913 1.00 63.20  ? 327 PRO B HD2    1 
ATOM   5294  H  HD3    . PRO B 2 221 ? 26.423  41.062 220.576 1.00 63.20  ? 327 PRO B HD3    1 
ATOM   5295  N  N      . GLU B 2 222 ? 24.010  43.259 222.925 1.00 72.99  ? 328 GLU B N      1 
ATOM   5296  C  CA     . GLU B 2 222 ? 23.203  44.441 223.191 1.00 81.83  ? 328 GLU B CA     1 
ATOM   5297  C  C      . GLU B 2 222 ? 23.487  45.500 222.134 1.00 77.96  ? 328 GLU B C      1 
ATOM   5298  O  O      . GLU B 2 222 ? 24.464  45.412 221.385 1.00 77.83  ? 328 GLU B O      1 
ATOM   5299  C  CB     . GLU B 2 222 ? 23.479  44.993 224.596 1.00 61.98  ? 328 GLU B CB     1 
ATOM   5300  H  H      . GLU B 2 222 ? 24.708  43.408 222.446 1.00 87.59  ? 328 GLU B H      1 
ATOM   5301  H  HA     . GLU B 2 222 ? 22.264  44.204 223.138 1.00 98.20  ? 328 GLU B HA     1 
ATOM   5302  H  HB2    . GLU B 2 222 ? 22.927  45.778 224.740 1.00 74.38  ? 328 GLU B HB2    1 
ATOM   5303  H  HB3    . GLU B 2 222 ? 24.417  45.232 224.662 1.00 74.38  ? 328 GLU B HB3    1 
ATOM   5304  N  N      . ALA B 2 223 ? 22.600  46.493 222.076 1.00 73.05  ? 329 ALA B N      1 
ATOM   5305  C  CA     . ALA B 2 223 ? 22.774  47.651 221.208 1.00 86.77  ? 329 ALA B CA     1 
ATOM   5306  C  C      . ALA B 2 223 ? 23.348  48.831 221.989 1.00 79.30  ? 329 ALA B C      1 
ATOM   5307  O  O      . ALA B 2 223 ? 23.010  49.990 221.733 1.00 74.85  ? 329 ALA B O      1 
ATOM   5308  C  CB     . ALA B 2 223 ? 21.440  48.041 220.565 1.00 51.58  ? 329 ALA B CB     1 
ATOM   5309  H  H      . ALA B 2 223 ? 21.877  46.517 222.540 1.00 87.67  ? 329 ALA B H      1 
ATOM   5310  H  HA     . ALA B 2 223 ? 23.396  47.426 220.499 1.00 104.12 ? 329 ALA B HA     1 
ATOM   5311  H  HB1    . ALA B 2 223 ? 21.579  48.812 219.994 1.00 61.89  ? 329 ALA B HB1    1 
ATOM   5312  H  HB2    . ALA B 2 223 ? 21.112  47.294 220.040 1.00 61.89  ? 329 ALA B HB2    1 
ATOM   5313  H  HB3    . ALA B 2 223 ? 20.804  48.258 221.265 1.00 61.89  ? 329 ALA B HB3    1 
ATOM   5314  N  N      . LYS B 2 228 ? 23.098  59.321 222.090 1.00 162.00 ? 334 LYS B N      1 
ATOM   5315  C  CA     . LYS B 2 228 ? 21.769  59.913 222.074 1.00 160.38 ? 334 LYS B CA     1 
ATOM   5316  C  C      . LYS B 2 228 ? 20.728  58.859 221.717 1.00 138.50 ? 334 LYS B C      1 
ATOM   5317  O  O      . LYS B 2 228 ? 20.920  58.078 220.785 1.00 134.22 ? 334 LYS B O      1 
ATOM   5318  C  CB     . LYS B 2 228 ? 21.710  61.077 221.080 1.00 152.98 ? 334 LYS B CB     1 
ATOM   5319  H  H      . LYS B 2 228 ? 23.336  58.975 221.340 1.00 194.39 ? 334 LYS B H      1 
ATOM   5320  H  HA     . LYS B 2 228 ? 21.562  60.258 222.957 1.00 192.46 ? 334 LYS B HA     1 
ATOM   5321  N  N      . PHE B 2 229 ? 19.628  58.850 222.462 1.00 132.81 ? 335 PHE B N      1 
ATOM   5322  C  CA     . PHE B 2 229 ? 18.529  57.919 222.261 1.00 126.67 ? 335 PHE B CA     1 
ATOM   5323  C  C      . PHE B 2 229 ? 17.299  58.677 221.767 1.00 130.28 ? 335 PHE B C      1 
ATOM   5324  O  O      . PHE B 2 229 ? 17.329  59.895 221.571 1.00 154.23 ? 335 PHE B O      1 
ATOM   5325  C  CB     . PHE B 2 229 ? 18.216  57.170 223.555 1.00 133.38 ? 335 PHE B CB     1 
ATOM   5326  C  CG     . PHE B 2 229 ? 19.245  56.151 223.930 1.00 142.99 ? 335 PHE B CG     1 
ATOM   5327  C  CD1    . PHE B 2 229 ? 20.460  56.532 224.472 1.00 135.20 ? 335 PHE B CD1    1 
ATOM   5328  C  CD2    . PHE B 2 229 ? 18.990  54.805 223.745 1.00 140.20 ? 335 PHE B CD2    1 
ATOM   5329  C  CE1    . PHE B 2 229 ? 21.403  55.588 224.816 1.00 135.73 ? 335 PHE B CE1    1 
ATOM   5330  C  CE2    . PHE B 2 229 ? 19.926  53.858 224.087 1.00 137.70 ? 335 PHE B CE2    1 
ATOM   5331  C  CZ     . PHE B 2 229 ? 21.135  54.248 224.623 1.00 150.66 ? 335 PHE B CZ     1 
ATOM   5332  H  H      . PHE B 2 229 ? 19.493  59.394 223.114 1.00 159.37 ? 335 PHE B H      1 
ATOM   5333  H  HA     . PHE B 2 229 ? 18.778  57.269 221.585 1.00 152.01 ? 335 PHE B HA     1 
ATOM   5334  H  HB2    . PHE B 2 229 ? 18.157  57.812 224.281 1.00 160.05 ? 335 PHE B HB2    1 
ATOM   5335  H  HB3    . PHE B 2 229 ? 17.368  56.711 223.453 1.00 160.05 ? 335 PHE B HB3    1 
ATOM   5336  H  HD1    . PHE B 2 229 ? 20.643  57.435 224.602 1.00 162.24 ? 335 PHE B HD1    1 
ATOM   5337  H  HD2    . PHE B 2 229 ? 18.177  54.537 223.383 1.00 168.25 ? 335 PHE B HD2    1 
ATOM   5338  H  HE1    . PHE B 2 229 ? 22.217  55.852 225.178 1.00 162.88 ? 335 PHE B HE1    1 
ATOM   5339  H  HE2    . PHE B 2 229 ? 19.744  52.955 223.956 1.00 165.24 ? 335 PHE B HE2    1 
ATOM   5340  H  HZ     . PHE B 2 229 ? 21.769  53.609 224.855 1.00 180.79 ? 335 PHE B HZ     1 
ATOM   5341  N  N      . CYS B 2 230 ? 16.196  57.949 221.591 1.00 119.62 ? 336 CYS B N      1 
ATOM   5342  C  CA     . CYS B 2 230 ? 14.943  58.569 221.186 1.00 117.23 ? 336 CYS B CA     1 
ATOM   5343  C  C      . CYS B 2 230 ? 13.774  57.770 221.736 1.00 114.05 ? 336 CYS B C      1 
ATOM   5344  O  O      . CYS B 2 230 ? 13.832  56.542 221.865 1.00 124.44 ? 336 CYS B O      1 
ATOM   5345  C  CB     . CYS B 2 230 ? 14.797  58.674 219.667 1.00 110.15 ? 336 CYS B CB     1 
ATOM   5346  S  SG     . CYS B 2 230 ? 15.862  59.884 218.837 1.00 117.52 ? 336 CYS B SG     1 
ATOM   5347  H  H      . CYS B 2 230 ? 16.151  57.098 221.701 1.00 143.55 ? 336 CYS B H      1 
ATOM   5348  H  HA     . CYS B 2 230 ? 14.898  59.465 221.556 1.00 140.67 ? 336 CYS B HA     1 
ATOM   5349  H  HB2    . CYS B 2 230 ? 14.993  57.806 219.282 1.00 132.18 ? 336 CYS B HB2    1 
ATOM   5350  H  HB3    . CYS B 2 230 ? 13.878  58.914 219.466 1.00 132.18 ? 336 CYS B HB3    1 
ATOM   5351  H  HG     . CYS B 2 230 ? 15.640  59.857 217.659 1.00 141.03 ? 336 CYS B HG     1 
ATOM   5352  N  N      . LEU B 2 231 ? 12.713  58.498 222.060 1.00 109.54 ? 337 LEU B N      1 
ATOM   5353  C  CA     . LEU B 2 231 ? 11.446  57.926 222.484 1.00 112.11 ? 337 LEU B CA     1 
ATOM   5354  C  C      . LEU B 2 231 ? 10.600  57.684 221.238 1.00 102.13 ? 337 LEU B C      1 
ATOM   5355  O  O      . LEU B 2 231 ? 10.190  58.636 220.560 1.00 103.83 ? 337 LEU B O      1 
ATOM   5356  C  CB     . LEU B 2 231 ? 10.757  58.876 223.464 1.00 114.67 ? 337 LEU B CB     1 
ATOM   5357  C  CG     . LEU B 2 231 ? 9.651   58.369 224.395 1.00 95.43  ? 337 LEU B CG     1 
ATOM   5358  C  CD1    . LEU B 2 231 ? 8.354   58.210 223.639 1.00 89.65  ? 337 LEU B CD1    1 
ATOM   5359  C  CD2    . LEU B 2 231 ? 10.049  57.064 225.085 1.00 111.49 ? 337 LEU B CD2    1 
ATOM   5360  H  H      . LEU B 2 231 ? 12.705  59.358 222.040 1.00 131.45 ? 337 LEU B H      1 
ATOM   5361  H  HA     . LEU B 2 231 ? 11.600  57.077 222.927 1.00 134.53 ? 337 LEU B HA     1 
ATOM   5362  H  HB2    . LEU B 2 231 ? 11.446  59.248 224.037 1.00 137.61 ? 337 LEU B HB2    1 
ATOM   5363  H  HB3    . LEU B 2 231 ? 10.367  59.595 222.943 1.00 137.61 ? 337 LEU B HB3    1 
ATOM   5364  H  HG     . LEU B 2 231 ? 9.504   59.032 225.088 1.00 114.51 ? 337 LEU B HG     1 
ATOM   5365  H  HD11   . LEU B 2 231 ? 7.671   57.889 224.249 1.00 107.58 ? 337 LEU B HD11   1 
ATOM   5366  H  HD12   . LEU B 2 231 ? 8.095   59.070 223.274 1.00 107.58 ? 337 LEU B HD12   1 
ATOM   5367  H  HD13   . LEU B 2 231 ? 8.485   57.570 222.922 1.00 107.58 ? 337 LEU B HD13   1 
ATOM   5368  H  HD21   . LEU B 2 231 ? 9.323   56.779 225.663 1.00 133.78 ? 337 LEU B HD21   1 
ATOM   5369  H  HD22   . LEU B 2 231 ? 10.218  56.389 224.409 1.00 133.78 ? 337 LEU B HD22   1 
ATOM   5370  H  HD23   . LEU B 2 231 ? 10.850  57.216 225.610 1.00 133.78 ? 337 LEU B HD23   1 
ATOM   5371  N  N      . VAL B 2 232 ? 10.377  56.411 220.920 1.00 85.40  ? 338 VAL B N      1 
ATOM   5372  C  CA     . VAL B 2 232 ? 9.501   55.995 219.830 1.00 78.32  ? 338 VAL B CA     1 
ATOM   5373  C  C      . VAL B 2 232 ? 8.175   55.595 220.458 1.00 71.94  ? 338 VAL B C      1 
ATOM   5374  O  O      . VAL B 2 232 ? 8.076   54.539 221.094 1.00 116.21 ? 338 VAL B O      1 
ATOM   5375  C  CB     . VAL B 2 232 ? 10.105  54.831 219.028 1.00 95.95  ? 338 VAL B CB     1 
ATOM   5376  C  CG1    . VAL B 2 232 ? 9.152   54.373 217.922 1.00 88.09  ? 338 VAL B CG1    1 
ATOM   5377  C  CG2    . VAL B 2 232 ? 11.456  55.222 218.446 1.00 136.13 ? 338 VAL B CG2    1 
ATOM   5378  H  H      . VAL B 2 232 ? 10.734  55.749 221.338 1.00 102.48 ? 338 VAL B H      1 
ATOM   5379  H  HA     . VAL B 2 232 ? 9.349   56.741 219.229 1.00 93.99  ? 338 VAL B HA     1 
ATOM   5380  H  HB     . VAL B 2 232 ? 10.246  54.081 219.626 1.00 115.14 ? 338 VAL B HB     1 
ATOM   5381  H  HG11   . VAL B 2 232 ? 9.562   53.640 217.437 1.00 105.71 ? 338 VAL B HG11   1 
ATOM   5382  H  HG12   . VAL B 2 232 ? 8.320   54.079 218.325 1.00 105.71 ? 338 VAL B HG12   1 
ATOM   5383  H  HG13   . VAL B 2 232 ? 8.985   55.116 217.321 1.00 105.71 ? 338 VAL B HG13   1 
ATOM   5384  H  HG21   . VAL B 2 232 ? 11.813  54.471 217.946 1.00 163.35 ? 338 VAL B HG21   1 
ATOM   5385  H  HG22   . VAL B 2 232 ? 11.338  55.984 217.858 1.00 163.35 ? 338 VAL B HG22   1 
ATOM   5386  H  HG23   . VAL B 2 232 ? 12.057  55.452 219.171 1.00 163.35 ? 338 VAL B HG23   1 
ATOM   5387  N  N      . ALA B 2 233 ? 7.148   56.427 220.294 1.00 95.04  ? 339 ALA B N      1 
ATOM   5388  C  CA     . ALA B 2 233 ? 5.886   56.141 220.957 1.00 89.67  ? 339 ALA B CA     1 
ATOM   5389  C  C      . ALA B 2 233 ? 4.730   56.589 220.084 1.00 82.10  ? 339 ALA B C      1 
ATOM   5390  O  O      . ALA B 2 233 ? 4.901   57.350 219.130 1.00 89.67  ? 339 ALA B O      1 
ATOM   5391  C  CB     . ALA B 2 233 ? 5.792   56.825 222.323 1.00 100.82 ? 339 ALA B CB     1 
ATOM   5392  H  H      . ALA B 2 233 ? 7.157   57.142 219.817 1.00 114.05 ? 339 ALA B H      1 
ATOM   5393  H  HA     . ALA B 2 233 ? 5.808   55.184 221.093 1.00 107.61 ? 339 ALA B HA     1 
ATOM   5394  H  HB1    . ALA B 2 233 ? 4.938   56.607 222.727 1.00 120.98 ? 339 ALA B HB1    1 
ATOM   5395  H  HB2    . ALA B 2 233 ? 6.515   56.505 222.885 1.00 120.98 ? 339 ALA B HB2    1 
ATOM   5396  H  HB3    . ALA B 2 233 ? 5.866   57.784 222.201 1.00 120.98 ? 339 ALA B HB3    1 
ATOM   5397  N  N      . ILE B 2 234 ? 3.544   56.104 220.433 1.00 73.38  ? 340 ILE B N      1 
ATOM   5398  C  CA     . ILE B 2 234 ? 2.305   56.515 219.793 1.00 80.70  ? 340 ILE B CA     1 
ATOM   5399  C  C      . ILE B 2 234 ? 1.413   57.125 220.859 1.00 65.25  ? 340 ILE B C      1 
ATOM   5400  O  O      . ILE B 2 234 ? 1.385   56.660 222.007 1.00 47.36  ? 340 ILE B O      1 
ATOM   5401  C  CB     . ILE B 2 234 ? 1.592   55.343 219.084 1.00 73.84  ? 340 ILE B CB     1 
ATOM   5402  C  CG1    . ILE B 2 234 ? 0.981   54.376 220.098 1.00 85.38  ? 340 ILE B CG1    1 
ATOM   5403  C  CG2    . ILE B 2 234 ? 2.556   54.604 218.165 1.00 125.56 ? 340 ILE B CG2    1 
ATOM   5404  C  CD1    . ILE B 2 234 ? -0.494  54.621 220.356 1.00 91.95  ? 340 ILE B CD1    1 
ATOM   5405  H  H      . ILE B 2 234 ? 3.431   55.520 221.054 1.00 88.06  ? 340 ILE B H      1 
ATOM   5406  H  HA     . ILE B 2 234 ? 2.498   57.197 219.131 1.00 96.84  ? 340 ILE B HA     1 
ATOM   5407  H  HB     . ILE B 2 234 ? 0.875   55.707 218.541 1.00 88.61  ? 340 ILE B HB     1 
ATOM   5408  H  HG12   . ILE B 2 234 ? 1.078   53.470 219.765 1.00 102.46 ? 340 ILE B HG12   1 
ATOM   5409  H  HG13   . ILE B 2 234 ? 1.450   54.470 220.942 1.00 102.46 ? 340 ILE B HG13   1 
ATOM   5410  H  HG21   . ILE B 2 234 ? 2.084   53.875 217.733 1.00 150.67 ? 340 ILE B HG21   1 
ATOM   5411  H  HG22   . ILE B 2 234 ? 2.893   55.222 217.497 1.00 150.67 ? 340 ILE B HG22   1 
ATOM   5412  H  HG23   . ILE B 2 234 ? 3.291   54.255 218.694 1.00 150.67 ? 340 ILE B HG23   1 
ATOM   5413  H  HD11   . ILE B 2 234 ? -0.811  53.975 221.006 1.00 110.34 ? 340 ILE B HD11   1 
ATOM   5414  H  HD12   . ILE B 2 234 ? -0.608  55.521 220.701 1.00 110.34 ? 340 ILE B HD12   1 
ATOM   5415  H  HD13   . ILE B 2 234 ? -0.981  54.521 219.523 1.00 110.34 ? 340 ILE B HD13   1 
ATOM   5416  N  N      . GLY B 2 235 ? 0.702   58.180 220.477 1.00 82.44  ? 341 GLY B N      1 
ATOM   5417  C  CA     . GLY B 2 235 ? -0.230  58.842 221.360 1.00 92.80  ? 341 GLY B CA     1 
ATOM   5418  C  C      . GLY B 2 235 ? -1.637  58.757 220.817 1.00 72.56  ? 341 GLY B C      1 
ATOM   5419  O  O      . GLY B 2 235 ? -1.873  59.025 219.634 1.00 65.20  ? 341 GLY B O      1 
ATOM   5420  H  H      . GLY B 2 235 ? 0.747   58.533 219.694 1.00 98.93  ? 341 GLY B H      1 
ATOM   5421  H  HA2    . GLY B 2 235 ? -0.207  58.424 222.235 1.00 111.36 ? 341 GLY B HA2    1 
ATOM   5422  H  HA3    . GLY B 2 235 ? 0.013   59.776 221.453 1.00 111.36 ? 341 GLY B HA3    1 
ATOM   5423  N  N      . ARG B 2 236 ? -2.573  58.370 221.676 1.00 79.32  ? 342 ARG B N      1 
ATOM   5424  C  CA     . ARG B 2 236 ? -3.974  58.251 221.313 1.00 87.71  ? 342 ARG B CA     1 
ATOM   5425  C  C      . ARG B 2 236 ? -4.814  58.981 222.346 1.00 82.78  ? 342 ARG B C      1 
ATOM   5426  O  O      . ARG B 2 236 ? -4.413  59.127 223.502 1.00 99.94  ? 342 ARG B O      1 
ATOM   5427  C  CB     . ARG B 2 236 ? -4.406  56.779 221.226 1.00 86.69  ? 342 ARG B CB     1 
ATOM   5428  C  CG     . ARG B 2 236 ? -4.325  56.010 222.549 1.00 71.09  ? 342 ARG B CG     1 
ATOM   5429  C  CD     . ARG B 2 236 ? -4.819  54.585 222.363 1.00 73.63  ? 342 ARG B CD     1 
ATOM   5430  N  NE     . ARG B 2 236 ? -4.980  53.850 223.616 1.00 68.07  ? 342 ARG B NE     1 
ATOM   5431  C  CZ     . ARG B 2 236 ? -3.987  53.284 224.296 1.00 73.53  ? 342 ARG B CZ     1 
ATOM   5432  N  NH1    . ARG B 2 236 ? -2.736  53.379 223.863 1.00 68.45  ? 342 ARG B NH1    1 
ATOM   5433  N  NH2    . ARG B 2 236 ? -4.245  52.630 225.420 1.00 83.89  ? 342 ARG B NH2    1 
ATOM   5434  H  H      . ARG B 2 236 ? -2.414  58.166 222.497 1.00 95.18  ? 342 ARG B H      1 
ATOM   5435  H  HA     . ARG B 2 236 ? -4.120  58.666 220.448 1.00 105.25 ? 342 ARG B HA     1 
ATOM   5436  H  HB2    . ARG B 2 236 ? -5.326  56.745 220.921 1.00 104.02 ? 342 ARG B HB2    1 
ATOM   5437  H  HB3    . ARG B 2 236 ? -3.834  56.326 220.587 1.00 104.02 ? 342 ARG B HB3    1 
ATOM   5438  H  HG2    . ARG B 2 236 ? -3.404  55.980 222.850 1.00 85.31  ? 342 ARG B HG2    1 
ATOM   5439  H  HG3    . ARG B 2 236 ? -4.885  56.445 223.211 1.00 85.31  ? 342 ARG B HG3    1 
ATOM   5440  H  HD2    . ARG B 2 236 ? -5.681  54.608 221.920 1.00 88.36  ? 342 ARG B HD2    1 
ATOM   5441  H  HD3    . ARG B 2 236 ? -4.180  54.102 221.815 1.00 88.36  ? 342 ARG B HD3    1 
ATOM   5442  H  HE     . ARG B 2 236 ? -5.774  53.777 223.936 1.00 81.68  ? 342 ARG B HE     1 
ATOM   5443  H  HH11   . ARG B 2 236 ? -2.565  53.801 223.133 1.00 82.14  ? 342 ARG B HH11   1 
ATOM   5444  H  HH12   . ARG B 2 236 ? -2.098  53.014 224.308 1.00 82.14  ? 342 ARG B HH12   1 
ATOM   5445  H  HH21   . ARG B 2 236 ? -5.053  52.569 225.707 1.00 100.66 ? 342 ARG B HH21   1 
ATOM   5446  H  HH22   . ARG B 2 236 ? -3.603  52.269 225.865 1.00 100.66 ? 342 ARG B HH22   1 
ATOM   5447  N  N      . LEU B 2 237 ? -5.983  59.446 221.923 1.00 59.21  ? 343 LEU B N      1 
ATOM   5448  C  CA     . LEU B 2 237 ? -6.890  60.093 222.856 1.00 68.73  ? 343 LEU B CA     1 
ATOM   5449  C  C      . LEU B 2 237 ? -7.190  59.151 224.015 1.00 85.70  ? 343 LEU B C      1 
ATOM   5450  O  O      . LEU B 2 237 ? -7.542  57.984 223.809 1.00 53.96  ? 343 LEU B O      1 
ATOM   5451  C  CB     . LEU B 2 237 ? -8.182  60.493 222.148 1.00 98.77  ? 343 LEU B CB     1 
ATOM   5452  C  CG     . LEU B 2 237 ? -8.025  61.369 220.904 1.00 87.29  ? 343 LEU B CG     1 
ATOM   5453  C  CD1    . LEU B 2 237 ? -9.393  61.686 220.311 1.00 73.90  ? 343 LEU B CD1    1 
ATOM   5454  C  CD2    . LEU B 2 237 ? -7.255  62.647 221.224 1.00 58.05  ? 343 LEU B CD2    1 
ATOM   5455  H  H      . LEU B 2 237 ? -6.269  59.401 221.113 1.00 71.05  ? 343 LEU B H      1 
ATOM   5456  H  HA     . LEU B 2 237 ? -6.473  60.894 223.211 1.00 82.48  ? 343 LEU B HA     1 
ATOM   5457  H  HB2    . LEU B 2 237 ? -8.642  59.684 221.875 1.00 118.52 ? 343 LEU B HB2    1 
ATOM   5458  H  HB3    . LEU B 2 237 ? -8.736  60.981 222.777 1.00 118.52 ? 343 LEU B HB3    1 
ATOM   5459  H  HG     . LEU B 2 237 ? -7.520  60.878 220.238 1.00 104.75 ? 343 LEU B HG     1 
ATOM   5460  H  HD11   . LEU B 2 237 ? -9.275  62.241 219.525 1.00 88.68  ? 343 LEU B HD11   1 
ATOM   5461  H  HD12   . LEU B 2 237 ? -9.831  60.855 220.068 1.00 88.68  ? 343 LEU B HD12   1 
ATOM   5462  H  HD13   . LEU B 2 237 ? -9.922  62.157 220.974 1.00 88.68  ? 343 LEU B HD13   1 
ATOM   5463  H  HD21   . LEU B 2 237 ? -7.174  63.178 220.416 1.00 69.66  ? 343 LEU B HD21   1 
ATOM   5464  H  HD22   . LEU B 2 237 ? -7.739  63.146 221.901 1.00 69.66  ? 343 LEU B HD22   1 
ATOM   5465  H  HD23   . LEU B 2 237 ? -6.374  62.410 221.554 1.00 69.66  ? 343 LEU B HD23   1 
ATOM   5466  N  N      . GLN B 2 238 ? -7.029  59.654 225.236 1.00 103.16 ? 344 GLN B N      1 
ATOM   5467  C  CA     . GLN B 2 238 ? -7.346  58.862 226.416 1.00 108.54 ? 344 GLN B CA     1 
ATOM   5468  C  C      . GLN B 2 238 ? -8.857  58.703 226.553 1.00 80.31  ? 344 GLN B C      1 
ATOM   5469  O  O      . GLN B 2 238 ? -9.639  59.537 226.086 1.00 66.06  ? 344 GLN B O      1 
ATOM   5470  C  CB     . GLN B 2 238 ? -6.760  59.516 227.673 1.00 101.85 ? 344 GLN B CB     1 
ATOM   5471  C  CG     . GLN B 2 238 ? -7.105  58.810 228.995 1.00 58.36  ? 344 GLN B CG     1 
ATOM   5472  C  CD     . GLN B 2 238 ? -6.751  57.326 228.992 1.00 93.74  ? 344 GLN B CD     1 
ATOM   5473  O  OE1    . GLN B 2 238 ? -5.791  56.902 228.347 1.00 106.34 ? 344 GLN B OE1    1 
ATOM   5474  N  NE2    . GLN B 2 238 ? -7.533  56.532 229.713 1.00 117.72 ? 344 GLN B NE2    1 
ATOM   5475  H  H      . GLN B 2 238 ? -6.739  60.445 225.406 1.00 123.79 ? 344 GLN B H      1 
ATOM   5476  H  HA     . GLN B 2 238 ? -6.955  57.980 226.322 1.00 130.25 ? 344 GLN B HA     1 
ATOM   5477  H  HB2    . GLN B 2 238 ? -5.794  59.528 227.593 1.00 122.22 ? 344 GLN B HB2    1 
ATOM   5478  H  HB3    . GLN B 2 238 ? -7.093  60.425 227.732 1.00 122.22 ? 344 GLN B HB3    1 
ATOM   5479  H  HG2    . GLN B 2 238 ? -6.613  59.234 229.715 1.00 70.03  ? 344 GLN B HG2    1 
ATOM   5480  H  HG3    . GLN B 2 238 ? -8.059  58.890 229.154 1.00 70.03  ? 344 GLN B HG3    1 
ATOM   5481  H  HE21   . GLN B 2 238 ? -8.196  56.862 230.149 1.00 141.26 ? 344 GLN B HE21   1 
ATOM   5482  H  HE22   . GLN B 2 238 ? -7.376  55.687 229.744 1.00 141.26 ? 344 GLN B HE22   1 
ATOM   5483  N  N      . VAL B 2 239 ? -9.262  57.610 227.195 1.00 77.72  ? 345 VAL B N      1 
ATOM   5484  C  CA     . VAL B 2 239 ? -10.673 57.314 227.404 1.00 87.85  ? 345 VAL B CA     1 
ATOM   5485  C  C      . VAL B 2 239 ? -10.878 56.619 228.746 1.00 70.47  ? 345 VAL B C      1 
ATOM   5486  O  O      . VAL B 2 239 ? -11.799 56.952 229.492 1.00 96.68  ? 345 VAL B O      1 
ATOM   5487  C  CB     . VAL B 2 239 ? -11.221 56.459 226.249 1.00 103.51 ? 345 VAL B CB     1 
ATOM   5488  C  CG1    . VAL B 2 239 ? -12.542 55.800 226.639 1.00 114.60 ? 345 VAL B CG1    1 
ATOM   5489  C  CG2    . VAL B 2 239 ? -11.389 57.313 224.994 1.00 63.71  ? 345 VAL B CG2    1 
ATOM   5490  H  H      . VAL B 2 239 ? -8.731  57.018 227.522 1.00 93.26  ? 345 VAL B H      1 
ATOM   5491  H  HA     . VAL B 2 239 ? -11.170 58.146 227.420 1.00 105.42 ? 345 VAL B HA     1 
ATOM   5492  H  HB     . VAL B 2 239 ? -10.584 55.755 226.049 1.00 124.21 ? 345 VAL B HB     1 
ATOM   5493  H  HG11   . VAL B 2 239 ? -12.862 55.270 225.893 1.00 137.52 ? 345 VAL B HG11   1 
ATOM   5494  H  HG12   . VAL B 2 239 ? -12.395 55.232 227.412 1.00 137.52 ? 345 VAL B HG12   1 
ATOM   5495  H  HG13   . VAL B 2 239 ? -13.187 56.492 226.855 1.00 137.52 ? 345 VAL B HG13   1 
ATOM   5496  H  HG21   . VAL B 2 239 ? -11.735 56.758 224.278 1.00 76.45  ? 345 VAL B HG21   1 
ATOM   5497  H  HG22   . VAL B 2 239 ? -12.010 58.034 225.184 1.00 76.45  ? 345 VAL B HG22   1 
ATOM   5498  H  HG23   . VAL B 2 239 ? -10.526 57.677 224.743 1.00 76.45  ? 345 VAL B HG23   1 
ATOM   5499  N  N      . LYS C 1 13  ? -8.685  23.766 245.091 1.00 73.00  ? 32  LYS C N      1 
ATOM   5500  C  CA     . LYS C 1 13  ? -7.903  22.920 245.987 1.00 99.35  ? 32  LYS C CA     1 
ATOM   5501  C  C      . LYS C 1 13  ? -6.571  22.553 245.338 1.00 117.72 ? 32  LYS C C      1 
ATOM   5502  O  O      . LYS C 1 13  ? -6.537  22.129 244.181 1.00 91.46  ? 32  LYS C O      1 
ATOM   5503  C  CB     . LYS C 1 13  ? -8.686  21.655 246.349 1.00 72.00  ? 32  LYS C CB     1 
ATOM   5504  H  HA     . LYS C 1 13  ? -7.718  23.407 246.805 1.00 119.22 ? 32  LYS C HA     1 
ATOM   5505  N  N      . SER C 1 14  ? -5.478  22.717 246.084 1.00 122.37 ? 33  SER C N      1 
ATOM   5506  C  CA     . SER C 1 14  ? -4.130  22.462 245.579 1.00 126.23 ? 33  SER C CA     1 
ATOM   5507  C  C      . SER C 1 14  ? -3.485  21.363 246.415 1.00 126.75 ? 33  SER C C      1 
ATOM   5508  O  O      . SER C 1 14  ? -3.176  21.571 247.595 1.00 72.50  ? 33  SER C O      1 
ATOM   5509  C  CB     . SER C 1 14  ? -3.282  23.733 245.608 1.00 101.12 ? 33  SER C CB     1 
ATOM   5510  O  OG     . SER C 1 14  ? -3.082  24.181 246.938 1.00 107.44 ? 33  SER C OG     1 
ATOM   5511  H  H      . SER C 1 14  ? -5.493  22.981 246.902 1.00 146.85 ? 33  SER C H      1 
ATOM   5512  H  HA     . SER C 1 14  ? -4.185  22.154 244.661 1.00 151.48 ? 33  SER C HA     1 
ATOM   5513  H  HB2    . SER C 1 14  ? -2.419  23.546 245.206 1.00 121.35 ? 33  SER C HB2    1 
ATOM   5514  H  HB3    . SER C 1 14  ? -3.737  24.427 245.107 1.00 121.35 ? 33  SER C HB3    1 
ATOM   5515  H  HG     . SER C 1 14  ? -2.688  23.588 247.384 1.00 128.93 ? 33  SER C HG     1 
ATOM   5516  N  N      . ASN C 1 15  ? -3.272  20.208 245.795 1.00 106.86 ? 34  ASN C N      1 
ATOM   5517  C  CA     . ASN C 1 15  ? -2.652  19.069 246.456 1.00 76.19  ? 34  ASN C CA     1 
ATOM   5518  C  C      . ASN C 1 15  ? -1.148  19.279 246.573 1.00 56.82  ? 34  ASN C C      1 
ATOM   5519  O  O      . ASN C 1 15  ? -0.578  20.175 245.952 1.00 68.05  ? 34  ASN C O      1 
ATOM   5520  C  CB     . ASN C 1 15  ? -2.968  17.791 245.678 1.00 93.39  ? 34  ASN C CB     1 
ATOM   5521  C  CG     . ASN C 1 15  ? -2.703  17.930 244.198 1.00 87.64  ? 34  ASN C CG     1 
ATOM   5522  O  OD1    . ASN C 1 15  ? -3.069  18.932 243.584 1.00 93.20  ? 34  ASN C OD1    1 
ATOM   5523  N  ND2    . ASN C 1 15  ? -2.055  16.927 243.615 1.00 117.59 ? 34  ASN C ND2    1 
ATOM   5524  H  H      . ASN C 1 15  ? -3.483  20.058 244.975 1.00 128.23 ? 34  ASN C H      1 
ATOM   5525  H  HA     . ASN C 1 15  ? -3.017  18.979 247.350 1.00 91.43  ? 34  ASN C HA     1 
ATOM   5526  H  HB2    . ASN C 1 15  ? -2.414  17.070 246.016 1.00 112.07 ? 34  ASN C HB2    1 
ATOM   5527  H  HB3    . ASN C 1 15  ? -3.906  17.573 245.796 1.00 112.07 ? 34  ASN C HB3    1 
ATOM   5528  H  HD21   . ASN C 1 15  ? -1.880  16.960 242.773 1.00 141.11 ? 34  ASN C HD21   1 
ATOM   5529  H  HD22   . ASN C 1 15  ? -1.811  16.246 244.079 1.00 141.11 ? 34  ASN C HD22   1 
ATOM   5530  N  N      . PRO C 1 16  ? -0.464  18.464 247.380 1.00 87.51  ? 35  PRO C N      1 
ATOM   5531  C  CA     . PRO C 1 16  ? 0.996   18.623 247.486 1.00 88.53  ? 35  PRO C CA     1 
ATOM   5532  C  C      . PRO C 1 16  ? 1.727   18.366 246.183 1.00 49.64  ? 35  PRO C C      1 
ATOM   5533  O  O      . PRO C 1 16  ? 2.794   18.952 245.956 1.00 45.88  ? 35  PRO C O      1 
ATOM   5534  C  CB     . PRO C 1 16  ? 1.383   17.602 248.568 1.00 96.19  ? 35  PRO C CB     1 
ATOM   5535  C  CG     . PRO C 1 16  ? 0.252   16.630 248.606 1.00 94.80  ? 35  PRO C CG     1 
ATOM   5536  C  CD     . PRO C 1 16  ? -0.969  17.433 248.303 1.00 111.06 ? 35  PRO C CD     1 
ATOM   5537  H  HA     . PRO C 1 16  ? 1.212   19.515 247.801 1.00 106.23 ? 35  PRO C HA     1 
ATOM   5538  H  HB2    . PRO C 1 16  ? 2.208   17.158 248.318 1.00 115.43 ? 35  PRO C HB2    1 
ATOM   5539  H  HB3    . PRO C 1 16  ? 1.479   18.051 249.422 1.00 115.43 ? 35  PRO C HB3    1 
ATOM   5540  H  HG2    . PRO C 1 16  ? 0.387   15.945 247.933 1.00 113.77 ? 35  PRO C HG2    1 
ATOM   5541  H  HG3    . PRO C 1 16  ? 0.191   16.235 249.490 1.00 113.77 ? 35  PRO C HG3    1 
ATOM   5542  H  HD2    . PRO C 1 16  ? -1.637  16.883 247.865 1.00 133.28 ? 35  PRO C HD2    1 
ATOM   5543  H  HD3    . PRO C 1 16  ? -1.316  17.841 249.112 1.00 133.28 ? 35  PRO C HD3    1 
ATOM   5544  N  N      . SER C 1 17  ? 1.192   17.506 245.314 1.00 98.35  ? 36  SER C N      1 
ATOM   5545  C  CA     . SER C 1 17  ? 1.887   17.203 244.068 1.00 78.92  ? 36  SER C CA     1 
ATOM   5546  C  C      . SER C 1 17  ? 1.760   18.341 243.067 1.00 66.79  ? 36  SER C C      1 
ATOM   5547  O  O      . SER C 1 17  ? 2.724   18.654 242.361 1.00 31.64  ? 36  SER C O      1 
ATOM   5548  C  CB     . SER C 1 17  ? 1.360   15.905 243.462 1.00 47.06  ? 36  SER C CB     1 
ATOM   5549  O  OG     . SER C 1 17  ? 2.410   14.958 243.334 1.00 61.61  ? 36  SER C OG     1 
ATOM   5550  H  H      . SER C 1 17  ? 0.445   17.094 245.421 1.00 118.01 ? 36  SER C H      1 
ATOM   5551  H  HA     . SER C 1 17  ? 2.830   17.080 244.258 1.00 94.71  ? 36  SER C HA     1 
ATOM   5552  H  HB2    . SER C 1 17  ? 0.672   15.540 244.041 1.00 56.47  ? 36  SER C HB2    1 
ATOM   5553  H  HB3    . SER C 1 17  ? 0.992   16.091 242.584 1.00 56.47  ? 36  SER C HB3    1 
ATOM   5554  H  HG     . SER C 1 17  ? 2.116   14.245 243.001 1.00 73.93  ? 36  SER C HG     1 
ATOM   5555  N  N      . LYS C 1 18  ? 0.584   18.968 242.984 1.00 34.58  ? 37  LYS C N      1 
ATOM   5556  C  CA     . LYS C 1 18  ? 0.442   20.126 242.112 1.00 32.24  ? 37  LYS C CA     1 
ATOM   5557  C  C      . LYS C 1 18  ? 1.502   21.172 242.419 1.00 56.84  ? 37  LYS C C      1 
ATOM   5558  O  O      . LYS C 1 18  ? 2.086   21.756 241.505 1.00 50.41  ? 37  LYS C O      1 
ATOM   5559  C  CB     . LYS C 1 18  ? -0.949  20.741 242.242 1.00 53.53  ? 37  LYS C CB     1 
ATOM   5560  C  CG     . LYS C 1 18  ? -1.218  21.847 241.222 1.00 58.36  ? 37  LYS C CG     1 
ATOM   5561  C  CD     . LYS C 1 18  ? -2.356  22.756 241.651 1.00 104.97 ? 37  LYS C CD     1 
ATOM   5562  C  CE     . LYS C 1 18  ? -3.666  21.996 241.809 1.00 105.92 ? 37  LYS C CE     1 
ATOM   5563  N  NZ     . LYS C 1 18  ? -4.784  22.897 242.203 1.00 102.57 ? 37  LYS C NZ     1 
ATOM   5564  H  H      . LYS C 1 18  ? -0.128  18.746 243.413 1.00 41.49  ? 37  LYS C H      1 
ATOM   5565  H  HA     . LYS C 1 18  ? 0.559   19.843 241.191 1.00 38.69  ? 37  LYS C HA     1 
ATOM   5566  H  HB2    . LYS C 1 18  ? -1.613  20.046 242.111 1.00 64.24  ? 37  LYS C HB2    1 
ATOM   5567  H  HB3    . LYS C 1 18  ? -1.041  21.123 243.129 1.00 64.24  ? 37  LYS C HB3    1 
ATOM   5568  H  HG2    . LYS C 1 18  ? -0.420  22.389 241.123 1.00 70.03  ? 37  LYS C HG2    1 
ATOM   5569  H  HG3    . LYS C 1 18  ? -1.456  21.445 240.372 1.00 70.03  ? 37  LYS C HG3    1 
ATOM   5570  H  HD2    . LYS C 1 18  ? -2.137  23.160 242.504 1.00 125.96 ? 37  LYS C HD2    1 
ATOM   5571  H  HD3    . LYS C 1 18  ? -2.485  23.443 240.978 1.00 125.96 ? 37  LYS C HD3    1 
ATOM   5572  H  HE2    . LYS C 1 18  ? -3.897  21.579 240.964 1.00 127.10 ? 37  LYS C HE2    1 
ATOM   5573  H  HE3    . LYS C 1 18  ? -3.563  21.321 242.498 1.00 127.10 ? 37  LYS C HE3    1 
ATOM   5574  H  HZ1    . LYS C 1 18  ? -5.536  22.428 242.289 1.00 123.09 ? 37  LYS C HZ1    1 
ATOM   5575  H  HZ2    . LYS C 1 18  ? -4.598  23.290 242.980 1.00 123.09 ? 37  LYS C HZ2    1 
ATOM   5576  H  HZ3    . LYS C 1 18  ? -4.903  23.523 241.583 1.00 123.09 ? 37  LYS C HZ3    1 
ATOM   5577  N  N      . ARG C 1 19  ? 1.766   21.430 243.701 1.00 43.30  ? 38  ARG C N      1 
ATOM   5578  C  CA     . ARG C 1 19  ? 2.802   22.399 244.044 1.00 68.56  ? 38  ARG C CA     1 
ATOM   5579  C  C      . ARG C 1 19  ? 4.153   21.977 243.478 1.00 58.67  ? 38  ARG C C      1 
ATOM   5580  O  O      . ARG C 1 19  ? 4.900   22.806 242.941 1.00 98.27  ? 38  ARG C O      1 
ATOM   5581  C  CB     . ARG C 1 19  ? 2.876   22.581 245.562 1.00 106.36 ? 38  ARG C CB     1 
ATOM   5582  C  CG     . ARG C 1 19  ? 1.713   23.404 246.132 1.00 116.98 ? 38  ARG C CG     1 
ATOM   5583  C  CD     . ARG C 1 19  ? 1.863   23.701 247.622 1.00 66.70  ? 38  ARG C CD     1 
ATOM   5584  N  NE     . ARG C 1 19  ? 0.867   22.982 248.415 1.00 81.56  ? 38  ARG C NE     1 
ATOM   5585  C  CZ     . ARG C 1 19  ? 1.100   21.881 249.125 1.00 111.52 ? 38  ARG C CZ     1 
ATOM   5586  N  NH1    . ARG C 1 19  ? 2.312   21.339 249.173 1.00 95.57  ? 38  ARG C NH1    1 
ATOM   5587  N  NH2    . ARG C 1 19  ? 0.108   21.316 249.801 1.00 123.55 ? 38  ARG C NH2    1 
ATOM   5588  H  H      . ARG C 1 19  ? 1.371   21.066 244.373 1.00 51.96  ? 38  ARG C H      1 
ATOM   5589  H  HA     . ARG C 1 19  ? 2.571   23.256 243.653 1.00 82.27  ? 38  ARG C HA     1 
ATOM   5590  H  HB2    . ARG C 1 19  ? 2.858   21.708 245.985 1.00 127.64 ? 38  ARG C HB2    1 
ATOM   5591  H  HB3    . ARG C 1 19  ? 3.701   23.039 245.784 1.00 127.64 ? 38  ARG C HB3    1 
ATOM   5592  H  HG2    . ARG C 1 19  ? 1.665   24.250 245.661 1.00 140.37 ? 38  ARG C HG2    1 
ATOM   5593  H  HG3    . ARG C 1 19  ? 0.887   22.909 246.008 1.00 140.37 ? 38  ARG C HG3    1 
ATOM   5594  H  HD2    . ARG C 1 19  ? 2.745   23.423 247.917 1.00 80.04  ? 38  ARG C HD2    1 
ATOM   5595  H  HD3    . ARG C 1 19  ? 1.743   24.652 247.772 1.00 80.04  ? 38  ARG C HD3    1 
ATOM   5596  H  HE     . ARG C 1 19  ? 0.067   23.296 248.423 1.00 97.88  ? 38  ARG C HE     1 
ATOM   5597  H  HH11   . ARG C 1 19  ? 2.961   21.698 248.738 1.00 114.68 ? 38  ARG C HH11   1 
ATOM   5598  H  HH12   . ARG C 1 19  ? 2.447   20.628 249.638 1.00 114.68 ? 38  ARG C HH12   1 
ATOM   5599  H  HH21   . ARG C 1 19  ? -0.680  21.661 249.778 1.00 148.26 ? 38  ARG C HH21   1 
ATOM   5600  H  HH22   . ARG C 1 19  ? 0.253   20.606 250.265 1.00 148.26 ? 38  ARG C HH22   1 
ATOM   5601  N  N      . HIS C 1 20  ? 4.473   20.685 243.562 1.00 47.39  ? 39  HIS C N      1 
ATOM   5602  C  CA     . HIS C 1 20  ? 5.742   20.202 243.026 1.00 46.74  ? 39  HIS C CA     1 
ATOM   5603  C  C      . HIS C 1 20  ? 5.788   20.338 241.511 1.00 72.65  ? 39  HIS C C      1 
ATOM   5604  O  O      . HIS C 1 20  ? 6.723   20.933 240.957 1.00 74.91  ? 39  HIS C O      1 
ATOM   5605  C  CB     . HIS C 1 20  ? 5.961   18.747 243.428 1.00 42.64  ? 39  HIS C CB     1 
ATOM   5606  C  CG     . HIS C 1 20  ? 7.246   18.174 242.918 1.00 40.15  ? 39  HIS C CG     1 
ATOM   5607  N  ND1    . HIS C 1 20  ? 7.306   16.994 242.209 1.00 47.25  ? 39  HIS C ND1    1 
ATOM   5608  C  CD2    . HIS C 1 20  ? 8.520   18.625 243.007 1.00 63.61  ? 39  HIS C CD2    1 
ATOM   5609  C  CE1    . HIS C 1 20  ? 8.562   16.737 241.890 1.00 42.91  ? 39  HIS C CE1    1 
ATOM   5610  N  NE2    . HIS C 1 20  ? 9.319   17.711 242.363 1.00 92.38  ? 39  HIS C NE2    1 
ATOM   5611  H  H      . HIS C 1 20  ? 3.980   20.078 243.919 1.00 56.86  ? 39  HIS C H      1 
ATOM   5612  H  HA     . HIS C 1 20  ? 6.466   20.730 243.398 1.00 56.08  ? 39  HIS C HA     1 
ATOM   5613  H  HB2    . HIS C 1 20  ? 5.973   18.688 244.396 1.00 51.17  ? 39  HIS C HB2    1 
ATOM   5614  H  HB3    . HIS C 1 20  ? 5.235   18.211 243.073 1.00 51.17  ? 39  HIS C HB3    1 
ATOM   5615  H  HD2    . HIS C 1 20  ? 8.802   19.403 243.431 1.00 76.33  ? 39  HIS C HD2    1 
ATOM   5616  H  HE1    . HIS C 1 20  ? 8.862   15.998 241.412 1.00 51.49  ? 39  HIS C HE1    1 
ATOM   5617  H  HE2    . HIS C 1 20  ? 10.173  17.766 242.279 1.00 110.85 ? 39  HIS C HE2    1 
ATOM   5618  N  N      . ARG C 1 21  ? 4.797   19.771 240.820 1.00 92.27  ? 40  ARG C N      1 
ATOM   5619  C  CA     . ARG C 1 21  ? 4.741   19.905 239.370 1.00 66.61  ? 40  ARG C CA     1 
ATOM   5620  C  C      . ARG C 1 21  ? 4.904   21.363 238.969 1.00 59.52  ? 40  ARG C C      1 
ATOM   5621  O  O      . ARG C 1 21  ? 5.773   21.706 238.165 1.00 53.32  ? 40  ARG C O      1 
ATOM   5622  C  CB     . ARG C 1 21  ? 3.422   19.346 238.831 1.00 78.40  ? 40  ARG C CB     1 
ATOM   5623  C  CG     . ARG C 1 21  ? 3.096   17.922 239.280 1.00 82.15  ? 40  ARG C CG     1 
ATOM   5624  C  CD     . ARG C 1 21  ? 1.964   17.322 238.455 1.00 45.06  ? 40  ARG C CD     1 
ATOM   5625  N  NE     . ARG C 1 21  ? 0.924   18.313 238.189 1.00 44.44  ? 40  ARG C NE     1 
ATOM   5626  C  CZ     . ARG C 1 21  ? -0.253  18.385 238.807 1.00 55.29  ? 40  ARG C CZ     1 
ATOM   5627  N  NH1    . ARG C 1 21  ? -0.594  17.514 239.748 1.00 78.40  ? 40  ARG C NH1    1 
ATOM   5628  N  NH2    . ARG C 1 21  ? -1.105  19.343 238.468 1.00 76.53  ? 40  ARG C NH2    1 
ATOM   5629  H  H      . ARG C 1 21  ? 4.156   19.311 241.163 1.00 110.72 ? 40  ARG C H      1 
ATOM   5630  H  HA     . ARG C 1 21  ? 5.468   19.399 238.974 1.00 79.93  ? 40  ARG C HA     1 
ATOM   5631  H  HB2    . ARG C 1 21  ? 2.699   19.920 239.128 1.00 94.08  ? 40  ARG C HB2    1 
ATOM   5632  H  HB3    . ARG C 1 21  ? 3.460   19.345 237.861 1.00 94.08  ? 40  ARG C HB3    1 
ATOM   5633  H  HG2    . ARG C 1 21  ? 3.882   17.363 239.171 1.00 98.58  ? 40  ARG C HG2    1 
ATOM   5634  H  HG3    . ARG C 1 21  ? 2.820   17.935 240.210 1.00 98.58  ? 40  ARG C HG3    1 
ATOM   5635  H  HD2    . ARG C 1 21  ? 2.315   17.012 237.605 1.00 54.07  ? 40  ARG C HD2    1 
ATOM   5636  H  HD3    . ARG C 1 21  ? 1.566   16.585 238.943 1.00 54.07  ? 40  ARG C HD3    1 
ATOM   5637  H  HE     . ARG C 1 21  ? 1.086   18.900 237.582 1.00 53.33  ? 40  ARG C HE     1 
ATOM   5638  H  HH11   . ARG C 1 21  ? -0.048  16.890 239.975 1.00 94.09  ? 40  ARG C HH11   1 
ATOM   5639  H  HH12   . ARG C 1 21  ? -1.360  17.576 240.134 1.00 94.09  ? 40  ARG C HH12   1 
ATOM   5640  H  HH21   . ARG C 1 21  ? -0.893  19.910 237.857 1.00 91.83  ? 40  ARG C HH21   1 
ATOM   5641  H  HH22   . ARG C 1 21  ? -1.869  19.397 238.858 1.00 91.83  ? 40  ARG C HH22   1 
ATOM   5642  N  N      . ASP C 1 22  ? 4.096   22.241 239.560 1.00 31.27  ? 41  ASP C N      1 
ATOM   5643  C  CA     . ASP C 1 22  ? 4.125   23.653 239.198 1.00 50.81  ? 41  ASP C CA     1 
ATOM   5644  C  C      . ASP C 1 22  ? 5.512   24.249 239.398 1.00 31.55  ? 41  ASP C C      1 
ATOM   5645  O  O      . ASP C 1 22  ? 6.004   24.990 238.539 1.00 80.65  ? 41  ASP C O      1 
ATOM   5646  C  CB     . ASP C 1 22  ? 3.076   24.416 240.010 1.00 36.31  ? 41  ASP C CB     1 
ATOM   5647  C  CG     . ASP C 1 22  ? 1.665   23.897 239.768 1.00 101.88 ? 41  ASP C CG     1 
ATOM   5648  O  OD1    . ASP C 1 22  ? 1.522   22.879 239.058 1.00 108.89 ? 41  ASP C OD1    1 
ATOM   5649  O  OD2    . ASP C 1 22  ? 0.698   24.499 240.282 1.00 60.09  ? 41  ASP C OD2    1 
ATOM   5650  H  H      . ASP C 1 22  ? 3.525   22.045 240.172 1.00 37.53  ? 41  ASP C H      1 
ATOM   5651  H  HA     . ASP C 1 22  ? 3.896   23.740 238.259 1.00 60.97  ? 41  ASP C HA     1 
ATOM   5652  H  HB2    . ASP C 1 22  ? 3.274   24.319 240.954 1.00 43.58  ? 41  ASP C HB2    1 
ATOM   5653  H  HB3    . ASP C 1 22  ? 3.100   25.352 239.758 1.00 43.58  ? 41  ASP C HB3    1 
ATOM   5654  N  N      . ARG C 1 23  ? 6.162   23.944 240.522 1.00 47.56  ? 42  ARG C N      1 
ATOM   5655  C  CA     . ARG C 1 23  ? 7.533   24.409 240.705 1.00 90.84  ? 42  ARG C CA     1 
ATOM   5656  C  C      . ARG C 1 23  ? 8.417   23.946 239.554 1.00 70.20  ? 42  ARG C C      1 
ATOM   5657  O  O      . ARG C 1 23  ? 9.118   24.753 238.927 1.00 81.93  ? 42  ARG C O      1 
ATOM   5658  C  CB     . ARG C 1 23  ? 8.090   23.922 242.043 1.00 88.40  ? 42  ARG C CB     1 
ATOM   5659  C  CG     . ARG C 1 23  ? 7.481   24.624 243.251 1.00 90.74  ? 42  ARG C CG     1 
ATOM   5660  C  CD     . ARG C 1 23  ? 8.137   24.199 244.551 1.00 101.83 ? 42  ARG C CD     1 
ATOM   5661  N  NE     . ARG C 1 23  ? 7.135   23.822 245.546 1.00 85.89  ? 42  ARG C NE     1 
ATOM   5662  C  CZ     . ARG C 1 23  ? 6.994   22.611 246.083 1.00 108.31 ? 42  ARG C CZ     1 
ATOM   5663  N  NH1    . ARG C 1 23  ? 7.807   21.612 245.756 1.00 65.90  ? 42  ARG C NH1    1 
ATOM   5664  N  NH2    . ARG C 1 23  ? 6.034   22.400 246.976 1.00 101.53 ? 42  ARG C NH2    1 
ATOM   5665  H  H      . ARG C 1 23  ? 5.843   23.483 241.173 1.00 57.07  ? 42  ARG C H      1 
ATOM   5666  H  HA     . ARG C 1 23  ? 7.538   25.379 240.715 1.00 109.01 ? 42  ARG C HA     1 
ATOM   5667  H  HB2    . ARG C 1 23  ? 7.910   22.972 242.130 1.00 106.07 ? 42  ARG C HB2    1 
ATOM   5668  H  HB3    . ARG C 1 23  ? 9.047   24.078 242.060 1.00 106.07 ? 42  ARG C HB3    1 
ATOM   5669  H  HG2    . ARG C 1 23  ? 7.596   25.582 243.153 1.00 108.88 ? 42  ARG C HG2    1 
ATOM   5670  H  HG3    . ARG C 1 23  ? 6.537   24.405 243.303 1.00 108.88 ? 42  ARG C HG3    1 
ATOM   5671  H  HD2    . ARG C 1 23  ? 8.709   23.433 244.387 1.00 122.20 ? 42  ARG C HD2    1 
ATOM   5672  H  HD3    . ARG C 1 23  ? 8.657   24.938 244.905 1.00 122.20 ? 42  ARG C HD3    1 
ATOM   5673  H  HE     . ARG C 1 23  ? 6.590   24.434 245.807 1.00 103.07 ? 42  ARG C HE     1 
ATOM   5674  H  HH11   . ARG C 1 23  ? 8.432   21.738 245.178 1.00 79.08  ? 42  ARG C HH11   1 
ATOM   5675  H  HH12   . ARG C 1 23  ? 7.704   20.838 246.115 1.00 79.08  ? 42  ARG C HH12   1 
ATOM   5676  H  HH21   . ARG C 1 23  ? 5.505   23.041 247.198 1.00 121.84 ? 42  ARG C HH21   1 
ATOM   5677  H  HH22   . ARG C 1 23  ? 5.941   21.623 247.332 1.00 121.84 ? 42  ARG C HH22   1 
ATOM   5678  N  N      . LEU C 1 24  ? 8.387   22.647 239.251 1.00 59.04  ? 43  LEU C N      1 
ATOM   5679  C  CA     . LEU C 1 24  ? 9.215   22.128 238.167 1.00 77.22  ? 43  LEU C CA     1 
ATOM   5680  C  C      . LEU C 1 24  ? 8.936   22.871 236.870 1.00 63.84  ? 43  LEU C C      1 
ATOM   5681  O  O      . LEU C 1 24  ? 9.820   23.516 236.303 1.00 68.54  ? 43  LEU C O      1 
ATOM   5682  C  CB     . LEU C 1 24  ? 8.969   20.626 237.984 1.00 44.20  ? 43  LEU C CB     1 
ATOM   5683  C  CG     . LEU C 1 24  ? 9.845   19.584 238.694 1.00 50.81  ? 43  LEU C CG     1 
ATOM   5684  C  CD1    . LEU C 1 24  ? 10.277  18.519 237.694 1.00 77.39  ? 43  LEU C CD1    1 
ATOM   5685  C  CD2    . LEU C 1 24  ? 11.060  20.175 239.385 1.00 70.36  ? 43  LEU C CD2    1 
ATOM   5686  H  H      . LEU C 1 24  ? 7.904   22.057 239.650 1.00 70.85  ? 43  LEU C H      1 
ATOM   5687  H  HA     . LEU C 1 24  ? 10.150  22.255 238.393 1.00 92.66  ? 43  LEU C HA     1 
ATOM   5688  H  HB2    . LEU C 1 24  ? 8.057   20.449 238.265 1.00 53.05  ? 43  LEU C HB2    1 
ATOM   5689  H  HB3    . LEU C 1 24  ? 9.040   20.438 237.035 1.00 53.05  ? 43  LEU C HB3    1 
ATOM   5690  H  HG     . LEU C 1 24  ? 9.310   19.144 239.373 1.00 60.97  ? 43  LEU C HG     1 
ATOM   5691  H  HD11   . LEU C 1 24  ? 10.830  17.865 238.149 1.00 92.87  ? 43  LEU C HD11   1 
ATOM   5692  H  HD12   . LEU C 1 24  ? 9.487   18.090 237.330 1.00 92.87  ? 43  LEU C HD12   1 
ATOM   5693  H  HD13   . LEU C 1 24  ? 10.782  18.942 236.982 1.00 92.87  ? 43  LEU C HD13   1 
ATOM   5694  H  HD21   . LEU C 1 24  ? 11.561  19.460 239.808 1.00 84.43  ? 43  LEU C HD21   1 
ATOM   5695  H  HD22   . LEU C 1 24  ? 11.613  20.621 238.725 1.00 84.43  ? 43  LEU C HD22   1 
ATOM   5696  H  HD23   . LEU C 1 24  ? 10.764  20.812 240.054 1.00 84.43  ? 43  LEU C HD23   1 
ATOM   5697  N  N      . ASN C 1 25  ? 7.698   22.792 236.388 1.00 78.44  ? 44  ASN C N      1 
ATOM   5698  C  CA     . ASN C 1 25  ? 7.333   23.423 235.127 1.00 32.96  ? 44  ASN C CA     1 
ATOM   5699  C  C      . ASN C 1 25  ? 7.696   24.899 235.104 1.00 39.81  ? 44  ASN C C      1 
ATOM   5700  O  O      . ASN C 1 25  ? 7.942   25.460 234.033 1.00 80.40  ? 44  ASN C O      1 
ATOM   5701  C  CB     . ASN C 1 25  ? 5.833   23.245 234.881 1.00 31.06  ? 44  ASN C CB     1 
ATOM   5702  C  CG     . ASN C 1 25  ? 5.450   21.799 234.626 1.00 52.02  ? 44  ASN C CG     1 
ATOM   5703  O  OD1    . ASN C 1 25  ? 6.283   20.895 234.731 1.00 66.39  ? 44  ASN C OD1    1 
ATOM   5704  N  ND2    . ASN C 1 25  ? 4.180   21.570 234.298 1.00 61.28  ? 44  ASN C ND2    1 
ATOM   5705  H  H      . ASN C 1 25  ? 7.051   22.377 236.774 1.00 94.13  ? 44  ASN C H      1 
ATOM   5706  H  HA     . ASN C 1 25  ? 7.810   22.985 234.405 1.00 39.55  ? 44  ASN C HA     1 
ATOM   5707  H  HB2    . ASN C 1 25  ? 5.345   23.552 235.661 1.00 37.27  ? 44  ASN C HB2    1 
ATOM   5708  H  HB3    . ASN C 1 25  ? 5.576   23.765 234.103 1.00 37.27  ? 44  ASN C HB3    1 
ATOM   5709  H  HD21   . ASN C 1 25  ? 3.914   20.767 234.143 1.00 73.54  ? 44  ASN C HD21   1 
ATOM   5710  H  HD22   . ASN C 1 25  ? 3.626   22.226 234.240 1.00 73.54  ? 44  ASN C HD22   1 
ATOM   5711  N  N      . THR C 1 26  ? 7.719   25.553 236.264 1.00 35.02  ? 45  THR C N      1 
ATOM   5712  C  CA     . THR C 1 26  ? 8.088   26.963 236.294 1.00 58.02  ? 45  THR C CA     1 
ATOM   5713  C  C      . THR C 1 26  ? 9.588   27.131 236.084 1.00 36.79  ? 45  THR C C      1 
ATOM   5714  O  O      . THR C 1 26  ? 10.025  27.963 235.278 1.00 74.60  ? 45  THR C O      1 
ATOM   5715  C  CB     . THR C 1 26  ? 7.646   27.600 237.614 1.00 37.22  ? 45  THR C CB     1 
ATOM   5716  O  OG1    . THR C 1 26  ? 6.237   27.406 237.786 1.00 63.42  ? 45  THR C OG1    1 
ATOM   5717  C  CG2    . THR C 1 26  ? 7.939   29.095 237.617 1.00 65.17  ? 45  THR C CG2    1 
ATOM   5718  H  H      . THR C 1 26  ? 7.529   25.211 237.030 1.00 42.03  ? 45  THR C H      1 
ATOM   5719  H  HA     . THR C 1 26  ? 7.632   27.423 235.573 1.00 69.63  ? 45  THR C HA     1 
ATOM   5720  H  HB     . THR C 1 26  ? 8.124   27.189 238.351 1.00 44.66  ? 45  THR C HB     1 
ATOM   5721  H  HG1    . THR C 1 26  ? 6.060   26.585 237.801 1.00 76.11  ? 45  THR C HG1    1 
ATOM   5722  H  HG21   . THR C 1 26  ? 7.654   29.486 238.458 1.00 78.21  ? 45  THR C HG21   1 
ATOM   5723  H  HG22   . THR C 1 26  ? 8.890   29.247 237.505 1.00 78.21  ? 45  THR C HG22   1 
ATOM   5724  H  HG23   . THR C 1 26  ? 7.462   29.528 236.891 1.00 78.21  ? 45  THR C HG23   1 
ATOM   5725  N  N      . GLU C 1 27  ? 10.397  26.343 236.794 1.00 64.80  ? 46  GLU C N      1 
ATOM   5726  C  CA     . GLU C 1 27  ? 11.838  26.452 236.606 1.00 65.32  ? 46  GLU C CA     1 
ATOM   5727  C  C      . GLU C 1 27  ? 12.247  26.001 235.212 1.00 59.27  ? 46  GLU C C      1 
ATOM   5728  O  O      . GLU C 1 27  ? 13.250  26.481 234.674 1.00 74.29  ? 46  GLU C O      1 
ATOM   5729  C  CB     . GLU C 1 27  ? 12.579  25.634 237.663 1.00 66.60  ? 46  GLU C CB     1 
ATOM   5730  C  CG     . GLU C 1 27  ? 13.861  26.297 238.151 1.00 65.23  ? 46  GLU C CG     1 
ATOM   5731  C  CD     . GLU C 1 27  ? 13.595  27.589 238.907 1.00 104.25 ? 46  GLU C CD     1 
ATOM   5732  O  OE1    . GLU C 1 27  ? 12.515  27.709 239.525 1.00 87.70  ? 46  GLU C OE1    1 
ATOM   5733  O  OE2    . GLU C 1 27  ? 14.461  28.487 238.877 1.00 103.40 ? 46  GLU C OE2    1 
ATOM   5734  H  H      . GLU C 1 27  ? 10.145  25.758 237.372 1.00 77.76  ? 46  GLU C H      1 
ATOM   5735  H  HA     . GLU C 1 27  ? 12.100  27.381 236.708 1.00 78.38  ? 46  GLU C HA     1 
ATOM   5736  H  HB2    . GLU C 1 27  ? 11.998  25.510 238.429 1.00 79.92  ? 46  GLU C HB2    1 
ATOM   5737  H  HB3    . GLU C 1 27  ? 12.815  24.773 237.285 1.00 79.92  ? 46  GLU C HB3    1 
ATOM   5738  H  HG2    . GLU C 1 27  ? 14.324  25.689 238.749 1.00 78.28  ? 46  GLU C HG2    1 
ATOM   5739  H  HG3    . GLU C 1 27  ? 14.421  26.505 237.388 1.00 78.28  ? 46  GLU C HG3    1 
ATOM   5740  N  N      . LEU C 1 28  ? 11.488  25.082 234.619 1.00 74.71  ? 47  LEU C N      1 
ATOM   5741  C  CA     . LEU C 1 28  ? 11.792  24.590 233.283 1.00 53.10  ? 47  LEU C CA     1 
ATOM   5742  C  C      . LEU C 1 28  ? 11.355  25.589 232.222 1.00 66.24  ? 47  LEU C C      1 
ATOM   5743  O  O      . LEU C 1 28  ? 12.050  25.775 231.219 1.00 73.02  ? 47  LEU C O      1 
ATOM   5744  C  CB     . LEU C 1 28  ? 11.110  23.240 233.068 1.00 50.97  ? 47  LEU C CB     1 
ATOM   5745  C  CG     . LEU C 1 28  ? 11.564  22.416 231.867 1.00 77.81  ? 47  LEU C CG     1 
ATOM   5746  C  CD1    . LEU C 1 28  ? 11.290  20.942 232.139 1.00 67.47  ? 47  LEU C CD1    1 
ATOM   5747  C  CD2    . LEU C 1 28  ? 10.858  22.869 230.593 1.00 117.29 ? 47  LEU C CD2    1 
ATOM   5748  H  H      . LEU C 1 28  ? 10.789  24.728 234.972 1.00 89.65  ? 47  LEU C H      1 
ATOM   5749  H  HA     . LEU C 1 28  ? 12.750  24.462 233.201 1.00 63.72  ? 47  LEU C HA     1 
ATOM   5750  H  HB2    . LEU C 1 28  ? 11.259  22.698 233.858 1.00 61.17  ? 47  LEU C HB2    1 
ATOM   5751  H  HB3    . LEU C 1 28  ? 10.159  23.397 232.963 1.00 61.17  ? 47  LEU C HB3    1 
ATOM   5752  H  HG     . LEU C 1 28  ? 12.519  22.530 231.742 1.00 93.37  ? 47  LEU C HG     1 
ATOM   5753  H  HD11   . LEU C 1 28  ? 11.579  20.421 231.374 1.00 80.96  ? 47  LEU C HD11   1 
ATOM   5754  H  HD12   . LEU C 1 28  ? 11.782  20.671 232.930 1.00 80.96  ? 47  LEU C HD12   1 
ATOM   5755  H  HD13   . LEU C 1 28  ? 10.338  20.820 232.283 1.00 80.96  ? 47  LEU C HD13   1 
ATOM   5756  H  HD21   . LEU C 1 28  ? 11.168  22.326 229.851 1.00 140.75 ? 47  LEU C HD21   1 
ATOM   5757  H  HD22   . LEU C 1 28  ? 9.901   22.758 230.706 1.00 140.75 ? 47  LEU C HD22   1 
ATOM   5758  H  HD23   . LEU C 1 28  ? 11.066  23.802 230.430 1.00 140.75 ? 47  LEU C HD23   1 
ATOM   5759  N  N      . ASP C 1 29  ? 10.199  26.224 232.417 1.00 58.31  ? 48  ASP C N      1 
ATOM   5760  C  CA     . ASP C 1 29  ? 9.789   27.300 231.522 1.00 73.57  ? 48  ASP C CA     1 
ATOM   5761  C  C      . ASP C 1 29  ? 10.799  28.439 231.564 1.00 44.77  ? 48  ASP C C      1 
ATOM   5762  O  O      . ASP C 1 29  ? 11.156  29.010 230.525 1.00 79.47  ? 48  ASP C O      1 
ATOM   5763  C  CB     . ASP C 1 29  ? 8.391   27.790 231.906 1.00 38.66  ? 48  ASP C CB     1 
ATOM   5764  C  CG     . ASP C 1 29  ? 7.612   28.334 230.721 1.00 107.23 ? 48  ASP C CG     1 
ATOM   5765  O  OD1    . ASP C 1 29  ? 8.236   28.928 229.815 1.00 122.85 ? 48  ASP C OD1    1 
ATOM   5766  O  OD2    . ASP C 1 29  ? 6.373   28.161 230.697 1.00 92.80  ? 48  ASP C OD2    1 
ATOM   5767  H  H      . ASP C 1 29  ? 9.643   26.053 233.050 1.00 69.97  ? 48  ASP C H      1 
ATOM   5768  H  HA     . ASP C 1 29  ? 9.753   26.962 230.613 1.00 88.28  ? 48  ASP C HA     1 
ATOM   5769  H  HB2    . ASP C 1 29  ? 7.888   27.050 232.280 1.00 46.39  ? 48  ASP C HB2    1 
ATOM   5770  H  HB3    . ASP C 1 29  ? 8.474   28.500 232.561 1.00 46.39  ? 48  ASP C HB3    1 
ATOM   5771  N  N      . ARG C 1 30  ? 11.280  28.775 232.760 1.00 48.30  ? 49  ARG C N      1 
ATOM   5772  C  CA     . ARG C 1 30  ? 12.328  29.780 232.877 1.00 71.89  ? 49  ARG C CA     1 
ATOM   5773  C  C      . ARG C 1 30  ? 13.590  29.326 232.158 1.00 40.75  ? 49  ARG C C      1 
ATOM   5774  O  O      . ARG C 1 30  ? 14.208  30.091 231.410 1.00 61.14  ? 49  ARG C O      1 
ATOM   5775  C  CB     . ARG C 1 30  ? 12.616  30.055 234.356 1.00 69.23  ? 49  ARG C CB     1 
ATOM   5776  C  CG     . ARG C 1 30  ? 13.518  31.260 234.612 1.00 89.92  ? 49  ARG C CG     1 
ATOM   5777  C  CD     . ARG C 1 30  ? 12.946  32.538 234.006 1.00 122.88 ? 49  ARG C CD     1 
ATOM   5778  N  NE     . ARG C 1 30  ? 11.509  32.658 234.239 1.00 147.05 ? 49  ARG C NE     1 
ATOM   5779  C  CZ     . ARG C 1 30  ? 10.965  32.979 235.409 1.00 137.07 ? 49  ARG C CZ     1 
ATOM   5780  N  NH1    . ARG C 1 30  ? 11.737  33.207 236.465 1.00 85.62  ? 49  ARG C NH1    1 
ATOM   5781  N  NH2    . ARG C 1 30  ? 9.645   33.063 235.526 1.00 115.29 ? 49  ARG C NH2    1 
ATOM   5782  H  H      . ARG C 1 30  ? 11.019  28.441 233.508 1.00 57.96  ? 49  ARG C H      1 
ATOM   5783  H  HA     . ARG C 1 30  ? 12.026  30.606 232.468 1.00 86.26  ? 49  ARG C HA     1 
ATOM   5784  H  HB2    . ARG C 1 30  ? 11.775  30.215 234.811 1.00 83.07  ? 49  ARG C HB2    1 
ATOM   5785  H  HB3    . ARG C 1 30  ? 13.050  29.276 234.737 1.00 83.07  ? 49  ARG C HB3    1 
ATOM   5786  H  HG2    . ARG C 1 30  ? 13.608  31.393 235.569 1.00 107.90 ? 49  ARG C HG2    1 
ATOM   5787  H  HG3    . ARG C 1 30  ? 14.387  31.098 234.213 1.00 107.90 ? 49  ARG C HG3    1 
ATOM   5788  H  HD2    . ARG C 1 30  ? 13.383  33.305 234.408 1.00 147.46 ? 49  ARG C HD2    1 
ATOM   5789  H  HD3    . ARG C 1 30  ? 13.097  32.531 233.048 1.00 147.46 ? 49  ARG C HD3    1 
ATOM   5790  H  HE     . ARG C 1 30  ? 10.981  32.517 233.575 1.00 176.46 ? 49  ARG C HE     1 
ATOM   5791  H  HH11   . ARG C 1 30  ? 12.592  33.152 236.393 1.00 102.75 ? 49  ARG C HH11   1 
ATOM   5792  H  HH12   . ARG C 1 30  ? 11.381  33.413 237.221 1.00 102.75 ? 49  ARG C HH12   1 
ATOM   5793  H  HH21   . ARG C 1 30  ? 9.142   32.915 234.844 1.00 138.35 ? 49  ARG C HH21   1 
ATOM   5794  H  HH22   . ARG C 1 30  ? 9.292   33.270 236.283 1.00 138.35 ? 49  ARG C HH22   1 
ATOM   5795  N  N      . LEU C 1 31  ? 13.991  28.075 232.378 1.00 56.98  ? 50  LEU C N      1 
ATOM   5796  C  CA     . LEU C 1 31  ? 15.165  27.539 231.702 1.00 51.34  ? 50  LEU C CA     1 
ATOM   5797  C  C      . LEU C 1 31  ? 15.018  27.648 230.192 1.00 58.99  ? 50  LEU C C      1 
ATOM   5798  O  O      . LEU C 1 31  ? 15.993  27.908 229.479 1.00 44.93  ? 50  LEU C O      1 
ATOM   5799  C  CB     . LEU C 1 31  ? 15.372  26.085 232.125 1.00 51.20  ? 50  LEU C CB     1 
ATOM   5800  C  CG     . LEU C 1 31  ? 16.523  25.307 231.493 1.00 57.71  ? 50  LEU C CG     1 
ATOM   5801  C  CD1    . LEU C 1 31  ? 17.842  25.986 231.780 1.00 47.07  ? 50  LEU C CD1    1 
ATOM   5802  C  CD2    . LEU C 1 31  ? 16.524  23.882 232.023 1.00 62.81  ? 50  LEU C CD2    1 
ATOM   5803  H  H      . LEU C 1 31  ? 13.602  27.522 232.909 1.00 68.37  ? 50  LEU C H      1 
ATOM   5804  H  HA     . LEU C 1 31  ? 15.947  28.048 231.968 1.00 61.61  ? 50  LEU C HA     1 
ATOM   5805  H  HB2    . LEU C 1 31  ? 15.517  26.072 233.084 1.00 61.44  ? 50  LEU C HB2    1 
ATOM   5806  H  HB3    . LEU C 1 31  ? 14.558  25.598 231.922 1.00 61.44  ? 50  LEU C HB3    1 
ATOM   5807  H  HG     . LEU C 1 31  ? 16.399  25.275 230.532 1.00 69.25  ? 50  LEU C HG     1 
ATOM   5808  H  HD11   . LEU C 1 31  ? 18.556  25.473 231.369 1.00 56.48  ? 50  LEU C HD11   1 
ATOM   5809  H  HD12   . LEU C 1 31  ? 17.823  26.882 231.410 1.00 56.48  ? 50  LEU C HD12   1 
ATOM   5810  H  HD13   . LEU C 1 31  ? 17.974  26.026 232.740 1.00 56.48  ? 50  LEU C HD13   1 
ATOM   5811  H  HD21   . LEU C 1 31  ? 17.258  23.395 231.616 1.00 75.38  ? 50  LEU C HD21   1 
ATOM   5812  H  HD22   . LEU C 1 31  ? 16.634  23.904 232.986 1.00 75.38  ? 50  LEU C HD22   1 
ATOM   5813  H  HD23   . LEU C 1 31  ? 15.680  23.461 231.795 1.00 75.38  ? 50  LEU C HD23   1 
ATOM   5814  N  N      . ALA C 1 32  ? 13.796  27.461 229.688 1.00 74.32  ? 51  ALA C N      1 
ATOM   5815  C  CA     . ALA C 1 32  ? 13.544  27.583 228.258 1.00 60.36  ? 51  ALA C CA     1 
ATOM   5816  C  C      . ALA C 1 32  ? 13.725  29.020 227.802 1.00 36.96  ? 51  ALA C C      1 
ATOM   5817  O  O      . ALA C 1 32  ? 14.564  29.310 226.944 1.00 36.61  ? 51  ALA C O      1 
ATOM   5818  C  CB     . ALA C 1 32  ? 12.133  27.093 227.927 1.00 65.11  ? 51  ALA C CB     1 
ATOM   5819  H  H      . ALA C 1 32  ? 13.101  27.263 230.154 1.00 89.19  ? 51  ALA C H      1 
ATOM   5820  H  HA     . ALA C 1 32  ? 14.177  27.030 227.774 1.00 72.44  ? 51  ALA C HA     1 
ATOM   5821  H  HB1    . ALA C 1 32  ? 11.984  27.182 226.972 1.00 78.14  ? 51  ALA C HB1    1 
ATOM   5822  H  HB2    . ALA C 1 32  ? 12.052  26.163 228.189 1.00 78.14  ? 51  ALA C HB2    1 
ATOM   5823  H  HB3    . ALA C 1 32  ? 11.490  27.632 228.414 1.00 78.14  ? 51  ALA C HB3    1 
ATOM   5824  N  N      . SER C 1 33  ? 12.962  29.944 228.391 1.00 78.08  ? 52  SER C N      1 
ATOM   5825  C  CA     . SER C 1 33  ? 12.984  31.348 227.984 1.00 55.16  ? 52  SER C CA     1 
ATOM   5826  C  C      . SER C 1 33  ? 14.393  31.932 227.929 1.00 45.07  ? 52  SER C C      1 
ATOM   5827  O  O      . SER C 1 33  ? 14.588  33.033 227.406 1.00 76.07  ? 52  SER C O      1 
ATOM   5828  C  CB     . SER C 1 33  ? 12.125  32.186 228.933 1.00 76.98  ? 52  SER C CB     1 
ATOM   5829  O  OG     . SER C 1 33  ? 12.693  32.227 230.231 1.00 104.35 ? 52  SER C OG     1 
ATOM   5830  H  H      . SER C 1 33  ? 12.418  29.779 229.036 1.00 93.69  ? 52  SER C H      1 
ATOM   5831  H  HA     . SER C 1 33  ? 12.600  31.420 227.097 1.00 66.20  ? 52  SER C HA     1 
ATOM   5832  H  HB2    . SER C 1 33  ? 12.063  33.090 228.587 1.00 92.37  ? 52  SER C HB2    1 
ATOM   5833  H  HB3    . SER C 1 33  ? 11.240  31.792 228.989 1.00 92.37  ? 52  SER C HB3    1 
ATOM   5834  H  HG     . SER C 1 33  ? 12.752  31.449 230.544 1.00 125.22 ? 52  SER C HG     1 
ATOM   5835  N  N      . LEU C 1 34  ? 15.375  31.222 228.476 1.00 87.93  ? 53  LEU C N      1 
ATOM   5836  C  CA     . LEU C 1 34  ? 16.768  31.631 228.406 1.00 63.21  ? 53  LEU C CA     1 
ATOM   5837  C  C      . LEU C 1 34  ? 17.524  30.954 227.269 1.00 71.78  ? 53  LEU C C      1 
ATOM   5838  O  O      . LEU C 1 34  ? 18.755  31.049 227.215 1.00 63.00  ? 53  LEU C O      1 
ATOM   5839  C  CB     . LEU C 1 34  ? 17.459  31.336 229.738 1.00 75.20  ? 53  LEU C CB     1 
ATOM   5840  C  CG     . LEU C 1 34  ? 17.350  32.421 230.812 1.00 72.00  ? 53  LEU C CG     1 
ATOM   5841  C  CD1    . LEU C 1 34  ? 15.902  32.807 231.112 1.00 83.93  ? 53  LEU C CD1    1 
ATOM   5842  C  CD2    . LEU C 1 34  ? 18.051  31.948 232.073 1.00 74.19  ? 53  LEU C CD2    1 
ATOM   5843  H  H      . LEU C 1 34  ? 15.254  30.484 228.901 1.00 105.52 ? 53  LEU C H      1 
ATOM   5844  H  HA     . LEU C 1 34  ? 16.806  32.589 228.258 1.00 75.85  ? 53  LEU C HA     1 
ATOM   5845  H  HB2    . LEU C 1 34  ? 17.074  30.525 230.107 1.00 90.24  ? 53  LEU C HB2    1 
ATOM   5846  H  HB3    . LEU C 1 34  ? 18.403  31.194 229.566 1.00 90.24  ? 53  LEU C HB3    1 
ATOM   5847  H  HG     . LEU C 1 34  ? 17.809  33.216 230.499 1.00 86.40  ? 53  LEU C HG     1 
ATOM   5848  H  HD11   . LEU C 1 34  ? 15.894  33.495 231.796 1.00 100.72 ? 53  LEU C HD11   1 
ATOM   5849  H  HD12   . LEU C 1 34  ? 15.490  33.142 230.301 1.00 100.72 ? 53  LEU C HD12   1 
ATOM   5850  H  HD13   . LEU C 1 34  ? 15.425  32.023 231.426 1.00 100.72 ? 53  LEU C HD13   1 
ATOM   5851  H  HD21   . LEU C 1 34  ? 17.980  32.639 232.751 1.00 89.03  ? 53  LEU C HD21   1 
ATOM   5852  H  HD22   . LEU C 1 34  ? 17.626  31.134 232.384 1.00 89.03  ? 53  LEU C HD22   1 
ATOM   5853  H  HD23   . LEU C 1 34  ? 18.984  31.778 231.870 1.00 89.03  ? 53  LEU C HD23   1 
ATOM   5854  N  N      . LEU C 1 35  ? 16.826  30.275 226.367 1.00 90.45  ? 54  LEU C N      1 
ATOM   5855  C  CA     . LEU C 1 35  ? 17.473  29.618 225.241 1.00 68.93  ? 54  LEU C CA     1 
ATOM   5856  C  C      . LEU C 1 35  ? 17.827  30.639 224.167 1.00 110.78 ? 54  LEU C C      1 
ATOM   5857  O  O      . LEU C 1 35  ? 17.395  31.795 224.216 1.00 119.73 ? 54  LEU C O      1 
ATOM   5858  C  CB     . LEU C 1 35  ? 16.560  28.533 224.673 1.00 49.71  ? 54  LEU C CB     1 
ATOM   5859  C  CG     . LEU C 1 35  ? 16.448  27.231 225.458 1.00 37.50  ? 54  LEU C CG     1 
ATOM   5860  C  CD1    . LEU C 1 35  ? 15.378  26.366 224.833 1.00 41.44  ? 54  LEU C CD1    1 
ATOM   5861  C  CD2    . LEU C 1 35  ? 17.781  26.491 225.500 1.00 44.37  ? 54  LEU C CD2    1 
ATOM   5862  H  H      . LEU C 1 35  ? 15.972  30.179 226.385 1.00 108.54 ? 54  LEU C H      1 
ATOM   5863  H  HA     . LEU C 1 35  ? 18.294  29.198 225.544 1.00 82.72  ? 54  LEU C HA     1 
ATOM   5864  H  HB2    . LEU C 1 35  ? 15.665  28.901 224.603 1.00 59.65  ? 54  LEU C HB2    1 
ATOM   5865  H  HB3    . LEU C 1 35  ? 16.880  28.304 223.787 1.00 59.65  ? 54  LEU C HB3    1 
ATOM   5866  H  HG     . LEU C 1 35  ? 16.183  27.429 226.370 1.00 45.00  ? 54  LEU C HG     1 
ATOM   5867  H  HD11   . LEU C 1 35  ? 15.309  25.538 225.334 1.00 49.73  ? 54  LEU C HD11   1 
ATOM   5868  H  HD12   . LEU C 1 35  ? 14.533  26.841 224.861 1.00 49.73  ? 54  LEU C HD12   1 
ATOM   5869  H  HD13   . LEU C 1 35  ? 15.622  26.177 223.914 1.00 49.73  ? 54  LEU C HD13   1 
ATOM   5870  H  HD21   . LEU C 1 35  ? 17.670  25.670 226.006 1.00 53.24  ? 54  LEU C HD21   1 
ATOM   5871  H  HD22   . LEU C 1 35  ? 18.057  26.286 224.593 1.00 53.24  ? 54  LEU C HD22   1 
ATOM   5872  H  HD23   . LEU C 1 35  ? 18.442  27.057 225.928 1.00 53.24  ? 54  LEU C HD23   1 
ATOM   5873  N  N      . PRO C 1 36  ? 18.623  30.238 223.164 1.00 105.31 ? 55  PRO C N      1 
ATOM   5874  C  CA     . PRO C 1 36  ? 19.023  31.184 222.118 1.00 93.16  ? 55  PRO C CA     1 
ATOM   5875  C  C      . PRO C 1 36  ? 18.279  30.987 220.805 1.00 65.39  ? 55  PRO C C      1 
ATOM   5876  O  O      . PRO C 1 36  ? 18.879  31.086 219.730 1.00 110.86 ? 55  PRO C O      1 
ATOM   5877  C  CB     . PRO C 1 36  ? 20.523  30.896 221.961 1.00 89.21  ? 55  PRO C CB     1 
ATOM   5878  C  CG     . PRO C 1 36  ? 20.747  29.525 222.637 1.00 98.33  ? 55  PRO C CG     1 
ATOM   5879  C  CD     . PRO C 1 36  ? 19.409  29.003 223.057 1.00 95.68  ? 55  PRO C CD     1 
ATOM   5880  H  HA     . PRO C 1 36  ? 18.902  32.097 222.424 1.00 111.79 ? 55  PRO C HA     1 
ATOM   5881  H  HB2    . PRO C 1 36  ? 20.750  30.854 221.019 1.00 107.05 ? 55  PRO C HB2    1 
ATOM   5882  H  HB3    . PRO C 1 36  ? 21.037  31.586 222.407 1.00 107.05 ? 55  PRO C HB3    1 
ATOM   5883  H  HG2    . PRO C 1 36  ? 21.160  28.918 222.002 1.00 117.99 ? 55  PRO C HG2    1 
ATOM   5884  H  HG3    . PRO C 1 36  ? 21.320  29.640 223.412 1.00 117.99 ? 55  PRO C HG3    1 
ATOM   5885  H  HD2    . PRO C 1 36  ? 19.039  28.421 222.375 1.00 114.82 ? 55  PRO C HD2    1 
ATOM   5886  H  HD3    . PRO C 1 36  ? 19.468  28.559 223.917 1.00 114.82 ? 55  PRO C HD3    1 
ATOM   5887  N  N      . PHE C 1 37  ? 16.977  30.726 220.870 1.00 75.74  ? 56  PHE C N      1 
ATOM   5888  C  CA     . PHE C 1 37  ? 16.147  30.629 219.680 1.00 104.71 ? 56  PHE C CA     1 
ATOM   5889  C  C      . PHE C 1 37  ? 15.165  31.794 219.616 1.00 120.99 ? 56  PHE C C      1 
ATOM   5890  O  O      . PHE C 1 37  ? 14.900  32.452 220.627 1.00 111.04 ? 56  PHE C O      1 
ATOM   5891  C  CB     . PHE C 1 37  ? 15.379  29.301 219.654 1.00 84.64  ? 56  PHE C CB     1 
ATOM   5892  C  CG     . PHE C 1 37  ? 16.268  28.093 219.624 1.00 74.97  ? 56  PHE C CG     1 
ATOM   5893  C  CD1    . PHE C 1 37  ? 16.896  27.707 218.452 1.00 118.58 ? 56  PHE C CD1    1 
ATOM   5894  C  CD2    . PHE C 1 37  ? 16.475  27.343 220.766 1.00 85.04  ? 56  PHE C CD2    1 
ATOM   5895  C  CE1    . PHE C 1 37  ? 17.715  26.596 218.422 1.00 126.07 ? 56  PHE C CE1    1 
ATOM   5896  C  CE2    . PHE C 1 37  ? 17.291  26.230 220.743 1.00 109.42 ? 56  PHE C CE2    1 
ATOM   5897  C  CZ     . PHE C 1 37  ? 17.913  25.857 219.570 1.00 127.28 ? 56  PHE C CZ     1 
ATOM   5898  H  H      . PHE C 1 37  ? 16.547  30.599 221.604 1.00 90.89  ? 56  PHE C H      1 
ATOM   5899  H  HA     . PHE C 1 37  ? 16.713  30.667 218.893 1.00 125.65 ? 56  PHE C HA     1 
ATOM   5900  H  HB2    . PHE C 1 37  ? 14.826  29.244 220.448 1.00 101.57 ? 56  PHE C HB2    1 
ATOM   5901  H  HB3    . PHE C 1 37  ? 14.820  29.279 218.861 1.00 101.57 ? 56  PHE C HB3    1 
ATOM   5902  H  HD1    . PHE C 1 37  ? 16.766  28.203 217.676 1.00 142.30 ? 56  PHE C HD1    1 
ATOM   5903  H  HD2    . PHE C 1 37  ? 16.058  27.591 221.560 1.00 102.05 ? 56  PHE C HD2    1 
ATOM   5904  H  HE1    . PHE C 1 37  ? 18.132  26.346 217.629 1.00 151.29 ? 56  PHE C HE1    1 
ATOM   5905  H  HE2    . PHE C 1 37  ? 17.423  25.734 221.518 1.00 131.31 ? 56  PHE C HE2    1 
