data_5NKS
# 
_entry.id   5NKS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NKS         
WWPDB D_1200004271 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NKS 
_pdbx_database_status.recvd_initial_deposition_date   2017-03-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mathea, S.'          1  ? 
'Elkins, J.M.'        2  ? 
'Strain-Damerell, C.' 3  ? 
'Salah, E.'           4  ? 
'Borkowska, O.'       5  ? 
'Chalk, R.'           6  ? 
'Burgess-Brown, N.'   7  ? 
'Pinkas, D.M.'        8  ? 
'von Delft, F.'       9  ? 
'Krojer, T.'          10 ? 
'Arrowsmith, C.H.'    11 ? 
'Edwards, A.M.'       12 ? 
'Bountra, C.'         13 ? 
'Knapp, S.'           14 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Human Dihydropyrimidinase-related Protein 4 (DPYSL4, CRMP3, ULIP-4)' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mathea, S.' 1 
primary 'Knapp, S.'  2 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NKS 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     80.470 
_cell.length_a_esd                 ? 
_cell.length_b                     102.650 
_cell.length_b_esd                 ? 
_cell.length_c                     116.990 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NKS 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Dihydropyrimidinase-related protein 4' 62043.570 1   ? ? ? ? 
2 water   nat water                                   18.015    314 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DRP-4,Collapsin response mediator protein 3,CRMP-3,UNC33-like phosphoprotein 4,ULIP-4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGVDVHTRLQMP
VLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYEQWRERADSAACCDYSLHVDITRWHESIKEELEALVKEK
GVNSFLVFMAYKDRCQCSDSQMYEIFSIIRDLGALAQVHAENGDIVEEEQKRLLELGITGPEGHVLSHPEEVEAEAVYRA
VTIAKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTC
LLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKG
RVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVY
KRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM
APPGGRSNITSLS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGVDVHTRLQMP
VLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYEQWRERADSAACCDYSLHVDITRWHESIKEELEALVKEK
GVNSFLVFMAYKDRCQCSDSQMYEIFSIIRDLGALAQVHAENGDIVEEEQKRLLELGITGPEGHVLSHPEEVEAEAVYRA
VTIAKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTC
LLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKG
RVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVY
KRIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIM
APPGGRSNITSLS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   SER n 
1 4   PHE n 
1 5   GLN n 
1 6   GLY n 
1 7   LYS n 
1 8   LYS n 
1 9   SER n 
1 10  ILE n 
1 11  PRO n 
1 12  ARG n 
1 13  ILE n 
1 14  THR n 
1 15  SER n 
1 16  ASP n 
1 17  ARG n 
1 18  LEU n 
1 19  LEU n 
1 20  ILE n 
1 21  ARG n 
1 22  GLY n 
1 23  GLY n 
1 24  ARG n 
1 25  ILE n 
1 26  VAL n 
1 27  ASN n 
1 28  ASP n 
1 29  ASP n 
1 30  GLN n 
1 31  SER n 
1 32  PHE n 
1 33  TYR n 
1 34  ALA n 
1 35  ASP n 
1 36  VAL n 
1 37  HIS n 
1 38  VAL n 
1 39  GLU n 
1 40  ASP n 
1 41  GLY n 
1 42  LEU n 
1 43  ILE n 
1 44  LYS n 
1 45  GLN n 
1 46  ILE n 
1 47  GLY n 
1 48  GLU n 
1 49  ASN n 
1 50  LEU n 
1 51  ILE n 
1 52  VAL n 
1 53  PRO n 
1 54  GLY n 
1 55  GLY n 
1 56  ILE n 
1 57  LYS n 
1 58  THR n 
1 59  ILE n 
1 60  ASP n 
1 61  ALA n 
1 62  HIS n 
1 63  GLY n 
1 64  LEU n 
1 65  MET n 
1 66  VAL n 
1 67  LEU n 
1 68  PRO n 
1 69  GLY n 
1 70  GLY n 
1 71  VAL n 
1 72  ASP n 
1 73  VAL n 
1 74  HIS n 
1 75  THR n 
1 76  ARG n 
1 77  LEU n 
1 78  GLN n 
1 79  MET n 
1 80  PRO n 
1 81  VAL n 
1 82  LEU n 
1 83  GLY n 
1 84  MET n 
1 85  THR n 
1 86  PRO n 
1 87  ALA n 
1 88  ASP n 
1 89  ASP n 
1 90  PHE n 
1 91  CYS n 
1 92  GLN n 
1 93  GLY n 
1 94  THR n 
1 95  LYS n 
1 96  ALA n 
1 97  ALA n 
1 98  LEU n 
1 99  ALA n 
1 100 GLY n 
1 101 GLY n 
1 102 THR n 
1 103 THR n 
1 104 MET n 
1 105 ILE n 
1 106 LEU n 
1 107 ASP n 
1 108 HIS n 
1 109 VAL n 
1 110 PHE n 
1 111 PRO n 
1 112 ASP n 
1 113 THR n 
1 114 GLY n 
1 115 VAL n 
1 116 SER n 
1 117 LEU n 
1 118 LEU n 
1 119 ALA n 
1 120 ALA n 
1 121 TYR n 
1 122 GLU n 
1 123 GLN n 
1 124 TRP n 
1 125 ARG n 
1 126 GLU n 
1 127 ARG n 
1 128 ALA n 
1 129 ASP n 
1 130 SER n 
1 131 ALA n 
1 132 ALA n 
1 133 CYS n 
1 134 CYS n 
1 135 ASP n 
1 136 TYR n 
1 137 SER n 
1 138 LEU n 
1 139 HIS n 
1 140 VAL n 
1 141 ASP n 
1 142 ILE n 
1 143 THR n 
1 144 ARG n 
1 145 TRP n 
1 146 HIS n 
1 147 GLU n 
1 148 SER n 
1 149 ILE n 
1 150 LYS n 
1 151 GLU n 
1 152 GLU n 
1 153 LEU n 
1 154 GLU n 
1 155 ALA n 
1 156 LEU n 
1 157 VAL n 
1 158 LYS n 
1 159 GLU n 
1 160 LYS n 
1 161 GLY n 
1 162 VAL n 
1 163 ASN n 
1 164 SER n 
1 165 PHE n 
1 166 LEU n 
1 167 VAL n 
1 168 PHE n 
1 169 MET n 
1 170 ALA n 
1 171 TYR n 
1 172 LYS n 
1 173 ASP n 
1 174 ARG n 
1 175 CYS n 
1 176 GLN n 
1 177 CYS n 
1 178 SER n 
1 179 ASP n 
1 180 SER n 
1 181 GLN n 
1 182 MET n 
1 183 TYR n 
1 184 GLU n 
1 185 ILE n 
1 186 PHE n 
1 187 SER n 
1 188 ILE n 
1 189 ILE n 
1 190 ARG n 
1 191 ASP n 
1 192 LEU n 
1 193 GLY n 
1 194 ALA n 
1 195 LEU n 
1 196 ALA n 
1 197 GLN n 
1 198 VAL n 
1 199 HIS n 
1 200 ALA n 
1 201 GLU n 
1 202 ASN n 
1 203 GLY n 
1 204 ASP n 
1 205 ILE n 
1 206 VAL n 
1 207 GLU n 
1 208 GLU n 
1 209 GLU n 
1 210 GLN n 
1 211 LYS n 
1 212 ARG n 
1 213 LEU n 
1 214 LEU n 
1 215 GLU n 
1 216 LEU n 
1 217 GLY n 
1 218 ILE n 
1 219 THR n 
1 220 GLY n 
1 221 PRO n 
1 222 GLU n 
1 223 GLY n 
1 224 HIS n 
1 225 VAL n 
1 226 LEU n 
1 227 SER n 
1 228 HIS n 
1 229 PRO n 
1 230 GLU n 
1 231 GLU n 
1 232 VAL n 
1 233 GLU n 
1 234 ALA n 
1 235 GLU n 
1 236 ALA n 
1 237 VAL n 
1 238 TYR n 
1 239 ARG n 
1 240 ALA n 
1 241 VAL n 
1 242 THR n 
1 243 ILE n 
1 244 ALA n 
1 245 LYS n 
1 246 GLN n 
1 247 ALA n 
1 248 ASN n 
1 249 CYS n 
1 250 PRO n 
1 251 LEU n 
1 252 TYR n 
1 253 VAL n 
1 254 THR n 
1 255 LYS n 
1 256 VAL n 
1 257 MET n 
1 258 SER n 
1 259 LYS n 
1 260 GLY n 
1 261 ALA n 
1 262 ALA n 
1 263 ASP n 
1 264 ALA n 
1 265 ILE n 
1 266 ALA n 
1 267 GLN n 
1 268 ALA n 
1 269 LYS n 
1 270 ARG n 
1 271 ARG n 
1 272 GLY n 
1 273 VAL n 
1 274 VAL n 
1 275 VAL n 
1 276 PHE n 
1 277 GLY n 
1 278 GLU n 
1 279 PRO n 
1 280 ILE n 
1 281 THR n 
1 282 ALA n 
1 283 SER n 
1 284 LEU n 
1 285 GLY n 
1 286 THR n 
1 287 ASP n 
1 288 GLY n 
1 289 SER n 
1 290 HIS n 
1 291 TYR n 
1 292 TRP n 
1 293 SER n 
1 294 LYS n 
1 295 ASN n 
1 296 TRP n 
1 297 ALA n 
1 298 LYS n 
1 299 ALA n 
1 300 ALA n 
1 301 ALA n 
1 302 PHE n 
1 303 VAL n 
1 304 THR n 
1 305 SER n 
1 306 PRO n 
1 307 PRO n 
1 308 VAL n 
1 309 ASN n 
1 310 PRO n 
1 311 ASP n 
1 312 PRO n 
1 313 THR n 
1 314 THR n 
1 315 ALA n 
1 316 ASP n 
1 317 HIS n 
1 318 LEU n 
1 319 THR n 
1 320 CYS n 
1 321 LEU n 
1 322 LEU n 
1 323 SER n 
1 324 SER n 
1 325 GLY n 
1 326 ASP n 
1 327 LEU n 
1 328 GLN n 
1 329 VAL n 
1 330 THR n 
1 331 GLY n 
1 332 SER n 
1 333 ALA n 
1 334 HIS n 
1 335 CYS n 
1 336 THR n 
1 337 PHE n 
1 338 THR n 
1 339 THR n 
1 340 ALA n 
1 341 GLN n 
1 342 LYS n 
1 343 ALA n 
1 344 VAL n 
1 345 GLY n 
1 346 LYS n 
1 347 ASP n 
1 348 ASN n 
1 349 PHE n 
1 350 ALA n 
1 351 LEU n 
1 352 ILE n 
1 353 PRO n 
1 354 GLU n 
1 355 GLY n 
1 356 THR n 
1 357 ASN n 
1 358 GLY n 
1 359 ILE n 
1 360 GLU n 
1 361 GLU n 
1 362 ARG n 
1 363 MET n 
1 364 SER n 
1 365 MET n 
1 366 VAL n 
1 367 TRP n 
1 368 GLU n 
1 369 LYS n 
1 370 CYS n 
1 371 VAL n 
1 372 ALA n 
1 373 SER n 
1 374 GLY n 
1 375 LYS n 
1 376 MET n 
1 377 ASP n 
1 378 GLU n 
1 379 ASN n 
1 380 GLU n 
1 381 PHE n 
1 382 VAL n 
1 383 ALA n 
1 384 VAL n 
1 385 THR n 
1 386 SER n 
1 387 THR n 
1 388 ASN n 
1 389 ALA n 
1 390 ALA n 
1 391 LYS n 
1 392 ILE n 
1 393 PHE n 
1 394 ASN n 
1 395 PHE n 
1 396 TYR n 
1 397 PRO n 
1 398 ARG n 
1 399 LYS n 
1 400 GLY n 
1 401 ARG n 
1 402 VAL n 
1 403 ALA n 
1 404 VAL n 
1 405 GLY n 
1 406 SER n 
1 407 ASP n 
1 408 ALA n 
1 409 ASP n 
1 410 LEU n 
1 411 VAL n 
1 412 ILE n 
1 413 TRP n 
1 414 ASN n 
1 415 PRO n 
1 416 LYS n 
1 417 ALA n 
1 418 THR n 
1 419 LYS n 
1 420 ILE n 
1 421 ILE n 
1 422 SER n 
1 423 ALA n 
1 424 LYS n 
1 425 THR n 
1 426 HIS n 
1 427 ASN n 
1 428 LEU n 
1 429 ASN n 
1 430 VAL n 
1 431 GLU n 
1 432 TYR n 
1 433 ASN n 
1 434 ILE n 
1 435 PHE n 
1 436 GLU n 
1 437 GLY n 
1 438 VAL n 
1 439 GLU n 
1 440 CYS n 
1 441 ARG n 
1 442 GLY n 
1 443 ALA n 
1 444 PRO n 
1 445 ALA n 
1 446 VAL n 
1 447 VAL n 
1 448 ILE n 
1 449 SER n 
1 450 GLN n 
1 451 GLY n 
1 452 ARG n 
1 453 VAL n 
1 454 ALA n 
1 455 LEU n 
1 456 GLU n 
1 457 ASP n 
1 458 GLY n 
1 459 LYS n 
1 460 MET n 
1 461 PHE n 
1 462 VAL n 
1 463 THR n 
1 464 PRO n 
1 465 GLY n 
1 466 ALA n 
1 467 GLY n 
1 468 ARG n 
1 469 PHE n 
1 470 VAL n 
1 471 PRO n 
1 472 ARG n 
1 473 LYS n 
1 474 THR n 
1 475 PHE n 
1 476 PRO n 
1 477 ASP n 
1 478 PHE n 
1 479 VAL n 
1 480 TYR n 
1 481 LYS n 
1 482 ARG n 
1 483 ILE n 
1 484 LYS n 
1 485 ALA n 
1 486 ARG n 
1 487 ASN n 
1 488 ARG n 
1 489 LEU n 
1 490 ALA n 
1 491 GLU n 
1 492 ILE n 
1 493 HIS n 
1 494 GLY n 
1 495 VAL n 
1 496 PRO n 
1 497 ARG n 
1 498 GLY n 
1 499 LEU n 
1 500 TYR n 
1 501 ASP n 
1 502 GLY n 
1 503 PRO n 
1 504 VAL n 
1 505 HIS n 
1 506 GLU n 
1 507 VAL n 
1 508 MET n 
1 509 VAL n 
1 510 PRO n 
1 511 ALA n 
1 512 LYS n 
1 513 PRO n 
1 514 GLY n 
1 515 SER n 
1 516 GLY n 
1 517 ALA n 
1 518 PRO n 
1 519 ALA n 
1 520 ARG n 
1 521 ALA n 
1 522 SER n 
1 523 CYS n 
1 524 PRO n 
1 525 GLY n 
1 526 LYS n 
1 527 ILE n 
1 528 SER n 
1 529 VAL n 
1 530 PRO n 
1 531 PRO n 
1 532 VAL n 
1 533 ARG n 
1 534 ASN n 
1 535 LEU n 
1 536 HIS n 
1 537 GLN n 
1 538 SER n 
1 539 GLY n 
1 540 PHE n 
1 541 SER n 
1 542 LEU n 
1 543 SER n 
1 544 GLY n 
1 545 SER n 
1 546 GLN n 
1 547 ALA n 
1 548 ASP n 
1 549 ASP n 
1 550 HIS n 
1 551 ILE n 
1 552 ALA n 
1 553 ARG n 
1 554 ARG n 
1 555 THR n 
1 556 ALA n 
1 557 GLN n 
1 558 LYS n 
1 559 ILE n 
1 560 MET n 
1 561 ALA n 
1 562 PRO n 
1 563 PRO n 
1 564 GLY n 
1 565 GLY n 
1 566 ARG n 
1 567 SER n 
1 568 ASN n 
1 569 ILE n 
1 570 THR n 
1 571 SER n 
1 572 LEU n 
1 573 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   573 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DPYSL4, CRMP3, ULIP4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPYL4_HUMAN 
_struct_ref.pdbx_db_accession          O14531 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGGVDVHTRLQMPV
LGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYEQWRERADSAACCDYSLHVDITRWHESIKEELEALVKEKG
VNSFLVFMAYKDRCQCSDSQMYEIFSIIRDLGALAQVHAENGDIVEEEQKRLLELGITGPEGHVLSHPEEVEAEAVYRAV
TIAKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCL
LSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGR
VAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYK
RIKARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA
PPGGRSNITSLS
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5NKS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 573 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O14531 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  572 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       572 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             5NKS 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O14531 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NKS 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.95 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         36.82 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M Bis-tris-propane
0.2 M Sodium fluoride
10% Ethylene glycol
20% PEG3350
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-03-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9797 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9797 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5NKS 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.80 
_reflns.d_resolution_low                 27.85 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       44328 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.0 
_reflns.pdbx_Rmerge_I_obs                0.080 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.80 
_reflns_shell.d_res_low                   1.84 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2548 
_reflns_shell.percent_possible_all        96.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.651 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -1.69 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            2.04 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -0.34 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               23.729 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.971 
_refine.correlation_coeff_Fo_to_Fc_free          0.953 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5NKS 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.80 
_refine.ls_d_res_low                             77.16 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     42105 
_refine.ls_number_reflns_R_free                  2200 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.03 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.15680 
_refine.ls_R_factor_R_free                       0.20049 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.15452 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      4BKN 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.113 
_refine.pdbx_overall_ESU_R_Free                  0.115 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             3.332 
_refine.overall_SU_ML                            0.096 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3698 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             314 
_refine_hist.number_atoms_total               4012 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        77.16 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.018  0.019  3826 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  3613 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.831  1.945  5206 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.055  3.000  8309 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.992  5.000  499  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 34.116 24.321 162  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 13.163 15.000 617  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.301 15.000 21   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.113  0.200  592  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.009  0.021  4401 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  856  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.904  2.173  1981 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.897  2.171  1980 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.685  3.247  2482 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.685  3.249  2483 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.922  2.497  1844 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.921  2.499  1845 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.330  3.622  2724 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.875  18.403 4491 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.762  18.111 4378 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.800 
_refine_ls_shell.d_res_low                        1.847 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             150 
_refine_ls_shell.number_reflns_R_work             3003 
_refine_ls_shell.percent_reflns_obs               96.30 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.324 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.281 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5NKS 
_struct.title                        'Human Dihydropyrimidinase-related Protein 4 (DPYSL4, CRMP3, ULIP-4)' 
_struct.pdbx_descriptor              'Dihydropyrimidinase-related protein 4' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NKS 
_struct_keywords.text            'Hydrolase, Cytoskeleton, Neuroplasticity, Tetramerisation' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 89  ? GLY A 100 ? ASP A 88  GLY A 99  1 ? 12 
HELX_P HELX_P2  AA2 SER A 116 ? ALA A 132 ? SER A 115 ALA A 131 1 ? 17 
HELX_P HELX_P3  AA3 SER A 148 ? LYS A 160 ? SER A 147 LYS A 159 1 ? 13 
HELX_P HELX_P4  AA4 SER A 178 ? LEU A 192 ? SER A 177 LEU A 191 1 ? 15 
HELX_P HELX_P5  AA5 ASN A 202 ? LEU A 216 ? ASN A 201 LEU A 215 1 ? 15 
HELX_P HELX_P6  AA6 GLY A 220 ? SER A 227 ? GLY A 219 SER A 226 1 ? 8  
HELX_P HELX_P7  AA7 PRO A 229 ? ASN A 248 ? PRO A 228 ASN A 247 1 ? 20 
HELX_P HELX_P8  AA8 SER A 258 ? ARG A 271 ? SER A 257 ARG A 270 1 ? 14 
HELX_P HELX_P9  AA9 ILE A 280 ? THR A 286 ? ILE A 279 THR A 285 1 ? 7  
HELX_P HELX_P10 AB1 ASP A 287 ? SER A 293 ? ASP A 286 SER A 292 5 ? 7  
HELX_P HELX_P11 AB2 ASN A 295 ? PHE A 302 ? ASN A 294 PHE A 301 1 ? 8  
HELX_P HELX_P12 AB3 THR A 313 ? SER A 324 ? THR A 312 SER A 323 1 ? 12 
HELX_P HELX_P13 AB4 THR A 338 ? ALA A 343 ? THR A 337 ALA A 342 1 ? 6  
HELX_P HELX_P14 AB5 VAL A 344 ? LYS A 346 ? VAL A 343 LYS A 345 5 ? 3  
HELX_P HELX_P15 AB6 ASN A 348 ? ILE A 352 ? ASN A 347 ILE A 351 5 ? 5  
HELX_P HELX_P16 AB7 GLU A 361 ? VAL A 371 ? GLU A 360 VAL A 370 1 ? 11 
HELX_P HELX_P17 AB8 ASP A 377 ? SER A 386 ? ASP A 376 SER A 385 1 ? 10 
HELX_P HELX_P18 AB9 SER A 386 ? ASN A 394 ? SER A 385 ASN A 393 1 ? 9  
HELX_P HELX_P19 AC1 PRO A 476 ? HIS A 493 ? PRO A 475 HIS A 492 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 305 A . ? SER 304 A PRO 306 A ? PRO 305 A 1 -5.96 
2 TYR 396 A . ? TYR 395 A PRO 397 A ? PRO 396 A 1 5.21  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 7 ? 
AA3 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 42  ? GLY A 47  ? LEU A 41  GLY A 46  
AA1 2 ASP A 35  ? GLU A 39  ? ASP A 34  GLU A 38  
AA1 3 LEU A 18  ? ARG A 21  ? LEU A 17  ARG A 20  
AA1 4 THR A 58  ? ASP A 60  ? THR A 57  ASP A 59  
AA2 1 SER A 31  ? TYR A 33  ? SER A 30  TYR A 32  
AA2 2 ARG A 24  ? VAL A 26  ? ARG A 23  VAL A 25  
AA2 3 MET A 65  ? PRO A 68  ? MET A 64  PRO A 67  
AA2 4 LEU A 410 ? ILE A 420 ? LEU A 409 ILE A 419 
AA2 5 GLU A 439 ? SER A 449 ? GLU A 438 SER A 448 
AA2 6 ARG A 452 ? GLU A 456 ? ARG A 451 GLU A 455 
AA2 7 LYS A 459 ? MET A 460 ? LYS A 458 MET A 459 
AA3 1 GLY A 70  ? THR A 75  ? GLY A 69  THR A 74  
AA3 2 THR A 102 ? VAL A 109 ? THR A 101 VAL A 108 
AA3 3 ASP A 135 ? ILE A 142 ? ASP A 134 ILE A 141 
AA3 4 SER A 164 ? PHE A 168 ? SER A 163 PHE A 167 
AA3 5 LEU A 195 ? HIS A 199 ? LEU A 194 HIS A 198 
AA3 6 LEU A 251 ? VAL A 256 ? LEU A 250 VAL A 255 
AA3 7 VAL A 275 ? PRO A 279 ? VAL A 274 PRO A 278 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LYS A 44  ? O LYS A 43  N HIS A 37  ? N HIS A 36  
AA1 2 3 O VAL A 36  ? O VAL A 35  N ILE A 20  ? N ILE A 19  
AA1 3 4 N ARG A 21  ? N ARG A 20  O ILE A 59  ? O ILE A 58  
AA2 1 2 O PHE A 32  ? O PHE A 31  N ILE A 25  ? N ILE A 24  
AA2 2 3 N VAL A 26  ? N VAL A 25  O VAL A 66  ? O VAL A 65  
AA2 3 4 N LEU A 67  ? N LEU A 66  O VAL A 411 ? O VAL A 410 
AA2 4 5 N ILE A 412 ? N ILE A 411 O ALA A 445 ? O ALA A 444 
AA2 5 6 N VAL A 447 ? N VAL A 446 O ALA A 454 ? O ALA A 453 
AA2 6 7 N GLU A 456 ? N GLU A 455 O LYS A 459 ? O LYS A 458 
AA3 1 2 N ASP A 72  ? N ASP A 71  O MET A 104 ? O MET A 103 
AA3 2 3 N VAL A 109 ? N VAL A 108 O ASP A 141 ? O ASP A 140 
AA3 3 4 N ILE A 142 ? N ILE A 141 O LEU A 166 ? O LEU A 165 
AA3 4 5 N PHE A 165 ? N PHE A 164 O GLN A 197 ? O GLN A 196 
AA3 5 6 N ALA A 196 ? N ALA A 195 O TYR A 252 ? O TYR A 251 
AA3 6 7 N VAL A 253 ? N VAL A 252 O PHE A 276 ? O PHE A 275 
# 
_atom_sites.entry_id                    5NKS 
_atom_sites.fract_transf_matrix[1][1]   0.012427 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009742 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008548 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 7   ? -20.552 -12.006 16.743  1.00 67.66 ? 6   LYS A N   1 
ATOM   2    C CA  . LYS A 1 7   ? -20.550 -12.829 15.502  1.00 63.17 ? 6   LYS A CA  1 
ATOM   3    C C   . LYS A 1 7   ? -20.204 -11.969 14.272  1.00 67.27 ? 6   LYS A C   1 
ATOM   4    O O   . LYS A 1 7   ? -20.689 -10.848 14.114  1.00 64.53 ? 6   LYS A O   1 
ATOM   5    C CB  . LYS A 1 7   ? -21.891 -13.618 15.333  1.00 58.85 ? 6   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 7   ? -23.076 -12.908 14.667  1.00 56.28 ? 6   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 7   ? -24.457 -13.447 15.095  1.00 51.84 ? 6   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 7   ? -24.856 -14.779 14.449  1.00 48.48 ? 6   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 7   ? -25.446 -15.794 15.386  1.00 40.84 ? 6   LYS A NZ  1 
ATOM   10   N N   . LYS A 1 8   ? -19.334 -12.521 13.432  1.00 73.57 ? 7   LYS A N   1 
ATOM   11   C CA  . LYS A 1 8   ? -18.971 -11.956 12.137  1.00 68.53 ? 7   LYS A CA  1 
ATOM   12   C C   . LYS A 1 8   ? -19.947 -12.584 11.109  1.00 63.35 ? 7   LYS A C   1 
ATOM   13   O O   . LYS A 1 8   ? -20.259 -13.773 11.223  1.00 52.36 ? 7   LYS A O   1 
ATOM   14   C CB  . LYS A 1 8   ? -17.493 -12.323 11.818  1.00 67.94 ? 7   LYS A CB  1 
ATOM   15   C CG  . LYS A 1 8   ? -16.520 -12.133 12.984  1.00 61.45 ? 7   LYS A CG  1 
ATOM   16   N N   . SER A 1 9   ? -20.463 -11.777 10.170  1.00 57.82 ? 8   SER A N   1 
ATOM   17   C CA  . SER A 1 9   ? -21.122 -12.264 8.940   1.00 57.83 ? 8   SER A CA  1 
ATOM   18   C C   . SER A 1 9   ? -20.095 -12.167 7.792   1.00 61.22 ? 8   SER A C   1 
ATOM   19   O O   . SER A 1 9   ? -19.699 -11.059 7.428   1.00 65.04 ? 8   SER A O   1 
ATOM   20   C CB  . SER A 1 9   ? -22.350 -11.399 8.624   1.00 57.77 ? 8   SER A CB  1 
ATOM   21   O OG  . SER A 1 9   ? -22.939 -11.755 7.377   1.00 54.32 ? 8   SER A OG  1 
ATOM   22   N N   . ILE A 1 10  ? -19.654 -13.307 7.235   1.00 53.53 ? 9   ILE A N   1 
ATOM   23   C CA  . ILE A 1 10  ? -18.509 -13.340 6.289   1.00 49.45 ? 9   ILE A CA  1 
ATOM   24   C C   . ILE A 1 10  ? -18.985 -13.445 4.819   1.00 50.50 ? 9   ILE A C   1 
ATOM   25   O O   . ILE A 1 10  ? -19.744 -14.378 4.477   1.00 40.15 ? 9   ILE A O   1 
ATOM   26   C CB  . ILE A 1 10  ? -17.520 -14.500 6.599   1.00 48.92 ? 9   ILE A CB  1 
ATOM   27   C CG1 . ILE A 1 10  ? -17.006 -14.411 8.050   1.00 47.11 ? 9   ILE A CG1 1 
ATOM   28   C CG2 . ILE A 1 10  ? -16.347 -14.505 5.603   1.00 46.77 ? 9   ILE A CG2 1 
ATOM   29   C CD1 . ILE A 1 10  ? -15.855 -15.367 8.357   1.00 45.23 ? 9   ILE A CD1 1 
ATOM   30   N N   . PRO A 1 11  ? -18.531 -12.503 3.945   1.00 54.88 ? 10  PRO A N   1 
ATOM   31   C CA  . PRO A 1 11  ? -18.925 -12.592 2.525   1.00 55.11 ? 10  PRO A CA  1 
ATOM   32   C C   . PRO A 1 11  ? -18.173 -13.728 1.845   1.00 49.28 ? 10  PRO A C   1 
ATOM   33   O O   . PRO A 1 11  ? -17.047 -14.074 2.252   1.00 38.92 ? 10  PRO A O   1 
ATOM   34   C CB  . PRO A 1 11  ? -18.511 -11.221 1.929   1.00 57.88 ? 10  PRO A CB  1 
ATOM   35   C CG  . PRO A 1 11  ? -17.405 -10.724 2.814   1.00 60.93 ? 10  PRO A CG  1 
ATOM   36   C CD  . PRO A 1 11  ? -17.535 -11.421 4.167   1.00 60.76 ? 10  PRO A CD  1 
ATOM   37   N N   . ARG A 1 12  ? -18.816 -14.329 0.848   1.00 43.91 ? 11  ARG A N   1 
ATOM   38   C CA  . ARG A 1 12  ? -18.137 -15.328 0.029   1.00 46.19 ? 11  ARG A CA  1 
ATOM   39   C C   . ARG A 1 12  ? -17.189 -14.627 -0.955  1.00 45.65 ? 11  ARG A C   1 
ATOM   40   O O   . ARG A 1 12  ? -17.567 -13.576 -1.514  1.00 48.50 ? 11  ARG A O   1 
ATOM   41   C CB  . ARG A 1 12  ? -19.164 -16.178 -0.703  1.00 41.54 ? 11  ARG A CB  1 
ATOM   42   C CG  . ARG A 1 12  ? -19.921 -17.080 0.269   1.00 39.28 ? 11  ARG A CG  1 
ATOM   43   C CD  . ARG A 1 12  ? -21.095 -17.700 -0.413  1.00 37.69 ? 11  ARG A CD  1 
ATOM   44   N NE  . ARG A 1 12  ? -21.776 -18.686 0.433   1.00 38.23 ? 11  ARG A NE  1 
ATOM   45   C CZ  . ARG A 1 12  ? -21.597 -20.018 0.408   1.00 34.57 ? 11  ARG A CZ  1 
ATOM   46   N NH1 . ARG A 1 12  ? -20.693 -20.596 -0.389  1.00 32.97 ? 11  ARG A NH1 1 
ATOM   47   N NH2 . ARG A 1 12  ? -22.380 -20.782 1.167   1.00 28.66 ? 11  ARG A NH2 1 
ATOM   48   N N   . ILE A 1 13  ? -15.993 -15.199 -1.129  1.00 45.63 ? 12  ILE A N   1 
ATOM   49   C CA  . ILE A 1 13  ? -14.966 -14.765 -2.116  1.00 49.70 ? 12  ILE A CA  1 
ATOM   50   C C   . ILE A 1 13  ? -15.040 -15.778 -3.275  1.00 50.86 ? 12  ILE A C   1 
ATOM   51   O O   . ILE A 1 13  ? -14.831 -16.973 -3.036  1.00 42.87 ? 12  ILE A O   1 
ATOM   52   C CB  . ILE A 1 13  ? -13.521 -14.746 -1.524  1.00 45.01 ? 12  ILE A CB  1 
ATOM   53   N N   . THR A 1 14  ? -15.339 -15.295 -4.502  1.00 45.91 ? 13  THR A N   1 
ATOM   54   C CA  . THR A 1 14  ? -15.570 -16.136 -5.683  1.00 43.79 ? 13  THR A CA  1 
ATOM   55   C C   . THR A 1 14  ? -14.259 -16.798 -6.170  1.00 41.96 ? 13  THR A C   1 
ATOM   56   O O   . THR A 1 14  ? -13.167 -16.245 -6.021  1.00 37.98 ? 13  THR A O   1 
ATOM   57   C CB  . THR A 1 14  ? -16.230 -15.328 -6.872  1.00 48.46 ? 13  THR A CB  1 
ATOM   58   O OG1 . THR A 1 14  ? -15.460 -14.146 -7.160  1.00 48.20 ? 13  THR A OG1 1 
ATOM   59   C CG2 . THR A 1 14  ? -17.689 -14.894 -6.585  1.00 44.13 ? 13  THR A CG2 1 
ATOM   60   N N   . SER A 1 15  ? -14.387 -17.985 -6.770  1.00 38.51 ? 14  SER A N   1 
ATOM   61   C CA  . SER A 1 15  ? -13.219 -18.799 -7.227  1.00 40.52 ? 14  SER A CA  1 
ATOM   62   C C   . SER A 1 15  ? -12.657 -18.486 -8.675  1.00 36.55 ? 14  SER A C   1 
ATOM   63   O O   . SER A 1 15  ? -11.815 -19.246 -9.194  1.00 35.47 ? 14  SER A O   1 
ATOM   64   C CB  . SER A 1 15  ? -13.573 -20.292 -7.117  1.00 37.33 ? 14  SER A CB  1 
ATOM   65   O OG  . SER A 1 15  ? -14.617 -20.568 -8.033  1.00 35.33 ? 14  SER A OG  1 
ATOM   66   N N   . ASP A 1 16  ? -13.071 -17.374 -9.290  1.00 30.87 ? 15  ASP A N   1 
ATOM   67   C CA  . ASP A 1 16  ? -12.498 -16.921 -10.592 1.00 30.02 ? 15  ASP A CA  1 
ATOM   68   C C   . ASP A 1 16  ? -11.167 -16.158 -10.343 1.00 30.81 ? 15  ASP A C   1 
ATOM   69   O O   . ASP A 1 16  ? -11.012 -15.005 -10.774 1.00 32.85 ? 15  ASP A O   1 
ATOM   70   C CB  . ASP A 1 16  ? -13.504 -16.043 -11.356 1.00 32.38 ? 15  ASP A CB  1 
ATOM   71   C CG  . ASP A 1 16  ? -14.202 -15.027 -10.442 1.00 35.22 ? 15  ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 16  ? -13.859 -14.966 -9.187  1.00 30.84 ? 15  ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 16  ? -15.071 -14.301 -10.979 1.00 33.60 ? 15  ASP A OD2 1 
ATOM   74   N N   . ARG A 1 17  ? -10.237 -16.853 -9.654  1.00 28.53 ? 16  ARG A N   1 
ATOM   75   C CA  . ARG A 1 17  ? -8.914  -16.372 -9.227  1.00 30.39 ? 16  ARG A CA  1 
ATOM   76   C C   . ARG A 1 17  ? -7.853  -17.413 -9.609  1.00 30.88 ? 16  ARG A C   1 
ATOM   77   O O   . ARG A 1 17  ? -8.079  -18.636 -9.547  1.00 27.20 ? 16  ARG A O   1 
ATOM   78   C CB  . ARG A 1 17  ? -8.835  -16.101 -7.715  1.00 33.80 ? 16  ARG A CB  1 
ATOM   79   C CG  . ARG A 1 17  ? -9.181  -17.307 -6.851  1.00 38.40 ? 16  ARG A CG  1 
ATOM   80   C CD  . ARG A 1 17  ? -8.802  -17.125 -5.381  1.00 40.39 ? 16  ARG A CD  1 
ATOM   81   N NE  . ARG A 1 17  ? -9.525  -16.027 -4.780  1.00 44.36 ? 16  ARG A NE  1 
ATOM   82   N N   . LEU A 1 18  ? -6.696  -16.925 -10.006 1.00 26.72 ? 17  LEU A N   1 
ATOM   83   C CA  . LEU A 1 18  ? -5.605  -17.796 -10.372 1.00 25.78 ? 17  LEU A CA  1 
ATOM   84   C C   . LEU A 1 18  ? -4.339  -16.972 -10.483 1.00 22.14 ? 17  LEU A C   1 
ATOM   85   O O   . LEU A 1 18  ? -4.386  -15.721 -10.450 1.00 20.27 ? 17  LEU A O   1 
ATOM   86   C CB  . LEU A 1 18  ? -5.897  -18.648 -11.640 1.00 31.40 ? 17  LEU A CB  1 
ATOM   87   C CG  . LEU A 1 18  ? -6.358  -18.010 -12.926 1.00 35.09 ? 17  LEU A CG  1 
ATOM   88   C CD1 . LEU A 1 18  ? -5.172  -17.414 -13.657 1.00 39.93 ? 17  LEU A CD1 1 
ATOM   89   C CD2 . LEU A 1 18  ? -7.008  -19.048 -13.822 1.00 37.23 ? 17  LEU A CD2 1 
ATOM   90   N N   . LEU A 1 19  ? -3.224  -17.699 -10.498 1.00 22.56 ? 18  LEU A N   1 
ATOM   91   C CA  . LEU A 1 19  ? -1.894  -17.153 -10.592 1.00 22.15 ? 18  LEU A CA  1 
ATOM   92   C C   . LEU A 1 19  ? -1.238  -17.829 -11.770 1.00 22.62 ? 18  LEU A C   1 
ATOM   93   O O   . LEU A 1 19  ? -1.151  -19.059 -11.810 1.00 25.09 ? 18  LEU A O   1 
ATOM   94   C CB  . LEU A 1 19  ? -1.099  -17.423 -9.300  1.00 23.48 ? 18  LEU A CB  1 
ATOM   95   C CG  . LEU A 1 19  ? 0.390   -17.057 -9.420  1.00 24.01 ? 18  LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 19  ? 0.544   -15.540 -9.607  1.00 22.78 ? 18  LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 19  ? 1.193   -17.527 -8.231  1.00 24.98 ? 18  LEU A CD2 1 
ATOM   98   N N   . ILE A 1 20  ? -0.810  -17.042 -12.755 1.00 22.23 ? 19  ILE A N   1 
ATOM   99   C CA  . ILE A 1 20  ? -0.029  -17.561 -13.889 1.00 21.65 ? 19  ILE A CA  1 
ATOM   100  C C   . ILE A 1 20  ? 1.432   -17.089 -13.731 1.00 19.75 ? 19  ILE A C   1 
ATOM   101  O O   . ILE A 1 20  ? 1.737   -15.878 -13.729 1.00 20.91 ? 19  ILE A O   1 
ATOM   102  C CB  . ILE A 1 20  ? -0.569  -17.048 -15.256 1.00 22.69 ? 19  ILE A CB  1 
ATOM   103  C CG1 . ILE A 1 20  ? -2.063  -17.350 -15.367 1.00 24.14 ? 19  ILE A CG1 1 
ATOM   104  C CG2 . ILE A 1 20  ? 0.185   -17.708 -16.387 1.00 22.15 ? 19  ILE A CG2 1 
ATOM   105  C CD1 . ILE A 1 20  ? -2.732  -16.655 -16.514 1.00 27.66 ? 19  ILE A CD1 1 
ATOM   106  N N   . ARG A 1 21  ? 2.309   -18.053 -13.599 1.00 21.74 ? 20  ARG A N   1 
ATOM   107  C CA  . ARG A 1 21  ? 3.702   -17.820 -13.303 1.00 22.06 ? 20  ARG A CA  1 
ATOM   108  C C   . ARG A 1 21  ? 4.539   -18.103 -14.499 1.00 21.53 ? 20  ARG A C   1 
ATOM   109  O O   . ARG A 1 21  ? 4.372   -19.146 -15.154 1.00 21.84 ? 20  ARG A O   1 
ATOM   110  C CB  . ARG A 1 21  ? 4.203   -18.811 -12.261 1.00 24.89 ? 20  ARG A CB  1 
ATOM   111  C CG  . ARG A 1 21  ? 3.568   -18.641 -10.949 1.00 25.37 ? 20  ARG A CG  1 
ATOM   112  C CD  . ARG A 1 21  ? 4.382   -19.365 -9.866  1.00 25.70 ? 20  ARG A CD  1 
ATOM   113  N NE  . ARG A 1 21  ? 4.376   -20.807 -10.040 1.00 27.70 ? 20  ARG A NE  1 
ATOM   114  C CZ  . ARG A 1 21  ? 4.682   -21.660 -9.076  1.00 28.09 ? 20  ARG A CZ  1 
ATOM   115  N NH1 . ARG A 1 21  ? 5.006   -21.223 -7.866  1.00 28.03 ? 20  ARG A NH1 1 
ATOM   116  N NH2 . ARG A 1 21  ? 4.661   -22.943 -9.326  1.00 28.95 ? 20  ARG A NH2 1 
ATOM   117  N N   . GLY A 1 22  ? 5.507   -17.232 -14.732 1.00 21.23 ? 21  GLY A N   1 
ATOM   118  C CA  . GLY A 1 22  ? 6.606   -17.570 -15.611 1.00 20.89 ? 21  GLY A CA  1 
ATOM   119  C C   . GLY A 1 22  ? 6.383   -17.321 -17.095 1.00 20.80 ? 21  GLY A C   1 
ATOM   120  O O   . GLY A 1 22  ? 7.266   -17.570 -17.913 1.00 19.89 ? 21  GLY A O   1 
ATOM   121  N N   . GLY A 1 23  ? 5.210   -16.854 -17.444 1.00 21.33 ? 22  GLY A N   1 
ATOM   122  C CA  . GLY A 1 23  ? 4.892   -16.597 -18.845 1.00 20.49 ? 22  GLY A CA  1 
ATOM   123  C C   . GLY A 1 23  ? 5.581   -15.354 -19.419 1.00 19.63 ? 22  GLY A C   1 
ATOM   124  O O   . GLY A 1 23  ? 5.952   -14.410 -18.719 1.00 17.59 ? 22  GLY A O   1 
ATOM   125  N N   . ARG A 1 24  ? 5.700   -15.386 -20.735 1.00 18.30 ? 23  ARG A N   1 
ATOM   126  C CA  . ARG A 1 24  ? 6.064   -14.244 -21.545 1.00 18.47 ? 23  ARG A CA  1 
ATOM   127  C C   . ARG A 1 24  ? 4.723   -13.597 -21.921 1.00 17.70 ? 23  ARG A C   1 
ATOM   128  O O   . ARG A 1 24  ? 3.981   -14.094 -22.790 1.00 18.35 ? 23  ARG A O   1 
ATOM   129  C CB  . ARG A 1 24  ? 6.808   -14.721 -22.786 1.00 19.65 ? 23  ARG A CB  1 
ATOM   130  C CG  . ARG A 1 24  ? 7.288   -13.597 -23.731 1.00 22.06 ? 23  ARG A CG  1 
ATOM   131  C CD  . ARG A 1 24  ? 7.897   -14.253 -24.996 1.00 24.17 ? 23  ARG A CD  1 
ATOM   132  N NE  . ARG A 1 24  ? 8.295   -13.241 -25.963 1.00 25.12 ? 23  ARG A NE  1 
ATOM   133  C CZ  . ARG A 1 24  ? 9.453   -12.560 -25.985 1.00 28.63 ? 23  ARG A CZ  1 
ATOM   134  N NH1 . ARG A 1 24  ? 10.397  -12.819 -25.101 1.00 27.83 ? 23  ARG A NH1 1 
ATOM   135  N NH2 . ARG A 1 24  ? 9.683   -11.608 -26.912 1.00 25.67 ? 23  ARG A NH2 1 
ATOM   136  N N   . ILE A 1 25  ? 4.437   -12.472 -21.309 1.00 16.26 ? 24  ILE A N   1 
ATOM   137  C CA  . ILE A 1 25  ? 3.253   -11.768 -21.611 1.00 17.96 ? 24  ILE A CA  1 
ATOM   138  C C   . ILE A 1 25  ? 3.418   -11.120 -22.977 1.00 17.76 ? 24  ILE A C   1 
ATOM   139  O O   . ILE A 1 25  ? 4.436   -10.489 -23.262 1.00 15.80 ? 24  ILE A O   1 
ATOM   140  C CB  . ILE A 1 25  ? 2.959   -10.714 -20.565 1.00 19.25 ? 24  ILE A CB  1 
ATOM   141  C CG1 . ILE A 1 25  ? 2.621   -11.447 -19.251 1.00 23.92 ? 24  ILE A CG1 1 
ATOM   142  C CG2 . ILE A 1 25  ? 1.757   -9.897  -20.986 1.00 18.57 ? 24  ILE A CG2 1 
ATOM   143  C CD1 . ILE A 1 25  ? 2.472   -10.459 -18.092 1.00 27.43 ? 24  ILE A CD1 1 
ATOM   144  N N   . VAL A 1 26  ? 2.431   -11.328 -23.840 1.00 17.84 ? 25  VAL A N   1 
ATOM   145  C CA  . VAL A 1 26  ? 2.483   -10.691 -25.171 1.00 16.62 ? 25  VAL A CA  1 
ATOM   146  C C   . VAL A 1 26  ? 1.304   -9.782  -25.398 1.00 16.23 ? 25  VAL A C   1 
ATOM   147  O O   . VAL A 1 26  ? 0.177   -10.275 -25.514 1.00 16.64 ? 25  VAL A O   1 
ATOM   148  C CB  . VAL A 1 26  ? 2.488   -11.793 -26.223 1.00 18.26 ? 25  VAL A CB  1 
ATOM   149  C CG1 . VAL A 1 26  ? 2.543   -11.162 -27.643 1.00 16.85 ? 25  VAL A CG1 1 
ATOM   150  C CG2 . VAL A 1 26  ? 3.662   -12.727 -25.933 1.00 18.00 ? 25  VAL A CG2 1 
ATOM   151  N N   . ASN A 1 27  ? 1.536   -8.474  -25.443 1.00 16.45 ? 26  ASN A N   1 
ATOM   152  C CA  . ASN A 1 27  ? 0.567   -7.523  -25.839 1.00 16.14 ? 26  ASN A CA  1 
ATOM   153  C C   . ASN A 1 27  ? 0.835   -7.004  -27.296 1.00 15.48 ? 26  ASN A C   1 
ATOM   154  O O   . ASN A 1 27  ? 1.814   -7.355  -27.926 1.00 17.75 ? 26  ASN A O   1 
ATOM   155  C CB  . ASN A 1 27  ? 0.523   -6.378  -24.853 1.00 16.26 ? 26  ASN A CB  1 
ATOM   156  C CG  . ASN A 1 27  ? -0.264  -6.728  -23.590 1.00 19.05 ? 26  ASN A CG  1 
ATOM   157  O OD1 . ASN A 1 27  ? -1.229  -7.507  -23.631 1.00 17.59 ? 26  ASN A OD1 1 
ATOM   158  N ND2 . ASN A 1 27  ? 0.145   -6.143  -22.465 1.00 17.44 ? 26  ASN A ND2 1 
ATOM   159  N N   . ASP A 1 28  ? -0.000  -6.127  -27.817 1.00 15.77 ? 27  ASP A N   1 
ATOM   160  C CA  . ASP A 1 28  ? 0.233   -5.730  -29.195 1.00 17.76 ? 27  ASP A CA  1 
ATOM   161  C C   . ASP A 1 28  ? 1.429   -4.786  -29.296 1.00 17.36 ? 27  ASP A C   1 
ATOM   162  O O   . ASP A 1 28  ? 2.032   -4.678  -30.349 1.00 15.42 ? 27  ASP A O   1 
ATOM   163  C CB  . ASP A 1 28  ? -1.026  -5.152  -29.826 1.00 19.59 ? 27  ASP A CB  1 
ATOM   164  C CG  . ASP A 1 28  ? -1.339  -3.845  -29.348 1.00 21.78 ? 27  ASP A CG  1 
ATOM   165  O OD1 . ASP A 1 28  ? -1.424  -3.649  -28.132 1.00 22.13 ? 27  ASP A OD1 1 
ATOM   166  O OD2 . ASP A 1 28  ? -1.564  -2.965  -30.192 1.00 28.54 ? 27  ASP A OD2 1 
ATOM   167  N N   . ASP A 1 29  ? 1.770   -4.113  -28.179 1.00 16.93 ? 28  ASP A N   1 
ATOM   168  C CA  . ASP A 1 29  ? 2.872   -3.147  -28.143 1.00 18.10 ? 28  ASP A CA  1 
ATOM   169  C C   . ASP A 1 29  ? 4.240   -3.695  -27.715 1.00 18.82 ? 28  ASP A C   1 
ATOM   170  O O   . ASP A 1 29  ? 5.228   -3.131  -28.085 1.00 20.13 ? 28  ASP A O   1 
ATOM   171  C CB  . ASP A 1 29  ? 2.501   -1.953  -27.316 1.00 17.88 ? 28  ASP A CB  1 
ATOM   172  C CG  . ASP A 1 29  ? 2.280   -2.289  -25.819 1.00 19.55 ? 28  ASP A CG  1 
ATOM   173  O OD1 . ASP A 1 29  ? 1.644   -3.284  -25.477 1.00 16.60 ? 28  ASP A OD1 1 
ATOM   174  O OD2 . ASP A 1 29  ? 2.761   -1.499  -24.967 1.00 21.59 ? 28  ASP A OD2 1 
ATOM   175  N N   . GLN A 1 30  ? 4.285   -4.767  -26.922 1.00 18.81 ? 29  GLN A N   1 
ATOM   176  C CA  . GLN A 1 30  ? 5.540   -5.340  -26.412 1.00 20.43 ? 29  GLN A CA  1 
ATOM   177  C C   . GLN A 1 30  ? 5.239   -6.668  -25.765 1.00 19.63 ? 29  GLN A C   1 
ATOM   178  O O   . GLN A 1 30  ? 4.048   -7.020  -25.494 1.00 16.95 ? 29  GLN A O   1 
ATOM   179  C CB  . GLN A 1 30  ? 6.241   -4.440  -25.388 1.00 23.64 ? 29  GLN A CB  1 
ATOM   180  C CG  . GLN A 1 30  ? 5.333   -3.879  -24.384 1.00 24.11 ? 29  GLN A CG  1 
ATOM   181  C CD  . GLN A 1 30  ? 5.989   -3.411  -23.064 1.00 30.08 ? 29  GLN A CD  1 
ATOM   182  O OE1 . GLN A 1 30  ? 7.186   -3.243  -22.934 1.00 27.61 ? 29  GLN A OE1 1 
ATOM   183  N NE2 . GLN A 1 30  ? 5.145   -3.225  -22.070 1.00 33.04 ? 29  GLN A NE2 1 
ATOM   184  N N   . SER A 1 31  ? 6.314   -7.400  -25.542 1.00 16.68 ? 30  SER A N   1 
ATOM   185  C CA  . SER A 1 31  ? 6.283   -8.635  -24.813 1.00 17.23 ? 30  SER A CA  1 
ATOM   186  C C   . SER A 1 31  ? 7.195   -8.407  -23.606 1.00 20.04 ? 30  SER A C   1 
ATOM   187  O O   . SER A 1 31  ? 8.162   -7.620  -23.693 1.00 18.36 ? 30  SER A O   1 
ATOM   188  C CB  . SER A 1 31  ? 6.757   -9.776  -25.622 1.00 16.14 ? 30  SER A CB  1 
ATOM   189  O OG  . SER A 1 31  ? 5.871   -10.038 -26.696 1.00 14.62 ? 30  SER A OG  1 
ATOM   190  N N   . PHE A 1 32  ? 6.900   -9.088  -22.504 1.00 17.92 ? 31  PHE A N   1 
ATOM   191  C CA  . PHE A 1 32  ? 7.700   -8.985  -21.296 1.00 19.36 ? 31  PHE A CA  1 
ATOM   192  C C   . PHE A 1 32  ? 7.390   -10.131 -20.346 1.00 20.37 ? 31  PHE A C   1 
ATOM   193  O O   . PHE A 1 32  ? 6.361   -10.770 -20.461 1.00 18.31 ? 31  PHE A O   1 
ATOM   194  C CB  . PHE A 1 32  ? 7.518   -7.626  -20.638 1.00 19.48 ? 31  PHE A CB  1 
ATOM   195  C CG  . PHE A 1 32  ? 6.117   -7.356  -20.171 1.00 20.43 ? 31  PHE A CG  1 
ATOM   196  C CD1 . PHE A 1 32  ? 5.140   -6.912  -21.045 1.00 23.43 ? 31  PHE A CD1 1 
ATOM   197  C CD2 . PHE A 1 32  ? 5.774   -7.544  -18.839 1.00 21.21 ? 31  PHE A CD2 1 
ATOM   198  C CE1 . PHE A 1 32  ? 3.855   -6.705  -20.604 1.00 23.61 ? 31  PHE A CE1 1 
ATOM   199  C CE2 . PHE A 1 32  ? 4.507   -7.340  -18.399 1.00 20.08 ? 31  PHE A CE2 1 
ATOM   200  C CZ  . PHE A 1 32  ? 3.531   -6.948  -19.281 1.00 23.51 ? 31  PHE A CZ  1 
ATOM   201  N N   . TYR A 1 33  ? 8.324   -10.418 -19.433 1.00 21.16 ? 32  TYR A N   1 
ATOM   202  C CA  . TYR A 1 33  ? 8.187   -11.542 -18.534 1.00 21.27 ? 32  TYR A CA  1 
ATOM   203  C C   . TYR A 1 33  ? 7.619   -11.077 -17.210 1.00 22.95 ? 32  TYR A C   1 
ATOM   204  O O   . TYR A 1 33  ? 8.111   -10.108 -16.667 1.00 24.23 ? 32  TYR A O   1 
ATOM   205  C CB  . TYR A 1 33  ? 9.546   -12.239 -18.322 1.00 21.79 ? 32  TYR A CB  1 
ATOM   206  C CG  . TYR A 1 33  ? 9.942   -12.988 -19.541 1.00 21.58 ? 32  TYR A CG  1 
ATOM   207  C CD1 . TYR A 1 33  ? 9.492   -14.255 -19.756 1.00 20.83 ? 32  TYR A CD1 1 
ATOM   208  C CD2 . TYR A 1 33  ? 10.680  -12.374 -20.557 1.00 24.00 ? 32  TYR A CD2 1 
ATOM   209  C CE1 . TYR A 1 33  ? 9.840   -14.945 -20.886 1.00 23.54 ? 32  TYR A CE1 1 
ATOM   210  C CE2 . TYR A 1 33  ? 10.986  -13.040 -21.732 1.00 23.50 ? 32  TYR A CE2 1 
ATOM   211  C CZ  . TYR A 1 33  ? 10.584  -14.332 -21.868 1.00 22.51 ? 32  TYR A CZ  1 
ATOM   212  O OH  . TYR A 1 33  ? 10.868  -15.006 -22.989 1.00 25.41 ? 32  TYR A OH  1 
ATOM   213  N N   . ALA A 1 34  ? 6.536   -11.712 -16.738 1.00 19.46 ? 33  ALA A N   1 
ATOM   214  C CA  . ALA A 1 34  ? 5.924   -11.370 -15.473 1.00 19.32 ? 33  ALA A CA  1 
ATOM   215  C C   . ALA A 1 34  ? 4.881   -12.388 -15.128 1.00 21.14 ? 33  ALA A C   1 
ATOM   216  O O   . ALA A 1 34  ? 4.352   -13.138 -16.019 1.00 19.44 ? 33  ALA A O   1 
ATOM   217  C CB  . ALA A 1 34  ? 5.253   -10.021 -15.459 1.00 21.06 ? 33  ALA A CB  1 
ATOM   218  N N   . ASP A 1 35  ? 4.549   -12.391 -13.820 1.00 19.24 ? 34  ASP A N   1 
ATOM   219  C CA  . ASP A 1 35  ? 3.492   -13.229 -13.340 1.00 20.74 ? 34  ASP A CA  1 
ATOM   220  C C   . ASP A 1 35  ? 2.188   -12.505 -13.394 1.00 18.03 ? 34  ASP A C   1 
ATOM   221  O O   . ASP A 1 35  ? 2.127   -11.288 -13.392 1.00 18.96 ? 34  ASP A O   1 
ATOM   222  C CB  . ASP A 1 35  ? 3.804   -13.728 -11.919 1.00 21.28 ? 34  ASP A CB  1 
ATOM   223  C CG  . ASP A 1 35  ? 5.083   -14.599 -11.866 1.00 24.55 ? 34  ASP A CG  1 
ATOM   224  O OD1 . ASP A 1 35  ? 5.576   -15.195 -12.874 1.00 21.30 ? 34  ASP A OD1 1 
ATOM   225  O OD2 . ASP A 1 35  ? 5.612   -14.699 -10.747 1.00 29.18 ? 34  ASP A OD2 1 
ATOM   226  N N   . VAL A 1 36  ? 1.113   -13.247 -13.494 1.00 18.01 ? 35  VAL A N   1 
ATOM   227  C CA  . VAL A 1 36  ? -0.221  -12.622 -13.588 1.00 19.03 ? 35  VAL A CA  1 
ATOM   228  C C   . VAL A 1 36  ? -1.152  -13.208 -12.521 1.00 19.45 ? 35  VAL A C   1 
ATOM   229  O O   . VAL A 1 36  ? -1.327  -14.436 -12.463 1.00 19.30 ? 35  VAL A O   1 
ATOM   230  C CB  . VAL A 1 36  ? -0.858  -12.868 -14.962 1.00 19.31 ? 35  VAL A CB  1 
ATOM   231  C CG1 . VAL A 1 36  ? -2.209  -12.215 -15.036 1.00 17.52 ? 35  VAL A CG1 1 
ATOM   232  C CG2 . VAL A 1 36  ? 0.049   -12.253 -16.043 1.00 20.02 ? 35  VAL A CG2 1 
ATOM   233  N N   . HIS A 1 37  ? -1.645  -12.302 -11.682 1.00 19.08 ? 36  HIS A N   1 
ATOM   234  C CA  . HIS A 1 37  ? -2.681  -12.555 -10.670 1.00 20.96 ? 36  HIS A CA  1 
ATOM   235  C C   . HIS A 1 37  ? -4.060  -12.029 -11.088 1.00 17.87 ? 36  HIS A C   1 
ATOM   236  O O   . HIS A 1 37  ? -4.268  -10.806 -11.301 1.00 19.41 ? 36  HIS A O   1 
ATOM   237  C CB  . HIS A 1 37  ? -2.261  -11.902 -9.339  1.00 23.50 ? 36  HIS A CB  1 
ATOM   238  C CG  . HIS A 1 37  ? -3.227  -12.099 -8.209  1.00 25.15 ? 36  HIS A CG  1 
ATOM   239  N ND1 . HIS A 1 37  ? -3.396  -11.161 -7.216  1.00 31.79 ? 36  HIS A ND1 1 
ATOM   240  C CD2 . HIS A 1 37  ? -4.024  -13.130 -7.880  1.00 27.47 ? 36  HIS A CD2 1 
ATOM   241  C CE1 . HIS A 1 37  ? -4.300  -11.574 -6.355  1.00 29.06 ? 36  HIS A CE1 1 
ATOM   242  N NE2 . HIS A 1 37  ? -4.683  -12.780 -6.724  1.00 29.91 ? 36  HIS A NE2 1 
ATOM   243  N N   . VAL A 1 38  ? -4.984  -12.986 -11.222 1.00 19.37 ? 37  VAL A N   1 
ATOM   244  C CA  . VAL A 1 38  ? -6.395  -12.811 -11.574 1.00 18.11 ? 37  VAL A CA  1 
ATOM   245  C C   . VAL A 1 38  ? -7.241  -13.014 -10.287 1.00 22.35 ? 37  VAL A C   1 
ATOM   246  O O   . VAL A 1 38  ? -6.993  -13.916 -9.492  1.00 20.76 ? 37  VAL A O   1 
ATOM   247  C CB  . VAL A 1 38  ? -6.802  -13.884 -12.630 1.00 19.65 ? 37  VAL A CB  1 
ATOM   248  C CG1 . VAL A 1 38  ? -8.289  -13.917 -12.911 1.00 18.34 ? 37  VAL A CG1 1 
ATOM   249  C CG2 . VAL A 1 38  ? -6.003  -13.641 -13.927 1.00 20.22 ? 37  VAL A CG2 1 
ATOM   250  N N   . GLU A 1 39  ? -8.207  -12.136 -10.111 1.00 24.27 ? 38  GLU A N   1 
ATOM   251  C CA  . GLU A 1 39  ? -9.169  -12.190 -9.025  1.00 27.39 ? 38  GLU A CA  1 
ATOM   252  C C   . GLU A 1 39  ? -10.451 -11.568 -9.531  1.00 23.22 ? 38  GLU A C   1 
ATOM   253  O O   . GLU A 1 39  ? -10.416 -10.525 -10.248 1.00 21.77 ? 38  GLU A O   1 
ATOM   254  C CB  . GLU A 1 39  ? -8.623  -11.448 -7.801  1.00 32.01 ? 38  GLU A CB  1 
ATOM   255  C CG  . GLU A 1 39  ? -9.089  -11.990 -6.458  1.00 43.37 ? 38  GLU A CG  1 
ATOM   256  C CD  . GLU A 1 39  ? -8.228  -11.440 -5.318  1.00 48.41 ? 38  GLU A CD  1 
ATOM   257  O OE1 . GLU A 1 39  ? -8.401  -10.224 -5.020  1.00 48.53 ? 38  GLU A OE1 1 
ATOM   258  O OE2 . GLU A 1 39  ? -7.347  -12.211 -4.796  1.00 53.65 ? 38  GLU A OE2 1 
ATOM   259  N N   . ASP A 1 40  ? -11.585 -12.205 -9.156  1.00 21.97 ? 39  ASP A N   1 
ATOM   260  C CA  . ASP A 1 40  ? -12.915 -11.746 -9.546  1.00 23.53 ? 39  ASP A CA  1 
ATOM   261  C C   . ASP A 1 40  ? -13.013 -11.534 -11.076 1.00 22.64 ? 39  ASP A C   1 
ATOM   262  O O   . ASP A 1 40  ? -13.648 -10.627 -11.527 1.00 19.26 ? 39  ASP A O   1 
ATOM   263  C CB  . ASP A 1 40  ? -13.266 -10.456 -8.817  1.00 25.96 ? 39  ASP A CB  1 
ATOM   264  C CG  . ASP A 1 40  ? -13.341 -10.650 -7.262  1.00 32.98 ? 39  ASP A CG  1 
ATOM   265  O OD1 . ASP A 1 40  ? -13.702 -11.755 -6.814  1.00 34.99 ? 39  ASP A OD1 1 
ATOM   266  O OD2 . ASP A 1 40  ? -13.008 -9.707  -6.521  1.00 37.60 ? 39  ASP A OD2 1 
ATOM   267  N N   . GLY A 1 41  ? -12.401 -12.415 -11.832 1.00 22.55 ? 40  GLY A N   1 
ATOM   268  C CA  . GLY A 1 41  ? -12.518 -12.343 -13.300 1.00 23.92 ? 40  GLY A CA  1 
ATOM   269  C C   . GLY A 1 41  ? -11.727 -11.207 -13.959 1.00 23.25 ? 40  GLY A C   1 
ATOM   270  O O   . GLY A 1 41  ? -11.887 -10.970 -15.167 1.00 22.74 ? 40  GLY A O   1 
ATOM   271  N N   . LEU A 1 42  ? -10.856 -10.544 -13.197 1.00 20.74 ? 41  LEU A N   1 
ATOM   272  C CA  . LEU A 1 42  ? -10.082 -9.426  -13.657 1.00 21.35 ? 41  LEU A CA  1 
ATOM   273  C C   . LEU A 1 42  ? -8.610  -9.668  -13.403 1.00 22.12 ? 41  LEU A C   1 
ATOM   274  O O   . LEU A 1 42  ? -8.251  -10.391 -12.467 1.00 23.47 ? 41  LEU A O   1 
ATOM   275  C CB  . LEU A 1 42  ? -10.471 -8.180  -12.935 1.00 21.59 ? 41  LEU A CB  1 
ATOM   276  C CG  . LEU A 1 42  ? -11.888 -7.724  -13.169 1.00 22.20 ? 41  LEU A CG  1 
ATOM   277  C CD1 . LEU A 1 42  ? -12.293 -6.598  -12.214 1.00 22.90 ? 41  LEU A CD1 1 
ATOM   278  C CD2 . LEU A 1 42  ? -12.092 -7.272  -14.620 1.00 22.36 ? 41  LEU A CD2 1 
ATOM   279  N N   . ILE A 1 43  ? -7.747  -9.034  -14.201 1.00 19.92 ? 42  ILE A N   1 
ATOM   280  C CA  . ILE A 1 43  ? -6.297  -9.073  -13.919 1.00 19.67 ? 42  ILE A CA  1 
ATOM   281  C C   . ILE A 1 43  ? -6.049  -8.060  -12.774 1.00 21.10 ? 42  ILE A C   1 
ATOM   282  O O   . ILE A 1 43  ? -6.362  -6.856  -12.916 1.00 21.04 ? 42  ILE A O   1 
ATOM   283  C CB  . ILE A 1 43  ? -5.481  -8.733  -15.186 1.00 19.29 ? 42  ILE A CB  1 
ATOM   284  C CG1 . ILE A 1 43  ? -5.742  -9.820  -16.234 1.00 20.99 ? 42  ILE A CG1 1 
ATOM   285  C CG2 . ILE A 1 43  ? -3.999  -8.560  -14.852 1.00 18.63 ? 42  ILE A CG2 1 
ATOM   286  C CD1 . ILE A 1 43  ? -5.389  -9.372  -17.637 1.00 23.21 ? 42  ILE A CD1 1 
ATOM   287  N N   . LYS A 1 44  ? -5.568  -8.573  -11.646 1.00 22.89 ? 43  LYS A N   1 
ATOM   288  C CA  . LYS A 1 44  ? -5.388  -7.756  -10.417 1.00 23.61 ? 43  LYS A CA  1 
ATOM   289  C C   . LYS A 1 44  ? -3.949  -7.268  -10.275 1.00 21.57 ? 43  LYS A C   1 
ATOM   290  O O   . LYS A 1 44  ? -3.751  -6.158  -9.891  1.00 23.65 ? 43  LYS A O   1 
ATOM   291  C CB  . LYS A 1 44  ? -5.822  -8.520  -9.137  1.00 28.89 ? 43  LYS A CB  1 
ATOM   292  C CG  . LYS A 1 44  ? -5.837  -7.615  -7.884  1.00 31.64 ? 43  LYS A CG  1 
ATOM   293  C CD  . LYS A 1 44  ? -6.253  -8.282  -6.571  1.00 37.05 ? 43  LYS A CD  1 
ATOM   294  N N   . GLN A 1 45  ? -2.968  -8.089  -10.590 1.00 20.77 ? 44  GLN A N   1 
ATOM   295  C CA  . GLN A 1 45  ? -1.571  -7.698  -10.536 1.00 20.69 ? 44  GLN A CA  1 
ATOM   296  C C   . GLN A 1 45  ? -0.779  -8.315  -11.695 1.00 20.03 ? 44  GLN A C   1 
ATOM   297  O O   . GLN A 1 45  ? -1.081  -9.430  -12.170 1.00 19.93 ? 44  GLN A O   1 
ATOM   298  C CB  . GLN A 1 45  ? -0.895  -8.153  -9.246  1.00 20.68 ? 44  GLN A CB  1 
ATOM   299  C CG  . GLN A 1 45  ? -1.663  -7.930  -7.960  1.00 22.68 ? 44  GLN A CG  1 
ATOM   300  C CD  . GLN A 1 45  ? -0.803  -8.344  -6.794  1.00 22.34 ? 44  GLN A CD  1 
ATOM   301  O OE1 . GLN A 1 45  ? 0.119   -7.623  -6.415  1.00 26.92 ? 44  GLN A OE1 1 
ATOM   302  N NE2 . GLN A 1 45  ? -1.022  -9.533  -6.305  1.00 24.08 ? 44  GLN A NE2 1 
ATOM   303  N N   . ILE A 1 46  ? 0.244   -7.582  -12.117 1.00 18.83 ? 45  ILE A N   1 
ATOM   304  C CA  . ILE A 1 46  ? 1.193   -8.078  -13.091 1.00 19.76 ? 45  ILE A CA  1 
ATOM   305  C C   . ILE A 1 46  ? 2.568   -7.655  -12.571 1.00 19.99 ? 45  ILE A C   1 
ATOM   306  O O   . ILE A 1 46  ? 2.778   -6.476  -12.329 1.00 21.15 ? 45  ILE A O   1 
ATOM   307  C CB  . ILE A 1 46  ? 0.972   -7.464  -14.483 1.00 19.50 ? 45  ILE A CB  1 
ATOM   308  C CG1 . ILE A 1 46  ? -0.440  -7.786  -15.006 1.00 20.53 ? 45  ILE A CG1 1 
ATOM   309  C CG2 . ILE A 1 46  ? 2.065   -7.973  -15.437 1.00 18.48 ? 45  ILE A CG2 1 
ATOM   310  C CD1 . ILE A 1 46  ? -0.717  -6.982  -16.295 1.00 21.49 ? 45  ILE A CD1 1 
ATOM   311  N N   . GLY A 1 47  ? 3.472   -8.613  -12.378 1.00 18.80 ? 46  GLY A N   1 
ATOM   312  C CA  . GLY A 1 47  ? 4.769   -8.324  -11.805 1.00 21.11 ? 46  GLY A CA  1 
ATOM   313  C C   . GLY A 1 47  ? 5.558   -9.564  -11.437 1.00 23.33 ? 46  GLY A C   1 
ATOM   314  O O   . GLY A 1 47  ? 5.132   -10.653 -11.743 1.00 21.47 ? 46  GLY A O   1 
ATOM   315  N N   . GLU A 1 48  ? 6.718   -9.359  -10.782 1.00 28.24 ? 47  GLU A N   1 
ATOM   316  C CA  . GLU A 1 48  ? 7.568   -10.422 -10.239 1.00 30.23 ? 47  GLU A CA  1 
ATOM   317  C C   . GLU A 1 48  ? 7.360   -10.460 -8.715  1.00 33.02 ? 47  GLU A C   1 
ATOM   318  O O   . GLU A 1 48  ? 7.064   -9.431  -8.118  1.00 31.88 ? 47  GLU A O   1 
ATOM   319  C CB  . GLU A 1 48  ? 9.051   -10.158 -10.597 1.00 32.84 ? 47  GLU A CB  1 
ATOM   320  N N   . ASN A 1 49  ? 7.458   -11.639 -8.096  1.00 34.02 ? 48  ASN A N   1 
ATOM   321  C CA  . ASN A 1 49  ? 7.360   -11.761 -6.611  1.00 36.29 ? 48  ASN A CA  1 
ATOM   322  C C   . ASN A 1 49  ? 6.097   -11.161 -6.086  1.00 39.43 ? 48  ASN A C   1 
ATOM   323  O O   . ASN A 1 49  ? 6.116   -10.354 -5.126  1.00 37.38 ? 48  ASN A O   1 
ATOM   324  C CB  . ASN A 1 49  ? 8.557   -11.097 -5.893  1.00 33.85 ? 48  ASN A CB  1 
ATOM   325  C CG  . ASN A 1 49  ? 9.852   -11.649 -6.356  1.00 35.76 ? 48  ASN A CG  1 
ATOM   326  O OD1 . ASN A 1 49  ? 10.759  -10.914 -6.687  1.00 43.99 ? 48  ASN A OD1 1 
ATOM   327  N ND2 . ASN A 1 49  ? 9.923   -12.981 -6.459  1.00 34.43 ? 48  ASN A ND2 1 
ATOM   328  N N   . LEU A 1 50  ? 5.011   -11.526 -6.756  1.00 33.75 ? 49  LEU A N   1 
ATOM   329  C CA  . LEU A 1 50  ? 3.729   -11.037 -6.424  1.00 36.17 ? 49  LEU A CA  1 
ATOM   330  C C   . LEU A 1 50  ? 3.273   -11.633 -5.089  1.00 38.26 ? 49  LEU A C   1 
ATOM   331  O O   . LEU A 1 50  ? 3.350   -12.828 -4.895  1.00 38.68 ? 49  LEU A O   1 
ATOM   332  C CB  . LEU A 1 50  ? 2.721   -11.467 -7.488  1.00 33.07 ? 49  LEU A CB  1 
ATOM   333  C CG  . LEU A 1 50  ? 2.902   -10.769 -8.847  1.00 30.39 ? 49  LEU A CG  1 
ATOM   334  C CD1 . LEU A 1 50  ? 1.760   -11.288 -9.724  1.00 30.70 ? 49  LEU A CD1 1 
ATOM   335  C CD2 . LEU A 1 50  ? 2.919   -9.232  -8.735  1.00 27.90 ? 49  LEU A CD2 1 
ATOM   336  N N   . ILE A 1 51  ? 2.734   -10.785 -4.227  1.00 41.52 ? 50  ILE A N   1 
ATOM   337  C CA  . ILE A 1 51  ? 2.082   -11.232 -2.986  1.00 47.74 ? 50  ILE A CA  1 
ATOM   338  C C   . ILE A 1 51  ? 0.642   -11.745 -3.283  1.00 40.65 ? 50  ILE A C   1 
ATOM   339  O O   . ILE A 1 51  ? -0.242  -10.994 -3.672  1.00 38.18 ? 50  ILE A O   1 
ATOM   340  C CB  . ILE A 1 51  ? 2.106   -10.088 -1.936  1.00 51.31 ? 50  ILE A CB  1 
ATOM   341  C CG1 . ILE A 1 51  ? 3.554   -9.730  -1.523  1.00 51.72 ? 50  ILE A CG1 1 
ATOM   342  C CG2 . ILE A 1 51  ? 1.358   -10.515 -0.701  1.00 55.08 ? 50  ILE A CG2 1 
ATOM   343  C CD1 . ILE A 1 51  ? 3.742   -8.248  -1.214  1.00 49.70 ? 50  ILE A CD1 1 
ATOM   344  N N   . VAL A 1 52  ? 0.418   -13.031 -3.096  1.00 40.38 ? 51  VAL A N   1 
ATOM   345  C CA  . VAL A 1 52  ? -0.817  -13.681 -3.497  1.00 45.28 ? 51  VAL A CA  1 
ATOM   346  C C   . VAL A 1 52  ? -1.233  -14.688 -2.405  1.00 52.11 ? 51  VAL A C   1 
ATOM   347  O O   . VAL A 1 52  ? -0.378  -15.317 -1.799  1.00 54.81 ? 51  VAL A O   1 
ATOM   348  C CB  . VAL A 1 52  ? -0.589  -14.366 -4.868  1.00 45.06 ? 51  VAL A CB  1 
ATOM   349  C CG1 . VAL A 1 52  ? -1.683  -15.353 -5.224  1.00 43.72 ? 51  VAL A CG1 1 
ATOM   350  C CG2 . VAL A 1 52  ? -0.459  -13.301 -5.960  1.00 40.90 ? 51  VAL A CG2 1 
ATOM   351  N N   . PRO A 1 53  ? -2.542  -14.811 -2.127  1.00 58.47 ? 52  PRO A N   1 
ATOM   352  C CA  . PRO A 1 53  ? -3.041  -15.867 -1.238  1.00 58.02 ? 52  PRO A CA  1 
ATOM   353  C C   . PRO A 1 53  ? -2.485  -17.267 -1.493  1.00 55.11 ? 52  PRO A C   1 
ATOM   354  O O   . PRO A 1 53  ? -2.410  -17.709 -2.637  1.00 58.49 ? 52  PRO A O   1 
ATOM   355  C CB  . PRO A 1 53  ? -4.552  -15.871 -1.532  1.00 60.09 ? 52  PRO A CB  1 
ATOM   356  C CG  . PRO A 1 53  ? -4.875  -14.466 -1.945  1.00 60.09 ? 52  PRO A CG  1 
ATOM   357  C CD  . PRO A 1 53  ? -3.597  -13.819 -2.436  1.00 59.86 ? 52  PRO A CD  1 
ATOM   358  N N   . GLY A 1 54  ? -2.122  -17.972 -0.423  1.00 52.83 ? 53  GLY A N   1 
ATOM   359  C CA  . GLY A 1 54  ? -1.791  -19.401 -0.496  1.00 45.31 ? 53  GLY A CA  1 
ATOM   360  C C   . GLY A 1 54  ? -3.040  -20.151 -0.854  1.00 48.39 ? 53  GLY A C   1 
ATOM   361  O O   . GLY A 1 54  ? -4.139  -19.650 -0.612  1.00 45.85 ? 53  GLY A O   1 
ATOM   362  N N   . GLY A 1 55  ? -2.874  -21.317 -1.491  1.00 45.90 ? 54  GLY A N   1 
ATOM   363  C CA  . GLY A 1 55  ? -3.995  -22.172 -1.930  1.00 48.17 ? 54  GLY A CA  1 
ATOM   364  C C   . GLY A 1 55  ? -4.420  -21.968 -3.399  1.00 47.15 ? 54  GLY A C   1 
ATOM   365  O O   . GLY A 1 55  ? -4.892  -22.903 -4.042  1.00 44.58 ? 54  GLY A O   1 
ATOM   366  N N   . ILE A 1 56  ? -4.219  -20.748 -3.912  1.00 44.37 ? 55  ILE A N   1 
ATOM   367  C CA  . ILE A 1 56  ? -4.646  -20.309 -5.268  1.00 41.86 ? 55  ILE A CA  1 
ATOM   368  C C   . ILE A 1 56  ? -4.236  -21.269 -6.367  1.00 36.96 ? 55  ILE A C   1 
