data_5NO6
# 
_entry.id   5NO6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NO6         
WWPDB D_1200004435 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NO6 
_pdbx_database_status.recvd_initial_deposition_date   2017-04-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Morgunova, E.' 1 ? 
'Jolma, A.'     2 ? 
'Yin, Y.'       3 ? 
'Popov, A.'     4 ? 
'Taipale, J.'   5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'TEAD4-HOXB13 complex bound to DNA' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Morgunova, E.' 1 
primary 'Jolma, A.'     2 
primary 'Yin, Y.'       3 
primary 'Popov, A.'     4 
primary 'Taipale, J.'   5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   93.81 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NO6 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     82.659 
_cell.length_a_esd                 ? 
_cell.length_b                     56.674 
_cell.length_b_esd                 ? 
_cell.length_c                     144.993 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NO6 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Homeobox protein Hox-B13'              7510.880 2  ? ? ? ? 
2 polymer syn DNA                                     5471.562 2  ? ? ? ? 
3 polymer syn DNA                                     5556.656 2  ? ? ? ? 
4 polymer man 'Transcriptional enhancer factor TEF-3' 8517.875 2  ? ? ? ? 
5 water   nat water                                   18.015   16 ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        'TEA domain family member 4,TEAD-4,Transcription factor 13-like 1,Transcription factor RTEF-1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV             
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV            A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DT)(DT)(DA)(DT)(DT)(DG)(DC)(DA)(DT)(DT)(DC)(DC)(DA)(DG)(DT)' ATTTTATTGCATTCCAGT C,D 
? 
3 polydeoxyribonucleotide no no '(DA)(DC)(DT)(DG)(DG)(DA)(DA)(DT)(DG)(DC)(DA)(DA)(DT)(DA)(DA)(DA)(DA)(DT)' ACTGGAATGCAATAAAAT F,E 
? 
4 'polypeptide(L)'        no no EGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKARE  
EGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKARE I,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  LYS n 
1 3  LYS n 
1 4  ARG n 
1 5  ILE n 
1 6  PRO n 
1 7  TYR n 
1 8  SER n 
1 9  LYS n 
1 10 GLY n 
1 11 GLN n 
1 12 LEU n 
1 13 ARG n 
1 14 GLU n 
1 15 LEU n 
1 16 GLU n 
1 17 ARG n 
1 18 GLU n 
1 19 TYR n 
1 20 ALA n 
1 21 ALA n 
1 22 ASN n 
1 23 LYS n 
1 24 PHE n 
1 25 ILE n 
1 26 THR n 
1 27 LYS n 
1 28 ASP n 
1 29 LYS n 
1 30 ARG n 
1 31 ARG n 
1 32 LYS n 
1 33 ILE n 
1 34 SER n 
1 35 ALA n 
1 36 ALA n 
1 37 THR n 
1 38 SER n 
1 39 LEU n 
1 40 SER n 
1 41 GLU n 
1 42 ARG n 
1 43 GLN n 
1 44 ILE n 
1 45 THR n 
1 46 ILE n 
1 47 TRP n 
1 48 PHE n 
1 49 GLN n 
1 50 ASN n 
1 51 ARG n 
1 52 ARG n 
1 53 VAL n 
1 54 LYS n 
1 55 GLU n 
1 56 LYS n 
1 57 LYS n 
1 58 VAL n 
1 59 LEU n 
1 60 ALA n 
1 61 LYS n 
1 62 VAL n 
2 1  DA  n 
2 2  DT  n 
2 3  DT  n 
2 4  DT  n 
2 5  DT  n 
2 6  DA  n 
2 7  DT  n 
2 8  DT  n 
2 9  DG  n 
2 10 DC  n 
2 11 DA  n 
2 12 DT  n 
2 13 DT  n 
2 14 DC  n 
2 15 DC  n 
2 16 DA  n 
2 17 DG  n 
2 18 DT  n 
3 1  DA  n 
3 2  DC  n 
3 3  DT  n 
3 4  DG  n 
3 5  DG  n 
3 6  DA  n 
3 7  DA  n 
3 8  DT  n 
3 9  DG  n 
3 10 DC  n 
3 11 DA  n 
3 12 DA  n 
3 13 DT  n 
3 14 DA  n 
3 15 DA  n 
3 16 DA  n 
3 17 DA  n 
3 18 DT  n 
4 1  GLU n 
4 2  GLY n 
4 3  VAL n 
4 4  TRP n 
4 5  SER n 
4 6  PRO n 
4 7  ASP n 
4 8  ILE n 
4 9  GLU n 
4 10 GLN n 
4 11 SER n 
4 12 PHE n 
4 13 GLN n 
4 14 GLU n 
4 15 ALA n 
4 16 LEU n 
4 17 ALA n 
4 18 ILE n 
4 19 TYR n 
4 20 PRO n 
4 21 PRO n 
4 22 CYS n 
4 23 GLY n 
4 24 ARG n 
4 25 ARG n 
4 26 LYS n 
4 27 ILE n 
4 28 ILE n 
4 29 LEU n 
4 30 SER n 
4 31 ASP n 
4 32 GLU n 
4 33 GLY n 
4 34 LYS n 
4 35 MET n 
4 36 TYR n 
4 37 GLY n 
4 38 ARG n 
4 39 ASN n 
4 40 GLU n 
4 41 LEU n 
4 42 ILE n 
4 43 ALA n 
4 44 ARG n 
4 45 TYR n 
4 46 ILE n 
4 47 LYS n 
4 48 LEU n 
4 49 ARG n 
4 50 THR n 
4 51 GLY n 
4 52 LYS n 
4 53 THR n 
4 54 ARG n 
4 55 THR n 
4 56 ARG n 
4 57 LYS n 
4 58 GLN n 
4 59 VAL n 
4 60 SER n 
4 61 SER n 
4 62 HIS n 
4 63 ILE n 
4 64 GLN n 
4 65 VAL n 
4 66 LEU n 
4 67 ALA n 
4 68 ARG n 
4 69 ARG n 
4 70 LYS n 
4 71 ALA n 
4 72 ARG n 
4 73 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 62 Human ? HOXB13                        ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? Rosetta ? ? ? ? ? ? plasmid ? ? ? pETG20A ? ? 
4 1 sample 'Biological sequence' 1 73 Human ? 'TEAD4, RTEF1, TCF13L1, TEF3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? Rosetta ? ? ? ? ? ? plasmid ? ? ? pETG20A ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 18 'Homo sapiens' Human 9606 ? 
3 1 sample 1 18 'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP HXB13_HUMAN Q92826 ? 1 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV            217 
2 PDB 5NO6        5NO6   ? 2 ?                                                                         1   
3 PDB 5NO6        5NO6   ? 3 ?                                                                         1   
4 UNP TEAD4_HUMAN Q15561 ? 4 EGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKARE 40  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5NO6 A 1 ? 62 ? Q92826 217 ? 278 ? 217 278 
2 2 5NO6 C 1 ? 18 ? 5NO6   20  ? 37  ? 20  37  
3 3 5NO6 F 1 ? 18 ? 5NO6   1   ? 18  ? 1   18  
4 1 5NO6 B 1 ? 62 ? Q92826 217 ? 278 ? 217 278 
5 2 5NO6 D 1 ? 18 ? 5NO6   20  ? 37  ? 20  37  
6 3 5NO6 E 1 ? 18 ? 5NO6   1   ? 18  ? 1   18  
7 4 5NO6 I 1 ? 73 ? Q15561 40  ? 112 ? 40  112 
8 4 5NO6 N 1 ? 73 ? Q15561 40  ? 112 ? 40  112 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NO6 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.13 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.72 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.24 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG (4000), Ammonium sulphate, PME(550, MOPs' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-04-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97242 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97242 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5NO6 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.880 
_reflns.d_resolution_low                 46.710 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       14626 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.400 
_reflns.pdbx_Rmerge_I_obs                0.039 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.049 
_reflns.pdbx_Rpim_I_all                  0.029 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1.000 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.880 3.060  ? ? ? ? ? ? ? 94.800 ? ? ? ? 1.845 ? ? ? ? ? ? ? ? 2.400 ? ? ? ? 2.288 1.331 ? 1 1 0.257 ? 
8.650 46.710 ? ? ? ? ? ? ? 88.400 ? ? ? ? 0.012 ? ? ? ? ? ? ? ? 2.300 ? ? ? ? 0.015 0.009 ? 2 1 1.000 ? 
# 
_refine.aniso_B[1][1]                            2.99 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            3.45 
_refine.aniso_B[2][2]                            1.42 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -4.82 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               125.688 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.943 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5NO6 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.88 
_refine.ls_d_res_low                             45.00 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     13860 
_refine.ls_number_reflns_R_free                  765 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.04 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.24371 
_refine.ls_R_factor_R_free                       0.31677 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.23955 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5EEA 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.490 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             32.537 
_refine.overall_SU_ML                            0.569 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        2230 
_refine_hist.pdbx_number_atoms_nucleic_acid   1476 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             16 
_refine_hist.number_atoms_total               3722 
_refine_hist.d_res_high                       2.88 
_refine_hist.d_res_low                        45.00 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.016  3984  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  3170  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.459  1.612  5547  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.307  3.000  7334  ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 29.575 6.764  409   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.051 21.100 100   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 22.732 15.000 458   ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 14.822 15.000 35    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.258  0.232  601   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.009  0.020  3289  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  877   ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 8.836  13.573 1064  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 8.821  13.573 1063  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 14.274 20.315 1323  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 14.268 20.315 1324  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 7.536  12.034 2920  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 7.532  12.033 2918  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 11.776 17.929 4224  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 16.968 ?      12357 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 16.968 ?      12358 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.883 