ATOM   5906  H  HZ     . PHE C 1 37  ? 18.463  25.107 219.553 1.00 152.74 ? 56  PHE C HZ     1 
ATOM   5907  N  N      . PRO C 1 38  ? 14.611  32.087 218.440 1.00 79.89  ? 57  PRO C N      1 
ATOM   5908  C  CA     . PRO C 1 38  ? 13.686  33.219 218.331 1.00 62.48  ? 57  PRO C CA     1 
ATOM   5909  C  C      . PRO C 1 38  ? 12.396  32.972 219.099 1.00 86.62  ? 57  PRO C C      1 
ATOM   5910  O  O      . PRO C 1 38  ? 11.983  31.836 219.339 1.00 64.15  ? 57  PRO C O      1 
ATOM   5911  C  CB     . PRO C 1 38  ? 13.422  33.327 216.825 1.00 76.82  ? 57  PRO C CB     1 
ATOM   5912  C  CG     . PRO C 1 38  ? 14.520  32.561 216.174 1.00 90.84  ? 57  PRO C CG     1 
ATOM   5913  C  CD     . PRO C 1 38  ? 14.873  31.472 217.128 1.00 107.38 ? 57  PRO C CD     1 
ATOM   5914  H  HA     . PRO C 1 38  ? 14.104  34.034 218.649 1.00 74.98  ? 57  PRO C HA     1 
ATOM   5915  H  HB2    . PRO C 1 38  ? 12.560  32.935 216.616 1.00 92.19  ? 57  PRO C HB2    1 
ATOM   5916  H  HB3    . PRO C 1 38  ? 13.449  34.259 216.555 1.00 92.19  ? 57  PRO C HB3    1 
ATOM   5917  H  HG2    . PRO C 1 38  ? 14.205  32.190 215.335 1.00 109.01 ? 57  PRO C HG2    1 
ATOM   5918  H  HG3    . PRO C 1 38  ? 15.280  33.144 216.026 1.00 109.01 ? 57  PRO C HG3    1 
ATOM   5919  H  HD2    . PRO C 1 38  ? 14.298  30.702 216.993 1.00 128.85 ? 57  PRO C HD2    1 
ATOM   5920  H  HD3    . PRO C 1 38  ? 15.810  31.237 217.044 1.00 128.85 ? 57  PRO C HD3    1 
ATOM   5921  N  N      . GLN C 1 39  ? 11.749  34.077 219.478 1.00 113.52 ? 58  GLN C N      1 
ATOM   5922  C  CA     . GLN C 1 39  ? 10.496  33.995 220.222 1.00 75.30  ? 58  GLN C CA     1 
ATOM   5923  C  C      . GLN C 1 39  ? 9.483   33.095 219.524 1.00 65.59  ? 58  GLN C C      1 
ATOM   5924  O  O      . GLN C 1 39  ? 8.624   32.496 220.183 1.00 92.45  ? 58  GLN C O      1 
ATOM   5925  C  CB     . GLN C 1 39  ? 9.916   35.398 220.418 1.00 108.56 ? 58  GLN C CB     1 
ATOM   5926  C  CG     . GLN C 1 39  ? 10.782  36.294 221.296 1.00 136.41 ? 58  GLN C CG     1 
ATOM   5927  C  CD     . GLN C 1 39  ? 10.186  37.678 221.504 1.00 149.85 ? 58  GLN C CD     1 
ATOM   5928  O  OE1    . GLN C 1 39  ? 9.472   38.199 220.644 1.00 123.52 ? 58  GLN C OE1    1 
ATOM   5929  N  NE2    . GLN C 1 39  ? 10.477  38.277 222.654 1.00 140.03 ? 58  GLN C NE2    1 
ATOM   5930  H  H      . GLN C 1 39  ? 12.015  34.879 219.318 1.00 136.22 ? 58  GLN C H      1 
ATOM   5931  H  HA     . GLN C 1 39  ? 10.674  33.620 221.098 1.00 90.36  ? 58  GLN C HA     1 
ATOM   5932  H  HB2    . GLN C 1 39  ? 9.828   35.825 219.552 1.00 130.27 ? 58  GLN C HB2    1 
ATOM   5933  H  HB3    . GLN C 1 39  ? 9.045   35.322 220.838 1.00 130.27 ? 58  GLN C HB3    1 
ATOM   5934  H  HG2    . GLN C 1 39  ? 10.884  35.878 222.166 1.00 163.69 ? 58  GLN C HG2    1 
ATOM   5935  H  HG3    . GLN C 1 39  ? 11.649  36.402 220.876 1.00 163.69 ? 58  GLN C HG3    1 
ATOM   5936  H  HE21   . GLN C 1 39  ? 10.977  37.881 223.231 1.00 168.03 ? 58  GLN C HE21   1 
ATOM   5937  H  HE22   . GLN C 1 39  ? 10.165  39.061 222.821 1.00 168.03 ? 58  GLN C HE22   1 
ATOM   5938  N  N      . ASP C 1 40  ? 9.566   32.989 218.194 1.00 124.69 ? 59  ASP C N      1 
ATOM   5939  C  CA     . ASP C 1 40  ? 8.628   32.158 217.445 1.00 121.71 ? 59  ASP C CA     1 
ATOM   5940  C  C      . ASP C 1 40  ? 8.644   30.719 217.946 1.00 93.89  ? 59  ASP C C      1 
ATOM   5941  O  O      . ASP C 1 40  ? 7.599   30.159 218.298 1.00 104.34 ? 59  ASP C O      1 
ATOM   5942  C  CB     . ASP C 1 40  ? 8.965   32.203 215.953 1.00 111.07 ? 59  ASP C CB     1 
ATOM   5943  C  CG     . ASP C 1 40  ? 8.670   33.552 215.327 1.00 105.37 ? 59  ASP C CG     1 
ATOM   5944  O  OD1    . ASP C 1 40  ? 7.535   34.050 215.488 1.00 106.06 ? 59  ASP C OD1    1 
ATOM   5945  O  OD2    . ASP C 1 40  ? 9.577   34.115 214.678 1.00 116.68 ? 59  ASP C OD2    1 
ATOM   5946  H  H      . ASP C 1 40  ? 10.153  33.387 217.708 1.00 149.63 ? 59  ASP C H      1 
ATOM   5947  H  HA     . ASP C 1 40  ? 7.731   32.508 217.562 1.00 146.05 ? 59  ASP C HA     1 
ATOM   5948  H  HB2    . ASP C 1 40  ? 9.910   32.019 215.837 1.00 133.28 ? 59  ASP C HB2    1 
ATOM   5949  H  HB3    . ASP C 1 40  ? 8.437   31.535 215.489 1.00 133.28 ? 59  ASP C HB3    1 
ATOM   5950  N  N      . VAL C 1 41  ? 9.823   30.105 217.987 1.00 64.18  ? 60  VAL C N      1 
ATOM   5951  C  CA     . VAL C 1 41  ? 9.925   28.684 218.303 1.00 93.72  ? 60  VAL C CA     1 
ATOM   5952  C  C      . VAL C 1 41  ? 10.076  28.451 219.802 1.00 69.87  ? 60  VAL C C      1 
ATOM   5953  O  O      . VAL C 1 41  ? 9.473   27.526 220.351 1.00 72.63  ? 60  VAL C O      1 
ATOM   5954  C  CB     . VAL C 1 41  ? 11.091  28.052 217.511 1.00 98.60  ? 60  VAL C CB     1 
ATOM   5955  C  CG1    . VAL C 1 41  ? 12.411  28.757 217.808 1.00 69.43  ? 60  VAL C CG1    1 
ATOM   5956  C  CG2    . VAL C 1 41  ? 11.197  26.561 217.809 1.00 86.24  ? 60  VAL C CG2    1 
ATOM   5957  H  H      . VAL C 1 41  ? 10.577  30.488 217.837 1.00 77.02  ? 60  VAL C H      1 
ATOM   5958  H  HA     . VAL C 1 41  ? 9.108   28.245 218.020 1.00 112.46 ? 60  VAL C HA     1 
ATOM   5959  H  HB     . VAL C 1 41  ? 10.911  28.150 216.563 1.00 118.32 ? 60  VAL C HB     1 
ATOM   5960  H  HG11   . VAL C 1 41  ? 13.117  28.334 217.294 1.00 83.32  ? 60  VAL C HG11   1 
ATOM   5961  H  HG12   . VAL C 1 41  ? 12.333  29.691 217.557 1.00 83.32  ? 60  VAL C HG12   1 
ATOM   5962  H  HG13   . VAL C 1 41  ? 12.602  28.683 218.756 1.00 83.32  ? 60  VAL C HG13   1 
ATOM   5963  H  HG21   . VAL C 1 41  ? 11.935  26.190 217.301 1.00 103.49 ? 60  VAL C HG21   1 
ATOM   5964  H  HG22   . VAL C 1 41  ? 11.355  26.440 218.759 1.00 103.49 ? 60  VAL C HG22   1 
ATOM   5965  H  HG23   . VAL C 1 41  ? 10.367  26.129 217.554 1.00 103.49 ? 60  VAL C HG23   1 
ATOM   5966  N  N      . ILE C 1 42  ? 10.883  29.273 220.479 1.00 89.22  ? 61  ILE C N      1 
ATOM   5967  C  CA     . ILE C 1 42  ? 11.120  29.093 221.910 1.00 49.43  ? 61  ILE C CA     1 
ATOM   5968  C  C      . ILE C 1 42  ? 9.802   28.976 222.655 1.00 53.52  ? 61  ILE C C      1 
ATOM   5969  O  O      . ILE C 1 42  ? 9.697   28.236 223.640 1.00 84.36  ? 61  ILE C O      1 
ATOM   5970  C  CB     . ILE C 1 42  ? 11.972  30.259 222.451 1.00 64.38  ? 61  ILE C CB     1 
ATOM   5971  C  CG1    . ILE C 1 42  ? 12.673  29.861 223.744 1.00 54.43  ? 61  ILE C CG1    1 
ATOM   5972  C  CG2    . ILE C 1 42  ? 11.109  31.498 222.681 1.00 129.44 ? 61  ILE C CG2    1 
ATOM   5973  C  CD1    . ILE C 1 42  ? 13.730  30.859 224.171 1.00 94.72  ? 61  ILE C CD1    1 
ATOM   5974  H  H      . ILE C 1 42  ? 11.303  29.939 220.133 1.00 107.07 ? 61  ILE C H      1 
ATOM   5975  H  HA     . ILE C 1 42  ? 11.616  28.271 222.047 1.00 59.32  ? 61  ILE C HA     1 
ATOM   5976  H  HB     . ILE C 1 42  ? 12.648  30.476 221.790 1.00 77.25  ? 61  ILE C HB     1 
ATOM   5977  H  HG12   . ILE C 1 42  ? 12.015  29.799 224.454 1.00 65.32  ? 61  ILE C HG12   1 
ATOM   5978  H  HG13   . ILE C 1 42  ? 13.106  29.003 223.617 1.00 65.32  ? 61  ILE C HG13   1 
ATOM   5979  H  HG21   . ILE C 1 42  ? 11.669  32.214 223.020 1.00 155.33 ? 61  ILE C HG21   1 
ATOM   5980  H  HG22   . ILE C 1 42  ? 10.706  31.763 221.839 1.00 155.33 ? 61  ILE C HG22   1 
ATOM   5981  H  HG23   . ILE C 1 42  ? 10.417  31.285 223.327 1.00 155.33 ? 61  ILE C HG23   1 
ATOM   5982  H  HD11   . ILE C 1 42  ? 14.139  30.552 224.995 1.00 113.67 ? 61  ILE C HD11   1 
ATOM   5983  H  HD12   . ILE C 1 42  ? 14.401  30.926 223.474 1.00 113.67 ? 61  ILE C HD12   1 
ATOM   5984  H  HD13   . ILE C 1 42  ? 13.310  31.722 224.310 1.00 113.67 ? 61  ILE C HD13   1 
ATOM   5985  N  N      . ASN C 1 43  ? 8.775   29.692 222.198 1.00 66.91  ? 62  ASN C N      1 
ATOM   5986  C  CA     . ASN C 1 43  ? 7.459   29.668 222.814 1.00 81.21  ? 62  ASN C CA     1 
ATOM   5987  C  C      . ASN C 1 43  ? 6.605   28.514 222.300 1.00 59.75  ? 62  ASN C C      1 
ATOM   5988  O  O      . ASN C 1 43  ? 5.378   28.547 222.442 1.00 93.03  ? 62  ASN C O      1 
ATOM   5989  C  CB     . ASN C 1 43  ? 6.753   31.010 222.581 1.00 57.21  ? 62  ASN C CB     1 
ATOM   5990  C  CG     . ASN C 1 43  ? 5.471   31.154 223.384 1.00 105.05 ? 62  ASN C CG     1 
ATOM   5991  O  OD1    . ASN C 1 43  ? 4.485   31.693 222.889 1.00 132.60 ? 62  ASN C OD1    1 
ATOM   5992  N  ND2    . ASN C 1 43  ? 5.477   30.673 224.622 1.00 118.49 ? 62  ASN C ND2    1 
ATOM   5993  H  H      . ASN C 1 43  ? 8.823   30.211 221.514 1.00 80.29  ? 62  ASN C H      1 
ATOM   5994  H  HA     . ASN C 1 43  ? 7.566   29.552 223.772 1.00 97.45  ? 62  ASN C HA     1 
ATOM   5995  H  HB2    . ASN C 1 43  ? 7.350   31.729 222.840 1.00 68.65  ? 62  ASN C HB2    1 
ATOM   5996  H  HB3    . ASN C 1 43  ? 6.527   31.088 221.641 1.00 68.65  ? 62  ASN C HB3    1 
ATOM   5997  H  HD21   . ASN C 1 43  ? 4.772   30.733 225.111 1.00 142.18 ? 62  ASN C HD21   1 
ATOM   5998  H  HD22   . ASN C 1 43  ? 6.187   30.300 224.935 1.00 142.18 ? 62  ASN C HD22   1 
ATOM   5999  N  N      . LYS C 1 44  ? 7.232   27.495 221.700 1.00 59.26  ? 63  LYS C N      1 
ATOM   6000  C  CA     . LYS C 1 44  ? 6.486   26.348 221.192 1.00 64.18  ? 63  LYS C CA     1 
ATOM   6001  C  C      . LYS C 1 44  ? 7.275   25.049 221.332 1.00 67.69  ? 63  LYS C C      1 
ATOM   6002  O  O      . LYS C 1 44  ? 6.941   24.062 220.668 1.00 60.42  ? 63  LYS C O      1 
ATOM   6003  C  CB     . LYS C 1 44  ? 6.104   26.579 219.723 1.00 59.29  ? 63  LYS C CB     1 
ATOM   6004  C  CG     . LYS C 1 44  ? 4.749   26.010 219.333 1.00 79.87  ? 63  LYS C CG     1 
ATOM   6005  C  CD     . LYS C 1 44  ? 4.162   26.759 218.141 1.00 63.03  ? 63  LYS C CD     1 
ATOM   6006  C  CE     . LYS C 1 44  ? 2.757   26.266 217.806 1.00 108.32 ? 63  LYS C CE     1 
ATOM   6007  N  NZ     . LYS C 1 44  ? 2.076   27.118 216.788 1.00 124.99 ? 63  LYS C NZ     1 
ATOM   6008  H  H      . LYS C 1 44  ? 8.082   27.447 221.578 1.00 71.12  ? 63  LYS C H      1 
ATOM   6009  H  HA     . LYS C 1 44  ? 5.667   26.255 221.703 1.00 77.02  ? 63  LYS C HA     1 
ATOM   6010  H  HB2    . LYS C 1 44  ? 6.082   27.534 219.554 1.00 71.15  ? 63  LYS C HB2    1 
ATOM   6011  H  HB3    . LYS C 1 44  ? 6.773   26.162 219.158 1.00 71.15  ? 63  LYS C HB3    1 
ATOM   6012  H  HG2    . LYS C 1 44  ? 4.851   25.077 219.088 1.00 95.84  ? 63  LYS C HG2    1 
ATOM   6013  H  HG3    . LYS C 1 44  ? 4.137   26.097 220.080 1.00 95.84  ? 63  LYS C HG3    1 
ATOM   6014  H  HD2    . LYS C 1 44  ? 4.110   27.705 218.351 1.00 75.63  ? 63  LYS C HD2    1 
ATOM   6015  H  HD3    . LYS C 1 44  ? 4.726   26.618 217.365 1.00 75.63  ? 63  LYS C HD3    1 
ATOM   6016  H  HE2    . LYS C 1 44  ? 2.814   25.364 217.454 1.00 129.98 ? 63  LYS C HE2    1 
ATOM   6017  H  HE3    . LYS C 1 44  ? 2.219   26.274 218.613 1.00 129.98 ? 63  LYS C HE3    1 
ATOM   6018  H  HZ1    . LYS C 1 44  ? 1.262   26.799 216.620 1.00 149.99 ? 63  LYS C HZ1    1 
ATOM   6019  H  HZ2    . LYS C 1 44  ? 2.003   27.952 217.088 1.00 149.99 ? 63  LYS C HZ2    1 
ATOM   6020  H  HZ3    . LYS C 1 44  ? 2.546   27.122 216.032 1.00 149.99 ? 63  LYS C HZ3    1 
ATOM   6021  N  N      . LEU C 1 45  ? 8.304   25.021 222.173 1.00 85.32  ? 64  LEU C N      1 
ATOM   6022  C  CA     . LEU C 1 45  ? 9.090   23.820 222.407 1.00 63.79  ? 64  LEU C CA     1 
ATOM   6023  C  C      . LEU C 1 45  ? 8.433   22.982 223.494 1.00 56.11  ? 64  LEU C C      1 
ATOM   6024  O  O      . LEU C 1 45  ? 8.035   23.514 224.535 1.00 64.54  ? 64  LEU C O      1 
ATOM   6025  C  CB     . LEU C 1 45  ? 10.513  24.187 222.829 1.00 36.81  ? 64  LEU C CB     1 
ATOM   6026  C  CG     . LEU C 1 45  ? 11.350  24.977 221.827 1.00 57.14  ? 64  LEU C CG     1 
ATOM   6027  C  CD1    . LEU C 1 45  ? 12.613  25.469 222.492 1.00 44.95  ? 64  LEU C CD1    1 
ATOM   6028  C  CD2    . LEU C 1 45  ? 11.684  24.133 220.603 1.00 89.31  ? 64  LEU C CD2    1 
ATOM   6029  H  H      . LEU C 1 45  ? 8.570   25.701 222.628 1.00 102.39 ? 64  LEU C H      1 
ATOM   6030  H  HA     . LEU C 1 45  ? 9.134   23.294 221.593 1.00 76.55  ? 64  LEU C HA     1 
ATOM   6031  H  HB2    . LEU C 1 45  ? 10.460  24.719 223.639 1.00 44.17  ? 64  LEU C HB2    1 
ATOM   6032  H  HB3    . LEU C 1 45  ? 10.994  23.366 223.018 1.00 44.17  ? 64  LEU C HB3    1 
ATOM   6033  H  HG     . LEU C 1 45  ? 10.845  25.751 221.531 1.00 68.56  ? 64  LEU C HG     1 
ATOM   6034  H  HD11   . LEU C 1 45  ? 13.136  25.969 221.846 1.00 53.94  ? 64  LEU C HD11   1 
ATOM   6035  H  HD12   . LEU C 1 45  ? 12.374  26.041 223.238 1.00 53.94  ? 64  LEU C HD12   1 
ATOM   6036  H  HD13   . LEU C 1 45  ? 13.120  24.705 222.809 1.00 53.94  ? 64  LEU C HD13   1 
ATOM   6037  H  HD21   . LEU C 1 45  ? 12.215  24.664 219.989 1.00 107.17 ? 64  LEU C HD21   1 
ATOM   6038  H  HD22   . LEU C 1 45  ? 12.187  23.353 220.886 1.00 107.17 ? 64  LEU C HD22   1 
ATOM   6039  H  HD23   . LEU C 1 45  ? 10.859  23.858 220.175 1.00 107.17 ? 64  LEU C HD23   1 
ATOM   6040  N  N      . ASP C 1 46  ? 8.320   21.677 223.255 1.00 86.01  ? 65  ASP C N      1 
ATOM   6041  C  CA     . ASP C 1 46  ? 7.908   20.784 224.324 1.00 30.90  ? 65  ASP C CA     1 
ATOM   6042  C  C      . ASP C 1 46  ? 9.020   20.693 225.368 1.00 64.67  ? 65  ASP C C      1 
ATOM   6043  O  O      . ASP C 1 46  ? 10.144  21.162 225.166 1.00 75.85  ? 65  ASP C O      1 
ATOM   6044  C  CB     . ASP C 1 46  ? 7.542   19.401 223.776 1.00 53.38  ? 65  ASP C CB     1 
ATOM   6045  C  CG     . ASP C 1 46  ? 8.709   18.700 223.101 1.00 77.75  ? 65  ASP C CG     1 
ATOM   6046  O  OD1    . ASP C 1 46  ? 9.596   19.402 222.573 1.00 103.92 ? 65  ASP C OD1    1 
ATOM   6047  O  OD2    . ASP C 1 46  ? 8.732   17.448 223.084 1.00 65.06  ? 65  ASP C OD2    1 
ATOM   6048  H  H      . ASP C 1 46  ? 8.473   21.294 222.500 1.00 103.22 ? 65  ASP C H      1 
ATOM   6049  H  HA     . ASP C 1 46  ? 7.121   21.152 224.756 1.00 37.08  ? 65  ASP C HA     1 
ATOM   6050  H  HB2    . ASP C 1 46  ? 7.241   18.841 224.509 1.00 64.05  ? 65  ASP C HB2    1 
ATOM   6051  H  HB3    . ASP C 1 46  ? 6.832   19.499 223.122 1.00 64.05  ? 65  ASP C HB3    1 
ATOM   6052  N  N      . LYS C 1 47  ? 8.691   20.088 226.506 1.00 98.59  ? 66  LYS C N      1 
ATOM   6053  C  CA     . LYS C 1 47  ? 9.587   20.090 227.657 1.00 36.33  ? 66  LYS C CA     1 
ATOM   6054  C  C      . LYS C 1 47  ? 10.932  19.442 227.348 1.00 52.73  ? 66  LYS C C      1 
ATOM   6055  O  O      . LYS C 1 47  ? 11.977  20.113 227.351 1.00 58.81  ? 66  LYS C O      1 
ATOM   6056  C  CB     . LYS C 1 47  ? 8.924   19.365 228.827 1.00 64.78  ? 66  LYS C CB     1 
ATOM   6057  C  CG     . LYS C 1 47  ? 8.359   20.278 229.903 1.00 67.04  ? 66  LYS C CG     1 
ATOM   6058  C  CD     . LYS C 1 47  ? 7.367   21.282 229.346 1.00 84.96  ? 66  LYS C CD     1 
ATOM   6059  C  CE     . LYS C 1 47  ? 6.540   21.910 230.456 1.00 69.02  ? 66  LYS C CE     1 
ATOM   6060  N  NZ     . LYS C 1 47  ? 5.651   20.902 231.106 1.00 79.36  ? 66  LYS C NZ     1 
ATOM   6061  H  H      . LYS C 1 47  ? 7.952   19.668 226.637 1.00 118.31 ? 66  LYS C H      1 
ATOM   6062  H  HA     . LYS C 1 47  ? 9.751   21.007 227.927 1.00 43.59  ? 66  LYS C HA     1 
ATOM   6063  H  HB2    . LYS C 1 47  ? 8.193   18.827 228.484 1.00 77.74  ? 66  LYS C HB2    1 
ATOM   6064  H  HB3    . LYS C 1 47  ? 9.582   18.789 229.247 1.00 77.74  ? 66  LYS C HB3    1 
ATOM   6065  H  HG2    . LYS C 1 47  ? 7.901   19.740 230.568 1.00 80.45  ? 66  LYS C HG2    1 
ATOM   6066  H  HG3    . LYS C 1 47  ? 9.086   20.770 230.316 1.00 80.45  ? 66  LYS C HG3    1 
ATOM   6067  H  HD2    . LYS C 1 47  ? 7.849   21.988 228.887 1.00 101.96 ? 66  LYS C HD2    1 
ATOM   6068  H  HD3    . LYS C 1 47  ? 6.764   20.832 228.733 1.00 101.96 ? 66  LYS C HD3    1 
ATOM   6069  H  HE2    . LYS C 1 47  ? 7.134   22.273 231.132 1.00 82.82  ? 66  LYS C HE2    1 
ATOM   6070  H  HE3    . LYS C 1 47  ? 5.984   22.612 230.084 1.00 82.82  ? 66  LYS C HE3    1 
ATOM   6071  H  HZ1    . LYS C 1 47  ? 5.175   21.288 231.752 1.00 95.23  ? 66  LYS C HZ1    1 
ATOM   6072  H  HZ2    . LYS C 1 47  ? 5.094   20.556 230.505 1.00 95.23  ? 66  LYS C HZ2    1 
ATOM   6073  H  HZ3    . LYS C 1 47  ? 6.140   20.248 231.459 1.00 95.23  ? 66  LYS C HZ3    1 
ATOM   6074  N  N      . LEU C 1 48  ? 10.925  18.130 227.100 1.00 37.08  ? 67  LEU C N      1 
ATOM   6075  C  CA     . LEU C 1 48  ? 12.190  17.422 226.942 1.00 67.13  ? 67  LEU C CA     1 
ATOM   6076  C  C      . LEU C 1 48  ? 13.032  18.013 225.818 1.00 55.01  ? 67  LEU C C      1 
ATOM   6077  O  O      . LEU C 1 48  ? 14.259  17.871 225.839 1.00 92.89  ? 67  LEU C O      1 
ATOM   6078  C  CB     . LEU C 1 48  ? 11.961  15.922 226.715 1.00 36.08  ? 67  LEU C CB     1 
ATOM   6079  C  CG     . LEU C 1 48  ? 10.770  15.415 225.895 1.00 54.03  ? 67  LEU C CG     1 
ATOM   6080  C  CD1    . LEU C 1 48  ? 11.153  14.083 225.269 1.00 90.65  ? 67  LEU C CD1    1 
ATOM   6081  C  CD2    . LEU C 1 48  ? 9.492   15.240 226.729 1.00 64.85  ? 67  LEU C CD2    1 
ATOM   6082  H  H      . LEU C 1 48  ? 10.221  17.641 227.021 1.00 44.50  ? 67  LEU C H      1 
ATOM   6083  H  HA     . LEU C 1 48  ? 12.698  17.517 227.763 1.00 80.55  ? 67  LEU C HA     1 
ATOM   6084  H  HB2    . LEU C 1 48  ? 12.756  15.573 226.282 1.00 43.30  ? 67  LEU C HB2    1 
ATOM   6085  H  HB3    . LEU C 1 48  ? 11.882  15.510 227.590 1.00 43.30  ? 67  LEU C HB3    1 
ATOM   6086  H  HG     . LEU C 1 48  ? 10.583  16.044 225.181 1.00 64.84  ? 67  LEU C HG     1 
ATOM   6087  H  HD11   . LEU C 1 48  ? 10.405  13.753 224.747 1.00 108.78 ? 67  LEU C HD11   1 
ATOM   6088  H  HD12   . LEU C 1 48  ? 11.924  14.214 224.696 1.00 108.78 ? 67  LEU C HD12   1 
ATOM   6089  H  HD13   . LEU C 1 48  ? 11.368  13.453 225.975 1.00 108.78 ? 67  LEU C HD13   1 
ATOM   6090  H  HD21   . LEU C 1 48  ? 8.781   14.918 226.152 1.00 77.81  ? 67  LEU C HD21   1 
ATOM   6091  H  HD22   . LEU C 1 48  ? 9.661   14.597 227.435 1.00 77.81  ? 67  LEU C HD22   1 
ATOM   6092  H  HD23   . LEU C 1 48  ? 9.245   16.096 227.112 1.00 77.81  ? 67  LEU C HD23   1 
ATOM   6093  N  N      . SER C 1 49  ? 12.410  18.692 224.851 1.00 64.72  ? 68  SER C N      1 
ATOM   6094  C  CA     . SER C 1 49  ? 13.189  19.432 223.865 1.00 58.25  ? 68  SER C CA     1 
ATOM   6095  C  C      . SER C 1 49  ? 13.859  20.648 224.501 1.00 46.16  ? 68  SER C C      1 
ATOM   6096  O  O      . SER C 1 49  ? 15.013  20.962 224.187 1.00 98.29  ? 68  SER C O      1 
ATOM   6097  C  CB     . SER C 1 49  ? 12.303  19.846 222.691 1.00 48.62  ? 68  SER C CB     1 
ATOM   6098  O  OG     . SER C 1 49  ? 11.185  20.591 223.132 1.00 109.01 ? 68  SER C OG     1 
ATOM   6099  H  H      . SER C 1 49  ? 11.557  18.738 224.747 1.00 77.67  ? 68  SER C H      1 
ATOM   6100  H  HA     . SER C 1 49  ? 13.888  18.855 223.520 1.00 69.90  ? 68  SER C HA     1 
ATOM   6101  H  HB2    . SER C 1 49  ? 12.824  20.392 222.081 1.00 58.34  ? 68  SER C HB2    1 
ATOM   6102  H  HB3    . SER C 1 49  ? 11.990  19.048 222.237 1.00 58.34  ? 68  SER C HB3    1 
ATOM   6103  H  HG     . SER C 1 49  ? 10.724  20.131 223.661 1.00 130.82 ? 68  SER C HG     1 
ATOM   6104  N  N      . VAL C 1 50  ? 13.156  21.346 225.397 1.00 54.68  ? 69  VAL C N      1 
ATOM   6105  C  CA     . VAL C 1 50  ? 13.797  22.412 226.168 1.00 53.98  ? 69  VAL C CA     1 
ATOM   6106  C  C      . VAL C 1 50  ? 15.029  21.872 226.869 1.00 50.47  ? 69  VAL C C      1 
ATOM   6107  O  O      . VAL C 1 50  ? 16.097  22.505 226.875 1.00 47.66  ? 69  VAL C O      1 
ATOM   6108  C  CB     . VAL C 1 50  ? 12.803  23.020 227.177 1.00 46.74  ? 69  VAL C CB     1 
ATOM   6109  C  CG1    . VAL C 1 50  ? 13.529  23.910 228.185 1.00 49.91  ? 69  VAL C CG1    1 
ATOM   6110  C  CG2    . VAL C 1 50  ? 11.725  23.800 226.450 1.00 61.23  ? 69  VAL C CG2    1 
ATOM   6111  H  H      . VAL C 1 50  ? 12.324  21.225 225.575 1.00 65.62  ? 69  VAL C H      1 
ATOM   6112  H  HA     . VAL C 1 50  ? 14.079  23.115 225.562 1.00 64.78  ? 69  VAL C HA     1 
ATOM   6113  H  HB     . VAL C 1 50  ? 12.374  22.302 227.667 1.00 56.09  ? 69  VAL C HB     1 
ATOM   6114  H  HG11   . VAL C 1 50  ? 12.880  24.278 228.805 1.00 59.89  ? 69  VAL C HG11   1 
ATOM   6115  H  HG12   . VAL C 1 50  ? 14.180  23.376 228.665 1.00 59.89  ? 69  VAL C HG12   1 
ATOM   6116  H  HG13   . VAL C 1 50  ? 13.975  24.627 227.709 1.00 59.89  ? 69  VAL C HG13   1 
ATOM   6117  H  HG21   . VAL C 1 50  ? 11.112  24.173 227.102 1.00 73.47  ? 69  VAL C HG21   1 
ATOM   6118  H  HG22   . VAL C 1 50  ? 12.140  24.512 225.940 1.00 73.47  ? 69  VAL C HG22   1 
ATOM   6119  H  HG23   . VAL C 1 50  ? 11.250  23.199 225.854 1.00 73.47  ? 69  VAL C HG23   1 
ATOM   6120  N  N      . LEU C 1 51  ? 14.904  20.692 227.474 1.00 43.29  ? 70  LEU C N      1 
ATOM   6121  C  CA     . LEU C 1 51  ? 16.037  20.127 228.197 1.00 64.50  ? 70  LEU C CA     1 
ATOM   6122  C  C      . LEU C 1 51  ? 17.183  19.790 227.250 1.00 60.16  ? 70  LEU C C      1 
ATOM   6123  O  O      . LEU C 1 51  ? 18.321  20.217 227.467 1.00 69.91  ? 70  LEU C O      1 
ATOM   6124  C  CB     . LEU C 1 51  ? 15.600  18.892 228.982 1.00 58.50  ? 70  LEU C CB     1 
ATOM   6125  C  CG     . LEU C 1 51  ? 14.664  19.187 230.155 1.00 50.51  ? 70  LEU C CG     1 
ATOM   6126  C  CD1    . LEU C 1 51  ? 14.105  17.900 230.726 1.00 40.93  ? 70  LEU C CD1    1 
ATOM   6127  C  CD2    . LEU C 1 51  ? 15.385  19.983 231.230 1.00 52.59  ? 70  LEU C CD2    1 
ATOM   6128  H  H      . LEU C 1 51  ? 14.192  20.211 227.481 1.00 51.95  ? 70  LEU C H      1 
ATOM   6129  H  HA     . LEU C 1 51  ? 16.361  20.784 228.833 1.00 77.40  ? 70  LEU C HA     1 
ATOM   6130  H  HB2    . LEU C 1 51  ? 15.136  18.289 228.379 1.00 70.20  ? 70  LEU C HB2    1 
ATOM   6131  H  HB3    . LEU C 1 51  ? 16.389  18.455 229.337 1.00 70.20  ? 70  LEU C HB3    1 
ATOM   6132  H  HG     . LEU C 1 51  ? 13.920  19.721 229.836 1.00 60.61  ? 70  LEU C HG     1 
ATOM   6133  H  HD11   . LEU C 1 51  ? 13.516  18.113 231.466 1.00 49.12  ? 70  LEU C HD11   1 
ATOM   6134  H  HD12   . LEU C 1 51  ? 13.610  17.436 230.032 1.00 49.12  ? 70  LEU C HD12   1 
ATOM   6135  H  HD13   . LEU C 1 51  ? 14.839  17.347 231.035 1.00 49.12  ? 70  LEU C HD13   1 
ATOM   6136  H  HD21   . LEU C 1 51  ? 14.770  20.156 231.960 1.00 63.11  ? 70  LEU C HD21   1 
ATOM   6137  H  HD22   . LEU C 1 51  ? 16.142  19.468 231.550 1.00 63.11  ? 70  LEU C HD22   1 
ATOM   6138  H  HD23   . LEU C 1 51  ? 15.692  20.821 230.850 1.00 63.11  ? 70  LEU C HD23   1 
ATOM   6139  N  N      . ARG C 1 52  ? 16.909  19.027 226.188 1.00 66.83  ? 71  ARG C N      1 
ATOM   6140  C  CA     . ARG C 1 52  ? 17.994  18.624 225.295 1.00 78.01  ? 71  ARG C CA     1 
ATOM   6141  C  C      . ARG C 1 52  ? 18.663  19.833 224.657 1.00 51.03  ? 71  ARG C C      1 
ATOM   6142  O  O      . ARG C 1 52  ? 19.872  19.811 224.401 1.00 74.67  ? 71  ARG C O      1 
ATOM   6143  C  CB     . ARG C 1 52  ? 17.482  17.665 224.219 1.00 86.95  ? 71  ARG C CB     1 
ATOM   6144  C  CG     . ARG C 1 52  ? 16.776  18.311 223.046 1.00 65.27  ? 71  ARG C CG     1 
ATOM   6145  C  CD     . ARG C 1 52  ? 16.255  17.245 222.087 1.00 88.23  ? 71  ARG C CD     1 
ATOM   6146  N  NE     . ARG C 1 52  ? 15.171  17.743 221.248 1.00 107.75 ? 71  ARG C NE     1 
ATOM   6147  C  CZ     . ARG C 1 52  ? 15.344  18.508 220.177 1.00 86.31  ? 71  ARG C CZ     1 
ATOM   6148  N  NH1    . ARG C 1 52  ? 16.563  18.875 219.809 1.00 64.52  ? 71  ARG C NH1    1 
ATOM   6149  N  NH2    . ARG C 1 52  ? 14.294  18.913 219.475 1.00 126.06 ? 71  ARG C NH2    1 
ATOM   6150  H  H      . ARG C 1 52  ? 16.129  18.738 225.969 1.00 80.20  ? 71  ARG C H      1 
ATOM   6151  H  HA     . ARG C 1 52  ? 18.665  18.154 225.814 1.00 93.61  ? 71  ARG C HA     1 
ATOM   6152  H  HB2    . ARG C 1 52  ? 18.238  17.170 223.866 1.00 104.34 ? 71  ARG C HB2    1 
ATOM   6153  H  HB3    . ARG C 1 52  ? 16.857  17.049 224.631 1.00 104.34 ? 71  ARG C HB3    1 
ATOM   6154  H  HG2    . ARG C 1 52  ? 16.023  18.831 223.367 1.00 78.33  ? 71  ARG C HG2    1 
ATOM   6155  H  HG3    . ARG C 1 52  ? 17.399  18.879 222.565 1.00 78.33  ? 71  ARG C HG3    1 
ATOM   6156  H  HD2    . ARG C 1 52  ? 16.977  16.957 221.508 1.00 105.88 ? 71  ARG C HD2    1 
ATOM   6157  H  HD3    . ARG C 1 52  ? 15.919  16.493 222.600 1.00 105.88 ? 71  ARG C HD3    1 
ATOM   6158  H  HE     . ARG C 1 52  ? 14.366  17.525 221.461 1.00 129.30 ? 71  ARG C HE     1 
ATOM   6159  H  HH11   . ARG C 1 52  ? 17.246  18.614 220.262 1.00 77.42  ? 71  ARG C HH11   1 
ATOM   6160  H  HH12   . ARG C 1 52  ? 16.672  19.371 219.115 1.00 77.42  ? 71  ARG C HH12   1 
ATOM   6161  H  HH21   . ARG C 1 52  ? 13.502  18.677 219.712 1.00 151.27 ? 71  ARG C HH21   1 
ATOM   6162  H  HH22   . ARG C 1 52  ? 14.406  19.409 218.782 1.00 151.27 ? 71  ARG C HH22   1 
ATOM   6163  N  N      . LEU C 1 53  ? 17.902  20.898 224.405 1.00 53.02  ? 72  LEU C N      1 
ATOM   6164  C  CA     . LEU C 1 53  ? 18.485  22.106 223.832 1.00 67.72  ? 72  LEU C CA     1 
ATOM   6165  C  C      . LEU C 1 53  ? 19.374  22.818 224.842 1.00 60.52  ? 72  LEU C C      1 
ATOM   6166  O  O      . LEU C 1 53  ? 20.499  23.216 224.519 1.00 78.05  ? 72  LEU C O      1 
ATOM   6167  C  CB     . LEU C 1 53  ? 17.378  23.035 223.337 1.00 78.59  ? 72  LEU C CB     1 
ATOM   6168  C  CG     . LEU C 1 53  ? 16.594  22.490 222.142 1.00 91.04  ? 72  LEU C CG     1 
ATOM   6169  C  CD1    . LEU C 1 53  ? 15.328  23.295 221.911 1.00 98.74  ? 72  LEU C CD1    1 
ATOM   6170  C  CD2    . LEU C 1 53  ? 17.456  22.494 220.901 1.00 55.61  ? 72  LEU C CD2    1 
ATOM   6171  H  H      . LEU C 1 53  ? 17.056  20.945 224.554 1.00 63.63  ? 72  LEU C H      1 
ATOM   6172  H  HA     . LEU C 1 53  ? 19.033  21.861 223.070 1.00 81.26  ? 72  LEU C HA     1 
ATOM   6173  H  HB2    . LEU C 1 53  ? 16.748  23.182 224.060 1.00 94.31  ? 72  LEU C HB2    1 
ATOM   6174  H  HB3    . LEU C 1 53  ? 17.775  23.878 223.070 1.00 94.31  ? 72  LEU C HB3    1 
ATOM   6175  H  HG     . LEU C 1 53  ? 16.336  21.573 222.325 1.00 109.25 ? 72  LEU C HG     1 
ATOM   6176  H  HD11   . LEU C 1 53  ? 14.854  22.927 221.149 1.00 118.49 ? 72  LEU C HD11   1 
ATOM   6177  H  HD12   . LEU C 1 53  ? 14.771  23.242 222.704 1.00 118.49 ? 72  LEU C HD12   1 
ATOM   6178  H  HD13   . LEU C 1 53  ? 15.568  24.219 221.736 1.00 118.49 ? 72  LEU C HD13   1 
ATOM   6179  H  HD21   . LEU C 1 53  ? 16.939  22.145 220.157 1.00 66.73  ? 72  LEU C HD21   1 
ATOM   6180  H  HD22   . LEU C 1 53  ? 17.735  23.403 220.713 1.00 66.73  ? 72  LEU C HD22   1 
ATOM   6181  H  HD23   . LEU C 1 53  ? 18.233  21.934 221.055 1.00 66.73  ? 72  LEU C HD23   1 
ATOM   6182  N  N      . SER C 1 54  ? 18.890  22.985 226.074 1.00 78.00  ? 73  SER C N      1 
ATOM   6183  C  CA     . SER C 1 54  ? 19.696  23.662 227.085 1.00 85.78  ? 73  SER C CA     1 
ATOM   6184  C  C      . SER C 1 54  ? 20.967  22.874 227.399 1.00 68.35  ? 73  SER C C      1 
ATOM   6185  O  O      . SER C 1 54  ? 22.054  23.453 227.516 1.00 94.52  ? 73  SER C O      1 
ATOM   6186  C  CB     . SER C 1 54  ? 18.862  23.889 228.348 1.00 35.71  ? 73  SER C CB     1 
ATOM   6187  O  OG     . SER C 1 54  ? 18.219  22.696 228.754 1.00 94.88  ? 73  SER C OG     1 
ATOM   6188  H  H      . SER C 1 54  ? 18.117  22.722 226.343 1.00 93.60  ? 73  SER C H      1 
ATOM   6189  H  HA     . SER C 1 54  ? 19.961  24.530 226.745 1.00 102.94 ? 73  SER C HA     1 
ATOM   6190  H  HB2    . SER C 1 54  ? 19.447  24.190 229.061 1.00 42.85  ? 73  SER C HB2    1 
ATOM   6191  H  HB3    . SER C 1 54  ? 18.189  24.563 228.164 1.00 42.85  ? 73  SER C HB3    1 
ATOM   6192  H  HG     . SER C 1 54  ? 17.709  22.423 228.145 1.00 113.85 ? 73  SER C HG     1 
ATOM   6193  N  N      . VAL C 1 55  ? 20.858  21.548 227.518 1.00 54.92  ? 74  VAL C N      1 
ATOM   6194  C  CA     . VAL C 1 55  ? 22.043  20.740 227.798 1.00 68.17  ? 74  VAL C CA     1 
ATOM   6195  C  C      . VAL C 1 55  ? 22.974  20.720 226.597 1.00 83.96  ? 74  VAL C C      1 
ATOM   6196  O  O      . VAL C 1 55  ? 24.195  20.607 226.754 1.00 110.57 ? 74  VAL C O      1 
ATOM   6197  C  CB     . VAL C 1 55  ? 21.649  19.309 228.216 1.00 66.25  ? 74  VAL C CB     1 
ATOM   6198  C  CG1    . VAL C 1 55  ? 21.040  18.558 227.058 1.00 100.03 ? 74  VAL C CG1    1 
ATOM   6199  C  CG2    . VAL C 1 55  ? 22.859  18.562 228.759 1.00 99.85  ? 74  VAL C CG2    1 
ATOM   6200  H  H      . VAL C 1 55  ? 20.127  21.103 227.444 1.00 65.91  ? 74  VAL C H      1 
ATOM   6201  H  HA     . VAL C 1 55  ? 22.525  21.141 228.538 1.00 81.80  ? 74  VAL C HA     1 
ATOM   6202  H  HB     . VAL C 1 55  ? 20.986  19.358 228.923 1.00 79.49  ? 74  VAL C HB     1 
ATOM   6203  H  HG11   . VAL C 1 55  ? 20.804  17.664 227.351 1.00 120.04 ? 74  VAL C HG11   1 
ATOM   6204  H  HG12   . VAL C 1 55  ? 20.247  19.029 226.758 1.00 120.04 ? 74  VAL C HG12   1 
ATOM   6205  H  HG13   . VAL C 1 55  ? 21.688  18.510 226.337 1.00 120.04 ? 74  VAL C HG13   1 
ATOM   6206  H  HG21   . VAL C 1 55  ? 22.588  17.666 229.015 1.00 119.82 ? 74  VAL C HG21   1 
ATOM   6207  H  HG22   . VAL C 1 55  ? 23.538  18.517 228.068 1.00 119.82 ? 74  VAL C HG22   1 
ATOM   6208  H  HG23   . VAL C 1 55  ? 23.203  19.037 229.531 1.00 119.82 ? 74  VAL C HG23   1 
ATOM   6209  N  N      . SER C 1 56  ? 22.428  20.802 225.383 1.00 97.52  ? 75  SER C N      1 
ATOM   6210  C  CA     . SER C 1 56  ? 23.272  20.893 224.198 1.00 105.37 ? 75  SER C CA     1 
ATOM   6211  C  C      . SER C 1 56  ? 24.079  22.181 224.221 1.00 84.71  ? 75  SER C C      1 
ATOM   6212  O  O      . SER C 1 56  ? 25.312  22.165 224.146 1.00 118.82 ? 75  SER C O      1 
ATOM   6213  C  CB     . SER C 1 56  ? 22.412  20.815 222.937 1.00 96.57  ? 75  SER C CB     1 
ATOM   6214  O  OG     . SER C 1 56  ? 21.766  19.557 222.839 1.00 121.64 ? 75  SER C OG     1 
ATOM   6215  H  H      . SER C 1 56  ? 21.583  20.808 225.223 1.00 117.03 ? 75  SER C H      1 
ATOM   6216  H  HA     . SER C 1 56  ? 23.892  20.147 224.190 1.00 126.44 ? 75  SER C HA     1 
ATOM   6217  H  HB2    . SER C 1 56  ? 21.739  21.513 222.970 1.00 115.89 ? 75  SER C HB2    1 
ATOM   6218  H  HB3    . SER C 1 56  ? 22.980  20.939 222.160 1.00 115.89 ? 75  SER C HB3    1 
ATOM   6219  H  HG     . SER C 1 56  ? 21.271  19.436 223.506 1.00 145.97 ? 75  SER C HG     1 
ATOM   6220  N  N      . TYR C 1 57  ? 23.384  23.316 224.319 1.00 67.88  ? 76  TYR C N      1 
ATOM   6221  C  CA     . TYR C 1 57  ? 24.033  24.606 224.525 1.00 74.46  ? 76  TYR C CA     1 
ATOM   6222  C  C      . TYR C 1 57  ? 25.159  24.499 225.548 1.00 110.33 ? 76  TYR C C      1 
ATOM   6223  O  O      . TYR C 1 57  ? 26.311  24.870 225.277 1.00 136.01 ? 76  TYR C O      1 
ATOM   6224  C  CB     . TYR C 1 57  ? 22.974  25.616 224.975 1.00 67.36  ? 76  TYR C CB     1 
ATOM   6225  C  CG     . TYR C 1 57  ? 23.456  27.040 225.096 1.00 69.53  ? 76  TYR C CG     1 
ATOM   6226  C  CD1    . TYR C 1 57  ? 23.598  27.842 223.974 1.00 79.86  ? 76  TYR C CD1    1 
ATOM   6227  C  CD2    . TYR C 1 57  ? 23.745  27.593 226.337 1.00 90.81  ? 76  TYR C CD2    1 
ATOM   6228  C  CE1    . TYR C 1 57  ? 24.029  29.148 224.079 1.00 92.34  ? 76  TYR C CE1    1 
ATOM   6229  C  CE2    . TYR C 1 57  ? 24.178  28.899 226.451 1.00 99.97  ? 76  TYR C CE2    1 
ATOM   6230  C  CZ     . TYR C 1 57  ? 24.318  29.671 225.319 1.00 96.37  ? 76  TYR C CZ     1 
ATOM   6231  O  OH     . TYR C 1 57  ? 24.747  30.974 225.427 1.00 138.73 ? 76  TYR C OH     1 
ATOM   6232  H  H      . TYR C 1 57  ? 22.527  23.363 224.270 1.00 81.45  ? 76  TYR C H      1 
ATOM   6233  H  HA     . TYR C 1 57  ? 24.412  24.913 223.686 1.00 89.35  ? 76  TYR C HA     1 
ATOM   6234  H  HB2    . TYR C 1 57  ? 22.248  25.608 224.331 1.00 80.84  ? 76  TYR C HB2    1 
ATOM   6235  H  HB3    . TYR C 1 57  ? 22.640  25.346 225.844 1.00 80.84  ? 76  TYR C HB3    1 
ATOM   6236  H  HD1    . TYR C 1 57  ? 23.405  27.491 223.134 1.00 95.83  ? 76  TYR C HD1    1 
ATOM   6237  H  HD2    . TYR C 1 57  ? 23.653  27.073 227.102 1.00 108.98 ? 76  TYR C HD2    1 
ATOM   6238  H  HE1    . TYR C 1 57  ? 24.124  29.672 223.317 1.00 110.81 ? 76  TYR C HE1    1 
ATOM   6239  H  HE2    . TYR C 1 57  ? 24.373  29.255 227.287 1.00 119.96 ? 76  TYR C HE2    1 
ATOM   6240  H  HH     . TYR C 1 57  ? 24.887  31.165 226.233 1.00 166.47 ? 76  TYR C HH     1 
ATOM   6241  N  N      . LEU C 1 58  ? 24.838  23.970 226.732 1.00 78.42  ? 77  LEU C N      1 
ATOM   6242  C  CA     . LEU C 1 58  ? 25.847  23.819 227.774 1.00 66.88  ? 77  LEU C CA     1 
ATOM   6243  C  C      . LEU C 1 58  ? 27.024  22.983 227.291 1.00 84.51  ? 77  LEU C C      1 
ATOM   6244  O  O      . LEU C 1 58  ? 28.181  23.303 227.583 1.00 79.12  ? 77  LEU C O      1 
ATOM   6245  C  CB     . LEU C 1 58  ? 25.219  23.187 229.013 1.00 82.88  ? 77  LEU C CB     1 
ATOM   6246  C  CG     . LEU C 1 58  ? 24.379  24.122 229.878 1.00 63.03  ? 77  LEU C CG     1 
ATOM   6247  C  CD1    . LEU C 1 58  ? 23.533  23.332 230.864 1.00 76.26  ? 77  LEU C CD1    1 
ATOM   6248  C  CD2    . LEU C 1 58  ? 25.287  25.087 230.612 1.00 76.33  ? 77  LEU C CD2    1 
ATOM   6249  H  H      . LEU C 1 58  ? 24.053  23.696 226.951 1.00 94.11  ? 77  LEU C H      1 
ATOM   6250  H  HA     . LEU C 1 58  ? 26.181  24.696 228.020 1.00 80.25  ? 77  LEU C HA     1 
ATOM   6251  H  HB2    . LEU C 1 58  ? 24.644  22.460 228.728 1.00 99.46  ? 77  LEU C HB2    1 
ATOM   6252  H  HB3    . LEU C 1 58  ? 25.930  22.836 229.571 1.00 99.46  ? 77  LEU C HB3    1 
ATOM   6253  H  HG     . LEU C 1 58  ? 23.784  24.636 229.311 1.00 75.64  ? 77  LEU C HG     1 
ATOM   6254  H  HD11   . LEU C 1 58  ? 23.012  23.951 231.399 1.00 91.52  ? 77  LEU C HD11   1 
ATOM   6255  H  HD12   . LEU C 1 58  ? 22.943  22.741 230.371 1.00 91.52  ? 77  LEU C HD12   1 
ATOM   6256  H  HD13   . LEU C 1 58  ? 24.119  22.812 231.437 1.00 91.52  ? 77  LEU C HD13   1 
ATOM   6257  H  HD21   . LEU C 1 58  ? 24.745  25.677 231.159 1.00 91.60  ? 77  LEU C HD21   1 
ATOM   6258  H  HD22   . LEU C 1 58  ? 25.897  24.582 231.173 1.00 91.60  ? 77  LEU C HD22   1 
ATOM   6259  H  HD23   . LEU C 1 58  ? 25.788  25.605 229.962 1.00 91.60  ? 77  LEU C HD23   1 
ATOM   6260  N  N      . ARG C 1 59  ? 26.751  21.900 226.561 1.00 77.80  ? 78  ARG C N      1 
ATOM   6261  C  CA     . ARG C 1 59  ? 27.828  21.042 226.080 1.00 89.33  ? 78  ARG C CA     1 
ATOM   6262  C  C      . ARG C 1 59  ? 28.751  21.798 225.136 1.00 129.38 ? 78  ARG C C      1 
ATOM   6263  O  O      . ARG C 1 59  ? 29.980  21.683 225.228 1.00 121.94 ? 78  ARG C O      1 
ATOM   6264  C  CB     . ARG C 1 59  ? 27.248  19.810 225.386 1.00 80.27  ? 78  ARG C CB     1 
ATOM   6265  C  CG     . ARG C 1 59  ? 27.064  18.617 226.305 1.00 96.79  ? 78  ARG C CG     1 
ATOM   6266  C  CD     . ARG C 1 59  ? 26.362  17.471 225.596 1.00 107.99 ? 78  ARG C CD     1 
ATOM   6267  N  NE     . ARG C 1 59  ? 27.036  16.195 225.818 1.00 107.66 ? 78  ARG C NE     1 
ATOM   6268  C  CZ     . ARG C 1 59  ? 27.006  15.517 226.961 1.00 112.99 ? 78  ARG C CZ     1 
ATOM   6269  N  NH1    . ARG C 1 59  ? 26.340  15.993 228.004 1.00 116.55 ? 78  ARG C NH1    1 
ATOM   6270  N  NH2    . ARG C 1 59  ? 27.650  14.362 227.065 1.00 137.49 ? 78  ARG C NH2    1 
ATOM   6271  H  H      . ARG C 1 59  ? 25.961  21.646 226.334 1.00 93.36  ? 78  ARG C H      1 
ATOM   6272  H  HA     . ARG C 1 59  ? 28.354  20.740 226.837 1.00 107.19 ? 78  ARG C HA     1 
ATOM   6273  H  HB2    . ARG C 1 59  ? 26.379  20.039 225.020 1.00 96.33  ? 78  ARG C HB2    1 
ATOM   6274  H  HB3    . ARG C 1 59  ? 27.846  19.544 224.670 1.00 96.33  ? 78  ARG C HB3    1 
ATOM   6275  H  HG2    . ARG C 1 59  ? 27.933  18.304 226.601 1.00 116.14 ? 78  ARG C HG2    1 
ATOM   6276  H  HG3    . ARG C 1 59  ? 26.524  18.880 227.066 1.00 116.14 ? 78  ARG C HG3    1 
ATOM   6277  H  HD2    . ARG C 1 59  ? 25.455  17.397 225.933 1.00 129.59 ? 78  ARG C HD2    1 
ATOM   6278  H  HD3    . ARG C 1 59  ? 26.351  17.646 224.642 1.00 129.59 ? 78  ARG C HD3    1 
ATOM   6279  H  HE     . ARG C 1 59  ? 27.484  15.859 225.164 1.00 129.19 ? 78  ARG C HE     1 
ATOM   6280  H  HH11   . ARG C 1 59  ? 25.920  16.741 227.941 1.00 139.86 ? 78  ARG C HH11   1 
ATOM   6281  H  HH12   . ARG C 1 59  ? 26.324  15.552 228.742 1.00 139.86 ? 78  ARG C HH12   1 
ATOM   6282  H  HH21   . ARG C 1 59  ? 28.085  14.050 226.391 1.00 164.99 ? 78  ARG C HH21   1 
ATOM   6283  H  HH22   . ARG C 1 59  ? 27.633  13.925 227.805 1.00 164.99 ? 78  ARG C HH22   1 
ATOM   6284  N  N      . ALA C 1 60  ? 28.179  22.575 224.219 1.00 128.11 ? 79  ALA C N      1 
ATOM   6285  C  CA     . ALA C 1 60  ? 28.991  23.349 223.291 1.00 121.64 ? 79  ALA C CA     1 
ATOM   6286  C  C      . ALA C 1 60  ? 29.860  24.353 224.039 1.00 112.60 ? 79  ALA C C      1 
ATOM   6287  O  O      . ALA C 1 60  ? 31.093  24.326 223.942 1.00 122.16 ? 79  ALA C O      1 
ATOM   6288  C  CB     . ALA C 1 60  ? 28.090  24.055 222.278 1.00 99.57  ? 79  ALA C CB     1 
ATOM   6289  H  H      . ALA C 1 60  ? 27.330  22.670 224.116 1.00 153.73 ? 79  ALA C H      1 
ATOM   6290  H  HA     . ALA C 1 60  ? 29.577  22.748 222.805 1.00 145.97 ? 79  ALA C HA     1 
ATOM   6291  H  HB1    . ALA C 1 60  ? 28.643  24.566 221.666 1.00 119.49 ? 79  ALA C HB1    1 
ATOM   6292  H  HB2    . ALA C 1 60  ? 27.584  23.388 221.788 1.00 119.49 ? 79  ALA C HB2    1 
ATOM   6293  H  HB3    . ALA C 1 60  ? 27.486  24.647 222.752 1.00 119.49 ? 79  ALA C HB3    1 
ATOM   6294  N  N      . LYS C 1 61  ? 29.229  25.248 224.805 1.00 82.36  ? 80  LYS C N      1 
ATOM   6295  C  CA     . LYS C 1 61  ? 29.999  26.277 225.497 1.00 122.18 ? 80  LYS C CA     1 
ATOM   6296  C  C      . LYS C 1 61  ? 31.042  25.671 226.430 1.00 154.48 ? 80  LYS C C      1 
ATOM   6297  O  O      . LYS C 1 61  ? 32.137  26.230 226.588 1.00 128.90 ? 80  LYS C O      1 
ATOM   6298  C  CB     . LYS C 1 61  ? 29.061  27.196 226.279 1.00 93.38  ? 80  LYS C CB     1 
ATOM   6299  H  H      . LYS C 1 61  ? 28.380  25.279 224.937 1.00 98.83  ? 80  LYS C H      1 
ATOM   6300  H  HA     . LYS C 1 61  ? 30.465  26.816 224.839 1.00 146.62 ? 80  LYS C HA     1 
ATOM   6301  N  N      . SER C 1 62  ? 30.730  24.522 227.037 1.00 140.48 ? 81  SER C N      1 
ATOM   6302  C  CA     . SER C 1 62  ? 31.597  23.958 228.067 1.00 122.17 ? 81  SER C CA     1 
ATOM   6303  C  C      . SER C 1 62  ? 33.006  23.722 227.551 1.00 119.18 ? 81  SER C C      1 
ATOM   6304  O  O      . SER C 1 62  ? 33.980  23.884 228.296 1.00 133.13 ? 81  SER C O      1 
ATOM   6305  C  CB     . SER C 1 62  ? 31.015  22.649 228.594 1.00 131.07 ? 81  SER C CB     1 
ATOM   6306  O  OG     . SER C 1 62  ? 31.946  22.029 229.469 1.00 116.06 ? 81  SER C OG     1 
ATOM   6307  H  H      . SER C 1 62  ? 30.028  24.055 226.869 1.00 168.57 ? 81  SER C H      1 
ATOM   6308  H  HA     . SER C 1 62  ? 31.650  24.581 228.808 1.00 146.60 ? 81  SER C HA     1 
ATOM   6309  H  HB2    . SER C 1 62  ? 30.196  22.836 229.079 1.00 157.29 ? 81  SER C HB2    1 
ATOM   6310  H  HB3    . SER C 1 62  ? 30.835  22.057 227.847 1.00 157.29 ? 81  SER C HB3    1 
ATOM   6311  H  HG     . SER C 1 62  ? 31.629  21.308 229.761 1.00 139.27 ? 81  SER C HG     1 
ATOM   6312  N  N      . PHE C 1 63  ? 33.139  23.304 226.295 1.00 110.55 ? 82  PHE C N      1 
ATOM   6313  C  CA     . PHE C 1 63  ? 34.459  23.138 225.706 1.00 173.36 ? 82  PHE C CA     1 
ATOM   6314  C  C      . PHE C 1 63  ? 34.865  24.305 224.824 1.00 143.83 ? 82  PHE C C      1 
ATOM   6315  O  O      . PHE C 1 63  ? 36.065  24.499 224.589 1.00 143.27 ? 82  PHE C O      1 
ATOM   6316  C  CB     . PHE C 1 63  ? 34.516  21.849 224.888 1.00 174.90 ? 82  PHE C CB     1 
ATOM   6317  C  CG     . PHE C 1 63  ? 34.347  22.048 223.418 1.00 161.82 ? 82  PHE C CG     1 
ATOM   6318  C  CD1    . PHE C 1 63  ? 33.092  22.009 222.845 1.00 151.73 ? 82  PHE C CD1    1 
ATOM   6319  C  CD2    . PHE C 1 63  ? 35.450  22.229 222.601 1.00 131.72 ? 82  PHE C CD2    1 
ATOM   6320  C  CE1    . PHE C 1 63  ? 32.938  22.166 221.489 1.00 154.94 ? 82  PHE C CE1    1 
ATOM   6321  C  CE2    . PHE C 1 63  ? 35.302  22.391 221.247 1.00 119.73 ? 82  PHE C CE2    1 
ATOM   6322  C  CZ     . PHE C 1 63  ? 34.044  22.358 220.687 1.00 120.76 ? 82  PHE C CZ     1 
ATOM   6323  H  H      . PHE C 1 63  ? 32.487  23.111 225.769 1.00 132.66 ? 82  PHE C H      1 
ATOM   6324  H  HA     . PHE C 1 63  ? 35.112  23.066 226.419 1.00 208.03 ? 82  PHE C HA     1 
ATOM   6325  H  HB2    . PHE C 1 63  ? 35.378  21.428 225.032 1.00 209.88 ? 82  PHE C HB2    1 
ATOM   6326  H  HB3    . PHE C 1 63  ? 33.809  21.258 225.189 1.00 209.88 ? 82  PHE C HB3    1 
ATOM   6327  H  HD1    . PHE C 1 63  ? 32.344  21.878 223.382 1.00 182.07 ? 82  PHE C HD1    1 
ATOM   6328  H  HD2    . PHE C 1 63  ? 36.301  22.250 222.975 1.00 158.06 ? 82  PHE C HD2    1 
ATOM   6329  H  HE1    . PHE C 1 63  ? 32.088  22.147 221.112 1.00 185.93 ? 82  PHE C HE1    1 
ATOM   6330  H  HE2    . PHE C 1 63  ? 36.049  22.519 220.709 1.00 143.68 ? 82  PHE C HE2    1 
ATOM   6331  H  HZ     . PHE C 1 63  ? 33.941  22.469 219.770 1.00 144.91 ? 82  PHE C HZ     1 
ATOM   6332  N  N      . PHE C 1 64  ? 33.902  25.078 224.326 1.00 143.67 ? 83  PHE C N      1 
ATOM   6333  C  CA     . PHE C 1 64  ? 34.259  26.272 223.573 1.00 131.78 ? 83  PHE C CA     1 
ATOM   6334  C  C      . PHE C 1 64  ? 35.018  27.265 224.437 1.00 136.03 ? 83  PHE C C      1 
ATOM   6335  O  O      . PHE C 1 64  ? 35.850  28.020 223.923 1.00 177.10 ? 83  PHE C O      1 
ATOM   6336  C  CB     . PHE C 1 64  ? 33.011  26.921 222.983 1.00 110.87 ? 83  PHE C CB     1 
ATOM   6337  C  CG     . PHE C 1 64  ? 32.871  26.715 221.509 1.00 121.14 ? 83  PHE C CG     1 
ATOM   6338  C  CD1    . PHE C 1 64  ? 32.668  25.449 220.991 1.00 139.81 ? 83  PHE C CD1    1 
ATOM   6339  C  CD2    . PHE C 1 64  ? 32.938  27.787 220.640 1.00 144.98 ? 83  PHE C CD2    1 
ATOM   6340  C  CE1    . PHE C 1 64  ? 32.536  25.256 219.630 1.00 144.74 ? 83  PHE C CE1    1 
ATOM   6341  C  CE2    . PHE C 1 64  ? 32.806  27.601 219.277 1.00 163.06 ? 83  PHE C CE2    1 
ATOM   6342  C  CZ     . PHE C 1 64  ? 32.605  26.333 218.772 1.00 146.98 ? 83  PHE C CZ     1 
ATOM   6343  H  H      . PHE C 1 64  ? 33.058  24.937 224.407 1.00 172.40 ? 83  PHE C H      1 
ATOM   6344  H  HA     . PHE C 1 64  ? 34.837  26.016 222.837 1.00 158.14 ? 83  PHE C HA     1 
ATOM   6345  H  HB2    . PHE C 1 64  ? 32.228  26.542 223.412 1.00 133.04 ? 83  PHE C HB2    1 
ATOM   6346  H  HB3    . PHE C 1 64  ? 33.048  27.876 223.148 1.00 133.04 ? 83  PHE C HB3    1 
ATOM   6347  H  HD1    . PHE C 1 64  ? 32.621  24.720 221.566 1.00 167.78 ? 83  PHE C HD1    1 
ATOM   6348  H  HD2    . PHE C 1 64  ? 33.073  28.644 220.976 1.00 173.98 ? 83  PHE C HD2    1 
ATOM   6349  H  HE1    . PHE C 1 64  ? 32.401  24.400 219.292 1.00 173.69 ? 83  PHE C HE1    1 
ATOM   6350  H  HE2    . PHE C 1 64  ? 32.854  28.329 218.701 1.00 195.67 ? 83  PHE C HE2    1 
ATOM   6351  H  HZ     . PHE C 1 64  ? 32.517  26.205 217.855 1.00 176.37 ? 83  PHE C HZ     1 
ATOM   6352  N  N      . ASP C 1 65  ? 34.764  27.278 225.748 1.00 145.34 ? 84  ASP C N      1 
ATOM   6353  C  CA     . ASP C 1 65  ? 35.540  28.157 226.616 1.00 163.44 ? 84  ASP C CA     1 
ATOM   6354  C  C      . ASP C 1 65  ? 37.003  27.730 226.679 1.00 183.70 ? 84  ASP C C      1 
ATOM   6355  O  O      . ASP C 1 65  ? 37.877  28.558 226.960 1.00 197.15 ? 84  ASP C O      1 
ATOM   6356  C  CB     . ASP C 1 65  ? 34.943  28.187 228.021 1.00 163.20 ? 84  ASP C CB     1 
ATOM   6357  C  CG     . ASP C 1 65  ? 35.317  26.971 228.838 1.00 163.78 ? 84  ASP C CG     1 
ATOM   6358  O  OD1    . ASP C 1 65  ? 35.460  25.883 228.248 1.00 153.38 ? 84  ASP C OD1    1 
ATOM   6359  O  OD2    . ASP C 1 65  ? 35.478  27.106 230.069 1.00 158.94 ? 84  ASP C OD2    1 
ATOM   6360  H  H      . ASP C 1 65  ? 34.167  26.803 226.146 1.00 174.40 ? 84  ASP C H      1 
ATOM   6361  H  HA     . ASP C 1 65  ? 35.508  29.058 226.259 1.00 196.13 ? 84  ASP C HA     1 
ATOM   6362  H  HB2    . ASP C 1 65  ? 35.268  28.974 228.487 1.00 195.84 ? 84  ASP C HB2    1 
ATOM   6363  H  HB3    . ASP C 1 65  ? 33.975  28.217 227.953 1.00 195.84 ? 84  ASP C HB3    1 
ATOM   6364  N  N      . VAL C 1 66  ? 37.290  26.453 226.423 1.00 155.63 ? 85  VAL C N      1 
ATOM   6365  C  CA     . VAL C 1 66  ? 38.672  25.984 226.392 1.00 167.08 ? 85  VAL C CA     1 
ATOM   6366  C  C      . VAL C 1 66  ? 39.292  26.229 225.023 1.00 156.50 ? 85  VAL C C      1 
ATOM   6367  O  O      . VAL C 1 66  ? 40.409  26.747 224.913 1.00 175.48 ? 85  VAL C O      1 
ATOM   6368  C  CB     . VAL C 1 66  ? 38.740  24.492 226.772 1.00 159.29 ? 85  VAL C CB     1 
ATOM   6369  C  CG1    . VAL C 1 66  ? 40.168  23.968 226.641 1.00 159.07 ? 85  VAL C CG1    1 
ATOM   6370  C  CG2    . VAL C 1 66  ? 38.227  24.276 228.183 1.00 134.78 ? 85  VAL C CG2    1 
ATOM   6371  H  H      . VAL C 1 66  ? 36.705  25.842 226.265 1.00 186.75 ? 85  VAL C H      1 
ATOM   6372  H  HA     . VAL C 1 66  ? 39.188  26.482 227.046 1.00 200.50 ? 85  VAL C HA     1 
ATOM   6373  H  HB     . VAL C 1 66  ? 38.177  23.986 226.167 1.00 191.15 ? 85  VAL C HB     1 
ATOM   6374  H  HG11   . VAL C 1 66  ? 40.183  23.029 226.886 1.00 190.89 ? 85  VAL C HG11   1 
ATOM   6375  H  HG12   . VAL C 1 66  ? 40.460  24.075 225.723 1.00 190.89 ? 85  VAL C HG12   1 
ATOM   6376  H  HG13   . VAL C 1 66  ? 40.746  24.473 227.234 1.00 190.89 ? 85  VAL C HG13   1 
ATOM   6377  H  HG21   . VAL C 1 66  ? 38.280  23.331 228.396 1.00 161.74 ? 85  VAL C HG21   1 
ATOM   6378  H  HG22   . VAL C 1 66  ? 38.774  24.786 228.799 1.00 161.74 ? 85  VAL C HG22   1 
ATOM   6379  H  HG23   . VAL C 1 66  ? 37.305  24.575 228.232 1.00 161.74 ? 85  VAL C HG23   1 
ATOM   6380  N  N      . ALA C 1 67  ? 38.576  25.857 223.960 1.00 158.42 ? 86  ALA C N      1 
ATOM   6381  C  CA     . ALA C 1 67  ? 39.151  25.908 222.619 1.00 162.63 ? 86  ALA C CA     1 
ATOM   6382  C  C      . ALA C 1 67  ? 39.622  27.315 222.269 1.00 163.43 ? 86  ALA C C      1 
ATOM   6383  O  O      . ALA C 1 67  ? 40.737  27.501 221.767 1.00 190.59 ? 86  ALA C O      1 
ATOM   6384  C  CB     . ALA C 1 67  ? 38.130  25.409 221.596 1.00 148.42 ? 86  ALA C CB     1 
ATOM   6385  H  H      . ALA C 1 67  ? 37.765  25.573 223.989 1.00 190.10 ? 86  ALA C H      1 
ATOM   6386  H  HA     . ALA C 1 67  ? 39.920  25.319 222.584 1.00 195.15 ? 86  ALA C HA     1 
ATOM   6387  H  HB1    . ALA C 1 67  ? 38.525  25.449 220.711 1.00 178.10 ? 86  ALA C HB1    1 
ATOM   6388  H  HB2    . ALA C 1 67  ? 37.890  24.494 221.811 1.00 178.10 ? 86  ALA C HB2    1 
ATOM   6389  H  HB3    . ALA C 1 67  ? 37.344  25.975 221.633 1.00 178.10 ? 86  ALA C HB3    1 
ATOM   6390  N  N      . LEU C 1 68  ? 38.788  28.324 222.529 1.00 143.55 ? 87  LEU C N      1 
ATOM   6391  C  CA     . LEU C 1 68  ? 39.136  29.687 222.139 1.00 167.28 ? 87  LEU C CA     1 
ATOM   6392  C  C      . LEU C 1 68  ? 40.113  30.325 223.121 1.00 206.17 ? 87  LEU C C      1 
ATOM   6393  O  O      . LEU C 1 68  ? 41.005  31.076 222.712 1.00 199.24 ? 87  LEU C O      1 
ATOM   6394  C  CB     . LEU C 1 68  ? 37.870  30.536 222.014 1.00 146.18 ? 87  LEU C CB     1 
ATOM   6395  C  CG     . LEU C 1 68  ? 37.011  30.717 223.268 1.00 138.42 ? 87  LEU C CG     1 
ATOM   6396  C  CD1    . LEU C 1 68  ? 37.383  31.985 224.024 1.00 170.71 ? 87  LEU C CD1    1 
ATOM   6397  C  CD2    . LEU C 1 68  ? 35.532  30.734 222.892 1.00 147.37 ? 87  LEU C CD2    1 
ATOM   6398  H  H      . LEU C 1 68  ? 38.028  28.246 222.923 1.00 172.26 ? 87  LEU C H      1 
ATOM   6399  H  HA     . LEU C 1 68  ? 39.564  29.663 221.269 1.00 200.73 ? 87  LEU C HA     1 
ATOM   6400  H  HB2    . LEU C 1 68  ? 38.131  31.422 221.720 1.00 175.41 ? 87  LEU C HB2    1 
ATOM   6401  H  HB3    . LEU C 1 68  ? 37.303  30.131 221.339 1.00 175.41 ? 87  LEU C HB3    1 
ATOM   6402  H  HG     . LEU C 1 68  ? 37.158  29.964 223.861 1.00 166.11 ? 87  LEU C HG     1 
ATOM   6403  H  HD11   . LEU C 1 68  ? 36.817  32.062 224.809 1.00 204.85 ? 87  LEU C HD11   1 
ATOM   6404  H  HD12   . LEU C 1 68  ? 38.314  31.932 224.291 1.00 204.85 ? 87  LEU C HD12   1 
ATOM   6405  H  HD13   . LEU C 1 68  ? 37.248  32.750 223.443 1.00 204.85 ? 87  LEU C HD13   1 
ATOM   6406  H  HD21   . LEU C 1 68  ? 35.003  30.850 223.697 1.00 176.84 ? 87  LEU C HD21   1 
ATOM   6407  H  HD22   . LEU C 1 68  ? 35.370  31.470 222.281 1.00 176.84 ? 87  LEU C HD22   1 
ATOM   6408  H  HD23   . LEU C 1 68  ? 35.305  29.893 222.465 1.00 176.84 ? 87  LEU C HD23   1 
ATOM   6409  N  N      . LYS C 1 69  ? 39.966  30.038 224.410 1.00 195.35 ? 88  LYS C N      1 
ATOM   6410  C  CA     . LYS C 1 69  ? 40.823  30.638 225.426 1.00 188.99 ? 88  LYS C CA     1 
ATOM   6411  C  C      . LYS C 1 69  ? 42.159  29.911 225.507 1.00 177.12 ? 88  LYS C C      1 
ATOM   6412  O  O      . LYS C 1 69  ? 43.199  30.464 225.150 1.00 176.00 ? 88  LYS C O      1 
ATOM   6413  C  CB     . LYS C 1 69  ? 40.129  30.620 226.789 1.00 166.00 ? 88  LYS C CB     1 
ATOM   6414  H  H      . LYS C 1 69  ? 39.375  29.497 224.723 1.00 234.42 ? 88  LYS C H      1 
ATOM   6415  H  HA     . LYS C 1 69  ? 40.997  31.562 225.188 1.00 226.79 ? 88  LYS C HA     1 
ATOM   6416  N  N      . ARG C 1 88  ? 33.289  50.542 211.629 1.00 151.15 ? 107 ARG C N      1 
ATOM   6417  C  CA     . ARG C 1 88  ? 34.607  50.669 212.240 1.00 166.96 ? 107 ARG C CA     1 
ATOM   6418  C  C      . ARG C 1 88  ? 34.611  50.130 213.668 1.00 168.05 ? 107 ARG C C      1 
ATOM   6419  O  O      . ARG C 1 88  ? 35.670  49.855 214.231 1.00 176.87 ? 107 ARG C O      1 
ATOM   6420  C  CB     . ARG C 1 88  ? 35.061  52.130 212.235 1.00 168.04 ? 107 ARG C CB     1 
ATOM   6421  H  HA     . ARG C 1 88  ? 35.246  50.154 211.723 1.00 200.35 ? 107 ARG C HA     1 
ATOM   6422  N  N      . GLU C 1 89  ? 33.421  49.982 214.249 1.00 153.85 ? 108 GLU C N      1 
ATOM   6423  C  CA     . GLU C 1 89  ? 33.275  49.500 215.616 1.00 145.33 ? 108 GLU C CA     1 
ATOM   6424  C  C      . GLU C 1 89  ? 32.409  48.256 215.741 1.00 144.60 ? 108 GLU C C      1 
ATOM   6425  O  O      . GLU C 1 89  ? 32.590  47.493 216.694 1.00 130.77 ? 108 GLU C O      1 
ATOM   6426  C  CB     . GLU C 1 89  ? 32.681  50.604 216.507 1.00 111.85 ? 108 GLU C CB     1 
ATOM   6427  H  H      . GLU C 1 89  ? 32.673  50.157 213.864 1.00 184.62 ? 108 GLU C H      1 
ATOM   6428  H  HA     . GLU C 1 89  ? 34.154  49.282 215.963 1.00 174.39 ? 108 GLU C HA     1 
ATOM   6429  N  N      . GLY C 1 90  ? 31.486  48.022 214.808 1.00 135.54 ? 109 GLY C N      1 
ATOM   6430  C  CA     . GLY C 1 90  ? 30.525  46.944 214.924 1.00 114.86 ? 109 GLY C CA     1 
ATOM   6431  C  C      . GLY C 1 90  ? 30.680  45.800 213.950 1.00 107.90 ? 109 GLY C C      1 
ATOM   6432  O  O      . GLY C 1 90  ? 29.759  44.979 213.839 1.00 135.92 ? 109 GLY C O      1 
ATOM   6433  H  H      . GLY C 1 90  ? 31.401  48.486 214.088 1.00 162.65 ? 109 GLY C H      1 
ATOM   6434  H  HA2    . GLY C 1 90  ? 30.580  46.576 215.820 1.00 137.84 ? 109 GLY C HA2    1 
ATOM   6435  H  HA3    . GLY C 1 90  ? 29.634  47.310 214.809 1.00 137.84 ? 109 GLY C HA3    1 
ATOM   6436  N  N      . LEU C 1 91  ? 31.797  45.705 213.230 1.00 114.85 ? 110 LEU C N      1 
ATOM   6437  C  CA     . LEU C 1 91  ? 31.997  44.592 212.311 1.00 132.33 ? 110 LEU C CA     1 
ATOM   6438  C  C      . LEU C 1 91  ? 32.684  43.411 212.976 1.00 139.35 ? 110 LEU C C      1 
ATOM   6439  O  O      . LEU C 1 91  ? 32.398  42.258 212.626 1.00 125.49 ? 110 LEU C O      1 
ATOM   6440  C  CB     . LEU C 1 91  ? 32.806  45.050 211.094 1.00 147.01 ? 110 LEU C CB     1 
ATOM   6441  C  CG     . LEU C 1 91  ? 32.043  45.886 210.054 1.00 135.26 ? 110 LEU C CG     1 
ATOM   6442  C  CD1    . LEU C 1 91  ? 30.825  45.130 209.523 1.00 126.49 ? 110 LEU C CD1    1 
ATOM   6443  C  CD2    . LEU C 1 91  ? 31.635  47.243 210.615 1.00 135.10 ? 110 LEU C CD2    1 
ATOM   6444  H  H      . LEU C 1 91  ? 32.447  46.267 213.257 1.00 137.81 ? 110 LEU C H      1 
ATOM   6445  H  HA     . LEU C 1 91  ? 31.132  44.290 211.995 1.00 158.80 ? 110 LEU C HA     1 
ATOM   6446  H  HB2    . LEU C 1 91  ? 33.550  45.588 211.407 1.00 176.41 ? 110 LEU C HB2    1 
ATOM   6447  H  HB3    . LEU C 1 91  ? 33.145  44.263 210.639 1.00 176.41 ? 110 LEU C HB3    1 
ATOM   6448  H  HG     . LEU C 1 91  ? 32.633  46.049 209.302 1.00 162.31 ? 110 LEU C HG     1 
ATOM   6449  H  HD11   . LEU C 1 91  ? 30.369  45.686 208.871 1.00 151.78 ? 110 LEU C HD11   1 
ATOM   6450  H  HD12   . LEU C 1 91  ? 31.122  44.306 209.106 1.00 151.78 ? 110 LEU C HD12   1 
ATOM   6451  H  HD13   . LEU C 1 91  ? 30.229  44.931 210.263 1.00 151.78 ? 110 LEU C HD13   1 
ATOM   6452  H  HD21   . LEU C 1 91  ? 31.158  47.736 209.929 1.00 162.12 ? 110 LEU C HD21   1 
ATOM   6453  H  HD22   . LEU C 1 91  ? 31.061  47.106 211.385 1.00 162.12 ? 110 LEU C HD22   1 
ATOM   6454  H  HD23   . LEU C 1 91  ? 32.433  47.728 210.878 1.00 162.12 ? 110 LEU C HD23   1 
ATOM   6455  N  N      . ASN C 1 92  ? 33.578  43.668 213.933 1.00 138.71 ? 111 ASN C N      1 
ATOM   6456  C  CA     . ASN C 1 92  ? 34.018  42.611 214.833 1.00 130.42 ? 111 ASN C CA     1 
ATOM   6457  C  C      . ASN C 1 92  ? 32.862  42.049 215.646 1.00 123.72 ? 111 ASN C C      1 
ATOM   6458  O  O      . ASN C 1 92  ? 33.023  41.006 216.288 1.00 130.71 ? 111 ASN C O      1 
ATOM   6459  C  CB     . ASN C 1 92  ? 35.109  43.139 215.770 1.00 145.81 ? 111 ASN C CB     1 
ATOM   6460  C  CG     . ASN C 1 92  ? 34.688  44.397 216.510 1.00 152.16 ? 111 ASN C CG     1 
ATOM   6461  O  OD1    . ASN C 1 92  ? 33.899  45.197 216.002 1.00 124.46 ? 111 ASN C OD1    1 
ATOM   6462  N  ND2    . ASN C 1 92  ? 35.218  44.579 217.717 1.00 161.37 ? 111 ASN C ND2    1 
ATOM   6463  H  H      . ASN C 1 92  ? 33.938  44.436 214.077 1.00 166.45 ? 111 ASN C H      1 
ATOM   6464  H  HA     . ASN C 1 92  ? 34.396  41.888 214.310 1.00 156.50 ? 111 ASN C HA     1 
ATOM   6465  H  HB2    . ASN C 1 92  ? 35.316  42.458 216.429 1.00 174.97 ? 111 ASN C HB2    1 
ATOM   6466  H  HB3    . ASN C 1 92  ? 35.899  43.348 215.248 1.00 174.97 ? 111 ASN C HB3    1 
ATOM   6467  H  HD21   . ASN C 1 92  ? 35.011  45.276 218.177 1.00 193.64 ? 111 ASN C HD21   1 
ATOM   6468  H  HD22   . ASN C 1 92  ? 35.768  44.000 218.037 1.00 193.64 ? 111 ASN C HD22   1 
ATOM   6469  N  N      . LEU C 1 93  ? 31.707  42.716 215.632 1.00 131.01 ? 112 LEU C N      1 
ATOM   6470  C  CA     . LEU C 1 93  ? 30.513  42.274 216.338 1.00 94.73  ? 112 LEU C CA     1 
ATOM   6471  C  C      . LEU C 1 93  ? 29.512  41.570 215.431 1.00 93.94  ? 112 LEU C C      1 
ATOM   6472  O  O      . LEU C 1 93  ? 28.913  40.573 215.843 1.00 146.84 ? 112 LEU C O      1 
ATOM   6473  C  CB     . LEU C 1 93  ? 29.835  43.474 217.008 1.00 112.81 ? 112 LEU C CB     1 
ATOM   6474  C  CG     . LEU C 1 93  ? 30.360  43.840 218.400 1.00 134.76 ? 112 LEU C CG     1 
ATOM   6475  C  CD1    . LEU C 1 93  ? 31.878  43.990 218.417 1.00 123.05 ? 112 LEU C CD1    1 
ATOM   6476  C  CD2    . LEU C 1 93  ? 29.699  45.117 218.895 1.00 119.19 ? 112 LEU C CD2    1 
ATOM   6477  H  H      . LEU C 1 93  ? 31.592  43.453 215.204 1.00 157.21 ? 112 LEU C H      1 
ATOM   6478  H  HA     . LEU C 1 93  ? 30.772  41.651 217.034 1.00 113.68 ? 112 LEU C HA     1 
ATOM   6479  H  HB2    . LEU C 1 93  ? 29.954  44.250 216.439 1.00 135.37 ? 112 LEU C HB2    1 
ATOM   6480  H  HB3    . LEU C 1 93  ? 28.888  43.281 217.097 1.00 135.37 ? 112 LEU C HB3    1 
ATOM   6481  H  HG     . LEU C 1 93  ? 30.127  43.129 219.017 1.00 161.72 ? 112 LEU C HG     1 
ATOM   6482  H  HD11   . LEU C 1 93  ? 32.162  44.221 219.315 1.00 147.66 ? 112 LEU C HD11   1 
ATOM   6483  H  HD12   . LEU C 1 93  ? 32.281  43.149 218.148 1.00 147.66 ? 112 LEU C HD12   1 
ATOM   6484  H  HD13   . LEU C 1 93  ? 32.133  44.692 217.798 1.00 147.66 ? 112 LEU C HD13   1 
ATOM   6485  H  HD21   . LEU C 1 93  ? 30.045  45.331 219.775 1.00 143.03 ? 112 LEU C HD21   1 
ATOM   6486  H  HD22   . LEU C 1 93  ? 29.900  45.837 218.276 1.00 143.03 ? 112 LEU C HD22   1 
ATOM   6487  H  HD23   . LEU C 1 93  ? 28.740  44.978 218.940 1.00 143.03 ? 112 LEU C HD23   1 
ATOM   6488  N  N      . GLN C 1 94  ? 29.310  42.060 214.211 1.00 91.42  ? 113 GLN C N      1 
ATOM   6489  C  CA     . GLN C 1 94  ? 28.396  41.429 213.267 1.00 98.48  ? 113 GLN C CA     1 
ATOM   6490  C  C      . GLN C 1 94  ? 29.078  40.367 212.417 1.00 94.73  ? 113 GLN C C      1 
ATOM   6491  O  O      . GLN C 1 94  ? 28.415  39.728 211.581 1.00 109.26 ? 113 GLN C O      1 
ATOM   6492  C  CB     . GLN C 1 94  ? 27.766  42.487 212.357 1.00 124.48 ? 113 GLN C CB     1 
ATOM   6493  H  H      . GLN C 1 94  ? 29.695  42.766 213.904 1.00 109.70 ? 113 GLN C H      1 
ATOM   6494  H  HA     . GLN C 1 94  ? 27.682  40.999 213.762 1.00 118.17 ? 113 GLN C HA     1 
ATOM   6495  N  N      . GLU C 1 95  ? 30.382  40.159 212.615 1.00 89.57  ? 114 GLU C N      1 
ATOM   6496  C  CA     . GLU C 1 95  ? 31.092  39.181 211.803 1.00 124.21 ? 114 GLU C CA     1 
ATOM   6497  C  C      . GLU C 1 95  ? 30.351  37.850 211.816 1.00 123.49 ? 114 GLU C C      1 
ATOM   6498  O  O      . GLU C 1 95  ? 30.022  37.311 210.759 1.00 132.30 ? 114 GLU C O      1 
ATOM   6499  C  CB     . GLU C 1 95  ? 32.545  39.037 212.280 1.00 125.44 ? 114 GLU C CB     1 
ATOM   6500  C  CG     . GLU C 1 95  ? 32.848  37.866 213.207 1.00 119.44 ? 114 GLU C CG     1 
ATOM   6501  C  CD     . GLU C 1 95  ? 34.320  37.785 213.574 1.00 131.30 ? 114 GLU C CD     1 
ATOM   6502  O  OE1    . GLU C 1 95  ? 35.052  37.007 212.924 1.00 131.70 ? 114 GLU C OE1    1 
ATOM   6503  O  OE2    . GLU C 1 95  ? 34.746  38.509 214.503 1.00 140.78 ? 114 GLU C OE2    1 
ATOM   6504  H  H      . GLU C 1 95  ? 30.865  40.563 213.200 1.00 107.49 ? 114 GLU C H      1 
ATOM   6505  H  HA     . GLU C 1 95  ? 31.114  39.496 210.886 1.00 149.05 ? 114 GLU C HA     1 
ATOM   6506  H  HB2    . GLU C 1 95  ? 33.112  38.938 211.499 1.00 150.52 ? 114 GLU C HB2    1 
ATOM   6507  H  HB3    . GLU C 1 95  ? 32.790  39.848 212.753 1.00 150.52 ? 114 GLU C HB3    1 
ATOM   6508  H  HG2    . GLU C 1 95  ? 32.339  37.969 214.026 1.00 143.33 ? 114 GLU C HG2    1 
ATOM   6509  H  HG3    . GLU C 1 95  ? 32.602  37.039 212.764 1.00 143.33 ? 114 GLU C HG3    1 
ATOM   6510  N  N      . GLY C 1 96  ? 30.012  37.346 213.003 1.00 128.56 ? 115 GLY C N      1 
ATOM   6511  C  CA     . GLY C 1 96  ? 29.319  36.075 213.128 1.00 114.01 ? 115 GLY C CA     1 
ATOM   6512  C  C      . GLY C 1 96  ? 28.214  35.871 212.106 1.00 115.94 ? 115 GLY C C      1 
ATOM   6513  O  O      . GLY C 1 96  ? 28.224  34.895 211.346 1.00 102.39 ? 115 GLY C O      1 
ATOM   6514  H  H      . GLY C 1 96  ? 30.176  37.729 213.756 1.00 154.27 ? 115 GLY C H      1 
ATOM   6515  H  HA2    . GLY C 1 96  ? 29.959  35.353 213.029 1.00 136.81 ? 115 GLY C HA2    1 
ATOM   6516  H  HA3    . GLY C 1 96  ? 28.926  36.013 214.013 1.00 136.81 ? 115 GLY C HA3    1 
ATOM   6517  N  N      . GLU C 1 97  ? 27.256  36.798 212.070 1.00 136.58 ? 116 GLU C N      1 