ATOM   369  O O   . ILE A 1 56  ? -3.115  -21.755 -6.383  1.00 41.75 ? 55  ILE A O   1 
ATOM   370  C CB  . ILE A 1 56  ? -4.069  -18.895 -5.575  1.00 47.18 ? 55  ILE A CB  1 
ATOM   371  C CG1 . ILE A 1 56  ? -4.823  -18.218 -6.726  1.00 41.91 ? 55  ILE A CG1 1 
ATOM   372  C CG2 . ILE A 1 56  ? -2.539  -18.933 -5.795  1.00 49.61 ? 55  ILE A CG2 1 
ATOM   373  C CD1 . ILE A 1 56  ? -4.527  -16.742 -6.798  1.00 43.89 ? 55  ILE A CD1 1 
ATOM   374  N N   . LYS A 1 57  ? -5.148  -21.534 -7.279  1.00 30.39 ? 56  LYS A N   1 
ATOM   375  C CA  . LYS A 1 57  ? -4.861  -22.288 -8.456  1.00 33.09 ? 56  LYS A CA  1 
ATOM   376  C C   . LYS A 1 57  ? -3.691  -21.575 -9.177  1.00 31.15 ? 56  LYS A C   1 
ATOM   377  O O   . LYS A 1 57  ? -3.693  -20.328 -9.309  1.00 29.17 ? 56  LYS A O   1 
ATOM   378  C CB  . LYS A 1 57  ? -6.087  -22.299 -9.311  1.00 31.56 ? 56  LYS A CB  1 
ATOM   379  C CG  . LYS A 1 57  ? -5.988  -23.165 -10.525 1.00 35.80 ? 56  LYS A CG  1 
ATOM   380  C CD  . LYS A 1 57  ? -7.318  -23.105 -11.255 1.00 40.22 ? 56  LYS A CD  1 
ATOM   381  C CE  . LYS A 1 57  ? -7.493  -24.344 -12.127 1.00 44.08 ? 56  LYS A CE  1 
ATOM   382  N NZ  . LYS A 1 57  ? -8.942  -24.504 -12.441 1.00 44.79 ? 56  LYS A NZ  1 
ATOM   383  N N   . THR A 1 58  ? -2.693  -22.372 -9.548  1.00 28.23 ? 57  THR A N   1 
ATOM   384  C CA  . THR A 1 58  ? -1.435  -21.862 -10.070 1.00 26.48 ? 57  THR A CA  1 
ATOM   385  C C   . THR A 1 58  ? -1.121  -22.585 -11.339 1.00 26.87 ? 57  THR A C   1 
ATOM   386  O O   . THR A 1 58  ? -1.149  -23.799 -11.345 1.00 27.81 ? 57  THR A O   1 
ATOM   387  C CB  . THR A 1 58  ? -0.287  -22.068 -9.063  1.00 28.83 ? 57  THR A CB  1 
ATOM   388  O OG1 . THR A 1 58  ? -0.652  -21.383 -7.881  1.00 30.79 ? 57  THR A OG1 1 
ATOM   389  C CG2 . THR A 1 58  ? 1.033   -21.425 -9.565  1.00 28.01 ? 57  THR A CG2 1 
ATOM   390  N N   . ILE A 1 59  ? -0.837  -21.827 -12.405 1.00 25.02 ? 58  ILE A N   1 
ATOM   391  C CA  . ILE A 1 59  ? -0.503  -22.343 -13.726 1.00 27.83 ? 58  ILE A CA  1 
ATOM   392  C C   . ILE A 1 59  ? 0.942   -21.907 -14.065 1.00 26.03 ? 58  ILE A C   1 
ATOM   393  O O   . ILE A 1 59  ? 1.301   -20.742 -13.944 1.00 26.09 ? 58  ILE A O   1 
ATOM   394  C CB  . ILE A 1 59  ? -1.479  -21.818 -14.794 1.00 31.50 ? 58  ILE A CB  1 
ATOM   395  C CG1 . ILE A 1 59  ? -2.857  -22.417 -14.541 1.00 34.59 ? 58  ILE A CG1 1 
ATOM   396  C CG2 . ILE A 1 59  ? -1.063  -22.260 -16.192 1.00 31.47 ? 58  ILE A CG2 1 
ATOM   397  C CD1 . ILE A 1 59  ? -3.957  -21.594 -15.124 1.00 37.98 ? 58  ILE A CD1 1 
ATOM   398  N N   . ASP A 1 60  ? 1.767   -22.878 -14.410 1.00 23.97 ? 59  ASP A N   1 
ATOM   399  C CA  . ASP A 1 60  ? 3.134   -22.603 -14.743 1.00 26.32 ? 59  ASP A CA  1 
ATOM   400  C C   . ASP A 1 60  ? 3.216   -22.439 -16.272 1.00 26.51 ? 59  ASP A C   1 
ATOM   401  O O   . ASP A 1 60  ? 3.084   -23.388 -16.984 1.00 29.34 ? 59  ASP A O   1 
ATOM   402  C CB  . ASP A 1 60  ? 4.018   -23.741 -14.245 1.00 31.18 ? 59  ASP A CB  1 
ATOM   403  C CG  . ASP A 1 60  ? 4.248   -23.683 -12.746 1.00 33.35 ? 59  ASP A CG  1 
ATOM   404  O OD1 . ASP A 1 60  ? 4.224   -22.563 -12.137 1.00 32.81 ? 59  ASP A OD1 1 
ATOM   405  O OD2 . ASP A 1 60  ? 4.563   -24.750 -12.185 1.00 31.06 ? 59  ASP A OD2 1 
ATOM   406  N N   . ALA A 1 61  ? 3.429   -21.210 -16.732 1.00 23.36 ? 60  ALA A N   1 
ATOM   407  C CA  . ALA A 1 61  ? 3.460   -20.848 -18.122 1.00 20.55 ? 60  ALA A CA  1 
ATOM   408  C C   . ALA A 1 61  ? 4.897   -20.676 -18.652 1.00 21.24 ? 60  ALA A C   1 
ATOM   409  O O   . ALA A 1 61  ? 5.135   -19.990 -19.646 1.00 20.18 ? 60  ALA A O   1 
ATOM   410  C CB  . ALA A 1 61  ? 2.715   -19.527 -18.260 1.00 20.99 ? 60  ALA A CB  1 
ATOM   411  N N   . HIS A 1 62  ? 5.876   -21.305 -18.002 1.00 21.12 ? 61  HIS A N   1 
ATOM   412  C CA  . HIS A 1 62  ? 7.272   -21.063 -18.338 1.00 22.16 ? 61  HIS A CA  1 
ATOM   413  C C   . HIS A 1 62  ? 7.590   -21.625 -19.670 1.00 20.70 ? 61  HIS A C   1 
ATOM   414  O O   . HIS A 1 62  ? 7.310   -22.769 -19.924 1.00 24.17 ? 61  HIS A O   1 
ATOM   415  C CB  . HIS A 1 62  ? 8.172   -21.716 -17.313 1.00 22.23 ? 61  HIS A CB  1 
ATOM   416  C CG  . HIS A 1 62  ? 7.931   -21.217 -15.930 1.00 22.09 ? 61  HIS A CG  1 
ATOM   417  N ND1 . HIS A 1 62  ? 6.883   -21.659 -15.169 1.00 23.30 ? 61  HIS A ND1 1 
ATOM   418  C CD2 . HIS A 1 62  ? 8.637   -20.364 -15.156 1.00 22.16 ? 61  HIS A CD2 1 
ATOM   419  C CE1 . HIS A 1 62  ? 6.916   -21.055 -14.000 1.00 25.58 ? 61  HIS A CE1 1 
ATOM   420  N NE2 . HIS A 1 62  ? 7.951   -20.240 -13.979 1.00 24.10 ? 61  HIS A NE2 1 
ATOM   421  N N   . GLY A 1 63  ? 8.204   -20.806 -20.507 1.00 22.49 ? 62  GLY A N   1 
ATOM   422  C CA  . GLY A 1 63  ? 8.548   -21.188 -21.905 1.00 22.00 ? 62  GLY A CA  1 
ATOM   423  C C   . GLY A 1 63  ? 7.383   -20.938 -22.800 1.00 21.31 ? 62  GLY A C   1 
ATOM   424  O O   . GLY A 1 63  ? 7.500   -21.101 -24.004 1.00 22.42 ? 62  GLY A O   1 
ATOM   425  N N   . LEU A 1 64  ? 6.245   -20.503 -22.248 1.00 21.38 ? 63  LEU A N   1 
ATOM   426  C CA  . LEU A 1 64  ? 5.061   -20.287 -23.077 1.00 20.96 ? 63  LEU A CA  1 
ATOM   427  C C   . LEU A 1 64  ? 4.701   -18.805 -23.040 1.00 18.83 ? 63  LEU A C   1 
ATOM   428  O O   . LEU A 1 64  ? 5.254   -18.037 -22.262 1.00 18.49 ? 63  LEU A O   1 
ATOM   429  C CB  . LEU A 1 64  ? 3.928   -21.139 -22.591 1.00 20.68 ? 63  LEU A CB  1 
ATOM   430  C CG  . LEU A 1 64  ? 4.210   -22.635 -22.516 1.00 21.47 ? 63  LEU A CG  1 
ATOM   431  C CD1 . LEU A 1 64  ? 2.999   -23.279 -21.793 1.00 24.98 ? 63  LEU A CD1 1 
ATOM   432  C CD2 . LEU A 1 64  ? 4.434   -23.303 -23.855 1.00 21.18 ? 63  LEU A CD2 1 
ATOM   433  N N   . MET A 1 65  ? 3.738   -18.423 -23.860 1.00 17.98 ? 64  MET A N   1 
ATOM   434  C CA  . MET A 1 65  ? 3.284   -17.031 -23.930 1.00 18.02 ? 64  MET A CA  1 
ATOM   435  C C   . MET A 1 65  ? 1.932   -16.885 -23.242 1.00 19.01 ? 64  MET A C   1 
ATOM   436  O O   . MET A 1 65  ? 1.195   -17.826 -23.180 1.00 19.72 ? 64  MET A O   1 
ATOM   437  C CB  . MET A 1 65  ? 3.138   -16.648 -25.389 1.00 18.85 ? 64  MET A CB  1 
ATOM   438  C CG  . MET A 1 65  ? 4.479   -16.440 -26.088 1.00 19.15 ? 64  MET A CG  1 
ATOM   439  S SD  . MET A 1 65  ? 4.193   -16.505 -27.871 1.00 22.72 ? 64  MET A SD  1 
ATOM   440  C CE  . MET A 1 65  ? 5.881   -16.529 -28.449 1.00 23.98 ? 64  MET A CE  1 
ATOM   441  N N   . VAL A 1 66  ? 1.633   -15.698 -22.713 1.00 15.92 ? 65  VAL A N   1 
ATOM   442  C CA  . VAL A 1 66  ? 0.376   -15.408 -22.114 1.00 17.55 ? 65  VAL A CA  1 
ATOM   443  C C   . VAL A 1 66  ? -0.169  -14.264 -22.920 1.00 20.75 ? 65  VAL A C   1 
ATOM   444  O O   . VAL A 1 66  ? 0.407   -13.183 -22.911 1.00 18.20 ? 65  VAL A O   1 
ATOM   445  C CB  . VAL A 1 66  ? 0.524   -14.928 -20.648 1.00 18.74 ? 65  VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 66  ? -0.830  -14.472 -20.079 1.00 19.12 ? 65  VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 66  ? 1.111   -16.057 -19.809 1.00 19.85 ? 65  VAL A CG2 1 
ATOM   448  N N   . LEU A 1 67  ? -1.244  -14.493 -23.665 1.00 18.82 ? 66  LEU A N   1 
ATOM   449  C CA  . LEU A 1 67  ? -1.746  -13.406 -24.486 1.00 19.35 ? 66  LEU A CA  1 
ATOM   450  C C   . LEU A 1 67  ? -3.222  -13.183 -24.339 1.00 16.20 ? 66  LEU A C   1 
ATOM   451  O O   . LEU A 1 67  ? -3.907  -13.985 -23.696 1.00 15.49 ? 66  LEU A O   1 
ATOM   452  C CB  . LEU A 1 67  ? -1.319  -13.611 -25.919 1.00 23.32 ? 66  LEU A CB  1 
ATOM   453  C CG  . LEU A 1 67  ? -1.443  -14.963 -26.558 1.00 24.72 ? 66  LEU A CG  1 
ATOM   454  C CD1 . LEU A 1 67  ? -2.807  -15.084 -27.153 1.00 29.81 ? 66  LEU A CD1 1 
ATOM   455  C CD2 . LEU A 1 67  ? -0.428  -15.042 -27.692 1.00 25.53 ? 66  LEU A CD2 1 
ATOM   456  N N   . PRO A 1 68  ? -3.696  -12.032 -24.816 1.00 15.15 ? 67  PRO A N   1 
ATOM   457  C CA  . PRO A 1 68  ? -5.136  -11.850 -24.659 1.00 15.21 ? 67  PRO A CA  1 
ATOM   458  C C   . PRO A 1 68  ? -5.902  -12.902 -25.435 1.00 14.24 ? 67  PRO A C   1 
ATOM   459  O O   . PRO A 1 68  ? -5.517  -13.286 -26.560 1.00 14.41 ? 67  PRO A O   1 
ATOM   460  C CB  . PRO A 1 68  ? -5.391  -10.440 -25.199 1.00 15.50 ? 67  PRO A CB  1 
ATOM   461  C CG  . PRO A 1 68  ? -4.037  -9.785  -25.218 1.00 15.37 ? 67  PRO A CG  1 
ATOM   462  C CD  . PRO A 1 68  ? -3.064  -10.871 -25.486 1.00 15.64 ? 67  PRO A CD  1 
ATOM   463  N N   . GLY A 1 69  ? -7.013  -13.356 -24.859 1.00 14.84 ? 68  GLY A N   1 
ATOM   464  C CA  . GLY A 1 69  ? -7.933  -14.176 -25.597 1.00 13.84 ? 68  GLY A CA  1 
ATOM   465  C C   . GLY A 1 69  ? -8.372  -13.594 -26.941 1.00 14.92 ? 68  GLY A C   1 
ATOM   466  O O   . GLY A 1 69  ? -8.498  -12.365 -27.110 1.00 13.63 ? 68  GLY A O   1 
ATOM   467  N N   . GLY A 1 70  ? -8.514  -14.482 -27.934 1.00 13.87 ? 69  GLY A N   1 
ATOM   468  C CA  . GLY A 1 70  ? -8.963  -13.997 -29.227 1.00 15.31 ? 69  GLY A CA  1 
ATOM   469  C C   . GLY A 1 70  ? -10.332 -13.328 -29.186 1.00 15.45 ? 69  GLY A C   1 
ATOM   470  O O   . GLY A 1 70  ? -11.201 -13.711 -28.358 1.00 16.28 ? 69  GLY A O   1 
ATOM   471  N N   . VAL A 1 71  ? -10.526 -12.344 -30.071 1.00 13.42 ? 70  VAL A N   1 
ATOM   472  C CA  . VAL A 1 71  ? -11.824 -11.668 -30.278 1.00 12.92 ? 70  VAL A CA  1 
ATOM   473  C C   . VAL A 1 71  ? -12.227 -11.958 -31.691 1.00 13.00 ? 70  VAL A C   1 
ATOM   474  O O   . VAL A 1 71  ? -11.621 -11.453 -32.648 1.00 12.42 ? 70  VAL A O   1 
ATOM   475  C CB  . VAL A 1 71  ? -11.775 -10.145 -30.004 1.00 12.84 ? 70  VAL A CB  1 
ATOM   476  C CG1 . VAL A 1 71  ? -13.097 -9.463  -30.300 1.00 12.13 ? 70  VAL A CG1 1 
ATOM   477  C CG2 . VAL A 1 71  ? -11.319 -9.883  -28.586 1.00 13.75 ? 70  VAL A CG2 1 
ATOM   478  N N   . ASP A 1 72  ? -13.238 -12.806 -31.871 1.00 12.70 ? 71  ASP A N   1 
ATOM   479  C CA  . ASP A 1 72  ? -13.694 -13.145 -33.188 1.00 13.50 ? 71  ASP A CA  1 
ATOM   480  C C   . ASP A 1 72  ? -14.732 -12.127 -33.595 1.00 13.78 ? 71  ASP A C   1 
ATOM   481  O O   . ASP A 1 72  ? -15.885 -12.138 -33.123 1.00 13.72 ? 71  ASP A O   1 
ATOM   482  C CB  . ASP A 1 72  ? -14.194 -14.585 -33.275 1.00 15.00 ? 71  ASP A CB  1 
ATOM   483  C CG  . ASP A 1 72  ? -14.522 -15.044 -34.724 1.00 14.77 ? 71  ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 72  ? -14.730 -14.211 -35.631 1.00 14.13 ? 71  ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 72  ? -14.564 -16.292 -34.913 1.00 15.79 ? 71  ASP A OD2 1 
ATOM   486  N N   . VAL A 1 73  ? -14.315 -11.277 -34.537 1.00 13.63 ? 72  VAL A N   1 
ATOM   487  C CA  . VAL A 1 73  ? -15.135 -10.206 -34.995 1.00 14.22 ? 72  VAL A CA  1 
ATOM   488  C C   . VAL A 1 73  ? -16.330 -10.571 -35.852 1.00 13.71 ? 72  VAL A C   1 
ATOM   489  O O   . VAL A 1 73  ? -17.182 -9.700  -36.076 1.00 12.94 ? 72  VAL A O   1 
ATOM   490  C CB  . VAL A 1 73  ? -14.326 -9.127  -35.722 1.00 14.18 ? 72  VAL A CB  1 
ATOM   491  C CG1 . VAL A 1 73  ? -13.361 -8.480  -34.786 1.00 15.48 ? 72  VAL A CG1 1 
ATOM   492  C CG2 . VAL A 1 73  ? -13.590 -9.691  -36.945 1.00 15.28 ? 72  VAL A CG2 1 
ATOM   493  N N   . HIS A 1 74  ? -16.471 -11.853 -36.225 1.00 13.76 ? 73  HIS A N   1 
ATOM   494  C CA  . HIS A 1 74  ? -17.538 -12.269 -37.085 1.00 14.27 ? 73  HIS A CA  1 
ATOM   495  C C   . HIS A 1 74  ? -17.938 -13.712 -36.846 1.00 13.75 ? 73  HIS A C   1 
ATOM   496  O O   . HIS A 1 74  ? -17.257 -14.660 -37.312 1.00 15.10 ? 73  HIS A O   1 
ATOM   497  C CB  . HIS A 1 74  ? -17.085 -12.087 -38.541 1.00 16.19 ? 73  HIS A CB  1 
ATOM   498  C CG  . HIS A 1 74  ? -18.183 -12.151 -39.551 1.00 16.19 ? 73  HIS A CG  1 
ATOM   499  N ND1 . HIS A 1 74  ? -18.087 -11.507 -40.763 1.00 16.42 ? 73  HIS A ND1 1 
ATOM   500  C CD2 . HIS A 1 74  ? -19.415 -12.715 -39.521 1.00 17.60 ? 73  HIS A CD2 1 
ATOM   501  C CE1 . HIS A 1 74  ? -19.196 -11.702 -41.454 1.00 18.25 ? 73  HIS A CE1 1 
ATOM   502  N NE2 . HIS A 1 74  ? -20.001 -12.458 -40.735 1.00 18.17 ? 73  HIS A NE2 1 
ATOM   503  N N   . THR A 1 75  ? -19.108 -13.864 -36.236 1.00 13.11 ? 74  THR A N   1 
ATOM   504  C CA  . THR A 1 75  ? -19.772 -15.172 -36.164 1.00 14.12 ? 74  THR A CA  1 
ATOM   505  C C   . THR A 1 75  ? -21.247 -15.041 -36.558 1.00 14.77 ? 74  THR A C   1 
ATOM   506  O O   . THR A 1 75  ? -21.840 -13.940 -36.467 1.00 13.64 ? 74  THR A O   1 
ATOM   507  C CB  . THR A 1 75  ? -19.656 -15.818 -34.754 1.00 14.36 ? 74  THR A CB  1 
ATOM   508  O OG1 . THR A 1 75  ? -20.362 -15.023 -33.781 1.00 14.32 ? 74  THR A OG1 1 
ATOM   509  C CG2 . THR A 1 75  ? -18.127 -16.045 -34.382 1.00 14.56 ? 74  THR A CG2 1 
ATOM   510  N N   . ARG A 1 76  ? -21.820 -16.153 -37.004 1.00 15.76 ? 75  ARG A N   1 
ATOM   511  C CA  . ARG A 1 76  ? -23.198 -16.211 -37.479 1.00 15.95 ? 75  ARG A CA  1 
ATOM   512  C C   . ARG A 1 76  ? -23.813 -17.510 -36.967 1.00 17.42 ? 75  ARG A C   1 
ATOM   513  O O   . ARG A 1 76  ? -24.265 -18.362 -37.714 1.00 20.64 ? 75  ARG A O   1 
ATOM   514  C CB  . ARG A 1 76  ? -23.240 -16.103 -39.044 1.00 16.18 ? 75  ARG A CB  1 
ATOM   515  C CG  . ARG A 1 76  ? -23.012 -14.680 -39.538 1.00 16.94 ? 75  ARG A CG  1 
ATOM   516  C CD  . ARG A 1 76  ? -23.064 -14.580 -41.093 1.00 17.08 ? 75  ARG A CD  1 
ATOM   517  N NE  . ARG A 1 76  ? -22.780 -13.184 -41.457 1.00 18.88 ? 75  ARG A NE  1 
ATOM   518  C CZ  . ARG A 1 76  ? -23.679 -12.207 -41.412 1.00 21.15 ? 75  ARG A CZ  1 
ATOM   519  N NH1 . ARG A 1 76  ? -24.956 -12.442 -41.054 1.00 24.38 ? 75  ARG A NH1 1 
ATOM   520  N NH2 . ARG A 1 76  ? -23.306 -10.976 -41.676 1.00 20.44 ? 75  ARG A NH2 1 
ATOM   521  N N   . LEU A 1 77  ? -23.820 -17.642 -35.658 1.00 18.15 ? 76  LEU A N   1 
ATOM   522  C CA  . LEU A 1 77  ? -24.188 -18.865 -35.032 1.00 17.72 ? 76  LEU A CA  1 
ATOM   523  C C   . LEU A 1 77  ? -25.708 -19.138 -34.938 1.00 19.68 ? 76  LEU A C   1 
ATOM   524  O O   . LEU A 1 77  ? -26.086 -20.248 -34.631 1.00 20.04 ? 76  LEU A O   1 
ATOM   525  C CB  . LEU A 1 77  ? -23.588 -18.947 -33.617 1.00 18.01 ? 76  LEU A CB  1 
ATOM   526  C CG  . LEU A 1 77  ? -22.067 -18.803 -33.455 1.00 17.22 ? 76  LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 77  ? -21.616 -18.918 -32.010 1.00 18.04 ? 76  LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 77  ? -21.384 -19.819 -34.348 1.00 17.69 ? 76  LEU A CD2 1 
ATOM   529  N N   A GLN A 1 78  ? -26.536 -18.131 -35.146 0.50 19.30 ? 77  GLN A N   1 
ATOM   530  N N   B GLN A 1 78  ? -26.519 -18.109 -35.124 0.50 19.56 ? 77  GLN A N   1 
ATOM   531  C CA  A GLN A 1 78  ? -27.992 -18.287 -35.068 0.50 21.25 ? 77  GLN A CA  1 
ATOM   532  C CA  B GLN A 1 78  ? -27.976 -18.198 -35.021 0.50 21.62 ? 77  GLN A CA  1 
ATOM   533  C C   A GLN A 1 78  ? -28.709 -17.735 -36.287 0.50 21.81 ? 77  GLN A C   1 
ATOM   534  C C   B GLN A 1 78  ? -28.671 -17.931 -36.350 0.50 21.81 ? 77  GLN A C   1 
ATOM   535  O O   A GLN A 1 78  ? -29.936 -17.615 -36.278 0.50 20.35 ? 77  GLN A O   1 
ATOM   536  O O   B GLN A 1 78  ? -29.824 -18.264 -36.497 0.50 20.17 ? 77  GLN A O   1 
ATOM   537  C CB  A GLN A 1 78  ? -28.504 -17.586 -33.817 0.50 22.05 ? 77  GLN A CB  1 
ATOM   538  C CB  B GLN A 1 78  ? -28.482 -17.196 -33.987 0.50 23.15 ? 77  GLN A CB  1 
ATOM   539  C CG  A GLN A 1 78  ? -27.966 -18.129 -32.479 0.50 24.20 ? 77  GLN A CG  1 
ATOM   540  C CG  B GLN A 1 78  ? -27.813 -17.267 -32.603 0.50 26.46 ? 77  GLN A CG  1 
ATOM   541  C CD  A GLN A 1 78  ? -28.759 -19.303 -31.932 0.50 25.41 ? 77  GLN A CD  1 
ATOM   542  C CD  B GLN A 1 78  ? -28.610 -16.558 -31.491 0.50 27.48 ? 77  GLN A CD  1 
ATOM   543  O OE1 A GLN A 1 78  ? -29.934 -19.474 -32.305 0.50 28.37 ? 77  GLN A OE1 1 
ATOM   544  O OE1 B GLN A 1 78  ? -29.731 -16.089 -31.712 0.50 30.54 ? 77  GLN A OE1 1 
ATOM   545  N NE2 A GLN A 1 78  ? -28.131 -20.127 -31.064 0.50 19.16 ? 77  GLN A NE2 1 
ATOM   546  N NE2 B GLN A 1 78  ? -28.028 -16.469 -30.313 0.50 30.13 ? 77  GLN A NE2 1 
ATOM   547  N N   . MET A 1 79  ? -27.967 -17.373 -37.333 1.00 22.50 ? 78  MET A N   1 
ATOM   548  C CA  . MET A 1 79  ? -28.595 -16.761 -38.491 1.00 26.66 ? 78  MET A CA  1 
ATOM   549  C C   . MET A 1 79  ? -29.375 -17.811 -39.290 1.00 24.52 ? 78  MET A C   1 
ATOM   550  O O   . MET A 1 79  ? -28.801 -18.803 -39.629 1.00 24.94 ? 78  MET A O   1 
ATOM   551  C CB  . MET A 1 79  ? -27.531 -16.191 -39.438 1.00 32.29 ? 78  MET A CB  1 
ATOM   552  C CG  . MET A 1 79  ? -28.100 -15.592 -40.722 1.00 34.43 ? 78  MET A CG  1 
ATOM   553  S SD  . MET A 1 79  ? -26.669 -15.053 -41.641 1.00 37.46 ? 78  MET A SD  1 
ATOM   554  C CE  . MET A 1 79  ? -26.058 -16.536 -42.325 1.00 40.43 ? 78  MET A CE  1 
ATOM   555  N N   . PRO A 1 80  ? -30.640 -17.538 -39.643 1.00 26.29 ? 79  PRO A N   1 
ATOM   556  C CA  . PRO A 1 80  ? -31.351 -18.496 -40.525 1.00 26.96 ? 79  PRO A CA  1 
ATOM   557  C C   . PRO A 1 80  ? -30.853 -18.349 -41.969 1.00 25.14 ? 79  PRO A C   1 
ATOM   558  O O   . PRO A 1 80  ? -30.691 -17.236 -42.418 1.00 24.71 ? 79  PRO A O   1 
ATOM   559  C CB  . PRO A 1 80  ? -32.800 -18.040 -40.417 1.00 26.76 ? 79  PRO A CB  1 
ATOM   560  C CG  . PRO A 1 80  ? -32.695 -16.590 -40.176 1.00 27.89 ? 79  PRO A CG  1 
ATOM   561  C CD  . PRO A 1 80  ? -31.509 -16.421 -39.266 1.00 25.93 ? 79  PRO A CD  1 
ATOM   562  N N   . VAL A 1 81  ? -30.585 -19.447 -42.659 1.00 24.44 ? 80  VAL A N   1 
ATOM   563  C CA  . VAL A 1 81  ? -30.129 -19.443 -44.073 1.00 25.58 ? 80  VAL A CA  1 
ATOM   564  C C   . VAL A 1 81  ? -30.975 -20.394 -44.899 1.00 25.39 ? 80  VAL A C   1 
ATOM   565  O O   . VAL A 1 81  ? -30.919 -21.610 -44.682 1.00 24.68 ? 80  VAL A O   1 
ATOM   566  C CB  . VAL A 1 81  ? -28.658 -19.854 -44.208 1.00 25.18 ? 80  VAL A CB  1 
ATOM   567  C CG1 . VAL A 1 81  ? -28.204 -19.729 -45.667 1.00 26.51 ? 80  VAL A CG1 1 
ATOM   568  C CG2 . VAL A 1 81  ? -27.788 -18.938 -43.371 1.00 26.14 ? 80  VAL A CG2 1 
ATOM   569  N N   . LEU A 1 82  ? -31.783 -19.850 -45.835 1.00 27.91 ? 81  LEU A N   1 
ATOM   570  C CA  . LEU A 1 82  ? -32.754 -20.668 -46.607 1.00 27.15 ? 81  LEU A CA  1 
ATOM   571  C C   . LEU A 1 82  ? -33.633 -21.502 -45.686 1.00 25.98 ? 81  LEU A C   1 
ATOM   572  O O   . LEU A 1 82  ? -33.861 -22.696 -45.943 1.00 24.42 ? 81  LEU A O   1 
ATOM   573  C CB  . LEU A 1 82  ? -32.016 -21.533 -47.628 1.00 27.32 ? 81  LEU A CB  1 
ATOM   574  C CG  . LEU A 1 82  ? -31.106 -20.670 -48.545 1.00 30.93 ? 81  LEU A CG  1 
ATOM   575  C CD1 . LEU A 1 82  ? -30.294 -21.537 -49.483 1.00 32.56 ? 81  LEU A CD1 1 
ATOM   576  C CD2 . LEU A 1 82  ? -31.927 -19.679 -49.334 1.00 32.74 ? 81  LEU A CD2 1 
ATOM   577  N N   . GLY A 1 83  ? -34.111 -20.891 -44.596 1.00 25.05 ? 82  GLY A N   1 
ATOM   578  C CA  . GLY A 1 83  ? -34.939 -21.631 -43.627 1.00 25.52 ? 82  GLY A CA  1 
ATOM   579  C C   . GLY A 1 83  ? -34.160 -22.553 -42.655 1.00 29.41 ? 82  GLY A C   1 
ATOM   580  O O   . GLY A 1 83  ? -34.784 -23.178 -41.768 1.00 27.26 ? 82  GLY A O   1 
ATOM   581  N N   . MET A 1 84  ? -32.824 -22.652 -42.799 1.00 27.16 ? 83  MET A N   1 
ATOM   582  C CA  . MET A 1 84  ? -32.035 -23.640 -42.032 1.00 28.97 ? 83  MET A CA  1 
ATOM   583  C C   . MET A 1 84  ? -31.433 -22.903 -40.812 1.00 28.66 ? 83  MET A C   1 
ATOM   584  O O   . MET A 1 84  ? -30.956 -21.790 -40.948 1.00 28.32 ? 83  MET A O   1 
ATOM   585  C CB  . MET A 1 84  ? -30.851 -24.165 -42.855 1.00 30.38 ? 83  MET A CB  1 
ATOM   586  C CG  . MET A 1 84  ? -31.146 -24.893 -44.171 1.00 34.21 ? 83  MET A CG  1 
ATOM   587  S SD  . MET A 1 84  ? -31.867 -26.472 -43.749 1.00 29.21 ? 83  MET A SD  1 
ATOM   588  C CE  . MET A 1 84  ? -31.878 -27.234 -45.365 1.00 36.53 ? 83  MET A CE  1 
ATOM   589  N N   . THR A 1 85  ? -31.394 -23.566 -39.670 1.00 24.58 ? 84  THR A N   1 
ATOM   590  C CA  . THR A 1 85  ? -30.724 -23.088 -38.478 1.00 23.98 ? 84  THR A CA  1 
ATOM   591  C C   . THR A 1 85  ? -29.287 -23.640 -38.479 1.00 22.32 ? 84  THR A C   1 
ATOM   592  O O   . THR A 1 85  ? -29.093 -24.863 -38.606 1.00 18.31 ? 84  THR A O   1 
ATOM   593  C CB  . THR A 1 85  ? -31.456 -23.720 -37.264 1.00 26.97 ? 84  THR A CB  1 
ATOM   594  O OG1 . THR A 1 85  ? -32.843 -23.393 -37.369 1.00 27.02 ? 84  THR A OG1 1 
ATOM   595  C CG2 . THR A 1 85  ? -30.947 -23.235 -35.954 1.00 25.63 ? 84  THR A CG2 1 
ATOM   596  N N   . PRO A 1 86  ? -28.290 -22.796 -38.234 1.00 19.62 ? 85  PRO A N   1 
ATOM   597  C CA  . PRO A 1 86  ? -26.915 -23.377 -38.216 1.00 21.83 ? 85  PRO A CA  1 
ATOM   598  C C   . PRO A 1 86  ? -26.705 -24.515 -37.230 1.00 21.01 ? 85  PRO A C   1 
ATOM   599  O O   . PRO A 1 86  ? -27.236 -24.496 -36.143 1.00 19.72 ? 85  PRO A O   1 
ATOM   600  C CB  . PRO A 1 86  ? -26.014 -22.173 -37.809 1.00 19.30 ? 85  PRO A CB  1 
ATOM   601  C CG  . PRO A 1 86  ? -26.752 -21.015 -38.249 1.00 19.39 ? 85  PRO A CG  1 
ATOM   602  C CD  . PRO A 1 86  ? -28.237 -21.343 -38.025 1.00 20.50 ? 85  PRO A CD  1 
ATOM   603  N N   . ALA A 1 87  ? -25.929 -25.481 -37.647 1.00 20.87 ? 86  ALA A N   1 
ATOM   604  C CA  . ALA A 1 87  ? -25.644 -26.677 -36.834 1.00 23.48 ? 86  ALA A CA  1 
ATOM   605  C C   . ALA A 1 87  ? -24.843 -26.402 -35.516 1.00 24.74 ? 86  ALA A C   1 
ATOM   606  O O   . ALA A 1 87  ? -24.996 -27.133 -34.563 1.00 25.28 ? 86  ALA A O   1 
ATOM   607  C CB  . ALA A 1 87  ? -24.907 -27.739 -37.700 1.00 23.15 ? 86  ALA A CB  1 
ATOM   608  N N   . ASP A 1 88  ? -23.943 -25.404 -35.509 1.00 22.75 ? 87  ASP A N   1 
ATOM   609  C CA  . ASP A 1 88  ? -23.209 -24.985 -34.299 1.00 22.84 ? 87  ASP A CA  1 
ATOM   610  C C   . ASP A 1 88  ? -23.902 -23.755 -33.810 1.00 22.08 ? 87  ASP A C   1 
ATOM   611  O O   . ASP A 1 88  ? -23.847 -22.698 -34.430 1.00 19.87 ? 87  ASP A O   1 
ATOM   612  C CB  . ASP A 1 88  ? -21.699 -24.706 -34.598 1.00 23.42 ? 87  ASP A CB  1 
ATOM   613  C CG  . ASP A 1 88  ? -20.982 -25.915 -35.056 1.00 27.28 ? 87  ASP A CG  1 
ATOM   614  O OD1 . ASP A 1 88  ? -21.261 -27.019 -34.476 1.00 24.79 ? 87  ASP A OD1 1 
ATOM   615  O OD2 . ASP A 1 88  ? -20.172 -25.785 -36.043 1.00 27.78 ? 87  ASP A OD2 1 
ATOM   616  N N   . ASP A 1 89  ? -24.661 -23.908 -32.739 1.00 20.99 ? 88  ASP A N   1 
ATOM   617  C CA  . ASP A 1 89  ? -25.453 -22.824 -32.181 1.00 20.07 ? 88  ASP A CA  1 
ATOM   618  C C   . ASP A 1 89  ? -24.627 -22.069 -31.154 1.00 19.00 ? 88  ASP A C   1 
ATOM   619  O O   . ASP A 1 89  ? -23.436 -22.290 -31.058 1.00 18.90 ? 88  ASP A O   1 
ATOM   620  C CB  . ASP A 1 89  ? -26.760 -23.396 -31.595 1.00 21.76 ? 88  ASP A CB  1 
ATOM   621  C CG  . ASP A 1 89  ? -26.548 -24.220 -30.351 1.00 25.89 ? 88  ASP A CG  1 
ATOM   622  O OD1 . ASP A 1 89  ? -25.402 -24.452 -29.853 1.00 25.19 ? 88  ASP A OD1 1 
ATOM   623  O OD2 . ASP A 1 89  ? -27.592 -24.673 -29.883 1.00 28.29 ? 88  ASP A OD2 1 
ATOM   624  N N   . PHE A 1 90  ? -25.216 -21.189 -30.380 1.00 17.92 ? 89  PHE A N   1 
ATOM   625  C CA  . PHE A 1 90  ? -24.396 -20.334 -29.553 1.00 22.09 ? 89  PHE A CA  1 
ATOM   626  C C   . PHE A 1 90  ? -23.552 -21.070 -28.526 1.00 21.76 ? 89  PHE A C   1 
ATOM   627  O O   . PHE A 1 90  ? -22.435 -20.667 -28.190 1.00 22.71 ? 89  PHE A O   1 
ATOM   628  C CB  . PHE A 1 90  ? -25.237 -19.275 -28.876 1.00 22.12 ? 89  PHE A CB  1 
ATOM   629  C CG  . PHE A 1 90  ? -24.703 -17.864 -29.071 1.00 25.34 ? 89  PHE A CG  1 
ATOM   630  C CD1 . PHE A 1 90  ? -25.119 -17.118 -30.122 1.00 26.76 ? 89  PHE A CD1 1 
ATOM   631  C CD2 . PHE A 1 90  ? -23.850 -17.292 -28.163 1.00 28.33 ? 89  PHE A CD2 1 
ATOM   632  C CE1 . PHE A 1 90  ? -24.708 -15.827 -30.337 1.00 25.09 ? 89  PHE A CE1 1 
ATOM   633  C CE2 . PHE A 1 90  ? -23.411 -15.975 -28.335 1.00 32.01 ? 89  PHE A CE2 1 
ATOM   634  C CZ  . PHE A 1 90  ? -23.832 -15.256 -29.451 1.00 30.02 ? 89  PHE A CZ  1 
ATOM   635  N N   . CYS A 1 91  ? -24.107 -22.136 -27.992 1.00 21.60 ? 90  CYS A N   1 
ATOM   636  C CA  . CYS A 1 91  ? -23.437 -22.987 -27.054 1.00 21.85 ? 90  CYS A CA  1 
ATOM   637  C C   . CYS A 1 91  ? -22.282 -23.792 -27.679 1.00 21.67 ? 90  CYS A C   1 
ATOM   638  O O   . CYS A 1 91  ? -21.147 -23.760 -27.194 1.00 21.59 ? 90  CYS A O   1 
ATOM   639  C CB  . CYS A 1 91  ? -24.454 -23.993 -26.442 1.00 24.40 ? 90  CYS A CB  1 
ATOM   640  S SG  . CYS A 1 91  ? -23.595 -25.000 -25.226 1.00 31.04 ? 90  CYS A SG  1 
ATOM   641  N N   . GLN A 1 92  ? -22.541 -24.503 -28.775 1.00 20.67 ? 91  GLN A N   1 
ATOM   642  C CA  . GLN A 1 92  ? -21.487 -25.269 -29.407 1.00 21.67 ? 91  GLN A CA  1 
ATOM   643  C C   . GLN A 1 92  ? -20.392 -24.383 -30.046 1.00 20.64 ? 91  GLN A C   1 
ATOM   644  O O   . GLN A 1 92  ? -19.180 -24.744 -29.965 1.00 18.60 ? 91  GLN A O   1 
ATOM   645  C CB  . GLN A 1 92  ? -22.032 -26.234 -30.430 1.00 20.74 ? 91  GLN A CB  1 
ATOM   646  C CG  . GLN A 1 92  ? -21.008 -27.273 -30.882 1.00 22.81 ? 91  GLN A CG  1 
ATOM   647  C CD  . GLN A 1 92  ? -20.553 -28.202 -29.780 1.00 24.23 ? 91  GLN A CD  1 
ATOM   648  O OE1 . GLN A 1 92  ? -21.331 -28.619 -28.956 1.00 27.87 ? 91  GLN A OE1 1 
ATOM   649  N NE2 . GLN A 1 92  ? -19.267 -28.498 -29.738 1.00 24.91 ? 91  GLN A NE2 1 
ATOM   650  N N   . GLY A 1 93  ? -20.829 -23.292 -30.700 1.00 18.20 ? 92  GLY A N   1 
ATOM   651  C CA  . GLY A 1 93  ? -19.952 -22.290 -31.328 1.00 18.51 ? 92  GLY A CA  1 
ATOM   652  C C   . GLY A 1 93  ? -18.983 -21.683 -30.294 1.00 19.89 ? 92  GLY A C   1 
ATOM   653  O O   . GLY A 1 93  ? -17.788 -21.630 -30.516 1.00 19.72 ? 92  GLY A O   1 
ATOM   654  N N   . THR A 1 94  ? -19.486 -21.275 -29.143 1.00 16.50 ? 93  THR A N   1 
ATOM   655  C CA  . THR A 1 94  ? -18.636 -20.634 -28.173 1.00 17.77 ? 93  THR A CA  1 
ATOM   656  C C   . THR A 1 94  ? -17.718 -21.639 -27.481 1.00 20.96 ? 93  THR A C   1 
ATOM   657  O O   . THR A 1 94  ? -16.597 -21.273 -27.078 1.00 17.14 ? 93  THR A O   1 
ATOM   658  C CB  . THR A 1 94  ? -19.385 -19.807 -27.133 1.00 17.30 ? 93  THR A CB  1 
ATOM   659  O OG1 . THR A 1 94  ? -20.365 -20.602 -26.438 1.00 17.08 ? 93  THR A OG1 1 
ATOM   660  C CG2 . THR A 1 94  ? -20.040 -18.594 -27.789 1.00 16.55 ? 93  THR A CG2 1 
ATOM   661  N N   . LYS A 1 95  ? -18.173 -22.887 -27.357 1.00 18.38 ? 94  LYS A N   1 
ATOM   662  C CA  . LYS A 1 95  ? -17.308 -23.926 -26.872 1.00 19.56 ? 94  LYS A CA  1 
ATOM   663  C C   . LYS A 1 95  ? -16.153 -24.138 -27.869 1.00 17.77 ? 94  LYS A C   1 
ATOM   664  O O   . LYS A 1 95  ? -14.985 -24.234 -27.467 1.00 18.00 ? 94  LYS A O   1 
ATOM   665  C CB  . LYS A 1 95  ? -18.081 -25.204 -26.684 1.00 21.14 ? 94  LYS A CB  1 
ATOM   666  C CG  . LYS A 1 95  ? -17.272 -26.362 -26.136 1.00 23.29 ? 94  LYS A CG  1 
ATOM   667  C CD  . LYS A 1 95  ? -18.137 -27.604 -26.023 1.00 26.00 ? 94  LYS A CD  1 
ATOM   668  C CE  . LYS A 1 95  ? -17.280 -28.738 -25.551 1.00 30.95 ? 94  LYS A CE  1 
ATOM   669  N NZ  . LYS A 1 95  ? -18.185 -29.883 -25.385 1.00 33.11 ? 94  LYS A NZ  1 
ATOM   670  N N   . ALA A 1 96  ? -16.468 -24.197 -29.145 1.00 16.15 ? 95  ALA A N   1 
ATOM   671  C CA  . ALA A 1 96  ? -15.479 -24.396 -30.170 1.00 17.05 ? 95  ALA A CA  1 
ATOM   672  C C   . ALA A 1 96  ? -14.477 -23.204 -30.204 1.00 17.72 ? 95  ALA A C   1 
ATOM   673  O O   . ALA A 1 96  ? -13.295 -23.377 -30.465 1.00 17.90 ? 95  ALA A O   1 
ATOM   674  C CB  . ALA A 1 96  ? -16.172 -24.559 -31.508 1.00 16.01 ? 95  ALA A CB  1 
ATOM   675  N N   . ALA A 1 97  ? -15.008 -22.012 -30.037 1.00 17.48 ? 96  ALA A N   1 
ATOM   676  C CA  . ALA A 1 97  ? -14.205 -20.820 -29.945 1.00 18.75 ? 96  ALA A CA  1 
ATOM   677  C C   . ALA A 1 97  ? -13.143 -20.926 -28.791 1.00 16.55 ? 96  ALA A C   1 
ATOM   678  O O   . ALA A 1 97  ? -11.948 -20.807 -29.060 1.00 15.61 ? 96  ALA A O   1 
ATOM   679  C CB  . ALA A 1 97  ? -15.106 -19.595 -29.762 1.00 18.39 ? 96  ALA A CB  1 
ATOM   680  N N   . LEU A 1 98  ? -13.605 -21.120 -27.565 1.00 15.69 ? 97  LEU A N   1 
ATOM   681  C CA  . LEU A 1 98  ? -12.754 -21.363 -26.408 1.00 15.86 ? 97  LEU A CA  1 
ATOM   682  C C   . LEU A 1 98  ? -11.724 -22.449 -26.686 1.00 17.93 ? 97  LEU A C   1 
ATOM   683  O O   . LEU A 1 98  ? -10.572 -22.263 -26.410 1.00 18.03 ? 97  LEU A O   1 
ATOM   684  C CB  . LEU A 1 98  ? -13.573 -21.725 -25.185 1.00 16.57 ? 97  LEU A CB  1 
ATOM   685  C CG  . LEU A 1 98  ? -14.396 -20.557 -24.603 1.00 17.50 ? 97  LEU A CG  1 
ATOM   686  C CD1 . LEU A 1 98  ? -15.429 -21.054 -23.597 1.00 17.62 ? 97  LEU A CD1 1 
ATOM   687  C CD2 . LEU A 1 98  ? -13.480 -19.540 -23.916 1.00 18.08 ? 97  LEU A CD2 1 
ATOM   688  N N   . ALA A 1 99  ? -12.121 -23.571 -27.265 1.00 18.08 ? 98  ALA A N   1 
ATOM   689  C CA  . ALA A 1 99  ? -11.134 -24.615 -27.608 1.00 20.27 ? 98  ALA A CA  1 
ATOM   690  C C   . ALA A 1 99  ? -10.008 -24.120 -28.519 1.00 19.34 ? 98  ALA A C   1 
ATOM   691  O O   . ALA A 1 99  ? -8.895  -24.610 -28.443 1.00 17.06 ? 98  ALA A O   1 
ATOM   692  C CB  . ALA A 1 99  ? -11.806 -25.772 -28.256 1.00 19.19 ? 98  ALA A CB  1 
ATOM   693  N N   . GLY A 1 100 ? -10.286 -23.124 -29.352 1.00 18.55 ? 99  GLY A N   1 
ATOM   694  C CA  . GLY A 1 100 ? -9.239  -22.567 -30.192 1.00 17.70 ? 99  GLY A CA  1 
ATOM   695  C C   . GLY A 1 100 ? -8.617  -21.265 -29.719 1.00 18.19 ? 99  GLY A C   1 
ATOM   696  O O   . GLY A 1 100 ? -7.836  -20.648 -30.477 1.00 18.88 ? 99  GLY A O   1 
ATOM   697  N N   . GLY A 1 101 ? -8.873  -20.867 -28.485 1.00 16.04 ? 100 GLY A N   1 
ATOM   698  C CA  . GLY A 1 101 ? -8.244  -19.746 -27.920 1.00 15.56 ? 100 GLY A CA  1 
ATOM   699  C C   . GLY A 1 101 ? -8.952  -18.422 -28.139 1.00 14.65 ? 100 GLY A C   1 
ATOM   700  O O   . GLY A 1 101 ? -8.392  -17.370 -27.880 1.00 14.83 ? 100 GLY A O   1 
ATOM   701  N N   . THR A 1 102 ? -10.205 -18.485 -28.571 1.00 14.04 ? 101 THR A N   1 
ATOM   702  C CA  . THR A 1 102 ? -11.041 -17.283 -28.675 1.00 14.82 ? 101 THR A CA  1 
ATOM   703  C C   . THR A 1 102 ? -11.973 -17.190 -27.486 1.00 15.47 ? 101 THR A C   1 
ATOM   704  O O   . THR A 1 102 ? -12.638 -18.180 -27.154 1.00 17.38 ? 101 THR A O   1 
ATOM   705  C CB  . THR A 1 102 ? -11.810 -17.349 -30.003 1.00 15.28 ? 101 THR A CB  1 
ATOM   706  O OG1 . THR A 1 102 ? -10.849 -17.165 -31.041 1.00 15.03 ? 101 THR A OG1 1 
ATOM   707  C CG2 . THR A 1 102 ? -12.845 -16.284 -30.087 1.00 15.65 ? 101 THR A CG2 1 
ATOM   708  N N   . THR A 1 103 ? -11.984 -16.031 -26.824 1.00 16.07 ? 102 THR A N   1 
ATOM   709  C CA  . THR A 1 103 ? -12.768 -15.808 -25.620 1.00 16.23 ? 102 THR A CA  1 
ATOM   710  C C   . THR A 1 103 ? -13.840 -14.781 -25.759 1.00 16.19 ? 102 THR A C   1 
ATOM   711  O O   . THR A 1 103 ? -14.574 -14.520 -24.807 1.00 14.72 ? 102 THR A O   1 
ATOM   712  C CB  . THR A 1 103 ? -11.851 -15.357 -24.486 1.00 18.28 ? 102 THR A CB  1 
ATOM   713  O OG1 . THR A 1 103 ? -11.027 -14.251 -24.910 1.00 17.73 ? 102 THR A OG1 1 
ATOM   714  C CG2 . THR A 1 103 ? -10.965 -16.557 -24.039 1.00 17.70 ? 102 THR A CG2 1 
ATOM   715  N N   . MET A 1 104 ? -13.946 -14.174 -26.924 1.00 15.50 ? 103 MET A N   1 
ATOM   716  C CA  . MET A 1 104 ? -15.038 -13.265 -27.192 1.00 17.78 ? 103 MET A CA  1 
ATOM   717  C C   . MET A 1 104 ? -15.436 -13.369 -28.651 1.00 16.64 ? 103 MET A C   1 
ATOM   718  O O   . MET A 1 104 ? -14.579 -13.487 -29.575 1.00 16.84 ? 103 MET A O   1 
ATOM   719  C CB  . MET A 1 104 ? -14.727 -11.785 -26.899 1.00 19.66 ? 103 MET A CB  1 
ATOM   720  C CG  . MET A 1 104 ? -16.071 -11.021 -26.603 1.00 24.22 ? 103 MET A CG  1 
ATOM   721  S SD  . MET A 1 104 ? -15.656 -9.340  -26.600 1.00 35.57 ? 103 MET A SD  1 
ATOM   722  C CE  . MET A 1 104 ? -17.220 -8.557  -26.877 1.00 25.92 ? 103 MET A CE  1 
ATOM   723  N N   . ILE A 1 105 ? -16.743 -13.346 -28.883 1.00 17.99 ? 104 ILE A N   1 
ATOM   724  C CA  . ILE A 1 105 ? -17.295 -13.417 -30.249 1.00 17.14 ? 104 ILE A CA  1 
ATOM   725  C C   . ILE A 1 105 ? -18.227 -12.251 -30.482 1.00 17.23 ? 104 ILE A C   1 
ATOM   726  O O   . ILE A 1 105 ? -18.893 -11.804 -29.586 1.00 18.61 ? 104 ILE A O   1 
ATOM   727  C CB  . ILE A 1 105 ? -17.969 -14.787 -30.608 1.00 17.43 ? 104 ILE A CB  1 
ATOM   728  C CG1 . ILE A 1 105 ? -19.293 -15.004 -29.910 1.00 18.31 ? 104 ILE A CG1 1 
ATOM   729  C CG2 . ILE A 1 105 ? -17.000 -15.915 -30.371 1.00 18.14 ? 104 ILE A CG2 1 
ATOM   730  C CD1 . ILE A 1 105 ? -20.089 -16.150 -30.467 1.00 18.58 ? 104 ILE A CD1 1 
ATOM   731  N N   . LEU A 1 106 ? -18.315 -11.806 -31.728 1.00 16.16 ? 105 LEU A N   1 
ATOM   732  C CA  . LEU A 1 106 ? -19.241 -10.774 -32.154 1.00 15.87 ? 105 LEU A CA  1 
ATOM   733  C C   . LEU A 1 106 ? -20.129 -11.413 -33.184 1.00 17.06 ? 105 LEU A C   1 
ATOM   734  O O   . LEU A 1 106 ? -19.698 -11.664 -34.317 1.00 15.13 ? 105 LEU A O   1 
ATOM   735  C CB  . LEU A 1 106 ? -18.539 -9.573  -32.735 1.00 16.47 ? 105 LEU A CB  1 
ATOM   736  C CG  . LEU A 1 106 ? -17.547 -8.880  -31.832 1.00 20.12 ? 105 LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 106 ? -17.035 -7.650  -32.571 1.00 21.62 ? 105 LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 106 ? -18.181 -8.415  -30.561 1.00 21.61 ? 105 LEU A CD2 1 
ATOM   739  N N   . ASP A 1 107 ? -21.348 -11.725 -32.762 1.00 15.34 ? 106 ASP A N   1 
ATOM   740  C CA  . ASP A 1 107 ? -22.295 -12.406 -33.593 1.00 16.28 ? 106 ASP A CA  1 
ATOM   741  C C   . ASP A 1 107 ? -23.269 -11.428 -34.288 1.00 14.94 ? 106 ASP A C   1 
ATOM   742  O O   . ASP A 1 107 ? -23.617 -10.337 -33.778 1.00 14.97 ? 106 ASP A O   1 
ATOM   743  C CB  . ASP A 1 107 ? -23.052 -13.417 -32.713 1.00 16.74 ? 106 ASP A CB  1 
ATOM   744  C CG  . ASP A 1 107 ? -23.724 -14.508 -33.542 1.00 18.30 ? 106 ASP A CG  1 
ATOM   745  O OD1 . ASP A 1 107 ? -23.029 -15.460 -34.016 1.00 18.31 ? 106 ASP A OD1 1 
ATOM   746  O OD2 . ASP A 1 107 ? -24.969 -14.403 -33.728 1.00 19.97 ? 106 ASP A OD2 1 
ATOM   747  N N   . HIS A 1 108 ? -23.680 -11.815 -35.479 1.00 15.29 ? 107 HIS A N   1 
ATOM   748  C CA  . HIS A 1 108 ? -24.588 -11.063 -36.290 1.00 16.86 ? 107 HIS A CA  1 
ATOM   749  C C   . HIS A 1 108 ? -26.058 -11.441 -36.055 1.00 16.85 ? 107 HIS A C   1 
ATOM   750  O O   . HIS A 1 108 ? -26.527 -12.577 -36.384 1.00 15.79 ? 107 HIS A O   1 
ATOM   751  C CB  . HIS A 1 108 ? -24.266 -11.203 -37.795 1.00 16.30 ? 107 HIS A CB  1 
ATOM   752  C CG  . HIS A 1 108 ? -23.030 -10.474 -38.212 1.00 16.51 ? 107 HIS A CG  1 
ATOM   753  N ND1 . HIS A 1 108 ? -23.048 -9.211  -38.775 1.00 17.73 ? 107 HIS A ND1 1 
ATOM   754  C CD2 . HIS A 1 108 ? -21.731 -10.832 -38.169 1.00 17.90 ? 107 HIS A CD2 1 
ATOM   755  C CE1 . HIS A 1 108 ? -21.815 -8.815  -39.034 1.00 17.75 ? 107 HIS A CE1 1 
ATOM   756  N NE2 . HIS A 1 108 ? -20.993 -9.791  -38.689 1.00 16.89 ? 107 HIS A NE2 1 
ATOM   757  N N   . VAL A 1 109 ? -26.762 -10.431 -35.576 1.00 16.19 ? 108 VAL A N   1 
ATOM   758  C CA  . VAL A 1 109 ? -28.224 -10.453 -35.469 1.00 16.54 ? 108 VAL A CA  1 
ATOM   759  C C   . VAL A 1 109 ? -28.778 -10.246 -36.867 1.00 18.79 ? 108 VAL A C   1 
ATOM   760  O O   . VAL A 1 109 ? -28.473 -9.228  -37.538 1.00 19.19 ? 108 VAL A O   1 
ATOM   761  C CB  . VAL A 1 109 ? -28.774 -9.312  -34.573 1.00 17.37 ? 108 VAL A CB  1 
ATOM   762  C CG1 . VAL A 1 109 ? -30.320 -9.241  -34.629 1.00 17.20 ? 108 VAL A CG1 1 
ATOM   763  C CG2 . VAL A 1 109 ? -28.258 -9.439  -33.153 1.00 17.58 ? 108 VAL A CG2 1 
ATOM   764  N N   . PHE A 1 110 ? -29.599 -11.204 -37.312 1.00 18.56 ? 109 PHE A N   1 
ATOM   765  C CA  . PHE A 1 110 ? -30.162 -11.203 -38.658 1.00 19.92 ? 109 PHE A CA  1 
ATOM   766  C C   . PHE A 1 110 ? -31.700 -11.387 -38.543 1.00 22.23 ? 109 PHE A C   1 
ATOM   767  O O   . PHE A 1 110 ? -32.173 -12.511 -38.287 1.00 23.72 ? 109 PHE A O   1 
ATOM   768  C CB  . PHE A 1 110 ? -29.539 -12.306 -39.494 1.00 20.02 ? 109 PHE A CB  1 
ATOM   769  C CG  . PHE A 1 110 ? -29.945 -12.250 -40.950 1.00 23.81 ? 109 PHE A CG  1 
ATOM   770  C CD1 . PHE A 1 110 ? -31.099 -12.855 -41.401 1.00 27.53 ? 109 PHE A CD1 1 
ATOM   771  C CD2 . PHE A 1 110 ? -29.194 -11.582 -41.861 1.00 21.08 ? 109 PHE A CD2 1 
ATOM   772  C CE1 . PHE A 1 110 ? -31.456 -12.800 -42.766 1.00 24.98 ? 109 PHE A CE1 1 
ATOM   773  C CE2 . PHE A 1 110 ? -29.549 -11.528 -43.186 1.00 22.69 ? 109 PHE A CE2 1 
ATOM   774  C CZ  . PHE A 1 110 ? -30.664 -12.150 -43.649 1.00 22.56 ? 109 PHE A CZ  1 
ATOM   775  N N   . PRO A 1 111 ? -32.450 -10.300 -38.712 1.00 23.94 ? 110 PRO A N   1 
ATOM   776  C CA  . PRO A 1 111 ? -33.918 -10.378 -38.583 1.00 25.16 ? 110 PRO A CA  1 
ATOM   777  C C   . PRO A 1 111 ? -34.509 -11.188 -39.687 1.00 25.61 ? 110 PRO A C   1 
ATOM   778  O O   . PRO A 1 111 ? -34.237 -10.925 -40.864 1.00 27.09 ? 110 PRO A O   1 
ATOM   779  C CB  . PRO A 1 111 ? -34.386 -8.942  -38.752 1.00 24.39 ? 110 PRO A CB  1 
ATOM   780  C CG  . PRO A 1 111 ? -33.268 -8.214  -39.360 1.00 28.35 ? 110 PRO A CG  1 
ATOM   781  C CD  . PRO A 1 111 ? -32.002 -8.933  -39.081 1.00 24.62 ? 110 PRO A CD  1 
ATOM   782  N N   . ASP A 1 112 ? -35.292 -12.167 -39.306 1.00 27.41 ? 111 ASP A N   1 
ATOM   783  C CA  . ASP A 1 112 ? -36.107 -12.886 -40.277 1.00 31.78 ? 111 ASP A CA  1 
ATOM   784  C C   . ASP A 1 112 ? -37.171 -11.939 -40.935 1.00 30.04 ? 111 ASP A C   1 
ATOM   785  O O   . ASP A 1 112 ? -37.424 -10.863 -40.448 1.00 27.81 ? 111 ASP A O   1 
ATOM   786  C CB  . ASP A 1 112 ? -36.720 -14.117 -39.618 1.00 37.17 ? 111 ASP A CB  1 
ATOM   787  C CG  . ASP A 1 112 ? -36.533 -15.362 -40.442 1.00 45.73 ? 111 ASP A CG  1 
ATOM   788  O OD1 . ASP A 1 112 ? -36.639 -15.253 -41.695 1.00 48.02 ? 111 ASP A OD1 1 
ATOM   789  O OD2 . ASP A 1 112 ? -36.304 -16.441 -39.845 1.00 55.67 ? 111 ASP A OD2 1 
ATOM   790  N N   . THR A 1 113 ? -37.766 -12.327 -42.047 1.00 35.33 ? 112 THR A N   1 
ATOM   791  C CA  . THR A 1 113 ? -38.744 -11.452 -42.718 1.00 36.76 ? 112 THR A CA  1 
ATOM   792  C C   . THR A 1 113 ? -39.929 -11.138 -41.780 1.00 29.36 ? 112 THR A C   1 
ATOM   793  O O   . THR A 1 113 ? -40.370 -11.945 -40.953 1.00 27.53 ? 112 THR A O   1 
ATOM   794  C CB  . THR A 1 113 ? -39.253 -12.052 -44.042 1.00 41.98 ? 112 THR A CB  1 
ATOM   795  O OG1 . THR A 1 113 ? -39.823 -13.311 -43.745 1.00 48.30 ? 112 THR A OG1 1 
ATOM   796  C CG2 . THR A 1 113 ? -38.118 -12.289 -45.052 1.00 41.05 ? 112 THR A CG2 1 
ATOM   797  N N   . GLY A 1 114 ? -40.364 -9.898  -41.837 1.00 28.63 ? 113 GLY A N   1 
ATOM   798  C CA  . GLY A 1 114 ? -41.362 -9.426  -40.928 1.00 27.50 ? 113 GLY A CA  1 
ATOM   799  C C   . GLY A 1 114 ? -40.867 -9.052  -39.528 1.00 31.57 ? 113 GLY A C   1 
ATOM   800  O O   . GLY A 1 114 ? -41.644 -8.506  -38.769 1.00 29.38 ? 113 GLY A O   1 
ATOM   801  N N   . VAL A 1 115 ? -39.578 -9.270  -39.176 1.00 28.42 ? 114 VAL A N   1 
ATOM   802  C CA  . VAL A 1 115 ? -39.081 -9.058  -37.814 1.00 25.66 ? 114 VAL A CA  1 
ATOM   803  C C   . VAL A 1 115 ? -38.267 -7.764  -37.790 1.00 24.02 ? 114 VAL A C   1 
ATOM   804  O O   . VAL A 1 115 ? -37.448 -7.510  -38.679 1.00 21.35 ? 114 VAL A O   1 
ATOM   805  C CB  . VAL A 1 115 ? -38.253 -10.275 -37.291 1.00 25.31 ? 114 VAL A CB  1 
ATOM   806  C CG1 . VAL A 1 115 ? -37.754 -10.035 -35.899 1.00 24.08 ? 114 VAL A CG1 1 
ATOM   807  C CG2 . VAL A 1 115 ? -39.116 -11.521 -37.315 1.00 28.56 ? 114 VAL A CG2 1 
ATOM   808  N N   . SER A 1 116 ? -38.542 -6.905  -36.801 1.00 21.89 ? 115 SER A N   1 
ATOM   809  C CA  . SER A 1 116 ? -37.845 -5.646  -36.688 1.00 21.49 ? 115 SER A CA  1 
ATOM   810  C C   . SER A 1 116 ? -36.437 -5.912  -36.143 1.00 20.22 ? 115 SER A C   1 
ATOM   811  O O   . SER A 1 116 ? -36.165 -6.959  -35.568 1.00 19.37 ? 115 SER A O   1 
ATOM   812  C CB  . SER A 1 116 ? -38.544 -4.681  -35.742 1.00 20.72 ? 115 SER A CB  1 
ATOM   813  O OG  . SER A 1 116 ? -38.450 -5.147  -34.397 1.00 21.53 ? 115 SER A OG  1 
ATOM   814  N N   . LEU A 1 117 ? -35.609 -4.890  -36.221 1.00 21.17 ? 116 LEU A N   1 
ATOM   815  C CA  . LEU A 1 117 ? -34.266 -5.018  -35.693 1.00 21.13 ? 116 LEU A CA  1 
ATOM   816  C C   . LEU A 1 117 ? -34.312 -5.209  -34.197 1.00 19.94 ? 116 LEU A C   1 
ATOM   817  O O   . LEU A 1 117 ? -33.540 -5.987  -33.673 1.00 19.60 ? 116 LEU A O   1 
ATOM   818  C CB  . LEU A 1 117 ? -33.416 -3.795  -36.091 1.00 19.81 ? 116 LEU A CB  1 
ATOM   819  C CG  . LEU A 1 117 ? -33.310 -3.465  -37.544 1.00 19.76 ? 116 LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 117 ? -32.432 -2.234  -37.707 1.00 20.88 ? 116 LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 117 ? -32.716 -4.631  -38.237 1.00 20.25 ? 116 LEU A CD2 1 
ATOM   822  N N   . LEU A 1 118 ? -35.160 -4.478  -33.486 1.00 21.56 ? 117 LEU A N   1 
ATOM   823  C CA  . LEU A 1 118 ? -35.187 -4.572  -32.036 1.00 23.24 ? 117 LEU A CA  1 
ATOM   824  C C   . LEU A 1 118 ? -35.678 -5.918  -31.618 1.00 24.05 ? 117 LEU A C   1 
ATOM   825  O O   . LEU A 1 118 ? -35.162 -6.499  -30.683 1.00 25.22 ? 117 LEU A O   1 
ATOM   826  C CB  . LEU A 1 118 ? -36.059 -3.495  -31.400 1.00 26.53 ? 117 LEU A CB  1 
ATOM   827  C CG  . LEU A 1 118 ? -35.294 -2.173  -31.249 1.00 32.29 ? 117 LEU A CG  1 
ATOM   828  C CD1 . LEU A 1 118 ? -36.221 -0.967  -30.992 1.00 35.68 ? 117 LEU A CD1 1 
ATOM   829  C CD2 . LEU A 1 118 ? -34.279 -2.276  -30.116 1.00 32.09 ? 117 LEU A CD2 1 
ATOM   830  N N   . ALA A 1 119 ? -36.697 -6.429  -32.306 1.00 23.18 ? 118 ALA A N   1 
ATOM   831  C CA  . ALA A 1 119 ? -37.194 -7.734  -31.956 1.00 20.43 ? 118 ALA A CA  1 
ATOM   832  C C   . ALA A 1 119 ? -36.150 -8.814  -32.202 1.00 19.52 ? 118 ALA A C   1 
ATOM   833  O O   . ALA A 1 119 ? -36.007 -9.707  -31.425 1.00 19.00 ? 118 ALA A O   1 
ATOM   834  C CB  . ALA A 1 119 ? -38.453 -8.056  -32.742 1.00 21.89 ? 118 ALA A CB  1 
ATOM   835  N N   . ALA A 1 120 ? -35.467 -8.761  -33.318 1.00 19.89 ? 119 ALA A N   1 
ATOM   836  C CA  . ALA A 1 120 ? -34.391 -9.730  -33.578 1.00 18.57 ? 119 ALA A CA  1 
ATOM   837  C C   . ALA A 1 120 ? -33.262 -9.609  -32.512 1.00 18.71 ? 119 ALA A C   1 
ATOM   838  O O   . ALA A 1 120 ? -32.738 -10.600 -32.018 1.00 17.35 ? 119 ALA A O   1 
ATOM   839  C CB  . ALA A 1 120 ? -33.876 -9.502  -34.969 1.00 19.08 ? 119 ALA A CB  1 
ATOM   840  N N   . TYR A 1 121 ? -32.897 -8.383  -32.138 1.00 18.08 ? 120 TYR A N   1 
ATOM   841  C CA  . TYR A 1 121 ? -31.920 -8.182  -31.110 1.00 18.64 ? 120 TYR A CA  1 
ATOM   842  C C   . TYR A 1 121 ? -32.347 -8.882  -29.829 1.00 20.21 ? 120 TYR A C   1 
ATOM   843  O O   . TYR A 1 121 ? -31.530 -9.603  -29.190 1.00 17.92 ? 120 TYR A O   1 
ATOM   844  C CB  . TYR A 1 121 ? -31.653 -6.689  -30.848 1.00 19.61 ? 120 TYR A CB  1 
ATOM   845  C CG  . TYR A 1 121 ? -30.809 -6.418  -29.630 1.00 19.82 ? 120 TYR A CG  1 
ATOM   846  C CD1 . TYR A 1 121 ? -31.381 -6.273  -28.365 1.00 19.42 ? 120 TYR A CD1 1 
ATOM   847  C CD2 . TYR A 1 121 ? -29.427 -6.303  -29.732 1.00 18.67 ? 120 TYR A CD2 1 
ATOM   848  C CE1 . TYR A 1 121 ? -30.612 -6.039  -27.251 1.00 18.65 ? 120 TYR A CE1 1 
ATOM   849  C CE2 . TYR A 1 121 ? -28.662 -5.988  -28.626 1.00 18.26 ? 120 TYR A CE2 1 
ATOM   850  C CZ  . TYR A 1 121 ? -29.262 -5.881  -27.398 1.00 18.54 ? 120 TYR A CZ  1 
ATOM   851  O OH  . TYR A 1 121 ? -28.489 -5.621  -26.303 1.00 19.76 ? 120 TYR A OH  1 
ATOM   852  N N   . GLU A 1 122 ? -33.617 -8.713  -29.447 1.00 21.06 ? 121 GLU A N   1 
ATOM   853  C CA  . GLU A 1 122 ? -34.095 -9.347  -28.216 1.00 22.05 ? 121 GLU A CA  1 
ATOM   854  C C   . GLU A 1 122 ? -34.068 -10.906 -28.342 1.00 19.66 ? 121 GLU A C   1 
ATOM   855  O O   . GLU A 1 122 ? -33.649 -11.593 -27.413 1.00 22.64 ? 121 GLU A O   1 
ATOM   856  C CB  . GLU A 1 122 ? -35.499 -8.813  -27.822 1.00 26.92 ? 121 GLU A CB  1 
ATOM   857  C CG  . GLU A 1 122 ? -35.523 -7.324  -27.344 1.00 35.72 ? 121 GLU A CG  1 
ATOM   858  C CD  . GLU A 1 122 ? -34.789 -7.098  -26.026 1.00 40.96 ? 121 GLU A CD  1 
ATOM   859  O OE1 . GLU A 1 122 ? -34.939 -7.957  -25.124 1.00 50.13 ? 121 GLU A OE1 1 
ATOM   860  O OE2 . GLU A 1 122 ? -34.046 -6.082  -25.880 1.00 50.10 ? 121 GLU A OE2 1 
ATOM   861  N N   . GLN A 1 123 ? -34.432 -11.458 -29.488 1.00 20.70 ? 122 GLN A N   1 
ATOM   862  C CA  . GLN A 1 123 ? -34.378 -12.931 -29.677 1.00 23.68 ? 122 GLN A CA  1 
ATOM   863  C C   . GLN A 1 123 ? -32.888 -13.388 -29.528 1.00 22.72 ? 122 GLN A C   1 
ATOM   864  O O   . GLN A 1 123 ? -32.588 -14.403 -28.875 1.00 20.59 ? 122 GLN A O   1 
ATOM   865  C CB  . GLN A 1 123 ? -34.886 -13.414 -31.035 1.00 27.11 ? 122 GLN A CB  1 
ATOM   866  C CG  . GLN A 1 123 ? -36.382 -13.244 -31.410 1.00 35.10 ? 122 GLN A CG  1 
ATOM   867  C CD  . GLN A 1 123 ? -36.643 -13.108 -32.938 1.00 39.56 ? 122 GLN A CD  1 
ATOM   868  O OE1 . GLN A 1 123 ? -35.749 -13.207 -33.787 1.00 44.07 ? 122 GLN A OE1 1 
ATOM   869  N NE2 . GLN A 1 123 ? -37.884 -12.837 -33.273 1.00 47.77 ? 122 GLN A NE2 1 
ATOM   870  N N   . TRP A 1 124 ? -31.950 -12.631 -30.109 1.00 20.46 ? 123 TRP A N   1 
ATOM   871  C CA  . TRP A 1 124 ? -30.522 -13.021 -29.986 1.00 19.53 ? 123 TRP A CA  1 
ATOM   872  C C   . TRP A 1 124 ? -30.040 -12.980 -28.570 1.00 19.80 ? 123 TRP A C   1 
ATOM   873  O O   . TRP A 1 124 ? -29.319 -13.886 -28.161 1.00 21.22 ? 123 TRP A O   1 
ATOM   874  C CB  . TRP A 1 124 ? -29.599 -12.167 -30.870 1.00 18.59 ? 123 TRP A CB  1 
ATOM   875  C CG  . TRP A 1 124 ? -29.136 -12.840 -32.103 1.00 18.29 ? 123 TRP A CG  1 
ATOM   876  C CD1 . TRP A 1 124 ? -27.856 -13.220 -32.357 1.00 18.23 ? 123 TRP A CD1 1 
ATOM   877  C CD2 . TRP A 1 124 ? -29.902 -13.178 -33.280 1.00 16.84 ? 123 TRP A CD2 1 
ATOM   878  N NE1 . TRP A 1 124 ? -27.777 -13.772 -33.609 1.00 18.52 ? 123 TRP A NE1 1 
ATOM   879  C CE2 . TRP A 1 124 ? -29.008 -13.742 -34.203 1.00 17.52 ? 123 TRP A CE2 1 
ATOM   880  C CE3 . TRP A 1 124 ? -31.241 -13.023 -33.651 1.00 18.23 ? 123 TRP A CE3 1 
ATOM   881  C CZ2 . TRP A 1 124 ? -29.402 -14.156 -35.471 1.00 18.28 ? 123 TRP A CZ2 1 
ATOM   882  C CZ3 . TRP A 1 124 ? -31.658 -13.453 -34.875 1.00 18.03 ? 123 TRP A CZ3 1 
ATOM   883  C CH2 . TRP A 1 124 ? -30.739 -14.025 -35.793 1.00 20.35 ? 123 TRP A CH2 1 
ATOM   884  N N   . ARG A 1 125 ? -30.379 -11.931 -27.826 1.00 19.91 ? 124 ARG A N   1 
ATOM   885  C CA  . ARG A 1 125 ? -29.999 -11.843 -26.452 1.00 21.20 ? 124 ARG A CA  1 
ATOM   886  C C   . ARG A 1 125 ? -30.576 -12.986 -25.635 1.00 25.27 ? 124 ARG A C   1 
ATOM   887  O O   . ARG A 1 125 ? -29.869 -13.544 -24.797 1.00 23.29 ? 124 ARG A O   1 
ATOM   888  C CB  . ARG A 1 125 ? -30.407 -10.544 -25.810 1.00 19.78 ? 124 ARG A CB  1 
ATOM   889  C CG  . ARG A 1 125 ? -29.648 -9.299  -26.242 1.00 20.68 ? 124 ARG A CG  1 
ATOM   890  C CD  . ARG A 1 125 ? -28.173 -9.321  -25.818 1.00 22.73 ? 124 ARG A CD  1 
ATOM   891  N NE  . ARG A 1 125 ? -28.071 -9.444  -24.358 1.00 23.35 ? 124 ARG A NE  1 
ATOM   892  C CZ  . ARG A 1 125 ? -28.286 -8.498  -23.449 1.00 24.03 ? 124 ARG A CZ  1 
ATOM   893  N NH1 . ARG A 1 125 ? -28.519 -7.230  -23.765 1.00 22.06 ? 124 ARG A NH1 1 
ATOM   894  N NH2 . ARG A 1 125 ? -28.188 -8.841  -22.170 1.00 25.19 ? 124 ARG A NH2 1 
ATOM   895  N N   A GLU A 1 126 ? -31.835 -13.341 -25.885 0.50 25.41 ? 125 GLU A N   1 
ATOM   896  N N   B GLU A 1 126 ? -31.839 -13.354 -25.854 0.50 25.85 ? 125 GLU A N   1 
ATOM   897  C CA  A GLU A 1 126 ? -32.472 -14.414 -25.122 0.50 27.14 ? 125 GLU A CA  1 
ATOM   898  C CA  B GLU A 1 126 ? -32.435 -14.403 -25.013 0.50 27.70 ? 125 GLU A CA  1 
ATOM   899  C C   A GLU A 1 126 ? -31.694 -15.719 -25.306 0.50 27.96 ? 125 GLU A C   1 
ATOM   900  C C   B GLU A 1 126 ? -31.734 -15.763 -25.294 0.50 28.53 ? 125 GLU A C   1 
ATOM   901  O O   A GLU A 1 126 ? -31.321 -16.354 -24.309 0.50 28.41 ? 125 GLU A O   1 
ATOM   902  O O   B GLU A 1 126 ? -31.452 -16.498 -24.337 0.50 29.70 ? 125 GLU A O   1 
ATOM   903  C CB  A GLU A 1 126 ? -33.957 -14.559 -25.526 0.50 28.73 ? 125 GLU A CB  1 
ATOM   904  C CB  B GLU A 1 126 ? -33.988 -14.450 -25.148 0.50 30.06 ? 125 GLU A CB  1 
ATOM   905  C CG  A GLU A 1 126 ? -34.495 -15.978 -25.601 0.50 30.15 ? 125 GLU A CG  1 
ATOM   906  C CG  B GLU A 1 126 ? -34.681 -15.536 -24.326 0.50 32.14 ? 125 GLU A CG  1 
ATOM   907  C CD  A GLU A 1 126 ? -36.009 -15.970 -25.777 0.50 31.17 ? 125 GLU A CD  1 
ATOM   908  C CD  B GLU A 1 126 ? -35.529 -15.007 -23.174 0.50 35.61 ? 125 GLU A CD  1 
ATOM   909  O OE1 A GLU A 1 126 ? -36.594 -16.966 -26.263 0.50 30.46 ? 125 GLU A OE1 1 
ATOM   910  O OE1 B GLU A 1 126 ? -35.965 -15.830 -22.352 0.50 37.49 ? 125 GLU A OE1 1 
ATOM   911  O OE2 A GLU A 1 126 ? -36.602 -14.946 -25.403 0.50 28.53 ? 125 GLU A OE2 1 
ATOM   912  O OE2 B GLU A 1 126 ? -35.771 -13.781 -23.069 0.50 37.15 ? 125 GLU A OE2 1 
ATOM   913  N N   . ARG A 1 127 ? -31.407 -16.067 -26.567 1.00 26.37 ? 126 ARG A N   1 
ATOM   914  C CA  . ARG A 1 127 ? -30.690 -17.277 -26.904 1.00 28.30 ? 126 ARG A CA  1 
ATOM   915  C C   . ARG A 1 127 ? -29.243 -17.260 -26.403 1.00 27.37 ? 126 ARG A C   1 
ATOM   916  O O   . ARG A 1 127 ? -28.786 -18.214 -25.788 1.00 28.66 ? 126 ARG A O   1 
ATOM   917  C CB  . ARG A 1 127 ? -30.776 -17.618 -28.415 1.00 31.82 ? 126 ARG A CB  1 
ATOM   918  C CG  . ARG A 1 127 ? -32.191 -18.142 -28.773 1.00 39.18 ? 126 ARG A CG  1 
ATOM   919  C CD  . ARG A 1 127 ? -32.437 -18.466 -30.241 1.00 46.62 ? 126 ARG A CD  1 
ATOM   920  N NE  . ARG A 1 127 ? -32.555 -17.275 -31.110 1.00 57.89 ? 126 ARG A NE  1 
ATOM   921  C CZ  . ARG A 1 127 ? -32.300 -17.230 -32.433 1.00 58.51 ? 126 ARG A CZ  1 
ATOM   922  N NH1 . ARG A 1 127 ? -31.882 -18.303 -33.114 1.00 68.92 ? 126 ARG A NH1 1 
ATOM   923  N NH2 . ARG A 1 127 ? -32.436 -16.086 -33.086 1.00 57.55 ? 126 ARG A NH2 1 
ATOM   924  N N   . ALA A 1 128 ? -28.551 -16.151 -26.623 1.00 26.45 ? 127 ALA A N   1 
ATOM   925  C CA  . ALA A 1 128 ? -27.081 -16.052 -26.275 1.00 24.83 ? 127 ALA A CA  1 
ATOM   926  C C   . ALA A 1 128 ? -26.847 -15.974 -24.792 1.00 23.22 ? 127 ALA A C   1 
ATOM   927  O O   . ALA A 1 128 ? -25.955 -16.655 -24.280 1.00 20.23 ? 127 ALA A O   1 
ATOM   928  C CB  . ALA A 1 128 ? -26.462 -14.858 -26.943 1.00 24.47 ? 127 ALA A CB  1 
ATOM   929  N N   . ASP A 1 129 ? -27.675 -15.199 -24.071 1.00 23.37 ? 128 ASP A N   1 
ATOM   930  C CA  . ASP A 1 129 ? -27.483 -15.071 -22.607 1.00 24.38 ? 128 ASP A CA  1 
ATOM   931  C C   . ASP A 1 129 ? -27.579 -16.375 -21.876 1.00 25.14 ? 128 ASP A C   1 
ATOM   932  O O   . ASP A 1 129 ? -26.930 -16.541 -20.878 1.00 30.52 ? 128 ASP A O   1 
ATOM   933  C CB  . ASP A 1 129 ? -28.461 -14.088 -21.941 1.00 27.58 ? 128 ASP A CB  1 
ATOM   934  C CG  . ASP A 1 129 ? -28.181 -12.653 -22.303 1.00 30.87 ? 128 ASP A CG  1 
ATOM   935  O OD1 . ASP A 1 129 ? -27.124 -12.346 -22.869 1.00 35.61 ? 128 ASP A OD1 1 
ATOM   936  O OD2 . ASP A 1 129 ? -29.033 -11.793 -22.028 1.00 35.78 ? 128 ASP A OD2 1 
ATOM   937  N N   . SER A 1 130 ? -28.336 -17.324 -22.383 1.00 24.39 ? 129 SER A N   1 
ATOM   938  C CA  . SER A 1 130 ? -28.502 -18.570 -21.665 1.00 27.24 ? 129 SER A CA  1 
ATOM   939  C C   . SER A 1 130 ? -27.609 -19.699 -22.202 1.00 25.60 ? 129 SER A C   1 
ATOM   940  O O   . SER A 1 130 ? -27.504 -20.756 -21.614 1.00 24.95 ? 129 SER A O   1 
ATOM   941  C CB  . SER A 1 130 ? -29.986 -18.910 -21.681 1.00 31.13 ? 129 SER A CB  1 
ATOM   942  O OG  . SER A 1 130 ? -30.358 -19.194 -23.013 1.00 38.15 ? 129 SER A OG  1 
ATOM   943  N N   . ALA A 1 131 ? -26.904 -19.467 -23.307 1.00 21.48 ? 130 ALA A N   1 
ATOM   944  C CA  . ALA A 1 131 ? -26.147 -20.522 -23.966 1.00 19.65 ? 130 ALA A CA  1 
ATOM   945  C C   . ALA A 1 131 ? -24.651 -20.173 -24.213 1.00 18.63 ? 130 ALA A C   1 
ATOM   946  O O   . ALA A 1 131 ? -23.839 -21.047 -24.332 1.00 19.10 ? 130 ALA A O   1 
ATOM   947  C CB  . ALA A 1 131 ? -26.835 -20.842 -25.285 1.00 21.77 ? 130 ALA A CB  1 
ATOM   948  N N   . ALA A 1 132 ? -24.311 -18.906 -24.261 1.00 17.01 ? 131 ALA A N   1 
ATOM   949  C CA  . ALA A 1 132 ? -22.898 -18.448 -24.490 1.00 18.31 ? 131 ALA A CA  1 
ATOM   950  C C   . ALA A 1 132 ? -21.923 -18.987 -23.391 1.00 18.08 ? 131 ALA A C   1 
ATOM   951  O O   . ALA A 1 132 ? -22.173 -18.791 -22.204 1.00 16.87 ? 131 ALA A O   1 
ATOM   952  C CB  . ALA A 1 132 ? -22.853 -16.960 -24.501 1.00 18.50 ? 131 ALA A CB  1 
ATOM   953  N N   . CYS A 1 133 ? -20.877 -19.692 -23.819 1.00 16.59 ? 132 CYS A N   1 
ATOM   954  C CA  . CYS A 1 133 ? -19.845 -20.182 -22.928 1.00 18.08 ? 132 CYS A CA  1 
ATOM   955  C C   . CYS A 1 133 ? -18.785 -19.123 -22.677 1.00 19.93 ? 132 CYS A C   1 
ATOM   956  O O   . CYS A 1 133 ? -18.091 -19.208 -21.661 1.00 18.10 ? 132 CYS A O   1 
ATOM   957  C CB  . CYS A 1 133 ? -19.179 -21.426 -23.459 1.00 22.53 ? 132 CYS A CB  1 
ATOM   958  S SG  . CYS A 1 133 ? -20.289 -22.828 -23.722 1.00 22.59 ? 132 CYS A SG  1 