_refine_ls_shell.d_res_low                        2.958 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             53 
_refine_ls_shell.number_reflns_R_work             1016 
_refine_ls_shell.percent_reflns_obs               92.63 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.383 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.421 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5NO6 
_struct.title                        'TEAD4-HOXB13 complex bound to DNA' 
_struct.pdbx_descriptor              'Homeobox protein Hox-B13, Transcriptional enhancer factor TEF-3/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NO6 
_struct_keywords.text            'Transcription factor, DNA binding, transcription' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 8  ? ASN A 22 ? SER A 224 ASN A 238 1 ? 15 
HELX_P HELX_P2  AA2 THR A 26 ? SER A 38 ? THR A 242 SER A 254 1 ? 13 
HELX_P HELX_P3  AA3 SER A 40 ? VAL A 58 ? SER A 256 VAL A 274 1 ? 19 
HELX_P HELX_P4  AA4 SER D 8  ? ASN D 22 ? SER B 224 ASN B 238 1 ? 15 
HELX_P HELX_P5  AA5 THR D 26 ? SER D 38 ? THR B 242 SER B 254 1 ? 13 
HELX_P HELX_P6  AA6 SER D 40 ? LEU D 59 ? SER B 256 LEU B 275 1 ? 20 
HELX_P HELX_P7  AA7 SER G 5  ? TYR G 19 ? SER I 44  TYR I 58  1 ? 15 
HELX_P HELX_P8  AA8 GLY G 37 ? GLY G 51 ? GLY I 76  GLY I 90  1 ? 15 
HELX_P HELX_P9  AA9 THR G 55 ? ALA G 71 ? THR I 94  ALA I 110 1 ? 17 
HELX_P HELX_P10 AB1 SER H 5  ? ILE H 18 ? SER N 44  ILE N 57  1 ? 14 
HELX_P HELX_P11 AB2 GLY H 37 ? GLY H 51 ? GLY N 76  GLY N 90  1 ? 15 
HELX_P HELX_P12 AB3 THR H 55 ? ARG H 72 ? THR N 94  ARG N 111 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DA 1  N1 ? ? ? 1_555 C DT 18 N3 ? ? C DA 20 F DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DA 1  N6 ? ? ? 1_555 C DT 18 O4 ? ? C DA 20 F DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DT 2  N3 ? ? ? 1_555 C DA 17 N1 ? ? C DT 21 F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DT 2  O4 ? ? ? 1_555 C DA 17 N6 ? ? C DT 21 F DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DT 3  N3 ? ? ? 1_555 C DA 16 N1 ? ? C DT 22 F DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DT 3  O4 ? ? ? 1_555 C DA 16 N6 ? ? C DT 22 F DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DT 4  N3 ? ? ? 1_555 C DA 15 N1 ? ? C DT 23 F DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DT 4  O4 ? ? ? 1_555 C DA 15 N6 ? ? C DT 23 F DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA 14 N1 ? ? C DT 24 F DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA 14 N6 ? ? C DT 24 F DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 13 N3 ? ? C DA 25 F DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 13 O4 ? ? C DA 25 F DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DT 7  N3 ? ? ? 1_555 C DA 12 N1 ? ? C DT 26 F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DT 7  O4 ? ? ? 1_555 C DA 12 N6 ? ? C DT 26 F DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DT 8  N3 ? ? ? 1_555 C DA 11 N1 ? ? C DT 27 F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DT 8  O4 ? ? ? 1_555 C DA 11 N6 ? ? C DT 27 F DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DG 9  N1 ? ? ? 1_555 C DC 10 N3 ? ? C DG 28 F DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DG 9  N2 ? ? ? 1_555 C DC 10 O2 ? ? C DG 28 F DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DG 9  O6 ? ? ? 1_555 C DC 10 N4 ? ? C DG 28 F DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DC 10 N3 ? ? ? 1_555 C DG 9  N1 ? ? C DC 29 F DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DC 10 N4 ? ? ? 1_555 C DG 9  O6 ? ? C DC 29 F DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DC 10 O2 ? ? ? 1_555 C DG 9  N2 ? ? C DC 29 F DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DA 11 N1 ? ? ? 1_555 C DT 8  N3 ? ? C DA 30 F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? B DA 11 N6 ? ? ? 1_555 C DT 8  O4 ? ? C DA 30 F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA 7  N1 ? ? C DT 31 F DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA 7  N6 ? ? C DT 31 F DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? B DT 13 N3 ? ? ? 1_555 C DA 6  N1 ? ? C DT 32 F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? B DT 13 O4 ? ? ? 1_555 C DA 6  N6 ? ? C DT 32 F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? B DC 14 N3 ? ? ? 1_555 C DG 5  N1 ? ? C DC 33 F DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? B DC 14 N4 ? ? ? 1_555 C DG 5  O6 ? ? C DC 33 F DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? B DC 14 O2 ? ? ? 1_555 C DG 5  N2 ? ? C DC 33 F DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? B DC 15 N4 ? ? ? 1_555 C DG 4  O6 ? ? C DC 34 F DG 4  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog33 hydrog ? ? B DA 16 N1 ? ? ? 1_555 C DT 3  N3 ? ? C DA 35 F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? B DA 16 N6 ? ? ? 1_555 C DT 3  O4 ? ? C DA 35 F DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? B DG 17 N1 ? ? ? 1_555 C DC 2  N3 ? ? C DG 36 F DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? B DG 17 N2 ? ? ? 1_555 C DC 2  O2 ? ? C DG 36 F DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? B DG 17 O6 ? ? ? 1_555 C DC 2  N4 ? ? C DG 36 F DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? B DT 18 N3 ? ? ? 1_555 C DA 1  N1 ? ? C DT 37 F DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? B DT 18 O4 ? ? ? 1_555 C DA 1  N6 ? ? C DT 37 F DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? E DA 1  N1 ? ? ? 1_555 F DT 18 N3 ? ? D DA 20 E DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? E DA 1  N6 ? ? ? 1_555 F DT 18 O4 ? ? D DA 20 E DT 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? E DT 2  N3 ? ? ? 1_555 F DA 17 N1 ? ? D DT 21 E DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? E DT 2  O4 ? ? ? 1_555 F DA 17 N6 ? ? D DT 21 E DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? E DT 3  N3 ? ? ? 1_555 F DA 16 N1 ? ? D DT 22 E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? E DT 3  O4 ? ? ? 1_555 F DA 16 N6 ? ? D DT 22 E DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? E DT 4  N3 ? ? ? 1_555 F DA 15 N1 ? ? D DT 23 E DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? E DT 4  O4 ? ? ? 1_555 F DA 15 N6 ? ? D DT 23 E DA 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA 14 N1 ? ? D DT 24 E DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA 14 N6 ? ? D DT 24 E DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? E DA 6  N1 ? ? ? 1_555 F DT 13 N3 ? ? D DA 25 E DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? E DA 6  N6 ? ? ? 1_555 F DT 13 O4 ? ? D DA 25 E DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? E DT 7  N3 ? ? ? 1_555 F DA 12 N1 ? ? D DT 26 E DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? E DT 7  O4 ? ? ? 1_555 F DA 12 N6 ? ? D DT 26 E DA 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? E DT 8  N3 ? ? ? 1_555 F DA 11 N1 ? ? D DT 27 E DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? E DT 8  O4 ? ? ? 1_555 F DA 11 N6 ? ? D DT 27 E DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? E DG 9  N1 ? ? ? 1_555 F DC 10 N3 ? ? D DG 28 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? E DG 9  N2 ? ? ? 1_555 F DC 10 O2 ? ? D DG 28 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? E DG 9  O6 ? ? ? 1_555 F DC 10 N4 ? ? D DG 28 E DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? E DC 10 N3 ? ? ? 1_555 F DG 9  N1 ? ? D DC 29 E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? E DC 10 N4 ? ? ? 1_555 F DG 9  O6 ? ? D DC 29 E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? E DC 10 O2 ? ? ? 1_555 F DG 9  N2 ? ? D DC 29 E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? E DA 11 N1 ? ? ? 1_555 F DT 8  N3 ? ? D DA 30 E DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? E DA 11 N6 ? ? ? 1_555 F DT 8  O4 ? ? D DA 30 E DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? E DT 12 N3 ? ? ? 1_555 F DA 7  N1 ? ? D DT 31 E DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? E DT 12 O4 ? ? ? 1_555 F DA 7  N6 ? ? D DT 31 E DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? E DT 13 N3 ? ? ? 1_555 F DA 6  N1 ? ? D DT 32 E DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67 hydrog ? ? E DT 13 O4 ? ? ? 1_555 F DA 6  N6 ? ? D DT 32 E DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68 hydrog ? ? E DC 14 N3 ? ? ? 1_555 F DG 5  N1 ? ? D DC 33 E DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69 hydrog ? ? E DC 14 N4 ? ? ? 1_555 F DG 5  O6 ? ? D DC 33 E DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70 hydrog ? ? E DC 14 O2 ? ? ? 1_555 F DG 5  N2 ? ? D DC 33 E DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71 hydrog ? ? E DC 15 N3 ? ? ? 1_555 F DG 4  N1 ? ? D DC 34 E DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72 hydrog ? ? E DC 15 N4 ? ? ? 1_555 F DG 4  O6 ? ? D DC 34 E DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73 hydrog ? ? E DC 15 O2 ? ? ? 1_555 F DG 4  N2 ? ? D DC 34 E DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74 hydrog ? ? E DA 16 N1 ? ? ? 1_555 F DT 3  N3 ? ? D DA 35 E DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75 hydrog ? ? E DA 16 N6 ? ? ? 1_555 F DT 3  O4 ? ? D DA 35 E DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76 hydrog ? ? E DG 17 N1 ? ? ? 1_555 F DA 1  N1 ? ? D DG 36 E DA 1  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog77 hydrog ? ? E DG 17 O6 ? ? ? 1_555 F DA 1  N6 ? ? D DG 36 E DA 1  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog78 hydrog ? ? E DT 18 N3 ? ? ? 1_555 F DA 1  N1 ? ? D DT 37 E DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79 hydrog ? ? E DT 18 O4 ? ? ? 1_555 F DA 1  N6 ? ? D DT 37 E DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 1 A . ? ARG 217 A LYS 2 A ? LYS 218 A 1 9.90 
2 LYS 2 A . ? LYS 218 A LYS 3 A ? LYS 219 A 1 5.01 
# 
_atom_sites.entry_id                    5NO6 