ATOM   6518  C  CA     . GLU C 1 97  ? 26.173  36.698 211.098 1.00 119.12 ? 116 GLU C CA     1 
ATOM   6519  C  C      . GLU C 1 97  ? 26.722  36.773 209.681 1.00 119.61 ? 116 GLU C C      1 
ATOM   6520  O  O      . GLU C 1 97  ? 26.322  35.992 208.798 1.00 135.98 ? 116 GLU C O      1 
ATOM   6521  C  CB     . GLU C 1 97  ? 25.147  37.807 211.334 1.00 128.74 ? 116 GLU C CB     1 
ATOM   6522  C  CG     . GLU C 1 97  ? 24.380  37.705 212.647 1.00 114.54 ? 116 GLU C CG     1 
ATOM   6523  C  CD     . GLU C 1 97  ? 25.218  38.064 213.862 1.00 59.40  ? 116 GLU C CD     1 
ATOM   6524  O  OE1    . GLU C 1 97  ? 26.459  37.976 213.785 1.00 59.37  ? 116 GLU C OE1    1 
ATOM   6525  O  OE2    . GLU C 1 97  ? 24.621  38.438 214.886 1.00 98.86  ? 116 GLU C OE2    1 
ATOM   6526  H  H      . GLU C 1 97  ? 27.212  37.483 212.589 1.00 163.90 ? 116 GLU C H      1 
ATOM   6527  H  HA     . GLU C 1 97  ? 25.727  35.843 211.205 1.00 142.94 ? 116 GLU C HA     1 
ATOM   6528  H  HB2    . GLU C 1 97  ? 25.608  38.660 211.330 1.00 154.48 ? 116 GLU C HB2    1 
ATOM   6529  H  HB3    . GLU C 1 97  ? 24.498  37.785 210.614 1.00 154.48 ? 116 GLU C HB3    1 
ATOM   6530  H  HG2    . GLU C 1 97  ? 23.624  38.311 212.617 1.00 137.45 ? 116 GLU C HG2    1 
ATOM   6531  H  HG3    . GLU C 1 97  ? 24.069  36.793 212.759 1.00 137.45 ? 116 GLU C HG3    1 
ATOM   6532  N  N      . PHE C 1 98  ? 27.654  37.706 209.447 1.00 101.62 ? 117 PHE C N      1 
ATOM   6533  C  CA     . PHE C 1 98  ? 28.270  37.794 208.130 1.00 107.41 ? 117 PHE C CA     1 
ATOM   6534  C  C      . PHE C 1 98  ? 28.818  36.446 207.680 1.00 127.47 ? 117 PHE C C      1 
ATOM   6535  O  O      . PHE C 1 98  ? 28.785  36.135 206.487 1.00 151.85 ? 117 PHE C O      1 
ATOM   6536  C  CB     . PHE C 1 98  ? 29.373  38.852 208.129 1.00 111.34 ? 117 PHE C CB     1 
ATOM   6537  C  CG     . PHE C 1 98  ? 28.859  40.260 208.211 1.00 117.78 ? 117 PHE C CG     1 
ATOM   6538  C  CD1    . PHE C 1 98  ? 27.966  40.739 207.268 1.00 125.64 ? 117 PHE C CD1    1 
ATOM   6539  C  CD2    . PHE C 1 98  ? 29.277  41.110 209.223 1.00 141.69 ? 117 PHE C CD2    1 
ATOM   6540  C  CE1    . PHE C 1 98  ? 27.491  42.034 207.338 1.00 124.38 ? 117 PHE C CE1    1 
ATOM   6541  C  CE2    . PHE C 1 98  ? 28.808  42.407 209.298 1.00 127.52 ? 117 PHE C CE2    1 
ATOM   6542  C  CZ     . PHE C 1 98  ? 27.914  42.870 208.352 1.00 116.53 ? 117 PHE C CZ     1 
ATOM   6543  H  H      . PHE C 1 98  ? 27.936  38.282 210.020 1.00 121.94 ? 117 PHE C H      1 
ATOM   6544  H  HA     . PHE C 1 98  ? 27.596  38.069 207.489 1.00 128.89 ? 117 PHE C HA     1 
ATOM   6545  H  HB2    . PHE C 1 98  ? 29.951  38.702 208.894 1.00 133.61 ? 117 PHE C HB2    1 
ATOM   6546  H  HB3    . PHE C 1 98  ? 29.884  38.770 207.309 1.00 133.61 ? 117 PHE C HB3    1 
ATOM   6547  H  HD1    . PHE C 1 98  ? 27.677  40.180 206.583 1.00 150.77 ? 117 PHE C HD1    1 
ATOM   6548  H  HD2    . PHE C 1 98  ? 29.879  40.802 209.862 1.00 170.03 ? 117 PHE C HD2    1 
ATOM   6549  H  HE1    . PHE C 1 98  ? 26.890  42.344 206.700 1.00 149.26 ? 117 PHE C HE1    1 
ATOM   6550  H  HE2    . PHE C 1 98  ? 29.094  42.967 209.983 1.00 153.03 ? 117 PHE C HE2    1 
ATOM   6551  H  HZ     . PHE C 1 98  ? 27.596  43.743 208.400 1.00 139.84 ? 117 PHE C HZ     1 
ATOM   6552  N  N      . LEU C 1 99  ? 29.318  35.631 208.610 1.00 119.03 ? 118 LEU C N      1 
ATOM   6553  C  CA     . LEU C 1 99  ? 29.689  34.264 208.267 1.00 113.32 ? 118 LEU C CA     1 
ATOM   6554  C  C      . LEU C 1 99  ? 28.453  33.425 208.005 1.00 109.35 ? 118 LEU C C      1 
ATOM   6555  O  O      . LEU C 1 99  ? 28.430  32.611 207.075 1.00 111.53 ? 118 LEU C O      1 
ATOM   6556  C  CB     . LEU C 1 99  ? 30.509  33.623 209.389 1.00 105.52 ? 118 LEU C CB     1 
ATOM   6557  C  CG     . LEU C 1 99  ? 31.943  34.081 209.650 1.00 110.72 ? 118 LEU C CG     1 
ATOM   6558  C  CD1    . LEU C 1 99  ? 32.783  33.989 208.387 1.00 155.20 ? 118 LEU C CD1    1 
ATOM   6559  C  CD2    . LEU C 1 99  ? 31.947  35.479 210.212 1.00 104.82 ? 118 LEU C CD2    1 
ATOM   6560  H  H      . LEU C 1 99  ? 29.448  35.842 209.434 1.00 142.84 ? 118 LEU C H      1 
ATOM   6561  H  HA     . LEU C 1 99  ? 30.229  34.271 207.461 1.00 135.98 ? 118 LEU C HA     1 
ATOM   6562  H  HB2    . LEU C 1 99  ? 30.023  33.758 210.217 1.00 126.63 ? 118 LEU C HB2    1 
ATOM   6563  H  HB3    . LEU C 1 99  ? 30.554  32.671 209.207 1.00 126.63 ? 118 LEU C HB3    1 
ATOM   6564  H  HG     . LEU C 1 99  ? 32.342  33.495 210.313 1.00 132.86 ? 118 LEU C HG     1 
ATOM   6565  H  HD11   . LEU C 1 99  ? 33.685  34.286 208.585 1.00 186.24 ? 118 LEU C HD11   1 
ATOM   6566  H  HD12   . LEU C 1 99  ? 32.796  33.068 208.083 1.00 186.24 ? 118 LEU C HD12   1 
ATOM   6567  H  HD13   . LEU C 1 99  ? 32.389  34.557 207.705 1.00 186.24 ? 118 LEU C HD13   1 
ATOM   6568  H  HD21   . LEU C 1 99  ? 32.863  35.752 210.371 1.00 125.78 ? 118 LEU C HD21   1 
ATOM   6569  H  HD22   . LEU C 1 99  ? 31.529  36.077 209.572 1.00 125.78 ? 118 LEU C HD22   1 
ATOM   6570  H  HD23   . LEU C 1 99  ? 31.449  35.485 211.044 1.00 125.78 ? 118 LEU C HD23   1 
ATOM   6571  N  N      . LEU C 1 100 ? 27.416  33.605 208.824 1.00 135.79 ? 119 LEU C N      1 
ATOM   6572  C  CA     . LEU C 1 100 ? 26.251  32.740 208.710 1.00 139.24 ? 119 LEU C CA     1 
ATOM   6573  C  C      . LEU C 1 100 ? 25.636  32.800 207.319 1.00 106.20 ? 119 LEU C C      1 
ATOM   6574  O  O      . LEU C 1 100 ? 25.118  31.788 206.837 1.00 100.00 ? 119 LEU C O      1 
ATOM   6575  C  CB     . LEU C 1 100 ? 25.221  33.100 209.785 1.00 136.12 ? 119 LEU C CB     1 
ATOM   6576  C  CG     . LEU C 1 100 ? 25.601  32.720 211.226 1.00 124.64 ? 119 LEU C CG     1 
ATOM   6577  C  CD1    . LEU C 1 100 ? 24.493  33.105 212.203 1.00 101.15 ? 119 LEU C CD1    1 
ATOM   6578  C  CD2    . LEU C 1 100 ? 25.930  31.228 211.361 1.00 105.02 ? 119 LEU C CD2    1 
ATOM   6579  H  H      . LEU C 1 100 ? 27.365  34.206 209.437 1.00 162.95 ? 119 LEU C H      1 
ATOM   6580  H  HA     . LEU C 1 100 ? 26.530  31.824 208.867 1.00 167.08 ? 119 LEU C HA     1 
ATOM   6581  H  HB2    . LEU C 1 100 ? 25.081  34.059 209.765 1.00 163.35 ? 119 LEU C HB2    1 
ATOM   6582  H  HB3    . LEU C 1 100 ? 24.389  32.647 209.575 1.00 163.35 ? 119 LEU C HB3    1 
ATOM   6583  H  HG     . LEU C 1 100 ? 26.395  33.217 211.476 1.00 149.57 ? 119 LEU C HG     1 
ATOM   6584  H  HD11   . LEU C 1 100 ? 24.762  32.853 213.100 1.00 121.38 ? 119 LEU C HD11   1 
ATOM   6585  H  HD12   . LEU C 1 100 ? 24.350  34.063 212.157 1.00 121.38 ? 119 LEU C HD12   1 
ATOM   6586  H  HD13   . LEU C 1 100 ? 23.679  32.637 211.958 1.00 121.38 ? 119 LEU C HD13   1 
ATOM   6587  H  HD21   . LEU C 1 100 ? 26.162  31.038 212.283 1.00 126.03 ? 119 LEU C HD21   1 
ATOM   6588  H  HD22   . LEU C 1 100 ? 25.152  30.709 211.101 1.00 126.03 ? 119 LEU C HD22   1 
ATOM   6589  H  HD23   . LEU C 1 100 ? 26.678  31.016 210.781 1.00 126.03 ? 119 LEU C HD23   1 
ATOM   6590  N  N      . GLN C 1 101 ? 25.695  33.950 206.641 1.00 106.11 ? 120 GLN C N      1 
ATOM   6591  C  CA     . GLN C 1 101 ? 25.157  34.006 205.281 1.00 128.77 ? 120 GLN C CA     1 
ATOM   6592  C  C      . GLN C 1 101 ? 26.193  34.361 204.218 1.00 149.38 ? 120 GLN C C      1 
ATOM   6593  O  O      . GLN C 1 101 ? 25.823  34.542 203.052 1.00 140.63 ? 120 GLN C O      1 
ATOM   6594  C  CB     . GLN C 1 101 ? 23.978  34.979 205.196 1.00 140.43 ? 120 GLN C CB     1 
ATOM   6595  C  CG     . GLN C 1 101 ? 23.200  34.835 203.883 1.00 139.29 ? 120 GLN C CG     1 
ATOM   6596  C  CD     . GLN C 1 101 ? 21.719  35.121 204.026 1.00 138.45 ? 120 GLN C CD     1 
ATOM   6597  O  OE1    . GLN C 1 101 ? 21.316  36.040 204.740 1.00 134.71 ? 120 GLN C OE1    1 
ATOM   6598  N  NE2    . GLN C 1 101 ? 20.899  34.326 203.347 1.00 138.49 ? 120 GLN C NE2    1 
ATOM   6599  H  H      . GLN C 1 101 ? 26.029  34.686 206.934 1.00 127.33 ? 120 GLN C H      1 
ATOM   6600  H  HA     . GLN C 1 101 ? 24.815  33.126 205.059 1.00 154.52 ? 120 GLN C HA     1 
ATOM   6601  H  HB2    . GLN C 1 101 ? 23.367  34.803 205.929 1.00 168.52 ? 120 GLN C HB2    1 
ATOM   6602  H  HB3    . GLN C 1 101 ? 24.312  35.888 205.251 1.00 168.52 ? 120 GLN C HB3    1 
ATOM   6603  H  HG2    . GLN C 1 101 ? 23.563  35.458 203.234 1.00 167.14 ? 120 GLN C HG2    1 
ATOM   6604  H  HG3    . GLN C 1 101 ? 23.298  33.926 203.559 1.00 167.14 ? 120 GLN C HG3    1 
ATOM   6605  H  HE21   . GLN C 1 101 ? 21.218  33.692 202.862 1.00 166.19 ? 120 GLN C HE21   1 
ATOM   6606  H  HE22   . GLN C 1 101 ? 20.048  34.446 203.393 1.00 166.19 ? 120 GLN C HE22   1 
ATOM   6607  N  N      . ALA C 1 102 ? 27.477  34.444 204.566 1.00 146.23 ? 121 ALA C N      1 
ATOM   6608  C  CA     . ALA C 1 102 ? 28.499  34.626 203.541 1.00 150.62 ? 121 ALA C CA     1 
ATOM   6609  C  C      . ALA C 1 102 ? 28.958  33.296 202.957 1.00 158.41 ? 121 ALA C C      1 
ATOM   6610  O  O      . ALA C 1 102 ? 29.206  33.201 201.750 1.00 167.91 ? 121 ALA C O      1 
ATOM   6611  C  CB     . ALA C 1 102 ? 29.702  35.389 204.100 1.00 160.52 ? 121 ALA C CB     1 
ATOM   6612  H  H      . ALA C 1 102 ? 27.776  34.398 205.371 1.00 175.48 ? 121 ALA C H      1 
ATOM   6613  H  HA     . ALA C 1 102 ? 28.125  35.154 202.818 1.00 180.74 ? 121 ALA C HA     1 
ATOM   6614  H  HB1    . ALA C 1 102 ? 30.362  35.495 203.398 1.00 192.63 ? 121 ALA C HB1    1 
ATOM   6615  H  HB2    . ALA C 1 102 ? 29.406  36.259 204.412 1.00 192.63 ? 121 ALA C HB2    1 
ATOM   6616  H  HB3    . ALA C 1 102 ? 30.080  34.884 204.837 1.00 192.63 ? 121 ALA C HB3    1 
ATOM   6617  N  N      . LEU C 1 103 ? 29.071  32.266 203.788 1.00 146.19 ? 122 LEU C N      1 
ATOM   6618  C  CA     . LEU C 1 103 ? 29.435  30.946 203.296 1.00 142.18 ? 122 LEU C CA     1 
ATOM   6619  C  C      . LEU C 1 103 ? 28.332  30.408 202.395 1.00 146.20 ? 122 LEU C C      1 
ATOM   6620  O  O      . LEU C 1 103 ? 27.150  30.445 202.750 1.00 139.49 ? 122 LEU C O      1 
ATOM   6621  C  CB     . LEU C 1 103 ? 29.681  29.994 204.465 1.00 127.43 ? 122 LEU C CB     1 
ATOM   6622  H  H      . LEU C 1 103 ? 28.942  32.305 204.638 1.00 175.43 ? 122 LEU C H      1 
ATOM   6623  H  HA     . LEU C 1 103 ? 30.252  31.010 202.777 1.00 170.61 ? 122 LEU C HA     1 
ATOM   6624  N  N      . ASN C 1 104 ? 28.718  29.914 201.216 1.00 184.21 ? 123 ASN C N      1 
ATOM   6625  C  CA     . ASN C 1 104 ? 27.755  29.300 200.311 1.00 187.75 ? 123 ASN C CA     1 
ATOM   6626  C  C      . ASN C 1 104 ? 27.099  28.063 200.910 1.00 175.72 ? 123 ASN C C      1 
ATOM   6627  O  O      . ASN C 1 104 ? 26.102  27.584 200.357 1.00 171.49 ? 123 ASN C O      1 
ATOM   6628  C  CB     . ASN C 1 104 ? 28.440  28.932 198.993 1.00 172.40 ? 123 ASN C CB     1 
ATOM   6629  H  H      . ASN C 1 104 ? 29.526  29.924 200.923 1.00 221.05 ? 123 ASN C H      1 
ATOM   6630  H  HA     . ASN C 1 104 ? 27.056  29.942 200.114 1.00 225.30 ? 123 ASN C HA     1 
ATOM   6631  N  N      . GLY C 1 105 ? 27.635  27.536 202.009 1.00 143.71 ? 124 GLY C N      1 
ATOM   6632  C  CA     . GLY C 1 105 ? 27.031  26.421 202.709 1.00 146.82 ? 124 GLY C CA     1 
ATOM   6633  C  C      . GLY C 1 105 ? 26.852  26.721 204.183 1.00 148.02 ? 124 GLY C C      1 
ATOM   6634  O  O      . GLY C 1 105 ? 26.990  27.874 204.605 1.00 128.34 ? 124 GLY C O      1 
ATOM   6635  H  H      . GLY C 1 105 ? 28.363  27.817 202.371 1.00 172.45 ? 124 GLY C H      1 
ATOM   6636  H  HA2    . GLY C 1 105 ? 26.162  26.227 202.325 1.00 176.18 ? 124 GLY C HA2    1 
ATOM   6637  H  HA3    . GLY C 1 105 ? 27.593  25.635 202.618 1.00 176.18 ? 124 GLY C HA3    1 
ATOM   6638  N  N      . PHE C 1 106 ? 26.535  25.695 204.974 1.00 151.05 ? 125 PHE C N      1 
ATOM   6639  C  CA     . PHE C 1 106 ? 26.352  25.838 206.410 1.00 113.94 ? 125 PHE C CA     1 
ATOM   6640  C  C      . PHE C 1 106 ? 27.448  25.086 207.173 1.00 116.78 ? 125 PHE C C      1 
ATOM   6641  O  O      . PHE C 1 106 ? 28.528  24.814 206.630 1.00 169.81 ? 125 PHE C O      1 
ATOM   6642  C  CB     . PHE C 1 106 ? 24.942  25.376 206.786 1.00 123.86 ? 125 PHE C CB     1 
ATOM   6643  C  CG     . PHE C 1 106 ? 24.612  23.977 206.363 1.00 111.94 ? 125 PHE C CG     1 
ATOM   6644  C  CD1    . PHE C 1 106 ? 23.962  23.741 205.163 1.00 127.77 ? 125 PHE C CD1    1 
ATOM   6645  C  CD2    . PHE C 1 106 ? 24.905  22.908 207.186 1.00 99.60  ? 125 PHE C CD2    1 
ATOM   6646  C  CE1    . PHE C 1 106 ? 23.632  22.458 204.779 1.00 160.85 ? 125 PHE C CE1    1 
ATOM   6647  C  CE2    . PHE C 1 106 ? 24.578  21.624 206.816 1.00 107.20 ? 125 PHE C CE2    1 
ATOM   6648  C  CZ     . PHE C 1 106 ? 23.942  21.395 205.605 1.00 145.29 ? 125 PHE C CZ     1 
ATOM   6649  H  H      . PHE C 1 106 ? 26.418  24.892 204.691 1.00 181.26 ? 125 PHE C H      1 
ATOM   6650  H  HA     . PHE C 1 106 ? 26.425  26.778 206.640 1.00 136.73 ? 125 PHE C HA     1 
ATOM   6651  H  HB2    . PHE C 1 106 ? 24.848  25.421 207.751 1.00 148.64 ? 125 PHE C HB2    1 
ATOM   6652  H  HB3    . PHE C 1 106 ? 24.299  25.969 206.368 1.00 148.64 ? 125 PHE C HB3    1 
ATOM   6653  H  HD1    . PHE C 1 106 ? 23.753  24.455 204.605 1.00 153.32 ? 125 PHE C HD1    1 
ATOM   6654  H  HD2    . PHE C 1 106 ? 25.331  23.058 207.999 1.00 119.52 ? 125 PHE C HD2    1 
ATOM   6655  H  HE1    . PHE C 1 106 ? 23.205  22.308 203.967 1.00 193.02 ? 125 PHE C HE1    1 
ATOM   6656  H  HE2    . PHE C 1 106 ? 24.790  20.910 207.374 1.00 128.64 ? 125 PHE C HE2    1 
ATOM   6657  H  HZ     . PHE C 1 106 ? 23.724  20.527 205.350 1.00 174.34 ? 125 PHE C HZ     1 
ATOM   6658  N  N      . VAL C 1 107 ? 27.178  24.771 208.439 1.00 99.99  ? 126 VAL C N      1 
ATOM   6659  C  CA     . VAL C 1 107 ? 28.140  24.100 209.302 1.00 121.35 ? 126 VAL C CA     1 
ATOM   6660  C  C      . VAL C 1 107 ? 27.454  22.938 210.004 1.00 122.15 ? 126 VAL C C      1 
ATOM   6661  O  O      . VAL C 1 107 ? 26.250  22.977 210.277 1.00 141.14 ? 126 VAL C O      1 
ATOM   6662  C  CB     . VAL C 1 107 ? 28.752  25.077 210.334 1.00 100.94 ? 126 VAL C CB     1 
ATOM   6663  C  CG1    . VAL C 1 107 ? 29.682  24.343 211.294 1.00 118.79 ? 126 VAL C CG1    1 
ATOM   6664  C  CG2    . VAL C 1 107 ? 29.500  26.192 209.621 1.00 111.25 ? 126 VAL C CG2    1 
ATOM   6665  H  H      . VAL C 1 107 ? 26.429  24.940 208.825 1.00 119.99 ? 126 VAL C H      1 
ATOM   6666  H  HA     . VAL C 1 107 ? 28.861  23.743 208.759 1.00 145.62 ? 126 VAL C HA     1 
ATOM   6667  H  HB     . VAL C 1 107 ? 28.037  25.478 210.854 1.00 121.13 ? 126 VAL C HB     1 
ATOM   6668  H  HG11   . VAL C 1 107 ? 30.048  24.980 211.927 1.00 142.54 ? 126 VAL C HG11   1 
ATOM   6669  H  HG12   . VAL C 1 107 ? 29.175  23.663 211.765 1.00 142.54 ? 126 VAL C HG12   1 
ATOM   6670  H  HG13   . VAL C 1 107 ? 30.398  23.931 210.786 1.00 142.54 ? 126 VAL C HG13   1 
ATOM   6671  H  HG21   . VAL C 1 107 ? 29.876  26.793 210.284 1.00 133.50 ? 126 VAL C HG21   1 
ATOM   6672  H  HG22   . VAL C 1 107 ? 30.210  25.803 209.087 1.00 133.50 ? 126 VAL C HG22   1 
ATOM   6673  H  HG23   . VAL C 1 107 ? 28.881  26.673 209.051 1.00 133.50 ? 126 VAL C HG23   1 
ATOM   6674  N  N      . LEU C 1 108 ? 28.227  21.892 210.291 1.00 107.11 ? 127 LEU C N      1 
ATOM   6675  C  CA     . LEU C 1 108 ? 27.712  20.791 211.090 1.00 105.03 ? 127 LEU C CA     1 
ATOM   6676  C  C      . LEU C 1 108 ? 28.839  20.204 211.923 1.00 116.90 ? 127 LEU C C      1 
ATOM   6677  O  O      . LEU C 1 108 ? 30.003  20.201 211.511 1.00 146.35 ? 127 LEU C O      1 
ATOM   6678  C  CB     . LEU C 1 108 ? 27.077  19.693 210.227 1.00 101.61 ? 127 LEU C CB     1 
ATOM   6679  C  CG     . LEU C 1 108 ? 25.618  19.889 209.808 1.00 113.24 ? 127 LEU C CG     1 
ATOM   6680  C  CD1    . LEU C 1 108 ? 25.211  18.802 208.832 1.00 111.88 ? 127 LEU C CD1    1 
ATOM   6681  C  CD2    . LEU C 1 108 ? 24.689  19.886 211.012 1.00 137.34 ? 127 LEU C CD2    1 
ATOM   6682  H  H      . LEU C 1 108 ? 29.044  21.800 210.037 1.00 128.53 ? 127 LEU C H      1 
ATOM   6683  H  HA     . LEU C 1 108 ? 27.034  21.129 211.696 1.00 126.03 ? 127 LEU C HA     1 
ATOM   6684  H  HB2    . LEU C 1 108 ? 27.599  19.610 209.413 1.00 121.93 ? 127 LEU C HB2    1 
ATOM   6685  H  HB3    . LEU C 1 108 ? 27.122  18.859 210.720 1.00 121.93 ? 127 LEU C HB3    1 
ATOM   6686  H  HG     . LEU C 1 108 ? 25.529  20.745 209.360 1.00 135.89 ? 127 LEU C HG     1 
ATOM   6687  H  HD11   . LEU C 1 108 ? 24.286  18.939 208.575 1.00 134.26 ? 127 LEU C HD11   1 
ATOM   6688  H  HD12   . LEU C 1 108 ? 25.782  18.850 208.050 1.00 134.26 ? 127 LEU C HD12   1 
ATOM   6689  H  HD13   . LEU C 1 108 ? 25.311  17.938 209.263 1.00 134.26 ? 127 LEU C HD13   1 
ATOM   6690  H  HD21   . LEU C 1 108 ? 23.777  20.012 210.707 1.00 164.80 ? 127 LEU C HD21   1 
ATOM   6691  H  HD22   . LEU C 1 108 ? 24.770  19.035 211.470 1.00 164.80 ? 127 LEU C HD22   1 
ATOM   6692  H  HD23   . LEU C 1 108 ? 24.942  20.609 211.607 1.00 164.80 ? 127 LEU C HD23   1 
ATOM   6693  N  N      . VAL C 1 109 ? 28.477  19.708 213.103 1.00 106.56 ? 128 VAL C N      1 
ATOM   6694  C  CA     . VAL C 1 109 ? 29.428  19.049 213.991 1.00 99.17  ? 128 VAL C CA     1 
ATOM   6695  C  C      . VAL C 1 109 ? 28.763  17.799 214.544 1.00 88.38  ? 128 VAL C C      1 
ATOM   6696  O  O      . VAL C 1 109 ? 27.723  17.893 215.208 1.00 108.51 ? 128 VAL C O      1 
ATOM   6697  C  CB     . VAL C 1 109 ? 29.885  19.962 215.139 1.00 97.93  ? 128 VAL C CB     1 
ATOM   6698  C  CG1    . VAL C 1 109 ? 30.896  19.238 216.018 1.00 127.77 ? 128 VAL C CG1    1 
ATOM   6699  C  CG2    . VAL C 1 109 ? 30.470  21.255 214.586 1.00 98.55  ? 128 VAL C CG2    1 
ATOM   6700  H  H      . VAL C 1 109 ? 27.676  19.741 213.416 1.00 127.87 ? 128 VAL C H      1 
ATOM   6701  H  HA     . VAL C 1 109 ? 30.210  18.781 213.483 1.00 119.01 ? 128 VAL C HA     1 
ATOM   6702  H  HB     . VAL C 1 109 ? 29.118  20.190 215.688 1.00 117.51 ? 128 VAL C HB     1 
ATOM   6703  H  HG11   . VAL C 1 109 ? 31.172  19.830 216.735 1.00 153.32 ? 128 VAL C HG11   1 
ATOM   6704  H  HG12   . VAL C 1 109 ? 30.481  18.442 216.386 1.00 153.32 ? 128 VAL C HG12   1 
ATOM   6705  H  HG13   . VAL C 1 109 ? 31.664  18.992 215.479 1.00 153.32 ? 128 VAL C HG13   1 
ATOM   6706  H  HG21   . VAL C 1 109 ? 30.751  21.816 215.326 1.00 118.27 ? 128 VAL C HG21   1 
ATOM   6707  H  HG22   . VAL C 1 109 ? 31.231  21.042 214.024 1.00 118.27 ? 128 VAL C HG22   1 
ATOM   6708  H  HG23   . VAL C 1 109 ? 29.791  21.711 214.065 1.00 118.27 ? 128 VAL C HG23   1 
ATOM   6709  N  N      . VAL C 1 110 ? 29.374  16.637 214.292 1.00 108.36 ? 129 VAL C N      1 
ATOM   6710  C  CA     . VAL C 1 110 ? 28.815  15.343 214.674 1.00 120.81 ? 129 VAL C CA     1 
ATOM   6711  C  C      . VAL C 1 110 ? 29.850  14.575 215.485 1.00 120.72 ? 129 VAL C C      1 
ATOM   6712  O  O      . VAL C 1 110 ? 31.051  14.636 215.197 1.00 112.60 ? 129 VAL C O      1 
ATOM   6713  C  CB     . VAL C 1 110 ? 28.385  14.516 213.442 1.00 101.54 ? 129 VAL C CB     1 
ATOM   6714  C  CG1    . VAL C 1 110 ? 27.747  13.196 213.874 1.00 114.99 ? 129 VAL C CG1    1 
ATOM   6715  C  CG2    . VAL C 1 110 ? 27.424  15.307 212.572 1.00 100.95 ? 129 VAL C CG2    1 
ATOM   6716  H  H      . VAL C 1 110 ? 30.132  16.576 213.890 1.00 130.03 ? 129 VAL C H      1 
ATOM   6717  H  HA     . VAL C 1 110 ? 28.035  15.484 215.233 1.00 144.97 ? 129 VAL C HA     1 
ATOM   6718  H  HB     . VAL C 1 110 ? 29.169  14.309 212.911 1.00 121.85 ? 129 VAL C HB     1 
ATOM   6719  H  HG11   . VAL C 1 110 ? 27.486  12.698 213.083 1.00 137.99 ? 129 VAL C HG11   1 
ATOM   6720  H  HG12   . VAL C 1 110 ? 28.393  12.687 214.388 1.00 137.99 ? 129 VAL C HG12   1 
ATOM   6721  H  HG13   . VAL C 1 110 ? 26.966  13.386 214.418 1.00 137.99 ? 129 VAL C HG13   1 
ATOM   6722  H  HG21   . VAL C 1 110 ? 27.171  14.766 211.809 1.00 121.13 ? 129 VAL C HG21   1 
ATOM   6723  H  HG22   . VAL C 1 110 ? 26.638  15.532 213.094 1.00 121.13 ? 129 VAL C HG22   1 
ATOM   6724  H  HG23   . VAL C 1 110 ? 27.866  16.117 212.272 1.00 121.13 ? 129 VAL C HG23   1 
ATOM   6725  N  N      . THR C 1 111 ? 29.380  13.834 216.486 1.00 110.81 ? 130 THR C N      1 
ATOM   6726  C  CA     . THR C 1 111 ? 30.235  13.028 217.345 1.00 107.50 ? 130 THR C CA     1 
ATOM   6727  C  C      . THR C 1 111 ? 30.269  11.580 216.863 1.00 112.10 ? 130 THR C C      1 
ATOM   6728  O  O      . THR C 1 111 ? 29.531  11.175 215.961 1.00 106.11 ? 130 THR C O      1 
ATOM   6729  C  CB     . THR C 1 111 ? 29.750  13.082 218.799 1.00 110.49 ? 130 THR C CB     1 
ATOM   6730  O  OG1    . THR C 1 111 ? 28.408  12.585 218.880 1.00 109.31 ? 130 THR C OG1    1 
ATOM   6731  C  CG2    . THR C 1 111 ? 29.792  14.504 219.330 1.00 94.75  ? 130 THR C CG2    1 
ATOM   6732  H  H      . THR C 1 111 ? 28.546  13.783 216.690 1.00 132.97 ? 130 THR C H      1 
ATOM   6733  H  HA     . THR C 1 111 ? 31.139  13.379 217.314 1.00 128.99 ? 130 THR C HA     1 
ATOM   6734  H  HB     . THR C 1 111 ? 30.329  12.533 219.351 1.00 132.59 ? 130 THR C HB     1 
ATOM   6735  H  HG1    . THR C 1 111 ? 28.138  12.614 219.675 1.00 131.18 ? 130 THR C HG1    1 
ATOM   6736  H  HG21   . THR C 1 111 ? 29.483  14.523 220.249 1.00 113.70 ? 130 THR C HG21   1 
ATOM   6737  H  HG22   . THR C 1 111 ? 30.700  14.843 219.295 1.00 113.70 ? 130 THR C HG22   1 
ATOM   6738  H  HG23   . THR C 1 111 ? 29.221  15.075 218.793 1.00 113.70 ? 130 THR C HG23   1 
ATOM   6739  N  N      . THR C 1 112 ? 31.145  10.793 217.494 1.00 131.85 ? 131 THR C N      1 
ATOM   6740  C  CA     . THR C 1 112 ? 31.262  9.381  217.146 1.00 140.72 ? 131 THR C CA     1 
ATOM   6741  C  C      . THR C 1 112 ? 29.940  8.647  217.319 1.00 152.92 ? 131 THR C C      1 
ATOM   6742  O  O      . THR C 1 112 ? 29.687  7.654  216.626 1.00 162.76 ? 131 THR C O      1 
ATOM   6743  C  CB     . THR C 1 112 ? 32.342  8.715  217.999 1.00 152.08 ? 131 THR C CB     1 
ATOM   6744  O  OG1    . THR C 1 112 ? 32.125  9.026  219.383 1.00 127.75 ? 131 THR C OG1    1 
ATOM   6745  C  CG2    . THR C 1 112 ? 33.726  9.187  217.576 1.00 146.43 ? 131 THR C CG2    1 
ATOM   6746  H  H      . THR C 1 112 ? 31.676  11.051 218.119 1.00 158.21 ? 131 THR C H      1 
ATOM   6747  H  HA     . THR C 1 112 ? 31.527  9.306  216.215 1.00 168.86 ? 131 THR C HA     1 
ATOM   6748  H  HB     . THR C 1 112 ? 32.299  7.754  217.877 1.00 182.49 ? 131 THR C HB     1 
ATOM   6749  H  HG1    . THR C 1 112 ? 32.717  8.662  219.856 1.00 153.30 ? 131 THR C HG1    1 
ATOM   6750  H  HG21   . THR C 1 112 ? 34.403  8.759  218.123 1.00 175.72 ? 131 THR C HG21   1 
ATOM   6751  H  HG22   . THR C 1 112 ? 33.883  8.960  216.646 1.00 175.72 ? 131 THR C HG22   1 
ATOM   6752  H  HG23   . THR C 1 112 ? 33.795  10.148 217.682 1.00 175.72 ? 131 THR C HG23   1 
ATOM   6753  N  N      . ASP C 1 113 ? 29.090  9.110  218.233 1.00 113.53 ? 132 ASP C N      1 
ATOM   6754  C  CA     . ASP C 1 113 ? 27.791  8.494  218.464 1.00 95.92  ? 132 ASP C CA     1 
ATOM   6755  C  C      . ASP C 1 113 ? 26.759  8.870  217.408 1.00 120.52 ? 132 ASP C C      1 
ATOM   6756  O  O      . ASP C 1 113 ? 25.573  8.579  217.596 1.00 131.75 ? 132 ASP C O      1 
ATOM   6757  C  CB     . ASP C 1 113 ? 27.272  8.880  219.852 1.00 121.78 ? 132 ASP C CB     1 
ATOM   6758  C  CG     . ASP C 1 113 ? 28.161  8.372  220.968 1.00 128.04 ? 132 ASP C CG     1 
ATOM   6759  O  OD1    . ASP C 1 113 ? 29.170  7.699  220.666 1.00 116.86 ? 132 ASP C OD1    1 
ATOM   6760  O  OD2    . ASP C 1 113 ? 27.847  8.644  222.147 1.00 99.71  ? 132 ASP C OD2    1 
ATOM   6761  H  H      . ASP C 1 113 ? 29.246  9.789  218.736 1.00 136.24 ? 132 ASP C H      1 
ATOM   6762  H  HA     . ASP C 1 113 ? 27.896  7.530  218.445 1.00 115.10 ? 132 ASP C HA     1 
ATOM   6763  H  HB2    . ASP C 1 113 ? 27.232  9.847  219.917 1.00 146.14 ? 132 ASP C HB2    1 
ATOM   6764  H  HB3    . ASP C 1 113 ? 26.388  8.502  219.976 1.00 146.14 ? 132 ASP C HB3    1 
ATOM   6765  N  N      . ALA C 1 114 ? 27.174  9.504  216.310 1.00 112.52 ? 133 ALA C N      1 
ATOM   6766  C  CA     . ALA C 1 114 ? 26.255  9.917  215.250 1.00 102.87 ? 133 ALA C CA     1 
ATOM   6767  C  C      . ALA C 1 114 ? 25.198  10.884 215.774 1.00 135.61 ? 133 ALA C C      1 
ATOM   6768  O  O      . ALA C 1 114 ? 24.090  10.964 215.236 1.00 98.80  ? 133 ALA C O      1 
ATOM   6769  C  CB     . ALA C 1 114 ? 25.589  8.708  214.588 1.00 115.24 ? 133 ALA C CB     1 
ATOM   6770  H  H      . ALA C 1 114 ? 27.994  9.708  216.154 1.00 135.03 ? 133 ALA C H      1 
ATOM   6771  H  HA     . ALA C 1 114 ? 26.763  10.382 214.567 1.00 123.44 ? 133 ALA C HA     1 
ATOM   6772  H  HB1    . ALA C 1 114 ? 24.989  9.020  213.893 1.00 138.28 ? 133 ALA C HB1    1 
ATOM   6773  H  HB2    . ALA C 1 114 ? 26.276  8.141  214.203 1.00 138.28 ? 133 ALA C HB2    1 
ATOM   6774  H  HB3    . ALA C 1 114 ? 25.091  8.215  215.259 1.00 138.28 ? 133 ALA C HB3    1 
ATOM   6775  N  N      . LEU C 1 115 ? 25.528  11.611 216.839 1.00 160.47 ? 134 LEU C N      1 
ATOM   6776  C  CA     . LEU C 1 115 ? 24.668  12.655 217.376 1.00 123.78 ? 134 LEU C CA     1 
ATOM   6777  C  C      . LEU C 1 115 ? 25.126  13.998 216.832 1.00 110.16 ? 134 LEU C C      1 
ATOM   6778  O  O      . LEU C 1 115 ? 26.319  14.317 216.878 1.00 83.37  ? 134 LEU C O      1 
ATOM   6779  C  CB     . LEU C 1 115 ? 24.705  12.678 218.906 1.00 67.73  ? 134 LEU C CB     1 
ATOM   6780  C  CG     . LEU C 1 115 ? 24.193  11.441 219.641 1.00 84.73  ? 134 LEU C CG     1 
ATOM   6781  C  CD1    . LEU C 1 115 ? 24.327  11.634 221.148 1.00 104.00 ? 134 LEU C CD1    1 
ATOM   6782  C  CD2    . LEU C 1 115 ? 22.752  11.148 219.257 1.00 113.69 ? 134 LEU C CD2    1 
ATOM   6783  H  H      . LEU C 1 115 ? 26.262  11.513 217.275 1.00 192.57 ? 134 LEU C H      1 
ATOM   6784  H  HA     . LEU C 1 115 ? 23.753  12.501 217.091 1.00 148.54 ? 134 LEU C HA     1 
ATOM   6785  H  HB2    . LEU C 1 115 ? 25.625  12.812 219.182 1.00 81.27  ? 134 LEU C HB2    1 
ATOM   6786  H  HB3    . LEU C 1 115 ? 24.170  13.429 219.207 1.00 81.27  ? 134 LEU C HB3    1 
ATOM   6787  H  HG     . LEU C 1 115 ? 24.733  10.677 219.387 1.00 101.68 ? 134 LEU C HG     1 
ATOM   6788  H  HD11   . LEU C 1 115 ? 23.998  10.840 221.598 1.00 124.80 ? 134 LEU C HD11   1 
ATOM   6789  H  HD12   . LEU C 1 115 ? 25.261  11.775 221.366 1.00 124.80 ? 134 LEU C HD12   1 
ATOM   6790  H  HD13   . LEU C 1 115 ? 23.804  12.406 221.415 1.00 124.80 ? 134 LEU C HD13   1 
ATOM   6791  H  HD21   . LEU C 1 115 ? 22.452  10.360 219.737 1.00 136.43 ? 134 LEU C HD21   1 
ATOM   6792  H  HD22   . LEU C 1 115 ? 22.201  11.910 219.495 1.00 136.43 ? 134 LEU C HD22   1 
ATOM   6793  H  HD23   . LEU C 1 115 ? 22.705  10.991 218.301 1.00 136.43 ? 134 LEU C HD23   1 
ATOM   6794  N  N      . VAL C 1 116 ? 24.182  14.776 216.304 1.00 82.82  ? 135 VAL C N      1 
ATOM   6795  C  CA     . VAL C 1 116 ? 24.488  16.151 215.935 1.00 75.99  ? 135 VAL C CA     1 
ATOM   6796  C  C      . VAL C 1 116 ? 24.973  16.879 217.178 1.00 78.52  ? 135 VAL C C      1 
ATOM   6797  O  O      . VAL C 1 116 ? 24.290  16.900 218.209 1.00 133.75 ? 135 VAL C O      1 
ATOM   6798  C  CB     . VAL C 1 116 ? 23.261  16.837 215.327 1.00 83.12  ? 135 VAL C CB     1 
ATOM   6799  C  CG1    . VAL C 1 116 ? 23.592  18.281 214.953 1.00 98.33  ? 135 VAL C CG1    1 
ATOM   6800  C  CG2    . VAL C 1 116 ? 22.762  16.072 214.111 1.00 94.69  ? 135 VAL C CG2    1 
ATOM   6801  H  H      . VAL C 1 116 ? 23.370  14.534 216.153 1.00 99.39  ? 135 VAL C H      1 
ATOM   6802  H  HA     . VAL C 1 116 ? 25.201  16.157 215.278 1.00 91.19  ? 135 VAL C HA     1 
ATOM   6803  H  HB     . VAL C 1 116 ? 22.549  16.853 215.985 1.00 99.74  ? 135 VAL C HB     1 
ATOM   6804  H  HG11   . VAL C 1 116 ? 22.803  18.696 214.571 1.00 117.99 ? 135 VAL C HG11   1 
ATOM   6805  H  HG12   . VAL C 1 116 ? 23.863  18.759 215.753 1.00 117.99 ? 135 VAL C HG12   1 
ATOM   6806  H  HG13   . VAL C 1 116 ? 24.314  18.282 214.306 1.00 117.99 ? 135 VAL C HG13   1 
ATOM   6807  H  HG21   . VAL C 1 116 ? 21.987  16.529 213.748 1.00 113.63 ? 135 VAL C HG21   1 
ATOM   6808  H  HG22   . VAL C 1 116 ? 23.469  16.039 213.447 1.00 113.63 ? 135 VAL C HG22   1 
ATOM   6809  H  HG23   . VAL C 1 116 ? 22.520  15.173 214.382 1.00 113.63 ? 135 VAL C HG23   1 
ATOM   6810  N  N      . PHE C 1 117 ? 26.170  17.458 217.099 1.00 83.49  ? 136 PHE C N      1 
ATOM   6811  C  CA     . PHE C 1 117 ? 26.670  18.312 218.167 1.00 72.23  ? 136 PHE C CA     1 
ATOM   6812  C  C      . PHE C 1 117 ? 26.498  19.787 217.861 1.00 71.13  ? 136 PHE C C      1 
ATOM   6813  O  O      . PHE C 1 117 ? 26.529  20.600 218.791 1.00 94.84  ? 136 PHE C O      1 
ATOM   6814  C  CB     . PHE C 1 117 ? 28.151  18.033 218.443 1.00 108.70 ? 136 PHE C CB     1 
ATOM   6815  C  CG     . PHE C 1 117 ? 28.663  18.691 219.695 1.00 111.44 ? 136 PHE C CG     1 
ATOM   6816  C  CD1    . PHE C 1 117 ? 28.493  18.084 220.931 1.00 124.92 ? 136 PHE C CD1    1 
ATOM   6817  C  CD2    . PHE C 1 117 ? 29.309  19.914 219.638 1.00 93.01  ? 136 PHE C CD2    1 
ATOM   6818  C  CE1    . PHE C 1 117 ? 28.962  18.685 222.086 1.00 133.10 ? 136 PHE C CE1    1 
ATOM   6819  C  CE2    . PHE C 1 117 ? 29.779  20.521 220.791 1.00 105.14 ? 136 PHE C CE2    1 
ATOM   6820  C  CZ     . PHE C 1 117 ? 29.605  19.906 222.015 1.00 128.84 ? 136 PHE C CZ     1 
ATOM   6821  H  H      . PHE C 1 117 ? 26.711  17.370 216.436 1.00 100.19 ? 136 PHE C H      1 
ATOM   6822  H  HA     . PHE C 1 117 ? 26.175  18.118 218.979 1.00 86.67  ? 136 PHE C HA     1 
ATOM   6823  H  HB2    . PHE C 1 117 ? 28.277  17.076 218.537 1.00 130.44 ? 136 PHE C HB2    1 
ATOM   6824  H  HB3    . PHE C 1 117 ? 28.676  18.364 217.698 1.00 130.44 ? 136 PHE C HB3    1 
ATOM   6825  H  HD1    . PHE C 1 117 ? 28.061  17.263 220.984 1.00 149.90 ? 136 PHE C HD1    1 
ATOM   6826  H  HD2    . PHE C 1 117 ? 29.429  20.333 218.816 1.00 111.61 ? 136 PHE C HD2    1 
ATOM   6827  H  HE1    . PHE C 1 117 ? 28.842  18.268 222.909 1.00 159.72 ? 136 PHE C HE1    1 
ATOM   6828  H  HE2    . PHE C 1 117 ? 30.213  21.342 220.741 1.00 126.17 ? 136 PHE C HE2    1 
ATOM   6829  H  HZ     . PHE C 1 117 ? 29.921  20.312 222.790 1.00 154.61 ? 136 PHE C HZ     1 
ATOM   6830  N  N      . TYR C 1 118 ? 26.322  20.155 216.595 1.00 114.06 ? 137 TYR C N      1 
ATOM   6831  C  CA     . TYR C 1 118 ? 25.969  21.538 216.300 1.00 90.12  ? 137 TYR C CA     1 
ATOM   6832  C  C      . TYR C 1 118 ? 25.481  21.658 214.867 1.00 84.52  ? 137 TYR C C      1 
ATOM   6833  O  O      . TYR C 1 118 ? 25.942  20.942 213.972 1.00 89.67  ? 137 TYR C O      1 
ATOM   6834  C  CB     . TYR C 1 118 ? 27.150  22.491 216.521 1.00 139.61 ? 137 TYR C CB     1 
ATOM   6835  C  CG     . TYR C 1 118 ? 26.868  23.908 216.055 1.00 142.16 ? 137 TYR C CG     1 
ATOM   6836  C  CD1    . TYR C 1 118 ? 27.163  24.309 214.758 1.00 152.58 ? 137 TYR C CD1    1 
ATOM   6837  C  CD2    . TYR C 1 118 ? 26.294  24.838 216.908 1.00 106.14 ? 137 TYR C CD2    1 
ATOM   6838  C  CE1    . TYR C 1 118 ? 26.900  25.597 214.329 1.00 159.09 ? 137 TYR C CE1    1 
ATOM   6839  C  CE2    . TYR C 1 118 ? 26.030  26.128 216.486 1.00 91.20  ? 137 TYR C CE2    1 
ATOM   6840  C  CZ     . TYR C 1 118 ? 26.335  26.501 215.200 1.00 128.98 ? 137 TYR C CZ     1 
ATOM   6841  O  OH     . TYR C 1 118 ? 26.067  27.786 214.791 1.00 139.63 ? 137 TYR C OH     1 
ATOM   6842  H  H      . TYR C 1 118 ? 26.398  19.642 215.909 1.00 136.87 ? 137 TYR C H      1 
ATOM   6843  H  HA     . TYR C 1 118 ? 25.247  21.812 216.888 1.00 108.14 ? 137 TYR C HA     1 
ATOM   6844  H  HB2    . TYR C 1 118 ? 27.355  22.524 217.469 1.00 167.53 ? 137 TYR C HB2    1 
ATOM   6845  H  HB3    . TYR C 1 118 ? 27.917  22.161 216.028 1.00 167.53 ? 137 TYR C HB3    1 
ATOM   6846  H  HD1    . TYR C 1 118 ? 27.546  23.700 214.168 1.00 183.10 ? 137 TYR C HD1    1 
ATOM   6847  H  HD2    . TYR C 1 118 ? 26.086  24.591 217.780 1.00 127.37 ? 137 TYR C HD2    1 
ATOM   6848  H  HE1    . TYR C 1 118 ? 27.106  25.851 213.459 1.00 190.91 ? 137 TYR C HE1    1 
ATOM   6849  H  HE2    . TYR C 1 118 ? 25.647  26.741 217.071 1.00 109.44 ? 137 TYR C HE2    1 
ATOM   6850  H  HH     . TYR C 1 118 ? 25.725  28.223 215.422 1.00 167.55 ? 137 TYR C HH     1 
ATOM   6851  N  N      . ALA C 1 119 ? 24.549  22.586 214.672 1.00 93.61  ? 138 ALA C N      1 
ATOM   6852  C  CA     . ALA C 1 119 ? 24.119  23.025 213.357 1.00 97.66  ? 138 ALA C CA     1 
ATOM   6853  C  C      . ALA C 1 119 ? 23.915  24.530 213.406 1.00 93.07  ? 138 ALA C C      1 
ATOM   6854  O  O      . ALA C 1 119 ? 23.357  25.055 214.375 1.00 97.81  ? 138 ALA C O      1 
ATOM   6855  C  CB     . ALA C 1 119 ? 22.821  22.336 212.925 1.00 152.28 ? 138 ALA C CB     1 
ATOM   6856  H  H      . ALA C 1 119 ? 24.140  22.988 215.313 1.00 112.33 ? 138 ALA C H      1 
ATOM   6857  H  HA     . ALA C 1 119 ? 24.809  22.826 212.705 1.00 117.19 ? 138 ALA C HA     1 
ATOM   6858  H  HB1    . ALA C 1 119 ? 22.572  22.658 212.044 1.00 182.74 ? 138 ALA C HB1    1 
ATOM   6859  H  HB2    . ALA C 1 119 ? 22.967  21.377 212.898 1.00 182.74 ? 138 ALA C HB2    1 
ATOM   6860  H  HB3    . ALA C 1 119 ? 22.124  22.547 213.564 1.00 182.74 ? 138 ALA C HB3    1 
ATOM   6861  N  N      . SER C 1 120 ? 24.384  25.223 212.373 1.00 97.02  ? 139 SER C N      1 
ATOM   6862  C  CA     . SER C 1 120 ? 24.101  26.642 212.252 1.00 84.12  ? 139 SER C CA     1 
ATOM   6863  C  C      . SER C 1 120 ? 22.627  26.851 211.915 1.00 82.41  ? 139 SER C C      1 
ATOM   6864  O  O      . SER C 1 120 ? 21.914  25.929 211.512 1.00 104.42 ? 139 SER C O      1 
ATOM   6865  C  CB     . SER C 1 120 ? 24.979  27.271 211.174 1.00 140.02 ? 139 SER C CB     1 
ATOM   6866  O  OG     . SER C 1 120 ? 24.497  26.937 209.887 1.00 149.87 ? 139 SER C OG     1 
ATOM   6867  H  H      . SER C 1 120 ? 24.862  24.897 211.738 1.00 116.42 ? 139 SER C H      1 
ATOM   6868  H  HA     . SER C 1 120 ? 24.289  27.082 213.096 1.00 100.94 ? 139 SER C HA     1 
ATOM   6869  H  HB2    . SER C 1 120 ? 24.966  28.235 211.278 1.00 168.02 ? 139 SER C HB2    1 
ATOM   6870  H  HB3    . SER C 1 120 ? 25.885  26.938 211.270 1.00 168.02 ? 139 SER C HB3    1 
ATOM   6871  H  HG     . SER C 1 120 ? 24.984  27.285 209.298 1.00 179.84 ? 139 SER C HG     1 
ATOM   6872  N  N      . SER C 1 121 ? 22.164  28.091 212.081 1.00 109.14 ? 140 SER C N      1 
ATOM   6873  C  CA     . SER C 1 121 ? 20.791  28.407 211.709 1.00 105.51 ? 140 SER C CA     1 
ATOM   6874  C  C      . SER C 1 121 ? 20.542  28.205 210.222 1.00 87.30  ? 140 SER C C      1 
ATOM   6875  O  O      . SER C 1 121 ? 19.384  28.070 209.810 1.00 80.29  ? 140 SER C O      1 
ATOM   6876  C  CB     . SER C 1 121 ? 20.464  29.844 212.103 1.00 104.93 ? 140 SER C CB     1 
ATOM   6877  O  OG     . SER C 1 121 ? 21.497  30.723 211.697 1.00 93.00  ? 140 SER C OG     1 
ATOM   6878  H  H      . SER C 1 121 ? 22.615  28.750 212.399 1.00 130.97 ? 140 SER C H      1 
ATOM   6879  H  HA     . SER C 1 121 ? 20.191  27.820 212.195 1.00 126.61 ? 140 SER C HA     1 
ATOM   6880  H  HB2    . SER C 1 121 ? 19.636  30.109 211.672 1.00 125.92 ? 140 SER C HB2    1 
ATOM   6881  H  HB3    . SER C 1 121 ? 20.368  29.894 213.067 1.00 125.92 ? 140 SER C HB3    1 
ATOM   6882  H  HG     . SER C 1 121 ? 21.308  31.510 211.918 1.00 111.60 ? 140 SER C HG     1 
ATOM   6883  N  N      . THR C 1 122 ? 21.602  28.149 209.413 1.00 132.10 ? 141 THR C N      1 
ATOM   6884  C  CA     . THR C 1 122 ? 21.459  28.135 207.964 1.00 124.87 ? 141 THR C CA     1 
ATOM   6885  C  C      . THR C 1 122 ? 20.776  26.876 207.446 1.00 95.34  ? 141 THR C C      1 
ATOM   6886  O  O      . THR C 1 122 ? 20.270  26.894 206.318 1.00 103.60 ? 141 THR C O      1 
ATOM   6887  C  CB     . THR C 1 122 ? 22.838  28.259 207.330 1.00 98.89  ? 141 THR C CB     1 
ATOM   6888  O  OG1    . THR C 1 122 ? 23.769  27.543 208.142 1.00 103.32 ? 141 THR C OG1    1 
ATOM   6889  C  CG2    . THR C 1 122 ? 23.282  29.694 207.235 1.00 93.84  ? 141 THR C CG2    1 
ATOM   6890  H  H      . THR C 1 122 ? 22.417  28.118 209.685 1.00 158.52 ? 141 THR C H      1 
ATOM   6891  H  HA     . THR C 1 122 ? 20.930  28.900 207.690 1.00 149.84 ? 141 THR C HA     1 
ATOM   6892  H  HB     . THR C 1 122 ? 22.823  27.879 206.438 1.00 118.67 ? 141 THR C HB     1 
ATOM   6893  H  HG1    . THR C 1 122 ? 23.548  26.734 208.187 1.00 123.99 ? 141 THR C HG1    1 
ATOM   6894  H  HG21   . THR C 1 122 ? 24.162  29.742 206.828 1.00 112.61 ? 141 THR C HG21   1 
ATOM   6895  H  HG22   . THR C 1 122 ? 22.656  30.200 206.694 1.00 112.61 ? 141 THR C HG22   1 
ATOM   6896  H  HG23   . THR C 1 122 ? 23.323  30.087 208.121 1.00 112.61 ? 141 THR C HG23   1 
ATOM   6897  N  N      . ILE C 1 123 ? 20.764  25.783 208.220 1.00 102.34 ? 142 ILE C N      1 
ATOM   6898  C  CA     . ILE C 1 123 ? 20.184  24.536 207.717 1.00 101.08 ? 142 ILE C CA     1 
ATOM   6899  C  C      . ILE C 1 123 ? 18.818  24.809 207.118 1.00 119.38 ? 142 ILE C C      1 
ATOM   6900  O  O      . ILE C 1 123 ? 18.535  24.450 205.971 1.00 130.79 ? 142 ILE C O      1 
ATOM   6901  C  CB     . ILE C 1 123 ? 20.066  23.475 208.828 1.00 115.25 ? 142 ILE C CB     1 
ATOM   6902  C  CG1    . ILE C 1 123 ? 21.367  23.294 209.608 1.00 119.79 ? 142 ILE C CG1    1 
ATOM   6903  C  CG2    . ILE C 1 123 ? 19.615  22.128 208.207 1.00 98.14  ? 142 ILE C CG2    1 
ATOM   6904  C  CD1    . ILE C 1 123 ? 22.367  22.558 208.848 1.00 150.15 ? 142 ILE C CD1    1 
ATOM   6905  H  H      . ILE C 1 123 ? 21.078  25.739 209.019 1.00 122.80 ? 142 ILE C H      1 
ATOM   6906  H  HA     . ILE C 1 123 ? 20.754  24.179 207.019 1.00 121.30 ? 142 ILE C HA     1 
ATOM   6907  H  HB     . ILE C 1 123 ? 19.380  23.765 209.450 1.00 138.31 ? 142 ILE C HB     1 
ATOM   6908  H  HG12   . ILE C 1 123 ? 21.733  24.166 209.823 1.00 143.75 ? 142 ILE C HG12   1 
ATOM   6909  H  HG13   . ILE C 1 123 ? 21.183  22.800 210.422 1.00 143.75 ? 142 ILE C HG13   1 
ATOM   6910  H  HG21   . ILE C 1 123 ? 19.543  21.465 208.911 1.00 117.77 ? 142 ILE C HG21   1 
ATOM   6911  H  HG22   . ILE C 1 123 ? 18.754  22.251 207.778 1.00 117.77 ? 142 ILE C HG22   1 
ATOM   6912  H  HG23   . ILE C 1 123 ? 20.274  21.847 207.553 1.00 117.77 ? 142 ILE C HG23   1 
ATOM   6913  H  HD11   . ILE C 1 123 ? 23.170  22.471 209.385 1.00 180.18 ? 142 ILE C HD11   1 
ATOM   6914  H  HD12   . ILE C 1 123 ? 22.016  21.680 208.632 1.00 180.18 ? 142 ILE C HD12   1 
ATOM   6915  H  HD13   . ILE C 1 123 ? 22.565  23.045 208.032 1.00 180.18 ? 142 ILE C HD13   1 
ATOM   6916  N  N      . GLN C 1 124 ? 17.945  25.435 207.904 1.00 135.41 ? 143 GLN C N      1 
ATOM   6917  C  CA     . GLN C 1 124 ? 16.628  25.807 207.413 1.00 110.14 ? 143 GLN C CA     1 
ATOM   6918  C  C      . GLN C 1 124 ? 16.718  26.625 206.134 1.00 122.84 ? 143 GLN C C      1 
ATOM   6919  O  O      . GLN C 1 124 ? 15.805  26.587 205.300 1.00 132.73 ? 143 GLN C O      1 
ATOM   6920  C  CB     . GLN C 1 124 ? 15.886  26.603 208.483 1.00 123.00 ? 143 GLN C CB     1 
ATOM   6921  C  CG     . GLN C 1 124 ? 14.559  26.016 208.911 1.00 131.54 ? 143 GLN C CG     1 
ATOM   6922  C  CD     . GLN C 1 124 ? 13.482  27.067 209.038 1.00 119.51 ? 143 GLN C CD     1 
ATOM   6923  O  OE1    . GLN C 1 124 ? 13.743  28.192 209.463 1.00 119.19 ? 143 GLN C OE1    1 
ATOM   6924  N  NE2    . GLN C 1 124 ? 12.264  26.710 208.659 1.00 121.45 ? 143 GLN C NE2    1 
ATOM   6925  H  H      . GLN C 1 124 ? 18.094  25.654 208.722 1.00 162.49 ? 143 GLN C H      1 
ATOM   6926  H  HA     . GLN C 1 124 ? 16.119  25.003 207.224 1.00 132.17 ? 143 GLN C HA     1 
ATOM   6927  H  HB2    . GLN C 1 124 ? 16.449  26.660 209.272 1.00 147.60 ? 143 GLN C HB2    1 
ATOM   6928  H  HB3    . GLN C 1 124 ? 15.715  27.495 208.142 1.00 147.60 ? 143 GLN C HB3    1 
ATOM   6929  H  HG2    . GLN C 1 124 ? 14.271  25.367 208.250 1.00 157.85 ? 143 GLN C HG2    1 
ATOM   6930  H  HG3    . GLN C 1 124 ? 14.665  25.587 209.775 1.00 157.85 ? 143 GLN C HG3    1 
ATOM   6931  H  HE21   . GLN C 1 124 ? 12.122  25.916 208.361 1.00 145.75 ? 143 GLN C HE21   1 
ATOM   6932  H  HE22   . GLN C 1 124 ? 11.615  27.272 208.711 1.00 145.75 ? 143 GLN C HE22   1 
ATOM   6933  N  N      . ASP C 1 125 ? 17.798  27.390 205.970 1.00 132.51 ? 144 ASP C N      1 
ATOM   6934  C  CA     . ASP C 1 125 ? 17.962  28.188 204.762 1.00 119.67 ? 144 ASP C CA     1 
ATOM   6935  C  C      . ASP C 1 125 ? 18.184  27.295 203.545 1.00 126.48 ? 144 ASP C C      1 
ATOM   6936  O  O      . ASP C 1 125 ? 17.465  27.400 202.543 1.00 143.51 ? 144 ASP C O      1 
ATOM   6937  C  CB     . ASP C 1 125 ? 19.132  29.152 204.955 1.00 108.30 ? 144 ASP C CB     1 
ATOM   6938  C  CG     . ASP C 1 125 ? 18.828  30.557 204.484 1.00 132.48 ? 144 ASP C CG     1 
ATOM   6939  O  OD1    . ASP C 1 125 ? 17.671  30.841 204.107 1.00 136.88 ? 144 ASP C OD1    1 
ATOM   6940  O  OD2    . ASP C 1 125 ? 19.761  31.384 204.503 1.00 153.57 ? 144 ASP C OD2    1 
ATOM   6941  H  H      . ASP C 1 125 ? 18.440  27.463 206.537 1.00 159.01 ? 144 ASP C H      1 
ATOM   6942  H  HA     . ASP C 1 125 ? 17.159  28.711 204.613 1.00 143.60 ? 144 ASP C HA     1 
ATOM   6943  H  HB2    . ASP C 1 125 ? 19.352  29.195 205.898 1.00 129.96 ? 144 ASP C HB2    1 
ATOM   6944  H  HB3    . ASP C 1 125 ? 19.894  28.827 204.451 1.00 129.96 ? 144 ASP C HB3    1 
ATOM   6945  N  N      . TYR C 1 126 ? 19.183  26.412 203.612 1.00 129.24 ? 145 TYR C N      1 
ATOM   6946  C  CA     . TYR C 1 126 ? 19.500  25.517 202.505 1.00 109.82 ? 145 TYR C CA     1 
ATOM   6947  C  C      . TYR C 1 126 ? 18.654  24.250 202.522 1.00 109.72 ? 145 TYR C C      1 
ATOM   6948  O  O      . TYR C 1 126 ? 18.251  23.764 201.460 1.00 123.51 ? 145 TYR C O      1 
ATOM   6949  C  CB     . TYR C 1 126 ? 20.988  25.155 202.540 1.00 110.64 ? 145 TYR C CB     1 
ATOM   6950  C  CG     . TYR C 1 126 ? 21.906  26.327 202.279 1.00 116.87 ? 145 TYR C CG     1 
ATOM   6951  C  CD1    . TYR C 1 126 ? 21.667  27.205 201.229 1.00 150.65 ? 145 TYR C CD1    1 
ATOM   6952  C  CD2    . TYR C 1 126 ? 23.010  26.563 203.086 1.00 121.73 ? 145 TYR C CD2    1 
ATOM   6953  C  CE1    . TYR C 1 126 ? 22.503  28.280 200.987 1.00 145.23 ? 145 TYR C CE1    1 
ATOM   6954  C  CE2    . TYR C 1 126 ? 23.851  27.638 202.852 1.00 153.68 ? 145 TYR C CE2    1 
ATOM   6955  C  CZ     . TYR C 1 126 ? 23.593  28.494 201.801 1.00 144.25 ? 145 TYR C CZ     1 
ATOM   6956  O  OH     . TYR C 1 126 ? 24.428  29.564 201.563 1.00 127.09 ? 145 TYR C OH     1 
ATOM   6957  H  H      . TYR C 1 126 ? 19.694  26.313 204.296 1.00 155.09 ? 145 TYR C H      1 
ATOM   6958  H  HA     . TYR C 1 126 ? 19.327  25.978 201.670 1.00 131.79 ? 145 TYR C HA     1 
ATOM   6959  H  HB2    . TYR C 1 126 ? 21.202  24.799 203.417 1.00 132.77 ? 145 TYR C HB2    1 
ATOM   6960  H  HB3    . TYR C 1 126 ? 21.162  24.484 201.862 1.00 132.77 ? 145 TYR C HB3    1 
ATOM   6961  H  HD1    . TYR C 1 126 ? 20.932  27.065 200.676 1.00 180.79 ? 145 TYR C HD1    1 
ATOM   6962  H  HD2    . TYR C 1 126 ? 23.188  25.989 203.796 1.00 146.08 ? 145 TYR C HD2    1 
ATOM   6963  H  HE1    . TYR C 1 126 ? 22.329  28.857 200.279 1.00 174.28 ? 145 TYR C HE1    1 
ATOM   6964  H  HE2    . TYR C 1 126 ? 24.588  27.781 203.401 1.00 184.42 ? 145 TYR C HE2    1 
ATOM   6965  H  HH     . TYR C 1 126 ? 25.048  29.576 202.129 1.00 152.51 ? 145 TYR C HH     1 
ATOM   6966  N  N      . LEU C 1 127 ? 18.380  23.703 203.700 1.00 137.39 ? 146 LEU C N      1 
ATOM   6967  C  CA     . LEU C 1 127 ? 17.465  22.582 203.855 1.00 142.93 ? 146 LEU C CA     1 
ATOM   6968  C  C      . LEU C 1 127 ? 16.135  23.105 204.403 1.00 158.28 ? 146 LEU C C      1 
ATOM   6969  O  O      . LEU C 1 127 ? 15.800  24.282 204.226 1.00 157.33 ? 146 LEU C O      1 
ATOM   6970  C  CB     . LEU C 1 127 ? 18.117  21.518 204.751 1.00 129.60 ? 146 LEU C CB     1 
ATOM   6971  C  CG     . LEU C 1 127 ? 19.516  21.057 204.327 1.00 127.58 ? 146 LEU C CG     1 
ATOM   6972  C  CD1    . LEU C 1 127 ? 20.054  20.001 205.283 1.00 128.66 ? 146 LEU C CD1    1 
ATOM   6973  C  CD2    . LEU C 1 127 ? 19.503  20.501 202.919 1.00 159.02 ? 146 LEU C CD2    1 
ATOM   6974  H  H      . LEU C 1 127 ? 18.721  23.972 204.442 1.00 164.86 ? 146 LEU C H      1 
ATOM   6975  H  HA     . LEU C 1 127 ? 17.299  22.185 202.986 1.00 171.52 ? 146 LEU C HA     1 
ATOM   6976  H  HB2    . LEU C 1 127 ? 18.189  21.877 205.650 1.00 155.52 ? 146 LEU C HB2    1 
ATOM   6977  H  HB3    . LEU C 1 127 ? 17.544  20.735 204.762 1.00 155.52 ? 146 LEU C HB3    1 
ATOM   6978  H  HG     . LEU C 1 127 ? 20.120  21.816 204.346 1.00 153.10 ? 146 LEU C HG     1 
ATOM   6979  H  HD11   . LEU C 1 127 ? 20.938  19.731 204.989 1.00 154.39 ? 146 LEU C HD11   1 
ATOM   6980  H  HD12   . LEU C 1 127 ? 20.102  20.379 206.175 1.00 154.39 ? 146 LEU C HD12   1 
ATOM   6981  H  HD13   . LEU C 1 127 ? 19.455  19.238 205.279 1.00 154.39 ? 146 LEU C HD13   1 
ATOM   6982  H  HD21   . LEU C 1 127 ? 20.401  20.220 202.683 1.00 190.83 ? 146 LEU C HD21   1 
ATOM   6983  H  HD22   . LEU C 1 127 ? 18.899  19.743 202.885 1.00 190.83 ? 146 LEU C HD22   1 
ATOM   6984  H  HD23   . LEU C 1 127 ? 19.202  21.193 202.310 1.00 190.83 ? 146 LEU C HD23   1 
ATOM   6985  N  N      . GLY C 1 128 ? 15.372  22.242 205.068 1.00 143.22 ? 147 GLY C N      1 
ATOM   6986  C  CA     . GLY C 1 128 ? 14.083  22.641 205.598 1.00 127.52 ? 147 GLY C CA     1 
ATOM   6987  C  C      . GLY C 1 128 ? 13.909  22.356 207.076 1.00 106.91 ? 147 GLY C C      1 
ATOM   6988  O  O      . GLY C 1 128 ? 12.957  22.837 207.696 1.00 139.86 ? 147 GLY C O      1 
ATOM   6989  H  H      . GLY C 1 128 ? 15.582  21.423 205.223 1.00 171.86 ? 147 GLY C H      1 
ATOM   6990  H  HA2    . GLY C 1 128 ? 13.963  23.593 205.458 1.00 153.02 ? 147 GLY C HA2    1 
ATOM   6991  H  HA3    . GLY C 1 128 ? 13.383  22.173 205.116 1.00 153.02 ? 147 GLY C HA3    1 
ATOM   6992  N  N      . PHE C 1 129 ? 14.822  21.582 207.655 1.00 117.73 ? 148 PHE C N      1 
ATOM   6993  C  CA     . PHE C 1 129 ? 14.695  21.193 209.052 1.00 126.66 ? 148 PHE C CA     1 
ATOM   6994  C  C      . PHE C 1 129 ? 15.024  22.361 209.975 1.00 130.83 ? 148 PHE C C      1 
ATOM   6995  O  O      . PHE C 1 129 ? 15.965  23.124 209.734 1.00 112.33 ? 148 PHE C O      1 
ATOM   6996  C  CB     . PHE C 1 129 ? 15.614  20.008 209.359 1.00 95.07  ? 148 PHE C CB     1 
ATOM   6997  C  CG     . PHE C 1 129 ? 15.152  18.696 208.767 1.00 94.13  ? 148 PHE C CG     1 
ATOM   6998  C  CD1    . PHE C 1 129 ? 14.063  18.636 207.912 1.00 108.18 ? 148 PHE C CD1    1 
ATOM   6999  C  CD2    . PHE C 1 129 ? 15.809  17.517 209.083 1.00 139.62 ? 148 PHE C CD2    1 
ATOM   7000  C  CE1    . PHE C 1 129 ? 13.645  17.432 207.380 1.00 109.90 ? 148 PHE C CE1    1 
ATOM   7001  C  CE2    . PHE C 1 129 ? 15.395  16.310 208.555 1.00 121.23 ? 148 PHE C CE2    1 
ATOM   7002  C  CZ     . PHE C 1 129 ? 14.311  16.268 207.703 1.00 129.24 ? 148 PHE C CZ     1 
ATOM   7003  H  H      . PHE C 1 129 ? 15.521  21.270 207.261 1.00 141.28 ? 148 PHE C H      1 
ATOM   7004  H  HA     . PHE C 1 129 ? 13.780  20.919 209.225 1.00 151.99 ? 148 PHE C HA     1 
ATOM   7005  H  HB2    . PHE C 1 129 ? 16.496  20.199 209.002 1.00 114.08 ? 148 PHE C HB2    1 
ATOM   7006  H  HB3    . PHE C 1 129 ? 15.667  19.896 210.321 1.00 114.08 ? 148 PHE C HB3    1 
ATOM   7007  H  HD1    . PHE C 1 129 ? 13.609  19.417 207.691 1.00 129.82 ? 148 PHE C HD1    1 
ATOM   7008  H  HD2    . PHE C 1 129 ? 16.540  17.539 209.657 1.00 167.55 ? 148 PHE C HD2    1 
ATOM   7009  H  HE1    . PHE C 1 129 ? 12.914  17.405 206.806 1.00 131.88 ? 148 PHE C HE1    1 
ATOM   7010  H  HE2    . PHE C 1 129 ? 15.846  15.526 208.773 1.00 145.47 ? 148 PHE C HE2    1 
ATOM   7011  H  HZ     . PHE C 1 129 ? 14.031  15.457 207.345 1.00 155.08 ? 148 PHE C HZ     1 
ATOM   7012  N  N      . GLN C 1 130 ? 14.238  22.495 211.040 1.00 116.11 ? 149 GLN C N      1 
ATOM   7013  C  CA     . GLN C 1 130 ? 14.463  23.548 212.018 1.00 81.06  ? 149 GLN C CA     1 
ATOM   7014  C  C      . GLN C 1 130 ? 15.730  23.262 212.816 1.00 80.96  ? 149 GLN C C      1 
ATOM   7015  O  O      . GLN C 1 130 ? 15.986  22.123 213.218 1.00 74.54  ? 149 GLN C O      1 
ATOM   7016  C  CB     . GLN C 1 130 ? 13.257  23.664 212.954 1.00 92.21  ? 149 GLN C CB     1 
ATOM   7017  C  CG     . GLN C 1 130 ? 13.362  24.757 214.019 1.00 117.53 ? 149 GLN C CG     1 
ATOM   7018  C  CD     . GLN C 1 130 ? 13.281  26.158 213.448 1.00 116.33 ? 149 GLN C CD     1 
ATOM   7019  O  OE1    . GLN C 1 130 ? 12.277  26.539 212.847 1.00 136.46 ? 149 GLN C OE1    1 
ATOM   7020  N  NE2    . GLN C 1 130 ? 14.339  26.939 213.642 1.00 89.64  ? 149 GLN C NE2    1 
ATOM   7021  H  H      . GLN C 1 130 ? 13.567  21.986 211.217 1.00 139.33 ? 149 GLN C H      1 
ATOM   7022  H  HA     . GLN C 1 130 ? 14.576  24.395 211.559 1.00 97.27  ? 149 GLN C HA     1 
ATOM   7023  H  HB2    . GLN C 1 130 ? 12.470  23.852 212.419 1.00 110.65 ? 149 GLN C HB2    1 
ATOM   7024  H  HB3    . GLN C 1 130 ? 13.142  22.818 213.414 1.00 110.65 ? 149 GLN C HB3    1 
ATOM   7025  H  HG2    . GLN C 1 130 ? 12.634  24.650 214.652 1.00 141.03 ? 149 GLN C HG2    1 
ATOM   7026  H  HG3    . GLN C 1 130 ? 14.213  24.669 214.476 1.00 141.03 ? 149 GLN C HG3    1 
ATOM   7027  H  HE21   . GLN C 1 130 ? 15.020  26.641 214.072 1.00 107.57 ? 149 GLN C HE21   1 
ATOM   7028  H  HE22   . GLN C 1 130 ? 14.341  27.743 213.337 1.00 107.57 ? 149 GLN C HE22   1 
ATOM   7029  N  N      . GLN C 1 131 ? 16.532  24.309 213.029 1.00 96.00  ? 150 GLN C N      1 
ATOM   7030  C  CA     . GLN C 1 131 ? 17.749  24.181 213.827 1.00 74.25  ? 150 GLN C CA     1 
ATOM   7031  C  C      . GLN C 1 131 ? 17.462  23.479 215.149 1.00 122.74 ? 150 GLN C C      1 
ATOM   7032  O  O      . GLN C 1 131 ? 18.161  22.534 215.534 1.00 76.09  ? 150 GLN C O      1 
ATOM   7033  C  CB     . GLN C 1 131 ? 18.347  25.570 214.073 1.00 70.22  ? 150 GLN C CB     1 
ATOM   7034  C  CG     . GLN C 1 131 ? 19.624  25.593 214.907 1.00 62.66  ? 150 GLN C CG     1 
ATOM   7035  C  CD     . GLN C 1 131 ? 20.034  27.007 215.300 1.00 87.44  ? 150 GLN C CD     1 
ATOM   7036  O  OE1    . GLN C 1 131 ? 19.195  27.899 215.424 1.00 95.86  ? 150 GLN C OE1    1 
ATOM   7037  N  NE2    . GLN C 1 131 ? 21.329  27.213 215.507 1.00 74.46  ? 150 GLN C NE2    1 
ATOM   7038  H  H      . GLN C 1 131 ? 16.392  25.100 212.722 1.00 115.20 ? 150 GLN C H      1 
ATOM   7039  H  HA     . GLN C 1 131 ? 18.398  23.653 213.337 1.00 89.10  ? 150 GLN C HA     1 
ATOM   7040  H  HB2    . GLN C 1 131 ? 18.553  25.972 213.214 1.00 84.26  ? 150 GLN C HB2    1 
ATOM   7041  H  HB3    . GLN C 1 131 ? 17.688  26.111 214.534 1.00 84.26  ? 150 GLN C HB3    1 
ATOM   7042  H  HG2    . GLN C 1 131 ? 19.481  25.084 215.720 1.00 75.19  ? 150 GLN C HG2    1 
ATOM   7043  H  HG3    . GLN C 1 131 ? 20.347  25.203 214.392 1.00 75.19  ? 150 GLN C HG3    1 
ATOM   7044  H  HE21   . GLN C 1 131 ? 21.887  26.564 215.417 1.00 89.36  ? 150 GLN C HE21   1 
ATOM   7045  H  HE22   . GLN C 1 131 ? 21.610  27.994 215.730 1.00 89.36  ? 150 GLN C HE22   1 
ATOM   7046  N  N      . SER C 1 132 ? 16.416  23.924 215.847 1.00 117.19 ? 151 SER C N      1 
ATOM   7047  C  CA     . SER C 1 132 ? 16.066  23.416 217.166 1.00 52.76  ? 151 SER C CA     1 
ATOM   7048  C  C      . SER C 1 132 ? 15.589  21.968 217.161 1.00 64.86  ? 151 SER C C      1 
ATOM   7049  O  O      . SER C 1 132 ? 15.380  21.407 218.242 1.00 98.13  ? 151 SER C O      1 
ATOM   7050  C  CB     . SER C 1 132 ? 14.972  24.297 217.766 1.00 71.74  ? 151 SER C CB     1 
ATOM   7051  O  OG     . SER C 1 132 ? 13.871  24.386 216.883 1.00 71.38  ? 151 SER C OG     1 
ATOM   7052  H  H      . SER C 1 132 ? 15.883  24.538 215.565 1.00 140.63 ? 151 SER C H      1 
ATOM   7053  H  HA     . SER C 1 132 ? 16.844  23.472 217.741 1.00 63.32  ? 151 SER C HA     1 
ATOM   7054  H  HB2    . SER C 1 132 ? 14.676  23.909 218.604 1.00 86.09  ? 151 SER C HB2    1 
ATOM   7055  H  HB3    . SER C 1 132 ? 15.329  25.186 217.918 1.00 86.09  ? 151 SER C HB3    1 
ATOM   7056  H  HG     . SER C 1 132 ? 13.273  24.871 217.218 1.00 85.66  ? 151 SER C HG     1 
ATOM   7057  N  N      . ASP C 1 133 ? 15.403  21.352 215.993 1.00 69.67  ? 152 ASP C N      1 
ATOM   7058  C  CA     . ASP C 1 133 ? 14.880  19.992 215.919 1.00 87.92  ? 152 ASP C CA     1 
ATOM   7059  C  C      . ASP C 1 133 ? 15.936  18.952 215.581 1.00 81.99  ? 152 ASP C C      1 
ATOM   7060  O  O      . ASP C 1 133 ? 15.743  17.773 215.894 1.00 95.33  ? 152 ASP C O      1 
ATOM   7061  C  CB     . ASP C 1 133 ? 13.764  19.912 214.872 1.00 115.06 ? 152 ASP C CB     1 
ATOM   7062  C  CG     . ASP C 1 133 ? 12.586  20.800 215.210 1.00 106.30 ? 152 ASP C CG     1 
ATOM   7063  O  OD1    . ASP C 1 133 ? 12.614  21.437 216.284 1.00 90.85  ? 152 ASP C OD1    1 
ATOM   7064  O  OD2    . ASP C 1 133 ? 11.635  20.861 214.401 1.00 108.16 ? 152 ASP C OD2    1 
ATOM   7065  H  H      . ASP C 1 133 ? 15.573  21.704 215.227 1.00 83.60  ? 152 ASP C H      1 
ATOM   7066  H  HA     . ASP C 1 133 ? 14.498  19.758 216.780 1.00 105.51 ? 152 ASP C HA     1 
ATOM   7067  H  HB2    . ASP C 1 133 ? 14.115  20.193 214.013 1.00 138.08 ? 152 ASP C HB2    1 
ATOM   7068  H  HB3    . ASP C 1 133 ? 13.445  18.997 214.819 1.00 138.08 ? 152 ASP C HB3    1 
ATOM   7069  N  N      . VAL C 1 134 ? 17.037  19.357 214.954 1.00 76.46  ? 153 VAL C N      1 
ATOM   7070  C  CA     . VAL C 1 134 ? 18.059  18.421 214.496 1.00 90.50  ? 153 VAL C CA     1 
ATOM   7071  C  C      . VAL C 1 134 ? 19.328  18.489 215.325 1.00 79.32  ? 153 VAL C C      1 
ATOM   7072  O  O      . VAL C 1 134 ? 20.225  17.652 215.123 1.00 122.33 ? 153 VAL C O      1 
ATOM   7073  C  CB     . VAL C 1 134 ? 18.403  18.650 213.008 1.00 116.55 ? 153 VAL C CB     1 
ATOM   7074  C  CG1    . VAL C 1 134 ? 17.199  18.371 212.136 1.00 125.07 ? 153 VAL C CG1    1 
ATOM   7075  C  CG2    . VAL C 1 134 ? 18.904  20.076 212.788 1.00 102.25 ? 153 VAL C CG2    1 
ATOM   7076  H  H      . VAL C 1 134 ? 17.217  20.180 214.779 1.00 91.75  ? 153 VAL C H      1 
ATOM   7077  H  HA     . VAL C 1 134 ? 17.707  17.521 214.577 1.00 108.60 ? 153 VAL C HA     1 
ATOM   7078  H  HB     . VAL C 1 134 ? 19.111  18.039 212.749 1.00 139.86 ? 153 VAL C HB     1 
ATOM   7079  H  HG11   . VAL C 1 134 ? 17.440  18.521 211.209 1.00 150.09 ? 153 VAL C HG11   1 
ATOM   7080  H  HG12   . VAL C 1 134 ? 16.926  17.449 212.262 1.00 150.09 ? 153 VAL C HG12   1 
ATOM   7081  H  HG13   . VAL C 1 134 ? 16.479  18.968 212.392 1.00 150.09 ? 153 VAL C HG13   1 
ATOM   7082  H  HG21   . VAL C 1 134 ? 19.113  20.195 211.848 1.00 122.71 ? 153 VAL C HG21   1 
ATOM   7083  H  HG22   . VAL C 1 134 ? 18.210  20.699 213.054 1.00 122.71 ? 153 VAL C HG22   1 
ATOM   7084  H  HG23   . VAL C 1 134 ? 19.700  20.218 213.325 1.00 122.71 ? 153 VAL C HG23   1 
ATOM   7085  N  N      . ILE C 1 135 ? 19.432  19.438 216.256 1.00 77.74  ? 154 ILE C N      1 
ATOM   7086  C  CA     . ILE C 1 135 ? 20.724  19.745 216.857 1.00 110.78 ? 154 ILE C CA     1 
ATOM   7087  C  C      . ILE C 1 135 ? 21.197  18.626 217.775 1.00 103.18 ? 154 ILE C C      1 
ATOM   7088  O  O      . ILE C 1 135 ? 22.402  18.367 217.867 1.00 138.00 ? 154 ILE C O      1 
ATOM   7089  C  CB     . ILE C 1 135 ? 20.653  21.089 217.601 1.00 76.57  ? 154 ILE C CB     1 
ATOM   7090  C  CG1    . ILE C 1 135 ? 22.036  21.452 218.142 1.00 116.91 ? 154 ILE C CG1    1 
ATOM   7091  C  CG2    . ILE C 1 135 ? 19.638  21.027 218.738 1.00 105.21 ? 154 ILE C CG2    1 
ATOM   7092  C  CD1    . ILE C 1 135 ? 22.168  22.885 218.575 1.00 110.52 ? 154 ILE C CD1    1 
ATOM   7093  H  H      . ILE C 1 135 ? 18.777  19.912 216.551 1.00 93.28  ? 154 ILE C H      1 
ATOM   7094  H  HA     . ILE C 1 135 ? 21.379  19.838 216.148 1.00 132.94 ? 154 ILE C HA     1 
ATOM   7095  H  HB     . ILE C 1 135 ? 20.375  21.776 216.975 1.00 91.89  ? 154 ILE C HB     1 
ATOM   7096  H  HG12   . ILE C 1 135 ? 22.227  20.892 218.910 1.00 140.29 ? 154 ILE C HG12   1 
ATOM   7097  H  HG13   . ILE C 1 135 ? 22.694  21.291 217.447 1.00 140.29 ? 154 ILE C HG13   1 
ATOM   7098  H  HG21   . ILE C 1 135 ? 19.616  21.886 219.188 1.00 126.25 ? 154 ILE C HG21   1 
ATOM   7099  H  HG22   . ILE C 1 135 ? 18.764  20.823 218.370 1.00 126.25 ? 154 ILE C HG22   1 
ATOM   7100  H  HG23   . ILE C 1 135 ? 19.905  20.334 219.362 1.00 126.25 ? 154 ILE C HG23   1 
ATOM   7101  H  HD11   . ILE C 1 135 ? 23.068  23.034 218.903 1.00 132.62 ? 154 ILE C HD11   1 
ATOM   7102  H  HD12   . ILE C 1 135 ? 21.992  23.462 217.814 1.00 132.62 ? 154 ILE C HD12   1 
ATOM   7103  H  HD13   . ILE C 1 135 ? 21.525  23.062 219.279 1.00 132.62 ? 154 ILE C HD13   1 
ATOM   7104  N  N      . HIS C 1 136 ? 20.284  17.952 218.478 1.00 61.62  ? 155 HIS C N      1 
ATOM   7105  C  CA     . HIS C 1 136 ? 20.679  16.910 219.419 1.00 85.86  ? 155 HIS C CA     1 
ATOM   7106  C  C      . HIS C 1 136 ? 20.210  15.513 219.039 1.00 102.95 ? 155 HIS C C      1 
ATOM   7107  O  O      . HIS C 1 136 ? 20.776  14.539 219.545 1.00 91.15  ? 155 HIS C O      1 
ATOM   7108  C  CB     . HIS C 1 136 ? 20.156  17.228 220.825 1.00 94.00  ? 155 HIS C CB     1 
ATOM   7109  C  CG     . HIS C 1 136 ? 20.765  16.378 221.897 1.00 95.07  ? 155 HIS C CG     1 
ATOM   7110  N  ND1    . HIS C 1 136 ? 22.062  16.543 222.331 1.00 94.52  ? 155 HIS C ND1    1 
ATOM   7111  C  CD2    . HIS C 1 136 ? 20.258  15.347 222.614 1.00 87.97  ? 155 HIS C CD2    1 
ATOM   7112  C  CE1    . HIS C 1 136 ? 22.325  15.658 223.276 1.00 90.30  ? 155 HIS C CE1    1 
ATOM   7113  N  NE2    . HIS C 1 136 ? 21.247  14.920 223.467 1.00 74.60  ? 155 HIS C NE2    1 
ATOM   7114  H  H      . HIS C 1 136 ? 19.435  18.080 218.426 1.00 73.94  ? 155 HIS C H      1 
ATOM   7115  H  HA     . HIS C 1 136 ? 21.647  16.889 219.464 1.00 103.04 ? 155 HIS C HA     1 
ATOM   7116  H  HB2    . HIS C 1 136 ? 20.357  18.155 221.031 1.00 112.80 ? 155 HIS C HB2    1 
ATOM   7117  H  HB3    . HIS C 1 136 ? 19.197  17.087 220.843 1.00 112.80 ? 155 HIS C HB3    1 
ATOM   7118  H  HD2    . HIS C 1 136 ? 19.398  14.998 222.547 1.00 105.56 ? 155 HIS C HD2    1 
ATOM   7119  H  HE1    . HIS C 1 136 ? 23.133  15.568 223.728 1.00 108.37 ? 155 HIS C HE1    1 
ATOM   7120  H  HE2    . HIS C 1 136 ? 21.176  14.275 224.031 1.00 89.52  ? 155 HIS C HE2    1 
ATOM   7121  N  N      . GLN C 1 137 ? 19.206  15.384 218.175 1.00 129.88 ? 156 GLN C N      1 
ATOM   7122  C  CA     . GLN C 1 137 ? 18.731  14.066 217.780 1.00 81.35  ? 156 GLN C CA     1 
ATOM   7123  C  C      . GLN C 1 137 ? 19.654  13.452 216.727 1.00 84.77  ? 156 GLN C C      1 
ATOM   7124  O  O      . GLN C 1 137 ? 20.477  14.132 216.108 1.00 94.76  ? 156 GLN C O      1 
ATOM   7125  C  CB     . GLN C 1 137 ? 17.295  14.145 217.259 1.00 78.45  ? 156 GLN C CB     1 
ATOM   7126  C  CG     . GLN C 1 137 ? 16.262  14.389 218.362 1.00 72.99  ? 156 GLN C CG     1 
ATOM   7127  C  CD     . GLN C 1 137 ? 14.849  14.517 217.828 1.00 118.98 ? 156 GLN C CD     1 
ATOM   7128  O  OE1    . GLN C 1 137 ? 14.609  14.367 216.629 1.00 136.90 ? 156 GLN C OE1    1 
ATOM   7129  N  NE2    . GLN C 1 137 ? 13.904  14.798 218.717 1.00 94.02  ? 156 GLN C NE2    1 