ATOM   959  N N   . CYS A 1 134 ? -18.731 -18.082 -23.530 1.00 18.74 ? 133 CYS A N   1 
ATOM   960  C CA  . CYS A 1 134 ? -17.785 -16.976 -23.331 1.00 18.13 ? 133 CYS A CA  1 
ATOM   961  C C   . CYS A 1 134 ? -18.491 -15.677 -23.562 1.00 17.22 ? 133 CYS A C   1 
ATOM   962  O O   . CYS A 1 134 ? -19.629 -15.669 -24.062 1.00 16.52 ? 133 CYS A O   1 
ATOM   963  C CB  . CYS A 1 134 ? -16.623 -17.152 -24.322 1.00 18.26 ? 133 CYS A CB  1 
ATOM   964  S SG  . CYS A 1 134 ? -17.042 -16.972 -26.080 1.00 17.88 ? 133 CYS A SG  1 
ATOM   965  N N   . ASP A 1 135 ? -17.805 -14.580 -23.298 1.00 16.51 ? 134 ASP A N   1 
ATOM   966  C CA  . ASP A 1 135 ? -18.399 -13.275 -23.497 1.00 16.03 ? 134 ASP A CA  1 
ATOM   967  C C   . ASP A 1 135 ? -18.668 -13.043 -24.959 1.00 16.56 ? 134 ASP A C   1 
ATOM   968  O O   . ASP A 1 135 ? -18.017 -13.646 -25.811 1.00 16.34 ? 134 ASP A O   1 
ATOM   969  C CB  . ASP A 1 135 ? -17.514 -12.180 -23.004 1.00 16.26 ? 134 ASP A CB  1 
ATOM   970  C CG  . ASP A 1 135 ? -17.470 -12.063 -21.425 1.00 17.17 ? 134 ASP A CG  1 
ATOM   971  O OD1 . ASP A 1 135 ? -18.379 -12.627 -20.724 1.00 18.33 ? 134 ASP A OD1 1 
ATOM   972  O OD2 . ASP A 1 135 ? -16.540 -11.390 -20.950 1.00 17.95 ? 134 ASP A OD2 1 
ATOM   973  N N   . TYR A 1 136 ? -19.614 -12.141 -25.238 1.00 17.15 ? 135 TYR A N   1 
ATOM   974  C CA  . TYR A 1 136 ? -20.031 -11.878 -26.593 1.00 16.77 ? 135 TYR A CA  1 
ATOM   975  C C   . TYR A 1 136 ? -20.600 -10.476 -26.755 1.00 16.53 ? 135 TYR A C   1 
ATOM   976  O O   . TYR A 1 136 ? -20.916 -9.823  -25.818 1.00 15.31 ? 135 TYR A O   1 
ATOM   977  C CB  . TYR A 1 136 ? -21.013 -12.949 -27.084 1.00 16.46 ? 135 TYR A CB  1 
ATOM   978  C CG  . TYR A 1 136 ? -22.413 -12.754 -26.531 1.00 17.87 ? 135 TYR A CG  1 
ATOM   979  C CD1 . TYR A 1 136 ? -22.744 -13.139 -25.231 1.00 20.90 ? 135 TYR A CD1 1 
ATOM   980  C CD2 . TYR A 1 136 ? -23.374 -12.126 -27.275 1.00 19.26 ? 135 TYR A CD2 1 
ATOM   981  C CE1 . TYR A 1 136 ? -24.038 -12.902 -24.732 1.00 20.68 ? 135 TYR A CE1 1 
ATOM   982  C CE2 . TYR A 1 136 ? -24.626 -11.905 -26.791 1.00 20.85 ? 135 TYR A CE2 1 
ATOM   983  C CZ  . TYR A 1 136 ? -24.944 -12.292 -25.538 1.00 21.79 ? 135 TYR A CZ  1 
ATOM   984  O OH  . TYR A 1 136 ? -26.225 -12.027 -25.121 1.00 26.70 ? 135 TYR A OH  1 
ATOM   985  N N   . SER A 1 137 ? -20.727 -10.041 -28.000 1.00 14.78 ? 136 SER A N   1 
ATOM   986  C CA  . SER A 1 137 ? -21.558 -8.914  -28.321 1.00 14.76 ? 136 SER A CA  1 
ATOM   987  C C   . SER A 1 137 ? -22.133 -9.154  -29.715 1.00 14.82 ? 136 SER A C   1 
ATOM   988  O O   . SER A 1 137 ? -21.959 -10.260 -30.329 1.00 15.67 ? 136 SER A O   1 
ATOM   989  C CB  . SER A 1 137 ? -20.751 -7.610  -28.180 1.00 15.47 ? 136 SER A CB  1 
ATOM   990  O OG  . SER A 1 137 ? -21.632 -6.508  -28.039 1.00 15.72 ? 136 SER A OG  1 
ATOM   991  N N   . LEU A 1 138 ? -22.903 -8.174  -30.172 1.00 16.35 ? 137 LEU A N   1 
ATOM   992  C CA  . LEU A 1 138 ? -23.791 -8.338  -31.313 1.00 15.57 ? 137 LEU A CA  1 
ATOM   993  C C   . LEU A 1 138 ? -23.639 -7.202  -32.298 1.00 16.37 ? 137 LEU A C   1 
ATOM   994  O O   . LEU A 1 138 ? -23.592 -6.051  -31.924 1.00 19.23 ? 137 LEU A O   1 
ATOM   995  C CB  . LEU A 1 138 ? -25.280 -8.443  -30.865 1.00 15.42 ? 137 LEU A CB  1 
ATOM   996  C CG  . LEU A 1 138 ? -25.585 -9.636  -29.964 1.00 15.88 ? 137 LEU A CG  1 
ATOM   997  C CD1 . LEU A 1 138 ? -26.985 -9.428  -29.446 1.00 16.90 ? 137 LEU A CD1 1 
ATOM   998  C CD2 . LEU A 1 138 ? -25.425 -11.007 -30.589 1.00 16.81 ? 137 LEU A CD2 1 
ATOM   999  N N   . HIS A 1 139 ? -23.523 -7.562  -33.565 1.00 15.76 ? 138 HIS A N   1 
ATOM   1000 C CA  . HIS A 1 139 ? -23.679 -6.644  -34.649 1.00 15.72 ? 138 HIS A CA  1 
ATOM   1001 C C   . HIS A 1 139 ? -25.132 -6.799  -35.049 1.00 16.12 ? 138 HIS A C   1 
ATOM   1002 O O   . HIS A 1 139 ? -25.701 -7.872  -34.910 1.00 18.36 ? 138 HIS A O   1 
ATOM   1003 C CB  . HIS A 1 139 ? -22.856 -7.044  -35.890 1.00 15.79 ? 138 HIS A CB  1 
ATOM   1004 C CG  . HIS A 1 139 ? -21.400 -7.217  -35.645 1.00 16.47 ? 138 HIS A CG  1 
ATOM   1005 N ND1 . HIS A 1 139 ? -20.569 -6.164  -35.365 1.00 17.32 ? 138 HIS A ND1 1 
ATOM   1006 C CD2 . HIS A 1 139 ? -20.618 -8.320  -35.694 1.00 16.87 ? 138 HIS A CD2 1 
ATOM   1007 C CE1 . HIS A 1 139 ? -19.333 -6.606  -35.266 1.00 17.79 ? 138 HIS A CE1 1 
ATOM   1008 N NE2 . HIS A 1 139 ? -19.339 -7.908  -35.479 1.00 16.69 ? 138 HIS A NE2 1 
ATOM   1009 N N   . VAL A 1 140 ? -25.669 -5.781  -35.693 1.00 15.84 ? 139 VAL A N   1 
ATOM   1010 C CA  . VAL A 1 140 ? -27.064 -5.882  -36.199 1.00 16.22 ? 139 VAL A CA  1 
ATOM   1011 C C   . VAL A 1 140 ? -27.080 -5.710  -37.695 1.00 15.69 ? 139 VAL A C   1 
ATOM   1012 O O   . VAL A 1 140 ? -26.681 -4.641  -38.236 1.00 15.53 ? 139 VAL A O   1 
ATOM   1013 C CB  . VAL A 1 140 ? -27.976 -4.875  -35.493 1.00 16.38 ? 139 VAL A CB  1 
ATOM   1014 C CG1 . VAL A 1 140 ? -29.348 -4.837  -36.176 1.00 18.61 ? 139 VAL A CG1 1 
ATOM   1015 C CG2 . VAL A 1 140 ? -28.132 -5.277  -34.038 1.00 16.46 ? 139 VAL A CG2 1 
ATOM   1016 N N   . ASP A 1 141 ? -27.564 -6.733  -38.382 1.00 16.93 ? 140 ASP A N   1 
ATOM   1017 C CA  . ASP A 1 141 ? -27.656 -6.687  -39.864 1.00 18.71 ? 140 ASP A CA  1 
ATOM   1018 C C   . ASP A 1 141 ? -29.004 -6.027  -40.322 1.00 19.74 ? 140 ASP A C   1 
ATOM   1019 O O   . ASP A 1 141 ? -30.066 -6.376  -39.829 1.00 19.75 ? 140 ASP A O   1 
ATOM   1020 C CB  . ASP A 1 141 ? -27.527 -8.074  -40.486 1.00 19.51 ? 140 ASP A CB  1 
ATOM   1021 C CG  . ASP A 1 141 ? -26.176 -8.745  -40.196 1.00 21.33 ? 140 ASP A CG  1 
ATOM   1022 O OD1 . ASP A 1 141 ? -25.328 -8.171  -39.447 1.00 20.02 ? 140 ASP A OD1 1 
ATOM   1023 O OD2 . ASP A 1 141 ? -26.005 -9.918  -40.628 1.00 24.27 ? 140 ASP A OD2 1 
ATOM   1024 N N   . ILE A 1 142 ? -28.908 -5.000  -41.169 1.00 18.08 ? 141 ILE A N   1 
ATOM   1025 C CA  . ILE A 1 142 ? -30.039 -4.320  -41.725 1.00 18.35 ? 141 ILE A CA  1 
ATOM   1026 C C   . ILE A 1 142 ? -30.466 -4.996  -43.035 1.00 20.65 ? 141 ILE A C   1 
ATOM   1027 O O   . ILE A 1 142 ? -29.850 -4.806  -44.117 1.00 22.40 ? 141 ILE A O   1 
ATOM   1028 C CB  . ILE A 1 142 ? -29.664 -2.868  -42.010 1.00 18.84 ? 141 ILE A CB  1 
ATOM   1029 C CG1 . ILE A 1 142 ? -29.259 -2.177  -40.748 1.00 18.70 ? 141 ILE A CG1 1 
ATOM   1030 C CG2 . ILE A 1 142 ? -30.857 -2.122  -42.646 1.00 20.71 ? 141 ILE A CG2 1 
ATOM   1031 C CD1 . ILE A 1 142 ? -28.631 -0.826  -40.994 1.00 19.39 ? 141 ILE A CD1 1 
ATOM   1032 N N   . THR A 1 143 ? -31.519 -5.787  -42.976 1.00 23.06 ? 142 THR A N   1 
ATOM   1033 C CA  . THR A 1 143 ? -31.988 -6.451  -44.168 1.00 25.88 ? 142 THR A CA  1 
ATOM   1034 C C   . THR A 1 143 ? -32.965 -5.689  -45.053 1.00 29.70 ? 142 THR A C   1 
ATOM   1035 O O   . THR A 1 143 ? -33.102 -6.068  -46.234 1.00 31.52 ? 142 THR A O   1 
ATOM   1036 C CB  . THR A 1 143 ? -32.613 -7.784  -43.822 1.00 29.53 ? 142 THR A CB  1 
ATOM   1037 O OG1 . THR A 1 143 ? -33.716 -7.576  -42.945 1.00 33.73 ? 142 THR A OG1 1 
ATOM   1038 C CG2 . THR A 1 143 ? -31.603 -8.657  -43.092 1.00 31.37 ? 142 THR A CG2 1 
ATOM   1039 N N   . ARG A 1 144 ? -33.659 -4.673  -44.516 1.00 29.57 ? 143 ARG A N   1 
ATOM   1040 C CA  . ARG A 1 144 ? -34.600 -3.872  -45.280 1.00 32.26 ? 143 ARG A CA  1 
ATOM   1041 C C   . ARG A 1 144 ? -34.427 -2.402  -44.863 1.00 31.93 ? 143 ARG A C   1 
ATOM   1042 O O   . ARG A 1 144 ? -34.383 -2.121  -43.692 1.00 37.16 ? 143 ARG A O   1 
ATOM   1043 C CB  . ARG A 1 144 ? -36.046 -4.371  -44.972 1.00 32.95 ? 143 ARG A CB  1 
ATOM   1044 N N   . TRP A 1 145 ? -34.246 -1.485  -45.801 1.00 30.82 ? 144 TRP A N   1 
ATOM   1045 C CA  A TRP A 1 145 ? -34.333 -0.005  -45.599 0.50 33.01 ? 144 TRP A CA  1 
ATOM   1046 C CA  B TRP A 1 145 ? -34.343 -0.080  -45.426 0.50 32.36 ? 144 TRP A CA  1 
ATOM   1047 C C   . TRP A 1 145 ? -35.800 0.379   -45.494 1.00 30.90 ? 144 TRP A C   1 
ATOM   1048 O O   . TRP A 1 145 ? -36.541 -0.101  -46.281 1.00 29.02 ? 144 TRP A O   1 
ATOM   1049 C CB  A TRP A 1 145 ? -33.786 0.740   -46.849 0.50 31.94 ? 144 TRP A CB  1 
ATOM   1050 C CB  B TRP A 1 145 ? -33.491 0.805   -46.300 0.50 30.58 ? 144 TRP A CB  1 
ATOM   1051 C CG  A TRP A 1 145 ? -33.964 2.306   -46.896 0.50 32.63 ? 144 TRP A CG  1 
ATOM   1052 C CG  B TRP A 1 145 ? -33.295 2.130   -45.652 0.50 30.60 ? 144 TRP A CG  1 
ATOM   1053 C CD1 A TRP A 1 145 ? -33.073 3.227   -46.435 0.50 33.03 ? 144 TRP A CD1 1 
ATOM   1054 C CD1 B TRP A 1 145 ? -33.696 3.346   -46.127 0.50 30.16 ? 144 TRP A CD1 1 
ATOM   1055 C CD2 A TRP A 1 145 ? -35.051 3.073   -47.474 0.50 34.34 ? 144 TRP A CD2 1 
ATOM   1056 C CD2 B TRP A 1 145 ? -32.663 2.375   -44.383 0.50 29.61 ? 144 TRP A CD2 1 
ATOM   1057 N NE1 A TRP A 1 145 ? -33.538 4.495   -46.643 0.50 34.69 ? 144 TRP A NE1 1 
ATOM   1058 N NE1 B TRP A 1 145 ? -33.341 4.331   -45.241 0.50 28.61 ? 144 TRP A NE1 1 
ATOM   1059 C CE2 A TRP A 1 145 ? -34.746 4.438   -47.279 0.50 35.31 ? 144 TRP A CE2 1 
ATOM   1060 C CE2 B TRP A 1 145 ? -32.694 3.765   -44.171 0.50 29.09 ? 144 TRP A CE2 1 
ATOM   1061 C CE3 A TRP A 1 145 ? -36.254 2.742   -48.105 0.50 34.18 ? 144 TRP A CE3 1 
ATOM   1062 C CE3 B TRP A 1 145 ? -32.058 1.546   -43.421 0.50 28.86 ? 144 TRP A CE3 1 
ATOM   1063 C CZ2 A TRP A 1 145 ? -35.584 5.467   -47.712 0.50 33.43 ? 144 TRP A CZ2 1 
ATOM   1064 C CZ2 B TRP A 1 145 ? -32.162 4.359   -43.033 0.50 29.40 ? 144 TRP A CZ2 1 
ATOM   1065 C CZ3 A TRP A 1 145 ? -37.084 3.761   -48.512 0.50 31.53 ? 144 TRP A CZ3 1 
ATOM   1066 C CZ3 B TRP A 1 145 ? -31.493 2.129   -42.307 0.50 30.46 ? 144 TRP A CZ3 1 
ATOM   1067 C CH2 A TRP A 1 145 ? -36.749 5.103   -48.318 0.50 33.53 ? 144 TRP A CH2 1 
ATOM   1068 C CH2 B TRP A 1 145 ? -31.556 3.538   -42.115 0.50 33.42 ? 144 TRP A CH2 1 
ATOM   1069 N N   . HIS A 1 146 ? -36.181 1.259   -44.576 1.00 33.62 ? 145 HIS A N   1 
ATOM   1070 C CA  . HIS A 1 146 ? -37.486 1.978   -44.593 1.00 33.68 ? 145 HIS A CA  1 
ATOM   1071 C C   . HIS A 1 146 ? -37.260 3.349   -43.966 1.00 35.94 ? 145 HIS A C   1 
ATOM   1072 O O   . HIS A 1 146 ? -36.170 3.640   -43.390 1.00 33.31 ? 145 HIS A O   1 
ATOM   1073 C CB  . HIS A 1 146 ? -38.648 1.198   -43.947 1.00 38.53 ? 145 HIS A CB  1 
ATOM   1074 C CG  . HIS A 1 146 ? -38.432 0.852   -42.511 1.00 51.26 ? 145 HIS A CG  1 
ATOM   1075 N ND1 . HIS A 1 146 ? -38.612 1.760   -41.491 1.00 55.49 ? 145 HIS A ND1 1 
ATOM   1076 C CD2 . HIS A 1 146 ? -38.019 -0.296  -41.922 1.00 58.77 ? 145 HIS A CD2 1 
ATOM   1077 C CE1 . HIS A 1 146 ? -38.315 1.192   -40.336 1.00 57.55 ? 145 HIS A CE1 1 
ATOM   1078 N NE2 . HIS A 1 146 ? -37.951 -0.055  -40.571 1.00 61.31 ? 145 HIS A NE2 1 
ATOM   1079 N N   . GLU A 1 147 ? -38.298 4.172   -44.057 1.00 36.31 ? 146 GLU A N   1 
ATOM   1080 C CA  . GLU A 1 147 ? -38.188 5.615   -43.884 1.00 36.70 ? 146 GLU A CA  1 
ATOM   1081 C C   . GLU A 1 147 ? -37.838 6.022   -42.444 1.00 34.43 ? 146 GLU A C   1 
ATOM   1082 O O   . GLU A 1 147 ? -37.272 7.071   -42.266 1.00 39.22 ? 146 GLU A O   1 
ATOM   1083 C CB  . GLU A 1 147 ? -39.495 6.305   -44.375 1.00 40.37 ? 146 GLU A CB  1 
ATOM   1084 N N   . SER A 1 148 ? -38.171 5.206   -41.447 1.00 27.83 ? 147 SER A N   1 
ATOM   1085 C CA  . SER A 1 148 ? -38.020 5.552   -40.056 1.00 31.66 ? 147 SER A CA  1 
ATOM   1086 C C   . SER A 1 148 ? -37.055 4.629   -39.286 1.00 36.86 ? 147 SER A C   1 
ATOM   1087 O O   . SER A 1 148 ? -36.955 4.652   -38.063 1.00 29.93 ? 147 SER A O   1 
ATOM   1088 C CB  . SER A 1 148 ? -39.379 5.508   -39.389 1.00 32.64 ? 147 SER A CB  1 
ATOM   1089 O OG  . SER A 1 148 ? -39.865 4.205   -39.410 1.00 36.18 ? 147 SER A OG  1 
ATOM   1090 N N   . ILE A 1 149 ? -36.326 3.811   -40.012 1.00 43.11 ? 148 ILE A N   1 
ATOM   1091 C CA  . ILE A 1 149 ? -35.456 2.835   -39.348 1.00 42.66 ? 148 ILE A CA  1 
ATOM   1092 C C   . ILE A 1 149 ? -34.307 3.537   -38.591 1.00 35.91 ? 148 ILE A C   1 
ATOM   1093 O O   . ILE A 1 149 ? -33.772 2.930   -37.661 1.00 36.53 ? 148 ILE A O   1 
ATOM   1094 C CB  . ILE A 1 149 ? -34.919 1.862   -40.387 1.00 48.07 ? 148 ILE A CB  1 
ATOM   1095 C CG1 . ILE A 1 149 ? -34.258 0.606   -39.791 1.00 53.92 ? 148 ILE A CG1 1 
ATOM   1096 C CG2 . ILE A 1 149 ? -33.942 2.595   -41.213 1.00 46.67 ? 148 ILE A CG2 1 
ATOM   1097 C CD1 . ILE A 1 149 ? -35.230 -0.383  -39.201 1.00 55.03 ? 148 ILE A CD1 1 
ATOM   1098 N N   . LYS A 1 150 ? -33.987 4.806   -38.931 1.00 29.66 ? 149 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 150 ? -33.147 5.615   -38.041 1.00 30.07 ? 149 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 150 ? -33.551 5.540   -36.553 1.00 28.53 ? 149 LYS A C   1 
ATOM   1101 O O   . LYS A 1 150 ? -32.657 5.529   -35.682 1.00 27.84 ? 149 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 150 ? -33.013 7.090   -38.465 1.00 31.85 ? 149 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 150 ? -32.210 7.898   -37.414 1.00 37.43 ? 149 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 150 ? -31.709 9.293   -37.784 1.00 39.90 ? 149 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 150 ? -31.165 9.955   -36.521 1.00 42.64 ? 149 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 150 ? -30.155 11.024  -36.759 1.00 44.19 ? 149 LYS A NZ  1 
ATOM   1107 N N   . GLU A 1 151 ? -34.855 5.500   -36.222 1.00 25.47 ? 150 GLU A N   1 
ATOM   1108 C CA  . GLU A 1 151 ? -35.236 5.367   -34.823 1.00 26.57 ? 150 GLU A CA  1 
ATOM   1109 C C   . GLU A 1 151 ? -34.828 4.049   -34.215 1.00 26.07 ? 150 GLU A C   1 
ATOM   1110 O O   . GLU A 1 151 ? -34.563 3.995   -33.007 1.00 24.94 ? 150 GLU A O   1 
ATOM   1111 C CB  . GLU A 1 151 ? -36.772 5.475   -34.564 1.00 27.58 ? 150 GLU A CB  1 
ATOM   1112 C CG  . GLU A 1 151 ? -37.418 6.701   -35.099 1.00 27.51 ? 150 GLU A CG  1 
ATOM   1113 C CD  . GLU A 1 151 ? -38.908 6.706   -34.752 1.00 27.17 ? 150 GLU A CD  1 
ATOM   1114 O OE1 . GLU A 1 151 ? -39.389 5.884   -33.929 1.00 25.97 ? 150 GLU A OE1 1 
ATOM   1115 O OE2 . GLU A 1 151 ? -39.532 7.587   -35.258 1.00 26.22 ? 150 GLU A OE2 1 
ATOM   1116 N N   . GLU A 1 152 ? -34.905 2.970   -35.007 1.00 25.91 ? 151 GLU A N   1 
ATOM   1117 C CA  . GLU A 1 152 ? -34.419 1.683   -34.508 1.00 27.76 ? 151 GLU A CA  1 
ATOM   1118 C C   . GLU A 1 152 ? -32.938 1.701   -34.269 1.00 23.30 ? 151 GLU A C   1 
ATOM   1119 O O   . GLU A 1 152 ? -32.481 1.206   -33.237 1.00 23.96 ? 151 GLU A O   1 
ATOM   1120 C CB  . GLU A 1 152 ? -34.702 0.545   -35.495 1.00 31.79 ? 151 GLU A CB  1 
ATOM   1121 C CG  . GLU A 1 152 ? -36.194 0.201   -35.595 1.00 37.01 ? 151 GLU A CG  1 
ATOM   1122 C CD  . GLU A 1 152 ? -36.408 -1.304  -35.796 1.00 38.38 ? 151 GLU A CD  1 
ATOM   1123 O OE1 . GLU A 1 152 ? -36.502 -1.676  -36.987 1.00 39.64 ? 151 GLU A OE1 1 
ATOM   1124 O OE2 . GLU A 1 152 ? -36.419 -2.082  -34.770 1.00 33.18 ? 151 GLU A OE2 1 
ATOM   1125 N N   . LEU A 1 153 ? -32.208 2.230   -35.230 1.00 22.80 ? 152 LEU A N   1 
ATOM   1126 C CA  . LEU A 1 153 ? -30.737 2.287   -35.098 1.00 21.47 ? 152 LEU A CA  1 
ATOM   1127 C C   . LEU A 1 153 ? -30.382 3.097   -33.908 1.00 22.19 ? 152 LEU A C   1 
ATOM   1128 O O   . LEU A 1 153 ? -29.566 2.664   -33.094 1.00 19.36 ? 152 LEU A O   1 
ATOM   1129 C CB  . LEU A 1 153 ? -30.076 2.828   -36.335 1.00 22.26 ? 152 LEU A CB  1 
ATOM   1130 C CG  . LEU A 1 153 ? -30.333 2.125   -37.656 1.00 24.90 ? 152 LEU A CG  1 
ATOM   1131 C CD1 . LEU A 1 153 ? -29.550 2.761   -38.752 1.00 24.39 ? 152 LEU A CD1 1 
ATOM   1132 C CD2 . LEU A 1 153 ? -30.007 0.649   -37.579 1.00 25.44 ? 152 LEU A CD2 1 
ATOM   1133 N N   . GLU A 1 154 ? -31.041 4.257   -33.758 1.00 23.61 ? 153 GLU A N   1 
ATOM   1134 C CA  . GLU A 1 154 ? -30.824 5.101   -32.599 1.00 25.48 ? 153 GLU A CA  1 
ATOM   1135 C C   . GLU A 1 154 ? -31.110 4.439   -31.252 1.00 23.67 ? 153 GLU A C   1 
ATOM   1136 O O   . GLU A 1 154 ? -30.294 4.521   -30.345 1.00 23.80 ? 153 GLU A O   1 
ATOM   1137 C CB  . GLU A 1 154 ? -31.559 6.409   -32.755 1.00 30.27 ? 153 GLU A CB  1 
ATOM   1138 C CG  . GLU A 1 154 ? -31.079 7.482   -31.806 1.00 37.38 ? 153 GLU A CG  1 
ATOM   1139 C CD  . GLU A 1 154 ? -31.534 8.892   -32.210 1.00 47.08 ? 153 GLU A CD  1 
ATOM   1140 O OE1 . GLU A 1 154 ? -31.643 9.223   -33.436 1.00 52.56 ? 153 GLU A OE1 1 
ATOM   1141 O OE2 . GLU A 1 154 ? -31.792 9.682   -31.273 1.00 55.86 ? 153 GLU A OE2 1 
ATOM   1142 N N   . ALA A 1 155 ? -32.226 3.720   -31.122 1.00 22.28 ? 154 ALA A N   1 
ATOM   1143 C CA  . ALA A 1 155 ? -32.489 2.970   -29.903 1.00 23.05 ? 154 ALA A CA  1 
ATOM   1144 C C   . ALA A 1 155 ? -31.388 1.913   -29.643 1.00 22.79 ? 154 ALA A C   1 
ATOM   1145 O O   . ALA A 1 155 ? -30.915 1.724   -28.514 1.00 24.28 ? 154 ALA A O   1 
ATOM   1146 C CB  . ALA A 1 155 ? -33.849 2.256   -30.019 1.00 24.87 ? 154 ALA A CB  1 
ATOM   1147 N N   . LEU A 1 156 ? -30.952 1.245   -30.711 1.00 20.19 ? 155 LEU A N   1 
ATOM   1148 C CA  . LEU A 1 156 ? -29.954 0.216   -30.558 1.00 22.15 ? 155 LEU A CA  1 
ATOM   1149 C C   . LEU A 1 156 ? -28.638 0.724   -30.031 1.00 22.14 ? 155 LEU A C   1 
ATOM   1150 O O   . LEU A 1 156 ? -28.050 0.057   -29.152 1.00 23.63 ? 155 LEU A O   1 
ATOM   1151 C CB  . LEU A 1 156 ? -29.747 -0.539  -31.868 1.00 23.24 ? 155 LEU A CB  1 
ATOM   1152 C CG  . LEU A 1 156 ? -30.927 -1.471  -32.187 1.00 22.52 ? 155 LEU A CG  1 
ATOM   1153 C CD1 . LEU A 1 156 ? -30.903 -1.773  -33.675 1.00 23.04 ? 155 LEU A CD1 1 
ATOM   1154 C CD2 . LEU A 1 156 ? -30.780 -2.719  -31.359 1.00 24.44 ? 155 LEU A CD2 1 
ATOM   1155 N N   . VAL A 1 157 ? -28.171 1.890   -30.538 1.00 19.13 ? 156 VAL A N   1 
ATOM   1156 C CA  . VAL A 1 157 ? -26.917 2.380   -30.074 1.00 19.26 ? 156 VAL A CA  1 
ATOM   1157 C C   . VAL A 1 157 ? -27.074 3.083   -28.691 1.00 21.14 ? 156 VAL A C   1 
ATOM   1158 O O   . VAL A 1 157 ? -26.131 3.076   -27.936 1.00 19.83 ? 156 VAL A O   1 
ATOM   1159 C CB  . VAL A 1 157 ? -26.201 3.310   -31.080 1.00 19.14 ? 156 VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 157 ? -26.118 2.708   -32.477 1.00 17.48 ? 156 VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 157 ? -26.809 4.707   -31.147 1.00 19.46 ? 156 VAL A CG2 1 
ATOM   1162 N N   . LYS A 1 158 ? -28.207 3.702   -28.401 1.00 23.36 ? 157 LYS A N   1 
ATOM   1163 C CA  . LYS A 1 158 ? -28.358 4.467   -27.138 1.00 27.82 ? 157 LYS A CA  1 
ATOM   1164 C C   . LYS A 1 158 ? -28.729 3.523   -25.999 1.00 26.90 ? 157 LYS A C   1 
ATOM   1165 O O   . LYS A 1 158 ? -28.309 3.714   -24.882 1.00 25.80 ? 157 LYS A O   1 
ATOM   1166 C CB  . LYS A 1 158 ? -29.475 5.527   -27.216 1.00 32.59 ? 157 LYS A CB  1 
ATOM   1167 C CG  . LYS A 1 158 ? -29.318 6.661   -28.223 1.00 38.44 ? 157 LYS A CG  1 
ATOM   1168 C CD  . LYS A 1 158 ? -28.141 7.577   -27.964 1.00 41.89 ? 157 LYS A CD  1 
ATOM   1169 C CE  . LYS A 1 158 ? -27.897 8.499   -29.142 1.00 43.86 ? 157 LYS A CE  1 
ATOM   1170 N NZ  . LYS A 1 158 ? -28.858 9.625   -29.135 1.00 45.72 ? 157 LYS A NZ  1 
ATOM   1171 N N   . GLU A 1 159 ? -29.530 2.517   -26.261 1.00 25.94 ? 158 GLU A N   1 
ATOM   1172 C CA  . GLU A 1 159 ? -30.042 1.619   -25.207 1.00 28.67 ? 158 GLU A CA  1 
ATOM   1173 C C   . GLU A 1 159 ? -29.499 0.226   -25.192 1.00 25.10 ? 158 GLU A C   1 
ATOM   1174 O O   . GLU A 1 159 ? -29.467 -0.343  -24.138 1.00 23.03 ? 158 GLU A O   1 
ATOM   1175 C CB  . GLU A 1 159 ? -31.553 1.477   -25.347 1.00 34.95 ? 158 GLU A CB  1 
ATOM   1176 C CG  . GLU A 1 159 ? -32.291 2.796   -25.161 1.00 43.05 ? 158 GLU A CG  1 
ATOM   1177 C CD  . GLU A 1 159 ? -33.722 2.740   -25.675 1.00 51.95 ? 158 GLU A CD  1 
ATOM   1178 O OE1 . GLU A 1 159 ? -34.303 1.622   -25.683 1.00 61.54 ? 158 GLU A OE1 1 
ATOM   1179 O OE2 . GLU A 1 159 ? -34.250 3.812   -26.093 1.00 60.91 ? 158 GLU A OE2 1 
ATOM   1180 N N   . LYS A 1 160 ? -29.103 -0.355  -26.337 1.00 20.83 ? 159 LYS A N   1 
ATOM   1181 C CA  . LYS A 1 160 ? -28.825 -1.782  -26.373 1.00 21.02 ? 159 LYS A CA  1 
ATOM   1182 C C   . LYS A 1 160 ? -27.325 -2.137  -26.532 1.00 20.23 ? 159 LYS A C   1 
ATOM   1183 O O   . LYS A 1 160 ? -26.998 -3.300  -26.746 1.00 20.61 ? 159 LYS A O   1 
ATOM   1184 C CB  . LYS A 1 160 ? -29.668 -2.420  -27.484 1.00 23.04 ? 159 LYS A CB  1 
ATOM   1185 C CG  . LYS A 1 160 ? -31.178 -2.099  -27.408 1.00 24.96 ? 159 LYS A CG  1 
ATOM   1186 C CD  . LYS A 1 160 ? -31.776 -2.554  -26.075 1.00 26.44 ? 159 LYS A CD  1 
ATOM   1187 C CE  . LYS A 1 160 ? -33.290 -2.329  -25.953 1.00 29.98 ? 159 LYS A CE  1 
ATOM   1188 N NZ  . LYS A 1 160 ? -33.746 -3.190  -24.824 1.00 31.39 ? 159 LYS A NZ  1 
ATOM   1189 N N   . GLY A 1 161 ? -26.434 -1.146  -26.408 1.00 19.56 ? 160 GLY A N   1 
ATOM   1190 C CA  . GLY A 1 161 ? -24.985 -1.408  -26.451 1.00 19.76 ? 160 GLY A CA  1 
ATOM   1191 C C   . GLY A 1 161 ? -24.426 -1.905  -27.812 1.00 18.96 ? 160 GLY A C   1 
ATOM   1192 O O   . GLY A 1 161 ? -23.356 -2.580  -27.837 1.00 18.50 ? 160 GLY A O   1 
ATOM   1193 N N   . VAL A 1 162 ? -25.092 -1.554  -28.912 1.00 17.28 ? 161 VAL A N   1 
ATOM   1194 C CA  . VAL A 1 162 ? -24.703 -1.925  -30.248 1.00 18.00 ? 161 VAL A CA  1 
ATOM   1195 C C   . VAL A 1 162 ? -24.042 -0.717  -30.849 1.00 18.33 ? 161 VAL A C   1 
ATOM   1196 O O   . VAL A 1 162 ? -24.530 0.369   -30.657 1.00 20.85 ? 161 VAL A O   1 
ATOM   1197 C CB  . VAL A 1 162 ? -25.930 -2.249  -31.101 1.00 19.33 ? 161 VAL A CB  1 
ATOM   1198 C CG1 . VAL A 1 162 ? -25.534 -2.426  -32.517 1.00 20.29 ? 161 VAL A CG1 1 
ATOM   1199 C CG2 . VAL A 1 162 ? -26.521 -3.547  -30.612 1.00 22.74 ? 161 VAL A CG2 1 
ATOM   1200 N N   . ASN A 1 163 ? -22.917 -0.866  -31.541 1.00 15.95 ? 162 ASN A N   1 
ATOM   1201 C CA  . ASN A 1 163 ? -22.312 0.267   -32.307 1.00 16.26 ? 162 ASN A CA  1 
ATOM   1202 C C   . ASN A 1 163 ? -21.833 -0.105  -33.703 1.00 17.03 ? 162 ASN A C   1 
ATOM   1203 O O   . ASN A 1 163 ? -20.996 0.590   -34.276 1.00 16.80 ? 162 ASN A O   1 
ATOM   1204 C CB  . ASN A 1 163 ? -21.169 0.912   -31.526 1.00 16.32 ? 162 ASN A CB  1 
ATOM   1205 C CG  . ASN A 1 163 ? -19.967 0.008   -31.414 1.00 17.88 ? 162 ASN A CG  1 
ATOM   1206 O OD1 . ASN A 1 163 ? -19.900 -1.119  -31.979 1.00 17.47 ? 162 ASN A OD1 1 
ATOM   1207 N ND2 . ASN A 1 163 ? -19.055 0.438   -30.592 1.00 18.65 ? 162 ASN A ND2 1 
ATOM   1208 N N   . SER A 1 164 ? -22.383 -1.198  -34.248 1.00 16.48 ? 163 SER A N   1 
ATOM   1209 C CA  . SER A 1 164 ? -22.072 -1.593  -35.607 1.00 16.60 ? 163 SER A CA  1 
ATOM   1210 C C   . SER A 1 164 ? -23.278 -2.227  -36.296 1.00 17.29 ? 163 SER A C   1 
ATOM   1211 O O   . SER A 1 164 ? -23.984 -3.057  -35.718 1.00 16.71 ? 163 SER A O   1 
ATOM   1212 C CB  . SER A 1 164 ? -20.886 -2.583  -35.599 1.00 17.11 ? 163 SER A CB  1 
ATOM   1213 O OG  . SER A 1 164 ? -21.117 -3.637  -34.668 1.00 19.31 ? 163 SER A OG  1 
ATOM   1214 N N   . PHE A 1 165 ? -23.474 -1.862  -37.549 1.00 17.23 ? 164 PHE A N   1 
ATOM   1215 C CA  . PHE A 1 165 ? -24.590 -2.354  -38.370 1.00 16.04 ? 164 PHE A CA  1 
ATOM   1216 C C   . PHE A 1 165 ? -24.093 -2.778  -39.742 1.00 17.82 ? 164 PHE A C   1 
ATOM   1217 O O   . PHE A 1 165 ? -23.212 -2.089  -40.317 1.00 18.61 ? 164 PHE A O   1 
ATOM   1218 C CB  . PHE A 1 165 ? -25.622 -1.234  -38.585 1.00 17.26 ? 164 PHE A CB  1 
ATOM   1219 C CG  . PHE A 1 165 ? -26.161 -0.669  -37.320 1.00 17.54 ? 164 PHE A CG  1 
ATOM   1220 C CD1 . PHE A 1 165 ? -27.122 -1.357  -36.599 1.00 18.82 ? 164 PHE A CD1 1 
ATOM   1221 C CD2 . PHE A 1 165 ? -25.667 0.524   -36.811 1.00 16.60 ? 164 PHE A CD2 1 
ATOM   1222 C CE1 . PHE A 1 165 ? -27.631 -0.858  -35.397 1.00 18.83 ? 164 PHE A CE1 1 
ATOM   1223 C CE2 . PHE A 1 165 ? -26.133 1.006   -35.565 1.00 19.67 ? 164 PHE A CE2 1 
ATOM   1224 C CZ  . PHE A 1 165 ? -27.141 0.318   -34.885 1.00 18.33 ? 164 PHE A CZ  1 
ATOM   1225 N N   . LEU A 1 166 ? -24.670 -3.832  -40.306 1.00 14.64 ? 165 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 166 ? -24.245 -4.322  -41.577 1.00 16.09 ? 165 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 166 ? -25.292 -4.081  -42.672 1.00 18.26 ? 165 LEU A C   1 
ATOM   1228 O O   . LEU A 1 166 ? -26.508 -4.256  -42.455 1.00 16.26 ? 165 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 166 ? -23.961 -5.786  -41.459 1.00 18.55 ? 165 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 166 ? -23.445 -6.380  -42.790 1.00 20.00 ? 165 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 166 ? -22.333 -7.355  -42.523 1.00 22.01 ? 165 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 166 ? -24.545 -7.050  -43.548 1.00 21.24 ? 165 LEU A CD2 1 
ATOM   1233 N N   . VAL A 1 167 ? -24.818 -3.621  -43.813 1.00 18.40 ? 166 VAL A N   1 
ATOM   1234 C CA  . VAL A 1 167 ? -25.600 -3.445  -45.018 1.00 21.15 ? 166 VAL A CA  1 
ATOM   1235 C C   . VAL A 1 167 ? -25.187 -4.473  -46.103 1.00 21.04 ? 166 VAL A C   1 
ATOM   1236 O O   . VAL A 1 167 ? -23.994 -4.764  -46.259 1.00 20.55 ? 166 VAL A O   1 
ATOM   1237 C CB  . VAL A 1 167 ? -25.357 -1.997  -45.500 1.00 26.20 ? 166 VAL A CB  1 
ATOM   1238 C CG1 . VAL A 1 167 ? -25.902 -1.758  -46.877 1.00 32.66 ? 166 VAL A CG1 1 
ATOM   1239 C CG2 . VAL A 1 167 ? -26.008 -1.042  -44.527 1.00 29.39 ? 166 VAL A CG2 1 
ATOM   1240 N N   . PHE A 1 168 ? -26.164 -5.041  -46.835 1.00 17.77 ? 167 PHE A N   1 
ATOM   1241 C CA  . PHE A 1 168 ? -25.873 -5.990  -47.880 1.00 20.67 ? 167 PHE A CA  1 
ATOM   1242 C C   . PHE A 1 168 ? -25.912 -5.339  -49.279 1.00 21.53 ? 167 PHE A C   1 
ATOM   1243 O O   . PHE A 1 168 ? -26.873 -4.660  -49.594 1.00 22.38 ? 167 PHE A O   1 
ATOM   1244 C CB  . PHE A 1 168 ? -26.906 -7.133  -47.866 1.00 21.74 ? 167 PHE A CB  1 
ATOM   1245 C CG  . PHE A 1 168 ? -26.919 -7.904  -46.598 1.00 20.41 ? 167 PHE A CG  1 
ATOM   1246 C CD1 . PHE A 1 168 ? -27.679 -7.461  -45.537 1.00 21.27 ? 167 PHE A CD1 1 
ATOM   1247 C CD2 . PHE A 1 168 ? -26.248 -9.100  -46.502 1.00 22.21 ? 167 PHE A CD2 1 
ATOM   1248 C CE1 . PHE A 1 168 ? -27.712 -8.150  -44.333 1.00 21.96 ? 167 PHE A CE1 1 
ATOM   1249 C CE2 . PHE A 1 168 ? -26.284 -9.816  -45.327 1.00 23.43 ? 167 PHE A CE2 1 
ATOM   1250 C CZ  . PHE A 1 168 ? -27.063 -9.367  -44.252 1.00 23.80 ? 167 PHE A CZ  1 
ATOM   1251 N N   . MET A 1 169 ? -24.866 -5.523  -50.066 1.00 19.80 ? 168 MET A N   1 
ATOM   1252 C CA  . MET A 1 169 ? -24.841 -5.104  -51.497 1.00 21.11 ? 168 MET A CA  1 
ATOM   1253 C C   . MET A 1 169 ? -25.258 -6.260  -52.445 1.00 24.77 ? 168 MET A C   1 
ATOM   1254 O O   . MET A 1 169 ? -25.359 -6.083  -53.681 1.00 22.91 ? 168 MET A O   1 
ATOM   1255 C CB  . MET A 1 169 ? -23.469 -4.625  -51.882 1.00 21.15 ? 168 MET A CB  1 
ATOM   1256 C CG  . MET A 1 169 ? -23.008 -3.500  -50.967 1.00 22.95 ? 168 MET A CG  1 
ATOM   1257 S SD  . MET A 1 169 ? -21.324 -2.933  -51.275 1.00 22.64 ? 168 MET A SD  1 
ATOM   1258 C CE  . MET A 1 169 ? -21.528 -1.993  -52.755 1.00 21.96 ? 168 MET A CE  1 
ATOM   1259 N N   . ALA A 1 170 ? -25.514 -7.426  -51.864 1.00 26.03 ? 169 ALA A N   1 
ATOM   1260 C CA  . ALA A 1 170 ? -25.868 -8.642  -52.595 1.00 27.53 ? 169 ALA A CA  1 
ATOM   1261 C C   . ALA A 1 170 ? -27.185 -9.188  -52.024 1.00 29.15 ? 169 ALA A C   1 
ATOM   1262 O O   . ALA A 1 170 ? -27.803 -8.555  -51.170 1.00 29.69 ? 169 ALA A O   1 
ATOM   1263 C CB  . ALA A 1 170 ? -24.761 -9.660  -52.477 1.00 27.30 ? 169 ALA A CB  1 
ATOM   1264 N N   . TYR A 1 171 ? -27.621 -10.338 -52.539 1.00 31.21 ? 170 TYR A N   1 
ATOM   1265 C CA  . TYR A 1 171 ? -28.950 -10.920 -52.263 1.00 34.35 ? 170 TYR A CA  1 
ATOM   1266 C C   . TYR A 1 171 ? -30.042 -9.994  -52.896 1.00 37.41 ? 170 TYR A C   1 
ATOM   1267 O O   . TYR A 1 171 ? -30.909 -9.485  -52.202 1.00 29.20 ? 170 TYR A O   1 
ATOM   1268 C CB  . TYR A 1 171 ? -29.136 -11.202 -50.763 1.00 33.59 ? 170 TYR A CB  1 
ATOM   1269 C CG  . TYR A 1 171 ? -27.952 -11.980 -50.223 1.00 33.84 ? 170 TYR A CG  1 
ATOM   1270 C CD1 . TYR A 1 171 ? -27.719 -13.283 -50.659 1.00 38.30 ? 170 TYR A CD1 1 
ATOM   1271 C CD2 . TYR A 1 171 ? -27.021 -11.393 -49.339 1.00 33.49 ? 170 TYR A CD2 1 
ATOM   1272 C CE1 . TYR A 1 171 ? -26.621 -14.013 -50.215 1.00 40.07 ? 170 TYR A CE1 1 
ATOM   1273 C CE2 . TYR A 1 171 ? -25.917 -12.110 -48.877 1.00 33.62 ? 170 TYR A CE2 1 
ATOM   1274 C CZ  . TYR A 1 171 ? -25.716 -13.409 -49.343 1.00 39.93 ? 170 TYR A CZ  1 
ATOM   1275 O OH  . TYR A 1 171 ? -24.660 -14.168 -48.936 1.00 45.71 ? 170 TYR A OH  1 
ATOM   1276 N N   . LYS A 1 172 ? -29.938 -9.784  -54.227 1.00 39.55 ? 171 LYS A N   1 
ATOM   1277 C CA  . LYS A 1 172 ? -30.915 -9.001  -55.023 1.00 40.42 ? 171 LYS A CA  1 
ATOM   1278 C C   . LYS A 1 172 ? -32.386 -9.412  -54.691 1.00 36.72 ? 171 LYS A C   1 
ATOM   1279 O O   . LYS A 1 172 ? -32.657 -10.586 -54.492 1.00 38.28 ? 171 LYS A O   1 
ATOM   1280 C CB  . LYS A 1 172 ? -30.580 -9.163  -56.524 1.00 40.34 ? 171 LYS A CB  1 
ATOM   1281 C CG  . LYS A 1 172 ? -31.502 -8.460  -57.525 1.00 42.38 ? 171 LYS A CG  1 
ATOM   1282 C CD  . LYS A 1 172 ? -31.131 -8.902  -58.933 1.00 44.98 ? 171 LYS A CD  1 
ATOM   1283 C CE  . LYS A 1 172 ? -32.044 -8.361  -60.022 1.00 47.26 ? 171 LYS A CE  1 
ATOM   1284 N NZ  . LYS A 1 172 ? -31.981 -6.879  -60.086 1.00 44.86 ? 171 LYS A NZ  1 
ATOM   1285 N N   . ASP A 1 173 ? -33.305 -8.453  -54.594 1.00 39.79 ? 172 ASP A N   1 
ATOM   1286 C CA  . ASP A 1 173 ? -34.733 -8.787  -54.297 1.00 48.51 ? 172 ASP A CA  1 
ATOM   1287 C C   . ASP A 1 173 ? -34.940 -9.394  -52.876 1.00 51.46 ? 172 ASP A C   1 
ATOM   1288 O O   . ASP A 1 173 ? -35.952 -10.043 -52.625 1.00 58.08 ? 172 ASP A O   1 
ATOM   1289 C CB  . ASP A 1 173 ? -35.357 -9.721  -55.406 1.00 45.23 ? 172 ASP A CB  1 
ATOM   1290 N N   . ARG A 1 174 ? -33.997 -9.190  -51.951 1.00 49.12 ? 173 ARG A N   1 
ATOM   1291 C CA  . ARG A 1 174 ? -34.119 -9.761  -50.586 1.00 50.01 ? 173 ARG A CA  1 
ATOM   1292 C C   . ARG A 1 174 ? -33.592 -8.829  -49.512 1.00 50.82 ? 173 ARG A C   1 
ATOM   1293 O O   . ARG A 1 174 ? -34.364 -8.367  -48.653 1.00 55.66 ? 173 ARG A O   1 
ATOM   1294 C CB  . ARG A 1 174 ? -33.403 -11.093 -50.464 1.00 50.91 ? 173 ARG A CB  1 
ATOM   1295 C CG  . ARG A 1 174 ? -34.295 -12.301 -50.657 1.00 59.25 ? 173 ARG A CG  1 
ATOM   1296 C CD  . ARG A 1 174 ? -33.432 -13.458 -51.068 1.00 62.11 ? 173 ARG A CD  1 
ATOM   1297 N NE  . ARG A 1 174 ? -32.834 -13.119 -52.354 1.00 65.53 ? 173 ARG A NE  1 
ATOM   1298 C CZ  . ARG A 1 174 ? -31.630 -13.482 -52.777 1.00 67.40 ? 173 ARG A CZ  1 
ATOM   1299 N NH1 . ARG A 1 174 ? -30.824 -14.228 -52.023 1.00 68.91 ? 173 ARG A NH1 1 
ATOM   1300 N NH2 . ARG A 1 174 ? -31.226 -13.089 -53.987 1.00 65.91 ? 173 ARG A NH2 1 
ATOM   1301 N N   . CYS A 1 175 ? -32.273 -8.616  -49.500 1.00 41.94 ? 174 CYS A N   1 
ATOM   1302 C CA  . CYS A 1 175 ? -31.727 -7.588  -48.636 1.00 39.17 ? 174 CYS A CA  1 
ATOM   1303 C C   . CYS A 1 175 ? -30.691 -6.637  -49.243 1.00 34.78 ? 174 CYS A C   1 
ATOM   1304 O O   . CYS A 1 175 ? -30.156 -5.778  -48.528 1.00 30.32 ? 174 CYS A O   1 
ATOM   1305 C CB  . CYS A 1 175 ? -31.298 -8.185  -47.290 1.00 46.15 ? 174 CYS A CB  1 
ATOM   1306 S SG  . CYS A 1 175 ? -30.421 -9.738  -47.331 1.00 45.93 ? 174 CYS A SG  1 
ATOM   1307 N N   . GLN A 1 176 ? -30.514 -6.687  -50.563 1.00 30.88 ? 175 GLN A N   1 
ATOM   1308 C CA  . GLN A 1 176 ? -29.624 -5.754  -51.256 1.00 32.04 ? 175 GLN A CA  1 
ATOM   1309 C C   . GLN A 1 176 ? -30.108 -4.309  -51.149 1.00 34.44 ? 175 GLN A C   1 
ATOM   1310 O O   . GLN A 1 176 ? -31.268 -4.045  -51.318 1.00 33.80 ? 175 GLN A O   1 
ATOM   1311 C CB  . GLN A 1 176 ? -29.565 -6.107  -52.718 1.00 36.32 ? 175 GLN A CB  1 
ATOM   1312 C CG  . GLN A 1 176 ? -28.664 -5.195  -53.553 1.00 41.16 ? 175 GLN A CG  1 
ATOM   1313 C CD  . GLN A 1 176 ? -28.435 -5.733  -54.976 1.00 43.15 ? 175 GLN A CD  1 
ATOM   1314 O OE1 . GLN A 1 176 ? -28.259 -6.938  -55.184 1.00 51.49 ? 175 GLN A OE1 1 
ATOM   1315 N NE2 . GLN A 1 176 ? -28.424 -4.853  -55.931 1.00 40.43 ? 175 GLN A NE2 1 
ATOM   1316 N N   . CYS A 1 177 ? -29.218 -3.385  -50.834 1.00 34.14 ? 176 CYS A N   1 
ATOM   1317 C CA  . CYS A 1 177 ? -29.514 -1.955  -50.831 1.00 34.34 ? 176 CYS A CA  1 
ATOM   1318 C C   . CYS A 1 177 ? -29.091 -1.369  -52.174 1.00 30.93 ? 176 CYS A C   1 
ATOM   1319 O O   . CYS A 1 177 ? -28.226 -1.923  -52.839 1.00 33.22 ? 176 CYS A O   1 
ATOM   1320 C CB  . CYS A 1 177 ? -28.802 -1.243  -49.656 1.00 37.61 ? 176 CYS A CB  1 
ATOM   1321 S SG  . CYS A 1 177 ? -29.516 -1.724  -48.016 1.00 63.48 ? 176 CYS A SG  1 
ATOM   1322 N N   . SER A 1 178 ? -29.754 -0.275  -52.582 1.00 26.33 ? 177 SER A N   1 
ATOM   1323 C CA  . SER A 1 178 ? -29.320 0.557   -53.700 1.00 23.75 ? 177 SER A CA  1 
ATOM   1324 C C   . SER A 1 178 ? -28.223 1.586   -53.200 1.00 22.97 ? 177 SER A C   1 
ATOM   1325 O O   . SER A 1 178 ? -28.081 1.810   -51.953 1.00 20.52 ? 177 SER A O   1 
ATOM   1326 C CB  . SER A 1 178 ? -30.498 1.343   -54.185 1.00 24.46 ? 177 SER A CB  1 
ATOM   1327 O OG  . SER A 1 178 ? -30.776 2.409   -53.275 1.00 23.76 ? 177 SER A OG  1 
ATOM   1328 N N   . ASP A 1 179 ? -27.504 2.223   -54.132 1.00 21.12 ? 178 ASP A N   1 
ATOM   1329 C CA  . ASP A 1 179 ? -26.479 3.146   -53.772 1.00 21.68 ? 178 ASP A CA  1 
ATOM   1330 C C   . ASP A 1 179 ? -27.028 4.348   -52.999 1.00 22.46 ? 178 ASP A C   1 
ATOM   1331 O O   . ASP A 1 179 ? -26.400 4.763   -52.022 1.00 18.73 ? 178 ASP A O   1 
ATOM   1332 C CB  . ASP A 1 179 ? -25.683 3.642   -54.961 1.00 22.88 ? 178 ASP A CB  1 
ATOM   1333 C CG  . ASP A 1 179 ? -24.843 2.575   -55.604 1.00 23.60 ? 178 ASP A CG  1 
ATOM   1334 O OD1 . ASP A 1 179 ? -24.590 1.488   -55.029 1.00 22.37 ? 178 ASP A OD1 1 
ATOM   1335 O OD2 . ASP A 1 179 ? -24.498 2.834   -56.783 1.00 26.40 ? 178 ASP A OD2 1 
ATOM   1336 N N   . SER A 1 180 ? -28.203 4.859   -53.378 1.00 20.95 ? 179 SER A N   1 
ATOM   1337 C CA  . SER A 1 180 ? -28.894 5.928   -52.609 1.00 21.25 ? 179 SER A CA  1 
ATOM   1338 C C   . SER A 1 180 ? -29.195 5.582   -51.191 1.00 20.22 ? 179 SER A C   1 
ATOM   1339 O O   . SER A 1 180 ? -28.944 6.379   -50.283 1.00 18.16 ? 179 SER A O   1 
ATOM   1340 C CB  . SER A 1 180 ? -30.228 6.299   -53.288 1.00 22.76 ? 179 SER A CB  1 
ATOM   1341 O OG  . SER A 1 180 ? -29.777 6.892   -54.504 1.00 32.24 ? 179 SER A OG  1 
ATOM   1342 N N   . GLN A 1 181 ? -29.687 4.360   -51.003 1.00 18.99 ? 180 GLN A N   1 
ATOM   1343 C CA  . GLN A 1 181 ? -30.023 3.877   -49.700 1.00 22.40 ? 180 GLN A CA  1 
ATOM   1344 C C   . GLN A 1 181 ? -28.762 3.685   -48.880 1.00 20.67 ? 180 GLN A C   1 
ATOM   1345 O O   . GLN A 1 181 ? -28.759 3.997   -47.680 1.00 19.08 ? 180 GLN A O   1 
ATOM   1346 C CB  . GLN A 1 181 ? -30.750 2.524   -49.714 1.00 22.97 ? 180 GLN A CB  1 
ATOM   1347 C CG  . GLN A 1 181 ? -32.142 2.652   -50.273 1.00 28.33 ? 180 GLN A CG  1 
ATOM   1348 C CD  . GLN A 1 181 ? -32.808 1.314   -50.505 1.00 33.12 ? 180 GLN A CD  1 
ATOM   1349 O OE1 . GLN A 1 181 ? -32.152 0.254   -50.612 1.00 32.50 ? 180 GLN A OE1 1 
ATOM   1350 N NE2 . GLN A 1 181 ? -34.121 1.345   -50.572 1.00 34.69 ? 180 GLN A NE2 1 
ATOM   1351 N N   . MET A 1 182 ? -27.718 3.162   -49.531 1.00 18.17 ? 181 MET A N   1 
ATOM   1352 C CA  . MET A 1 182 ? -26.473 2.983   -48.842 1.00 19.25 ? 181 MET A CA  1 
ATOM   1353 C C   . MET A 1 182 ? -25.959 4.325   -48.347 1.00 16.85 ? 181 MET A C   1 
ATOM   1354 O O   . MET A 1 182 ? -25.541 4.428   -47.227 1.00 16.04 ? 181 MET A O   1 
ATOM   1355 C CB  . MET A 1 182 ? -25.465 2.285   -49.730 1.00 21.76 ? 181 MET A CB  1 
ATOM   1356 C CG  . MET A 1 182 ? -24.084 2.102   -49.085 1.00 31.07 ? 181 MET A CG  1 
ATOM   1357 S SD  . MET A 1 182 ? -22.952 0.867   -49.884 1.00 32.44 ? 181 MET A SD  1 
ATOM   1358 C CE  . MET A 1 182 ? -24.206 -0.068  -50.838 1.00 31.87 ? 181 MET A CE  1 
ATOM   1359 N N   . TYR A 1 183 ? -25.981 5.335   -49.204 1.00 16.15 ? 182 TYR A N   1 
ATOM   1360 C CA  . TYR A 1 183 ? -25.500 6.654   -48.819 1.00 19.08 ? 182 TYR A CA  1 
ATOM   1361 C C   . TYR A 1 183 ? -26.311 7.210   -47.593 1.00 18.78 ? 182 TYR A C   1 
ATOM   1362 O O   . TYR A 1 183 ? -25.756 7.788   -46.654 1.00 17.14 ? 182 TYR A O   1 
ATOM   1363 C CB  . TYR A 1 183 ? -25.589 7.598   -50.019 1.00 19.90 ? 182 TYR A CB  1 
ATOM   1364 C CG  . TYR A 1 183 ? -24.953 8.952   -49.806 1.00 23.33 ? 182 TYR A CG  1 
ATOM   1365 C CD1 . TYR A 1 183 ? -25.571 9.963   -49.037 1.00 28.75 ? 182 TYR A CD1 1 
ATOM   1366 C CD2 . TYR A 1 183 ? -23.754 9.255   -50.405 1.00 27.75 ? 182 TYR A CD2 1 
ATOM   1367 C CE1 . TYR A 1 183 ? -24.940 11.210  -48.833 1.00 30.46 ? 182 TYR A CE1 1 
ATOM   1368 C CE2 . TYR A 1 183 ? -23.125 10.480  -50.193 1.00 29.83 ? 182 TYR A CE2 1 
ATOM   1369 C CZ  . TYR A 1 183 ? -23.707 11.437  -49.409 1.00 30.10 ? 182 TYR A CZ  1 
ATOM   1370 O OH  . TYR A 1 183 ? -23.036 12.649  -49.317 1.00 38.81 ? 182 TYR A OH  1 
ATOM   1371 N N   . GLU A 1 184 ? -27.626 7.048   -47.647 1.00 18.49 ? 183 GLU A N   1 
ATOM   1372 C CA  . GLU A 1 184 ? -28.492 7.507   -46.576 1.00 20.09 ? 183 GLU A CA  1 
ATOM   1373 C C   . GLU A 1 184 ? -28.216 6.742   -45.264 1.00 17.47 ? 183 GLU A C   1 
ATOM   1374 O O   . GLU A 1 184 ? -28.109 7.337   -44.214 1.00 16.34 ? 183 GLU A O   1 
ATOM   1375 C CB  . GLU A 1 184 ? -29.971 7.403   -46.948 1.00 23.69 ? 183 GLU A CB  1 
ATOM   1376 C CG  . GLU A 1 184 ? -30.844 7.903   -45.790 1.00 29.42 ? 183 GLU A CG  1 
ATOM   1377 C CD  . GLU A 1 184 ? -32.362 7.779   -45.973 1.00 40.40 ? 183 GLU A CD  1 
ATOM   1378 O OE1 . GLU A 1 184 ? -32.849 6.967   -46.811 1.00 45.61 ? 183 GLU A OE1 1 
ATOM   1379 O OE2 . GLU A 1 184 ? -33.069 8.485   -45.212 1.00 48.91 ? 183 GLU A OE2 1 
ATOM   1380 N N   . ILE A 1 185 ? -28.084 5.436   -45.330 1.00 15.73 ? 184 ILE A N   1 
ATOM   1381 C CA  . ILE A 1 185 ? -27.755 4.619   -44.132 1.00 16.89 ? 184 ILE A CA  1 
ATOM   1382 C C   . ILE A 1 185 ? -26.379 4.928   -43.518 1.00 15.84 ? 184 ILE A C   1 
ATOM   1383 O O   . ILE A 1 185 ? -26.247 5.029   -42.295 1.00 14.46 ? 184 ILE A O   1 
ATOM   1384 C CB  . ILE A 1 185 ? -27.865 3.137   -44.450 1.00 18.73 ? 184 ILE A CB  1 
ATOM   1385 C CG1 . ILE A 1 185 ? -29.330 2.785   -44.788 1.00 19.92 ? 184 ILE A CG1 1 
ATOM   1386 C CG2 . ILE A 1 185 ? -27.353 2.325   -43.276 1.00 20.63 ? 184 ILE A CG2 1 
ATOM   1387 C CD1 . ILE A 1 185 ? -29.476 1.425   -45.395 1.00 19.88 ? 184 ILE A CD1 1 
ATOM   1388 N N   . PHE A 1 186 ? -25.394 5.112   -44.389 1.00 14.89 ? 185 PHE A N   1 
ATOM   1389 C CA  . PHE A 1 186 ? -24.069 5.456   -43.964 1.00 15.37 ? 185 PHE A CA  1 
ATOM   1390 C C   . PHE A 1 186 ? -24.075 6.843   -43.331 1.00 14.61 ? 185 PHE A C   1 
ATOM   1391 O O   . PHE A 1 186 ? -23.383 7.037   -42.333 1.00 15.40 ? 185 PHE A O   1 
ATOM   1392 C CB  . PHE A 1 186 ? -23.129 5.483   -45.146 1.00 15.18 ? 185 PHE A CB  1 
ATOM   1393 C CG  . PHE A 1 186 ? -22.660 4.138   -45.621 1.00 15.87 ? 185 PHE A CG  1 
ATOM   1394 C CD1 . PHE A 1 186 ? -23.176 2.968   -45.137 1.00 16.64 ? 185 PHE A CD1 1 
ATOM   1395 C CD2 . PHE A 1 186 ? -21.733 4.080   -46.646 1.00 16.79 ? 185 PHE A CD2 1 
ATOM   1396 C CE1 . PHE A 1 186 ? -22.769 1.753   -45.662 1.00 18.63 ? 185 PHE A CE1 1 
ATOM   1397 C CE2 . PHE A 1 186 ? -21.278 2.879   -47.135 1.00 17.44 ? 185 PHE A CE2 1 
ATOM   1398 C CZ  . PHE A 1 186 ? -21.811 1.709   -46.659 1.00 18.23 ? 185 PHE A CZ  1 
ATOM   1399 N N   . SER A 1 187 ? -24.849 7.781   -43.861 1.00 14.29 ? 186 SER A N   1 
ATOM   1400 C CA  . SER A 1 187 ? -24.932 9.113   -43.202 1.00 14.96 ? 186 SER A CA  1 
ATOM   1401 C C   . SER A 1 187 ? -25.554 9.061   -41.786 1.00 14.38 ? 186 SER A C   1 
ATOM   1402 O O   . SER A 1 187 ? -25.075 9.710   -40.836 1.00 16.03 ? 186 SER A O   1 
ATOM   1403 C CB  . SER A 1 187 ? -25.715 10.097  -44.036 1.00 17.61 ? 186 SER A CB  1 
ATOM   1404 O OG  . SER A 1 187 ? -25.094 10.216  -45.290 1.00 19.70 ? 186 SER A OG  1 
ATOM   1405 N N   . ILE A 1 188 ? -26.631 8.291   -41.635 1.00 15.21 ? 187 ILE A N   1 
ATOM   1406 C CA  . ILE A 1 188 ? -27.219 7.998   -40.319 1.00 15.37 ? 187 ILE A CA  1 
ATOM   1407 C C   . ILE A 1 188 ? -26.215 7.304   -39.383 1.00 16.66 ? 187 ILE A C   1 
ATOM   1408 O O   . ILE A 1 188 ? -26.061 7.705   -38.227 1.00 15.82 ? 187 ILE A O   1 
ATOM   1409 C CB  . ILE A 1 188 ? -28.511 7.195   -40.439 1.00 17.36 ? 187 ILE A CB  1 
ATOM   1410 C CG1 . ILE A 1 188 ? -29.615 8.020   -41.120 1.00 19.27 ? 187 ILE A CG1 1 
ATOM   1411 C CG2 . ILE A 1 188 ? -28.995 6.639   -39.105 1.00 17.99 ? 187 ILE A CG2 1 
ATOM   1412 C CD1 . ILE A 1 188 ? -30.634 7.115   -41.778 1.00 20.92 ? 187 ILE A CD1 1 
ATOM   1413 N N   . ILE A 1 189 ? -25.516 6.270   -39.882 1.00 16.41 ? 188 ILE A N   1 
ATOM   1414 C CA  . ILE A 1 189 ? -24.550 5.510   -39.048 1.00 15.81 ? 188 ILE A CA  1 
ATOM   1415 C C   . ILE A 1 189 ? -23.454 6.466   -38.535 1.00 15.37 ? 188 ILE A C   1 
ATOM   1416 O O   . ILE A 1 189 ? -23.132 6.413   -37.343 1.00 15.18 ? 188 ILE A O   1 
ATOM   1417 C CB  . ILE A 1 189 ? -23.983 4.301   -39.784 1.00 15.56 ? 188 ILE A CB  1 
ATOM   1418 C CG1 . ILE A 1 189 ? -25.033 3.226   -39.895 1.00 15.94 ? 188 ILE A CG1 1 
ATOM   1419 C CG2 . ILE A 1 189 ? -22.685 3.802   -39.142 1.00 16.50 ? 188 ILE A CG2 1 
ATOM   1420 C CD1 . ILE A 1 189 ? -24.703 2.115   -40.872 1.00 16.56 ? 188 ILE A CD1 1 
ATOM   1421 N N   . ARG A 1 190 ? -22.950 7.331   -39.414 1.00 14.84 ? 189 ARG A N   1 
ATOM   1422 C CA  . ARG A 1 190 ? -22.002 8.352   -39.049 1.00 16.50 ? 189 ARG A CA  1 
ATOM   1423 C C   . ARG A 1 190 ? -22.475 9.313   -37.931 1.00 17.29 ? 189 ARG A C   1 
ATOM   1424 O O   . ARG A 1 190 ? -21.745 9.541   -36.952 1.00 17.49 ? 189 ARG A O   1 
ATOM   1425 C CB  . ARG A 1 190 ? -21.640 9.187   -40.272 1.00 17.86 ? 189 ARG A CB  1 
ATOM   1426 C CG  . ARG A 1 190 ? -20.667 10.329  -39.983 1.00 19.46 ? 189 ARG A CG  1 
ATOM   1427 C CD  . ARG A 1 190 ? -20.712 11.438  -41.064 1.00 22.32 ? 189 ARG A CD  1 
ATOM   1428 N NE  . ARG A 1 190 ? -21.974 12.195  -41.011 1.00 22.02 ? 189 ARG A NE  1 
ATOM   1429 C CZ  . ARG A 1 190 ? -22.824 12.396  -42.018 1.00 22.82 ? 189 ARG A CZ  1 
ATOM   1430 N NH1 . ARG A 1 190 ? -22.574 12.030  -43.266 1.00 21.53 ? 189 ARG A NH1 1 
ATOM   1431 N NH2 . ARG A 1 190 ? -23.939 13.066  -41.768 1.00 22.83 ? 189 ARG A NH2 1 
ATOM   1432 N N   . ASP A 1 191 ? -23.659 9.900   -38.131 1.00 17.30 ? 190 ASP A N   1 
ATOM   1433 C CA  . ASP A 1 191 ? -24.286 10.692  -37.071 1.00 17.70 ? 190 ASP A CA  1 
ATOM   1434 C C   . ASP A 1 191 ? -24.477 9.981   -35.745 1.00 17.08 ? 190 ASP A C   1 
ATOM   1435 O O   . ASP A 1 191 ? -24.417 10.620  -34.712 1.00 19.80 ? 190 ASP A O   1 
ATOM   1436 C CB  . ASP A 1 191 ? -25.621 11.180  -37.531 1.00 20.37 ? 190 ASP A CB  1 
ATOM   1437 C CG  . ASP A 1 191 ? -25.521 12.234  -38.608 1.00 24.70 ? 190 ASP A CG  1 
ATOM   1438 O OD1 . ASP A 1 191 ? -24.440 12.830  -38.855 1.00 25.97 ? 190 ASP A OD1 1 
ATOM   1439 O OD2 . ASP A 1 191 ? -26.545 12.438  -39.270 1.00 29.09 ? 190 ASP A OD2 1 
ATOM   1440 N N   . LEU A 1 192 ? -24.711 8.666   -35.750 1.00 15.96 ? 191 LEU A N   1 
ATOM   1441 C CA  . LEU A 1 192 ? -24.868 7.915   -34.533 1.00 16.30 ? 191 LEU A CA  1 
ATOM   1442 C C   . LEU A 1 192 ? -23.551 7.456   -33.866 1.00 15.45 ? 191 LEU A C   1 
ATOM   1443 O O   . LEU A 1 192 ? -23.606 6.844   -32.768 1.00 16.67 ? 191 LEU A O   1 
ATOM   1444 C CB  . LEU A 1 192 ? -25.768 6.690   -34.743 1.00 16.51 ? 191 LEU A CB  1 
ATOM   1445 C CG  . LEU A 1 192 ? -27.264 6.979   -35.035 1.00 18.69 ? 191 LEU A CG  1 
ATOM   1446 C CD1 . LEU A 1 192 ? -28.007 5.698   -35.371 1.00 19.25 ? 191 LEU A CD1 1 
ATOM   1447 C CD2 . LEU A 1 192 ? -27.933 7.727   -33.874 1.00 20.41 ? 191 LEU A CD2 1 
ATOM   1448 N N   . GLY A 1 193 ? -22.409 7.630   -34.559 1.00 14.51 ? 192 GLY A N   1 
ATOM   1449 C CA  . GLY A 1 193 ? -21.122 7.189   -34.038 1.00 15.56 ? 192 GLY A CA  1 
ATOM   1450 C C   . GLY A 1 193 ? -20.938 5.709   -34.146 1.00 15.75 ? 192 GLY A C   1 
ATOM   1451 O O   . GLY A 1 193 ? -20.288 5.084   -33.310 1.00 16.15 ? 192 GLY A O   1 
ATOM   1452 N N   . ALA A 1 194 ? -21.523 5.106   -35.183 1.00 15.01 ? 193 ALA A N   1 
ATOM   1453 C CA  . ALA A 1 194 ? -21.504 3.686   -35.291 1.00 14.22 ? 193 ALA A CA  1 
ATOM   1454 C C   . ALA A 1 194 ? -20.632 3.326   -36.516 1.00 14.90 ? 193 ALA A C   1 
ATOM   1455 O O   . ALA A 1 194 ? -20.219 4.203   -37.275 1.00 15.19 ? 193 ALA A O   1 
ATOM   1456 C CB  . ALA A 1 194 ? -22.917 3.171   -35.416 1.00 14.40 ? 193 ALA A CB  1 
ATOM   1457 N N   A LEU A 1 195 ? -20.332 2.054   -36.661 0.50 14.56 ? 194 LEU A N   1 
ATOM   1458 N N   B LEU A 1 195 ? -20.344 2.048   -36.657 0.50 15.26 ? 194 LEU A N   1 
ATOM   1459 C CA  A LEU A 1 195 ? -19.509 1.550   -37.742 0.50 14.70 ? 194 LEU A CA  1 
ATOM   1460 C CA  B LEU A 1 195 ? -19.534 1.511   -37.736 0.50 15.73 ? 194 LEU A CA  1 
ATOM   1461 C C   A LEU A 1 195 ? -20.411 0.937   -38.779 0.50 14.70 ? 194 LEU A C   1 
ATOM   1462 C C   B LEU A 1 195 ? -20.426 0.922   -38.787 0.50 15.39 ? 194 LEU A C   1 
ATOM   1463 O O   A LEU A 1 195 ? -21.310 0.153   -38.435 0.50 15.95 ? 194 LEU A O   1 
ATOM   1464 O O   B LEU A 1 195 ? -21.321 0.123   -38.465 0.50 16.86 ? 194 LEU A O   1 
ATOM   1465 C CB  A LEU A 1 195 ? -18.565 0.475   -37.195 0.50 15.63 ? 194 LEU A CB  1 
ATOM   1466 C CB  B LEU A 1 195 ? -18.640 0.395   -37.186 0.50 17.35 ? 194 LEU A CB  1 
ATOM   1467 C CG  A LEU A 1 195 ? -17.391 0.075   -38.068 0.50 16.35 ? 194 LEU A CG  1 
ATOM   1468 C CG  B LEU A 1 195 ? -17.492 0.967   -36.363 0.50 18.37 ? 194 LEU A CG  1 
ATOM   1469 C CD1 A LEU A 1 195 ? -16.541 1.273   -38.475 0.50 16.57 ? 194 LEU A CD1 1 
ATOM   1470 C CD1 B LEU A 1 195 ? -17.373 0.371   -34.976 0.50 20.22 ? 194 LEU A CD1 1 
ATOM   1471 C CD2 A LEU A 1 195 ? -16.570 -0.973  -37.352 0.50 16.50 ? 194 LEU A CD2 1 
ATOM   1472 C CD2 B LEU A 1 195 ? -16.228 0.823   -37.187 0.50 19.26 ? 194 LEU A CD2 1 
ATOM   1473 N N   . ALA A 1 196 ? -20.200 1.301   -40.033 1.00 15.04 ? 195 ALA A N   1 
ATOM   1474 C CA  . ALA A 1 196 ? -20.954 0.687   -41.203 1.00 15.77 ? 195 ALA A CA  1 
ATOM   1475 C C   . ALA A 1 196 ? -20.190 -0.525  -41.702 1.00 15.66 ? 195 ALA A C   1 
ATOM   1476 O O   . ALA A 1 196 ? -19.099 -0.374  -42.295 1.00 16.39 ? 195 ALA A O   1 
ATOM   1477 C CB  . ALA A 1 196 ? -21.063 1.691   -42.352 1.00 16.53 ? 195 ALA A CB  1 
ATOM   1478 N N   . GLN A 1 197 ? -20.738 -1.693  -41.505 1.00 13.45 ? 196 GLN A N   1 
ATOM   1479 C CA  . GLN A 1 197 ? -20.202 -2.884  -42.140 1.00 14.59 ? 196 GLN A CA  1 
ATOM   1480 C C   . GLN A 1 197 ? -20.890 -3.140  -43.440 1.00 13.01 ? 196 GLN A C   1 
ATOM   1481 O O   . GLN A 1 197 ? -22.052 -2.785  -43.595 1.00 13.71 ? 196 GLN A O   1 
ATOM   1482 C CB  . GLN A 1 197 ? -20.385 -4.096  -41.252 1.00 14.68 ? 196 GLN A CB  1 
ATOM   1483 C CG  . GLN A 1 197 ? -19.867 -3.900  -39.852 1.00 15.57 ? 196 GLN A CG  1 
ATOM   1484 C CD  . GLN A 1 197 ? -20.061 -5.191  -39.092 1.00 20.06 ? 196 GLN A CD  1 
ATOM   1485 O OE1 . GLN A 1 197 ? -21.215 -5.646  -38.887 1.00 20.98 ? 196 GLN A OE1 1 
ATOM   1486 N NE2 . GLN A 1 197 ? -18.960 -5.876  -38.803 1.00 21.41 ? 196 GLN A NE2 1 
ATOM   1487 N N   . VAL A 1 198 ? -20.199 -3.799  -44.337 1.00 13.82 ? 197 VAL A N   1 
ATOM   1488 C CA  . VAL A 1 198 ? -20.787 -4.248  -45.603 1.00 16.21 ? 197 VAL A CA  1 
ATOM   1489 C C   . VAL A 1 198 ? -20.489 -5.679  -45.894 1.00 15.90 ? 197 VAL A C   1 
ATOM   1490 O O   . VAL A 1 198 ? -19.412 -6.159  -45.568 1.00 15.56 ? 197 VAL A O   1 
ATOM   1491 C CB  . VAL A 1 198 ? -20.314 -3.467  -46.856 1.00 17.46 ? 197 VAL A CB  1 
ATOM   1492 C CG1 . VAL A 1 198 ? -20.917 -2.106  -46.878 1.00 20.09 ? 197 VAL A CG1 1 
ATOM   1493 C CG2 . VAL A 1 198 ? -18.795 -3.413  -46.952 1.00 18.53 ? 197 VAL A CG2 1 
ATOM   1494 N N   . HIS A 1 199 ? -21.492 -6.331  -46.501 1.00 16.66 ? 198 HIS A N   1 
ATOM   1495 C CA  . HIS A 1 199 ? -21.301 -7.564  -47.275 1.00 19.48 ? 198 HIS A CA  1 
ATOM   1496 C C   . HIS A 1 199 ? -21.197 -7.097  -48.723 1.00 20.23 ? 198 HIS A C   1 
ATOM   1497 O O   . HIS A 1 199 ? -22.220 -6.803  -49.377 1.00 19.73 ? 198 HIS A O   1 
ATOM   1498 C CB  . HIS A 1 199 ? -22.450 -8.594  -47.148 1.00 21.76 ? 198 HIS A CB  1 
ATOM   1499 C CG  . HIS A 1 199 ? -22.261 -9.783  -48.030 1.00 22.63 ? 198 HIS A CG  1 
ATOM   1500 N ND1 . HIS A 1 199 ? -22.154 -11.052 -47.537 1.00 24.89 ? 198 HIS A ND1 1 
ATOM   1501 C CD2 . HIS A 1 199 ? -22.112 -9.898  -49.379 1.00 25.98 ? 198 HIS A CD2 1 
ATOM   1502 C CE1 . HIS A 1 199 ? -22.004 -11.913 -48.527 1.00 23.73 ? 198 HIS A CE1 1 
ATOM   1503 N NE2 . HIS A 1 199 ? -21.915 -11.230 -49.651 1.00 25.36 ? 198 HIS A NE2 1 
ATOM   1504 N N   . ALA A 1 200 ? -19.972 -7.104  -49.225 1.00 19.92 ? 199 ALA A N   1 
ATOM   1505 C CA  . ALA A 1 200 ? -19.593 -6.438  -50.478 1.00 22.19 ? 199 ALA A CA  1 
ATOM   1506 C C   . ALA A 1 200 ? -19.482 -7.416  -51.662 1.00 21.13 ? 199 ALA A C   1 
ATOM   1507 O O   . ALA A 1 200 ? -18.422 -7.938  -52.005 1.00 21.61 ? 199 ALA A O   1 
ATOM   1508 C CB  . ALA A 1 200 ? -18.315 -5.681  -50.271 1.00 23.09 ? 199 ALA A CB  1 
ATOM   1509 N N   . GLU A 1 201 ? -20.619 -7.644  -52.282 1.00 21.39 ? 200 GLU A N   1 
ATOM   1510 C CA  . GLU A 1 201 ? -20.659 -8.310  -53.569 1.00 21.27 ? 200 GLU A CA  1 
ATOM   1511 C C   . GLU A 1 201 ? -21.762 -7.659  -54.367 1.00 19.85 ? 200 GLU A C   1 
ATOM   1512 O O   . GLU A 1 201 ? -22.787 -7.282  -53.839 1.00 20.11 ? 200 GLU A O   1 
ATOM   1513 C CB  . GLU A 1 201 ? -20.925 -9.809  -53.452 1.00 23.52 ? 200 GLU A CB  1 
ATOM   1514 C CG  . GLU A 1 201 ? -19.769 -10.653 -52.948 1.00 24.14 ? 200 GLU A CG  1 
ATOM   1515 C CD  . GLU A 1 201 ? -20.152 -12.110 -52.896 1.00 28.12 ? 200 GLU A CD  1 
ATOM   1516 O OE1 . GLU A 1 201 ? -21.154 -12.410 -52.134 1.00 28.41 ? 200 GLU A OE1 1 
ATOM   1517 O OE2 . GLU A 1 201 ? -19.494 -12.971 -53.614 1.00 27.88 ? 200 GLU A OE2 1 
ATOM   1518 N N   . ASN A 1 202 ? -21.535 -7.536  -55.670 1.00 18.51 ? 201 ASN A N   1 
ATOM   1519 C CA  . ASN A 1 202 ? -22.574 -7.015  -56.588 1.00 19.83 ? 201 ASN A CA  1 
ATOM   1520 C C   . ASN A 1 202 ? -23.645 -8.056  -56.859 1.00 18.23 ? 201 ASN A C   1 
ATOM   1521 O O   . ASN A 1 202 ? -23.428 -8.970  -57.694 1.00 18.30 ? 201 ASN A O   1 
ATOM   1522 C CB  . ASN A 1 202 ? -21.917 -6.628  -57.928 1.00 20.82 ? 201 ASN A CB  1 
ATOM   1523 C CG  . ASN A 1 202 ? -22.872 -5.851  -58.810 1.00 25.10 ? 201 ASN A CG  1 
ATOM   1524 O OD1 . ASN A 1 202 ? -23.991 -6.299  -59.120 1.00 22.77 ? 201 ASN A OD1 1 
ATOM   1525 N ND2 . ASN A 1 202 ? -22.444 -4.612  -59.184 1.00 24.42 ? 201 ASN A ND2 1 
ATOM   1526 N N   . GLY A 1 203 ? -24.756 -7.955  -56.172 1.00 17.63 ? 202 GLY A N   1 
ATOM   1527 C CA  . GLY A 1 203 ? -25.826 -8.914  -56.248 1.00 19.37 ? 202 GLY A CA  1 
ATOM   1528 C C   . GLY A 1 203 ? -26.497 -9.076  -57.607 1.00 20.53 ? 202 GLY A C   1 
ATOM   1529 O O   . GLY A 1 203 ? -26.892 -10.179 -57.983 1.00 20.64 ? 202 GLY A O   1 
ATOM   1530 N N   . ASP A 1 204 ? -26.593 -7.976  -58.337 1.00 20.73 ? 203 ASP A N   1 
ATOM   1531 C CA  . ASP A 1 204 ? -27.192 -7.989  -59.671 1.00 23.84 ? 203 ASP A CA  1 
ATOM   1532 C C   . ASP A 1 204 ? -26.346 -8.814  -60.606 1.00 21.75 ? 203 ASP A C   1 
ATOM   1533 O O   . ASP A 1 204 ? -26.911 -9.603  -61.391 1.00 21.06 ? 203 ASP A O   1 
ATOM   1534 C CB  . ASP A 1 204 ? -27.322 -6.577  -60.244 1.00 26.88 ? 203 ASP A CB  1 
ATOM   1535 C CG  . ASP A 1 204 ? -28.483 -5.791  -59.623 1.00 33.44 ? 203 ASP A CG  1 
ATOM   1536 O OD1 . ASP A 1 204 ? -29.138 -6.316  -58.720 1.00 34.70 ? 203 ASP A OD1 1 
ATOM   1537 O OD2 . ASP A 1 204 ? -28.764 -4.668  -60.091 1.00 44.98 ? 203 ASP A OD2 1 
ATOM   1538 N N   . ILE A 1 205 ? -25.028 -8.688  -60.501 1.00 20.41 ? 204 ILE A N   1 
ATOM   1539 C CA  . ILE A 1 205 ? -24.133 -9.473  -61.366 1.00 20.48 ? 204 ILE A CA  1 
ATOM   1540 C C   . ILE A 1 205 ? -24.113 -10.914 -60.982 1.00 20.08 ? 204 ILE A C   1 
ATOM   1541 O O   . ILE A 1 205 ? -24.203 -11.800 -61.878 1.00 21.73 ? 204 ILE A O   1 
ATOM   1542 C CB  . ILE A 1 205 ? -22.705 -8.966  -61.444 1.00 23.36 ? 204 ILE A CB  1 
ATOM   1543 C CG1 . ILE A 1 205 ? -22.666 -7.562  -61.975 1.00 26.56 ? 204 ILE A CG1 1 
ATOM   1544 C CG2 . ILE A 1 205 ? -21.874 -9.832  -62.388 1.00 24.41 ? 204 ILE A CG2 1 
ATOM   1545 C CD1 . ILE A 1 205 ? -21.281 -6.927  -61.838 1.00 31.26 ? 204 ILE A CD1 1 
ATOM   1546 N N   . VAL A 1 206 ? -24.040 -11.199 -59.678 1.00 17.90 ? 205 VAL A N   1 
ATOM   1547 C CA  . VAL A 1 206 ? -24.150 -12.559 -59.194 1.00 18.42 ? 205 VAL A CA  1 
ATOM   1548 C C   . VAL A 1 206 ? -25.426 -13.259 -59.734 1.00 19.82 ? 205 VAL A C   1 
ATOM   1549 O O   . VAL A 1 206 ? -25.387 -14.415 -60.164 1.00 19.47 ? 205 VAL A O   1 