_atom_sites.fract_transf_matrix[1][1]   0.012098 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000805 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017645 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006912 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 1  ? 13.869  -4.856  17.206  1.00 178.49 ? 217 ARG A N     1 
ATOM   2    C CA    . ARG A 1 1  ? 14.897  -4.577  16.158  1.00 180.35 ? 217 ARG A CA    1 
ATOM   3    C C     . ARG A 1 1  ? 14.559  -3.287  15.368  1.00 180.16 ? 217 ARG A C     1 
ATOM   4    O O     . ARG A 1 1  ? 13.703  -3.336  14.482  1.00 159.30 ? 217 ARG A O     1 
ATOM   5    C CB    . ARG A 1 1  ? 15.031  -5.776  15.210  1.00 181.69 ? 217 ARG A CB    1 
ATOM   6    C CG    . ARG A 1 1  ? 15.839  -6.943  15.780  1.00 180.71 ? 217 ARG A CG    1 
ATOM   7    C CD    . ARG A 1 1  ? 16.320  -7.891  14.688  1.00 173.81 ? 217 ARG A CD    1 
ATOM   8    N NE    . ARG A 1 1  ? 17.416  -8.768  15.117  1.00 176.65 ? 217 ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 1  ? 18.699  -8.411  15.263  1.00 178.95 ? 217 ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 1  ? 19.590  -9.325  15.650  1.00 179.91 ? 217 ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 1  ? 19.109  -7.160  15.042  1.00 177.17 ? 217 ARG A NH2   1 
ATOM   12   N N     . LYS A 1 2  ? 15.228  -2.150  15.624  1.00 189.63 ? 218 LYS A N     1 
ATOM   13   C CA    . LYS A 1 2  ? 16.440  -2.030  16.475  1.00 184.53 ? 218 LYS A CA    1 
ATOM   14   C C     . LYS A 1 2  ? 16.408  -0.874  17.509  1.00 163.48 ? 218 LYS A C     1 
ATOM   15   O O     . LYS A 1 2  ? 16.262  -1.178  18.693  1.00 152.39 ? 218 LYS A O     1 
ATOM   16   C CB    . LYS A 1 2  ? 17.723  -2.039  15.616  1.00 194.00 ? 218 LYS A CB    1 
ATOM   17   C CG    . LYS A 1 2  ? 17.899  -3.299  14.769  1.00 197.23 ? 218 LYS A CG    1 
ATOM   18   C CD    . LYS A 1 2  ? 18.696  -3.040  13.501  1.00 199.56 ? 218 LYS A CD    1 
ATOM   19   C CE    . LYS A 1 2  ? 20.124  -2.656  13.826  1.00 201.18 ? 218 LYS A CE    1 
ATOM   20   N NZ    . LYS A 1 2  ? 20.996  -2.685  12.625  1.00 206.68 ? 218 LYS A NZ    1 
ATOM   21   N N     . LYS A 1 3  ? 16.512  0.418   17.151  1.00 153.63 ? 219 LYS A N     1 
ATOM   22   C CA    . LYS A 1 3  ? 16.567  0.987   15.787  1.00 152.67 ? 219 LYS A CA    1 
ATOM   23   C C     . LYS A 1 3  ? 17.918  1.692   15.485  1.00 135.79 ? 219 LYS A C     1 
ATOM   24   O O     . LYS A 1 3  ? 18.471  2.414   16.326  1.00 108.58 ? 219 LYS A O     1 
ATOM   25   C CB    . LYS A 1 3  ? 15.416  2.003   15.577  1.00 164.91 ? 219 LYS A CB    1 
ATOM   26   C CG    . LYS A 1 3  ? 14.293  1.585   14.616  1.00 171.27 ? 219 LYS A CG    1 
ATOM   27   C CD    . LYS A 1 3  ? 12.981  1.238   15.320  1.00 179.74 ? 219 LYS A CD    1 
ATOM   28   C CE    . LYS A 1 3  ? 11.821  1.077   14.339  1.00 179.33 ? 219 LYS A CE    1 
ATOM   29   N NZ    . LYS A 1 3  ? 11.825  -0.231  13.622  1.00 180.71 ? 219 LYS A NZ    1 
ATOM   30   N N     . ARG A 1 4  ? 18.415  1.481   14.266  1.00 126.69 ? 220 ARG A N     1 
ATOM   31   C CA    . ARG A 1 4  ? 19.611  2.149   13.730  1.00 120.08 ? 220 ARG A CA    1 
ATOM   32   C C     . ARG A 1 4  ? 19.594  3.684   13.943  1.00 118.66 ? 220 ARG A C     1 
ATOM   33   O O     . ARG A 1 4  ? 18.636  4.357   13.561  1.00 113.26 ? 220 ARG A O     1 
ATOM   34   C CB    . ARG A 1 4  ? 19.749  1.786   12.228  1.00 125.24 ? 220 ARG A CB    1 
ATOM   35   C CG    . ARG A 1 4  ? 20.670  2.677   11.407  1.00 129.28 ? 220 ARG A CG    1 
ATOM   36   C CD    . ARG A 1 4  ? 20.939  2.150   10.006  1.00 121.13 ? 220 ARG A CD    1 
ATOM   37   N NE    . ARG A 1 4  ? 20.792  3.221   9.014   1.00 129.06 ? 220 ARG A NE    1 
ATOM   38   C CZ    . ARG A 1 4  ? 21.632  4.249   8.841   1.00 139.96 ? 220 ARG A CZ    1 
ATOM   39   N NH1   . ARG A 1 4  ? 22.729  4.380   9.587   1.00 141.52 ? 220 ARG A NH1   1 
ATOM   40   N NH2   . ARG A 1 4  ? 21.374  5.162   7.904   1.00 145.94 ? 220 ARG A NH2   1 
ATOM   41   N N     . ILE A 1 5  ? 20.651  4.217   14.562  1.00 128.44 ? 221 ILE A N     1 
ATOM   42   C CA    . ILE A 1 5  ? 20.816  5.672   14.764  1.00 129.08 ? 221 ILE A CA    1 
ATOM   43   C C     . ILE A 1 5  ? 21.857  6.218   13.765  1.00 120.95 ? 221 ILE A C     1 
ATOM   44   O O     . ILE A 1 5  ? 22.990  5.751   13.733  1.00 127.64 ? 221 ILE A O     1 
ATOM   45   C CB    . ILE A 1 5  ? 21.181  6.022   16.238  1.00 141.24 ? 221 ILE A CB    1 
ATOM   46   C CG1   . ILE A 1 5  ? 22.646  5.642   16.585  1.00 151.45 ? 221 ILE A CG1   1 
ATOM   47   C CG2   . ILE A 1 5  ? 20.155  5.401   17.186  1.00 140.15 ? 221 ILE A CG2   1 
ATOM   48   C CD1   . ILE A 1 5  ? 22.953  5.357   18.048  1.00 155.19 ? 221 ILE A CD1   1 
ATOM   49   N N     . PRO A 1 6  ? 21.471  7.182   12.916  1.00 113.22 ? 222 PRO A N     1 
ATOM   50   C CA    . PRO A 1 6  ? 22.429  7.773   11.969  1.00 108.73 ? 222 PRO A CA    1 
ATOM   51   C C     . PRO A 1 6  ? 23.286  8.878   12.602  1.00 102.04 ? 222 PRO A C     1 
ATOM   52   O O     . PRO A 1 6  ? 22.762  9.916   13.022  1.00 98.03  ? 222 PRO A O     1 
ATOM   53   C CB    . PRO A 1 6  ? 21.528  8.339   10.873  1.00 105.48 ? 222 PRO A CB    1 
ATOM   54   C CG    . PRO A 1 6  ? 20.255  8.659   11.566  1.00 107.67 ? 222 PRO A CG    1 
ATOM   55   C CD    . PRO A 1 6  ? 20.105  7.689   12.703  1.00 113.82 ? 222 PRO A CD    1 
ATOM   56   N N     . TYR A 1 7  ? 24.595  8.660   12.650  1.00 92.80  ? 223 TYR A N     1 
ATOM   57   C CA    . TYR A 1 7  ? 25.495  9.600   13.315  1.00 90.79  ? 223 TYR A CA    1 
ATOM   58   C C     . TYR A 1 7  ? 25.558  10.919  12.539  1.00 95.86  ? 223 TYR A C     1 
ATOM   59   O O     . TYR A 1 7  ? 25.609  10.915  11.324  1.00 105.91 ? 223 TYR A O     1 
ATOM   60   C CB    . TYR A 1 7  ? 26.917  9.038   13.441  1.00 86.98  ? 223 TYR A CB    1 
ATOM   61   C CG    . TYR A 1 7  ? 27.089  7.612   13.958  1.00 83.86  ? 223 TYR A CG    1 
ATOM   62   C CD1   . TYR A 1 7  ? 26.130  6.981   14.771  1.00 81.24  ? 223 TYR A CD1   1 
ATOM   63   C CD2   . TYR A 1 7  ? 28.255  6.909   13.668  1.00 80.70  ? 223 TYR A CD2   1 
ATOM   64   C CE1   . TYR A 1 7  ? 26.324  5.681   15.244  1.00 74.60  ? 223 TYR A CE1   1 
ATOM   65   C CE2   . TYR A 1 7  ? 28.454  5.619   14.129  1.00 77.53  ? 223 TYR A CE2   1 
ATOM   66   C CZ    . TYR A 1 7  ? 27.495  5.009   14.917  1.00 77.48  ? 223 TYR A CZ    1 
ATOM   67   O OH    . TYR A 1 7  ? 27.731  3.722   15.352  1.00 81.96  ? 223 TYR A OH    1 
ATOM   68   N N     . SER A 1 8  ? 25.542  12.040  13.243  1.00 110.47 ? 224 SER A N     1 
ATOM   69   C CA    . SER A 1 8  ? 25.577  13.362  12.605  1.00 121.64 ? 224 SER A CA    1 
ATOM   70   C C     . SER A 1 8  ? 26.904  13.766  11.943  1.00 125.24 ? 224 SER A C     1 
ATOM   71   O O     . SER A 1 8  ? 27.976  13.144  12.146  1.00 129.47 ? 224 SER A O     1 
ATOM   72   C CB    . SER A 1 8  ? 25.160  14.455  13.609  1.00 133.43 ? 224 SER A CB    1 
ATOM   73   O OG    . SER A 1 8  ? 26.219  14.805  14.489  1.00 135.29 ? 224 SER A OG    1 
ATOM   74   N N     . LYS A 1 9  ? 26.783  14.853  11.173  1.00 127.40 ? 225 LYS A N     1 
ATOM   75   C CA    . LYS A 1 9  ? 27.876  15.501  10.423  1.00 128.69 ? 225 LYS A CA    1 
ATOM   76   C C     . LYS A 1 9  ? 29.148  15.687  11.240  1.00 125.35 ? 225 LYS A C     1 
ATOM   77   O O     . LYS A 1 9  ? 30.245  15.462  10.736  1.00 119.78 ? 225 LYS A O     1 
ATOM   78   C CB    . LYS A 1 9  ? 27.426  16.881  9.895   1.00 127.58 ? 225 LYS A CB    1 
ATOM   79   C CG    . LYS A 1 9  ? 27.870  17.208  8.473   1.00 127.87 ? 225 LYS A CG    1 
ATOM   80   C CD    . LYS A 1 9  ? 26.712  17.725  7.630   1.00 128.92 ? 225 LYS A CD    1 
ATOM   81   C CE    . LYS A 1 9  ? 25.679  16.631  7.376   1.00 128.02 ? 225 LYS A CE    1 
ATOM   82   N NZ    . LYS A 1 9  ? 24.691  16.997  6.326   1.00 132.35 ? 225 LYS A NZ    1 
ATOM   83   N N     . GLY A 1 10 ? 28.993  16.121  12.487  1.00 126.20 ? 226 GLY A N     1 
ATOM   84   C CA    . GLY A 1 10 ? 30.124  16.237  13.405  1.00 135.48 ? 226 GLY A CA    1 
ATOM   85   C C     . GLY A 1 10 ? 30.699  14.873  13.733  1.00 129.58 ? 226 GLY A C     1 
ATOM   86   O O     . GLY A 1 10 ? 31.920  14.639  13.606  1.00 121.41 ? 226 GLY A O     1 
ATOM   87   N N     . GLN A 1 11 ? 29.799  13.964  14.109  1.00 128.80 ? 227 GLN A N     1 
ATOM   88   C CA    . GLN A 1 11 ? 30.188  12.619  14.518  1.00 132.22 ? 227 GLN A CA    1 
ATOM   89   C C     . GLN A 1 11 ? 31.075  12.036  13.418  1.00 126.50 ? 227 GLN A C     1 
ATOM   90   O O     . GLN A 1 11 ? 32.200  11.598  13.695  1.00 115.61 ? 227 GLN A O     1 
ATOM   91   C CB    . GLN A 1 11 ? 28.980  11.689  14.738  1.00 138.44 ? 227 GLN A CB    1 
ATOM   92   C CG    . GLN A 1 11 ? 27.821  12.197  15.588  1.00 136.92 ? 227 GLN A CG    1 
ATOM   93   C CD    . GLN A 1 11 ? 28.024  12.023  17.070  1.00 154.09 ? 227 GLN A CD    1 
ATOM   94   O OE1   . GLN A 1 11 ? 27.855  10.926  17.601  1.00 157.13 ? 227 GLN A OE1   1 
ATOM   95   N NE2   . GLN A 1 11 ? 28.347  13.114  17.759  1.00 167.08 ? 227 GLN A NE2   1 
ATOM   96   N N     . LEU A 1 12 ? 30.573  12.081  12.174  1.00 112.88 ? 228 LEU A N     1 
ATOM   97   C CA    . LEU A 1 12 ? 31.300  11.507  11.031  1.00 104.29 ? 228 LEU A CA    1 
ATOM   98   C C     . LEU A 1 12 ? 32.500  12.341  10.590  1.00 106.72 ? 228 LEU A C     1 
ATOM   99   O O     . LEU A 1 12 ? 33.550  11.787  10.370  1.00 109.87 ? 228 LEU A O     1 
ATOM   100  C CB    . LEU A 1 12 ? 30.372  11.257  9.844   1.00 108.61 ? 228 LEU A CB    1 
ATOM   101  C CG    . LEU A 1 12 ? 29.407  10.079  10.000  1.00 111.90 ? 228 LEU A CG    1 
ATOM   102  C CD1   . LEU A 1 12 ? 28.224  10.178  9.034   1.00 110.45 ? 228 LEU A CD1   1 
ATOM   103  C CD2   . LEU A 1 12 ? 30.155  8.767   9.812   1.00 114.79 ? 228 LEU A CD2   1 
ATOM   104  N N     . ARG A 1 13 ? 32.373  13.662  10.488  1.00 112.36 ? 229 ARG A N     1 
ATOM   105  C CA    . ARG A 1 13 ? 33.556  14.525  10.260  1.00 125.43 ? 229 ARG A CA    1 