ATOM   7130  H  H      . GLN C 1 137 ? 18.787  16.039 217.807 1.00 155.85 ? 156 GLN C H      1 
ATOM   7131  H  HA     . GLN C 1 137 ? 18.736  13.485 218.556 1.00 97.62  ? 156 GLN C HA     1 
ATOM   7132  H  HB2    . GLN C 1 137 ? 17.231  14.875 216.623 1.00 94.14  ? 156 GLN C HB2    1 
ATOM   7133  H  HB3    . GLN C 1 137 ? 17.073  13.307 216.822 1.00 94.14  ? 156 GLN C HB3    1 
ATOM   7134  H  HG2    . GLN C 1 137 ? 16.282  13.644 218.983 1.00 87.58  ? 156 GLN C HG2    1 
ATOM   7135  H  HG3    . GLN C 1 137 ? 16.483  15.212 218.824 1.00 87.58  ? 156 GLN C HG3    1 
ATOM   7136  H  HE21   . GLN C 1 137 ? 14.111  14.898 219.546 1.00 112.82 ? 156 GLN C HE21   1 
ATOM   7137  H  HE22   . GLN C 1 137 ? 13.087  14.881 218.464 1.00 112.82 ? 156 GLN C HE22   1 
ATOM   7138  N  N      . SER C 1 138 ? 19.506  12.141 216.536 1.00 110.43 ? 157 SER C N      1 
ATOM   7139  C  CA     . SER C 1 138 ? 20.427  11.385 215.694 1.00 93.07  ? 157 SER C CA     1 
ATOM   7140  C  C      . SER C 1 138 ? 20.475  11.957 214.285 1.00 106.07 ? 157 SER C C      1 
ATOM   7141  O  O      . SER C 1 138 ? 19.443  12.131 213.630 1.00 113.68 ? 157 SER C O      1 
ATOM   7142  C  CB     . SER C 1 138 ? 20.011  9.916  215.646 1.00 124.00 ? 157 SER C CB     1 
ATOM   7143  H  H      . SER C 1 138 ? 18.878  11.667 216.884 1.00 132.51 ? 157 SER C H      1 
ATOM   7144  H  HA     . SER C 1 138 ? 21.318  11.436 216.073 1.00 111.69 ? 157 SER C HA     1 
ATOM   7145  N  N      . VAL C 1 139 ? 21.692  12.234 213.812 1.00 95.15  ? 158 VAL C N      1 
ATOM   7146  C  CA     . VAL C 1 139 ? 21.869  12.789 212.477 1.00 139.29 ? 158 VAL C CA     1 
ATOM   7147  C  C      . VAL C 1 139 ? 21.471  11.796 211.395 1.00 144.29 ? 158 VAL C C      1 
ATOM   7148  O  O      . VAL C 1 139 ? 21.239  12.195 210.248 1.00 110.66 ? 158 VAL C O      1 
ATOM   7149  C  CB     . VAL C 1 139 ? 23.332  13.236 212.281 1.00 137.55 ? 158 VAL C CB     1 
ATOM   7150  C  CG1    . VAL C 1 139 ? 24.264  12.034 212.205 1.00 131.88 ? 158 VAL C CG1    1 
ATOM   7151  C  CG2    . VAL C 1 139 ? 23.469  14.101 211.043 1.00 96.31  ? 158 VAL C CG2    1 
ATOM   7152  H  H      . VAL C 1 139 ? 22.425  12.110 214.244 1.00 114.18 ? 158 VAL C H      1 
ATOM   7153  H  HA     . VAL C 1 139 ? 21.303  13.572 212.385 1.00 167.15 ? 158 VAL C HA     1 
ATOM   7154  H  HB     . VAL C 1 139 ? 23.600  13.770 213.045 1.00 165.05 ? 158 VAL C HB     1 
ATOM   7155  H  HG11   . VAL C 1 139 ? 25.174  12.348 212.082 1.00 158.25 ? 158 VAL C HG11   1 
ATOM   7156  H  HG12   . VAL C 1 139 ? 24.197  11.530 213.031 1.00 158.25 ? 158 VAL C HG12   1 
ATOM   7157  H  HG13   . VAL C 1 139 ? 24.002  11.478 211.455 1.00 158.25 ? 158 VAL C HG13   1 
ATOM   7158  H  HG21   . VAL C 1 139 ? 24.397  14.367 210.945 1.00 115.58 ? 158 VAL C HG21   1 
ATOM   7159  H  HG22   . VAL C 1 139 ? 23.187  13.590 210.268 1.00 115.58 ? 158 VAL C HG22   1 
ATOM   7160  H  HG23   . VAL C 1 139 ? 22.908  14.886 211.143 1.00 115.58 ? 158 VAL C HG23   1 
ATOM   7161  N  N      . TYR C 1 140 ? 21.377  10.510 211.733 1.00 153.42 ? 159 TYR C N      1 
ATOM   7162  C  CA     . TYR C 1 140 ? 21.308  9.478  210.705 1.00 125.69 ? 159 TYR C CA     1 
ATOM   7163  C  C      . TYR C 1 140 ? 20.128  9.702  209.771 1.00 121.43 ? 159 TYR C C      1 
ATOM   7164  O  O      . TYR C 1 140 ? 20.274  9.628  208.545 1.00 143.84 ? 159 TYR C O      1 
ATOM   7165  C  CB     . TYR C 1 140 ? 21.230  8.094  211.351 1.00 129.91 ? 159 TYR C CB     1 
ATOM   7166  C  CG     . TYR C 1 140 ? 22.294  7.147  210.841 1.00 153.25 ? 159 TYR C CG     1 
ATOM   7167  C  CD1    . TYR C 1 140 ? 23.618  7.283  211.238 1.00 142.74 ? 159 TYR C CD1    1 
ATOM   7168  C  CD2    . TYR C 1 140 ? 21.977  6.124  209.956 1.00 159.04 ? 159 TYR C CD2    1 
ATOM   7169  C  CE1    . TYR C 1 140 ? 24.596  6.426  210.775 1.00 139.32 ? 159 TYR C CE1    1 
ATOM   7170  C  CE2    . TYR C 1 140 ? 22.950  5.259  209.486 1.00 161.97 ? 159 TYR C CE2    1 
ATOM   7171  C  CZ     . TYR C 1 140 ? 24.258  5.415  209.899 1.00 158.17 ? 159 TYR C CZ     1 
ATOM   7172  O  OH     . TYR C 1 140 ? 25.232  4.559  209.435 1.00 162.34 ? 159 TYR C OH     1 
ATOM   7173  H  H      . TYR C 1 140 ? 21.352  10.214 212.540 1.00 184.11 ? 159 TYR C H      1 
ATOM   7174  H  HA     . TYR C 1 140 ? 22.119  9.512  210.173 1.00 150.83 ? 159 TYR C HA     1 
ATOM   7175  H  HB2    . TYR C 1 140 ? 21.346  8.186  212.310 1.00 155.89 ? 159 TYR C HB2    1 
ATOM   7176  H  HB3    . TYR C 1 140 ? 20.364  7.704  211.158 1.00 155.89 ? 159 TYR C HB3    1 
ATOM   7177  H  HD1    . TYR C 1 140 ? 23.849  7.963  211.829 1.00 171.29 ? 159 TYR C HD1    1 
ATOM   7178  H  HD2    . TYR C 1 140 ? 21.097  6.016  209.677 1.00 190.84 ? 159 TYR C HD2    1 
ATOM   7179  H  HE1    . TYR C 1 140 ? 25.478  6.530  211.052 1.00 167.18 ? 159 TYR C HE1    1 
ATOM   7180  H  HE2    . TYR C 1 140 ? 22.725  4.578  208.896 1.00 194.37 ? 159 TYR C HE2    1 
ATOM   7181  H  HH     . TYR C 1 140 ? 24.893  3.995  208.913 1.00 194.81 ? 159 TYR C HH     1 
ATOM   7182  N  N      . GLU C 1 141 ? 18.948  9.979  210.322 1.00 110.03 ? 160 GLU C N      1 
ATOM   7183  C  CA     . GLU C 1 141 ? 17.768  10.099 209.478 1.00 131.52 ? 160 GLU C CA     1 
ATOM   7184  C  C      . GLU C 1 141 ? 17.717  11.415 208.715 1.00 151.71 ? 160 GLU C C      1 
ATOM   7185  O  O      . GLU C 1 141 ? 16.700  11.704 208.076 1.00 150.05 ? 160 GLU C O      1 
ATOM   7186  C  CB     . GLU C 1 141 ? 16.489  9.929  210.304 1.00 109.85 ? 160 GLU C CB     1 
ATOM   7187  C  CG     . GLU C 1 141 ? 15.638  8.744  209.854 1.00 128.54 ? 160 GLU C CG     1 
ATOM   7188  C  CD     . GLU C 1 141 ? 15.385  8.739  208.357 1.00 163.39 ? 160 GLU C CD     1 
ATOM   7189  O  OE1    . GLU C 1 141 ? 14.909  9.768  207.829 1.00 166.80 ? 160 GLU C OE1    1 
ATOM   7190  O  OE2    . GLU C 1 141 ? 15.682  7.712  207.706 1.00 148.51 ? 160 GLU C OE2    1 
ATOM   7191  H  H      . GLU C 1 141 ? 18.808  10.098 211.162 1.00 132.03 ? 160 GLU C H      1 
ATOM   7192  H  HA     . GLU C 1 141 ? 17.787  9.385  208.822 1.00 157.83 ? 160 GLU C HA     1 
ATOM   7193  H  HB2    . GLU C 1 141 ? 16.730  9.787  211.233 1.00 131.82 ? 160 GLU C HB2    1 
ATOM   7194  H  HB3    . GLU C 1 141 ? 15.951  10.732 210.221 1.00 131.82 ? 160 GLU C HB3    1 
ATOM   7195  H  HG2    . GLU C 1 141 ? 16.095  7.921  210.083 1.00 154.25 ? 160 GLU C HG2    1 
ATOM   7196  H  HG3    . GLU C 1 141 ? 14.779  8.783  210.303 1.00 154.25 ? 160 GLU C HG3    1 
ATOM   7197  N  N      . LEU C 1 142 ? 18.779  12.218 208.771 1.00 128.95 ? 161 LEU C N      1 
ATOM   7198  C  CA     . LEU C 1 142 ? 18.948  13.294 207.804 1.00 136.70 ? 161 LEU C CA     1 
ATOM   7199  C  C      . LEU C 1 142 ? 19.583  12.805 206.509 1.00 155.00 ? 161 LEU C C      1 
ATOM   7200  O  O      . LEU C 1 142 ? 19.470  13.485 205.484 1.00 131.69 ? 161 LEU C O      1 
ATOM   7201  C  CB     . LEU C 1 142 ? 19.801  14.416 208.394 1.00 106.19 ? 161 LEU C CB     1 
ATOM   7202  C  CG     . LEU C 1 142 ? 19.064  15.432 209.266 1.00 117.50 ? 161 LEU C CG     1 
ATOM   7203  C  CD1    . LEU C 1 142 ? 18.628  14.816 210.585 1.00 132.39 ? 161 LEU C CD1    1 
ATOM   7204  C  CD2    . LEU C 1 142 ? 19.949  16.649 209.495 1.00 105.93 ? 161 LEU C CD2    1 
ATOM   7205  H  H      . LEU C 1 142 ? 19.408  12.161 209.354 1.00 154.74 ? 161 LEU C H      1 
ATOM   7206  H  HA     . LEU C 1 142 ? 18.077  13.662 207.589 1.00 164.04 ? 161 LEU C HA     1 
ATOM   7207  H  HB2    . LEU C 1 142 ? 20.495  14.016 208.941 1.00 127.43 ? 161 LEU C HB2    1 
ATOM   7208  H  HB3    . LEU C 1 142 ? 20.210  14.905 207.663 1.00 127.43 ? 161 LEU C HB3    1 
ATOM   7209  H  HG     . LEU C 1 142 ? 18.268  15.727 208.798 1.00 140.99 ? 161 LEU C HG     1 
ATOM   7210  H  HD11   . LEU C 1 142 ? 18.166  15.489 211.109 1.00 158.87 ? 161 LEU C HD11   1 
ATOM   7211  H  HD12   . LEU C 1 142 ? 18.034  14.071 210.404 1.00 158.87 ? 161 LEU C HD12   1 
ATOM   7212  H  HD13   . LEU C 1 142 ? 19.413  14.506 211.063 1.00 158.87 ? 161 LEU C HD13   1 
ATOM   7213  H  HD21   . LEU C 1 142 ? 19.471  17.286 210.048 1.00 127.11 ? 161 LEU C HD21   1 
ATOM   7214  H  HD22   . LEU C 1 142 ? 20.763  16.367 209.941 1.00 127.11 ? 161 LEU C HD22   1 
ATOM   7215  H  HD23   . LEU C 1 142 ? 20.162  17.049 208.637 1.00 127.11 ? 161 LEU C HD23   1 
ATOM   7216  N  N      . ILE C 1 143 ? 20.245  11.650 206.534 1.00 140.50 ? 162 ILE C N      1 
ATOM   7217  C  CA     . ILE C 1 143 ? 20.863  11.055 205.356 1.00 128.52 ? 162 ILE C CA     1 
ATOM   7218  C  C      . ILE C 1 143 ? 20.244  9.682  205.141 1.00 150.81 ? 162 ILE C C      1 
ATOM   7219  O  O      . ILE C 1 143 ? 20.111  8.901  206.090 1.00 164.26 ? 162 ILE C O      1 
ATOM   7220  C  CB     . ILE C 1 143 ? 22.391  10.948 205.506 1.00 125.50 ? 162 ILE C CB     1 
ATOM   7221  H  H      . ILE C 1 143 ? 20.353  11.180 207.246 1.00 168.60 ? 162 ILE C H      1 
ATOM   7222  H  HA     . ILE C 1 143 ? 20.670  11.604 204.579 1.00 154.23 ? 162 ILE C HA     1 
ATOM   7223  N  N      . HIS C 1 144 ? 19.859  9.395  203.901 1.00 160.41 ? 163 HIS C N      1 
ATOM   7224  C  CA     . HIS C 1 144 ? 19.294  8.092  203.582 1.00 179.18 ? 163 HIS C CA     1 
ATOM   7225  C  C      . HIS C 1 144 ? 20.261  6.989  203.992 1.00 167.57 ? 163 HIS C C      1 
ATOM   7226  O  O      . HIS C 1 144 ? 21.482  7.165  203.975 1.00 167.28 ? 163 HIS C O      1 
ATOM   7227  C  CB     . HIS C 1 144 ? 18.975  8.003  202.089 1.00 63.51  ? 163 HIS C CB     1 
ATOM   7228  C  CG     . HIS C 1 144 ? 17.974  9.018  201.631 1.00 86.83  ? 163 HIS C CG     1 
ATOM   7229  N  ND1    . HIS C 1 144 ? 16.640  8.955  201.974 1.00 73.51  ? 163 HIS C ND1    1 
ATOM   7230  C  CD2    . HIS C 1 144 ? 18.113  10.131 200.870 1.00 86.13  ? 163 HIS C CD2    1 
ATOM   7231  C  CE1    . HIS C 1 144 ? 15.999  9.980  201.440 1.00 78.35  ? 163 HIS C CE1    1 
ATOM   7232  N  NE2    . HIS C 1 144 ? 16.870  10.710 200.765 1.00 88.78  ? 163 HIS C NE2    1 
ATOM   7233  H  H      . HIS C 1 144 ? 19.914  9.933  203.232 1.00 192.49 ? 163 HIS C H      1 
ATOM   7234  H  HA     . HIS C 1 144 ? 18.468  7.971  204.076 1.00 215.02 ? 163 HIS C HA     1 
ATOM   7235  H  HB2    . HIS C 1 144 ? 19.792  8.142  201.585 1.00 76.22  ? 163 HIS C HB2    1 
ATOM   7236  H  HB3    . HIS C 1 144 ? 18.616  7.122  201.897 1.00 76.22  ? 163 HIS C HB3    1 
ATOM   7237  H  HD2    . HIS C 1 144 ? 18.901  10.444 200.489 1.00 103.36 ? 163 HIS C HD2    1 
ATOM   7238  H  HE1    . HIS C 1 144 ? 15.090  10.158 201.524 1.00 94.02  ? 163 HIS C HE1    1 
ATOM   7239  H  HE2    . HIS C 1 144 ? 16.688  11.429 200.330 1.00 106.53 ? 163 HIS C HE2    1 
ATOM   7240  N  N      . THR C 1 145 ? 19.697  5.840  204.374 1.00 158.32 ? 164 THR C N      1 
ATOM   7241  C  CA     . THR C 1 145 ? 20.499  4.771  204.963 1.00 167.64 ? 164 THR C CA     1 
ATOM   7242  C  C      . THR C 1 145 ? 21.722  4.450  204.113 1.00 173.62 ? 164 THR C C      1 
ATOM   7243  O  O      . THR C 1 145 ? 22.822  4.250  204.642 1.00 167.20 ? 164 THR C O      1 
ATOM   7244  C  CB     . THR C 1 145 ? 19.642  3.518  205.150 1.00 174.79 ? 164 THR C CB     1 
ATOM   7245  H  H      . THR C 1 145 ? 18.860  5.658  204.303 1.00 189.98 ? 164 THR C H      1 
ATOM   7246  H  HA     . THR C 1 145 ? 20.809  5.054  205.837 1.00 201.17 ? 164 THR C HA     1 
ATOM   7247  N  N      . GLU C 1 146 ? 21.551  4.399  202.790 1.00 177.28 ? 165 GLU C N      1 
ATOM   7248  C  CA     . GLU C 1 146 ? 22.675  4.087  201.913 1.00 190.85 ? 165 GLU C CA     1 
ATOM   7249  C  C      . GLU C 1 146 ? 23.784  5.123  202.045 1.00 176.98 ? 165 GLU C C      1 
ATOM   7250  O  O      . GLU C 1 146 ? 24.963  4.771  202.170 1.00 185.27 ? 165 GLU C O      1 
ATOM   7251  C  CB     . GLU C 1 146 ? 22.196  3.995  200.465 1.00 189.94 ? 165 GLU C CB     1 
ATOM   7252  H  H      . GLU C 1 146 ? 20.807  4.539  202.383 1.00 212.74 ? 165 GLU C H      1 
ATOM   7253  H  HA     . GLU C 1 146 ? 23.040  3.224  202.163 1.00 229.02 ? 165 GLU C HA     1 
ATOM   7254  N  N      . ASP C 1 147 ? 23.428  6.409  202.026 1.00 167.91 ? 166 ASP C N      1 
ATOM   7255  C  CA     . ASP C 1 147 ? 24.440  7.457  202.113 1.00 175.22 ? 166 ASP C CA     1 
ATOM   7256  C  C      . ASP C 1 147 ? 25.144  7.450  203.464 1.00 187.13 ? 166 ASP C C      1 
ATOM   7257  O  O      . ASP C 1 147 ? 26.330  7.790  203.544 1.00 178.18 ? 166 ASP C O      1 
ATOM   7258  C  CB     . ASP C 1 147 ? 23.801  8.822  201.858 1.00 181.84 ? 166 ASP C CB     1 
ATOM   7259  H  H      . ASP C 1 147 ? 22.619  6.696  201.964 1.00 201.49 ? 166 ASP C H      1 
ATOM   7260  H  HA     . ASP C 1 147 ? 25.108  7.306  201.427 1.00 210.27 ? 166 ASP C HA     1 
ATOM   7261  N  N      . ARG C 1 148 ? 24.439  7.065  204.529 1.00 189.68 ? 167 ARG C N      1 
ATOM   7262  C  CA     . ARG C 1 148 ? 25.031  7.097  205.862 1.00 165.30 ? 167 ARG C CA     1 
ATOM   7263  C  C      . ARG C 1 148 ? 26.066  5.993  206.035 1.00 154.97 ? 167 ARG C C      1 
ATOM   7264  O  O      . ARG C 1 148 ? 27.117  6.212  206.651 1.00 146.75 ? 167 ARG C O      1 
ATOM   7265  C  CB     . ARG C 1 148 ? 23.936  6.975  206.922 1.00 158.45 ? 167 ARG C CB     1 
ATOM   7266  H  H      . ARG C 1 148 ? 23.626  6.786  204.506 1.00 227.61 ? 167 ARG C H      1 
ATOM   7267  H  HA     . ARG C 1 148 ? 25.477  7.949  205.989 1.00 198.36 ? 167 ARG C HA     1 
ATOM   7268  N  N      . ALA C 1 149 ? 25.788  4.801  205.503 1.00 165.84 ? 168 ALA C N      1 
ATOM   7269  C  CA     . ALA C 1 149 ? 26.735  3.697  205.623 1.00 180.15 ? 168 ALA C CA     1 
ATOM   7270  C  C      . ALA C 1 149 ? 28.120  4.109  205.147 1.00 180.15 ? 168 ALA C C      1 
ATOM   7271  O  O      . ALA C 1 149 ? 29.125  3.808  205.800 1.00 170.78 ? 168 ALA C O      1 
ATOM   7272  C  CB     . ALA C 1 149 ? 26.233  2.488  204.834 1.00 171.90 ? 168 ALA C CB     1 
ATOM   7273  H  H      . ALA C 1 149 ? 25.068  4.609  205.074 1.00 199.01 ? 168 ALA C H      1 
ATOM   7274  H  HA     . ALA C 1 149 ? 26.803  3.440  206.556 1.00 216.18 ? 168 ALA C HA     1 
ATOM   7275  H  HB1    . ALA C 1 149 ? 26.873  1.765  204.924 1.00 206.28 ? 168 ALA C HB1    1 
ATOM   7276  H  HB2    . ALA C 1 149 ? 25.372  2.215  205.188 1.00 206.28 ? 168 ALA C HB2    1 
ATOM   7277  H  HB3    . ALA C 1 149 ? 26.143  2.736  203.900 1.00 206.28 ? 168 ALA C HB3    1 
ATOM   7278  N  N      . GLU C 1 150 ? 28.197  4.802  204.007 1.00 182.82 ? 169 GLU C N      1 
ATOM   7279  C  CA     . GLU C 1 150 ? 29.487  5.303  203.546 1.00 185.07 ? 169 GLU C CA     1 
ATOM   7280  C  C      . GLU C 1 150 ? 30.073  6.304  204.531 1.00 174.91 ? 169 GLU C C      1 
ATOM   7281  O  O      . GLU C 1 150 ? 31.298  6.405  204.660 1.00 171.55 ? 169 GLU C O      1 
ATOM   7282  C  CB     . GLU C 1 150 ? 29.349  5.935  202.158 1.00 189.48 ? 169 GLU C CB     1 
ATOM   7283  C  CG     . GLU C 1 150 ? 30.139  5.209  201.056 1.00 197.30 ? 169 GLU C CG     1 
ATOM   7284  C  CD     . GLU C 1 150 ? 29.256  4.454  200.075 1.00 199.31 ? 169 GLU C CD     1 
ATOM   7285  O  OE1    . GLU C 1 150 ? 29.249  4.825  198.877 1.00 197.68 ? 169 GLU C OE1    1 
ATOM   7286  O  OE2    . GLU C 1 150 ? 28.575  3.491  200.498 1.00 201.84 ? 169 GLU C OE2    1 
ATOM   7287  H  H      . GLU C 1 150 ? 27.532  4.990  203.496 1.00 219.39 ? 169 GLU C H      1 
ATOM   7288  H  HA     . GLU C 1 150 ? 30.105  4.559  203.474 1.00 222.08 ? 169 GLU C HA     1 
ATOM   7289  H  HB2    . GLU C 1 150 ? 28.413  5.929  201.903 1.00 227.38 ? 169 GLU C HB2    1 
ATOM   7290  H  HB3    . GLU C 1 150 ? 29.671  6.850  202.198 1.00 227.38 ? 169 GLU C HB3    1 
ATOM   7291  H  HG2    . GLU C 1 150 ? 30.651  5.863  200.554 1.00 236.76 ? 169 GLU C HG2    1 
ATOM   7292  H  HG3    . GLU C 1 150 ? 30.739  4.569  201.471 1.00 236.76 ? 169 GLU C HG3    1 
ATOM   7293  N  N      . PHE C 1 151 ? 29.220  7.045  205.242 1.00 160.92 ? 170 PHE C N      1 
ATOM   7294  C  CA     . PHE C 1 151 ? 29.714  7.937  206.286 1.00 160.63 ? 170 PHE C CA     1 
ATOM   7295  C  C      . PHE C 1 151 ? 30.217  7.154  207.492 1.00 164.67 ? 170 PHE C C      1 
ATOM   7296  O  O      . PHE C 1 151 ? 31.160  7.589  208.163 1.00 166.82 ? 170 PHE C O      1 
ATOM   7297  C  CB     . PHE C 1 151 ? 28.616  8.911  206.708 1.00 46.62  ? 170 PHE C CB     1 
ATOM   7298  H  H      . PHE C 1 151 ? 28.366  7.050  205.141 1.00 193.11 ? 170 PHE C H      1 
ATOM   7299  H  HA     . PHE C 1 151 ? 30.456  8.454  205.934 1.00 192.76 ? 170 PHE C HA     1 
ATOM   7300  N  N      . GLN C 1 152 ? 29.601  6.005  207.783 1.00 170.05 ? 171 GLN C N      1 
ATOM   7301  C  CA     . GLN C 1 152 ? 30.080  5.166  208.876 1.00 167.82 ? 171 GLN C CA     1 
ATOM   7302  C  C      . GLN C 1 152 ? 31.483  4.645  208.589 1.00 178.98 ? 171 GLN C C      1 
ATOM   7303  O  O      . GLN C 1 152 ? 32.346  4.643  209.475 1.00 166.87 ? 171 GLN C O      1 
ATOM   7304  C  CB     . GLN C 1 152 ? 29.112  4.006  209.108 1.00 173.79 ? 171 GLN C CB     1 
ATOM   7305  H  H      . GLN C 1 152 ? 28.915  5.695  207.367 1.00 204.06 ? 171 GLN C H      1 
ATOM   7306  H  HA     . GLN C 1 152 ? 30.116  5.694  209.688 1.00 201.39 ? 171 GLN C HA     1 
ATOM   7307  N  N      . ARG C 1 153 ? 31.729  4.199  207.354 1.00 190.00 ? 172 ARG C N      1 
ATOM   7308  C  CA     . ARG C 1 153 ? 33.067  3.747  206.984 1.00 181.53 ? 172 ARG C CA     1 
ATOM   7309  C  C      . ARG C 1 153 ? 34.088  4.859  207.175 1.00 190.18 ? 172 ARG C C      1 
ATOM   7310  O  O      . ARG C 1 153 ? 35.206  4.615  207.645 1.00 191.39 ? 172 ARG C O      1 
ATOM   7311  C  CB     . ARG C 1 153 ? 33.072  3.256  205.536 1.00 177.25 ? 172 ARG C CB     1 
ATOM   7312  H  H      . ARG C 1 153 ? 31.147  4.151  206.723 1.00 227.99 ? 172 ARG C H      1 
ATOM   7313  H  HA     . ARG C 1 153 ? 33.319  3.004  207.555 1.00 217.84 ? 172 ARG C HA     1 
ATOM   7314  N  N      . GLN C 1 154 ? 33.721  6.085  206.818 1.00 176.27 ? 173 GLN C N      1 
ATOM   7315  C  CA     . GLN C 1 154 ? 34.582  7.240  207.028 1.00 167.48 ? 173 GLN C CA     1 
ATOM   7316  C  C      . GLN C 1 154 ? 34.853  7.421  208.521 1.00 168.91 ? 173 GLN C C      1 
ATOM   7317  O  O      . GLN C 1 154 ? 35.999  7.577  208.944 1.00 166.63 ? 173 GLN C O      1 
ATOM   7318  C  CB     . GLN C 1 154 ? 33.936  8.495  206.426 1.00 88.43  ? 173 GLN C CB     1 
ATOM   7319  C  CG     . GLN C 1 154 ? 34.557  9.812  206.872 1.00 86.83  ? 173 GLN C CG     1 
ATOM   7320  C  CD     . GLN C 1 154 ? 34.042  10.269 208.225 1.00 160.61 ? 173 GLN C CD     1 
ATOM   7321  O  OE1    . GLN C 1 154 ? 32.981  9.834  208.676 1.00 160.83 ? 173 GLN C OE1    1 
ATOM   7322  N  NE2    . GLN C 1 154 ? 34.799  11.136 208.887 1.00 132.26 ? 173 GLN C NE2    1 
ATOM   7323  H  H      . GLN C 1 154 ? 32.969  6.275  206.447 1.00 211.53 ? 173 GLN C H      1 
ATOM   7324  H  HA     . GLN C 1 154 ? 35.430  7.091  206.581 1.00 200.98 ? 173 GLN C HA     1 
ATOM   7325  H  HB2    . GLN C 1 154 ? 34.012  8.447  205.460 1.00 106.12 ? 173 GLN C HB2    1 
ATOM   7326  H  HB3    . GLN C 1 154 ? 33.000  8.512  206.678 1.00 106.12 ? 173 GLN C HB3    1 
ATOM   7327  H  HG2    . GLN C 1 154 ? 35.519  9.703  206.937 1.00 104.20 ? 173 GLN C HG2    1 
ATOM   7328  H  HG3    . GLN C 1 154 ? 34.344  10.499 206.221 1.00 104.20 ? 173 GLN C HG3    1 
ATOM   7329  H  HE21   . GLN C 1 154 ? 35.539  11.409 208.545 1.00 158.71 ? 173 GLN C HE21   1 
ATOM   7330  H  HE22   . GLN C 1 154 ? 34.549  11.425 209.657 1.00 158.71 ? 173 GLN C HE22   1 
ATOM   7331  N  N      . GLU C 1 192 ? 44.333  16.678 215.542 1.00 164.29 ? 211 GLU C N      1 
ATOM   7332  C  CA     . GLU C 1 192 ? 45.357  17.165 216.458 1.00 163.48 ? 211 GLU C CA     1 
ATOM   7333  C  C      . GLU C 1 192 ? 46.740  17.051 215.829 1.00 181.27 ? 211 GLU C C      1 
ATOM   7334  O  O      . GLU C 1 192 ? 47.460  18.041 215.710 1.00 191.15 ? 211 GLU C O      1 
ATOM   7335  C  CB     . GLU C 1 192 ? 45.312  16.387 217.775 1.00 181.20 ? 211 GLU C CB     1 
ATOM   7336  H  HA     . GLU C 1 192 ? 45.190  18.100 216.653 1.00 196.17 ? 211 GLU C HA     1 
ATOM   7337  N  N      . ASN C 1 193 ? 47.106  15.832 215.425 1.00 182.96 ? 212 ASN C N      1 
ATOM   7338  C  CA     . ASN C 1 193 ? 48.424  15.607 214.840 1.00 202.39 ? 212 ASN C CA     1 
ATOM   7339  C  C      . ASN C 1 193 ? 48.578  16.366 213.528 1.00 210.07 ? 212 ASN C C      1 
ATOM   7340  O  O      . ASN C 1 193 ? 49.564  17.083 213.323 1.00 211.33 ? 212 ASN C O      1 
ATOM   7341  C  CB     . ASN C 1 193 ? 48.651  14.111 214.616 1.00 201.54 ? 212 ASN C CB     1 
ATOM   7342  C  CG     . ASN C 1 193 ? 48.464  13.297 215.879 1.00 198.08 ? 212 ASN C CG     1 
ATOM   7343  O  OD1    . ASN C 1 193 ? 47.640  12.384 215.926 1.00 194.70 ? 212 ASN C OD1    1 
ATOM   7344  N  ND2    . ASN C 1 193 ? 49.232  13.623 216.912 1.00 209.79 ? 212 ASN C ND2    1 
ATOM   7345  H  H      . ASN C 1 193 ? 46.614  15.128 215.478 1.00 219.55 ? 212 ASN C H      1 
ATOM   7346  H  HA     . ASN C 1 193 ? 49.103  15.927 215.454 1.00 242.87 ? 212 ASN C HA     1 
ATOM   7347  H  HB2    . ASN C 1 193 ? 48.017  13.790 213.956 1.00 241.85 ? 212 ASN C HB2    1 
ATOM   7348  H  HB3    . ASN C 1 193 ? 49.557  13.972 214.301 1.00 241.85 ? 212 ASN C HB3    1 
ATOM   7349  H  HD21   . ASN C 1 193 ? 49.163  13.190 217.652 1.00 251.75 ? 212 ASN C HD21   1 
ATOM   7350  H  HD22   . ASN C 1 193 ? 49.797  14.267 216.841 1.00 251.75 ? 212 ASN C HD22   1 
ATOM   7351  N  N      . SER C 1 194 ? 47.611  16.220 212.627 1.00 208.01 ? 213 SER C N      1 
ATOM   7352  C  CA     . SER C 1 194 ? 47.727  16.765 211.281 1.00 209.84 ? 213 SER C CA     1 
ATOM   7353  C  C      . SER C 1 194 ? 46.377  16.672 210.582 1.00 203.29 ? 213 SER C C      1 
ATOM   7354  O  O      . SER C 1 194 ? 45.394  16.246 211.202 1.00 180.77 ? 213 SER C O      1 
ATOM   7355  C  CB     . SER C 1 194 ? 48.801  16.005 210.501 1.00 211.12 ? 213 SER C CB     1 
ATOM   7356  H  H      . SER C 1 194 ? 46.871  15.806 212.774 1.00 249.62 ? 213 SER C H      1 
ATOM   7357  H  HA     . SER C 1 194 ? 47.986  17.699 211.331 1.00 251.81 ? 213 SER C HA     1 
ATOM   7358  N  N      . PRO C 1 195 ? 46.269  17.059 209.306 1.00 213.50 ? 214 PRO C N      1 
ATOM   7359  C  CA     . PRO C 1 195 ? 44.995  16.872 208.596 1.00 210.30 ? 214 PRO C CA     1 
ATOM   7360  C  C      . PRO C 1 195 ? 44.645  15.417 208.333 1.00 211.82 ? 214 PRO C C      1 
ATOM   7361  O  O      . PRO C 1 195 ? 43.616  15.156 207.699 1.00 217.48 ? 214 PRO C O      1 
ATOM   7362  C  CB     . PRO C 1 195 ? 45.210  17.638 207.281 1.00 212.22 ? 214 PRO C CB     1 
ATOM   7363  C  CG     . PRO C 1 195 ? 46.676  17.697 207.105 1.00 209.36 ? 214 PRO C CG     1 
ATOM   7364  C  CD     . PRO C 1 195 ? 47.248  17.792 208.481 1.00 211.49 ? 214 PRO C CD     1 
ATOM   7365  H  HA     . PRO C 1 195 ? 44.273  17.289 209.092 1.00 252.35 ? 214 PRO C HA     1 
ATOM   7366  H  HB2    . PRO C 1 195 ? 44.796  17.154 206.549 1.00 254.67 ? 214 PRO C HB2    1 
ATOM   7367  H  HB3    . PRO C 1 195 ? 44.837  18.530 207.357 1.00 254.67 ? 214 PRO C HB3    1 
ATOM   7368  H  HG2    . PRO C 1 195 ? 46.983  16.891 206.663 1.00 251.24 ? 214 PRO C HG2    1 
ATOM   7369  H  HG3    . PRO C 1 195 ? 46.909  18.482 206.585 1.00 251.24 ? 214 PRO C HG3    1 
ATOM   7370  H  HD2    . PRO C 1 195 ? 48.115  17.358 208.518 1.00 253.79 ? 214 PRO C HD2    1 
ATOM   7371  H  HD3    . PRO C 1 195 ? 47.301  18.719 208.763 1.00 253.79 ? 214 PRO C HD3    1 
ATOM   7372  N  N      . LEU C 1 196 ? 45.462  14.465 208.783 1.00 208.92 ? 215 LEU C N      1 
ATOM   7373  C  CA     . LEU C 1 196 ? 45.119  13.058 208.643 1.00 212.52 ? 215 LEU C CA     1 
ATOM   7374  C  C      . LEU C 1 196 ? 43.738  12.793 209.228 1.00 224.72 ? 215 LEU C C      1 
ATOM   7375  O  O      . LEU C 1 196 ? 43.339  13.405 210.221 1.00 217.83 ? 215 LEU C O      1 
ATOM   7376  C  CB     . LEU C 1 196 ? 46.166  12.187 209.342 1.00 215.35 ? 215 LEU C CB     1 
ATOM   7377  H  H      . LEU C 1 196 ? 46.215  14.610 209.171 1.00 250.71 ? 215 LEU C H      1 
ATOM   7378  H  HA     . LEU C 1 196 ? 45.104  12.822 207.702 1.00 255.03 ? 215 LEU C HA     1 
ATOM   7379  N  N      . MET C 1 197 ? 43.008  11.875 208.598 1.00 230.71 ? 216 MET C N      1 
ATOM   7380  C  CA     . MET C 1 197 ? 41.634  11.523 208.953 1.00 203.86 ? 216 MET C CA     1 
ATOM   7381  C  C      . MET C 1 197 ? 40.651  12.595 208.501 1.00 178.73 ? 216 MET C C      1 
ATOM   7382  O  O      . MET C 1 197 ? 39.462  12.511 208.843 1.00 166.33 ? 216 MET C O      1 
ATOM   7383  C  CB     . MET C 1 197 ? 41.465  11.290 210.458 1.00 180.73 ? 216 MET C CB     1 
ATOM   7384  H  H      . MET C 1 197 ? 43.302  11.422 207.929 1.00 276.85 ? 216 MET C H      1 
ATOM   7385  H  HA     . MET C 1 197 ? 41.408  10.694 208.505 1.00 244.64 ? 216 MET C HA     1 
ATOM   7386  N  N      . GLU C 1 198 ? 41.101  13.598 207.749 1.00 190.92 ? 217 GLU C N      1 
ATOM   7387  C  CA     . GLU C 1 198 ? 40.204  14.620 207.225 1.00 187.77 ? 217 GLU C CA     1 
ATOM   7388  C  C      . GLU C 1 198 ? 39.235  13.994 206.231 1.00 191.90 ? 217 GLU C C      1 
ATOM   7389  O  O      . GLU C 1 198 ? 39.652  13.469 205.193 1.00 207.73 ? 217 GLU C O      1 
ATOM   7390  C  CB     . GLU C 1 198 ? 41.008  15.735 206.561 1.00 181.72 ? 217 GLU C CB     1 
ATOM   7391  C  CG     . GLU C 1 198 ? 40.164  16.777 205.846 1.00 180.24 ? 217 GLU C CG     1 
ATOM   7392  C  CD     . GLU C 1 198 ? 40.993  17.915 205.290 1.00 184.09 ? 217 GLU C CD     1 
ATOM   7393  O  OE1    . GLU C 1 198 ? 42.234  17.869 205.427 1.00 188.34 ? 217 GLU C OE1    1 
ATOM   7394  O  OE2    . GLU C 1 198 ? 40.402  18.856 204.718 1.00 196.01 ? 217 GLU C OE2    1 
ATOM   7395  H  H      . GLU C 1 198 ? 41.925  13.707 207.528 1.00 229.10 ? 217 GLU C H      1 
ATOM   7396  H  HA     . GLU C 1 198 ? 39.691  15.004 207.954 1.00 225.32 ? 217 GLU C HA     1 
ATOM   7397  H  HB2    . GLU C 1 198 ? 41.526  16.193 207.241 1.00 218.06 ? 217 GLU C HB2    1 
ATOM   7398  H  HB3    . GLU C 1 198 ? 41.605  15.340 205.906 1.00 218.06 ? 217 GLU C HB3    1 
ATOM   7399  H  HG2    . GLU C 1 198 ? 39.699  16.355 205.107 1.00 216.28 ? 217 GLU C HG2    1 
ATOM   7400  H  HG3    . GLU C 1 198 ? 39.524  17.149 206.473 1.00 216.28 ? 217 GLU C HG3    1 
ATOM   7401  N  N      . ARG C 1 199 ? 37.944  14.048 206.545 1.00 173.59 ? 218 ARG C N      1 
ATOM   7402  C  CA     . ARG C 1 199 ? 36.914  13.479 205.686 1.00 173.85 ? 218 ARG C CA     1 
ATOM   7403  C  C      . ARG C 1 199 ? 36.419  14.549 204.720 1.00 180.47 ? 218 ARG C C      1 
ATOM   7404  O  O      . ARG C 1 199 ? 35.894  15.583 205.147 1.00 187.61 ? 218 ARG C O      1 
ATOM   7405  C  CB     . ARG C 1 199 ? 35.758  12.930 206.520 1.00 173.01 ? 218 ARG C CB     1 
ATOM   7406  H  H      . ARG C 1 199 ? 37.637  14.413 207.260 1.00 208.30 ? 218 ARG C H      1 
ATOM   7407  H  HA     . ARG C 1 199 ? 37.291  12.751 205.168 1.00 208.62 ? 218 ARG C HA     1 
ATOM   7408  N  N      . CYS C 1 200 ? 36.592  14.302 203.422 1.00 176.61 ? 219 CYS C N      1 
ATOM   7409  C  CA     . CYS C 1 200 ? 36.119  15.199 202.366 1.00 185.66 ? 219 CYS C CA     1 
ATOM   7410  C  C      . CYS C 1 200 ? 35.404  14.338 201.329 1.00 189.31 ? 219 CYS C C      1 
ATOM   7411  O  O      . CYS C 1 200 ? 36.008  13.912 200.340 1.00 209.52 ? 219 CYS C O      1 
ATOM   7412  C  CB     . CYS C 1 200 ? 37.271  15.989 201.753 1.00 201.06 ? 219 CYS C CB     1 
ATOM   7413  S  SG     . CYS C 1 200 ? 38.051  17.161 202.887 1.00 203.37 ? 219 CYS C SG     1 
ATOM   7414  H  H      . CYS C 1 200 ? 36.992  13.603 203.120 1.00 211.93 ? 219 CYS C H      1 
ATOM   7415  H  HA     . CYS C 1 200 ? 35.479  15.827 202.737 1.00 222.79 ? 219 CYS C HA     1 
ATOM   7416  H  HB2    . CYS C 1 200 ? 37.953  15.366 201.457 1.00 241.27 ? 219 CYS C HB2    1 
ATOM   7417  H  HB3    . CYS C 1 200 ? 36.935  16.491 200.994 1.00 241.27 ? 219 CYS C HB3    1 
ATOM   7418  H  HG     . CYS C 1 200 ? 38.939  17.729 202.312 1.00 244.05 ? 219 CYS C HG     1 
ATOM   7419  N  N      . PHE C 1 201 ? 34.116  14.083 201.558 1.00 178.17 ? 220 PHE C N      1 
ATOM   7420  C  CA     . PHE C 1 201 ? 33.338  13.220 200.678 1.00 188.02 ? 220 PHE C CA     1 
ATOM   7421  C  C      . PHE C 1 201 ? 32.020  13.880 200.295 1.00 174.08 ? 220 PHE C C      1 
ATOM   7422  O  O      . PHE C 1 201 ? 31.827  15.079 200.520 1.00 178.51 ? 220 PHE C O      1 
ATOM   7423  C  CB     . PHE C 1 201 ? 33.076  11.872 201.352 1.00 207.38 ? 220 PHE C CB     1 
ATOM   7424  H  H      . PHE C 1 201 ? 33.670  14.400 202.221 1.00 213.80 ? 220 PHE C H      1 
ATOM   7425  H  HA     . PHE C 1 201 ? 33.841  13.059 199.865 1.00 225.62 ? 220 PHE C HA     1 
ATOM   7426  N  N      . ILE C 1 202 ? 31.112  13.103 199.711 1.00 172.16 ? 221 ILE C N      1 
ATOM   7427  C  CA     . ILE C 1 202 ? 29.790  13.577 199.320 1.00 169.87 ? 221 ILE C CA     1 
ATOM   7428  C  C      . ILE C 1 202 ? 28.759  12.656 199.954 1.00 175.66 ? 221 ILE C C      1 
ATOM   7429  O  O      . ILE C 1 202 ? 28.778  11.441 199.721 1.00 184.69 ? 221 ILE C O      1 
ATOM   7430  C  CB     . ILE C 1 202 ? 29.624  13.612 197.793 1.00 182.53 ? 221 ILE C CB     1 
ATOM   7431  H  H      . ILE C 1 202 ? 31.244  12.273 199.526 1.00 206.60 ? 221 ILE C H      1 
ATOM   7432  H  HA     . ILE C 1 202 ? 29.654  14.474 199.664 1.00 203.85 ? 221 ILE C HA     1 
ATOM   7433  N  N      . CYS C 1 203 ? 27.866  13.233 200.757 1.00 189.78 ? 222 CYS C N      1 
ATOM   7434  C  CA     . CYS C 1 203 ? 26.800  12.491 201.415 1.00 163.33 ? 222 CYS C CA     1 
ATOM   7435  C  C      . CYS C 1 203 ? 25.472  13.181 201.144 1.00 170.51 ? 222 CYS C C      1 
ATOM   7436  O  O      . CYS C 1 203 ? 25.392  14.413 201.137 1.00 155.55 ? 222 CYS C O      1 
ATOM   7437  C  CB     . CYS C 1 203 ? 27.043  12.386 202.926 1.00 149.36 ? 222 CYS C CB     1 
ATOM   7438  H  H      . CYS C 1 203 ? 27.860  14.073 200.938 1.00 227.73 ? 222 CYS C H      1 
ATOM   7439  H  HA     . CYS C 1 203 ? 26.759  11.593 201.050 1.00 196.00 ? 222 CYS C HA     1 
ATOM   7440  N  N      . ARG C 1 204 ? 24.431  12.382 200.923 1.00 167.82 ? 223 ARG C N      1 
ATOM   7441  C  CA     . ARG C 1 204 ? 23.119  12.901 200.559 1.00 156.44 ? 223 ARG C CA     1 
ATOM   7442  C  C      . ARG C 1 204 ? 22.306  13.175 201.819 1.00 172.07 ? 223 ARG C C      1 
ATOM   7443  O  O      . ARG C 1 204 ? 22.057  12.263 202.615 1.00 157.23 ? 223 ARG C O      1 
ATOM   7444  C  CB     . ARG C 1 204 ? 22.385  11.914 199.653 1.00 162.08 ? 223 ARG C CB     1 
ATOM   7445  H  H      . ARG C 1 204 ? 24.462  11.525 200.978 1.00 201.38 ? 223 ARG C H      1 
ATOM   7446  H  HA     . ARG C 1 204 ? 23.226  13.736 200.077 1.00 187.73 ? 223 ARG C HA     1 
ATOM   7447  N  N      . LEU C 1 205 ? 21.890  14.428 201.991 1.00 180.80 ? 224 LEU C N      1 
ATOM   7448  C  CA     . LEU C 1 205 ? 21.083  14.843 203.127 1.00 137.30 ? 224 LEU C CA     1 
ATOM   7449  C  C      . LEU C 1 205 ? 19.656  15.132 202.678 1.00 137.98 ? 224 LEU C C      1 
ATOM   7450  O  O      . LEU C 1 205 ? 19.434  15.712 201.611 1.00 140.09 ? 224 LEU C O      1 
ATOM   7451  C  CB     . LEU C 1 205 ? 21.679  16.084 203.796 1.00 123.06 ? 224 LEU C CB     1 
ATOM   7452  H  H      . LEU C 1 205 ? 22.069  15.069 201.446 1.00 216.96 ? 224 LEU C H      1 
ATOM   7453  H  HA     . LEU C 1 205 ? 21.057  14.127 203.781 1.00 164.75 ? 224 LEU C HA     1 
ATOM   7454  N  N      . ARG C 1 206 ? 18.694  14.718 203.498 1.00 137.11 ? 225 ARG C N      1 
ATOM   7455  C  CA     . ARG C 1 206 ? 17.285  14.975 203.236 1.00 126.79 ? 225 ARG C CA     1 
ATOM   7456  C  C      . ARG C 1 206 ? 17.020  16.479 203.191 1.00 118.37 ? 225 ARG C C      1 
ATOM   7457  O  O      . ARG C 1 206 ? 17.796  17.288 203.705 1.00 121.83 ? 225 ARG C O      1 
ATOM   7458  C  CB     . ARG C 1 206 ? 16.436  14.294 204.312 1.00 134.34 ? 225 ARG C CB     1 
ATOM   7459  C  CG     . ARG C 1 206 ? 14.959  14.678 204.386 1.00 148.01 ? 225 ARG C CG     1 
ATOM   7460  C  CD     . ARG C 1 206 ? 14.129  13.998 203.312 1.00 119.05 ? 225 ARG C CD     1 
ATOM   7461  N  NE     . ARG C 1 206 ? 12.843  13.568 203.854 1.00 131.58 ? 225 ARG C NE     1 
ATOM   7462  C  CZ     . ARG C 1 206 ? 12.689  12.555 204.702 1.00 148.69 ? 225 ARG C CZ     1 
ATOM   7463  N  NH1    . ARG C 1 206 ? 11.481  12.239 205.148 1.00 152.42 ? 225 ARG C NH1    1 
ATOM   7464  N  NH2    . ARG C 1 206 ? 13.743  11.860 205.113 1.00 156.12 ? 225 ARG C NH2    1 
ATOM   7465  H  H      . ARG C 1 206 ? 18.837  14.280 204.224 1.00 164.54 ? 225 ARG C H      1 
ATOM   7466  H  HA     . ARG C 1 206 ? 17.045  14.598 202.375 1.00 152.15 ? 225 ARG C HA     1 
ATOM   7467  H  HB2    . ARG C 1 206 ? 16.474  13.336 204.163 1.00 161.21 ? 225 ARG C HB2    1 
ATOM   7468  H  HB3    . ARG C 1 206 ? 16.826  14.497 205.177 1.00 161.21 ? 225 ARG C HB3    1 
ATOM   7469  H  HG2    . ARG C 1 206 ? 14.606  14.415 205.251 1.00 177.62 ? 225 ARG C HG2    1 
ATOM   7470  H  HG3    . ARG C 1 206 ? 14.874  15.637 204.270 1.00 177.62 ? 225 ARG C HG3    1 
ATOM   7471  H  HD2    . ARG C 1 206 ? 13.964  14.621 202.587 1.00 142.86 ? 225 ARG C HD2    1 
ATOM   7472  H  HD3    . ARG C 1 206 ? 14.601  13.216 202.985 1.00 142.86 ? 225 ARG C HD3    1 
ATOM   7473  H  HE     . ARG C 1 206 ? 12.139  13.994 203.603 1.00 157.89 ? 225 ARG C HE     1 
ATOM   7474  H  HH11   . ARG C 1 206 ? 10.794  12.686 204.885 1.00 182.90 ? 225 ARG C HH11   1 
ATOM   7475  H  HH12   . ARG C 1 206 ? 11.382  11.583 205.696 1.00 182.90 ? 225 ARG C HH12   1 
ATOM   7476  H  HH21   . ARG C 1 206 ? 14.529  12.062 204.829 1.00 187.35 ? 225 ARG C HH21   1 
ATOM   7477  H  HH22   . ARG C 1 206 ? 13.639  11.206 205.662 1.00 187.35 ? 225 ARG C HH22   1 
ATOM   7478  N  N      . CYS C 1 207 ? 15.914  16.853 202.549 1.00 127.13 ? 226 CYS C N      1 
ATOM   7479  C  CA     . CYS C 1 207 ? 15.560  18.262 202.438 1.00 140.43 ? 226 CYS C CA     1 
ATOM   7480  C  C      . CYS C 1 207 ? 14.095  18.410 202.056 1.00 139.25 ? 226 CYS C C      1 
ATOM   7481  O  O      . CYS C 1 207 ? 13.449  17.460 201.603 1.00 165.09 ? 226 CYS C O      1 
ATOM   7482  C  CB     . CYS C 1 207 ? 16.435  18.979 201.406 1.00 142.33 ? 226 CYS C CB     1 
ATOM   7483  S  SG     . CYS C 1 207 ? 15.850  20.644 200.980 1.00 152.16 ? 226 CYS C SG     1 
ATOM   7484  H  H      . CYS C 1 207 ? 15.359  16.315 202.172 1.00 152.55 ? 226 CYS C H      1 
ATOM   7485  H  HA     . CYS C 1 207 ? 15.693  18.692 203.297 1.00 168.52 ? 226 CYS C HA     1 
ATOM   7486  H  HB2    . CYS C 1 207 ? 17.333  19.062 201.762 1.00 170.80 ? 226 CYS C HB2    1 
ATOM   7487  H  HB3    . CYS C 1 207 ? 16.451  18.453 200.591 1.00 170.80 ? 226 CYS C HB3    1 
ATOM   7488  H  HG     . CYS C 1 207 ? 16.594  21.124 200.170 1.00 182.59 ? 226 CYS C HG     1 
ATOM   7489  N  N      . LEU C 1 208 ? 13.581  19.622 202.261 1.00 127.27 ? 227 LEU C N      1 
ATOM   7490  C  CA     . LEU C 1 208 ? 12.273  20.008 201.747 1.00 150.87 ? 227 LEU C CA     1 
ATOM   7491  C  C      . LEU C 1 208 ? 12.264  21.490 201.400 1.00 154.56 ? 227 LEU C C      1 
ATOM   7492  O  O      . LEU C 1 208 ? 12.412  21.864 200.237 1.00 128.16 ? 227 LEU C O      1 
ATOM   7493  C  CB     . LEU C 1 208 ? 11.168  19.708 202.760 1.00 130.88 ? 227 LEU C CB     1 
ATOM   7494  C  CG     . LEU C 1 208 ? 9.881   19.107 202.184 1.00 134.24 ? 227 LEU C CG     1 
ATOM   7495  C  CD1    . LEU C 1 208 ? 9.229   20.047 201.177 1.00 137.81 ? 227 LEU C CD1    1 
ATOM   7496  C  CD2    . LEU C 1 208 ? 10.160  17.745 201.551 1.00 156.65 ? 227 LEU C CD2    1 
ATOM   7497  H  H      . LEU C 1 208 ? 13.978  20.245 202.701 1.00 152.72 ? 227 LEU C H      1 
ATOM   7498  H  HA     . LEU C 1 208 ? 12.087  19.506 200.938 1.00 181.05 ? 227 LEU C HA     1 
ATOM   7499  H  HB2    . LEU C 1 208 ? 11.514  19.080 203.413 1.00 157.06 ? 227 LEU C HB2    1 
ATOM   7500  H  HB3    . LEU C 1 208 ? 10.927  20.536 203.204 1.00 157.06 ? 227 LEU C HB3    1 
ATOM   7501  H  HG     . LEU C 1 208 ? 9.251   18.970 202.909 1.00 161.08 ? 227 LEU C HG     1 
ATOM   7502  H  HD11   . LEU C 1 208 ? 8.420   19.632 200.836 1.00 165.37 ? 227 LEU C HD11   1 
ATOM   7503  H  HD12   . LEU C 1 208 ? 9.011   20.882 201.620 1.00 165.37 ? 227 LEU C HD12   1 
ATOM   7504  H  HD13   . LEU C 1 208 ? 9.849   20.209 200.449 1.00 165.37 ? 227 LEU C HD13   1 
ATOM   7505  H  HD21   . LEU C 1 208 ? 9.332   17.387 201.194 1.00 187.98 ? 227 LEU C HD21   1 
ATOM   7506  H  HD22   . LEU C 1 208 ? 10.807  17.857 200.836 1.00 187.98 ? 227 LEU C HD22   1 
ATOM   7507  H  HD23   . LEU C 1 208 ? 10.515  17.149 202.229 1.00 187.98 ? 227 LEU C HD23   1 
ATOM   7508  N  N      . PHE C 1 215 ? 16.342  13.748 200.125 1.00 134.63 ? 234 PHE C N      1 
ATOM   7509  C  CA     . PHE C 1 215 ? 16.172  14.097 198.722 1.00 143.54 ? 234 PHE C CA     1 
ATOM   7510  C  C      . PHE C 1 215 ? 17.385  14.873 198.210 1.00 153.46 ? 234 PHE C C      1 
ATOM   7511  O  O      . PHE C 1 215 ? 18.446  14.289 197.996 1.00 195.46 ? 234 PHE C O      1 
ATOM   7512  C  CB     . PHE C 1 215 ? 14.894  14.913 198.522 1.00 163.23 ? 234 PHE C CB     1 
ATOM   7513  H  HA     . PHE C 1 215 ? 16.094  13.283 198.200 1.00 172.25 ? 234 PHE C HA     1 
ATOM   7514  N  N      . LEU C 1 216 ? 17.231  16.182 198.019 1.00 141.75 ? 235 LEU C N      1 
ATOM   7515  C  CA     . LEU C 1 216 ? 18.302  17.003 197.465 1.00 149.69 ? 235 LEU C CA     1 
ATOM   7516  C  C      . LEU C 1 216 ? 19.600  16.777 198.225 1.00 159.07 ? 235 LEU C C      1 
ATOM   7517  O  O      . LEU C 1 216 ? 19.691  17.065 199.422 1.00 159.40 ? 235 LEU C O      1 
ATOM   7518  C  CB     . LEU C 1 216 ? 17.902  18.480 197.517 1.00 167.54 ? 235 LEU C CB     1 
ATOM   7519  H  H      . LEU C 1 216 ? 16.513  16.618 198.202 1.00 170.10 ? 235 LEU C H      1 
ATOM   7520  H  HA     . LEU C 1 216 ? 18.445  16.759 196.537 1.00 179.63 ? 235 LEU C HA     1 
ATOM   7521  N  N      . ALA C 1 217 ? 20.604  16.264 197.523 1.00 177.00 ? 236 ALA C N      1 
ATOM   7522  C  CA     . ALA C 1 217 ? 21.880  15.910 198.122 1.00 166.10 ? 236 ALA C CA     1 
ATOM   7523  C  C      . ALA C 1 217 ? 22.914  16.993 197.842 1.00 153.42 ? 236 ALA C C      1 
ATOM   7524  O  O      . ALA C 1 217 ? 22.783  17.791 196.909 1.00 163.28 ? 236 ALA C O      1 
ATOM   7525  C  CB     . ALA C 1 217 ? 22.382  14.568 197.588 1.00 170.77 ? 236 ALA C CB     1 
ATOM   7526  H  H      . ALA C 1 217 ? 20.567  16.108 196.678 1.00 212.40 ? 236 ALA C H      1 
ATOM   7527  H  HA     . ALA C 1 217 ? 21.772  15.834 199.083 1.00 199.32 ? 236 ALA C HA     1 
ATOM   7528  H  HB1    . ALA C 1 217 ? 23.232  14.360 198.006 1.00 204.93 ? 236 ALA C HB1    1 
ATOM   7529  H  HB2    . ALA C 1 217 ? 21.731  13.880 197.803 1.00 204.93 ? 236 ALA C HB2    1 
ATOM   7530  H  HB3    . ALA C 1 217 ? 22.491  14.631 196.627 1.00 204.93 ? 236 ALA C HB3    1 
ATOM   7531  N  N      . MET C 1 218 ? 23.953  17.007 198.672 1.00 161.86 ? 237 MET C N      1 
ATOM   7532  C  CA     . MET C 1 218 ? 25.020  17.986 198.545 1.00 160.19 ? 237 MET C CA     1 
ATOM   7533  C  C      . MET C 1 218 ? 26.251  17.435 199.254 1.00 160.16 ? 237 MET C C      1 
ATOM   7534  O  O      . MET C 1 218 ? 26.130  16.784 200.296 1.00 184.64 ? 237 MET C O      1 
ATOM   7535  C  CB     . MET C 1 218 ? 24.599  19.329 199.142 1.00 173.99 ? 237 MET C CB     1 
ATOM   7536  H  H      . MET C 1 218 ? 24.062  16.454 199.321 1.00 194.24 ? 237 MET C H      1 
ATOM   7537  H  HA     . MET C 1 218 ? 25.223  18.120 197.606 1.00 192.22 ? 237 MET C HA     1 
ATOM   7538  N  N      . ASN C 1 219 ? 27.425  17.683 198.680 1.00 181.58 ? 238 ASN C N      1 
ATOM   7539  C  CA     . ASN C 1 219 ? 28.680  17.222 199.255 1.00 185.20 ? 238 ASN C CA     1 
ATOM   7540  C  C      . ASN C 1 219 ? 29.300  18.309 200.123 1.00 160.06 ? 238 ASN C C      1 
ATOM   7541  O  O      . ASN C 1 219 ? 29.109  19.506 199.888 1.00 154.52 ? 238 ASN C O      1 
ATOM   7542  C  CB     . ASN C 1 219 ? 29.659  16.814 198.154 1.00 187.89 ? 238 ASN C CB     1 
ATOM   7543  H  H      . ASN C 1 219 ? 27.520  18.123 197.947 1.00 217.89 ? 238 ASN C H      1 
ATOM   7544  H  HA     . ASN C 1 219 ? 28.510  16.447 199.813 1.00 222.24 ? 238 ASN C HA     1 
ATOM   7545  N  N      . PHE C 1 220 ? 30.063  17.881 201.128 1.00 155.28 ? 239 PHE C N      1 
ATOM   7546  C  CA     . PHE C 1 220 ? 30.658  18.796 202.092 1.00 154.04 ? 239 PHE C CA     1 
ATOM   7547  C  C      . PHE C 1 220 ? 32.113  18.412 202.313 1.00 159.48 ? 239 PHE C C      1 
ATOM   7548  O  O      . PHE C 1 220 ? 32.616  17.441 201.740 1.00 200.31 ? 239 PHE C O      1 
ATOM   7549  C  CB     . PHE C 1 220 ? 29.889  18.783 203.419 1.00 174.20 ? 239 PHE C CB     1 
ATOM   7550  H  H      . PHE C 1 220 ? 30.251  17.054 201.272 1.00 186.34 ? 239 PHE C H      1 
ATOM   7551  H  HA     . PHE C 1 220 ? 30.633  19.697 201.736 1.00 184.85 ? 239 PHE C HA     1 
ATOM   7552  N  N      . GLN C 1 221 ? 32.795  19.175 203.164 1.00 152.36 ? 240 GLN C N      1 
ATOM   7553  C  CA     . GLN C 1 221 ? 34.192  18.893 203.450 1.00 179.31 ? 240 GLN C CA     1 
ATOM   7554  C  C      . GLN C 1 221 ? 34.518  19.436 204.831 1.00 162.99 ? 240 GLN C C      1 
ATOM   7555  O  O      . GLN C 1 221 ? 33.959  20.449 205.257 1.00 152.27 ? 240 GLN C O      1 
ATOM   7556  C  CB     . GLN C 1 221 ? 35.109  19.509 202.388 1.00 192.75 ? 240 GLN C CB     1 
ATOM   7557  H  H      . GLN C 1 221 ? 32.473  19.854 203.583 1.00 182.84 ? 240 GLN C H      1 
ATOM   7558  H  HA     . GLN C 1 221 ? 34.332  17.934 203.456 1.00 215.17 ? 240 GLN C HA     1 
ATOM   7559  N  N      . GLY C 1 222 ? 35.410  18.744 205.534 1.00 171.82 ? 241 GLY C N      1 
ATOM   7560  C  CA     . GLY C 1 222 ? 35.768  19.148 206.881 1.00 160.20 ? 241 GLY C CA     1 
ATOM   7561  C  C      . GLY C 1 222 ? 36.940  18.362 207.420 1.00 164.50 ? 241 GLY C C      1 
ATOM   7562  O  O      . GLY C 1 222 ? 37.217  17.240 206.985 1.00 181.72 ? 241 GLY C O      1 
ATOM   7563  H  H      . GLY C 1 222 ? 35.819  18.041 205.253 1.00 206.18 ? 241 GLY C H      1 
ATOM   7564  H  HA2    . GLY C 1 222 ? 35.999  20.090 206.886 1.00 192.24 ? 241 GLY C HA2    1 
ATOM   7565  H  HA3    . GLY C 1 222 ? 35.010  19.014 207.471 1.00 192.24 ? 241 GLY C HA3    1 
ATOM   7566  N  N      . LYS C 1 223 ? 37.610  18.962 208.406 1.00 153.79 ? 242 LYS C N      1 
ATOM   7567  C  CA     . LYS C 1 223 ? 38.766  18.368 209.072 1.00 163.19 ? 242 LYS C CA     1 
ATOM   7568  C  C      . LYS C 1 223 ? 38.371  18.001 210.499 1.00 158.98 ? 242 LYS C C      1 
ATOM   7569  O  O      . LYS C 1 223 ? 38.139  18.884 211.330 1.00 157.24 ? 242 LYS C O      1 
ATOM   7570  C  CB     . LYS C 1 223 ? 39.949  19.334 209.063 1.00 163.93 ? 242 LYS C CB     1 
ATOM   7571  H  H      . LYS C 1 223 ? 37.404  19.739 208.714 1.00 184.54 ? 242 LYS C H      1 
ATOM   7572  H  HA     . LYS C 1 223 ? 39.027  17.558 208.606 1.00 195.82 ? 242 LYS C HA     1 
ATOM   7573  N  N      . LEU C 1 224 ? 38.304  16.699 210.781 1.00 173.56 ? 243 LEU C N      1 
ATOM   7574  C  CA     . LEU C 1 224 ? 37.985  16.223 212.121 1.00 140.80 ? 243 LEU C CA     1 
ATOM   7575  C  C      . LEU C 1 224 ? 38.903  16.883 213.142 1.00 138.00 ? 243 LEU C C      1 
ATOM   7576  O  O      . LEU C 1 224 ? 39.973  17.387 212.786 1.00 144.44 ? 243 LEU C O      1 
ATOM   7577  C  CB     . LEU C 1 224 ? 38.109  14.700 212.195 1.00 138.62 ? 243 LEU C CB     1 
ATOM   7578  H  H      . LEU C 1 224 ? 38.439  16.071 210.209 1.00 208.27 ? 243 LEU C H      1 
ATOM   7579  H  HA     . LEU C 1 224 ? 37.070  16.463 212.336 1.00 168.96 ? 243 LEU C HA     1 
ATOM   7580  N  N      . LYS C 1 225 ? 38.499  16.888 214.408 1.00 144.99 ? 244 LYS C N      1 
ATOM   7581  C  CA     . LYS C 1 225 ? 39.245  17.586 215.449 1.00 152.17 ? 244 LYS C CA     1 
ATOM   7582  C  C      . LYS C 1 225 ? 39.071  16.835 216.765 1.00 149.55 ? 244 LYS C C      1 
ATOM   7583  O  O      . LYS C 1 225 ? 38.470  15.757 216.813 1.00 144.80 ? 244 LYS C O      1 
ATOM   7584  C  CB     . LYS C 1 225 ? 38.782  19.044 215.563 1.00 144.46 ? 244 LYS C CB     1 
ATOM   7585  H  H      . LYS C 1 225 ? 37.791  16.492 214.692 1.00 173.99 ? 244 LYS C H      1 
ATOM   7586  H  HA     . LYS C 1 225 ? 40.188  17.585 215.221 1.00 182.60 ? 244 LYS C HA     1 
ATOM   7587  N  N      . TYR C 1 226 ? 39.607  17.413 217.837 1.00 153.22 ? 245 TYR C N      1 
ATOM   7588  C  CA     . TYR C 1 226 ? 39.572  16.818 219.165 1.00 156.06 ? 245 TYR C CA     1 
ATOM   7589  C  C      . TYR C 1 226 ? 38.546  17.533 220.031 1.00 138.20 ? 245 TYR C C      1 
ATOM   7590  O  O      . TYR C 1 226 ? 38.483  18.767 220.049 1.00 138.02 ? 245 TYR C O      1 
ATOM   7591  C  CB     . TYR C 1 226 ? 40.948  16.886 219.831 1.00 145.00 ? 245 TYR C CB     1 
ATOM   7592  H  H      . TYR C 1 226 ? 40.007  18.174 217.817 1.00 183.87 ? 245 TYR C H      1 
ATOM   7593  H  HA     . TYR C 1 226 ? 39.313  15.886 219.093 1.00 187.27 ? 245 TYR C HA     1 
ATOM   7594  N  N      . LEU C 1 227 ? 37.765  16.753 220.763 1.00 132.80 ? 246 LEU C N      1 
ATOM   7595  C  CA     . LEU C 1 227 ? 36.639  17.263 221.525 1.00 134.20 ? 246 LEU C CA     1 
ATOM   7596  C  C      . LEU C 1 227 ? 37.031  17.406 222.992 1.00 119.66 ? 246 LEU C C      1 
ATOM   7597  O  O      . LEU C 1 227 ? 37.998  16.794 223.453 1.00 148.23 ? 246 LEU C O      1 
ATOM   7598  C  CB     . LEU C 1 227 ? 35.443  16.315 221.359 1.00 128.62 ? 246 LEU C CB     1 
ATOM   7599  C  CG     . LEU C 1 227 ? 33.995  16.792 221.531 1.00 115.66 ? 246 LEU C CG     1 
ATOM   7600  C  CD1    . LEU C 1 227 ? 33.531  16.661 222.980 1.00 135.62 ? 246 LEU C CD1    1 
ATOM   7601  C  CD2    . LEU C 1 227 ? 33.794  18.216 221.016 1.00 103.66 ? 246 LEU C CD2    1 
ATOM   7602  H  H      . LEU C 1 227 ? 37.871  15.903 220.836 1.00 159.35 ? 246 LEU C H      1 
ATOM   7603  H  HA     . LEU C 1 227 ? 36.388  18.137 221.187 1.00 161.04 ? 246 LEU C HA     1 
ATOM   7604  H  HB2    . LEU C 1 227 ? 35.498  15.945 220.465 1.00 154.35 ? 246 LEU C HB2    1 
ATOM   7605  H  HB3    . LEU C 1 227 ? 35.564  15.594 221.996 1.00 154.35 ? 246 LEU C HB3    1 
ATOM   7606  H  HG     . LEU C 1 227 ? 33.426  16.215 220.998 1.00 138.79 ? 246 LEU C HG     1 
ATOM   7607  H  HD11   . LEU C 1 227 ? 32.614  16.971 223.047 1.00 162.75 ? 246 LEU C HD11   1 
ATOM   7608  H  HD12   . LEU C 1 227 ? 33.586  15.730 223.246 1.00 162.75 ? 246 LEU C HD12   1 
ATOM   7609  H  HD13   . LEU C 1 227 ? 34.105  17.201 223.545 1.00 162.75 ? 246 LEU C HD13   1 
ATOM   7610  H  HD21   . LEU C 1 227 ? 32.867  18.470 221.146 1.00 124.39 ? 246 LEU C HD21   1 
ATOM   7611  H  HD22   . LEU C 1 227 ? 34.374  18.815 221.511 1.00 124.39 ? 246 LEU C HD22   1 
ATOM   7612  H  HD23   . LEU C 1 227 ? 34.016  18.244 220.072 1.00 124.39 ? 246 LEU C HD23   1 
ATOM   7613  N  N      . HIS C 1 228 ? 36.272  18.219 223.727 1.00 108.56 ? 247 HIS C N      1 
ATOM   7614  C  CA     . HIS C 1 228 ? 36.570  18.462 225.128 1.00 114.61 ? 247 HIS C CA     1 
ATOM   7615  C  C      . HIS C 1 228 ? 35.276  18.825 225.841 1.00 116.91 ? 247 HIS C C      1 
ATOM   7616  O  O      . HIS C 1 228 ? 34.178  18.739 225.279 1.00 87.62  ? 247 HIS C O      1 
ATOM   7617  C  CB     . HIS C 1 228 ? 37.626  19.560 225.287 1.00 122.83 ? 247 HIS C CB     1 
ATOM   7618  H  H      . HIS C 1 228 ? 35.581  18.639 223.434 1.00 130.27 ? 247 HIS C H      1 
ATOM   7619  H  HA     . HIS C 1 228 ? 36.918  17.649 225.526 1.00 137.53 ? 247 HIS C HA     1 
ATOM   7620  N  N      . GLY C 1 229 ? 35.420  19.214 227.103 1.00 60.99  ? 248 GLY C N      1 
ATOM   7621  C  CA     . GLY C 1 229 ? 34.328  19.788 227.868 1.00 60.61  ? 248 GLY C CA     1 
ATOM   7622  C  C      . GLY C 1 229 ? 33.690  18.811 228.829 1.00 71.48  ? 248 GLY C C      1 
ATOM   7623  O  O      . GLY C 1 229 ? 34.263  18.472 229.867 1.00 70.37  ? 248 GLY C O      1 
ATOM   7624  H  H      . GLY C 1 229 ? 36.155  19.152 227.544 1.00 73.18  ? 248 GLY C H      1 
ATOM   7625  H  HA2    . GLY C 1 229 ? 34.658  20.544 228.378 1.00 72.73  ? 248 GLY C HA2    1 
ATOM   7626  H  HA3    . GLY C 1 229 ? 33.644  20.106 227.259 1.00 72.73  ? 248 GLY C HA3    1 
ATOM   7627  N  N      . GLN C 1 230 ? 32.498  18.347 228.473 1.00 69.60  ? 249 GLN C N      1 
ATOM   7628  C  CA     . GLN C 1 230 ? 31.704  17.507 229.360 1.00 73.41  ? 249 GLN C CA     1 
ATOM   7629  C  C      . GLN C 1 230 ? 32.410  16.195 229.712 1.00 45.73  ? 249 GLN C C      1 
ATOM   7630  O  O      . GLN C 1 230 ? 33.118  15.589 228.895 1.00 51.01  ? 249 GLN C O      1 
ATOM   7631  C  CB     . GLN C 1 230 ? 30.351  17.206 228.712 1.00 58.17  ? 249 GLN C CB     1 
ATOM   7632  H  H      . GLN C 1 230 ? 32.124  18.505 227.715 1.00 83.53  ? 249 GLN C H      1 
ATOM   7633  H  HA     . GLN C 1 230 ? 31.540  17.988 230.186 1.00 88.10  ? 249 GLN C HA     1 
ATOM   7634  N  N      . LYS C 1 231 ? 32.193  15.751 230.952 1.00 73.64  ? 250 LYS C N      1 
ATOM   7635  C  CA     . LYS C 1 231 ? 32.656  14.437 231.384 1.00 119.79 ? 250 LYS C CA     1 
ATOM   7636  C  C      . LYS C 1 231 ? 31.682  13.416 230.809 1.00 121.12 ? 250 LYS C C      1 
ATOM   7637  O  O      . LYS C 1 231 ? 30.705  13.026 231.453 1.00 94.57  ? 250 LYS C O      1 
ATOM   7638  C  CB     . LYS C 1 231 ? 32.727  14.362 232.903 1.00 79.07  ? 250 LYS C CB     1 
ATOM   7639  H  H      . LYS C 1 231 ? 31.779  16.195 231.561 1.00 88.37  ? 250 LYS C H      1 
ATOM   7640  H  HA     . LYS C 1 231 ? 33.539  14.265 231.021 1.00 143.75 ? 250 LYS C HA     1 
ATOM   7641  N  N      . LYS C 1 232 ? 31.929  13.001 229.569 1.00 115.56 ? 251 LYS C N      1 
ATOM   7642  C  CA     . LYS C 1 232 ? 31.093  11.995 228.923 1.00 118.82 ? 251 LYS C CA     1 
ATOM   7643  C  C      . LYS C 1 232 ? 31.611  10.604 229.260 1.00 121.30 ? 251 LYS C C      1 
ATOM   7644  O  O      . LYS C 1 232 ? 32.519  10.459 230.078 1.00 96.85  ? 251 LYS C O      1 
ATOM   7645  C  CB     . LYS C 1 232 ? 31.061  12.199 227.407 1.00 97.60  ? 251 LYS C CB     1 
ATOM   7646  H  H      . LYS C 1 232 ? 32.576  13.288 229.080 1.00 138.67 ? 251 LYS C H      1 
ATOM   7647  H  HA     . LYS C 1 232 ? 30.186  12.070 229.258 1.00 142.58 ? 251 LYS C HA     1 
ATOM   7648  N  N      . ASP C 1 236 ? 34.890  1.353  231.892 1.00 146.22 ? 255 ASP C N      1 
ATOM   7649  C  CA     . ASP C 1 236 ? 33.868  2.392  231.874 1.00 149.89 ? 255 ASP C CA     1 
ATOM   7650  C  C      . ASP C 1 236 ? 33.487  2.807  233.291 1.00 148.66 ? 255 ASP C C      1 
ATOM   7651  O  O      . ASP C 1 236 ? 34.001  2.264  234.270 1.00 112.75 ? 255 ASP C O      1 
ATOM   7652  C  CB     . ASP C 1 236 ? 32.629  1.912  231.113 1.00 120.51 ? 255 ASP C CB     1 
ATOM   7653  H  HA     . ASP C 1 236 ? 34.218  3.172  231.416 1.00 179.86 ? 255 ASP C HA     1 
ATOM   7654  N  N      . GLY C 1 237 ? 32.583  3.776  233.395 1.00 150.86 ? 256 GLY C N      1 
ATOM   7655  C  CA     . GLY C 1 237 ? 32.198  4.301  234.691 1.00 131.98 ? 256 GLY C CA     1 
ATOM   7656  C  C      . GLY C 1 237 ? 33.295  5.092  235.372 1.00 141.35 ? 256 GLY C C      1 
ATOM   7657  O  O      . GLY C 1 237 ? 33.347  5.139  236.605 1.00 143.74 ? 256 GLY C O      1 
ATOM   7658  H  H      . GLY C 1 237 ? 32.180  4.144  232.729 1.00 181.03 ? 256 GLY C H      1 
ATOM   7659  H  HA2    . GLY C 1 237 ? 31.428  4.881  234.585 1.00 158.38 ? 256 GLY C HA2    1 
ATOM   7660  H  HA3    . GLY C 1 237 ? 31.949  3.566  235.272 1.00 158.38 ? 256 GLY C HA3    1 
ATOM   7661  N  N      . SER C 1 238 ? 34.174  5.727  234.595 1.00 141.72 ? 257 SER C N      1 
ATOM   7662  C  CA     . SER C 1 238 ? 35.247  6.550  235.128 1.00 140.01 ? 257 SER C CA     1 
ATOM   7663  C  C      . SER C 1 238 ? 35.430  7.746  234.206 1.00 142.23 ? 257 SER C C      1 
ATOM   7664  O  O      . SER C 1 238 ? 34.833  7.831  233.130 1.00 129.51 ? 257 SER C O      1 
ATOM   7665  C  CB     . SER C 1 238 ? 36.559  5.767  235.263 1.00 127.94 ? 257 SER C CB     1 
ATOM   7666  H  H      . SER C 1 238 ? 34.164  5.692  233.736 1.00 170.07 ? 257 SER C H      1 
ATOM   7667  H  HA     . SER C 1 238 ? 34.996  6.877  236.006 1.00 168.01 ? 257 SER C HA     1 
ATOM   7668  N  N      . ILE C 1 239 ? 36.268  8.682  234.640 1.00 151.29 ? 258 ILE C N      1 
ATOM   7669  C  CA     . ILE C 1 239 ? 36.626  9.835  233.822 1.00 127.29 ? 258 ILE C CA     1 
ATOM   7670  C  C      . ILE C 1 239 ? 37.170  9.318  232.499 1.00 152.71 ? 258 ILE C C      1 
ATOM   7671  O  O      . ILE C 1 239 ? 38.227  8.674  232.457 1.00 139.36 ? 258 ILE C O      1 
ATOM   7672  C  CB     . ILE C 1 239 ? 37.656  10.733 234.531 1.00 117.98 ? 258 ILE C CB     1 
ATOM   7673  H  H      . ILE C 1 239 ? 36.646  8.671  235.412 1.00 181.55 ? 258 ILE C H      1 
ATOM   7674  H  HA     . ILE C 1 239 ? 35.831  10.362 233.643 1.00 152.75 ? 258 ILE C HA     1 
ATOM   7675  N  N      . LEU C 1 240 ? 36.455  9.600  231.413 1.00 159.48 ? 259 LEU C N      1 
ATOM   7676  C  CA     . LEU C 1 240 ? 36.815  9.083  230.104 1.00 153.16 ? 259 LEU C CA     1 
ATOM   7677  C  C      . LEU C 1 240 ? 37.386  10.203 229.251 1.00 114.87 ? 259 LEU C C      1 
ATOM   7678  O  O      . LEU C 1 240 ? 36.746  11.256 229.132 1.00 107.30 ? 259 LEU C O      1 
ATOM   7679  C  CB     . LEU C 1 240 ? 35.596  8.475  229.407 1.00 133.61 ? 259 LEU C CB     1 
ATOM   7680  H  H      . LEU C 1 240 ? 35.751  10.093 231.412 1.00 191.38 ? 259 LEU C H      1 
ATOM   7681  H  HA     . LEU C 1 240 ? 37.491  8.393  230.202 1.00 183.79 ? 259 LEU C HA     1 
ATOM   7682  N  N      . PRO C 1 241 ? 38.568  10.043 228.657 1.00 128.02 ? 260 PRO C N      1 
ATOM   7683  C  CA     . PRO C 1 241 ? 39.080  11.085 227.775 1.00 142.76 ? 260 PRO C CA     1 
ATOM   7684  C  C      . PRO C 1 241 ? 38.084  11.359 226.657 1.00 150.50 ? 260 PRO C C      1 
ATOM   7685  O  O      . PRO C 1 241 ? 37.306  10.470 226.276 1.00 146.99 ? 260 PRO C O      1 
ATOM   7686  C  CB     . PRO C 1 241 ? 40.385  10.488 227.233 1.00 151.88 ? 260 PRO C CB     1 
ATOM   7687  C  CG     . PRO C 1 241 ? 40.792  9.488  228.251 1.00 167.20 ? 260 PRO C CG     1 
ATOM   7688  C  CD     . PRO C 1 241 ? 39.518  8.929  228.796 1.00 152.47 ? 260 PRO C CD     1 
ATOM   7689  H  HA     . PRO C 1 241 ? 39.265  11.900 228.268 1.00 171.31 ? 260 PRO C HA     1 
ATOM   7690  H  HB2    . PRO C 1 241 ? 40.221  10.061 226.378 1.00 182.25 ? 260 PRO C HB2    1 
ATOM   7691  H  HB3    . PRO C 1 241 ? 41.055  11.185 227.148 1.00 182.25 ? 260 PRO C HB3    1 
ATOM   7692  H  HG2    . PRO C 1 241 ? 41.319  8.791  227.830 1.00 200.64 ? 260 PRO C HG2    1 
ATOM   7693  H  HG3    . PRO C 1 241 ? 41.300  9.926  228.952 1.00 200.64 ? 260 PRO C HG3    1 
ATOM   7694  H  HD2    . PRO C 1 241 ? 39.229  8.170  228.266 1.00 182.96 ? 260 PRO C HD2    1 
ATOM   7695  H  HD3    . PRO C 1 241 ? 39.626  8.690  229.730 1.00 182.96 ? 260 PRO C HD3    1 
ATOM   7696  N  N      . PRO C 1 242 ? 38.077  12.573 226.118 1.00 157.28 ? 261 PRO C N      1 
ATOM   7697  C  CA     . PRO C 1 242 ? 37.121  12.868 225.042 1.00 159.63 ? 261 PRO C CA     1 
ATOM   7698  C  C      . PRO C 1 242 ? 37.496  12.155 223.750 1.00 148.02 ? 261 PRO C C      1 
ATOM   7699  O  O      . PRO C 1 242 ? 38.671  12.051 223.391 1.00 141.11 ? 261 PRO C O      1 
ATOM   7700  C  CB     . PRO C 1 242 ? 37.210  14.393 224.889 1.00 156.44 ? 261 PRO C CB     1 
ATOM   7701  C  CG     . PRO C 1 242 ? 38.000  14.878 226.075 1.00 135.12 ? 261 PRO C CG     1 
ATOM   7702  C  CD     . PRO C 1 242 ? 38.885  13.752 226.462 1.00 134.00 ? 261 PRO C CD     1 
ATOM   7703  H  HA     . PRO C 1 242 ? 36.222  12.618 225.305 1.00 191.56 ? 261 PRO C HA     1 
ATOM   7704  H  HB2    . PRO C 1 242 ? 37.668  14.610 224.062 1.00 187.73 ? 261 PRO C HB2    1 
ATOM   7705  H  HB3    . PRO C 1 242 ? 36.317  14.773 224.895 1.00 187.73 ? 261 PRO C HB3    1 
ATOM   7706  H  HG2    . PRO C 1 242 ? 38.526  15.652 225.820 1.00 162.14 ? 261 PRO C HG2    1 
ATOM   7707  H  HG3    . PRO C 1 242 ? 37.395  15.100 226.799 1.00 162.14 ? 261 PRO C HG3    1 
ATOM   7708  H  HD2    . PRO C 1 242 ? 39.703  13.767 225.942 1.00 160.79 ? 261 PRO C HD2    1 
ATOM   7709  H  HD3    . PRO C 1 242 ? 39.066  13.774 227.415 1.00 160.79 ? 261 PRO C HD3    1 
ATOM   7710  N  N      . GLN C 1 243 ? 36.478  11.665 223.048 1.00 133.79 ? 262 GLN C N      1 
ATOM   7711  C  CA     . GLN C 1 243 ? 36.676  11.029 221.757 1.00 137.35 ? 262 GLN C CA     1 
ATOM   7712  C  C      . GLN C 1 243 ? 36.646  12.073 220.645 1.00 131.79 ? 262 GLN C C      1 
ATOM   7713  O  O      . GLN C 1 243 ? 36.243  13.221 220.842 1.00 119.56 ? 262 GLN C O      1 
ATOM   7714  C  CB     . GLN C 1 243 ? 35.611  9.961  221.505 1.00 132.30 ? 262 GLN C CB     1 
ATOM   7715  C  CG     . GLN C 1 243 ? 35.766  8.706  222.346 1.00 128.58 ? 262 GLN C CG     1 
ATOM   7716  C  CD     . GLN C 1 243 ? 35.401  8.924  223.802 1.00 138.32 ? 262 GLN C CD     1 
ATOM   7717  O  OE1    . GLN C 1 243 ? 34.721  9.890  224.147 1.00 144.02 ? 262 GLN C OE1    1 
ATOM   7718  N  NE2    . GLN C 1 243 ? 35.856  8.024  224.665 1.00 149.04 ? 262 GLN C NE2    1 
ATOM   7719  H  H      . GLN C 1 243 ? 35.658  11.691 223.303 1.00 160.55 ? 262 GLN C H      1 
ATOM   7720  H  HA     . GLN C 1 243 ? 37.545  10.598 221.744 1.00 164.82 ? 262 GLN C HA     1 
ATOM   7721  H  HB2    . GLN C 1 243 ? 34.739  10.340 221.700 1.00 158.76 ? 262 GLN C HB2    1 
ATOM   7722  H  HB3    . GLN C 1 243 ? 35.650  9.697  220.572 1.00 158.76 ? 262 GLN C HB3    1 
ATOM   7723  H  HG2    . GLN C 1 243 ? 35.184  8.015  221.992 1.00 154.30 ? 262 GLN C HG2    1 
ATOM   7724  H  HG3    . GLN C 1 243 ? 36.690  8.413  222.309 1.00 154.30 ? 262 GLN C HG3    1 
ATOM   7725  H  HE21   . GLN C 1 243 ? 36.329  7.362  224.387 1.00 178.85 ? 262 GLN C HE21   1 
ATOM   7726  H  HE22   . GLN C 1 243 ? 35.677  8.103  225.502 1.00 178.85 ? 262 GLN C HE22   1 
ATOM   7727  N  N      . LEU C 1 244 ? 37.081  11.655 219.460 1.00 161.65 ? 263 LEU C N      1 
ATOM   7728  C  CA     . LEU C 1 244 ? 37.110  12.547 218.315 1.00 158.16 ? 263 LEU C CA     1 
ATOM   7729  C  C      . LEU C 1 244 ? 35.691  12.833 217.829 1.00 137.39 ? 263 LEU C C      1 
ATOM   7730  O  O      . LEU C 1 244 ? 34.714  12.211 218.254 1.00 120.04 ? 263 LEU C O      1 
ATOM   7731  C  CB     . LEU C 1 244 ? 37.945  11.942 217.187 1.00 138.08 ? 263 LEU C CB     1 
ATOM   7732  H  H      . LEU C 1 244 ? 37.364  10.859 219.297 1.00 193.98 ? 263 LEU C H      1 
ATOM   7733  H  HA     . LEU C 1 244 ? 37.517  13.388 218.576 1.00 189.79 ? 263 LEU C HA     1 
ATOM   7734  N  N      . ALA C 1 245 ? 35.592  13.795 216.917 1.00 129.24 ? 264 ALA C N      1 
ATOM   7735  C  CA     . ALA C 1 245 ? 34.317  14.217 216.353 1.00 129.59 ? 264 ALA C CA     1 
ATOM   7736  C  C      . ALA C 1 245 ? 34.603  15.161 215.197 1.00 132.37 ? 264 ALA C C      1 
ATOM   7737  O  O      . ALA C 1 245 ? 35.605  15.880 215.207 1.00 162.07 ? 264 ALA C O      1 
ATOM   7738  C  CB     . ALA C 1 245 ? 33.434  14.904 217.401 1.00 140.64 ? 264 ALA C CB     1 
ATOM   7739  H  H      . ALA C 1 245 ? 36.266  14.227 216.602 1.00 155.09 ? 264 ALA C H      1 
ATOM   7740  H  HA     . ALA C 1 245 ? 33.843  13.443 216.009 1.00 155.50 ? 264 ALA C HA     1 
ATOM   7741  H  HB1    . ALA C 1 245 ? 32.598  15.168 216.985 1.00 168.76 ? 264 ALA C HB1    1 
ATOM   7742  H  HB2    . ALA C 1 245 ? 33.261  14.282 218.125 1.00 168.76 ? 264 ALA C HB2    1 