ATOM   1550 C CB  . VAL A 1 206 ? -24.136 -12.614 -57.632 1.00 19.30 ? 205 VAL A CB  1 
ATOM   1551 C CG1 . VAL A 1 206 ? -24.307 -14.038 -57.095 1.00 20.69 ? 205 VAL A CG1 1 
ATOM   1552 C CG2 . VAL A 1 206 ? -22.793 -12.140 -57.096 1.00 19.74 ? 205 VAL A CG2 1 
ATOM   1553 N N   . GLU A 1 207 ? -26.541 -12.586 -59.638 1.00 19.92 ? 206 GLU A N   1 
ATOM   1554 C CA  . GLU A 1 207 ? -27.805 -13.146 -60.086 1.00 23.56 ? 206 GLU A CA  1 
ATOM   1555 C C   . GLU A 1 207 ? -27.747 -13.488 -61.580 1.00 25.02 ? 206 GLU A C   1 
ATOM   1556 O O   . GLU A 1 207 ? -28.228 -14.543 -61.983 1.00 22.99 ? 206 GLU A O   1 
ATOM   1557 C CB  . GLU A 1 207 ? -28.885 -12.121 -59.874 1.00 27.51 ? 206 GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 207 ? -30.238 -12.458 -60.420 1.00 38.26 ? 206 GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 207 ? -31.078 -13.115 -59.370 1.00 46.97 ? 206 GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 207 ? -31.853 -12.371 -58.736 1.00 61.70 ? 206 GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 207 ? -30.910 -14.343 -59.145 1.00 52.26 ? 206 GLU A OE2 1 
ATOM   1562 N N   . GLU A 1 208 ? -27.174 -12.606 -62.402 1.00 23.85 ? 207 GLU A N   1 
ATOM   1563 C CA  . GLU A 1 208 ? -27.037 -12.879 -63.840 1.00 25.96 ? 207 GLU A CA  1 
ATOM   1564 C C   . GLU A 1 208 ? -26.140 -14.041 -64.144 1.00 25.95 ? 207 GLU A C   1 
ATOM   1565 O O   . GLU A 1 208 ? -26.473 -14.869 -64.995 1.00 26.79 ? 207 GLU A O   1 
ATOM   1566 C CB  . GLU A 1 208 ? -26.505 -11.667 -64.630 1.00 25.37 ? 207 GLU A CB  1 
ATOM   1567 C CG  . GLU A 1 208 ? -27.469 -10.499 -64.651 1.00 27.84 ? 207 GLU A CG  1 
ATOM   1568 C CD  . GLU A 1 208 ? -28.861 -10.879 -65.187 1.00 29.20 ? 207 GLU A CD  1 
ATOM   1569 O OE1 . GLU A 1 208 ? -28.981 -11.685 -66.169 1.00 28.41 ? 207 GLU A OE1 1 
ATOM   1570 O OE2 . GLU A 1 208 ? -29.829 -10.380 -64.607 1.00 31.37 ? 207 GLU A OE2 1 
ATOM   1571 N N   . GLU A 1 209 ? -25.007 -14.142 -63.471 1.00 23.31 ? 208 GLU A N   1 
ATOM   1572 C CA  . GLU A 1 209 ? -24.133 -15.327 -63.657 1.00 24.71 ? 208 GLU A CA  1 
ATOM   1573 C C   . GLU A 1 209 ? -24.779 -16.614 -63.184 1.00 25.51 ? 208 GLU A C   1 
ATOM   1574 O O   . GLU A 1 209 ? -24.618 -17.647 -63.823 1.00 26.91 ? 208 GLU A O   1 
ATOM   1575 C CB  . GLU A 1 209 ? -22.798 -15.175 -62.939 1.00 25.67 ? 208 GLU A CB  1 
ATOM   1576 C CG  . GLU A 1 209 ? -21.931 -14.021 -63.382 1.00 31.36 ? 208 GLU A CG  1 
ATOM   1577 C CD  . GLU A 1 209 ? -21.569 -14.065 -64.883 1.00 36.06 ? 208 GLU A CD  1 
ATOM   1578 O OE1 . GLU A 1 209 ? -21.523 -15.160 -65.465 1.00 39.86 ? 208 GLU A OE1 1 
ATOM   1579 O OE2 . GLU A 1 209 ? -21.335 -12.996 -65.457 1.00 41.19 ? 208 GLU A OE2 1 
ATOM   1580 N N   . GLN A 1 210 ? -25.481 -16.577 -62.065 1.00 25.34 ? 209 GLN A N   1 
ATOM   1581 C CA  . GLN A 1 210 ? -26.093 -17.796 -61.529 1.00 26.72 ? 209 GLN A CA  1 
ATOM   1582 C C   . GLN A 1 210 ? -27.062 -18.340 -62.581 1.00 27.34 ? 209 GLN A C   1 
ATOM   1583 O O   . GLN A 1 210 ? -27.007 -19.502 -62.891 1.00 23.00 ? 209 GLN A O   1 
ATOM   1584 C CB  . GLN A 1 210 ? -26.866 -17.563 -60.216 1.00 30.12 ? 209 GLN A CB  1 
ATOM   1585 C CG  . GLN A 1 210 ? -25.935 -17.424 -58.998 1.00 36.50 ? 209 GLN A CG  1 
ATOM   1586 C CD  . GLN A 1 210 ? -26.645 -17.519 -57.646 1.00 41.80 ? 209 GLN A CD  1 
ATOM   1587 O OE1 . GLN A 1 210 ? -26.018 -17.840 -56.628 1.00 48.57 ? 209 GLN A OE1 1 
ATOM   1588 N NE2 . GLN A 1 210 ? -27.926 -17.216 -57.626 1.00 39.18 ? 209 GLN A NE2 1 
ATOM   1589 N N   . LYS A 1 211 ? -27.903 -17.466 -63.133 1.00 25.17 ? 210 LYS A N   1 
ATOM   1590 C CA  . LYS A 1 211 ? -28.834 -17.871 -64.212 1.00 29.07 ? 210 LYS A CA  1 
ATOM   1591 C C   . LYS A 1 211 ? -28.162 -18.508 -65.418 1.00 29.79 ? 210 LYS A C   1 
ATOM   1592 O O   . LYS A 1 211 ? -28.601 -19.576 -65.837 1.00 31.61 ? 210 LYS A O   1 
ATOM   1593 C CB  . LYS A 1 211 ? -29.716 -16.716 -64.627 1.00 33.63 ? 210 LYS A CB  1 
ATOM   1594 C CG  . LYS A 1 211 ? -30.774 -16.459 -63.557 1.00 39.82 ? 210 LYS A CG  1 
ATOM   1595 C CD  . LYS A 1 211 ? -31.847 -15.471 -64.006 1.00 45.88 ? 210 LYS A CD  1 
ATOM   1596 C CE  . LYS A 1 211 ? -31.277 -14.107 -64.337 1.00 47.53 ? 210 LYS A CE  1 
ATOM   1597 N NZ  . LYS A 1 211 ? -32.201 -13.080 -63.800 1.00 53.72 ? 210 LYS A NZ  1 
ATOM   1598 N N   . ARG A 1 212 ? -27.120 -17.867 -65.961 1.00 29.82 ? 211 ARG A N   1 
ATOM   1599 C CA  . ARG A 1 212 ? -26.384 -18.382 -67.104 1.00 28.06 ? 211 ARG A CA  1 
ATOM   1600 C C   . ARG A 1 212 ? -25.825 -19.744 -66.770 1.00 30.20 ? 211 ARG A C   1 
ATOM   1601 O O   . ARG A 1 212 ? -25.914 -20.682 -67.568 1.00 28.06 ? 211 ARG A O   1 
ATOM   1602 C CB  . ARG A 1 212 ? -25.259 -17.439 -67.531 1.00 30.15 ? 211 ARG A CB  1 
ATOM   1603 C CG  . ARG A 1 212 ? -25.734 -16.163 -68.235 1.00 34.88 ? 211 ARG A CG  1 
ATOM   1604 C CD  . ARG A 1 212 ? -24.580 -15.220 -68.663 1.00 37.02 ? 211 ARG A CD  1 
ATOM   1605 N N   . LEU A 1 213 ? -25.255 -19.892 -65.571 1.00 27.40 ? 212 LEU A N   1 
ATOM   1606 C CA  . LEU A 1 213 ? -24.619 -21.138 -65.211 1.00 26.24 ? 212 LEU A CA  1 
ATOM   1607 C C   . LEU A 1 213 ? -25.623 -22.257 -65.076 1.00 26.58 ? 212 LEU A C   1 
ATOM   1608 O O   . LEU A 1 213 ? -25.353 -23.376 -65.582 1.00 25.41 ? 212 LEU A O   1 
ATOM   1609 C CB  . LEU A 1 213 ? -23.786 -21.046 -63.905 1.00 25.96 ? 212 LEU A CB  1 
ATOM   1610 C CG  . LEU A 1 213 ? -22.444 -20.316 -64.146 1.00 28.14 ? 212 LEU A CG  1 
ATOM   1611 C CD1 . LEU A 1 213 ? -21.985 -19.772 -62.811 1.00 29.51 ? 212 LEU A CD1 1 
ATOM   1612 C CD2 . LEU A 1 213 ? -21.324 -21.146 -64.770 1.00 27.58 ? 212 LEU A CD2 1 
ATOM   1613 N N   . LEU A 1 214 ? -26.756 -21.973 -64.430 1.00 28.45 ? 213 LEU A N   1 
ATOM   1614 C CA  . LEU A 1 214 ? -27.810 -22.997 -64.262 1.00 31.31 ? 213 LEU A CA  1 
ATOM   1615 C C   . LEU A 1 214 ? -28.344 -23.370 -65.674 1.00 38.44 ? 213 LEU A C   1 
ATOM   1616 O O   . LEU A 1 214 ? -28.395 -24.534 -66.014 1.00 37.24 ? 213 LEU A O   1 
ATOM   1617 C CB  . LEU A 1 214 ? -28.935 -22.556 -63.299 1.00 29.36 ? 213 LEU A CB  1 
ATOM   1618 C CG  . LEU A 1 214 ? -28.509 -22.407 -61.832 1.00 29.56 ? 213 LEU A CG  1 
ATOM   1619 C CD1 . LEU A 1 214 ? -29.550 -21.706 -60.993 1.00 28.55 ? 213 LEU A CD1 1 
ATOM   1620 C CD2 . LEU A 1 214 ? -28.154 -23.747 -61.215 1.00 29.19 ? 213 LEU A CD2 1 
ATOM   1621 N N   . GLU A 1 215 ? -28.614 -22.366 -66.515 1.00 39.41 ? 214 GLU A N   1 
ATOM   1622 C CA  . GLU A 1 215 ? -28.977 -22.569 -67.903 1.00 39.45 ? 214 GLU A CA  1 
ATOM   1623 C C   . GLU A 1 215 ? -28.054 -23.573 -68.602 1.00 35.72 ? 214 GLU A C   1 
ATOM   1624 O O   . GLU A 1 215 ? -28.573 -24.391 -69.335 1.00 38.79 ? 214 GLU A O   1 
ATOM   1625 C CB  . GLU A 1 215 ? -29.087 -21.224 -68.660 1.00 42.78 ? 214 GLU A CB  1 
ATOM   1626 C CG  . GLU A 1 215 ? -29.283 -21.303 -70.168 1.00 50.61 ? 214 GLU A CG  1 
ATOM   1627 C CD  . GLU A 1 215 ? -29.269 -19.930 -70.853 1.00 55.42 ? 214 GLU A CD  1 
ATOM   1628 O OE1 . GLU A 1 215 ? -28.344 -19.128 -70.618 1.00 56.55 ? 214 GLU A OE1 1 
ATOM   1629 O OE2 . GLU A 1 215 ? -30.184 -19.656 -71.653 1.00 65.09 ? 214 GLU A OE2 1 
ATOM   1630 N N   . LEU A 1 216 ? -26.745 -23.558 -68.379 1.00 34.98 ? 215 LEU A N   1 
ATOM   1631 C CA  . LEU A 1 216 ? -25.843 -24.547 -69.019 1.00 37.47 ? 215 LEU A CA  1 
ATOM   1632 C C   . LEU A 1 216 ? -25.644 -25.862 -68.223 1.00 37.48 ? 215 LEU A C   1 
ATOM   1633 O O   . LEU A 1 216 ? -24.717 -26.644 -68.516 1.00 35.11 ? 215 LEU A O   1 
ATOM   1634 C CB  . LEU A 1 216 ? -24.490 -23.919 -69.339 1.00 40.60 ? 215 LEU A CB  1 
ATOM   1635 C CG  . LEU A 1 216 ? -24.519 -22.614 -70.145 1.00 44.55 ? 215 LEU A CG  1 
ATOM   1636 C CD1 . LEU A 1 216 ? -23.114 -22.064 -70.359 1.00 45.84 ? 215 LEU A CD1 1 
ATOM   1637 C CD2 . LEU A 1 216 ? -25.204 -22.824 -71.483 1.00 44.16 ? 215 LEU A CD2 1 
ATOM   1638 N N   . GLY A 1 217 ? -26.510 -26.097 -67.227 1.00 35.30 ? 216 GLY A N   1 
ATOM   1639 C CA  . GLY A 1 217 ? -26.433 -27.258 -66.370 1.00 33.32 ? 216 GLY A CA  1 
ATOM   1640 C C   . GLY A 1 217 ? -25.212 -27.379 -65.481 1.00 34.11 ? 216 GLY A C   1 
ATOM   1641 O O   . GLY A 1 217 ? -24.749 -28.497 -65.229 1.00 31.05 ? 216 GLY A O   1 
ATOM   1642 N N   . ILE A 1 218 ? -24.638 -26.264 -65.035 1.00 30.52 ? 217 ILE A N   1 
ATOM   1643 C CA  . ILE A 1 218 ? -23.494 -26.340 -64.136 1.00 30.08 ? 217 ILE A CA  1 
ATOM   1644 C C   . ILE A 1 218 ? -24.169 -26.149 -62.806 1.00 31.68 ? 217 ILE A C   1 
ATOM   1645 O O   . ILE A 1 218 ? -24.381 -24.982 -62.371 1.00 31.01 ? 217 ILE A O   1 
ATOM   1646 C CB  . ILE A 1 218 ? -22.412 -25.302 -64.473 1.00 31.64 ? 217 ILE A CB  1 
ATOM   1647 C CG1 . ILE A 1 218 ? -21.827 -25.624 -65.865 1.00 34.52 ? 217 ILE A CG1 1 
ATOM   1648 C CG2 . ILE A 1 218 ? -21.249 -25.328 -63.489 1.00 29.61 ? 217 ILE A CG2 1 
ATOM   1649 C CD1 . ILE A 1 218 ? -20.844 -24.566 -66.337 1.00 38.11 ? 217 ILE A CD1 1 
ATOM   1650 N N   . THR A 1 219 ? -24.658 -27.270 -62.240 1.00 25.46 ? 218 THR A N   1 
ATOM   1651 C CA  . THR A 1 219 ? -25.503 -27.211 -61.042 1.00 25.77 ? 218 THR A CA  1 
ATOM   1652 C C   . THR A 1 219 ? -24.772 -27.555 -59.736 1.00 24.42 ? 218 THR A C   1 
ATOM   1653 O O   . THR A 1 219 ? -25.325 -27.370 -58.646 1.00 24.64 ? 218 THR A O   1 
ATOM   1654 C CB  . THR A 1 219 ? -26.646 -28.216 -61.148 1.00 26.35 ? 218 THR A CB  1 
ATOM   1655 O OG1 . THR A 1 219 ? -26.079 -29.559 -61.229 1.00 26.97 ? 218 THR A OG1 1 
ATOM   1656 C CG2 . THR A 1 219 ? -27.509 -27.885 -62.360 1.00 29.68 ? 218 THR A CG2 1 
ATOM   1657 N N   . GLY A 1 220 ? -23.552 -28.071 -59.858 1.00 23.96 ? 219 GLY A N   1 
ATOM   1658 C CA  . GLY A 1 220 ? -22.712 -28.424 -58.708 1.00 26.58 ? 219 GLY A CA  1 
ATOM   1659 C C   . GLY A 1 220 ? -22.145 -27.226 -57.970 1.00 23.02 ? 219 GLY A C   1 
ATOM   1660 O O   . GLY A 1 220 ? -22.324 -26.120 -58.381 1.00 21.66 ? 219 GLY A O   1 
ATOM   1661 N N   . PRO A 1 221 ? -21.401 -27.474 -56.881 1.00 25.42 ? 220 PRO A N   1 
ATOM   1662 C CA  . PRO A 1 221 ? -20.858 -26.343 -56.119 1.00 23.89 ? 220 PRO A CA  1 
ATOM   1663 C C   . PRO A 1 221 ? -19.892 -25.446 -56.847 1.00 23.51 ? 220 PRO A C   1 
ATOM   1664 O O   . PRO A 1 221 ? -19.766 -24.282 -56.447 1.00 22.59 ? 220 PRO A O   1 
ATOM   1665 C CB  . PRO A 1 221 ? -20.200 -27.019 -54.898 1.00 22.04 ? 220 PRO A CB  1 
ATOM   1666 C CG  . PRO A 1 221 ? -21.049 -28.242 -54.732 1.00 23.72 ? 220 PRO A CG  1 
ATOM   1667 C CD  . PRO A 1 221 ? -21.268 -28.721 -56.124 1.00 23.17 ? 220 PRO A CD  1 
ATOM   1668 N N   . GLU A 1 222 ? -19.263 -25.920 -57.921 1.00 21.44 ? 221 GLU A N   1 
ATOM   1669 C CA  . GLU A 1 222 ? -18.399 -25.062 -58.701 1.00 22.89 ? 221 GLU A CA  1 
ATOM   1670 C C   . GLU A 1 222 ? -19.174 -23.950 -59.378 1.00 23.51 ? 221 GLU A C   1 
ATOM   1671 O O   . GLU A 1 222 ? -18.629 -22.850 -59.601 1.00 23.97 ? 221 GLU A O   1 
ATOM   1672 C CB  . GLU A 1 222 ? -17.527 -25.879 -59.669 1.00 27.96 ? 221 GLU A CB  1 
ATOM   1673 C CG  . GLU A 1 222 ? -18.226 -26.464 -60.896 1.00 29.40 ? 221 GLU A CG  1 
ATOM   1674 C CD  . GLU A 1 222 ? -19.040 -27.731 -60.628 1.00 32.58 ? 221 GLU A CD  1 
ATOM   1675 O OE1 . GLU A 1 222 ? -19.284 -28.111 -59.451 1.00 29.45 ? 221 GLU A OE1 1 
ATOM   1676 O OE2 . GLU A 1 222 ? -19.472 -28.348 -61.625 1.00 36.43 ? 221 GLU A OE2 1 
ATOM   1677 N N   . GLY A 1 223 ? -20.458 -24.193 -59.671 1.00 21.52 ? 222 GLY A N   1 
ATOM   1678 C CA  . GLY A 1 223 ? -21.352 -23.114 -60.107 1.00 24.57 ? 222 GLY A CA  1 
ATOM   1679 C C   . GLY A 1 223 ? -21.446 -21.952 -59.101 1.00 23.12 ? 222 GLY A C   1 
ATOM   1680 O O   . GLY A 1 223 ? -21.584 -20.776 -59.493 1.00 22.22 ? 222 GLY A O   1 
ATOM   1681 N N   . HIS A 1 224 ? -21.380 -22.267 -57.803 1.00 23.20 ? 223 HIS A N   1 
ATOM   1682 C CA  . HIS A 1 224 ? -21.391 -21.212 -56.791 1.00 22.36 ? 223 HIS A CA  1 
ATOM   1683 C C   . HIS A 1 224 ? -20.172 -20.268 -56.911 1.00 21.37 ? 223 HIS A C   1 
ATOM   1684 O O   . HIS A 1 224 ? -20.347 -19.061 -57.018 1.00 20.71 ? 223 HIS A O   1 
ATOM   1685 C CB  . HIS A 1 224 ? -21.464 -21.810 -55.369 1.00 22.40 ? 223 HIS A CB  1 
ATOM   1686 C CG  . HIS A 1 224 ? -21.450 -20.769 -54.328 1.00 24.17 ? 223 HIS A CG  1 
ATOM   1687 N ND1 . HIS A 1 224 ? -22.531 -19.946 -54.106 1.00 25.69 ? 223 HIS A ND1 1 
ATOM   1688 C CD2 . HIS A 1 224 ? -20.459 -20.331 -53.525 1.00 22.02 ? 223 HIS A CD2 1 
ATOM   1689 C CE1 . HIS A 1 224 ? -22.216 -19.066 -53.177 1.00 24.47 ? 223 HIS A CE1 1 
ATOM   1690 N NE2 . HIS A 1 224 ? -20.962 -19.270 -52.823 1.00 22.53 ? 223 HIS A NE2 1 
ATOM   1691 N N   . VAL A 1 225 ? -18.960 -20.821 -56.921 1.00 20.11 ? 224 VAL A N   1 
ATOM   1692 C CA  . VAL A 1 225 ? -17.761 -20.005 -57.098 1.00 22.11 ? 224 VAL A CA  1 
ATOM   1693 C C   . VAL A 1 225 ? -17.734 -19.332 -58.458 1.00 21.31 ? 224 VAL A C   1 
ATOM   1694 O O   . VAL A 1 225 ? -17.377 -18.141 -58.572 1.00 22.13 ? 224 VAL A O   1 
ATOM   1695 C CB  . VAL A 1 225 ? -16.440 -20.771 -56.745 1.00 22.92 ? 224 VAL A CB  1 
ATOM   1696 C CG1 . VAL A 1 225 ? -16.062 -21.862 -57.744 1.00 22.82 ? 224 VAL A CG1 1 
ATOM   1697 C CG2 . VAL A 1 225 ? -15.261 -19.819 -56.602 1.00 23.67 ? 224 VAL A CG2 1 
ATOM   1698 N N   . LEU A 1 226 ? -18.191 -20.032 -59.501 1.00 23.35 ? 225 LEU A N   1 
ATOM   1699 C CA  . LEU A 1 226 ? -18.239 -19.447 -60.842 1.00 23.41 ? 225 LEU A CA  1 
ATOM   1700 C C   . LEU A 1 226 ? -19.198 -18.297 -60.975 1.00 23.31 ? 225 LEU A C   1 
ATOM   1701 O O   . LEU A 1 226 ? -18.940 -17.377 -61.717 1.00 22.58 ? 225 LEU A O   1 
ATOM   1702 C CB  . LEU A 1 226 ? -18.492 -20.465 -61.933 1.00 25.18 ? 225 LEU A CB  1 
ATOM   1703 C CG  . LEU A 1 226 ? -17.391 -21.489 -62.149 1.00 27.96 ? 225 LEU A CG  1 
ATOM   1704 C CD1 . LEU A 1 226 ? -17.859 -22.472 -63.218 1.00 28.89 ? 225 LEU A CD1 1 
ATOM   1705 C CD2 . LEU A 1 226 ? -16.039 -20.870 -62.508 1.00 29.15 ? 225 LEU A CD2 1 
ATOM   1706 N N   . SER A 1 227 ? -20.266 -18.306 -60.218 1.00 23.70 ? 226 SER A N   1 
ATOM   1707 C CA  . SER A 1 227 ? -21.200 -17.217 -60.238 1.00 24.87 ? 226 SER A CA  1 
ATOM   1708 C C   . SER A 1 227 ? -20.800 -16.036 -59.303 1.00 23.38 ? 226 SER A C   1 
ATOM   1709 O O   . SER A 1 227 ? -21.467 -15.008 -59.302 1.00 20.76 ? 226 SER A O   1 
ATOM   1710 C CB  . SER A 1 227 ? -22.611 -17.735 -59.886 1.00 26.39 ? 226 SER A CB  1 
ATOM   1711 O OG  . SER A 1 227 ? -22.636 -18.293 -58.616 1.00 27.22 ? 226 SER A OG  1 
ATOM   1712 N N   . HIS A 1 228 ? -19.728 -16.186 -58.532 1.00 23.06 ? 227 HIS A N   1 
ATOM   1713 C CA  . HIS A 1 228 ? -19.268 -15.132 -57.590 1.00 23.29 ? 227 HIS A CA  1 
ATOM   1714 C C   . HIS A 1 228 ? -17.818 -14.886 -57.878 1.00 22.77 ? 227 HIS A C   1 
ATOM   1715 O O   . HIS A 1 228 ? -16.976 -15.060 -56.986 1.00 24.82 ? 227 HIS A O   1 
ATOM   1716 C CB  . HIS A 1 228 ? -19.394 -15.583 -56.104 1.00 22.38 ? 227 HIS A CB  1 
ATOM   1717 C CG  . HIS A 1 228 ? -20.800 -15.728 -55.595 1.00 25.45 ? 227 HIS A CG  1 
ATOM   1718 N ND1 . HIS A 1 228 ? -21.350 -14.838 -54.692 1.00 26.65 ? 227 HIS A ND1 1 
ATOM   1719 C CD2 . HIS A 1 228 ? -21.728 -16.696 -55.781 1.00 25.61 ? 227 HIS A CD2 1 
ATOM   1720 C CE1 . HIS A 1 228 ? -22.564 -15.242 -54.371 1.00 25.68 ? 227 HIS A CE1 1 
ATOM   1721 N NE2 . HIS A 1 228 ? -22.821 -16.360 -55.021 1.00 26.49 ? 227 HIS A NE2 1 
ATOM   1722 N N   . PRO A 1 229 ? -17.507 -14.491 -59.112 1.00 24.42 ? 228 PRO A N   1 
ATOM   1723 C CA  . PRO A 1 229 ? -16.131 -14.211 -59.404 1.00 27.13 ? 228 PRO A CA  1 
ATOM   1724 C C   . PRO A 1 229 ? -15.576 -13.057 -58.568 1.00 27.23 ? 228 PRO A C   1 
ATOM   1725 O O   . PRO A 1 229 ? -16.320 -12.173 -58.145 1.00 24.18 ? 228 PRO A O   1 
ATOM   1726 C CB  . PRO A 1 229 ? -16.162 -13.765 -60.883 1.00 26.08 ? 228 PRO A CB  1 
ATOM   1727 C CG  . PRO A 1 229 ? -17.498 -13.185 -61.046 1.00 25.67 ? 228 PRO A CG  1 
ATOM   1728 C CD  . PRO A 1 229 ? -18.394 -14.065 -60.208 1.00 25.15 ? 228 PRO A CD  1 
ATOM   1729 N N   . GLU A 1 230 ? -14.275 -13.098 -58.373 1.00 25.09 ? 229 GLU A N   1 
ATOM   1730 C CA  . GLU A 1 230 ? -13.525 -12.134 -57.608 1.00 27.53 ? 229 GLU A CA  1 
ATOM   1731 C C   . GLU A 1 230 ? -13.869 -10.676 -57.982 1.00 25.96 ? 229 GLU A C   1 
ATOM   1732 O O   . GLU A 1 230 ? -13.997 -9.798  -57.113 1.00 22.95 ? 229 GLU A O   1 
ATOM   1733 C CB  . GLU A 1 230 ? -12.009 -12.427 -57.869 1.00 31.83 ? 229 GLU A CB  1 
ATOM   1734 C CG  . GLU A 1 230 ? -11.020 -11.277 -57.687 1.00 39.96 ? 229 GLU A CG  1 
ATOM   1735 C CD  . GLU A 1 230 ? -9.616  -11.766 -57.331 1.00 40.29 ? 229 GLU A CD  1 
ATOM   1736 O OE1 . GLU A 1 230 ? -9.380  -13.023 -57.426 1.00 36.51 ? 229 GLU A OE1 1 
ATOM   1737 O OE2 . GLU A 1 230 ? -8.812  -10.886 -56.893 1.00 31.52 ? 229 GLU A OE2 1 
ATOM   1738 N N   . GLU A 1 231 ? -14.044 -10.444 -59.271 1.00 22.34 ? 230 GLU A N   1 
ATOM   1739 C CA  . GLU A 1 231 ? -14.423 -9.136  -59.739 1.00 27.67 ? 230 GLU A CA  1 
ATOM   1740 C C   . GLU A 1 231 ? -15.730 -8.587  -59.084 1.00 24.12 ? 230 GLU A C   1 
ATOM   1741 O O   . GLU A 1 231 ? -15.849 -7.404  -58.927 1.00 25.04 ? 230 GLU A O   1 
ATOM   1742 C CB  . GLU A 1 231 ? -14.531 -9.137  -61.280 1.00 31.67 ? 230 GLU A CB  1 
ATOM   1743 C CG  . GLU A 1 231 ? -13.187 -9.342  -62.032 1.00 32.10 ? 230 GLU A CG  1 
ATOM   1744 C CD  . GLU A 1 231 ? -12.813 -10.820 -62.271 1.00 35.40 ? 230 GLU A CD  1 
ATOM   1745 O OE1 . GLU A 1 231 ? -13.447 -11.722 -61.661 1.00 33.92 ? 230 GLU A OE1 1 
ATOM   1746 O OE2 . GLU A 1 231 ? -11.848 -11.104 -63.018 1.00 34.37 ? 230 GLU A OE2 1 
ATOM   1747 N N   . VAL A 1 232 ? -16.698 -9.400  -58.689 1.00 23.98 ? 231 VAL A N   1 
ATOM   1748 C CA  . VAL A 1 232 ? -17.875 -8.772  -58.138 1.00 26.12 ? 231 VAL A CA  1 
ATOM   1749 C C   . VAL A 1 232 ? -17.648 -8.311  -56.687 1.00 26.04 ? 231 VAL A C   1 
ATOM   1750 O O   . VAL A 1 232 ? -18.297 -7.380  -56.255 1.00 24.72 ? 231 VAL A O   1 
ATOM   1751 C CB  . VAL A 1 232 ? -19.135 -9.649  -58.202 1.00 27.51 ? 231 VAL A CB  1 
ATOM   1752 C CG1 . VAL A 1 232 ? -19.419 -10.008 -59.654 1.00 29.60 ? 231 VAL A CG1 1 
ATOM   1753 C CG2 . VAL A 1 232 ? -19.078 -10.878 -57.263 1.00 27.38 ? 231 VAL A CG2 1 
ATOM   1754 N N   . GLU A 1 233 ? -16.749 -8.998  -55.967 1.00 21.57 ? 232 GLU A N   1 
ATOM   1755 C CA  . GLU A 1 233 ? -16.316 -8.585  -54.637 1.00 21.91 ? 232 GLU A CA  1 
ATOM   1756 C C   . GLU A 1 233 ? -15.499 -7.311  -54.757 1.00 18.50 ? 232 GLU A C   1 
ATOM   1757 O O   . GLU A 1 233 ? -15.809 -6.366  -54.087 1.00 18.81 ? 232 GLU A O   1 
ATOM   1758 C CB  . GLU A 1 233 ? -15.550 -9.724  -53.923 1.00 23.61 ? 232 GLU A CB  1 
ATOM   1759 C CG  . GLU A 1 233 ? -15.191 -9.410  -52.454 1.00 27.66 ? 232 GLU A CG  1 
ATOM   1760 C CD  . GLU A 1 233 ? -14.179 -10.436 -51.845 1.00 30.12 ? 232 GLU A CD  1 
ATOM   1761 O OE1 . GLU A 1 233 ? -13.642 -11.302 -52.603 1.00 29.29 ? 232 GLU A OE1 1 
ATOM   1762 O OE2 . GLU A 1 233 ? -13.985 -10.400 -50.610 1.00 22.34 ? 232 GLU A OE2 1 
ATOM   1763 N N   . ALA A 1 234 ? -14.492 -7.266  -55.643 1.00 17.24 ? 233 ALA A N   1 
ATOM   1764 C CA  . ALA A 1 234 ? -13.620 -6.118  -55.713 1.00 16.66 ? 233 ALA A CA  1 
ATOM   1765 C C   . ALA A 1 234 ? -14.410 -4.848  -56.076 1.00 16.83 ? 233 ALA A C   1 
ATOM   1766 O O   . ALA A 1 234 ? -14.250 -3.796  -55.460 1.00 17.44 ? 233 ALA A O   1 
ATOM   1767 C CB  . ALA A 1 234 ? -12.462 -6.335  -56.657 1.00 18.02 ? 233 ALA A CB  1 
ATOM   1768 N N   . GLU A 1 235 ? -15.272 -4.974  -57.071 1.00 17.78 ? 234 GLU A N   1 
ATOM   1769 C CA  . GLU A 1 235 ? -16.104 -3.864  -57.474 1.00 18.18 ? 234 GLU A CA  1 
ATOM   1770 C C   . GLU A 1 235 ? -17.009 -3.390  -56.369 1.00 16.96 ? 234 GLU A C   1 
ATOM   1771 O O   . GLU A 1 235 ? -17.085 -2.193  -56.162 1.00 15.14 ? 234 GLU A O   1 
ATOM   1772 C CB  . GLU A 1 235 ? -16.987 -4.209  -58.700 1.00 21.41 ? 234 GLU A CB  1 
ATOM   1773 C CG  . GLU A 1 235 ? -17.840 -3.019  -59.213 1.00 23.30 ? 234 GLU A CG  1 
ATOM   1774 C CD  . GLU A 1 235 ? -19.135 -2.782  -58.452 1.00 24.00 ? 234 GLU A CD  1 
ATOM   1775 O OE1 . GLU A 1 235 ? -19.923 -3.763  -58.055 1.00 24.60 ? 234 GLU A OE1 1 
ATOM   1776 O OE2 . GLU A 1 235 ? -19.377 -1.572  -58.239 1.00 26.70 ? 234 GLU A OE2 1 
ATOM   1777 N N   . ALA A 1 236 ? -17.661 -4.301  -55.655 1.00 16.72 ? 235 ALA A N   1 
ATOM   1778 C CA  . ALA A 1 236 ? -18.572 -3.881  -54.610 1.00 17.93 ? 235 ALA A CA  1 
ATOM   1779 C C   . ALA A 1 236 ? -17.806 -3.193  -53.465 1.00 15.66 ? 235 ALA A C   1 
ATOM   1780 O O   . ALA A 1 236 ? -18.279 -2.207  -52.907 1.00 15.88 ? 235 ALA A O   1 
ATOM   1781 C CB  . ALA A 1 236 ? -19.387 -5.073  -54.117 1.00 20.09 ? 235 ALA A CB  1 
ATOM   1782 N N   . VAL A 1 237 ? -16.616 -3.689  -53.148 1.00 15.70 ? 236 VAL A N   1 
ATOM   1783 C CA  . VAL A 1 237 ? -15.804 -3.058  -52.102 1.00 15.83 ? 236 VAL A CA  1 
ATOM   1784 C C   . VAL A 1 237 ? -15.419 -1.677  -52.530 1.00 16.29 ? 236 VAL A C   1 
ATOM   1785 O O   . VAL A 1 237 ? -15.499 -0.703  -51.750 1.00 16.10 ? 236 VAL A O   1 
ATOM   1786 C CB  . VAL A 1 237 ? -14.533 -3.884  -51.795 1.00 16.48 ? 236 VAL A CB  1 
ATOM   1787 C CG1 . VAL A 1 237 ? -13.552 -3.124  -50.942 1.00 16.80 ? 236 VAL A CG1 1 
ATOM   1788 C CG2 . VAL A 1 237 ? -14.894 -5.226  -51.188 1.00 16.36 ? 236 VAL A CG2 1 
ATOM   1789 N N   . TYR A 1 238 ? -14.970 -1.536  -53.762 1.00 16.29 ? 237 TYR A N   1 
ATOM   1790 C CA  . TYR A 1 238 ? -14.635 -0.197  -54.245 1.00 17.58 ? 237 TYR A CA  1 
ATOM   1791 C C   . TYR A 1 238 ? -15.819 0.773   -54.188 1.00 17.17 ? 237 TYR A C   1 
ATOM   1792 O O   . TYR A 1 238 ? -15.670 1.966   -53.872 1.00 14.58 ? 237 TYR A O   1 
ATOM   1793 C CB  . TYR A 1 238 ? -14.079 -0.340  -55.657 1.00 21.17 ? 237 TYR A CB  1 
ATOM   1794 C CG  . TYR A 1 238 ? -13.428 0.875   -56.115 1.00 26.06 ? 237 TYR A CG  1 
ATOM   1795 C CD1 . TYR A 1 238 ? -12.123 1.179   -55.749 1.00 30.01 ? 237 TYR A CD1 1 
ATOM   1796 C CD2 . TYR A 1 238 ? -14.123 1.784   -56.866 1.00 31.22 ? 237 TYR A CD2 1 
ATOM   1797 C CE1 . TYR A 1 238 ? -11.557 2.394   -56.154 1.00 31.32 ? 237 TYR A CE1 1 
ATOM   1798 C CE2 . TYR A 1 238 ? -13.546 2.950   -57.306 1.00 34.68 ? 237 TYR A CE2 1 
ATOM   1799 C CZ  . TYR A 1 238 ? -12.279 3.241   -56.964 1.00 32.75 ? 237 TYR A CZ  1 
ATOM   1800 O OH  . TYR A 1 238 ? -11.839 4.412   -57.445 1.00 35.85 ? 237 TYR A OH  1 
ATOM   1801 N N   . ARG A 1 239 ? -16.998 0.291   -54.585 1.00 16.93 ? 238 ARG A N   1 
ATOM   1802 C CA  . ARG A 1 239 ? -18.226 1.130   -54.574 1.00 15.70 ? 238 ARG A CA  1 
ATOM   1803 C C   . ARG A 1 239 ? -18.591 1.467   -53.127 1.00 16.47 ? 238 ARG A C   1 
ATOM   1804 O O   . ARG A 1 239 ? -18.886 2.591   -52.809 1.00 16.02 ? 238 ARG A O   1 
ATOM   1805 C CB  . ARG A 1 239 ? -19.338 0.397   -55.295 1.00 17.06 ? 238 ARG A CB  1 
ATOM   1806 C CG  . ARG A 1 239 ? -20.709 1.080   -55.229 1.00 18.24 ? 238 ARG A CG  1 
ATOM   1807 C CD  . ARG A 1 239 ? -21.548 0.747   -56.442 1.00 21.07 ? 238 ARG A CD  1 
ATOM   1808 N NE  . ARG A 1 239 ? -21.510 -0.675  -56.631 1.00 21.47 ? 238 ARG A NE  1 
ATOM   1809 C CZ  . ARG A 1 239 ? -22.412 -1.536  -56.187 1.00 27.89 ? 238 ARG A CZ  1 
ATOM   1810 N NH1 . ARG A 1 239 ? -23.472 -1.115  -55.482 1.00 28.02 ? 238 ARG A NH1 1 
ATOM   1811 N NH2 . ARG A 1 239 ? -22.213 -2.865  -56.418 1.00 27.43 ? 238 ARG A NH2 1 
ATOM   1812 N N   . ALA A 1 240 ? -18.463 0.510   -52.223 1.00 15.58 ? 239 ALA A N   1 
ATOM   1813 C CA  . ALA A 1 240 ? -18.729 0.815   -50.801 1.00 15.65 ? 239 ALA A CA  1 
ATOM   1814 C C   . ALA A 1 240 ? -17.796 1.844   -50.225 1.00 17.12 ? 239 ALA A C   1 
ATOM   1815 O O   . ALA A 1 240 ? -18.259 2.784   -49.556 1.00 16.62 ? 239 ALA A O   1 
ATOM   1816 C CB  . ALA A 1 240 ? -18.715 -0.443  -49.949 1.00 16.56 ? 239 ALA A CB  1 
ATOM   1817 N N   . VAL A 1 241 ? -16.495 1.660   -50.449 1.00 15.81 ? 240 VAL A N   1 
ATOM   1818 C CA  . VAL A 1 241 ? -15.484 2.629   -50.090 1.00 15.94 ? 240 VAL A CA  1 
ATOM   1819 C C   . VAL A 1 241 ? -15.820 3.995   -50.625 1.00 15.92 ? 240 VAL A C   1 
ATOM   1820 O O   . VAL A 1 241 ? -15.731 4.997   -49.907 1.00 18.33 ? 240 VAL A O   1 
ATOM   1821 C CB  . VAL A 1 241 ? -14.076 2.201   -50.614 1.00 17.62 ? 240 VAL A CB  1 
ATOM   1822 C CG1 . VAL A 1 241 ? -13.089 3.392   -50.627 1.00 19.50 ? 240 VAL A CG1 1 
ATOM   1823 C CG2 . VAL A 1 241 ? -13.541 1.061   -49.828 1.00 16.55 ? 240 VAL A CG2 1 
ATOM   1824 N N   . THR A 1 242 ? -16.206 4.064   -51.893 1.00 16.93 ? 241 THR A N   1 
ATOM   1825 C CA  . THR A 1 242 ? -16.535 5.332   -52.491 1.00 17.52 ? 241 THR A CA  1 
ATOM   1826 C C   . THR A 1 242 ? -17.710 6.067   -51.764 1.00 16.78 ? 241 THR A C   1 
ATOM   1827 O O   . THR A 1 242 ? -17.676 7.306   -51.570 1.00 17.96 ? 241 THR A O   1 
ATOM   1828 C CB  . THR A 1 242 ? -16.890 5.111   -54.010 1.00 20.00 ? 241 THR A CB  1 
ATOM   1829 O OG1 . THR A 1 242 ? -15.749 4.568   -54.705 1.00 19.76 ? 241 THR A OG1 1 
ATOM   1830 C CG2 . THR A 1 242 ? -17.255 6.384   -54.654 1.00 19.96 ? 241 THR A CG2 1 
ATOM   1831 N N   . ILE A 1 243 ? -18.766 5.339   -51.486 1.00 16.33 ? 242 ILE A N   1 
ATOM   1832 C CA  . ILE A 1 243 ? -19.964 5.897   -50.861 1.00 16.95 ? 242 ILE A CA  1 
ATOM   1833 C C   . ILE A 1 243 ? -19.620 6.298   -49.408 1.00 17.58 ? 242 ILE A C   1 
ATOM   1834 O O   . ILE A 1 243 ? -20.027 7.375   -48.935 1.00 17.77 ? 242 ILE A O   1 
ATOM   1835 C CB  . ILE A 1 243 ? -21.122 4.872   -50.923 1.00 17.61 ? 242 ILE A CB  1 
ATOM   1836 C CG1 . ILE A 1 243 ? -21.513 4.661   -52.417 1.00 18.53 ? 242 ILE A CG1 1 
ATOM   1837 C CG2 . ILE A 1 243 ? -22.327 5.371   -50.098 1.00 20.70 ? 242 ILE A CG2 1 
ATOM   1838 C CD1 . ILE A 1 243 ? -22.473 3.530   -52.665 1.00 20.01 ? 242 ILE A CD1 1 
ATOM   1839 N N   . ALA A 1 244 ? -18.889 5.439   -48.707 1.00 17.00 ? 243 ALA A N   1 
ATOM   1840 C CA  . ALA A 1 244 ? -18.454 5.729   -47.326 1.00 16.76 ? 243 ALA A CA  1 
ATOM   1841 C C   . ALA A 1 244 ? -17.606 6.969   -47.249 1.00 17.31 ? 243 ALA A C   1 
ATOM   1842 O O   . ALA A 1 244 ? -17.809 7.825   -46.370 1.00 15.68 ? 243 ALA A O   1 
ATOM   1843 C CB  . ALA A 1 244 ? -17.689 4.530   -46.728 1.00 17.68 ? 243 ALA A CB  1 
ATOM   1844 N N   . LYS A 1 245 ? -16.632 7.058   -48.165 1.00 19.12 ? 244 LYS A N   1 
ATOM   1845 C CA  . LYS A 1 245 ? -15.809 8.255   -48.250 1.00 19.32 ? 244 LYS A CA  1 
ATOM   1846 C C   . LYS A 1 245 ? -16.665 9.526   -48.498 1.00 18.57 ? 244 LYS A C   1 
ATOM   1847 O O   . LYS A 1 245 ? -16.483 10.540  -47.819 1.00 17.26 ? 244 LYS A O   1 
ATOM   1848 C CB  . LYS A 1 245 ? -14.708 8.127   -49.312 1.00 23.65 ? 244 LYS A CB  1 
ATOM   1849 C CG  . LYS A 1 245 ? -13.856 9.403   -49.461 1.00 26.58 ? 244 LYS A CG  1 
ATOM   1850 C CD  . LYS A 1 245 ? -12.825 9.225   -50.567 1.00 34.32 ? 244 LYS A CD  1 
ATOM   1851 N N   . GLN A 1 246 ? -17.590 9.490   -49.455 1.00 17.91 ? 245 GLN A N   1 
ATOM   1852 C CA  . GLN A 1 246 ? -18.417 10.669  -49.693 1.00 19.25 ? 245 GLN A CA  1 
ATOM   1853 C C   . GLN A 1 246 ? -19.232 11.023  -48.488 1.00 18.50 ? 245 GLN A C   1 
ATOM   1854 O O   . GLN A 1 246 ? -19.456 12.185  -48.218 1.00 21.94 ? 245 GLN A O   1 
ATOM   1855 C CB  . GLN A 1 246 ? -19.352 10.480  -50.903 1.00 19.53 ? 245 GLN A CB  1 
ATOM   1856 C CG  . GLN A 1 246 ? -18.605 10.371  -52.211 1.00 23.98 ? 245 GLN A CG  1 
ATOM   1857 C CD  . GLN A 1 246 ? -17.684 11.552  -52.487 1.00 23.53 ? 245 GLN A CD  1 
ATOM   1858 O OE1 . GLN A 1 246 ? -16.522 11.368  -52.787 1.00 24.95 ? 245 GLN A OE1 1 
ATOM   1859 N NE2 . GLN A 1 246 ? -18.199 12.768  -52.288 1.00 24.20 ? 245 GLN A NE2 1 
ATOM   1860 N N   . ALA A 1 247 ? -19.694 10.029  -47.741 1.00 18.82 ? 246 ALA A N   1 
ATOM   1861 C CA  . ALA A 1 247 ? -20.530 10.288  -46.561 1.00 19.42 ? 246 ALA A CA  1 
ATOM   1862 C C   . ALA A 1 247 ? -19.714 10.597  -45.287 1.00 18.40 ? 246 ALA A C   1 
ATOM   1863 O O   . ALA A 1 247 ? -20.305 10.827  -44.252 1.00 18.01 ? 246 ALA A O   1 
ATOM   1864 C CB  . ALA A 1 247 ? -21.483 9.115   -46.295 1.00 19.39 ? 246 ALA A CB  1 
ATOM   1865 N N   . ASN A 1 248 ? -18.386 10.499  -45.357 1.00 18.34 ? 247 ASN A N   1 
ATOM   1866 C CA  . ASN A 1 248 ? -17.516 10.505  -44.167 1.00 16.55 ? 247 ASN A CA  1 
ATOM   1867 C C   . ASN A 1 248 ? -17.977 9.555   -43.068 1.00 16.82 ? 247 ASN A C   1 
ATOM   1868 O O   . ASN A 1 248 ? -18.057 9.904   -41.876 1.00 16.00 ? 247 ASN A O   1 
ATOM   1869 C CB  . ASN A 1 248 ? -17.357 11.952  -43.677 1.00 15.73 ? 247 ASN A CB  1 
ATOM   1870 C CG  . ASN A 1 248 ? -16.357 12.083  -42.561 1.00 16.48 ? 247 ASN A CG  1 
ATOM   1871 O OD1 . ASN A 1 248 ? -15.293 11.496  -42.594 1.00 17.50 ? 247 ASN A OD1 1 
ATOM   1872 N ND2 . ASN A 1 248 ? -16.675 12.931  -41.577 1.00 17.15 ? 247 ASN A ND2 1 
ATOM   1873 N N   . CYS A 1 249 ? -18.279 8.336   -43.489 1.00 16.30 ? 248 CYS A N   1 
ATOM   1874 C CA  . CYS A 1 249 ? -18.781 7.272   -42.610 1.00 17.45 ? 248 CYS A CA  1 
ATOM   1875 C C   . CYS A 1 249 ? -17.714 6.197   -42.596 1.00 16.00 ? 248 CYS A C   1 
ATOM   1876 O O   . CYS A 1 249 ? -17.306 5.741   -43.651 1.00 15.67 ? 248 CYS A O   1 
ATOM   1877 C CB  . CYS A 1 249 ? -20.097 6.688   -43.157 1.00 17.39 ? 248 CYS A CB  1 
ATOM   1878 S SG  . CYS A 1 249 ? -20.732 5.382   -42.093 1.00 17.33 ? 248 CYS A SG  1 
ATOM   1879 N N   . PRO A 1 250 ? -17.285 5.747   -41.388 1.00 15.05 ? 249 PRO A N   1 
ATOM   1880 C CA  . PRO A 1 250 ? -16.304 4.732   -41.331 1.00 14.61 ? 249 PRO A CA  1 
ATOM   1881 C C   . PRO A 1 250 ? -16.830 3.422   -41.819 1.00 15.05 ? 249 PRO A C   1 
ATOM   1882 O O   . PRO A 1 250 ? -17.988 3.066   -41.520 1.00 14.96 ? 249 PRO A O   1 
ATOM   1883 C CB  . PRO A 1 250 ? -15.980 4.661   -39.858 1.00 15.14 ? 249 PRO A CB  1 
ATOM   1884 C CG  . PRO A 1 250 ? -17.283 4.954   -39.202 1.00 14.89 ? 249 PRO A CG  1 
ATOM   1885 C CD  . PRO A 1 250 ? -17.814 6.076   -40.048 1.00 15.87 ? 249 PRO A CD  1 
ATOM   1886 N N   . LEU A 1 251 ? -16.020 2.717   -42.601 1.00 14.78 ? 250 LEU A N   1 
ATOM   1887 C CA  . LEU A 1 251 ? -16.463 1.522   -43.299 1.00 14.16 ? 250 LEU A CA  1 
ATOM   1888 C C   . LEU A 1 251 ? -15.693 0.301   -42.821 1.00 14.54 ? 250 LEU A C   1 
ATOM   1889 O O   . LEU A 1 251 ? -14.509 0.372   -42.483 1.00 14.81 ? 250 LEU A O   1 
ATOM   1890 C CB  . LEU A 1 251 ? -16.320 1.698   -44.809 1.00 14.19 ? 250 LEU A CB  1 
ATOM   1891 C CG  . LEU A 1 251 ? -16.762 0.499   -45.671 1.00 15.64 ? 250 LEU A CG  1 
ATOM   1892 C CD1 . LEU A 1 251 ? -18.223 0.299   -45.647 1.00 15.64 ? 250 LEU A CD1 1 
ATOM   1893 C CD2 . LEU A 1 251 ? -16.294 0.703   -47.117 1.00 17.55 ? 250 LEU A CD2 1 
ATOM   1894 N N   . TYR A 1 252 ? -16.407 -0.811  -42.713 1.00 13.83 ? 251 TYR A N   1 
ATOM   1895 C CA  . TYR A 1 252 ? -15.795 -2.064  -42.268 1.00 13.89 ? 251 TYR A CA  1 
ATOM   1896 C C   . TYR A 1 252 ? -16.207 -3.129  -43.289 1.00 14.34 ? 251 TYR A C   1 
ATOM   1897 O O   . TYR A 1 252 ? -17.415 -3.428  -43.459 1.00 16.17 ? 251 TYR A O   1 
ATOM   1898 C CB  . TYR A 1 252 ? -16.261 -2.357  -40.871 1.00 13.56 ? 251 TYR A CB  1 
ATOM   1899 C CG  . TYR A 1 252 ? -15.782 -3.666  -40.251 1.00 14.80 ? 251 TYR A CG  1 
ATOM   1900 C CD1 . TYR A 1 252 ? -16.275 -4.912  -40.698 1.00 14.36 ? 251 TYR A CD1 1 
ATOM   1901 C CD2 . TYR A 1 252 ? -14.822 -3.662  -39.246 1.00 14.60 ? 251 TYR A CD2 1 
ATOM   1902 C CE1 . TYR A 1 252 ? -15.876 -6.104  -40.124 1.00 15.59 ? 251 TYR A CE1 1 
ATOM   1903 C CE2 . TYR A 1 252 ? -14.377 -4.854  -38.683 1.00 14.55 ? 251 TYR A CE2 1 
ATOM   1904 C CZ  . TYR A 1 252 ? -14.925 -6.049  -39.077 1.00 14.89 ? 251 TYR A CZ  1 
ATOM   1905 O OH  . TYR A 1 252 ? -14.497 -7.144  -38.448 1.00 16.13 ? 251 TYR A OH  1 
ATOM   1906 N N   . VAL A 1 253 ? -15.242 -3.709  -44.001 1.00 14.88 ? 252 VAL A N   1 
ATOM   1907 C CA  . VAL A 1 253 ? -15.559 -4.694  -45.056 1.00 14.10 ? 252 VAL A CA  1 
ATOM   1908 C C   . VAL A 1 253 ? -15.469 -6.081  -44.447 1.00 13.56 ? 252 VAL A C   1 
ATOM   1909 O O   . VAL A 1 253 ? -14.387 -6.534  -44.061 1.00 13.31 ? 252 VAL A O   1 
ATOM   1910 C CB  . VAL A 1 253 ? -14.594 -4.556  -46.222 1.00 14.34 ? 252 VAL A CB  1 
ATOM   1911 C CG1 . VAL A 1 253 ? -14.959 -5.594  -47.277 1.00 15.97 ? 252 VAL A CG1 1 
ATOM   1912 C CG2 . VAL A 1 253 ? -14.670 -3.133  -46.795 1.00 14.88 ? 252 VAL A CG2 1 
ATOM   1913 N N   . THR A 1 254 ? -16.592 -6.771  -44.388 1.00 14.37 ? 253 THR A N   1 
ATOM   1914 C CA  . THR A 1 254 ? -16.612 -8.122  -43.900 1.00 13.98 ? 253 THR A CA  1 
ATOM   1915 C C   . THR A 1 254 ? -16.086 -9.152  -44.936 1.00 14.72 ? 253 THR A C   1 
ATOM   1916 O O   . THR A 1 254 ? -16.159 -8.932  -46.154 1.00 13.92 ? 253 THR A O   1 
ATOM   1917 C CB  . THR A 1 254 ? -18.041 -8.599  -43.470 1.00 15.27 ? 253 THR A CB  1 
ATOM   1918 O OG1 . THR A 1 254 ? -18.944 -8.661  -44.584 1.00 14.48 ? 253 THR A OG1 1 
ATOM   1919 C CG2 . THR A 1 254 ? -18.600 -7.688  -42.367 1.00 15.04 ? 253 THR A CG2 1 
ATOM   1920 N N   . LYS A 1 255 ? -15.608 -10.286 -44.425 1.00 13.59 ? 254 LYS A N   1 
ATOM   1921 C CA  . LYS A 1 255 ? -15.353 -11.463 -45.306 1.00 16.34 ? 254 LYS A CA  1 
ATOM   1922 C C   . LYS A 1 255 ? -14.504 -11.136 -46.550 1.00 15.29 ? 254 LYS A C   1 
ATOM   1923 O O   . LYS A 1 255 ? -14.900 -11.376 -47.682 1.00 15.86 ? 254 LYS A O   1 
ATOM   1924 C CB  . LYS A 1 255 ? -16.635 -12.088 -45.740 1.00 17.04 ? 254 LYS A CB  1 
ATOM   1925 C CG  . LYS A 1 255 ? -17.416 -12.804 -44.649 1.00 19.75 ? 254 LYS A CG  1 
ATOM   1926 C CD  . LYS A 1 255 ? -18.726 -13.304 -45.307 1.00 22.88 ? 254 LYS A CD  1 
ATOM   1927 C CE  . LYS A 1 255 ? -19.531 -14.278 -44.476 1.00 24.88 ? 254 LYS A CE  1 
ATOM   1928 N NZ  . LYS A 1 255 ? -20.816 -14.601 -45.162 1.00 25.94 ? 254 LYS A NZ  1 
ATOM   1929 N N   . VAL A 1 256 ? -13.329 -10.610 -46.303 1.00 15.09 ? 255 VAL A N   1 
ATOM   1930 C CA  . VAL A 1 256 ? -12.382 -10.329 -47.356 1.00 15.77 ? 255 VAL A CA  1 
ATOM   1931 C C   . VAL A 1 256 ? -11.770 -11.668 -47.849 1.00 16.17 ? 255 VAL A C   1 
ATOM   1932 O O   . VAL A 1 256 ? -10.982 -12.231 -47.146 1.00 14.35 ? 255 VAL A O   1 
ATOM   1933 C CB  . VAL A 1 256 ? -11.253 -9.405  -46.843 1.00 15.72 ? 255 VAL A CB  1 
ATOM   1934 C CG1 . VAL A 1 256 ? -10.198 -9.213  -47.925 1.00 17.66 ? 255 VAL A CG1 1 
ATOM   1935 C CG2 . VAL A 1 256 ? -11.821 -8.014  -46.473 1.00 15.77 ? 255 VAL A CG2 1 
ATOM   1936 N N   . MET A 1 257 ? -12.160 -12.114 -49.054 1.00 16.14 ? 256 MET A N   1 
ATOM   1937 C CA  . MET A 1 257 ? -11.809 -13.442 -49.561 1.00 15.87 ? 256 MET A CA  1 
ATOM   1938 C C   . MET A 1 257 ? -10.840 -13.380 -50.747 1.00 17.28 ? 256 MET A C   1 
ATOM   1939 O O   . MET A 1 257 ? -10.275 -14.392 -51.089 1.00 18.09 ? 256 MET A O   1 
ATOM   1940 C CB  . MET A 1 257 ? -13.059 -14.176 -50.043 1.00 17.13 ? 256 MET A CB  1 
ATOM   1941 C CG  . MET A 1 257 ? -14.247 -14.280 -49.068 1.00 16.78 ? 256 MET A CG  1 
ATOM   1942 S SD  . MET A 1 257 ? -13.745 -14.986 -47.504 1.00 17.63 ? 256 MET A SD  1 
ATOM   1943 C CE  . MET A 1 257 ? -13.563 -16.720 -48.040 1.00 17.45 ? 256 MET A CE  1 
ATOM   1944 N N   . SER A 1 258 ? -10.678 -12.227 -51.374 1.00 16.18 ? 257 SER A N   1 
ATOM   1945 C CA  . SER A 1 258 ? -9.891  -12.106 -52.602 1.00 19.16 ? 257 SER A CA  1 
ATOM   1946 C C   . SER A 1 258 ? -8.818  -11.031 -52.521 1.00 18.04 ? 257 SER A C   1 
ATOM   1947 O O   . SER A 1 258 ? -8.926  -10.059 -51.739 1.00 17.77 ? 257 SER A O   1 
ATOM   1948 C CB  . SER A 1 258 ? -10.859 -11.767 -53.797 1.00 17.95 ? 257 SER A CB  1 
ATOM   1949 O OG  . SER A 1 258 ? -11.306 -10.399 -53.797 1.00 20.20 ? 257 SER A OG  1 
ATOM   1950 N N   . LYS A 1 259 ? -7.827  -11.178 -53.397 1.00 18.54 ? 258 LYS A N   1 
ATOM   1951 C CA  . LYS A 1 259 ? -6.733  -10.226 -53.556 1.00 18.16 ? 258 LYS A CA  1 
ATOM   1952 C C   . LYS A 1 259 ? -7.301  -8.899  -53.962 1.00 18.59 ? 258 LYS A C   1 
ATOM   1953 O O   . LYS A 1 259 ? -6.870  -7.879  -53.427 1.00 17.24 ? 258 LYS A O   1 
ATOM   1954 C CB  . LYS A 1 259 ? -5.700  -10.710 -54.589 1.00 19.72 ? 258 LYS A CB  1 
ATOM   1955 C CG  . LYS A 1 259 ? -5.089  -12.047 -54.178 1.00 23.23 ? 258 LYS A CG  1 
ATOM   1956 C CD  . LYS A 1 259 ? -3.720  -12.327 -54.830 1.00 28.50 ? 258 LYS A CD  1 
ATOM   1957 C CE  . LYS A 1 259 ? -3.782  -12.838 -56.235 1.00 31.01 ? 258 LYS A CE  1 
ATOM   1958 N NZ  . LYS A 1 259 ? -2.427  -13.455 -56.527 1.00 32.54 ? 258 LYS A NZ  1 
ATOM   1959 N N   . GLY A 1 260 ? -8.261  -8.918  -54.898 1.00 17.65 ? 259 GLY A N   1 
ATOM   1960 C CA  . GLY A 1 260 ? -8.830  -7.686  -55.431 1.00 18.34 ? 259 GLY A CA  1 
ATOM   1961 C C   . GLY A 1 260 ? -9.568  -6.861  -54.380 1.00 18.00 ? 259 GLY A C   1 
ATOM   1962 O O   . GLY A 1 260 ? -9.459  -5.639  -54.320 1.00 15.70 ? 259 GLY A O   1 
ATOM   1963 N N   . ALA A 1 261 ? -10.311 -7.537  -53.530 1.00 17.31 ? 260 ALA A N   1 
ATOM   1964 C CA  . ALA A 1 261 ? -11.028 -6.857  -52.447 1.00 17.64 ? 260 ALA A CA  1 
ATOM   1965 C C   . ALA A 1 261 ? -10.031 -6.223  -51.436 1.00 16.44 ? 260 ALA A C   1 
ATOM   1966 O O   . ALA A 1 261 ? -10.129 -5.077  -51.077 1.00 18.42 ? 260 ALA A O   1 
ATOM   1967 C CB  . ALA A 1 261 ? -11.911 -7.873  -51.762 1.00 17.24 ? 260 ALA A CB  1 
ATOM   1968 N N   . ALA A 1 262 ? -9.015  -6.972  -51.095 1.00 16.49 ? 261 ALA A N   1 
ATOM   1969 C CA  . ALA A 1 262 ? -7.999  -6.543  -50.131 1.00 16.47 ? 261 ALA A CA  1 
ATOM   1970 C C   . ALA A 1 262 ? -7.208  -5.390  -50.680 1.00 17.28 ? 261 ALA A C   1 
ATOM   1971 O O   . ALA A 1 262 ? -6.955  -4.422  -49.959 1.00 15.15 ? 261 ALA A O   1 
ATOM   1972 C CB  . ALA A 1 262 ? -7.077  -7.676  -49.735 1.00 16.55 ? 261 ALA A CB  1 
ATOM   1973 N N   . ASP A 1 263 ? -6.866  -5.472  -51.976 1.00 16.88 ? 262 ASP A N   1 
ATOM   1974 C CA  . ASP A 1 263 ? -6.155  -4.350  -52.608 1.00 17.86 ? 262 ASP A CA  1 
ATOM   1975 C C   . ASP A 1 263 ? -6.934  -3.067  -52.646 1.00 15.43 ? 262 ASP A C   1 
ATOM   1976 O O   . ASP A 1 263 ? -6.347  -2.000  -52.544 1.00 16.68 ? 262 ASP A O   1 
ATOM   1977 C CB  . ASP A 1 263 ? -5.695  -4.705  -54.055 1.00 18.49 ? 262 ASP A CB  1 
ATOM   1978 C CG  . ASP A 1 263 ? -4.579  -5.786  -54.075 1.00 20.93 ? 262 ASP A CG  1 
ATOM   1979 O OD1 . ASP A 1 263 ? -3.926  -5.998  -53.041 1.00 22.38 ? 262 ASP A OD1 1 
ATOM   1980 O OD2 . ASP A 1 263 ? -4.389  -6.448  -55.138 1.00 22.71 ? 262 ASP A OD2 1 
ATOM   1981 N N   . ALA A 1 264 ? -8.230  -3.156  -52.857 1.00 15.28 ? 263 ALA A N   1 
ATOM   1982 C CA  . ALA A 1 264 ? -9.073  -2.015  -52.848 1.00 16.47 ? 263 ALA A CA  1 
ATOM   1983 C C   . ALA A 1 264 ? -9.081  -1.314  -51.492 1.00 16.07 ? 263 ALA A C   1 
ATOM   1984 O O   . ALA A 1 264 ? -9.052  -0.072  -51.403 1.00 15.22 ? 263 ALA A O   1 
ATOM   1985 C CB  . ALA A 1 264 ? -10.507 -2.379  -53.269 1.00 16.69 ? 263 ALA A CB  1 
ATOM   1986 N N   . ILE A 1 265 ? -9.135  -2.114  -50.451 1.00 15.33 ? 264 ILE A N   1 
ATOM   1987 C CA  . ILE A 1 265 ? -9.028  -1.573  -49.109 1.00 15.43 ? 264 ILE A CA  1 
ATOM   1988 C C   . ILE A 1 265 ? -7.632  -0.917  -48.872 1.00 15.75 ? 264 ILE A C   1 
ATOM   1989 O O   . ILE A 1 265 ? -7.569  0.219   -48.331 1.00 15.77 ? 264 ILE A O   1 
ATOM   1990 C CB  . ILE A 1 265 ? -9.311  -2.705  -48.092 1.00 15.96 ? 264 ILE A CB  1 
ATOM   1991 C CG1 . ILE A 1 265 ? -10.771 -3.173  -48.189 1.00 15.89 ? 264 ILE A CG1 1 
ATOM   1992 C CG2 . ILE A 1 265 ? -8.888  -2.342  -46.667 1.00 17.20 ? 264 ILE A CG2 1 
ATOM   1993 C CD1 . ILE A 1 265 ? -10.974 -4.571  -47.619 1.00 16.38 ? 264 ILE A CD1 1 
ATOM   1994 N N   . ALA A 1 266 ? -6.543  -1.608  -49.252 1.00 14.36 ? 265 ALA A N   1 
ATOM   1995 C CA  . ALA A 1 266 ? -5.199  -1.071  -49.059 1.00 15.51 ? 265 ALA A CA  1 
ATOM   1996 C C   . ALA A 1 266 ? -5.071  0.271   -49.807 1.00 15.60 ? 265 ALA A C   1 
ATOM   1997 O O   . ALA A 1 266 ? -4.594  1.265   -49.243 1.00 17.46 ? 265 ALA A O   1 
ATOM   1998 C CB  . ALA A 1 266 ? -4.144  -2.088  -49.545 1.00 15.79 ? 265 ALA A CB  1 
ATOM   1999 N N   . GLN A 1 267 ? -5.559  0.347   -51.061 1.00 15.98 ? 266 GLN A N   1 
ATOM   2000 C CA  . GLN A 1 267 ? -5.528  1.590   -51.829 1.00 18.52 ? 266 GLN A CA  1 
ATOM   2001 C C   . GLN A 1 267 ? -6.348  2.690   -51.167 1.00 18.57 ? 266 GLN A C   1 
ATOM   2002 O O   . GLN A 1 267 ? -5.894  3.842   -51.076 1.00 18.82 ? 266 GLN A O   1 
ATOM   2003 C CB  . GLN A 1 267 ? -6.057  1.378   -53.269 1.00 20.43 ? 266 GLN A CB  1 
ATOM   2004 C CG  . GLN A 1 267 ? -5.113  0.510   -54.089 1.00 27.63 ? 266 GLN A CG  1 
ATOM   2005 C CD  . GLN A 1 267 ? -5.777  -0.201  -55.301 1.00 34.47 ? 266 GLN A CD  1 
ATOM   2006 O OE1 . GLN A 1 267 ? -6.963  0.038   -55.618 1.00 45.88 ? 266 GLN A OE1 1 
ATOM   2007 N NE2 . GLN A 1 267 ? -5.014  -1.132  -55.952 1.00 36.18 ? 266 GLN A NE2 1 
ATOM   2008 N N   . ALA A 1 268 ? -7.521  2.334   -50.688 1.00 15.94 ? 267 ALA A N   1 
ATOM   2009 C CA  . ALA A 1 268 ? -8.341  3.311   -49.947 1.00 19.50 ? 267 ALA A CA  1 
ATOM   2010 C C   . ALA A 1 268 ? -7.648  3.925   -48.725 1.00 16.71 ? 267 ALA A C   1 
ATOM   2011 O O   . ALA A 1 268 ? -7.706  5.119   -48.475 1.00 16.69 ? 267 ALA A O   1 
ATOM   2012 C CB  . ALA A 1 268 ? -9.679  2.672   -49.556 1.00 18.30 ? 267 ALA A CB  1 
ATOM   2013 N N   . LYS A 1 269 ? -7.002  3.082   -47.949 1.00 17.29 ? 268 LYS A N   1 
ATOM   2014 C CA  . LYS A 1 269 ? -6.265  3.517   -46.773 1.00 19.48 ? 268 LYS A CA  1 
ATOM   2015 C C   . LYS A 1 269 ? -5.153  4.497   -47.128 1.00 21.13 ? 268 LYS A C   1 
ATOM   2016 O O   . LYS A 1 269 ? -4.938  5.453   -46.403 1.00 20.67 ? 268 LYS A O   1 
ATOM   2017 C CB  . LYS A 1 269 ? -5.672  2.359   -46.037 1.00 19.11 ? 268 LYS A CB  1 
ATOM   2018 C CG  . LYS A 1 269 ? -6.689  1.612   -45.204 1.00 19.61 ? 268 LYS A CG  1 
ATOM   2019 C CD  . LYS A 1 269 ? -5.896  0.650   -44.345 1.00 22.25 ? 268 LYS A CD  1 
ATOM   2020 C CE  . LYS A 1 269 ? -6.718  -0.016  -43.303 1.00 24.15 ? 268 LYS A CE  1 
ATOM   2021 N NZ  . LYS A 1 269 ? -7.098  0.890   -42.200 1.00 22.74 ? 268 LYS A NZ  1 
ATOM   2022 N N   . ARG A 1 270 ? -4.494  4.269   -48.247 1.00 22.04 ? 269 ARG A N   1 
ATOM   2023 C CA  . ARG A 1 270 ? -3.479  5.185   -48.755 1.00 25.62 ? 269 ARG A CA  1 
ATOM   2024 C C   . ARG A 1 270 ? -4.019  6.519   -49.190 1.00 25.76 ? 269 ARG A C   1 
ATOM   2025 O O   . ARG A 1 270 ? -3.321  7.509   -49.126 1.00 29.03 ? 269 ARG A O   1 
ATOM   2026 C CB  . ARG A 1 270 ? -2.664  4.508   -49.865 1.00 28.81 ? 269 ARG A CB  1 
ATOM   2027 C CG  . ARG A 1 270 ? -1.644  3.695   -49.173 1.00 33.10 ? 269 ARG A CG  1 
ATOM   2028 C CD  . ARG A 1 270 ? -0.820  2.652   -49.942 1.00 42.21 ? 269 ARG A CD  1 
ATOM   2029 N NE  . ARG A 1 270 ? -0.234  2.046   -48.763 1.00 45.39 ? 269 ARG A NE  1 
ATOM   2030 C CZ  . ARG A 1 270 ? -0.920  1.279   -47.887 1.00 55.84 ? 269 ARG A CZ  1 
ATOM   2031 N NH1 . ARG A 1 270 ? -2.191  0.861   -48.099 1.00 45.31 ? 269 ARG A NH1 1 
ATOM   2032 N NH2 . ARG A 1 270 ? -0.312  0.911   -46.780 1.00 44.03 ? 269 ARG A NH2 1 
ATOM   2033 N N   . ARG A 1 271 ? -5.255  6.555   -49.627 1.00 25.33 ? 270 ARG A N   1 
ATOM   2034 C CA  . ARG A 1 271 ? -5.887  7.802   -49.881 1.00 24.36 ? 270 ARG A CA  1 
ATOM   2035 C C   . ARG A 1 271 ? -6.557  8.415   -48.624 1.00 25.21 ? 270 ARG A C   1 
ATOM   2036 O O   . ARG A 1 271 ? -7.253  9.361   -48.783 1.00 29.24 ? 270 ARG A O   1 
ATOM   2037 C CB  . ARG A 1 271 ? -6.890  7.624   -51.004 1.00 28.12 ? 270 ARG A CB  1 
ATOM   2038 C CG  . ARG A 1 271 ? -6.323  7.083   -52.294 1.00 30.81 ? 270 ARG A CG  1 
ATOM   2039 C CD  . ARG A 1 271 ? -7.384  7.080   -53.383 1.00 34.88 ? 270 ARG A CD  1 
ATOM   2040 N NE  . ARG A 1 271 ? -8.787  6.667   -53.021 1.00 41.69 ? 270 ARG A NE  1 
ATOM   2041 C CZ  . ARG A 1 271 ? -9.314  5.420   -53.085 1.00 41.38 ? 270 ARG A CZ  1 
ATOM   2042 N NH1 . ARG A 1 271 ? -8.590  4.367   -53.441 1.00 38.65 ? 270 ARG A NH1 1 
ATOM   2043 N NH2 . ARG A 1 271 ? -10.604 5.220   -52.791 1.00 41.82 ? 270 ARG A NH2 1 
ATOM   2044 N N   . GLY A 1 272 ? -6.318  7.908   -47.407 1.00 23.90 ? 271 GLY A N   1 
ATOM   2045 C CA  . GLY A 1 272 ? -6.895  8.441   -46.181 1.00 20.93 ? 271 GLY A CA  1 
ATOM   2046 C C   . GLY A 1 272 ? -8.340  8.063   -45.831 1.00 19.74 ? 271 GLY A C   1 
ATOM   2047 O O   . GLY A 1 272 ? -8.881  8.595   -44.891 1.00 20.46 ? 271 GLY A O   1 
ATOM   2048 N N   . VAL A 1 273 ? -8.923  7.088   -46.523 1.00 16.92 ? 272 VAL A N   1 
ATOM   2049 C CA  . VAL A 1 273 ? -10.251 6.620   -46.236 1.00 15.99 ? 272 VAL A CA  1 
ATOM   2050 C C   . VAL A 1 273 ? -10.238 5.847   -44.950 1.00 14.95 ? 272 VAL A C   1 
ATOM   2051 O O   . VAL A 1 273 ? -9.288  5.069   -44.702 1.00 15.01 ? 272 VAL A O   1 
ATOM   2052 C CB  . VAL A 1 273 ? -10.772 5.674   -47.329 1.00 16.01 ? 272 VAL A CB  1 
ATOM   2053 C CG1 . VAL A 1 273 ? -12.136 5.126   -46.921 1.00 16.55 ? 272 VAL A CG1 1 
ATOM   2054 C CG2 . VAL A 1 273 ? -10.839 6.408   -48.657 1.00 17.74 ? 272 VAL A CG2 1 
ATOM   2055 N N   . VAL A 1 274 ? -11.260 6.065   -44.114 1.00 15.66 ? 273 VAL A N   1 
ATOM   2056 C CA  . VAL A 1 274 ? -11.402 5.317   -42.825 1.00 14.20 ? 273 VAL A CA  1 
ATOM   2057 C C   . VAL A 1 274 ? -12.116 4.018   -43.134 1.00 15.02 ? 273 VAL A C   1 
ATOM   2058 O O   . VAL A 1 274 ? -13.331 3.997   -43.277 1.00 15.88 ? 273 VAL A O   1 
ATOM   2059 C CB  . VAL A 1 274 ? -12.119 6.105   -41.701 1.00 15.48 ? 273 VAL A CB  1 
ATOM   2060 C CG1 . VAL A 1 274 ? -12.253 5.232   -40.490 1.00 15.70 ? 273 VAL A CG1 1 
ATOM   2061 C CG2 . VAL A 1 274 ? -11.323 7.326   -41.356 1.00 16.12 ? 273 VAL A CG2 1 
ATOM   2062 N N   . VAL A 1 275 ? -11.336 2.957   -43.305 1.00 14.35 ? 274 VAL A N   1 
ATOM   2063 C CA  . VAL A 1 275 ? -11.855 1.634   -43.686 1.00 14.98 ? 274 VAL A CA  1 
ATOM   2064 C C   . VAL A 1 275 ? -11.051 0.536   -43.016 1.00 16.27 ? 274 VAL A C   1 
ATOM   2065 O O   . VAL A 1 275 ? -9.800  0.657   -42.861 1.00 16.84 ? 274 VAL A O   1 
ATOM   2066 C CB  . VAL A 1 275 ? -11.923 1.478   -45.238 1.00 14.64 ? 274 VAL A CB  1 
ATOM   2067 C CG1 . VAL A 1 275 ? -10.573 1.636   -45.904 1.00 15.74 ? 274 VAL A CG1 1 
ATOM   2068 C CG2 . VAL A 1 275 ? -12.546 0.185   -45.710 1.00 14.25 ? 274 VAL A CG2 1 
ATOM   2069 N N   . PHE A 1 276 ? -11.761 -0.524  -42.640 1.00 13.88 ? 275 PHE A N   1 
ATOM   2070 C CA  . PHE A 1 276 ? -11.209 -1.735  -42.025 1.00 13.75 ? 275 PHE A CA  1 
ATOM   2071 C C   . PHE A 1 276 ? -11.576 -2.947  -42.882 1.00 13.50 ? 275 PHE A C   1 
ATOM   2072 O O   . PHE A 1 276 ? -12.667 -3.054  -43.408 1.00 15.00 ? 275 PHE A O   1 
ATOM   2073 C CB  . PHE A 1 276 ? -11.706 -1.892  -40.546 1.00 14.32 ? 275 PHE A CB  1 
ATOM   2074 C CG  . PHE A 1 276 ? -11.591 -0.594  -39.808 1.00 15.04 ? 275 PHE A CG  1 
ATOM   2075 C CD1 . PHE A 1 276 ? -10.359 -0.164  -39.390 1.00 16.66 ? 275 PHE A CD1 1 
ATOM   2076 C CD2 . PHE A 1 276 ? -12.664 0.248   -39.651 1.00 17.11 ? 275 PHE A CD2 1 
ATOM   2077 C CE1 . PHE A 1 276 ? -10.196 1.060   -38.739 1.00 15.08 ? 275 PHE A CE1 1 
ATOM   2078 C CE2 . PHE A 1 276 ? -12.492 1.506   -39.064 1.00 18.05 ? 275 PHE A CE2 1 
ATOM   2079 C CZ  . PHE A 1 276 ? -11.243 1.893   -38.591 1.00 16.26 ? 275 PHE A CZ  1 
ATOM   2080 N N   . GLY A 1 277 ? -10.673 -3.892  -42.924 1.00 14.84 ? 276 GLY A N   1 
ATOM   2081 C CA  . GLY A 1 277 ? -10.863 -5.142  -43.622 1.00 13.90 ? 276 GLY A CA  1 
ATOM   2082 C C   . GLY A 1 277 ? -10.728 -6.335  -42.680 1.00 15.21 ? 276 GLY A C   1 
ATOM   2083 O O   . GLY A 1 277 ? -9.842  -6.379  -41.830 1.00 14.80 ? 276 GLY A O   1 
ATOM   2084 N N   . GLU A 1 278 ? -11.565 -7.322  -42.955 1.00 14.05 ? 277 GLU A N   1 
ATOM   2085 C CA  . GLU A 1 278 ? -11.757 -8.548  -42.190 1.00 14.43 ? 277 GLU A CA  1 
ATOM   2086 C C   . GLU A 1 278 ? -11.575 -9.799  -43.030 1.00 14.59 ? 277 GLU A C   1 
ATOM   2087 O O   . GLU A 1 278 ? -12.575 -10.392 -43.541 1.00 15.24 ? 277 GLU A O   1 
ATOM   2088 C CB  . GLU A 1 278 ? -13.193 -8.522  -41.615 1.00 14.14 ? 277 GLU A CB  1 
ATOM   2089 C CG  . GLU A 1 278 ? -13.549 -9.646  -40.684 1.00 13.92 ? 277 GLU A CG  1 
ATOM   2090 C CD  . GLU A 1 278 ? -15.070 -9.774  -40.572 1.00 15.41 ? 277 GLU A CD  1 
ATOM   2091 O OE1 . GLU A 1 278 ? -15.657 -10.405 -41.488 1.00 16.02 ? 277 GLU A OE1 1 
ATOM   2092 O OE2 . GLU A 1 278 ? -15.621 -9.244  -39.547 1.00 15.00 ? 277 GLU A OE2 1 
ATOM   2093 N N   . PRO A 1 279 ? -10.319 -10.227 -43.228 1.00 14.21 ? 278 PRO A N   1 
ATOM   2094 C CA  . PRO A 1 279 ? -10.188 -11.595 -43.682 1.00 14.00 ? 278 PRO A CA  1 
ATOM   2095 C C   . PRO A 1 279 ? -10.693 -12.576 -42.628 1.00 14.04 ? 278 PRO A C   1 
ATOM   2096 O O   . PRO A 1 279 ? -10.761 -12.273 -41.395 1.00 14.10 ? 278 PRO A O   1 
ATOM   2097 C CB  . PRO A 1 279 ? -8.678  -11.745 -43.853 1.00 15.17 ? 278 PRO A CB  1 
ATOM   2098 C CG  . PRO A 1 279 ? -8.123  -10.801 -42.825 1.00 15.18 ? 278 PRO A CG  1 
ATOM   2099 C CD  . PRO A 1 279 ? -9.021  -9.623  -42.916 1.00 15.38 ? 278 PRO A CD  1 
ATOM   2100 N N   . ILE A 1 280 ? -11.011 -13.763 -43.082 1.00 15.05 ? 279 ILE A N   1 
ATOM   2101 C CA  . ILE A 1 280 ? -11.538 -14.788 -42.179 1.00 15.36 ? 279 ILE A CA  1 
ATOM   2102 C C   . ILE A 1 280 ? -10.672 -16.039 -42.250 1.00 16.61 ? 279 ILE A C   1 
ATOM   2103 O O   . ILE A 1 280 ? -9.831  -16.177 -43.123 1.00 17.43 ? 279 ILE A O   1 
ATOM   2104 C CB  . ILE A 1 280 ? -13.020 -15.088 -42.423 1.00 15.39 ? 279 ILE A CB  1 
ATOM   2105 C CG1 . ILE A 1 280 ? -13.267 -15.651 -43.845 1.00 15.89 ? 279 ILE A CG1 1 
ATOM   2106 C CG2 . ILE A 1 280 ? -13.826 -13.829 -42.214 1.00 16.56 ? 279 ILE A CG2 1 
ATOM   2107 C CD1 . ILE A 1 280 ? -14.689 -16.151 -44.123 1.00 15.88 ? 279 ILE A CD1 1 
ATOM   2108 N N   . THR A 1 281 ? -10.883 -16.968 -41.332 1.00 15.27 ? 280 THR A N   1 
ATOM   2109 C CA  . THR A 1 281 ? -10.109 -18.174 -41.344 1.00 16.53 ? 280 THR A CA  1 
ATOM   2110 C C   . THR A 1 281 ? -10.070 -18.896 -42.708 1.00 16.86 ? 280 THR A C   1 
ATOM   2111 O O   . THR A 1 281 ? -9.023  -19.418 -43.123 1.00 15.72 ? 280 THR A O   1 
ATOM   2112 C CB  . THR A 1 281 ? -10.607 -19.164 -40.289 1.00 16.16 ? 280 THR A CB  1 
ATOM   2113 O OG1 . THR A 1 281 ? -10.946 -18.476 -39.088 1.00 16.19 ? 280 THR A OG1 1 
ATOM   2114 C CG2 . THR A 1 281 ? -9.504  -20.187 -39.992 1.00 18.48 ? 280 THR A CG2 1 
ATOM   2115 N N   . ALA A 1 282 ? -11.222 -18.998 -43.356 1.00 17.04 ? 281 ALA A N   1 
ATOM   2116 C CA  . ALA A 1 282 ? -11.301 -19.667 -44.647 1.00 16.63 ? 281 ALA A CA  1 
ATOM   2117 C C   . ALA A 1 282 ? -10.420 -18.975 -45.696 1.00 17.44 ? 281 ALA A C   1 
ATOM   2118 O O   . ALA A 1 282 ? -9.789  -19.652 -46.488 1.00 20.15 ? 281 ALA A O   1 
ATOM   2119 C CB  . ALA A 1 282 ? -12.715 -19.700 -45.127 1.00 16.24 ? 281 ALA A CB  1 
ATOM   2120 N N   . SER A 1 283 ? -10.383 -17.661 -45.734 1.00 16.28 ? 282 SER A N   1 
ATOM   2121 C CA  . SER A 1 283 ? -9.559  -16.992 -46.743 1.00 17.04 ? 282 SER A CA  1 
ATOM   2122 C C   . SER A 1 283 ? -8.047  -17.054 -46.501 1.00 17.13 ? 282 SER A C   1 
ATOM   2123 O O   . SER A 1 283 ? -7.268  -16.973 -47.447 1.00 15.56 ? 282 SER A O   1 
ATOM   2124 C CB  . SER A 1 283 ? -10.031 -15.600 -47.040 1.00 17.75 ? 282 SER A CB  1 
ATOM   2125 O OG  . SER A 1 283 ? -10.085 -14.737 -45.945 1.00 16.16 ? 282 SER A OG  1 
ATOM   2126 N N   . LEU A 1 284 ? -7.642  -17.314 -45.266 1.00 16.99 ? 283 LEU A N   1 
ATOM   2127 C CA  . LEU A 1 284 ? -6.248  -17.486 -44.914 1.00 17.46 ? 283 LEU A CA  1 
ATOM   2128 C C   . LEU A 1 284 ? -5.820  -18.946 -44.965 1.00 17.90 ? 283 LEU A C   1 
ATOM   2129 O O   . LEU A 1 284 ? -4.642  -19.201 -45.085 1.00 18.99 ? 283 LEU A O   1 
ATOM   2130 C CB  . LEU A 1 284 ? -6.015  -16.995 -43.499 1.00 17.82 ? 283 LEU A CB  1 
ATOM   2131 C CG  . LEU A 1 284 ? -6.365  -15.530 -43.237 1.00 20.17 ? 283 LEU A CG  1 
ATOM   2132 C CD1 . LEU A 1 284 ? -6.119  -15.188 -41.792 1.00 20.24 ? 283 LEU A CD1 1 
ATOM   2133 C CD2 . LEU A 1 284 ? -5.520  -14.676 -44.149 1.00 23.09 ? 283 LEU A CD2 1 
ATOM   2134 N N   . GLY A 1 285 ? -6.763  -19.875 -44.847 1.00 17.30 ? 284 GLY A N   1 
ATOM   2135 C CA  . GLY A 1 285 ? -6.447  -21.282 -44.574 1.00 16.34 ? 284 GLY A CA  1 
ATOM   2136 C C   . GLY A 1 285 ? -6.642  -22.345 -45.642 1.00 16.90 ? 284 GLY A C   1 
ATOM   2137 O O   . GLY A 1 285 ? -6.210  -23.497 -45.447 1.00 19.72 ? 284 GLY A O   1 
ATOM   2138 N N   . THR A 1 286 ? -7.374  -22.025 -46.696 1.00 18.87 ? 285 THR A N   1 
ATOM   2139 C CA  . THR A 1 286 ? -7.697  -22.985 -47.751 1.00 20.02 ? 285 THR A CA  1 
ATOM   2140 C C   . THR A 1 286 ? -7.954  -22.212 -49.020 1.00 20.08 ? 285 THR A C   1 