ATOM   106  C C     . ARG A 1 13 ? 34.706  14.180  11.227  1.00 118.68 ? 229 ARG A C     1 
ATOM   107  O O     . ARG A 1 13 ? 35.876  14.206  10.839  1.00 109.82 ? 229 ARG A O     1 
ATOM   108  C CB    . ARG A 1 13 ? 33.197  16.021  10.370  1.00 138.43 ? 229 ARG A CB    1 
ATOM   109  C CG    . ARG A 1 13 ? 34.367  17.010  10.244  1.00 146.29 ? 229 ARG A CG    1 
ATOM   110  C CD    . ARG A 1 13 ? 33.879  18.455  10.109  1.00 157.10 ? 229 ARG A CD    1 
ATOM   111  N NE    . ARG A 1 13 ? 33.064  18.882  11.259  1.00 167.34 ? 229 ARG A NE    1 
ATOM   112  C CZ    . ARG A 1 13 ? 32.224  19.926  11.285  1.00 161.87 ? 229 ARG A CZ    1 
ATOM   113  N NH1   . ARG A 1 13 ? 32.051  20.708  10.216  1.00 162.07 ? 229 ARG A NH1   1 
ATOM   114  N NH2   . ARG A 1 13 ? 31.540  20.193  12.403  1.00 150.31 ? 229 ARG A NH2   1 
ATOM   115  N N     . GLU A 1 14 ? 34.363  13.854  12.475  1.00 116.41 ? 230 GLU A N     1 
ATOM   116  C CA    . GLU A 1 14 ? 35.367  13.368  13.428  1.00 116.97 ? 230 GLU A CA    1 
ATOM   117  C C     . GLU A 1 14 ? 35.967  12.025  12.970  1.00 110.99 ? 230 GLU A C     1 
ATOM   118  O O     . GLU A 1 14 ? 37.198  11.852  12.958  1.00 103.99 ? 230 GLU A O     1 
ATOM   119  C CB    . GLU A 1 14 ? 34.779  13.232  14.854  1.00 122.03 ? 230 GLU A CB    1 
ATOM   120  C CG    . GLU A 1 14 ? 35.543  13.993  15.943  1.00 123.44 ? 230 GLU A CG    1 
ATOM   121  C CD    . GLU A 1 14 ? 36.999  13.567  16.113  1.00 119.59 ? 230 GLU A CD    1 
ATOM   122  O OE1   . GLU A 1 14 ? 37.379  12.464  15.677  1.00 127.12 ? 230 GLU A OE1   1 
ATOM   123  O OE2   . GLU A 1 14 ? 37.780  14.341  16.699  1.00 114.47 ? 230 GLU A OE2   1 
ATOM   124  N N     . LEU A 1 15 ? 35.094  11.085  12.602  1.00 105.15 ? 231 LEU A N     1 
ATOM   125  C CA    . LEU A 1 15 ? 35.516  9.711   12.305  1.00 98.43  ? 231 LEU A CA    1 
ATOM   126  C C     . LEU A 1 15 ? 36.343  9.648   11.034  1.00 100.99 ? 231 LEU A C     1 
ATOM   127  O O     . LEU A 1 15 ? 37.488  9.228   11.072  1.00 98.99  ? 231 LEU A O     1 
ATOM   128  C CB    . LEU A 1 15 ? 34.312  8.777   12.209  1.00 96.65  ? 231 LEU A CB    1 
ATOM   129  C CG    . LEU A 1 15 ? 33.644  8.436   13.548  1.00 101.30 ? 231 LEU A CG    1 
ATOM   130  C CD1   . LEU A 1 15 ? 32.209  7.941   13.368  1.00 103.05 ? 231 LEU A CD1   1 
ATOM   131  C CD2   . LEU A 1 15 ? 34.474  7.414   14.322  1.00 98.50  ? 231 LEU A CD2   1 
ATOM   132  N N     . GLU A 1 16 ? 35.761  10.132  9.940   1.00 104.95 ? 232 GLU A N     1 
ATOM   133  C CA    . GLU A 1 16 ? 36.372  10.173  8.603   1.00 111.79 ? 232 GLU A CA    1 
ATOM   134  C C     . GLU A 1 16 ? 37.796  10.739  8.675   1.00 115.41 ? 232 GLU A C     1 
ATOM   135  O O     . GLU A 1 16 ? 38.726  10.154  8.115   1.00 115.36 ? 232 GLU A O     1 
ATOM   136  C CB    . GLU A 1 16 ? 35.542  11.054  7.646   1.00 119.41 ? 232 GLU A CB    1 
ATOM   137  C CG    . GLU A 1 16 ? 34.050  10.706  7.463   1.00 124.69 ? 232 GLU A CG    1 
ATOM   138  C CD    . GLU A 1 16 ? 33.712  9.921   6.203   1.00 121.86 ? 232 GLU A CD    1 
ATOM   139  O OE1   . GLU A 1 16 ? 32.688  9.205   6.207   1.00 113.09 ? 232 GLU A OE1   1 
ATOM   140  O OE2   . GLU A 1 16 ? 34.453  10.006  5.203   1.00 124.74 ? 232 GLU A OE2   1 
ATOM   141  N N     . ARG A 1 17 ? 37.947  11.867  9.376   1.00 109.84 ? 233 ARG A N     1 
ATOM   142  C CA    . ARG A 1 17 ? 39.253  12.507  9.599   1.00 107.15 ? 233 ARG A CA    1 
ATOM   143  C C     . ARG A 1 17 ? 40.261  11.589  10.306  1.00 104.97 ? 233 ARG A C     1 
ATOM   144  O O     . ARG A 1 17 ? 41.458  11.611  9.991   1.00 96.58  ? 233 ARG A O     1 
ATOM   145  C CB    . ARG A 1 17 ? 39.083  13.802  10.414  1.00 110.68 ? 233 ARG A CB    1 
ATOM   146  C CG    . ARG A 1 17 ? 40.371  14.600  10.627  1.00 114.61 ? 233 ARG A CG    1 
ATOM   147  C CD    . ARG A 1 17 ? 40.154  15.879  11.434  1.00 118.37 ? 233 ARG A CD    1 
ATOM   148  N NE    . ARG A 1 17 ? 39.803  15.648  12.846  1.00 123.78 ? 233 ARG A NE    1 
ATOM   149  C CZ    . ARG A 1 17 ? 40.644  15.278  13.825  1.00 126.56 ? 233 ARG A CZ    1 
ATOM   150  N NH1   . ARG A 1 17 ? 41.936  15.043  13.598  1.00 123.38 ? 233 ARG A NH1   1 
ATOM   151  N NH2   . ARG A 1 17 ? 40.178  15.121  15.062  1.00 134.98 ? 233 ARG A NH2   1 
ATOM   152  N N     . GLU A 1 18 ? 39.784  10.819  11.280  1.00 99.68  ? 234 GLU A N     1 
ATOM   153  C CA    . GLU A 1 18 ? 40.651  9.913   12.009  1.00 103.73 ? 234 GLU A CA    1 
ATOM   154  C C     . GLU A 1 18 ? 40.935  8.627   11.216  1.00 108.13 ? 234 GLU A C     1 
ATOM   155  O O     . GLU A 1 18 ? 41.994  8.022   11.383  1.00 113.12 ? 234 GLU A O     1 
ATOM   156  C CB    . GLU A 1 18 ? 40.047  9.593   13.374  1.00 111.02 ? 234 GLU A CB    1 
ATOM   157  C CG    . GLU A 1 18 ? 41.032  8.978   14.365  1.00 119.95 ? 234 GLU A CG    1 
ATOM   158  C CD    . GLU A 1 18 ? 42.073  9.954   14.898  1.00 134.05 ? 234 GLU A CD    1 
ATOM   159  O OE1   . GLU A 1 18 ? 41.725  11.137  15.142  1.00 140.00 ? 234 GLU A OE1   1 
ATOM   160  O OE2   . GLU A 1 18 ? 43.239  9.529   15.097  1.00 133.76 ? 234 GLU A OE2   1 
ATOM   161  N N     . TYR A 1 19 ? 39.994  8.207   10.370  1.00 108.25 ? 235 TYR A N     1 
ATOM   162  C CA    . TYR A 1 19 ? 40.167  7.030   9.516   1.00 107.36 ? 235 TYR A CA    1 
ATOM   163  C C     . TYR A 1 19 ? 41.193  7.373   8.461   1.00 103.39 ? 235 TYR A C     1 
ATOM   164  O O     . TYR A 1 19 ? 42.205  6.692   8.317   1.00 107.36 ? 235 TYR A O     1 
ATOM   165  C CB    . TYR A 1 19 ? 38.845  6.607   8.862   1.00 109.47 ? 235 TYR A CB    1 
ATOM   166  C CG    . TYR A 1 19 ? 38.975  5.458   7.879   1.00 109.88 ? 235 TYR A CG    1 
ATOM   167  C CD1   . TYR A 1 19 ? 39.460  4.225   8.287   1.00 114.87 ? 235 TYR A CD1   1 
ATOM   168  C CD2   . TYR A 1 19 ? 38.606  5.602   6.539   1.00 115.76 ? 235 TYR A CD2   1 
ATOM   169  C CE1   . TYR A 1 19 ? 39.580  3.165   7.397   1.00 118.79 ? 235 TYR A CE1   1 
ATOM   170  C CE2   . TYR A 1 19 ? 38.724  4.546   5.640   1.00 115.64 ? 235 TYR A CE2   1 
ATOM   171  C CZ    . TYR A 1 19 ? 39.214  3.327   6.077   1.00 116.14 ? 235 TYR A CZ    1 
ATOM   172  O OH    . TYR A 1 19 ? 39.343  2.266   5.208   1.00 115.20 ? 235 TYR A OH    1 
ATOM   173  N N     . ALA A 1 20 ? 40.931  8.469   7.759   1.00 101.89 ? 236 ALA A N     1 
ATOM   174  C CA    . ALA A 1 20 ? 41.884  9.068   6.832   1.00 107.54 ? 236 ALA A CA    1 
ATOM   175  C C     . ALA A 1 20 ? 43.305  9.061   7.403   1.00 103.96 ? 236 ALA A C     1 
ATOM   176  O O     . ALA A 1 20 ? 44.253  8.623   6.746   1.00 94.54  ? 236 ALA A O     1 
ATOM   177  C CB    . ALA A 1 20 ? 41.456  10.497  6.514   1.00 109.46 ? 236 ALA A CB    1 
ATOM   178  N N     . ALA A 1 21 ? 43.426  9.533   8.642   1.00 118.22 ? 237 ALA A N     1 
ATOM   179  C CA    . ALA A 1 21 ? 44.705  9.577   9.355   1.00 114.82 ? 237 ALA A CA    1 
ATOM   180  C C     . ALA A 1 21 ? 45.247  8.172   9.676   1.00 102.72 ? 237 ALA A C     1 
ATOM   181  O O     . ALA A 1 21 ? 46.457  7.935   9.601   1.00 93.61  ? 237 ALA A O     1 
ATOM   182  C CB    . ALA A 1 21 ? 44.560  10.411  10.621  1.00 115.95 ? 237 ALA A CB    1 
ATOM   183  N N     . ASN A 1 22 ? 44.357  7.247   10.030  1.00 103.39 ? 238 ASN A N     1 
ATOM   184  C CA    . ASN A 1 22 ? 44.765  5.862   10.197  1.00 104.55 ? 238 ASN A CA    1 
ATOM   185  C C     . ASN A 1 22 ? 43.603  4.888   10.089  1.00 100.19 ? 238 ASN A C     1 
ATOM   186  O O     . ASN A 1 22 ? 42.484  5.167   10.533  1.00 86.01  ? 238 ASN A O     1 
ATOM   187  C CB    . ASN A 1 22 ? 45.517  5.649   11.506  1.00 111.20 ? 238 ASN A CB    1 
ATOM   188  C CG    . ASN A 1 22 ? 46.615  4.622   11.355  1.00 122.36 ? 238 ASN A CG    1 
ATOM   189  O OD1   . ASN A 1 22 ? 47.543  4.809   10.557  1.00 126.74 ? 238 ASN A OD1   1 
ATOM   190  N ND2   . ASN A 1 22 ? 46.503  3.517   12.088  1.00 120.60 ? 238 ASN A ND2   1 
ATOM   191  N N     . LYS A 1 23 ? 43.913  3.732   9.512   1.00 100.64 ? 239 LYS A N     1 
ATOM   192  C CA    . LYS A 1 23 ? 42.914  2.863   8.910   1.00 101.52 ? 239 LYS A CA    1 
ATOM   193  C C     . LYS A 1 23 ? 42.271  2.012   9.973   1.00 97.03  ? 239 LYS A C     1 
ATOM   194  O O     . LYS A 1 23 ? 41.064  1.830   9.960   1.00 99.54  ? 239 LYS A O     1 
ATOM   195  C CB    . LYS A 1 23 ? 43.560  1.971   7.840   1.00 110.59 ? 239 LYS A CB    1 
ATOM   196  C CG    . LYS A 1 23 ? 42.752  1.797   6.570   1.00 106.49 ? 239 LYS A CG    1 
ATOM   197  C CD    . LYS A 1 23 ? 42.802  3.032   5.676   1.00 108.53 ? 239 LYS A CD    1 
ATOM   198  C CE    . LYS A 1 23 ? 42.630  2.652   4.211   1.00 106.61 ? 239 LYS A CE    1 
ATOM   199  N NZ    . LYS A 1 23 ? 42.815  3.780   3.265   1.00 107.81 ? 239 LYS A NZ    1 
ATOM   200  N N     . PHE A 1 24 ? 43.080  1.436   10.863  1.00 103.29 ? 240 PHE A N     1 
ATOM   201  C CA    . PHE A 1 24 ? 42.534  0.786   12.064  1.00 111.05 ? 240 PHE A CA    1 
ATOM   202  C C     . PHE A 1 24 ? 42.798  1.655   13.315  1.00 108.11 ? 240 PHE A C     1 
ATOM   203  O O     . PHE A 1 24 ? 43.567  2.624   13.298  1.00 108.79 ? 240 PHE A O     1 
ATOM   204  C CB    . PHE A 1 24 ? 43.051  -0.653  12.310  1.00 111.61 ? 240 PHE A CB    1 
ATOM   205  C CG    . PHE A 1 24 ? 43.227  -1.521  11.075  1.00 115.63 ? 240 PHE A CG    1 
ATOM   206  C CD1   . PHE A 1 24 ? 42.704  -1.220  9.829   1.00 122.16 ? 240 PHE A CD1   1 
ATOM   207  C CD2   . PHE A 1 24 ? 43.916  -2.712  11.210  1.00 123.43 ? 240 PHE A CD2   1 
ATOM   208  C CE1   . PHE A 1 24 ? 42.923  -2.064  8.752   1.00 136.50 ? 240 PHE A CE1   1 
ATOM   209  C CE2   . PHE A 1 24 ? 44.126  -3.563  10.147  1.00 127.00 ? 240 PHE A CE2   1 
ATOM   210  C CZ    . PHE A 1 24 ? 43.627  -3.241  8.912   1.00 135.06 ? 240 PHE A CZ    1 
ATOM   211  N N     . ILE A 1 25 ? 42.134  1.280   14.396  1.00 102.02 ? 241 ILE A N     1 
ATOM   212  C CA    . ILE A 1 25 ? 42.132  2.028   15.633  1.00 97.37  ? 241 ILE A CA    1 
ATOM   213  C C     . ILE A 1 25 ? 43.073  1.356   16.647  1.00 108.63 ? 241 ILE A C     1 