ATOM   7743  H  HB3    . ALA C 1 245 ? 33.897  15.686 217.740 1.00 168.76 ? 264 ALA C HB3    1 
ATOM   7744  N  N      . LEU C 1 246 ? 33.725  15.150 214.200 1.00 116.82 ? 265 LEU C N      1 
ATOM   7745  C  CA     . LEU C 1 246 ? 33.970  15.881 212.965 1.00 145.98 ? 265 LEU C CA     1 
ATOM   7746  C  C      . LEU C 1 246 ? 33.306  17.251 213.011 1.00 128.83 ? 265 LEU C C      1 
ATOM   7747  O  O      . LEU C 1 246 ? 32.119  17.372 213.337 1.00 130.57 ? 265 LEU C O      1 
ATOM   7748  C  CB     . LEU C 1 246 ? 33.486  15.094 211.746 1.00 151.10 ? 265 LEU C CB     1 
ATOM   7749  C  CG     . LEU C 1 246 ? 31.991  14.834 211.568 1.00 144.58 ? 265 LEU C CG     1 
ATOM   7750  C  CD1    . LEU C 1 246 ? 31.324  15.942 210.762 1.00 142.49 ? 265 LEU C CD1    1 
ATOM   7751  C  CD2    . LEU C 1 246 ? 31.786  13.494 210.877 1.00 141.58 ? 265 LEU C CD2    1 
ATOM   7752  H  H      . LEU C 1 246 ? 32.978  14.724 214.215 1.00 140.18 ? 265 LEU C H      1 
ATOM   7753  H  HA     . LEU C 1 246 ? 34.926  16.018 212.867 1.00 175.18 ? 265 LEU C HA     1 
ATOM   7754  H  HB2    . LEU C 1 246 ? 33.780  15.569 210.954 1.00 181.33 ? 265 LEU C HB2    1 
ATOM   7755  H  HB3    . LEU C 1 246 ? 33.917  14.225 211.768 1.00 181.33 ? 265 LEU C HB3    1 
ATOM   7756  H  HG     . LEU C 1 246 ? 31.567  14.794 212.439 1.00 173.49 ? 265 LEU C HG     1 
ATOM   7757  H  HD11   . LEU C 1 246 ? 30.380  15.741 210.671 1.00 170.98 ? 265 LEU C HD11   1 
ATOM   7758  H  HD12   . LEU C 1 246 ? 31.440  16.785 211.228 1.00 170.98 ? 265 LEU C HD12   1 
ATOM   7759  H  HD13   . LEU C 1 246 ? 31.739  15.988 209.886 1.00 170.98 ? 265 LEU C HD13   1 
ATOM   7760  H  HD21   . LEU C 1 246 ? 30.835  13.337 210.768 1.00 169.90 ? 265 LEU C HD21   1 
ATOM   7761  H  HD22   . LEU C 1 246 ? 32.220  13.517 210.010 1.00 169.90 ? 265 LEU C HD22   1 
ATOM   7762  H  HD23   . LEU C 1 246 ? 32.177  12.794 211.424 1.00 169.90 ? 265 LEU C HD23   1 
ATOM   7763  N  N      . PHE C 1 247 ? 34.102  18.279 212.713 1.00 117.96 ? 266 PHE C N      1 
ATOM   7764  C  CA     . PHE C 1 247 ? 33.618  19.646 212.517 1.00 113.22 ? 266 PHE C CA     1 
ATOM   7765  C  C      . PHE C 1 247 ? 33.603  19.916 211.019 1.00 119.66 ? 266 PHE C C      1 
ATOM   7766  O  O      . PHE C 1 247 ? 34.497  20.550 210.466 1.00 134.81 ? 266 PHE C O      1 
ATOM   7767  C  CB     . PHE C 1 247 ? 34.509  20.657 213.245 1.00 76.53  ? 266 PHE C CB     1 
ATOM   7768  C  CG     . PHE C 1 247 ? 34.544  20.487 214.739 1.00 102.64 ? 266 PHE C CG     1 
ATOM   7769  C  CD1    . PHE C 1 247 ? 35.020  19.319 215.310 1.00 72.64  ? 266 PHE C CD1    1 
ATOM   7770  C  CD2    . PHE C 1 247 ? 34.129  21.513 215.578 1.00 113.18 ? 266 PHE C CD2    1 
ATOM   7771  C  CE1    . PHE C 1 247 ? 35.062  19.165 216.684 1.00 98.02  ? 266 PHE C CE1    1 
ATOM   7772  C  CE2    . PHE C 1 247 ? 34.171  21.367 216.956 1.00 71.39  ? 266 PHE C CE2    1 
ATOM   7773  C  CZ     . PHE C 1 247 ? 34.640  20.187 217.511 1.00 87.02  ? 266 PHE C CZ     1 
ATOM   7774  H  H      . PHE C 1 247 ? 34.953  18.206 212.617 1.00 141.55 ? 266 PHE C H      1 
ATOM   7775  H  HA     . PHE C 1 247 ? 32.713  19.726 212.858 1.00 135.87 ? 266 PHE C HA     1 
ATOM   7776  H  HB2    . PHE C 1 247 ? 35.417  20.565 212.916 1.00 91.83  ? 266 PHE C HB2    1 
ATOM   7777  H  HB3    . PHE C 1 247 ? 34.182  21.551 213.057 1.00 91.83  ? 266 PHE C HB3    1 
ATOM   7778  H  HD1    . PHE C 1 247 ? 35.306  18.623 214.762 1.00 87.17  ? 266 PHE C HD1    1 
ATOM   7779  H  HD2    . PHE C 1 247 ? 33.813  22.306 215.210 1.00 135.81 ? 266 PHE C HD2    1 
ATOM   7780  H  HE1    . PHE C 1 247 ? 35.379  18.372 217.052 1.00 117.62 ? 266 PHE C HE1    1 
ATOM   7781  H  HE2    . PHE C 1 247 ? 33.884  22.059 217.507 1.00 85.67  ? 266 PHE C HE2    1 
ATOM   7782  H  HZ     . PHE C 1 247 ? 34.669  20.083 218.435 1.00 104.43 ? 266 PHE C HZ     1 
ATOM   7783  N  N      . ALA C 1 248 ? 32.560  19.436 210.353 1.00 123.97 ? 267 ALA C N      1 
ATOM   7784  C  CA     . ALA C 1 248 ? 32.534  19.433 208.895 1.00 141.31 ? 267 ALA C CA     1 
ATOM   7785  C  C      . ALA C 1 248 ? 31.671  20.567 208.357 1.00 124.58 ? 267 ALA C C      1 
ATOM   7786  O  O      . ALA C 1 248 ? 30.561  20.803 208.843 1.00 131.61 ? 267 ALA C O      1 
ATOM   7787  C  CB     . ALA C 1 248 ? 32.071  18.068 208.365 1.00 146.85 ? 267 ALA C CB     1 
ATOM   7788  H  H      . ALA C 1 248 ? 31.856  19.107 210.720 1.00 148.76 ? 267 ALA C H      1 
ATOM   7789  H  HA     . ALA C 1 248 ? 33.437  19.578 208.573 1.00 169.57 ? 267 ALA C HA     1 
ATOM   7790  H  HB1    . ALA C 1 248 ? 32.063  18.093 207.395 1.00 176.22 ? 267 ALA C HB1    1 
ATOM   7791  H  HB2    . ALA C 1 248 ? 32.687  17.384 208.673 1.00 176.22 ? 267 ALA C HB2    1 
ATOM   7792  H  HB3    . ALA C 1 248 ? 31.179  17.885 208.699 1.00 176.22 ? 267 ALA C HB3    1 
ATOM   7793  N  N      . ILE C 1 249 ? 32.215  21.296 207.388 1.00 140.40 ? 268 ILE C N      1 
ATOM   7794  C  CA     . ILE C 1 249 ? 31.505  22.403 206.760 1.00 130.82 ? 268 ILE C CA     1 
ATOM   7795  C  C      . ILE C 1 249 ? 30.741  21.860 205.562 1.00 130.65 ? 268 ILE C C      1 
ATOM   7796  O  O      . ILE C 1 249 ? 31.168  20.904 204.901 1.00 150.05 ? 268 ILE C O      1 
ATOM   7797  C  CB     . ILE C 1 249 ? 32.455  23.555 206.355 1.00 135.58 ? 268 ILE C CB     1 
ATOM   7798  H  H      . ILE C 1 249 ? 33.005  21.166 207.073 1.00 168.48 ? 268 ILE C H      1 
ATOM   7799  H  HA     . ILE C 1 249 ? 30.859  22.758 207.390 1.00 156.99 ? 268 ILE C HA     1 
ATOM   7800  N  N      . ALA C 1 250 ? 29.610  22.495 205.265 1.00 118.66 ? 269 ALA C N      1 
ATOM   7801  C  CA     . ALA C 1 250 ? 28.466  21.718 204.815 1.00 121.53 ? 269 ALA C CA     1 
ATOM   7802  C  C      . ALA C 1 250 ? 27.890  22.010 203.441 1.00 134.09 ? 269 ALA C C      1 
ATOM   7803  O  O      . ALA C 1 250 ? 28.225  23.006 202.773 1.00 164.48 ? 269 ALA C O      1 
ATOM   7804  C  CB     . ALA C 1 250 ? 27.417  21.828 205.857 1.00 137.73 ? 269 ALA C CB     1 
ATOM   7805  H  H      . ALA C 1 250 ? 29.483  23.344 205.314 1.00 142.39 ? 269 ALA C H      1 
ATOM   7806  H  HA     . ALA C 1 250 ? 28.740  20.788 204.799 1.00 145.84 ? 269 ALA C HA     1 
ATOM   7807  H  HB1    . ALA C 1 250 ? 26.641  21.317 205.579 1.00 165.28 ? 269 ALA C HB1    1 
ATOM   7808  H  HB2    . ALA C 1 250 ? 27.764  21.476 206.692 1.00 165.28 ? 269 ALA C HB2    1 
ATOM   7809  H  HB3    . ALA C 1 250 ? 27.177  22.762 205.966 1.00 165.28 ? 269 ALA C HB3    1 
ATOM   7810  N  N      . THR C 1 251 ? 26.957  21.152 203.067 1.00 165.64 ? 270 THR C N      1 
ATOM   7811  C  CA     . THR C 1 251 ? 26.976  20.634 201.707 1.00 168.59 ? 270 THR C CA     1 
ATOM   7812  C  C      . THR C 1 251 ? 26.050  21.484 200.840 1.00 166.58 ? 270 THR C C      1 
ATOM   7813  O  O      . THR C 1 251 ? 24.881  21.699 201.255 1.00 160.83 ? 270 THR C O      1 
ATOM   7814  C  CB     . THR C 1 251 ? 26.497  19.178 201.728 1.00 154.72 ? 270 THR C CB     1 
ATOM   7815  H  H      . THR C 1 251 ? 26.318  20.859 203.563 1.00 198.77 ? 270 THR C H      1 
ATOM   7816  H  HA     . THR C 1 251 ? 27.875  20.670 201.346 1.00 202.31 ? 270 THR C HA     1 
ATOM   7817  N  N      . PRO C 1 252 ? 26.462  22.027 199.662 1.00 158.89 ? 271 PRO C N      1 
ATOM   7818  C  CA     . PRO C 1 252 ? 25.607  22.702 198.668 1.00 152.00 ? 271 PRO C CA     1 
ATOM   7819  C  C      . PRO C 1 252 ? 25.262  21.795 197.486 1.00 173.13 ? 271 PRO C C      1 
ATOM   7820  O  O      . PRO C 1 252 ? 24.145  21.816 196.978 1.00 167.45 ? 271 PRO C O      1 
ATOM   7821  C  CB     . PRO C 1 252 ? 26.481  23.883 198.181 1.00 167.55 ? 271 PRO C CB     1 
ATOM   7822  C  CG     . PRO C 1 252 ? 27.910  23.533 198.644 1.00 168.55 ? 271 PRO C CG     1 
ATOM   7823  C  CD     . PRO C 1 252 ? 27.868  22.170 199.265 1.00 172.36 ? 271 PRO C CD     1 
ATOM   7824  H  HA     . PRO C 1 252 ? 24.795  23.038 199.078 1.00 182.39 ? 271 PRO C HA     1 
ATOM   7825  H  HB2    . PRO C 1 252 ? 26.438  23.946 197.214 1.00 201.06 ? 271 PRO C HB2    1 
ATOM   7826  H  HB3    . PRO C 1 252 ? 26.178  24.707 198.594 1.00 201.06 ? 271 PRO C HB3    1 
ATOM   7827  H  HG2    . PRO C 1 252 ? 28.503  23.533 197.876 1.00 202.26 ? 271 PRO C HG2    1 
ATOM   7828  H  HG3    . PRO C 1 252 ? 28.205  24.189 199.294 1.00 202.26 ? 271 PRO C HG3    1 
ATOM   7829  H  HD2    . PRO C 1 252 ? 28.107  21.492 198.614 1.00 206.84 ? 271 PRO C HD2    1 
ATOM   7830  H  HD3    . PRO C 1 252 ? 28.445  22.135 200.044 1.00 206.84 ? 271 PRO C HD3    1 
ATOM   7831  N  N      . ALA D 2 6   ? -13.548 3.698  219.941 1.00 110.26 ? 84  ALA D N      1 
ATOM   7832  C  CA     . ALA D 2 6   ? -13.689 2.247  219.955 1.00 122.08 ? 84  ALA D CA     1 
ATOM   7833  C  C      . ALA D 2 6   ? -12.791 1.600  218.896 1.00 110.62 ? 84  ALA D C      1 
ATOM   7834  O  O      . ALA D 2 6   ? -12.797 0.380  218.712 1.00 109.24 ? 84  ALA D O      1 
ATOM   7835  C  CB     . ALA D 2 6   ? -15.146 1.862  219.729 1.00 123.60 ? 84  ALA D CB     1 
ATOM   7836  H  H      . ALA D 2 6   ? -14.294 4.122  219.992 1.00 132.32 ? 84  ALA D H      1 
ATOM   7837  H  HA     . ALA D 2 6   ? -13.420 1.911  220.824 1.00 146.50 ? 84  ALA D HA     1 
ATOM   7838  H  HB1    . ALA D 2 6   ? -15.222 0.895  219.740 1.00 148.32 ? 84  ALA D HB1    1 
ATOM   7839  H  HB2    . ALA D 2 6   ? -15.687 2.245  220.437 1.00 148.32 ? 84  ALA D HB2    1 
ATOM   7840  H  HB3    . ALA D 2 6   ? -15.434 2.206  218.869 1.00 148.32 ? 84  ALA D HB3    1 
ATOM   7841  N  N      . ASP D 2 7   ? -12.007 2.431  218.215 1.00 93.42  ? 85  ASP D N      1 
ATOM   7842  C  CA     . ASP D 2 7   ? -11.208 2.001  217.070 1.00 107.94 ? 85  ASP D CA     1 
ATOM   7843  C  C      . ASP D 2 7   ? -9.869  1.469  217.566 1.00 105.85 ? 85  ASP D C      1 
ATOM   7844  O  O      . ASP D 2 7   ? -8.969  2.243  217.905 1.00 85.61  ? 85  ASP D O      1 
ATOM   7845  C  CB     . ASP D 2 7   ? -11.017 3.160  216.098 1.00 41.37  ? 85  ASP D CB     1 
ATOM   7846  H  H      . ASP D 2 7   ? -11.919 3.267  218.400 1.00 112.10 ? 85  ASP D H      1 
ATOM   7847  H  HA     . ASP D 2 7   ? -11.669 1.284  216.607 1.00 129.53 ? 85  ASP D HA     1 
ATOM   7848  N  N      . LYS D 2 8   ? -9.734  0.141  217.598 1.00 112.22 ? 86  LYS D N      1 
ATOM   7849  C  CA     . LYS D 2 8   ? -8.464  -0.494 217.927 1.00 93.59  ? 86  LYS D CA     1 
ATOM   7850  C  C      . LYS D 2 8   ? -7.775  0.233  219.073 1.00 108.65 ? 86  LYS D C      1 
ATOM   7851  O  O      . LYS D 2 8   ? -6.580  0.538  218.998 1.00 113.07 ? 86  LYS D O      1 
ATOM   7852  C  CB     . LYS D 2 8   ? -7.547  -0.524 216.704 1.00 28.54  ? 86  LYS D CB     1 
ATOM   7853  H  H      . LYS D 2 8   ? -10.369 -0.414 217.431 1.00 134.66 ? 86  LYS D H      1 
ATOM   7854  H  HA     . LYS D 2 8   ? -8.628  -1.409 218.205 1.00 112.31 ? 86  LYS D HA     1 
ATOM   7855  N  N      . GLU D 2 9   ? -8.535  0.543  220.126 1.00 121.28 ? 87  GLU D N      1 
ATOM   7856  C  CA     . GLU D 2 9   ? -7.960  1.197  221.293 1.00 94.98  ? 87  GLU D CA     1 
ATOM   7857  C  C      . GLU D 2 9   ? -6.825  0.384  221.901 1.00 80.83  ? 87  GLU D C      1 
ATOM   7858  O  O      . GLU D 2 9   ? -5.967  0.950  222.583 1.00 96.74  ? 87  GLU D O      1 
ATOM   7859  C  CB     . GLU D 2 9   ? -9.050  1.437  222.339 1.00 88.47  ? 87  GLU D CB     1 
ATOM   7860  C  CG     . GLU D 2 9   ? -9.704  0.157  222.846 1.00 97.69  ? 87  GLU D CG     1 
ATOM   7861  C  CD     . GLU D 2 9   ? -11.193 0.106  222.568 1.00 132.91 ? 87  GLU D CD     1 
ATOM   7862  O  OE1    . GLU D 2 9   ? -11.844 1.175  222.596 1.00 127.07 ? 87  GLU D OE1    1 
ATOM   7863  O  OE2    . GLU D 2 9   ? -11.711 -1.004 222.315 1.00 128.44 ? 87  GLU D OE2    1 
ATOM   7864  H  H      . GLU D 2 9   ? -9.378  0.385  220.185 1.00 145.54 ? 87  GLU D H      1 
ATOM   7865  H  HA     . GLU D 2 9   ? -7.602  2.059  221.028 1.00 113.98 ? 87  GLU D HA     1 
ATOM   7866  H  HB2    . GLU D 2 9   ? -8.658  1.893  223.100 1.00 106.17 ? 87  GLU D HB2    1 
ATOM   7867  H  HB3    . GLU D 2 9   ? -9.744  1.990  221.946 1.00 106.17 ? 87  GLU D HB3    1 
ATOM   7868  H  HG2    . GLU D 2 9   ? -9.291  -0.603 222.408 1.00 117.23 ? 87  GLU D HG2    1 
ATOM   7869  H  HG3    . GLU D 2 9   ? -9.576  0.097  223.806 1.00 117.23 ? 87  GLU D HG3    1 
ATOM   7870  N  N      . ARG D 2 10  ? -6.799  -0.929 221.665 1.00 89.12  ? 88  ARG D N      1 
ATOM   7871  C  CA     . ARG D 2 10  ? -5.763  -1.775 222.249 1.00 100.09 ? 88  ARG D CA     1 
ATOM   7872  C  C      . ARG D 2 10  ? -4.373  -1.329 221.810 1.00 65.76  ? 88  ARG D C      1 
ATOM   7873  O  O      . ARG D 2 10  ? -3.451  -1.241 222.629 1.00 112.95 ? 88  ARG D O      1 
ATOM   7874  C  CB     . ARG D 2 10  ? -6.008  -3.231 221.862 1.00 98.90  ? 88  ARG D CB     1 
ATOM   7875  C  CG     . ARG D 2 10  ? -6.147  -3.437 220.368 1.00 116.03 ? 88  ARG D CG     1 
ATOM   7876  C  CD     . ARG D 2 10  ? -7.436  -4.143 219.980 1.00 139.57 ? 88  ARG D CD     1 
ATOM   7877  N  NE     . ARG D 2 10  ? -7.191  -5.534 219.627 1.00 129.60 ? 88  ARG D NE     1 
ATOM   7878  C  CZ     . ARG D 2 10  ? -6.484  -5.905 218.568 1.00 119.96 ? 88  ARG D CZ     1 
ATOM   7879  N  NH1    . ARG D 2 10  ? -5.940  -4.990 217.779 1.00 102.91 ? 88  ARG D NH1    1 
ATOM   7880  N  NH2    . ARG D 2 10  ? -6.295  -7.190 218.310 1.00 154.16 ? 88  ARG D NH2    1 
ATOM   7881  H  H      . ARG D 2 10  ? -7.367  -1.350 221.175 1.00 106.94 ? 88  ARG D H      1 
ATOM   7882  H  HA     . ARG D 2 10  ? -5.808  -1.709 223.215 1.00 120.10 ? 88  ARG D HA     1 
ATOM   7883  H  HB2    . ARG D 2 10  ? -5.260  -3.768 222.169 1.00 118.67 ? 88  ARG D HB2    1 
ATOM   7884  H  HB3    . ARG D 2 10  ? -6.827  -3.535 222.283 1.00 118.67 ? 88  ARG D HB3    1 
ATOM   7885  H  HG2    . ARG D 2 10  ? -6.137  -2.572 219.929 1.00 139.23 ? 88  ARG D HG2    1 
ATOM   7886  H  HG3    . ARG D 2 10  ? -5.405  -3.976 220.053 1.00 139.23 ? 88  ARG D HG3    1 
ATOM   7887  H  HD2    . ARG D 2 10  ? -8.051  -4.123 220.730 1.00 167.48 ? 88  ARG D HD2    1 
ATOM   7888  H  HD3    . ARG D 2 10  ? -7.828  -3.698 219.212 1.00 167.48 ? 88  ARG D HD3    1 
ATOM   7889  H  HE     . ARG D 2 10  ? -7.405  -6.138 220.200 1.00 155.52 ? 88  ARG D HE     1 
ATOM   7890  H  HH11   . ARG D 2 10  ? -6.057  -4.154 217.945 1.00 123.49 ? 88  ARG D HH11   1 
ATOM   7891  H  HH12   . ARG D 2 10  ? -5.478  -5.231 217.095 1.00 123.49 ? 88  ARG D HH12   1 
ATOM   7892  H  HH21   . ARG D 2 10  ? -6.643  -7.787 218.822 1.00 185.00 ? 88  ARG D HH21   1 
ATOM   7893  H  HH22   . ARG D 2 10  ? -5.833  -7.427 217.625 1.00 185.00 ? 88  ARG D HH22   1 
ATOM   7894  N  N      . LEU D 2 11  ? -4.199  -1.053 220.518 1.00 66.12  ? 89  LEU D N      1 
ATOM   7895  C  CA     . LEU D 2 11  ? -2.900  -0.603 220.030 1.00 122.68 ? 89  LEU D CA     1 
ATOM   7896  C  C      . LEU D 2 11  ? -2.446  0.640  220.781 1.00 74.87  ? 89  LEU D C      1 
ATOM   7897  O  O      . LEU D 2 11  ? -1.341  0.680  221.334 1.00 66.48  ? 89  LEU D O      1 
ATOM   7898  C  CB     . LEU D 2 11  ? -2.971  -0.331 218.527 1.00 69.80  ? 89  LEU D CB     1 
ATOM   7899  H  H      . LEU D 2 11  ? -4.808  -1.117 219.914 1.00 79.34  ? 89  LEU D H      1 
ATOM   7900  H  HA     . LEU D 2 11  ? -2.245  -1.302 220.180 1.00 147.22 ? 89  LEU D HA     1 
ATOM   7901  N  N      . ALA D 2 12  ? -3.294  1.669  220.812 1.00 106.82 ? 90  ALA D N      1 
ATOM   7902  C  CA     . ALA D 2 12  ? -2.967  2.874  221.565 1.00 131.77 ? 90  ALA D CA     1 
ATOM   7903  C  C      . ALA D 2 12  ? -2.887  2.579  223.061 1.00 84.01  ? 90  ALA D C      1 
ATOM   7904  O  O      . ALA D 2 12  ? -2.019  3.110  223.762 1.00 82.23  ? 90  ALA D O      1 
ATOM   7905  C  CB     . ALA D 2 12  ? -4.006  3.959  221.277 1.00 123.63 ? 90  ALA D CB     1 
ATOM   7906  H  H      . ALA D 2 12  ? -4.054  1.692  220.411 1.00 128.18 ? 90  ALA D H      1 
ATOM   7907  H  HA     . ALA D 2 12  ? -2.101  3.202  221.277 1.00 158.13 ? 90  ALA D HA     1 
ATOM   7908  H  HB1    . ALA D 2 12  ? -3.779  4.755  221.782 1.00 148.35 ? 90  ALA D HB1    1 
ATOM   7909  H  HB2    . ALA D 2 12  ? -4.000  4.156  220.327 1.00 148.35 ? 90  ALA D HB2    1 
ATOM   7910  H  HB3    . ALA D 2 12  ? -4.881  3.636  221.542 1.00 148.35 ? 90  ALA D HB3    1 
ATOM   7911  N  N      . ARG D 2 13  ? -3.779  1.728  223.565 1.00 71.84  ? 91  ARG D N      1 
ATOM   7912  C  CA     . ARG D 2 13  ? -3.765  1.376  224.981 1.00 68.24  ? 91  ARG D CA     1 
ATOM   7913  C  C      . ARG D 2 13  ? -2.502  0.601  225.334 1.00 70.40  ? 91  ARG D C      1 
ATOM   7914  O  O      . ARG D 2 13  ? -1.678  1.054  226.137 1.00 111.30 ? 91  ARG D O      1 
ATOM   7915  C  CB     . ARG D 2 13  ? -5.015  0.560  225.319 1.00 87.38  ? 91  ARG D CB     1 
ATOM   7916  C  CG     . ARG D 2 13  ? -5.160  0.185  226.784 1.00 123.04 ? 91  ARG D CG     1 
ATOM   7917  C  CD     . ARG D 2 13  ? -6.394  -0.671 227.002 1.00 121.25 ? 91  ARG D CD     1 
ATOM   7918  N  NE     . ARG D 2 13  ? -6.107  -2.093 226.803 1.00 131.72 ? 91  ARG D NE     1 
ATOM   7919  C  CZ     . ARG D 2 13  ? -6.244  -3.046 227.724 1.00 115.83 ? 91  ARG D CZ     1 
ATOM   7920  N  NH1    . ARG D 2 13  ? -6.687  -2.763 228.944 1.00 89.93  ? 91  ARG D NH1    1 
ATOM   7921  N  NH2    . ARG D 2 13  ? -5.951  -4.304 227.416 1.00 112.80 ? 91  ARG D NH2    1 
ATOM   7922  H  H      . ARG D 2 13  ? -4.398  1.342  223.110 1.00 86.21  ? 91  ARG D H      1 
ATOM   7923  H  HA     . ARG D 2 13  ? -3.781  2.188  225.511 1.00 81.89  ? 91  ARG D HA     1 
ATOM   7924  H  HB2    . ARG D 2 13  ? -5.798  1.078  225.070 1.00 104.86 ? 91  ARG D HB2    1 
ATOM   7925  H  HB3    . ARG D 2 13  ? -4.994  -0.263 224.806 1.00 104.86 ? 91  ARG D HB3    1 
ATOM   7926  H  HG2    . ARG D 2 13  ? -4.382  -0.322 227.065 1.00 147.65 ? 91  ARG D HG2    1 
ATOM   7927  H  HG3    . ARG D 2 13  ? -5.249  0.991  227.316 1.00 147.65 ? 91  ARG D HG3    1 
ATOM   7928  H  HD2    . ARG D 2 13  ? -6.710  -0.550 227.911 1.00 145.50 ? 91  ARG D HD2    1 
ATOM   7929  H  HD3    . ARG D 2 13  ? -7.081  -0.409 226.370 1.00 145.50 ? 91  ARG D HD3    1 
ATOM   7930  H  HE     . ARG D 2 13  ? -5.826  -2.333 226.026 1.00 158.07 ? 91  ARG D HE     1 
ATOM   7931  H  HH11   . ARG D 2 13  ? -6.881  -1.952 229.154 1.00 107.92 ? 91  ARG D HH11   1 
ATOM   7932  H  HH12   . ARG D 2 13  ? -6.772  -3.390 229.526 1.00 107.92 ? 91  ARG D HH12   1 
ATOM   7933  H  HH21   . ARG D 2 13  ? -5.666  -4.499 226.628 1.00 135.36 ? 91  ARG D HH21   1 
ATOM   7934  H  HH22   . ARG D 2 13  ? -6.041  -4.923 228.006 1.00 135.36 ? 91  ARG D HH22   1 
ATOM   7935  N  N      . GLU D 2 14  ? -2.331  -0.575 224.729 1.00 52.69  ? 92  GLU D N      1 
ATOM   7936  C  CA     . GLU D 2 14  ? -1.159  -1.415 224.957 1.00 64.89  ? 92  GLU D CA     1 
ATOM   7937  C  C      . GLU D 2 14  ? 0.170   -0.696 224.698 1.00 58.49  ? 92  GLU D C      1 
ATOM   7938  O  O      . GLU D 2 14  ? 1.227   -1.274 224.978 1.00 43.60  ? 92  GLU D O      1 
ATOM   7939  C  CB     . GLU D 2 14  ? -1.291  -2.669 224.081 1.00 123.83 ? 92  GLU D CB     1 
ATOM   7940  C  CG     . GLU D 2 14  ? -0.126  -3.652 224.140 1.00 127.35 ? 92  GLU D CG     1 
ATOM   7941  C  CD     . GLU D 2 14  ? 0.922   -3.401 223.070 1.00 65.15  ? 92  GLU D CD     1 
ATOM   7942  O  OE1    . GLU D 2 14  ? 0.864   -2.337 222.422 1.00 67.36  ? 92  GLU D OE1    1 
ATOM   7943  O  OE2    . GLU D 2 14  ? 1.805   -4.266 222.877 1.00 61.74  ? 92  GLU D OE2    1 
ATOM   7944  H  H      . GLU D 2 14  ? -2.892  -0.913 224.171 1.00 63.23  ? 92  GLU D H      1 
ATOM   7945  H  HA     . GLU D 2 14  ? -1.160  -1.702 225.884 1.00 77.87  ? 92  GLU D HA     1 
ATOM   7946  H  HB2    . GLU D 2 14  ? -2.088  -3.149 224.353 1.00 148.60 ? 92  GLU D HB2    1 
ATOM   7947  H  HB3    . GLU D 2 14  ? -1.384  -2.387 223.157 1.00 148.60 ? 92  GLU D HB3    1 
ATOM   7948  H  HG2    . GLU D 2 14  ? 0.306   -3.576 225.005 1.00 152.82 ? 92  GLU D HG2    1 
ATOM   7949  H  HG3    . GLU D 2 14  ? -0.467  -4.552 224.019 1.00 152.82 ? 92  GLU D HG3    1 
ATOM   7950  N  N      . ASN D 2 15  ? 0.157   0.538  224.184 1.00 109.63 ? 93  ASN D N      1 
ATOM   7951  C  CA     . ASN D 2 15  ? 1.382   1.303  223.992 1.00 111.90 ? 93  ASN D CA     1 
ATOM   7952  C  C      . ASN D 2 15  ? 1.409   2.626  224.743 1.00 61.25  ? 93  ASN D C      1 
ATOM   7953  O  O      . ASN D 2 15  ? 2.482   3.230  224.845 1.00 60.70  ? 93  ASN D O      1 
ATOM   7954  C  CB     . ASN D 2 15  ? 1.612   1.590  222.501 1.00 97.88  ? 93  ASN D CB     1 
ATOM   7955  C  CG     . ASN D 2 15  ? 2.034   0.362  221.729 1.00 56.43  ? 93  ASN D CG     1 
ATOM   7956  O  OD1    . ASN D 2 15  ? 2.822   -0.454 222.210 1.00 136.61 ? 93  ASN D OD1    1 
ATOM   7957  N  ND2    . ASN D 2 15  ? 1.511   0.224  220.520 1.00 85.58  ? 93  ASN D ND2    1 
ATOM   7958  H  H      . ASN D 2 15  ? -0.556  0.953  223.939 1.00 131.56 ? 93  ASN D H      1 
ATOM   7959  H  HA     . ASN D 2 15  ? 2.129   0.772  224.308 1.00 134.28 ? 93  ASN D HA     1 
ATOM   7960  H  HB2    . ASN D 2 15  ? 0.787   1.920  222.112 1.00 117.45 ? 93  ASN D HB2    1 
ATOM   7961  H  HB3    . ASN D 2 15  ? 2.311   2.257  222.412 1.00 117.45 ? 93  ASN D HB3    1 
ATOM   7962  H  HD21   . ASN D 2 15  ? 1.717   -0.457 220.037 1.00 102.70 ? 93  ASN D HD21   1 
ATOM   7963  H  HD22   . ASN D 2 15  ? 0.964   0.815  220.218 1.00 102.70 ? 93  ASN D HD22   1 
ATOM   7964  N  N      . HIS D 2 16  ? 0.279   3.097  225.271 1.00 46.01  ? 94  HIS D N      1 
ATOM   7965  C  CA     . HIS D 2 16  ? 0.266   4.398  225.934 1.00 38.89  ? 94  HIS D CA     1 
ATOM   7966  C  C      . HIS D 2 16  ? 0.999   4.338  227.266 1.00 86.05  ? 94  HIS D C      1 
ATOM   7967  O  O      . HIS D 2 16  ? 1.836   5.198  227.567 1.00 47.75  ? 94  HIS D O      1 
ATOM   7968  C  CB     . HIS D 2 16  ? -1.170  4.877  226.133 1.00 47.75  ? 94  HIS D CB     1 
ATOM   7969  C  CG     . HIS D 2 16  ? -1.271  6.291  226.609 1.00 47.16  ? 94  HIS D CG     1 
ATOM   7970  N  ND1    . HIS D 2 16  ? -0.174  7.116  226.724 1.00 31.06  ? 94  HIS D ND1    1 
ATOM   7971  C  CD2    . HIS D 2 16  ? -2.340  7.029  226.990 1.00 78.75  ? 94  HIS D CD2    1 
ATOM   7972  C  CE1    . HIS D 2 16  ? -0.562  8.304  227.154 1.00 36.69  ? 94  HIS D CE1    1 
ATOM   7973  N  NE2    . HIS D 2 16  ? -1.872  8.277  227.326 1.00 55.56  ? 94  HIS D NE2    1 
ATOM   7974  H  H      . HIS D 2 16  ? -0.479  2.691  225.258 1.00 55.21  ? 94  HIS D H      1 
ATOM   7975  H  HA     . HIS D 2 16  ? 0.722   5.043  225.370 1.00 46.67  ? 94  HIS D HA     1 
ATOM   7976  H  HB2    . HIS D 2 16  ? -1.642  4.814  225.288 1.00 57.30  ? 94  HIS D HB2    1 
ATOM   7977  H  HB3    . HIS D 2 16  ? -1.600  4.310  226.793 1.00 57.30  ? 94  HIS D HB3    1 
ATOM   7978  H  HD2    . HIS D 2 16  ? -3.225  6.746  227.019 1.00 94.51  ? 94  HIS D HD2    1 
ATOM   7979  H  HE1    . HIS D 2 16  ? -0.007  9.032  227.315 1.00 44.02  ? 94  HIS D HE1    1 
ATOM   7980  H  HE2    . HIS D 2 16  ? -2.353  8.933  227.604 1.00 66.67  ? 94  HIS D HE2    1 
ATOM   7981  N  N      . SER D 2 17  ? 0.700   3.323  228.079 1.00 115.16 ? 95  SER D N      1 
ATOM   7982  C  CA     . SER D 2 17  ? 1.361   3.194  229.372 1.00 86.24  ? 95  SER D CA     1 
ATOM   7983  C  C      . SER D 2 17  ? 2.875   3.209  229.228 1.00 74.04  ? 95  SER D C      1 
ATOM   7984  O  O      . SER D 2 17  ? 3.583   3.618  230.156 1.00 86.08  ? 95  SER D O      1 
ATOM   7985  C  CB     . SER D 2 17  ? 0.913   1.905  230.067 1.00 101.34 ? 95  SER D CB     1 
ATOM   7986  O  OG     . SER D 2 17  ? -0.483  1.909  230.311 1.00 132.09 ? 95  SER D OG     1 
ATOM   7987  H  H      . SER D 2 17  ? 0.126   2.706  227.906 1.00 138.19 ? 95  SER D H      1 
ATOM   7988  H  HA     . SER D 2 17  ? 1.105   3.943  229.934 1.00 103.49 ? 95  SER D HA     1 
ATOM   7989  H  HB2    . SER D 2 17  ? 1.131   1.150  229.499 1.00 121.61 ? 95  SER D HB2    1 
ATOM   7990  H  HB3    . SER D 2 17  ? 1.380   1.827  230.914 1.00 121.61 ? 95  SER D HB3    1 
ATOM   7991  H  HG     . SER D 2 17  ? -0.710  1.196  230.692 1.00 158.51 ? 95  SER D HG     1 
ATOM   7992  N  N      . GLU D 2 18  ? 3.388   2.775  228.076 1.00 75.90  ? 96  GLU D N      1 
ATOM   7993  C  CA     . GLU D 2 18  ? 4.827   2.675  227.866 1.00 48.57  ? 96  GLU D CA     1 
ATOM   7994  C  C      . GLU D 2 18  ? 5.431   3.987  227.384 1.00 51.71  ? 96  GLU D C      1 
ATOM   7995  O  O      . GLU D 2 18  ? 6.417   4.464  227.953 1.00 79.75  ? 96  GLU D O      1 
ATOM   7996  C  CB     . GLU D 2 18  ? 5.145   1.565  226.858 1.00 57.41  ? 96  GLU D CB     1 
ATOM   7997  C  CG     . GLU D 2 18  ? 6.646   1.416  226.577 1.00 84.41  ? 96  GLU D CG     1 
ATOM   7998  C  CD     . GLU D 2 18  ? 6.977   0.244  225.669 1.00 74.87  ? 96  GLU D CD     1 
ATOM   7999  O  OE1    . GLU D 2 18  ? 7.672   -0.690 226.126 1.00 71.92  ? 96  GLU D OE1    1 
ATOM   8000  O  OE2    . GLU D 2 18  ? 6.548   0.257  224.496 1.00 114.82 ? 96  GLU D OE2    1 
ATOM   8001  H  H      . GLU D 2 18  ? 2.919   2.530  227.398 1.00 91.08  ? 96  GLU D H      1 
ATOM   8002  H  HA     . GLU D 2 18  ? 5.251   2.444  228.707 1.00 58.28  ? 96  GLU D HA     1 
ATOM   8003  H  HB2    . GLU D 2 18  ? 4.822   0.720  227.208 1.00 68.89  ? 96  GLU D HB2    1 
ATOM   8004  H  HB3    . GLU D 2 18  ? 4.703   1.766  226.019 1.00 68.89  ? 96  GLU D HB3    1 
ATOM   8005  H  HG2    . GLU D 2 18  ? 6.966   2.225  226.149 1.00 101.29 ? 96  GLU D HG2    1 
ATOM   8006  H  HG3    . GLU D 2 18  ? 7.110   1.282  227.418 1.00 101.29 ? 96  GLU D HG3    1 
ATOM   8007  N  N      . ILE D 2 19  ? 4.873   4.571  226.323 1.00 106.04 ? 97  ILE D N      1 
ATOM   8008  C  CA     . ILE D 2 19  ? 5.479   5.774  225.762 1.00 51.68  ? 97  ILE D CA     1 
ATOM   8009  C  C      . ILE D 2 19  ? 5.527   6.873  226.811 1.00 49.29  ? 97  ILE D C      1 
ATOM   8010  O  O      . ILE D 2 19  ? 6.549   7.552  226.972 1.00 60.80  ? 97  ILE D O      1 
ATOM   8011  C  CB     . ILE D 2 19  ? 4.731   6.227  224.492 1.00 48.17  ? 97  ILE D CB     1 
ATOM   8012  C  CG1    . ILE D 2 19  ? 5.334   7.532  223.957 1.00 117.52 ? 97  ILE D CG1    1 
ATOM   8013  C  CG2    . ILE D 2 19  ? 3.247   6.422  224.759 1.00 84.71  ? 97  ILE D CG2    1 
ATOM   8014  C  CD1    . ILE D 2 19  ? 6.835   7.461  223.668 1.00 123.22 ? 97  ILE D CD1    1 
ATOM   8015  H  H      . ILE D 2 19  ? 4.164   4.299  225.921 1.00 127.25 ? 97  ILE D H      1 
ATOM   8016  H  HA     . ILE D 2 19  ? 6.393   5.570  225.507 1.00 62.01  ? 97  ILE D HA     1 
ATOM   8017  H  HB     . ILE D 2 19  ? 4.833   5.541  223.814 1.00 57.80  ? 97  ILE D HB     1 
ATOM   8018  H  HG12   . ILE D 2 19  ? 4.885   7.765  223.129 1.00 141.03 ? 97  ILE D HG12   1 
ATOM   8019  H  HG13   . ILE D 2 19  ? 5.192   8.232  224.613 1.00 141.03 ? 97  ILE D HG13   1 
ATOM   8020  H  HG21   . ILE D 2 19  ? 2.813   6.706  223.939 1.00 101.65 ? 97  ILE D HG21   1 
ATOM   8021  H  HG22   . ILE D 2 19  ? 2.868   5.582  225.061 1.00 101.65 ? 97  ILE D HG22   1 
ATOM   8022  H  HG23   . ILE D 2 19  ? 3.136   7.100  225.444 1.00 101.65 ? 97  ILE D HG23   1 
ATOM   8023  H  HD11   . ILE D 2 19  ? 7.132   8.322  223.335 1.00 147.86 ? 97  ILE D HD11   1 
ATOM   8024  H  HD12   . ILE D 2 19  ? 7.303   7.243  224.489 1.00 147.86 ? 97  ILE D HD12   1 
ATOM   8025  H  HD13   . ILE D 2 19  ? 6.996   6.775  223.002 1.00 147.86 ? 97  ILE D HD13   1 
ATOM   8026  N  N      . GLU D 2 20  ? 4.432   7.062  227.550 1.00 75.54  ? 98  GLU D N      1 
ATOM   8027  C  CA     . GLU D 2 20  ? 4.441   8.060  228.613 1.00 48.89  ? 98  GLU D CA     1 
ATOM   8028  C  C      . GLU D 2 20  ? 5.481   7.714  229.660 1.00 26.85  ? 98  GLU D C      1 
ATOM   8029  O  O      . GLU D 2 20  ? 6.140   8.602  230.209 1.00 24.13  ? 98  GLU D O      1 
ATOM   8030  C  CB     . GLU D 2 20  ? 3.059   8.172  229.254 1.00 56.39  ? 98  GLU D CB     1 
ATOM   8031  C  CG     . GLU D 2 20  ? 2.952   9.278  230.286 1.00 21.43  ? 98  GLU D CG     1 
ATOM   8032  C  CD     . GLU D 2 20  ? 3.363   10.633 229.745 1.00 39.58  ? 98  GLU D CD     1 
ATOM   8033  O  OE1    . GLU D 2 20  ? 3.291   10.831 228.517 1.00 130.08 ? 98  GLU D OE1    1 
ATOM   8034  O  OE2    . GLU D 2 20  ? 3.761   11.501 230.548 1.00 67.46  ? 98  GLU D OE2    1 
ATOM   8035  H  H      . GLU D 2 20  ? 3.691   6.636  227.457 1.00 90.65  ? 98  GLU D H      1 
ATOM   8036  H  HA     . GLU D 2 20  ? 4.669   8.924  228.235 1.00 58.67  ? 98  GLU D HA     1 
ATOM   8037  H  HB2    . GLU D 2 20  ? 2.405   8.351  228.559 1.00 67.67  ? 98  GLU D HB2    1 
ATOM   8038  H  HB3    . GLU D 2 20  ? 2.849   7.334  229.694 1.00 67.67  ? 98  GLU D HB3    1 
ATOM   8039  H  HG2    . GLU D 2 20  ? 2.032   9.342  230.586 1.00 25.72  ? 98  GLU D HG2    1 
ATOM   8040  H  HG3    . GLU D 2 20  ? 3.531   9.066  231.035 1.00 25.72  ? 98  GLU D HG3    1 
ATOM   8041  N  N      . ARG D 2 21  ? 5.647   6.423  229.947 1.00 61.79  ? 99  ARG D N      1 
ATOM   8042  C  CA     . ARG D 2 21  ? 6.733   5.996  230.819 1.00 44.46  ? 99  ARG D CA     1 
ATOM   8043  C  C      . ARG D 2 21  ? 8.084   6.313  230.196 1.00 42.01  ? 99  ARG D C      1 
ATOM   8044  O  O      . ARG D 2 21  ? 8.995   6.792  230.880 1.00 42.41  ? 99  ARG D O      1 
ATOM   8045  C  CB     . ARG D 2 21  ? 6.614   4.500  231.098 1.00 74.60  ? 99  ARG D CB     1 
ATOM   8046  C  CG     . ARG D 2 21  ? 7.515   3.992  232.205 1.00 63.07  ? 99  ARG D CG     1 
ATOM   8047  C  CD     . ARG D 2 21  ? 7.981   2.598  231.896 1.00 56.78  ? 99  ARG D CD     1 
ATOM   8048  N  NE     . ARG D 2 21  ? 6.871   1.728  231.517 1.00 49.50  ? 99  ARG D NE     1 
ATOM   8049  C  CZ     . ARG D 2 21  ? 7.004   0.610  230.810 1.00 84.53  ? 99  ARG D CZ     1 
ATOM   8050  N  NH1    . ARG D 2 21  ? 8.199   0.211  230.385 1.00 73.05  ? 99  ARG D NH1    1 
ATOM   8051  N  NH2    . ARG D 2 21  ? 5.935   -0.113 230.520 1.00 67.49  ? 99  ARG D NH2    1 
ATOM   8052  H  H      . ARG D 2 21  ? 5.151   5.785  229.653 1.00 74.15  ? 99  ARG D H      1 
ATOM   8053  H  HA     . ARG D 2 21  ? 6.669   6.469  231.663 1.00 53.35  ? 99  ARG D HA     1 
ATOM   8054  H  HB2    . ARG D 2 21  ? 5.698   4.305  231.352 1.00 89.52  ? 99  ARG D HB2    1 
ATOM   8055  H  HB3    . ARG D 2 21  ? 6.839   4.015  230.289 1.00 89.52  ? 99  ARG D HB3    1 
ATOM   8056  H  HG2    . ARG D 2 21  ? 8.293   4.567  232.279 1.00 75.69  ? 99  ARG D HG2    1 
ATOM   8057  H  HG3    . ARG D 2 21  ? 7.024   3.974  233.041 1.00 75.69  ? 99  ARG D HG3    1 
ATOM   8058  H  HD2    . ARG D 2 21  ? 8.609   2.627  231.157 1.00 68.13  ? 99  ARG D HD2    1 
ATOM   8059  H  HD3    . ARG D 2 21  ? 8.406   2.221  232.682 1.00 68.13  ? 99  ARG D HD3    1 
ATOM   8060  H  HE     . ARG D 2 21  ? 6.079   1.954  231.766 1.00 59.40  ? 99  ARG D HE     1 
ATOM   8061  H  HH11   . ARG D 2 21  ? 8.899   0.676  230.570 1.00 87.66  ? 99  ARG D HH11   1 
ATOM   8062  H  HH12   . ARG D 2 21  ? 8.273   -0.513 229.927 1.00 87.66  ? 99  ARG D HH12   1 
ATOM   8063  H  HH21   . ARG D 2 21  ? 5.159   0.140  230.790 1.00 80.99  ? 99  ARG D HH21   1 
ATOM   8064  H  HH22   . ARG D 2 21  ? 6.016   -0.835 230.061 1.00 80.99  ? 99  ARG D HH22   1 
ATOM   8065  N  N      . ARG D 2 22  ? 8.231   6.057  228.894 1.00 86.86  ? 100 ARG D N      1 
ATOM   8066  C  CA     . ARG D 2 22  ? 9.485   6.341  228.205 1.00 49.13  ? 100 ARG D CA     1 
ATOM   8067  C  C      . ARG D 2 22  ? 9.819   7.827  228.190 1.00 42.55  ? 100 ARG D C      1 
ATOM   8068  O  O      . ARG D 2 22  ? 10.995  8.182  228.060 1.00 42.12  ? 100 ARG D O      1 
ATOM   8069  C  CB     . ARG D 2 22  ? 9.422   5.811  226.775 1.00 60.75  ? 100 ARG D CB     1 
ATOM   8070  H  H      . ARG D 2 22  ? 7.620   5.719  228.391 1.00 104.23 ? 100 ARG D H      1 
ATOM   8071  H  HA     . ARG D 2 22  ? 10.206  5.880  228.663 1.00 58.96  ? 100 ARG D HA     1 
ATOM   8072  N  N      . ARG D 2 23  ? 8.813   8.699  228.304 1.00 62.44  ? 101 ARG D N      1 
ATOM   8073  C  CA     . ARG D 2 23  ? 9.081   10.133 228.370 1.00 51.27  ? 101 ARG D CA     1 
ATOM   8074  C  C      . ARG D 2 23  ? 9.722   10.511 229.701 1.00 81.08  ? 101 ARG D C      1 
ATOM   8075  O  O      . ARG D 2 23  ? 10.652  11.327 229.740 1.00 82.05  ? 101 ARG D O      1 
ATOM   8076  C  CB     . ARG D 2 23  ? 7.790   10.928 228.161 1.00 35.28  ? 101 ARG D CB     1 
ATOM   8077  C  CG     . ARG D 2 23  ? 7.197   10.830 226.771 1.00 42.31  ? 101 ARG D CG     1 
ATOM   8078  C  CD     . ARG D 2 23  ? 5.918   11.664 226.636 1.00 53.73  ? 101 ARG D CD     1 
ATOM   8079  N  NE     . ARG D 2 23  ? 6.177   13.098 226.763 1.00 35.37  ? 101 ARG D NE     1 
ATOM   8080  C  CZ     . ARG D 2 23  ? 5.908   13.837 227.836 1.00 90.83  ? 101 ARG D CZ     1 
ATOM   8081  N  NH1    . ARG D 2 23  ? 5.354   13.297 228.917 1.00 80.74  ? 101 ARG D NH1    1 
ATOM   8082  N  NH2    . ARG D 2 23  ? 6.194   15.133 227.826 1.00 75.71  ? 101 ARG D NH2    1 
ATOM   8083  H  H      . ARG D 2 23  ? 7.981   8.487  228.344 1.00 74.93  ? 101 ARG D H      1 
ATOM   8084  H  HA     . ARG D 2 23  ? 9.698   10.372 227.661 1.00 61.52  ? 101 ARG D HA     1 
ATOM   8085  H  HB2    . ARG D 2 23  ? 7.123   10.603 228.786 1.00 42.34  ? 101 ARG D HB2    1 
ATOM   8086  H  HB3    . ARG D 2 23  ? 7.972   11.864 228.336 1.00 42.34  ? 101 ARG D HB3    1 
ATOM   8087  H  HG2    . ARG D 2 23  ? 7.843   11.158 226.125 1.00 50.77  ? 101 ARG D HG2    1 
ATOM   8088  H  HG3    . ARG D 2 23  ? 6.977   9.904  226.582 1.00 50.77  ? 101 ARG D HG3    1 
ATOM   8089  H  HD2    . ARG D 2 23  ? 5.525   11.505 225.764 1.00 64.47  ? 101 ARG D HD2    1 
ATOM   8090  H  HD3    . ARG D 2 23  ? 5.296   11.407 227.334 1.00 64.47  ? 101 ARG D HD3    1 
ATOM   8091  H  HE     . ARG D 2 23  ? 6.532   13.497 226.089 1.00 42.44  ? 101 ARG D HE     1 
ATOM   8092  H  HH11   . ARG D 2 23  ? 5.166   12.458 228.931 1.00 96.88  ? 101 ARG D HH11   1 
ATOM   8093  H  HH12   . ARG D 2 23  ? 5.185   13.787 229.604 1.00 96.88  ? 101 ARG D HH12   1 
ATOM   8094  H  HH21   . ARG D 2 23  ? 6.551   15.489 227.129 1.00 90.86  ? 101 ARG D HH21   1 
ATOM   8095  H  HH22   . ARG D 2 23  ? 6.021   15.617 228.516 1.00 90.86  ? 101 ARG D HH22   1 
ATOM   8096  N  N      . ARG D 2 24  ? 9.238   9.932  230.803 1.00 71.42  ? 102 ARG D N      1 
ATOM   8097  C  CA     . ARG D 2 24  ? 9.837   10.220 232.102 1.00 57.32  ? 102 ARG D CA     1 
ATOM   8098  C  C      . ARG D 2 24  ? 11.304  9.818  232.119 1.00 72.56  ? 102 ARG D C      1 
ATOM   8099  O  O      . ARG D 2 24  ? 12.156  10.566 232.615 1.00 69.72  ? 102 ARG D O      1 
ATOM   8100  C  CB     . ARG D 2 24  ? 9.077   9.496  233.216 1.00 49.21  ? 102 ARG D CB     1 
ATOM   8101  C  CG     . ARG D 2 24  ? 7.573   9.653  233.165 1.00 46.72  ? 102 ARG D CG     1 
ATOM   8102  C  CD     . ARG D 2 24  ? 6.902   9.057  234.389 1.00 43.71  ? 102 ARG D CD     1 
ATOM   8103  N  NE     . ARG D 2 24  ? 5.544   8.599  234.086 1.00 47.59  ? 102 ARG D NE     1 
ATOM   8104  C  CZ     . ARG D 2 24  ? 5.166   7.325  233.997 1.00 70.84  ? 102 ARG D CZ     1 
ATOM   8105  N  NH1    . ARG D 2 24  ? 6.033   6.343  234.197 1.00 42.38  ? 102 ARG D NH1    1 
ATOM   8106  N  NH2    . ARG D 2 24  ? 3.903   7.028  233.718 1.00 45.94  ? 102 ARG D NH2    1 
ATOM   8107  H  H      . ARG D 2 24  ? 8.578   9.381  230.824 1.00 85.71  ? 102 ARG D H      1 
ATOM   8108  H  HA     . ARG D 2 24  ? 9.784   11.174 232.272 1.00 68.78  ? 102 ARG D HA     1 
ATOM   8109  H  HB2    . ARG D 2 24  ? 9.275   8.548  233.160 1.00 59.06  ? 102 ARG D HB2    1 
ATOM   8110  H  HB3    . ARG D 2 24  ? 9.379   9.842  234.071 1.00 59.06  ? 102 ARG D HB3    1 
ATOM   8111  H  HG2    . ARG D 2 24  ? 7.351   10.596 233.127 1.00 56.06  ? 102 ARG D HG2    1 
ATOM   8112  H  HG3    . ARG D 2 24  ? 7.231   9.197  232.380 1.00 56.06  ? 102 ARG D HG3    1 
ATOM   8113  H  HD2    . ARG D 2 24  ? 7.417   8.296  234.699 1.00 52.45  ? 102 ARG D HD2    1 
ATOM   8114  H  HD3    . ARG D 2 24  ? 6.847   9.731  235.085 1.00 52.45  ? 102 ARG D HD3    1 
ATOM   8115  H  HE     . ARG D 2 24  ? 4.943   9.200  233.956 1.00 57.11  ? 102 ARG D HE     1 
ATOM   8116  H  HH11   . ARG D 2 24  ? 6.853   6.524  234.381 1.00 50.85  ? 102 ARG D HH11   1 
ATOM   8117  H  HH12   . ARG D 2 24  ? 5.775   5.524  234.139 1.00 50.85  ? 102 ARG D HH12   1 
ATOM   8118  H  HH21   . ARG D 2 24  ? 3.332   7.658  233.588 1.00 55.13  ? 102 ARG D HH21   1 
ATOM   8119  H  HH22   . ARG D 2 24  ? 3.657   6.206  233.662 1.00 55.13  ? 102 ARG D HH22   1 
ATOM   8120  N  N      . ASN D 2 25  ? 11.619  8.640  231.575 1.00 65.65  ? 103 ASN D N      1 
ATOM   8121  C  CA     . ASN D 2 25  ? 13.001  8.173  231.569 1.00 82.53  ? 103 ASN D CA     1 
ATOM   8122  C  C      . ASN D 2 25  ? 13.912  9.172  230.869 1.00 84.50  ? 103 ASN D C      1 
ATOM   8123  O  O      . ASN D 2 25  ? 15.049  9.396  231.300 1.00 95.79  ? 103 ASN D O      1 
ATOM   8124  C  CB     . ASN D 2 25  ? 13.091  6.804  230.892 1.00 101.94 ? 103 ASN D CB     1 
ATOM   8125  C  CG     . ASN D 2 25  ? 12.177  5.776  231.528 1.00 91.31  ? 103 ASN D CG     1 
ATOM   8126  O  OD1    . ASN D 2 25  ? 11.671  5.975  232.635 1.00 68.28  ? 103 ASN D OD1    1 
ATOM   8127  N  ND2    . ASN D 2 25  ? 11.963  4.666  230.829 1.00 69.10  ? 103 ASN D ND2    1 
ATOM   8128  H  H      . ASN D 2 25  ? 11.057  8.102  231.207 1.00 78.78  ? 103 ASN D H      1 
ATOM   8129  H  HA     . ASN D 2 25  ? 13.306  8.077  232.485 1.00 99.04  ? 103 ASN D HA     1 
ATOM   8130  H  HB2    . ASN D 2 25  ? 12.838  6.895  229.960 1.00 122.32 ? 103 ASN D HB2    1 
ATOM   8131  H  HB3    . ASN D 2 25  ? 14.002  6.478  230.959 1.00 122.32 ? 103 ASN D HB3    1 
ATOM   8132  H  HD21   . ASN D 2 25  ? 11.452  4.051  231.145 1.00 82.92  ? 103 ASN D HD21   1 
ATOM   8133  H  HD22   . ASN D 2 25  ? 12.335  4.563  230.060 1.00 82.92  ? 103 ASN D HD22   1 
ATOM   8134  N  N      . LYS D 2 26  ? 13.428  9.781  229.786 1.00 86.99  ? 104 LYS D N      1 
ATOM   8135  C  CA     . LYS D 2 26  ? 14.212  10.789 229.079 1.00 76.53  ? 104 LYS D CA     1 
ATOM   8136  C  C      . LYS D 2 26  ? 14.401  12.032 229.936 1.00 45.90  ? 104 LYS D C      1 
ATOM   8137  O  O      . LYS D 2 26  ? 15.530  12.477 230.167 1.00 66.46  ? 104 LYS D O      1 
ATOM   8138  C  CB     . LYS D 2 26  ? 13.528  11.151 227.760 1.00 63.67  ? 104 LYS D CB     1 
ATOM   8139  C  CG     . LYS D 2 26  ? 14.001  10.346 226.564 1.00 95.08  ? 104 LYS D CG     1 
ATOM   8140  C  CD     . LYS D 2 26  ? 15.057  11.106 225.776 1.00 81.63  ? 104 LYS D CD     1 
ATOM   8141  C  CE     . LYS D 2 26  ? 15.460  10.349 224.519 1.00 88.72  ? 104 LYS D CE     1 
ATOM   8142  N  NZ     . LYS D 2 26  ? 14.315  10.149 223.582 1.00 94.43  ? 104 LYS D NZ     1 
ATOM   8143  H  H      . LYS D 2 26  ? 12.654  9.629  229.443 1.00 104.39 ? 104 LYS D H      1 
ATOM   8144  H  HA     . LYS D 2 26  ? 15.088  10.425 228.876 1.00 91.84  ? 104 LYS D HA     1 
ATOM   8145  H  HB2    . LYS D 2 26  ? 12.574  11.004 227.855 1.00 76.40  ? 104 LYS D HB2    1 
ATOM   8146  H  HB3    . LYS D 2 26  ? 13.697  12.087 227.570 1.00 76.40  ? 104 LYS D HB3    1 
ATOM   8147  H  HG2    . LYS D 2 26  ? 14.391  9.513  226.871 1.00 114.10 ? 104 LYS D HG2    1 
ATOM   8148  H  HG3    . LYS D 2 26  ? 13.249  10.171 225.977 1.00 114.10 ? 104 LYS D HG3    1 
ATOM   8149  H  HD2    . LYS D 2 26  ? 14.700  11.968 225.511 1.00 97.96  ? 104 LYS D HD2    1 
ATOM   8150  H  HD3    . LYS D 2 26  ? 15.846  11.223 226.327 1.00 97.96  ? 104 LYS D HD3    1 
ATOM   8151  H  HE2    . LYS D 2 26  ? 16.146  10.852 224.053 1.00 106.46 ? 104 LYS D HE2    1 
ATOM   8152  H  HE3    . LYS D 2 26  ? 15.799  9.476  224.770 1.00 106.46 ? 104 LYS D HE3    1 
ATOM   8153  H  HZ1    . LYS D 2 26  ? 14.586  9.704  222.860 1.00 113.32 ? 104 LYS D HZ1    1 
ATOM   8154  H  HZ2    . LYS D 2 26  ? 13.671  9.683  223.983 1.00 113.32 ? 104 LYS D HZ2    1 
ATOM   8155  H  HZ3    . LYS D 2 26  ? 13.987  10.937 223.329 1.00 113.32 ? 104 LYS D HZ3    1 
ATOM   8156  N  N      . MET D 2 27  ? 13.300  12.606 230.418 1.00 56.69  ? 105 MET D N      1 
ATOM   8157  C  CA     . MET D 2 27  ? 13.387  13.833 231.196 1.00 56.71  ? 105 MET D CA     1 
ATOM   8158  C  C      . MET D 2 27  ? 14.402  13.694 232.322 1.00 52.66  ? 105 MET D C      1 
ATOM   8159  O  O      . MET D 2 27  ? 15.178  14.617 232.588 1.00 58.86  ? 105 MET D O      1 
ATOM   8160  C  CB     . MET D 2 27  ? 12.004  14.189 231.742 1.00 48.02  ? 105 MET D CB     1 
ATOM   8161  C  CG     . MET D 2 27  ? 11.845  15.652 232.128 1.00 75.54  ? 105 MET D CG     1 
ATOM   8162  S  SD     . MET D 2 27  ? 10.124  16.157 232.253 1.00 138.20 ? 105 MET D SD     1 
ATOM   8163  C  CE     . MET D 2 27  ? 9.623   16.016 230.536 1.00 54.33  ? 105 MET D CE     1 
ATOM   8164  H  H      . MET D 2 27  ? 12.501  12.307 230.308 1.00 68.03  ? 105 MET D H      1 
ATOM   8165  H  HA     . MET D 2 27  ? 13.669  14.554 230.611 1.00 68.05  ? 105 MET D HA     1 
ATOM   8166  H  HB2    . MET D 2 27  ? 11.341  13.988 231.063 1.00 57.63  ? 105 MET D HB2    1 
ATOM   8167  H  HB3    . MET D 2 27  ? 11.835  13.654 232.533 1.00 57.63  ? 105 MET D HB3    1 
ATOM   8168  H  HG2    . MET D 2 27  ? 12.263  15.798 232.990 1.00 90.65  ? 105 MET D HG2    1 
ATOM   8169  H  HG3    . MET D 2 27  ? 12.271  16.204 231.454 1.00 90.65  ? 105 MET D HG3    1 
ATOM   8170  H  HE1    . MET D 2 27  ? 8.689   16.267 230.459 1.00 65.20  ? 105 MET D HE1    1 
ATOM   8171  H  HE2    . MET D 2 27  ? 10.171  16.609 229.998 1.00 65.20  ? 105 MET D HE2    1 
ATOM   8172  H  HE3    . MET D 2 27  ? 9.745   15.099 230.247 1.00 65.20  ? 105 MET D HE3    1 
ATOM   8173  N  N      . THR D 2 28  ? 14.424  12.536 232.984 1.00 69.27  ? 106 THR D N      1 
ATOM   8174  C  CA     . THR D 2 28  ? 15.396  12.315 234.048 1.00 48.33  ? 106 THR D CA     1 
ATOM   8175  C  C      . THR D 2 28  ? 16.797  12.107 233.490 1.00 64.39  ? 106 THR D C      1 
ATOM   8176  O  O      . THR D 2 28  ? 17.781  12.475 234.140 1.00 79.30  ? 106 THR D O      1 
ATOM   8177  C  CB     . THR D 2 28  ? 14.988  11.115 234.897 1.00 47.67  ? 106 THR D CB     1 
ATOM   8178  O  OG1    . THR D 2 28  ? 13.745  11.399 235.546 1.00 46.94  ? 106 THR D OG1    1 
ATOM   8179  C  CG2    . THR D 2 28  ? 16.050  10.819 235.947 1.00 69.11  ? 106 THR D CG2    1 
ATOM   8180  H  H      . THR D 2 28  ? 13.895  11.874 232.836 1.00 83.13  ? 106 THR D H      1 
ATOM   8181  H  HA     . THR D 2 28  ? 15.416  13.095 234.624 1.00 58.00  ? 106 THR D HA     1 
ATOM   8182  H  HB     . THR D 2 28  ? 14.888  10.334 234.329 1.00 57.20  ? 106 THR D HB     1 
ATOM   8183  H  HG1    . THR D 2 28  ? 13.510  10.744 236.017 1.00 56.33  ? 106 THR D HG1    1 
ATOM   8184  H  HG21   . THR D 2 28  ? 15.783  10.055 236.481 1.00 82.94  ? 106 THR D HG21   1 
ATOM   8185  H  HG22   . THR D 2 28  ? 16.897  10.621 235.516 1.00 82.94  ? 106 THR D HG22   1 
ATOM   8186  H  HG23   . THR D 2 28  ? 16.164  11.586 236.528 1.00 82.94  ? 106 THR D HG23   1 
ATOM   8187  N  N      . ALA D 2 29  ? 16.913  11.499 232.307 1.00 82.36  ? 107 ALA D N      1 
ATOM   8188  C  CA     . ALA D 2 29  ? 18.221  11.359 231.678 1.00 64.87  ? 107 ALA D CA     1 
ATOM   8189  C  C      . ALA D 2 29  ? 18.802  12.723 231.338 1.00 57.15  ? 107 ALA D C      1 
ATOM   8190  O  O      . ALA D 2 29  ? 19.945  13.030 231.695 1.00 74.98  ? 107 ALA D O      1 
ATOM   8191  C  CB     . ALA D 2 29  ? 18.116  10.493 230.422 1.00 94.83  ? 107 ALA D CB     1 
ATOM   8192  H  H      . ALA D 2 29  ? 16.260  11.166 231.857 1.00 98.83  ? 107 ALA D H      1 
ATOM   8193  H  HA     . ALA D 2 29  ? 18.825  10.920 232.297 1.00 77.85  ? 107 ALA D HA     1 
ATOM   8194  H  HB1    . ALA D 2 29  ? 18.995  10.412 230.020 1.00 113.80 ? 107 ALA D HB1    1 
ATOM   8195  H  HB2    . ALA D 2 29  ? 17.784  9.616  230.671 1.00 113.80 ? 107 ALA D HB2    1 
ATOM   8196  H  HB3    . ALA D 2 29  ? 17.504  10.914 229.799 1.00 113.80 ? 107 ALA D HB3    1 
ATOM   8197  N  N      . TYR D 2 30  ? 18.023  13.558 230.647 1.00 74.19  ? 108 TYR D N      1 
ATOM   8198  C  CA     . TYR D 2 30  ? 18.488  14.898 230.305 1.00 60.85  ? 108 TYR D CA     1 
ATOM   8199  C  C      . TYR D 2 30  ? 18.885  15.670 231.553 1.00 63.69  ? 108 TYR D C      1 
ATOM   8200  O  O      . TYR D 2 30  ? 19.987  16.224 231.634 1.00 68.90  ? 108 TYR D O      1 
ATOM   8201  C  CB     . TYR D 2 30  ? 17.399  15.658 229.543 1.00 67.39  ? 108 TYR D CB     1 
ATOM   8202  C  CG     . TYR D 2 30  ? 17.199  15.251 228.094 1.00 91.11  ? 108 TYR D CG     1 
ATOM   8203  C  CD1    . TYR D 2 30  ? 18.265  14.845 227.299 1.00 75.29  ? 108 TYR D CD1    1 
ATOM   8204  C  CD2    . TYR D 2 30  ? 15.936  15.292 227.518 1.00 88.43  ? 108 TYR D CD2    1 
ATOM   8205  C  CE1    . TYR D 2 30  ? 18.074  14.484 225.978 1.00 90.71  ? 108 TYR D CE1    1 
ATOM   8206  C  CE2    . TYR D 2 30  ? 15.737  14.932 226.201 1.00 86.82  ? 108 TYR D CE2    1 
ATOM   8207  C  CZ     . TYR D 2 30  ? 16.807  14.528 225.437 1.00 94.40  ? 108 TYR D CZ     1 
ATOM   8208  O  OH     . TYR D 2 30  ? 16.600  14.175 224.123 1.00 80.63  ? 108 TYR D OH     1 
ATOM   8209  H  H      . TYR D 2 30  ? 17.230  13.373 230.369 1.00 89.03  ? 108 TYR D H      1 
ATOM   8210  H  HA     . TYR D 2 30  ? 19.267  14.828 229.731 1.00 73.02  ? 108 TYR D HA     1 
ATOM   8211  H  HB2    . TYR D 2 30  ? 16.555  15.523 230.001 1.00 80.87  ? 108 TYR D HB2    1 
ATOM   8212  H  HB3    . TYR D 2 30  ? 17.622  16.602 229.551 1.00 80.87  ? 108 TYR D HB3    1 
ATOM   8213  H  HD1    . TYR D 2 30  ? 19.120  14.813 227.663 1.00 90.35  ? 108 TYR D HD1    1 
ATOM   8214  H  HD2    . TYR D 2 30  ? 15.209  15.562 228.031 1.00 106.11 ? 108 TYR D HD2    1 
ATOM   8215  H  HE1    . TYR D 2 30  ? 18.795  14.212 225.459 1.00 108.85 ? 108 TYR D HE1    1 
ATOM   8216  H  HE2    . TYR D 2 30  ? 14.884  14.962 225.832 1.00 104.19 ? 108 TYR D HE2    1 
ATOM   8217  H  HH     . TYR D 2 30  ? 15.786  14.249 223.930 1.00 96.76  ? 108 TYR D HH     1 
ATOM   8218  N  N      . ILE D 2 31  ? 17.991  15.723 232.539 1.00 71.42  ? 109 ILE D N      1 
ATOM   8219  C  CA     . ILE D 2 31  ? 18.255  16.521 233.730 1.00 80.47  ? 109 ILE D CA     1 
ATOM   8220  C  C      . ILE D 2 31  ? 19.499  16.008 234.442 1.00 98.18  ? 109 ILE D C      1 
ATOM   8221  O  O      . ILE D 2 31  ? 20.314  16.790 234.947 1.00 103.61 ? 109 ILE D O      1 
ATOM   8222  C  CB     . ILE D 2 31  ? 17.021  16.525 234.653 1.00 65.97  ? 109 ILE D CB     1 
ATOM   8223  C  CG1    . ILE D 2 31  ? 17.048  17.746 235.564 1.00 89.64  ? 109 ILE D CG1    1 
ATOM   8224  C  CG2    . ILE D 2 31  ? 16.949  15.249 235.481 1.00 104.34 ? 109 ILE D CG2    1 
ATOM   8225  C  CD1    . ILE D 2 31  ? 15.763  17.947 236.308 1.00 94.93  ? 109 ILE D CD1    1 
ATOM   8226  H  H      . ILE D 2 31  ? 17.235  15.312 232.542 1.00 85.70  ? 109 ILE D H      1 
ATOM   8227  H  HA     . ILE D 2 31  ? 18.426  17.437 233.461 1.00 96.57  ? 109 ILE D HA     1 
ATOM   8228  H  HB     . ILE D 2 31  ? 16.227  16.575 234.099 1.00 79.16  ? 109 ILE D HB     1 
ATOM   8229  H  HG12   . ILE D 2 31  ? 17.758  17.637 236.216 1.00 107.57 ? 109 ILE D HG12   1 
ATOM   8230  H  HG13   . ILE D 2 31  ? 17.210  18.537 235.026 1.00 107.57 ? 109 ILE D HG13   1 
ATOM   8231  H  HG21   . ILE D 2 31  ? 16.163  15.285 236.048 1.00 125.20 ? 109 ILE D HG21   1 
ATOM   8232  H  HG22   . ILE D 2 31  ? 16.891  14.488 234.882 1.00 125.20 ? 109 ILE D HG22   1 
ATOM   8233  H  HG23   . ILE D 2 31  ? 17.748  15.181 236.026 1.00 125.20 ? 109 ILE D HG23   1 
ATOM   8234  H  HD11   . ILE D 2 31  ? 15.844  18.736 236.868 1.00 113.92 ? 109 ILE D HD11   1 
ATOM   8235  H  HD12   . ILE D 2 31  ? 15.044  18.067 235.669 1.00 113.92 ? 109 ILE D HD12   1 
ATOM   8236  H  HD13   . ILE D 2 31  ? 15.592  17.167 236.858 1.00 113.92 ? 109 ILE D HD13   1 
ATOM   8237  N  N      . THR D 2 32  ? 19.670  14.687 234.489 1.00 78.51  ? 110 THR D N      1 
ATOM   8238  C  CA     . THR D 2 32  ? 20.890  14.126 235.052 1.00 64.01  ? 110 THR D CA     1 
ATOM   8239  C  C      . THR D 2 32  ? 22.092  14.438 234.172 1.00 69.04  ? 110 THR D C      1 
ATOM   8240  O  O      . THR D 2 32  ? 23.214  14.566 234.674 1.00 66.27  ? 110 THR D O      1 
ATOM   8241  C  CB     . THR D 2 32  ? 20.737  12.616 235.229 1.00 85.14  ? 110 THR D CB     1 
ATOM   8242  O  OG1    . THR D 2 32  ? 19.646  12.345 236.116 1.00 100.34 ? 110 THR D OG1    1 
ATOM   8243  C  CG2    . THR D 2 32  ? 22.010  12.004 235.799 1.00 84.46  ? 110 THR D CG2    1 
ATOM   8244  H  H      . THR D 2 32  ? 19.103  14.105 234.207 1.00 94.21  ? 110 THR D H      1 
ATOM   8245  H  HA     . THR D 2 32  ? 21.046  14.518 235.925 1.00 76.82  ? 110 THR D HA     1 
ATOM   8246  H  HB     . THR D 2 32  ? 20.560  12.207 234.367 1.00 102.17 ? 110 THR D HB     1 
ATOM   8247  H  HG1    . THR D 2 32  ? 18.934  12.659 235.800 1.00 120.41 ? 110 THR D HG1    1 
ATOM   8248  H  HG21   . THR D 2 32  ? 21.898  11.046 235.906 1.00 101.36 ? 110 THR D HG21   1 
ATOM   8249  H  HG22   . THR D 2 32  ? 22.754  12.169 235.200 1.00 101.36 ? 110 THR D HG22   1 
ATOM   8250  H  HG23   . THR D 2 32  ? 22.207  12.396 236.664 1.00 101.36 ? 110 THR D HG23   1 
ATOM   8251  N  N      . GLU D 2 33  ? 21.880  14.561 232.862 1.00 96.50  ? 111 GLU D N      1 
ATOM   8252  C  CA     . GLU D 2 33  ? 22.982  14.894 231.969 1.00 97.96  ? 111 GLU D CA     1 
ATOM   8253  C  C      . GLU D 2 33  ? 23.560  16.257 232.317 1.00 65.79  ? 111 GLU D C      1 
ATOM   8254  O  O      . GLU D 2 33  ? 24.777  16.406 232.477 1.00 109.08 ? 111 GLU D O      1 
ATOM   8255  C  CB     . GLU D 2 33  ? 22.505  14.858 230.514 1.00 90.77  ? 111 GLU D CB     1 
ATOM   8256  C  CG     . GLU D 2 33  ? 23.616  14.920 229.482 1.00 64.07  ? 111 GLU D CG     1 
ATOM   8257  C  CD     . GLU D 2 33  ? 23.096  14.781 228.064 1.00 112.59 ? 111 GLU D CD     1 
ATOM   8258  O  OE1    . GLU D 2 33  ? 21.861  14.751 227.886 1.00 124.94 ? 111 GLU D OE1    1 
ATOM   8259  O  OE2    . GLU D 2 33  ? 23.919  14.699 227.128 1.00 125.33 ? 111 GLU D OE2    1 
ATOM   8260  H  H      . GLU D 2 33  ? 21.120  14.460 232.474 1.00 115.80 ? 111 GLU D H      1 
ATOM   8261  H  HA     . GLU D 2 33  ? 23.684  14.233 232.072 1.00 117.55 ? 111 GLU D HA     1 
ATOM   8262  H  HB2    . GLU D 2 33  ? 22.015  14.034 230.369 1.00 108.93 ? 111 GLU D HB2    1 
ATOM   8263  H  HB3    . GLU D 2 33  ? 21.920  15.617 230.362 1.00 108.93 ? 111 GLU D HB3    1 
ATOM   8264  H  HG2    . GLU D 2 33  ? 24.069  15.774 229.554 1.00 76.88  ? 111 GLU D HG2    1 
ATOM   8265  H  HG3    . GLU D 2 33  ? 24.241  14.196 229.646 1.00 76.88  ? 111 GLU D HG3    1 
ATOM   8266  N  N      . LEU D 2 34  ? 22.700  17.268 232.458 1.00 70.78  ? 112 LEU D N      1 
ATOM   8267  C  CA     . LEU D 2 34  ? 23.194  18.612 232.719 1.00 99.90  ? 112 LEU D CA     1 
ATOM   8268  C  C      . LEU D 2 34  ? 23.640  18.797 234.164 1.00 63.45  ? 112 LEU D C      1 
ATOM   8269  O  O      . LEU D 2 34  ? 24.445  19.692 234.438 1.00 86.23  ? 112 LEU D O      1 
ATOM   8270  C  CB     . LEU D 2 34  ? 22.138  19.659 232.345 1.00 93.68  ? 112 LEU D CB     1 
ATOM   8271  C  CG     . LEU D 2 34  ? 20.785  19.661 233.049 1.00 84.54  ? 112 LEU D CG     1 
ATOM   8272  C  CD1    . LEU D 2 34  ? 20.852  20.436 234.348 1.00 89.85  ? 112 LEU D CD1    1 
ATOM   8273  C  CD2    . LEU D 2 34  ? 19.732  20.268 232.133 1.00 77.23  ? 112 LEU D CD2    1 
ATOM   8274  H  H      . LEU D 2 34  ? 21.844  17.200 232.407 1.00 84.93  ? 112 LEU D H      1 
ATOM   8275  H  HA     . LEU D 2 34  ? 23.968  18.768 232.156 1.00 119.88 ? 112 LEU D HA     1 
ATOM   8276  H  HB2    . LEU D 2 34  ? 22.528  20.534 232.499 1.00 112.41 ? 112 LEU D HB2    1 
ATOM   8277  H  HB3    . LEU D 2 34  ? 21.955  19.563 231.398 1.00 112.41 ? 112 LEU D HB3    1 
ATOM   8278  H  HG     . LEU D 2 34  ? 20.525  18.748 233.250 1.00 101.44 ? 112 LEU D HG     1 
ATOM   8279  H  HD11   . LEU D 2 34  ? 19.980  20.419 234.771 1.00 107.82 ? 112 LEU D HD11   1 
ATOM   8280  H  HD12   . LEU D 2 34  ? 21.510  20.022 234.928 1.00 107.82 ? 112 LEU D HD12   1 
ATOM   8281  H  HD13   . LEU D 2 34  ? 21.109  21.351 234.156 1.00 107.82 ? 112 LEU D HD13   1 
ATOM   8282  H  HD21   . LEU D 2 34  ? 18.876  20.264 232.589 1.00 92.68  ? 112 LEU D HD21   1 
ATOM   8283  H  HD22   . LEU D 2 34  ? 19.989  21.179 231.918 1.00 92.68  ? 112 LEU D HD22   1 
ATOM   8284  H  HD23   . LEU D 2 34  ? 19.677  19.739 231.321 1.00 92.68  ? 112 LEU D HD23   1 
ATOM   8285  N  N      . SER D 2 35  ? 23.149  17.975 235.095 1.00 68.98  ? 113 SER D N      1 
ATOM   8286  C  CA     . SER D 2 35  ? 23.724  17.980 236.437 1.00 111.73 ? 113 SER D CA     1 
ATOM   8287  C  C      . SER D 2 35  ? 25.173  17.517 236.404 1.00 70.00  ? 113 SER D C      1 
ATOM   8288  O  O      . SER D 2 35  ? 25.987  17.953 237.224 1.00 82.07  ? 113 SER D O      1 
ATOM   8289  C  CB     . SER D 2 35  ? 22.907  17.091 237.374 1.00 88.83  ? 113 SER D CB     1 
ATOM   8290  O  OG     . SER D 2 35  ? 23.212  15.726 237.168 1.00 94.19  ? 113 SER D OG     1 
ATOM   8291  H  H      . SER D 2 35  ? 22.502  17.421 234.978 1.00 82.78  ? 113 SER D H      1 
ATOM   8292  H  HA     . SER D 2 35  ? 23.705  18.884 236.787 1.00 134.07 ? 113 SER D HA     1 
ATOM   8293  H  HB2    . SER D 2 35  ? 23.115  17.325 238.292 1.00 106.59 ? 113 SER D HB2    1 
ATOM   8294  H  HB3    . SER D 2 35  ? 21.963  17.233 237.201 1.00 106.59 ? 113 SER D HB3    1 
ATOM   8295  H  HG     . SER D 2 35  ? 23.037  15.509 236.376 1.00 113.02 ? 113 SER D HG     1 
ATOM   8296  N  N      . ASP D 2 36  ? 25.504  16.617 235.478 1.00 81.29  ? 114 ASP D N      1 
ATOM   8297  C  CA     . ASP D 2 36  ? 26.894  16.298 235.190 1.00 104.96 ? 114 ASP D CA     1 
ATOM   8298  C  C      . ASP D 2 36  ? 27.607  17.466 234.522 1.00 94.64  ? 114 ASP D C      1 
ATOM   8299  O  O      . ASP D 2 36  ? 28.837  17.564 234.602 1.00 90.93  ? 114 ASP D O      1 
ATOM   8300  C  CB     . ASP D 2 36  ? 26.953  15.059 234.291 1.00 76.08  ? 114 ASP D CB     1 
ATOM   8301  C  CG     . ASP D 2 36  ? 28.315  14.394 234.292 1.00 124.53 ? 114 ASP D CG     1 
ATOM   8302  O  OD1    . ASP D 2 36  ? 29.321  15.085 234.554 1.00 146.55 ? 114 ASP D OD1    1 
ATOM   8303  O  OD2    . ASP D 2 36  ? 28.378  13.175 234.025 1.00 146.99 ? 114 ASP D OD2    1 
ATOM   8304  H  H      . ASP D 2 36  ? 24.937  16.178 235.003 1.00 97.54  ? 114 ASP D H      1 
ATOM   8305  H  HA     . ASP D 2 36  ? 27.354  16.094 236.020 1.00 125.95 ? 114 ASP D HA     1 
ATOM   8306  H  HB2    . ASP D 2 36  ? 26.303  14.410 234.604 1.00 91.29  ? 114 ASP D HB2    1 
ATOM   8307  H  HB3    . ASP D 2 36  ? 26.749  15.321 233.379 1.00 91.29  ? 114 ASP D HB3    1 
ATOM   8308  N  N      . MET D 2 37  ? 26.852  18.367 233.895 1.00 106.07 ? 115 MET D N      1 
ATOM   8309  C  CA     . MET D 2 37  ? 27.375  19.411 233.024 1.00 103.35 ? 115 MET D CA     1 
ATOM   8310  C  C      . MET D 2 37  ? 27.615  20.720 233.773 1.00 85.91  ? 115 MET D C      1 
ATOM   8311  O  O      . MET D 2 37  ? 28.682  21.326 233.642 1.00 87.03  ? 115 MET D O      1 
ATOM   8312  C  CB     . MET D 2 37  ? 26.388  19.636 231.868 1.00 79.46  ? 115 MET D CB     1 
ATOM   8313  C  CG     . MET D 2 37  ? 26.934  20.368 230.676 1.00 78.04  ? 115 MET D CG     1 
ATOM   8314  S  SD     . MET D 2 37  ? 28.179  19.401 229.811 1.00 138.51 ? 115 MET D SD     1 
ATOM   8315  C  CE     . MET D 2 37  ? 29.657  20.124 230.492 1.00 121.58 ? 115 MET D CE     1 
ATOM   8316  H  H      . MET D 2 37  ? 25.995  18.390 233.965 1.00 127.29 ? 115 MET D H      1 
ATOM   8317  H  HA     . MET D 2 37  ? 28.215  19.109 232.643 1.00 124.02 ? 115 MET D HA     1 
ATOM   8318  H  HB2    . MET D 2 37  ? 26.077  18.771 231.559 1.00 95.35  ? 115 MET D HB2    1 
ATOM   8319  H  HB3    . MET D 2 37  ? 25.636  20.148 232.204 1.00 95.35  ? 115 MET D HB3    1 
ATOM   8320  H  HG2    . MET D 2 37  ? 26.211  20.554 230.057 1.00 93.65  ? 115 MET D HG2    1 
ATOM   8321  H  HG3    . MET D 2 37  ? 27.344  21.196 230.970 1.00 93.65  ? 115 MET D HG3    1 
ATOM   8322  H  HE1    . MET D 2 37  ? 30.430  19.686 230.102 1.00 145.89 ? 115 MET D HE1    1 
ATOM   8323  H  HE2    . MET D 2 37  ? 29.671  21.071 230.280 1.00 145.89 ? 115 MET D HE2    1 
ATOM   8324  H  HE3    . MET D 2 37  ? 29.655  19.999 231.453 1.00 145.89 ? 115 MET D HE3    1 
ATOM   8325  N  N      . VAL D 2 38  ? 26.632  21.171 234.546 1.00 93.27  ? 116 VAL D N      1 
ATOM   8326  C  CA     . VAL D 2 38  ? 26.729  22.487 235.191 1.00 85.49  ? 116 VAL D CA     1 
ATOM   8327  C  C      . VAL D 2 38  ? 27.958  22.514 236.092 1.00 93.62  ? 116 VAL D C      1 
ATOM   8328  O  O      . VAL D 2 38  ? 28.173  21.565 236.868 1.00 111.82 ? 116 VAL D O      1 
ATOM   8329  C  CB     . VAL D 2 38  ? 25.450  22.789 235.997 1.00 95.99  ? 116 VAL D CB     1 
ATOM   8330  C  CG1    . VAL D 2 38  ? 25.575  24.122 236.730 1.00 85.01  ? 116 VAL D CG1    1 
ATOM   8331  C  CG2    . VAL D 2 38  ? 24.245  22.819 235.077 1.00 86.04  ? 116 VAL D CG2    1 
ATOM   8332  H  H      . VAL D 2 38  ? 25.905  20.744 234.715 1.00 111.93 ? 116 VAL D H      1 
ATOM   8333  H  HA     . VAL D 2 38  ? 26.832  23.172 234.512 1.00 102.58 ? 116 VAL D HA     1 
ATOM   8334  H  HB     . VAL D 2 38  ? 25.314  22.090 236.656 1.00 115.18 ? 116 VAL D HB     1 
ATOM   8335  H  HG11   . VAL D 2 38  ? 24.758  24.286 237.227 1.00 102.01 ? 116 VAL D HG11   1 
ATOM   8336  H  HG12   . VAL D 2 38  ? 26.330  24.078 237.337 1.00 102.01 ? 116 VAL D HG12   1 
ATOM   8337  H  HG13   . VAL D 2 38  ? 25.714  24.828 236.079 1.00 102.01 ? 116 VAL D HG13   1 
ATOM   8338  H  HG21   . VAL D 2 38  ? 23.452  23.011 235.602 1.00 103.25 ? 116 VAL D HG21   1 
ATOM   8339  H  HG22   . VAL D 2 38  ? 24.375  23.511 234.409 1.00 103.25 ? 116 VAL D HG22   1 
ATOM   8340  H  HG23   . VAL D 2 38  ? 24.155  21.955 234.645 1.00 103.25 ? 116 VAL D HG23   1 
ATOM   8341  N  N      . PRO D 2 39  ? 28.787  23.566 236.052 1.00 105.85 ? 117 PRO D N      1 
ATOM   8342  C  CA     . PRO D 2 39  ? 29.977  23.586 236.923 1.00 84.60  ? 117 PRO D CA     1 
ATOM   8343  C  C      . PRO D 2 39  ? 29.645  23.453 238.398 1.00 74.23  ? 117 PRO D C      1 
ATOM   8344  O  O      . PRO D 2 39  ? 30.357  22.759 239.134 1.00 80.81  ? 117 PRO D O      1 
ATOM   8345  C  CB     . PRO D 2 39  ? 30.616  24.947 236.607 1.00 87.26  ? 117 PRO D CB     1 
ATOM   8346  C  CG     . PRO D 2 39  ? 30.085  25.331 235.281 1.00 118.95 ? 117 PRO D CG     1 
ATOM   8347  C  CD     . PRO D 2 39  ? 28.706  24.767 235.206 1.00 111.63 ? 117 PRO D CD     1 
ATOM   8348  H  HA     . PRO D 2 39  ? 30.590  22.879 236.668 1.00 101.52 ? 117 PRO D HA     1 
ATOM   8349  H  HB2    . PRO D 2 39  ? 30.356  25.594 237.281 1.00 104.71 ? 117 PRO D HB2    1 
ATOM   8350  H  HB3    . PRO D 2 39  ? 31.581  24.854 236.575 1.00 104.71 ? 117 PRO D HB3    1 
ATOM   8351  H  HG2    . PRO D 2 39  ? 30.061  26.298 235.210 1.00 142.74 ? 117 PRO D HG2    1 
ATOM   8352  H  HG3    . PRO D 2 39  ? 30.645  24.953 234.586 1.00 142.74 ? 117 PRO D HG3    1 
ATOM   8353  H  HD2    . PRO D 2 39  ? 28.063  25.395 235.570 1.00 133.95 ? 117 PRO D HD2    1 
ATOM   8354  H  HD3    . PRO D 2 39  ? 28.489  24.524 234.293 1.00 133.95 ? 117 PRO D HD3    1 