ATOM   2141 O O   . THR A 1 286 ? -7.833  -20.976 -49.065 1.00 19.02 ? 285 THR A O   1 
ATOM   2142 C CB  . THR A 1 286 ? -8.892  -23.912 -47.348 1.00 22.04 ? 285 THR A CB  1 
ATOM   2143 O OG1 . THR A 1 286 ? -8.984  -25.035 -48.249 1.00 23.24 ? 285 THR A OG1 1 
ATOM   2144 C CG2 . THR A 1 286 ? -10.234 -23.167 -47.279 1.00 20.80 ? 285 THR A CG2 1 
ATOM   2145 N N   . ASP A 1 287 ? -8.278  -22.929 -50.074 1.00 20.99 ? 286 ASP A N   1 
ATOM   2146 C CA  . ASP A 1 287 ? -8.553  -22.284 -51.368 1.00 19.76 ? 286 ASP A CA  1 
ATOM   2147 C C   . ASP A 1 287 ? -9.741  -22.931 -52.038 1.00 19.79 ? 286 ASP A C   1 
ATOM   2148 O O   . ASP A 1 287 ? -10.248 -24.005 -51.612 1.00 18.26 ? 286 ASP A O   1 
ATOM   2149 C CB  . ASP A 1 287 ? -7.320  -22.318 -52.278 1.00 22.23 ? 286 ASP A CB  1 
ATOM   2150 C CG  . ASP A 1 287 ? -6.900  -23.746 -52.627 1.00 26.43 ? 286 ASP A CG  1 
ATOM   2151 O OD1 . ASP A 1 287 ? -7.580  -24.431 -53.410 1.00 28.54 ? 286 ASP A OD1 1 
ATOM   2152 O OD2 . ASP A 1 287 ? -5.911  -24.218 -52.065 1.00 33.16 ? 286 ASP A OD2 1 
ATOM   2153 N N   . GLY A 1 288 ? -10.177 -22.292 -53.115 1.00 17.76 ? 287 GLY A N   1 
ATOM   2154 C CA  . GLY A 1 288 ? -11.393 -22.717 -53.765 1.00 20.48 ? 287 GLY A CA  1 
ATOM   2155 C C   . GLY A 1 288 ? -11.267 -23.880 -54.736 1.00 20.96 ? 287 GLY A C   1 
ATOM   2156 O O   . GLY A 1 288 ? -12.259 -24.222 -55.420 1.00 21.96 ? 287 GLY A O   1 
ATOM   2157 N N   . SER A 1 289 ? -10.086 -24.518 -54.828 1.00 22.97 ? 288 SER A N   1 
ATOM   2158 C CA  . SER A 1 289 ? -9.953  -25.719 -55.706 1.00 23.70 ? 288 SER A CA  1 
ATOM   2159 C C   . SER A 1 289 ? -10.983 -26.788 -55.300 1.00 21.88 ? 288 SER A C   1 
ATOM   2160 O O   . SER A 1 289 ? -11.506 -27.521 -56.150 1.00 22.95 ? 288 SER A O   1 
ATOM   2161 C CB  . SER A 1 289 ? -8.501  -26.259 -55.707 1.00 24.39 ? 288 SER A CB  1 
ATOM   2162 O OG  . SER A 1 289 ? -8.166  -26.783 -54.440 1.00 23.35 ? 288 SER A OG  1 
ATOM   2163 N N   . HIS A 1 290 ? -11.399 -26.779 -54.037 1.00 20.77 ? 289 HIS A N   1 
ATOM   2164 C CA  . HIS A 1 290 ? -12.278 -27.847 -53.516 1.00 22.27 ? 289 HIS A CA  1 
ATOM   2165 C C   . HIS A 1 290 ? -13.694 -27.756 -53.971 1.00 21.66 ? 289 HIS A C   1 
ATOM   2166 O O   . HIS A 1 290 ? -14.410 -28.728 -53.859 1.00 21.59 ? 289 HIS A O   1 
ATOM   2167 C CB  . HIS A 1 290 ? -12.193 -27.870 -51.992 1.00 23.67 ? 289 HIS A CB  1 
ATOM   2168 C CG  . HIS A 1 290 ? -10.787 -27.982 -51.513 1.00 27.18 ? 289 HIS A CG  1 
ATOM   2169 N ND1 . HIS A 1 290 ? -10.059 -29.146 -51.654 1.00 27.60 ? 289 HIS A ND1 1 
ATOM   2170 C CD2 . HIS A 1 290 ? -9.940  -27.056 -51.001 1.00 25.87 ? 289 HIS A CD2 1 
ATOM   2171 C CE1 . HIS A 1 290 ? -8.832  -28.945 -51.205 1.00 29.22 ? 289 HIS A CE1 1 
ATOM   2172 N NE2 . HIS A 1 290 ? -8.730  -27.678 -50.828 1.00 27.97 ? 289 HIS A NE2 1 
ATOM   2173 N N   . TYR A 1 291 ? -14.114 -26.622 -54.529 1.00 20.67 ? 290 TYR A N   1 
ATOM   2174 C CA  . TYR A 1 291 ? -15.413 -26.577 -55.115 1.00 21.83 ? 290 TYR A CA  1 
ATOM   2175 C C   . TYR A 1 291 ? -15.556 -27.638 -56.243 1.00 23.25 ? 290 TYR A C   1 
ATOM   2176 O O   . TYR A 1 291 ? -16.667 -27.995 -56.572 1.00 24.71 ? 290 TYR A O   1 
ATOM   2177 C CB  . TYR A 1 291 ? -15.750 -25.217 -55.669 1.00 21.61 ? 290 TYR A CB  1 
ATOM   2178 C CG  . TYR A 1 291 ? -15.991 -24.166 -54.580 1.00 21.99 ? 290 TYR A CG  1 
ATOM   2179 C CD1 . TYR A 1 291 ? -17.075 -24.243 -53.712 1.00 21.63 ? 290 TYR A CD1 1 
ATOM   2180 C CD2 . TYR A 1 291 ? -15.094 -23.096 -54.405 1.00 21.95 ? 290 TYR A CD2 1 
ATOM   2181 C CE1 . TYR A 1 291 ? -17.265 -23.285 -52.700 1.00 20.46 ? 290 TYR A CE1 1 
ATOM   2182 C CE2 . TYR A 1 291 ? -15.264 -22.173 -53.377 1.00 21.52 ? 290 TYR A CE2 1 
ATOM   2183 C CZ  . TYR A 1 291 ? -16.342 -22.271 -52.517 1.00 20.49 ? 290 TYR A CZ  1 
ATOM   2184 O OH  . TYR A 1 291 ? -16.456 -21.317 -51.525 1.00 20.02 ? 290 TYR A OH  1 
ATOM   2185 N N   . TRP A 1 292 ? -14.448 -28.059 -56.843 1.00 22.41 ? 291 TRP A N   1 
ATOM   2186 C CA  . TRP A 1 292 ? -14.441 -28.993 -57.999 1.00 23.06 ? 291 TRP A CA  1 
ATOM   2187 C C   . TRP A 1 292 ? -14.198 -30.408 -57.514 1.00 24.34 ? 291 TRP A C   1 
ATOM   2188 O O   . TRP A 1 292 ? -13.976 -31.294 -58.336 1.00 25.05 ? 291 TRP A O   1 
ATOM   2189 C CB  . TRP A 1 292 ? -13.375 -28.600 -59.034 1.00 22.78 ? 291 TRP A CB  1 
ATOM   2190 C CG  . TRP A 1 292 ? -13.771 -27.460 -59.913 1.00 24.24 ? 291 TRP A CG  1 
ATOM   2191 C CD1 . TRP A 1 292 ? -14.391 -27.544 -61.125 1.00 25.58 ? 291 TRP A CD1 1 
ATOM   2192 C CD2 . TRP A 1 292 ? -13.597 -26.053 -59.649 1.00 25.30 ? 291 TRP A CD2 1 
ATOM   2193 N NE1 . TRP A 1 292 ? -14.635 -26.291 -61.628 1.00 28.51 ? 291 TRP A NE1 1 
ATOM   2194 C CE2 . TRP A 1 292 ? -14.123 -25.354 -60.757 1.00 26.94 ? 291 TRP A CE2 1 
ATOM   2195 C CE3 . TRP A 1 292 ? -13.046 -25.319 -58.587 1.00 23.22 ? 291 TRP A CE3 1 
ATOM   2196 C CZ2 . TRP A 1 292 ? -14.142 -23.947 -60.819 1.00 27.44 ? 291 TRP A CZ2 1 
ATOM   2197 C CZ3 . TRP A 1 292 ? -13.035 -23.931 -58.669 1.00 24.18 ? 291 TRP A CZ3 1 
ATOM   2198 C CH2 . TRP A 1 292 ? -13.560 -23.252 -59.769 1.00 25.74 ? 291 TRP A CH2 1 
ATOM   2199 N N   . SER A 1 293 ? -14.264 -30.641 -56.207 1.00 22.50 ? 292 SER A N   1 
ATOM   2200 C CA  . SER A 1 293 ? -14.026 -31.974 -55.640 1.00 26.16 ? 292 SER A CA  1 
ATOM   2201 C C   . SER A 1 293 ? -15.037 -32.977 -56.205 1.00 27.11 ? 292 SER A C   1 
ATOM   2202 O O   . SER A 1 293 ? -16.226 -32.623 -56.364 1.00 24.54 ? 292 SER A O   1 
ATOM   2203 C CB  . SER A 1 293 ? -14.174 -31.951 -54.140 1.00 27.81 ? 292 SER A CB  1 
ATOM   2204 O OG  . SER A 1 293 ? -14.137 -33.250 -53.570 1.00 29.29 ? 292 SER A OG  1 
ATOM   2205 N N   . LYS A 1 294 ? -14.561 -34.218 -56.463 1.00 25.63 ? 293 LYS A N   1 
ATOM   2206 C CA  . LYS A 1 294 ? -15.451 -35.284 -56.964 1.00 28.81 ? 293 LYS A CA  1 
ATOM   2207 C C   . LYS A 1 294 ? -16.502 -35.611 -55.899 1.00 27.75 ? 293 LYS A C   1 
ATOM   2208 O O   . LYS A 1 294 ? -17.595 -36.078 -56.205 1.00 30.44 ? 293 LYS A O   1 
ATOM   2209 C CB  . LYS A 1 294 ? -14.661 -36.567 -57.377 1.00 26.50 ? 293 LYS A CB  1 
ATOM   2210 N N   . ASN A 1 295 ? -16.159 -35.357 -54.649 1.00 27.77 ? 294 ASN A N   1 
ATOM   2211 C CA  . ASN A 1 295 ? -17.064 -35.573 -53.546 1.00 24.05 ? 294 ASN A CA  1 
ATOM   2212 C C   . ASN A 1 295 ? -17.972 -34.330 -53.338 1.00 25.66 ? 294 ASN A C   1 
ATOM   2213 O O   . ASN A 1 295 ? -17.562 -33.306 -52.762 1.00 24.49 ? 294 ASN A O   1 
ATOM   2214 C CB  . ASN A 1 295 ? -16.277 -35.856 -52.299 1.00 23.87 ? 294 ASN A CB  1 
ATOM   2215 C CG  . ASN A 1 295 ? -17.184 -36.052 -51.064 1.00 24.77 ? 294 ASN A CG  1 
ATOM   2216 O OD1 . ASN A 1 295 ? -18.409 -35.975 -51.168 1.00 25.57 ? 294 ASN A OD1 1 
ATOM   2217 N ND2 . ASN A 1 295 ? -16.569 -36.268 -49.899 1.00 24.53 ? 294 ASN A ND2 1 
ATOM   2218 N N   . TRP A 1 296 ? -19.215 -34.450 -53.765 1.00 25.45 ? 295 TRP A N   1 
ATOM   2219 C CA  . TRP A 1 296 ? -20.177 -33.340 -53.673 1.00 22.20 ? 295 TRP A CA  1 
ATOM   2220 C C   . TRP A 1 296 ? -20.234 -32.748 -52.256 1.00 24.80 ? 295 TRP A C   1 
ATOM   2221 O O   . TRP A 1 296 ? -20.375 -31.516 -52.100 1.00 22.81 ? 295 TRP A O   1 
ATOM   2222 C CB  . TRP A 1 296 ? -21.582 -33.781 -54.155 1.00 22.47 ? 295 TRP A CB  1 
ATOM   2223 C CG  . TRP A 1 296 ? -22.555 -32.657 -54.207 1.00 19.37 ? 295 TRP A CG  1 
ATOM   2224 C CD1 . TRP A 1 296 ? -22.846 -31.912 -55.256 1.00 21.64 ? 295 TRP A CD1 1 
ATOM   2225 C CD2 . TRP A 1 296 ? -23.286 -32.120 -53.109 1.00 19.98 ? 295 TRP A CD2 1 
ATOM   2226 N NE1 . TRP A 1 296 ? -23.779 -30.952 -54.929 1.00 21.00 ? 295 TRP A NE1 1 
ATOM   2227 C CE2 . TRP A 1 296 ? -24.024 -31.026 -53.597 1.00 17.58 ? 295 TRP A CE2 1 
ATOM   2228 C CE3 . TRP A 1 296 ? -23.389 -32.462 -51.752 1.00 19.34 ? 295 TRP A CE3 1 
ATOM   2229 C CZ2 . TRP A 1 296 ? -24.832 -30.240 -52.789 1.00 18.13 ? 295 TRP A CZ2 1 
ATOM   2230 C CZ3 . TRP A 1 296 ? -24.234 -31.714 -50.939 1.00 18.27 ? 295 TRP A CZ3 1 
ATOM   2231 C CH2 . TRP A 1 296 ? -24.935 -30.604 -51.459 1.00 18.88 ? 295 TRP A CH2 1 
ATOM   2232 N N   . ALA A 1 297 ? -20.193 -33.609 -51.239 1.00 23.41 ? 296 ALA A N   1 
ATOM   2233 C CA  . ALA A 1 297 ? -20.426 -33.168 -49.858 1.00 25.17 ? 296 ALA A CA  1 
ATOM   2234 C C   . ALA A 1 297 ? -19.251 -32.292 -49.381 1.00 25.15 ? 296 ALA A C   1 
ATOM   2235 O O   . ALA A 1 297 ? -19.449 -31.335 -48.621 1.00 22.31 ? 296 ALA A O   1 
ATOM   2236 C CB  . ALA A 1 297 ? -20.609 -34.334 -48.912 1.00 24.16 ? 296 ALA A CB  1 
ATOM   2237 N N   . LYS A 1 298 ? -18.064 -32.621 -49.869 1.00 23.82 ? 297 LYS A N   1 
ATOM   2238 C CA  . LYS A 1 298 ? -16.865 -31.891 -49.554 1.00 23.29 ? 297 LYS A CA  1 
ATOM   2239 C C   . LYS A 1 298 ? -16.923 -30.545 -50.219 1.00 21.51 ? 297 LYS A C   1 
ATOM   2240 O O   . LYS A 1 298 ? -16.779 -29.543 -49.568 1.00 22.65 ? 297 LYS A O   1 
ATOM   2241 C CB  . LYS A 1 298 ? -15.626 -32.676 -49.958 1.00 24.89 ? 297 LYS A CB  1 
ATOM   2242 C CG  . LYS A 1 298 ? -14.359 -31.911 -49.735 1.00 25.47 ? 297 LYS A CG  1 
ATOM   2243 C CD  . LYS A 1 298 ? -13.144 -32.792 -49.948 1.00 29.02 ? 297 LYS A CD  1 
ATOM   2244 C CE  . LYS A 1 298 ? -11.884 -31.945 -49.784 1.00 31.97 ? 297 LYS A CE  1 
ATOM   2245 N NZ  . LYS A 1 298 ? -10.711 -32.635 -50.383 1.00 34.12 ? 297 LYS A NZ  1 
ATOM   2246 N N   . ALA A 1 299 ? -17.262 -30.523 -51.503 1.00 20.37 ? 298 ALA A N   1 
ATOM   2247 C CA  . ALA A 1 299 ? -17.367 -29.329 -52.229 1.00 19.44 ? 298 ALA A CA  1 
ATOM   2248 C C   . ALA A 1 299 ? -18.409 -28.381 -51.653 1.00 21.51 ? 298 ALA A C   1 
ATOM   2249 O O   . ALA A 1 299 ? -18.177 -27.177 -51.549 1.00 22.02 ? 298 ALA A O   1 
ATOM   2250 C CB  . ALA A 1 299 ? -17.656 -29.651 -53.664 1.00 22.03 ? 298 ALA A CB  1 
ATOM   2251 N N   . ALA A 1 300 ? -19.555 -28.927 -51.265 1.00 18.91 ? 299 ALA A N   1 
ATOM   2252 C CA  . ALA A 1 300 ? -20.627 -28.129 -50.684 1.00 18.18 ? 299 ALA A CA  1 
ATOM   2253 C C   . ALA A 1 300 ? -20.225 -27.518 -49.361 1.00 17.90 ? 299 ALA A C   1 
ATOM   2254 O O   . ALA A 1 300 ? -20.748 -26.481 -48.999 1.00 15.80 ? 299 ALA A O   1 
ATOM   2255 C CB  . ALA A 1 300 ? -21.924 -28.913 -50.512 1.00 16.68 ? 299 ALA A CB  1 
ATOM   2256 N N   . ALA A 1 301 ? -19.336 -28.190 -48.641 1.00 18.54 ? 300 ALA A N   1 
ATOM   2257 C CA  . ALA A 1 301 ? -18.860 -27.718 -47.361 1.00 18.00 ? 300 ALA A CA  1 
ATOM   2258 C C   . ALA A 1 301 ? -18.149 -26.361 -47.477 1.00 17.98 ? 300 ALA A C   1 
ATOM   2259 O O   . ALA A 1 301 ? -18.098 -25.637 -46.509 1.00 19.59 ? 300 ALA A O   1 
ATOM   2260 C CB  . ALA A 1 301 ? -17.951 -28.728 -46.748 1.00 19.82 ? 300 ALA A CB  1 
ATOM   2261 N N   . PHE A 1 302 ? -17.615 -26.038 -48.659 1.00 18.50 ? 301 PHE A N   1 
ATOM   2262 C CA  . PHE A 1 302 ? -16.949 -24.778 -48.936 1.00 17.90 ? 301 PHE A CA  1 
ATOM   2263 C C   . PHE A 1 302 ? -17.917 -23.650 -49.380 1.00 18.15 ? 301 PHE A C   1 
ATOM   2264 O O   . PHE A 1 302 ? -17.497 -22.485 -49.487 1.00 16.52 ? 301 PHE A O   1 
ATOM   2265 C CB  . PHE A 1 302 ? -15.866 -25.039 -50.023 1.00 19.37 ? 301 PHE A CB  1 
ATOM   2266 C CG  . PHE A 1 302 ? -14.659 -25.774 -49.496 1.00 21.91 ? 301 PHE A CG  1 
ATOM   2267 C CD1 . PHE A 1 302 ? -14.700 -27.158 -49.253 1.00 22.14 ? 301 PHE A CD1 1 
ATOM   2268 C CD2 . PHE A 1 302 ? -13.475 -25.094 -49.224 1.00 21.16 ? 301 PHE A CD2 1 
ATOM   2269 C CE1 . PHE A 1 302 ? -13.606 -27.816 -48.744 1.00 21.93 ? 301 PHE A CE1 1 
ATOM   2270 C CE2 . PHE A 1 302 ? -12.379 -25.764 -48.729 1.00 21.47 ? 301 PHE A CE2 1 
ATOM   2271 C CZ  . PHE A 1 302 ? -12.440 -27.117 -48.472 1.00 22.11 ? 301 PHE A CZ  1 
ATOM   2272 N N   . VAL A 1 303 ? -19.181 -23.969 -49.684 1.00 16.38 ? 302 VAL A N   1 
ATOM   2273 C CA  . VAL A 1 303 ? -20.113 -22.977 -50.246 1.00 17.64 ? 302 VAL A CA  1 
ATOM   2274 C C   . VAL A 1 303 ? -20.440 -21.918 -49.189 1.00 17.11 ? 302 VAL A C   1 
ATOM   2275 O O   . VAL A 1 303 ? -21.004 -22.204 -48.126 1.00 16.44 ? 302 VAL A O   1 
ATOM   2276 C CB  . VAL A 1 303 ? -21.359 -23.624 -50.840 1.00 17.89 ? 302 VAL A CB  1 
ATOM   2277 C CG1 . VAL A 1 303 ? -22.442 -22.622 -51.186 1.00 18.94 ? 302 VAL A CG1 1 
ATOM   2278 C CG2 . VAL A 1 303 ? -20.960 -24.461 -52.055 1.00 19.77 ? 302 VAL A CG2 1 
ATOM   2279 N N   . THR A 1 304 ? -20.021 -20.694 -49.490 1.00 18.63 ? 303 THR A N   1 
ATOM   2280 C CA  . THR A 1 304 ? -20.210 -19.518 -48.630 1.00 17.43 ? 303 THR A CA  1 
ATOM   2281 C C   . THR A 1 304 ? -20.006 -18.320 -49.509 1.00 16.30 ? 303 THR A C   1 
ATOM   2282 O O   . THR A 1 304 ? -19.434 -18.460 -50.627 1.00 16.21 ? 303 THR A O   1 
ATOM   2283 C CB  . THR A 1 304 ? -19.229 -19.536 -47.421 1.00 20.27 ? 303 THR A CB  1 
ATOM   2284 O OG1 . THR A 1 304 ? -19.683 -18.577 -46.479 1.00 22.57 ? 303 THR A OG1 1 
ATOM   2285 C CG2 . THR A 1 304 ? -17.779 -19.293 -47.829 1.00 20.02 ? 303 THR A CG2 1 
ATOM   2286 N N   . SER A 1 305 ? -20.492 -17.170 -49.112 1.00 15.41 ? 304 SER A N   1 
ATOM   2287 C CA  . SER A 1 305 ? -20.331 -15.940 -49.964 1.00 17.82 ? 304 SER A CA  1 
ATOM   2288 C C   . SER A 1 305 ? -19.682 -14.826 -49.184 1.00 16.79 ? 304 SER A C   1 
ATOM   2289 O O   . SER A 1 305 ? -20.072 -14.605 -48.044 1.00 17.70 ? 304 SER A O   1 
ATOM   2290 C CB  . SER A 1 305 ? -21.678 -15.428 -50.451 1.00 20.39 ? 304 SER A CB  1 
ATOM   2291 O OG  . SER A 1 305 ? -22.192 -16.363 -51.370 1.00 26.88 ? 304 SER A OG  1 
ATOM   2292 N N   . PRO A 1 306 ? -18.657 -14.178 -49.691 1.00 17.55 ? 305 PRO A N   1 
ATOM   2293 C CA  . PRO A 1 306 ? -17.993 -14.513 -50.912 1.00 17.00 ? 305 PRO A CA  1 
ATOM   2294 C C   . PRO A 1 306 ? -17.323 -15.891 -50.790 1.00 18.54 ? 305 PRO A C   1 
ATOM   2295 O O   . PRO A 1 306 ? -17.054 -16.376 -49.684 1.00 16.40 ? 305 PRO A O   1 
ATOM   2296 C CB  . PRO A 1 306 ? -17.014 -13.371 -51.138 1.00 16.68 ? 305 PRO A CB  1 
ATOM   2297 C CG  . PRO A 1 306 ? -17.456 -12.259 -50.189 1.00 17.88 ? 305 PRO A CG  1 
ATOM   2298 C CD  . PRO A 1 306 ? -18.138 -12.962 -49.060 1.00 17.20 ? 305 PRO A CD  1 
ATOM   2299 N N   . PRO A 1 307 ? -17.107 -16.535 -51.920 1.00 20.58 ? 306 PRO A N   1 
ATOM   2300 C CA  . PRO A 1 307 ? -16.503 -17.879 -51.866 1.00 18.51 ? 306 PRO A CA  1 
ATOM   2301 C C   . PRO A 1 307 ? -15.025 -17.842 -51.558 1.00 17.76 ? 306 PRO A C   1 
ATOM   2302 O O   . PRO A 1 307 ? -14.356 -16.802 -51.682 1.00 18.63 ? 306 PRO A O   1 
ATOM   2303 C CB  . PRO A 1 307 ? -16.733 -18.421 -53.290 1.00 22.16 ? 306 PRO A CB  1 
ATOM   2304 C CG  . PRO A 1 307 ? -16.823 -17.195 -54.150 1.00 20.53 ? 306 PRO A CG  1 
ATOM   2305 C CD  . PRO A 1 307 ? -17.423 -16.107 -53.300 1.00 21.15 ? 306 PRO A CD  1 
ATOM   2306 N N   . VAL A 1 308 ? -14.516 -19.001 -51.188 1.00 17.36 ? 307 VAL A N   1 
ATOM   2307 C CA  . VAL A 1 308 ? -13.105 -19.222 -51.027 1.00 19.12 ? 307 VAL A CA  1 
ATOM   2308 C C   . VAL A 1 308 ? -12.487 -19.090 -52.432 1.00 18.24 ? 307 VAL A C   1 
ATOM   2309 O O   . VAL A 1 308 ? -12.958 -19.715 -53.397 1.00 18.79 ? 307 VAL A O   1 
ATOM   2310 C CB  . VAL A 1 308 ? -12.809 -20.584 -50.397 1.00 18.68 ? 307 VAL A CB  1 
ATOM   2311 C CG1 . VAL A 1 308 ? -11.343 -20.632 -50.024 1.00 19.01 ? 307 VAL A CG1 1 
ATOM   2312 C CG2 . VAL A 1 308 ? -13.634 -20.782 -49.114 1.00 20.64 ? 307 VAL A CG2 1 
ATOM   2313 N N   . ASN A 1 309 ? -11.509 -18.222 -52.568 1.00 17.09 ? 308 ASN A N   1 
ATOM   2314 C CA  . ASN A 1 309 ? -11.037 -17.919 -53.873 1.00 18.87 ? 308 ASN A CA  1 
ATOM   2315 C C   . ASN A 1 309 ? -10.302 -19.122 -54.503 1.00 18.15 ? 308 ASN A C   1 
ATOM   2316 O O   . ASN A 1 309 ? -9.446  -19.691 -53.893 1.00 16.56 ? 308 ASN A O   1 
ATOM   2317 C CB  . ASN A 1 309 ? -10.164 -16.678 -53.863 1.00 19.69 ? 308 ASN A CB  1 
ATOM   2318 C CG  . ASN A 1 309 ? -10.005 -16.130 -55.224 1.00 22.19 ? 308 ASN A CG  1 
ATOM   2319 O OD1 . ASN A 1 309 ? -9.179  -16.592 -55.993 1.00 21.93 ? 308 ASN A OD1 1 
ATOM   2320 N ND2 . ASN A 1 309 ? -10.805 -15.133 -55.545 1.00 22.41 ? 308 ASN A ND2 1 
ATOM   2321 N N   . PRO A 1 310 ? -10.590 -19.447 -55.770 1.00 21.98 ? 309 PRO A N   1 
ATOM   2322 C CA  . PRO A 1 310 ? -9.830  -20.543 -56.443 1.00 22.97 ? 309 PRO A CA  1 
ATOM   2323 C C   . PRO A 1 310 ? -8.357  -20.244 -56.681 1.00 23.51 ? 309 PRO A C   1 
ATOM   2324 O O   . PRO A 1 310 ? -7.599  -21.177 -56.808 1.00 27.55 ? 309 PRO A O   1 
ATOM   2325 C CB  . PRO A 1 310 ? -10.572 -20.732 -57.779 1.00 25.32 ? 309 PRO A CB  1 
ATOM   2326 C CG  . PRO A 1 310 ? -11.871 -20.046 -57.608 1.00 25.68 ? 309 PRO A CG  1 
ATOM   2327 C CD  . PRO A 1 310 ? -11.619 -18.885 -56.663 1.00 23.72 ? 309 PRO A CD  1 
ATOM   2328 N N   . ASP A 1 311 ? -7.916  -18.976 -56.672 1.00 22.63 ? 310 ASP A N   1 
ATOM   2329 C CA  . ASP A 1 311 ? -6.479  -18.676 -56.868 1.00 24.47 ? 310 ASP A CA  1 
ATOM   2330 C C   . ASP A 1 311 ? -5.755  -19.014 -55.562 1.00 24.20 ? 310 ASP A C   1 
ATOM   2331 O O   . ASP A 1 311 ? -5.951  -18.353 -54.504 1.00 20.39 ? 310 ASP A O   1 
ATOM   2332 C CB  . ASP A 1 311 ? -6.321  -17.203 -57.237 1.00 24.65 ? 310 ASP A CB  1 
ATOM   2333 C CG  . ASP A 1 311 ? -4.889  -16.779 -57.448 1.00 28.09 ? 310 ASP A CG  1 
ATOM   2334 O OD1 . ASP A 1 311 ? -3.981  -17.493 -57.012 1.00 26.86 ? 310 ASP A OD1 1 
ATOM   2335 O OD2 . ASP A 1 311 ? -4.698  -15.648 -58.005 1.00 31.09 ? 310 ASP A OD2 1 
ATOM   2336 N N   . PRO A 1 312 ? -4.897  -20.020 -55.615 1.00 24.56 ? 311 PRO A N   1 
ATOM   2337 C CA  . PRO A 1 312 ? -4.220  -20.476 -54.436 1.00 24.22 ? 311 PRO A CA  1 
ATOM   2338 C C   . PRO A 1 312 ? -3.108  -19.577 -53.957 1.00 23.10 ? 311 PRO A C   1 
ATOM   2339 O O   . PRO A 1 312 ? -2.563  -19.866 -52.943 1.00 25.18 ? 311 PRO A O   1 
ATOM   2340 C CB  . PRO A 1 312 ? -3.637  -21.824 -54.877 1.00 28.31 ? 311 PRO A CB  1 
ATOM   2341 C CG  . PRO A 1 312 ? -3.286  -21.568 -56.298 1.00 30.48 ? 311 PRO A CG  1 
ATOM   2342 C CD  . PRO A 1 312 ? -4.455  -20.779 -56.819 1.00 28.89 ? 311 PRO A CD  1 
ATOM   2343 N N   . THR A 1 313 ? -2.805  -18.479 -54.632 1.00 24.11 ? 312 THR A N   1 
ATOM   2344 C CA  . THR A 1 313 ? -1.881  -17.495 -54.080 1.00 24.60 ? 312 THR A CA  1 
ATOM   2345 C C   . THR A 1 313 ? -2.612  -16.468 -53.202 1.00 22.74 ? 312 THR A C   1 
ATOM   2346 O O   . THR A 1 313 ? -1.984  -15.594 -52.607 1.00 19.04 ? 312 THR A O   1 
ATOM   2347 C CB  . THR A 1 313 ? -1.125  -16.761 -55.201 1.00 26.10 ? 312 THR A CB  1 
ATOM   2348 O OG1 . THR A 1 313 ? -2.032  -15.961 -55.974 1.00 26.38 ? 312 THR A OG1 1 
ATOM   2349 C CG2 . THR A 1 313 ? -0.420  -17.760 -56.109 1.00 28.41 ? 312 THR A CG2 1 
ATOM   2350 N N   . THR A 1 314 ? -3.931  -16.584 -53.104 1.00 20.22 ? 313 THR A N   1 
ATOM   2351 C CA  . THR A 1 314 ? -4.691  -15.607 -52.358 1.00 19.68 ? 313 THR A CA  1 
ATOM   2352 C C   . THR A 1 314 ? -4.315  -15.499 -50.890 1.00 19.16 ? 313 THR A C   1 
ATOM   2353 O O   . THR A 1 314 ? -4.138  -14.373 -50.385 1.00 18.96 ? 313 THR A O   1 
ATOM   2354 C CB  . THR A 1 314 ? -6.198  -15.912 -52.484 1.00 18.87 ? 313 THR A CB  1 
ATOM   2355 O OG1 . THR A 1 314 ? -6.554  -15.882 -53.868 1.00 18.76 ? 313 THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 314 ? -7.042  -14.909 -51.662 1.00 18.55 ? 313 THR A CG2 1 
ATOM   2357 N N   . ALA A 1 315 ? -4.300  -16.629 -50.187 1.00 17.06 ? 314 ALA A N   1 
ATOM   2358 C CA  . ALA A 1 315 ? -3.988  -16.625 -48.751 1.00 20.87 ? 314 ALA A CA  1 
ATOM   2359 C C   . ALA A 1 315 ? -2.654  -15.888 -48.394 1.00 22.23 ? 314 ALA A C   1 
ATOM   2360 O O   . ALA A 1 315 ? -2.587  -15.066 -47.468 1.00 22.45 ? 314 ALA A O   1 
ATOM   2361 C CB  . ALA A 1 315 ? -3.986  -18.061 -48.218 1.00 20.82 ? 314 ALA A CB  1 
ATOM   2362 N N   . ASP A 1 316 ? -1.621  -16.153 -49.193 1.00 21.06 ? 315 ASP A N   1 
ATOM   2363 C CA  . ASP A 1 316 ? -0.325  -15.529 -48.966 1.00 22.64 ? 315 ASP A CA  1 
ATOM   2364 C C   . ASP A 1 316 ? -0.378  -14.034 -49.171 1.00 20.37 ? 315 ASP A C   1 
ATOM   2365 O O   . ASP A 1 316 ? 0.237   -13.297 -48.428 1.00 17.38 ? 315 ASP A O   1 
ATOM   2366 C CB  . ASP A 1 316 ? 0.697   -16.195 -49.869 1.00 27.14 ? 315 ASP A CB  1 
ATOM   2367 C CG  . ASP A 1 316 ? 1.062   -17.610 -49.376 1.00 34.08 ? 315 ASP A CG  1 
ATOM   2368 O OD1 . ASP A 1 316 ? 0.822   -17.931 -48.169 1.00 43.04 ? 315 ASP A OD1 1 
ATOM   2369 O OD2 . ASP A 1 316 ? 1.536   -18.420 -50.210 1.00 43.23 ? 315 ASP A OD2 1 
ATOM   2370 N N   . HIS A 1 317 ? -1.187  -13.615 -50.152 1.00 19.06 ? 316 HIS A N   1 
ATOM   2371 C CA  . HIS A 1 317 ? -1.407  -12.214 -50.372 1.00 20.22 ? 316 HIS A CA  1 
ATOM   2372 C C   . HIS A 1 317 ? -2.125  -11.556 -49.173 1.00 19.44 ? 316 HIS A C   1 
ATOM   2373 O O   . HIS A 1 317 ? -1.714  -10.489 -48.697 1.00 16.48 ? 316 HIS A O   1 
ATOM   2374 C CB  . HIS A 1 317 ? -2.109  -11.973 -51.721 1.00 21.98 ? 316 HIS A CB  1 
ATOM   2375 C CG  . HIS A 1 317 ? -2.214  -10.528 -52.098 1.00 26.12 ? 316 HIS A CG  1 
ATOM   2376 N ND1 . HIS A 1 317 ? -1.141  -9.798  -52.536 1.00 32.72 ? 316 HIS A ND1 1 
ATOM   2377 C CD2 . HIS A 1 317 ? -3.258  -9.663  -52.058 1.00 26.93 ? 316 HIS A CD2 1 
ATOM   2378 C CE1 . HIS A 1 317 ? -1.519  -8.554  -52.782 1.00 33.36 ? 316 HIS A CE1 1 
ATOM   2379 N NE2 . HIS A 1 317 ? -2.811  -8.455  -52.526 1.00 28.85 ? 316 HIS A NE2 1 
ATOM   2380 N N   . LEU A 1 318 ? -3.174  -12.211 -48.678 1.00 17.92 ? 317 LEU A N   1 
ATOM   2381 C CA  . LEU A 1 318 ? -3.935  -11.699 -47.567 1.00 18.24 ? 317 LEU A CA  1 
ATOM   2382 C C   . LEU A 1 318 ? -3.072  -11.653 -46.340 1.00 18.44 ? 317 LEU A C   1 
ATOM   2383 O O   . LEU A 1 318 ? -3.172  -10.738 -45.577 1.00 16.36 ? 317 LEU A O   1 
ATOM   2384 C CB  . LEU A 1 318 ? -5.204  -12.487 -47.304 1.00 17.44 ? 317 LEU A CB  1 
ATOM   2385 C CG  . LEU A 1 318 ? -6.204  -12.376 -48.489 1.00 18.15 ? 317 LEU A CG  1 
ATOM   2386 C CD1 . LEU A 1 318 ? -7.383  -13.281 -48.236 1.00 19.24 ? 317 LEU A CD1 1 
ATOM   2387 C CD2 . LEU A 1 318 ? -6.659  -10.961 -48.799 1.00 20.02 ? 317 LEU A CD2 1 
ATOM   2388 N N   . THR A 1 319 ? -2.208  -12.630 -46.200 1.00 17.84 ? 318 THR A N   1 
ATOM   2389 C CA  . THR A 1 319 ? -1.295  -12.695 -45.079 1.00 19.73 ? 318 THR A CA  1 
ATOM   2390 C C   . THR A 1 319 ? -0.302  -11.540 -45.163 1.00 18.13 ? 318 THR A C   1 
ATOM   2391 O O   . THR A 1 319 ? 0.011   -10.920 -44.139 1.00 17.42 ? 318 THR A O   1 
ATOM   2392 C CB  . THR A 1 319 ? -0.600  -14.092 -45.098 1.00 22.84 ? 318 THR A CB  1 
ATOM   2393 O OG1 . THR A 1 319 ? -1.562  -15.111 -44.717 1.00 27.02 ? 318 THR A OG1 1 
ATOM   2394 C CG2 . THR A 1 319 ? 0.445   -14.143 -44.080 1.00 29.58 ? 318 THR A CG2 1 
ATOM   2395 N N   . CYS A 1 320 ? 0.241   -11.249 -46.348 1.00 17.67 ? 319 CYS A N   1 
ATOM   2396 C CA  . CYS A 1 320 ? 1.047   -10.016 -46.538 1.00 18.72 ? 319 CYS A CA  1 
ATOM   2397 C C   . CYS A 1 320 ? 0.362   -8.752  -46.104 1.00 17.44 ? 319 CYS A C   1 
ATOM   2398 O O   . CYS A 1 320 ? 1.021   -7.866  -45.508 1.00 17.00 ? 319 CYS A O   1 
ATOM   2399 C CB  . CYS A 1 320 ? 1.509   -9.859  -47.985 1.00 21.25 ? 319 CYS A CB  1 
ATOM   2400 S SG  . CYS A 1 320 ? 2.791   -11.121 -48.362 1.00 26.36 ? 319 CYS A SG  1 
ATOM   2401 N N   . LEU A 1 321 ? -0.947  -8.644  -46.366 1.00 16.13 ? 320 LEU A N   1 
ATOM   2402 C CA  . LEU A 1 321 ? -1.688  -7.398  -46.021 1.00 17.83 ? 320 LEU A CA  1 
ATOM   2403 C C   . LEU A 1 321 ? -2.114  -7.292  -44.555 1.00 16.70 ? 320 LEU A C   1 
ATOM   2404 O O   . LEU A 1 321 ? -2.270  -6.174  -44.040 1.00 17.89 ? 320 LEU A O   1 
ATOM   2405 C CB  . LEU A 1 321 ? -2.907  -7.143  -46.911 1.00 19.07 ? 320 LEU A CB  1 
ATOM   2406 C CG  . LEU A 1 321 ? -2.615  -6.987  -48.406 1.00 23.92 ? 320 LEU A CG  1 
ATOM   2407 C CD1 . LEU A 1 321 ? -3.757  -6.478  -49.290 1.00 25.45 ? 320 LEU A CD1 1 
ATOM   2408 C CD2 . LEU A 1 321 ? -1.407  -6.190  -48.742 1.00 23.69 ? 320 LEU A CD2 1 
ATOM   2409 N N   . LEU A 1 322 ? -2.258  -8.419  -43.892 1.00 17.37 ? 321 LEU A N   1 
ATOM   2410 C CA  . LEU A 1 322 ? -2.254  -8.415  -42.416 1.00 17.33 ? 321 LEU A CA  1 
ATOM   2411 C C   . LEU A 1 322 ? -0.954  -7.915  -41.853 1.00 19.90 ? 321 LEU A C   1 
ATOM   2412 O O   . LEU A 1 322 ? -0.908  -7.080  -40.934 1.00 20.14 ? 321 LEU A O   1 
ATOM   2413 C CB  . LEU A 1 322 ? -2.531  -9.828  -41.867 1.00 19.25 ? 321 LEU A CB  1 
ATOM   2414 C CG  . LEU A 1 322 ? -4.025  -10.213 -41.862 1.00 19.71 ? 321 LEU A CG  1 
ATOM   2415 C CD1 . LEU A 1 322 ? -4.134  -11.723 -41.841 1.00 20.47 ? 321 LEU A CD1 1 
ATOM   2416 C CD2 . LEU A 1 322 ? -4.848  -9.492  -40.765 1.00 18.76 ? 321 LEU A CD2 1 
ATOM   2417 N N   . SER A 1 323 ? 0.150   -8.356  -42.432 1.00 20.30 ? 322 SER A N   1 
ATOM   2418 C CA  . SER A 1 323 ? 1.477   -7.852  -42.016 1.00 22.50 ? 322 SER A CA  1 
ATOM   2419 C C   . SER A 1 323 ? 1.726   -6.403  -42.253 1.00 22.61 ? 322 SER A C   1 
ATOM   2420 O O   . SER A 1 323 ? 2.412   -5.773  -41.482 1.00 23.13 ? 322 SER A O   1 
ATOM   2421 C CB  . SER A 1 323 ? 2.605   -8.664  -42.681 1.00 24.42 ? 322 SER A CB  1 
ATOM   2422 O OG  . SER A 1 323 ? 2.260   -10.057 -42.441 1.00 32.76 ? 322 SER A OG  1 
ATOM   2423 N N   . SER A 1 324 ? 1.196   -5.861  -43.298 1.00 20.61 ? 323 SER A N   1 
ATOM   2424 C CA  . SER A 1 324 ? 1.461   -4.459  -43.595 1.00 21.28 ? 323 SER A CA  1 
ATOM   2425 C C   . SER A 1 324 ? 0.465   -3.523  -42.926 1.00 21.23 ? 323 SER A C   1 
ATOM   2426 O O   . SER A 1 324 ? 0.600   -2.321  -43.076 1.00 24.39 ? 323 SER A O   1 
ATOM   2427 C CB  . SER A 1 324 ? 1.401   -4.252  -45.085 1.00 22.93 ? 323 SER A CB  1 
ATOM   2428 O OG  . SER A 1 324 ? 0.085   -4.542  -45.527 1.00 22.75 ? 323 SER A OG  1 
ATOM   2429 N N   . GLY A 1 325 ? -0.573  -4.054  -42.262 1.00 20.06 ? 324 GLY A N   1 
ATOM   2430 C CA  . GLY A 1 325 ? -1.561  -3.221  -41.555 1.00 19.98 ? 324 GLY A CA  1 
ATOM   2431 C C   . GLY A 1 325 ? -2.744  -2.830  -42.372 1.00 19.90 ? 324 GLY A C   1 
ATOM   2432 O O   . GLY A 1 325 ? -3.596  -2.094  -41.900 1.00 19.04 ? 324 GLY A O   1 
ATOM   2433 N N   . ASP A 1 326 ? -2.821  -3.291  -43.641 1.00 17.86 ? 325 ASP A N   1 
ATOM   2434 C CA  . ASP A 1 326 ? -3.968  -2.982  -44.428 1.00 17.32 ? 325 ASP A CA  1 
ATOM   2435 C C   . ASP A 1 326 ? -5.207  -3.783  -44.022 1.00 15.38 ? 325 ASP A C   1 
ATOM   2436 O O   . ASP A 1 326 ? -6.314  -3.273  -44.165 1.00 16.79 ? 325 ASP A O   1 
ATOM   2437 C CB  . ASP A 1 326 ? -3.691  -3.126  -45.920 1.00 19.05 ? 325 ASP A CB  1 
ATOM   2438 C CG  . ASP A 1 326 ? -2.596  -2.202  -46.367 1.00 22.62 ? 325 ASP A CG  1 
ATOM   2439 O OD1 . ASP A 1 326 ? -2.729  -0.943  -46.254 1.00 26.54 ? 325 ASP A OD1 1 
ATOM   2440 O OD2 . ASP A 1 326 ? -1.534  -2.727  -46.736 1.00 26.79 ? 325 ASP A OD2 1 
ATOM   2441 N N   . LEU A 1 327 ? -5.029  -5.010  -43.540 1.00 13.51 ? 326 LEU A N   1 
ATOM   2442 C CA  . LEU A 1 327 ? -6.142  -5.829  -43.026 1.00 14.18 ? 326 LEU A CA  1 
ATOM   2443 C C   . LEU A 1 327 ? -5.842  -5.892  -41.523 1.00 14.43 ? 326 LEU A C   1 
ATOM   2444 O O   . LEU A 1 327 ? -4.699  -6.231  -41.150 1.00 17.73 ? 326 LEU A O   1 
ATOM   2445 C CB  . LEU A 1 327 ? -6.098  -7.204  -43.654 1.00 14.31 ? 326 LEU A CB  1 
ATOM   2446 C CG  . LEU A 1 327 ? -6.326  -7.233  -45.176 1.00 13.56 ? 326 LEU A CG  1 
ATOM   2447 C CD1 . LEU A 1 327 ? -6.314  -8.668  -45.653 1.00 14.47 ? 326 LEU A CD1 1 
ATOM   2448 C CD2 . LEU A 1 327 ? -7.603  -6.595  -45.628 1.00 14.69 ? 326 LEU A CD2 1 
ATOM   2449 N N   . GLN A 1 328 ? -6.766  -5.421  -40.692 1.00 13.08 ? 327 GLN A N   1 
ATOM   2450 C CA  . GLN A 1 328 ? -6.481  -5.223  -39.279 1.00 13.41 ? 327 GLN A CA  1 
ATOM   2451 C C   . GLN A 1 328 ? -7.083  -6.224  -38.301 1.00 13.33 ? 327 GLN A C   1 
ATOM   2452 O O   . GLN A 1 328 ? -6.679  -6.254  -37.136 1.00 11.03 ? 327 GLN A O   1 
ATOM   2453 C CB  . GLN A 1 328 ? -6.866  -3.835  -38.870 1.00 14.56 ? 327 GLN A CB  1 
ATOM   2454 C CG  . GLN A 1 328 ? -5.900  -2.773  -39.340 1.00 14.75 ? 327 GLN A CG  1 
ATOM   2455 C CD  . GLN A 1 328 ? -6.550  -1.394  -39.454 1.00 15.57 ? 327 GLN A CD  1 
ATOM   2456 O OE1 . GLN A 1 328 ? -7.409  -1.124  -40.329 1.00 17.58 ? 327 GLN A OE1 1 
ATOM   2457 N NE2 . GLN A 1 328 ? -6.076  -0.475  -38.646 1.00 18.47 ? 327 GLN A NE2 1 
ATOM   2458 N N   . VAL A 1 329 ? -8.107  -6.955  -38.719 1.00 13.17 ? 328 VAL A N   1 
ATOM   2459 C CA  . VAL A 1 329 ? -8.808  -7.870  -37.802 1.00 13.69 ? 328 VAL A CA  1 
ATOM   2460 C C   . VAL A 1 329 ? -9.002  -9.185  -38.499 1.00 14.26 ? 328 VAL A C   1 
ATOM   2461 O O   . VAL A 1 329 ? -9.014  -9.287  -39.762 1.00 15.27 ? 328 VAL A O   1 
ATOM   2462 C CB  . VAL A 1 329 ? -10.169 -7.315  -37.359 1.00 14.06 ? 328 VAL A CB  1 
ATOM   2463 C CG1 . VAL A 1 329 ? -9.960  -6.112  -36.497 1.00 13.25 ? 328 VAL A CG1 1 
ATOM   2464 C CG2 . VAL A 1 329 ? -11.065 -6.945  -38.567 1.00 14.18 ? 328 VAL A CG2 1 
ATOM   2465 N N   . THR A 1 330 ? -9.132  -10.225 -37.715 1.00 14.95 ? 329 THR A N   1 
ATOM   2466 C CA  . THR A 1 330 ? -9.426  -11.523 -38.284 1.00 14.20 ? 329 THR A CA  1 
ATOM   2467 C C   . THR A 1 330 ? -10.734 -12.013 -37.679 1.00 14.41 ? 329 THR A C   1 
ATOM   2468 O O   . THR A 1 330 ? -10.966 -11.922 -36.454 1.00 13.32 ? 329 THR A O   1 
ATOM   2469 C CB  . THR A 1 330 ? -8.338  -12.587 -38.004 1.00 13.57 ? 329 THR A CB  1 
ATOM   2470 O OG1 . THR A 1 330 ? -8.025  -12.657 -36.623 1.00 13.57 ? 329 THR A OG1 1 
ATOM   2471 C CG2 . THR A 1 330 ? -7.061  -12.330 -38.718 1.00 14.46 ? 329 THR A CG2 1 
ATOM   2472 N N   . GLY A 1 331 ? -11.563 -12.605 -38.500 1.00 15.70 ? 330 GLY A N   1 
ATOM   2473 C CA  . GLY A 1 331 ? -12.789 -13.289 -37.993 1.00 15.86 ? 330 GLY A CA  1 
ATOM   2474 C C   . GLY A 1 331 ? -12.923 -14.711 -38.561 1.00 14.48 ? 330 GLY A C   1 
ATOM   2475 O O   . GLY A 1 331 ? -12.068 -15.151 -39.285 1.00 15.86 ? 330 GLY A O   1 
ATOM   2476 N N   . SER A 1 332 ? -13.990 -15.410 -38.197 1.00 13.59 ? 331 SER A N   1 
ATOM   2477 C CA  . SER A 1 332 ? -14.333 -16.699 -38.751 1.00 13.44 ? 331 SER A CA  1 
ATOM   2478 C C   . SER A 1 332 ? -15.488 -16.672 -39.762 1.00 15.54 ? 331 SER A C   1 
ATOM   2479 O O   . SER A 1 332 ? -15.513 -17.497 -40.720 1.00 14.14 ? 331 SER A O   1 
ATOM   2480 C CB  . SER A 1 332 ? -14.613 -17.716 -37.683 1.00 14.54 ? 331 SER A CB  1 
ATOM   2481 O OG  . SER A 1 332 ? -15.764 -17.451 -36.974 1.00 13.35 ? 331 SER A OG  1 
ATOM   2482 N N   . ALA A 1 333 ? -16.453 -15.768 -39.558 1.00 15.66 ? 332 ALA A N   1 
ATOM   2483 C CA  . ALA A 1 333 ? -17.796 -15.858 -40.166 1.00 15.74 ? 332 ALA A CA  1 
ATOM   2484 C C   . ALA A 1 333 ? -18.409 -17.209 -39.984 1.00 15.77 ? 332 ALA A C   1 
ATOM   2485 O O   . ALA A 1 333 ? -19.167 -17.668 -40.843 1.00 18.98 ? 332 ALA A O   1 
ATOM   2486 C CB  . ALA A 1 333 ? -17.780 -15.480 -41.639 1.00 16.31 ? 332 ALA A CB  1 
ATOM   2487 N N   . HIS A 1 334 ? -18.140 -17.840 -38.863 1.00 14.86 ? 333 HIS A N   1 
ATOM   2488 C CA  . HIS A 1 334 ? -18.542 -19.238 -38.660 1.00 14.78 ? 333 HIS A CA  1 
ATOM   2489 C C   . HIS A 1 334 ? -20.063 -19.398 -38.787 1.00 15.07 ? 333 HIS A C   1 
ATOM   2490 O O   . HIS A 1 334 ? -20.821 -18.791 -38.036 1.00 13.49 ? 333 HIS A O   1 
ATOM   2491 C CB  . HIS A 1 334 ? -18.127 -19.683 -37.264 1.00 16.67 ? 333 HIS A CB  1 
ATOM   2492 C CG  . HIS A 1 334 ? -18.280 -21.143 -37.026 1.00 15.65 ? 333 HIS A CG  1 
ATOM   2493 N ND1 . HIS A 1 334 ? -17.228 -22.016 -37.171 1.00 15.23 ? 333 HIS A ND1 1 
ATOM   2494 C CD2 . HIS A 1 334 ? -19.345 -21.887 -36.636 1.00 16.99 ? 333 HIS A CD2 1 
ATOM   2495 C CE1 . HIS A 1 334 ? -17.629 -23.237 -36.849 1.00 16.92 ? 333 HIS A CE1 1 
ATOM   2496 N NE2 . HIS A 1 334 ? -18.913 -23.183 -36.529 1.00 15.24 ? 333 HIS A NE2 1 
ATOM   2497 N N   . CYS A 1 335 ? -20.471 -20.299 -39.650 1.00 15.79 ? 334 CYS A N   1 
ATOM   2498 C CA  . CYS A 1 335 ? -21.894 -20.485 -39.988 1.00 16.89 ? 334 CYS A CA  1 
ATOM   2499 C C   . CYS A 1 335 ? -22.018 -21.832 -40.631 1.00 17.03 ? 334 CYS A C   1 
ATOM   2500 O O   . CYS A 1 335 ? -21.867 -21.961 -41.836 1.00 16.47 ? 334 CYS A O   1 
ATOM   2501 C CB  . CYS A 1 335 ? -22.450 -19.348 -40.882 1.00 17.11 ? 334 CYS A CB  1 
ATOM   2502 S SG  . CYS A 1 335 ? -24.307 -19.457 -40.928 1.00 20.61 ? 334 CYS A SG  1 
ATOM   2503 N N   . THR A 1 336 ? -22.227 -22.852 -39.806 1.00 16.69 ? 335 THR A N   1 
ATOM   2504 C CA  . THR A 1 336 ? -22.134 -24.209 -40.308 1.00 18.34 ? 335 THR A CA  1 
ATOM   2505 C C   . THR A 1 336 ? -23.470 -24.936 -40.536 1.00 18.91 ? 335 THR A C   1 
ATOM   2506 O O   . THR A 1 336 ? -24.446 -24.682 -39.852 1.00 19.04 ? 335 THR A O   1 
ATOM   2507 C CB  . THR A 1 336 ? -21.232 -25.084 -39.415 1.00 17.91 ? 335 THR A CB  1 
ATOM   2508 O OG1 . THR A 1 336 ? -21.678 -24.986 -38.090 1.00 17.22 ? 335 THR A OG1 1 
ATOM   2509 C CG2 . THR A 1 336 ? -19.771 -24.621 -39.539 1.00 18.55 ? 335 THR A CG2 1 
ATOM   2510 N N   . PHE A 1 337 ? -23.445 -25.827 -41.522 1.00 19.56 ? 336 PHE A N   1 
ATOM   2511 C CA  . PHE A 1 337 ? -24.607 -26.643 -41.902 1.00 18.36 ? 336 PHE A CA  1 
ATOM   2512 C C   . PHE A 1 337 ? -24.088 -28.051 -42.167 1.00 17.01 ? 336 PHE A C   1 
ATOM   2513 O O   . PHE A 1 337 ? -22.982 -28.265 -42.688 1.00 19.21 ? 336 PHE A O   1 
ATOM   2514 C CB  . PHE A 1 337 ? -25.281 -26.048 -43.143 1.00 19.34 ? 336 PHE A CB  1 
ATOM   2515 C CG  . PHE A 1 337 ? -25.829 -24.671 -42.877 1.00 17.93 ? 336 PHE A CG  1 
ATOM   2516 C CD1 . PHE A 1 337 ? -26.998 -24.500 -42.155 1.00 18.61 ? 336 PHE A CD1 1 
ATOM   2517 C CD2 . PHE A 1 337 ? -25.093 -23.570 -43.213 1.00 17.22 ? 336 PHE A CD2 1 
ATOM   2518 C CE1 . PHE A 1 337 ? -27.488 -23.250 -41.827 1.00 16.78 ? 336 PHE A CE1 1 
ATOM   2519 C CE2 . PHE A 1 337 ? -25.575 -22.281 -42.871 1.00 18.62 ? 336 PHE A CE2 1 
ATOM   2520 C CZ  . PHE A 1 337 ? -26.737 -22.128 -42.155 1.00 17.24 ? 336 PHE A CZ  1 
ATOM   2521 N N   . THR A 1 338 ? -24.862 -29.026 -41.765 1.00 17.78 ? 337 THR A N   1 
ATOM   2522 C CA  . THR A 1 338 ? -24.504 -30.407 -41.992 1.00 17.68 ? 337 THR A CA  1 
ATOM   2523 C C   . THR A 1 338 ? -24.555 -30.726 -43.463 1.00 17.33 ? 337 THR A C   1 
ATOM   2524 O O   . THR A 1 338 ? -25.175 -29.982 -44.264 1.00 18.50 ? 337 THR A O   1 
ATOM   2525 C CB  . THR A 1 338 ? -25.455 -31.351 -41.280 1.00 19.16 ? 337 THR A CB  1 
ATOM   2526 O OG1 . THR A 1 338 ? -26.781 -31.163 -41.783 1.00 20.41 ? 337 THR A OG1 1 
ATOM   2527 C CG2 . THR A 1 338 ? -25.446 -31.096 -39.787 1.00 19.48 ? 337 THR A CG2 1 
ATOM   2528 N N   . THR A 1 339 ? -23.982 -31.861 -43.820 1.00 18.00 ? 338 THR A N   1 
ATOM   2529 C CA  . THR A 1 339 ? -24.143 -32.398 -45.168 1.00 19.54 ? 338 THR A CA  1 
ATOM   2530 C C   . THR A 1 339 ? -25.611 -32.523 -45.587 1.00 20.67 ? 338 THR A C   1 
ATOM   2531 O O   . THR A 1 339 ? -25.960 -32.115 -46.716 1.00 21.22 ? 338 THR A O   1 
ATOM   2532 C CB  . THR A 1 339 ? -23.328 -33.742 -45.344 1.00 19.78 ? 338 THR A CB  1 
ATOM   2533 O OG1 . THR A 1 339 ? -21.934 -33.463 -45.123 1.00 21.06 ? 338 THR A OG1 1 
ATOM   2534 C CG2 . THR A 1 339 ? -23.549 -34.385 -46.725 1.00 21.15 ? 338 THR A CG2 1 
ATOM   2535 N N   . ALA A 1 340 ? -26.493 -33.004 -44.700 1.00 20.09 ? 339 ALA A N   1 
ATOM   2536 C CA  . ALA A 1 340 ? -27.922 -33.118 -45.047 1.00 22.82 ? 339 ALA A CA  1 
ATOM   2537 C C   . ALA A 1 340 ? -28.515 -31.733 -45.376 1.00 22.93 ? 339 ALA A C   1 
ATOM   2538 O O   . ALA A 1 340 ? -29.313 -31.592 -46.312 1.00 21.24 ? 339 ALA A O   1 
ATOM   2539 C CB  . ALA A 1 340 ? -28.726 -33.752 -43.892 1.00 21.04 ? 339 ALA A CB  1 
ATOM   2540 N N   . GLN A 1 341 ? -28.177 -30.746 -44.538 1.00 19.99 ? 340 GLN A N   1 
ATOM   2541 C CA  . GLN A 1 341 ? -28.576 -29.348 -44.796 1.00 19.16 ? 340 GLN A CA  1 
ATOM   2542 C C   . GLN A 1 341 ? -28.049 -28.768 -46.111 1.00 19.93 ? 340 GLN A C   1 
ATOM   2543 O O   . GLN A 1 341 ? -28.811 -28.137 -46.876 1.00 19.97 ? 340 GLN A O   1 
ATOM   2544 C CB  . GLN A 1 341 ? -28.135 -28.504 -43.632 1.00 20.11 ? 340 GLN A CB  1 
ATOM   2545 C CG  . GLN A 1 341 ? -28.946 -28.735 -42.377 1.00 17.92 ? 340 GLN A CG  1 
ATOM   2546 C CD  . GLN A 1 341 ? -28.525 -27.848 -41.219 1.00 18.77 ? 340 GLN A CD  1 
ATOM   2547 O OE1 . GLN A 1 341 ? -27.393 -27.952 -40.734 1.00 18.47 ? 340 GLN A OE1 1 
ATOM   2548 N NE2 . GLN A 1 341 ? -29.453 -27.008 -40.724 1.00 19.18 ? 340 GLN A NE2 1 
ATOM   2549 N N   . LYS A 1 342 ? -26.757 -28.936 -46.357 1.00 17.66 ? 341 LYS A N   1 
ATOM   2550 C CA  . LYS A 1 342 ? -26.181 -28.535 -47.632 1.00 19.41 ? 341 LYS A CA  1 
ATOM   2551 C C   . LYS A 1 342 ? -26.942 -29.241 -48.813 1.00 21.43 ? 341 LYS A C   1 
ATOM   2552 O O   . LYS A 1 342 ? -27.178 -28.615 -49.833 1.00 19.58 ? 341 LYS A O   1 
ATOM   2553 C CB  . LYS A 1 342 ? -24.700 -28.854 -47.692 1.00 17.62 ? 341 LYS A CB  1 
ATOM   2554 C CG  . LYS A 1 342 ? -23.801 -28.106 -46.694 1.00 18.29 ? 341 LYS A CG  1 
ATOM   2555 C CD  . LYS A 1 342 ? -23.616 -26.664 -47.110 1.00 18.81 ? 341 LYS A CD  1 
ATOM   2556 C CE  . LYS A 1 342 ? -22.627 -25.883 -46.230 1.00 17.81 ? 341 LYS A CE  1 
ATOM   2557 N NZ  . LYS A 1 342 ? -22.369 -24.566 -46.871 1.00 18.10 ? 341 LYS A NZ  1 
ATOM   2558 N N   . ALA A 1 343 ? -27.345 -30.510 -48.615 1.00 21.67 ? 342 ALA A N   1 
ATOM   2559 C CA  . ALA A 1 343 ? -27.884 -31.376 -49.681 1.00 21.96 ? 342 ALA A CA  1 
ATOM   2560 C C   . ALA A 1 343 ? -29.252 -30.995 -50.249 1.00 24.70 ? 342 ALA A C   1 
ATOM   2561 O O   . ALA A 1 343 ? -29.651 -31.513 -51.340 1.00 25.99 ? 342 ALA A O   1 
ATOM   2562 C CB  . ALA A 1 343 ? -27.865 -32.880 -49.246 1.00 22.81 ? 342 ALA A CB  1 
ATOM   2563 N N   . VAL A 1 344 ? -29.946 -30.076 -49.599 1.00 22.31 ? 343 VAL A N   1 
ATOM   2564 C CA  . VAL A 1 344 ? -31.096 -29.478 -50.239 1.00 25.36 ? 343 VAL A CA  1 
ATOM   2565 C C   . VAL A 1 344 ? -30.710 -28.822 -51.555 1.00 23.53 ? 343 VAL A C   1 
ATOM   2566 O O   . VAL A 1 344 ? -31.584 -28.630 -52.413 1.00 24.58 ? 343 VAL A O   1 
ATOM   2567 C CB  . VAL A 1 344 ? -31.867 -28.492 -49.342 1.00 25.90 ? 343 VAL A CB  1 
ATOM   2568 C CG1 . VAL A 1 344 ? -32.362 -29.192 -48.088 1.00 27.94 ? 343 VAL A CG1 1 
ATOM   2569 C CG2 . VAL A 1 344 ? -31.093 -27.280 -48.991 1.00 25.46 ? 343 VAL A CG2 1 
ATOM   2570 N N   . GLY A 1 345 ? -29.434 -28.461 -51.712 1.00 21.41 ? 344 GLY A N   1 
ATOM   2571 C CA  . GLY A 1 345 ? -28.930 -27.915 -52.958 1.00 24.02 ? 344 GLY A CA  1 
ATOM   2572 C C   . GLY A 1 345 ? -28.231 -28.911 -53.820 1.00 21.12 ? 344 GLY A C   1 
ATOM   2573 O O   . GLY A 1 345 ? -27.459 -28.506 -54.711 1.00 24.02 ? 344 GLY A O   1 
ATOM   2574 N N   . LYS A 1 346 ? -28.492 -30.206 -53.629 1.00 24.10 ? 345 LYS A N   1 
ATOM   2575 C CA  . LYS A 1 346 ? -27.801 -31.237 -54.446 1.00 25.92 ? 345 LYS A CA  1 
ATOM   2576 C C   . LYS A 1 346 ? -27.964 -31.027 -55.964 1.00 24.63 ? 345 LYS A C   1 
ATOM   2577 O O   . LYS A 1 346 ? -27.025 -31.285 -56.733 1.00 25.73 ? 345 LYS A O   1 
ATOM   2578 C CB  . LYS A 1 346 ? -28.160 -32.692 -54.030 1.00 31.50 ? 345 LYS A CB  1 
ATOM   2579 C CG  . LYS A 1 346 ? -29.618 -33.129 -54.200 1.00 33.41 ? 345 LYS A CG  1 
ATOM   2580 N N   . ASP A 1 347 ? -29.118 -30.513 -56.354 1.00 26.63 ? 346 ASP A N   1 
ATOM   2581 C CA  . ASP A 1 347 ? -29.486 -30.312 -57.780 1.00 28.21 ? 346 ASP A CA  1 
ATOM   2582 C C   . ASP A 1 347 ? -29.377 -28.861 -58.275 1.00 29.59 ? 346 ASP A C   1 
ATOM   2583 O O   . ASP A 1 347 ? -29.621 -28.578 -59.489 1.00 27.01 ? 346 ASP A O   1 
ATOM   2584 C CB  . ASP A 1 347 ? -30.945 -30.796 -57.989 1.00 31.95 ? 346 ASP A CB  1 
ATOM   2585 C CG  . ASP A 1 347 ? -31.087 -32.292 -57.730 1.00 36.84 ? 346 ASP A CG  1 
ATOM   2586 O OD1 . ASP A 1 347 ? -30.129 -33.055 -58.012 1.00 36.84 ? 346 ASP A OD1 1 
ATOM   2587 O OD2 . ASP A 1 347 ? -32.141 -32.694 -57.202 1.00 48.49 ? 346 ASP A OD2 1 
ATOM   2588 N N   . ASN A 1 348 ? -29.010 -27.945 -57.371 1.00 24.23 ? 347 ASN A N   1 
ATOM   2589 C CA  . ASN A 1 348 ? -28.956 -26.549 -57.693 1.00 21.13 ? 347 ASN A CA  1 
ATOM   2590 C C   . ASN A 1 348 ? -28.129 -25.825 -56.661 1.00 21.58 ? 347 ASN A C   1 
ATOM   2591 O O   . ASN A 1 348 ? -28.585 -25.622 -55.519 1.00 23.53 ? 347 ASN A O   1 
ATOM   2592 C CB  . ASN A 1 348 ? -30.349 -26.011 -57.748 1.00 22.00 ? 347 ASN A CB  1 
ATOM   2593 C CG  . ASN A 1 348 ? -30.412 -24.553 -58.090 1.00 23.22 ? 347 ASN A CG  1 
ATOM   2594 O OD1 . ASN A 1 348 ? -29.404 -23.814 -58.102 1.00 23.91 ? 347 ASN A OD1 1 
ATOM   2595 N ND2 . ASN A 1 348 ? -31.592 -24.121 -58.390 1.00 25.33 ? 347 ASN A ND2 1 
ATOM   2596 N N   . PHE A 1 349 ? -26.919 -25.436 -57.056 1.00 21.09 ? 348 PHE A N   1 
ATOM   2597 C CA  . PHE A 1 349 ? -25.990 -24.810 -56.121 1.00 21.55 ? 348 PHE A CA  1 
ATOM   2598 C C   . PHE A 1 349 ? -26.579 -23.603 -55.427 1.00 21.69 ? 348 PHE A C   1 
ATOM   2599 O O   . PHE A 1 349 ? -26.239 -23.315 -54.300 1.00 21.49 ? 348 PHE A O   1 
ATOM   2600 C CB  . PHE A 1 349 ? -24.658 -24.425 -56.777 1.00 21.93 ? 348 PHE A CB  1 
ATOM   2601 C CG  . PHE A 1 349 ? -24.780 -23.371 -57.810 1.00 20.87 ? 348 PHE A CG  1 
ATOM   2602 C CD1 . PHE A 1 349 ? -24.813 -22.038 -57.450 1.00 22.03 ? 348 PHE A CD1 1 
ATOM   2603 C CD2 . PHE A 1 349 ? -24.852 -23.705 -59.130 1.00 23.10 ? 348 PHE A CD2 1 
ATOM   2604 C CE1 . PHE A 1 349 ? -24.891 -21.040 -58.399 1.00 24.03 ? 348 PHE A CE1 1 
ATOM   2605 C CE2 . PHE A 1 349 ? -24.953 -22.695 -60.088 1.00 24.05 ? 348 PHE A CE2 1 
ATOM   2606 C CZ  . PHE A 1 349 ? -25.005 -21.375 -59.718 1.00 22.94 ? 348 PHE A CZ  1 
ATOM   2607 N N   . ALA A 1 350 ? -27.482 -22.921 -56.095 1.00 20.84 ? 349 ALA A N   1 
ATOM   2608 C CA  . ALA A 1 350 ? -28.080 -21.707 -55.517 1.00 21.80 ? 349 ALA A CA  1 
ATOM   2609 C C   . ALA A 1 350 ? -29.001 -21.996 -54.346 1.00 21.26 ? 349 ALA A C   1 
ATOM   2610 O O   . ALA A 1 350 ? -29.400 -21.098 -53.659 1.00 21.00 ? 349 ALA A O   1 
ATOM   2611 C CB  . ALA A 1 350 ? -28.834 -20.974 -56.555 1.00 22.09 ? 349 ALA A CB  1 
ATOM   2612 N N   . LEU A 1 351 ? -29.324 -23.266 -54.124 1.00 23.08 ? 350 LEU A N   1 
ATOM   2613 C CA  . LEU A 1 351 ? -30.168 -23.661 -53.008 1.00 23.11 ? 350 LEU A CA  1 
ATOM   2614 C C   . LEU A 1 351 ? -29.356 -24.271 -51.906 1.00 22.34 ? 350 LEU A C   1 
ATOM   2615 O O   . LEU A 1 351 ? -29.926 -24.769 -50.922 1.00 22.26 ? 350 LEU A O   1 
ATOM   2616 C CB  . LEU A 1 351 ? -31.201 -24.697 -53.453 1.00 24.61 ? 350 LEU A CB  1 
ATOM   2617 C CG  . LEU A 1 351 ? -32.193 -24.253 -54.537 1.00 27.49 ? 350 LEU A CG  1 
ATOM   2618 C CD1 . LEU A 1 351 ? -33.100 -25.439 -54.908 1.00 26.52 ? 350 LEU A CD1 1 
ATOM   2619 C CD2 . LEU A 1 351 ? -32.969 -23.066 -54.052 1.00 26.76 ? 350 LEU A CD2 1 
ATOM   2620 N N   . ILE A 1 352 ? -28.034 -24.290 -52.057 1.00 20.52 ? 351 ILE A N   1 
ATOM   2621 C CA  . ILE A 1 352 ? -27.184 -24.793 -50.959 1.00 20.09 ? 351 ILE A CA  1 
ATOM   2622 C C   . ILE A 1 352 ? -27.116 -23.698 -49.879 1.00 20.39 ? 351 ILE A C   1 
ATOM   2623 O O   . ILE A 1 352 ? -26.695 -22.591 -50.182 1.00 21.47 ? 351 ILE A O   1 
ATOM   2624 C CB  . ILE A 1 352 ? -25.769 -25.085 -51.458 1.00 19.24 ? 351 ILE A CB  1 
ATOM   2625 C CG1 . ILE A 1 352 ? -25.746 -26.154 -52.582 1.00 19.70 ? 351 ILE A CG1 1 
ATOM   2626 C CG2 . ILE A 1 352 ? -24.870 -25.467 -50.305 1.00 19.65 ? 351 ILE A CG2 1 
ATOM   2627 C CD1 . ILE A 1 352 ? -24.393 -26.353 -53.236 1.00 19.78 ? 351 ILE A CD1 1 
ATOM   2628 N N   . PRO A 1 353 ? -27.465 -23.969 -48.617 1.00 19.52 ? 352 PRO A N   1 
ATOM   2629 C CA  . PRO A 1 353 ? -27.246 -22.933 -47.613 1.00 19.30 ? 352 PRO A CA  1 
ATOM   2630 C C   . PRO A 1 353 ? -25.755 -22.558 -47.454 1.00 19.87 ? 352 PRO A C   1 
ATOM   2631 O O   . PRO A 1 353 ? -24.880 -23.415 -47.246 1.00 19.32 ? 352 PRO A O   1 
ATOM   2632 C CB  . PRO A 1 353 ? -27.740 -23.567 -46.321 1.00 19.28 ? 352 PRO A CB  1 
ATOM   2633 C CG  . PRO A 1 353 ? -27.656 -24.996 -46.548 1.00 20.38 ? 352 PRO A CG  1 
ATOM   2634 C CD  . PRO A 1 353 ? -27.977 -25.186 -47.998 1.00 20.04 ? 352 PRO A CD  1 
ATOM   2635 N N   . GLU A 1 354 ? -25.498 -21.263 -47.603 1.00 19.60 ? 353 GLU A N   1 
ATOM   2636 C CA  . GLU A 1 354 ? -24.156 -20.700 -47.560 1.00 19.34 ? 353 GLU A CA  1 
ATOM   2637 C C   . GLU A 1 354 ? -23.614 -20.645 -46.154 1.00 19.56 ? 353 GLU A C   1 
ATOM   2638 O O   . GLU A 1 354 ? -24.303 -20.168 -45.219 1.00 19.49 ? 353 GLU A O   1 
ATOM   2639 C CB  . GLU A 1 354 ? -24.229 -19.260 -48.049 1.00 23.24 ? 353 GLU A CB  1 
ATOM   2640 C CG  . GLU A 1 354 ? -24.492 -19.127 -49.517 1.00 27.27 ? 353 GLU A CG  1 
ATOM   2641 C CD  . GLU A 1 354 ? -24.683 -17.658 -49.903 1.00 32.70 ? 353 GLU A CD  1 
ATOM   2642 O OE1 . GLU A 1 354 ? -24.813 -16.813 -48.976 1.00 32.76 ? 353 GLU A OE1 1 
ATOM   2643 O OE2 . GLU A 1 354 ? -24.628 -17.349 -51.122 1.00 35.68 ? 353 GLU A OE2 1 
ATOM   2644 N N   . GLY A 1 355 ? -22.374 -21.105 -45.986 1.00 17.23 ? 354 GLY A N   1 
ATOM   2645 C CA  . GLY A 1 355 ? -21.692 -20.900 -44.738 1.00 17.62 ? 354 GLY A CA  1 
ATOM   2646 C C   . GLY A 1 355 ? -20.673 -21.955 -44.508 1.00 18.04 ? 354 GLY A C   1 
ATOM   2647 O O   . GLY A 1 355 ? -20.843 -23.120 -44.927 1.00 18.55 ? 354 GLY A O   1 
ATOM   2648 N N   . THR A 1 356 ? -19.608 -21.574 -43.827 1.00 19.14 ? 355 THR A N   1 
ATOM   2649 C CA  . THR A 1 356 ? -18.567 -22.519 -43.536 1.00 20.36 ? 355 THR A CA  1 
ATOM   2650 C C   . THR A 1 356 ? -17.967 -22.399 -42.148 1.00 19.64 ? 355 THR A C   1 
ATOM   2651 O O   . THR A 1 356 ? -18.364 -21.528 -41.379 1.00 17.77 ? 355 THR A O   1 
ATOM   2652 C CB  . THR A 1 356 ? -17.495 -22.561 -44.664 1.00 24.93 ? 355 THR A CB  1 
ATOM   2653 O OG1 . THR A 1 356 ? -16.910 -23.869 -44.599 1.00 32.39 ? 355 THR A OG1 1 
ATOM   2654 C CG2 . THR A 1 356 ? -16.455 -21.524 -44.476 1.00 26.44 ? 355 THR A CG2 1 
ATOM   2655 N N   . ASN A 1 357 ? -17.077 -23.329 -41.794 1.00 17.42 ? 356 ASN A N   1 
ATOM   2656 C CA  . ASN A 1 357 ? -16.397 -23.276 -40.475 1.00 18.33 ? 356 ASN A CA  1 
ATOM   2657 C C   . ASN A 1 357 ? -15.186 -22.306 -40.390 1.00 18.02 ? 356 ASN A C   1 
ATOM   2658 O O   . ASN A 1 357 ? -14.680 -21.809 -41.406 1.00 18.90 ? 356 ASN A O   1 
ATOM   2659 C CB  . ASN A 1 357 ? -16.003 -24.662 -39.944 1.00 18.80 ? 356 ASN A CB  1 
ATOM   2660 C CG  . ASN A 1 357 ? -14.900 -25.337 -40.719 1.00 19.05 ? 356 ASN A CG  1 
ATOM   2661 O OD1 . ASN A 1 357 ? -15.125 -25.913 -41.779 1.00 16.76 ? 356 ASN A OD1 1 
ATOM   2662 N ND2 . ASN A 1 357 ? -13.690 -25.341 -40.143 1.00 19.64 ? 356 ASN A ND2 1 
ATOM   2663 N N   . GLY A 1 358 ? -14.689 -22.145 -39.181 1.00 17.33 ? 357 GLY A N   1 
ATOM   2664 C CA  . GLY A 1 358 ? -13.529 -21.333 -38.914 1.00 15.89 ? 357 GLY A CA  1 
ATOM   2665 C C   . GLY A 1 358 ? -13.316 -20.826 -37.500 1.00 15.56 ? 357 GLY A C   1 
ATOM   2666 O O   . GLY A 1 358 ? -12.268 -20.263 -37.204 1.00 16.85 ? 357 GLY A O   1 
ATOM   2667 N N   . ILE A 1 359 ? -14.281 -20.982 -36.608 1.00 15.25 ? 358 ILE A N   1 
ATOM   2668 C CA  . ILE A 1 359 ? -14.221 -20.336 -35.309 1.00 14.38 ? 358 ILE A CA  1 
ATOM   2669 C C   . ILE A 1 359 ? -13.134 -20.964 -34.468 1.00 15.61 ? 358 ILE A C   1 
ATOM   2670 O O   . ILE A 1 359 ? -12.374 -20.254 -33.745 1.00 16.86 ? 358 ILE A O   1 
ATOM   2671 C CB  . ILE A 1 359 ? -15.583 -20.353 -34.605 1.00 14.73 ? 358 ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 359 ? -15.688 -19.319 -33.498 1.00 15.03 ? 358 ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 359 ? -15.930 -21.729 -34.044 1.00 16.61 ? 358 ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 359 ? -17.073 -19.301 -32.898 1.00 16.62 ? 358 ILE A CD1 1 
ATOM   2675 N N   . GLU A 1 360 ? -12.972 -22.274 -34.604 1.00 15.56 ? 359 GLU A N   1 
ATOM   2676 C CA  . GLU A 1 360 ? -12.059 -22.988 -33.742 1.00 15.40 ? 359 GLU A CA  1 
ATOM   2677 C C   . GLU A 1 360 ? -10.630 -22.817 -34.219 1.00 17.88 ? 359 GLU A C   1 
ATOM   2678 O O   . GLU A 1 360 ? -9.702  -22.840 -33.423 1.00 17.61 ? 359 GLU A O   1 
ATOM   2679 C CB  . GLU A 1 360 ? -12.373 -24.493 -33.709 1.00 16.96 ? 359 GLU A CB  1 
ATOM   2680 C CG  . GLU A 1 360 ? -11.586 -25.255 -32.648 1.00 20.86 ? 359 GLU A CG  1 
ATOM   2681 C CD  . GLU A 1 360 ? -12.031 -26.736 -32.514 1.00 25.72 ? 359 GLU A CD  1 
ATOM   2682 O OE1 . GLU A 1 360 ? -13.012 -27.174 -33.195 1.00 26.26 ? 359 GLU A OE1 1 
ATOM   2683 O OE2 . GLU A 1 360 ? -11.432 -27.429 -31.673 1.00 27.35 ? 359 GLU A OE2 1 
ATOM   2684 N N   . GLU A 1 361 ? -10.446 -22.727 -35.523 1.00 17.26 ? 360 GLU A N   1 
ATOM   2685 C CA  . GLU A 1 361 ? -9.098  -22.733 -36.157 1.00 17.75 ? 360 GLU A CA  1 
ATOM   2686 C C   . GLU A 1 361 ? -8.459  -21.342 -36.285 1.00 16.81 ? 360 GLU A C   1 
ATOM   2687 O O   . GLU A 1 361 ? -7.275  -21.232 -36.627 1.00 17.84 ? 360 GLU A O   1 
ATOM   2688 C CB  . GLU A 1 361 ? -9.243  -23.330 -37.547 1.00 17.16 ? 360 GLU A CB  1 
ATOM   2689 C CG  . GLU A 1 361 ? -9.635  -24.805 -37.598 1.00 18.25 ? 360 GLU A CG  1 
ATOM   2690 C CD  . GLU A 1 361 ? -11.152 -25.078 -37.524 1.00 20.83 ? 360 GLU A CD  1 
ATOM   2691 O OE1 . GLU A 1 361 ? -11.932 -24.160 -37.801 1.00 20.18 ? 360 GLU A OE1 1 
ATOM   2692 O OE2 . GLU A 1 361 ? -11.563 -26.246 -37.197 1.00 23.79 ? 360 GLU A OE2 1 
ATOM   2693 N N   . ARG A 1 362 ? -9.234  -20.277 -36.049 1.00 16.50 ? 361 ARG A N   1 
ATOM   2694 C CA  . ARG A 1 362 ? -8.760  -18.905 -36.348 1.00 16.14 ? 361 ARG A CA  1 
ATOM   2695 C C   . ARG A 1 362 ? -7.408  -18.581 -35.734 1.00 16.56 ? 361 ARG A C   1 
ATOM   2696 O O   . ARG A 1 362 ? -6.522  -18.258 -36.461 1.00 14.65 ? 361 ARG A O   1 
ATOM   2697 C CB  . ARG A 1 362 ? -9.770  -17.871 -35.914 1.00 15.46 ? 361 ARG A CB  1 
ATOM   2698 C CG  . ARG A 1 362 ? -9.399  -16.446 -36.354 1.00 16.08 ? 361 ARG A CG  1 
ATOM   2699 C CD  . ARG A 1 362 ? -10.501 -15.502 -35.993 1.00 15.64 ? 361 ARG A CD  1 
ATOM   2700 N NE  . ARG A 1 362 ? -10.635 -15.487 -34.536 1.00 15.36 ? 361 ARG A NE  1 
ATOM   2701 C CZ  . ARG A 1 362 ? -10.154 -14.554 -33.712 1.00 16.10 ? 361 ARG A CZ  1 
ATOM   2702 N NH1 . ARG A 1 362 ? -9.510  -13.467 -34.134 1.00 14.51 ? 361 ARG A NH1 1 
ATOM   2703 N NH2 . ARG A 1 362 ? -10.304 -14.723 -32.417 1.00 15.05 ? 361 ARG A NH2 1 
ATOM   2704 N N   . MET A 1 363 ? -7.272  -18.692 -34.413 1.00 15.99 ? 362 MET A N   1 
ATOM   2705 C CA  . MET A 1 363 ? -5.994  -18.339 -33.752 1.00 18.15 ? 362 MET A CA  1 
ATOM   2706 C C   . MET A 1 363 ? -4.788  -19.132 -34.309 1.00 17.56 ? 362 MET A C   1 
ATOM   2707 O O   . MET A 1 363 ? -3.733  -18.541 -34.648 1.00 15.14 ? 362 MET A O   1 
ATOM   2708 C CB  . MET A 1 363 ? -6.038  -18.578 -32.235 1.00 18.16 ? 362 MET A CB  1 
ATOM   2709 C CG  . MET A 1 363 ? -7.080  -17.764 -31.510 1.00 21.71 ? 362 MET A CG  1 
ATOM   2710 S SD  . MET A 1 363 ? -6.646  -16.054 -31.457 1.00 22.90 ? 362 MET A SD  1 
ATOM   2711 C CE  . MET A 1 363 ? -5.520  -16.000 -30.077 1.00 22.94 ? 362 MET A CE  1 
ATOM   2712 N N   . SER A 1 364 ? -4.928  -20.452 -34.378 1.00 16.37 ? 363 SER A N   1 
ATOM   2713 C CA  . SER A 1 364 ? -3.824  -21.313 -34.906 1.00 17.85 ? 363 SER A CA  1 
ATOM   2714 C C   . SER A 1 364 ? -3.555  -21.081 -36.377 1.00 16.96 ? 363 SER A C   1 
ATOM   2715 O O   . SER A 1 364 ? -2.400  -21.126 -36.800 1.00 16.99 ? 363 SER A O   1 
ATOM   2716 C CB  . SER A 1 364 ? -4.118  -22.800 -34.683 1.00 18.21 ? 363 SER A CB  1 
ATOM   2717 O OG  . SER A 1 364 ? -4.060  -23.036 -33.289 1.00 24.40 ? 363 SER A OG  1 
ATOM   2718 N N   . MET A 1 365 ? -4.593  -20.816 -37.172 1.00 15.62 ? 364 MET A N   1 
ATOM   2719 C CA  . MET A 1 365 ? -4.361  -20.599 -38.578 1.00 16.64 ? 364 MET A CA  1 
ATOM   2720 C C   . MET A 1 365 ? -3.683  -19.252 -38.810 1.00 16.68 ? 364 MET A C   1 
ATOM   2721 O O   . MET A 1 365 ? -2.818  -19.116 -39.673 1.00 15.02 ? 364 MET A O   1 
ATOM   2722 C CB  . MET A 1 365 ? -5.705  -20.645 -39.385 1.00 18.98 ? 364 MET A CB  1 
ATOM   2723 C CG  . MET A 1 365 ? -5.498  -20.567 -40.894 1.00 18.86 ? 364 MET A CG  1 
ATOM   2724 S SD  . MET A 1 365 ? -4.690  -22.063 -41.500 1.00 22.32 ? 364 MET A SD  1 
ATOM   2725 C CE  . MET A 1 365 ? -5.881  -23.229 -41.049 1.00 21.15 ? 364 MET A CE  1 
ATOM   2726 N N   . VAL A 1 366 ? -4.070  -18.243 -38.025 1.00 15.40 ? 365 VAL A N   1 
ATOM   2727 C CA  . VAL A 1 366 ? -3.390  -16.957 -38.136 1.00 16.56 ? 365 VAL A CA  1 
ATOM   2728 C C   . VAL A 1 366 ? -1.922  -17.048 -37.733 1.00 15.29 ? 365 VAL A C   1 
ATOM   2729 O O   . VAL A 1 366 ? -1.025  -16.521 -38.416 1.00 15.64 ? 365 VAL A O   1 
ATOM   2730 C CB  . VAL A 1 366 ? -4.119  -15.866 -37.339 1.00 17.17 ? 365 VAL A CB  1 
ATOM   2731 C CG1 . VAL A 1 366 ? -3.319  -14.548 -37.352 1.00 17.82 ? 365 VAL A CG1 1 
ATOM   2732 C CG2 . VAL A 1 366 ? -5.450  -15.626 -37.987 1.00 20.48 ? 365 VAL A CG2 1 