ATOM   214  O O     . ILE A 1 25 ? 43.471  0.194   16.503  1.00 118.15 ? 241 ILE A O     1 
ATOM   215  C CB    . ILE A 1 25 ? 40.682  2.057   16.183  1.00 95.62  ? 241 ILE A CB    1 
ATOM   216  C CG1   . ILE A 1 25 ? 40.352  3.393   16.855  1.00 92.64  ? 241 ILE A CG1   1 
ATOM   217  C CG2   . ILE A 1 25 ? 40.388  0.849   17.080  1.00 91.28  ? 241 ILE A CG2   1 
ATOM   218  C CD1   . ILE A 1 25 ? 40.073  4.510   15.877  1.00 88.71  ? 241 ILE A CD1   1 
ATOM   219  N N     . THR A 1 26 ? 43.412  2.111   17.676  1.00 112.24 ? 242 THR A N     1 
ATOM   220  C CA    . THR A 1 26 ? 44.100  1.610   18.852  1.00 110.64 ? 242 THR A CA    1 
ATOM   221  C C     . THR A 1 26 ? 43.317  2.137   20.037  1.00 111.37 ? 242 THR A C     1 
ATOM   222  O O     . THR A 1 26 ? 42.561  3.106   19.882  1.00 111.69 ? 242 THR A O     1 
ATOM   223  C CB    . THR A 1 26 ? 45.512  2.167   18.892  1.00 116.94 ? 242 THR A CB    1 
ATOM   224  O OG1   . THR A 1 26 ? 45.446  3.587   18.692  1.00 118.08 ? 242 THR A OG1   1 
ATOM   225  C CG2   . THR A 1 26 ? 46.363  1.525   17.793  1.00 115.20 ? 242 THR A CG2   1 
ATOM   226  N N     . LYS A 1 27 ? 43.502  1.531   21.211  1.00 106.36 ? 243 LYS A N     1 
ATOM   227  C CA    . LYS A 1 27 ? 42.610  1.816   22.356  1.00 104.43 ? 243 LYS A CA    1 
ATOM   228  C C     . LYS A 1 27 ? 42.667  3.319   22.636  1.00 104.90 ? 243 LYS A C     1 
ATOM   229  O O     . LYS A 1 27 ? 41.625  4.035   22.632  1.00 99.79  ? 243 LYS A O     1 
ATOM   230  C CB    . LYS A 1 27 ? 42.956  1.010   23.618  1.00 113.83 ? 243 LYS A CB    1 
ATOM   231  C CG    . LYS A 1 27 ? 43.475  -0.414  23.413  1.00 129.56 ? 243 LYS A CG    1 
ATOM   232  C CD    . LYS A 1 27 ? 45.004  -0.486  23.495  1.00 143.99 ? 243 LYS A CD    1 
ATOM   233  C CE    . LYS A 1 27 ? 45.596  -1.526  22.557  1.00 148.92 ? 243 LYS A CE    1 
ATOM   234  N NZ    . LYS A 1 27 ? 47.087  -1.472  22.559  1.00 154.19 ? 243 LYS A NZ    1 
ATOM   235  N N     . ASP A 1 28 ? 43.905  3.791   22.806  1.00 106.66 ? 244 ASP A N     1 
ATOM   236  C CA    . ASP A 1 28 ? 44.202  5.225   22.905  1.00 112.57 ? 244 ASP A CA    1 
ATOM   237  C C     . ASP A 1 28 ? 43.326  6.074   21.963  1.00 100.89 ? 244 ASP A C     1 
ATOM   238  O O     . ASP A 1 28 ? 42.682  7.028   22.411  1.00 98.84  ? 244 ASP A O     1 
ATOM   239  C CB    . ASP A 1 28 ? 45.719  5.547   22.753  1.00 120.00 ? 244 ASP A CB    1 
ATOM   240  C CG    . ASP A 1 28 ? 46.454  4.631   21.760  1.00 128.42 ? 244 ASP A CG    1 
ATOM   241  O OD1   . ASP A 1 28 ? 46.402  3.390   21.947  1.00 126.05 ? 244 ASP A OD1   1 
ATOM   242  O OD2   . ASP A 1 28 ? 47.120  5.156   20.829  1.00 125.81 ? 244 ASP A OD2   1 
ATOM   243  N N     . LYS A 1 29 ? 43.254  5.696   20.691  1.00 97.59  ? 245 LYS A N     1 
ATOM   244  C CA    . LYS A 1 29 ? 42.369  6.401   19.751  1.00 98.97  ? 245 LYS A CA    1 
ATOM   245  C C     . LYS A 1 29 ? 40.873  6.195   20.051  1.00 95.05  ? 245 LYS A C     1 
ATOM   246  O O     . LYS A 1 29 ? 40.140  7.207   20.109  1.00 95.32  ? 245 LYS A O     1 
ATOM   247  C CB    . LYS A 1 29 ? 42.695  6.070   18.291  1.00 103.63 ? 245 LYS A CB    1 
ATOM   248  C CG    . LYS A 1 29 ? 43.662  7.037   17.624  1.00 110.72 ? 245 LYS A CG    1 
ATOM   249  C CD    . LYS A 1 29 ? 44.536  6.320   16.606  1.00 124.16 ? 245 LYS A CD    1 
ATOM   250  C CE    . LYS A 1 29 ? 45.494  7.278   15.917  1.00 138.95 ? 245 LYS A CE    1 
ATOM   251  N NZ    . LYS A 1 29 ? 46.697  6.567   15.399  1.00 144.50 ? 245 LYS A NZ    1 
ATOM   252  N N     . ARG A 1 30 ? 40.414  4.945   20.270  1.00 89.05  ? 246 ARG A N     1 
ATOM   253  C CA    . ARG A 1 30 ? 38.977  4.734   20.561  1.00 91.08  ? 246 ARG A CA    1 
ATOM   254  C C     . ARG A 1 30 ? 38.603  5.713   21.657  1.00 99.17  ? 246 ARG A C     1 
ATOM   255  O O     . ARG A 1 30 ? 37.628  6.439   21.510  1.00 88.61  ? 246 ARG A O     1 
ATOM   256  C CB    . ARG A 1 30 ? 38.601  3.373   21.151  1.00 100.04 ? 246 ARG A CB    1 
ATOM   257  C CG    . ARG A 1 30 ? 38.657  2.136   20.310  1.00 106.75 ? 246 ARG A CG    1 
ATOM   258  C CD    . ARG A 1 30 ? 38.165  0.935   21.141  1.00 114.04 ? 246 ARG A CD    1 
ATOM   259  N NE    . ARG A 1 30 ? 38.874  -0.279  20.744  1.00 127.18 ? 246 ARG A NE    1 
ATOM   260  C CZ    . ARG A 1 30 ? 38.701  -0.906  19.579  1.00 148.37 ? 246 ARG A CZ    1 
ATOM   261  N NH1   . ARG A 1 30 ? 37.817  -0.468  18.680  1.00 160.49 ? 246 ARG A NH1   1 
ATOM   262  N NH2   . ARG A 1 30 ? 39.418  -1.983  19.289  1.00 150.25 ? 246 ARG A NH2   1 
ATOM   263  N N     . ARG A 1 31 ? 39.372  5.697   22.763  1.00 99.74  ? 247 ARG A N     1 
ATOM   264  C CA    . ARG A 1 31 ? 39.052  6.519   23.948  1.00 102.94 ? 247 ARG A CA    1 
ATOM   265  C C     . ARG A 1 31 ? 38.904  8.013   23.566  1.00 100.02 ? 247 ARG A C     1 
ATOM   266  O O     . ARG A 1 31 ? 37.795  8.573   23.605  1.00 85.26  ? 247 ARG A O     1 
ATOM   267  C CB    . ARG A 1 31 ? 40.093  6.317   25.074  1.00 110.27 ? 247 ARG A CB    1 
ATOM   268  C CG    . ARG A 1 31 ? 39.628  5.433   26.242  1.00 119.75 ? 247 ARG A CG    1 
ATOM   269  C CD    . ARG A 1 31 ? 40.755  5.081   27.233  1.00 125.31 ? 247 ARG A CD    1 
ATOM   270  N NE    . ARG A 1 31 ? 41.442  6.268   27.778  1.00 135.23 ? 247 ARG A NE    1 
ATOM   271  C CZ    . ARG A 1 31 ? 41.019  7.045   28.791  1.00 131.44 ? 247 ARG A CZ    1 
ATOM   272  N NH1   . ARG A 1 31 ? 39.877  6.800   29.448  1.00 134.72 ? 247 ARG A NH1   1 
ATOM   273  N NH2   . ARG A 1 31 ? 41.755  8.095   29.153  1.00 117.37 ? 247 ARG A NH2   1 
ATOM   274  N N     . LYS A 1 32 ? 40.012  8.627   23.144  1.00 94.41  ? 248 LYS A N     1 
ATOM   275  C CA    . LYS A 1 32 ? 40.001  10.025  22.717  1.00 94.75  ? 248 LYS A CA    1 
ATOM   276  C C     . LYS A 1 32 ? 38.803  10.280  21.834  1.00 96.96  ? 248 LYS A C     1 
ATOM   277  O O     . LYS A 1 32 ? 37.965  11.104  22.180  1.00 104.44 ? 248 LYS A O     1 
ATOM   278  C CB    . LYS A 1 32 ? 41.285  10.419  21.965  1.00 98.57  ? 248 LYS A CB    1 
ATOM   279  C CG    . LYS A 1 32 ? 41.420  11.929  21.724  1.00 103.33 ? 248 LYS A CG    1 
ATOM   280  C CD    . LYS A 1 32 ? 42.590  12.311  20.817  1.00 112.64 ? 248 LYS A CD    1 
ATOM   281  C CE    . LYS A 1 32 ? 43.935  12.338  21.540  1.00 121.66 ? 248 LYS A CE    1 
ATOM   282  N NZ    . LYS A 1 32 ? 44.472  10.992  21.923  1.00 126.94 ? 248 LYS A NZ    1 
ATOM   283  N N     . ILE A 1 33 ? 38.699  9.534   20.731  1.00 95.71  ? 249 ILE A N     1 
ATOM   284  C CA    . ILE A 1 33 ? 37.638  9.794   19.751  1.00 95.52  ? 249 ILE A CA    1 
ATOM   285  C C     . ILE A 1 33 ? 36.263  9.756   20.453  1.00 91.77  ? 249 ILE A C     1 
ATOM   286  O O     . ILE A 1 33 ? 35.523  10.730  20.386  1.00 80.23  ? 249 ILE A O     1 
ATOM   287  C CB    . ILE A 1 33 ? 37.666  8.799   18.554  1.00 104.76 ? 249 ILE A CB    1 
ATOM   288  C CG1   . ILE A 1 33 ? 39.009  8.800   17.814  1.00 107.73 ? 249 ILE A CG1   1 
ATOM   289  C CG2   . ILE A 1 33 ? 36.600  9.119   17.514  1.00 99.27  ? 249 ILE A CG2   1 
ATOM   290  C CD1   . ILE A 1 33 ? 39.243  7.500   17.069  1.00 109.01 ? 249 ILE A CD1   1 
ATOM   291  N N     . SER A 1 34 ? 35.984  8.673   21.185  1.00 85.43  ? 250 SER A N     1 
ATOM   292  C CA    . SER A 1 34 ? 34.704  8.437   21.895  1.00 90.44  ? 250 SER A CA    1 
ATOM   293  C C     . SER A 1 34 ? 34.196  9.642   22.692  1.00 100.40 ? 250 SER A C     1 
ATOM   294  O O     . SER A 1 34 ? 32.999  10.002  22.638  1.00 90.86  ? 250 SER A O     1 
ATOM   295  C CB    . SER A 1 34 ? 34.850  7.257   22.852  1.00 88.00  ? 250 SER A CB    1 
ATOM   296  O OG    . SER A 1 34 ? 33.662  7.047   23.600  1.00 89.58  ? 250 SER A OG    1 
ATOM   297  N N     . ALA A 1 35 ? 35.136  10.232  23.437  1.00 107.76 ? 251 ALA A N     1 
ATOM   298  C CA    . ALA A 1 35 ? 34.937  11.484  24.167  1.00 98.36  ? 251 ALA A CA    1 
ATOM   299  C C     . ALA A 1 35 ? 34.425  12.605  23.268  1.00 104.05 ? 251 ALA A C     1 
ATOM   300  O O     . ALA A 1 35 ? 33.391  13.206  23.567  1.00 112.42 ? 251 ALA A O     1 
ATOM   301  C CB    . ALA A 1 35 ? 36.236  11.906  24.824  1.00 94.44  ? 251 ALA A CB    1 
ATOM   302  N N     . ALA A 1 36 ? 35.136  12.861  22.166  1.00 107.24 ? 252 ALA A N     1 
ATOM   303  C CA    . ALA A 1 36 ? 34.789  13.960  21.246  1.00 110.29 ? 252 ALA A CA    1 
ATOM   304  C C     . ALA A 1 36 ? 33.529  13.670  20.449  1.00 114.11 ? 252 ALA A C     1 
ATOM   305  O O     . ALA A 1 36 ? 32.763  14.572  20.106  1.00 126.60 ? 252 ALA A O     1 
ATOM   306  C CB    . ALA A 1 36 ? 35.939  14.251  20.293  1.00 107.50 ? 252 ALA A CB    1 
ATOM   307  N N     . THR A 1 37 ? 33.319  12.400  20.161  1.00 107.85 ? 253 THR A N     1 
ATOM   308  C CA    . THR A 1 37 ? 32.262  11.978  19.286  1.00 106.36 ? 253 THR A CA    1 
ATOM   309  C C     . THR A 1 37 ? 30.984  11.820  20.057  1.00 107.08 ? 253 THR A C     1 
ATOM   310  O O     . THR A 1 37 ? 29.929  11.824  19.454  1.00 107.63 ? 253 THR A O     1 
ATOM   311  C CB    . THR A 1 37 ? 32.543  10.601  18.702  1.00 108.75 ? 253 THR A CB    1 
ATOM   312  O OG1   . THR A 1 37 ? 32.534  9.626   19.756  1.00 112.66 ? 253 THR A OG1   1 
ATOM   313  C CG2   . THR A 1 37 ? 33.835  10.531  17.986  1.00 113.73 ? 253 THR A CG2   1 
ATOM   314  N N     . SER A 1 38 ? 31.085  11.609  21.374  1.00 105.98 ? 254 SER A N     1 
ATOM   315  C CA    . SER A 1 38 ? 29.920  11.336  22.214  1.00 103.85 ? 254 SER A CA    1 
ATOM   316  C C     . SER A 1 38 ? 29.304  9.935   21.975  1.00 110.33 ? 254 SER A C     1 
ATOM   317  O O     . SER A 1 38 ? 28.177  9.673   22.418  1.00 107.38 ? 254 SER A O     1 
ATOM   318  C CB    . SER A 1 38 ? 28.863  12.442  22.034  1.00 97.61  ? 254 SER A CB    1 
ATOM   319  O OG    . SER A 1 38 ? 27.776  12.260  22.905  1.00 93.12  ? 254 SER A OG    1 
ATOM   320  N N     . LEU A 1 39 ? 30.040  9.037   21.301  1.00 112.68 ? 255 LEU A N     1 