ATOM   8355  N  N      . THR D 2 40  ? 28.576  24.106 238.851 1.00 74.80  ? 118 THR D N      1 
ATOM   8356  C  CA     . THR D 2 40  ? 28.187  24.028 240.255 1.00 60.84  ? 118 THR D CA     1 
ATOM   8357  C  C      . THR D 2 40  ? 27.926  22.584 240.671 1.00 106.54 ? 118 THR D C      1 
ATOM   8358  O  O      . THR D 2 40  ? 28.498  22.090 241.648 1.00 124.26 ? 118 THR D O      1 
ATOM   8359  C  CB     . THR D 2 40  ? 26.946  24.890 240.496 1.00 70.28  ? 118 THR D CB     1 
ATOM   8360  O  OG1    . THR D 2 40  ? 25.858  24.401 239.702 1.00 134.74 ? 118 THR D OG1    1 
ATOM   8361  C  CG2    . THR D 2 40  ? 27.216  26.340 240.129 1.00 112.89 ? 118 THR D CG2    1 
ATOM   8362  H  H      . THR D 2 40  ? 28.062  24.598 238.368 1.00 89.76  ? 118 THR D H      1 
ATOM   8363  H  HA     . THR D 2 40  ? 28.907  24.375 240.804 1.00 73.00  ? 118 THR D HA     1 
ATOM   8364  H  HB     . THR D 2 40  ? 26.704  24.852 241.435 1.00 84.34  ? 118 THR D HB     1 
ATOM   8365  H  HG1    . THR D 2 40  ? 25.174  24.871 239.832 1.00 161.69 ? 118 THR D HG1    1 
ATOM   8366  H  HG21   . THR D 2 40  ? 26.423  26.875 240.287 1.00 135.47 ? 118 THR D HG21   1 
ATOM   8367  H  HG22   . THR D 2 40  ? 27.944  26.689 240.668 1.00 135.47 ? 118 THR D HG22   1 
ATOM   8368  H  HG23   . THR D 2 40  ? 27.459  26.405 239.192 1.00 135.47 ? 118 THR D HG23   1 
ATOM   8369  N  N      . CYS D 2 41  ? 27.057  21.891 239.938 1.00 117.61 ? 119 CYS D N      1 
ATOM   8370  C  CA     . CYS D 2 41  ? 26.725  20.502 240.229 1.00 101.39 ? 119 CYS D CA     1 
ATOM   8371  C  C      . CYS D 2 41  ? 27.670  19.506 239.570 1.00 91.36  ? 119 CYS D C      1 
ATOM   8372  O  O      . CYS D 2 41  ? 27.435  18.297 239.670 1.00 125.00 ? 119 CYS D O      1 
ATOM   8373  C  CB     . CYS D 2 41  ? 25.294  20.201 239.775 1.00 65.45  ? 119 CYS D CB     1 
ATOM   8374  S  SG     . CYS D 2 41  ? 24.032  21.229 240.548 1.00 127.34 ? 119 CYS D SG     1 
ATOM   8375  H  H      . CYS D 2 41  ? 26.641  22.211 239.256 1.00 141.13 ? 119 CYS D H      1 
ATOM   8376  H  HA     . CYS D 2 41  ? 26.768  20.364 241.188 1.00 121.66 ? 119 CYS D HA     1 
ATOM   8377  H  HB2    . CYS D 2 41  ? 25.238  20.338 238.816 1.00 78.54  ? 119 CYS D HB2    1 
ATOM   8378  H  HB3    . CYS D 2 41  ? 25.090  19.277 239.985 1.00 78.54  ? 119 CYS D HB3    1 
ATOM   8379  H  HG     . CYS D 2 41  ? 22.956  20.911 240.123 1.00 152.80 ? 119 CYS D HG     1 
ATOM   8380  N  N      . SER D 2 42  ? 28.724  19.978 238.904 1.00 98.49  ? 120 SER D N      1 
ATOM   8381  C  CA     . SER D 2 42  ? 29.596  19.112 238.119 1.00 107.11 ? 120 SER D CA     1 
ATOM   8382  C  C      . SER D 2 42  ? 30.207  18.010 238.971 1.00 100.66 ? 120 SER D C      1 
ATOM   8383  O  O      . SER D 2 42  ? 29.911  16.827 238.777 1.00 94.70  ? 120 SER D O      1 
ATOM   8384  C  CB     . SER D 2 42  ? 30.712  19.932 237.465 1.00 122.57 ? 120 SER D CB     1 
ATOM   8385  O  OG     . SER D 2 42  ? 31.563  20.496 238.446 1.00 120.85 ? 120 SER D OG     1 
ATOM   8386  H  H      . SER D 2 42  ? 28.956  20.806 238.893 1.00 118.19 ? 120 SER D H      1 
ATOM   8387  H  HA     . SER D 2 42  ? 29.077  18.695 237.414 1.00 128.53 ? 120 SER D HA     1 
ATOM   8388  H  HB2    . SER D 2 42  ? 31.234  19.352 236.889 1.00 147.08 ? 120 SER D HB2    1 
ATOM   8389  H  HB3    . SER D 2 42  ? 30.314  20.647 236.943 1.00 147.08 ? 120 SER D HB3    1 
ATOM   8390  H  HG     . SER D 2 42  ? 31.123  21.001 238.953 1.00 145.03 ? 120 SER D HG     1 
ATOM   8391  N  N      . ALA D 2 43  ? 31.066  18.395 239.915 1.00 116.30 ? 121 ALA D N      1 
ATOM   8392  C  CA     . ALA D 2 43  ? 31.826  17.451 240.721 1.00 126.25 ? 121 ALA D CA     1 
ATOM   8393  C  C      . ALA D 2 43  ? 31.284  17.324 242.141 1.00 105.37 ? 121 ALA D C      1 
ATOM   8394  O  O      . ALA D 2 43  ? 32.024  16.926 243.047 1.00 95.62  ? 121 ALA D O      1 
ATOM   8395  C  CB     . ALA D 2 43  ? 33.298  17.863 240.753 1.00 145.03 ? 121 ALA D CB     1 
ATOM   8396  H  H      . ALA D 2 43  ? 31.227  19.217 240.107 1.00 139.56 ? 121 ALA D H      1 
ATOM   8397  H  HA     . ALA D 2 43  ? 31.773  16.576 240.307 1.00 151.50 ? 121 ALA D HA     1 
ATOM   8398  H  HB1    . ALA D 2 43  ? 33.792  17.226 241.293 1.00 174.03 ? 121 ALA D HB1    1 
ATOM   8399  H  HB2    . ALA D 2 43  ? 33.644  17.866 239.847 1.00 174.03 ? 121 ALA D HB2    1 
ATOM   8400  H  HB3    . ALA D 2 43  ? 33.369  18.750 241.139 1.00 174.03 ? 121 ALA D HB3    1 
ATOM   8401  N  N      . LEU D 2 44  ? 30.015  17.658 242.357 1.00 135.07 ? 122 LEU D N      1 
ATOM   8402  C  CA     . LEU D 2 44  ? 29.410  17.463 243.666 1.00 109.56 ? 122 LEU D CA     1 
ATOM   8403  C  C      . LEU D 2 44  ? 29.325  15.973 243.969 1.00 110.03 ? 122 LEU D C      1 
ATOM   8404  O  O      . LEU D 2 44  ? 28.779  15.196 243.179 1.00 107.85 ? 122 LEU D O      1 
ATOM   8405  C  CB     . LEU D 2 44  ? 28.025  18.106 243.710 1.00 83.40  ? 122 LEU D CB     1 
ATOM   8406  C  CG     . LEU D 2 44  ? 27.511  18.492 245.097 1.00 109.56 ? 122 LEU D CG     1 
ATOM   8407  C  CD1    . LEU D 2 44  ? 26.400  19.519 244.957 1.00 110.43 ? 122 LEU D CD1    1 
ATOM   8408  C  CD2    . LEU D 2 44  ? 27.018  17.277 245.869 1.00 98.87  ? 122 LEU D CD2    1 
ATOM   8409  H  H      . LEU D 2 44  ? 29.489  17.995 241.766 1.00 162.08 ? 122 LEU D H      1 
ATOM   8410  H  HA     . LEU D 2 44  ? 29.964  17.883 244.342 1.00 131.47 ? 122 LEU D HA     1 
ATOM   8411  H  HB2    . LEU D 2 44  ? 28.047  18.915 243.174 1.00 100.08 ? 122 LEU D HB2    1 
ATOM   8412  H  HB3    . LEU D 2 44  ? 27.388  17.483 243.328 1.00 100.08 ? 122 LEU D HB3    1 
ATOM   8413  H  HG     . LEU D 2 44  ? 28.233  18.897 245.602 1.00 131.48 ? 122 LEU D HG     1 
ATOM   8414  H  HD11   . LEU D 2 44  ? 26.079  19.759 245.840 1.00 132.52 ? 122 LEU D HD11   1 
ATOM   8415  H  HD12   . LEU D 2 44  ? 26.752  20.304 244.508 1.00 132.52 ? 122 LEU D HD12   1 
ATOM   8416  H  HD13   . LEU D 2 44  ? 25.679  19.134 244.435 1.00 132.52 ? 122 LEU D HD13   1 
ATOM   8417  H  HD21   . LEU D 2 44  ? 26.701  17.564 246.740 1.00 118.65 ? 122 LEU D HD21   1 
ATOM   8418  H  HD22   . LEU D 2 44  ? 26.295  16.861 245.375 1.00 118.65 ? 122 LEU D HD22   1 
ATOM   8419  H  HD23   . LEU D 2 44  ? 27.751  16.650 245.974 1.00 118.65 ? 122 LEU D HD23   1 
ATOM   8420  N  N      . ALA D 2 45  ? 29.873  15.575 245.118 1.00 107.80 ? 123 ALA D N      1 
ATOM   8421  C  CA     . ALA D 2 45  ? 29.968  14.157 245.456 1.00 99.09  ? 123 ALA D CA     1 
ATOM   8422  C  C      . ALA D 2 45  ? 28.587  13.539 245.644 1.00 117.11 ? 123 ALA D C      1 
ATOM   8423  O  O      . ALA D 2 45  ? 28.236  12.558 244.977 1.00 72.15  ? 123 ALA D O      1 
ATOM   8424  C  CB     . ALA D 2 45  ? 30.817  13.980 246.716 1.00 99.09  ? 123 ALA D CB     1 
ATOM   8425  H  H      . ALA D 2 45  ? 30.196  16.103 245.715 1.00 129.36 ? 123 ALA D H      1 
ATOM   8426  H  HA     . ALA D 2 45  ? 30.408  13.689 244.729 1.00 118.90 ? 123 ALA D HA     1 
ATOM   8427  H  HB1    . ALA D 2 45  ? 30.872  13.035 246.929 1.00 118.91 ? 123 ALA D HB1    1 
ATOM   8428  H  HB2    . ALA D 2 45  ? 31.705  14.334 246.551 1.00 118.91 ? 123 ALA D HB2    1 
ATOM   8429  H  HB3    . ALA D 2 45  ? 30.399  14.461 247.448 1.00 118.91 ? 123 ALA D HB3    1 
ATOM   8430  N  N      . ARG D 2 46  ? 27.792  14.093 246.556 1.00 127.80 ? 124 ARG D N      1 
ATOM   8431  C  CA     . ARG D 2 46  ? 26.461  13.567 246.808 1.00 138.06 ? 124 ARG D CA     1 
ATOM   8432  C  C      . ARG D 2 46  ? 25.554  13.799 245.602 1.00 107.24 ? 124 ARG D C      1 
ATOM   8433  O  O      . ARG D 2 46  ? 25.810  14.652 244.746 1.00 125.25 ? 124 ARG D O      1 
ATOM   8434  C  CB     . ARG D 2 46  ? 25.852  14.218 248.049 1.00 139.19 ? 124 ARG D CB     1 
ATOM   8435  H  H      . ARG D 2 46  ? 28.003  14.772 247.039 1.00 153.36 ? 124 ARG D H      1 
ATOM   8436  H  HA     . ARG D 2 46  ? 26.519  12.612 246.964 1.00 165.67 ? 124 ARG D HA     1 
ATOM   8437  N  N      . LYS D 2 47  ? 24.480  13.019 245.540 1.00 90.65  ? 125 LYS D N      1 
ATOM   8438  C  CA     . LYS D 2 47  ? 23.527  13.155 244.443 1.00 123.74 ? 125 LYS D CA     1 
ATOM   8439  C  C      . LYS D 2 47  ? 22.639  14.372 244.682 1.00 107.04 ? 125 LYS D C      1 
ATOM   8440  O  O      . LYS D 2 47  ? 22.025  14.477 245.746 1.00 134.68 ? 125 LYS D O      1 
ATOM   8441  C  CB     . LYS D 2 47  ? 22.669  11.899 244.322 1.00 90.47  ? 125 LYS D CB     1 
ATOM   8442  H  H      . LYS D 2 47  ? 24.281  12.410 246.114 1.00 108.78 ? 125 LYS D H      1 
ATOM   8443  H  HA     . LYS D 2 47  ? 24.008  13.282 243.610 1.00 148.49 ? 125 LYS D HA     1 
ATOM   8444  N  N      . PRO D 2 48  ? 22.534  15.299 243.733 1.00 75.61  ? 126 PRO D N      1 
ATOM   8445  C  CA     . PRO D 2 48  ? 21.690  16.479 243.946 1.00 61.31  ? 126 PRO D CA     1 
ATOM   8446  C  C      . PRO D 2 48  ? 20.222  16.177 243.664 1.00 71.10  ? 126 PRO D C      1 
ATOM   8447  O  O      . PRO D 2 48  ? 19.852  15.108 243.178 1.00 85.53  ? 126 PRO D O      1 
ATOM   8448  C  CB     . PRO D 2 48  ? 22.254  17.504 242.956 1.00 37.11  ? 126 PRO D CB     1 
ATOM   8449  C  CG     . PRO D 2 48  ? 22.941  16.681 241.885 1.00 123.46 ? 126 PRO D CG     1 
ATOM   8450  C  CD     . PRO D 2 48  ? 23.057  15.252 242.358 1.00 79.83  ? 126 PRO D CD     1 
ATOM   8451  H  HA     . PRO D 2 48  ? 21.789  16.812 244.852 1.00 73.57  ? 126 PRO D HA     1 
ATOM   8452  H  HB2    . PRO D 2 48  ? 21.529  18.025 242.576 1.00 44.53  ? 126 PRO D HB2    1 
ATOM   8453  H  HB3    . PRO D 2 48  ? 22.891  18.080 243.408 1.00 44.53  ? 126 PRO D HB3    1 
ATOM   8454  H  HG2    . PRO D 2 48  ? 22.413  16.719 241.072 1.00 148.16 ? 126 PRO D HG2    1 
ATOM   8455  H  HG3    . PRO D 2 48  ? 23.824  17.049 241.724 1.00 148.16 ? 126 PRO D HG3    1 
ATOM   8456  H  HD2    . PRO D 2 48  ? 22.510  14.669 241.808 1.00 95.80  ? 126 PRO D HD2    1 
ATOM   8457  H  HD3    . PRO D 2 48  ? 23.985  14.971 242.360 1.00 95.80  ? 126 PRO D HD3    1 
ATOM   8458  N  N      . ASP D 2 49  ? 19.381  17.155 243.985 1.00 74.24  ? 127 ASP D N      1 
ATOM   8459  C  CA     . ASP D 2 49  ? 17.940  17.018 243.817 1.00 73.59  ? 127 ASP D CA     1 
ATOM   8460  C  C      . ASP D 2 49  ? 17.522  17.498 242.433 1.00 67.44  ? 127 ASP D C      1 
ATOM   8461  O  O      . ASP D 2 49  ? 18.017  18.512 241.934 1.00 108.01 ? 127 ASP D O      1 
ATOM   8462  C  CB     . ASP D 2 49  ? 17.200  17.809 244.896 1.00 53.89  ? 127 ASP D CB     1 
ATOM   8463  C  CG     . ASP D 2 49  ? 15.692  17.620 244.840 1.00 88.65  ? 127 ASP D CG     1 
ATOM   8464  O  OD1    . ASP D 2 49  ? 15.121  17.596 243.728 1.00 88.01  ? 127 ASP D OD1    1 
ATOM   8465  O  OD2    . ASP D 2 49  ? 15.073  17.505 245.921 1.00 87.45  ? 127 ASP D OD2    1 
ATOM   8466  H  H      . ASP D 2 49  ? 19.623  17.915 244.305 1.00 89.09  ? 127 ASP D H      1 
ATOM   8467  H  HA     . ASP D 2 49  ? 17.695  16.083 243.902 1.00 88.31  ? 127 ASP D HA     1 
ATOM   8468  H  HB2    . ASP D 2 49  ? 17.506  17.515 245.768 1.00 64.67  ? 127 ASP D HB2    1 
ATOM   8469  H  HB3    . ASP D 2 49  ? 17.388  18.753 244.779 1.00 64.67  ? 127 ASP D HB3    1 
ATOM   8470  N  N      . LYS D 2 50  ? 16.611  16.750 241.818 1.00 94.48  ? 128 LYS D N      1 
ATOM   8471  C  CA     . LYS D 2 50  ? 16.037  17.091 240.522 1.00 84.02  ? 128 LYS D CA     1 
ATOM   8472  C  C      . LYS D 2 50  ? 15.753  18.587 240.424 1.00 43.52  ? 128 LYS D C      1 
ATOM   8473  O  O      . LYS D 2 50  ? 16.410  19.315 239.668 1.00 71.73  ? 128 LYS D O      1 
ATOM   8474  C  CB     . LYS D 2 50  ? 14.755  16.276 240.313 1.00 64.94  ? 128 LYS D CB     1 
ATOM   8475  C  CG     . LYS D 2 50  ? 14.232  16.242 238.898 1.00 51.28  ? 128 LYS D CG     1 
ATOM   8476  C  CD     . LYS D 2 50  ? 13.024  15.314 238.775 1.00 81.74  ? 128 LYS D CD     1 
ATOM   8477  C  CE     . LYS D 2 50  ? 13.332  14.098 237.913 1.00 51.77  ? 128 LYS D CE     1 
ATOM   8478  N  NZ     . LYS D 2 50  ? 14.549  13.361 238.362 1.00 102.20 ? 128 LYS D NZ     1 
ATOM   8479  H  H      . LYS D 2 50  ? 16.301  16.017 242.144 1.00 113.38 ? 128 LYS D H      1 
ATOM   8480  H  HA     . LYS D 2 50  ? 16.666  16.855 239.821 1.00 100.82 ? 128 LYS D HA     1 
ATOM   8481  H  HB2    . LYS D 2 50  ? 14.926  15.360 240.582 1.00 77.93  ? 128 LYS D HB2    1 
ATOM   8482  H  HB3    . LYS D 2 50  ? 14.058  16.653 240.872 1.00 77.93  ? 128 LYS D HB3    1 
ATOM   8483  H  HG2    . LYS D 2 50  ? 13.958  17.134 238.636 1.00 61.54  ? 128 LYS D HG2    1 
ATOM   8484  H  HG3    . LYS D 2 50  ? 14.928  15.915 238.307 1.00 61.54  ? 128 LYS D HG3    1 
ATOM   8485  H  HD2    . LYS D 2 50  ? 12.769  15.003 239.658 1.00 98.08  ? 128 LYS D HD2    1 
ATOM   8486  H  HD3    . LYS D 2 50  ? 12.290  15.798 238.366 1.00 98.08  ? 128 LYS D HD3    1 
ATOM   8487  H  HE2    . LYS D 2 50  ? 12.580  13.486 237.950 1.00 62.13  ? 128 LYS D HE2    1 
ATOM   8488  H  HE3    . LYS D 2 50  ? 13.478  14.388 236.999 1.00 62.13  ? 128 LYS D HE3    1 
ATOM   8489  H  HZ1    . LYS D 2 50  ? 14.692  12.660 237.833 1.00 122.64 ? 128 LYS D HZ1    1 
ATOM   8490  H  HZ2    . LYS D 2 50  ? 15.258  13.897 238.330 1.00 122.64 ? 128 LYS D HZ2    1 
ATOM   8491  H  HZ3    . LYS D 2 50  ? 14.439  13.075 239.198 1.00 122.64 ? 128 LYS D HZ3    1 
ATOM   8492  N  N      . LEU D 2 51  ? 14.772  19.049 241.198 1.00 64.44  ? 129 LEU D N      1 
ATOM   8493  C  CA     . LEU D 2 51  ? 14.457  20.471 241.243 1.00 48.83  ? 129 LEU D CA     1 
ATOM   8494  C  C      . LEU D 2 51  ? 15.716  21.311 241.431 1.00 65.86  ? 129 LEU D C      1 
ATOM   8495  O  O      . LEU D 2 51  ? 15.939  22.289 240.709 1.00 75.68  ? 129 LEU D O      1 
ATOM   8496  C  CB     . LEU D 2 51  ? 13.460  20.732 242.372 1.00 77.11  ? 129 LEU D CB     1 
ATOM   8497  C  CG     . LEU D 2 51  ? 13.159  22.197 242.677 1.00 56.77  ? 129 LEU D CG     1 
ATOM   8498  C  CD1    . LEU D 2 51  ? 12.631  22.907 241.444 1.00 67.69  ? 129 LEU D CD1    1 
ATOM   8499  C  CD2    . LEU D 2 51  ? 12.166  22.294 243.816 1.00 79.28  ? 129 LEU D CD2    1 
ATOM   8500  H  H      . LEU D 2 51  ? 14.277  18.560 241.704 1.00 77.33  ? 129 LEU D H      1 
ATOM   8501  H  HA     . LEU D 2 51  ? 14.041  20.732 240.407 1.00 58.60  ? 129 LEU D HA     1 
ATOM   8502  H  HB2    . LEU D 2 51  ? 12.620  20.306 242.141 1.00 92.54  ? 129 LEU D HB2    1 
ATOM   8503  H  HB3    . LEU D 2 51  ? 13.810  20.334 243.185 1.00 92.54  ? 129 LEU D HB3    1 
ATOM   8504  H  HG     . LEU D 2 51  ? 13.977  22.639 242.952 1.00 68.13  ? 129 LEU D HG     1 
ATOM   8505  H  HD11   . LEU D 2 51  ? 12.449  23.833 241.667 1.00 81.23  ? 129 LEU D HD11   1 
ATOM   8506  H  HD12   . LEU D 2 51  ? 13.300  22.861 240.743 1.00 81.23  ? 129 LEU D HD12   1 
ATOM   8507  H  HD13   . LEU D 2 51  ? 11.816  22.470 241.152 1.00 81.23  ? 129 LEU D HD13   1 
ATOM   8508  H  HD21   . LEU D 2 51  ? 11.985  23.230 243.997 1.00 95.13  ? 129 LEU D HD21   1 
ATOM   8509  H  HD22   . LEU D 2 51  ? 11.347  21.842 243.560 1.00 95.13  ? 129 LEU D HD22   1 
ATOM   8510  H  HD23   . LEU D 2 51  ? 12.546  21.872 244.602 1.00 95.13  ? 129 LEU D HD23   1 
ATOM   8511  N  N      . THR D 2 52  ? 16.550  20.946 242.408 1.00 47.74  ? 130 THR D N      1 
ATOM   8512  C  CA     . THR D 2 52  ? 17.800  21.666 242.623 1.00 53.46  ? 130 THR D CA     1 
ATOM   8513  C  C      . THR D 2 52  ? 18.614  21.728 241.337 1.00 65.18  ? 130 THR D C      1 
ATOM   8514  O  O      . THR D 2 52  ? 19.082  22.799 240.934 1.00 86.14  ? 130 THR D O      1 
ATOM   8515  C  CB     . THR D 2 52  ? 18.606  20.998 243.742 1.00 79.39  ? 130 THR D CB     1 
ATOM   8516  O  OG1    . THR D 2 52  ? 17.908  21.146 244.984 1.00 67.14  ? 130 THR D OG1    1 
ATOM   8517  C  CG2    . THR D 2 52  ? 20.001  21.610 243.872 1.00 56.38  ? 130 THR D CG2    1 
ATOM   8518  H  H      . THR D 2 52  ? 16.415  20.293 242.951 1.00 57.29  ? 130 THR D H      1 
ATOM   8519  H  HA     . THR D 2 52  ? 17.600  22.575 242.896 1.00 64.16  ? 130 THR D HA     1 
ATOM   8520  H  HB     . THR D 2 52  ? 18.707  20.054 243.543 1.00 95.27  ? 130 THR D HB     1 
ATOM   8521  H  HG1    . THR D 2 52  ? 18.343  20.782 245.603 1.00 80.57  ? 130 THR D HG1    1 
ATOM   8522  H  HG21   . THR D 2 52  ? 20.490  21.172 244.586 1.00 67.66  ? 130 THR D HG21   1 
ATOM   8523  H  HG22   . THR D 2 52  ? 20.489  21.500 243.041 1.00 67.66  ? 130 THR D HG22   1 
ATOM   8524  H  HG23   . THR D 2 52  ? 19.930  22.556 244.073 1.00 67.66  ? 130 THR D HG23   1 
ATOM   8525  N  N      . ILE D 2 53  ? 18.793  20.580 240.678 1.00 51.85  ? 131 ILE D N      1 
ATOM   8526  C  CA     . ILE D 2 53  ? 19.527  20.547 239.415 1.00 41.62  ? 131 ILE D CA     1 
ATOM   8527  C  C      . ILE D 2 53  ? 18.989  21.615 238.474 1.00 47.39  ? 131 ILE D C      1 
ATOM   8528  O  O      . ILE D 2 53  ? 19.739  22.447 237.951 1.00 75.15  ? 131 ILE D O      1 
ATOM   8529  C  CB     . ILE D 2 53  ? 19.444  19.149 238.777 1.00 63.20  ? 131 ILE D CB     1 
ATOM   8530  C  CG1    . ILE D 2 53  ? 20.190  18.121 239.632 1.00 54.91  ? 131 ILE D CG1    1 
ATOM   8531  C  CG2    . ILE D 2 53  ? 20.008  19.174 237.358 1.00 73.28  ? 131 ILE D CG2    1 
ATOM   8532  C  CD1    . ILE D 2 53  ? 19.887  16.683 239.255 1.00 105.03 ? 131 ILE D CD1    1 
ATOM   8533  H  H      . ILE D 2 53  ? 18.502  19.814 240.940 1.00 62.22  ? 131 ILE D H      1 
ATOM   8534  H  HA     . ILE D 2 53  ? 20.461  20.743 239.587 1.00 49.95  ? 131 ILE D HA     1 
ATOM   8535  H  HB     . ILE D 2 53  ? 18.510  18.889 238.731 1.00 75.83  ? 131 ILE D HB     1 
ATOM   8536  H  HG12   . ILE D 2 53  ? 21.144  18.261 239.528 1.00 65.90  ? 131 ILE D HG12   1 
ATOM   8537  H  HG13   . ILE D 2 53  ? 19.938  18.244 240.561 1.00 65.90  ? 131 ILE D HG13   1 
ATOM   8538  H  HG21   . ILE D 2 53  ? 19.945  18.284 236.978 1.00 87.93  ? 131 ILE D HG21   1 
ATOM   8539  H  HG22   . ILE D 2 53  ? 19.493  19.800 236.825 1.00 87.93  ? 131 ILE D HG22   1 
ATOM   8540  H  HG23   . ILE D 2 53  ? 20.936  19.455 237.393 1.00 87.93  ? 131 ILE D HG23   1 
ATOM   8541  H  HD11   . ILE D 2 53  ? 20.393  16.092 239.835 1.00 126.03 ? 131 ILE D HD11   1 
ATOM   8542  H  HD12   . ILE D 2 53  ? 18.937  16.522 239.364 1.00 126.03 ? 131 ILE D HD12   1 
ATOM   8543  H  HD13   . ILE D 2 53  ? 20.144  16.539 238.331 1.00 126.03 ? 131 ILE D HD13   1 
ATOM   8544  N  N      . LEU D 2 54  ? 17.674  21.609 238.246 1.00 57.76  ? 132 LEU D N      1 
ATOM   8545  C  CA     . LEU D 2 54  ? 17.088  22.592 237.340 1.00 66.60  ? 132 LEU D CA     1 
ATOM   8546  C  C      . LEU D 2 54  ? 17.409  24.016 237.779 1.00 70.57  ? 132 LEU D C      1 
ATOM   8547  O  O      . LEU D 2 54  ? 17.804  24.856 236.963 1.00 63.39  ? 132 LEU D O      1 
ATOM   8548  C  CB     . LEU D 2 54  ? 15.576  22.391 237.251 1.00 36.88  ? 132 LEU D CB     1 
ATOM   8549  C  CG     . LEU D 2 54  ? 15.102  21.437 236.155 1.00 23.30  ? 132 LEU D CG     1 
ATOM   8550  C  CD1    . LEU D 2 54  ? 13.628  21.126 236.346 1.00 53.39  ? 132 LEU D CD1    1 
ATOM   8551  C  CD2    . LEU D 2 54  ? 15.340  22.023 234.770 1.00 112.92 ? 132 LEU D CD2    1 
ATOM   8552  H  H      . LEU D 2 54  ? 17.113  21.059 238.596 1.00 69.31  ? 132 LEU D H      1 
ATOM   8553  H  HA     . LEU D 2 54  ? 17.459  22.462 236.453 1.00 79.92  ? 132 LEU D HA     1 
ATOM   8554  H  HB2    . LEU D 2 54  ? 15.263  22.038 238.099 1.00 44.26  ? 132 LEU D HB2    1 
ATOM   8555  H  HB3    . LEU D 2 54  ? 15.161  23.252 237.086 1.00 44.26  ? 132 LEU D HB3    1 
ATOM   8556  H  HG     . LEU D 2 54  ? 15.597  20.605 236.220 1.00 27.96  ? 132 LEU D HG     1 
ATOM   8557  H  HD11   . LEU D 2 54  ? 13.340  20.521 235.645 1.00 64.07  ? 132 LEU D HD11   1 
ATOM   8558  H  HD12   . LEU D 2 54  ? 13.503  20.712 237.214 1.00 64.07  ? 132 LEU D HD12   1 
ATOM   8559  H  HD13   . LEU D 2 54  ? 13.123  21.953 236.298 1.00 64.07  ? 132 LEU D HD13   1 
ATOM   8560  H  HD21   . LEU D 2 54  ? 15.028  21.392 234.103 1.00 135.51 ? 132 LEU D HD21   1 
ATOM   8561  H  HD22   . LEU D 2 54  ? 14.851  22.857 234.693 1.00 135.51 ? 132 LEU D HD22   1 
ATOM   8562  H  HD23   . LEU D 2 54  ? 16.290  22.184 234.656 1.00 135.51 ? 132 LEU D HD23   1 
ATOM   8563  N  N      . ARG D 2 55  ? 17.237  24.310 239.068 1.00 58.05  ? 133 ARG D N      1 
ATOM   8564  C  CA     . ARG D 2 55  ? 17.432  25.677 239.541 1.00 53.34  ? 133 ARG D CA     1 
ATOM   8565  C  C      . ARG D 2 55  ? 18.866  26.134 239.310 1.00 37.69  ? 133 ARG D C      1 
ATOM   8566  O  O      . ARG D 2 55  ? 19.108  27.216 238.759 1.00 55.30  ? 133 ARG D O      1 
ATOM   8567  C  CB     . ARG D 2 55  ? 17.068  25.774 241.022 1.00 65.81  ? 133 ARG D CB     1 
ATOM   8568  C  CG     . ARG D 2 55  ? 15.582  25.652 241.303 1.00 47.78  ? 133 ARG D CG     1 
ATOM   8569  C  CD     . ARG D 2 55  ? 15.272  25.822 242.776 1.00 77.76  ? 133 ARG D CD     1 
ATOM   8570  N  NE     . ARG D 2 55  ? 13.837  25.948 243.019 1.00 91.55  ? 133 ARG D NE     1 
ATOM   8571  C  CZ     . ARG D 2 55  ? 13.287  26.087 244.221 1.00 106.82 ? 133 ARG D CZ     1 
ATOM   8572  N  NH1    . ARG D 2 55  ? 14.050  26.119 245.309 1.00 104.74 ? 133 ARG D NH1    1 
ATOM   8573  N  NH2    . ARG D 2 55  ? 11.970  26.194 244.337 1.00 84.47  ? 133 ARG D NH2    1 
ATOM   8574  H  H      . ARG D 2 55  ? 17.011  23.747 239.677 1.00 69.65  ? 133 ARG D H      1 
ATOM   8575  H  HA     . ARG D 2 55  ? 16.844  26.270 239.047 1.00 64.01  ? 133 ARG D HA     1 
ATOM   8576  H  HB2    . ARG D 2 55  ? 17.519  25.061 241.501 1.00 78.98  ? 133 ARG D HB2    1 
ATOM   8577  H  HB3    . ARG D 2 55  ? 17.364  26.634 241.360 1.00 78.98  ? 133 ARG D HB3    1 
ATOM   8578  H  HG2    . ARG D 2 55  ? 15.107  26.340 240.812 1.00 57.34  ? 133 ARG D HG2    1 
ATOM   8579  H  HG3    . ARG D 2 55  ? 15.277  24.773 241.028 1.00 57.34  ? 133 ARG D HG3    1 
ATOM   8580  H  HD2    . ARG D 2 55  ? 15.594  25.047 243.262 1.00 93.31  ? 133 ARG D HD2    1 
ATOM   8581  H  HD3    . ARG D 2 55  ? 15.706  26.626 243.103 1.00 93.31  ? 133 ARG D HD3    1 
ATOM   8582  H  HE     . ARG D 2 55  ? 13.312  25.931 242.338 1.00 109.87 ? 133 ARG D HE     1 
ATOM   8583  H  HH11   . ARG D 2 55  ? 14.904  26.050 245.237 1.00 125.69 ? 133 ARG D HH11   1 
ATOM   8584  H  HH12   . ARG D 2 55  ? 13.689  26.209 246.084 1.00 125.69 ? 133 ARG D HH12   1 
ATOM   8585  H  HH21   . ARG D 2 55  ? 11.474  26.173 243.635 1.00 101.37 ? 133 ARG D HH21   1 
ATOM   8586  H  HH22   . ARG D 2 55  ? 11.612  26.284 245.114 1.00 101.37 ? 133 ARG D HH22   1 
ATOM   8587  N  N      . MET D 2 56  ? 19.833  25.317 239.724 1.00 41.08  ? 134 MET D N      1 
ATOM   8588  C  CA     . MET D 2 56  ? 21.231  25.704 239.583 1.00 68.01  ? 134 MET D CA     1 
ATOM   8589  C  C      . MET D 2 56  ? 21.630  25.789 238.119 1.00 69.29  ? 134 MET D C      1 
ATOM   8590  O  O      . MET D 2 56  ? 22.483  26.608 237.753 1.00 100.73 ? 134 MET D O      1 
ATOM   8591  C  CB     . MET D 2 56  ? 22.118  24.712 240.335 1.00 93.39  ? 134 MET D CB     1 
ATOM   8592  C  CG     . MET D 2 56  ? 21.753  24.571 241.811 1.00 78.37  ? 134 MET D CG     1 
ATOM   8593  S  SD     . MET D 2 56  ? 22.699  23.303 242.679 1.00 119.54 ? 134 MET D SD     1 
ATOM   8594  C  CE     . MET D 2 56  ? 24.349  23.986 242.587 1.00 101.58 ? 134 MET D CE     1 
ATOM   8595  H  H      . MET D 2 56  ? 19.708  24.546 240.083 1.00 49.29  ? 134 MET D H      1 
ATOM   8596  H  HA     . MET D 2 56  ? 21.354  26.576 239.990 1.00 81.62  ? 134 MET D HA     1 
ATOM   8597  H  HB2    . MET D 2 56  ? 22.033  23.839 239.922 1.00 112.07 ? 134 MET D HB2    1 
ATOM   8598  H  HB3    . MET D 2 56  ? 23.039  25.013 240.283 1.00 112.07 ? 134 MET D HB3    1 
ATOM   8599  H  HG2    . MET D 2 56  ? 21.915  25.418 242.255 1.00 94.04  ? 134 MET D HG2    1 
ATOM   8600  H  HG3    . MET D 2 56  ? 20.814  24.338 241.879 1.00 94.04  ? 134 MET D HG3    1 
ATOM   8601  H  HE1    . MET D 2 56  ? 24.965  23.382 243.030 1.00 121.90 ? 134 MET D HE1    1 
ATOM   8602  H  HE2    . MET D 2 56  ? 24.596  24.088 241.655 1.00 121.90 ? 134 MET D HE2    1 
ATOM   8603  H  HE3    . MET D 2 56  ? 24.357  24.850 243.029 1.00 121.90 ? 134 MET D HE3    1 
ATOM   8604  N  N      . ALA D 2 57  ? 21.016  24.964 237.269 1.00 60.93  ? 135 ALA D N      1 
ATOM   8605  C  CA     . ALA D 2 57  ? 21.237  25.081 235.832 1.00 77.08  ? 135 ALA D CA     1 
ATOM   8606  C  C      . ALA D 2 57  ? 20.760  26.433 235.324 1.00 72.74  ? 135 ALA D C      1 
ATOM   8607  O  O      . ALA D 2 57  ? 21.485  27.134 234.612 1.00 69.84  ? 135 ALA D O      1 
ATOM   8608  C  CB     . ALA D 2 57  ? 20.522  23.950 235.098 1.00 69.45  ? 135 ALA D CB     1 
ATOM   8609  H  H      . ALA D 2 57  ? 20.474  24.337 237.498 1.00 73.12  ? 135 ALA D H      1 
ATOM   8610  H  HA     . ALA D 2 57  ? 22.187  25.008 235.649 1.00 92.50  ? 135 ALA D HA     1 
ATOM   8611  H  HB1    . ALA D 2 57  ? 20.680  24.043 234.146 1.00 83.34  ? 135 ALA D HB1    1 
ATOM   8612  H  HB2    . ALA D 2 57  ? 20.872  23.101 235.411 1.00 83.34  ? 135 ALA D HB2    1 
ATOM   8613  H  HB3    . ALA D 2 57  ? 19.572  24.005 235.284 1.00 83.34  ? 135 ALA D HB3    1 
ATOM   8614  N  N      . VAL D 2 58  ? 19.530  26.812 235.682 1.00 37.16  ? 136 VAL D N      1 
ATOM   8615  C  CA     . VAL D 2 58  ? 19.024  28.140 235.342 1.00 34.46  ? 136 VAL D CA     1 
ATOM   8616  C  C      . VAL D 2 58  ? 20.020  29.207 235.772 1.00 51.91  ? 136 VAL D C      1 
ATOM   8617  O  O      . VAL D 2 58  ? 20.353  30.118 235.007 1.00 73.08  ? 136 VAL D O      1 
ATOM   8618  C  CB     . VAL D 2 58  ? 17.647  28.372 235.988 1.00 44.28  ? 136 VAL D CB     1 
ATOM   8619  C  CG1    . VAL D 2 58  ? 17.207  29.818 235.797 1.00 51.94  ? 136 VAL D CG1    1 
ATOM   8620  C  CG2    . VAL D 2 58  ? 16.620  27.419 235.402 1.00 45.68  ? 136 VAL D CG2    1 
ATOM   8621  H  H      . VAL D 2 58  ? 18.975  26.322 236.118 1.00 44.59  ? 136 VAL D H      1 
ATOM   8622  H  HA     . VAL D 2 58  ? 18.918  28.201 234.380 1.00 41.35  ? 136 VAL D HA     1 
ATOM   8623  H  HB     . VAL D 2 58  ? 17.710  28.199 236.940 1.00 53.14  ? 136 VAL D HB     1 
ATOM   8624  H  HG11   . VAL D 2 58  ? 16.338  29.940 236.211 1.00 62.33  ? 136 VAL D HG11   1 
ATOM   8625  H  HG12   . VAL D 2 58  ? 17.858  30.403 236.214 1.00 62.33  ? 136 VAL D HG12   1 
ATOM   8626  H  HG13   . VAL D 2 58  ? 17.151  30.007 234.847 1.00 62.33  ? 136 VAL D HG13   1 
ATOM   8627  H  HG21   . VAL D 2 58  ? 15.761  27.583 235.823 1.00 54.82  ? 136 VAL D HG21   1 
ATOM   8628  H  HG22   . VAL D 2 58  ? 16.555  27.574 234.447 1.00 54.82  ? 136 VAL D HG22   1 
ATOM   8629  H  HG23   . VAL D 2 58  ? 16.903  26.507 235.571 1.00 54.82  ? 136 VAL D HG23   1 
ATOM   8630  N  N      . SER D 2 59  ? 20.497  29.119 237.016 1.00 82.95  ? 137 SER D N      1 
ATOM   8631  C  CA     . SER D 2 59  ? 21.494  30.076 237.482 1.00 52.62  ? 137 SER D CA     1 
ATOM   8632  C  C      . SER D 2 59  ? 22.698  30.104 236.553 1.00 61.60  ? 137 SER D C      1 
ATOM   8633  O  O      . SER D 2 59  ? 23.208  31.178 236.214 1.00 87.93  ? 137 SER D O      1 
ATOM   8634  C  CB     . SER D 2 59  ? 21.932  29.735 238.905 1.00 97.21  ? 137 SER D CB     1 
ATOM   8635  O  OG     . SER D 2 59  ? 22.975  30.597 239.331 1.00 106.13 ? 137 SER D OG     1 
ATOM   8636  H  H      . SER D 2 59  ? 20.264  28.528 237.595 1.00 99.54  ? 137 SER D H      1 
ATOM   8637  H  HA     . SER D 2 59  ? 21.101  30.963 237.492 1.00 63.14  ? 137 SER D HA     1 
ATOM   8638  H  HB2    . SER D 2 59  ? 21.175  29.837 239.502 1.00 116.65 ? 137 SER D HB2    1 
ATOM   8639  H  HB3    . SER D 2 59  ? 22.251  28.819 238.926 1.00 116.65 ? 137 SER D HB3    1 
ATOM   8640  H  HG     . SER D 2 59  ? 23.209  30.401 240.113 1.00 127.35 ? 137 SER D HG     1 
ATOM   8641  N  N      . HIS D 2 60  ? 23.158  28.931 236.113 1.00 77.54  ? 138 HIS D N      1 
ATOM   8642  C  CA     . HIS D 2 60  ? 24.380  28.887 235.318 1.00 75.28  ? 138 HIS D CA     1 
ATOM   8643  C  C      . HIS D 2 60  ? 24.163  29.458 233.923 1.00 81.85  ? 138 HIS D C      1 
ATOM   8644  O  O      . HIS D 2 60  ? 25.071  30.073 233.356 1.00 103.13 ? 138 HIS D O      1 
ATOM   8645  C  CB     . HIS D 2 60  ? 24.909  27.461 235.224 1.00 90.92  ? 138 HIS D CB     1 
ATOM   8646  C  CG     . HIS D 2 60  ? 26.211  27.362 234.491 1.00 97.63  ? 138 HIS D CG     1 
ATOM   8647  N  ND1    . HIS D 2 60  ? 26.361  26.640 233.327 1.00 72.77  ? 138 HIS D ND1    1 
ATOM   8648  C  CD2    . HIS D 2 60  ? 27.418  27.921 234.745 1.00 92.36  ? 138 HIS D CD2    1 
ATOM   8649  C  CE1    . HIS D 2 60  ? 27.607  26.746 232.903 1.00 91.53  ? 138 HIS D CE1    1 
ATOM   8650  N  NE2    . HIS D 2 60  ? 28.270  27.517 233.746 1.00 84.06  ? 138 HIS D NE2    1 
ATOM   8651  H  H      . HIS D 2 60  ? 22.791  28.167 236.258 1.00 93.04  ? 138 HIS D H      1 
ATOM   8652  H  HA     . HIS D 2 60  ? 25.057  29.426 235.757 1.00 90.34  ? 138 HIS D HA     1 
ATOM   8653  H  HB2    . HIS D 2 60  ? 25.045  27.115 236.120 1.00 109.10 ? 138 HIS D HB2    1 
ATOM   8654  H  HB3    . HIS D 2 60  ? 24.260  26.915 234.753 1.00 109.10 ? 138 HIS D HB3    1 
ATOM   8655  H  HD2    . HIS D 2 60  ? 27.632  28.468 235.465 1.00 110.83 ? 138 HIS D HD2    1 
ATOM   8656  H  HE1    . HIS D 2 60  ? 27.959  26.345 232.141 1.00 109.84 ? 138 HIS D HE1    1 
ATOM   8657  H  HE2    . HIS D 2 60  ? 29.100  27.732 233.680 1.00 100.87 ? 138 HIS D HE2    1 
ATOM   8658  N  N      . MET D 2 61  ? 22.978  29.255 233.341 1.00 118.15 ? 139 MET D N      1 
ATOM   8659  C  CA     . MET D 2 61  ? 22.712  29.823 232.023 1.00 96.56  ? 139 MET D CA     1 
ATOM   8660  C  C      . MET D 2 61  ? 22.507  31.329 232.110 1.00 80.60  ? 139 MET D C      1 
ATOM   8661  O  O      . MET D 2 61  ? 23.012  32.077 231.265 1.00 87.26  ? 139 MET D O      1 
ATOM   8662  C  CB     . MET D 2 61  ? 21.497  29.153 231.383 1.00 57.97  ? 139 MET D CB     1 
ATOM   8663  C  CG     . MET D 2 61  ? 21.809  27.797 230.767 1.00 65.36  ? 139 MET D CG     1 
ATOM   8664  S  SD     . MET D 2 61  ? 20.442  27.117 229.812 1.00 102.24 ? 139 MET D SD     1 
ATOM   8665  C  CE     . MET D 2 61  ? 20.449  28.189 228.386 1.00 93.95  ? 139 MET D CE     1 
ATOM   8666  H  H      . MET D 2 61  ? 22.329  28.803 233.680 1.00 141.78 ? 139 MET D H      1 
ATOM   8667  H  HA     . MET D 2 61  ? 23.476  29.649 231.452 1.00 115.88 ? 139 MET D HA     1 
ATOM   8668  H  HB2    . MET D 2 61  ? 20.817  29.022 232.063 1.00 69.56  ? 139 MET D HB2    1 
ATOM   8669  H  HB3    . MET D 2 61  ? 21.155  29.728 230.681 1.00 69.56  ? 139 MET D HB3    1 
ATOM   8670  H  HG2    . MET D 2 61  ? 22.571  27.889 230.174 1.00 78.44  ? 139 MET D HG2    1 
ATOM   8671  H  HG3    . MET D 2 61  ? 22.018  27.169 231.477 1.00 78.44  ? 139 MET D HG3    1 
ATOM   8672  H  HE1    . MET D 2 61  ? 19.739  27.916 227.783 1.00 112.74 ? 139 MET D HE1    1 
ATOM   8673  H  HE2    . MET D 2 61  ? 20.303  29.103 228.677 1.00 112.74 ? 139 MET D HE2    1 
ATOM   8674  H  HE3    . MET D 2 61  ? 21.307  28.116 227.941 1.00 112.74 ? 139 MET D HE3    1 
ATOM   8675  N  N      . LYS D 2 62  ? 21.772  31.793 233.122 1.00 80.72  ? 140 LYS D N      1 
ATOM   8676  C  CA     . LYS D 2 62  ? 21.678  33.229 233.358 1.00 69.01  ? 140 LYS D CA     1 
ATOM   8677  C  C      . LYS D 2 62  ? 23.065  33.842 233.491 1.00 90.48  ? 140 LYS D C      1 
ATOM   8678  O  O      . LYS D 2 62  ? 23.338  34.914 232.937 1.00 83.84  ? 140 LYS D O      1 
ATOM   8679  C  CB     . LYS D 2 62  ? 20.844  33.504 234.609 1.00 44.63  ? 140 LYS D CB     1 
ATOM   8680  H  H      . LYS D 2 62  ? 21.329  31.306 233.675 1.00 96.87  ? 140 LYS D H      1 
ATOM   8681  H  HA     . LYS D 2 62  ? 21.235  33.646 232.602 1.00 82.81  ? 140 LYS D HA     1 
ATOM   8682  N  N      . SER D 2 63  ? 23.963  33.167 234.211 1.00 111.28 ? 141 SER D N      1 
ATOM   8683  C  CA     . SER D 2 63  ? 25.335  33.643 234.332 1.00 93.58  ? 141 SER D CA     1 
ATOM   8684  C  C      . SER D 2 63  ? 26.110  33.514 233.027 1.00 83.87  ? 141 SER D C      1 
ATOM   8685  O  O      . SER D 2 63  ? 27.089  34.241 232.828 1.00 106.98 ? 141 SER D O      1 
ATOM   8686  C  CB     . SER D 2 63  ? 26.056  32.873 235.441 1.00 101.31 ? 141 SER D CB     1 
ATOM   8687  O  OG     . SER D 2 63  ? 27.428  33.215 235.492 1.00 106.28 ? 141 SER D OG     1 
ATOM   8688  H  H      . SER D 2 63  ? 23.802  32.435 234.634 1.00 133.54 ? 141 SER D H      1 
ATOM   8689  H  HA     . SER D 2 63  ? 25.321  34.581 234.580 1.00 112.30 ? 141 SER D HA     1 
ATOM   8690  H  HB2    . SER D 2 63  ? 25.646  33.089 236.293 1.00 121.57 ? 141 SER D HB2    1 
ATOM   8691  H  HB3    . SER D 2 63  ? 25.975  31.922 235.267 1.00 121.57 ? 141 SER D HB3    1 
ATOM   8692  H  HG     . SER D 2 63  ? 27.809  32.784 236.105 1.00 127.54 ? 141 SER D HG     1 
ATOM   8693  N  N      . LEU D 2 64  ? 25.695  32.613 232.138 1.00 84.99  ? 142 LEU D N      1 
ATOM   8694  C  CA     . LEU D 2 64  ? 26.459  32.321 230.932 1.00 80.23  ? 142 LEU D CA     1 
ATOM   8695  C  C      . LEU D 2 64  ? 26.096  33.232 229.770 1.00 106.60 ? 142 LEU D C      1 
ATOM   8696  O  O      . LEU D 2 64  ? 26.947  33.499 228.914 1.00 139.16 ? 142 LEU D O      1 
ATOM   8697  C  CB     . LEU D 2 64  ? 26.246  30.860 230.523 1.00 76.99  ? 142 LEU D CB     1 
ATOM   8698  C  CG     . LEU D 2 64  ? 27.229  30.283 229.503 1.00 113.37 ? 142 LEU D CG     1 
ATOM   8699  C  CD1    . LEU D 2 64  ? 28.631  30.176 230.090 1.00 114.17 ? 142 LEU D CD1    1 
ATOM   8700  C  CD2    . LEU D 2 64  ? 26.747  28.926 229.024 1.00 95.03  ? 142 LEU D CD2    1 
ATOM   8701  H  H      . LEU D 2 64  ? 24.970  32.157 232.211 1.00 101.99 ? 142 LEU D H      1 
ATOM   8702  H  HA     . LEU D 2 64  ? 27.403  32.443 231.122 1.00 96.28  ? 142 LEU D HA     1 
ATOM   8703  H  HB2    . LEU D 2 64  ? 26.305  30.311 231.320 1.00 92.39  ? 142 LEU D HB2    1 
ATOM   8704  H  HB3    . LEU D 2 64  ? 25.358  30.779 230.143 1.00 92.39  ? 142 LEU D HB3    1 
ATOM   8705  H  HG     . LEU D 2 64  ? 27.270  30.874 228.735 1.00 136.05 ? 142 LEU D HG     1 
ATOM   8706  H  HD11   . LEU D 2 64  ? 29.226  29.808 229.419 1.00 137.00 ? 142 LEU D HD11   1 
ATOM   8707  H  HD12   . LEU D 2 64  ? 28.932  31.061 230.351 1.00 137.00 ? 142 LEU D HD12   1 
ATOM   8708  H  HD13   . LEU D 2 64  ? 28.605  29.594 230.866 1.00 137.00 ? 142 LEU D HD13   1 
ATOM   8709  H  HD21   . LEU D 2 64  ? 27.382  28.576 228.380 1.00 114.04 ? 142 LEU D HD21   1 
ATOM   8710  H  HD22   . LEU D 2 64  ? 26.684  28.327 229.785 1.00 114.04 ? 142 LEU D HD22   1 
ATOM   8711  H  HD23   . LEU D 2 64  ? 25.876  29.029 228.610 1.00 114.04 ? 142 LEU D HD23   1 
ATOM   8712  N  N      . ARG D 2 65  ? 24.856  33.713 229.718 1.00 113.61 ? 143 ARG D N      1 
ATOM   8713  C  CA     . ARG D 2 65  ? 24.420  34.630 228.671 1.00 97.03  ? 143 ARG D CA     1 
ATOM   8714  C  C      . ARG D 2 65  ? 23.494  35.665 229.290 1.00 91.66  ? 143 ARG D C      1 
ATOM   8715  O  O      . ARG D 2 65  ? 22.494  35.307 229.917 1.00 136.45 ? 143 ARG D O      1 
ATOM   8716  C  CB     . ARG D 2 65  ? 23.717  33.878 227.535 1.00 117.36 ? 143 ARG D CB     1 
ATOM   8717  C  CG     . ARG D 2 65  ? 22.492  33.075 227.962 1.00 84.22  ? 143 ARG D CG     1 
ATOM   8718  C  CD     . ARG D 2 65  ? 21.920  32.275 226.803 1.00 97.30  ? 143 ARG D CD     1 
ATOM   8719  N  NE     . ARG D 2 65  ? 21.606  33.115 225.647 1.00 112.31 ? 143 ARG D NE     1 
ATOM   8720  C  CZ     . ARG D 2 65  ? 20.437  33.715 225.435 1.00 99.55  ? 143 ARG D CZ     1 
ATOM   8721  N  NH1    . ARG D 2 65  ? 19.440  33.581 226.300 1.00 135.67 ? 143 ARG D NH1    1 
ATOM   8722  N  NH2    . ARG D 2 65  ? 20.261  34.454 224.349 1.00 115.41 ? 143 ARG D NH2    1 
ATOM   8723  H  H      . ARG D 2 65  ? 24.241  33.520 230.287 1.00 136.33 ? 143 ARG D H      1 
ATOM   8724  H  HA     . ARG D 2 65  ? 25.191  35.089 228.303 1.00 116.44 ? 143 ARG D HA     1 
ATOM   8725  H  HB2    . ARG D 2 65  ? 23.428  34.522 226.870 1.00 140.83 ? 143 ARG D HB2    1 
ATOM   8726  H  HB3    . ARG D 2 65  ? 24.348  33.259 227.137 1.00 140.83 ? 143 ARG D HB3    1 
ATOM   8727  H  HG2    . ARG D 2 65  ? 22.744  32.456 228.664 1.00 101.06 ? 143 ARG D HG2    1 
ATOM   8728  H  HG3    . ARG D 2 65  ? 21.806  33.683 228.280 1.00 101.06 ? 143 ARG D HG3    1 
ATOM   8729  H  HD2    . ARG D 2 65  ? 22.569  31.610 226.525 1.00 116.76 ? 143 ARG D HD2    1 
ATOM   8730  H  HD3    . ARG D 2 65  ? 21.101  31.841 227.090 1.00 116.76 ? 143 ARG D HD3    1 
ATOM   8731  H  HE     . ARG D 2 65  ? 22.223  33.230 225.059 1.00 134.77 ? 143 ARG D HE     1 
ATOM   8732  H  HH11   . ARG D 2 65  ? 19.545  33.103 227.007 1.00 162.80 ? 143 ARG D HH11   1 
ATOM   8733  H  HH12   . ARG D 2 65  ? 18.688  33.973 226.154 1.00 162.80 ? 143 ARG D HH12   1 
ATOM   8734  H  HH21   . ARG D 2 65  ? 20.902  34.547 223.783 1.00 138.50 ? 143 ARG D HH21   1 
ATOM   8735  H  HH22   . ARG D 2 65  ? 19.506  34.843 224.211 1.00 138.50 ? 143 ARG D HH22   1 
ATOM   8736  N  N      . GLY D 2 66  ? 23.832  36.939 229.125 1.00 96.98  ? 144 GLY D N      1 
ATOM   8737  C  CA     . GLY D 2 66  ? 23.026  38.015 229.676 1.00 117.92 ? 144 GLY D CA     1 
ATOM   8738  C  C      . GLY D 2 66  ? 23.510  39.393 229.269 1.00 124.32 ? 144 GLY D C      1 
ATOM   8739  O  O      . GLY D 2 66  ? 22.976  40.409 229.717 1.00 103.71 ? 144 GLY D O      1 
ATOM   8740  H  H      . GLY D 2 66  ? 24.527  37.206 228.696 1.00 116.38 ? 144 GLY D H      1 
ATOM   8741  H  HA2    . GLY D 2 66  ? 22.109  37.914 229.376 1.00 141.50 ? 144 GLY D HA2    1 
ATOM   8742  H  HA3    . GLY D 2 66  ? 23.038  37.961 230.644 1.00 141.50 ? 144 GLY D HA3    1 
ATOM   8743  N  N      . THR D 2 70  ? 18.548  42.270 227.024 1.00 117.74 ? 148 THR D N      1 
ATOM   8744  C  CA     . THR D 2 70  ? 17.682  43.357 226.584 1.00 114.49 ? 148 THR D CA     1 
ATOM   8745  C  C      . THR D 2 70  ? 16.283  42.840 226.255 1.00 114.18 ? 148 THR D C      1 
ATOM   8746  O  O      . THR D 2 70  ? 15.293  43.260 226.861 1.00 93.64  ? 148 THR D O      1 
ATOM   8747  C  CB     . THR D 2 70  ? 18.261  44.073 225.347 1.00 90.98  ? 148 THR D CB     1 
ATOM   8748  H  HA     . THR D 2 70  ? 17.602  44.008 227.299 1.00 137.39 ? 148 THR D HA     1 
ATOM   8749  N  N      . SER D 2 71  ? 16.213  41.920 225.293 1.00 123.02 ? 149 SER D N      1 
ATOM   8750  C  CA     . SER D 2 71  ? 14.972  41.315 224.819 1.00 124.75 ? 149 SER D CA     1 
ATOM   8751  C  C      . SER D 2 71  ? 14.114  42.282 224.013 1.00 112.35 ? 149 SER D C      1 
ATOM   8752  O  O      . SER D 2 71  ? 12.983  41.933 223.644 1.00 117.63 ? 149 SER D O      1 
ATOM   8753  C  CB     . SER D 2 71  ? 14.141  40.751 225.979 1.00 90.53  ? 149 SER D CB     1 
ATOM   8754  H  H      . SER D 2 71  ? 16.907  41.620 224.882 1.00 147.63 ? 149 SER D H      1 
ATOM   8755  H  HA     . SER D 2 71  ? 15.198  40.573 224.237 1.00 149.70 ? 149 SER D HA     1 
ATOM   8756  N  N      . THR D 2 72  ? 14.610  43.485 223.730 1.00 97.04  ? 150 THR D N      1 
ATOM   8757  C  CA     . THR D 2 72  ? 13.863  44.448 222.931 1.00 116.86 ? 150 THR D CA     1 
ATOM   8758  C  C      . THR D 2 72  ? 13.323  43.788 221.671 1.00 111.51 ? 150 THR D C      1 
ATOM   8759  O  O      . THR D 2 72  ? 14.089  43.317 220.823 1.00 94.87  ? 150 THR D O      1 
ATOM   8760  C  CB     . THR D 2 72  ? 14.762  45.633 222.568 1.00 98.92  ? 150 THR D CB     1 
ATOM   8761  H  H      . THR D 2 72  ? 15.380  43.766 223.990 1.00 116.45 ? 150 THR D H      1 
ATOM   8762  H  HA     . THR D 2 72  ? 13.113  44.780 223.448 1.00 140.23 ? 150 THR D HA     1 
ATOM   8763  N  N      . ASP D 2 73  ? 11.993  43.748 221.557 1.00 97.01  ? 151 ASP D N      1 
ATOM   8764  C  CA     . ASP D 2 73  ? 11.364  43.163 220.378 1.00 115.00 ? 151 ASP D CA     1 
ATOM   8765  C  C      . ASP D 2 73  ? 11.902  43.778 219.093 1.00 116.11 ? 151 ASP D C      1 
ATOM   8766  O  O      . ASP D 2 73  ? 11.850  43.148 218.031 1.00 102.60 ? 151 ASP D O      1 
ATOM   8767  C  CB     . ASP D 2 73  ? 9.847   43.344 220.455 1.00 51.94  ? 151 ASP D CB     1 
ATOM   8768  H  H      . ASP D 2 73  ? 11.441  44.050 222.143 1.00 116.41 ? 151 ASP D H      1 
ATOM   8769  H  HA     . ASP D 2 73  ? 11.553  42.212 220.358 1.00 138.00 ? 151 ASP D HA     1 
ATOM   8770  N  N      . GLY D 2 74  ? 12.429  44.999 219.169 1.00 60.80  ? 152 GLY D N      1 
ATOM   8771  C  CA     . GLY D 2 74  ? 12.945  45.682 218.002 1.00 50.76  ? 152 GLY D CA     1 
ATOM   8772  C  C      . GLY D 2 74  ? 14.063  44.959 217.273 1.00 55.23  ? 152 GLY D C      1 
ATOM   8773  O  O      . GLY D 2 74  ? 13.875  44.522 216.133 1.00 66.22  ? 152 GLY D O      1 
ATOM   8774  H  H      . GLY D 2 74  ? 12.496  45.452 219.897 1.00 72.96  ? 152 GLY D H      1 
ATOM   8775  H  HA2    . GLY D 2 74  ? 12.219  45.820 217.373 1.00 60.91  ? 152 GLY D HA2    1 
ATOM   8776  H  HA3    . GLY D 2 74  ? 13.278  46.553 218.270 1.00 60.91  ? 152 GLY D HA3    1 
ATOM   8777  N  N      . SER D 2 75  ? 15.222  44.792 217.917 1.00 125.08 ? 153 SER D N      1 
ATOM   8778  C  CA     . SER D 2 75  ? 16.474  44.644 217.184 1.00 71.65  ? 153 SER D CA     1 
ATOM   8779  C  C      . SER D 2 75  ? 17.296  43.406 217.538 1.00 121.00 ? 153 SER D C      1 
ATOM   8780  O  O      . SER D 2 75  ? 18.418  43.271 217.035 1.00 112.28 ? 153 SER D O      1 
ATOM   8781  C  CB     . SER D 2 75  ? 17.328  45.891 217.413 1.00 71.14  ? 153 SER D CB     1 
ATOM   8782  O  OG     . SER D 2 75  ? 18.661  45.686 216.993 1.00 94.51  ? 153 SER D OG     1 
ATOM   8783  H  H      . SER D 2 75  ? 15.307  44.761 218.772 1.00 150.10 ? 153 SER D H      1 
ATOM   8784  H  HA     . SER D 2 75  ? 16.271  44.598 216.236 1.00 85.98  ? 153 SER D HA     1 
ATOM   8785  H  HB2    . SER D 2 75  ? 16.949  46.628 216.909 1.00 85.37  ? 153 SER D HB2    1 
ATOM   8786  H  HB3    . SER D 2 75  ? 17.326  46.104 218.359 1.00 85.37  ? 153 SER D HB3    1 
ATOM   8787  H  HG     . SER D 2 75  ? 18.679  45.502 216.173 1.00 113.42 ? 153 SER D HG     1 
ATOM   8788  N  N      . TYR D 2 76  ? 16.791  42.498 218.373 1.00 110.77 ? 154 TYR D N      1 
ATOM   8789  C  CA     . TYR D 2 76  ? 17.589  41.384 218.882 1.00 83.36  ? 154 TYR D CA     1 
ATOM   8790  C  C      . TYR D 2 76  ? 17.274  40.094 218.131 1.00 104.73 ? 154 TYR D C      1 
ATOM   8791  O  O      . TYR D 2 76  ? 16.110  39.694 218.028 1.00 84.50  ? 154 TYR D O      1 
ATOM   8792  C  CB     . TYR D 2 76  ? 17.344  41.190 220.380 1.00 94.50  ? 154 TYR D CB     1 
ATOM   8793  H  H      . TYR D 2 76  ? 15.981  42.506 218.662 1.00 132.92 ? 154 TYR D H      1 
ATOM   8794  H  HA     . TYR D 2 76  ? 18.529  41.584 218.755 1.00 100.04 ? 154 TYR D HA     1 
ATOM   8795  N  N      . LYS D 2 77  ? 18.318  39.442 217.619 1.00 102.36 ? 155 LYS D N      1 
ATOM   8796  C  CA     . LYS D 2 77  ? 18.200  38.130 216.989 1.00 103.10 ? 155 LYS D CA     1 
ATOM   8797  C  C      . LYS D 2 77  ? 19.035  37.125 217.771 1.00 115.38 ? 155 LYS D C      1 
ATOM   8798  O  O      . LYS D 2 77  ? 20.273  37.239 217.777 1.00 72.16  ? 155 LYS D O      1 
ATOM   8799  C  CB     . LYS D 2 77  ? 18.662  38.176 215.530 1.00 83.16  ? 155 LYS D CB     1 
ATOM   8800  H  H      . LYS D 2 77  ? 19.122  39.747 217.625 1.00 122.83 ? 155 LYS D H      1 
ATOM   8801  H  HA     . LYS D 2 77  ? 17.274  37.843 217.010 1.00 123.72 ? 155 LYS D HA     1 
ATOM   8802  N  N      . PRO D 2 78  ? 18.436  36.132 218.432 1.00 108.29 ? 156 PRO D N      1 
ATOM   8803  C  CA     . PRO D 2 78  ? 19.231  35.218 219.262 1.00 58.46  ? 156 PRO D CA     1 
ATOM   8804  C  C      . PRO D 2 78  ? 20.160  34.351 218.426 1.00 61.93  ? 156 PRO D C      1 
ATOM   8805  O  O      . PRO D 2 78  ? 19.794  33.870 217.351 1.00 84.13  ? 156 PRO D O      1 
ATOM   8806  C  CB     . PRO D 2 78  ? 18.168  34.374 219.970 1.00 91.23  ? 156 PRO D CB     1 
ATOM   8807  C  CG     . PRO D 2 78  ? 17.011  34.393 219.045 1.00 92.01  ? 156 PRO D CG     1 
ATOM   8808  C  CD     . PRO D 2 78  ? 17.012  35.759 218.428 1.00 97.79  ? 156 PRO D CD     1 
ATOM   8809  H  HA     . PRO D 2 78  ? 19.747  35.712 219.918 1.00 70.15  ? 156 PRO D HA     1 
ATOM   8810  H  HB2    . PRO D 2 78  ? 18.496  33.469 220.096 1.00 109.48 ? 156 PRO D HB2    1 
ATOM   8811  H  HB3    . PRO D 2 78  ? 17.938  34.780 220.821 1.00 109.48 ? 156 PRO D HB3    1 
ATOM   8812  H  HG2    . PRO D 2 78  ? 17.126  33.711 218.365 1.00 110.41 ? 156 PRO D HG2    1 
ATOM   8813  H  HG3    . PRO D 2 78  ? 16.192  34.244 219.544 1.00 110.41 ? 156 PRO D HG3    1 
ATOM   8814  H  HD2    . PRO D 2 78  ? 16.675  35.720 217.519 1.00 117.34 ? 156 PRO D HD2    1 
ATOM   8815  H  HD3    . PRO D 2 78  ? 16.498  36.376 218.972 1.00 117.34 ? 156 PRO D HD3    1 
ATOM   8816  N  N      . SER D 2 79  ? 21.369  34.146 218.944 1.00 72.21  ? 157 SER D N      1 
ATOM   8817  C  CA     . SER D 2 79  ? 22.404  33.372 218.273 1.00 71.65  ? 157 SER D CA     1 
ATOM   8818  C  C      . SER D 2 79  ? 22.798  32.190 219.145 1.00 77.65  ? 157 SER D C      1 
ATOM   8819  O  O      . SER D 2 79  ? 22.958  32.334 220.362 1.00 108.02 ? 157 SER D O      1 
ATOM   8820  C  CB     . SER D 2 79  ? 23.640  34.236 217.981 1.00 105.33 ? 157 SER D CB     1 
ATOM   8821  O  OG     . SER D 2 79  ? 24.202  34.747 219.179 1.00 145.88 ? 157 SER D OG     1 
ATOM   8822  H  H      . SER D 2 79  ? 21.618  34.456 219.706 1.00 86.65  ? 157 SER D H      1 
ATOM   8823  H  HA     . SER D 2 79  ? 22.060  33.032 217.431 1.00 85.97  ? 157 SER D HA     1 
ATOM   8824  H  HB2    . SER D 2 79  ? 24.304  33.694 217.528 1.00 126.39 ? 157 SER D HB2    1 
ATOM   8825  H  HB3    . SER D 2 79  ? 23.377  34.979 217.415 1.00 126.39 ? 157 SER D HB3    1 
ATOM   8826  H  HG     . SER D 2 79  ? 24.875  35.216 219.003 1.00 175.06 ? 157 SER D HG     1 
ATOM   8827  N  N      . PHE D 2 80  ? 22.958  31.019 218.521 1.00 83.69  ? 158 PHE D N      1 
ATOM   8828  C  CA     . PHE D 2 80  ? 23.294  29.826 219.294 1.00 79.45  ? 158 PHE D CA     1 
ATOM   8829  C  C      . PHE D 2 80  ? 24.750  29.841 219.739 1.00 88.71  ? 158 PHE D C      1 
ATOM   8830  O  O      . PHE D 2 80  ? 25.057  29.486 220.884 1.00 77.71  ? 158 PHE D O      1 
ATOM   8831  C  CB     . PHE D 2 80  ? 23.004  28.563 218.486 1.00 71.57  ? 158 PHE D CB     1 
ATOM   8832  C  CG     . PHE D 2 80  ? 22.903  27.321 219.329 1.00 70.93  ? 158 PHE D CG     1 
ATOM   8833  C  CD1    . PHE D 2 80  ? 21.680  26.919 219.843 1.00 90.46  ? 158 PHE D CD1    1 
ATOM   8834  C  CD2    . PHE D 2 80  ? 24.029  26.565 219.622 1.00 71.79  ? 158 PHE D CD2    1 
ATOM   8835  C  CE1    . PHE D 2 80  ? 21.578  25.783 220.623 1.00 94.41  ? 158 PHE D CE1    1 
ATOM   8836  C  CE2    . PHE D 2 80  ? 23.932  25.423 220.404 1.00 60.00  ? 158 PHE D CE2    1 
ATOM   8837  C  CZ     . PHE D 2 80  ? 22.706  25.034 220.905 1.00 76.00  ? 158 PHE D CZ     1 
ATOM   8838  H  H      . PHE D 2 80  ? 22.880  30.893 217.674 1.00 100.42 ? 158 PHE D H      1 
ATOM   8839  H  HA     . PHE D 2 80  ? 22.740  29.802 220.090 1.00 95.34  ? 158 PHE D HA     1 
ATOM   8840  H  HB2    . PHE D 2 80  ? 22.161  28.676 218.020 1.00 85.89  ? 158 PHE D HB2    1 
ATOM   8841  H  HB3    . PHE D 2 80  ? 23.720  28.430 217.845 1.00 85.89  ? 158 PHE D HB3    1 
ATOM   8842  H  HD1    . PHE D 2 80  ? 20.918  27.418 219.657 1.00 108.55 ? 158 PHE D HD1    1 
ATOM   8843  H  HD2    . PHE D 2 80  ? 24.856  26.823 219.286 1.00 86.15  ? 158 PHE D HD2    1 
ATOM   8844  H  HE1    . PHE D 2 80  ? 20.751  25.523 220.959 1.00 113.29 ? 158 PHE D HE1    1 
ATOM   8845  H  HE2    . PHE D 2 80  ? 24.693  24.921 220.592 1.00 72.01  ? 158 PHE D HE2    1 
ATOM   8846  H  HZ     . PHE D 2 80  ? 22.638  24.269 221.430 1.00 91.20  ? 158 PHE D HZ     1 
ATOM   8847  N  N      . LEU D 2 81  ? 25.660  30.238 218.856 1.00 110.96 ? 159 LEU D N      1 
ATOM   8848  C  CA     . LEU D 2 81  ? 27.074  30.308 219.180 1.00 102.52 ? 159 LEU D CA     1 
ATOM   8849  C  C      . LEU D 2 81  ? 27.557  31.750 219.133 1.00 85.86  ? 159 LEU D C      1 
ATOM   8850  O  O      . LEU D 2 81  ? 27.009  32.587 218.408 1.00 67.86  ? 159 LEU D O      1 
ATOM   8851  C  CB     . LEU D 2 81  ? 27.903  29.450 218.224 1.00 80.79  ? 159 LEU D CB     1 
ATOM   8852  C  CG     . LEU D 2 81  ? 28.602  28.268 218.903 1.00 95.07  ? 159 LEU D CG     1 
ATOM   8853  C  CD1    . LEU D 2 81  ? 27.588  27.314 219.535 1.00 93.95  ? 159 LEU D CD1    1 
ATOM   8854  C  CD2    . LEU D 2 81  ? 29.485  27.534 217.909 1.00 115.18 ? 159 LEU D CD2    1 
ATOM   8855  H  H      . LEU D 2 81  ? 25.477  30.477 218.050 1.00 133.16 ? 159 LEU D H      1 
ATOM   8856  H  HA     . LEU D 2 81  ? 27.210  29.973 220.081 1.00 123.03 ? 159 LEU D HA     1 
ATOM   8857  H  HB2    . LEU D 2 81  ? 27.318  29.094 217.537 1.00 96.95  ? 159 LEU D HB2    1 
ATOM   8858  H  HB3    . LEU D 2 81  ? 28.587  30.006 217.819 1.00 96.95  ? 159 LEU D HB3    1 
ATOM   8859  H  HG     . LEU D 2 81  ? 29.171  28.607 219.611 1.00 114.08 ? 159 LEU D HG     1 
ATOM   8860  H  HD11   . LEU D 2 81  ? 28.064  26.581 219.954 1.00 112.74 ? 159 LEU D HD11   1 
ATOM   8861  H  HD12   . LEU D 2 81  ? 27.073  27.797 220.200 1.00 112.74 ? 159 LEU D HD12   1 
ATOM   8862  H  HD13   . LEU D 2 81  ? 27.000  26.975 218.842 1.00 112.74 ? 159 LEU D HD13   1 
ATOM   8863  H  HD21   . LEU D 2 81  ? 29.917  26.792 218.360 1.00 138.22 ? 159 LEU D HD21   1 
ATOM   8864  H  HD22   . LEU D 2 81  ? 28.935  27.206 217.181 1.00 138.22 ? 159 LEU D HD22   1 
ATOM   8865  H  HD23   . LEU D 2 81  ? 30.154  28.149 217.568 1.00 138.22 ? 159 LEU D HD23   1 
ATOM   8866  N  N      . THR D 2 82  ? 28.595  32.028 219.919 1.00 107.52 ? 160 THR D N      1 
ATOM   8867  C  CA     . THR D 2 82  ? 29.139  33.370 220.031 1.00 93.18  ? 160 THR D CA     1 
ATOM   8868  C  C      . THR D 2 82  ? 29.954  33.717 218.791 1.00 100.51 ? 160 THR D C      1 
ATOM   8869  O  O      . THR D 2 82  ? 30.415  32.844 218.051 1.00 109.34 ? 160 THR D O      1 
ATOM   8870  C  CB     . THR D 2 82  ? 30.009  33.494 221.281 1.00 72.62  ? 160 THR D CB     1 
ATOM   8871  H  H      . THR D 2 82  ? 29.004  31.445 220.402 1.00 129.02 ? 160 THR D H      1 
ATOM   8872  H  HA     . THR D 2 82  ? 28.409  34.005 220.103 1.00 111.82 ? 160 THR D HA     1 
ATOM   8873  N  N      . ASP D 2 83  ? 30.127  35.019 218.571 1.00 134.39 ? 161 ASP D N      1 
ATOM   8874  C  CA     . ASP D 2 83  ? 30.891  35.478 217.417 1.00 125.31 ? 161 ASP D CA     1 
ATOM   8875  C  C      . ASP D 2 83  ? 32.307  34.914 217.442 1.00 98.38  ? 161 ASP D C      1 
ATOM   8876  O  O      . ASP D 2 83  ? 32.755  34.293 216.470 1.00 116.70 ? 161 ASP D O      1 
ATOM   8877  C  CB     . ASP D 2 83  ? 30.897  37.006 217.381 1.00 95.03  ? 161 ASP D CB     1 
ATOM   8878  C  CG     . ASP D 2 83  ? 29.495  37.586 217.270 1.00 110.55 ? 161 ASP D CG     1 
ATOM   8879  O  OD1    . ASP D 2 83  ? 28.602  36.853 216.803 1.00 153.37 ? 161 ASP D OD1    1 
ATOM   8880  O  OD2    . ASP D 2 83  ? 29.278  38.755 217.650 1.00 138.04 ? 161 ASP D OD2    1 
ATOM   8881  H  H      . ASP D 2 83  ? 29.818  35.648 219.069 1.00 161.27 ? 161 ASP D H      1 
ATOM   8882  H  HA     . ASP D 2 83  ? 30.458  35.162 216.608 1.00 150.37 ? 161 ASP D HA     1 
ATOM   8883  H  HB2    . ASP D 2 83  ? 31.297  37.342 218.199 1.00 114.04 ? 161 ASP D HB2    1 
ATOM   8884  H  HB3    . ASP D 2 83  ? 31.408  37.304 216.613 1.00 114.04 ? 161 ASP D HB3    1 
ATOM   8885  N  N      . GLN D 2 84  ? 33.027  35.104 218.553 1.00 110.49 ? 162 GLN D N      1 
ATOM   8886  C  CA     . GLN D 2 84  ? 34.337  34.474 218.697 1.00 108.87 ? 162 GLN D CA     1 
ATOM   8887  C  C      . GLN D 2 84  ? 34.225  32.960 218.567 1.00 94.32  ? 162 GLN D C      1 
ATOM   8888  O  O      . GLN D 2 84  ? 35.119  32.307 218.016 1.00 101.94 ? 162 GLN D O      1 
ATOM   8889  C  CB     . GLN D 2 84  ? 34.963  34.854 220.039 1.00 109.84 ? 162 GLN D CB     1 
ATOM   8890  H  H      . GLN D 2 84  ? 32.782  35.584 219.224 1.00 132.59 ? 162 GLN D H      1 
ATOM   8891  H  HA     . GLN D 2 84  ? 34.921  34.793 217.991 1.00 130.64 ? 162 GLN D HA     1 
ATOM   8892  N  N      . GLU D 2 85  ? 33.130  32.386 219.069 1.00 125.72 ? 163 GLU D N      1 
ATOM   8893  C  CA     . GLU D 2 85  ? 32.879  30.960 218.892 1.00 137.70 ? 163 GLU D CA     1 
ATOM   8894  C  C      . GLU D 2 85  ? 32.710  30.620 217.415 1.00 104.82 ? 163 GLU D C      1 
ATOM   8895  O  O      . GLU D 2 85  ? 33.462  29.812 216.854 1.00 84.54  ? 163 GLU D O      1 
ATOM   8896  C  CB     . GLU D 2 85  ? 31.639  30.551 219.692 1.00 97.86  ? 163 GLU D CB     1 
ATOM   8897  H  H      . GLU D 2 85  ? 32.521  32.800 219.514 1.00 150.86 ? 163 GLU D H      1 
ATOM   8898  H  HA     . GLU D 2 85  ? 33.637  30.459 219.232 1.00 165.24 ? 163 GLU D HA     1 
ATOM   8899  N  N      . LEU D 2 86  ? 31.721  31.238 216.764 1.00 120.35 ? 164 LEU D N      1 
ATOM   8900  C  CA     . LEU D 2 86  ? 31.489  30.995 215.347 1.00 84.48  ? 164 LEU D CA     1 
ATOM   8901  C  C      . LEU D 2 86  ? 32.711  31.325 214.503 1.00 103.09 ? 164 LEU D C      1 
ATOM   8902  O  O      . LEU D 2 86  ? 32.833  30.811 213.386 1.00 128.30 ? 164 LEU D O      1 
ATOM   8903  C  CB     . LEU D 2 86  ? 30.287  31.810 214.866 1.00 71.81  ? 164 LEU D CB     1 
ATOM   8904  H  H      . LEU D 2 86  ? 31.177  31.800 217.122 1.00 144.42 ? 164 LEU D H      1 
ATOM   8905  H  HA     . LEU D 2 86  ? 31.283  30.056 215.219 1.00 101.37 ? 164 LEU D HA     1 
ATOM   8906  N  N      . LYS D 2 87  ? 33.612  32.173 215.002 1.00 96.15  ? 165 LYS D N      1 
ATOM   8907  C  CA     . LYS D 2 87  ? 34.869  32.410 214.302 1.00 122.28 ? 165 LYS D CA     1 
ATOM   8908  C  C      . LYS D 2 87  ? 35.831  31.247 214.499 1.00 108.33 ? 165 LYS D C      1 
ATOM   8909  O  O      . LYS D 2 87  ? 36.530  30.850 213.560 1.00 87.06  ? 165 LYS D O      1 
ATOM   8910  C  CB     . LYS D 2 87  ? 35.506  33.716 214.782 1.00 122.08 ? 165 LYS D CB     1 
ATOM   8911  H  H      . LYS D 2 87  ? 33.519  32.616 215.733 1.00 115.38 ? 165 LYS D H      1 
ATOM   8912  H  HA     . LYS D 2 87  ? 34.691  32.495 213.352 1.00 146.74 ? 165 LYS D HA     1 
ATOM   8913  N  N      . HIS D 2 88  ? 35.873  30.685 215.710 1.00 113.68 ? 166 HIS D N      1 
ATOM   8914  C  CA     . HIS D 2 88  ? 36.726  29.531 215.967 1.00 115.67 ? 166 HIS D CA     1 
ATOM   8915  C  C      . HIS D 2 88  ? 36.293  28.343 215.117 1.00 103.49 ? 166 HIS D C      1 
ATOM   8916  O  O      . HIS D 2 88  ? 37.078  27.805 214.332 1.00 101.60 ? 166 HIS D O      1 
ATOM   8917  C  CB     . HIS D 2 88  ? 36.695  29.173 217.455 1.00 129.91 ? 166 HIS D CB     1 
ATOM   8918  C  CG     . HIS D 2 88  ? 37.852  28.332 217.897 1.00 123.16 ? 166 HIS D CG     1 
ATOM   8919  N  ND1    . HIS D 2 88  ? 39.158  28.643 217.588 1.00 105.88 ? 166 HIS D ND1    1 
ATOM   8920  C  CD2    . HIS D 2 88  ? 37.900  27.192 218.627 1.00 128.18 ? 166 HIS D CD2    1 
ATOM   8921  C  CE1    . HIS D 2 88  ? 39.961  27.730 218.106 1.00 99.00  ? 166 HIS D CE1    1 
ATOM   8922  N  NE2    . HIS D 2 88  ? 39.222  26.839 218.742 1.00 121.76 ? 166 HIS D NE2    1 
ATOM   8923  H  H      . HIS D 2 88  ? 35.421  30.953 216.391 1.00 136.42 ? 166 HIS D H      1 
ATOM   8924  H  HA     . HIS D 2 88  ? 37.640  29.753 215.730 1.00 138.81 ? 166 HIS D HA     1 
ATOM   8925  H  HB2    . HIS D 2 88  ? 36.709  29.993 217.973 1.00 155.89 ? 166 HIS D HB2    1 
ATOM   8926  H  HB3    . HIS D 2 88  ? 35.880  28.680 217.641 1.00 155.89 ? 166 HIS D HB3    1 
ATOM   8927  H  HD1    . HIS D 2 88  ? 39.412  29.324 217.128 1.00 127.05 ? 166 HIS D HD1    1 
ATOM   8928  H  HD2    . HIS D 2 88  ? 37.173  26.733 218.983 1.00 153.81 ? 166 HIS D HD2    1 
ATOM   8929  H  HE1    . HIS D 2 88  ? 40.888  27.718 218.036 1.00 118.80 ? 166 HIS D HE1    1 
ATOM   8930  N  N      . LEU D 2 89  ? 35.036  27.918 215.257 1.00 124.84 ? 167 LEU D N      1 
ATOM   8931  C  CA     . LEU D 2 89  ? 34.541  26.839 214.411 1.00 100.59 ? 167 LEU D CA     1 
ATOM   8932  C  C      . LEU D 2 89  ? 34.644  27.217 212.938 1.00 107.00 ? 167 LEU D C      1 
ATOM   8933  O  O      . LEU D 2 89  ? 35.013  26.387 212.097 1.00 98.56  ? 167 LEU D O      1 
ATOM   8934  C  CB     . LEU D 2 89  ? 33.097  26.498 214.782 1.00 85.49  ? 167 LEU D CB     1 
ATOM   8935  H  H      . LEU D 2 89  ? 34.465  28.230 215.820 1.00 149.81 ? 167 LEU D H      1 
ATOM   8936  H  HA     . LEU D 2 89  ? 35.084  26.048 214.556 1.00 120.70 ? 167 LEU D HA     1 
ATOM   8937  N  N      . ILE D 2 90  ? 34.349  28.477 212.612 1.00 116.09 ? 168 ILE D N      1 
ATOM   8938  C  CA     . ILE D 2 90  ? 34.344  28.918 211.219 1.00 115.18 ? 168 ILE D CA     1 
ATOM   8939  C  C      . ILE D 2 90  ? 35.702  28.663 210.577 1.00 113.67 ? 168 ILE D C      1 
ATOM   8940  O  O      . ILE D 2 90  ? 35.817  27.932 209.586 1.00 101.69 ? 168 ILE D O      1 
ATOM   8941  C  CB     . ILE D 2 90  ? 33.954  30.404 211.127 1.00 106.95 ? 168 ILE D CB     1 
ATOM   8942  H  H      . ILE D 2 90  ? 34.149  29.093 213.179 1.00 139.31 ? 168 ILE D H      1 
ATOM   8943  H  HA     . ILE D 2 90  ? 33.682  28.406 210.729 1.00 138.22 ? 168 ILE D HA     1 
ATOM   8944  N  N      . LEU D 2 91  ? 36.753  29.266 211.136 1.00 133.23 ? 169 LEU D N      1 
ATOM   8945  C  CA     . LEU D 2 91  ? 38.091  29.103 210.574 1.00 129.24 ? 169 LEU D CA     1 
ATOM   8946  C  C      . LEU D 2 91  ? 38.620  27.696 210.827 1.00 126.75 ? 169 LEU D C      1 
ATOM   8947  O  O      . LEU D 2 91  ? 38.844  26.927 209.888 1.00 123.67 ? 169 LEU D O      1 
ATOM   8948  C  CB     . LEU D 2 91  ? 39.037  30.154 211.160 1.00 129.87 ? 169 LEU D CB     1 
ATOM   8949  H  H      . LEU D 2 91  ? 36.718  29.769 211.832 1.00 159.88 ? 169 LEU D H      1 
ATOM   8950  H  HA     . LEU D 2 91  ? 38.049  29.239 209.614 1.00 155.08 ? 169 LEU D HA     1 
ATOM   8951  N  N      . GLU D 2 92  ? 38.820  27.341 212.098 1.00 140.22 ? 170 GLU D N      1 
ATOM   8952  C  CA     . GLU D 2 92  ? 39.309  26.021 212.495 1.00 125.04 ? 170 GLU D CA     1 
ATOM   8953  C  C      . GLU D 2 92  ? 38.745  24.924 211.594 1.00 123.39 ? 170 GLU D C      1 
ATOM   8954  O  O      . GLU D 2 92  ? 39.479  24.026 211.170 1.00 100.40 ? 170 GLU D O      1 
ATOM   8955  C  CB     . GLU D 2 92  ? 38.950  25.751 213.961 1.00 113.52 ? 170 GLU D CB     1 
ATOM   8956  C  CG     . GLU D 2 92  ? 39.911  24.848 214.722 1.00 112.26 ? 170 GLU D CG     1 
ATOM   8957  C  CD     . GLU D 2 92  ? 39.839  23.393 214.304 1.00 123.67 ? 170 GLU D CD     1 
ATOM   8958  O  OE1    . GLU D 2 92  ? 40.434  23.038 213.264 1.00 127.83 ? 170 GLU D OE1    1 
ATOM   8959  O  OE2    . GLU D 2 92  ? 39.187  22.606 215.022 1.00 105.57 ? 170 GLU D OE2    1 
ATOM   8960  H  H      . GLU D 2 92  ? 38.676  27.864 212.766 1.00 168.26 ? 170 GLU D H      1 
ATOM   8961  H  HA     . GLU D 2 92  ? 40.275  26.005 212.415 1.00 150.05 ? 170 GLU D HA     1 
ATOM   8962  H  HB2    . GLU D 2 92  ? 38.918  26.600 214.429 1.00 136.22 ? 170 GLU D HB2    1 
ATOM   8963  H  HB3    . GLU D 2 92  ? 38.076  25.333 213.990 1.00 136.22 ? 170 GLU D HB3    1 
ATOM   8964  H  HG2    . GLU D 2 92  ? 40.818  25.157 214.568 1.00 134.72 ? 170 GLU D HG2    1 
ATOM   8965  H  HG3    . GLU D 2 92  ? 39.703  24.896 215.668 1.00 134.72 ? 170 GLU D HG3    1 
ATOM   8966  N  N      . ALA D 2 93  ? 37.450  25.002 211.272 1.00 131.01 ? 171 ALA D N      1 