ATOM   2733 N N   . TRP A 1 367 ? -1.683  -17.802 -36.676 1.00 16.94 ? 366 TRP A N   1 
ATOM   2734 C CA  . TRP A 1 367 ? -0.275  -18.055 -36.231 1.00 16.96 ? 366 TRP A CA  1 
ATOM   2735 C C   . TRP A 1 367 ? 0.505   -18.776 -37.296 1.00 16.77 ? 366 TRP A C   1 
ATOM   2736 O O   . TRP A 1 367 ? 1.605   -18.356 -37.658 1.00 15.99 ? 366 TRP A O   1 
ATOM   2737 C CB  . TRP A 1 367 ? -0.258  -18.803 -34.919 1.00 16.12 ? 366 TRP A CB  1 
ATOM   2738 C CG  . TRP A 1 367 ? 1.110   -18.848 -34.336 1.00 15.94 ? 366 TRP A CG  1 
ATOM   2739 C CD1 . TRP A 1 367 ? 2.113   -19.738 -34.667 1.00 15.51 ? 366 TRP A CD1 1 
ATOM   2740 C CD2 . TRP A 1 367 ? 1.647   -17.957 -33.360 1.00 16.20 ? 366 TRP A CD2 1 
ATOM   2741 N NE1 . TRP A 1 367 ? 3.255   -19.443 -33.942 1.00 14.54 ? 366 TRP A NE1 1 
ATOM   2742 C CE2 . TRP A 1 367 ? 3.004   -18.344 -33.140 1.00 16.60 ? 366 TRP A CE2 1 
ATOM   2743 C CE3 . TRP A 1 367 ? 1.125   -16.851 -32.651 1.00 18.72 ? 366 TRP A CE3 1 
ATOM   2744 C CZ2 . TRP A 1 367 ? 3.827   -17.694 -32.218 1.00 17.43 ? 366 TRP A CZ2 1 
ATOM   2745 C CZ3 . TRP A 1 367 ? 1.938   -16.188 -31.739 1.00 17.81 ? 366 TRP A CZ3 1 
ATOM   2746 C CH2 . TRP A 1 367 ? 3.308   -16.626 -31.516 1.00 15.28 ? 366 TRP A CH2 1 
ATOM   2747 N N   . GLU A 1 368 ? -0.046  -19.862 -37.783 1.00 17.57 ? 367 GLU A N   1 
ATOM   2748 C CA  . GLU A 1 368 ? 0.605   -20.650 -38.816 1.00 19.07 ? 367 GLU A CA  1 
ATOM   2749 C C   . GLU A 1 368 ? 0.920   -19.824 -40.048 1.00 20.25 ? 367 GLU A C   1 
ATOM   2750 O O   . GLU A 1 368 ? 2.059   -19.925 -40.578 1.00 20.23 ? 367 GLU A O   1 
ATOM   2751 C CB  . GLU A 1 368 ? -0.270  -21.874 -39.174 1.00 23.55 ? 367 GLU A CB  1 
ATOM   2752 C CG  . GLU A 1 368 ? 0.123   -22.627 -40.461 1.00 24.89 ? 367 GLU A CG  1 
ATOM   2753 C CD  . GLU A 1 368 ? 1.515   -23.259 -40.403 1.00 26.79 ? 367 GLU A CD  1 
ATOM   2754 O OE1 . GLU A 1 368 ? 2.067   -23.475 -39.324 1.00 24.79 ? 367 GLU A OE1 1 
ATOM   2755 O OE2 . GLU A 1 368 ? 2.078   -23.551 -41.477 1.00 30.79 ? 367 GLU A OE2 1 
ATOM   2756 N N   . LYS A 1 369 ? -0.036  -19.026 -40.547 1.00 17.04 ? 368 LYS A N   1 
ATOM   2757 C CA  . LYS A 1 369 ? 0.171   -18.301 -41.801 1.00 19.65 ? 368 LYS A CA  1 
ATOM   2758 C C   . LYS A 1 369 ? 1.018   -17.077 -41.635 1.00 20.46 ? 368 LYS A C   1 
ATOM   2759 O O   . LYS A 1 369 ? 1.812   -16.757 -42.538 1.00 22.18 ? 368 LYS A O   1 
ATOM   2760 C CB  . LYS A 1 369 ? -1.165  -17.898 -42.396 1.00 21.36 ? 368 LYS A CB  1 
ATOM   2761 C CG  . LYS A 1 369 ? -1.838  -19.093 -43.053 1.00 25.38 ? 368 LYS A CG  1 
ATOM   2762 C CD  . LYS A 1 369 ? -1.388  -18.981 -44.492 1.00 33.13 ? 368 LYS A CD  1 
ATOM   2763 C CE  . LYS A 1 369 ? -1.043  -20.302 -45.111 1.00 41.24 ? 368 LYS A CE  1 
ATOM   2764 N NZ  . LYS A 1 369 ? -0.900  -19.976 -46.581 1.00 39.60 ? 368 LYS A NZ  1 
ATOM   2765 N N   . CYS A 1 370 ? 0.881   -16.418 -40.488 1.00 20.49 ? 369 CYS A N   1 
ATOM   2766 C CA  . CYS A 1 370 ? 1.505   -15.103 -40.265 1.00 19.47 ? 369 CYS A CA  1 
ATOM   2767 C C   . CYS A 1 370 ? 2.812   -15.150 -39.456 1.00 17.18 ? 369 CYS A C   1 
ATOM   2768 O O   . CYS A 1 370 ? 3.746   -14.451 -39.809 1.00 18.52 ? 369 CYS A O   1 
ATOM   2769 C CB  . CYS A 1 370 ? 0.547   -14.120 -39.584 1.00 21.16 ? 369 CYS A CB  1 
ATOM   2770 S SG  . CYS A 1 370 ? -0.984  -13.790 -40.492 1.00 25.51 ? 369 CYS A SG  1 
ATOM   2771 N N   . VAL A 1 371 ? 2.828   -15.874 -38.350 1.00 17.37 ? 370 VAL A N   1 
ATOM   2772 C CA  . VAL A 1 371 ? 3.928   -15.833 -37.402 1.00 17.88 ? 370 VAL A CA  1 
ATOM   2773 C C   . VAL A 1 371 ? 4.934   -16.936 -37.709 1.00 17.33 ? 370 VAL A C   1 
ATOM   2774 O O   . VAL A 1 371 ? 6.120   -16.666 -37.801 1.00 16.30 ? 370 VAL A O   1 
ATOM   2775 C CB  . VAL A 1 371 ? 3.473   -15.950 -35.929 1.00 16.78 ? 370 VAL A CB  1 
ATOM   2776 C CG1 . VAL A 1 371 ? 4.657   -15.869 -34.989 1.00 18.59 ? 370 VAL A CG1 1 
ATOM   2777 C CG2 . VAL A 1 371 ? 2.557   -14.790 -35.592 1.00 18.00 ? 370 VAL A CG2 1 
ATOM   2778 N N   . ALA A 1 372 ? 4.461   -18.151 -37.827 1.00 17.72 ? 371 ALA A N   1 
ATOM   2779 C CA  . ALA A 1 372 ? 5.310   -19.281 -38.158 1.00 20.65 ? 371 ALA A CA  1 
ATOM   2780 C C   . ALA A 1 372 ? 6.019   -19.134 -39.541 1.00 21.64 ? 371 ALA A C   1 
ATOM   2781 O O   . ALA A 1 372 ? 7.067   -19.755 -39.785 1.00 20.75 ? 371 ALA A O   1 
ATOM   2782 C CB  . ALA A 1 372 ? 4.516   -20.539 -38.143 1.00 21.40 ? 371 ALA A CB  1 
ATOM   2783 N N   . SER A 1 373 ? 5.457   -18.326 -40.427 1.00 19.45 ? 372 SER A N   1 
ATOM   2784 C CA  . SER A 1 373 ? 6.052   -18.041 -41.721 1.00 19.44 ? 372 SER A CA  1 
ATOM   2785 C C   . SER A 1 373 ? 7.116   -16.954 -41.646 1.00 19.38 ? 372 SER A C   1 
ATOM   2786 O O   . SER A 1 373 ? 7.748   -16.684 -42.682 1.00 20.43 ? 372 SER A O   1 
ATOM   2787 C CB  . SER A 1 373 ? 4.958   -17.475 -42.657 1.00 20.26 ? 372 SER A CB  1 
ATOM   2788 O OG  . SER A 1 373 ? 4.381   -16.330 -42.053 1.00 18.25 ? 372 SER A OG  1 
ATOM   2789 N N   . GLY A 1 374 ? 7.245   -16.250 -40.520 1.00 17.72 ? 373 GLY A N   1 
ATOM   2790 C CA  . GLY A 1 374 ? 8.103   -15.076 -40.413 1.00 18.27 ? 373 GLY A CA  1 
ATOM   2791 C C   . GLY A 1 374 ? 7.542   -13.766 -40.968 1.00 20.06 ? 373 GLY A C   1 
ATOM   2792 O O   . GLY A 1 374 ? 8.224   -12.729 -40.915 1.00 19.04 ? 373 GLY A O   1 
ATOM   2793 N N   . LYS A 1 375 ? 6.314   -13.740 -41.455 1.00 17.91 ? 374 LYS A N   1 
ATOM   2794 C CA  . LYS A 1 375 ? 5.787   -12.472 -41.980 1.00 20.64 ? 374 LYS A CA  1 
ATOM   2795 C C   . LYS A 1 375 ? 5.475   -11.433 -40.899 1.00 19.08 ? 374 LYS A C   1 
ATOM   2796 O O   . LYS A 1 375 ? 5.579   -10.208 -41.125 1.00 20.90 ? 374 LYS A O   1 
ATOM   2797 C CB  . LYS A 1 375 ? 4.570   -12.720 -42.844 1.00 23.23 ? 374 LYS A CB  1 
ATOM   2798 C CG  . LYS A 1 375 ? 4.877   -13.543 -44.074 1.00 28.98 ? 374 LYS A CG  1 
ATOM   2799 C CD  . LYS A 1 375 ? 3.635   -13.679 -44.945 1.00 37.00 ? 374 LYS A CD  1 
ATOM   2800 C CE  . LYS A 1 375 ? 3.887   -14.172 -46.375 1.00 40.36 ? 374 LYS A CE  1 
ATOM   2801 N NZ  . LYS A 1 375 ? 3.499   -15.610 -46.495 1.00 44.00 ? 374 LYS A NZ  1 
ATOM   2802 N N   A MET A 1 376 ? 5.106   -11.920 -39.719 0.50 17.14 ? 375 MET A N   1 
ATOM   2803 N N   B MET A 1 376 ? 5.040   -11.891 -39.728 0.50 17.15 ? 375 MET A N   1 
ATOM   2804 C CA  A MET A 1 376 ? 4.691   -11.057 -38.618 0.50 18.40 ? 375 MET A CA  1 
ATOM   2805 C CA  B MET A 1 376 ? 4.702   -10.972 -38.629 0.50 18.39 ? 375 MET A CA  1 
ATOM   2806 C C   A MET A 1 376 ? 5.224   -11.621 -37.332 0.50 16.39 ? 375 MET A C   1 
ATOM   2807 C C   B MET A 1 376 ? 5.148   -11.607 -37.331 0.50 16.33 ? 375 MET A C   1 
ATOM   2808 O O   A MET A 1 376 ? 5.539   -12.797 -37.261 0.50 17.13 ? 375 MET A O   1 
ATOM   2809 O O   B MET A 1 376 ? 5.325   -12.812 -37.252 0.50 16.72 ? 375 MET A O   1 
ATOM   2810 C CB  A MET A 1 376 ? 3.160   -11.004 -38.517 0.50 18.44 ? 375 MET A CB  1 
ATOM   2811 C CB  B MET A 1 376 ? 3.179   -10.645 -38.562 0.50 18.64 ? 375 MET A CB  1 
ATOM   2812 C CG  A MET A 1 376 ? 2.536   -9.999  -39.449 0.50 19.46 ? 375 MET A CG  1 
ATOM   2813 C CG  B MET A 1 376 ? 2.355   -11.614 -37.709 0.50 19.30 ? 375 MET A CG  1 
ATOM   2814 S SD  A MET A 1 376 ? 0.832   -10.464 -39.910 0.50 18.92 ? 375 MET A SD  1 
ATOM   2815 S SD  B MET A 1 376 ? 0.557   -11.326 -37.445 0.50 21.79 ? 375 MET A SD  1 
ATOM   2816 C CE  A MET A 1 376 ? 0.093   -10.121 -38.318 0.50 18.60 ? 375 MET A CE  1 
ATOM   2817 C CE  B MET A 1 376 ? 0.198   -10.354 -38.890 0.50 20.85 ? 375 MET A CE  1 
ATOM   2818 N N   . ASP A 1 377 ? 5.310   -10.784 -36.324 1.00 16.05 ? 376 ASP A N   1 
ATOM   2819 C CA  . ASP A 1 377 ? 5.680   -11.231 -35.027 1.00 16.65 ? 376 ASP A CA  1 
ATOM   2820 C C   . ASP A 1 377 ? 4.490   -11.430 -34.070 1.00 16.56 ? 376 ASP A C   1 
ATOM   2821 O O   . ASP A 1 377 ? 3.296   -11.175 -34.405 1.00 15.85 ? 376 ASP A O   1 
ATOM   2822 C CB  . ASP A 1 377 ? 6.787   -10.355 -34.467 1.00 17.46 ? 376 ASP A CB  1 
ATOM   2823 C CG  . ASP A 1 377 ? 6.381   -8.968  -34.188 1.00 20.17 ? 376 ASP A CG  1 
ATOM   2824 O OD1 . ASP A 1 377 ? 5.219   -8.661  -33.804 1.00 19.50 ? 376 ASP A OD1 1 
ATOM   2825 O OD2 . ASP A 1 377 ? 7.277   -8.128  -34.270 1.00 19.21 ? 376 ASP A OD2 1 
ATOM   2826 N N   . GLU A 1 378 ? 4.823   -11.980 -32.921 1.00 13.94 ? 377 GLU A N   1 
ATOM   2827 C CA  . GLU A 1 378 ? 3.844   -12.296 -31.884 1.00 15.92 ? 377 GLU A CA  1 
ATOM   2828 C C   . GLU A 1 378 ? 2.982   -11.120 -31.468 1.00 15.84 ? 377 GLU A C   1 
ATOM   2829 O O   . GLU A 1 378 ? 1.798   -11.284 -31.164 1.00 16.64 ? 377 GLU A O   1 
ATOM   2830 C CB  . GLU A 1 378 ? 4.556   -12.927 -30.691 1.00 16.88 ? 377 GLU A CB  1 
ATOM   2831 C CG  . GLU A 1 378 ? 5.463   -11.954 -29.927 1.00 17.76 ? 377 GLU A CG  1 
ATOM   2832 C CD  . GLU A 1 378 ? 6.518   -12.625 -29.059 1.00 19.87 ? 377 GLU A CD  1 
ATOM   2833 O OE1 . GLU A 1 378 ? 7.240   -13.484 -29.641 1.00 21.38 ? 377 GLU A OE1 1 
ATOM   2834 O OE2 . GLU A 1 378 ? 6.616   -12.275 -27.842 1.00 19.38 ? 377 GLU A OE2 1 
ATOM   2835 N N   . ASN A 1 379 ? 3.576   -9.924  -31.421 1.00 14.36 ? 378 ASN A N   1 
ATOM   2836 C CA  . ASN A 1 379 ? 2.853   -8.744  -31.040 1.00 14.52 ? 378 ASN A CA  1 
ATOM   2837 C C   . ASN A 1 379 ? 1.802   -8.334  -32.118 1.00 15.47 ? 378 ASN A C   1 
ATOM   2838 O O   . ASN A 1 379 ? 0.693   -7.978  -31.777 1.00 15.80 ? 378 ASN A O   1 
ATOM   2839 C CB  . ASN A 1 379 ? 3.832   -7.619  -30.706 1.00 14.12 ? 378 ASN A CB  1 
ATOM   2840 C CG  . ASN A 1 379 ? 4.931   -8.076  -29.727 1.00 15.62 ? 378 ASN A CG  1 
ATOM   2841 O OD1 . ASN A 1 379 ? 6.056   -8.454  -30.141 1.00 16.94 ? 378 ASN A OD1 1 
ATOM   2842 N ND2 . ASN A 1 379 ? 4.584   -8.140  -28.439 1.00 14.95 ? 378 ASN A ND2 1 
ATOM   2843 N N   . GLU A 1 380 ? 2.179   -8.410  -33.381 1.00 13.98 ? 379 GLU A N   1 
ATOM   2844 C CA  . GLU A 1 380 ? 1.281   -8.142  -34.440 1.00 16.20 ? 379 GLU A CA  1 
ATOM   2845 C C   . GLU A 1 380 ? 0.165   -9.171  -34.407 1.00 15.62 ? 379 GLU A C   1 
ATOM   2846 O O   . GLU A 1 380 ? -0.988  -8.843  -34.689 1.00 15.74 ? 379 GLU A O   1 
ATOM   2847 C CB  . GLU A 1 380 ? 2.013   -8.173  -35.800 1.00 19.54 ? 379 GLU A CB  1 
ATOM   2848 C CG  . GLU A 1 380 ? 3.131   -7.134  -35.885 1.00 24.04 ? 379 GLU A CG  1 
ATOM   2849 C CD  . GLU A 1 380 ? 4.073   -7.271  -37.101 1.00 26.77 ? 379 GLU A CD  1 
ATOM   2850 O OE1 . GLU A 1 380 ? 4.962   -8.169  -37.206 1.00 23.26 ? 379 GLU A OE1 1 
ATOM   2851 O OE2 . GLU A 1 380 ? 3.934   -6.408  -37.970 1.00 31.29 ? 379 GLU A OE2 1 
ATOM   2852 N N   . PHE A 1 381 ? 0.511   -10.428 -34.127 1.00 14.91 ? 380 PHE A N   1 
ATOM   2853 C CA  . PHE A 1 381 ? -0.508  -11.467 -33.966 1.00 14.74 ? 380 PHE A CA  1 
ATOM   2854 C C   . PHE A 1 381 ? -1.613  -11.137 -32.952 1.00 14.34 ? 380 PHE A C   1 
ATOM   2855 O O   . PHE A 1 381 ? -2.816  -11.292 -33.238 1.00 14.35 ? 380 PHE A O   1 
ATOM   2856 C CB  . PHE A 1 381 ? 0.170   -12.792 -33.631 1.00 14.48 ? 380 PHE A CB  1 
ATOM   2857 C CG  . PHE A 1 381 ? -0.783  -13.896 -33.251 1.00 15.99 ? 380 PHE A CG  1 
ATOM   2858 C CD1 . PHE A 1 381 ? -1.348  -14.704 -34.239 1.00 15.20 ? 380 PHE A CD1 1 
ATOM   2859 C CD2 . PHE A 1 381 ? -1.098  -14.124 -31.926 1.00 14.98 ? 380 PHE A CD2 1 
ATOM   2860 C CE1 . PHE A 1 381 ? -2.191  -15.728 -33.906 1.00 16.68 ? 380 PHE A CE1 1 
ATOM   2861 C CE2 . PHE A 1 381 ? -1.983  -15.110 -31.589 1.00 16.42 ? 380 PHE A CE2 1 
ATOM   2862 C CZ  . PHE A 1 381 ? -2.540  -15.918 -32.581 1.00 15.93 ? 380 PHE A CZ  1 
ATOM   2863 N N   . VAL A 1 382 ? -1.219  -10.614 -31.803 1.00 13.45 ? 381 VAL A N   1 
ATOM   2864 C CA  . VAL A 1 382 ? -2.190  -10.165 -30.831 1.00 12.72 ? 381 VAL A CA  1 
ATOM   2865 C C   . VAL A 1 382 ? -3.023  -9.040  -31.409 1.00 13.12 ? 381 VAL A C   1 
ATOM   2866 O O   . VAL A 1 382 ? -4.249  -9.037  -31.214 1.00 11.74 ? 381 VAL A O   1 
ATOM   2867 C CB  . VAL A 1 382 ? -1.480  -9.786  -29.485 1.00 13.63 ? 381 VAL A CB  1 
ATOM   2868 C CG1 . VAL A 1 382 ? -2.400  -9.053  -28.493 1.00 13.77 ? 381 VAL A CG1 1 
ATOM   2869 C CG2 . VAL A 1 382 ? -0.877  -11.049 -28.864 1.00 13.12 ? 381 VAL A CG2 1 
ATOM   2870 N N   . ALA A 1 383 ? -2.376  -8.076  -32.085 1.00 14.29 ? 382 ALA A N   1 
ATOM   2871 C CA  . ALA A 1 383 ? -3.136  -7.009  -32.714 1.00 14.75 ? 382 ALA A CA  1 
ATOM   2872 C C   . ALA A 1 383 ? -4.289  -7.535  -33.601 1.00 13.89 ? 382 ALA A C   1 
ATOM   2873 O O   . ALA A 1 383 ? -5.449  -7.052  -33.529 1.00 12.24 ? 382 ALA A O   1 
ATOM   2874 C CB  . ALA A 1 383 ? -2.250  -6.035  -33.499 1.00 15.03 ? 382 ALA A CB  1 
ATOM   2875 N N   . VAL A 1 384 ? -3.970  -8.427  -34.515 1.00 13.55 ? 383 VAL A N   1 
ATOM   2876 C CA  . VAL A 1 384 ? -4.942  -8.806  -35.497 1.00 13.93 ? 383 VAL A CA  1 
ATOM   2877 C C   . VAL A 1 384 ? -5.915  -9.912  -35.032 1.00 14.97 ? 383 VAL A C   1 
ATOM   2878 O O   . VAL A 1 384 ? -6.821  -10.279 -35.809 1.00 15.47 ? 383 VAL A O   1 
ATOM   2879 C CB  . VAL A 1 384 ? -4.279  -9.213  -36.865 1.00 15.19 ? 383 VAL A CB  1 
ATOM   2880 C CG1 . VAL A 1 384 ? -3.389  -8.080  -37.436 1.00 14.57 ? 383 VAL A CG1 1 
ATOM   2881 C CG2 . VAL A 1 384 ? -3.457  -10.509 -36.691 1.00 15.90 ? 383 VAL A CG2 1 
ATOM   2882 N N   . THR A 1 385 ? -5.687  -10.473 -33.828 1.00 14.35 ? 384 THR A N   1 
ATOM   2883 C CA  . THR A 1 385 ? -6.552  -11.454 -33.265 1.00 13.70 ? 384 THR A CA  1 
ATOM   2884 C C   . THR A 1 385 ? -7.382  -10.949 -32.106 1.00 13.19 ? 384 THR A C   1 
ATOM   2885 O O   . THR A 1 385 ? -8.394  -11.585 -31.798 1.00 14.21 ? 384 THR A O   1 
ATOM   2886 C CB  . THR A 1 385 ? -5.836  -12.745 -32.827 1.00 14.29 ? 384 THR A CB  1 
ATOM   2887 O OG1 . THR A 1 385 ? -4.821  -12.472 -31.868 1.00 14.47 ? 384 THR A OG1 1 
ATOM   2888 C CG2 . THR A 1 385 ? -5.277  -13.502 -34.034 1.00 16.43 ? 384 THR A CG2 1 
ATOM   2889 N N   . SER A 1 386 ? -7.011  -9.848  -31.446 1.00 12.98 ? 385 SER A N   1 
ATOM   2890 C CA  . SER A 1 386 ? -7.863  -9.304  -30.361 1.00 12.88 ? 385 SER A CA  1 
ATOM   2891 C C   . SER A 1 386 ? -7.808  -7.812  -30.281 1.00 12.72 ? 385 SER A C   1 
ATOM   2892 O O   . SER A 1 386 ? -8.833  -7.163  -30.131 1.00 13.90 ? 385 SER A O   1 
ATOM   2893 C CB  . SER A 1 386 ? -7.546  -9.870  -28.976 1.00 13.60 ? 385 SER A CB  1 
ATOM   2894 O OG  . SER A 1 386 ? -6.160  -9.669  -28.638 1.00 14.78 ? 385 SER A OG  1 
ATOM   2895 N N   . THR A 1 387 ? -6.617  -7.250  -30.290 1.00 13.40 ? 386 THR A N   1 
ATOM   2896 C CA  . THR A 1 387 ? -6.511  -5.835  -29.906 1.00 13.97 ? 386 THR A CA  1 
ATOM   2897 C C   . THR A 1 387 ? -7.177  -4.800  -30.843 1.00 13.78 ? 386 THR A C   1 
ATOM   2898 O O   . THR A 1 387 ? -7.904  -3.906  -30.409 1.00 12.20 ? 386 THR A O   1 
ATOM   2899 C CB  . THR A 1 387 ? -5.028  -5.434  -29.643 1.00 14.21 ? 386 THR A CB  1 
ATOM   2900 O OG1 . THR A 1 387 ? -4.383  -6.461  -28.879 1.00 15.04 ? 386 THR A OG1 1 
ATOM   2901 C CG2 . THR A 1 387 ? -4.977  -4.225  -28.833 1.00 14.30 ? 386 THR A CG2 1 
ATOM   2902 N N   . ASN A 1 388 ? -6.933  -4.972  -32.137 1.00 14.66 ? 387 ASN A N   1 
ATOM   2903 C CA  . ASN A 1 388 ? -7.510  -4.095  -33.087 1.00 14.87 ? 387 ASN A CA  1 
ATOM   2904 C C   . ASN A 1 388 ? -9.019  -4.183  -33.042 1.00 13.50 ? 387 ASN A C   1 
ATOM   2905 O O   . ASN A 1 388 ? -9.689  -3.180  -33.125 1.00 13.96 ? 387 ASN A O   1 
ATOM   2906 C CB  . ASN A 1 388 ? -6.995  -4.410  -34.509 1.00 13.88 ? 387 ASN A CB  1 
ATOM   2907 C CG  . ASN A 1 388 ? -5.568  -3.940  -34.737 1.00 16.30 ? 387 ASN A CG  1 
ATOM   2908 O OD1 . ASN A 1 388 ? -5.056  -3.081  -34.022 1.00 16.01 ? 387 ASN A OD1 1 
ATOM   2909 N ND2 . ASN A 1 388 ? -4.923  -4.514  -35.726 1.00 15.71 ? 387 ASN A ND2 1 
ATOM   2910 N N   . ALA A 1 389 ? -9.544  -5.380  -32.905 1.00 14.20 ? 388 ALA A N   1 
ATOM   2911 C CA  . ALA A 1 389 ? -10.972 -5.575  -32.755 1.00 14.08 ? 388 ALA A CA  1 
ATOM   2912 C C   . ALA A 1 389 ? -11.548 -4.817  -31.584 1.00 14.57 ? 388 ALA A C   1 
ATOM   2913 O O   . ALA A 1 389 ? -12.610 -4.220  -31.670 1.00 14.27 ? 388 ALA A O   1 
ATOM   2914 C CB  . ALA A 1 389 ? -11.286 -7.066  -32.583 1.00 13.78 ? 388 ALA A CB  1 
ATOM   2915 N N   . ALA A 1 390 ? -10.836 -4.886  -30.461 1.00 13.61 ? 389 ALA A N   1 
ATOM   2916 C CA  . ALA A 1 390 ? -11.265 -4.217  -29.235 1.00 14.15 ? 389 ALA A CA  1 
ATOM   2917 C C   . ALA A 1 390 ? -11.281 -2.701  -29.450 1.00 13.44 ? 389 ALA A C   1 
ATOM   2918 O O   . ALA A 1 390 ? -12.194 -2.015  -28.992 1.00 14.57 ? 389 ALA A O   1 
ATOM   2919 C CB  . ALA A 1 390 ? -10.382 -4.589  -28.070 1.00 13.83 ? 389 ALA A CB  1 
ATOM   2920 N N   . LYS A 1 391 ? -10.282 -2.188  -30.164 1.00 13.98 ? 390 LYS A N   1 
ATOM   2921 C CA  . LYS A 1 391 ? -10.207 -0.727  -30.389 1.00 12.55 ? 390 LYS A CA  1 
ATOM   2922 C C   . LYS A 1 391 ? -11.298 -0.258  -31.409 1.00 13.40 ? 390 LYS A C   1 
ATOM   2923 O O   . LYS A 1 391 ? -11.932 0.787   -31.229 1.00 13.91 ? 390 LYS A O   1 
ATOM   2924 C CB  . LYS A 1 391 ? -8.852  -0.388  -30.870 1.00 13.16 ? 390 LYS A CB  1 
ATOM   2925 C CG  . LYS A 1 391 ? -7.790  -0.486  -29.792 1.00 13.02 ? 390 LYS A CG  1 
ATOM   2926 C CD  . LYS A 1 391 ? -6.438  -0.266  -30.408 1.00 14.99 ? 390 LYS A CD  1 
ATOM   2927 C CE  . LYS A 1 391 ? -5.352  -0.296  -29.347 1.00 16.49 ? 390 LYS A CE  1 
ATOM   2928 N NZ  . LYS A 1 391 ? -3.944  -0.444  -29.906 1.00 16.99 ? 390 LYS A NZ  1 
ATOM   2929 N N   . ILE A 1 392 ? -11.512 -1.044  -32.459 1.00 12.88 ? 391 ILE A N   1 
ATOM   2930 C CA  . ILE A 1 392 ? -12.534 -0.718  -33.483 1.00 13.89 ? 391 ILE A CA  1 
ATOM   2931 C C   . ILE A 1 392 ? -13.980 -0.689  -32.952 1.00 14.30 ? 391 ILE A C   1 
ATOM   2932 O O   . ILE A 1 392 ? -14.779 0.247   -33.223 1.00 16.28 ? 391 ILE A O   1 
ATOM   2933 C CB  . ILE A 1 392 ? -12.404 -1.636  -34.743 1.00 14.04 ? 391 ILE A CB  1 
ATOM   2934 C CG1 . ILE A 1 392 ? -11.145 -1.288  -35.507 1.00 13.70 ? 391 ILE A CG1 1 
ATOM   2935 C CG2 . ILE A 1 392 ? -13.636 -1.501  -35.636 1.00 14.37 ? 391 ILE A CG2 1 
ATOM   2936 C CD1 . ILE A 1 392 ? -10.668 -2.434  -36.416 1.00 15.23 ? 391 ILE A CD1 1 
ATOM   2937 N N   . PHE A 1 393 ? -14.305 -1.688  -32.152 1.00 15.03 ? 392 PHE A N   1 
ATOM   2938 C CA  . PHE A 1 393 ? -15.656 -1.887  -31.633 1.00 16.23 ? 392 PHE A CA  1 
ATOM   2939 C C   . PHE A 1 393 ? -15.870 -1.364  -30.180 1.00 16.11 ? 392 PHE A C   1 
ATOM   2940 O O   . PHE A 1 393 ? -16.968 -1.519  -29.612 1.00 17.70 ? 392 PHE A O   1 
ATOM   2941 C CB  . PHE A 1 393 ? -15.977 -3.398  -31.767 1.00 16.33 ? 392 PHE A CB  1 
ATOM   2942 C CG  . PHE A 1 393 ? -16.086 -3.844  -33.211 1.00 16.47 ? 392 PHE A CG  1 
ATOM   2943 C CD1 . PHE A 1 393 ? -17.171 -3.443  -33.939 1.00 18.07 ? 392 PHE A CD1 1 
ATOM   2944 C CD2 . PHE A 1 393 ? -15.116 -4.602  -33.822 1.00 16.39 ? 392 PHE A CD2 1 
ATOM   2945 C CE1 . PHE A 1 393 ? -17.333 -3.789  -35.301 1.00 18.88 ? 392 PHE A CE1 1 
ATOM   2946 C CE2 . PHE A 1 393 ? -15.287 -5.002  -35.156 1.00 16.30 ? 392 PHE A CE2 1 
ATOM   2947 C CZ  . PHE A 1 393 ? -16.392 -4.589  -35.894 1.00 17.86 ? 392 PHE A CZ  1 
ATOM   2948 N N   . ASN A 1 394 ? -14.834 -0.757  -29.606 1.00 15.87 ? 393 ASN A N   1 
ATOM   2949 C CA  . ASN A 1 394 ? -14.880 0.085   -28.395 1.00 17.29 ? 393 ASN A CA  1 
ATOM   2950 C C   . ASN A 1 394 ? -14.953 -0.665  -27.059 1.00 16.85 ? 393 ASN A C   1 
ATOM   2951 O O   . ASN A 1 394 ? -15.748 -0.372  -26.192 1.00 17.07 ? 393 ASN A O   1 
ATOM   2952 C CB  . ASN A 1 394 ? -15.965 1.141   -28.491 1.00 16.67 ? 393 ASN A CB  1 
ATOM   2953 C CG  . ASN A 1 394 ? -15.580 2.438   -27.819 1.00 16.59 ? 393 ASN A CG  1 
ATOM   2954 O OD1 . ASN A 1 394 ? -14.407 2.660   -27.468 1.00 18.60 ? 393 ASN A OD1 1 
ATOM   2955 N ND2 . ASN A 1 394 ? -16.525 3.359   -27.777 1.00 15.84 ? 393 ASN A ND2 1 
ATOM   2956 N N   . PHE A 1 395 ? -14.123 -1.684  -26.931 1.00 17.00 ? 394 PHE A N   1 
ATOM   2957 C CA  . PHE A 1 395 ? -13.953 -2.351  -25.654 1.00 16.00 ? 394 PHE A CA  1 
ATOM   2958 C C   . PHE A 1 395 ? -12.481 -2.636  -25.317 1.00 14.28 ? 394 PHE A C   1 
ATOM   2959 O O   . PHE A 1 395 ? -12.144 -3.717  -24.842 1.00 15.69 ? 394 PHE A O   1 
ATOM   2960 C CB  . PHE A 1 395 ? -14.922 -3.581  -25.541 1.00 16.87 ? 394 PHE A CB  1 
ATOM   2961 C CG  . PHE A 1 395 ? -14.904 -4.540  -26.712 1.00 16.71 ? 394 PHE A CG  1 
ATOM   2962 C CD1 . PHE A 1 395 ? -13.919 -5.526  -26.827 1.00 16.86 ? 394 PHE A CD1 1 
ATOM   2963 C CD2 . PHE A 1 395 ? -15.897 -4.485  -27.738 1.00 18.37 ? 394 PHE A CD2 1 
ATOM   2964 C CE1 . PHE A 1 395 ? -13.883 -6.414  -27.888 1.00 17.28 ? 394 PHE A CE1 1 
ATOM   2965 C CE2 . PHE A 1 395 ? -15.877 -5.399  -28.782 1.00 17.93 ? 394 PHE A CE2 1 
ATOM   2966 C CZ  . PHE A 1 395 ? -14.880 -6.381  -28.854 1.00 18.49 ? 394 PHE A CZ  1 
ATOM   2967 N N   . TYR A 1 396 ? -11.600 -1.716  -25.720 1.00 14.93 ? 395 TYR A N   1 
ATOM   2968 C CA  . TYR A 1 396 ? -10.182 -1.678  -25.366 1.00 14.67 ? 395 TYR A CA  1 
ATOM   2969 C C   . TYR A 1 396 ? -9.969  -0.685  -24.208 1.00 14.99 ? 395 TYR A C   1 
ATOM   2970 O O   . TYR A 1 396 ? -10.445 0.410   -24.319 1.00 15.29 ? 395 TYR A O   1 
ATOM   2971 C CB  . TYR A 1 396 ? -9.313  -1.210  -26.515 1.00 14.32 ? 395 TYR A CB  1 
ATOM   2972 C CG  . TYR A 1 396 ? -7.847  -1.117  -26.201 1.00 14.12 ? 395 TYR A CG  1 
ATOM   2973 C CD1 . TYR A 1 396 ? -7.043  -2.250  -26.196 1.00 14.88 ? 395 TYR A CD1 1 
ATOM   2974 C CD2 . TYR A 1 396 ? -7.246  0.096   -25.901 1.00 15.56 ? 395 TYR A CD2 1 
ATOM   2975 C CE1 . TYR A 1 396 ? -5.678  -2.142  -25.908 1.00 16.19 ? 395 TYR A CE1 1 
ATOM   2976 C CE2 . TYR A 1 396 ? -5.891  0.201   -25.653 1.00 16.10 ? 395 TYR A CE2 1 
ATOM   2977 C CZ  . TYR A 1 396 ? -5.108  -0.931  -25.640 1.00 15.52 ? 395 TYR A CZ  1 
ATOM   2978 O OH  . TYR A 1 396 ? -3.743  -0.850  -25.385 1.00 16.17 ? 395 TYR A OH  1 
ATOM   2979 N N   . PRO A 1 397 ? -9.254  -1.033  -23.145 1.00 16.93 ? 396 PRO A N   1 
ATOM   2980 C CA  . PRO A 1 397 ? -8.515  -2.282  -22.969 1.00 17.28 ? 396 PRO A CA  1 
ATOM   2981 C C   . PRO A 1 397 ? -9.173  -3.367  -22.155 1.00 16.28 ? 396 PRO A C   1 
ATOM   2982 O O   . PRO A 1 397 ? -8.480  -4.271  -21.677 1.00 17.06 ? 396 PRO A O   1 
ATOM   2983 C CB  . PRO A 1 397 ? -7.218  -1.808  -22.286 1.00 18.68 ? 396 PRO A CB  1 
ATOM   2984 C CG  . PRO A 1 397 ? -7.753  -0.733  -21.357 1.00 19.49 ? 396 PRO A CG  1 
ATOM   2985 C CD  . PRO A 1 397 ? -8.839  -0.019  -22.151 1.00 18.26 ? 396 PRO A CD  1 
ATOM   2986 N N   . ARG A 1 398 ? -10.481 -3.330  -22.020 1.00 16.31 ? 397 ARG A N   1 
ATOM   2987 C CA  . ARG A 1 398 ? -11.193 -4.386  -21.321 1.00 15.64 ? 397 ARG A CA  1 
ATOM   2988 C C   . ARG A 1 398 ? -10.839 -5.733  -21.915 1.00 15.95 ? 397 ARG A C   1 
ATOM   2989 O O   . ARG A 1 398 ? -10.510 -6.671  -21.164 1.00 15.17 ? 397 ARG A O   1 
ATOM   2990 C CB  . ARG A 1 398 ? -12.687 -4.159  -21.393 1.00 17.00 ? 397 ARG A CB  1 
ATOM   2991 C CG  . ARG A 1 398 ? -13.484 -5.326  -20.809 1.00 17.43 ? 397 ARG A CG  1 
ATOM   2992 C CD  . ARG A 1 398 ? -14.970 -4.965  -20.719 1.00 19.17 ? 397 ARG A CD  1 
ATOM   2993 N NE  . ARG A 1 398 ? -15.659 -6.216  -20.314 1.00 22.67 ? 397 ARG A NE  1 
ATOM   2994 C CZ  . ARG A 1 398 ? -16.953 -6.338  -20.036 1.00 23.20 ? 397 ARG A CZ  1 
ATOM   2995 N NH1 . ARG A 1 398 ? -17.745 -5.319  -20.189 1.00 23.72 ? 397 ARG A NH1 1 
ATOM   2996 N NH2 . ARG A 1 398 ? -17.447 -7.524  -19.666 1.00 22.95 ? 397 ARG A NH2 1 
ATOM   2997 N N   . LYS A 1 399 ? -10.899 -5.822  -23.234 1.00 14.35 ? 398 LYS A N   1 
ATOM   2998 C CA  . LYS A 1 399 ? -10.342 -6.961  -23.986 1.00 16.02 ? 398 LYS A CA  1 
ATOM   2999 C C   . LYS A 1 399 ? -9.091  -6.553  -24.789 1.00 14.71 ? 398 LYS A C   1 
ATOM   3000 O O   . LYS A 1 399 ? -8.781  -5.371  -24.980 1.00 14.98 ? 398 LYS A O   1 
ATOM   3001 C CB  . LYS A 1 399 ? -11.366 -7.560  -24.974 1.00 16.69 ? 398 LYS A CB  1 
ATOM   3002 C CG  . LYS A 1 399 ? -12.772 -7.737  -24.427 1.00 16.83 ? 398 LYS A CG  1 
ATOM   3003 C CD  . LYS A 1 399 ? -12.822 -8.751  -23.288 1.00 18.13 ? 398 LYS A CD  1 
ATOM   3004 C CE  . LYS A 1 399 ? -14.264 -9.176  -22.932 1.00 18.24 ? 398 LYS A CE  1 
ATOM   3005 N NZ  . LYS A 1 399 ? -14.370 -10.207 -21.865 1.00 19.42 ? 398 LYS A NZ  1 
ATOM   3006 N N   . GLY A 1 400 ? -8.425  -7.553  -25.312 1.00 15.61 ? 399 GLY A N   1 
ATOM   3007 C CA  . GLY A 1 400 ? -7.270  -7.361  -26.192 1.00 14.70 ? 399 GLY A CA  1 
ATOM   3008 C C   . GLY A 1 400 ? -6.023  -6.838  -25.496 1.00 15.69 ? 399 GLY A C   1 
ATOM   3009 O O   . GLY A 1 400 ? -5.091  -6.396  -26.200 1.00 16.26 ? 399 GLY A O   1 
ATOM   3010 N N   . ARG A 1 401 ? -5.929  -6.940  -24.138 1.00 14.76 ? 400 ARG A N   1 
ATOM   3011 C CA  . ARG A 1 401 ? -4.725  -6.446  -23.424 1.00 14.32 ? 400 ARG A CA  1 
ATOM   3012 C C   . ARG A 1 401 ? -4.519  -7.148  -22.103 1.00 16.70 ? 400 ARG A C   1 
ATOM   3013 O O   . ARG A 1 401 ? -5.437  -7.193  -21.289 1.00 15.37 ? 400 ARG A O   1 
ATOM   3014 C CB  . ARG A 1 401 ? -4.803  -4.937  -23.144 1.00 15.97 ? 400 ARG A CB  1 
ATOM   3015 C CG  . ARG A 1 401 ? -3.428  -4.379  -22.852 1.00 16.61 ? 400 ARG A CG  1 
ATOM   3016 C CD  . ARG A 1 401 ? -3.407  -2.866  -22.852 1.00 19.74 ? 400 ARG A CD  1 
ATOM   3017 N NE  . ARG A 1 401 ? -2.083  -2.318  -22.607 1.00 18.72 ? 400 ARG A NE  1 
ATOM   3018 C CZ  . ARG A 1 401 ? -1.062  -2.365  -23.468 1.00 18.57 ? 400 ARG A CZ  1 
ATOM   3019 N NH1 . ARG A 1 401 ? -1.090  -3.084  -24.609 1.00 18.44 ? 400 ARG A NH1 1 
ATOM   3020 N NH2 . ARG A 1 401 ? 0.044   -1.791  -23.102 1.00 19.43 ? 400 ARG A NH2 1 
ATOM   3021 N N   . VAL A 1 402 ? -3.324  -7.674  -21.878 1.00 15.74 ? 401 VAL A N   1 
ATOM   3022 C CA  . VAL A 1 402 ? -2.937  -8.176  -20.542 1.00 16.48 ? 401 VAL A CA  1 
ATOM   3023 C C   . VAL A 1 402 ? -2.470  -6.952  -19.757 1.00 16.81 ? 401 VAL A C   1 
ATOM   3024 O O   . VAL A 1 402 ? -1.287  -6.534  -19.844 1.00 15.43 ? 401 VAL A O   1 
ATOM   3025 C CB  . VAL A 1 402 ? -1.838  -9.262  -20.637 1.00 17.11 ? 401 VAL A CB  1 
ATOM   3026 C CG1 . VAL A 1 402 ? -1.752  -10.079 -19.321 1.00 17.22 ? 401 VAL A CG1 1 
ATOM   3027 C CG2 . VAL A 1 402 ? -2.138  -10.230 -21.773 1.00 18.67 ? 401 VAL A CG2 1 
ATOM   3028 N N   . ALA A 1 403 ? -3.398  -6.386  -18.994 1.00 17.01 ? 402 ALA A N   1 
ATOM   3029 C CA  . ALA A 1 403 ? -3.160  -5.190  -18.211 1.00 18.92 ? 402 ALA A CA  1 
ATOM   3030 C C   . ALA A 1 403 ? -4.034  -5.230  -16.973 1.00 17.51 ? 402 ALA A C   1 
ATOM   3031 O O   . ALA A 1 403 ? -5.111  -5.781  -16.980 1.00 16.26 ? 402 ALA A O   1 
ATOM   3032 C CB  . ALA A 1 403 ? -3.463  -3.901  -19.017 1.00 18.33 ? 402 ALA A CB  1 
ATOM   3033 N N   . VAL A 1 404 ? -3.524  -4.631  -15.910 1.00 19.24 ? 403 VAL A N   1 
ATOM   3034 C CA  . VAL A 1 404 ? -4.240  -4.550  -14.649 1.00 18.15 ? 403 VAL A CA  1 
ATOM   3035 C C   . VAL A 1 404 ? -5.567  -3.863  -14.890 1.00 18.14 ? 403 VAL A C   1 
ATOM   3036 O O   . VAL A 1 404 ? -5.622  -2.793  -15.480 1.00 20.03 ? 403 VAL A O   1 
ATOM   3037 C CB  . VAL A 1 404 ? -3.377  -3.786  -13.566 1.00 19.16 ? 403 VAL A CB  1 
ATOM   3038 C CG1 . VAL A 1 404 ? -4.263  -3.407  -12.357 1.00 17.92 ? 403 VAL A CG1 1 
ATOM   3039 C CG2 . VAL A 1 404 ? -2.214  -4.691  -13.134 1.00 20.48 ? 403 VAL A CG2 1 
ATOM   3040 N N   . GLY A 1 405 ? -6.632  -4.509  -14.466 1.00 17.93 ? 404 GLY A N   1 
ATOM   3041 C CA  . GLY A 1 405 ? -7.976  -3.984  -14.567 1.00 18.96 ? 404 GLY A CA  1 
ATOM   3042 C C   . GLY A 1 405 ? -8.750  -4.529  -15.765 1.00 19.30 ? 404 GLY A C   1 
ATOM   3043 O O   . GLY A 1 405 ? -9.952  -4.323  -15.839 1.00 19.49 ? 404 GLY A O   1 
ATOM   3044 N N   . SER A 1 406 ? -8.061  -5.184  -16.710 1.00 18.11 ? 405 SER A N   1 
ATOM   3045 C CA  . SER A 1 406 ? -8.684  -5.779  -17.871 1.00 16.51 ? 405 SER A CA  1 
ATOM   3046 C C   . SER A 1 406 ? -9.302  -7.116  -17.483 1.00 17.49 ? 405 SER A C   1 
ATOM   3047 O O   . SER A 1 406 ? -8.912  -7.730  -16.461 1.00 18.56 ? 405 SER A O   1 
ATOM   3048 C CB  . SER A 1 406 ? -7.632  -5.967  -18.988 1.00 16.20 ? 405 SER A CB  1 
ATOM   3049 O OG  . SER A 1 406 ? -7.141  -4.679  -19.419 1.00 16.40 ? 405 SER A OG  1 
ATOM   3050 N N   . ASP A 1 407 ? -10.179 -7.620  -18.351 1.00 16.71 ? 406 ASP A N   1 
ATOM   3051 C CA  . ASP A 1 407 ? -10.836 -8.867  -18.110 1.00 18.27 ? 406 ASP A CA  1 
ATOM   3052 C C   . ASP A 1 407 ? -9.809  -9.948  -18.227 1.00 19.08 ? 406 ASP A C   1 
ATOM   3053 O O   . ASP A 1 407 ? -8.933  -9.931  -19.116 1.00 17.03 ? 406 ASP A O   1 
ATOM   3054 C CB  . ASP A 1 407 ? -11.976 -9.138  -19.099 1.00 19.15 ? 406 ASP A CB  1 
ATOM   3055 C CG  . ASP A 1 407 ? -13.209 -8.343  -18.816 1.00 20.51 ? 406 ASP A CG  1 
ATOM   3056 O OD1 . ASP A 1 407 ? -13.187 -7.459  -17.926 1.00 20.46 ? 406 ASP A OD1 1 
ATOM   3057 O OD2 . ASP A 1 407 ? -14.186 -8.554  -19.566 1.00 20.75 ? 406 ASP A OD2 1 
ATOM   3058 N N   . ALA A 1 408 ? -9.973  -10.965 -17.375 1.00 19.62 ? 407 ALA A N   1 
ATOM   3059 C CA  . ALA A 1 408 ? -9.070  -12.072 -17.370 1.00 19.93 ? 407 ALA A CA  1 
ATOM   3060 C C   . ALA A 1 408 ? -9.526  -13.102 -18.412 1.00 20.38 ? 407 ALA A C   1 
ATOM   3061 O O   . ALA A 1 408 ? -10.041 -14.154 -18.095 1.00 20.14 ? 407 ALA A O   1 
ATOM   3062 C CB  . ALA A 1 408 ? -8.939  -12.675 -15.974 1.00 22.23 ? 407 ALA A CB  1 
ATOM   3063 N N   . ASP A 1 409 ? -9.286  -12.761 -19.683 1.00 19.19 ? 408 ASP A N   1 
ATOM   3064 C CA  . ASP A 1 409 ? -9.507  -13.624 -20.828 1.00 18.50 ? 408 ASP A CA  1 
ATOM   3065 C C   . ASP A 1 409 ? -8.137  -13.808 -21.373 1.00 18.02 ? 408 ASP A C   1 
ATOM   3066 O O   . ASP A 1 409 ? -7.578  -12.860 -21.919 1.00 16.83 ? 408 ASP A O   1 
ATOM   3067 C CB  . ASP A 1 409 ? -10.394 -12.929 -21.846 1.00 19.52 ? 408 ASP A CB  1 
ATOM   3068 C CG  . ASP A 1 409 ? -11.867 -12.851 -21.435 1.00 21.95 ? 408 ASP A CG  1 
ATOM   3069 O OD1 . ASP A 1 409 ? -12.327 -13.494 -20.419 1.00 19.92 ? 408 ASP A OD1 1 
ATOM   3070 O OD2 . ASP A 1 409 ? -12.571 -12.070 -22.136 1.00 22.36 ? 408 ASP A OD2 1 
ATOM   3071 N N   . LEU A 1 410 ? -7.559  -14.991 -21.219 1.00 18.26 ? 409 LEU A N   1 
ATOM   3072 C CA  . LEU A 1 410 ? -6.129  -15.158 -21.401 1.00 17.89 ? 409 LEU A CA  1 
ATOM   3073 C C   . LEU A 1 410 ? -5.904  -16.482 -22.056 1.00 20.36 ? 409 LEU A C   1 
ATOM   3074 O O   . LEU A 1 410 ? -6.636  -17.428 -21.796 1.00 18.46 ? 409 LEU A O   1 
ATOM   3075 C CB  . LEU A 1 410 ? -5.356  -15.097 -20.060 1.00 17.38 ? 409 LEU A CB  1 
ATOM   3076 C CG  . LEU A 1 410 ? -5.414  -13.791 -19.275 1.00 19.07 ? 409 LEU A CG  1 
ATOM   3077 C CD1 . LEU A 1 410 ? -4.782  -13.882 -17.890 1.00 22.48 ? 409 LEU A CD1 1 
ATOM   3078 C CD2 . LEU A 1 410 ? -4.733  -12.698 -20.028 1.00 19.35 ? 409 LEU A CD2 1 
ATOM   3079 N N   . VAL A 1 411 ? -4.918  -16.527 -22.961 1.00 19.52 ? 410 VAL A N   1 
ATOM   3080 C CA  . VAL A 1 411 ? -4.507  -17.767 -23.596 1.00 19.71 ? 410 VAL A CA  1 
ATOM   3081 C C   . VAL A 1 411 ? -3.056  -18.016 -23.235 1.00 20.58 ? 410 VAL A C   1 
ATOM   3082 O O   . VAL A 1 411 ? -2.201  -17.144 -23.463 1.00 18.43 ? 410 VAL A O   1 
ATOM   3083 C CB  . VAL A 1 411 ? -4.670  -17.758 -25.125 1.00 19.28 ? 410 VAL A CB  1 
ATOM   3084 C CG1 . VAL A 1 411 ? -4.269  -19.137 -25.727 1.00 19.56 ? 410 VAL A CG1 1 
ATOM   3085 C CG2 . VAL A 1 411 ? -6.124  -17.541 -25.397 1.00 19.58 ? 410 VAL A CG2 1 
ATOM   3086 N N   . ILE A 1 412 ? -2.789  -19.214 -22.693 1.00 20.76 ? 411 ILE A N   1 
ATOM   3087 C CA  . ILE A 1 412 ? -1.439  -19.669 -22.568 1.00 21.19 ? 411 ILE A CA  1 
ATOM   3088 C C   . ILE A 1 412 ? -1.117  -20.420 -23.839 1.00 19.67 ? 411 ILE A C   1 
ATOM   3089 O O   . ILE A 1 412 ? -1.589  -21.511 -24.048 1.00 18.61 ? 411 ILE A O   1 
ATOM   3090 C CB  . ILE A 1 412 ? -1.187  -20.451 -21.300 1.00 23.17 ? 411 ILE A CB  1 
ATOM   3091 C CG1 . ILE A 1 412 ? -1.616  -19.581 -20.096 1.00 24.62 ? 411 ILE A CG1 1 
ATOM   3092 C CG2 . ILE A 1 412 ? 0.311   -20.785 -21.193 1.00 25.63 ? 411 ILE A CG2 1 
ATOM   3093 C CD1 . ILE A 1 412 ? -1.529  -20.350 -18.818 1.00 26.63 ? 411 ILE A CD1 1 
ATOM   3094 N N   . TRP A 1 413 ? -0.286  -19.793 -24.661 1.00 17.24 ? 412 TRP A N   1 
ATOM   3095 C CA  . TRP A 1 413 ? -0.051  -20.130 -26.064 1.00 17.33 ? 412 TRP A CA  1 
ATOM   3096 C C   . TRP A 1 413 ? 1.291   -20.838 -26.196 1.00 17.76 ? 412 TRP A C   1 
ATOM   3097 O O   . TRP A 1 413 ? 2.306   -20.389 -25.666 1.00 17.97 ? 412 TRP A O   1 
ATOM   3098 C CB  . TRP A 1 413 ? -0.071  -18.836 -26.920 1.00 17.58 ? 412 TRP A CB  1 
ATOM   3099 C CG  . TRP A 1 413 ? -0.018  -19.095 -28.400 1.00 17.98 ? 412 TRP A CG  1 
ATOM   3100 C CD1 . TRP A 1 413 ? 1.068   -19.058 -29.219 1.00 18.82 ? 412 TRP A CD1 1 
ATOM   3101 C CD2 . TRP A 1 413 ? -1.120  -19.463 -29.226 1.00 17.92 ? 412 TRP A CD2 1 
ATOM   3102 N NE1 . TRP A 1 413 ? 0.728   -19.421 -30.501 1.00 18.46 ? 412 TRP A NE1 1 
ATOM   3103 C CE2 . TRP A 1 413 ? -0.612  -19.672 -30.540 1.00 17.69 ? 412 TRP A CE2 1 
ATOM   3104 C CE3 . TRP A 1 413 ? -2.478  -19.638 -28.993 1.00 17.98 ? 412 TRP A CE3 1 
ATOM   3105 C CZ2 . TRP A 1 413 ? -1.410  -19.999 -31.588 1.00 18.35 ? 412 TRP A CZ2 1 
ATOM   3106 C CZ3 . TRP A 1 413 ? -3.285  -19.961 -30.081 1.00 20.50 ? 412 TRP A CZ3 1 
ATOM   3107 C CH2 . TRP A 1 413 ? -2.751  -20.168 -31.336 1.00 18.24 ? 412 TRP A CH2 1 
ATOM   3108 N N   . ASN A 1 414 ? 1.296   -21.936 -26.919 1.00 18.30 ? 413 ASN A N   1 
ATOM   3109 C CA  . ASN A 1 414 ? 2.494   -22.715 -27.196 1.00 18.67 ? 413 ASN A CA  1 
ATOM   3110 C C   . ASN A 1 414 ? 2.901   -22.600 -28.675 1.00 19.17 ? 413 ASN A C   1 
ATOM   3111 O O   . ASN A 1 414 ? 2.322   -23.276 -29.577 1.00 19.18 ? 413 ASN A O   1 
ATOM   3112 C CB  . ASN A 1 414 ? 2.322   -24.172 -26.854 1.00 19.90 ? 413 ASN A CB  1 
ATOM   3113 C CG  . ASN A 1 414 ? 3.631   -24.963 -27.066 1.00 23.42 ? 413 ASN A CG  1 
ATOM   3114 O OD1 . ASN A 1 414 ? 4.655   -24.431 -27.531 1.00 25.53 ? 413 ASN A OD1 1 
ATOM   3115 N ND2 . ASN A 1 414 ? 3.591   -26.225 -26.767 1.00 24.78 ? 413 ASN A ND2 1 
ATOM   3116 N N   . PRO A 1 415 ? 3.895   -21.740 -28.949 1.00 21.09 ? 414 PRO A N   1 
ATOM   3117 C CA  . PRO A 1 415 ? 4.322   -21.595 -30.369 1.00 23.50 ? 414 PRO A CA  1 
ATOM   3118 C C   . PRO A 1 415 ? 4.946   -22.815 -31.017 1.00 24.89 ? 414 PRO A C   1 
ATOM   3119 O O   . PRO A 1 415 ? 4.997   -22.892 -32.239 1.00 28.66 ? 414 PRO A O   1 
ATOM   3120 C CB  . PRO A 1 415 ? 5.282   -20.397 -30.336 1.00 24.29 ? 414 PRO A CB  1 
ATOM   3121 C CG  . PRO A 1 415 ? 5.751   -20.289 -28.938 1.00 24.56 ? 414 PRO A CG  1 
ATOM   3122 C CD  . PRO A 1 415 ? 4.764   -20.990 -28.031 1.00 23.92 ? 414 PRO A CD  1 
ATOM   3123 N N   . LYS A 1 416 ? 5.368   -23.793 -30.229 1.00 27.32 ? 415 LYS A N   1 
ATOM   3124 C CA  . LYS A 1 416 ? 5.946   -25.005 -30.782 1.00 27.79 ? 415 LYS A CA  1 
ATOM   3125 C C   . LYS A 1 416 ? 4.993   -26.129 -30.992 1.00 26.90 ? 415 LYS A C   1 
ATOM   3126 O O   . LYS A 1 416 ? 5.367   -27.073 -31.595 1.00 29.60 ? 415 LYS A O   1 
ATOM   3127 C CB  . LYS A 1 416 ? 7.113   -25.492 -29.918 1.00 33.41 ? 415 LYS A CB  1 
ATOM   3128 C CG  . LYS A 1 416 ? 8.255   -24.487 -29.891 1.00 34.04 ? 415 LYS A CG  1 
ATOM   3129 C CD  . LYS A 1 416 ? 9.396   -24.866 -28.966 1.00 38.16 ? 415 LYS A CD  1 
ATOM   3130 C CE  . LYS A 1 416 ? 10.379  -23.706 -28.963 1.00 41.44 ? 415 LYS A CE  1 
ATOM   3131 N NZ  . LYS A 1 416 ? 11.626  -24.056 -28.241 1.00 48.06 ? 415 LYS A NZ  1 
ATOM   3132 N N   . ALA A 1 417 ? 3.752   -26.025 -30.560 1.00 25.88 ? 416 ALA A N   1 
ATOM   3133 C CA  . ALA A 1 417 ? 2.811   -27.099 -30.756 1.00 27.88 ? 416 ALA A CA  1 
ATOM   3134 C C   . ALA A 1 417 ? 2.436   -27.156 -32.236 1.00 29.24 ? 416 ALA A C   1 
ATOM   3135 O O   . ALA A 1 417 ? 2.450   -26.146 -32.924 1.00 26.35 ? 416 ALA A O   1 
ATOM   3136 C CB  . ALA A 1 417 ? 1.555   -26.848 -29.928 1.00 28.38 ? 416 ALA A CB  1 
ATOM   3137 N N   . THR A 1 418 ? 2.078   -28.335 -32.704 1.00 30.39 ? 417 THR A N   1 
ATOM   3138 C CA  . THR A 1 418 ? 1.613   -28.506 -34.070 1.00 34.06 ? 417 THR A CA  1 
ATOM   3139 C C   . THR A 1 418 ? 0.361   -29.372 -33.995 1.00 36.31 ? 417 THR A C   1 
ATOM   3140 O O   . THR A 1 418 ? 0.280   -30.274 -33.154 1.00 39.81 ? 417 THR A O   1 
ATOM   3141 C CB  . THR A 1 418 ? 2.665   -29.223 -34.918 1.00 35.24 ? 417 THR A CB  1 
ATOM   3142 O OG1 . THR A 1 418 ? 2.861   -30.491 -34.350 1.00 40.79 ? 417 THR A OG1 1 
ATOM   3143 C CG2 . THR A 1 418 ? 3.958   -28.531 -34.915 1.00 37.35 ? 417 THR A CG2 1 
ATOM   3144 N N   . LYS A 1 419 ? -0.637  -29.089 -34.812 1.00 32.87 ? 418 LYS A N   1 
ATOM   3145 C CA  . LYS A 1 419 ? -1.885  -29.878 -34.817 1.00 32.03 ? 418 LYS A CA  1 
ATOM   3146 C C   . LYS A 1 419 ? -2.329  -29.992 -36.253 1.00 31.88 ? 418 LYS A C   1 
ATOM   3147 O O   . LYS A 1 419 ? -2.144  -29.038 -36.982 1.00 31.98 ? 418 LYS A O   1 
ATOM   3148 C CB  . LYS A 1 419 ? -2.958  -29.210 -33.967 1.00 29.22 ? 418 LYS A CB  1 
ATOM   3149 N N   . ILE A 1 420 ? -2.853  -31.166 -36.652 1.00 29.17 ? 419 ILE A N   1 
ATOM   3150 C CA  . ILE A 1 420 ? -3.490  -31.384 -37.937 1.00 29.29 ? 419 ILE A CA  1 
ATOM   3151 C C   . ILE A 1 420 ? -4.975  -31.208 -37.692 1.00 29.66 ? 419 ILE A C   1 
ATOM   3152 O O   . ILE A 1 420 ? -5.553  -31.866 -36.831 1.00 29.55 ? 419 ILE A O   1 
ATOM   3153 C CB  . ILE A 1 420 ? -3.156  -32.766 -38.533 1.00 32.94 ? 419 ILE A CB  1 
ATOM   3154 C CG1 . ILE A 1 420 ? -1.612  -32.897 -38.598 1.00 37.34 ? 419 ILE A CG1 1 
ATOM   3155 C CG2 . ILE A 1 420 ? -3.761  -32.929 -39.931 1.00 33.49 ? 419 ILE A CG2 1 
ATOM   3156 C CD1 . ILE A 1 420 ? -1.061  -34.045 -39.414 1.00 39.34 ? 419 ILE A CD1 1 
ATOM   3157 N N   . ILE A 1 421 ? -5.593  -30.281 -38.418 1.00 24.22 ? 420 ILE A N   1 
ATOM   3158 C CA  . ILE A 1 421 ? -7.021  -30.058 -38.275 1.00 22.46 ? 420 ILE A CA  1 
ATOM   3159 C C   . ILE A 1 421 ? -7.779  -31.226 -38.930 1.00 21.34 ? 420 ILE A C   1 
ATOM   3160 O O   . ILE A 1 421 ? -7.445  -31.642 -40.055 1.00 23.12 ? 420 ILE A O   1 
ATOM   3161 C CB  . ILE A 1 421 ? -7.397  -28.695 -38.893 1.00 21.73 ? 420 ILE A CB  1 
ATOM   3162 C CG1 . ILE A 1 421 ? -6.672  -27.585 -38.142 1.00 21.45 ? 420 ILE A CG1 1 
ATOM   3163 C CG2 . ILE A 1 421 ? -8.879  -28.482 -38.769 1.00 21.98 ? 420 ILE A CG2 1 
ATOM   3164 C CD1 . ILE A 1 421 ? -6.538  -26.332 -38.983 1.00 22.93 ? 420 ILE A CD1 1 
ATOM   3165 N N   . SER A 1 422 ? -8.811  -31.720 -38.252 1.00 21.51 ? 421 SER A N   1 
ATOM   3166 C CA  . SER A 1 422 ? -9.650  -32.778 -38.789 1.00 23.22 ? 421 SER A CA  1 
ATOM   3167 C C   . SER A 1 422 ? -11.035 -32.763 -38.215 1.00 22.86 ? 421 SER A C   1 
ATOM   3168 O O   . SER A 1 422 ? -11.207 -32.502 -37.014 1.00 23.49 ? 421 SER A O   1 
ATOM   3169 C CB  . SER A 1 422 ? -9.068  -34.173 -38.430 1.00 26.01 ? 421 SER A CB  1 
ATOM   3170 O OG  . SER A 1 422 ? -9.763  -35.177 -39.175 1.00 30.40 ? 421 SER A OG  1 
ATOM   3171 N N   . ALA A 1 423 ? -12.004 -33.141 -39.036 1.00 22.81 ? 422 ALA A N   1 
ATOM   3172 C CA  . ALA A 1 423 ? -13.337 -33.402 -38.492 1.00 26.90 ? 422 ALA A CA  1 
ATOM   3173 C C   . ALA A 1 423 ? -13.369 -34.512 -37.443 1.00 27.42 ? 422 ALA A C   1 
ATOM   3174 O O   . ALA A 1 423 ? -14.302 -34.535 -36.606 1.00 25.89 ? 422 ALA A O   1 
ATOM   3175 C CB  . ALA A 1 423 ? -14.360 -33.727 -39.560 1.00 24.04 ? 422 ALA A CB  1 
ATOM   3176 N N   . LYS A 1 424 ? -12.368 -35.404 -37.488 1.00 28.01 ? 423 LYS A N   1 
ATOM   3177 C CA  . LYS A 1 424 ? -12.238 -36.415 -36.439 1.00 32.18 ? 423 LYS A CA  1 
ATOM   3178 C C   . LYS A 1 424 ? -12.085 -35.817 -35.063 1.00 31.17 ? 423 LYS A C   1 
ATOM   3179 O O   . LYS A 1 424 ? -12.541 -36.398 -34.137 1.00 30.70 ? 423 LYS A O   1 
ATOM   3180 C CB  . LYS A 1 424 ? -11.089 -37.378 -36.728 1.00 35.57 ? 423 LYS A CB  1 
ATOM   3181 C CG  . LYS A 1 424 ? -11.394 -38.297 -37.897 1.00 41.36 ? 423 LYS A CG  1 
ATOM   3182 C CD  . LYS A 1 424 ? -10.143 -38.994 -38.414 1.00 49.63 ? 423 LYS A CD  1 
ATOM   3183 C CE  . LYS A 1 424 ? -9.319  -38.097 -39.339 1.00 56.25 ? 423 LYS A CE  1 
ATOM   3184 N NZ  . LYS A 1 424 ? -8.380  -38.848 -40.235 1.00 65.33 ? 423 LYS A NZ  1 
ATOM   3185 N N   . THR A 1 425 ? -11.441 -34.659 -34.914 1.00 30.35 ? 424 THR A N   1 
ATOM   3186 C CA  . THR A 1 425 ? -11.222 -34.084 -33.561 1.00 26.98 ? 424 THR A CA  1 
ATOM   3187 C C   . THR A 1 425 ? -11.843 -32.720 -33.312 1.00 25.71 ? 424 THR A C   1 
ATOM   3188 O O   . THR A 1 425 ? -11.726 -32.204 -32.217 1.00 25.41 ? 424 THR A O   1 
ATOM   3189 C CB  . THR A 1 425 ? -9.709  -33.930 -33.287 1.00 29.39 ? 424 THR A CB  1 
ATOM   3190 O OG1 . THR A 1 425 ? -9.139  -33.140 -34.327 1.00 28.39 ? 424 THR A OG1 1 
ATOM   3191 C CG2 . THR A 1 425 ? -8.994  -35.284 -33.264 1.00 27.15 ? 424 THR A CG2 1 
ATOM   3192 N N   . HIS A 1 426 ? -12.456 -32.103 -34.311 1.00 23.31 ? 425 HIS A N   1 
ATOM   3193 C CA  . HIS A 1 426 ? -12.997 -30.748 -34.120 1.00 23.17 ? 425 HIS A CA  1 
ATOM   3194 C C   . HIS A 1 426 ? -14.209 -30.725 -33.206 1.00 22.09 ? 425 HIS A C   1 
ATOM   3195 O O   . HIS A 1 426 ? -14.845 -31.723 -32.997 1.00 25.28 ? 425 HIS A O   1 
ATOM   3196 C CB  . HIS A 1 426 ? -13.298 -30.051 -35.443 1.00 22.94 ? 425 HIS A CB  1 
ATOM   3197 C CG  . HIS A 1 426 ? -14.441 -30.598 -36.238 1.00 22.94 ? 425 HIS A CG  1 
ATOM   3198 N ND1 . HIS A 1 426 ? -14.645 -30.227 -37.546 1.00 21.15 ? 425 HIS A ND1 1 
ATOM   3199 C CD2 . HIS A 1 426 ? -15.473 -31.423 -35.918 1.00 23.54 ? 425 HIS A CD2 1 
ATOM   3200 C CE1 . HIS A 1 426 ? -15.720 -30.838 -38.013 1.00 22.29 ? 425 HIS A CE1 1 
ATOM   3201 N NE2 . HIS A 1 426 ? -16.243 -31.558 -37.045 1.00 22.24 ? 425 HIS A NE2 1 
ATOM   3202 N N   . ASN A 1 427 ? -14.516 -29.562 -32.658 1.00 22.21 ? 426 ASN A N   1 
ATOM   3203 C CA  . ASN A 1 427 ? -15.603 -29.406 -31.692 1.00 21.29 ? 426 ASN A CA  1 
ATOM   3204 C C   . ASN A 1 427 ? -16.870 -28.851 -32.329 1.00 21.88 ? 426 ASN A C   1 
ATOM   3205 O O   . ASN A 1 427 ? -17.489 -27.910 -31.778 1.00 22.99 ? 426 ASN A O   1 
ATOM   3206 C CB  . ASN A 1 427 ? -15.128 -28.498 -30.607 1.00 20.17 ? 426 ASN A CB  1 
ATOM   3207 C CG  . ASN A 1 427 ? -14.229 -29.197 -29.637 1.00 22.58 ? 426 ASN A CG  1 
ATOM   3208 O OD1 . ASN A 1 427 ? -14.719 -29.884 -28.745 1.00 25.48 ? 426 ASN A OD1 1 
ATOM   3209 N ND2 . ASN A 1 427 ? -12.937 -28.987 -29.752 1.00 20.62 ? 426 ASN A ND2 1 
ATOM   3210 N N   . LEU A 1 428 ? -17.190 -29.359 -33.531 1.00 23.18 ? 427 LEU A N   1 
ATOM   3211 C CA  . LEU A 1 428 ? -18.350 -28.885 -34.331 1.00 23.06 ? 427 LEU A CA  1 
ATOM   3212 C C   . LEU A 1 428 ? -19.319 -30.031 -34.524 1.00 23.87 ? 427 LEU A C   1 
ATOM   3213 O O   . LEU A 1 428 ? -18.953 -31.221 -34.484 1.00 23.09 ? 427 LEU A O   1 
ATOM   3214 C CB  . LEU A 1 428 ? -17.928 -28.408 -35.734 1.00 24.38 ? 427 LEU A CB  1 
ATOM   3215 C CG  . LEU A 1 428 ? -16.796 -27.374 -35.772 1.00 24.86 ? 427 LEU A CG  1 
ATOM   3216 C CD1 . LEU A 1 428 ? -16.500 -26.939 -37.207 1.00 25.29 ? 427 LEU A CD1 1 
ATOM   3217 C CD2 . LEU A 1 428 ? -17.131 -26.208 -34.898 1.00 26.19 ? 427 LEU A CD2 1 
ATOM   3218 N N   . ASN A 1 429 ? -20.520 -29.639 -34.883 1.00 21.62 ? 428 ASN A N   1 
ATOM   3219 C CA  . ASN A 1 429 ? -21.611 -30.562 -35.080 1.00 23.61 ? 428 ASN A CA  1 
ATOM   3220 C C   . ASN A 1 429 ? -21.780 -30.981 -36.567 1.00 26.22 ? 428 ASN A C   1 
ATOM   3221 O O   . ASN A 1 429 ? -22.790 -31.537 -36.933 1.00 29.21 ? 428 ASN A O   1 
ATOM   3222 C CB  . ASN A 1 429 ? -22.857 -29.881 -34.566 1.00 22.53 ? 428 ASN A CB  1 
ATOM   3223 C CG  . ASN A 1 429 ? -22.953 -29.932 -33.060 1.00 25.99 ? 428 ASN A CG  1 
ATOM   3224 O OD1 . ASN A 1 429 ? -22.492 -30.880 -32.451 1.00 28.53 ? 428 ASN A OD1 1 
ATOM   3225 N ND2 . ASN A 1 429 ? -23.614 -28.950 -32.462 1.00 26.26 ? 428 ASN A ND2 1 
ATOM   3226 N N   . VAL A 1 430 ? -20.779 -30.744 -37.397 1.00 23.75 ? 429 VAL A N   1 
ATOM   3227 C CA  . VAL A 1 430 ? -20.817 -31.086 -38.805 1.00 22.41 ? 429 VAL A CA  1 
ATOM   3228 C C   . VAL A 1 430 ? -19.717 -32.091 -39.088 1.00 24.44 ? 429 VAL A C   1 
ATOM   3229 O O   . VAL A 1 430 ? -18.767 -32.249 -38.301 1.00 23.97 ? 429 VAL A O   1 
ATOM   3230 C CB  . VAL A 1 430 ? -20.678 -29.832 -39.690 1.00 22.28 ? 429 VAL A CB  1 
ATOM   3231 C CG1 . VAL A 1 430 ? -21.852 -28.899 -39.451 1.00 20.57 ? 429 VAL A CG1 1 
ATOM   3232 C CG2 . VAL A 1 430 ? -19.372 -29.085 -39.423 1.00 21.06 ? 429 VAL A CG2 1 
ATOM   3233 N N   . GLU A 1 431 ? -19.857 -32.767 -40.217 1.00 21.96 ? 430 GLU A N   1 
ATOM   3234 C CA  . GLU A 1 431 ? -19.026 -33.904 -40.579 1.00 24.26 ? 430 GLU A CA  1 
ATOM   3235 C C   . GLU A 1 431 ? -17.753 -33.505 -41.319 1.00 23.18 ? 430 GLU A C   1 
ATOM   3236 O O   . GLU A 1 431 ? -16.776 -34.252 -41.256 1.00 22.11 ? 430 GLU A O   1 
ATOM   3237 C CB  . GLU A 1 431 ? -19.851 -34.842 -41.494 1.00 26.11 ? 430 GLU A CB  1 
ATOM   3238 C CG  . GLU A 1 431 ? -21.224 -35.237 -40.938 1.00 30.62 ? 430 GLU A CG  1 
ATOM   3239 C CD  . GLU A 1 431 ? -22.445 -34.316 -41.339 1.00 30.21 ? 430 GLU A CD  1 
ATOM   3240 O OE1 . GLU A 1 431 ? -22.358 -33.118 -41.723 1.00 27.46 ? 430 GLU A OE1 1 
ATOM   3241 O OE2 . GLU A 1 431 ? -23.567 -34.818 -41.225 1.00 35.21 ? 430 GLU A OE2 1 
ATOM   3242 N N   . TYR A 1 432 ? -17.789 -32.372 -42.059 1.00 21.74 ? 431 TYR A N   1 
ATOM   3243 C CA  . TYR A 1 432 ? -16.645 -31.884 -42.822 1.00 20.34 ? 431 TYR A CA  1 
ATOM   3244 C C   . TYR A 1 432 ? -16.018 -30.694 -42.154 1.00 21.26 ? 431 TYR A C   1 
ATOM   3245 O O   . TYR A 1 432 ? -16.681 -29.926 -41.437 1.00 20.06 ? 431 TYR A O   1 
ATOM   3246 C CB  . TYR A 1 432 ? -16.986 -31.560 -44.280 1.00 20.77 ? 431 TYR A CB  1 
ATOM   3247 C CG  . TYR A 1 432 ? -17.218 -32.799 -45.100 1.00 21.96 ? 431 TYR A CG  1 
ATOM   3248 C CD1 . TYR A 1 432 ? -18.447 -33.463 -45.061 1.00 22.59 ? 431 TYR A CD1 1 
ATOM   3249 C CD2 . TYR A 1 432 ? -16.213 -33.313 -45.929 1.00 24.76 ? 431 TYR A CD2 1 
ATOM   3250 C CE1 . TYR A 1 432 ? -18.671 -34.604 -45.843 1.00 24.35 ? 431 TYR A CE1 1 
ATOM   3251 C CE2 . TYR A 1 432 ? -16.428 -34.445 -46.678 1.00 23.04 ? 431 TYR A CE2 1 
ATOM   3252 C CZ  . TYR A 1 432 ? -17.647 -35.090 -46.623 1.00 23.67 ? 431 TYR A CZ  1 
ATOM   3253 O OH  . TYR A 1 432 ? -17.832 -36.191 -47.418 1.00 29.22 ? 431 TYR A OH  1 
ATOM   3254 N N   . ASN A 1 433 ? -14.721 -30.578 -42.362 1.00 21.27 ? 432 ASN A N   1 
ATOM   3255 C CA  . ASN A 1 433 ? -13.956 -29.385 -41.966 1.00 20.67 ? 432 ASN A CA  1 
ATOM   3256 C C   . ASN A 1 433 ? -13.195 -28.853 -43.195 1.00 19.31 ? 432 ASN A C   1 
ATOM   3257 O O   . ASN A 1 433 ? -12.465 -29.588 -43.828 1.00 21.26 ? 432 ASN A O   1 
ATOM   3258 C CB  . ASN A 1 433 ? -13.053 -29.720 -40.780 1.00 19.52 ? 432 ASN A CB  1 
ATOM   3259 C CG  . ASN A 1 433 ? -12.493 -28.493 -40.150 1.00 19.57 ? 432 ASN A CG  1 
ATOM   3260 O OD1 . ASN A 1 433 ? -11.896 -27.631 -40.840 1.00 19.92 ? 432 ASN A OD1 1 
ATOM   3261 N ND2 . ASN A 1 433 ? -12.667 -28.384 -38.870 1.00 21.17 ? 432 ASN A ND2 1 
ATOM   3262 N N   . ILE A 1 434 ? -13.410 -27.592 -43.570 1.00 17.19 ? 433 ILE A N   1 
ATOM   3263 C CA  . ILE A 1 434 ? -12.749 -27.067 -44.759 1.00 18.67 ? 433 ILE A CA  1 
ATOM   3264 C C   . ILE A 1 434 ? -11.220 -27.034 -44.584 1.00 18.77 ? 433 ILE A C   1 
ATOM   3265 O O   . ILE A 1 434 ? -10.531 -26.815 -45.566 1.00 22.61 ? 433 ILE A O   1 
ATOM   3266 C CB  . ILE A 1 434 ? -13.289 -25.691 -45.231 1.00 17.59 ? 433 ILE A CB  1 
ATOM   3267 C CG1 . ILE A 1 434 ? -13.073 -24.588 -44.183 1.00 18.94 ? 433 ILE A CG1 1 
ATOM   3268 C CG2 . ILE A 1 434 ? -14.763 -25.850 -45.629 1.00 17.70 ? 433 ILE A CG2 1 
ATOM   3269 C CD1 . ILE A 1 434 ? -13.223 -23.182 -44.758 1.00 19.05 ? 433 ILE A CD1 1 
ATOM   3270 N N   . PHE A 1 435 ? -10.700 -27.239 -43.370 1.00 17.76 ? 434 PHE A N   1 
ATOM   3271 C CA  . PHE A 1 435 ? -9.254  -27.338 -43.160 1.00 19.55 ? 434 PHE A CA  1 
ATOM   3272 C C   . PHE A 1 435 ? -8.723  -28.756 -42.925 1.00 20.70 ? 434 PHE A C   1 
ATOM   3273 O O   . PHE A 1 435 ? -7.625  -28.914 -42.376 1.00 19.88 ? 434 PHE A O   1 
ATOM   3274 C CB  . PHE A 1 435 ? -8.818  -26.423 -42.012 1.00 18.58 ? 434 PHE A CB  1 
ATOM   3275 C CG  . PHE A 1 435 ? -9.393  -25.030 -42.123 1.00 18.10 ? 434 PHE A CG  1 
ATOM   3276 C CD1 . PHE A 1 435 ? -9.013  -24.191 -43.194 1.00 19.34 ? 434 PHE A CD1 1 
ATOM   3277 C CD2 . PHE A 1 435 ? -10.383 -24.600 -41.259 1.00 19.37 ? 434 PHE A CD2 1 
ATOM   3278 C CE1 . PHE A 1 435 ? -9.574  -22.911 -43.343 1.00 18.03 ? 434 PHE A CE1 1 
ATOM   3279 C CE2 . PHE A 1 435 ? -10.987 -23.329 -41.434 1.00 17.49 ? 434 PHE A CE2 1 
ATOM   3280 C CZ  . PHE A 1 435 ? -10.572 -22.508 -42.442 1.00 18.52 ? 434 PHE A CZ  1 
ATOM   3281 N N   . GLU A 1 436 ? -9.477  -29.752 -43.360 1.00 19.31 ? 435 GLU A N   1 
ATOM   3282 C CA  . GLU A 1 436 ? -9.114  -31.123 -43.175 1.00 22.10 ? 435 GLU A CA  1 
ATOM   3283 C C   . GLU A 1 436 ? -7.719  -31.337 -43.671 1.00 21.05 ? 435 GLU A C   1 
ATOM   3284 O O   . GLU A 1 436 ? -7.372  -30.978 -44.824 1.00 20.71 ? 435 GLU A O   1 
ATOM   3285 C CB  . GLU A 1 436 ? -10.055 -32.083 -43.935 1.00 22.57 ? 435 GLU A CB  1 
ATOM   3286 C CG  . GLU A 1 436 ? -9.834  -33.595 -43.645 1.00 24.35 ? 435 GLU A CG  1 
ATOM   3287 C CD  . GLU A 1 436 ? -10.227 -33.986 -42.244 1.00 25.67 ? 435 GLU A CD  1 
ATOM   3288 O OE1 . GLU A 1 436 ? -11.271 -33.460 -41.738 1.00 28.49 ? 435 GLU A OE1 1 
ATOM   3289 O OE2 . GLU A 1 436 ? -9.467  -34.775 -41.604 1.00 27.97 ? 435 GLU A OE2 1 
ATOM   3290 N N   . GLY A 1 437 ? -6.906  -31.858 -42.760 1.00 24.69 ? 436 GLY A N   1 
ATOM   3291 C CA  . GLY A 1 437 ? -5.511  -32.205 -43.065 1.00 26.09 ? 436 GLY A CA  1 
ATOM   3292 C C   . GLY A 1 437 ? -4.531  -31.044 -43.039 1.00 24.49 ? 436 GLY A C   1 
ATOM   3293 O O   . GLY A 1 437 ? -3.401  -31.266 -43.274 1.00 25.77 ? 436 GLY A O   1 
ATOM   3294 N N   . VAL A 1 438 ? -4.925  -29.815 -42.713 1.00 24.64 ? 437 VAL A N   1 
ATOM   3295 C CA  . VAL A 1 438 ? -4.005  -28.695 -42.690 1.00 23.25 ? 437 VAL A CA  1 
ATOM   3296 C C   . VAL A 1 438 ? -3.298  -28.806 -41.369 1.00 23.95 ? 437 VAL A C   1 
ATOM   3297 O O   . VAL A 1 438 ? -3.923  -29.039 -40.340 1.00 28.01 ? 437 VAL A O   1 
ATOM   3298 C CB  . VAL A 1 438 ? -4.690  -27.322 -42.835 1.00 22.18 ? 437 VAL A CB  1 
ATOM   3299 C CG1 . VAL A 1 438 ? -3.724  -26.157 -42.605 1.00 22.22 ? 437 VAL A CG1 1 
ATOM   3300 C CG2 . VAL A 1 438 ? -5.255  -27.188 -44.234 1.00 24.49 ? 437 VAL A CG2 1 
ATOM   3301 N N   . GLU A 1 439 ? -1.982  -28.670 -41.404 1.00 26.15 ? 438 GLU A N   1 
ATOM   3302 C CA  . GLU A 1 439 ? -1.172  -28.700 -40.178 1.00 26.51 ? 438 GLU A CA  1 
ATOM   3303 C C   . GLU A 1 439 ? -0.828  -27.259 -39.775 1.00 24.52 ? 438 GLU A C   1 
ATOM   3304 O O   . GLU A 1 439 ? -0.335  -26.502 -40.611 1.00 25.21 ? 438 GLU A O   1 
ATOM   3305 C CB  . GLU A 1 439 ? 0.106   -29.486 -40.427 1.00 35.25 ? 438 GLU A CB  1 
ATOM   3306 C CG  . GLU A 1 439 ? 0.911   -29.659 -39.134 1.00 42.49 ? 438 GLU A CG  1 
ATOM   3307 C CD  . GLU A 1 439 ? 1.988   -30.737 -39.265 1.00 50.48 ? 438 GLU A CD  1 
ATOM   3308 O OE1 . GLU A 1 439 ? 2.805   -30.587 -40.190 1.00 52.64 ? 438 GLU A OE1 1 
ATOM   3309 O OE2 . GLU A 1 439 ? 1.998   -31.728 -38.470 1.00 59.13 ? 438 GLU A OE2 1 
ATOM   3310 N N   . CYS A 1 440 ? -1.112  -26.871 -38.538 1.00 24.16 ? 439 CYS A N   1 
ATOM   3311 C CA  . CYS A 1 440 ? -0.754  -25.542 -38.027 1.00 22.32 ? 439 CYS A CA  1 
ATOM   3312 C C   . CYS A 1 440 ? 0.215   -25.634 -36.876 1.00 23.14 ? 439 CYS A C   1 
ATOM   3313 O O   . CYS A 1 440 ? 0.088   -26.523 -36.010 1.00 23.72 ? 439 CYS A O   1 
ATOM   3314 C CB  . CYS A 1 440 ? -1.993  -24.826 -37.476 1.00 25.54 ? 439 CYS A CB  1 
ATOM   3315 S SG  . CYS A 1 440 ? -3.183  -24.503 -38.765 1.00 27.08 ? 439 CYS A SG  1 
ATOM   3316 N N   . ARG A 1 441 ? 1.180   -24.724 -36.904 1.00 23.36 ? 440 ARG A N   1 
ATOM   3317 C CA  . ARG A 1 441 ? 2.103   -24.461 -35.813 1.00 24.36 ? 440 ARG A CA  1 
ATOM   3318 C C   . ARG A 1 441 ? 1.477   -23.418 -34.929 1.00 23.34 ? 440 ARG A C   1 
ATOM   3319 O O   . ARG A 1 441 ? 0.858   -22.451 -35.421 1.00 21.90 ? 440 ARG A O   1 
ATOM   3320 C CB  . ARG A 1 441 ? 3.444   -24.008 -36.368 1.00 26.40 ? 440 ARG A CB  1 
ATOM   3321 C CG  . ARG A 1 441 ? 4.093   -25.227 -37.087 1.00 33.50 ? 440 ARG A CG  1 
ATOM   3322 C CD  . ARG A 1 441 ? 5.219   -24.889 -38.059 1.00 35.52 ? 440 ARG A CD  1 
ATOM   3323 N NE  . ARG A 1 441 ? 4.732   -24.220 -39.277 1.00 36.64 ? 440 ARG A NE  1 
ATOM   3324 C CZ  . ARG A 1 441 ? 5.511   -23.520 -40.118 1.00 45.66 ? 440 ARG A CZ  1 
ATOM   3325 N NH1 . ARG A 1 441 ? 6.826   -23.383 -39.899 1.00 50.03 ? 440 ARG A NH1 1 