ATOM   321  C CA    . LEU A 1 39 ? 29.596  7.652   21.080  1.00 109.18 ? 255 LEU A CA    1 
ATOM   322  C C     . LEU A 1 39 ? 30.370  6.637   21.916  1.00 100.04 ? 255 LEU A C     1 
ATOM   323  O O     . LEU A 1 39 ? 31.492  6.893   22.371  1.00 86.61  ? 255 LEU A O     1 
ATOM   324  C CB    . LEU A 1 39 ? 29.759  7.208   19.615  1.00 111.19 ? 255 LEU A CB    1 
ATOM   325  C CG    . LEU A 1 39 ? 29.100  7.907   18.425  1.00 114.32 ? 255 LEU A CG    1 
ATOM   326  C CD1   . LEU A 1 39 ? 30.135  8.724   17.699  1.00 114.85 ? 255 LEU A CD1   1 
ATOM   327  C CD2   . LEU A 1 39 ? 28.462  6.934   17.448  1.00 116.89 ? 255 LEU A CD2   1 
ATOM   328  N N     . SER A 1 40 ? 29.756  5.460   22.046  1.00 94.88  ? 256 SER A N     1 
ATOM   329  C CA    . SER A 1 40 ? 30.383  4.261   22.604  1.00 90.00  ? 256 SER A CA    1 
ATOM   330  C C     . SER A 1 40 ? 31.713  3.916   21.940  1.00 85.41  ? 256 SER A C     1 
ATOM   331  O O     . SER A 1 40 ? 31.913  4.174   20.769  1.00 85.09  ? 256 SER A O     1 
ATOM   332  C CB    . SER A 1 40 ? 29.441  3.068   22.432  1.00 87.16  ? 256 SER A CB    1 
ATOM   333  O OG    . SER A 1 40 ? 30.150  1.855   22.581  1.00 91.94  ? 256 SER A OG    1 
ATOM   334  N N     . GLU A 1 41 ? 32.614  3.312   22.699  1.00 86.83  ? 257 GLU A N     1 
ATOM   335  C CA    . GLU A 1 41 ? 33.810  2.707   22.119  1.00 89.02  ? 257 GLU A CA    1 
ATOM   336  C C     . GLU A 1 41 ? 33.388  1.603   21.158  1.00 82.51  ? 257 GLU A C     1 
ATOM   337  O O     . GLU A 1 41 ? 33.960  1.475   20.082  1.00 74.88  ? 257 GLU A O     1 
ATOM   338  C CB    . GLU A 1 41 ? 34.738  2.106   23.199  1.00 96.90  ? 257 GLU A CB    1 
ATOM   339  C CG    . GLU A 1 41 ? 35.554  3.117   23.997  1.00 97.03  ? 257 GLU A CG    1 
ATOM   340  C CD    . GLU A 1 41 ? 36.533  2.476   24.976  1.00 101.63 ? 257 GLU A CD    1 
ATOM   341  O OE1   . GLU A 1 41 ? 37.178  1.456   24.630  1.00 94.83  ? 257 GLU A OE1   1 
ATOM   342  O OE2   . GLU A 1 41 ? 36.672  3.018   26.096  1.00 102.93 ? 257 GLU A OE2   1 
ATOM   343  N N     . ARG A 1 42 ? 32.395  0.811   21.569  1.00 82.01  ? 258 ARG A N     1 
ATOM   344  C CA    . ARG A 1 42 ? 31.904  -0.304  20.770  1.00 89.66  ? 258 ARG A CA    1 
ATOM   345  C C     . ARG A 1 42 ? 31.599  0.224   19.375  1.00 94.25  ? 258 ARG A C     1 
ATOM   346  O O     . ARG A 1 42 ? 32.197  -0.207  18.385  1.00 100.60 ? 258 ARG A O     1 
ATOM   347  C CB    . ARG A 1 42 ? 30.652  -0.943  21.412  1.00 92.64  ? 258 ARG A CB    1 
ATOM   348  C CG    . ARG A 1 42 ? 30.091  -2.197  20.746  1.00 98.44  ? 258 ARG A CG    1 
ATOM   349  C CD    . ARG A 1 42 ? 31.135  -3.292  20.548  1.00 111.95 ? 258 ARG A CD    1 
ATOM   350  N NE    . ARG A 1 42 ? 30.564  -4.480  19.895  1.00 122.33 ? 258 ARG A NE    1 
ATOM   351  C CZ    . ARG A 1 42 ? 31.225  -5.341  19.107  1.00 112.15 ? 258 ARG A CZ    1 
ATOM   352  N NH1   . ARG A 1 42 ? 30.567  -6.379  18.581  1.00 108.51 ? 258 ARG A NH1   1 
ATOM   353  N NH2   . ARG A 1 42 ? 32.528  -5.186  18.831  1.00 99.66  ? 258 ARG A NH2   1 
ATOM   354  N N     . GLN A 1 43 ? 30.723  1.217   19.319  1.00 84.03  ? 259 GLN A N     1 
ATOM   355  C CA    . GLN A 1 43 ? 30.282  1.768   18.058  1.00 78.71  ? 259 GLN A CA    1 
ATOM   356  C C     . GLN A 1 43 ? 31.471  2.118   17.176  1.00 80.57  ? 259 GLN A C     1 
ATOM   357  O O     . GLN A 1 43 ? 31.561  1.633   16.043  1.00 90.37  ? 259 GLN A O     1 
ATOM   358  C CB    . GLN A 1 43 ? 29.412  2.989   18.310  1.00 79.42  ? 259 GLN A CB    1 
ATOM   359  C CG    . GLN A 1 43 ? 28.040  2.650   18.866  1.00 76.05  ? 259 GLN A CG    1 
ATOM   360  C CD    . GLN A 1 43 ? 27.319  3.877   19.310  1.00 78.03  ? 259 GLN A CD    1 
ATOM   361  O OE1   . GLN A 1 43 ? 27.936  4.784   19.819  1.00 79.68  ? 259 GLN A OE1   1 
ATOM   362  N NE2   . GLN A 1 43 ? 26.013  3.915   19.140  1.00 89.60  ? 259 GLN A NE2   1 
ATOM   363  N N     . ILE A 1 44 ? 32.409  2.893   17.727  1.00 81.34  ? 260 ILE A N     1 
ATOM   364  C CA    . ILE A 1 44 ? 33.645  3.272   17.022  1.00 81.53  ? 260 ILE A CA    1 
ATOM   365  C C     . ILE A 1 44 ? 34.259  2.016   16.410  1.00 79.49  ? 260 ILE A C     1 
ATOM   366  O O     . ILE A 1 44 ? 34.498  1.974   15.197  1.00 84.66  ? 260 ILE A O     1 
ATOM   367  C CB    . ILE A 1 44 ? 34.669  4.012   17.945  1.00 89.11  ? 260 ILE A CB    1 
ATOM   368  C CG1   . ILE A 1 44 ? 34.434  5.537   17.956  1.00 94.08  ? 260 ILE A CG1   1 
ATOM   369  C CG2   . ILE A 1 44 ? 36.117  3.792   17.489  1.00 90.83  ? 260 ILE A CG2   1 
ATOM   370  C CD1   . ILE A 1 44 ? 33.118  6.030   18.528  1.00 94.34  ? 260 ILE A CD1   1 
ATOM   371  N N     . THR A 1 45 ? 34.457  0.982   17.231  1.00 76.76  ? 261 THR A N     1 
ATOM   372  C CA    . THR A 1 45 ? 35.036  -0.280  16.756  1.00 79.56  ? 261 THR A CA    1 
ATOM   373  C C     . THR A 1 45 ? 34.362  -0.823  15.496  1.00 79.81  ? 261 THR A C     1 
ATOM   374  O O     . THR A 1 45 ? 35.039  -1.359  14.612  1.00 77.05  ? 261 THR A O     1 
ATOM   375  C CB    . THR A 1 45 ? 34.934  -1.383  17.804  1.00 86.06  ? 261 THR A CB    1 
ATOM   376  O OG1   . THR A 1 45 ? 35.351  -0.876  19.084  1.00 110.13 ? 261 THR A OG1   1 
ATOM   377  C CG2   . THR A 1 45 ? 35.766  -2.607  17.394  1.00 89.89  ? 261 THR A CG2   1 
ATOM   378  N N     . ILE A 1 46 ? 33.037  -0.677  15.444  1.00 77.20  ? 262 ILE A N     1 
ATOM   379  C CA    . ILE A 1 46 ? 32.228  -1.165  14.346  1.00 72.63  ? 262 ILE A CA    1 
ATOM   380  C C     . ILE A 1 46 ? 32.379  -0.257  13.149  1.00 77.39  ? 262 ILE A C     1 
ATOM   381  O O     . ILE A 1 46 ? 32.661  -0.732  12.025  1.00 90.23  ? 262 ILE A O     1 
ATOM   382  C CB    . ILE A 1 46 ? 30.758  -1.289  14.782  1.00 76.13  ? 262 ILE A CB    1 
ATOM   383  C CG1   . ILE A 1 46 ? 30.622  -2.537  15.653  1.00 81.00  ? 262 ILE A CG1   1 
ATOM   384  C CG2   . ILE A 1 46 ? 29.819  -1.352  13.586  1.00 80.10  ? 262 ILE A CG2   1 
ATOM   385  C CD1   . ILE A 1 46 ? 29.352  -2.590  16.460  1.00 90.93  ? 262 ILE A CD1   1 
ATOM   386  N N     . TRP A 1 47 ? 32.202  1.043   13.384  1.00 76.02  ? 263 TRP A N     1 
ATOM   387  C CA    . TRP A 1 47 ? 32.304  2.044   12.318  1.00 80.08  ? 263 TRP A CA    1 
ATOM   388  C C     . TRP A 1 47 ? 33.581  1.901   11.522  1.00 76.15  ? 263 TRP A C     1 
ATOM   389  O O     . TRP A 1 47 ? 33.584  2.109   10.307  1.00 77.05  ? 263 TRP A O     1 
ATOM   390  C CB    . TRP A 1 47 ? 32.220  3.469   12.844  1.00 82.20  ? 263 TRP A CB    1 
ATOM   391  C CG    . TRP A 1 47 ? 32.030  4.415   11.738  1.00 84.59  ? 263 TRP A CG    1 
ATOM   392  C CD1   . TRP A 1 47 ? 30.858  4.743   11.141  1.00 90.31  ? 263 TRP A CD1   1 
ATOM   393  C CD2   . TRP A 1 47 ? 33.048  5.112   11.039  1.00 91.04  ? 263 TRP A CD2   1 
ATOM   394  N NE1   . TRP A 1 47 ? 31.076  5.628   10.119  1.00 93.36  ? 263 TRP A NE1   1 
ATOM   395  C CE2   . TRP A 1 47 ? 32.417  5.877   10.038  1.00 90.29  ? 263 TRP A CE2   1 
ATOM   396  C CE3   . TRP A 1 47 ? 34.438  5.163   11.155  1.00 90.07  ? 263 TRP A CE3   1 
ATOM   397  C CZ2   . TRP A 1 47 ? 33.127  6.699   9.169   1.00 87.81  ? 263 TRP A CZ2   1 
ATOM   398  C CZ3   . TRP A 1 47 ? 35.150  5.974   10.281  1.00 87.70  ? 263 TRP A CZ3   1 
ATOM   399  C CH2   . TRP A 1 47 ? 34.491  6.735   9.305   1.00 84.74  ? 263 TRP A CH2   1 
ATOM   400  N N     . PHE A 1 48 ? 34.656  1.537   12.206  1.00 78.04  ? 264 PHE A N     1 
ATOM   401  C CA    . PHE A 1 48 ? 35.910  1.276   11.518  1.00 83.11  ? 264 PHE A CA    1 
ATOM   402  C C     . PHE A 1 48 ? 35.832  0.010   10.676  1.00 74.77  ? 264 PHE A C     1 
ATOM   403  O O     . PHE A 1 48 ? 36.171  0.049   9.494   1.00 75.89  ? 264 PHE A O     1 
ATOM   404  C CB    . PHE A 1 48 ? 37.112  1.315   12.485  1.00 86.44  ? 264 PHE A CB    1 
ATOM   405  C CG    . PHE A 1 48 ? 37.701  2.689   12.614  1.00 84.81  ? 264 PHE A CG    1 
ATOM   406  C CD1   . PHE A 1 48 ? 36.906  3.751   13.040  1.00 81.00  ? 264 PHE A CD1   1 
ATOM   407  C CD2   . PHE A 1 48 ? 39.014  2.944   12.242  1.00 90.43  ? 264 PHE A CD2   1 
ATOM   408  C CE1   . PHE A 1 48 ? 37.410  5.034   13.138  1.00 78.81  ? 264 PHE A CE1   1 
ATOM   409  C CE2   . PHE A 1 48 ? 39.532  4.233   12.327  1.00 93.05  ? 264 PHE A CE2   1 
ATOM   410  C CZ    . PHE A 1 48 ? 38.728  5.279   12.783  1.00 87.02  ? 264 PHE A CZ    1 
ATOM   411  N N     . GLN A 1 49 ? 35.333  -1.077  11.257  1.00 72.59  ? 265 GLN A N     1 
ATOM   412  C CA    . GLN A 1 49 ? 35.128  -2.337  10.515  1.00 79.27  ? 265 GLN A CA    1 
ATOM   413  C C     . GLN A 1 49 ? 34.357  -2.107  9.208   1.00 85.22  ? 265 GLN A C     1 
ATOM   414  O O     . GLN A 1 49 ? 34.826  -2.459  8.091   1.00 90.42  ? 265 GLN A O     1 
ATOM   415  C CB    . GLN A 1 49 ? 34.369  -3.346  11.373  1.00 72.73  ? 265 GLN A CB    1 
ATOM   416  C CG    . GLN A 1 49 ? 35.217  -3.915  12.488  1.00 75.77  ? 265 GLN A CG    1 
ATOM   417  C CD    . GLN A 1 49 ? 34.450  -4.798  13.439  1.00 79.43  ? 265 GLN A CD    1 
ATOM   418  O OE1   . GLN A 1 49 ? 35.042  -5.611  14.139  1.00 77.93  ? 265 GLN A OE1   1 
ATOM   419  N NE2   . GLN A 1 49 ? 33.131  -4.649  13.473  1.00 91.09  ? 265 GLN A NE2   1 
ATOM   420  N N     . ASN A 1 50 ? 33.193  -1.475  9.372   1.00 77.36  ? 266 ASN A N     1 
ATOM   421  C CA    . ASN A 1 50 ? 32.336  -1.136  8.245   1.00 74.81  ? 266 ASN A CA    1 
ATOM   422  C C     . ASN A 1 50 ? 32.988  -0.176  7.261   1.00 81.32  ? 266 ASN A C     1 
ATOM   423  O O     . ASN A 1 50 ? 32.965  -0.407  6.034   1.00 87.85  ? 266 ASN A O     1 
ATOM   424  C CB    . ASN A 1 50 ? 31.032  -0.542  8.754   1.00 72.40  ? 266 ASN A CB    1 
ATOM   425  C CG    . ASN A 1 50 ? 30.156  -1.582  9.414   1.00 73.47  ? 266 ASN A CG    1 
ATOM   426  O OD1   . ASN A 1 50 ? 30.229  -2.785  9.078   1.00 70.00  ? 266 ASN A OD1   1 
ATOM   427  N ND2   . ASN A 1 50 ? 29.322  -1.142  10.360  1.00 74.77  ? 266 ASN A ND2   1 
ATOM   428  N N     . ARG A 1 51 ? 33.590  0.886   7.786   1.00 82.53  ? 267 ARG A N     1 