ATOM   8967  C  CA     . ALA D 2 93  ? 36.856  24.033 210.355 1.00 105.20 ? 171 ALA D CA     1 
ATOM   8968  C  C      . ALA D 2 93  ? 37.248  24.324 208.911 1.00 104.47 ? 171 ALA D C      1 
ATOM   8969  O  O      . ALA D 2 93  ? 37.613  23.410 208.165 1.00 98.17  ? 171 ALA D O      1 
ATOM   8970  C  CB     . ALA D 2 93  ? 35.334  24.033 210.498 1.00 118.08 ? 171 ALA D CB     1 
ATOM   8971  H  H      . ALA D 2 93  ? 36.904  25.597 211.567 1.00 157.21 ? 171 ALA D H      1 
ATOM   8972  H  HA     . ALA D 2 93  ? 37.178  23.147 210.580 1.00 126.24 ? 171 ALA D HA     1 
ATOM   8973  H  HB1    . ALA D 2 93  ? 34.959  23.385 209.881 1.00 141.69 ? 171 ALA D HB1    1 
ATOM   8974  H  HB2    . ALA D 2 93  ? 35.103  23.795 211.410 1.00 141.69 ? 171 ALA D HB2    1 
ATOM   8975  H  HB3    . ALA D 2 93  ? 34.998  24.919 210.292 1.00 141.69 ? 171 ALA D HB3    1 
ATOM   8976  N  N      . ALA D 2 94  ? 37.176  25.591 208.502 1.00 121.01 ? 172 ALA D N      1 
ATOM   8977  C  CA     . ALA D 2 94  ? 37.428  25.987 207.122 1.00 111.71 ? 172 ALA D CA     1 
ATOM   8978  C  C      . ALA D 2 94  ? 38.717  26.785 206.960 1.00 144.06 ? 172 ALA D C      1 
ATOM   8979  O  O      . ALA D 2 94  ? 38.937  27.380 205.898 1.00 149.81 ? 172 ALA D O      1 
ATOM   8980  C  CB     . ALA D 2 94  ? 36.242  26.794 206.590 1.00 108.47 ? 172 ALA D CB     1 
ATOM   8981  H  H      . ALA D 2 94  ? 36.979  26.250 209.017 1.00 145.21 ? 172 ALA D H      1 
ATOM   8982  H  HA     . ALA D 2 94  ? 37.507  25.187 206.579 1.00 134.06 ? 172 ALA D HA     1 
ATOM   8983  H  HB1    . ALA D 2 94  ? 36.422  27.052 205.672 1.00 130.16 ? 172 ALA D HB1    1 
ATOM   8984  H  HB2    . ALA D 2 94  ? 35.444  26.245 206.629 1.00 130.16 ? 172 ALA D HB2    1 
ATOM   8985  H  HB3    . ALA D 2 94  ? 36.128  27.586 207.139 1.00 130.16 ? 172 ALA D HB3    1 
ATOM   8986  N  N      . ASP D 2 95  ? 39.576  26.797 207.975 1.00 141.11 ? 173 ASP D N      1 
ATOM   8987  C  CA     . ASP D 2 95  ? 40.798  27.598 207.969 1.00 140.69 ? 173 ASP D CA     1 
ATOM   8988  C  C      . ASP D 2 95  ? 40.568  29.002 207.413 1.00 152.01 ? 173 ASP D C      1 
ATOM   8989  O  O      . ASP D 2 95  ? 40.792  29.265 206.232 1.00 142.17 ? 173 ASP D O      1 
ATOM   8990  C  CB     . ASP D 2 95  ? 41.879  26.879 207.169 1.00 120.64 ? 173 ASP D CB     1 
ATOM   8991  C  CG     . ASP D 2 95  ? 42.083  25.446 207.629 1.00 149.60 ? 173 ASP D CG     1 
ATOM   8992  O  OD1    . ASP D 2 95  ? 42.248  25.233 208.847 1.00 153.58 ? 173 ASP D OD1    1 
ATOM   8993  O  OD2    . ASP D 2 95  ? 42.057  24.533 206.776 1.00 138.28 ? 173 ASP D OD2    1 
ATOM   8994  H  H      . ASP D 2 95  ? 39.471  26.339 208.695 1.00 169.33 ? 173 ASP D H      1 
ATOM   8995  H  HA     . ASP D 2 95  ? 41.116  27.689 208.881 1.00 168.83 ? 173 ASP D HA     1 
ATOM   8996  H  HB2    . ASP D 2 95  ? 41.623  26.862 206.234 1.00 144.77 ? 173 ASP D HB2    1 
ATOM   8997  H  HB3    . ASP D 2 95  ? 42.720  27.352 207.275 1.00 144.77 ? 173 ASP D HB3    1 
ATOM   8998  N  N      . PHE D 2 97  ? 39.318  32.726 207.045 1.00 114.66 ? 175 PHE D N      1 
ATOM   8999  C  CA     . PHE D 2 97  ? 39.686  34.101 206.729 1.00 142.70 ? 175 PHE D CA     1 
ATOM   9000  C  C      . PHE D 2 97  ? 38.451  34.928 206.395 1.00 140.77 ? 175 PHE D C      1 
ATOM   9001  O  O      . PHE D 2 97  ? 37.435  34.395 205.951 1.00 155.52 ? 175 PHE D O      1 
ATOM   9002  C  CB     . PHE D 2 97  ? 40.674  34.142 205.562 1.00 131.26 ? 175 PHE D CB     1 
ATOM   9003  H  HA     . PHE D 2 97  ? 40.116  34.499 207.501 1.00 171.24 ? 175 PHE D HA     1 
ATOM   9004  N  N      . LEU D 2 98  ? 38.550  36.237 206.609 1.00 124.22 ? 176 LEU D N      1 
ATOM   9005  C  CA     . LEU D 2 98  ? 37.413  37.129 206.452 1.00 110.50 ? 176 LEU D CA     1 
ATOM   9006  C  C      . LEU D 2 98  ? 37.880  38.451 205.859 1.00 128.44 ? 176 LEU D C      1 
ATOM   9007  O  O      . LEU D 2 98  ? 39.073  38.765 205.844 1.00 141.11 ? 176 LEU D O      1 
ATOM   9008  C  CB     . LEU D 2 98  ? 36.709  37.365 207.791 1.00 102.26 ? 176 LEU D CB     1 
ATOM   9009  C  CG     . LEU D 2 98  ? 36.238  36.112 208.534 1.00 106.95 ? 176 LEU D CG     1 
ATOM   9010  C  CD1    . LEU D 2 98  ? 37.323  35.458 209.392 1.00 128.43 ? 176 LEU D CD1    1 
ATOM   9011  C  CD2    . LEU D 2 98  ? 35.074  36.487 209.406 1.00 132.73 ? 176 LEU D CD2    1 
ATOM   9012  H  H      . LEU D 2 98  ? 39.274  36.635 206.849 1.00 149.06 ? 176 LEU D H      1 
ATOM   9013  H  HA     . LEU D 2 98  ? 36.776  36.730 205.840 1.00 132.60 ? 176 LEU D HA     1 
ATOM   9014  H  HB2    . LEU D 2 98  ? 37.321  37.836 208.378 1.00 122.71 ? 176 LEU D HB2    1 
ATOM   9015  H  HB3    . LEU D 2 98  ? 35.927  37.917 207.631 1.00 122.71 ? 176 LEU D HB3    1 
ATOM   9016  H  HG     . LEU D 2 98  ? 35.931  35.457 207.887 1.00 128.35 ? 176 LEU D HG     1 
ATOM   9017  H  HD11   . LEU D 2 98  ? 36.950  34.675 209.828 1.00 154.12 ? 176 LEU D HD11   1 
ATOM   9018  H  HD12   . LEU D 2 98  ? 38.063  35.198 208.821 1.00 154.12 ? 176 LEU D HD12   1 
ATOM   9019  H  HD13   . LEU D 2 98  ? 37.625  36.095 210.057 1.00 154.12 ? 176 LEU D HD13   1 
ATOM   9020  H  HD21   . LEU D 2 98  ? 34.769  35.698 209.881 1.00 159.28 ? 176 LEU D HD21   1 
ATOM   9021  H  HD22   . LEU D 2 98  ? 35.359  37.164 210.039 1.00 159.28 ? 176 LEU D HD22   1 
ATOM   9022  H  HD23   . LEU D 2 98  ? 34.361  36.834 208.848 1.00 159.28 ? 176 LEU D HD23   1 
ATOM   9023  N  N      . PHE D 2 99  ? 36.917  39.229 205.371 1.00 120.57 ? 177 PHE D N      1 
ATOM   9024  C  CA     . PHE D 2 99  ? 37.212  40.529 204.781 1.00 115.40 ? 177 PHE D CA     1 
ATOM   9025  C  C      . PHE D 2 99  ? 35.947  41.368 204.642 1.00 111.27 ? 177 PHE D C      1 
ATOM   9026  O  O      . PHE D 2 99  ? 35.292  41.353 203.602 1.00 112.65 ? 177 PHE D O      1 
ATOM   9027  C  CB     . PHE D 2 99  ? 37.878  40.352 203.418 1.00 127.45 ? 177 PHE D CB     1 
ATOM   9028  H  H      . PHE D 2 99  ? 36.082  39.025 205.370 1.00 144.69 ? 177 PHE D H      1 
ATOM   9029  H  HA     . PHE D 2 99  ? 37.829  41.006 205.358 1.00 138.48 ? 177 PHE D HA     1 
ATOM   9030  N  N      . TYR D 2 110 ? 37.014  45.762 206.596 1.00 133.93 ? 188 TYR D N      1 
ATOM   9031  C  CA     . TYR D 2 110 ? 37.973  45.293 207.589 1.00 141.13 ? 188 TYR D CA     1 
ATOM   9032  C  C      . TYR D 2 110 ? 38.278  43.811 207.393 1.00 136.46 ? 188 TYR D C      1 
ATOM   9033  O  O      . TYR D 2 110 ? 37.547  43.103 206.700 1.00 142.33 ? 188 TYR D O      1 
ATOM   9034  C  CB     . TYR D 2 110 ? 37.442  45.537 209.004 1.00 127.36 ? 188 TYR D CB     1 
ATOM   9035  H  HA     . TYR D 2 110 ? 38.802  45.787 207.488 1.00 169.36 ? 188 TYR D HA     1 
ATOM   9036  N  N      . VAL D 2 111 ? 39.367  43.351 208.007 1.00 139.00 ? 189 VAL D N      1 
ATOM   9037  C  CA     . VAL D 2 111 ? 39.773  41.954 207.963 1.00 130.05 ? 189 VAL D CA     1 
ATOM   9038  C  C      . VAL D 2 111 ? 39.792  41.416 209.388 1.00 124.11 ? 189 VAL D C      1 
ATOM   9039  O  O      . VAL D 2 111 ? 39.928  42.164 210.359 1.00 133.54 ? 189 VAL D O      1 
ATOM   9040  C  CB     . VAL D 2 111 ? 41.150  41.769 207.293 1.00 142.41 ? 189 VAL D CB     1 
ATOM   9041  H  H      . VAL D 2 111 ? 39.899  43.846 208.468 1.00 166.80 ? 189 VAL D H      1 
ATOM   9042  H  HA     . VAL D 2 111 ? 39.119  41.448 207.456 1.00 156.06 ? 189 VAL D HA     1 
ATOM   9043  N  N      . SER D 2 112 ? 39.651  40.101 209.505 1.00 150.47 ? 190 SER D N      1 
ATOM   9044  C  CA     . SER D 2 112 ? 39.596  39.452 210.806 1.00 137.43 ? 190 SER D CA     1 
ATOM   9045  C  C      . SER D 2 112 ? 40.970  38.926 211.208 1.00 142.30 ? 190 SER D C      1 
ATOM   9046  O  O      . SER D 2 112 ? 41.846  38.692 210.372 1.00 174.18 ? 190 SER D O      1 
ATOM   9047  C  CB     . SER D 2 112 ? 38.585  38.307 210.797 1.00 122.46 ? 190 SER D CB     1 
ATOM   9048  H  H      . SER D 2 112 ? 39.584  39.559 208.840 1.00 180.57 ? 190 SER D H      1 
ATOM   9049  H  HA     . SER D 2 112 ? 39.314  40.098 211.472 1.00 164.92 ? 190 SER D HA     1 
ATOM   9050  N  N      . ASP D 2 113 ? 41.146  38.738 212.518 1.00 135.02 ? 191 ASP D N      1 
ATOM   9051  C  CA     . ASP D 2 113 ? 42.423  38.279 213.050 1.00 148.01 ? 191 ASP D CA     1 
ATOM   9052  C  C      . ASP D 2 113 ? 42.735  36.843 212.656 1.00 153.30 ? 191 ASP D C      1 
ATOM   9053  O  O      . ASP D 2 113 ? 43.901  36.439 212.712 1.00 168.57 ? 191 ASP D O      1 
ATOM   9054  C  CB     . ASP D 2 113 ? 42.433  38.407 214.574 1.00 139.40 ? 191 ASP D CB     1 
ATOM   9055  H  H      . ASP D 2 113 ? 40.541  38.869 213.115 1.00 162.03 ? 191 ASP D H      1 
ATOM   9056  H  HA     . ASP D 2 113 ? 43.130  38.844 212.699 1.00 177.62 ? 191 ASP D HA     1 
ATOM   9057  N  N      . SER D 2 114 ? 41.725  36.064 212.264 1.00 147.37 ? 192 SER D N      1 
ATOM   9058  C  CA     . SER D 2 114 ? 41.961  34.680 211.877 1.00 159.24 ? 192 SER D CA     1 
ATOM   9059  C  C      . SER D 2 114 ? 42.787  34.568 210.602 1.00 165.52 ? 192 SER D C      1 
ATOM   9060  O  O      . SER D 2 114 ? 43.354  33.501 210.341 1.00 150.71 ? 192 SER D O      1 
ATOM   9061  C  CB     . SER D 2 114 ? 40.628  33.951 211.696 1.00 132.16 ? 192 SER D CB     1 
ATOM   9062  H  H      . SER D 2 114 ? 40.903  36.313 212.215 1.00 176.84 ? 192 SER D H      1 
ATOM   9063  H  HA     . SER D 2 114 ? 42.450  34.235 212.587 1.00 191.09 ? 192 SER D HA     1 
ATOM   9064  N  N      . VAL D 2 115 ? 42.868  35.639 209.807 1.00 173.41 ? 193 VAL D N      1 
ATOM   9065  C  CA     . VAL D 2 115 ? 43.659  35.602 208.579 1.00 169.58 ? 193 VAL D CA     1 
ATOM   9066  C  C      . VAL D 2 115 ? 45.087  35.170 208.882 1.00 154.58 ? 193 VAL D C      1 
ATOM   9067  O  O      . VAL D 2 115 ? 45.719  34.455 208.094 1.00 158.43 ? 193 VAL D O      1 
ATOM   9068  C  CB     . VAL D 2 115 ? 43.621  36.973 207.878 1.00 143.53 ? 193 VAL D CB     1 
ATOM   9069  H  H      . VAL D 2 115 ? 42.477  36.390 209.956 1.00 208.10 ? 193 VAL D H      1 
ATOM   9070  H  HA     . VAL D 2 115 ? 43.272  34.948 207.975 1.00 203.50 ? 193 VAL D HA     1 
ATOM   9071  N  N      . THR D 2 116 ? 45.616  35.593 210.029 1.00 143.98 ? 194 THR D N      1 
ATOM   9072  C  CA     . THR D 2 116 ? 46.963  35.183 210.414 1.00 160.25 ? 194 THR D CA     1 
ATOM   9073  C  C      . THR D 2 116 ? 47.097  33.673 210.547 1.00 150.67 ? 194 THR D C      1 
ATOM   9074  O  O      . THR D 2 116 ? 48.114  33.127 210.084 1.00 162.01 ? 194 THR D O      1 
ATOM   9075  C  CB     . THR D 2 116 ? 47.357  35.868 211.728 1.00 150.78 ? 194 THR D CB     1 
ATOM   9076  H  H      . THR D 2 116 ? 45.223  36.110 210.593 1.00 172.77 ? 194 THR D H      1 
ATOM   9077  H  HA     . THR D 2 116 ? 47.585  35.475 209.730 1.00 192.30 ? 194 THR D HA     1 
ATOM   9078  N  N      . PRO D 2 117 ? 46.149  32.950 211.149 1.00 134.92 ? 195 PRO D N      1 
ATOM   9079  C  CA     . PRO D 2 117 ? 46.315  31.490 211.241 1.00 146.22 ? 195 PRO D CA     1 
ATOM   9080  C  C      . PRO D 2 117 ? 46.487  30.824 209.889 1.00 155.19 ? 195 PRO D C      1 
ATOM   9081  O  O      . PRO D 2 117 ? 47.243  29.852 209.772 1.00 157.75 ? 195 PRO D O      1 
ATOM   9082  C  CB     . PRO D 2 117 ? 45.028  31.040 211.944 1.00 148.25 ? 195 PRO D CB     1 
ATOM   9083  H  HA     . PRO D 2 117 ? 47.077  31.275 211.802 1.00 175.47 ? 195 PRO D HA     1 
ATOM   9084  N  N      . VAL D 2 118 ? 45.805  31.321 208.862 1.00 156.09 ? 196 VAL D N      1 
ATOM   9085  C  CA     . VAL D 2 118 ? 45.912  30.764 207.521 1.00 154.51 ? 196 VAL D CA     1 
ATOM   9086  C  C      . VAL D 2 118 ? 46.774  31.673 206.653 1.00 152.51 ? 196 VAL D C      1 
ATOM   9087  O  O      . VAL D 2 118 ? 47.998  31.703 206.790 1.00 155.58 ? 196 VAL D O      1 
ATOM   9088  C  CB     . VAL D 2 118 ? 44.524  30.566 206.891 1.00 141.82 ? 196 VAL D CB     1 
ATOM   9089  H  H      . VAL D 2 118 ? 45.267  31.990 208.919 1.00 187.31 ? 196 VAL D H      1 
ATOM   9090  H  HA     . VAL D 2 118 ? 46.345  29.898 207.572 1.00 185.41 ? 196 VAL D HA     1 
ATOM   9091  N  N      . GLN D 2 121 ? 50.887  35.166 208.916 1.00 178.96 ? 199 GLN D N      1 
ATOM   9092  C  CA     . GLN D 2 121 ? 51.136  36.498 208.374 1.00 188.61 ? 199 GLN D CA     1 
ATOM   9093  C  C      . GLN D 2 121 ? 50.009  37.463 208.746 1.00 184.36 ? 199 GLN D C      1 
ATOM   9094  O  O      . GLN D 2 121 ? 49.115  37.713 207.938 1.00 185.05 ? 199 GLN D O      1 
ATOM   9095  C  CB     . GLN D 2 121 ? 51.289  36.435 206.853 1.00 180.80 ? 199 GLN D CB     1 
ATOM   9096  H  H      . GLN D 2 121 ? 50.110  34.852 208.727 1.00 214.75 ? 199 GLN D H      1 
ATOM   9097  H  HA     . GLN D 2 121 ? 51.963  36.842 208.747 1.00 226.34 ? 199 GLN D HA     1 
ATOM   9098  N  N      . PRO D 2 122 ? 50.048  38.003 209.965 1.00 178.41 ? 200 PRO D N      1 
ATOM   9099  C  CA     . PRO D 2 122 ? 49.019  38.962 210.381 1.00 165.15 ? 200 PRO D CA     1 
ATOM   9100  C  C      . PRO D 2 122 ? 49.301  40.358 209.849 1.00 170.16 ? 200 PRO D C      1 
ATOM   9101  O  O      . PRO D 2 122 ? 50.452  40.792 209.754 1.00 173.74 ? 200 PRO D O      1 
ATOM   9102  C  CB     . PRO D 2 122 ? 49.104  38.925 211.910 1.00 161.84 ? 200 PRO D CB     1 
ATOM   9103  C  CG     . PRO D 2 122 ? 50.531  38.607 212.181 1.00 182.33 ? 200 PRO D CG     1 
ATOM   9104  C  CD     . PRO D 2 122 ? 50.996  37.711 211.055 1.00 180.72 ? 200 PRO D CD     1 
ATOM   9105  H  HA     . PRO D 2 122 ? 48.140  38.671 210.093 1.00 198.18 ? 200 PRO D HA     1 
ATOM   9106  H  HB2    . PRO D 2 122 ? 48.866  39.791 212.275 1.00 194.21 ? 200 PRO D HB2    1 
ATOM   9107  H  HB3    . PRO D 2 122 ? 48.522  38.230 212.256 1.00 194.21 ? 200 PRO D HB3    1 
ATOM   9108  H  HG2    . PRO D 2 122 ? 51.047  39.428 212.196 1.00 218.80 ? 200 PRO D HG2    1 
ATOM   9109  H  HG3    . PRO D 2 122 ? 50.603  38.146 213.032 1.00 218.80 ? 200 PRO D HG3    1 
ATOM   9110  H  HD2    . PRO D 2 122 ? 51.899  37.945 210.789 1.00 216.87 ? 200 PRO D HD2    1 
ATOM   9111  H  HD3    . PRO D 2 122 ? 50.933  36.780 211.317 1.00 216.87 ? 200 PRO D HD3    1 
ATOM   9112  N  N      . GLN D 2 123 ? 48.230  41.066 209.502 1.00 183.12 ? 201 GLN D N      1 
ATOM   9113  C  CA     . GLN D 2 123 ? 48.340  42.421 208.980 1.00 181.27 ? 201 GLN D CA     1 
ATOM   9114  C  C      . GLN D 2 123 ? 46.937  42.975 208.787 1.00 175.51 ? 201 GLN D C      1 
ATOM   9115  O  O      . GLN D 2 123 ? 45.964  42.222 208.683 1.00 170.16 ? 201 GLN D O      1 
ATOM   9116  C  CB     . GLN D 2 123 ? 49.117  42.462 207.658 1.00 173.35 ? 201 GLN D CB     1 
ATOM   9117  H  H      . GLN D 2 123 ? 47.421  40.779 209.561 1.00 219.75 ? 201 GLN D H      1 
ATOM   9118  H  HA     . GLN D 2 123 ? 48.803  42.979 209.625 1.00 217.52 ? 201 GLN D HA     1 
ATOM   9119  N  N      . SER D 2 124 ? 46.845  44.300 208.747 1.00 179.50 ? 202 SER D N      1 
ATOM   9120  C  CA     . SER D 2 124 ? 45.584  44.992 208.530 1.00 172.39 ? 202 SER D CA     1 
ATOM   9121  C  C      . SER D 2 124 ? 45.481  45.434 207.076 1.00 167.67 ? 202 SER D C      1 
ATOM   9122  O  O      . SER D 2 124 ? 46.464  45.884 206.481 1.00 166.38 ? 202 SER D O      1 
ATOM   9123  C  CB     . SER D 2 124 ? 45.460  46.205 209.455 1.00 157.30 ? 202 SER D CB     1 
ATOM   9124  H  H      . SER D 2 124 ? 47.516  44.830 208.845 1.00 215.40 ? 202 SER D H      1 
ATOM   9125  H  HA     . SER D 2 124 ? 44.849  44.387 208.718 1.00 206.86 ? 202 SER D HA     1 
ATOM   9126  N  N      . GLU D 2 125 ? 44.286  45.298 206.510 1.00 158.23 ? 203 GLU D N      1 
ATOM   9127  C  CA     . GLU D 2 125 ? 44.045  45.701 205.132 1.00 161.19 ? 203 GLU D CA     1 
ATOM   9128  C  C      . GLU D 2 125 ? 44.313  47.192 204.960 1.00 170.29 ? 203 GLU D C      1 
ATOM   9129  O  O      . GLU D 2 125 ? 44.552  47.907 205.934 1.00 162.97 ? 203 GLU D O      1 
ATOM   9130  C  CB     . GLU D 2 125 ? 42.610  45.369 204.719 1.00 151.27 ? 203 GLU D CB     1 
ATOM   9131  H  H      . GLU D 2 125 ? 43.595  44.974 206.906 1.00 189.88 ? 203 GLU D H      1 
ATOM   9132  H  HA     . GLU D 2 125 ? 44.649  45.215 204.548 1.00 193.43 ? 203 GLU D HA     1 
ATOM   9133  N  N      . SER D 2 129 ? 43.615  48.658 202.393 1.00 177.47 ? 207 SER D N      1 
ATOM   9134  C  CA     . SER D 2 129 ? 44.511  48.108 201.384 1.00 181.72 ? 207 SER D CA     1 
ATOM   9135  C  C      . SER D 2 129 ? 43.751  47.193 200.433 1.00 184.95 ? 207 SER D C      1 
ATOM   9136  O  O      . SER D 2 129 ? 43.159  46.200 200.854 1.00 180.02 ? 207 SER D O      1 
ATOM   9137  C  CB     . SER D 2 129 ? 45.659  47.342 202.044 1.00 179.91 ? 207 SER D CB     1 
ATOM   9138  H  HA     . SER D 2 129 ? 44.890  48.834 200.865 1.00 218.06 ? 207 SER D HA     1 
ATOM   9139  N  N      . THR D 2 130 ? 43.771  47.535 199.147 1.00 199.17 ? 208 THR D N      1 
ATOM   9140  C  CA     . THR D 2 130 ? 43.092  46.730 198.145 1.00 189.36 ? 208 THR D CA     1 
ATOM   9141  C  C      . THR D 2 130 ? 43.660  45.313 198.126 1.00 196.01 ? 208 THR D C      1 
ATOM   9142  O  O      . THR D 2 130 ? 44.733  45.033 198.668 1.00 206.22 ? 208 THR D O      1 
ATOM   9143  C  CB     . THR D 2 130 ? 43.231  47.364 196.761 1.00 197.04 ? 208 THR D CB     1 
ATOM   9144  H  H      . THR D 2 130 ? 44.171  48.229 198.833 1.00 239.00 ? 208 THR D H      1 
ATOM   9145  H  HA     . THR D 2 130 ? 42.149  46.677 198.362 1.00 227.23 ? 208 THR D HA     1 
ATOM   9146  N  N      . LEU D 2 131 ? 42.915  44.408 197.486 1.00 187.58 ? 209 LEU D N      1 
ATOM   9147  C  CA     . LEU D 2 131 ? 43.335  43.012 197.425 1.00 188.97 ? 209 LEU D CA     1 
ATOM   9148  C  C      . LEU D 2 131 ? 44.676  42.859 196.719 1.00 198.39 ? 209 LEU D C      1 
ATOM   9149  O  O      . LEU D 2 131 ? 45.475  41.991 197.089 1.00 188.35 ? 209 LEU D O      1 
ATOM   9150  C  CB     . LEU D 2 131 ? 42.267  42.177 196.718 1.00 181.68 ? 209 LEU D CB     1 
ATOM   9151  H  H      . LEU D 2 131 ? 42.172  44.577 197.086 1.00 225.09 ? 209 LEU D H      1 
ATOM   9152  H  HA     . LEU D 2 131 ? 43.431  42.672 198.328 1.00 226.76 ? 209 LEU D HA     1 
ATOM   9153  N  N      . TYR D 2 132 ? 44.940  43.685 195.704 1.00 205.56 ? 210 TYR D N      1 
ATOM   9154  C  CA     . TYR D 2 132 ? 46.209  43.596 194.990 1.00 221.10 ? 210 TYR D CA     1 
ATOM   9155  C  C      . TYR D 2 132 ? 47.388  43.768 195.940 1.00 224.82 ? 210 TYR D C      1 
ATOM   9156  O  O      . TYR D 2 132 ? 48.412  43.089 195.800 1.00 229.89 ? 210 TYR D O      1 
ATOM   9157  C  CB     . TYR D 2 132 ? 46.258  44.645 193.880 1.00 230.73 ? 210 TYR D CB     1 
ATOM   9158  H  H      . TYR D 2 132 ? 44.408  44.297 195.416 1.00 246.67 ? 210 TYR D H      1 
ATOM   9159  H  HA     . TYR D 2 132 ? 46.280  42.720 194.579 1.00 265.32 ? 210 TYR D HA     1 
ATOM   9160  N  N      . ASP D 2 133 ? 47.262  44.665 196.912 1.00 212.22 ? 211 ASP D N      1 
ATOM   9161  C  CA     . ASP D 2 133 ? 48.328  44.903 197.877 1.00 208.53 ? 211 ASP D CA     1 
ATOM   9162  C  C      . ASP D 2 133 ? 48.524  43.688 198.777 1.00 205.52 ? 211 ASP D C      1 
ATOM   9163  O  O      . ASP D 2 133 ? 49.110  42.687 198.365 1.00 205.41 ? 211 ASP D O      1 
ATOM   9164  C  CB     . ASP D 2 133 ? 48.018  46.139 198.723 1.00 206.82 ? 211 ASP D CB     1 
ATOM   9165  H  H      . ASP D 2 133 ? 46.564  45.152 197.035 1.00 254.67 ? 211 ASP D H      1 
ATOM   9166  H  HA     . ASP D 2 133 ? 49.158  45.064 197.401 1.00 250.23 ? 211 ASP D HA     1 
ATOM   9167  N  N      . SER D 2 181 ? 23.795  39.654 193.952 1.00 138.98 ? 259 SER D N      1 
ATOM   9168  C  CA     . SER D 2 181 ? 24.162  39.916 195.338 1.00 153.80 ? 259 SER D CA     1 
ATOM   9169  C  C      . SER D 2 181 ? 25.420  39.142 195.724 1.00 161.48 ? 259 SER D C      1 
ATOM   9170  O  O      . SER D 2 181 ? 26.502  39.718 195.843 1.00 181.92 ? 259 SER D O      1 
ATOM   9171  C  CB     . SER D 2 181 ? 23.011  39.547 196.274 1.00 116.07 ? 259 SER D CB     1 
ATOM   9172  O  OG     . SER D 2 181 ? 22.749  38.155 196.230 1.00 113.53 ? 259 SER D OG     1 
ATOM   9173  H  HA     . SER D 2 181 ? 24.346  40.862 195.445 1.00 184.56 ? 259 SER D HA     1 
ATOM   9174  H  HB2    . SER D 2 181 ? 23.250  39.794 197.181 1.00 139.29 ? 259 SER D HB2    1 
ATOM   9175  H  HB3    . SER D 2 181 ? 22.214  40.027 195.998 1.00 139.29 ? 259 SER D HB3    1 
ATOM   9176  H  HG     . SER D 2 181 ? 22.116  37.966 196.748 1.00 136.24 ? 259 SER D HG     1 
ATOM   9177  N  N      . ARG D 2 182 ? 25.272  37.834 195.918 1.00 152.36 ? 260 ARG D N      1 
ATOM   9178  C  CA     . ARG D 2 182 ? 26.383  36.979 196.315 1.00 150.96 ? 260 ARG D CA     1 
ATOM   9179  C  C      . ARG D 2 182 ? 27.098  36.437 195.083 1.00 169.39 ? 260 ARG D C      1 
ATOM   9180  O  O      . ARG D 2 182 ? 26.468  35.841 194.203 1.00 164.10 ? 260 ARG D O      1 
ATOM   9181  C  CB     . ARG D 2 182 ? 25.883  35.826 197.188 1.00 122.00 ? 260 ARG D CB     1 
ATOM   9182  H  H      . ARG D 2 182 ? 24.528  37.414 195.823 1.00 182.83 ? 260 ARG D H      1 
ATOM   9183  H  HA     . ARG D 2 182 ? 27.018  37.499 196.832 1.00 181.16 ? 260 ARG D HA     1 
ATOM   9184  N  N      . ARG D 2 183 ? 28.412  36.642 195.028 1.00 172.04 ? 261 ARG D N      1 
ATOM   9185  C  CA     . ARG D 2 183 ? 29.252  36.171 193.927 1.00 152.13 ? 261 ARG D CA     1 
ATOM   9186  C  C      . ARG D 2 183 ? 30.326  35.251 194.500 1.00 169.59 ? 261 ARG D C      1 
ATOM   9187  O  O      . ARG D 2 183 ? 31.321  35.722 195.060 1.00 182.85 ? 261 ARG D O      1 
ATOM   9188  C  CB     . ARG D 2 183 ? 29.873  37.344 193.174 1.00 147.49 ? 261 ARG D CB     1 
ATOM   9189  H  H      . ARG D 2 183 ? 28.853  37.064 195.634 1.00 206.45 ? 261 ARG D H      1 
ATOM   9190  H  HA     . ARG D 2 183 ? 28.711  35.660 193.305 1.00 182.55 ? 261 ARG D HA     1 
ATOM   9191  N  N      . SER D 2 184 ? 30.127  33.942 194.356 1.00 160.66 ? 262 SER D N      1 
ATOM   9192  C  CA     . SER D 2 184 ? 31.059  32.947 194.877 1.00 136.92 ? 262 SER D CA     1 
ATOM   9193  C  C      . SER D 2 184 ? 32.092  32.634 193.800 1.00 160.74 ? 262 SER D C      1 
ATOM   9194  O  O      . SER D 2 184 ? 31.762  32.046 192.765 1.00 176.50 ? 262 SER D O      1 
ATOM   9195  C  CB     . SER D 2 184 ? 30.315  31.686 195.311 1.00 124.82 ? 262 SER D CB     1 
ATOM   9196  H  H      . SER D 2 184 ? 29.448  33.601 193.953 1.00 192.79 ? 262 SER D H      1 
ATOM   9197  H  HA     . SER D 2 184 ? 31.522  33.311 195.649 1.00 164.30 ? 262 SER D HA     1 
ATOM   9198  N  N      . PHE D 2 185 ? 33.336  33.031 194.041 1.00 171.53 ? 263 PHE D N      1 
ATOM   9199  C  CA     . PHE D 2 185 ? 34.442  32.793 193.123 1.00 170.74 ? 263 PHE D CA     1 
ATOM   9200  C  C      . PHE D 2 185 ? 35.564  32.062 193.856 1.00 182.18 ? 263 PHE D C      1 
ATOM   9201  O  O      . PHE D 2 185 ? 35.475  31.775 195.052 1.00 180.94 ? 263 PHE D O      1 
ATOM   9202  C  CB     . PHE D 2 185 ? 34.947  34.110 192.525 1.00 152.20 ? 263 PHE D CB     1 
ATOM   9203  H  H      . PHE D 2 185 ? 33.571  33.453 194.752 1.00 205.84 ? 263 PHE D H      1 
ATOM   9204  H  HA     . PHE D 2 185 ? 34.137  32.228 192.396 1.00 204.89 ? 263 PHE D HA     1 
ATOM   9205  N  N      . ILE D 2 186 ? 36.628  31.756 193.116 1.00 174.13 ? 264 ILE D N      1 
ATOM   9206  C  CA     . ILE D 2 186 ? 37.817  31.110 193.661 1.00 164.55 ? 264 ILE D CA     1 
ATOM   9207  C  C      . ILE D 2 186 ? 39.037  31.845 193.129 1.00 184.67 ? 264 ILE D C      1 
ATOM   9208  O  O      . ILE D 2 186 ? 39.167  32.044 191.916 1.00 180.13 ? 264 ILE D O      1 
ATOM   9209  C  CB     . ILE D 2 186 ? 37.879  29.615 193.292 1.00 167.39 ? 264 ILE D CB     1 
ATOM   9210  H  H      . ILE D 2 186 ? 36.685  31.918 192.274 1.00 208.95 ? 264 ILE D H      1 
ATOM   9211  H  HA     . ILE D 2 186 ? 37.810  31.186 194.628 1.00 197.45 ? 264 ILE D HA     1 
ATOM   9212  N  N      . CYS D 2 187 ? 39.927  32.245 194.033 1.00 189.81 ? 265 CYS D N      1 
ATOM   9213  C  CA     . CYS D 2 187 ? 41.080  33.066 193.697 1.00 175.98 ? 265 CYS D CA     1 
ATOM   9214  C  C      . CYS D 2 187 ? 42.330  32.471 194.334 1.00 177.89 ? 265 CYS D C      1 
ATOM   9215  O  O      . CYS D 2 187 ? 42.278  31.454 195.032 1.00 195.03 ? 265 CYS D O      1 
ATOM   9216  C  CB     . CYS D 2 187 ? 40.869  34.512 194.158 1.00 177.50 ? 265 CYS D CB     1 
ATOM   9217  S  SG     . CYS D 2 187 ? 40.372  34.652 195.890 1.00 189.73 ? 265 CYS D SG     1 
ATOM   9218  H  H      . CYS D 2 187 ? 39.880  32.046 194.868 1.00 227.77 ? 265 CYS D H      1 
ATOM   9219  H  HA     . CYS D 2 187 ? 41.201  33.068 192.734 1.00 211.18 ? 265 CYS D HA     1 
ATOM   9220  H  HB2    . CYS D 2 187 ? 41.700  35.001 194.047 1.00 213.00 ? 265 CYS D HB2    1 
ATOM   9221  H  HB3    . CYS D 2 187 ? 40.174  34.916 193.616 1.00 213.00 ? 265 CYS D HB3    1 
ATOM   9222  H  HG     . CYS D 2 187 ? 40.231  35.812 196.164 1.00 227.68 ? 265 CYS D HG     1 
ATOM   9223  N  N      . ARG D 2 188 ? 43.464  33.119 194.084 1.00 181.22 ? 266 ARG D N      1 
ATOM   9224  C  CA     . ARG D 2 188 ? 44.748  32.706 194.627 1.00 193.12 ? 266 ARG D CA     1 
ATOM   9225  C  C      . ARG D 2 188 ? 45.387  33.871 195.369 1.00 186.51 ? 266 ARG D C      1 
ATOM   9226  O  O      . ARG D 2 188 ? 45.154  35.039 195.044 1.00 183.52 ? 266 ARG D O      1 
ATOM   9227  C  CB     . ARG D 2 188 ? 45.689  32.216 193.520 1.00 213.07 ? 266 ARG D CB     1 
ATOM   9228  H  H      . ARG D 2 188 ? 43.513  33.820 193.588 1.00 217.47 ? 266 ARG D H      1 
ATOM   9229  H  HA     . ARG D 2 188 ? 44.612  31.980 195.256 1.00 231.74 ? 266 ARG D HA     1 
ATOM   9230  N  N      . MET D 2 189 ? 46.196  33.542 196.373 1.00 191.64 ? 267 MET D N      1 
ATOM   9231  C  CA     . MET D 2 189 ? 46.875  34.550 197.173 1.00 188.24 ? 267 MET D CA     1 
ATOM   9232  C  C      . MET D 2 189 ? 48.173  33.966 197.709 1.00 203.38 ? 267 MET D C      1 
ATOM   9233  O  O      . MET D 2 189 ? 48.221  32.795 198.096 1.00 196.52 ? 267 MET D O      1 
ATOM   9234  C  CB     . MET D 2 189 ? 45.994  35.030 198.332 1.00 193.00 ? 267 MET D CB     1 
ATOM   9235  H  H      . MET D 2 189 ? 46.369  32.733 196.610 1.00 229.96 ? 267 MET D H      1 
ATOM   9236  H  HA     . MET D 2 189 ? 47.079  35.315 196.613 1.00 225.89 ? 267 MET D HA     1 
ATOM   9237  N  N      . ARG D 2 190 ? 49.218  34.789 197.727 1.00 213.34 ? 268 ARG D N      1 
ATOM   9238  C  CA     . ARG D 2 190 ? 50.530  34.394 198.219 1.00 214.45 ? 268 ARG D CA     1 
ATOM   9239  C  C      . ARG D 2 190 ? 50.924  35.305 199.371 1.00 217.24 ? 268 ARG D C      1 
ATOM   9240  O  O      . ARG D 2 190 ? 50.782  36.529 199.276 1.00 213.77 ? 268 ARG D O      1 
ATOM   9241  C  CB     . ARG D 2 190 ? 51.580  34.461 197.107 1.00 211.74 ? 268 ARG D CB     1 
ATOM   9242  H  H      . ARG D 2 190 ? 49.189  35.603 197.451 1.00 256.01 ? 268 ARG D H      1 
ATOM   9243  H  HA     . ARG D 2 190 ? 50.490  33.482 198.549 1.00 257.33 ? 268 ARG D HA     1 
ATOM   9244  N  N      . CYS D 2 191 ? 51.413  34.709 200.454 1.00 212.24 ? 269 CYS D N      1 
ATOM   9245  C  CA     . CYS D 2 191 ? 51.837  35.469 201.623 1.00 201.86 ? 269 CYS D CA     1 
ATOM   9246  C  C      . CYS D 2 191 ? 53.149  34.921 202.175 1.00 209.99 ? 269 CYS D C      1 
ATOM   9247  O  O      . CYS D 2 191 ? 53.195  34.402 203.289 1.00 201.27 ? 269 CYS D O      1 
ATOM   9248  C  CB     . CYS D 2 191 ? 50.758  35.436 202.706 1.00 186.65 ? 269 CYS D CB     1 
ATOM   9249  H  H      . CYS D 2 191 ? 51.510  33.858 200.536 1.00 254.69 ? 269 CYS D H      1 
ATOM   9250  H  HA     . CYS D 2 191 ? 51.980  36.394 201.367 1.00 242.23 ? 269 CYS D HA     1 
ATOM   9251  N  N      . HIS D 2 201 ? 39.114  29.435 197.248 1.00 162.30 ? 307 HIS D N      1 
ATOM   9252  C  CA     . HIS D 2 201 ? 37.668  29.615 197.241 1.00 149.10 ? 307 HIS D CA     1 
ATOM   9253  C  C      . HIS D 2 201 ? 37.261  30.740 198.187 1.00 158.88 ? 307 HIS D C      1 
ATOM   9254  O  O      . HIS D 2 201 ? 37.917  30.982 199.200 1.00 167.33 ? 307 HIS D O      1 
ATOM   9255  C  CB     . HIS D 2 201 ? 36.962  28.315 197.633 1.00 139.60 ? 307 HIS D CB     1 
ATOM   9256  H  HA     . HIS D 2 201 ? 37.382  29.856 196.346 1.00 178.92 ? 307 HIS D HA     1 
ATOM   9257  N  N      . CYS D 2 202 ? 36.172  31.424 197.848 1.00 165.16 ? 308 CYS D N      1 
ATOM   9258  C  CA     . CYS D 2 202 ? 35.660  32.507 198.674 1.00 158.66 ? 308 CYS D CA     1 
ATOM   9259  C  C      . CYS D 2 202 ? 34.186  32.700 198.360 1.00 154.70 ? 308 CYS D C      1 
ATOM   9260  O  O      . CYS D 2 202 ? 33.743  32.464 197.232 1.00 159.73 ? 308 CYS D O      1 
ATOM   9261  C  CB     . CYS D 2 202 ? 36.434  33.808 198.434 1.00 160.57 ? 308 CYS D CB     1 
ATOM   9262  H  H      . CYS D 2 202 ? 35.709  31.277 197.138 1.00 198.19 ? 308 CYS D H      1 
ATOM   9263  H  HA     . CYS D 2 202 ? 35.746  32.268 199.610 1.00 190.39 ? 308 CYS D HA     1 
ATOM   9264  N  N      . THR D 2 203 ? 33.430  33.126 199.371 1.00 119.76 ? 309 THR D N      1 
ATOM   9265  C  CA     . THR D 2 203 ? 32.005  33.378 199.211 1.00 124.77 ? 309 THR D CA     1 
ATOM   9266  C  C      . THR D 2 203 ? 31.628  34.640 199.970 1.00 108.82 ? 309 THR D C      1 
ATOM   9267  O  O      . THR D 2 203 ? 32.067  34.843 201.104 1.00 132.60 ? 309 THR D O      1 
ATOM   9268  C  CB     . THR D 2 203 ? 31.165  32.198 199.714 1.00 122.60 ? 309 THR D CB     1 
ATOM   9269  H  H      . THR D 2 203 ? 33.724  33.277 200.165 1.00 143.72 ? 309 THR D H      1 
ATOM   9270  H  HA     . THR D 2 203 ? 31.806  33.515 198.271 1.00 149.73 ? 309 THR D HA     1 
ATOM   9271  N  N      . GLY D 2 204 ? 30.812  35.481 199.342 1.00 104.06 ? 310 GLY D N      1 
ATOM   9272  C  CA     . GLY D 2 204 ? 30.452  36.747 199.948 1.00 104.72 ? 310 GLY D CA     1 
ATOM   9273  C  C      . GLY D 2 204 ? 29.137  37.264 199.413 1.00 104.21 ? 310 GLY D C      1 
ATOM   9274  O  O      . GLY D 2 204 ? 28.534  36.690 198.503 1.00 104.23 ? 310 GLY D O      1 
ATOM   9275  H  H      . GLY D 2 204 ? 30.458  35.340 198.571 1.00 124.87 ? 310 GLY D H      1 
ATOM   9276  H  HA2    . GLY D 2 204 ? 30.375  36.638 200.909 1.00 125.67 ? 310 GLY D HA2    1 
ATOM   9277  H  HA3    . GLY D 2 204 ? 31.142  37.404 199.765 1.00 125.67 ? 310 GLY D HA3    1 
ATOM   9278  N  N      . TYR D 2 205 ? 28.706  38.379 199.995 1.00 130.03 ? 311 TYR D N      1 
ATOM   9279  C  CA     . TYR D 2 205 ? 27.473  39.049 199.617 1.00 119.55 ? 311 TYR D CA     1 
ATOM   9280  C  C      . TYR D 2 205 ? 27.774  40.493 199.236 1.00 135.19 ? 311 TYR D C      1 
ATOM   9281  O  O      . TYR D 2 205 ? 28.779  41.074 199.659 1.00 146.18 ? 311 TYR D O      1 
ATOM   9282  C  CB     . TYR D 2 205 ? 26.451  39.008 200.760 1.00 97.28  ? 311 TYR D CB     1 
ATOM   9283  H  H      . TYR D 2 205 ? 29.126  38.775 200.632 1.00 156.04 ? 311 TYR D H      1 
ATOM   9284  H  HA     . TYR D 2 205 ? 27.088  38.603 198.846 1.00 143.46 ? 311 TYR D HA     1 
ATOM   9285  N  N      . ILE D 2 206 ? 26.886  41.070 198.427 1.00 139.22 ? 312 ILE D N      1 
ATOM   9286  C  CA     . ILE D 2 206 ? 27.034  42.450 197.974 1.00 131.13 ? 312 ILE D CA     1 
ATOM   9287  C  C      . ILE D 2 206 ? 26.018  43.330 198.691 1.00 144.39 ? 312 ILE D C      1 
ATOM   9288  O  O      . ILE D 2 206 ? 25.360  42.889 199.640 1.00 153.46 ? 312 ILE D O      1 
ATOM   9289  C  CB     . ILE D 2 206 ? 26.875  42.558 196.446 1.00 130.84 ? 312 ILE D CB     1 
ATOM   9290  H  H      . ILE D 2 206 ? 26.183  40.679 198.125 1.00 167.07 ? 312 ILE D H      1 
ATOM   9291  H  HA     . ILE D 2 206 ? 27.922  42.766 198.206 1.00 157.35 ? 312 ILE D HA     1 
ATOM   9292  N  N      . LYS D 2 207 ? 25.894  44.581 198.244 1.00 131.16 ? 313 LYS D N      1 
ATOM   9293  C  CA     . LYS D 2 207 ? 24.981  45.552 198.840 1.00 154.65 ? 313 LYS D CA     1 
ATOM   9294  C  C      . LYS D 2 207 ? 25.571  46.148 200.114 1.00 152.17 ? 313 LYS D C      1 
ATOM   9295  O  O      . LYS D 2 207 ? 24.832  46.559 201.015 1.00 142.47 ? 313 LYS D O      1 
ATOM   9296  C  CB     . LYS D 2 207 ? 23.620  44.911 199.137 1.00 125.78 ? 313 LYS D CB     1 
ATOM   9297  H  H      . LYS D 2 207 ? 26.340  44.896 197.579 1.00 157.39 ? 313 LYS D H      1 
ATOM   9298  H  HA     . LYS D 2 207 ? 24.838  46.276 198.211 1.00 185.58 ? 313 LYS D HA     1 
ATOM   9299  N  N      . ALA D 2 208 ? 26.897  46.209 200.194 1.00 159.50 ? 314 ALA D N      1 
ATOM   9300  C  CA     . ALA D 2 208 ? 27.573  46.776 201.357 1.00 163.22 ? 314 ALA D CA     1 
ATOM   9301  C  C      . ALA D 2 208 ? 27.206  48.246 201.540 1.00 146.07 ? 314 ALA D C      1 
ATOM   9302  O  O      . ALA D 2 208 ? 27.789  48.943 202.372 1.00 136.00 ? 314 ALA D O      1 
ATOM   9303  C  CB     . ALA D 2 208 ? 29.079  46.622 201.219 1.00 146.07 ? 314 ALA D CB     1 
ATOM   9304  H  H      . ALA D 2 208 ? 27.432  45.926 199.583 1.00 191.40 ? 314 ALA D H      1 
ATOM   9305  H  HA     . ALA D 2 208 ? 27.293  46.295 202.151 1.00 195.87 ? 314 ALA D HA     1 
ATOM   9306  H  HB1    . ALA D 2 208 ? 29.508  47.005 202.000 1.00 175.28 ? 314 ALA D HB1    1 
ATOM   9307  H  HB2    . ALA D 2 208 ? 29.294  45.679 201.151 1.00 175.28 ? 314 ALA D HB2    1 
ATOM   9308  H  HB3    . ALA D 2 208 ? 29.371  47.087 200.419 1.00 175.28 ? 314 ALA D HB3    1 
ATOM   9309  N  N      . LEU D 2 231 ? 30.840  45.037 198.806 1.00 138.31 ? 337 LEU D N      1 
ATOM   9310  C  CA     . LEU D 2 231 ? 30.614  43.621 199.071 1.00 140.76 ? 337 LEU D CA     1 
ATOM   9311  C  C      . LEU D 2 231 ? 31.646  43.086 200.057 1.00 131.12 ? 337 LEU D C      1 
ATOM   9312  O  O      . LEU D 2 231 ? 32.750  43.620 200.161 1.00 146.80 ? 337 LEU D O      1 
ATOM   9313  C  CB     . LEU D 2 231 ? 30.664  42.817 197.771 1.00 151.05 ? 337 LEU D CB     1 
ATOM   9314  H  HA     . LEU D 2 231 ? 29.734  43.507 199.463 1.00 168.91 ? 337 LEU D HA     1 
ATOM   9315  N  N      . VAL D 2 232 ? 31.277  42.030 200.779 1.00 151.61 ? 338 VAL D N      1 
ATOM   9316  C  CA     . VAL D 2 232 ? 32.143  41.403 201.770 1.00 152.60 ? 338 VAL D CA     1 
ATOM   9317  C  C      . VAL D 2 232 ? 32.153  39.903 201.513 1.00 131.44 ? 338 VAL D C      1 
ATOM   9318  O  O      . VAL D 2 232 ? 31.090  39.283 201.391 1.00 144.52 ? 338 VAL D O      1 
ATOM   9319  C  CB     . VAL D 2 232 ? 31.676  41.700 203.208 1.00 115.32 ? 338 VAL D CB     1 
ATOM   9320  H  H      . VAL D 2 232 ? 30.509  41.651 200.710 1.00 181.93 ? 338 VAL D H      1 
ATOM   9321  H  HA     . VAL D 2 232 ? 33.048  41.738 201.667 1.00 183.12 ? 338 VAL D HA     1 
ATOM   9322  N  N      . ALA D 2 233 ? 33.348  39.323 201.432 1.00 141.27 ? 339 ALA D N      1 
ATOM   9323  C  CA     . ALA D 2 233 ? 33.493  37.907 201.134 1.00 163.33 ? 339 ALA D CA     1 
ATOM   9324  C  C      . ALA D 2 233 ? 34.536  37.294 202.055 1.00 155.90 ? 339 ALA D C      1 
ATOM   9325  O  O      . ALA D 2 233 ? 35.584  37.893 202.310 1.00 166.91 ? 339 ALA D O      1 
ATOM   9326  C  CB     . ALA D 2 233 ? 33.889  37.680 199.669 1.00 157.83 ? 339 ALA D CB     1 
ATOM   9327  H  H      . ALA D 2 233 ? 34.095  39.734 201.547 1.00 169.52 ? 339 ALA D H      1 
ATOM   9328  H  HA     . ALA D 2 233 ? 32.648  37.459 201.292 1.00 195.99 ? 339 ALA D HA     1 
ATOM   9329  H  HB1    . ALA D 2 233 ? 33.976  36.728 199.509 1.00 189.40 ? 339 ALA D HB1    1 
ATOM   9330  H  HB2    . ALA D 2 233 ? 33.201  38.051 199.095 1.00 189.40 ? 339 ALA D HB2    1 
ATOM   9331  H  HB3    . ALA D 2 233 ? 34.736  38.123 199.499 1.00 189.40 ? 339 ALA D HB3    1 
ATOM   9332  N  N      . ILE D 2 234 ? 34.236  36.097 202.553 1.00 134.04 ? 340 ILE D N      1 
ATOM   9333  C  CA     . ILE D 2 234 ? 35.165  35.318 203.360 1.00 127.38 ? 340 ILE D CA     1 
ATOM   9334  C  C      . ILE D 2 234 ? 35.858  34.304 202.456 1.00 148.53 ? 340 ILE D C      1 
ATOM   9335  O  O      . ILE D 2 234 ? 35.190  33.624 201.656 1.00 158.52 ? 340 ILE D O      1 
ATOM   9336  C  CB     . ILE D 2 234 ? 34.443  34.621 204.523 1.00 107.08 ? 340 ILE D CB     1 
ATOM   9337  H  H      . ILE D 2 234 ? 33.479  35.707 202.433 1.00 160.85 ? 340 ILE D H      1 
ATOM   9338  H  HA     . ILE D 2 234 ? 35.841  35.908 203.730 1.00 152.86 ? 340 ILE D HA     1 
ATOM   9339  N  N      . GLY D 2 235 ? 37.167  34.206 202.574 1.00 121.19 ? 341 GLY D N      1 
ATOM   9340  C  CA     . GLY D 2 235 ? 37.956  33.305 201.763 1.00 125.53 ? 341 GLY D CA     1 
ATOM   9341  C  C      . GLY D 2 235 ? 38.251  32.016 202.499 1.00 140.77 ? 341 GLY D C      1 
ATOM   9342  O  O      . GLY D 2 235 ? 38.896  32.023 203.550 1.00 141.65 ? 341 GLY D O      1 
ATOM   9343  H  H      . GLY D 2 235 ? 37.633  34.664 203.133 1.00 145.43 ? 341 GLY D H      1 
ATOM   9344  H  HA2    . GLY D 2 235 ? 37.475  33.094 200.947 1.00 150.64 ? 341 GLY D HA2    1 
ATOM   9345  H  HA3    . GLY D 2 235 ? 38.796  33.728 201.528 1.00 150.64 ? 341 GLY D HA3    1 
ATOM   9346  N  N      . ARG D 2 236 ? 37.776  30.907 201.940 1.00 167.74 ? 342 ARG D N      1 
ATOM   9347  C  CA     . ARG D 2 236 ? 37.994  29.589 202.528 1.00 159.09 ? 342 ARG D CA     1 
ATOM   9348  C  C      . ARG D 2 236 ? 39.224  28.923 201.918 1.00 158.95 ? 342 ARG D C      1 
ATOM   9349  O  O      . ARG D 2 236 ? 39.249  28.614 200.727 1.00 168.94 ? 342 ARG D O      1 
ATOM   9350  C  CB     . ARG D 2 236 ? 36.763  28.701 202.330 1.00 125.88 ? 342 ARG D CB     1 
ATOM   9351  H  H      . ARG D 2 236 ? 37.319  30.891 201.212 1.00 201.28 ? 342 ARG D H      1 
ATOM   9352  H  HA     . ARG D 2 236 ? 38.146  29.687 203.481 1.00 190.91 ? 342 ARG D HA     1 
ATOM   9353  C  "C5'"  . DG  E 3 1   ? -11.911 14.290 218.390 1.00 66.39  ? 1   DG  E "C5'"  1 
ATOM   9354  C  "C4'"  . DG  E 3 1   ? -10.780 15.065 217.742 1.00 66.41  ? 1   DG  E "C4'"  1 
ATOM   9355  O  "O4'"  . DG  E 3 1   ? -9.545  14.304 217.857 1.00 67.70  ? 1   DG  E "O4'"  1 
ATOM   9356  C  "C3'"  . DG  E 3 1   ? -10.973 15.343 216.257 1.00 66.61  ? 1   DG  E "C3'"  1 
ATOM   9357  O  "O3'"  . DG  E 3 1   ? -10.591 16.679 215.942 1.00 83.59  ? 1   DG  E "O3'"  1 
ATOM   9358  C  "C2'"  . DG  E 3 1   ? -10.090 14.304 215.574 1.00 67.20  ? 1   DG  E "C2'"  1 
ATOM   9359  C  "C1'"  . DG  E 3 1   ? -8.976  14.086 216.581 1.00 67.20  ? 1   DG  E "C1'"  1 
ATOM   9360  N  N9     . DG  E 3 1   ? -8.398  12.740 216.548 1.00 67.72  ? 1   DG  E N9     1 
ATOM   9361  C  C8     . DG  E 3 1   ? -9.054  11.550 216.754 1.00 67.98  ? 1   DG  E C8     1 
ATOM   9362  N  N7     . DG  E 3 1   ? -8.274  10.507 216.668 1.00 68.44  ? 1   DG  E N7     1 
ATOM   9363  C  C5     . DG  E 3 1   ? -7.023  11.038 216.389 1.00 68.48  ? 1   DG  E C5     1 
ATOM   9364  C  C6     . DG  E 3 1   ? -5.784  10.388 216.187 1.00 68.89  ? 1   DG  E C6     1 
ATOM   9365  O  O6     . DG  E 3 1   ? -5.542  9.175  216.215 1.00 93.69  ? 1   DG  E O6     1 
ATOM   9366  N  N1     . DG  E 3 1   ? -4.762  11.296 215.930 1.00 68.78  ? 1   DG  E N1     1 
ATOM   9367  C  C2     . DG  E 3 1   ? -4.919  12.660 215.875 1.00 68.33  ? 1   DG  E C2     1 
ATOM   9368  N  N2     . DG  E 3 1   ? -3.821  13.381 215.608 1.00 68.28  ? 1   DG  E N2     1 
ATOM   9369  N  N3     . DG  E 3 1   ? -6.077  13.280 216.059 1.00 67.94  ? 1   DG  E N3     1 
ATOM   9370  C  C4     . DG  E 3 1   ? -7.081  12.410 216.312 1.00 68.04  ? 1   DG  E C4     1 
ATOM   9371  H  "H4'"  . DG  E 3 1   ? -10.673 15.910 218.207 1.00 79.69  ? 1   DG  E "H4'"  1 
ATOM   9372  H  "H3'"  . DG  E 3 1   ? -11.901 15.199 216.013 1.00 79.93  ? 1   DG  E "H3'"  1 
ATOM   9373  H  "H2'"  . DG  E 3 1   ? -10.582 13.481 215.425 1.00 80.64  ? 1   DG  E "H2'"  1 
ATOM   9374  H  "H2''" . DG  E 3 1   ? -9.736  14.650 214.740 1.00 80.64  ? 1   DG  E "H2''" 1 
ATOM   9375  H  "H1'"  . DG  E 3 1   ? -8.275  14.739 216.428 1.00 80.64  ? 1   DG  E "H1'"  1 
ATOM   9376  H  H8     . DG  E 3 1   ? -9.964  11.493 216.936 1.00 81.58  ? 1   DG  E H8     1 
ATOM   9377  H  H1     . DG  E 3 1   ? -3.973  10.980 215.794 1.00 82.54  ? 1   DG  E H1     1 
ATOM   9378  H  H21    . DG  E 3 1   ? -3.871  14.238 215.557 1.00 81.94  ? 1   DG  E H21    1 
ATOM   9379  H  H22    . DG  E 3 1   ? -3.067  12.986 215.487 1.00 81.94  ? 1   DG  E H22    1 
ATOM   9380  P  P      . DG  E 3 2   ? -10.827 17.259 214.462 1.00 88.33  ? 2   DG  E P      1 
ATOM   9381  O  OP1    . DG  E 3 2   ? -10.983 18.725 214.568 1.00 65.86  ? 2   DG  E OP1    1 
ATOM   9382  O  OP2    . DG  E 3 2   ? -11.877 16.448 213.806 1.00 66.65  ? 2   DG  E OP2    1 
ATOM   9383  O  "O5'"  . DG  E 3 2   ? -9.437  16.988 213.733 1.00 69.37  ? 2   DG  E "O5'"  1 
ATOM   9384  C  "C5'"  . DG  E 3 2   ? -8.238  17.497 214.291 1.00 66.66  ? 2   DG  E "C5'"  1 
ATOM   9385  C  "C4'"  . DG  E 3 2   ? -7.035  16.986 213.524 1.00 102.57 ? 2   DG  E "C4'"  1 
ATOM   9386  O  "O4'"  . DG  E 3 2   ? -6.838  15.580 213.796 1.00 80.79  ? 2   DG  E "O4'"  1 
ATOM   9387  C  "C3'"  . DG  E 3 2   ? -7.167  17.086 212.002 1.00 67.41  ? 2   DG  E "C3'"  1 
ATOM   9388  O  "O3'"  . DG  E 3 2   ? -6.370  18.141 211.490 1.00 67.27  ? 2   DG  E "O3'"  1 
ATOM   9389  C  "C2'"  . DG  E 3 2   ? -6.717  15.715 211.482 1.00 68.02  ? 2   DG  E "C2'"  1 
ATOM   9390  C  "C1'"  . DG  E 3 2   ? -6.144  15.032 212.709 1.00 68.06  ? 2   DG  E "C1'"  1 
ATOM   9391  N  N9     . DG  E 3 2   ? -6.300  13.579 212.725 1.00 68.51  ? 2   DG  E N9     1 
ATOM   9392  C  C8     . DG  E 3 2   ? -7.454  12.867 212.948 1.00 68.55  ? 2   DG  E C8     1 
ATOM   9393  N  N7     . DG  E 3 2   ? -7.278  11.571 212.912 1.00 69.01  ? 2   DG  E N7     1 
ATOM   9394  C  C5     . DG  E 3 2   ? -5.921  11.418 212.656 1.00 69.28  ? 2   DG  E C5     1 
ATOM   9395  C  C6     . DG  E 3 2   ? -5.141  10.243 212.511 1.00 69.79  ? 2   DG  E C6     1 
ATOM   9396  O  O6     . DG  E 3 2   ? -5.507  9.063  212.584 1.00 70.12  ? 2   DG  E O6     1 
ATOM   9397  N  N1     . DG  E 3 2   ? -3.805  10.537 212.258 1.00 69.92  ? 2   DG  E N1     1 
ATOM   9398  C  C2     . DG  E 3 2   ? -3.286  11.805 212.157 1.00 69.59  ? 2   DG  E C2     1 
ATOM   9399  N  N2     . DG  E 3 2   ? -1.973  11.897 211.909 1.00 69.78  ? 2   DG  E N2     1 
ATOM   9400  N  N3     . DG  E 3 2   ? -4.003  12.911 212.290 1.00 69.11  ? 2   DG  E N3     1 
ATOM   9401  C  C4     . DG  E 3 2   ? -5.307  12.643 212.538 1.00 68.98  ? 2   DG  E C4     1 
ATOM   9402  H  "H5'"  . DG  E 3 2   ? -8.170  17.213 215.217 1.00 79.99  ? 2   DG  E "H5'"  1 
ATOM   9403  H  "H5''" . DG  E 3 2   ? -8.253  18.466 214.254 1.00 79.99  ? 2   DG  E "H5''" 1 
ATOM   9404  H  "H4'"  . DG  E 3 2   ? -6.247  17.477 213.807 1.00 123.08 ? 2   DG  E "H4'"  1 
ATOM   9405  H  "H3'"  . DG  E 3 2   ? -8.096  17.235 211.765 1.00 80.89  ? 2   DG  E "H3'"  1 
ATOM   9406  H  "H2'"  . DG  E 3 2   ? -7.474  15.217 211.137 1.00 81.63  ? 2   DG  E "H2'"  1 
ATOM   9407  H  "H2''" . DG  E 3 2   ? -6.035  15.818 210.800 1.00 81.63  ? 2   DG  E "H2''" 1 
ATOM   9408  H  "H1'"  . DG  E 3 2   ? -5.203  15.253 212.787 1.00 81.67  ? 2   DG  E "H1'"  1 
ATOM   9409  H  H8     . DG  E 3 2   ? -8.279  13.267 213.103 1.00 82.26  ? 2   DG  E H8     1 
ATOM   9410  H  H1     . DG  E 3 2   ? -3.264  9.876  212.157 1.00 83.90  ? 2   DG  E H1     1 
ATOM   9411  H  H21    . DG  E 3 2   ? -1.602  12.670 211.837 1.00 83.73  ? 2   DG  E H21    1 
ATOM   9412  H  H22    . DG  E 3 2   ? -1.500  11.184 211.822 1.00 83.73  ? 2   DG  E H22    1 
ATOM   9413  P  P      . DT  E 3 3   ? -6.335  18.412 209.910 1.00 83.48  ? 3   DT  E P      1 
ATOM   9414  O  OP1    . DT  E 3 3   ? -6.090  19.853 209.675 1.00 90.32  ? 3   DT  E OP1    1 
ATOM   9415  O  OP2    . DT  E 3 3   ? -7.541  17.774 209.336 1.00 86.60  ? 3   DT  E OP2    1 
ATOM   9416  O  "O5'"  . DT  E 3 3   ? -5.048  17.601 209.430 1.00 68.05  ? 3   DT  E "O5'"  1 
ATOM   9417  C  "C5'"  . DT  E 3 3   ? -3.789  17.876 210.019 1.00 67.99  ? 3   DT  E "C5'"  1 
ATOM   9418  C  "C4'"  . DT  E 3 3   ? -2.715  16.996 209.422 1.00 68.54  ? 3   DT  E "C4'"  1 
ATOM   9419  O  "O4'"  . DT  E 3 3   ? -3.020  15.610 209.705 1.00 93.69  ? 3   DT  E "O4'"  1 
ATOM   9420  C  "C3'"  . DT  E 3 3   ? -2.579  17.105 207.905 1.00 68.84  ? 3   DT  E "C3'"  1 
ATOM   9421  O  "O3'"  . DT  E 3 3   ? -1.245  17.426 207.567 1.00 68.97  ? 3   DT  E "O3'"  1 
ATOM   9422  C  "C2'"  . DT  E 3 3   ? -3.016  15.730 207.376 1.00 69.34  ? 3   DT  E "C2'"  1 
ATOM   9423  C  "C1'"  . DT  E 3 3   ? -2.787  14.821 208.561 1.00 69.42  ? 3   DT  E "C1'"  1 
ATOM   9424  N  N1     . DT  E 3 3   ? -3.687  13.639 208.651 1.00 69.68  ? 3   DT  E N1     1 
ATOM   9425  C  C2     . DT  E 3 3   ? -3.142  12.379 208.598 1.00 70.17  ? 3   DT  E C2     1 
ATOM   9426  O  O2     . DT  E 3 3   ? -1.954  12.172 208.421 1.00 70.42  ? 3   DT  E O2     1 
ATOM   9427  N  N3     . DT  E 3 3   ? -4.045  11.361 208.741 1.00 70.36  ? 3   DT  E N3     1 
ATOM   9428  C  C4     . DT  E 3 3   ? -5.404  11.471 208.948 1.00 70.11  ? 3   DT  E C4     1 
ATOM   9429  O  O4     . DT  E 3 3   ? -6.129  10.488 209.064 1.00 70.31  ? 3   DT  E O4     1 
ATOM   9430  C  C5     . DT  E 3 3   ? -5.911  12.820 209.016 1.00 69.59  ? 3   DT  E C5     1 
ATOM   9431  C  C7     . DT  E 3 3   ? -7.377  13.056 209.232 1.00 69.28  ? 3   DT  E C7     1 
ATOM   9432  C  C6     . DT  E 3 3   ? -5.038  13.830 208.872 1.00 69.40  ? 3   DT  E C6     1 
ATOM   9433  H  "H5'"  . DT  E 3 3   ? -3.841  17.713 210.974 1.00 81.59  ? 3   DT  E "H5'"  1 
ATOM   9434  H  "H5''" . DT  E 3 3   ? -3.561  18.806 209.866 1.00 81.59  ? 3   DT  E "H5''" 1 
ATOM   9435  H  "H4'"  . DT  E 3 3   ? -1.864  17.219 209.830 1.00 82.24  ? 3   DT  E "H4'"  1 
ATOM   9436  H  "H3'"  . DT  E 3 3   ? -3.178  17.791 207.571 1.00 82.60  ? 3   DT  E "H3'"  1 
ATOM   9437  H  "H2'"  . DT  E 3 3   ? -3.954  15.740 207.129 1.00 83.21  ? 3   DT  E "H2'"  1 
ATOM   9438  H  "H2''" . DT  E 3 3   ? -2.464  15.460 206.626 1.00 83.21  ? 3   DT  E "H2''" 1 
ATOM   9439  H  "H1'"  . DT  E 3 3   ? -1.864  14.522 208.562 1.00 83.30  ? 3   DT  E "H1'"  1 
ATOM   9440  H  H3     . DT  E 3 3   ? -3.729  10.562 208.702 1.00 84.43  ? 3   DT  E H3     1 
ATOM   9441  H  H71    . DT  E 3 3   ? -7.834  12.204 209.305 1.00 83.14  ? 3   DT  E H71    1 
ATOM   9442  H  H72    . DT  E 3 3   ? -7.506  13.563 210.049 1.00 83.14  ? 3   DT  E H72    1 
ATOM   9443  H  H73    . DT  E 3 3   ? -7.738  13.554 208.483 1.00 83.14  ? 3   DT  E H73    1 
ATOM   9444  H  H6     . DT  E 3 3   ? -5.359  14.702 208.917 1.00 83.28  ? 3   DT  E H6     1 
ATOM   9445  P  P      . DC  E 3 4   ? -0.898  18.037 206.127 1.00 76.61  ? 4   DC  E P      1 
ATOM   9446  O  OP1    . DC  E 3 4   ? 0.284   18.910 206.313 1.00 68.94  ? 4   DC  E OP1    1 
ATOM   9447  O  OP2    . DC  E 3 4   ? -2.152  18.583 205.556 1.00 68.90  ? 4   DC  E OP2    1 
ATOM   9448  O  "O5'"  . DC  E 3 4   ? -0.478  16.752 205.267 1.00 69.77  ? 4   DC  E "O5'"  1 
ATOM   9449  C  "C5'"  . DC  E 3 4   ? 0.619   15.957 205.684 1.00 70.08  ? 4   DC  E "C5'"  1 
ATOM   9450  C  "C4'"  . DC  E 3 4   ? 0.587   14.588 205.027 1.00 70.66  ? 4   DC  E "C4'"  1 
ATOM   9451  O  "O4'"  . DC  E 3 4   ? -0.539  13.826 205.520 1.00 70.67  ? 4   DC  E "O4'"  1 
ATOM   9452  C  "C3'"  . DC  E 3 4   ? 0.441   14.609 203.507 1.00 70.96  ? 4   DC  E "C3'"  1 
ATOM   9453  O  "O3'"  . DC  E 3 4   ? 1.635   14.142 202.905 1.00 71.39  ? 4   DC  E "O3'"  1 
ATOM   9454  C  "C2'"  . DC  E 3 4   ? -0.764  13.694 203.214 1.00 96.69  ? 4   DC  E "C2'"  1 
ATOM   9455  C  "C1'"  . DC  E 3 4   ? -0.949  12.935 204.516 1.00 71.12  ? 4   DC  E "C1'"  1 
ATOM   9456  N  N1     . DC  E 3 4   ? -2.349  12.514 204.810 1.00 71.02  ? 4   DC  E N1     1 
ATOM   9457  C  C2     . DC  E 3 4   ? -2.638  11.163 205.021 1.00 71.38  ? 4   DC  E C2     1 
ATOM   9458  O  O2     . DC  E 3 4   ? -1.728  10.332 204.934 1.00 71.79  ? 4   DC  E O2     1 
ATOM   9459  N  N3     . DC  E 3 4   ? -3.912  10.803 205.309 1.00 71.28  ? 4   DC  E N3     1 
ATOM   9460  C  C4     . DC  E 3 4   ? -4.865  11.728 205.394 1.00 70.84  ? 4   DC  E C4     1 
ATOM   9461  N  N4     . DC  E 3 4   ? -6.107  11.324 205.677 1.00 70.75  ? 4   DC  E N4     1 
ATOM   9462  C  C5     . DC  E 3 4   ? -4.588  13.109 205.188 1.00 70.46  ? 4   DC  E C5     1 
ATOM   9463  C  C6     . DC  E 3 4   ? -3.328  13.453 204.908 1.00 70.57  ? 4   DC  E C6     1 
ATOM   9464  H  "H5'"  . DC  E 3 4   ? 0.585   15.847 206.647 1.00 84.10  ? 4   DC  E "H5'"  1 
ATOM   9465  H  "H5''" . DC  E 3 4   ? 1.446   16.405 205.445 1.00 84.10  ? 4   DC  E "H5''" 1 
ATOM   9466  H  "H4'"  . DC  E 3 4   ? 1.404   14.117 205.253 1.00 84.80  ? 4   DC  E "H4'"  1 
ATOM   9467  H  "H3'"  . DC  E 3 4   ? 0.250   15.511 203.207 1.00 85.15  ? 4   DC  E "H3'"  1 
ATOM   9468  H  "H2'"  . DC  E 3 4   ? -1.552  14.222 203.011 1.00 116.03 ? 4   DC  E "H2'"  1 
ATOM   9469  H  "H2''" . DC  E 3 4   ? -0.561  13.084 202.488 1.00 116.03 ? 4   DC  E "H2''" 1 
ATOM   9470  H  "H1'"  . DC  E 3 4   ? -0.370  12.156 204.520 1.00 85.34  ? 4   DC  E "H1'"  1 
ATOM   9471  H  H41    . DC  E 3 4   ? -6.743  11.899 205.739 1.00 84.90  ? 4   DC  E H41    1 
ATOM   9472  H  H42    . DC  E 3 4   ? -6.270  10.488 205.798 1.00 84.90  ? 4   DC  E H42    1 
ATOM   9473  H  H5     . DC  E 3 4   ? -5.259  13.750 205.252 1.00 84.56  ? 4   DC  E H5     1 
ATOM   9474  H  H6     . DC  E 3 4   ? -3.119  14.348 204.769 1.00 84.68  ? 4   DC  E H6     1 
ATOM   9475  P  P      . DA  E 3 5   ? 1.841   14.256 201.321 1.00 109.83 ? 5   DA  E P      1 
ATOM   9476  O  OP1    . DA  E 3 5   ? 3.247   14.664 201.091 1.00 72.29  ? 5   DA  E OP1    1 
ATOM   9477  O  OP2    . DA  E 3 5   ? 0.724   15.073 200.793 1.00 103.70 ? 5   DA  E OP2    1 
ATOM   9478  O  "O5'"  . DA  E 3 5   ? 1.616   12.759 200.803 1.00 80.14  ? 5   DA  E "O5'"  1 
ATOM   9479  C  "C5'"  . DA  E 3 5   ? 2.217   11.678 201.497 1.00 78.33  ? 5   DA  E "C5'"  1 
ATOM   9480  C  "C4'"  . DA  E 3 5   ? 1.475   10.386 201.230 1.00 72.95  ? 5   DA  E "C4'"  1 
ATOM   9481  O  "O4'"  . DA  E 3 5   ? 0.155   10.453 201.828 1.00 105.70 ? 5   DA  E "O4'"  1 
ATOM   9482  C  "C3'"  . DA  E 3 5   ? 1.255   10.065 199.750 1.00 73.34  ? 5   DA  E "C3'"  1 
ATOM   9483  O  "O3'"  . DA  E 3 5   ? 1.855   8.820  199.424 1.00 106.41 ? 5   DA  E "O3'"  1 
ATOM   9484  C  "C2'"  . DA  E 3 5   ? -0.267  10.037 199.592 1.00 73.19  ? 5   DA  E "C2'"  1 
ATOM   9485  C  "C1'"  . DA  E 3 5   ? -0.750  9.775  200.999 1.00 72.92  ? 5   DA  E "C1'"  1 
ATOM   9486  N  N9     . DA  E 3 5   ? -2.097  10.263 201.259 1.00 72.53  ? 5   DA  E N9     1 
ATOM   9487  C  C8     . DA  E 3 5   ? -2.541  11.551 201.151 1.00 72.08  ? 5   DA  E C8     1 
ATOM   9488  N  N7     . DA  E 3 5   ? -3.812  11.699 201.444 1.00 74.50  ? 5   DA  E N7     1 
ATOM   9489  C  C5     . DA  E 3 5   ? -4.231  10.417 201.766 1.00 76.17  ? 5   DA  E C5     1 
ATOM   9490  C  C6     . DA  E 3 5   ? -5.479  9.898  202.169 1.00 72.04  ? 5   DA  E C6     1 
ATOM   9491  N  N6     . DA  E 3 5   ? -6.576  10.648 202.317 1.00 71.62  ? 5   DA  E N6     1 
ATOM   9492  N  N1     . DA  E 3 5   ? -5.556  8.573  202.414 1.00 72.41  ? 5   DA  E N1     1 
ATOM   9493  C  C2     . DA  E 3 5   ? -4.456  7.824  202.264 1.00 72.82  ? 5   DA  E C2     1 
ATOM   9494  N  N3     . DA  E 3 5   ? -3.230  8.198  201.892 1.00 72.93  ? 5   DA  E N3     1 
ATOM   9495  C  C4     . DA  E 3 5   ? -3.186  9.520  201.658 1.00 72.56  ? 5   DA  E C4     1 
ATOM   9496  H  "H5'"  . DA  E 3 5   ? 2.202   11.862 202.450 1.00 93.99  ? 5   DA  E "H5'"  1 
ATOM   9497  H  "H5''" . DA  E 3 5   ? 3.137   11.583 201.205 1.00 93.99  ? 5   DA  E "H5''" 1 
ATOM   9498  H  "H4'"  . DA  E 3 5   ? 1.966   9.655  201.638 1.00 87.54  ? 5   DA  E "H4'"  1 
ATOM   9499  H  "H3'"  . DA  E 3 5   ? 1.632   10.769 199.199 1.00 88.01  ? 5   DA  E "H3'"  1 
ATOM   9500  H  "H2'"  . DA  E 3 5   ? -0.594  10.892 199.271 1.00 87.83  ? 5   DA  E "H2'"  1 
ATOM   9501  H  "H2''" . DA  E 3 5   ? -0.537  9.319  198.997 1.00 87.83  ? 5   DA  E "H2''" 1 
ATOM   9502  H  "H1'"  . DA  E 3 5   ? -0.708  8.823  201.184 1.00 87.50  ? 5   DA  E "H1'"  1 
ATOM   9503  H  H8     . DA  E 3 5   ? -1.992  12.258 200.896 1.00 86.50  ? 5   DA  E H8     1 
ATOM   9504  H  H61    . DA  E 3 5   ? -7.315  10.284 202.565 1.00 85.95  ? 5   DA  E H61    1 
ATOM   9505  H  H62    . DA  E 3 5   ? -6.542  11.493 202.163 1.00 85.95  ? 5   DA  E H62    1 
ATOM   9506  H  H2     . DA  E 3 5   ? -4.562  6.918  202.440 1.00 87.39  ? 5   DA  E H2     1 
ATOM   9507  P  P      . DC  E 3 6   ? 2.434   8.553  197.951 1.00 120.67 ? 6   DC  E P      1 
ATOM   9508  O  OP1    . DC  E 3 6   ? 3.887   8.298  198.084 1.00 86.49  ? 6   DC  E OP1    1 
ATOM   9509  O  OP2    . DC  E 3 6   ? 1.961   9.649  197.075 1.00 87.99  ? 6   DC  E OP2    1 
ATOM   9510  O  "O5'"  . DC  E 3 6   ? 1.690   7.211  197.495 1.00 86.20  ? 6   DC  E "O5'"  1 
ATOM   9511  C  "C5'"  . DC  E 3 6   ? 0.347   7.273  197.039 1.00 83.60  ? 6   DC  E "C5'"  1 
ATOM   9512  C  "C4'"  . DC  E 3 6   ? -0.501  6.178  197.656 1.00 81.03  ? 6   DC  E "C4'"  1 
ATOM   9513  O  "O4'"  . DC  E 3 6   ? -1.388  6.764  198.624 1.00 74.93  ? 6   DC  E "O4'"  1 
ATOM   9514  C  "C3'"  . DC  E 3 6   ? -1.391  5.442  196.671 1.00 131.27 ? 6   DC  E "C3'"  1 
ATOM   9515  O  "O3'"  . DC  E 3 6   ? -0.746  4.254  196.239 1.00 112.13 ? 6   DC  E "O3'"  1 
ATOM   9516  C  "C2'"  . DC  E 3 6   ? -2.681  5.154  197.448 1.00 102.08 ? 6   DC  E "C2'"  1 
ATOM   9517  C  "C1'"  . DC  E 3 6   ? -2.624  6.078  198.654 1.00 74.89  ? 6   DC  E "C1'"  1 
ATOM   9518  N  N1     . DC  E 3 6   ? -3.700  7.115  198.726 1.00 73.93  ? 6   DC  E N1     1 
ATOM   9519  C  C2     . DC  E 3 6   ? -5.026  6.763  199.045 1.00 73.90  ? 6   DC  E C2     1 
ATOM   9520  O  O2     . DC  E 3 6   ? -5.326  5.575  199.212 1.00 75.54  ? 6   DC  E O2     1 
ATOM   9521  N  N3     . DC  E 3 6   ? -5.954  7.751  199.144 1.00 73.31  ? 6   DC  E N3     1 
ATOM   9522  C  C4     . DC  E 3 6   ? -5.602  9.022  198.961 1.00 72.98  ? 6   DC  E C4     1 
ATOM   9523  N  N4     . DC  E 3 6   ? -6.548  9.958  199.067 1.00 80.17  ? 6   DC  E N4     1 
ATOM   9524  C  C5     . DC  E 3 6   ? -4.264  9.395  198.654 1.00 93.03  ? 6   DC  E C5     1 
ATOM   9525  C  C6     . DC  E 3 6   ? -3.356  8.423  198.559 1.00 84.83  ? 6   DC  E C6     1 
ATOM   9526  H  "H5'"  . DC  E 3 6   ? 0.335   7.176  196.074 1.00 100.32 ? 6   DC  E "H5'"  1 
ATOM   9527  H  "H5''" . DC  E 3 6   ? -0.028  8.135  197.275 1.00 100.32 ? 6   DC  E "H5''" 1 
ATOM   9528  H  "H4'"  . DC  E 3 6   ? 0.078   5.540  198.100 1.00 97.23  ? 6   DC  E "H4'"  1 
ATOM   9529  H  "H3'"  . DC  E 3 6   ? -1.583  6.011  195.909 1.00 157.53 ? 6   DC  E "H3'"  1 
ATOM   9530  H  "H2'"  . DC  E 3 6   ? -3.457  5.359  196.903 1.00 122.50 ? 6   DC  E "H2'"  1 
ATOM   9531  H  "H2''" . DC  E 3 6   ? -2.703  4.227  197.734 1.00 122.50 ? 6   DC  E "H2''" 1 
ATOM   9532  H  "H1'"  . DC  E 3 6   ? -2.660  5.539  199.460 1.00 89.86  ? 6   DC  E "H1'"  1 
ATOM   9533  H  H41    . DC  E 3 6   ? -6.348  10.787 198.954 1.00 96.20  ? 6   DC  E H41    1 
ATOM   9534  H  H42    . DC  E 3 6   ? -7.358  9.732  199.248 1.00 96.20  ? 6   DC  E H42    1 
ATOM   9535  H  H5     . DC  E 3 6   ? -4.029  10.286 198.533 1.00 111.63 ? 6   DC  E H5     1 
ATOM   9536  H  H6     . DC  E 3 6   ? -2.473  8.641  198.365 1.00 101.79 ? 6   DC  E H6     1 
ATOM   9537  P  P      . DG  E 3 7   ? -0.506  3.982  194.677 1.00 97.24  ? 7   DG  E P      1 
ATOM   9538  O  OP1    . DG  E 3 7   ? 0.641   3.050  194.560 1.00 109.23 ? 7   DG  E OP1    1 
ATOM   9539  O  OP2    . DG  E 3 7   ? -0.467  5.291  193.982 1.00 90.14  ? 7   DG  E OP2    1 
ATOM   9540  O  "O5'"  . DG  E 3 7   ? -1.840  3.231  194.230 1.00 107.06 ? 7   DG  E "O5'"  1 
ATOM   9541  C  "C5'"  . DG  E 3 7   ? -2.346  2.173  195.023 1.00 96.03  ? 7   DG  E "C5'"  1 
ATOM   9542  C  "C4'"  . DG  E 3 7   ? -3.852  2.260  195.135 1.00 92.03  ? 7   DG  E "C4'"  1 
ATOM   9543  O  "O4'"  . DG  E 3 7   ? -4.220  3.533  195.692 1.00 86.50  ? 7   DG  E "O4'"  1 
ATOM   9544  C  "C3'"  . DG  E 3 7   ? -4.594  2.173  193.806 1.00 132.16 ? 7   DG  E "C3'"  1 
ATOM   9545  O  "O3'"  . DG  E 3 7   ? -5.137  0.880  193.626 1.00 127.42 ? 7   DG  E "O3'"  1 
ATOM   9546  C  "C2'"  . DG  E 3 7   ? -5.683  3.255  193.894 1.00 122.51 ? 7   DG  E "C2'"  1 
ATOM   9547  C  "C1'"  . DG  E 3 7   ? -5.533  3.819  195.301 1.00 87.09  ? 7   DG  E "C1'"  1 
ATOM   9548  N  N9     . DG  E 3 7   ? -5.750  5.258  195.389 1.00 80.47  ? 7   DG  E N9     1 
ATOM   9549  C  C8     . DG  E 3 7   ? -4.843  6.257  195.127 1.00 87.66  ? 7   DG  E C8     1 
ATOM   9550  N  N7     . DG  E 3 7   ? -5.324  7.454  195.302 1.00 76.50  ? 7   DG  E N7     1 
ATOM   9551  C  C5     . DG  E 3 7   ? -6.639  7.234  195.688 1.00 77.97  ? 7   DG  E C5     1 
ATOM   9552  C  C6     . DG  E 3 7   ? -7.658  8.157  196.006 1.00 84.28  ? 7   DG  E C6     1 
ATOM   9553  O  O6     . DG  E 3 7   ? -7.599  9.393  196.008 1.00 76.81  ? 7   DG  E O6     1 
ATOM   9554  N  N1     . DG  E 3 7   ? -8.848  7.514  196.347 1.00 79.21  ? 7   DG  E N1     1 
ATOM   9555  C  C2     . DG  E 3 7   ? -9.025  6.148  196.376 1.00 74.27  ? 7   DG  E C2     1 
ATOM   9556  N  N2     . DG  E 3 7   ? -10.242 5.706  196.729 1.00 74.00  ? 7   DG  E N2     1 
ATOM   9557  N  N3     . DG  E 3 7   ? -8.075  5.274  196.078 1.00 74.70  ? 7   DG  E N3     1 
ATOM   9558  C  C4     . DG  E 3 7   ? -6.914  5.887  195.746 1.00 75.43  ? 7   DG  E C4     1 
ATOM   9559  H  "H5'"  . DG  E 3 7   ? -1.957  2.225  195.910 1.00 115.23 ? 7   DG  E "H5'"  1 
ATOM   9560  H  "H5''" . DG  E 3 7   ? -2.105  1.326  194.618 1.00 115.23 ? 7   DG  E "H5''" 1 
ATOM   9561  H  "H4'"  . DG  E 3 7   ? -4.167  1.554  195.721 1.00 110.44 ? 7   DG  E "H4'"  1 
ATOM   9562  H  "H3'"  . DG  E 3 7   ? -3.987  2.378  193.078 1.00 158.59 ? 7   DG  E "H3'"  1 
ATOM   9563  H  "H2'"  . DG  E 3 7   ? -5.528  3.947  193.232 1.00 147.02 ? 7   DG  E "H2'"  1 
ATOM   9564  H  "H2''" . DG  E 3 7   ? -6.562  2.862  193.777 1.00 147.02 ? 7   DG  E "H2''" 1 
ATOM   9565  H  "H1'"  . DG  E 3 7   ? -6.150  3.365  195.895 1.00 104.50 ? 7   DG  E "H1'"  1 
ATOM   9566  H  H8     . DG  E 3 7   ? -3.963  6.093  194.875 1.00 105.20 ? 7   DG  E H8     1 
ATOM   9567  H  H1     . DG  E 3 7   ? -9.522  8.007  196.553 1.00 95.05  ? 7   DG  E H1     1 
ATOM   9568  H  H21    . DG  E 3 7   ? -10.401 4.861  196.760 1.00 88.80  ? 7   DG  E H21    1 
ATOM   9569  H  H22    . DG  E 3 7   ? -10.864 6.268  196.925 1.00 88.80  ? 7   DG  E H22    1 
ATOM   9570  P  P      . DC  E 3 8   ? -5.755  0.461  192.206 1.00 134.92 ? 8   DC  E P      1 
ATOM   9571  O  OP1    . DC  E 3 8   ? -5.966  -1.003 192.247 1.00 134.61 ? 8   DC  E OP1    1 
ATOM   9572  O  OP2    . DC  E 3 8   ? -4.908  1.062  191.151 1.00 128.77 ? 8   DC  E OP2    1 
ATOM   9573  O  "O5'"  . DC  E 3 8   ? -7.180  1.192  192.176 1.00 111.84 ? 8   DC  E "O5'"  1 
ATOM   9574  C  "C5'"  . DC  E 3 8   ? -8.351  0.477  192.559 1.00 115.27 ? 8   DC  E "C5'"  1 
ATOM   9575  C  "C4'"  . DC  E 3 8   ? -9.481  1.422  192.923 1.00 104.84 ? 8   DC  E "C4'"  1 
ATOM   9576  O  "O4'"  . DC  E 3 8   ? -8.947  2.686  193.346 1.00 98.19  ? 8   DC  E "O4'"  1 
ATOM   9577  C  "C3'"  . DC  E 3 8   ? -10.419 1.776  191.776 1.00 130.87 ? 8   DC  E "C3'"  1 
ATOM   9578  O  "O3'"  . DC  E 3 8   ? -11.518 0.879  191.727 1.00 135.32 ? 8   DC  E "O3'"  1 