ATOM   3326 N NH2 . ARG A 1 441 ? 4.977   -22.922 -41.181 1.00 48.37 ? 440 ARG A NH2 1 
ATOM   3327 N N   . GLY A 1 442 ? 1.569   -23.638 -33.629 1.00 21.23 ? 441 GLY A N   1 
ATOM   3328 C CA  . GLY A 1 442 ? 1.013   -22.720 -32.673 1.00 20.26 ? 441 GLY A CA  1 
ATOM   3329 C C   . GLY A 1 442 ? -0.329  -23.180 -32.209 1.00 20.18 ? 441 GLY A C   1 
ATOM   3330 O O   . GLY A 1 442 ? -1.242  -23.323 -33.011 1.00 20.34 ? 441 GLY A O   1 
ATOM   3331 N N   . ALA A 1 443 ? -0.505  -23.315 -30.910 1.00 22.60 ? 442 ALA A N   1 
ATOM   3332 C CA  . ALA A 1 443 ? -1.803  -23.710 -30.345 1.00 20.79 ? 442 ALA A CA  1 
ATOM   3333 C C   . ALA A 1 443 ? -1.940  -23.366 -28.908 1.00 22.68 ? 442 ALA A C   1 
ATOM   3334 O O   . ALA A 1 443 ? -0.937  -23.192 -28.201 1.00 21.07 ? 442 ALA A O   1 
ATOM   3335 C CB  . ALA A 1 443 ? -2.009  -25.204 -30.521 1.00 21.30 ? 442 ALA A CB  1 
ATOM   3336 N N   . PRO A 1 444 ? -3.195  -23.287 -28.425 1.00 24.69 ? 443 PRO A N   1 
ATOM   3337 C CA  . PRO A 1 444 ? -3.394  -23.015 -27.000 1.00 23.82 ? 443 PRO A CA  1 
ATOM   3338 C C   . PRO A 1 444 ? -3.078  -24.210 -26.177 1.00 23.66 ? 443 PRO A C   1 
ATOM   3339 O O   . PRO A 1 444 ? -3.416  -25.324 -26.564 1.00 28.05 ? 443 PRO A O   1 
ATOM   3340 C CB  . PRO A 1 444 ? -4.899  -22.700 -26.855 1.00 24.65 ? 443 PRO A CB  1 
ATOM   3341 C CG  . PRO A 1 444 ? -5.462  -22.783 -28.193 1.00 26.49 ? 443 PRO A CG  1 
ATOM   3342 C CD  . PRO A 1 444 ? -4.459  -23.331 -29.168 1.00 26.88 ? 443 PRO A CD  1 
ATOM   3343 N N   . ALA A 1 445 ? -2.410  -23.958 -25.061 1.00 22.19 ? 444 ALA A N   1 
ATOM   3344 C CA  . ALA A 1 445 ? -2.174  -24.920 -24.018 1.00 25.87 ? 444 ALA A CA  1 
ATOM   3345 C C   . ALA A 1 445 ? -3.268  -24.804 -22.934 1.00 23.00 ? 444 ALA A C   1 
ATOM   3346 O O   . ALA A 1 445 ? -3.825  -25.814 -22.508 1.00 24.14 ? 444 ALA A O   1 
ATOM   3347 C CB  . ALA A 1 445 ? -0.773  -24.702 -23.437 1.00 24.00 ? 444 ALA A CB  1 
ATOM   3348 N N   . VAL A 1 446 ? -3.559  -23.569 -22.534 1.00 23.27 ? 445 VAL A N   1 
ATOM   3349 C CA  . VAL A 1 446 ? -4.583  -23.219 -21.570 1.00 22.06 ? 445 VAL A CA  1 
ATOM   3350 C C   . VAL A 1 446 ? -5.377  -22.006 -22.075 1.00 20.67 ? 445 VAL A C   1 
ATOM   3351 O O   . VAL A 1 446 ? -4.805  -21.061 -22.611 1.00 20.67 ? 445 VAL A O   1 
ATOM   3352 C CB  . VAL A 1 446 ? -3.997  -22.883 -20.161 1.00 21.03 ? 445 VAL A CB  1 
ATOM   3353 C CG1 . VAL A 1 446 ? -5.080  -22.564 -19.171 1.00 20.93 ? 445 VAL A CG1 1 
ATOM   3354 C CG2 . VAL A 1 446 ? -3.148  -24.034 -19.611 1.00 24.83 ? 445 VAL A CG2 1 
ATOM   3355 N N   . VAL A 1 447 ? -6.701  -22.037 -21.887 1.00 19.13 ? 446 VAL A N   1 
ATOM   3356 C CA  . VAL A 1 447 ? -7.577  -20.915 -22.214 1.00 16.81 ? 446 VAL A CA  1 
ATOM   3357 C C   . VAL A 1 447 ? -8.325  -20.570 -20.972 1.00 17.50 ? 446 VAL A C   1 
ATOM   3358 O O   . VAL A 1 447 ? -8.885  -21.452 -20.316 1.00 18.63 ? 446 VAL A O   1 
ATOM   3359 C CB  . VAL A 1 447 ? -8.562  -21.268 -23.375 1.00 17.75 ? 446 VAL A CB  1 
ATOM   3360 C CG1 . VAL A 1 447 ? -9.555  -20.147 -23.631 1.00 19.76 ? 446 VAL A CG1 1 
ATOM   3361 C CG2 . VAL A 1 447 ? -7.780  -21.588 -24.606 1.00 18.72 ? 446 VAL A CG2 1 
ATOM   3362 N N   . ILE A 1 448 ? -8.332  -19.279 -20.626 1.00 17.11 ? 447 ILE A N   1 
ATOM   3363 C CA  . ILE A 1 448 ? -8.990  -18.772 -19.455 1.00 17.56 ? 447 ILE A CA  1 
ATOM   3364 C C   . ILE A 1 448 ? -10.018 -17.783 -19.915 1.00 20.79 ? 447 ILE A C   1 
ATOM   3365 O O   . ILE A 1 448 ? -9.694  -16.864 -20.713 1.00 16.86 ? 447 ILE A O   1 
ATOM   3366 C CB  . ILE A 1 448 ? -7.960  -18.121 -18.560 1.00 18.48 ? 447 ILE A CB  1 
ATOM   3367 C CG1 . ILE A 1 448 ? -7.042  -19.209 -17.983 1.00 21.94 ? 447 ILE A CG1 1 
ATOM   3368 C CG2 . ILE A 1 448 ? -8.541  -17.364 -17.420 1.00 17.90 ? 447 ILE A CG2 1 
ATOM   3369 C CD1 . ILE A 1 448 ? -5.671  -18.683 -17.639 1.00 24.11 ? 447 ILE A CD1 1 
ATOM   3370 N N   . SER A 1 449 ? -11.247 -17.944 -19.414 1.00 18.55 ? 448 SER A N   1 
ATOM   3371 C CA  . SER A 1 449 ? -12.354 -17.053 -19.712 1.00 19.86 ? 448 SER A CA  1 
ATOM   3372 C C   . SER A 1 449 ? -13.018 -16.595 -18.418 1.00 18.19 ? 448 SER A C   1 
ATOM   3373 O O   . SER A 1 449 ? -13.403 -17.413 -17.592 1.00 19.41 ? 448 SER A O   1 
ATOM   3374 C CB  . SER A 1 449 ? -13.366 -17.731 -20.603 1.00 19.67 ? 448 SER A CB  1 
ATOM   3375 O OG  . SER A 1 449 ? -14.500 -16.849 -20.862 1.00 20.88 ? 448 SER A OG  1 
ATOM   3376 N N   . GLN A 1 450 ? -13.066 -15.288 -18.225 1.00 18.70 ? 449 GLN A N   1 
ATOM   3377 C CA  . GLN A 1 450 ? -13.607 -14.664 -17.018 1.00 20.55 ? 449 GLN A CA  1 
ATOM   3378 C C   . GLN A 1 450 ? -12.870 -15.135 -15.789 1.00 20.10 ? 449 GLN A C   1 
ATOM   3379 O O   . GLN A 1 450 ? -13.455 -15.309 -14.715 1.00 21.34 ? 449 GLN A O   1 
ATOM   3380 C CB  . GLN A 1 450 ? -15.125 -14.912 -16.853 1.00 22.68 ? 449 GLN A CB  1 
ATOM   3381 C CG  . GLN A 1 450 ? -15.981 -14.597 -18.063 1.00 24.73 ? 449 GLN A CG  1 
ATOM   3382 C CD  . GLN A 1 450 ? -17.468 -14.616 -17.736 1.00 28.14 ? 449 GLN A CD  1 
ATOM   3383 O OE1 . GLN A 1 450 ? -17.928 -13.872 -16.896 1.00 31.46 ? 449 GLN A OE1 1 
ATOM   3384 N NE2 . GLN A 1 450 ? -18.194 -15.429 -18.414 1.00 30.90 ? 449 GLN A NE2 1 
ATOM   3385 N N   . GLY A 1 451 ? -11.581 -15.336 -15.947 1.00 18.73 ? 450 GLY A N   1 
ATOM   3386 C CA  . GLY A 1 451 ? -10.763 -15.865 -14.865 1.00 18.75 ? 450 GLY A CA  1 
ATOM   3387 C C   . GLY A 1 451 ? -10.921 -17.312 -14.482 1.00 19.92 ? 450 GLY A C   1 
ATOM   3388 O O   . GLY A 1 451 ? -10.445 -17.712 -13.410 1.00 20.60 ? 450 GLY A O   1 
ATOM   3389 N N   . ARG A 1 452 ? -11.535 -18.123 -15.340 1.00 18.91 ? 451 ARG A N   1 
ATOM   3390 C CA  . ARG A 1 452 ? -11.690 -19.508 -15.074 1.00 19.70 ? 451 ARG A CA  1 
ATOM   3391 C C   . ARG A 1 452 ? -11.116 -20.268 -16.209 1.00 20.10 ? 451 ARG A C   1 
ATOM   3392 O O   . ARG A 1 452 ? -11.303 -19.897 -17.370 1.00 19.18 ? 451 ARG A O   1 
ATOM   3393 C CB  . ARG A 1 452 ? -13.172 -19.854 -14.954 1.00 22.46 ? 451 ARG A CB  1 
ATOM   3394 C CG  . ARG A 1 452 ? -13.793 -19.278 -13.710 1.00 26.55 ? 451 ARG A CG  1 
ATOM   3395 C CD  . ARG A 1 452 ? -15.209 -19.853 -13.537 1.00 28.84 ? 451 ARG A CD  1 
ATOM   3396 N NE  . ARG A 1 452 ? -15.925 -19.141 -12.490 1.00 31.88 ? 451 ARG A NE  1 
ATOM   3397 C CZ  . ARG A 1 452 ? -15.761 -19.346 -11.175 1.00 38.19 ? 451 ARG A CZ  1 
ATOM   3398 N NH1 . ARG A 1 452 ? -14.915 -20.282 -10.699 1.00 37.64 ? 451 ARG A NH1 1 
ATOM   3399 N NH2 . ARG A 1 452 ? -16.453 -18.601 -10.316 1.00 41.13 ? 451 ARG A NH2 1 
ATOM   3400 N N   . VAL A 1 453 ? -10.500 -21.385 -15.896 1.00 19.58 ? 452 VAL A N   1 
ATOM   3401 C CA  . VAL A 1 453 ? -9.951  -22.280 -16.892 1.00 21.19 ? 452 VAL A CA  1 
ATOM   3402 C C   . VAL A 1 453 ? -11.037 -22.942 -17.741 1.00 22.72 ? 452 VAL A C   1 
ATOM   3403 O O   . VAL A 1 453 ? -11.920 -23.621 -17.226 1.00 23.74 ? 452 VAL A O   1 
ATOM   3404 C CB  . VAL A 1 453 ? -9.040  -23.344 -16.261 1.00 20.62 ? 452 VAL A CB  1 
ATOM   3405 C CG1 . VAL A 1 453 ? -8.559  -24.291 -17.344 1.00 20.46 ? 452 VAL A CG1 1 
ATOM   3406 C CG2 . VAL A 1 453 ? -7.863  -22.640 -15.548 1.00 21.88 ? 452 VAL A CG2 1 
ATOM   3407 N N   . ALA A 1 454 ? -10.980 -22.724 -19.045 1.00 21.66 ? 453 ALA A N   1 
ATOM   3408 C CA  . ALA A 1 454 ? -11.882 -23.367 -20.024 1.00 22.38 ? 453 ALA A CA  1 
ATOM   3409 C C   . ALA A 1 454 ? -11.230 -24.529 -20.770 1.00 22.81 ? 453 ALA A C   1 
ATOM   3410 O O   . ALA A 1 454 ? -11.912 -25.473 -21.209 1.00 22.13 ? 453 ALA A O   1 
ATOM   3411 C CB  . ALA A 1 454 ? -12.449 -22.310 -20.992 1.00 21.66 ? 453 ALA A CB  1 
ATOM   3412 N N   . LEU A 1 455 ? -9.910  -24.495 -20.924 1.00 20.96 ? 454 LEU A N   1 
ATOM   3413 C CA  . LEU A 1 455 ? -9.220  -25.556 -21.605 1.00 21.97 ? 454 LEU A CA  1 
ATOM   3414 C C   . LEU A 1 455 ? -7.943  -25.829 -20.836 1.00 23.44 ? 454 LEU A C   1 
ATOM   3415 O O   . LEU A 1 455 ? -7.185  -24.896 -20.579 1.00 23.26 ? 454 LEU A O   1 
ATOM   3416 C CB  . LEU A 1 455 ? -8.870  -25.186 -23.050 1.00 22.62 ? 454 LEU A CB  1 
ATOM   3417 C CG  . LEU A 1 455 ? -7.877  -26.097 -23.787 1.00 23.97 ? 454 LEU A CG  1 
ATOM   3418 C CD1 . LEU A 1 455 ? -8.458  -27.490 -24.065 1.00 26.22 ? 454 LEU A CD1 1 
ATOM   3419 C CD2 . LEU A 1 455 ? -7.336  -25.527 -25.124 1.00 26.32 ? 454 LEU A CD2 1 
ATOM   3420 N N   . GLU A 1 456 ? -7.675  -27.089 -20.498 1.00 24.62 ? 455 GLU A N   1 
ATOM   3421 C CA  . GLU A 1 456 ? -6.394  -27.482 -19.863 1.00 26.58 ? 455 GLU A CA  1 
ATOM   3422 C C   . GLU A 1 456 ? -6.137  -28.954 -20.105 1.00 26.56 ? 455 GLU A C   1 
ATOM   3423 O O   . GLU A 1 456 ? -7.080  -29.724 -20.026 1.00 29.39 ? 455 GLU A O   1 
ATOM   3424 C CB  . GLU A 1 456 ? -6.430  -27.236 -18.372 1.00 29.95 ? 455 GLU A CB  1 
ATOM   3425 C CG  . GLU A 1 456 ? -5.066  -27.455 -17.708 1.00 37.21 ? 455 GLU A CG  1 
ATOM   3426 C CD  . GLU A 1 456 ? -4.965  -26.870 -16.303 1.00 38.56 ? 455 GLU A CD  1 
ATOM   3427 O OE1 . GLU A 1 456 ? -3.936  -26.226 -16.004 1.00 43.69 ? 455 GLU A OE1 1 
ATOM   3428 O OE2 . GLU A 1 456 ? -5.915  -27.044 -15.522 1.00 36.10 ? 455 GLU A OE2 1 
ATOM   3429 N N   . ASP A 1 457 ? -4.894  -29.315 -20.455 1.00 28.57 ? 456 ASP A N   1 
ATOM   3430 C CA  . ASP A 1 457 ? -4.509  -30.674 -20.784 1.00 30.03 ? 456 ASP A CA  1 
ATOM   3431 C C   . ASP A 1 457 ? -5.459  -31.348 -21.746 1.00 31.50 ? 456 ASP A C   1 
ATOM   3432 O O   . ASP A 1 457 ? -5.832  -32.503 -21.561 1.00 32.28 ? 456 ASP A O   1 
ATOM   3433 C CB  . ASP A 1 457 ? -4.369  -31.511 -19.508 1.00 38.31 ? 456 ASP A CB  1 
ATOM   3434 C CG  . ASP A 1 457 ? -3.169  -31.111 -18.712 1.00 43.96 ? 456 ASP A CG  1 
ATOM   3435 O OD1 . ASP A 1 457 ? -2.091  -30.996 -19.324 1.00 54.81 ? 456 ASP A OD1 1 
ATOM   3436 O OD2 . ASP A 1 457 ? -3.282  -30.868 -17.490 1.00 58.13 ? 456 ASP A OD2 1 
ATOM   3437 N N   . GLY A 1 458 ? -5.869  -30.620 -22.782 1.00 32.99 ? 457 GLY A N   1 
ATOM   3438 C CA  . GLY A 1 458 ? -6.749  -31.142 -23.817 1.00 30.51 ? 457 GLY A CA  1 
ATOM   3439 C C   . GLY A 1 458 ? -8.207  -31.364 -23.439 1.00 32.69 ? 457 GLY A C   1 
ATOM   3440 O O   . GLY A 1 458 ? -8.930  -31.974 -24.243 1.00 32.81 ? 457 GLY A O   1 
ATOM   3441 N N   . LYS A 1 459 ? -8.666  -30.880 -22.270 1.00 31.18 ? 458 LYS A N   1 
ATOM   3442 C CA  . LYS A 1 459 ? -10.070 -31.102 -21.785 1.00 30.53 ? 458 LYS A CA  1 
ATOM   3443 C C   . LYS A 1 459 ? -10.735 -29.753 -21.714 1.00 27.36 ? 458 LYS A C   1 
ATOM   3444 O O   . LYS A 1 459 ? -10.128 -28.798 -21.254 1.00 30.06 ? 458 LYS A O   1 
ATOM   3445 C CB  . LYS A 1 459 ? -10.129 -31.786 -20.384 1.00 28.86 ? 458 LYS A CB  1 
ATOM   3446 N N   . MET A 1 460 ? -11.991 -29.676 -22.140 1.00 29.40 ? 459 MET A N   1 
ATOM   3447 C CA  . MET A 1 460 ? -12.811 -28.448 -22.019 1.00 28.58 ? 459 MET A CA  1 
ATOM   3448 C C   . MET A 1 460 ? -13.605 -28.367 -20.696 1.00 27.90 ? 459 MET A C   1 
ATOM   3449 O O   . MET A 1 460 ? -14.110 -29.345 -20.197 1.00 26.31 ? 459 MET A O   1 
ATOM   3450 C CB  . MET A 1 460 ? -13.808 -28.340 -23.185 1.00 29.94 ? 459 MET A CB  1 
ATOM   3451 C CG  . MET A 1 460 ? -13.219 -28.226 -24.596 1.00 32.26 ? 459 MET A CG  1 
ATOM   3452 S SD  . MET A 1 460 ? -12.170 -26.800 -24.773 1.00 34.70 ? 459 MET A SD  1 
ATOM   3453 C CE  . MET A 1 460 ? -13.343 -25.463 -24.432 1.00 30.98 ? 459 MET A CE  1 
ATOM   3454 N N   . PHE A 1 461 ? -13.805 -27.175 -20.160 1.00 26.07 ? 460 PHE A N   1 
ATOM   3455 C CA  . PHE A 1 461 ? -14.579 -27.000 -18.954 1.00 25.45 ? 460 PHE A CA  1 
ATOM   3456 C C   . PHE A 1 461 ? -15.425 -25.824 -19.286 1.00 26.07 ? 460 PHE A C   1 
ATOM   3457 O O   . PHE A 1 461 ? -14.928 -24.705 -19.287 1.00 29.27 ? 460 PHE A O   1 
ATOM   3458 C CB  . PHE A 1 461 ? -13.679 -26.692 -17.745 1.00 28.86 ? 460 PHE A CB  1 
ATOM   3459 C CG  . PHE A 1 461 ? -12.719 -27.811 -17.409 1.00 32.26 ? 460 PHE A CG  1 
ATOM   3460 C CD1 . PHE A 1 461 ? -11.482 -27.892 -18.025 1.00 33.16 ? 460 PHE A CD1 1 
ATOM   3461 C CD2 . PHE A 1 461 ? -13.083 -28.810 -16.480 1.00 35.18 ? 460 PHE A CD2 1 
ATOM   3462 C CE1 . PHE A 1 461 ? -10.595 -28.936 -17.698 1.00 37.59 ? 460 PHE A CE1 1 
ATOM   3463 C CE2 . PHE A 1 461 ? -12.212 -29.857 -16.176 1.00 35.96 ? 460 PHE A CE2 1 
ATOM   3464 C CZ  . PHE A 1 461 ? -10.970 -29.907 -16.778 1.00 36.71 ? 460 PHE A CZ  1 
ATOM   3465 N N   . VAL A 1 462 ? -16.687 -26.045 -19.658 1.00 23.22 ? 461 VAL A N   1 
ATOM   3466 C CA  . VAL A 1 462 ? -17.516 -24.921 -20.096 1.00 23.53 ? 461 VAL A CA  1 
ATOM   3467 C C   . VAL A 1 462 ? -18.787 -24.874 -19.316 1.00 25.28 ? 461 VAL A C   1 
ATOM   3468 O O   . VAL A 1 462 ? -19.262 -25.930 -18.846 1.00 25.10 ? 461 VAL A O   1 
ATOM   3469 C CB  . VAL A 1 462 ? -17.835 -24.953 -21.633 1.00 25.71 ? 461 VAL A CB  1 
ATOM   3470 C CG1 . VAL A 1 462 ? -16.579 -24.693 -22.440 1.00 25.65 ? 461 VAL A CG1 1 
ATOM   3471 C CG2 . VAL A 1 462 ? -18.500 -26.272 -22.053 1.00 27.75 ? 461 VAL A CG2 1 
ATOM   3472 N N   . THR A 1 463 ? -19.330 -23.652 -19.204 1.00 23.88 ? 462 THR A N   1 
ATOM   3473 C CA  . THR A 1 463 ? -20.586 -23.402 -18.548 1.00 25.93 ? 462 THR A CA  1 
ATOM   3474 C C   . THR A 1 463 ? -21.475 -22.585 -19.492 1.00 22.46 ? 462 THR A C   1 
ATOM   3475 O O   . THR A 1 463 ? -21.394 -21.364 -19.492 1.00 23.83 ? 462 THR A O   1 
ATOM   3476 C CB  . THR A 1 463 ? -20.406 -22.693 -17.189 1.00 27.86 ? 462 THR A CB  1 
ATOM   3477 O OG1 . THR A 1 463 ? -19.529 -23.458 -16.342 1.00 29.98 ? 462 THR A OG1 1 
ATOM   3478 C CG2 . THR A 1 463 ? -21.716 -22.612 -16.470 1.00 27.67 ? 462 THR A CG2 1 
ATOM   3479 N N   . PRO A 1 464 ? -22.335 -23.255 -20.276 1.00 24.65 ? 463 PRO A N   1 
ATOM   3480 C CA  . PRO A 1 464 ? -23.264 -22.541 -21.166 1.00 23.69 ? 463 PRO A CA  1 
ATOM   3481 C C   . PRO A 1 464 ? -24.084 -21.576 -20.378 1.00 23.77 ? 463 PRO A C   1 
ATOM   3482 O O   . PRO A 1 464 ? -24.614 -21.950 -19.350 1.00 28.23 ? 463 PRO A O   1 
ATOM   3483 C CB  . PRO A 1 464 ? -24.121 -23.670 -21.753 1.00 25.54 ? 463 PRO A CB  1 
ATOM   3484 C CG  . PRO A 1 464 ? -23.218 -24.834 -21.754 1.00 27.12 ? 463 PRO A CG  1 
ATOM   3485 C CD  . PRO A 1 464 ? -22.528 -24.711 -20.400 1.00 25.30 ? 463 PRO A CD  1 
ATOM   3486 N N   . GLY A 1 465 ? -24.138 -20.317 -20.810 1.00 21.68 ? 464 GLY A N   1 
ATOM   3487 C CA  . GLY A 1 465 ? -24.810 -19.265 -20.093 1.00 21.45 ? 464 GLY A CA  1 
ATOM   3488 C C   . GLY A 1 465 ? -23.912 -18.440 -19.169 1.00 20.39 ? 464 GLY A C   1 
ATOM   3489 O O   . GLY A 1 465 ? -24.306 -17.408 -18.747 1.00 22.59 ? 464 GLY A O   1 
ATOM   3490 N N   . ALA A 1 466 ? -22.683 -18.857 -18.897 1.00 20.24 ? 465 ALA A N   1 
ATOM   3491 C CA  . ALA A 1 466 ? -21.756 -17.999 -18.122 1.00 21.50 ? 465 ALA A CA  1 
ATOM   3492 C C   . ALA A 1 466 ? -21.318 -16.727 -18.906 1.00 19.65 ? 465 ALA A C   1 
ATOM   3493 O O   . ALA A 1 466 ? -20.973 -15.678 -18.317 1.00 17.17 ? 465 ALA A O   1 
ATOM   3494 C CB  . ALA A 1 466 ? -20.497 -18.810 -17.759 1.00 23.73 ? 465 ALA A CB  1 
ATOM   3495 N N   . GLY A 1 467 ? -21.268 -16.854 -20.238 1.00 21.39 ? 466 GLY A N   1 
ATOM   3496 C CA  . GLY A 1 467 ? -20.842 -15.755 -21.104 1.00 21.29 ? 466 GLY A CA  1 
ATOM   3497 C C   . GLY A 1 467 ? -21.735 -14.565 -20.981 1.00 21.97 ? 466 GLY A C   1 
ATOM   3498 O O   . GLY A 1 467 ? -22.951 -14.702 -20.931 1.00 20.84 ? 466 GLY A O   1 
ATOM   3499 N N   . ARG A 1 468 ? -21.162 -13.377 -20.942 1.00 19.04 ? 467 ARG A N   1 
ATOM   3500 C CA  . ARG A 1 468 ? -21.933 -12.181 -20.812 1.00 20.04 ? 467 ARG A CA  1 
ATOM   3501 C C   . ARG A 1 468 ? -21.944 -11.325 -22.065 1.00 18.96 ? 467 ARG A C   1 
ATOM   3502 O O   . ARG A 1 468 ? -20.956 -11.267 -22.796 1.00 16.01 ? 467 ARG A O   1 
ATOM   3503 C CB  . ARG A 1 468 ? -21.346 -11.303 -19.706 1.00 23.92 ? 467 ARG A CB  1 
ATOM   3504 C CG  . ARG A 1 468 ? -20.947 -12.046 -18.453 1.00 26.44 ? 467 ARG A CG  1 
ATOM   3505 C CD  . ARG A 1 468 ? -20.080 -11.145 -17.579 1.00 30.42 ? 467 ARG A CD  1 
ATOM   3506 N NE  . ARG A 1 468 ? -18.740 -11.061 -18.180 1.00 29.27 ? 467 ARG A NE  1 
ATOM   3507 C CZ  . ARG A 1 468 ? -17.759 -10.289 -17.728 1.00 30.70 ? 467 ARG A CZ  1 
ATOM   3508 N NH1 . ARG A 1 468 ? -17.958 -9.516  -16.651 1.00 28.56 ? 467 ARG A NH1 1 
ATOM   3509 N NH2 . ARG A 1 468 ? -16.599 -10.242 -18.385 1.00 27.78 ? 467 ARG A NH2 1 
ATOM   3510 N N   . PHE A 1 469 ? -23.061 -10.631 -22.268 1.00 18.99 ? 468 PHE A N   1 
ATOM   3511 C CA  . PHE A 1 469 ? -23.135 -9.526  -23.221 1.00 19.84 ? 468 PHE A CA  1 
ATOM   3512 C C   . PHE A 1 469 ? -22.282 -8.326  -22.826 1.00 20.99 ? 468 PHE A C   1 
ATOM   3513 O O   . PHE A 1 469 ? -22.378 -7.821  -21.695 1.00 20.27 ? 468 PHE A O   1 
ATOM   3514 C CB  . PHE A 1 469 ? -24.592 -9.106  -23.438 1.00 19.60 ? 468 PHE A CB  1 
ATOM   3515 C CG  . PHE A 1 469 ? -24.750 -8.004  -24.434 1.00 19.35 ? 468 PHE A CG  1 
ATOM   3516 C CD1 . PHE A 1 469 ? -24.638 -8.259  -25.789 1.00 19.38 ? 468 PHE A CD1 1 
ATOM   3517 C CD2 . PHE A 1 469 ? -24.996 -6.719  -24.012 1.00 19.49 ? 468 PHE A CD2 1 
ATOM   3518 C CE1 . PHE A 1 469 ? -24.773 -7.209  -26.705 1.00 19.43 ? 468 PHE A CE1 1 
ATOM   3519 C CE2 . PHE A 1 469 ? -25.145 -5.675  -24.902 1.00 21.03 ? 468 PHE A CE2 1 
ATOM   3520 C CZ  . PHE A 1 469 ? -24.999 -5.907  -26.270 1.00 19.56 ? 468 PHE A CZ  1 
ATOM   3521 N N   . VAL A 1 470 ? -21.465 -7.860  -23.783 1.00 17.13 ? 469 VAL A N   1 
ATOM   3522 C CA  . VAL A 1 470 ? -20.548 -6.761  -23.615 1.00 18.82 ? 469 VAL A CA  1 
ATOM   3523 C C   . VAL A 1 470 ? -21.110 -5.595  -24.424 1.00 17.25 ? 469 VAL A C   1 
ATOM   3524 O O   . VAL A 1 470 ? -21.088 -5.619  -25.660 1.00 16.58 ? 469 VAL A O   1 
ATOM   3525 C CB  . VAL A 1 470 ? -19.124 -7.077  -24.116 1.00 19.22 ? 469 VAL A CB  1 
ATOM   3526 C CG1 . VAL A 1 470 ? -18.192 -5.885  -23.951 1.00 18.77 ? 469 VAL A CG1 1 
ATOM   3527 C CG2 . VAL A 1 470 ? -18.538 -8.243  -23.323 1.00 20.23 ? 469 VAL A CG2 1 
ATOM   3528 N N   . PRO A 1 471 ? -21.615 -4.564  -23.744 1.00 21.10 ? 470 PRO A N   1 
ATOM   3529 C CA  . PRO A 1 471 ? -22.183 -3.453  -24.458 1.00 20.92 ? 470 PRO A CA  1 
ATOM   3530 C C   . PRO A 1 471 ? -21.057 -2.563  -24.942 1.00 23.56 ? 470 PRO A C   1 
ATOM   3531 O O   . PRO A 1 471 ? -20.023 -2.523  -24.307 1.00 24.34 ? 470 PRO A O   1 
ATOM   3532 C CB  . PRO A 1 471 ? -23.052 -2.726  -23.411 1.00 23.41 ? 470 PRO A CB  1 
ATOM   3533 C CG  . PRO A 1 471 ? -22.543 -3.158  -22.089 1.00 23.72 ? 470 PRO A CG  1 
ATOM   3534 C CD  . PRO A 1 471 ? -21.721 -4.411  -22.278 1.00 22.96 ? 470 PRO A CD  1 
ATOM   3535 N N   . ARG A 1 472 ? -21.257 -1.905  -26.090 1.00 22.69 ? 471 ARG A N   1 
ATOM   3536 C CA  . ARG A 1 472 ? -20.217 -1.145  -26.792 1.00 22.34 ? 471 ARG A CA  1 
ATOM   3537 C C   . ARG A 1 472 ? -20.694 0.273   -27.046 1.00 23.68 ? 471 ARG A C   1 
ATOM   3538 O O   . ARG A 1 472 ? -21.684 0.468   -27.748 1.00 29.44 ? 471 ARG A O   1 
ATOM   3539 C CB  . ARG A 1 472 ? -19.932 -1.836  -28.110 1.00 23.66 ? 471 ARG A CB  1 
ATOM   3540 C CG  . ARG A 1 472 ? -19.758 -3.315  -28.032 1.00 20.02 ? 471 ARG A CG  1 
ATOM   3541 C CD  . ARG A 1 472 ? -19.263 -3.906  -29.337 1.00 20.40 ? 471 ARG A CD  1 
ATOM   3542 N NE  . ARG A 1 472 ? -19.999 -3.559  -30.523 1.00 20.95 ? 471 ARG A NE  1 
ATOM   3543 C CZ  . ARG A 1 472 ? -21.100 -4.148  -30.947 1.00 24.39 ? 471 ARG A CZ  1 
ATOM   3544 N NH1 . ARG A 1 472 ? -21.667 -5.091  -30.248 1.00 25.80 ? 471 ARG A NH1 1 
ATOM   3545 N NH2 . ARG A 1 472 ? -21.716 -3.720  -32.058 1.00 29.09 ? 471 ARG A NH2 1 
ATOM   3546 N N   . LYS A 1 473 ? -20.032 1.264   -26.457 1.00 19.70 ? 472 LYS A N   1 
ATOM   3547 C CA  . LYS A 1 473 ? -20.376 2.664   -26.679 1.00 19.15 ? 472 LYS A CA  1 
ATOM   3548 C C   . LYS A 1 473 ? -20.069 3.075   -28.110 1.00 18.46 ? 472 LYS A C   1 
ATOM   3549 O O   . LYS A 1 473 ? -19.160 2.552   -28.765 1.00 18.27 ? 472 LYS A O   1 
ATOM   3550 C CB  . LYS A 1 473 ? -19.574 3.546   -25.681 1.00 20.74 ? 472 LYS A CB  1 
ATOM   3551 N N   . THR A 1 474 ? -20.790 4.081   -28.539 1.00 17.87 ? 473 THR A N   1 
ATOM   3552 C CA  . THR A 1 474 ? -20.604 4.752   -29.830 1.00 18.62 ? 473 THR A CA  1 
ATOM   3553 C C   . THR A 1 474 ? -19.356 5.639   -29.805 1.00 18.09 ? 473 THR A C   1 
ATOM   3554 O O   . THR A 1 474 ? -18.718 5.865   -28.760 1.00 17.44 ? 473 THR A O   1 
ATOM   3555 C CB  . THR A 1 474 ? -21.803 5.650   -30.152 1.00 17.72 ? 473 THR A CB  1 
ATOM   3556 O OG1 . THR A 1 474 ? -21.983 6.579   -29.063 1.00 19.09 ? 473 THR A OG1 1 
ATOM   3557 C CG2 . THR A 1 474 ? -23.030 4.832   -30.315 1.00 19.47 ? 473 THR A CG2 1 
ATOM   3558 N N   . PHE A 1 475 ? -18.994 6.081   -30.990 1.00 16.33 ? 474 PHE A N   1 
ATOM   3559 C CA  . PHE A 1 475 ? -17.839 6.929   -31.200 1.00 15.77 ? 474 PHE A CA  1 
ATOM   3560 C C   . PHE A 1 475 ? -16.507 6.362   -30.640 1.00 16.01 ? 474 PHE A C   1 
ATOM   3561 O O   . PHE A 1 475 ? -15.784 7.067   -29.960 1.00 15.10 ? 474 PHE A O   1 
ATOM   3562 C CB  . PHE A 1 475 ? -18.108 8.346   -30.647 1.00 15.64 ? 474 PHE A CB  1 
ATOM   3563 C CG  . PHE A 1 475 ? -19.221 9.054   -31.313 1.00 16.48 ? 474 PHE A CG  1 
ATOM   3564 C CD1 . PHE A 1 475 ? -19.042 9.683   -32.542 1.00 17.40 ? 474 PHE A CD1 1 
ATOM   3565 C CD2 . PHE A 1 475 ? -20.500 9.100   -30.728 1.00 18.29 ? 474 PHE A CD2 1 
ATOM   3566 C CE1 . PHE A 1 475 ? -20.115 10.350  -33.180 1.00 17.86 ? 474 PHE A CE1 1 
ATOM   3567 C CE2 . PHE A 1 475 ? -21.581 9.722   -31.393 1.00 17.95 ? 474 PHE A CE2 1 
ATOM   3568 C CZ  . PHE A 1 475 ? -21.375 10.366  -32.596 1.00 18.74 ? 474 PHE A CZ  1 
ATOM   3569 N N   . PRO A 1 476 ? -16.153 5.086   -30.926 1.00 16.25 ? 475 PRO A N   1 
ATOM   3570 C CA  . PRO A 1 476 ? -14.770 4.608   -30.541 1.00 16.38 ? 475 PRO A CA  1 
ATOM   3571 C C   . PRO A 1 476 ? -13.698 5.520   -31.126 1.00 17.46 ? 475 PRO A C   1 
ATOM   3572 O O   . PRO A 1 476 ? -13.763 5.847   -32.343 1.00 15.13 ? 475 PRO A O   1 
ATOM   3573 C CB  . PRO A 1 476 ? -14.662 3.223   -31.198 1.00 15.72 ? 475 PRO A CB  1 
ATOM   3574 C CG  . PRO A 1 476 ? -15.712 3.213   -32.256 1.00 16.50 ? 475 PRO A CG  1 
ATOM   3575 C CD  . PRO A 1 476 ? -16.814 4.152   -31.838 1.00 16.86 ? 475 PRO A CD  1 
ATOM   3576 N N   . ASP A 1 477 ? -12.795 6.011   -30.291 1.00 16.59 ? 476 ASP A N   1 
ATOM   3577 C CA  . ASP A 1 477 ? -11.787 6.948   -30.772 1.00 17.47 ? 476 ASP A CA  1 
ATOM   3578 C C   . ASP A 1 477 ? -10.993 6.458   -31.987 1.00 16.88 ? 476 ASP A C   1 
ATOM   3579 O O   . ASP A 1 477 ? -10.668 7.216   -32.884 1.00 15.22 ? 476 ASP A O   1 
ATOM   3580 C CB  . ASP A 1 477 ? -10.750 7.185   -29.668 1.00 19.12 ? 476 ASP A CB  1 
ATOM   3581 C CG  . ASP A 1 477 ? -11.249 8.142   -28.556 1.00 23.47 ? 476 ASP A CG  1 
ATOM   3582 O OD1 . ASP A 1 477 ? -12.346 8.778   -28.677 1.00 20.75 ? 476 ASP A OD1 1 
ATOM   3583 O OD2 . ASP A 1 477 ? -10.478 8.233   -27.573 1.00 22.55 ? 476 ASP A OD2 1 
ATOM   3584 N N   . PHE A 1 478 ? -10.637 5.178   -31.962 1.00 16.75 ? 477 PHE A N   1 
ATOM   3585 C CA  . PHE A 1 478 ? -9.764  4.593   -32.975 1.00 16.50 ? 477 PHE A CA  1 
ATOM   3586 C C   . PHE A 1 478 ? -10.407 4.786   -34.348 1.00 16.37 ? 477 PHE A C   1 
ATOM   3587 O O   . PHE A 1 478 ? -9.686  4.928   -35.331 1.00 18.48 ? 477 PHE A O   1 
ATOM   3588 C CB  . PHE A 1 478 ? -9.564  3.137   -32.664 1.00 17.15 ? 477 PHE A CB  1 
ATOM   3589 C CG  . PHE A 1 478 ? -8.633  2.418   -33.600 1.00 17.79 ? 477 PHE A CG  1 
ATOM   3590 C CD1 . PHE A 1 478 ? -7.277  2.430   -33.335 1.00 19.33 ? 477 PHE A CD1 1 
ATOM   3591 C CD2 . PHE A 1 478 ? -9.101  1.662   -34.675 1.00 19.59 ? 477 PHE A CD2 1 
ATOM   3592 C CE1 . PHE A 1 478 ? -6.374  1.838   -34.192 1.00 20.69 ? 477 PHE A CE1 1 
ATOM   3593 C CE2 . PHE A 1 478 ? -8.212  1.029   -35.534 1.00 22.00 ? 477 PHE A CE2 1 
ATOM   3594 C CZ  . PHE A 1 478 ? -6.844  1.112   -35.281 1.00 23.73 ? 477 PHE A CZ  1 
ATOM   3595 N N   . VAL A 1 479 ? -11.736 4.852   -34.409 1.00 15.35 ? 478 VAL A N   1 
ATOM   3596 C CA  . VAL A 1 479 ? -12.469 5.088   -35.617 1.00 15.81 ? 478 VAL A CA  1 
ATOM   3597 C C   . VAL A 1 479 ? -12.795 6.572   -35.819 1.00 15.96 ? 478 VAL A C   1 
ATOM   3598 O O   . VAL A 1 479 ? -12.588 7.174   -36.882 1.00 16.99 ? 478 VAL A O   1 
ATOM   3599 C CB  . VAL A 1 479 ? -13.755 4.287   -35.583 1.00 16.34 ? 478 VAL A CB  1 
ATOM   3600 C CG1 . VAL A 1 479 ? -14.540 4.450   -36.878 1.00 16.44 ? 478 VAL A CG1 1 
ATOM   3601 C CG2 . VAL A 1 479 ? -13.483 2.791   -35.371 1.00 16.43 ? 478 VAL A CG2 1 
ATOM   3602 N N   . TYR A 1 480 ? -13.354 7.177   -34.780 1.00 15.43 ? 479 TYR A N   1 
ATOM   3603 C CA  . TYR A 1 480 ? -14.055 8.402   -34.955 1.00 16.05 ? 479 TYR A CA  1 
ATOM   3604 C C   . TYR A 1 480 ? -13.274 9.662   -34.768 1.00 15.38 ? 479 TYR A C   1 
ATOM   3605 O O   . TYR A 1 480 ? -13.760 10.713  -35.146 1.00 14.63 ? 479 TYR A O   1 
ATOM   3606 C CB  . TYR A 1 480 ? -15.339 8.400   -34.094 1.00 15.63 ? 479 TYR A CB  1 
ATOM   3607 C CG  . TYR A 1 480 ? -16.541 7.940   -34.890 1.00 15.62 ? 479 TYR A CG  1 
ATOM   3608 C CD1 . TYR A 1 480 ? -17.289 8.860   -35.675 1.00 16.44 ? 479 TYR A CD1 1 
ATOM   3609 C CD2 . TYR A 1 480 ? -16.911 6.621   -34.904 1.00 14.17 ? 479 TYR A CD2 1 
ATOM   3610 C CE1 . TYR A 1 480 ? -18.375 8.472   -36.418 1.00 15.26 ? 479 TYR A CE1 1 
ATOM   3611 C CE2 . TYR A 1 480 ? -17.967 6.208   -35.707 1.00 15.57 ? 479 TYR A CE2 1 
ATOM   3612 C CZ  . TYR A 1 480 ? -18.694 7.140   -36.449 1.00 16.39 ? 479 TYR A CZ  1 
ATOM   3613 O OH  . TYR A 1 480 ? -19.747 6.696   -37.220 1.00 16.04 ? 479 TYR A OH  1 
ATOM   3614 N N   . LYS A 1 481 ? -12.092 9.616   -34.205 1.00 14.60 ? 480 LYS A N   1 
ATOM   3615 C CA  . LYS A 1 481 ? -11.341 10.890  -34.115 1.00 16.09 ? 480 LYS A CA  1 
ATOM   3616 C C   . LYS A 1 481 ? -11.109 11.479  -35.453 1.00 17.23 ? 480 LYS A C   1 
ATOM   3617 O O   . LYS A 1 481 ? -11.323 12.689  -35.647 1.00 15.94 ? 480 LYS A O   1 
ATOM   3618 C CB  . LYS A 1 481 ? -10.051 10.815  -33.348 1.00 17.01 ? 480 LYS A CB  1 
ATOM   3619 C CG  . LYS A 1 481 ? -10.200 10.420  -31.910 1.00 19.91 ? 480 LYS A CG  1 
ATOM   3620 C CD  . LYS A 1 481 ? -11.080 11.298  -31.051 1.00 23.77 ? 480 LYS A CD  1 
ATOM   3621 C CE  . LYS A 1 481 ? -10.412 12.559  -30.557 1.00 26.95 ? 480 LYS A CE  1 
ATOM   3622 N NZ  . LYS A 1 481 ? -11.338 13.125  -29.537 1.00 29.23 ? 480 LYS A NZ  1 
ATOM   3623 N N   . ARG A 1 482 ? -10.706 10.654  -36.409 1.00 17.60 ? 481 ARG A N   1 
ATOM   3624 C CA  . ARG A 1 482 ? -10.565 11.138  -37.787 1.00 17.68 ? 481 ARG A CA  1 
ATOM   3625 C C   . ARG A 1 482 ? -11.908 11.647  -38.354 1.00 16.85 ? 481 ARG A C   1 
ATOM   3626 O O   . ARG A 1 482 ? -11.928 12.721  -39.001 1.00 16.06 ? 481 ARG A O   1 
ATOM   3627 C CB  . ARG A 1 482 ? -10.018 10.043  -38.741 1.00 19.98 ? 481 ARG A CB  1 
ATOM   3628 C CG  . ARG A 1 482 ? -8.539  9.806   -38.517 1.00 23.47 ? 481 ARG A CG  1 
ATOM   3629 C CD  . ARG A 1 482 ? -8.021  8.538   -39.124 1.00 24.49 ? 481 ARG A CD  1 
ATOM   3630 N NE  . ARG A 1 482 ? -8.545  7.357   -38.417 1.00 29.41 ? 481 ARG A NE  1 
ATOM   3631 C CZ  . ARG A 1 482 ? -8.461  6.082   -38.866 1.00 31.04 ? 481 ARG A CZ  1 
ATOM   3632 N NH1 . ARG A 1 482 ? -7.902  5.788   -40.045 1.00 29.58 ? 481 ARG A NH1 1 
ATOM   3633 N NH2 . ARG A 1 482 ? -8.964  5.085   -38.143 1.00 27.58 ? 481 ARG A NH2 1 
ATOM   3634 N N   . ILE A 1 483 ? -12.963 10.862  -38.171 1.00 14.21 ? 482 ILE A N   1 
ATOM   3635 C CA  . ILE A 1 483 ? -14.278 11.152  -38.725 1.00 14.33 ? 482 ILE A CA  1 
ATOM   3636 C C   . ILE A 1 483 ? -14.762 12.483  -38.200 1.00 14.94 ? 482 ILE A C   1 
ATOM   3637 O O   . ILE A 1 483 ? -15.178 13.332  -38.970 1.00 15.75 ? 482 ILE A O   1 
ATOM   3638 C CB  . ILE A 1 483 ? -15.309 10.011  -38.445 1.00 14.29 ? 482 ILE A CB  1 
ATOM   3639 C CG1 . ILE A 1 483 ? -14.916 8.666   -39.098 1.00 14.41 ? 482 ILE A CG1 1 
ATOM   3640 C CG2 . ILE A 1 483 ? -16.720 10.388  -38.897 1.00 13.74 ? 482 ILE A CG2 1 
ATOM   3641 C CD1 . ILE A 1 483 ? -14.950 8.604   -40.608 1.00 14.54 ? 482 ILE A CD1 1 
ATOM   3642 N N   . LYS A 1 484 ? -14.672 12.704  -36.883 1.00 16.39 ? 483 LYS A N   1 
ATOM   3643 C CA  . LYS A 1 484 ? -15.109 13.967  -36.279 1.00 17.02 ? 483 LYS A CA  1 
ATOM   3644 C C   . LYS A 1 484 ? -14.279 15.157  -36.714 1.00 16.52 ? 483 LYS A C   1 
ATOM   3645 O O   . LYS A 1 484 ? -14.846 16.227  -36.959 1.00 16.11 ? 483 LYS A O   1 
ATOM   3646 C CB  . LYS A 1 484 ? -15.158 13.862  -34.743 1.00 17.64 ? 483 LYS A CB  1 
ATOM   3647 C CG  . LYS A 1 484 ? -16.271 12.913  -34.280 1.00 20.08 ? 483 LYS A CG  1 
ATOM   3648 C CD  . LYS A 1 484 ? -16.432 12.912  -32.750 1.00 24.11 ? 483 LYS A CD  1 
ATOM   3649 C CE  . LYS A 1 484 ? -15.236 12.300  -32.031 1.00 30.58 ? 483 LYS A CE  1 
ATOM   3650 N NZ  . LYS A 1 484 ? -15.554 11.904  -30.594 1.00 33.16 ? 483 LYS A NZ  1 
ATOM   3651 N N   . ALA A 1 485 ? -12.961 14.993  -36.869 1.00 15.17 ? 484 ALA A N   1 
ATOM   3652 C CA  . ALA A 1 485 ? -12.135 16.089  -37.421 1.00 16.39 ? 484 ALA A CA  1 
ATOM   3653 C C   . ALA A 1 485 ? -12.586 16.500  -38.815 1.00 16.54 ? 484 ALA A C   1 
ATOM   3654 O O   . ALA A 1 485 ? -12.582 17.714  -39.181 1.00 16.52 ? 484 ALA A O   1 
ATOM   3655 C CB  . ALA A 1 485 ? -10.690 15.634  -37.478 1.00 17.30 ? 484 ALA A CB  1 
ATOM   3656 N N   . ARG A 1 486 ? -12.881 15.477  -39.628 1.00 16.74 ? 485 ARG A N   1 
ATOM   3657 C CA  . ARG A 1 486 ? -13.366 15.729  -40.982 1.00 18.30 ? 485 ARG A CA  1 
ATOM   3658 C C   . ARG A 1 486 ? -14.759 16.408  -40.949 1.00 17.63 ? 485 ARG A C   1 
ATOM   3659 O O   . ARG A 1 486 ? -15.010 17.315  -41.763 1.00 19.61 ? 485 ARG A O   1 
ATOM   3660 C CB  . ARG A 1 486 ? -13.371 14.468  -41.791 1.00 17.47 ? 485 ARG A CB  1 
ATOM   3661 C CG  . ARG A 1 486 ? -11.973 13.991  -42.060 1.00 18.21 ? 485 ARG A CG  1 
ATOM   3662 C CD  . ARG A 1 486 ? -11.964 12.536  -42.488 1.00 17.89 ? 485 ARG A CD  1 
ATOM   3663 N NE  . ARG A 1 486 ? -10.607 12.015  -42.414 1.00 18.38 ? 485 ARG A NE  1 
ATOM   3664 C CZ  . ARG A 1 486 ? -10.161 10.891  -42.974 1.00 18.14 ? 485 ARG A CZ  1 
ATOM   3665 N NH1 . ARG A 1 486 ? -10.935 10.139  -43.766 1.00 18.47 ? 485 ARG A NH1 1 
ATOM   3666 N NH2 . ARG A 1 486 ? -8.886  10.548  -42.765 1.00 19.54 ? 485 ARG A NH2 1 
ATOM   3667 N N   . ASN A 1 487 ? -15.625 16.015  -40.050 1.00 17.02 ? 486 ASN A N   1 
ATOM   3668 C CA  . ASN A 1 487 ? -16.904 16.777  -39.868 1.00 18.29 ? 486 ASN A CA  1 
ATOM   3669 C C   . ASN A 1 487 ? -16.661 18.241  -39.561 1.00 19.60 ? 486 ASN A C   1 
ATOM   3670 O O   . ASN A 1 487 ? -17.256 19.113  -40.175 1.00 20.11 ? 486 ASN A O   1 
ATOM   3671 C CB  . ASN A 1 487 ? -17.796 16.180  -38.766 1.00 18.90 ? 486 ASN A CB  1 
ATOM   3672 C CG  . ASN A 1 487 ? -18.419 14.795  -39.119 1.00 21.26 ? 486 ASN A CG  1 
ATOM   3673 O OD1 . ASN A 1 487 ? -18.665 14.491  -40.272 1.00 21.85 ? 486 ASN A OD1 1 
ATOM   3674 N ND2 . ASN A 1 487 ? -18.736 13.988  -38.076 1.00 19.76 ? 486 ASN A ND2 1 
ATOM   3675 N N   . ARG A 1 488 ? -15.766 18.513  -38.614 1.00 19.43 ? 487 ARG A N   1 
ATOM   3676 C CA  . ARG A 1 488 ? -15.473 19.885  -38.208 1.00 20.41 ? 487 ARG A CA  1 
ATOM   3677 C C   . ARG A 1 488 ? -14.836 20.677  -39.376 1.00 21.94 ? 487 ARG A C   1 
ATOM   3678 O O   . ARG A 1 488 ? -15.196 21.816  -39.613 1.00 21.15 ? 487 ARG A O   1 
ATOM   3679 C CB  . ARG A 1 488 ? -14.576 19.922  -36.949 1.00 21.58 ? 487 ARG A CB  1 
ATOM   3680 C CG  . ARG A 1 488 ? -15.254 19.393  -35.686 1.00 23.15 ? 487 ARG A CG  1 
ATOM   3681 C CD  . ARG A 1 488 ? -14.522 19.774  -34.393 1.00 24.00 ? 487 ARG A CD  1 
ATOM   3682 N NE  . ARG A 1 488 ? -13.191 19.205  -34.448 1.00 24.85 ? 487 ARG A NE  1 
ATOM   3683 C CZ  . ARG A 1 488 ? -12.864 17.931  -34.133 1.00 26.60 ? 487 ARG A CZ  1 
ATOM   3684 N NH1 . ARG A 1 488 ? -13.746 17.094  -33.657 1.00 26.32 ? 487 ARG A NH1 1 
ATOM   3685 N NH2 . ARG A 1 488 ? -11.610 17.516  -34.244 1.00 27.38 ? 487 ARG A NH2 1 
ATOM   3686 N N   . LEU A 1 489 ? -13.924 20.072  -40.125 1.00 21.10 ? 488 LEU A N   1 
ATOM   3687 C CA  . LEU A 1 489 ? -13.348 20.739  -41.281 1.00 23.15 ? 488 LEU A CA  1 
ATOM   3688 C C   . LEU A 1 489 ? -14.393 21.063  -42.348 1.00 24.12 ? 488 LEU A C   1 
ATOM   3689 O O   . LEU A 1 489 ? -14.309 22.117  -42.984 1.00 24.53 ? 488 LEU A O   1 
ATOM   3690 C CB  . LEU A 1 489 ? -12.211 19.906  -41.900 1.00 24.75 ? 488 LEU A CB  1 
ATOM   3691 C CG  . LEU A 1 489 ? -10.927 19.801  -41.060 1.00 26.36 ? 488 LEU A CG  1 
ATOM   3692 C CD1 . LEU A 1 489 ? -10.014 18.680  -41.540 1.00 26.69 ? 488 LEU A CD1 1 
ATOM   3693 C CD2 . LEU A 1 489 ? -10.173 21.113  -41.046 1.00 27.14 ? 488 LEU A CD2 1 
ATOM   3694 N N   . ALA A 1 490 ? -15.336 20.156  -42.592 1.00 24.44 ? 489 ALA A N   1 
ATOM   3695 C CA  . ALA A 1 490 ? -16.397 20.423  -43.566 1.00 25.63 ? 489 ALA A CA  1 
ATOM   3696 C C   . ALA A 1 490 ? -17.195 21.657  -43.136 1.00 27.12 ? 489 ALA A C   1 
ATOM   3697 O O   . ALA A 1 490 ? -17.520 22.493  -43.967 1.00 28.01 ? 489 ALA A O   1 
ATOM   3698 C CB  . ALA A 1 490 ? -17.315 19.209  -43.729 1.00 27.49 ? 489 ALA A CB  1 
ATOM   3699 N N   . GLU A 1 491 ? -17.453 21.781  -41.838 1.00 26.52 ? 490 GLU A N   1 
ATOM   3700 C CA  . GLU A 1 491 ? -18.208 22.916  -41.290 1.00 29.11 ? 490 GLU A CA  1 
ATOM   3701 C C   . GLU A 1 491 ? -17.428 24.197  -41.480 1.00 29.08 ? 490 GLU A C   1 
ATOM   3702 O O   . GLU A 1 491 ? -17.981 25.162  -41.941 1.00 28.07 ? 490 GLU A O   1 
ATOM   3703 C CB  . GLU A 1 491 ? -18.461 22.812  -39.805 1.00 31.09 ? 490 GLU A CB  1 
ATOM   3704 C CG  . GLU A 1 491 ? -19.431 21.755  -39.392 1.00 34.89 ? 490 GLU A CG  1 
ATOM   3705 C CD  . GLU A 1 491 ? -19.702 21.779  -37.878 1.00 41.74 ? 490 GLU A CD  1 
ATOM   3706 O OE1 . GLU A 1 491 ? -18.966 22.486  -37.121 1.00 42.09 ? 490 GLU A OE1 1 
ATOM   3707 O OE2 . GLU A 1 491 ? -20.640 21.062  -37.460 1.00 44.88 ? 490 GLU A OE2 1 
ATOM   3708 N N   . ILE A 1 492 ? -16.164 24.187  -41.105 1.00 28.29 ? 491 ILE A N   1 
ATOM   3709 C CA  . ILE A 1 492 ? -15.285 25.358  -41.240 1.00 31.53 ? 491 ILE A CA  1 
ATOM   3710 C C   . ILE A 1 492 ? -15.252 25.796  -42.704 1.00 38.67 ? 491 ILE A C   1 
ATOM   3711 O O   . ILE A 1 492 ? -15.323 27.005  -43.014 1.00 40.38 ? 491 ILE A O   1 
ATOM   3712 C CB  . ILE A 1 492 ? -13.871 25.061  -40.675 1.00 32.67 ? 491 ILE A CB  1 
ATOM   3713 C CG1 . ILE A 1 492 ? -13.954 24.913  -39.135 1.00 33.70 ? 491 ILE A CG1 1 
ATOM   3714 C CG2 . ILE A 1 492 ? -12.837 26.148  -41.024 1.00 33.70 ? 491 ILE A CG2 1 
ATOM   3715 C CD1 . ILE A 1 492 ? -12.740 24.214  -38.543 1.00 37.25 ? 491 ILE A CD1 1 
ATOM   3716 N N   . HIS A 1 493 ? -15.192 24.822  -43.609 1.00 37.45 ? 492 HIS A N   1 
ATOM   3717 C CA  . HIS A 1 493 ? -15.052 25.151  -45.023 1.00 42.21 ? 492 HIS A CA  1 
ATOM   3718 C C   . HIS A 1 493 ? -16.403 25.269  -45.733 1.00 44.59 ? 492 HIS A C   1 
ATOM   3719 O O   . HIS A 1 493 ? -16.430 25.341  -46.949 1.00 46.71 ? 492 HIS A O   1 
ATOM   3720 C CB  . HIS A 1 493 ? -14.031 24.200  -45.673 1.00 46.27 ? 492 HIS A CB  1 
ATOM   3721 C CG  . HIS A 1 493 ? -12.651 24.421  -45.128 1.00 54.63 ? 492 HIS A CG  1 
ATOM   3722 N ND1 . HIS A 1 493 ? -11.989 23.491  -44.356 1.00 64.60 ? 492 HIS A ND1 1 
ATOM   3723 C CD2 . HIS A 1 493 ? -11.869 25.530  -45.124 1.00 60.04 ? 492 HIS A CD2 1 
ATOM   3724 C CE1 . HIS A 1 493 ? -10.834 23.997  -43.947 1.00 65.42 ? 492 HIS A CE1 1 
ATOM   3725 N NE2 . HIS A 1 493 ? -10.740 25.234  -44.397 1.00 63.98 ? 492 HIS A NE2 1 
ATOM   3726 N N   . GLY A 1 494 ? -17.510 25.335  -44.966 1.00 39.12 ? 493 GLY A N   1 
ATOM   3727 C CA  . GLY A 1 494 ? -18.838 25.449  -45.541 1.00 41.94 ? 493 GLY A CA  1 
ATOM   3728 C C   . GLY A 1 494 ? -19.236 24.428  -46.607 1.00 44.99 ? 493 GLY A C   1 
ATOM   3729 O O   . GLY A 1 494 ? -19.904 24.801  -47.558 1.00 47.89 ? 493 GLY A O   1 
ATOM   3730 N N   . VAL A 1 495 ? -18.842 23.152  -46.451 1.00 41.43 ? 494 VAL A N   1 
ATOM   3731 C CA  . VAL A 1 495 ? -19.213 22.044  -47.401 1.00 44.41 ? 494 VAL A CA  1 
ATOM   3732 C C   . VAL A 1 495 ? -19.814 20.801  -46.669 1.00 48.76 ? 494 VAL A C   1 
ATOM   3733 O O   . VAL A 1 495 ? -19.759 20.738  -45.420 1.00 38.05 ? 494 VAL A O   1 
ATOM   3734 C CB  . VAL A 1 495 ? -18.027 21.673  -48.355 1.00 41.04 ? 494 VAL A CB  1 
ATOM   3735 C CG1 . VAL A 1 495 ? -17.558 22.914  -49.113 1.00 39.86 ? 494 VAL A CG1 1 
ATOM   3736 C CG2 . VAL A 1 495 ? -16.849 21.026  -47.610 1.00 42.39 ? 494 VAL A CG2 1 
ATOM   3737 N N   . PRO A 1 496 ? -20.437 19.842  -47.425 1.00 56.26 ? 495 PRO A N   1 
ATOM   3738 C CA  . PRO A 1 496 ? -21.095 18.685  -46.746 1.00 57.11 ? 495 PRO A CA  1 
ATOM   3739 C C   . PRO A 1 496 ? -20.129 17.769  -45.980 1.00 52.17 ? 495 PRO A C   1 
ATOM   3740 O O   . PRO A 1 496 ? -19.117 17.388  -46.538 1.00 46.16 ? 495 PRO A O   1 
ATOM   3741 C CB  . PRO A 1 496 ? -21.764 17.918  -47.906 1.00 58.88 ? 495 PRO A CB  1 
ATOM   3742 C CG  . PRO A 1 496 ? -21.970 18.949  -48.968 1.00 61.17 ? 495 PRO A CG  1 
ATOM   3743 C CD  . PRO A 1 496 ? -20.794 19.896  -48.863 1.00 58.56 ? 495 PRO A CD  1 
HETATM 3744 O O   . HOH B 2 .   ? -29.672 -21.651 -32.889 1.00 32.13 ? 601 HOH A O   1 
HETATM 3745 O O   . HOH B 2 .   ? -14.536 -12.943 -54.066 1.00 24.25 ? 602 HOH A O   1 
HETATM 3746 O O   . HOH B 2 .   ? -25.058 -21.812 -17.017 1.00 39.48 ? 603 HOH A O   1 
HETATM 3747 O O   . HOH B 2 .   ? 2.276   -8.485  -4.744  1.00 41.54 ? 604 HOH A O   1 
HETATM 3748 O O   . HOH B 2 .   ? -9.048  -27.308 -31.384 1.00 35.73 ? 605 HOH A O   1 
HETATM 3749 O O   . HOH B 2 .   ? -4.078  -8.356  -56.583 1.00 52.91 ? 606 HOH A O   1 
HETATM 3750 O O   . HOH B 2 .   ? -29.524 9.286   -54.894 1.00 33.98 ? 607 HOH A O   1 
HETATM 3751 O O   . HOH B 2 .   ? -24.961 -19.468 -55.125 1.00 30.63 ? 608 HOH A O   1 
HETATM 3752 O O   . HOH B 2 .   ? -22.180 13.510  -38.160 1.00 31.19 ? 609 HOH A O   1 
HETATM 3753 O O   . HOH B 2 .   ? -11.914 -11.948 -24.962 1.00 20.11 ? 610 HOH A O   1 
HETATM 3754 O O   . HOH B 2 .   ? -25.816 -34.604 -42.279 1.00 24.29 ? 611 HOH A O   1 
HETATM 3755 O O   . HOH B 2 .   ? -25.754 -18.797 -52.822 1.00 37.53 ? 612 HOH A O   1 
HETATM 3756 O O   . HOH B 2 .   ? -24.318 12.569  -45.639 1.00 28.15 ? 613 HOH A O   1 
HETATM 3757 O O   . HOH B 2 .   ? -17.203 -0.317  -58.483 0.50 17.79 ? 614 HOH A O   1 
HETATM 3758 O O   . HOH B 2 .   ? -25.107 -14.935 -19.642 1.00 27.47 ? 615 HOH A O   1 
HETATM 3759 O O   . HOH B 2 .   ? -15.682 -14.504 -13.421 1.00 30.25 ? 616 HOH A O   1 
HETATM 3760 O O   . HOH B 2 .   ? -23.815 1.820   -27.502 1.00 31.44 ? 617 HOH A O   1 
HETATM 3761 O O   . HOH B 2 .   ? -39.262 5.462   -31.422 1.00 45.41 ? 618 HOH A O   1 
HETATM 3762 O O   . HOH B 2 .   ? -11.367 -3.102  -14.107 1.00 28.69 ? 619 HOH A O   1 
HETATM 3763 O O   . HOH B 2 .   ? -24.292 -7.547  -20.022 1.00 29.39 ? 620 HOH A O   1 
HETATM 3764 O O   . HOH B 2 .   ? -22.586 -12.066 -45.224 1.00 24.98 ? 621 HOH A O   1 
HETATM 3765 O O   . HOH B 2 .   ? -2.226  -1.247  -27.741 1.00 25.08 ? 622 HOH A O   1 
HETATM 3766 O O   . HOH B 2 .   ? -28.897 -4.132  -46.401 1.00 27.22 ? 623 HOH A O   1 
HETATM 3767 O O   . HOH B 2 .   ? -17.960 -17.249 -45.111 1.00 22.79 ? 624 HOH A O   1 
HETATM 3768 O O   . HOH B 2 .   ? -17.787 0.597   -24.963 1.00 22.18 ? 625 HOH A O   1 
HETATM 3769 O O   . HOH B 2 .   ? -14.864 -14.648 -22.139 1.00 21.43 ? 626 HOH A O   1 
HETATM 3770 O O   . HOH B 2 .   ? -13.757 10.547  -44.424 1.00 18.04 ? 627 HOH A O   1 
HETATM 3771 O O   . HOH B 2 .   ? -21.897 -29.085 -62.111 1.00 38.40 ? 628 HOH A O   1 
HETATM 3772 O O   . HOH B 2 .   ? 1.992   -17.376 -45.365 1.00 36.61 ? 629 HOH A O   1 
HETATM 3773 O O   . HOH B 2 .   ? -8.714  6.433   -27.001 1.00 21.90 ? 630 HOH A O   1 
HETATM 3774 O O   . HOH B 2 .   ? 9.739   -17.663 -17.164 1.00 38.15 ? 631 HOH A O   1 
HETATM 3775 O O   . HOH B 2 .   ? -25.946 -15.093 -36.185 1.00 21.01 ? 632 HOH A O   1 
HETATM 3776 O O   . HOH B 2 .   ? -15.452 9.012   -52.635 1.00 34.20 ? 633 HOH A O   1 
HETATM 3777 O O   . HOH B 2 .   ? -17.967 -8.675  -48.005 1.00 24.65 ? 634 HOH A O   1 
HETATM 3778 O O   . HOH B 2 .   ? -11.125 14.581  -33.873 1.00 19.32 ? 635 HOH A O   1 
HETATM 3779 O O   . HOH B 2 .   ? -32.395 -5.757  -23.884 1.00 40.74 ? 636 HOH A O   1 
HETATM 3780 O O   . HOH B 2 .   ? 2.944   -15.316 -16.327 1.00 18.96 ? 637 HOH A O   1 
HETATM 3781 O O   . HOH B 2 .   ? -37.149 -3.368  -38.869 1.00 47.88 ? 638 HOH A O   1 
HETATM 3782 O O   . HOH B 2 .   ? -6.914  -25.591 -29.836 1.00 30.90 ? 639 HOH A O   1 
HETATM 3783 O O   . HOH B 2 .   ? -8.034  -3.084  -41.950 1.00 14.96 ? 640 HOH A O   1 
HETATM 3784 O O   . HOH B 2 .   ? 9.320   -14.840 -28.806 1.00 27.41 ? 641 HOH A O   1 
HETATM 3785 O O   . HOH B 2 .   ? -10.204 -30.082 -31.959 1.00 43.43 ? 642 HOH A O   1 
HETATM 3786 O O   . HOH B 2 .   ? -10.513 -16.883 -50.272 1.00 15.00 ? 643 HOH A O   1 
HETATM 3787 O O   . HOH B 2 .   ? -21.094 20.517  -43.160 1.00 43.07 ? 644 HOH A O   1 
HETATM 3788 O O   . HOH B 2 .   ? -4.844  -26.689 -28.307 1.00 25.45 ? 645 HOH A O   1 
HETATM 3789 O O   . HOH B 2 .   ? -5.972  -24.387 -32.080 1.00 35.52 ? 646 HOH A O   1 
HETATM 3790 O O   . HOH B 2 .   ? -14.288 -24.028 -36.622 1.00 16.10 ? 647 HOH A O   1 
HETATM 3791 O O   . HOH B 2 .   ? -13.756 -26.775 -35.824 1.00 27.88 ? 648 HOH A O   1 
HETATM 3792 O O   . HOH B 2 .   ? -29.755 -26.965 -37.138 1.00 31.09 ? 649 HOH A O   1 
HETATM 3793 O O   . HOH B 2 .   ? -12.509 -17.422 -33.669 1.00 13.59 ? 650 HOH A O   1 
HETATM 3794 O O   . HOH B 2 .   ? 9.530   -8.095  -35.676 1.00 16.15 ? 651 HOH A O   1 
HETATM 3795 O O   . HOH B 2 .   ? -8.634  -4.296  -56.459 1.00 31.03 ? 652 HOH A O   1 
HETATM 3796 O O   . HOH B 2 .   ? -19.669 -26.019 -15.645 1.00 43.88 ? 653 HOH A O   1 
HETATM 3797 O O   . HOH B 2 .   ? 7.730   -7.220  -31.799 1.00 29.87 ? 654 HOH A O   1 
HETATM 3798 O O   . HOH B 2 .   ? -21.692 -16.779 -43.910 1.00 27.49 ? 655 HOH A O   1 
HETATM 3799 O O   . HOH B 2 .   ? -12.408 1.198   -26.492 1.00 19.08 ? 656 HOH A O   1 
HETATM 3800 O O   . HOH B 2 .   ? -3.442  -21.019 -46.615 1.00 23.45 ? 657 HOH A O   1 
HETATM 3801 O O   . HOH B 2 .   ? -28.847 -31.755 -40.210 1.00 26.72 ? 658 HOH A O   1 
HETATM 3802 O O   . HOH B 2 .   ? -7.876  -13.771 -54.819 1.00 21.86 ? 659 HOH A O   1 
HETATM 3803 O O   . HOH B 2 .   ? -4.863  -11.978 -28.948 1.00 16.28 ? 660 HOH A O   1 
HETATM 3804 O O   . HOH B 2 .   ? -6.830  -29.090 -54.515 1.00 37.40 ? 661 HOH A O   1 
HETATM 3805 O O   . HOH B 2 .   ? -9.804  -16.015 -58.521 1.00 42.29 ? 662 HOH A O   1 
HETATM 3806 O O   . HOH B 2 .   ? -28.931 11.249  -39.143 1.00 34.07 ? 663 HOH A O   1 
HETATM 3807 O O   . HOH B 2 .   ? -19.649 -18.638 -43.284 1.00 24.72 ? 664 HOH A O   1 
HETATM 3808 O O   . HOH B 2 .   ? -21.245 -31.181 -46.650 1.00 19.88 ? 665 HOH A O   1 
HETATM 3809 O O   . HOH B 2 .   ? -14.163 -10.957 -16.566 1.00 26.84 ? 666 HOH A O   1 
HETATM 3810 O O   . HOH B 2 .   ? -1.773  -25.779 -33.921 1.00 33.66 ? 667 HOH A O   1 
HETATM 3811 O O   . HOH B 2 .   ? -34.216 -28.171 -52.539 1.00 31.74 ? 668 HOH A O   1 
HETATM 3812 O O   . HOH B 2 .   ? 0.022   -26.095 -43.232 1.00 37.82 ? 669 HOH A O   1 
HETATM 3813 O O   . HOH B 2 .   ? 7.777   -25.030 -18.565 1.00 26.54 ? 670 HOH A O   1 
HETATM 3814 O O   . HOH B 2 .   ? -24.224 8.032   -28.845 1.00 34.35 ? 671 HOH A O   1 
HETATM 3815 O O   . HOH B 2 .   ? 4.772   -14.025 -8.293  1.00 30.06 ? 672 HOH A O   1 
HETATM 3816 O O   . HOH B 2 .   ? -1.370  -23.175 -4.915  1.00 41.01 ? 673 HOH A O   1 
HETATM 3817 O O   . HOH B 2 .   ? -14.216 -11.882 -19.392 1.00 24.87 ? 674 HOH A O   1 
HETATM 3818 O O   . HOH B 2 .   ? -11.074 9.250   -25.158 1.00 31.29 ? 675 HOH A O   1 
HETATM 3819 O O   . HOH B 2 .   ? -3.806  -2.717  -31.657 1.00 25.97 ? 676 HOH A O   1 
HETATM 3820 O O   . HOH B 2 .   ? -18.687 -37.485 -58.221 1.00 38.19 ? 677 HOH A O   1 
HETATM 3821 O O   . HOH B 2 .   ? -15.263 -17.516 -60.122 1.00 39.00 ? 678 HOH A O   1 
HETATM 3822 O O   . HOH B 2 .   ? -25.649 -21.275 -52.289 1.00 29.58 ? 679 HOH A O   1 
HETATM 3823 O O   . HOH B 2 .   ? -12.379 -10.180 -3.940  1.00 42.91 ? 680 HOH A O   1 
HETATM 3824 O O   . HOH B 2 .   ? -25.671 -4.643  -57.802 1.00 37.47 ? 681 HOH A O   1 
HETATM 3825 O O   . HOH B 2 .   ? -2.613  -5.081  -26.173 1.00 17.41 ? 682 HOH A O   1 
HETATM 3826 O O   . HOH B 2 .   ? -25.406 -30.621 -58.794 1.00 37.73 ? 683 HOH A O   1 
HETATM 3827 O O   . HOH B 2 .   ? -10.439 -27.856 -35.338 1.00 24.42 ? 684 HOH A O   1 
HETATM 3828 O O   . HOH B 2 .   ? -31.805 -32.528 -46.788 1.00 29.59 ? 685 HOH A O   1 
HETATM 3829 O O   . HOH B 2 .   ? -14.417 9.355   -30.423 1.00 21.34 ? 686 HOH A O   1 
HETATM 3830 O O   . HOH B 2 .   ? -8.262  -27.347 -47.044 1.00 31.85 ? 687 HOH A O   1 
HETATM 3831 O O   . HOH B 2 .   ? -11.870 -14.043 -6.909  1.00 33.46 ? 688 HOH A O   1 
HETATM 3832 O O   . HOH B 2 .   ? -8.133  -10.375 -22.843 1.00 20.62 ? 689 HOH A O   1 
HETATM 3833 O O   . HOH B 2 .   ? 2.603   -0.720  -43.963 1.00 29.39 ? 690 HOH A O   1 
HETATM 3834 O O   . HOH B 2 .   ? -12.193 -4.972  -17.491 1.00 18.80 ? 691 HOH A O   1 
HETATM 3835 O O   . HOH B 2 .   ? -27.863 -22.298 -34.565 1.00 23.45 ? 692 HOH A O   1 
HETATM 3836 O O   . HOH B 2 .   ? -2.657  -5.442  -39.546 1.00 20.82 ? 693 HOH A O   1 
HETATM 3837 O O   . HOH B 2 .   ? -7.196  -21.862 -33.063 1.00 18.59 ? 694 HOH A O   1 
HETATM 3838 O O   . HOH B 2 .   ? -16.848 -17.654 -19.761 1.00 24.42 ? 695 HOH A O   1 
HETATM 3839 O O   . HOH B 2 .   ? 7.062   -6.789  -9.968  1.00 40.87 ? 696 HOH A O   1 
HETATM 3840 O O   . HOH B 2 .   ? -16.927 -15.809 -47.028 1.00 16.40 ? 697 HOH A O   1 
HETATM 3841 O O   . HOH B 2 .   ? -6.854  -34.008 -35.518 1.00 44.62 ? 698 HOH A O   1 
HETATM 3842 O O   . HOH B 2 .   ? -35.135 5.886   -31.132 1.00 38.68 ? 699 HOH A O   1 
HETATM 3843 O O   . HOH B 2 .   ? -13.636 -19.174 -41.761 1.00 14.29 ? 700 HOH A O   1 
HETATM 3844 O O   . HOH B 2 .   ? -14.877 5.843   -44.882 1.00 18.26 ? 701 HOH A O   1 
HETATM 3845 O O   . HOH B 2 .   ? -12.861 4.901   -27.600 1.00 21.36 ? 702 HOH A O   1 
HETATM 3846 O O   . HOH B 2 .   ? -21.206 -25.293 -43.321 1.00 17.88 ? 703 HOH A O   1 
HETATM 3847 O O   . HOH B 2 .   ? -25.241 8.125   -31.001 1.00 24.40 ? 704 HOH A O   1 
HETATM 3848 O O   . HOH B 2 .   ? -27.095 -22.835 -27.930 1.00 34.37 ? 705 HOH A O   1 
HETATM 3849 O O   . HOH B 2 .   ? -7.467  -19.204 -52.076 1.00 33.00 ? 706 HOH A O   1 
HETATM 3850 O O   . HOH B 2 .   ? -31.148 -20.259 -65.124 1.00 38.37 ? 707 HOH A O   1 
HETATM 3851 O O   . HOH B 2 .   ? -21.498 -36.087 -44.497 1.00 33.91 ? 708 HOH A O   1 
HETATM 3852 O O   . HOH B 2 .   ? -15.266 -12.568 -4.662  1.00 49.49 ? 709 HOH A O   1 
HETATM 3853 O O   . HOH B 2 .   ? 7.632   -14.502 -36.836 1.00 20.16 ? 710 HOH A O   1 
HETATM 3854 O O   . HOH B 2 .   ? -35.730 -12.918 -36.505 1.00 28.96 ? 711 HOH A O   1 
HETATM 3855 O O   . HOH B 2 .   ? -33.787 -14.585 -37.529 1.00 23.57 ? 712 HOH A O   1 
HETATM 3856 O O   . HOH B 2 .   ? -12.653 6.946   -52.225 1.00 42.31 ? 713 HOH A O   1 
HETATM 3857 O O   . HOH B 2 .   ? -33.835 -5.115  -41.674 1.00 38.84 ? 714 HOH A O   1 
HETATM 3858 O O   . HOH B 2 .   ? -13.383 -15.364 -53.805 1.00 20.93 ? 715 HOH A O   1 
HETATM 3859 O O   . HOH B 2 .   ? -18.878 -33.814 -35.378 1.00 47.93 ? 716 HOH A O   1 
HETATM 3860 O O   . HOH B 2 .   ? -1.899  -4.446  -52.035 1.00 42.34 ? 717 HOH A O   1 
HETATM 3861 O O   . HOH B 2 .   ? -9.924  1.695   -53.315 1.00 22.48 ? 718 HOH A O   1 
HETATM 3862 O O   . HOH B 2 .   ? -8.017  -7.792  -22.023 1.00 19.76 ? 719 HOH A O   1 
HETATM 3863 O O   . HOH B 2 .   ? -20.533 -7.457  -19.690 1.00 35.74 ? 720 HOH A O   1 
HETATM 3864 O O   . HOH B 2 .   ? -25.692 -1.580  -53.848 1.00 44.53 ? 721 HOH A O   1 
HETATM 3865 O O   . HOH B 2 .   ? -13.414 -32.959 -43.388 1.00 19.98 ? 722 HOH A O   1 
HETATM 3866 O O   . HOH B 2 .   ? -25.343 -26.424 -31.771 1.00 46.33 ? 723 HOH A O   1 
HETATM 3867 O O   . HOH B 2 .   ? 2.988   -20.481 -43.108 1.00 30.74 ? 724 HOH A O   1 
HETATM 3868 O O   . HOH B 2 .   ? -28.158 12.134  -35.223 1.00 45.16 ? 725 HOH A O   1 
HETATM 3869 O O   . HOH B 2 .   ? -13.158 7.855   -44.998 1.00 17.21 ? 726 HOH A O   1 
HETATM 3870 O O   . HOH B 2 .   ? -26.369 1.396   -25.340 1.00 26.12 ? 727 HOH A O   1 
HETATM 3871 O O   . HOH B 2 .   ? 0.737   -25.435 -14.293 1.00 45.27 ? 728 HOH A O   1 
HETATM 3872 O O   . HOH B 2 .   ? -31.131 -29.034 -55.181 1.00 31.03 ? 729 HOH A O   1 
HETATM 3873 O O   . HOH B 2 .   ? -17.627 -30.218 -28.335 1.00 28.69 ? 730 HOH A O   1 
HETATM 3874 O O   . HOH B 2 .   ? -10.876 -31.235 -53.262 1.00 35.95 ? 731 HOH A O   1 
HETATM 3875 O O   . HOH B 2 .   ? -15.568 -8.727  -49.089 1.00 23.12 ? 732 HOH A O   1 
HETATM 3876 O O   . HOH B 2 .   ? -8.167  -18.270 -49.714 1.00 16.66 ? 733 HOH A O   1 
HETATM 3877 O O   . HOH B 2 .   ? -19.166 22.605  -34.368 1.00 39.33 ? 734 HOH A O   1 
HETATM 3878 O O   . HOH B 2 .   ? -33.292 -24.914 -47.491 1.00 33.97 ? 735 HOH A O   1 
HETATM 3879 O O   . HOH B 2 .   ? -35.228 -10.025 -43.284 1.00 41.32 ? 736 HOH A O   1 
HETATM 3880 O O   . HOH B 2 .   ? -6.749  -35.266 -41.753 1.00 40.43 ? 737 HOH A O   1 
HETATM 3881 O O   . HOH B 2 .   ? -25.053 -28.513 -56.141 1.00 23.67 ? 738 HOH A O   1 
HETATM 3882 O O   . HOH B 2 .   ? -31.785 -11.524 -22.160 1.00 42.40 ? 739 HOH A O   1 
HETATM 3883 O O   . HOH B 2 .   ? -34.165 -18.189 -43.985 1.00 29.85 ? 740 HOH A O   1 
HETATM 3884 O O   . HOH B 2 .   ? 5.615   -20.991 -34.159 1.00 24.59 ? 741 HOH A O   1 
HETATM 3885 O O   . HOH B 2 .   ? -9.517  18.876  -35.455 1.00 31.36 ? 742 HOH A O   1 
HETATM 3886 O O   . HOH B 2 .   ? -1.431  -18.554 -50.774 1.00 22.38 ? 743 HOH A O   1 
HETATM 3887 O O   . HOH B 2 .   ? -20.432 11.963  -36.608 1.00 22.54 ? 744 HOH A O   1 
HETATM 3888 O O   . HOH B 2 .   ? -6.693  -2.271  -18.111 1.00 20.51 ? 745 HOH A O   1 
HETATM 3889 O O   . HOH B 2 .   ? -25.569 -27.008 -28.776 1.00 44.16 ? 746 HOH A O   1 
HETATM 3890 O O   . HOH B 2 .   ? -17.709 -21.524 -20.171 1.00 20.06 ? 747 HOH A O   1 
HETATM 3891 O O   . HOH B 2 .   ? -2.378  -0.573  -20.456 1.00 36.20 ? 748 HOH A O   1 
HETATM 3892 O O   . HOH B 2 .   ? -2.576  -17.746 -59.404 1.00 46.42 ? 749 HOH A O   1 
HETATM 3893 O O   . HOH B 2 .   ? -11.346 3.160   -29.890 1.00 17.93 ? 750 HOH A O   1 
HETATM 3894 O O   . HOH B 2 .   ? -16.690 -36.584 -39.726 1.00 39.69 ? 751 HOH A O   1 
HETATM 3895 O O   . HOH B 2 .   ? -14.398 12.002  -46.666 1.00 27.70 ? 752 HOH A O   1 
HETATM 3896 O O   . HOH B 2 .   ? 5.182   -7.395  -40.269 1.00 35.33 ? 753 HOH A O   1 
HETATM 3897 O O   . HOH B 2 .   ? -17.558 -27.201 -42.277 1.00 29.27 ? 754 HOH A O   1 
HETATM 3898 O O   . HOH B 2 .   ? -24.585 -4.220  -55.621 1.00 22.57 ? 755 HOH A O   1 
HETATM 3899 O O   . HOH B 2 .   ? -11.398 -33.697 -53.203 1.00 37.08 ? 756 HOH A O   1 
HETATM 3900 O O   . HOH B 2 .   ? 7.650   -17.828 -20.821 1.00 34.74 ? 757 HOH A O   1 
HETATM 3901 O O   . HOH B 2 .   ? -4.686  -28.266 -23.742 1.00 28.46 ? 758 HOH A O   1 
HETATM 3902 O O   . HOH B 2 .   ? -9.340  -10.414 -25.279 1.00 14.90 ? 759 HOH A O   1 
HETATM 3903 O O   . HOH B 2 .   ? -15.980 -18.474 -17.261 1.00 32.88 ? 760 HOH A O   1 
HETATM 3904 O O   . HOH B 2 .   ? -25.426 10.590  -32.092 1.00 31.71 ? 761 HOH A O   1 
HETATM 3905 O O   . HOH B 2 .   ? -22.100 -17.026 -46.810 1.00 30.47 ? 762 HOH A O   1 
HETATM 3906 O O   . HOH B 2 .   ? -20.509 -31.386 -42.946 1.00 20.54 ? 763 HOH A O   1 
HETATM 3907 O O   . HOH B 2 .   ? -16.078 22.959  -37.194 1.00 31.01 ? 764 HOH A O   1 
HETATM 3908 O O   . HOH B 2 .   ? 8.132   -13.830 -9.831  1.00 32.57 ? 765 HOH A O   1 
HETATM 3909 O O   . HOH B 2 .   ? 0.330   -14.175 -53.382 1.00 37.86 ? 766 HOH A O   1 
HETATM 3910 O O   . HOH B 2 .   ? 1.722   -4.967  -33.140 1.00 31.37 ? 767 HOH A O   1 
HETATM 3911 O O   . HOH B 2 .   ? -21.004 -29.146 -44.501 1.00 24.71 ? 768 HOH A O   1 
HETATM 3912 O O   . HOH B 2 .   ? -11.802 -34.791 -56.240 1.00 36.41 ? 769 HOH A O   1 
HETATM 3913 O O   . HOH B 2 .   ? -32.720 -16.162 -44.068 1.00 41.36 ? 770 HOH A O   1 
HETATM 3914 O O   . HOH B 2 .   ? 7.412   -14.519 -16.299 1.00 32.31 ? 771 HOH A O   1 
HETATM 3915 O O   . HOH B 2 .   ? -18.274 -8.908  -38.604 1.00 13.91 ? 772 HOH A O   1 
HETATM 3916 O O   . HOH B 2 .   ? -24.071 -29.044 -29.661 1.00 39.05 ? 773 HOH A O   1 
HETATM 3917 O O   . HOH B 2 .   ? -16.898 -18.833 -42.814 1.00 30.66 ? 774 HOH A O   1 