ATOM   429  C CA    . ARG A 1 51 ? 34.246  1.836   6.914   1.00 82.42  ? 267 ARG A CA    1 
ATOM   430  C C     . ARG A 1 51 ? 35.312  1.139   6.081   1.00 80.56  ? 267 ARG A C     1 
ATOM   431  O O     . ARG A 1 51 ? 35.342  1.306   4.877   1.00 92.14  ? 267 ARG A O     1 
ATOM   432  C CB    . ARG A 1 51 ? 34.826  3.010   7.689   1.00 85.17  ? 267 ARG A CB    1 
ATOM   433  C CG    . ARG A 1 51 ? 35.647  3.969   6.850   1.00 90.19  ? 267 ARG A CG    1 
ATOM   434  C CD    . ARG A 1 51 ? 34.918  4.422   5.596   1.00 93.79  ? 267 ARG A CD    1 
ATOM   435  N NE    . ARG A 1 51 ? 34.960  5.873   5.453   1.00 104.88 ? 267 ARG A NE    1 
ATOM   436  C CZ    . ARG A 1 51 ? 35.603  6.550   4.500   1.00 112.71 ? 267 ARG A CZ    1 
ATOM   437  N NH1   . ARG A 1 51 ? 36.288  5.939   3.526   1.00 106.01 ? 267 ARG A NH1   1 
ATOM   438  N NH2   . ARG A 1 51 ? 35.545  7.876   4.520   1.00 117.34 ? 267 ARG A NH2   1 
ATOM   439  N N     . ARG A 1 52 ? 36.168  0.349   6.710   1.00 79.01  ? 268 ARG A N     1 
ATOM   440  C CA    . ARG A 1 52 ? 37.048  -0.555  5.956   1.00 80.28  ? 268 ARG A CA    1 
ATOM   441  C C     . ARG A 1 52 ? 36.300  -1.364  4.905   1.00 78.41  ? 268 ARG A C     1 
ATOM   442  O O     . ARG A 1 52 ? 36.677  -1.382  3.722   1.00 73.56  ? 268 ARG A O     1 
ATOM   443  C CB    . ARG A 1 52 ? 37.715  -1.563  6.885   1.00 83.16  ? 268 ARG A CB    1 
ATOM   444  C CG    . ARG A 1 52 ? 39.136  -1.229  7.279   1.00 81.91  ? 268 ARG A CG    1 
ATOM   445  C CD    . ARG A 1 52 ? 39.558  -2.192  8.362   1.00 87.00  ? 268 ARG A CD    1 
ATOM   446  N NE    . ARG A 1 52 ? 38.965  -1.833  9.643   1.00 93.17  ? 268 ARG A NE    1 
ATOM   447  C CZ    . ARG A 1 52 ? 39.391  -2.258  10.820  1.00 100.12 ? 268 ARG A CZ    1 
ATOM   448  N NH1   . ARG A 1 52 ? 40.451  -3.066  10.929  1.00 106.05 ? 268 ARG A NH1   1 
ATOM   449  N NH2   . ARG A 1 52 ? 38.749  -1.855  11.908  1.00 109.95 ? 268 ARG A NH2   1 
ATOM   450  N N     . VAL A 1 53 ? 35.252  -2.060  5.344   1.00 80.74  ? 269 VAL A N     1 
ATOM   451  C CA    . VAL A 1 53 ? 34.519  -2.943  4.416   1.00 78.63  ? 269 VAL A CA    1 
ATOM   452  C C     . VAL A 1 53 ? 34.047  -2.196  3.151   1.00 76.15  ? 269 VAL A C     1 
ATOM   453  O O     . VAL A 1 53 ? 34.215  -2.714  2.036   1.00 76.72  ? 269 VAL A O     1 
ATOM   454  C CB    . VAL A 1 53 ? 33.396  -3.754  5.122   1.00 76.15  ? 269 VAL A CB    1 
ATOM   455  C CG1   . VAL A 1 53 ? 32.006  -3.153  4.933   1.00 79.22  ? 269 VAL A CG1   1 
ATOM   456  C CG2   . VAL A 1 53 ? 33.417  -5.196  4.634   1.00 79.44  ? 269 VAL A CG2   1 
ATOM   457  N N     . LYS A 1 54 ? 33.525  -0.977  3.344   1.00 75.05  ? 270 LYS A N     1 
ATOM   458  C CA    . LYS A 1 54 ? 33.194  -0.061  2.236   1.00 76.76  ? 270 LYS A CA    1 
ATOM   459  C C     . LYS A 1 54 ? 34.393  0.163   1.318   1.00 80.11  ? 270 LYS A C     1 
ATOM   460  O O     . LYS A 1 54 ? 34.242  0.132   0.108   1.00 91.46  ? 270 LYS A O     1 
ATOM   461  C CB    . LYS A 1 54 ? 32.634  1.285   2.764   1.00 83.49  ? 270 LYS A CB    1 
ATOM   462  C CG    . LYS A 1 54 ? 32.689  2.495   1.826   1.00 90.13  ? 270 LYS A CG    1 
ATOM   463  C CD    . LYS A 1 54 ? 34.001  3.286   1.946   1.00 103.97 ? 270 LYS A CD    1 
ATOM   464  C CE    . LYS A 1 54 ? 34.654  3.576   0.585   1.00 111.66 ? 270 LYS A CE    1 
ATOM   465  N NZ    . LYS A 1 54 ? 36.011  4.211   0.634   1.00 105.73 ? 270 LYS A NZ    1 
ATOM   466  N N     . GLU A 1 55 ? 35.573  0.406   1.876   1.00 84.25  ? 271 GLU A N     1 
ATOM   467  C CA    . GLU A 1 55 ? 36.791  0.514   1.054   1.00 90.61  ? 271 GLU A CA    1 
ATOM   468  C C     . GLU A 1 55 ? 37.059  -0.767  0.290   1.00 89.19  ? 271 GLU A C     1 
ATOM   469  O O     . GLU A 1 55 ? 37.267  -0.730  -0.920  1.00 78.90  ? 271 GLU A O     1 
ATOM   470  C CB    . GLU A 1 55 ? 38.051  0.862   1.873   1.00 93.40  ? 271 GLU A CB    1 
ATOM   471  C CG    . GLU A 1 55 ? 38.588  2.269   1.624   1.00 95.86  ? 271 GLU A CG    1 
ATOM   472  C CD    . GLU A 1 55 ? 40.100  2.389   1.675   1.00 92.92  ? 271 GLU A CD    1 
ATOM   473  O OE1   . GLU A 1 55 ? 40.815  1.368   1.607   1.00 84.76  ? 271 GLU A OE1   1 
ATOM   474  O OE2   . GLU A 1 55 ? 40.564  3.544   1.762   1.00 92.28  ? 271 GLU A OE2   1 
ATOM   475  N N     . LYS A 1 56 ? 37.063  -1.896  0.994   1.00 89.78  ? 272 LYS A N     1 
ATOM   476  C CA    . LYS A 1 56 ? 37.307  -3.161  0.308   1.00 96.58  ? 272 LYS A CA    1 
ATOM   477  C C     . LYS A 1 56 ? 36.336  -3.345  -0.864  1.00 102.08 ? 272 LYS A C     1 
ATOM   478  O O     . LYS A 1 56 ? 36.773  -3.616  -1.997  1.00 106.95 ? 272 LYS A O     1 
ATOM   479  C CB    . LYS A 1 56 ? 37.256  -4.358  1.257   1.00 98.80  ? 272 LYS A CB    1 
ATOM   480  C CG    . LYS A 1 56 ? 38.635  -4.897  1.641   1.00 109.17 ? 272 LYS A CG    1 
ATOM   481  C CD    . LYS A 1 56 ? 38.718  -6.420  1.512   1.00 123.96 ? 272 LYS A CD    1 
ATOM   482  C CE    . LYS A 1 56 ? 40.132  -6.906  1.212   1.00 130.35 ? 272 LYS A CE    1 
ATOM   483  N NZ    . LYS A 1 56 ? 40.186  -8.391  1.069   1.00 130.27 ? 272 LYS A NZ    1 
ATOM   484  N N     . LYS A 1 57 ? 35.041  -3.135  -0.614  1.00 110.03 ? 273 LYS A N     1 
ATOM   485  C CA    . LYS A 1 57 ? 34.030  -3.275  -1.689  1.00 107.10 ? 273 LYS A CA    1 
ATOM   486  C C     . LYS A 1 57 ? 34.367  -2.527  -2.985  1.00 104.69 ? 273 LYS A C     1 
ATOM   487  O O     . LYS A 1 57 ? 34.144  -3.058  -4.071  1.00 116.53 ? 273 LYS A O     1 
ATOM   488  C CB    . LYS A 1 57 ? 32.618  -2.891  -1.213  1.00 112.55 ? 273 LYS A CB    1 
ATOM   489  C CG    . LYS A 1 57 ? 31.743  -4.073  -0.789  1.00 122.44 ? 273 LYS A CG    1 
ATOM   490  C CD    . LYS A 1 57 ? 32.079  -4.627  0.591   1.00 129.02 ? 273 LYS A CD    1 
ATOM   491  C CE    . LYS A 1 57 ? 31.175  -5.809  0.938   1.00 139.02 ? 273 LYS A CE    1 
ATOM   492  N NZ    . LYS A 1 57 ? 31.117  -6.146  2.394   1.00 139.54 ? 273 LYS A NZ    1 
ATOM   493  N N     . VAL A 1 58 ? 34.939  -1.328  -2.871  1.00 100.36 ? 274 VAL A N     1 
ATOM   494  C CA    . VAL A 1 58 ? 35.330  -0.513  -4.051  1.00 94.16  ? 274 VAL A CA    1 
ATOM   495  C C     . VAL A 1 58 ? 36.580  -1.047  -4.797  1.00 93.48  ? 274 VAL A C     1 
ATOM   496  O O     . VAL A 1 58 ? 36.962  -0.469  -5.806  1.00 98.61  ? 274 VAL A O     1 
ATOM   497  C CB    . VAL A 1 58 ? 35.492  0.999   -3.668  1.00 91.92  ? 274 VAL A CB    1 
ATOM   498  C CG1   . VAL A 1 58 ? 36.011  1.866   -4.814  1.00 94.34  ? 274 VAL A CG1   1 
ATOM   499  C CG2   . VAL A 1 58 ? 34.164  1.578   -3.188  1.00 91.53  ? 274 VAL A CG2   1 
ATOM   500  N N     . LEU A 1 59 ? 37.218  -2.129  -4.334  1.00 95.07  ? 275 LEU A N     1 
ATOM   501  C CA    . LEU A 1 59 ? 38.268  -2.788  -5.138  1.00 97.43  ? 275 LEU A CA    1 
ATOM   502  C C     . LEU A 1 59 ? 37.718  -4.100  -5.716  1.00 102.05 ? 275 LEU A C     1 
ATOM   503  O O     . LEU A 1 59 ? 38.180  -5.180  -5.363  1.00 102.79 ? 275 LEU A O     1 
ATOM   504  C CB    . LEU A 1 59 ? 39.535  -3.021  -4.303  1.00 100.15 ? 275 LEU A CB    1 
ATOM   505  C CG    . LEU A 1 59 ? 40.414  -1.820  -3.885  1.00 103.10 ? 275 LEU A CG    1 
ATOM   506  C CD1   . LEU A 1 59 ? 39.632  -0.546  -3.656  1.00 105.96 ? 275 LEU A CD1   1 
ATOM   507  C CD2   . LEU A 1 59 ? 41.228  -2.105  -2.627  1.00 100.46 ? 275 LEU A CD2   1 
ATOM   508  N N     . ALA A 1 60 ? 36.746  -3.988  -6.625  1.00 107.78 ? 276 ALA A N     1 
ATOM   509  C CA    . ALA A 1 60 ? 35.986  -5.149  -7.104  1.00 124.69 ? 276 ALA A CA    1 
ATOM   510  C C     . ALA A 1 60 ? 35.720  -5.198  -8.633  1.00 136.42 ? 276 ALA A C     1 
ATOM   511  O O     . ALA A 1 60 ? 36.415  -5.935  -9.346  1.00 133.42 ? 276 ALA A O     1 
ATOM   512  C CB    . ALA A 1 60 ? 34.684  -5.261  -6.319  1.00 127.58 ? 276 ALA A CB    1 
ATOM   513  N N     . LYS A 1 61 ? 34.723  -4.450  -9.130  1.00 147.29 ? 277 LYS A N     1 
ATOM   514  C CA    . LYS A 1 61 ? 34.299  -4.544  -10.556 1.00 158.39 ? 277 LYS A CA    1 
ATOM   515  C C     . LYS A 1 61 ? 35.214  -3.720  -11.477 1.00 171.53 ? 277 LYS A C     1 
ATOM   516  O O     . LYS A 1 61 ? 35.660  -2.630  -11.100 1.00 168.74 ? 277 LYS A O     1 
ATOM   517  C CB    . LYS A 1 61 ? 32.801  -4.155  -10.779 1.00 144.83 ? 277 LYS A CB    1 
ATOM   518  C CG    . LYS A 1 61 ? 31.876  -5.285  -11.259 1.00 132.42 ? 277 LYS A CG    1 
ATOM   519  C CD    . LYS A 1 61 ? 32.382  -5.968  -12.536 1.00 126.32 ? 277 LYS A CD    1 
ATOM   520  C CE    . LYS A 1 61 ? 31.434  -7.026  -13.085 1.00 124.74 ? 277 LYS A CE    1 
ATOM   521  N NZ    . LYS A 1 61 ? 30.628  -6.537  -14.242 1.00 120.19 ? 277 LYS A NZ    1 
ATOM   522  N N     . VAL A 1 62 ? 35.454  -4.242  -12.688 1.00 175.11 ? 278 VAL A N     1 
ATOM   523  C CA    . VAL A 1 62 ? 36.445  -3.698  -13.637 1.00 164.65 ? 278 VAL A CA    1 
ATOM   524  C C     . VAL A 1 62 ? 35.811  -2.761  -14.673 1.00 168.16 ? 278 VAL A C     1 
ATOM   525  O O     . VAL A 1 62 ? 34.709  -2.999  -15.167 1.00 170.92 ? 278 VAL A O     1 
ATOM   526  C CB    . VAL A 1 62 ? 37.229  -4.833  -14.357 1.00 157.62 ? 278 VAL A CB    1 
ATOM   527  C CG1   . VAL A 1 62 ? 38.446  -4.276  -15.096 1.00 146.32 ? 278 VAL A CG1   1 
ATOM   528  C CG2   . VAL A 1 62 ? 37.656  -5.918  -13.367 1.00 155.98 ? 278 VAL A CG2   1 
ATOM   529  P P     . DA  B 2 1  ? 14.759  -2.019  -6.504  1.00 245.56 ? 20  DA  C P     1 
ATOM   530  O OP1   . DA  B 2 1  ? 14.375  -3.087  -5.545  1.00 263.29 ? 20  DA  C OP1   1 
ATOM   531  O OP2   . DA  B 2 1  ? 14.193  -2.013  -7.880  1.00 236.63 ? 20  DA  C OP2   1 
ATOM   532  O "O5'" . DA  B 2 1  ? 16.349  -1.928  -6.573  1.00 194.59 ? 20  DA  C "O5'" 1 
ATOM   533  C "C5'" . DA  B 2 1  ? 16.993  -1.280  -7.681  1.00 155.33 ? 20  DA  C "C5'" 1 
ATOM   534  C "C4'" . DA  B 2 1  ? 18.242  -0.558  -7.236  1.00 138.66 ? 20  DA  C "C4'" 1 
ATOM   535  O "O4'" . DA  B 2 1  ? 17.927  0.371   -6.178  1.00 129.29 ? 20  DA  C "O4'" 1 
ATOM   536  C "C3'" . DA  B 2 1  ? 19.365  -1.432  -6.689  1.00 127.19 ? 20  DA  C "C3'" 1 