ATOM   9579  C  "C2'"  . DC  E 3 8   ? -10.858 3.215  192.076 1.00 120.57 ? 8   DC  E "C2'"  1 
ATOM   9580  C  "C1'"  . DC  E 3 8   ? -9.971  3.650  193.232 1.00 96.85  ? 8   DC  E "C1'"  1 
ATOM   9581  N  N1     . DC  E 3 8   ? -9.350  4.990  193.058 1.00 84.67  ? 8   DC  E N1     1 
ATOM   9582  C  C2     . DC  E 3 8   ? -10.108 6.138  193.296 1.00 82.61  ? 8   DC  E C2     1 
ATOM   9583  O  O2     . DC  E 3 8   ? -11.294 6.014  193.629 1.00 75.13  ? 8   DC  E O2     1 
ATOM   9584  N  N3     . DC  E 3 8   ? -9.520  7.354  193.151 1.00 83.31  ? 8   DC  E N3     1 
ATOM   9585  C  C4     . DC  E 3 8   ? -8.236  7.436  192.791 1.00 89.33  ? 8   DC  E C4     1 
ATOM   9586  N  N4     . DC  E 3 8   ? -7.695  8.652  192.659 1.00 83.31  ? 8   DC  E N4     1 
ATOM   9587  C  C5     . DC  E 3 8   ? -7.449  6.272  192.549 1.00 96.90  ? 8   DC  E C5     1 
ATOM   9588  C  C6     . DC  E 3 8   ? -8.040  5.083  192.695 1.00 93.71  ? 8   DC  E C6     1 
ATOM   9589  H  "H5'"  . DC  E 3 8   ? -8.145  -0.081 193.325 1.00 138.32 ? 8   DC  E "H5'"  1 
ATOM   9590  H  "H5''" . DC  E 3 8   ? -8.634  -0.087 191.822 1.00 138.32 ? 8   DC  E "H5''" 1 
ATOM   9591  H  "H4'"  . DC  E 3 8   ? -9.997  1.036  193.649 1.00 125.80 ? 8   DC  E "H4'"  1 
ATOM   9592  H  "H3'"  . DC  E 3 8   ? -9.934  1.748  190.936 1.00 157.04 ? 8   DC  E "H3'"  1 
ATOM   9593  H  "H2'"  . DC  E 3 8   ? -10.709 3.782  191.303 1.00 144.68 ? 8   DC  E "H2'"  1 
ATOM   9594  H  "H2''" . DC  E 3 8   ? -11.791 3.236  192.339 1.00 144.68 ? 8   DC  E "H2''" 1 
ATOM   9595  H  "H1'"  . DC  E 3 8   ? -10.495 3.650  194.048 1.00 116.22 ? 8   DC  E "H1'"  1 
ATOM   9596  H  H41    . DC  E 3 8   ? -6.871  8.734  192.428 1.00 99.97  ? 8   DC  E H41    1 
ATOM   9597  H  H42    . DC  E 3 8   ? -8.172  9.353  192.805 1.00 99.97  ? 8   DC  E H42    1 
ATOM   9598  H  H5     . DC  E 3 8   ? -6.555  6.339  192.300 1.00 116.27 ? 8   DC  E H5     1 
ATOM   9599  H  H6     . DC  E 3 8   ? -7.551  4.307  192.542 1.00 112.45 ? 8   DC  E H6     1 
ATOM   9600  P  P      . DA  E 3 9   ? -12.133 0.449  190.308 1.00 152.90 ? 9   DA  E P      1 
ATOM   9601  O  OP1    . DA  E 3 9   ? -12.837 -0.840 190.504 1.00 138.44 ? 9   DA  E OP1    1 
ATOM   9602  O  OP2    . DA  E 3 9   ? -11.049 0.557  189.306 1.00 134.01 ? 9   DA  E OP2    1 
ATOM   9603  O  "O5'"  . DA  E 3 9   ? -13.208 1.592  189.990 1.00 111.20 ? 9   DA  E "O5'"  1 
ATOM   9604  C  "C5'"  . DA  E 3 9   ? -14.499 1.537  190.584 1.00 112.17 ? 9   DA  E "C5'"  1 
ATOM   9605  C  "C4'"  . DA  E 3 9   ? -15.130 2.917  190.650 1.00 109.17 ? 9   DA  E "C4'"  1 
ATOM   9606  O  "O4'"  . DA  E 3 9   ? -14.102 3.901  190.949 1.00 108.72 ? 9   DA  E "O4'"  1 
ATOM   9607  C  "C3'"  . DA  E 3 9   ? -15.805 3.386  189.356 1.00 118.96 ? 9   DA  E "C3'"  1 
ATOM   9608  O  "O3'"  . DA  E 3 9   ? -17.091 3.933  189.630 1.00 127.53 ? 9   DA  E "O3'"  1 
ATOM   9609  C  "C2'"  . DA  E 3 9   ? -14.841 4.429  188.801 1.00 137.32 ? 9   DA  E "C2'"  1 
ATOM   9610  C  "C1'"  . DA  E 3 9   ? -14.209 4.989  190.059 1.00 107.80 ? 9   DA  E "C1'"  1 
ATOM   9611  N  N9     . DA  E 3 9   ? -12.883 5.559  189.852 1.00 107.88 ? 9   DA  E N9     1 
ATOM   9612  C  C8     . DA  E 3 9   ? -11.766 4.905  189.417 1.00 110.95 ? 9   DA  E C8     1 
ATOM   9613  N  N7     . DA  E 3 9   ? -10.701 5.668  189.337 1.00 100.04 ? 9   DA  E N7     1 
ATOM   9614  C  C5     . DA  E 3 9   ? -11.159 6.915  189.726 1.00 99.57  ? 9   DA  E C5     1 
ATOM   9615  C  C6     . DA  E 3 9   ? -10.523 8.163  189.844 1.00 95.10  ? 9   DA  E C6     1 
ATOM   9616  N  N6     . DA  E 3 9   ? -9.230  8.359  189.570 1.00 94.31  ? 9   DA  E N6     1 
ATOM   9617  N  N1     . DA  E 3 9   ? -11.269 9.206  190.263 1.00 95.77  ? 9   DA  E N1     1 
ATOM   9618  C  C2     . DA  E 3 9   ? -12.564 9.007  190.539 1.00 87.63  ? 9   DA  E C2     1 
ATOM   9619  N  N3     . DA  E 3 9   ? -13.272 7.883  190.464 1.00 85.03  ? 9   DA  E N3     1 
ATOM   9620  C  C4     . DA  E 3 9   ? -12.503 6.865  190.048 1.00 99.47  ? 9   DA  E C4     1 
ATOM   9621  H  "H5'"  . DA  E 3 9   ? -14.421 1.179  191.483 1.00 134.60 ? 9   DA  E "H5'"  1 
ATOM   9622  H  "H5''" . DA  E 3 9   ? -15.067 0.952  190.058 1.00 134.60 ? 9   DA  E "H5''" 1 
ATOM   9623  H  "H4'"  . DA  E 3 9   ? -15.786 2.925  191.364 1.00 131.00 ? 9   DA  E "H4'"  1 
ATOM   9624  H  "H3'"  . DA  E 3 9   ? -15.884 2.644  188.736 1.00 142.75 ? 9   DA  E "H3'"  1 
ATOM   9625  H  "H2'"  . DA  E 3 9   ? -14.172 4.013  188.234 1.00 164.78 ? 9   DA  E "H2'"  1 
ATOM   9626  H  "H2''" . DA  E 3 9   ? -15.322 5.121  188.320 1.00 164.78 ? 9   DA  E "H2''" 1 
ATOM   9627  H  "H1'"  . DA  E 3 9   ? -14.793 5.662  190.441 1.00 129.35 ? 9   DA  E "H1'"  1 
ATOM   9628  H  H8     . DA  E 3 9   ? -11.754 3.995  189.223 1.00 133.14 ? 9   DA  E H8     1 
ATOM   9629  H  H61    . DA  E 3 9   ? -8.885  9.141  189.661 1.00 113.17 ? 9   DA  E H61    1 
ATOM   9630  H  H62    . DA  E 3 9   ? -8.743  7.703  189.302 1.00 113.17 ? 9   DA  E H62    1 
ATOM   9631  H  H2     . DA  E 3 9   ? -13.033 9.758  190.822 1.00 105.16 ? 9   DA  E H2     1 
ATOM   9632  P  P      . DA  E 3 10  ? -18.225 3.951  188.493 1.00 140.98 ? 10  DA  E P      1 
ATOM   9633  O  OP1    . DA  E 3 10  ? -19.301 4.867  188.937 1.00 122.61 ? 10  DA  E OP1    1 
ATOM   9634  O  OP2    . DA  E 3 10  ? -18.545 2.542  188.176 1.00 114.22 ? 10  DA  E OP2    1 
ATOM   9635  O  "O5'"  . DA  E 3 10  ? -17.483 4.583  187.221 1.00 148.33 ? 10  DA  E "O5'"  1 
ATOM   9636  C  "C5'"  . DA  E 3 10  ? -18.126 5.596  186.438 1.00 146.16 ? 10  DA  E "C5'"  1 
ATOM   9637  C  "C4'"  . DA  E 3 10  ? -17.898 6.973  187.036 1.00 120.35 ? 10  DA  E "C4'"  1 
ATOM   9638  O  "O4'"  . DA  E 3 10  ? -16.566 7.036  187.571 1.00 112.46 ? 10  DA  E "O4'"  1 
ATOM   9639  C  "C3'"  . DA  E 3 10  ? -17.984 8.129  186.050 1.00 131.69 ? 10  DA  E "C3'"  1 
ATOM   9640  O  "O3'"  . DA  E 3 10  ? -19.320 8.636  185.991 1.00 124.05 ? 10  DA  E "O3'"  1 
ATOM   9641  C  "C2'"  . DA  E 3 10  ? -16.989 9.162  186.601 1.00 134.64 ? 10  DA  E "C2'"  1 
ATOM   9642  C  "C1'"  . DA  E 3 10  ? -16.114 8.372  187.576 1.00 108.38 ? 10  DA  E "C1'"  1 
ATOM   9643  N  N9     . DA  E 3 10  ? -14.682 8.358  187.268 1.00 99.10  ? 10  DA  E N9     1 
ATOM   9644  C  C8     . DA  E 3 10  ? -13.938 7.269  186.907 1.00 98.31  ? 10  DA  E C8     1 
ATOM   9645  N  N7     . DA  E 3 10  ? -12.666 7.528  186.729 1.00 98.92  ? 10  DA  E N7     1 
ATOM   9646  C  C5     . DA  E 3 10  ? -12.559 8.881  187.005 1.00 111.05 ? 10  DA  E C5     1 
ATOM   9647  C  C6     . DA  E 3 10  ? -11.461 9.769  186.997 1.00 119.87 ? 10  DA  E C6     1 
ATOM   9648  N  N6     . DA  E 3 10  ? -10.213 9.396  186.685 1.00 116.22 ? 10  DA  E N6     1 
ATOM   9649  N  N1     . DA  E 3 10  ? -11.696 11.060 187.321 1.00 107.52 ? 10  DA  E N1     1 
ATOM   9650  C  C2     . DA  E 3 10  ? -12.946 11.429 187.631 1.00 104.67 ? 10  DA  E C2     1 
ATOM   9651  N  N3     . DA  E 3 10  ? -14.057 10.686 187.674 1.00 104.70 ? 10  DA  E N3     1 
ATOM   9652  C  C4     . DA  E 3 10  ? -13.792 9.410  187.348 1.00 110.59 ? 10  DA  E C4     1 
ATOM   9653  H  "H5'"  . DA  E 3 10  ? -19.079 5.416  186.406 1.00 175.40 ? 10  DA  E "H5'"  1 
ATOM   9654  H  "H5''" . DA  E 3 10  ? -17.768 5.577  185.537 1.00 175.40 ? 10  DA  E "H5''" 1 
ATOM   9655  H  "H4'"  . DA  E 3 10  ? -18.536 7.118  187.753 1.00 144.43 ? 10  DA  E "H4'"  1 
ATOM   9656  H  "H3'"  . DA  E 3 10  ? -17.702 7.834  185.170 1.00 158.03 ? 10  DA  E "H3'"  1 
ATOM   9657  H  "H2'"  . DA  E 3 10  ? -16.450 9.528  185.883 1.00 161.56 ? 10  DA  E "H2'"  1 
ATOM   9658  H  "H2''" . DA  E 3 10  ? -17.460 9.870  187.067 1.00 161.56 ? 10  DA  E "H2''" 1 
ATOM   9659  H  "H1'"  . DA  E 3 10  ? -16.236 8.738  188.466 1.00 130.05 ? 10  DA  E "H1'"  1 
ATOM   9660  H  H8     . DA  E 3 10  ? -14.304 6.421  186.792 1.00 117.98 ? 10  DA  E H8     1 
ATOM   9661  H  H61    . DA  E 3 10  ? -9.577  9.974  186.693 1.00 139.47 ? 10  DA  E H61    1 
ATOM   9662  H  H62    . DA  E 3 10  ? -10.049 8.577  186.477 1.00 139.47 ? 10  DA  E H62    1 
ATOM   9663  H  H2     . DA  E 3 10  ? -13.056 12.327 187.847 1.00 125.60 ? 10  DA  E H2     1 
ATOM   9664  P  P      . DC  E 3 11  ? -20.134 8.620  184.605 1.00 130.99 ? 11  DC  E P      1 
ATOM   9665  O  OP1    . DC  E 3 11  ? -21.553 8.918  184.905 1.00 114.22 ? 11  DC  E OP1    1 
ATOM   9666  O  OP2    . DC  E 3 11  ? -19.781 7.373  183.890 1.00 153.15 ? 11  DC  E OP2    1 
ATOM   9667  O  "O5'"  . DC  E 3 11  ? -19.520 9.848  183.788 1.00 134.40 ? 11  DC  E "O5'"  1 
ATOM   9668  C  "C5'"  . DC  E 3 11  ? -19.843 11.176 184.167 1.00 122.02 ? 11  DC  E "C5'"  1 
ATOM   9669  C  "C4'"  . DC  E 3 11  ? -18.600 12.042 184.245 1.00 115.18 ? 11  DC  E "C4'"  1 
ATOM   9670  O  "O4'"  . DC  E 3 11  ? -17.463 11.241 184.611 1.00 105.94 ? 11  DC  E "O4'"  1 
ATOM   9671  C  "C3'"  . DC  E 3 11  ? -18.189 12.689 182.936 1.00 139.25 ? 11  DC  E "C3'"  1 
ATOM   9672  O  "O3'"  . DC  E 3 11  ? -18.859 13.927 182.760 1.00 152.78 ? 11  DC  E "O3'"  1 
ATOM   9673  C  "C2'"  . DC  E 3 11  ? -16.669 12.856 183.073 1.00 118.79 ? 11  DC  E "C2'"  1 
ATOM   9674  C  "C1'"  . DC  E 3 11  ? -16.289 11.926 184.225 1.00 107.16 ? 11  DC  E "C1'"  1 
ATOM   9675  N  N1     . DC  E 3 11  ? -15.233 10.918 183.886 1.00 108.05 ? 11  DC  E N1     1 
ATOM   9676  C  C2     . DC  E 3 11  ? -13.887 11.296 183.906 1.00 112.34 ? 11  DC  E C2     1 
ATOM   9677  O  O2     . DC  E 3 11  ? -13.594 12.464 184.180 1.00 114.01 ? 11  DC  E O2     1 
ATOM   9678  N  N3     . DC  E 3 11  ? -12.939 10.371 183.614 1.00 113.02 ? 11  DC  E N3     1 
ATOM   9679  C  C4     . DC  E 3 11  ? -13.295 9.120  183.322 1.00 122.59 ? 11  DC  E C4     1 
ATOM   9680  N  N4     . DC  E 3 11  ? -12.326 8.243  183.043 1.00 130.15 ? 11  DC  E N4     1 
ATOM   9681  C  C5     . DC  E 3 11  ? -14.662 8.713  183.304 1.00 125.49 ? 11  DC  E C5     1 
ATOM   9682  C  C6     . DC  E 3 11  ? -15.588 9.636  183.583 1.00 118.64 ? 11  DC  E C6     1 
ATOM   9683  H  "H5'"  . DC  E 3 11  ? -20.275 11.162 185.036 1.00 146.43 ? 11  DC  E "H5'"  1 
ATOM   9684  H  "H5''" . DC  E 3 11  ? -20.453 11.553 183.515 1.00 146.43 ? 11  DC  E "H5''" 1 
ATOM   9685  H  "H4'"  . DC  E 3 11  ? -18.733 12.732 184.913 1.00 138.22 ? 11  DC  E "H4'"  1 
ATOM   9686  H  "H3'"  . DC  E 3 11  ? -18.391 12.094 182.197 1.00 167.09 ? 11  DC  E "H3'"  1 
ATOM   9687  H  "H2'"  . DC  E 3 11  ? -16.224 12.583 182.256 1.00 142.54 ? 11  DC  E "H2'"  1 
ATOM   9688  H  "H2''" . DC  E 3 11  ? -16.448 13.775 183.291 1.00 142.54 ? 11  DC  E "H2''" 1 
ATOM   9689  H  "H1'"  . DC  E 3 11  ? -15.980 12.463 184.972 1.00 128.60 ? 11  DC  E "H1'"  1 
ATOM   9690  H  H41    . DC  E 3 11  ? -12.525 7.429  182.850 1.00 156.18 ? 11  DC  E H41    1 
ATOM   9691  H  H42    . DC  E 3 11  ? -11.503 8.493  183.055 1.00 156.18 ? 11  DC  E H42    1 
ATOM   9692  H  H5     . DC  E 3 11  ? -14.901 7.838  183.099 1.00 150.59 ? 11  DC  E H5     1 
ATOM   9693  H  H6     . DC  E 3 11  ? -16.486 9.397  183.587 1.00 142.36 ? 11  DC  E H6     1 
ATOM   9694  P  P      . DC  E 3 12  ? -19.490 14.290 181.331 1.00 119.50 ? 12  DC  E P      1 
ATOM   9695  O  OP1    . DC  E 3 12  ? -19.901 15.712 181.365 1.00 130.52 ? 12  DC  E OP1    1 
ATOM   9696  O  OP2    . DC  E 3 12  ? -20.484 13.241 181.008 1.00 120.02 ? 12  DC  E OP2    1 
ATOM   9697  O  "O5'"  . DC  E 3 12  ? -18.256 14.124 180.330 1.00 123.33 ? 12  DC  E "O5'"  1 
ATOM   9698  C  "C5'"  . DC  E 3 12  ? -17.882 15.195 179.473 1.00 148.78 ? 12  DC  E "C5'"  1 
ATOM   9699  C  "C4'"  . DC  E 3 12  ? -17.064 16.238 180.216 1.00 134.12 ? 12  DC  E "C4'"  1 
ATOM   9700  O  "O4'"  . DC  E 3 12  ? -16.032 15.586 180.996 1.00 125.85 ? 12  DC  E "O4'"  1 
ATOM   9701  C  "C3'"  . DC  E 3 12  ? -16.316 17.208 179.322 1.00 154.27 ? 12  DC  E "C3'"  1 
ATOM   9702  O  "O3'"  . DC  E 3 12  ? -16.089 18.450 179.994 1.00 128.68 ? 12  DC  E "O3'"  1 
ATOM   9703  C  "C2'"  . DC  E 3 12  ? -15.023 16.450 179.031 1.00 147.82 ? 12  DC  E "C2'"  1 
ATOM   9704  C  "C1'"  . DC  E 3 12  ? -14.777 15.691 180.333 1.00 128.01 ? 12  DC  E "C1'"  1 
ATOM   9705  N  N1     . DC  E 3 12  ? -14.240 14.312 180.155 1.00 125.62 ? 12  DC  E N1     1 
ATOM   9706  C  C2     . DC  E 3 12  ? -12.854 14.085 180.153 1.00 129.53 ? 12  DC  E C2     1 
ATOM   9707  O  O2     . DC  E 3 12  ? -12.079 15.045 180.272 1.00 139.71 ? 12  DC  E O2     1 
ATOM   9708  N  N3     . DC  E 3 12  ? -12.402 12.813 180.012 1.00 123.14 ? 12  DC  E N3     1 
ATOM   9709  C  C4     . DC  E 3 12  ? -13.269 11.806 179.887 1.00 128.40 ? 12  DC  E C4     1 
ATOM   9710  N  N4     . DC  E 3 12  ? -12.784 10.569 179.751 1.00 141.86 ? 12  DC  E N4     1 
ATOM   9711  C  C5     . DC  E 3 12  ? -14.677 12.020 179.897 1.00 131.97 ? 12  DC  E C5     1 
ATOM   9712  C  C6     . DC  E 3 12  ? -15.112 13.273 180.032 1.00 130.17 ? 12  DC  E C6     1 
ATOM   9713  H  "H5'"  . DC  E 3 12  ? -18.683 15.613 179.120 1.00 178.53 ? 12  DC  E "H5'"  1 
ATOM   9714  H  "H5''" . DC  E 3 12  ? -17.357 14.844 178.738 1.00 178.53 ? 12  DC  E "H5''" 1 
ATOM   9715  H  "H4'"  . DC  E 3 12  ? -17.647 16.737 180.810 1.00 160.94 ? 12  DC  E "H4'"  1 
ATOM   9716  H  "H3'"  . DC  E 3 12  ? -16.810 17.355 178.501 1.00 185.13 ? 12  DC  E "H3'"  1 
ATOM   9717  H  "HO3'" . DC  E 3 12  ? -15.305 18.723 180.118 1.00 154.41 ? 12  DC  E "HO3'" 1 
ATOM   9718  H  "H2'"  . DC  E 3 12  ? -15.146 15.834 178.292 1.00 177.39 ? 12  DC  E "H2'"  1 
ATOM   9719  H  "H2''" . DC  E 3 12  ? -14.297 17.067 178.851 1.00 177.39 ? 12  DC  E "H2''" 1 
ATOM   9720  H  "H1'"  . DC  E 3 12  ? -14.166 16.201 180.887 1.00 153.61 ? 12  DC  E "H1'"  1 
ATOM   9721  H  H41    . DC  E 3 12  ? -13.322 9.903  179.669 1.00 170.23 ? 12  DC  E H41    1 
ATOM   9722  H  H42    . DC  E 3 12  ? -11.934 10.439 179.746 1.00 170.23 ? 12  DC  E H42    1 
ATOM   9723  H  H5     . DC  E 3 12  ? -15.272 11.310 179.808 1.00 158.36 ? 12  DC  E H5     1 
ATOM   9724  H  H6     . DC  E 3 12  ? -16.026 13.441 180.044 1.00 156.21 ? 12  DC  E H6     1 
ATOM   9725  C  "C5'"  . DG  F 4 1   ? -1.328  11.359 179.073 1.00 169.03 ? 1   DG  F "C5'"  1 
ATOM   9726  C  "C4'"  . DG  F 4 1   ? -2.209  12.486 179.581 1.00 151.47 ? 1   DG  F "C4'"  1 
ATOM   9727  O  "O4'"  . DG  F 4 1   ? -3.585  12.250 179.173 1.00 158.48 ? 1   DG  F "O4'"  1 
ATOM   9728  C  "C3'"  . DG  F 4 1   ? -2.231  12.640 181.106 1.00 175.78 ? 1   DG  F "C3'"  1 
ATOM   9729  O  "O3'"  . DG  F 4 1   ? -1.918  13.981 181.491 1.00 203.63 ? 1   DG  F "O3'"  1 
ATOM   9730  C  "C2'"  . DG  F 4 1   ? -3.649  12.250 181.499 1.00 191.86 ? 1   DG  F "C2'"  1 
ATOM   9731  C  "C1'"  . DG  F 4 1   ? -4.446  12.543 180.244 1.00 148.90 ? 1   DG  F "C1'"  1 
ATOM   9732  N  N9     . DG  F 4 1   ? -5.645  11.725 180.145 1.00 152.16 ? 1   DG  F N9     1 
ATOM   9733  C  C8     . DG  F 4 1   ? -5.699  10.355 180.185 1.00 161.07 ? 1   DG  F C8     1 
ATOM   9734  N  N7     . DG  F 4 1   ? -6.906  9.880  180.111 1.00 162.20 ? 1   DG  F N7     1 
ATOM   9735  C  C5     . DG  F 4 1   ? -7.711  11.007 180.026 1.00 153.91 ? 1   DG  F C5     1 
ATOM   9736  C  C6     . DG  F 4 1   ? -9.114  11.106 179.922 1.00 157.80 ? 1   DG  F C6     1 
ATOM   9737  O  O6     . DG  F 4 1   ? -9.940  10.186 179.884 1.00 173.38 ? 1   DG  F O6     1 
ATOM   9738  N  N1     . DG  F 4 1   ? -9.537  12.430 179.859 1.00 142.48 ? 1   DG  F N1     1 
ATOM   9739  C  C2     . DG  F 4 1   ? -8.706  13.526 179.893 1.00 135.88 ? 1   DG  F C2     1 
ATOM   9740  N  N2     . DG  F 4 1   ? -9.304  14.726 179.823 1.00 129.86 ? 1   DG  F N2     1 
ATOM   9741  N  N3     . DG  F 4 1   ? -7.380  13.448 179.989 1.00 133.41 ? 1   DG  F N3     1 
ATOM   9742  C  C4     . DG  F 4 1   ? -6.955  12.156 180.052 1.00 144.71 ? 1   DG  F C4     1 
ATOM   9743  H  "H4'"  . DG  F 4 1   ? -1.905  13.319 179.188 1.00 181.77 ? 1   DG  F "H4'"  1 
ATOM   9744  H  "H3'"  . DG  F 4 1   ? -1.598  12.025 181.507 1.00 210.94 ? 1   DG  F "H3'"  1 
ATOM   9745  H  "H2'"  . DG  F 4 1   ? -3.695  11.308 181.723 1.00 230.23 ? 1   DG  F "H2'"  1 
ATOM   9746  H  "H2''" . DG  F 4 1   ? -3.961  12.796 182.238 1.00 230.23 ? 1   DG  F "H2''" 1 
ATOM   9747  H  "H1'"  . DG  F 4 1   ? -4.687  13.482 180.222 1.00 178.68 ? 1   DG  F "H1'"  1 
ATOM   9748  H  H8     . DG  F 4 1   ? -4.943  9.817  180.254 1.00 193.29 ? 1   DG  F H8     1 
ATOM   9749  H  H1     . DG  F 4 1   ? -10.383 12.574 179.794 1.00 170.97 ? 1   DG  F H1     1 
ATOM   9750  H  H21    . DG  F 4 1   ? -8.830  15.444 179.840 1.00 155.83 ? 1   DG  F H21    1 
ATOM   9751  H  H22    . DG  F 4 1   ? -10.160 14.777 179.761 1.00 155.83 ? 1   DG  F H22    1 
ATOM   9752  P  P      . DG  F 4 2   ? -2.053  14.435 183.029 1.00 117.57 ? 2   DG  F P      1 
ATOM   9753  O  OP1    . DG  F 4 2   ? -1.122  15.562 183.251 1.00 127.55 ? 2   DG  F OP1    1 
ATOM   9754  O  OP2    . DG  F 4 2   ? -2.050  13.213 183.864 1.00 117.10 ? 2   DG  F OP2    1 
ATOM   9755  O  "O5'"  . DG  F 4 2   ? -3.492  15.096 183.106 1.00 107.20 ? 2   DG  F "O5'"  1 
ATOM   9756  C  "C5'"  . DG  F 4 2   ? -3.696  16.342 182.480 1.00 119.12 ? 2   DG  F "C5'"  1 
ATOM   9757  C  "C4'"  . DG  F 4 2   ? -5.014  16.930 182.904 1.00 114.69 ? 2   DG  F "C4'"  1 
ATOM   9758  O  "O4'"  . DG  F 4 2   ? -6.068  16.161 182.300 1.00 122.95 ? 2   DG  F "O4'"  1 
ATOM   9759  C  "C3'"  . DG  F 4 2   ? -5.257  16.892 184.405 1.00 148.37 ? 2   DG  F "C3'"  1 
ATOM   9760  O  "O3'"  . DG  F 4 2   ? -4.933  18.145 184.998 1.00 138.17 ? 2   DG  F "O3'"  1 
ATOM   9761  C  "C2'"  . DG  F 4 2   ? -6.737  16.558 184.539 1.00 146.43 ? 2   DG  F "C2'"  1 
ATOM   9762  C  "C1'"  . DG  F 4 2   ? -7.102  15.901 183.223 1.00 108.13 ? 2   DG  F "C1'"  1 
ATOM   9763  N  N9     . DG  F 4 2   ? -7.283  14.456 183.302 1.00 112.09 ? 2   DG  F N9     1 
ATOM   9764  C  C8     . DG  F 4 2   ? -6.306  13.492 183.328 1.00 117.77 ? 2   DG  F C8     1 
ATOM   9765  N  N7     . DG  F 4 2   ? -6.779  12.276 183.368 1.00 116.98 ? 2   DG  F N7     1 
ATOM   9766  C  C5     . DG  F 4 2   ? -8.157  12.450 183.359 1.00 120.40 ? 2   DG  F C5     1 
ATOM   9767  C  C6     . DG  F 4 2   ? -9.200  11.496 183.388 1.00 139.15 ? 2   DG  F C6     1 
ATOM   9768  O  O6     . DG  F 4 2   ? -9.109  10.260 183.428 1.00 155.38 ? 2   DG  F O6     1 
ATOM   9769  N  N1     . DG  F 4 2   ? -10.455 12.104 183.366 1.00 130.58 ? 2   DG  F N1     1 
ATOM   9770  C  C2     . DG  F 4 2   ? -10.668 13.463 183.321 1.00 120.22 ? 2   DG  F C2     1 
ATOM   9771  N  N2     . DG  F 4 2   ? -11.944 13.868 183.305 1.00 122.78 ? 2   DG  F N2     1 
ATOM   9772  N  N3     . DG  F 4 2   ? -9.700  14.362 183.293 1.00 112.60 ? 2   DG  F N3     1 
ATOM   9773  C  C4     . DG  F 4 2   ? -8.477  13.787 183.314 1.00 114.56 ? 2   DG  F C4     1 
ATOM   9774  H  "H5'"  . DG  F 4 2   ? -3.694  16.222 181.518 1.00 142.95 ? 2   DG  F "H5'"  1 
ATOM   9775  H  "H5''" . DG  F 4 2   ? -2.980  16.947 182.729 1.00 142.95 ? 2   DG  F "H5''" 1 
ATOM   9776  H  "H4'"  . DG  F 4 2   ? -5.069  17.848 182.594 1.00 137.62 ? 2   DG  F "H4'"  1 
ATOM   9777  H  "H3'"  . DG  F 4 2   ? -4.723  16.189 184.807 1.00 178.04 ? 2   DG  F "H3'"  1 
ATOM   9778  H  "H2'"  . DG  F 4 2   ? -6.880  15.943 185.275 1.00 175.71 ? 2   DG  F "H2'"  1 
ATOM   9779  H  "H2''" . DG  F 4 2   ? -7.256  17.367 184.668 1.00 175.71 ? 2   DG  F "H2''" 1 
ATOM   9780  H  "H1'"  . DG  F 4 2   ? -7.922  16.299 182.893 1.00 129.75 ? 2   DG  F "H1'"  1 
ATOM   9781  H  H8     . DG  F 4 2   ? -5.396  13.686 183.320 1.00 141.32 ? 2   DG  F H8     1 
ATOM   9782  H  H1     . DG  F 4 2   ? -11.146 11.592 183.381 1.00 156.69 ? 2   DG  F H1     1 
ATOM   9783  H  H21    . DG  F 4 2   ? -12.128 14.708 183.278 1.00 147.34 ? 2   DG  F H21    1 
ATOM   9784  H  H22    . DG  F 4 2   ? -12.580 13.289 183.323 1.00 147.34 ? 2   DG  F H22    1 
ATOM   9785  P  P      . DT  F 4 3   ? -5.087  18.347 186.584 1.00 133.06 ? 3   DT  F P      1 
ATOM   9786  O  OP1    . DT  F 4 3   ? -4.709  19.740 186.897 1.00 154.89 ? 3   DT  F OP1    1 
ATOM   9787  O  OP2    . DT  F 4 3   ? -4.384  17.233 187.262 1.00 113.80 ? 3   DT  F OP2    1 
ATOM   9788  O  "O5'"  . DT  F 4 3   ? -6.658  18.204 186.836 1.00 85.63  ? 3   DT  F "O5'"  1 
ATOM   9789  C  "C5'"  . DT  F 4 3   ? -7.560  19.251 186.445 1.00 99.70  ? 3   DT  F "C5'"  1 
ATOM   9790  C  "C4'"  . DT  F 4 3   ? -8.935  18.964 186.992 1.00 101.14 ? 3   DT  F "C4'"  1 
ATOM   9791  O  "O4'"  . DT  F 4 3   ? -9.350  17.624 186.565 1.00 85.45  ? 3   DT  F "O4'"  1 
ATOM   9792  C  "C3'"  . DT  F 4 3   ? -8.994  18.953 188.518 1.00 126.84 ? 3   DT  F "C3'"  1 
ATOM   9793  O  "O3'"  . DT  F 4 3   ? -10.261 19.452 189.002 1.00 115.85 ? 3   DT  F "O3'"  1 
ATOM   9794  C  "C2'"  . DT  F 4 3   ? -8.769  17.477 188.818 1.00 164.04 ? 3   DT  F "C2'"  1 
ATOM   9795  C  "C1'"  . DT  F 4 3   ? -9.580  16.824 187.706 1.00 124.35 ? 3   DT  F "C1'"  1 
ATOM   9796  N  N1     . DT  F 4 3   ? -9.198  15.384 187.426 1.00 90.48  ? 3   DT  F N1     1 
ATOM   9797  C  C2     . DT  F 4 3   ? -10.193 14.454 187.217 1.00 101.74 ? 3   DT  F C2     1 
ATOM   9798  O  O2     . DT  F 4 3   ? -11.380 14.735 187.205 1.00 103.55 ? 3   DT  F O2     1 
ATOM   9799  N  N3     . DT  F 4 3   ? -9.747  13.173 187.006 1.00 104.78 ? 3   DT  F N3     1 
ATOM   9800  C  C4     . DT  F 4 3   ? -8.432  12.739 186.995 1.00 108.14 ? 3   DT  F C4     1 
ATOM   9801  O  O4     . DT  F 4 3   ? -8.129  11.566 186.794 1.00 125.42 ? 3   DT  F O4     1 
ATOM   9802  C  C5     . DT  F 4 3   ? -7.440  13.762 187.235 1.00 93.44  ? 3   DT  F C5     1 
ATOM   9803  C  C7     . DT  F 4 3   ? -5.980  13.413 187.248 1.00 95.18  ? 3   DT  F C7     1 
ATOM   9804  C  C6     . DT  F 4 3   ? -7.864  15.017 187.441 1.00 87.26  ? 3   DT  F C6     1 
ATOM   9805  H  "H5'"  . DT  F 4 3   ? -7.601  19.298 185.477 1.00 119.64 ? 3   DT  F "H5'"  1 
ATOM   9806  H  "H5''" . DT  F 4 3   ? -7.244  20.098 186.796 1.00 119.64 ? 3   DT  F "H5''" 1 
ATOM   9807  H  "H4'"  . DT  F 4 3   ? -9.563  19.620 186.649 1.00 121.36 ? 3   DT  F "H4'"  1 
ATOM   9808  H  "H3'"  . DT  F 4 3   ? -8.266  19.481 188.882 1.00 152.21 ? 3   DT  F "H3'"  1 
ATOM   9809  H  "H2'"  . DT  F 4 3   ? -7.829  17.246 188.744 1.00 196.85 ? 3   DT  F "H2'"  1 
ATOM   9810  H  "H2''" . DT  F 4 3   ? -9.121  17.241 189.690 1.00 196.85 ? 3   DT  F "H2''" 1 
ATOM   9811  H  "H1'"  . DT  F 4 3   ? -10.522 16.863 187.935 1.00 149.22 ? 3   DT  F "H1'"  1 
ATOM   9812  H  H3     . DT  F 4 3   ? -10.349 12.577 186.861 1.00 125.74 ? 3   DT  F H3     1 
ATOM   9813  H  H71    . DT  F 4 3   ? -5.873  12.464 187.080 1.00 114.21 ? 3   DT  F H71    1 
ATOM   9814  H  H72    . DT  F 4 3   ? -5.521  13.918 186.559 1.00 114.21 ? 3   DT  F H72    1 
ATOM   9815  H  H73    . DT  F 4 3   ? -5.603  13.633 188.115 1.00 114.21 ? 3   DT  F H73    1 
ATOM   9816  H  H6     . DT  F 4 3   ? -7.228  15.675 187.601 1.00 104.72 ? 3   DT  F H6     1 
ATOM   9817  P  P      . DT  F 4 4   ? -10.885 18.878 190.367 1.00 86.34  ? 4   DT  F P      1 
ATOM   9818  O  OP1    . DT  F 4 4   ? -9.911  19.137 191.451 1.00 126.87 ? 4   DT  F OP1    1 
ATOM   9819  O  OP2    . DT  F 4 4   ? -11.325 17.507 190.059 1.00 117.64 ? 4   DT  F OP2    1 
ATOM   9820  O  "O5'"  . DT  F 4 4   ? -12.206 19.743 190.631 1.00 79.34  ? 4   DT  F "O5'"  1 
ATOM   9821  C  "C5'"  . DT  F 4 4   ? -13.483 19.271 190.166 1.00 104.34 ? 4   DT  F "C5'"  1 
ATOM   9822  C  "C4'"  . DT  F 4 4   ? -14.030 18.119 191.020 1.00 112.37 ? 4   DT  F "C4'"  1 
ATOM   9823  O  "O4'"  . DT  F 4 4   ? -13.565 16.841 190.500 1.00 129.82 ? 4   DT  F "O4'"  1 
ATOM   9824  C  "C3'"  . DT  F 4 4   ? -13.629 18.136 192.510 1.00 88.17  ? 4   DT  F "C3'"  1 
ATOM   9825  O  "O3'"  . DT  F 4 4   ? -14.771 18.348 193.345 1.00 93.48  ? 4   DT  F "O3'"  1 
ATOM   9826  C  "C2'"  . DT  F 4 4   ? -12.995 16.761 192.751 1.00 78.76  ? 4   DT  F "C2'"  1 
ATOM   9827  C  "C1'"  . DT  F 4 4   ? -13.502 15.937 191.573 1.00 105.53 ? 4   DT  F "C1'"  1 
ATOM   9828  N  N1     . DT  F 4 4   ? -12.620 14.765 191.219 1.00 83.44  ? 4   DT  F N1     1 
ATOM   9829  C  C2     . DT  F 4 4   ? -13.181 13.515 191.097 1.00 93.74  ? 4   DT  F C2     1 
ATOM   9830  O  O2     . DT  F 4 4   ? -14.374 13.300 191.230 1.00 92.48  ? 4   DT  F O2     1 
ATOM   9831  N  N3     . DT  F 4 4   ? -12.293 12.515 190.800 1.00 95.74  ? 4   DT  F N3     1 
ATOM   9832  C  C4     . DT  F 4 4   ? -10.926 12.637 190.627 1.00 84.36  ? 4   DT  F C4     1 
ATOM   9833  O  O4     . DT  F 4 4   ? -10.209 11.678 190.364 1.00 97.96  ? 4   DT  F O4     1 
ATOM   9834  C  C5     . DT  F 4 4   ? -10.402 13.969 190.778 1.00 79.88  ? 4   DT  F C5     1 
ATOM   9835  C  C7     . DT  F 4 4   ? -8.934  14.224 190.616 1.00 79.95  ? 4   DT  F C7     1 
ATOM   9836  C  C6     . DT  F 4 4   ? -11.260 14.954 191.068 1.00 79.21  ? 4   DT  F C6     1 
ATOM   9837  H  "H5'"  . DT  F 4 4   ? -13.390 18.965 189.250 1.00 125.20 ? 4   DT  F "H5'"  1 
ATOM   9838  H  "H5''" . DT  F 4 4   ? -14.116 20.005 190.188 1.00 125.20 ? 4   DT  F "H5''" 1 
ATOM   9839  H  "H4'"  . DT  F 4 4   ? -14.999 18.135 190.966 1.00 134.84 ? 4   DT  F "H4'"  1 
ATOM   9840  H  "H3'"  . DT  F 4 4   ? -12.973 18.833 192.665 1.00 105.81 ? 4   DT  F "H3'"  1 
ATOM   9841  H  "H2'"  . DT  F 4 4   ? -12.027 16.822 192.734 1.00 94.52  ? 4   DT  F "H2'"  1 
ATOM   9842  H  "H2''" . DT  F 4 4   ? -13.303 16.384 193.590 1.00 94.52  ? 4   DT  F "H2''" 1 
ATOM   9843  H  "H1'"  . DT  F 4 4   ? -14.396 15.616 191.771 1.00 126.63 ? 4   DT  F "H1'"  1 
ATOM   9844  H  H3     . DT  F 4 4   ? -12.620 11.725 190.715 1.00 114.89 ? 4   DT  F H3     1 
ATOM   9845  H  H71    . DT  F 4 4   ? -8.793  14.854 189.892 1.00 95.94  ? 4   DT  F H71    1 
ATOM   9846  H  H72    . DT  F 4 4   ? -8.577  14.594 191.439 1.00 95.94  ? 4   DT  F H72    1 
ATOM   9847  H  H73    . DT  F 4 4   ? -8.481  13.391 190.413 1.00 95.94  ? 4   DT  F H73    1 
ATOM   9848  H  H6     . DT  F 4 4   ? -10.923 15.815 191.168 1.00 95.05  ? 4   DT  F H6     1 
ATOM   9849  P  P      . DG  F 4 5   ? -14.605 18.387 194.945 1.00 142.88 ? 5   DG  F P      1 
ATOM   9850  O  OP1    . DG  F 4 5   ? -15.589 19.345 195.493 1.00 96.56  ? 5   DG  F OP1    1 
ATOM   9851  O  OP2    . DG  F 4 5   ? -13.164 18.557 195.232 1.00 120.35 ? 5   DG  F OP2    1 
ATOM   9852  O  "O5'"  . DG  F 4 5   ? -14.999 16.915 195.420 1.00 99.41  ? 5   DG  F "O5'"  1 
ATOM   9853  C  "C5'"  . DG  F 4 5   ? -16.256 16.349 195.066 1.00 76.46  ? 5   DG  F "C5'"  1 
ATOM   9854  C  "C4'"  . DG  F 4 5   ? -16.195 14.840 195.166 1.00 92.39  ? 5   DG  F "C4'"  1 
ATOM   9855  O  "O4'"  . DG  F 4 5   ? -15.071 14.362 194.397 1.00 115.58 ? 5   DG  F "O4'"  1 
ATOM   9856  C  "C3'"  . DG  F 4 5   ? -15.973 14.302 196.580 1.00 81.84  ? 5   DG  F "C3'"  1 
ATOM   9857  O  "O3'"  . DG  F 4 5   ? -17.211 13.898 197.171 1.00 105.61 ? 5   DG  F "O3'"  1 
ATOM   9858  C  "C2'"  . DG  F 4 5   ? -15.005 13.125 196.398 1.00 77.47  ? 5   DG  F "C2'"  1 
ATOM   9859  C  "C1'"  . DG  F 4 5   ? -14.686 13.110 194.901 1.00 98.17  ? 5   DG  F "C1'"  1 
ATOM   9860  N  N9     . DG  F 4 5   ? -13.269 12.886 194.614 1.00 91.54  ? 5   DG  F N9     1 
ATOM   9861  C  C8     . DG  F 4 5   ? -12.271 13.830 194.531 1.00 78.12  ? 5   DG  F C8     1 
ATOM   9862  N  N7     . DG  F 4 5   ? -11.094 13.322 194.277 1.00 78.57  ? 5   DG  F N7     1 
ATOM   9863  C  C5     . DG  F 4 5   ? -11.329 11.954 194.187 1.00 92.70  ? 5   DG  F C5     1 
ATOM   9864  C  C6     . DG  F 4 5   ? -10.434 10.886 193.926 1.00 94.45  ? 5   DG  F C6     1 
ATOM   9865  O  O6     . DG  F 4 5   ? -9.215  10.938 193.716 1.00 105.07 ? 5   DG  F O6     1 
ATOM   9866  N  N1     . DG  F 4 5   ? -11.088 9.655  193.924 1.00 83.82  ? 5   DG  F N1     1 
ATOM   9867  C  C2     . DG  F 4 5   ? -12.435 9.479  194.148 1.00 90.98  ? 5   DG  F C2     1 
ATOM   9868  N  N2     . DG  F 4 5   ? -12.893 8.221  194.113 1.00 91.21  ? 5   DG  F N2     1 
ATOM   9869  N  N3     . DG  F 4 5   ? -13.279 10.469 194.392 1.00 90.78  ? 5   DG  F N3     1 
ATOM   9870  C  C4     . DG  F 4 5   ? -12.660 11.673 194.395 1.00 95.58  ? 5   DG  F C4     1 
ATOM   9871  H  "H5'"  . DG  F 4 5   ? -16.477 16.602 194.156 1.00 91.75  ? 5   DG  F "H5'"  1 
ATOM   9872  H  "H5''" . DG  F 4 5   ? -16.939 16.683 195.668 1.00 91.75  ? 5   DG  F "H5''" 1 
ATOM   9873  H  "H4'"  . DG  F 4 5   ? -17.013 14.462 194.805 1.00 110.86 ? 5   DG  F "H4'"  1 
ATOM   9874  H  "H3'"  . DG  F 4 5   ? -15.556 14.986 197.128 1.00 98.21  ? 5   DG  F "H3'"  1 
ATOM   9875  H  "H2'"  . DG  F 4 5   ? -14.196 13.269 196.914 1.00 92.96  ? 5   DG  F "H2'"  1 
ATOM   9876  H  "H2''" . DG  F 4 5   ? -15.431 12.294 196.661 1.00 92.96  ? 5   DG  F "H2''" 1 
ATOM   9877  H  "H1'"  . DG  F 4 5   ? -15.211 12.418 194.470 1.00 117.80 ? 5   DG  F "H1'"  1 
ATOM   9878  H  H8     . DG  F 4 5   ? -12.420 14.742 194.642 1.00 93.75  ? 5   DG  F H8     1 
ATOM   9879  H  H1     . DG  F 4 5   ? -10.614 8.952  193.778 1.00 100.58 ? 5   DG  F H1     1 
ATOM   9880  H  H21    . DG  F 4 5   ? -13.727 8.063  194.248 1.00 109.45 ? 5   DG  F H21    1 
ATOM   9881  H  H22    . DG  F 4 5   ? -12.352 7.571  193.956 1.00 109.45 ? 5   DG  F H22    1 
ATOM   9882  P  P      . DC  F 4 6   ? -17.268 13.443 198.713 1.00 133.54 ? 6   DC  F P      1 
ATOM   9883  O  OP1    . DC  F 4 6   ? -18.690 13.370 199.115 1.00 83.92  ? 6   DC  F OP1    1 
ATOM   9884  O  OP2    . DC  F 4 6   ? -16.315 14.282 199.475 1.00 103.33 ? 6   DC  F OP2    1 
ATOM   9885  O  "O5'"  . DC  F 4 6   ? -16.698 11.953 198.693 1.00 109.62 ? 6   DC  F "O5'"  1 
ATOM   9886  C  "C5'"  . DC  F 4 6   ? -17.451 10.917 198.084 1.00 101.60 ? 6   DC  F "C5'"  1 
ATOM   9887  C  "C4'"  . DC  F 4 6   ? -16.726 9.592  198.187 1.00 115.74 ? 6   DC  F "C4'"  1 
ATOM   9888  O  "O4'"  . DC  F 4 6   ? -15.528 9.646  197.387 1.00 92.59  ? 6   DC  F "O4'"  1 
ATOM   9889  C  "C3'"  . DC  F 4 6   ? -16.261 9.227  199.590 1.00 89.69  ? 6   DC  F "C3'"  1 
ATOM   9890  O  "O3'"  . DC  F 4 6   ? -17.243 8.425  200.255 1.00 82.58  ? 6   DC  F "O3'"  1 
ATOM   9891  C  "C2'"  . DC  F 4 6   ? -14.946 8.473  199.367 1.00 83.14  ? 6   DC  F "C2'"  1 
ATOM   9892  C  "C1'"  . DC  F 4 6   ? -14.569 8.756  197.909 1.00 83.01  ? 6   DC  F "C1'"  1 
ATOM   9893  N  N1     . DC  F 4 6   ? -13.225 9.374  197.752 1.00 78.82  ? 6   DC  F N1     1 
ATOM   9894  C  C2     . DC  F 4 6   ? -12.089 8.562  197.682 1.00 79.34  ? 6   DC  F C2     1 
ATOM   9895  O  O2     . DC  F 4 6   ? -12.215 7.336  197.745 1.00 79.92  ? 6   DC  F O2     1 
ATOM   9896  N  N3     . DC  F 4 6   ? -10.875 9.142  197.540 1.00 79.22  ? 6   DC  F N3     1 
ATOM   9897  C  C4     . DC  F 4 6   ? -10.773 10.468 197.472 1.00 78.60  ? 6   DC  F C4     1 
ATOM   9898  N  N4     . DC  F 4 6   ? -9.553  10.993 197.332 1.00 78.50  ? 6   DC  F N4     1 
ATOM   9899  C  C5     . DC  F 4 6   ? -11.917 11.313 197.543 1.00 84.11  ? 6   DC  F C5     1 
ATOM   9900  C  C6     . DC  F 4 6   ? -13.112 10.729 197.681 1.00 78.20  ? 6   DC  F C6     1 
ATOM   9901  H  "H5'"  . DC  F 4 6   ? -17.591 11.132 197.148 1.00 121.92 ? 6   DC  F "H5'"  1 
ATOM   9902  H  "H5''" . DC  F 4 6   ? -18.312 10.845 198.526 1.00 121.92 ? 6   DC  F "H5''" 1 
ATOM   9903  H  "H4'"  . DC  F 4 6   ? -17.301 8.887  197.850 1.00 138.89 ? 6   DC  F "H4'"  1 
ATOM   9904  H  "H3'"  . DC  F 4 6   ? -16.094 10.035 200.101 1.00 107.63 ? 6   DC  F "H3'"  1 
ATOM   9905  H  "H2'"  . DC  F 4 6   ? -14.259 8.809  199.964 1.00 99.77  ? 6   DC  F "H2'"  1 
ATOM   9906  H  "H2''" . DC  F 4 6   ? -15.076 7.522  199.502 1.00 99.77  ? 6   DC  F "H2''" 1 
ATOM   9907  H  "H1'"  . DC  F 4 6   ? -14.599 7.927  197.406 1.00 99.62  ? 6   DC  F "H1'"  1 
ATOM   9908  H  H41    . DC  F 4 6   ? -9.455  11.846 197.286 1.00 94.20  ? 6   DC  F H41    1 
ATOM   9909  H  H42    . DC  F 4 6   ? -8.866  10.478 197.289 1.00 94.20  ? 6   DC  F H42    1 
ATOM   9910  H  H5     . DC  F 4 6   ? -11.836 12.239 197.495 1.00 100.94 ? 6   DC  F H5     1 
ATOM   9911  H  H6     . DC  F 4 6   ? -13.876 11.256 197.732 1.00 93.84  ? 6   DC  F H6     1 
ATOM   9912  P  P      . DG  F 4 7   ? -17.185 8.209  201.848 1.00 136.19 ? 7   DG  F P      1 
ATOM   9913  O  OP1    . DG  F 4 7   ? -18.552 7.863  202.295 1.00 99.94  ? 7   DG  F OP1    1 
ATOM   9914  O  OP2    . DG  F 4 7   ? -16.478 9.359  202.453 1.00 139.98 ? 7   DG  F OP2    1 
ATOM   9915  O  "O5'"  . DG  F 4 7   ? -16.244 6.932  202.022 1.00 102.35 ? 7   DG  F "O5'"  1 
ATOM   9916  C  "C5'"  . DG  F 4 7   ? -16.519 5.747  201.292 1.00 122.82 ? 7   DG  F "C5'"  1 
ATOM   9917  C  "C4'"  . DG  F 4 7   ? -15.380 4.762  201.424 1.00 117.40 ? 7   DG  F "C4'"  1 
ATOM   9918  O  "O4'"  . DG  F 4 7   ? -14.208 5.310  200.764 1.00 131.21 ? 7   DG  F "O4'"  1 
ATOM   9919  C  "C3'"  . DG  F 4 7   ? -14.979 4.452  202.868 1.00 98.46  ? 7   DG  F "C3'"  1 
ATOM   9920  O  "O3'"  . DG  F 4 7   ? -15.010 3.042  203.111 1.00 143.90 ? 7   DG  F "O3'"  1 
ATOM   9921  C  "C2'"  . DG  F 4 7   ? -13.580 5.055  203.020 1.00 88.96  ? 7   DG  F "C2'"  1 
ATOM   9922  C  "C1'"  . DG  F 4 7   ? -13.076 5.205  201.592 1.00 93.42  ? 7   DG  F "C1'"  1 
ATOM   9923  N  N9     . DG  F 4 7   ? -12.252 6.398  201.410 1.00 85.88  ? 7   DG  F N9     1 
ATOM   9924  C  C8     . DG  F 4 7   ? -12.629 7.697  201.654 1.00 78.89  ? 7   DG  F C8     1 
ATOM   9925  N  N7     . DG  F 4 7   ? -11.687 8.565  201.426 1.00 77.80  ? 7   DG  F N7     1 
ATOM   9926  C  C5     . DG  F 4 7   ? -10.610 7.796  201.010 1.00 78.45  ? 7   DG  F C5     1 
ATOM   9927  C  C6     . DG  F 4 7   ? -9.314  8.194  200.625 1.00 81.23  ? 7   DG  F C6     1 
ATOM   9928  O  O6     . DG  F 4 7   ? -8.852  9.339  200.576 1.00 78.98  ? 7   DG  F O6     1 
ATOM   9929  N  N1     . DG  F 4 7   ? -8.518  7.104  200.274 1.00 79.30  ? 7   DG  F N1     1 
ATOM   9930  C  C2     . DG  F 4 7   ? -8.926  5.793  200.291 1.00 79.92  ? 7   DG  F C2     1 
ATOM   9931  N  N2     . DG  F 4 7   ? -8.011  4.880  199.920 1.00 80.64  ? 7   DG  F N2     1 
ATOM   9932  N  N3     . DG  F 4 7   ? -10.150 5.401  200.650 1.00 79.85  ? 7   DG  F N3     1 
ATOM   9933  C  C4     . DG  F 4 7   ? -10.935 6.457  200.997 1.00 79.10  ? 7   DG  F C4     1 
ATOM   9934  H  "H5'"  . DG  F 4 7   ? -16.643 5.970  200.356 1.00 147.39 ? 7   DG  F "H5'"  1 
ATOM   9935  H  "H5''" . DG  F 4 7   ? -17.332 5.343  201.634 1.00 147.39 ? 7   DG  F "H5''" 1 
ATOM   9936  H  "H4'"  . DG  F 4 7   ? -15.629 3.934  200.984 1.00 140.88 ? 7   DG  F "H4'"  1 
ATOM   9937  H  "H3'"  . DG  F 4 7   ? -15.590 4.898  203.475 1.00 118.15 ? 7   DG  F "H3'"  1 
ATOM   9938  H  "H2'"  . DG  F 4 7   ? -13.630 5.921  203.454 1.00 106.75 ? 7   DG  F "H2'"  1 
ATOM   9939  H  "H2''" . DG  F 4 7   ? -13.005 4.456  203.521 1.00 106.75 ? 7   DG  F "H2''" 1 
ATOM   9940  H  "H1'"  . DG  F 4 7   ? -12.566 4.418  201.344 1.00 112.10 ? 7   DG  F "H1'"  1 
ATOM   9941  H  H8     . DG  F 4 7   ? -13.479 7.934  201.949 1.00 94.67  ? 7   DG  F H8     1 
ATOM   9942  H  H1     . DG  F 4 7   ? -7.710  7.265  200.028 1.00 95.16  ? 7   DG  F H1     1 
ATOM   9943  H  H21    . DG  F 4 7   ? -8.214  4.044  199.915 1.00 96.77  ? 7   DG  F H21    1 
ATOM   9944  H  H22    . DG  F 4 7   ? -7.222  5.132  199.688 1.00 96.77  ? 7   DG  F H22    1 
ATOM   9945  P  P      . DT  F 4 8   ? -14.335 2.434  204.437 1.00 117.88 ? 8   DT  F P      1 
ATOM   9946  O  OP1    . DT  F 4 8   ? -15.022 1.170  204.791 1.00 119.03 ? 8   DT  F OP1    1 
ATOM   9947  O  OP2    . DT  F 4 8   ? -14.272 3.530  205.430 1.00 85.71  ? 8   DT  F OP2    1 
ATOM   9948  O  "O5'"  . DT  F 4 8   ? -12.844 2.119  203.958 1.00 88.30  ? 8   DT  F "O5'"  1 
ATOM   9949  C  "C5'"  . DT  F 4 8   ? -11.865 1.733  204.889 1.00 120.90 ? 8   DT  F "C5'"  1 
ATOM   9950  C  "C4'"  . DT  F 4 8   ? -10.488 1.745  204.260 1.00 99.38  ? 8   DT  F "C4'"  1 
ATOM   9951  O  "O4'"  . DT  F 4 8   ? -10.292 2.986  203.555 1.00 82.09  ? 8   DT  F "O4'"  1 
ATOM   9952  C  "C3'"  . DT  F 4 8   ? -9.343  1.670  205.248 1.00 125.76 ? 8   DT  F "C3'"  1 
ATOM   9953  O  "O3'"  . DT  F 4 8   ? -9.026  0.311  205.536 1.00 99.25  ? 8   DT  F "O3'"  1 
ATOM   9954  C  "C2'"  . DT  F 4 8   ? -8.205  2.407  204.537 1.00 122.42 ? 8   DT  F "C2'"  1 
ATOM   9955  C  "C1'"  . DT  F 4 8   ? -8.913  3.300  203.513 1.00 79.88  ? 8   DT  F "C1'"  1 
ATOM   9956  N  N1     . DT  F 4 8   ? -8.763  4.763  203.771 1.00 79.04  ? 8   DT  F N1     1 
ATOM   9957  C  C2     . DT  F 4 8   ? -7.544  5.368  203.559 1.00 78.93  ? 8   DT  F C2     1 
ATOM   9958  O  O2     . DT  F 4 8   ? -6.554  4.767  203.180 1.00 79.51  ? 8   DT  F O2     1 
ATOM   9959  N  N3     . DT  F 4 8   ? -7.523  6.714  203.814 1.00 78.14  ? 8   DT  F N3     1 
ATOM   9960  C  C4     . DT  F 4 8   ? -8.577  7.499  204.244 1.00 77.47  ? 8   DT  F C4     1 
ATOM   9961  O  O4     . DT  F 4 8   ? -8.460  8.703  204.444 1.00 76.79  ? 8   DT  F O4     1 
ATOM   9962  C  C5     . DT  F 4 8   ? -9.826  6.802  204.445 1.00 77.62  ? 8   DT  F C5     1 
ATOM   9963  C  C7     . DT  F 4 8   ? -11.040 7.551  204.916 1.00 76.94  ? 8   DT  F C7     1 
ATOM   9964  C  C6     . DT  F 4 8   ? -9.859  5.484  204.198 1.00 78.39  ? 8   DT  F C6     1 
ATOM   9965  H  "H5'"  . DT  F 4 8   ? -12.062 0.838  205.207 1.00 145.08 ? 8   DT  F "H5'"  1 
ATOM   9966  H  "H5''" . DT  F 4 8   ? -11.878 2.348  205.639 1.00 145.08 ? 8   DT  F "H5''" 1 
ATOM   9967  H  "H4'"  . DT  F 4 8   ? -10.418 1.008  203.633 1.00 119.26 ? 8   DT  F "H4'"  1 
ATOM   9968  H  "H3'"  . DT  F 4 8   ? -9.580  2.136  206.065 1.00 150.92 ? 8   DT  F "H3'"  1 
ATOM   9969  H  "H2'"  . DT  F 4 8   ? -7.704  2.947  205.168 1.00 146.90 ? 8   DT  F "H2'"  1 
ATOM   9970  H  "H2''" . DT  F 4 8   ? -7.620  1.776  204.089 1.00 146.90 ? 8   DT  F "H2''" 1 
ATOM   9971  H  "H1'"  . DT  F 4 8   ? -8.570  3.098  202.628 1.00 95.86  ? 8   DT  F "H1'"  1 
ATOM   9972  H  H3     . DT  F 4 8   ? -6.773  7.115  203.691 1.00 93.77  ? 8   DT  F H3     1 
ATOM   9973  H  H71    . DT  F 4 8   ? -11.746 7.470  204.256 1.00 92.33  ? 8   DT  F H71    1 
ATOM   9974  H  H72    . DT  F 4 8   ? -11.342 7.179  205.759 1.00 92.33  ? 8   DT  F H72    1 
ATOM   9975  H  H73    . DT  F 4 8   ? -10.816 8.487  205.037 1.00 92.33  ? 8   DT  F H73    1 
ATOM   9976  H  H6     . DT  F 4 8   ? -10.662 5.033  204.324 1.00 94.06  ? 8   DT  F H6     1 
ATOM   9977  P  P      . DG  F 4 9   ? -8.591  -0.117 207.020 1.00 176.57 ? 9   DG  F P      1 
ATOM   9978  O  OP1    . DG  F 4 9   ? -8.683  -1.591 207.119 1.00 126.44 ? 9   DG  F OP1    1 
ATOM   9979  O  OP2    . DG  F 4 9   ? -9.337  0.735  207.972 1.00 124.41 ? 9   DG  F OP2    1 
ATOM   9980  O  "O5'"  . DG  F 4 9   ? -7.062  0.327  207.099 1.00 127.18 ? 9   DG  F "O5'"  1 
ATOM   9981  C  "C5'"  . DG  F 4 9   ? -6.146  -0.080 206.093 1.00 107.06 ? 9   DG  F "C5'"  1 
ATOM   9982  C  "C4'"  . DG  F 4 9   ? -4.884  0.751  206.167 1.00 96.78  ? 9   DG  F "C4'"  1 
ATOM   9983  O  "O4'"  . DG  F 4 9   ? -5.191  2.101  205.774 1.00 115.76 ? 9   DG  F "O4'"  1 
ATOM   9984  C  "C3'"  . DG  F 4 9   ? -4.276  0.843  207.564 1.00 100.89 ? 9   DG  F "C3'"  1 
ATOM   9985  O  "O3'"  . DG  F 4 9   ? -3.122  0.021  207.666 1.00 103.26 ? 9   DG  F "O3'"  1 
ATOM   9986  C  "C2'"  . DG  F 4 9   ? -3.943  2.325  207.763 1.00 92.41  ? 9   DG  F "C2'"  1 
ATOM   9987  C  "C1'"  . DG  F 4 9   ? -4.367  3.004  206.469 1.00 94.65  ? 9   DG  F "C1'"  1 
ATOM   9988  N  N9     . DG  F 4 9   ? -5.118  4.240  206.661 1.00 79.27  ? 9   DG  F N9     1 
ATOM   9989  C  C8     . DG  F 4 9   ? -6.400  4.366  207.138 1.00 78.15  ? 9   DG  F C8     1 
ATOM   9990  N  N7     . DG  F 4 9   ? -6.819  5.600  207.178 1.00 77.45  ? 9   DG  F N7     1 
ATOM   9991  C  C5     . DG  F 4 9   ? -5.748  6.335  206.689 1.00 77.37  ? 9   DG  F C5     1 
ATOM   9992  C  C6     . DG  F 4 9   ? -5.610  7.727  206.502 1.00 76.75  ? 9   DG  F C6     1 
ATOM   9993  O  O6     . DG  F 4 9   ? -6.432  8.619  206.738 1.00 76.11  ? 9   DG  F O6     1 
ATOM   9994  N  N1     . DG  F 4 9   ? -4.361  8.056  205.981 1.00 77.35  ? 9   DG  F N1     1 
ATOM   9995  C  C2     . DG  F 4 9   ? -3.370  7.152  205.682 1.00 89.29  ? 9   DG  F C2     1 
ATOM   9996  N  N2     . DG  F 4 9   ? -2.228  7.651  205.189 1.00 77.69  ? 9   DG  F N2     1 
ATOM   9997  N  N3     . DG  F 4 9   ? -3.488  5.845  205.856 1.00 82.76  ? 9   DG  F N3     1 
ATOM   9998  C  C4     . DG  F 4 9   ? -4.698  5.511  206.362 1.00 78.05  ? 9   DG  F C4     1 
ATOM   9999  H  "H5'"  . DG  F 4 9   ? -6.556  0.035  205.221 1.00 128.47 ? 9   DG  F "H5'"  1 
ATOM   10000 H  "H5''" . DG  F 4 9   ? -5.923  -1.015 206.221 1.00 128.47 ? 9   DG  F "H5''" 1 
ATOM   10001 H  "H4'"  . DG  F 4 9   ? -4.225  0.384  205.556 1.00 116.13 ? 9   DG  F "H4'"  1 
ATOM   10002 H  "H3'"  . DG  F 4 9   ? -4.932  0.567  208.223 1.00 121.06 ? 9   DG  F "H3'"  1 
ATOM   10003 H  "H2'"  . DG  F 4 9   ? -4.443  2.685  208.512 1.00 110.89 ? 9   DG  F "H2'"  1 
ATOM   10004 H  "H2''" . DG  F 4 9   ? -2.990  2.440  207.907 1.00 110.89 ? 9   DG  F "H2''" 1 
ATOM   10005 H  "H1'"  . DG  F 4 9   ? -3.579  3.190  205.935 1.00 113.57 ? 9   DG  F "H1'"  1 
ATOM   10006 H  H8     . DG  F 4 9   ? -6.916  3.642  207.410 1.00 93.78  ? 9   DG  F H8     1 
ATOM   10007 H  H1     . DG  F 4 9   ? -4.197  8.888  205.836 1.00 92.82  ? 9   DG  F H1     1 
ATOM   10008 H  H21    . DG  F 4 9   ? -1.579  7.124  204.989 1.00 93.23  ? 9   DG  F H21    1 
ATOM   10009 H  H22    . DG  F 4 9   ? -2.144  8.499  205.073 1.00 93.23  ? 9   DG  F H22    1 
ATOM   10010 P  P      . DA  F 4 10  ? -2.273  -0.001 209.028 1.00 160.66 ? 10  DA  F P      1 
ATOM   10011 O  OP1    . DA  F 4 10  ? -1.557  -1.295 209.078 1.00 90.53  ? 10  DA  F OP1    1 
ATOM   10012 O  OP2    . DA  F 4 10  ? -3.190  0.379  210.127 1.00 112.75 ? 10  DA  F OP2    1 
ATOM   10013 O  "O5'"  . DA  F 4 10  ? -1.211  1.185  208.838 1.00 136.16 ? 10  DA  F "O5'"  1 
ATOM   10014 C  "C5'"  . DA  F 4 10  ? -0.419  1.247  207.653 1.00 111.36 ? 10  DA  F "C5'"  1 
ATOM   10015 C  "C4'"  . DA  F 4 10  ? 0.472   2.480  207.644 1.00 88.11  ? 10  DA  F "C4'"  1 
ATOM   10016 O  "O4'"  . DA  F 4 10  ? -0.342  3.678  207.533 1.00 101.89 ? 10  DA  F "O4'"  1 
ATOM   10017 C  "C3'"  . DA  F 4 10  ? 1.325   2.669  208.891 1.00 84.01  ? 10  DA  F "C3'"  1 
ATOM   10018 O  "O3'"  . DA  F 4 10  ? 2.620   3.122  208.530 1.00 92.55  ? 10  DA  F "O3'"  1 
ATOM   10019 C  "C2'"  . DA  F 4 10  ? 0.548   3.698  209.708 1.00 78.36  ? 10  DA  F "C2'"  1 
ATOM   10020 C  "C1'"  . DA  F 4 10  ? -0.116  4.540  208.634 1.00 78.23  ? 10  DA  F "C1'"  1 
ATOM   10021 N  N9     . DA  F 4 10  ? -1.401  5.107  209.018 1.00 77.62  ? 10  DA  F N9     1 
ATOM   10022 C  C8     . DA  F 4 10  ? -2.485  4.431  209.498 1.00 91.90  ? 10  DA  F C8     1 
ATOM   10023 N  N7     . DA  F 4 10  ? -3.525  5.193  209.729 1.00 77.04  ? 10  DA  F N7     1 
ATOM   10024 C  C5     . DA  F 4 10  ? -3.095  6.455  209.373 1.00 76.57  ? 10  DA  F C5     1 
ATOM   10025 C  C6     . DA  F 4 10  ? -3.728  7.704  209.392 1.00 75.84  ? 10  DA  F C6     1 
ATOM   10026 N  N6     . DA  F 4 10  ? -4.985  7.881  209.806 1.00 99.79  ? 10  DA  F N6     1 
ATOM   10027 N  N1     . DA  F 4 10  ? -3.019  8.769  208.969 1.00 79.90  ? 10  DA  F N1     1 
ATOM   10028 C  C2     . DA  F 4 10  ? -1.760  8.585  208.560 1.00 75.93  ? 10  DA  F C2     1 
ATOM   10029 N  N3     . DA  F 4 10  ? -1.056  7.458  208.499 1.00 76.62  ? 10  DA  F N3     1 
ATOM   10030 C  C4     . DA  F 4 10  ? -1.790  6.420  208.924 1.00 76.91  ? 10  DA  F C4     1 
ATOM   10031 H  "H5'"  . DA  F 4 10  ? -1.005  1.274  206.881 1.00 133.63 ? 10  DA  F "H5'"  1 
ATOM   10032 H  "H5''" . DA  F 4 10  ? 0.137   0.454  207.602 1.00 133.63 ? 10  DA  F "H5''" 1 
ATOM   10033 H  "H4'"  . DA  F 4 10  ? 1.059   2.432  206.873 1.00 105.74 ? 10  DA  F "H4'"  1 
ATOM   10034 H  "H3'"  . DA  F 4 10  ? 1.387   1.834  209.381 1.00 100.81 ? 10  DA  F "H3'"  1 
ATOM   10035 H  "H2'"  . DA  F 4 10  ? -0.117  3.264  210.265 1.00 94.03  ? 10  DA  F "H2'"  1 
ATOM   10036 H  "H2''" . DA  F 4 10  ? 1.150   4.238  210.244 1.00 94.03  ? 10  DA  F "H2''" 1 
ATOM   10037 H  "H1'"  . DA  F 4 10  ? 0.484   5.253  208.366 1.00 93.88  ? 10  DA  F "H1'"  1 
ATOM   10038 H  H8     . DA  F 4 10  ? -2.486  3.513  209.645 1.00 110.28 ? 10  DA  F H8     1 
ATOM   10039 H  H61    . DA  F 4 10  ? -5.333  8.667  209.801 1.00 119.74 ? 10  DA  F H61    1 
ATOM   10040 H  H62    . DA  F 4 10  ? -5.447  7.208  210.078 1.00 119.74 ? 10  DA  F H62    1 
ATOM   10041 H  H2     . DA  F 4 10  ? -1.314  9.352  208.279 1.00 91.12  ? 10  DA  F H2     1 
ATOM   10042 P  P      . DC  F 4 11  ? 3.804   3.129  209.611 1.00 130.76 ? 11  DC  F P      1 
ATOM   10043 O  OP1    . DC  F 4 11  ? 5.094   3.041  208.891 1.00 102.26 ? 11  DC  F OP1    1 
ATOM   10044 O  OP2    . DC  F 4 11  ? 3.461   2.136  210.651 1.00 109.30 ? 11  DC  F OP2    1 
ATOM   10045 O  "O5'"  . DC  F 4 11  ? 3.700   4.579  210.256 1.00 78.12  ? 11  DC  F "O5'"  1 
ATOM   10046 C  "C5'"  . DC  F 4 11  ? 3.769   5.716  209.421 1.00 96.04  ? 11  DC  F "C5'"  1 
ATOM   10047 C  "C4'"  . DC  F 4 11  ? 3.424   6.975  210.191 1.00 104.48 ? 11  DC  F "C4'"  1 
ATOM   10048 O  "O4'"  . DC  F 4 11  ? 1.992   7.100  210.300 1.00 120.68 ? 11  DC  F "O4'"  1 
ATOM   10049 C  "C3'"  . DC  F 4 11  ? 3.957   7.017  211.625 1.00 76.32  ? 11  DC  F "C3'"  1 
ATOM   10050 O  "O3'"  . DC  F 4 11  ? 5.058   7.920  211.707 1.00 75.97  ? 11  DC  F "O3'"  1 
ATOM   10051 C  "C2'"  . DC  F 4 11  ? 2.746   7.451  212.480 1.00 75.60  ? 11  DC  F "C2'"  1 
ATOM   10052 C  "C1'"  . DC  F 4 11  ? 1.695   7.845  211.450 1.00 75.64  ? 11  DC  F "C1'"  1 
ATOM   10053 N  N1     . DC  F 4 11  ? 0.271   7.551  211.848 1.00 75.46  ? 11  DC  F N1     1 
ATOM   10054 C  C2     . DC  F 4 11  ? -0.680  8.583  211.839 1.00 74.81  ? 11  DC  F C2     1 
ATOM   10055 O  O2     . DC  F 4 11  ? -0.326  9.724  211.523 1.00 74.38  ? 11  DC  F O2     1 
ATOM   10056 N  N3     . DC  F 4 11  ? -1.960  8.300  212.179 1.00 74.67  ? 11  DC  F N3     1 
ATOM   10057 C  C4     . DC  F 4 11  ? -2.302  7.056  212.513 1.00 75.16  ? 11  DC  F C4     1 
ATOM   10058 N  N4     . DC  F 4 11  ? -3.576  6.826  212.842 1.00 79.21  ? 11  DC  F N4     1 
ATOM   10059 C  C5     . DC  F 4 11  ? -1.354  5.989  212.519 1.00 75.83  ? 11  DC  F C5     1 
ATOM   10060 C  C6     . DC  F 4 11  ? -0.094  6.277  212.177 1.00 75.96  ? 11  DC  F C6     1 
ATOM   10061 H  "H5'"  . DC  F 4 11  ? 3.145   5.611  208.686 1.00 115.25 ? 11  DC  F "H5'"  1 
ATOM   10062 H  "H5''" . DC  F 4 11  ? 4.668   5.796  209.065 1.00 115.25 ? 11  DC  F "H5''" 1 
ATOM   10063 H  "H4'"  . DC  F 4 11  ? 3.769   7.741  209.706 1.00 125.37 ? 11  DC  F "H4'"  1 
ATOM   10064 H  "H3'"  . DC  F 4 11  ? 4.243   6.129  211.892 1.00 91.59  ? 11  DC  F "H3'"  1 
ATOM   10065 H  "H2'"  . DC  F 4 11  ? 2.430   6.712  213.023 1.00 90.72  ? 11  DC  F "H2'"  1 
ATOM   10066 H  "H2''" . DC  F 4 11  ? 2.978   8.210  213.037 1.00 90.72  ? 11  DC  F "H2''" 1 
ATOM   10067 H  "H1'"  . DC  F 4 11  ? 1.782   8.790  211.250 1.00 90.77  ? 11  DC  F "H1'"  1 
ATOM   10068 H  H41    . DC  F 4 11  ? -3.827  6.034  213.062 1.00 95.05  ? 11  DC  F H41    1 
ATOM   10069 H  H42    . DC  F 4 11  ? -4.145  7.471  212.834 1.00 95.05  ? 11  DC  F H42    1 
ATOM   10070 H  H5     . DC  F 4 11  ? -1.604  5.124  212.751 1.00 90.99  ? 11  DC  F H5     1 
ATOM   10071 H  H6     . DC  F 4 11  ? 0.545   5.602  212.175 1.00 91.16  ? 11  DC  F H6     1 
ATOM   10072 P  P      . DC  F 4 12  ? 5.628   8.395  213.129 1.00 75.26  ? 12  DC  F P      1 
ATOM   10073 O  OP1    . DC  F 4 12  ? 7.032   8.829  212.941 1.00 75.30  ? 12  DC  F OP1    1 
ATOM   10074 O  OP2    . DC  F 4 12  ? 5.307   7.329  214.106 1.00 85.88  ? 12  DC  F OP2    1 
ATOM   10075 O  "O5'"  . DC  F 4 12  ? 4.732   9.674  213.466 1.00 74.33  ? 12  DC  F "O5'"  1 
ATOM   10076 C  "C5'"  . DC  F 4 12  ? 4.626   10.153 214.792 1.00 77.90  ? 12  DC  F "C5'"  1 
ATOM   10077 C  "C4'"  . DC  F 4 12  ? 3.597   11.258 214.863 1.00 72.83  ? 12  DC  F "C4'"  1 
ATOM   10078 O  "O4'"  . DC  F 4 12  ? 2.362   10.810 214.262 1.00 73.12  ? 12  DC  F "O4'"  1 
ATOM   10079 C  "C3'"  . DC  F 4 12  ? 3.200   11.689 216.258 1.00 72.05  ? 12  DC  F "C3'"  1 
ATOM   10080 O  "O3'"  . DC  F 4 12  ? 4.131   12.629 216.786 1.00 89.00  ? 12  DC  F "O3'"  1 
ATOM   10081 C  "C2'"  . DC  F 4 12  ? 1.815   12.296 216.034 1.00 90.38  ? 12  DC  F "C2'"  1 
ATOM   10082 C  "C1'"  . DC  F 4 12  ? 1.280   11.542 214.812 1.00 72.41  ? 12  DC  F "C1'"  1 
ATOM   10083 N  N1     . DC  F 4 12  ? 0.186   10.597 215.133 1.00 72.65  ? 12  DC  F N1     1 
ATOM   10084 C  C2     . DC  F 4 12  ? -1.130  11.068 215.236 1.00 72.22  ? 12  DC  F C2     1 
ATOM   10085 O  O2     . DC  F 4 12  ? -1.357  12.273 215.055 1.00 71.64  ? 12  DC  F O2     1 
ATOM   10086 N  N3     . DC  F 4 12  ? -2.116  10.187 215.531 1.00 72.45  ? 12  DC  F N3     1 
ATOM   10087 C  C4     . DC  F 4 12  ? -1.822  8.899  215.719 1.00 73.08  ? 12  DC  F C4     1 
ATOM   10088 N  N4     . DC  F 4 12  ? -2.824  8.063  216.004 1.00 73.30  ? 12  DC  F N4     1 
ATOM   10089 C  C5     . DC  F 4 12  ? -0.490  8.407  215.616 1.00 73.53  ? 12  DC  F C5     1 
ATOM   10090 C  C6     . DC  F 4 12  ? 0.472   9.283  215.325 1.00 73.30  ? 12  DC  F C6     1 
ATOM   10091 H  "H5'"  . DC  F 4 12  ? 5.487   10.496 215.079 1.00 93.48  ? 12  DC  F "H5'"  1 
ATOM   10092 H  "H5''" . DC  F 4 12  ? 4.359   9.427  215.376 1.00 93.48  ? 12  DC  F "H5''" 1 
ATOM   10093 H  "H4'"  . DC  F 4 12  ? 3.925   12.030 214.375 1.00 87.39  ? 12  DC  F "H4'"  1 
ATOM   10094 H  "H3'"  . DC  F 4 12  ? 3.136   10.916 216.840 1.00 86.46  ? 12  DC  F "H3'"  1 
ATOM   10095 H  "HO3'" . DC  F 4 12  ? 3.872   13.398 217.006 1.00 106.80 ? 12  DC  F "HO3'" 1 
ATOM   10096 H  "H2'"  . DC  F 4 12  ? 1.247   12.142 216.805 1.00 108.45 ? 12  DC  F "H2'"  1 
ATOM   10097 H  "H2''" . DC  F 4 12  ? 1.886   13.245 215.845 1.00 108.45 ? 12  DC  F "H2''" 1 
ATOM   10098 H  "H1'"  . DC  F 4 12  ? 0.964   12.183 214.156 1.00 86.89  ? 12  DC  F "H1'"  1 
ATOM   10099 H  H41    . DC  F 4 12  ? -2.664  7.228  216.130 1.00 87.95  ? 12  DC  F H41    1 
ATOM   10100 H  H42    . DC  F 4 12  ? -3.628  8.361  216.062 1.00 87.95  ? 12  DC  F H42    1 
ATOM   10101 H  H5     . DC  F 4 12  ? -0.298  7.506  215.747 1.00 88.24  ? 12  DC  F H5     1 
ATOM   10102 H  H6     . DC  F 4 12  ? 1.352   8.990  215.252 1.00 87.95  ? 12  DC  F H6     1 
ATOM   10103 C  "C5'"  . DG  G 3 1   ? 3.431   5.480  216.431 1.00 54.87  ? 1   DG  G "C5'"  1 
ATOM   10104 C  "C4'"  . DG  G 3 1   ? 3.708   6.894  216.908 1.00 58.36  ? 1   DG  G "C4'"  1 
ATOM   10105 O  "O4'"  . DG  G 3 1   ? 2.453   7.608  217.042 1.00 65.61  ? 1   DG  G "O4'"  1 
ATOM   10106 C  "C3'"  . DG  G 3 1   ? 4.408   7.001  218.262 1.00 64.03  ? 1   DG  G "C3'"  1 
ATOM   10107 O  "O3'"  . DG  G 3 1   ? 5.494   7.924  218.174 1.00 54.77  ? 1   DG  G "O3'"  1 
ATOM   10108 C  "C2'"  . DG  G 3 1   ? 3.304   7.466  219.221 1.00 40.24  ? 1   DG  G "C2'"  1 
ATOM   10109 C  "C1'"  . DG  G 3 1   ? 2.359   8.224  218.311 1.00 41.84  ? 1   DG  G "C1'"  1 
ATOM   10110 N  N9     . DG  G 3 1   ? 0.953   8.195  218.710 1.00 40.71  ? 1   DG  G N9     1 
ATOM   10111 C  C8     . DG  G 3 1   ? 0.187   7.086  218.972 1.00 41.81  ? 1   DG  G C8     1 
ATOM   10112 N  N7     . DG  G 3 1   ? -1.056  7.368  219.264 1.00 80.33  ? 1   DG  G N7     1 
ATOM   10113 C  C5     . DG  G 3 1   ? -1.122  8.751  219.168 1.00 41.07  ? 1   DG  G C5     1 
ATOM   10114 C  C6     . DG  G 3 1   ? -2.214  9.628  219.371 1.00 41.53  ? 1   DG  G C6     1 
ATOM   10115 O  O6     . DG  G 3 1   ? -3.374  9.343  219.684 1.00 79.81  ? 1   DG  G O6     1 
ATOM   10116 N  N1     . DG  G 3 1   ? -1.852  10.960 219.174 1.00 42.07  ? 1   DG  G N1     1 
ATOM   10117 C  C2     . DG  G 3 1   ? -0.594  11.385 218.820 1.00 58.18  ? 1   DG  G C2     1 
ATOM   10118 N  N2     . DG  G 3 1   ? -0.425  12.708 218.670 1.00 89.85  ? 1   DG  G N2     1 
ATOM   10119 N  N3     . DG  G 3 1   ? 0.437   10.570 218.629 1.00 41.75  ? 1   DG  G N3     1 
ATOM   10120 C  C4     . DG  G 3 1   ? 0.101   9.274  218.818 1.00 41.21  ? 1   DG  G C4     1 
ATOM   10121 H  "H4'"  . DG  G 3 1   ? 4.252   7.345  216.242 1.00 70.03  ? 1   DG  G "H4'"  1 
ATOM   10122 H  "H3'"  . DG  G 3 1   ? 4.736   6.130  218.534 1.00 76.84  ? 1   DG  G "H3'"  1 
ATOM   10123 H  "H2'"  . DG  G 3 1   ? 2.857   6.705  219.622 1.00 48.29  ? 1   DG  G "H2'"  1 
ATOM   10124 H  "H2''" . DG  G 3 1   ? 3.667   8.052  219.903 1.00 48.29  ? 1   DG  G "H2''" 1 
ATOM   10125 H  "H1'"  . DG  G 3 1   ? 2.653   9.146  218.241 1.00 50.21  ? 1   DG  G "H1'"  1 
ATOM   10126 H  H8     . DG  G 3 1   ? 0.524   6.219  218.960 1.00 50.17  ? 1   DG  G H8     1 
ATOM   10127 H  H1     . DG  G 3 1   ? -2.462  11.559 219.276 1.00 50.48  ? 1   DG  G H1     1 
ATOM   10128 H  H21    . DG  G 3 1   ? 0.346   13.021 218.452 1.00 107.83 ? 1   DG  G H21    1 
ATOM   10129 H  H22    . DG  G 3 1   ? -1.087  13.243 218.791 1.00 107.83 ? 1   DG  G H22    1 
ATOM   10130 P  P      . DG  G 3 2   ? 6.382   8.268  219.466 1.00 74.38  ? 2   DG  G P      1 
ATOM   10131 O  OP1    . DG  G 3 2   ? 7.740   8.648  219.024 1.00 40.70  ? 2   DG  G OP1    1 
ATOM   10132 O  OP2    . DG  G 3 2   ? 6.216   7.160  220.431 1.00 39.93  ? 2   DG  G OP2    1 
ATOM   10133 O  "O5'"  . DG  G 3 2   ? 5.679   9.571  220.052 1.00 50.81  ? 2   DG  G "O5'"  1 
ATOM   10134 C  "C5'"  . DG  G 3 2   ? 5.746   10.798 219.334 1.00 45.25  ? 2   DG  G "C5'"  1 
ATOM   10135 C  "C4'"  . DG  G 3 2   ? 4.970   11.878 220.060 1.00 73.03  ? 2   DG  G "C4'"  1 
ATOM   10136 O  "O4'"  . DG  G 3 2   ? 3.586   11.487 220.161 1.00 41.81  ? 2   DG  G "O4'"  1 
ATOM   10137 C  "C3'"  . DG  G 3 2   ? 5.425   12.129 221.496 1.00 71.46  ? 2   DG  G "C3'"  1 
ATOM   10138 O  "O3'"  . DG  G 3 2   ? 6.154   13.337 221.582 1.00 75.24  ? 2   DG  G "O3'"  1 
ATOM   10139 C  "C2'"  . DG  G 3 2   ? 4.133   12.179 222.322 1.00 42.28  ? 2   DG  G "C2'"  1 
ATOM   10140 C  "C1'"  . DG  G 3 2   ? 3.028   12.121 221.279 1.00 47.14  ? 2   DG  G "C1'"  1 
ATOM   10141 N  N9     . DG  G 3 2   ? 1.841   11.374 221.685 1.00 41.71  ? 2   DG  G N9     1 
ATOM   10142 C  C8     . DG  G 3 2   ? 1.731   10.014 221.859 1.00 46.97  ? 2   DG  G C8     1 
ATOM   10143 N  N7     . DG  G 3 2   ? 0.528   9.632  222.202 1.00 59.73  ? 2   DG  G N7     1 
ATOM   10144 C  C5     . DG  G 3 2   ? -0.205  10.813 222.242 1.00 41.60  ? 2   DG  G C5     1 
ATOM   10145 C  C6     . DG  G 3 2   ? -1.567  11.032 222.552 1.00 42.20  ? 2   DG  G C6     1 
ATOM   10146 O  O6     . DG  G 3 2   ? -2.427  10.197 222.862 1.00 41.93  ? 2   DG  G O6     1 
ATOM   10147 N  N1     . DG  G 3 2   ? -1.902  12.384 222.478 1.00 42.46  ? 2   DG  G N1     1 
ATOM   10148 C  C2     . DG  G 3 2   ? -1.028  13.390 222.146 1.00 59.42  ? 2   DG  G C2     1 
ATOM   10149 N  N2     . DG  G 3 2   ? -1.519  14.635 222.128 1.00 66.53  ? 2   DG  G N2     1 
ATOM   10150 N  N3     . DG  G 3 2   ? 0.248   13.194 221.858 1.00 43.33  ? 2   DG  G N3     1 
ATOM   10151 C  C4     . DG  G 3 2   ? 0.589   11.889 221.923 1.00 42.01  ? 2   DG  G C4     1 
ATOM   10152 H  "H5'"  . DG  G 3 2   ? 5.368   10.672 218.450 1.00 54.30  ? 2   DG  G "H5'"  1 
ATOM   10153 H  "H5''" . DG  G 3 2   ? 6.673   11.070 219.251 1.00 54.30  ? 2   DG  G "H5''" 1 
ATOM   10154 H  "H4'"  . DG  G 3 2   ? 5.031   12.705 219.558 1.00 87.63  ? 2   DG  G "H4'"  1 
ATOM   10155 H  "H3'"  . DG  G 3 2   ? 5.978   11.391 221.798 1.00 85.76  ? 2   DG  G "H3'"  1 
ATOM   10156 H  "H2'"  . DG  G 3 2   ? 4.080   11.414 222.916 1.00 50.74  ? 2   DG  G "H2'"  1 
ATOM   10157 H  "H2''" . DG  G 3 2   ? 4.082   13.006 222.825 1.00 50.74  ? 2   DG  G "H2''" 1 
ATOM   10158 H  "H1'"  . DG  G 3 2   ? 2.770   13.024 221.038 1.00 56.57  ? 2   DG  G "H1'"  1 
ATOM   10159 H  H8     . DG  G 3 2   ? 2.443   9.425  221.752 1.00 56.36  ? 2   DG  G H8     1 
ATOM   10160 H  H1     . DG  G 3 2   ? -2.714  12.604 222.653 1.00 50.95  ? 2   DG  G H1     1 
ATOM   10161 H  H21    . DG  G 3 2   ? -1.007  15.297 221.930 1.00 79.83  ? 2   DG  G H21    1 
ATOM   10162 H  H22    . DG  G 3 2   ? -2.348  14.773 222.313 1.00 79.83  ? 2   DG  G H22    1 
ATOM   10163 P  P      . DT  G 3 3   ? 6.792   13.782 222.981 1.00 86.86  ? 3   DT  G P      1 
ATOM   10164 O  OP1    . DT  G 3 3   ? 7.942   14.686 222.757 1.00 47.01  ? 3   DT  G OP1    1 
ATOM   10165 O  OP2    . DT  G 3 3   ? 6.954   12.541 223.765 1.00 81.37  ? 3   DT  G OP2    1 
ATOM   10166 O  "O5'"  . DT  G 3 3   ? 5.636   14.638 223.652 1.00 56.81  ? 3   DT  G "O5'"  1 
ATOM   10167 C  "C5'"  . DT  G 3 3   ? 5.332   15.928 223.160 1.00 45.37  ? 3   DT  G "C5'"  1 
ATOM   10168 C  "C4'"  . DT  G 3 3   ? 4.255   16.569 224.002 1.00 62.73  ? 3   DT  G "C4'"  1 
ATOM   10169 O  "O4'"  . DT  G 3 3   ? 3.011   15.876 223.790 1.00 45.19  ? 3   DT  G "O4'"  1 
ATOM   10170 C  "C3'"  . DT  G 3 3   ? 4.502   16.481 225.503 1.00 96.19  ? 3   DT  G "C3'"  1 
ATOM   10171 O  "O3'"  . DT  G 3 3   ? 5.287   17.602 225.993 1.00 91.71  ? 3   DT  G "O3'"  1 
ATOM   10172 C  "C2'"  . DT  G 3 3   ? 3.099   16.418 226.100 1.00 60.85  ? 3   DT  G "C2'"  1 
ATOM   10173 C  "C1'"  . DT  G 3 3   ? 2.200   16.011 224.935 1.00 47.21  ? 3   DT  G "C1'"  1 
ATOM   10174 N  N1     . DT  G 3 3   ? 1.479   14.728 225.166 1.00 44.07  ? 3   DT  G N1     1 
ATOM   10175 C  C2     . DT  G 3 3   ? 0.132   14.755 225.433 1.00 44.20  ? 3   DT  G C2     1 
ATOM   10176 O  O2     . DT  G 3 3   ? -0.517  15.782 225.482 1.00 52.32  ? 3   DT  G O2     1 
ATOM   10177 N  N3     . DT  G 3 3   ? -0.437  13.532 225.631 1.00 42.62  ? 3   DT  G N3     1 
ATOM   10178 C  C4     . DT  G 3 3   ? 0.199   12.304 225.600 1.00 42.49  ? 3   DT  G C4     1 
ATOM   10179 O  O4     . DT  G 3 3   ? -0.395  11.253 225.792 1.00 42.13  ? 3   DT  G O4     1 
ATOM   10180 C  C5     . DT  G 3 3   ? 1.612   12.343 225.325 1.00 60.61  ? 3   DT  G C5     1 
ATOM   10181 C  C7     . DT  G 3 3   ? 2.401   11.066 225.278 1.00 41.56  ? 3   DT  G C7     1 
ATOM   10182 C  C6     . DT  G 3 3   ? 2.182   13.539 225.126 1.00 53.22  ? 3   DT  G C6     1 
ATOM   10183 H  "H5'"  . DT  G 3 3   ? 5.023   15.857 222.243 1.00 54.44  ? 3   DT  G "H5'"  1 
ATOM   10184 H  "H5''" . DT  G 3 3   ? 6.131   16.478 223.187 1.00 54.44  ? 3   DT  G "H5''" 1 
ATOM   10185 H  "H4'"  . DT  G 3 3   ? 4.154   17.499 223.745 1.00 75.28  ? 3   DT  G "H4'"  1 
ATOM   10186 H  "H3'"  . DT  G 3 3   ? 4.970   15.654 225.700 1.00 115.42 ? 3   DT  G "H3'"  1 
ATOM   10187 H  "H2'"  . DT  G 3 3   ? 3.062   15.752 226.804 1.00 73.02  ? 3   DT  G "H2'"  1 
ATOM   10188 H  "H2''" . DT  G 3 3   ? 2.838   17.287 226.441 1.00 73.02  ? 3   DT  G "H2''" 1 
ATOM   10189 H  "H1'"  . DT  G 3 3   ? 1.550   16.714 224.779 1.00 56.65  ? 3   DT  G "H1'"  1 
ATOM   10190 H  H3     . DT  G 3 3   ? -1.281  13.524 225.796 1.00 51.14  ? 3   DT  G H3     1 
ATOM   10191 H  H71    . DT  G 3 3   ? 1.812   10.315 22