HETATM 3918 O O   . HOH B 2 .   ? 9.039   -24.444 -38.462 1.00 44.33 ? 775 HOH A O   1 
HETATM 3919 O O   . HOH B 2 .   ? -17.035 -12.651 -55.010 1.00 28.23 ? 776 HOH A O   1 
HETATM 3920 O O   . HOH B 2 .   ? -6.818  7.576   -41.976 1.00 33.12 ? 777 HOH A O   1 
HETATM 3921 O O   . HOH B 2 .   ? -8.189  -7.796  -33.747 1.00 13.31 ? 778 HOH A O   1 
HETATM 3922 O O   . HOH B 2 .   ? -22.785 -21.877 -36.942 1.00 23.57 ? 779 HOH A O   1 
HETATM 3923 O O   . HOH B 2 .   ? 7.453   -13.204 -32.469 1.00 18.91 ? 780 HOH A O   1 
HETATM 3924 O O   . HOH B 2 .   ? -10.406 -22.148 -13.103 1.00 23.96 ? 781 HOH A O   1 
HETATM 3925 O O   . HOH B 2 .   ? 2.306   -4.101  -22.826 1.00 18.70 ? 782 HOH A O   1 
HETATM 3926 O O   . HOH B 2 .   ? -2.609  -27.512 -20.561 1.00 28.42 ? 783 HOH A O   1 
HETATM 3927 O O   . HOH B 2 .   ? -14.928 -34.507 -33.630 1.00 40.00 ? 784 HOH A O   1 
HETATM 3928 O O   . HOH B 2 .   ? -9.521  -7.934  -9.445  1.00 41.01 ? 785 HOH A O   1 
HETATM 3929 O O   . HOH B 2 .   ? -5.274  6.316   -43.695 1.00 41.13 ? 786 HOH A O   1 
HETATM 3930 O O   . HOH B 2 .   ? -28.376 -28.999 -38.252 1.00 34.33 ? 787 HOH A O   1 
HETATM 3931 O O   . HOH B 2 .   ? 8.266   -9.688  -28.788 1.00 20.89 ? 788 HOH A O   1 
HETATM 3932 O O   . HOH B 2 .   ? -15.587 -7.702  -16.368 1.00 32.56 ? 789 HOH A O   1 
HETATM 3933 O O   . HOH B 2 .   ? 0.401   -4.316  -19.151 1.00 31.24 ? 790 HOH A O   1 
HETATM 3934 O O   . HOH B 2 .   ? -32.702 -24.426 -50.265 1.00 24.21 ? 791 HOH A O   1 
HETATM 3935 O O   . HOH B 2 .   ? -2.670  -33.402 -34.853 1.00 39.81 ? 792 HOH A O   1 
HETATM 3936 O O   . HOH B 2 .   ? -5.896  -5.446  -57.373 1.00 37.74 ? 793 HOH A O   1 
HETATM 3937 O O   . HOH B 2 .   ? -8.928  -29.730 -46.898 1.00 35.48 ? 794 HOH A O   1 
HETATM 3938 O O   . HOH B 2 .   ? -2.442  -4.238  -37.158 1.00 22.43 ? 795 HOH A O   1 
HETATM 3939 O O   . HOH B 2 .   ? -33.717 -26.062 -58.407 1.00 36.42 ? 796 HOH A O   1 
HETATM 3940 O O   . HOH B 2 .   ? -34.658 7.002   -41.062 1.00 32.12 ? 797 HOH A O   1 
HETATM 3941 O O   . HOH B 2 .   ? -5.654  -4.265  -8.836  1.00 45.25 ? 798 HOH A O   1 
HETATM 3942 O O   . HOH B 2 .   ? -16.287 -16.946 -62.787 1.00 39.38 ? 799 HOH A O   1 
HETATM 3943 O O   . HOH B 2 .   ? -20.417 7.742   -26.924 1.00 32.96 ? 800 HOH A O   1 
HETATM 3944 O O   . HOH B 2 .   ? -9.862  -20.009 -11.745 1.00 31.56 ? 801 HOH A O   1 
HETATM 3945 O O   . HOH B 2 .   ? -27.738 1.563   -56.945 1.00 34.65 ? 802 HOH A O   1 
HETATM 3946 O O   . HOH B 2 .   ? -9.857  -10.080 -34.494 1.00 14.55 ? 803 HOH A O   1 
HETATM 3947 O O   . HOH B 2 .   ? -14.356 -16.131 -56.347 1.00 23.54 ? 804 HOH A O   1 
HETATM 3948 O O   . HOH B 2 .   ? 8.055   -3.177  -28.778 1.00 32.36 ? 805 HOH A O   1 
HETATM 3949 O O   . HOH B 2 .   ? -8.167  3.593   -42.395 1.00 25.47 ? 806 HOH A O   1 
HETATM 3950 O O   . HOH B 2 .   ? -3.597  -0.880  -16.342 1.00 45.63 ? 807 HOH A O   1 
HETATM 3951 O O   . HOH B 2 .   ? -31.388 -17.115 -46.770 1.00 28.21 ? 808 HOH A O   1 
HETATM 3952 O O   . HOH B 2 .   ? -32.830 6.532   -49.696 1.00 52.15 ? 809 HOH A O   1 
HETATM 3953 O O   . HOH B 2 .   ? -27.872 -11.621 -55.641 1.00 33.43 ? 810 HOH A O   1 
HETATM 3954 O O   . HOH B 2 .   ? -21.094 -10.433 -43.703 1.00 18.23 ? 811 HOH A O   1 
HETATM 3955 O O   . HOH B 2 .   ? -15.982 6.106   -26.940 1.00 32.63 ? 812 HOH A O   1 
HETATM 3956 O O   . HOH B 2 .   ? 10.822  -8.901  -19.461 1.00 25.14 ? 813 HOH A O   1 
HETATM 3957 O O   . HOH B 2 .   ? 7.411   -18.839 -25.854 1.00 38.67 ? 814 HOH A O   1 
HETATM 3958 O O   . HOH B 2 .   ? -17.314 -28.901 -19.644 1.00 36.06 ? 815 HOH A O   1 
HETATM 3959 O O   . HOH B 2 .   ? -5.078  -19.253 -51.218 1.00 23.95 ? 816 HOH A O   1 
HETATM 3960 O O   . HOH B 2 .   ? -12.147 -30.558 -46.573 1.00 27.03 ? 817 HOH A O   1 
HETATM 3961 O O   . HOH B 2 .   ? -9.812  -19.485 -32.499 1.00 21.06 ? 818 HOH A O   1 
HETATM 3962 O O   . HOH B 2 .   ? -31.963 -5.875  -55.040 1.00 40.89 ? 819 HOH A O   1 
HETATM 3963 O O   . HOH B 2 .   ? 8.733   -20.050 -37.376 1.00 38.62 ? 820 HOH A O   1 
HETATM 3964 O O   . HOH B 2 .   ? -24.269 -17.417 -44.151 1.00 42.92 ? 821 HOH A O   1 
HETATM 3965 O O   . HOH B 2 .   ? -25.477 -11.120 -20.635 1.00 28.87 ? 822 HOH A O   1 
HETATM 3966 O O   . HOH B 2 .   ? -19.367 18.710  -36.196 1.00 49.58 ? 823 HOH A O   1 
HETATM 3967 O O   . HOH B 2 .   ? -3.875  2.100   -31.416 1.00 34.49 ? 824 HOH A O   1 
HETATM 3968 O O   . HOH B 2 .   ? -16.388 -12.276 -14.932 1.00 38.45 ? 825 HOH A O   1 
HETATM 3969 O O   . HOH B 2 .   ? 2.316   -30.414 -30.602 1.00 44.35 ? 826 HOH A O   1 
HETATM 3970 O O   . HOH B 2 .   ? -38.354 -10.646 -29.863 1.00 36.67 ? 827 HOH A O   1 
HETATM 3971 O O   . HOH B 2 .   ? -15.170 -21.740 -19.309 1.00 34.54 ? 828 HOH A O   1 
HETATM 3972 O O   . HOH B 2 .   ? -0.921  -3.232  -16.262 1.00 21.83 ? 829 HOH A O   1 
HETATM 3973 O O   . HOH B 2 .   ? -12.961 -23.744 -14.440 1.00 33.85 ? 830 HOH A O   1 
HETATM 3974 O O   . HOH B 2 .   ? -16.710 17.137  -33.376 1.00 25.99 ? 831 HOH A O   1 
HETATM 3975 O O   . HOH B 2 .   ? -12.348 -1.029  -22.401 1.00 21.50 ? 832 HOH A O   1 
HETATM 3976 O O   . HOH B 2 .   ? -2.725  -25.210 -8.613  1.00 33.04 ? 833 HOH A O   1 
HETATM 3977 O O   . HOH B 2 .   ? -23.991 13.578  -34.662 1.00 44.52 ? 834 HOH A O   1 
HETATM 3978 O O   . HOH B 2 .   ? -20.531 -5.098  -19.095 1.00 34.84 ? 835 HOH A O   1 
HETATM 3979 O O   . HOH B 2 .   ? -9.342  -30.373 -35.501 1.00 26.10 ? 836 HOH A O   1 
HETATM 3980 O O   . HOH B 2 .   ? -17.313 -18.613 -7.117  1.00 38.73 ? 837 HOH A O   1 
HETATM 3981 O O   . HOH B 2 .   ? -15.875 14.647  -52.679 1.00 43.28 ? 838 HOH A O   1 
HETATM 3982 O O   . HOH B 2 .   ? -12.028 21.872  -35.235 1.00 38.42 ? 839 HOH A O   1 
HETATM 3983 O O   . HOH B 2 .   ? 0.591   -5.001  -10.594 1.00 23.50 ? 840 HOH A O   1 
HETATM 3984 O O   . HOH B 2 .   ? -39.130 2.532   -37.008 1.00 42.49 ? 841 HOH A O   1 
HETATM 3985 O O   . HOH B 2 .   ? 4.993   -5.662  -33.506 1.00 31.14 ? 842 HOH A O   1 
HETATM 3986 O O   . HOH B 2 .   ? -22.977 4.535   -26.478 1.00 28.31 ? 843 HOH A O   1 
HETATM 3987 O O   . HOH B 2 .   ? 10.603  -6.252  -22.500 1.00 43.42 ? 844 HOH A O   1 
HETATM 3988 O O   . HOH B 2 .   ? 6.691   -5.471  -35.632 1.00 28.82 ? 845 HOH A O   1 
HETATM 3989 O O   . HOH B 2 .   ? -25.339 -33.009 -36.143 1.00 46.34 ? 846 HOH A O   1 
HETATM 3990 O O   . HOH B 2 .   ? -19.196 -27.088 -44.064 1.00 33.26 ? 847 HOH A O   1 
HETATM 3991 O O   . HOH B 2 .   ? -27.594 -19.405 -48.831 1.00 28.16 ? 848 HOH A O   1 
HETATM 3992 O O   . HOH B 2 .   ? -27.622 -17.366 -18.003 1.00 50.12 ? 849 HOH A O   1 
HETATM 3993 O O   . HOH B 2 .   ? -13.534 -36.709 -50.113 1.00 40.75 ? 850 HOH A O   1 
HETATM 3994 O O   . HOH B 2 .   ? -13.066 -15.927 -58.516 1.00 44.05 ? 851 HOH A O   1 
HETATM 3995 O O   . HOH B 2 .   ? -13.413 1.111   -23.834 1.00 34.99 ? 852 HOH A O   1 
HETATM 3996 O O   . HOH B 2 .   ? -0.586  -28.443 -44.154 1.00 38.80 ? 853 HOH A O   1 
HETATM 3997 O O   . HOH B 2 .   ? -13.091 14.651  -31.578 1.00 14.68 ? 854 HOH A O   1 
HETATM 3998 O O   . HOH B 2 .   ? -18.544 15.554  -35.415 1.00 22.46 ? 855 HOH A O   1 
HETATM 3999 O O   . HOH B 2 .   ? -0.038  -12.073 -55.127 1.00 37.49 ? 856 HOH A O   1 
HETATM 4000 O O   . HOH B 2 .   ? -24.099 -13.340 -52.404 1.00 47.97 ? 857 HOH A O   1 
HETATM 4001 O O   . HOH B 2 .   ? -13.315 -32.034 -23.710 1.00 37.55 ? 858 HOH A O   1 
HETATM 4002 O O   . HOH B 2 .   ? -37.941 -14.799 -35.734 1.00 48.22 ? 859 HOH A O   1 
HETATM 4003 O O   . HOH B 2 .   ? -23.928 -14.168 -45.407 1.00 44.30 ? 860 HOH A O   1 
HETATM 4004 O O   . HOH B 2 .   ? 5.020   -4.169  -31.226 1.00 32.90 ? 861 HOH A O   1 
HETATM 4005 O O   . HOH B 2 .   ? 6.250   -2.807  -19.143 1.00 40.10 ? 862 HOH A O   1 
HETATM 4006 O O   . HOH B 2 .   ? -6.912  2.517   -39.209 1.00 19.55 ? 863 HOH A O   1 
HETATM 4007 O O   . HOH B 2 .   ? -11.694 20.632  -45.681 1.00 44.82 ? 864 HOH A O   1 
HETATM 4008 O O   . HOH B 2 .   ? -24.006 -0.059  -58.495 0.50 61.67 ? 865 HOH A O   1 
HETATM 4009 O O   . HOH B 2 .   ? -10.712 -30.018 -27.657 1.00 36.95 ? 866 HOH A O   1 
HETATM 4010 O O   . HOH B 2 .   ? 5.660   -25.209 -7.245  1.00 29.07 ? 867 HOH A O   1 
HETATM 4011 O O   . HOH B 2 .   ? -32.700 -21.095 -58.096 1.00 43.88 ? 868 HOH A O   1 
HETATM 4012 O O   . HOH B 2 .   ? -18.611 11.996  -29.494 1.00 38.22 ? 869 HOH A O   1 
HETATM 4013 O O   . HOH B 2 .   ? -4.584  -21.061 -49.272 1.00 33.87 ? 870 HOH A O   1 
HETATM 4014 O O   . HOH B 2 .   ? -33.045 -32.304 -54.096 1.00 49.34 ? 871 HOH A O   1 
HETATM 4015 O O   . HOH B 2 .   ? -15.213 -16.779 2.393   1.00 51.20 ? 872 HOH A O   1 
HETATM 4016 O O   . HOH B 2 .   ? -23.696 20.927  -36.301 1.00 45.73 ? 873 HOH A O   1 
HETATM 4017 O O   . HOH B 2 .   ? -12.873 -22.406 -12.146 1.00 39.96 ? 874 HOH A O   1 
HETATM 4018 O O   . HOH B 2 .   ? -15.814 -25.460 -64.616 1.00 37.52 ? 875 HOH A O   1 
HETATM 4019 O O   . HOH B 2 .   ? -10.309 -34.149 -47.405 1.00 47.46 ? 876 HOH A O   1 
HETATM 4020 O O   . HOH B 2 .   ? -0.000  -0.000  -26.312 0.50 31.73 ? 877 HOH A O   1 
HETATM 4021 O O   . HOH B 2 .   ? -16.903 -2.390  -21.752 1.00 39.85 ? 878 HOH A O   1 
HETATM 4022 O O   . HOH B 2 .   ? -11.534 2.776   -22.085 1.00 44.84 ? 879 HOH A O   1 
HETATM 4023 O O   . HOH B 2 .   ? -18.621 -31.717 -30.747 1.00 50.98 ? 880 HOH A O   1 
HETATM 4024 O O   . HOH B 2 .   ? 7.669   -5.444  -29.736 1.00 36.04 ? 881 HOH A O   1 
HETATM 4025 O O   . HOH B 2 .   ? 5.324   -4.145  -42.335 1.00 51.24 ? 882 HOH A O   1 
HETATM 4026 O O   . HOH B 2 .   ? 9.866   -16.326 -26.405 1.00 41.53 ? 883 HOH A O   1 
HETATM 4027 O O   . HOH B 2 .   ? -37.568 -12.407 -27.621 1.00 44.76 ? 884 HOH A O   1 
HETATM 4028 O O   . HOH B 2 .   ? -12.598 15.440  -27.206 1.00 43.60 ? 885 HOH A O   1 
HETATM 4029 O O   . HOH B 2 .   ? -9.684  -30.526 -55.313 1.00 46.38 ? 886 HOH A O   1 
HETATM 4030 O O   . HOH B 2 .   ? 0.064   -26.986 -26.343 1.00 47.11 ? 887 HOH A O   1 
HETATM 4031 O O   . HOH B 2 .   ? -21.777 -34.313 -33.401 1.00 47.48 ? 888 HOH A O   1 
HETATM 4032 O O   . HOH B 2 .   ? -10.757 5.051   -25.809 1.00 29.36 ? 889 HOH A O   1 
HETATM 4033 O O   . HOH B 2 .   ? -9.894  -1.486  -18.187 1.00 42.01 ? 890 HOH A O   1 
HETATM 4034 O O   . HOH B 2 .   ? -1.621  0.179   -51.684 1.00 40.92 ? 891 HOH A O   1 
HETATM 4035 O O   . HOH B 2 .   ? -5.332  -28.667 -26.461 1.00 38.20 ? 892 HOH A O   1 
HETATM 4036 O O   . HOH B 2 .   ? 9.623   -15.192 -15.985 1.00 39.25 ? 893 HOH A O   1 
HETATM 4037 O O   . HOH B 2 .   ? -1.368  -28.555 -27.199 1.00 46.81 ? 894 HOH A O   1 
HETATM 4038 O O   . HOH B 2 .   ? -17.075 -19.179 -0.176  1.00 46.26 ? 895 HOH A O   1 
HETATM 4039 O O   . HOH B 2 .   ? -10.101 2.713   -27.456 1.00 25.83 ? 896 HOH A O   1 
HETATM 4040 O O   . HOH B 2 .   ? 9.090   -16.898 -30.264 1.00 39.70 ? 897 HOH A O   1 
HETATM 4041 O O   . HOH B 2 .   ? -8.300  14.808  -34.237 1.00 24.74 ? 898 HOH A O   1 
HETATM 4042 O O   . HOH B 2 .   ? -8.206  -26.536 -34.186 1.00 37.68 ? 899 HOH A O   1 
HETATM 4043 O O   . HOH B 2 .   ? -4.978  -0.648  -18.980 1.00 34.22 ? 900 HOH A O   1 
HETATM 4044 O O   . HOH B 2 .   ? -21.683 0.994   -22.649 1.00 46.58 ? 901 HOH A O   1 
HETATM 4045 O O   . HOH B 2 .   ? -28.915 -17.391 -48.559 1.00 39.42 ? 902 HOH A O   1 
HETATM 4046 O O   . HOH B 2 .   ? 7.160   -22.008 -35.938 1.00 39.22 ? 903 HOH A O   1 
HETATM 4047 O O   . HOH B 2 .   ? -12.606 -33.020 -46.256 1.00 26.04 ? 904 HOH A O   1 
HETATM 4048 O O   . HOH B 2 .   ? -26.885 -37.105 -39.596 1.00 41.32 ? 905 HOH A O   1 
HETATM 4049 O O   . HOH B 2 .   ? 7.621   -19.400 -33.453 1.00 40.79 ? 906 HOH A O   1 
HETATM 4050 O O   . HOH B 2 .   ? -33.401 -28.356 -56.826 1.00 41.08 ? 907 HOH A O   1 
HETATM 4051 O O   . HOH B 2 .   ? -7.500  17.436  -32.290 1.00 39.30 ? 908 HOH A O   1 
HETATM 4052 O O   . HOH B 2 .   ? -34.331 -22.308 -50.495 1.00 44.13 ? 909 HOH A O   1 
HETATM 4053 O O   . HOH B 2 .   ? -33.346 -16.445 -48.575 1.00 44.05 ? 910 HOH A O   1 
HETATM 4054 O O   . HOH B 2 .   ? -4.003  -28.325 -30.686 1.00 45.54 ? 911 HOH A O   1 
HETATM 4055 O O   . HOH B 2 .   ? -19.923 -34.137 -27.913 1.00 46.45 ? 912 HOH A O   1 
HETATM 4056 O O   . HOH B 2 .   ? -6.249  -30.061 -29.849 1.00 40.10 ? 913 HOH A O   1 
HETATM 4057 O O   . HOH B 2 .   ? -13.284 -3.847  -9.693  1.00 46.29 ? 914 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   SER 3   2   ?   ?   ?   A . n 
A 1 4   PHE 4   3   ?   ?   ?   A . n 
A 1 5   GLN 5   4   ?   ?   ?   A . n 
A 1 6   GLY 6   5   ?   ?   ?   A . n 
A 1 7   LYS 7   6   6   LYS LYS A . n 
A 1 8   LYS 8   7   7   LYS LYS A . n 
A 1 9   SER 9   8   8   SER SER A . n 
A 1 10  ILE 10  9   9   ILE ILE A . n 
A 1 11  PRO 11  10  10  PRO PRO A . n 
A 1 12  ARG 12  11  11  ARG ARG A . n 
A 1 13  ILE 13  12  12  ILE ILE A . n 
A 1 14  THR 14  13  13  THR THR A . n 
A 1 15  SER 15  14  14  SER SER A . n 
A 1 16  ASP 16  15  15  ASP ASP A . n 
A 1 17  ARG 17  16  16  ARG ARG A . n 
A 1 18  LEU 18  17  17  LEU LEU A . n 
A 1 19  LEU 19  18  18  LEU LEU A . n 
A 1 20  ILE 20  19  19  ILE ILE A . n 
A 1 21  ARG 21  20  20  ARG ARG A . n 
A 1 22  GLY 22  21  21  GLY GLY A . n 
A 1 23  GLY 23  22  22  GLY GLY A . n 
A 1 24  ARG 24  23  23  ARG ARG A . n 
A 1 25  ILE 25  24  24  ILE ILE A . n 
A 1 26  VAL 26  25  25  VAL VAL A . n 
A 1 27  ASN 27  26  26  ASN ASN A . n 
A 1 28  ASP 28  27  27  ASP ASP A . n 
A 1 29  ASP 29  28  28  ASP ASP A . n 
A 1 30  GLN 30  29  29  GLN GLN A . n 
A 1 31  SER 31  30  30  SER SER A . n 
A 1 32  PHE 32  31  31  PHE PHE A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  ALA 34  33  33  ALA ALA A . n 
A 1 35  ASP 35  34  34  ASP ASP A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  HIS 37  36  36  HIS HIS A . n 
A 1 38  VAL 38  37  37  VAL VAL A . n 
A 1 39  GLU 39  38  38  GLU GLU A . n 
A 1 40  ASP 40  39  39  ASP ASP A . n 
A 1 41  GLY 41  40  40  GLY GLY A . n 
A 1 42  LEU 42  41  41  LEU LEU A . n 
A 1 43  ILE 43  42  42  ILE ILE A . n 
A 1 44  LYS 44  43  43  LYS LYS A . n 
A 1 45  GLN 45  44  44  GLN GLN A . n 
A 1 46  ILE 46  45  45  ILE ILE A . n 
A 1 47  GLY 47  46  46  GLY GLY A . n 
A 1 48  GLU 48  47  47  GLU GLU A . n 
A 1 49  ASN 49  48  48  ASN ASN A . n 
A 1 50  LEU 50  49  49  LEU LEU A . n 
A 1 51  ILE 51  50  50  ILE ILE A . n 
A 1 52  VAL 52  51  51  VAL VAL A . n 
A 1 53  PRO 53  52  52  PRO PRO A . n 
A 1 54  GLY 54  53  53  GLY GLY A . n 
A 1 55  GLY 55  54  54  GLY GLY A . n 
A 1 56  ILE 56  55  55  ILE ILE A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  THR 58  57  57  THR THR A . n 
A 1 59  ILE 59  58  58  ILE ILE A . n 
A 1 60  ASP 60  59  59  ASP ASP A . n 
A 1 61  ALA 61  60  60  ALA ALA A . n 
A 1 62  HIS 62  61  61  HIS HIS A . n 
A 1 63  GLY 63  62  62  GLY GLY A . n 
A 1 64  LEU 64  63  63  LEU LEU A . n 
A 1 65  MET 65  64  64  MET MET A . n 
A 1 66  VAL 66  65  65  VAL VAL A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  PRO 68  67  67  PRO PRO A . n 
A 1 69  GLY 69  68  68  GLY GLY A . n 
A 1 70  GLY 70  69  69  GLY GLY A . n 
A 1 71  VAL 71  70  70  VAL VAL A . n 
A 1 72  ASP 72  71  71  ASP ASP A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  HIS 74  73  73  HIS HIS A . n 
A 1 75  THR 75  74  74  THR THR A . n 
A 1 76  ARG 76  75  75  ARG ARG A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  GLN 78  77  77  GLN GLN A . n 
A 1 79  MET 79  78  78  MET MET A . n 
A 1 80  PRO 80  79  79  PRO PRO A . n 
A 1 81  VAL 81  80  80  VAL VAL A . n 
A 1 82  LEU 82  81  81  LEU LEU A . n 
A 1 83  GLY 83  82  82  GLY GLY A . n 
A 1 84  MET 84  83  83  MET MET A . n 
A 1 85  THR 85  84  84  THR THR A . n 
A 1 86  PRO 86  85  85  PRO PRO A . n 
A 1 87  ALA 87  86  86  ALA ALA A . n 
A 1 88  ASP 88  87  87  ASP ASP A . n 
A 1 89  ASP 89  88  88  ASP ASP A . n 
A 1 90  PHE 90  89  89  PHE PHE A . n 
A 1 91  CYS 91  90  90  CYS CYS A . n 
A 1 92  GLN 92  91  91  GLN GLN A . n 
A 1 93  GLY 93  92  92  GLY GLY A . n 
A 1 94  THR 94  93  93  THR THR A . n 
A 1 95  LYS 95  94  94  LYS LYS A . n 
A 1 96  ALA 96  95  95  ALA ALA A . n 
A 1 97  ALA 97  96  96  ALA ALA A . n 
A 1 98  LEU 98  97  97  LEU LEU A . n 
A 1 99  ALA 99  98  98  ALA ALA A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 GLY 101 100 100 GLY GLY A . n 
A 1 102 THR 102 101 101 THR THR A . n 
A 1 103 THR 103 102 102 THR THR A . n 
A 1 104 MET 104 103 103 MET MET A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 LEU 106 105 105 LEU LEU A . n 
A 1 107 ASP 107 106 106 ASP ASP A . n 
A 1 108 HIS 108 107 107 HIS HIS A . n 
A 1 109 VAL 109 108 108 VAL VAL A . n 
A 1 110 PHE 110 109 109 PHE PHE A . n 
A 1 111 PRO 111 110 110 PRO PRO A . n 
A 1 112 ASP 112 111 111 ASP ASP A . n 
A 1 113 THR 113 112 112 THR THR A . n 
A 1 114 GLY 114 113 113 GLY GLY A . n 
A 1 115 VAL 115 114 114 VAL VAL A . n 
A 1 116 SER 116 115 115 SER SER A . n 
A 1 117 LEU 117 116 116 LEU LEU A . n 
A 1 118 LEU 118 117 117 LEU LEU A . n 
A 1 119 ALA 119 118 118 ALA ALA A . n 
A 1 120 ALA 120 119 119 ALA ALA A . n 
A 1 121 TYR 121 120 120 TYR TYR A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 GLN 123 122 122 GLN GLN A . n 
A 1 124 TRP 124 123 123 TRP TRP A . n 
A 1 125 ARG 125 124 124 ARG ARG A . n 
A 1 126 GLU 126 125 125 GLU GLU A . n 
A 1 127 ARG 127 126 126 ARG ARG A . n 
A 1 128 ALA 128 127 127 ALA ALA A . n 
A 1 129 ASP 129 128 128 ASP ASP A . n 
A 1 130 SER 130 129 129 SER SER A . n 
A 1 131 ALA 131 130 130 ALA ALA A . n 
A 1 132 ALA 132 131 131 ALA ALA A . n 
A 1 133 CYS 133 132 132 CYS CYS A . n 
A 1 134 CYS 134 133 133 CYS CYS A . n 
A 1 135 ASP 135 134 134 ASP ASP A . n 
A 1 136 TYR 136 135 135 TYR TYR A . n 
A 1 137 SER 137 136 136 SER SER A . n 
A 1 138 LEU 138 137 137 LEU LEU A . n 
A 1 139 HIS 139 138 138 HIS HIS A . n 
A 1 140 VAL 140 139 139 VAL VAL A . n 
A 1 141 ASP 141 140 140 ASP ASP A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 THR 143 142 142 THR THR A . n 
A 1 144 ARG 144 143 143 ARG ARG A . n 
A 1 145 TRP 145 144 144 TRP TRP A . n 
A 1 146 HIS 146 145 145 HIS HIS A . n 
A 1 147 GLU 147 146 146 GLU GLU A . n 
A 1 148 SER 148 147 147 SER SER A . n 
A 1 149 ILE 149 148 148 ILE ILE A . n 
A 1 150 LYS 150 149 149 LYS LYS A . n 
A 1 151 GLU 151 150 150 GLU GLU A . n 
A 1 152 GLU 152 151 151 GLU GLU A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 GLU 154 153 153 GLU GLU A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 LEU 156 155 155 LEU LEU A . n 
A 1 157 VAL 157 156 156 VAL VAL A . n 
A 1 158 LYS 158 157 157 LYS LYS A . n 
A 1 159 GLU 159 158 158 GLU GLU A . n 
A 1 160 LYS 160 159 159 LYS LYS A . n 
A 1 161 GLY 161 160 160 GLY GLY A . n 
A 1 162 VAL 162 161 161 VAL VAL A . n 
A 1 163 ASN 163 162 162 ASN ASN A . n 
A 1 164 SER 164 163 163 SER SER A . n 
A 1 165 PHE 165 164 164 PHE PHE A . n 
A 1 166 LEU 166 165 165 LEU LEU A . n 
A 1 167 VAL 167 166 166 VAL VAL A . n 
A 1 168 PHE 168 167 167 PHE PHE A . n 
A 1 169 MET 169 168 168 MET MET A . n 
A 1 170 ALA 170 169 169 ALA ALA A . n 
A 1 171 TYR 171 170 170 TYR TYR A . n 
A 1 172 LYS 172 171 171 LYS LYS A . n 
A 1 173 ASP 173 172 172 ASP ASP A . n 
A 1 174 ARG 174 173 173 ARG ARG A . n 
A 1 175 CYS 175 174 174 CYS CYS A . n 
A 1 176 GLN 176 175 175 GLN GLN A . n 
A 1 177 CYS 177 176 176 CYS CYS A . n 
A 1 178 SER 178 177 177 SER SER A . n 
A 1 179 ASP 179 178 178 ASP ASP A . n 
A 1 180 SER 180 179 179 SER SER A . n 
A 1 181 GLN 181 180 180 GLN GLN A . n 
A 1 182 MET 182 181 181 MET MET A . n 
A 1 183 TYR 183 182 182 TYR TYR A . n 
A 1 184 GLU 184 183 183 GLU GLU A . n 
A 1 185 ILE 185 184 184 ILE ILE A . n 
A 1 186 PHE 186 185 185 PHE PHE A . n 
A 1 187 SER 187 186 186 SER SER A . n 
A 1 188 ILE 188 187 187 ILE ILE A . n 
A 1 189 ILE 189 188 188 ILE ILE A . n 
A 1 190 ARG 190 189 189 ARG ARG A . n 
A 1 191 ASP 191 190 190 ASP ASP A . n 
A 1 192 LEU 192 191 191 LEU LEU A . n 
A 1 193 GLY 193 192 192 GLY GLY A . n 
A 1 194 ALA 194 193 193 ALA ALA A . n 
A 1 195 LEU 195 194 194 LEU LEU A . n 
A 1 196 ALA 196 195 195 ALA ALA A . n 
A 1 197 GLN 197 196 196 GLN GLN A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 HIS 199 198 198 HIS HIS A . n 
A 1 200 ALA 200 199 199 ALA ALA A . n 
A 1 201 GLU 201 200 200 GLU GLU A . n 
A 1 202 ASN 202 201 201 ASN ASN A . n 
A 1 203 GLY 203 202 202 GLY GLY A . n 
A 1 204 ASP 204 203 203 ASP ASP A . n 
A 1 205 ILE 205 204 204 ILE ILE A . n 
A 1 206 VAL 206 205 205 VAL VAL A . n 
A 1 207 GLU 207 206 206 GLU GLU A . n 
A 1 208 GLU 208 207 207 GLU GLU A . n 
A 1 209 GLU 209 208 208 GLU GLU A . n 
A 1 210 GLN 210 209 209 GLN GLN A . n 
A 1 211 LYS 211 210 210 LYS LYS A . n 
A 1 212 ARG 212 211 211 ARG ARG A . n 
A 1 213 LEU 213 212 212 LEU LEU A . n 
A 1 214 LEU 214 213 213 LEU LEU A . n 
A 1 215 GLU 215 214 214 GLU GLU A . n 
A 1 216 LEU 216 215 215 LEU LEU A . n 
A 1 217 GLY 217 216 216 GLY GLY A . n 
A 1 218 ILE 218 217 217 ILE ILE A . n 
A 1 219 THR 219 218 218 THR THR A . n 
A 1 220 GLY 220 219 219 GLY GLY A . n 
A 1 221 PRO 221 220 220 PRO PRO A . n 
A 1 222 GLU 222 221 221 GLU GLU A . n 
A 1 223 GLY 223 222 222 GLY GLY A . n 
A 1 224 HIS 224 223 223 HIS HIS A . n 
A 1 225 VAL 225 224 224 VAL VAL A . n 
A 1 226 LEU 226 225 225 LEU LEU A . n 
A 1 227 SER 227 226 226 SER SER A . n 
A 1 228 HIS 228 227 227 HIS HIS A . n 
A 1 229 PRO 229 228 228 PRO PRO A . n 
A 1 230 GLU 230 229 229 GLU GLU A . n 
A 1 231 GLU 231 230 230 GLU GLU A . n 
A 1 232 VAL 232 231 231 VAL VAL A . n 
A 1 233 GLU 233 232 232 GLU GLU A . n 
A 1 234 ALA 234 233 233 ALA ALA A . n 
A 1 235 GLU 235 234 234 GLU GLU A . n 
A 1 236 ALA 236 235 235 ALA ALA A . n 
A 1 237 VAL 237 236 236 VAL VAL A . n 
A 1 238 TYR 238 237 237 TYR TYR A . n 
A 1 239 ARG 239 238 238 ARG ARG A . n 
A 1 240 ALA 240 239 239 ALA ALA A . n 
A 1 241 VAL 241 240 240 VAL VAL A . n 
A 1 242 THR 242 241 241 THR THR A . n 
A 1 243 ILE 243 242 242 ILE ILE A . n 
A 1 244 ALA 244 243 243 ALA ALA A . n 
A 1 245 LYS 245 244 244 LYS LYS A . n 
A 1 246 GLN 246 245 245 GLN GLN A . n 
A 1 247 ALA 247 246 246 ALA ALA A . n 
A 1 248 ASN 248 247 247 ASN ASN A . n 
A 1 249 CYS 249 248 248 CYS CYS A . n 
A 1 250 PRO 250 249 249 PRO PRO A . n 
A 1 251 LEU 251 250 250 LEU LEU A . n 
A 1 252 TYR 252 251 251 TYR TYR A . n 
A 1 253 VAL 253 252 252 VAL VAL A . n 
A 1 254 THR 254 253 253 THR THR A . n 
A 1 255 LYS 255 254 254 LYS LYS A . n 
A 1 256 VAL 256 255 255 VAL VAL A . n 
A 1 257 MET 257 256 256 MET MET A . n 
A 1 258 SER 258 257 257 SER SER A . n 
A 1 259 LYS 259 258 258 LYS LYS A . n 
A 1 260 GLY 260 259 259 GLY GLY A . n 
A 1 261 ALA 261 260 260 ALA ALA A . n 
A 1 262 ALA 262 261 261 ALA ALA A . n 
A 1 263 ASP 263 262 262 ASP ASP A . n 
A 1 264 ALA 264 263 263 ALA ALA A . n 
A 1 265 ILE 265 264 264 ILE ILE A . n 
A 1 266 ALA 266 265 265 ALA ALA A . n 
A 1 267 GLN 267 266 266 GLN GLN A . n 
A 1 268 ALA 268 267 267 ALA ALA A . n 
A 1 269 LYS 269 268 268 LYS LYS A . n 
A 1 270 ARG 270 269 269 ARG ARG A . n 
A 1 271 ARG 271 270 270 ARG ARG A . n 
A 1 272 GLY 272 271 271 GLY GLY A . n 
A 1 273 VAL 273 272 272 VAL VAL A . n 
A 1 274 VAL 274 273 273 VAL VAL A . n 
A 1 275 VAL 275 274 274 VAL VAL A . n 
A 1 276 PHE 276 275 275 PHE PHE A . n 
A 1 277 GLY 277 276 276 GLY GLY A . n 
A 1 278 GLU 278 277 277 GLU GLU A . n 
A 1 279 PRO 279 278 278 PRO PRO A . n 
A 1 280 ILE 280 279 279 ILE ILE A . n 
A 1 281 THR 281 280 280 THR THR A . n 
A 1 282 ALA 282 281 281 ALA ALA A . n 
A 1 283 SER 283 282 282 SER SER A . n 
A 1 284 LEU 284 283 283 LEU LEU A . n 
A 1 285 GLY 285 284 284 GLY GLY A . n 
A 1 286 THR 286 285 285 THR THR A . n 
A 1 287 ASP 287 286 286 ASP ASP A . n 
A 1 288 GLY 288 287 287 GLY GLY A . n 
A 1 289 SER 289 288 288 SER SER A . n 
A 1 290 HIS 290 289 289 HIS HIS A . n 
A 1 291 TYR 291 290 290 TYR TYR A . n 
A 1 292 TRP 292 291 291 TRP TRP A . n 
A 1 293 SER 293 292 292 SER SER A . n 
A 1 294 LYS 294 293 293 LYS LYS A . n 
A 1 295 ASN 295 294 294 ASN ASN A . n 
A 1 296 TRP 296 295 295 TRP TRP A . n 
A 1 297 ALA 297 296 296 ALA ALA A . n 
A 1 298 LYS 298 297 297 LYS LYS A . n 
A 1 299 ALA 299 298 298 ALA ALA A . n 
A 1 300 ALA 300 299 299 ALA ALA A . n 
A 1 301 ALA 301 300 300 ALA ALA A . n 
A 1 302 PHE 302 301 301 PHE PHE A . n 
A 1 303 VAL 303 302 302 VAL VAL A . n 
A 1 304 THR 304 303 303 THR THR A . n 
A 1 305 SER 305 304 304 SER SER A . n 
A 1 306 PRO 306 305 305 PRO PRO A . n 
A 1 307 PRO 307 306 306 PRO PRO A . n 
A 1 308 VAL 308 307 307 VAL VAL A . n 
A 1 309 ASN 309 308 308 ASN ASN A . n 
A 1 310 PRO 310 309 309 PRO PRO A . n 
A 1 311 ASP 311 310 310 ASP ASP A . n 
A 1 312 PRO 312 311 311 PRO PRO A . n 
A 1 313 THR 313 312 312 THR THR A . n 
A 1 314 THR 314 313 313 THR THR A . n 
A 1 315 ALA 315 314 314 ALA ALA A . n 
A 1 316 ASP 316 315 315 ASP ASP A . n 
A 1 317 HIS 317 316 316 HIS HIS A . n 
A 1 318 LEU 318 317 317 LEU LEU A . n 
A 1 319 THR 319 318 318 THR THR A . n 
A 1 320 CYS 320 319 319 CYS CYS A . n 
A 1 321 LEU 321 320 320 LEU LEU A . n 
A 1 322 LEU 322 321 321 LEU LEU A . n 
A 1 323 SER 323 322 322 SER SER A . n 
A 1 324 SER 324 323 323 SER SER A . n 
A 1 325 GLY 325 324 324 GLY GLY A . n 
A 1 326 ASP 326 325 325 ASP ASP A . n 
A 1 327 LEU 327 326 326 LEU LEU A . n 
A 1 328 GLN 328 327 327 GLN GLN A . n 
A 1 329 VAL 329 328 328 VAL VAL A . n 
A 1 330 THR 330 329 329 THR THR A . n 
A 1 331 GLY 331 330 330 GLY GLY A . n 
A 1 332 SER 332 331 331 SER SER A . n 
A 1 333 ALA 333 332 332 ALA ALA A . n 
A 1 334 HIS 334 333 333 HIS HIS A . n 
A 1 335 CYS 335 334 334 CYS CYS A . n 
A 1 336 THR 336 335 335 THR THR A . n 
A 1 337 PHE 337 336 336 PHE PHE A . n 
A 1 338 THR 338 337 337 THR THR A . n 
A 1 339 THR 339 338 338 THR THR A . n 
A 1 340 ALA 340 339 339 ALA ALA A . n 
A 1 341 GLN 341 340 340 GLN GLN A . n 
A 1 342 LYS 342 341 341 LYS LYS A . n 
A 1 343 ALA 343 342 342 ALA ALA A . n 
A 1 344 VAL 344 343 343 VAL VAL A . n 
A 1 345 GLY 345 344 344 GLY GLY A . n 
A 1 346 LYS 346 345 345 LYS LYS A . n 
A 1 347 ASP 347 346 346 ASP ASP A . n 
A 1 348 ASN 348 347 347 ASN ASN A . n 
A 1 349 PHE 349 348 348 PHE PHE A . n 
A 1 350 ALA 350 349 349 ALA ALA A . n 
A 1 351 LEU 351 350 350 LEU LEU A . n 
A 1 352 ILE 352 351 351 ILE ILE A . n 
A 1 353 PRO 353 352 352 PRO PRO A . n 
A 1 354 GLU 354 353 353 GLU GLU A . n 
A 1 355 GLY 355 354 354 GLY GLY A . n 
A 1 356 THR 356 355 355 THR THR A . n 
A 1 357 ASN 357 356 356 ASN ASN A . n 
A 1 358 GLY 358 357 357 GLY GLY A . n 
A 1 359 ILE 359 358 358 ILE ILE A . n 
A 1 360 GLU 360 359 359 GLU GLU A . n 
A 1 361 GLU 361 360 360 GLU GLU A . n 
A 1 362 ARG 362 361 361 ARG ARG A . n 
A 1 363 MET 363 362 362 MET MET A . n 
A 1 364 SER 364 363 363 SER SER A . n 
A 1 365 MET 365 364 364 MET MET A . n 
A 1 366 VAL 366 365 365 VAL VAL A . n 
A 1 367 TRP 367 366 366 TRP TRP A . n 
A 1 368 GLU 368 367 367 GLU GLU A . n 
A 1 369 LYS 369 368 368 LYS LYS A . n 
A 1 370 CYS 370 369 369 CYS CYS A . n 
A 1 371 VAL 371 370 370 VAL VAL A . n 
A 1 372 ALA 372 371 371 ALA ALA A . n 
A 1 373 SER 373 372 372 SER SER A . n 
A 1 374 GLY 374 373 373 GLY GLY A . n 
A 1 375 LYS 375 374 374 LYS LYS A . n 
A 1 376 MET 376 375 375 MET MET A . n 
A 1 377 ASP 377 376 376 ASP ASP A . n 
A 1 378 GLU 378 377 377 GLU GLU A . n 
A 1 379 ASN 379 378 378 ASN ASN A . n 
A 1 380 GLU 380 379 379 GLU GLU A . n 
A 1 381 PHE 381 380 380 PHE PHE A . n 
A 1 382 VAL 382 381 381 VAL VAL A . n 
A 1 383 ALA 383 382 382 ALA ALA A . n 
A 1 384 VAL 384 383 383 VAL VAL A . n 
A 1 385 THR 385 384 384 THR THR A . n 
A 1 386 SER 386 385 385 SER SER A . n 
A 1 387 THR 387 386 386 THR THR A . n 
A 1 388 ASN 388 387 387 ASN ASN A . n 
A 1 389 ALA 389 388 388 ALA ALA A . n 
A 1 390 ALA 390 389 389 ALA ALA A . n 
A 1 391 LYS 391 390 390 LYS LYS A . n 
A 1 392 ILE 392 391 391 ILE ILE A . n 
A 1 393 PHE 393 392 392 PHE PHE A . n 
A 1 394 ASN 394 393 393 ASN ASN A . n 
A 1 395 PHE 395 394 394 PHE PHE A . n 
A 1 396 TYR 396 395 395 TYR TYR A . n 
A 1 397 PRO 397 396 396 PRO PRO A . n 
A 1 398 ARG 398 397 397 ARG ARG A . n 
A 1 399 LYS 399 398 398 LYS LYS A . n 
A 1 400 GLY 400 399 399 GLY GLY A . n 
A 1 401 ARG 401 400 400 ARG ARG A . n 
A 1 402 VAL 402 401 401 VAL VAL A . n 
A 1 403 ALA 403 402 402 ALA ALA A . n 
A 1 404 VAL 404 403 403 VAL VAL A . n 
A 1 405 GLY 405 404 404 GLY GLY A . n 
A 1 406 SER 406 405 405 SER SER A . n 
A 1 407 ASP 407 406 406 ASP ASP A . n 
A 1 408 ALA 408 407 407 ALA ALA A . n 
A 1 409 ASP 409 408 408 ASP ASP A . n 
A 1 410 LEU 410 409 409 LEU LEU A . n 
A 1 411 VAL 411 410 410 VAL VAL A . n 
A 1 412 ILE 412 411 411 ILE ILE A . n 
A 1 413 TRP 413 412 412 TRP TRP A . n 
A 1 414 ASN 414 413 413 ASN ASN A . n 
A 1 415 PRO 415 414 414 PRO PRO A . n 
A 1 416 LYS 416 415 415 LYS LYS A . n 
A 1 417 ALA 417 416 416 ALA ALA A . n 
A 1 418 THR 418 417 417 THR THR A . n 
A 1 419 LYS 419 418 418 LYS LYS A . n 
A 1 420 ILE 420 419 419 ILE ILE A . n 
A 1 421 ILE 421 420 420 ILE ILE A . n 
A 1 422 SER 422 421 421 SER SER A . n 
A 1 423 ALA 423 422 422 ALA ALA A . n 
A 1 424 LYS 424 423 423 LYS LYS A . n 
A 1 425 THR 425 424 424 THR THR A . n 
A 1 426 HIS 426 425 425 HIS HIS A . n 
A 1 427 ASN 427 426 426 ASN ASN A . n 
A 1 428 LEU 428 427 427 LEU LEU A . n 
A 1 429 ASN 429 428 428 ASN ASN A . n 
A 1 430 VAL 430 429 429 VAL VAL A . n 
A 1 431 GLU 431 430 430 GLU GLU A . n 
A 1 432 TYR 432 431 431 TYR TYR A . n 
A 1 433 ASN 433 432 432 ASN ASN A . n 
A 1 434 ILE 434 433 433 ILE ILE A . n 
A 1 435 PHE 435 434 434 PHE PHE A . n 
A 1 436 GLU 436 435 435 GLU GLU A . n 
A 1 437 GLY 437 436 436 GLY GLY A . n 
A 1 438 VAL 438 437 437 VAL VAL A . n 
A 1 439 GLU 439 438 438 GLU GLU A . n 
A 1 440 CYS 440 439 439 CYS CYS A . n 
A 1 441 ARG 441 440 440 ARG ARG A . n 
A 1 442 GLY 442 441 441 GLY GLY A . n 
A 1 443 ALA 443 442 442 ALA ALA A . n 
A 1 444 PRO 444 443 443 PRO PRO A . n 
A 1 445 ALA 445 444 444 ALA ALA A . n 
A 1 446 VAL 446 445 445 VAL VAL A . n 
A 1 447 VAL 447 446 446 VAL VAL A . n 
A 1 448 ILE 448 447 447 ILE ILE A . n 
A 1 449 SER 449 448 448 SER SER A . n 
A 1 450 GLN 450 449 449 GLN GLN A . n 
A 1 451 GLY 451 450 450 GLY GLY A . n 
A 1 452 ARG 452 451 451 ARG ARG A . n 
A 1 453 VAL 453 452 452 VAL VAL A . n 
A 1 454 ALA 454 453 453 ALA ALA A . n 
A 1 455 LEU 455 454 454 LEU LEU A . n 
A 1 456 GLU 456 455 455 GLU GLU A . n 
A 1 457 ASP 457 456 456 ASP ASP A . n 
A 1 458 GLY 458 457 457 GLY GLY A . n 
A 1 459 LYS 459 458 458 LYS LYS A . n 
A 1 460 MET 460 459 459 MET MET A . n 
A 1 461 PHE 461 460 460 PHE PHE A . n 
A 1 462 VAL 462 461 461 VAL VAL A . n 
A 1 463 THR 463 462 462 THR THR A . n 
A 1 464 PRO 464 463 463 PRO PRO A . n 
A 1 465 GLY 465 464 464 GLY GLY A . n 
A 1 466 ALA 466 465 465 ALA ALA A . n 
A 1 467 GLY 467 466 466 GLY GLY A . n 
A 1 468 ARG 468 467 467 ARG ARG A . n 
A 1 469 PHE 469 468 468 PHE PHE A . n 
A 1 470 VAL 470 469 469 VAL VAL A . n 
A 1 471 PRO 471 470 470 PRO PRO A . n 
A 1 472 ARG 472 471 471 ARG ARG A . n 
A 1 473 LYS 473 472 472 LYS LYS A . n 
A 1 474 THR 474 473 473 THR THR A . n 
A 1 475 PHE 475 474 474 PHE PHE A . n 
A 1 476 PRO 476 475 475 PRO PRO A . n 
A 1 477 ASP 477 476 476 ASP ASP A . n 
A 1 478 PHE 478 477 477 PHE PHE A . n 
A 1 479 VAL 479 478 478 VAL VAL A . n 
A 1 480 TYR 480 479 479 TYR TYR A . n 
A 1 481 LYS 481 480 480 LYS LYS A . n 
A 1 482 ARG 482 481 481 ARG ARG A . n 
A 1 483 ILE 483 482 482 ILE ILE A . n 
A 1 484 LYS 484 483 483 LYS LYS A . n 
A 1 485 ALA 485 484 484 ALA ALA A . n 
A 1 486 ARG 486 485 485 ARG ARG A . n 
A 1 487 ASN 487 486 486 ASN ASN A . n 
A 1 488 ARG 488 487 487 ARG ARG A . n 
A 1 489 LEU 489 488 488 LEU LEU A . n 
A 1 490 ALA 490 489 489 ALA ALA A . n 
A 1 491 GLU 491 490 490 GLU GLU A . n 
A 1 492 ILE 492 491 491 ILE ILE A . n 
A 1 493 HIS 493 492 492 HIS HIS A . n 
A 1 494 GLY 494 493 493 GLY GLY A . n 
A 1 495 VAL 495 494 494 VAL VAL A . n 
A 1 496 PRO 496 495 495 PRO PRO A . n 
A 1 497 ARG 497 496 ?   ?   ?   A . n 
A 1 498 GLY 498 497 ?   ?   ?   A . n 
A 1 499 LEU 499 498 ?   ?   ?   A . n 
A 1 500 TYR 500 499 ?   ?   ?   A . n 
A 1 501 ASP 501 500 ?   ?   ?   A . n 
A 1 502 GLY 502 501 ?   ?   ?   A . n 
A 1 503 PRO 503 502 ?   ?   ?   A . n 
A 1 504 VAL 504 503 ?   ?   ?   A . n 
A 1 505 HIS 505 504 ?   ?   ?   A . n 
A 1 506 GLU 506 505 ?   ?   ?   A . n 
A 1 507 VAL 507 506 ?   ?   ?   A . n 
A 1 508 MET 508 507 ?   ?   ?   A . n 
A 1 509 VAL 509 508 ?   ?   ?   A . n 
A 1 510 PRO 510 509 ?   ?   ?   A . n 
A 1 511 ALA 511 510 ?   ?   ?   A . n 
A 1 512 LYS 512 511 ?   ?   ?   A . n 
A 1 513 PRO 513 512 ?   ?   ?   A . n 
A 1 514 GLY 514 513 ?   ?   ?   A . n 
A 1 515 SER 515 514 ?   ?   ?   A . n 
A 1 516 GLY 516 515 ?   ?   ?   A . n 
A 1 517 ALA 517 516 ?   ?   ?   A . n 
A 1 518 PRO 518 517 ?   ?   ?   A . n 
A 1 519 ALA 519 518 ?   ?   ?   A . n 
A 1 520 ARG 520 519 ?   ?   ?   A . n 
A 1 521 ALA 521 520 ?   ?   ?   A . n 
A 1 522 SER 522 521 ?   ?   ?   A . n 
A 1 523 CYS 523 522 ?   ?   ?   A . n 
A 1 524 PRO 524 523 ?   ?   ?   A . n 
A 1 525 GLY 525 524 ?   ?   ?   A . n 
A 1 526 LYS 526 525 ?   ?   ?   A . n 
A 1 527 ILE 527 526 ?   ?   ?   A . n 
A 1 528 SER 528 527 ?   ?   ?   A . n 
A 1 529 VAL 529 528 ?   ?   ?   A . n 
A 1 530 PRO 530 529 ?   ?   ?   A . n 
A 1 531 PRO 531 530 ?   ?   ?   A . n 
A 1 532 VAL 532 531 ?   ?   ?   A . n 
A 1 533 ARG 533 532 ?   ?   ?   A . n 
A 1 534 ASN 534 533 ?   ?   ?   A . n 
A 1 535 LEU 535 534 ?   ?   ?   A . n 
A 1 536 HIS 536 535 ?   ?   ?   A . n 
A 1 537 GLN 537 536 ?   ?   ?   A . n 
A 1 538 SER 538 537 ?   ?   ?   A . n 
A 1 539 GLY 539 538 ?   ?   ?   A . n 
A 1 540 PHE 540 539 ?   ?   ?   A . n 
A 1 541 SER 541 540 ?   ?   ?   A . n 
A 1 542 LEU 542 541 ?   ?   ?   A . n 
A 1 543 SER 543 542 ?   ?   ?   A . n 
A 1 544 GLY 544 543 ?   ?   ?   A . n 
A 1 545 SER 545 544 ?   ?   ?   A . n 
A 1 546 GLN 546 545 ?   ?   ?   A . n 
A 1 547 ALA 547 546 ?   ?   ?   A . n 
A 1 548 ASP 548 547 ?   ?   ?   A . n 
A 1 549 ASP 549 548 ?   ?   ?   A . n 
A 1 550 HIS 550 549 ?   ?   ?   A . n 
A 1 551 ILE 551 550 ?   ?   ?   A . n 
A 1 552 ALA 552 551 ?   ?   ?   A . n 
A 1 553 ARG 553 552 ?   ?   ?   A . n 
A 1 554 ARG 554 553 ?   ?   ?   A . n 
A 1 555 THR 555 554 ?   ?   ?   A . n 
A 1 556 ALA 556 555 ?   ?   ?   A . n 
A 1 557 GLN 557 556 ?   ?   ?   A . n 
A 1 558 LYS 558 557 ?   ?   ?   A . n 
A 1 559 ILE 559 558 ?   ?   ?   A . n 
A 1 560 MET 560 559 ?   ?   ?   A . n 
A 1 561 ALA 561 560 ?   ?   ?   A . n 
A 1 562 PRO 562 561 ?   ?   ?   A . n 
A 1 563 PRO 563 562 ?   ?   ?   A . n 
A 1 564 GLY 564 563 ?   ?   ?   A . n 
A 1 565 GLY 565 564 ?   ?   ?   A . n 
A 1 566 ARG 566 565 ?   ?   ?   A . n 
A 1 567 SER 567 566 ?   ?   ?   A . n 
A 1 568 ASN 568 567 ?   ?   ?   A . n 
A 1 569 ILE 569 568 ?   ?   ?   A . n 
A 1 570 THR 570 569 ?   ?   ?   A . n 
A 1 571 SER 571 570 ?   ?   ?   A . n 
A 1 572 LEU 572 571 ?   ?   ?   A . n 
A 1 573 SER 573 572 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   601 139 HOH HOH A . 
B 2 HOH 2   602 83  HOH HOH A . 
B 2 HOH 3   603 270 HOH HOH A . 
B 2 HOH 4   604 124 HOH HOH A . 
B 2 HOH 5   605 201 HOH HOH A . 
B 2 HOH 6   606 287 HOH HOH A . 
B 2 HOH 7   607 121 HOH HOH A . 
B 2 HOH 8   608 230 HOH HOH A . 
B 2 HOH 9   609 125 HOH HOH A . 
B 2 HOH 10  610 18  HOH HOH A . 
B 2 HOH 11  611 94  HOH HOH A . 
B 2 HOH 12  612 228 HOH HOH A . 
B 2 HOH 13  613 169 HOH HOH A . 
B 2 HOH 14  614 66  HOH HOH A . 
B 2 HOH 15  615 308 HOH HOH A . 
B 2 HOH 16  616 111 HOH HOH A . 
B 2 HOH 17  617 147 HOH HOH A . 
B 2 HOH 18  618 248 HOH HOH A . 
B 2 HOH 19  619 113 HOH HOH A . 
B 2 HOH 20  620 136 HOH HOH A . 
B 2 HOH 21  621 72  HOH HOH A . 
B 2 HOH 22  622 99  HOH HOH A . 
B 2 HOH 23  623 13  HOH HOH A . 
B 2 HOH 24  624 71  HOH HOH A . 
B 2 HOH 25  625 95  HOH HOH A . 
B 2 HOH 26  626 41  HOH HOH A . 
B 2 HOH 27  627 34  HOH HOH A . 
B 2 HOH 28  628 253 HOH HOH A . 
B 2 HOH 29  629 207 HOH HOH A . 
B 2 HOH 30  630 31  HOH HOH A . 
B 2 HOH 31  631 172 HOH HOH A . 
B 2 HOH 32  632 84  HOH HOH A . 
B 2 HOH 33  633 162 HOH HOH A . 
B 2 HOH 34  634 88  HOH HOH A . 
B 2 HOH 35  635 56  HOH HOH A . 
B 2 HOH 36  636 317 HOH HOH A . 
B 2 HOH 37  637 86  HOH HOH A . 
B 2 HOH 38  638 291 HOH HOH A . 
B 2 HOH 39  639 144 HOH HOH A . 
B 2 HOH 40  640 24  HOH HOH A . 
B 2 HOH 41  641 116 HOH HOH A . 
B 2 HOH 42  642 187 HOH HOH A . 
B 2 HOH 43  643 2   HOH HOH A . 
B 2 HOH 44  644 242 HOH HOH A . 
B 2 HOH 45  645 45  HOH HOH A . 
B 2 HOH 46  646 234 HOH HOH A . 
B 2 HOH 47  647 304 HOH HOH A . 
B 2 HOH 48  648 102 HOH HOH A . 
B 2 HOH 49  649 150 HOH HOH A . 
B 2 HOH 50  650 7   HOH HOH A . 
B 2 HOH 51  651 191 HOH HOH A . 
B 2 HOH 52  652 146 HOH HOH A . 
B 2 HOH 53  653 200 HOH HOH A . 
B 2 HOH 54  654 120 HOH HOH A . 
B 2 HOH 55  655 20  HOH HOH A . 
B 2 HOH 56  656 26  HOH HOH A . 
B 2 HOH 57  657 59  HOH HOH A . 
B 2 HOH 58  658 79  HOH HOH A . 
B 2 HOH 59  659 305 HOH HOH A . 
B 2 HOH 60  660 3   HOH HOH A . 
B 2 HOH 61  661 178 HOH HOH A . 
B 2 HOH 62  662 163 HOH HOH A . 
B 2 HOH 63  663 156 HOH HOH A . 
B 2 HOH 64  664 65  HOH HOH A . 
B 2 HOH 65  665 15  HOH HOH A . 
B 2 HOH 66  666 119 HOH HOH A . 
B 2 HOH 67  667 153 HOH HOH A . 
B 2 HOH 68  668 183 HOH HOH A . 
B 2 HOH 69  669 206 HOH HOH A . 
B 2 HOH 70  670 122 HOH HOH A . 
B 2 HOH 71  671 167 HOH HOH A . 
B 2 HOH 72  672 250 HOH HOH A . 
B 2 HOH 73  673 292 HOH HOH A . 
B 2 HOH 74  674 68  HOH HOH A . 
B 2 HOH 75  675 117 HOH HOH A . 
B 2 HOH 76  676 69  HOH HOH A . 
B 2 HOH 77  677 217 HOH HOH A . 
B 2 HOH 78  678 218 HOH HOH A . 
B 2 HOH 79  679 229 HOH HOH A . 
B 2 HOH 80  680 239 HOH HOH A . 
B 2 HOH 81  681 77  HOH HOH A . 
B 2 HOH 82  682 19  HOH HOH A . 
B 2 HOH 83  683 212 HOH HOH A . 
B 2 HOH 84  684 54  HOH HOH A . 
B 2 HOH 85  685 67  HOH HOH A . 
B 2 HOH 86  686 29  HOH HOH A . 
B 2 HOH 87  687 97  HOH HOH A . 
B 2 HOH 88  688 115 HOH HOH A . 
B 2 HOH 89  689 23  HOH HOH A . 
B 2 HOH 90  690 168 HOH HOH A . 
B 2 HOH 91  691 38  HOH HOH A . 
B 2 HOH 92  692 105 HOH HOH A . 
B 2 HOH 93  693 12  HOH HOH A . 
B 2 HOH 94  694 27  HOH HOH A . 
B 2 HOH 95  695 138 HOH HOH A . 
B 2 HOH 96  696 231 HOH HOH A . 
B 2 HOH 97  697 62  HOH HOH A . 
B 2 HOH 98  698 245 HOH HOH A . 
B 2 HOH 99  699 175 HOH HOH A . 
B 2 HOH 100 700 37  HOH HOH A . 
B 2 HOH 101 701 48  HOH HOH A . 
B 2 HOH 102 702 74  HOH HOH A . 
B 2 HOH 103 703 40  HOH HOH A . 
B 2 HOH 104 704 21  HOH HOH A . 
B 2 HOH 105 705 193 HOH HOH A . 
B 2 HOH 106 706 101 HOH HOH A . 
B 2 HOH 107 707 182 HOH HOH A . 
B 2 HOH 108 708 288 HOH HOH A . 
B 2 HOH 109 709 296 HOH HOH A . 
B 2 HOH 110 710 82  HOH HOH A . 
B 2 HOH 111 711 55  HOH HOH A . 
B 2 HOH 112 712 90  HOH HOH A . 
B 2 HOH 113 713 237 HOH HOH A . 
B 2 HOH 114 714 171 HOH HOH A . 
B 2 HOH 115 715 58  HOH HOH A . 
B 2 HOH 116 716 257 HOH HOH A . 
B 2 HOH 117 717 289 HOH HOH A . 
B 2 HOH 118 718 286 HOH HOH A . 
B 2 HOH 119 719 33  HOH HOH A . 
B 2 HOH 120 720 313 HOH HOH A . 
B 2 HOH 121 721 290 HOH HOH A . 
B 2 HOH 122 722 57  HOH HOH A . 
B 2 HOH 123 723 198 HOH HOH A . 
B 2 HOH 124 724 130 HOH HOH A . 
B 2 HOH 125 725 149 HOH HOH A . 
B 2 HOH 126 726 8   HOH HOH A . 
B 2 HOH 127 727 44  HOH HOH A . 
B 2 HOH 128 728 240 HOH HOH A . 
B 2 HOH 129 729 194 HOH HOH A . 
B 2 HOH 130 730 108 HOH HOH A . 
B 2 HOH 131 731 143 HOH HOH A . 
B 2 HOH 132 732 9   HOH HOH A . 
B 2 HOH 133 733 4   HOH HOH A . 
B 2 HOH 134 734 176 HOH HOH A . 
B 2 HOH 135 735 179 HOH HOH A . 
B 2 HOH 136 736 202 HOH HOH A . 
B 2 HOH 137 737 318 HOH HOH A . 
B 2 HOH 138 738 46  HOH HOH A . 
B 2 HOH 139 739 203 HOH HOH A . 
B 2 HOH 140 740 109 HOH HOH A . 
B 2 HOH 141 741 51  HOH HOH A . 
B 2 HOH 142 742 107 HOH HOH A . 
B 2 HOH 143 743 14  HOH HOH A . 
B 2 HOH 144 744 35  HOH HOH A . 
B 2 HOH 145 745 306 HOH HOH A . 
B 2 HOH 146 746 166 HOH HOH A . 
B 2 HOH 147 747 70  HOH HOH A . 
B 2 HOH 148 748 312 HOH HOH A . 
B 2 HOH 149 749 211 HOH HOH A . 
B 2 HOH 150 750 25  HOH HOH A . 
B 2 HOH 151 751 254 HOH HOH A . 
B 2 HOH 152 752 135 HOH HOH A . 
B 2 HOH 153 753 164 HOH HOH A . 
B 2 HOH 154 754 63  HOH HOH A . 
B 2 HOH 155 755 43  HOH HOH A . 
B 2 HOH 156 756 221 HOH HOH A . 
B 2 HOH 157 757 129 HOH HOH A . 
B 2 HOH 158 758 141 HOH HOH A . 
B 2 HOH 159 759 10  HOH HOH A . 
B 2 HOH 160 760 186 HOH HOH A . 
B 2 HOH 161 761 133 HOH HOH A . 
B 2 HOH 162 762 219 HOH HOH A . 
B 2 HOH 163 763 28  HOH HOH A . 
B 2 HOH 164 764 123 HOH HOH A . 
B 2 HOH 165 765 152 HOH HOH A . 
B 2 HOH 166 766 174 HOH HOH A . 
B 2 HOH 167 767 78  HOH HOH A . 
B 2 HOH 168 768 42  HOH HOH A . 
B 2 HOH 169 769 155 HOH HOH A . 
B 2 HOH 170 770 222 HOH HOH A . 
B 2 HOH 171 771 137 HOH HOH A . 
B 2 HOH 172 772 5   HOH HOH A . 
B 2 HOH 173 773 199 HOH HOH A . 
B 2 HOH 174 774 192 HOH HOH A . 
B 2 HOH 175 775 258 HOH HOH A . 
B 2 HOH 176 776 103 HOH HOH A . 
B 2 HOH 177 777 104 HOH HOH A . 
B 2 HOH 178 778 16  HOH HOH A . 
B 2 HOH 179 779 96  HOH HOH A . 
B 2 HOH 180 780 22  HOH HOH A . 
B 2 HOH 181 781 17  HOH HOH A . 
B 2 HOH 182 782 49  HOH HOH A . 
B 2 HOH 183 783 110 HOH HOH A . 
B 2 HOH 184 784 269 HOH HOH A . 
B 2 HOH 185 785 180 HOH HOH A . 
B 2 HOH 186 786 158 HOH HOH A . 
B 2 HOH 187 787 197 HOH HOH A . 
B 2 HOH 188 788 50  HOH HOH A . 
B 2 HOH 189 789 205 HOH HOH A . 
B 2 HOH 190 790 75  HOH HOH A . 
B 2 HOH 191 791 142 HOH HOH A . 
B 2 HOH 192 792 181 HOH HOH A . 
B 2 HOH 193 793 118 HOH HOH A . 
B 2 HOH 194 794 100 HOH HOH A . 
B 2 HOH 195 795 85  HOH HOH A . 
B 2 HOH 196 796 132 HOH HOH A . 
B 2 HOH 197 797 134 HOH HOH A . 
B 2 HOH 198 798 224 HOH HOH A . 
B 2 HOH 199 799 184 HOH HOH A . 
B 2 HOH 200 800 131 HOH HOH A . 
B 2 HOH 201 801 151 HOH HOH A . 
B 2 HOH 202 802 126 HOH HOH A . 
B 2 HOH 203 803 36  HOH HOH A . 
B 2 HOH 204 804 30  HOH HOH A . 
B 2 HOH 205 805 160 HOH HOH A . 
B 2 HOH 206 806 73  HOH HOH A . 
B 2 HOH 207 807 255 HOH HOH A . 
B 2 HOH 208 808 114 HOH HOH A . 
B 2 HOH 209 809 267 HOH HOH A . 
B 2 HOH 210 810 165 HOH HOH A . 
B 2 HOH 211 811 61  HOH HOH A . 
B 2 HOH 212 812 311 HOH HOH A . 
B 2 HOH 213 813 106 HOH HOH A . 
B 2 HOH 214 814 246 HOH HOH A . 
B 2 HOH 215 815 140 HOH HOH A . 
B 2 HOH 216 816 53  HOH HOH A . 
B 2 HOH 217 817 87  HOH HOH A . 
B 2 HOH 218 818 32  HOH HOH A . 
B 2 HOH 219 819 195 HOH HOH A . 
B 2 HOH 220 820 213 HOH HOH A . 
B 2 HOH 221 821 276 HOH HOH A . 
B 2 HOH 222 822 91  HOH HOH A . 
B 2 HOH 223 823 185 HOH HOH A . 
B 2 HOH 224 824 214 HOH HOH A . 
B 2 HOH 225 825 236 HOH HOH A . 
B 2 HOH 226 826 204 HOH HOH A . 
B 2 HOH 227 827 173 HOH HOH A . 
B 2 HOH 228 828 314 HOH HOH A . 
B 2 HOH 229 829 52  HOH HOH A . 
B 2 HOH 230 830 148 HOH HOH A . 
B 2 HOH 231 831 112 HOH HOH A . 
B 2 HOH 232 832 11  HOH HOH A . 
B 2 HOH 233 833 127 HOH HOH A . 
B 2 HOH 234 834 233 HOH HOH A . 
B 2 HOH 235 835 316 HOH HOH A . 
B 2 HOH 236 836 39  HOH HOH A . 
B 2 HOH 237 837 157 HOH HOH A . 
B 2 HOH 238 838 244 HOH HOH A . 
B 2 HOH 239 839 215 HOH HOH A . 
B 2 HOH 240 840 76  HOH HOH A . 
B 2 HOH 241 841 170 HOH HOH A . 
B 2 HOH 242 842 196 HOH HOH A . 
B 2 HOH 243 843 92  HOH HOH A . 
B 2 HOH 244 844 235 HOH HOH A . 
B 2 HOH 245 845 60  HOH HOH A . 
B 2 HOH 246 846 247 HOH HOH A . 
B 2 HOH 247 847 128 HOH HOH A . 
B 2 HOH 248 848 47  HOH HOH A . 
B 2 HOH 249 849 282 HOH HOH A . 
B 2 HOH 250 850 293 HOH HOH A . 
B 2 HOH 251 851 264 HOH HOH A . 
B 2 HOH 252 852 309 HOH HOH A . 
B 2 HOH 253 853 189 HOH HOH A . 
B 2 HOH 254 854 1   HOH HOH A . 
B 2 HOH 255 855 89  HOH HOH A . 
B 2 HOH 256 856 315 HOH HOH A . 
B 2 HOH 257 857 319 HOH HOH A . 
B 2 HOH 258 858 177 HOH HOH A . 
B 2 HOH 259 859 210 HOH HOH A . 
B 2 HOH 260 860 284 HOH HOH A . 
B 2 HOH 261 861 256 HOH HOH A . 
B 2 HOH 262 862 320 HOH HOH A . 
B 2 HOH 263 863 6   HOH HOH A . 
B 2 HOH 264 864 263 HOH HOH A . 
B 2 HOH 265 865 277 HOH HOH A . 
B 2 HOH 266 866 310 HOH HOH A . 
B 2 HOH 267 867 145 HOH HOH A . 
B 2 HOH 268 868 285 HOH HOH A . 
B 2 HOH 269 869 279 HOH HOH A . 
B 2 HOH 270 870 278 HOH HOH A . 
B 2 HOH 271 871 225 HOH HOH A . 
B 2 HOH 272 872 232 HOH HOH A . 
B 2 HOH 273 873 295 HOH HOH A . 
B 2 HOH 274 874 159 HOH HOH A . 
B 2 HOH 275 875 280 HOH HOH A . 
B 2 HOH 276 876 216 HOH HOH A . 
B 2 HOH 277 877 98  HOH HOH A . 
B 2 HOH 278 878 161 HOH HOH A . 
B 2 HOH 279 879 300 HOH HOH A . 
B 2 HOH 280 880 283 HOH HOH A . 
B 2 HOH 281 881 307 HOH HOH A . 
B 2 HOH 282 882 243 HOH HOH A . 
B 2 HOH 283 883 294 HOH HOH A . 
B 2 HOH 284 884 188 HOH HOH A . 
B 2 HOH 285 885 154 HOH HOH A . 
B 2 HOH 286 886 268 HOH HOH A . 
B 2 HOH 287 887 297 HOH HOH A . 
B 2 HOH 288 888 272 HOH HOH A . 
B 2 HOH 289 889 93  HOH HOH A . 
B 2 HOH 290 890 281 HOH HOH A . 
B 2 HOH 291 891 301 HOH HOH A . 
B 2 HOH 292 892 275 HOH HOH A . 
B 2 HOH 293 893 190 HOH HOH A . 
B 2 HOH 294 894 302 HOH HOH A . 
B 2 HOH 295 895 223 HOH HOH A . 
B 2 HOH 296 896 64  HOH HOH A . 
B 2 HOH 297 897 261 HOH HOH A . 
B 2 HOH 298 898 80  HOH HOH A . 
B 2 HOH 299 899 303 HOH HOH A . 
B 2 HOH 300 900 271 HOH HOH A . 
B 2 HOH 301 901 238 HOH HOH A . 
B 2 HOH 302 902 251 HOH HOH A . 
B 2 HOH 303 903 259 HOH HOH A . 
B 2 HOH 304 904 81  HOH HOH A . 
B 2 HOH 305 905 298 HOH HOH A . 
B 2 HOH 306 906 265 HOH HOH A . 
B 2 HOH 307 907 220 HOH HOH A . 
B 2 HOH 308 908 274 HOH HOH A . 
B 2 HOH 309 909 262 HOH HOH A . 
B 2 HOH 310 910 266 HOH HOH A . 
B 2 HOH 311 911 227 HOH HOH A . 
B 2 HOH 312 912 260 HOH HOH A . 
B 2 HOH 313 913 226 HOH HOH A . 
B 2 HOH 314 914 273 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B 
1 2 A,B 
1 3 A,B 
1 4 A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000    
2 'crystal symmetry operation' 2_555 -x,-y,z   -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000    
3 'crystal symmetry operation' 3_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -116.9900000000 
4 'crystal symmetry operation' 4_554 x,-y,-z-1 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -116.9900000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 865 ? B HOH . 
2 1 A HOH 877 ? B HOH . 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0103 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     269 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    NH2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ARG 
_pdbx_validate_symm_contact.auth_seq_id_2     269 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              1.93 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             234 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             234 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.319 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.067 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 34  ? ? CG A ASP 34  ? ? OD1 A ASP 34  ? ? 123.87 118.30 5.57   0.90 N 
2 1 NE A ARG 189 ? ? CZ A ARG 189 ? ? NH1 A ARG 189 ? ? 123.35 120.30 3.05   0.50 N 
3 1 CG A ARG 269 ? ? CD A ARG 269 ? ? NE  A ARG 269 ? ? 95.37  111.80 -16.43 2.10 N 
4 1 NE A ARG 269 ? ? CZ A ARG 269 ? ? NH1 A ARG 269 ? ? 123.36 120.30 3.06   0.50 N 
5 1 NE A ARG 361 ? ? CZ A ARG 361 ? ? NH1 A ARG 361 ? ? 123.31 120.30 3.01   0.50 N 
6 1 NE A ARG 400 ? ? CZ A ARG 400 ? ? NH2 A ARG 400 ? ? 116.97 120.30 -3.33  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 173 ? ? -142.88 -68.16 
2 1 CYS A 334 ? ? -162.31 88.59  
3 1 ASN A 347 ? ? -162.72 106.41 
4 1 SER A 385 ? ? -146.54 -48.44 
5 1 ASN A 393 ? ? 78.70   45.43  
6 1 ASN A 426 ? ? -99.97  41.91  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 913 ? 6.09 . 
2 1 O ? A HOH 914 ? 6.67 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 7   ? CD  ? A LYS 8   CD  
2  1 Y 1 A LYS 7   ? CE  ? A LYS 8   CE  
3  1 Y 1 A LYS 7   ? NZ  ? A LYS 8   NZ  
4  1 Y 1 A ILE 12  ? CG1 ? A ILE 13  CG1 
5  1 Y 1 A ILE 12  ? CG2 ? A ILE 13  CG2 
6  1 Y 1 A ILE 12  ? CD1 ? A ILE 13  CD1 
7  1 Y 1 A ARG 16  ? CZ  ? A ARG 17  CZ  
8  1 Y 1 A ARG 16  ? NH1 ? A ARG 17  NH1 
9  1 Y 1 A ARG 16  ? NH2 ? A ARG 17  NH2 
10 1 Y 1 A LYS 43  ? CE  ? A LYS 44  CE  
11 1 Y 1 A LYS 43  ? NZ  ? A LYS 44  NZ  
12 1 Y 1 A GLU 47  ? CG  ? A GLU 48  CG  
13 1 Y 1 A GLU 47  ? CD  ? A GLU 48  CD  
14 1 Y 1 A GLU 47  ? OE1 ? A GLU 48  OE1 
15 1 Y 1 A GLU 47  ? OE2 ? A GLU 48  OE2 
16 1 Y 1 A ARG 143 ? CG  ? A ARG 144 CG  
17 1 Y 1 A ARG 143 ? CD  ? A ARG 144 CD  
18 1 Y 1 A ARG 143 ? NE  ? A ARG 144 NE  
19 1 Y 1 A ARG 143 ? CZ  ? A ARG 144 CZ  
20 1 Y 1 A ARG 143 ? NH1 ? A ARG 144 NH1 
21 1 Y 1 A ARG 143 ? NH2 ? A ARG 144 NH2 
22 1 Y 1 A GLU 146 ? CG  ? A GLU 147 CG  
23 1 Y 1 A GLU 146 ? CD  ? A GLU 147 CD  
24 1 Y 1 A GLU 146 ? OE1 ? A GLU 147 OE1 
25 1 Y 1 A GLU 146 ? OE2 ? A GLU 147 OE2 
26 1 Y 1 A ASP 172 ? CG  ? A ASP 173 CG  
27 1 Y 1 A ASP 172 ? OD1 ? A ASP 173 OD1 
28 1 Y 1 A ASP 172 ? OD2 ? A ASP 173 OD2 
29 1 Y 1 A ARG 211 ? NE  ? A ARG 212 NE  
30 1 Y 1 A ARG 211 ? CZ  ? A ARG 212 CZ  
31 1 Y 1 A ARG 211 ? NH1 ? A ARG 212 NH1 
32 1 Y 1 A ARG 211 ? NH2 ? A ARG 212 NH2 
33 1 Y 1 A LYS 244 ? CE  ? A LYS 245 CE  
34 1 Y 1 A LYS 244 ? NZ  ? A LYS 245 NZ  
35 1 Y 1 A LYS 293 ? CG  ? A LYS 294 CG  
36 1 Y 1 A LYS 293 ? CD  ? A LYS 294 CD  
37 1 Y 1 A LYS 293 ? CE  ? A LYS 294 CE  
38 1 Y 1 A LYS 293 ? NZ  ? A LYS 294 NZ  
39 1 Y 1 A LYS 345 ? CD  ? A LYS 346 CD  
40 1 Y 1 A LYS 345 ? CE  ? A LYS 346 CE  
41 1 Y 1 A LYS 345 ? NZ  ? A LYS 346 NZ  
42 1 Y 1 A LYS 418 ? CG  ? A LYS 419 CG  
43 1 Y 1 A LYS 418 ? CD  ? A LYS 419 CD  
44 1 Y 1 A LYS 418 ? CE  ? A LYS 419 CE  
45 1 Y 1 A LYS 418 ? NZ  ? A LYS 419 NZ  
46 1 Y 1 A LYS 458 ? CG  ? A LYS 459 CG  
47 1 Y 1 A LYS 458 ? CD  ? A LYS 459 CD  
48 1 Y 1 A LYS 458 ? CE  ? A LYS 459 CE  
49 1 Y 1 A LYS 458 ? NZ  ? A LYS 459 NZ  
50 1 Y 1 A LYS 472 ? CG  ? A LYS 473 CG  
51 1 Y 1 A LYS 472 ? CD  ? A LYS 473 CD  
52 1 Y 1 A LYS 472 ? CE  ? A LYS 473 CE  
53 1 Y 1 A LYS 472 ? NZ  ? A LYS 473 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1   
2  1 Y 1 A MET 1   ? A MET 2   
3  1 Y 1 A SER 2   ? A SER 3   
4  1 Y 1 A PHE 3   ? A PHE 4   
5  1 Y 1 A GLN 4   ? A GLN 5   
6  1 Y 1 A GLY 5   ? A GLY 6   
7  1 Y 1 A ARG 496 ? A ARG 497 
8  1 Y 1 A GLY 497 ? A GLY 498 
9  1 Y 1 A LEU 498 ? A LEU 499 
10 1 Y 1 A TYR 499 ? A TYR 500 
11 1 Y 1 A ASP 500 ? A ASP 501 
12 1 Y 1 A GLY 501 ? A GLY 502 
13 1 Y 1 A PRO 502 ? A PRO 503 
14 1 Y 1 A VAL 503 ? A VAL 504 
15 1 Y 1 A HIS 504 ? A HIS 505 
16 1 Y 1 A GLU 505 ? A GLU 506 
17 1 Y 1 A VAL 506 ? A VAL 507 
18 1 Y 1 A MET 507 ? A MET 508 
19 1 Y 1 A VAL 508 ? A VAL 509 
20 1 Y 1 A PRO 509 ? A PRO 510 
21 1 Y 1 A ALA 510 ? A ALA 511 
22 1 Y 1 A LYS 511 ? A LYS 512 
23 1 Y 1 A PRO 512 ? A PRO 513 
24 1 Y 1 A GLY 513 ? A GLY 514 
25 1 Y 1 A SER 514 ? A SER 515 
26 1 Y 1 A GLY 515 ? A GLY 516 
27 1 Y 1 A ALA 516 ? A ALA 517 
28 1 Y 1 A PRO 517 ? A PRO 518 
29 1 Y 1 A ALA 518 ? A ALA 519 
30 1 Y 1 A ARG 519 ? A ARG 520 
31 1 Y 1 A ALA 520 ? A ALA 521 
32 1 Y 1 A SER 521 ? A SER 522 
33 1 Y 1 A CYS 522 ? A CYS 523 
34 1 Y 1 A PRO 523 ? A PRO 524 
35 1 Y 1 A GLY 524 ? A GLY 525 
36 1 Y 1 A LYS 525 ? A LYS 526 
37 1 Y 1 A ILE 526 ? A ILE 527 
38 1 Y 1 A SER 527 ? A SER 528 
39 1 Y 1 A VAL 528 ? A VAL 529 
40 1 Y 1 A PRO 529 ? A PRO 530 
41 1 Y 1 A PRO 530 ? A PRO 531 
42 1 Y 1 A VAL 531 ? A VAL 532 
43 1 Y 1 A ARG 532 ? A ARG 533 
44 1 Y 1 A ASN 533 ? A ASN 534 
45 1 Y 1 A LEU 534 ? A LEU 535 
46 1 Y 1 A HIS 535 ? A HIS 536 
47 1 Y 1 A GLN 536 ? A GLN 537 
48 1 Y 1 A SER 537 ? A SER 538 
49 1 Y 1 A GLY 538 ? A GLY 539 
50 1 Y 1 A PHE 539 ? A PHE 540 
51 1 Y 1 A SER 540 ? A SER 541 
52 1 Y 1 A LEU 541 ? A LEU 542 
53 1 Y 1 A SER 542 ? A SER 543 
54 1 Y 1 A GLY 543 ? A GLY 544 
55 1 Y 1 A SER 544 ? A SER 545 
56 1 Y 1 A GLN 545 ? A GLN 546 
57 1 Y 1 A ALA 546 ? A ALA 547 
58 1 Y 1 A ASP 547 ? A ASP 548 
59 1 Y 1 A ASP 548 ? A ASP 549 
60 1 Y 1 A HIS 549 ? A HIS 550 
61 1 Y 1 A ILE 550 ? A ILE 551 
62 1 Y 1 A ALA 551 ? A ALA 552 
63 1 Y 1 A ARG 552 ? A ARG 553 
64 1 Y 1 A ARG 553 ? A ARG 554 
65 1 Y 1 A THR 554 ? A THR 555 
66 1 Y 1 A ALA 555 ? A ALA 556 
67 1 Y 1 A GLN 556 ? A GLN 557 
68 1 Y 1 A LYS 557 ? A LYS 558 
69 1 Y 1 A ILE 558 ? A ILE 559 
70 1 Y 1 A MET 559 ? A MET 560 
71 1 Y 1 A ALA 560 ? A ALA 561 
72 1 Y 1 A PRO 561 ? A PRO 562 
73 1 Y 1 A PRO 562 ? A PRO 563 
74 1 Y 1 A GLY 563 ? A GLY 564 
75 1 Y 1 A GLY 564 ? A GLY 565 
76 1 Y 1 A ARG 565 ? A ARG 566 
77 1 Y 1 A SER 566 ? A SER 567 
78 1 Y 1 A ASN 567 ? A ASN 568 
79 1 Y 1 A ILE 568 ? A ILE 569 
80 1 Y 1 A THR 569 ? A THR 570 
81 1 Y 1 A SER 570 ? A SER 571 
82 1 Y 1 A LEU 571 ? A LEU 572 
83 1 Y 1 A SER 572 ? A SER 573 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   homology 
_pdbx_struct_assembly_auth_evidence.details                ? 
#