ATOM   537  O "O3'" . DA  B 2 1  ? 20.559  -0.781  -7.137  1.00 123.46 ? 20  DA  C "O3'" 1 
ATOM   538  C "C2'" . DA  B 2 1  ? 19.126  -1.400  -5.189  1.00 120.21 ? 20  DA  C "C2'" 1 
ATOM   539  C "C1'" . DA  B 2 1  ? 18.597  0.009   -4.976  1.00 121.45 ? 20  DA  C "C1'" 1 
ATOM   540  N N9    . DA  B 2 1  ? 17.650  0.195   -3.871  1.00 111.36 ? 20  DA  C N9    1 
ATOM   541  C C8    . DA  B 2 1  ? 16.639  -0.635  -3.447  1.00 104.14 ? 20  DA  C C8    1 
ATOM   542  N N7    . DA  B 2 1  ? 15.939  -0.147  -2.450  1.00 92.47  ? 20  DA  C N7    1 
ATOM   543  C C5    . DA  B 2 1  ? 16.518  1.091   -2.211  1.00 91.67  ? 20  DA  C C5    1 
ATOM   544  C C6    . DA  B 2 1  ? 16.234  2.104   -1.280  1.00 93.36  ? 20  DA  C C6    1 
ATOM   545  N N6    . DA  B 2 1  ? 15.263  2.020   -0.368  1.00 92.64  ? 20  DA  C N6    1 
ATOM   546  N N1    . DA  B 2 1  ? 17.008  3.212   -1.302  1.00 93.71  ? 20  DA  C N1    1 
ATOM   547  C C2    . DA  B 2 1  ? 17.985  3.297   -2.214  1.00 92.88  ? 20  DA  C C2    1 
ATOM   548  N N3    . DA  B 2 1  ? 18.351  2.411   -3.137  1.00 97.89  ? 20  DA  C N3    1 
ATOM   549  C C4    . DA  B 2 1  ? 17.568  1.318   -3.083  1.00 97.84  ? 20  DA  C C4    1 
ATOM   550  P P     . DT  B 2 2  ? 21.990  -1.253  -6.636  1.00 115.87 ? 21  DT  C P     1 
ATOM   551  O OP1   . DT  B 2 2  ? 22.970  -0.971  -7.720  1.00 101.18 ? 21  DT  C OP1   1 
ATOM   552  O OP2   . DT  B 2 2  ? 21.855  -2.636  -6.123  1.00 107.58 ? 21  DT  C OP2   1 
ATOM   553  O "O5'" . DT  B 2 2  ? 22.274  -0.219  -5.456  1.00 127.54 ? 21  DT  C "O5'" 1 
ATOM   554  C "C5'" . DT  B 2 2  ? 22.243  1.195   -5.746  1.00 124.87 ? 21  DT  C "C5'" 1 
ATOM   555  C "C4'" . DT  B 2 2  ? 22.836  2.020   -4.627  1.00 118.69 ? 21  DT  C "C4'" 1 
ATOM   556  O "O4'" . DT  B 2 2  ? 21.877  2.158   -3.552  1.00 122.95 ? 21  DT  C "O4'" 1 
ATOM   557  C "C3'" . DT  B 2 2  ? 24.115  1.475   -3.990  1.00 113.05 ? 21  DT  C "C3'" 1 
ATOM   558  O "O3'" . DT  B 2 2  ? 24.997  2.598   -3.852  1.00 111.75 ? 21  DT  C "O3'" 1 
ATOM   559  C "C2'" . DT  B 2 2  ? 23.611  0.800   -2.721  1.00 108.33 ? 21  DT  C "C2'" 1 
ATOM   560  C "C1'" . DT  B 2 2  ? 22.426  1.674   -2.333  1.00 107.28 ? 21  DT  C "C1'" 1 
ATOM   561  N N1    . DT  B 2 2  ? 21.324  1.047   -1.563  1.00 92.40  ? 21  DT  C N1    1 
ATOM   562  C C2    . DT  B 2 2  ? 20.726  1.800   -0.573  1.00 85.04  ? 21  DT  C C2    1 
ATOM   563  O O2    . DT  B 2 2  ? 21.097  2.923   -0.271  1.00 82.32  ? 21  DT  C O2    1 
ATOM   564  N N3    . DT  B 2 2  ? 19.704  1.167   0.090   1.00 85.52  ? 21  DT  C N3    1 
ATOM   565  C C4    . DT  B 2 2  ? 19.194  -0.092  -0.166  1.00 87.39  ? 21  DT  C C4    1 
ATOM   566  O O4    . DT  B 2 2  ? 18.252  -0.518  0.505   1.00 85.55  ? 21  DT  C O4    1 
ATOM   567  C C5    . DT  B 2 2  ? 19.859  -0.821  -1.232  1.00 84.90  ? 21  DT  C C5    1 
ATOM   568  C C7    . DT  B 2 2  ? 19.398  -2.205  -1.568  1.00 86.25  ? 21  DT  C C7    1 
ATOM   569  C C6    . DT  B 2 2  ? 20.865  -0.215  -1.878  1.00 83.23  ? 21  DT  C C6    1 
ATOM   570  P P     . DT  B 2 3  ? 26.318  2.531   -2.943  1.00 113.27 ? 22  DT  C P     1 
ATOM   571  O OP1   . DT  B 2 3  ? 27.275  3.544   -3.454  1.00 106.35 ? 22  DT  C OP1   1 
ATOM   572  O OP2   . DT  B 2 3  ? 26.741  1.110   -2.810  1.00 105.69 ? 22  DT  C OP2   1 
ATOM   573  O "O5'" . DT  B 2 3  ? 25.789  3.063   -1.539  1.00 118.64 ? 22  DT  C "O5'" 1 
ATOM   574  C "C5'" . DT  B 2 3  ? 25.128  4.340   -1.428  1.00 106.49 ? 22  DT  C "C5'" 1 
ATOM   575  C "C4'" . DT  B 2 3  ? 24.884  4.657   0.028   1.00 101.99 ? 22  DT  C "C4'" 1 
ATOM   576  O "O4'" . DT  B 2 3  ? 23.831  3.817   0.568   1.00 94.21  ? 22  DT  C "O4'" 1 
ATOM   577  C "C3'" . DT  B 2 3  ? 26.101  4.422   0.923   1.00 101.63 ? 22  DT  C "C3'" 1 
ATOM   578  O "O3'" . DT  B 2 3  ? 26.237  5.547   1.800   1.00 104.22 ? 22  DT  C "O3'" 1 
ATOM   579  C "C2'" . DT  B 2 3  ? 25.796  3.084   1.584   1.00 91.32  ? 22  DT  C "C2'" 1 
ATOM   580  C "C1'" . DT  B 2 3  ? 24.295  3.191   1.754   1.00 87.02  ? 22  DT  C "C1'" 1 
ATOM   581  N N1    . DT  B 2 3  ? 23.509  1.955   1.946   1.00 71.69  ? 22  DT  C N1    1 
ATOM   582  C C2    . DT  B 2 3  ? 22.521  1.980   2.904   1.00 73.98  ? 22  DT  C C2    1 
ATOM   583  O O2    . DT  B 2 3  ? 22.317  2.943   3.623   1.00 99.08  ? 22  DT  C O2    1 
ATOM   584  N N3    . DT  B 2 3  ? 21.793  0.823   3.009   1.00 68.95  ? 22  DT  C N3    1 
ATOM   585  C C4    . DT  B 2 3  ? 21.930  -0.318  2.246   1.00 74.87  ? 22  DT  C C4    1 
ATOM   586  O O4    . DT  B 2 3  ? 21.194  -1.279  2.447   1.00 77.48  ? 22  DT  C O4    1 
ATOM   587  C C5    . DT  B 2 3  ? 22.985  -0.278  1.262   1.00 75.60  ? 22  DT  C C5    1 
ATOM   588  C C7    . DT  B 2 3  ? 23.218  -1.479  0.402   1.00 80.99  ? 22  DT  C C7    1 
ATOM   589  C C6    . DT  B 2 3  ? 23.702  0.848   1.151   1.00 74.01  ? 22  DT  C C6    1 
ATOM   590  P P     . DT  B 2 4  ? 27.411  5.571   2.884   1.00 112.55 ? 23  DT  C P     1 
ATOM   591  O OP1   . DT  B 2 4  ? 27.953  6.972   2.966   1.00 78.85  ? 23  DT  C OP1   1 
ATOM   592  O OP2   . DT  B 2 4  ? 28.331  4.426   2.582   1.00 83.06  ? 23  DT  C OP2   1 
ATOM   593  O "O5'" . DT  B 2 4  ? 26.609  5.267   4.227   1.00 101.33 ? 23  DT  C "O5'" 1 
ATOM   594  C "C5'" . DT  B 2 4  ? 25.528  6.131   4.628   1.00 100.27 ? 23  DT  C "C5'" 1 
ATOM   595  C "C4'" . DT  B 2 4  ? 24.883  5.621   5.894   1.00 96.08  ? 23  DT  C "C4'" 1 
ATOM   596  O "O4'" . DT  B 2 4  ? 24.270  4.330   5.654   1.00 88.14  ? 23  DT  C "O4'" 1 
ATOM   597  C "C3'" . DT  B 2 4  ? 25.853  5.414   7.055   1.00 99.22  ? 23  DT  C "C3'" 1 
ATOM   598  O "O3'" . DT  B 2 4  ? 25.241  5.844   8.274   1.00 103.82 ? 23  DT  C "O3'" 1 
ATOM   599  C "C2'" . DT  B 2 4  ? 26.106  3.917   7.032   1.00 97.96  ? 23  DT  C "C2'" 1 
ATOM   600  C "C1'" . DT  B 2 4  ? 24.749  3.397   6.599   1.00 89.48  ? 23  DT  C "C1'" 1 
ATOM   601  N N1    . DT  B 2 4  ? 24.711  2.065   5.970   1.00 83.88  ? 23  DT  C N1    1 
ATOM   602  C C2    . DT  B 2 4  ? 23.760  1.175   6.415   1.00 85.83  ? 23  DT  C C2    1 
ATOM   603  O O2    . DT  B 2 4  ? 22.972  1.434   7.309   1.00 100.12 ? 23  DT  C O2    1 
ATOM   604  N N3    . DT  B 2 4  ? 23.770  -0.042  5.777   1.00 79.78  ? 23  DT  C N3    1 
ATOM   605  C C4    . DT  B 2 4  ? 24.612  -0.443  4.760   1.00 80.50  ? 23  DT  C C4    1 
ATOM   606  O O4    . DT  B 2 4  ? 24.501  -1.569  4.284   1.00 70.68  ? 23  DT  C O4    1 
ATOM   607  C C5    . DT  B 2 4  ? 25.582  0.543   4.338   1.00 88.97  ? 23  DT  C C5    1 
ATOM   608  C C7    . DT  B 2 4  ? 26.541  0.195   3.244   1.00 98.56  ? 23  DT  C C7    1 
ATOM   609  C C6    . DT  B 2 4  ? 25.579  1.734   4.952   1.00 86.34  ? 23  DT  C C6    1 
ATOM   610  P P     . DT  B 2 5  ? 26.142  6.213   9.543   1.00 105.51 ? 24  DT  C P     1 
ATOM   611  O OP1   . DT  B 2 5  ? 26.069  7.687   9.757   1.00 94.08  ? 24  DT  C OP1   1 
ATOM   612  O OP2   . DT  B 2 5  ? 27.477  5.547   9.378   1.00 82.92  ? 24  DT  C OP2   1 
ATOM   613  O "O5'" . DT  B 2 5  ? 25.323  5.536   10.725  1.00 101.68 ? 24  DT  C "O5'" 1 
ATOM   614  C "C5'" . DT  B 2 5  ? 25.859  4.383   11.386  1.00 109.90 ? 24  DT  C "C5'" 1 
ATOM   615  C "C4'" . DT  B 2 5  ? 24.749  3.519   11.933  1.00 101.40 ? 24  DT  C "C4'" 1 
ATOM   616  O "O4'" . DT  B 2 5  ? 24.345  2.561   10.922  1.00 96.47  ? 24  DT  C "O4'" 1 
ATOM   617  C "C3'" . DT  B 2 5  ? 25.151  2.704   13.163  1.00 96.75  ? 24  DT  C "C3'" 1 
ATOM   618  O "O3'" . DT  B 2 5  ? 24.104  2.691   14.136  1.00 97.10  ? 24  DT  C "O3'" 1 
ATOM   619  C "C2'" . DT  B 2 5  ? 25.472  1.343   12.585  1.00 98.88  ? 24  DT  C "C2'" 1 
ATOM   620  C "C1'" . DT  B 2 5  ? 24.505  1.246   11.426  1.00 99.25  ? 24  DT  C "C1'" 1 
ATOM   621  N N1    . DT  B 2 5  ? 25.008  0.388   10.340  1.00 100.08 ? 24  DT  C N1    1 
ATOM   622  C C2    . DT  B 2 5  ? 24.432  -0.853  10.218  1.00 102.63 ? 24  DT  C C2    1 
ATOM   623  O O2    . DT  B 2 5  ? 23.510  -1.234  10.922  1.00 105.31 ? 24  DT  C O2    1 
ATOM   624  N N3    . DT  B 2 5  ? 24.968  -1.636  9.229   1.00 97.68  ? 24  DT  C N3    1 
ATOM   625  C C4    . DT  B 2 5  ? 26.013  -1.325  8.386   1.00 99.85  ? 24  DT  C C4    1 
ATOM   626  O O4    . DT  B 2 5  ? 26.378  -2.142  7.541   1.00 94.51  ? 24  DT  C O4    1 
ATOM   627  C C5    . DT  B 2 5  ? 26.587  -0.009  8.579   1.00 104.14 ? 24  DT  C C5    1 
ATOM   628  C C7    . DT  B 2 5  ? 27.722  0.427   7.707   1.00 107.47 ? 24  DT  C C7    1 
ATOM   629  C C6    . DT  B 2 5  ? 26.075  0.762   9.549   1.00 102.90 ? 24  DT  C C6    1 
ATOM   630  P P     . DA  B 2 6  ? 24.377  2.135   15.615  1.00 92.60  ? 25  DA  C P     1 
ATOM   631  O OP1   . DA  B 2 6  ? 23.220  2.510   16.472  1.00 78.06  ? 25  DA  C OP1   1 
ATOM   632  O OP2   . DA  B 2 6  ? 25.770  2.467   16.008  1.00 87.43  ? 25  DA  C OP2   1 
ATOM   633  O "O5'" . DA  B 2 6  ? 24.272  0.565   15.433  1.00 82.35  ? 25  DA  C "O5'" 1 
ATOM   634  C "C5'" . DA  B 2 6  ? 22.984  -0.035  15.426  1.00 79.24  ? 25  DA  C "C5'" 1 
ATOM   635  C "C4'" . DA  B 2 6  ? 23.148  -1.523  15.272  1.00 84.46  ? 25  DA  C "C4'" 1 
ATOM   636  O "O4'" . DA  B 2 6  ? 23.661  -1.848  13.951  1.00 88.00  ? 25  DA  C "O4'" 1 
ATOM   637  C "C3'" . DA  B 2 6  ? 24.089  -2.191  16.283  1.00 82.85  ? 25  DA  C "C3'" 1 
ATOM   638  O "O3'" . DA  B 2 6  ? 23.354  -3.017  17.193  1.00 81.31  ? 25  DA  C "O3'" 1 
ATOM   639  C "C2'" . DA  B 2 6  ? 25.144  -2.850  15.405  1.00 87.17  ? 25  DA  C "C2'" 1 
ATOM   640  C "C1'" . DA  B 2 6  ? 24.401  -3.036  14.096  1.00 89.38  ? 25  DA  C "C1'" 1 
ATOM   641  N N9    . DA  B 2 6  ? 25.268  -3.204  12.927  1.00 87.68  ? 25  DA  C N9    1 
ATOM   642  C C8    . DA  B 2 6  ? 26.255  -2.367  12.468  1.00 81.30  ? 25  DA  C C8    1 
ATOM   643  N N7    . DA  B 2 6  ? 26.907  -2.838  11.432  1.00 87.00  ? 25  DA  C N7    1 
ATOM   644  C C5    . DA  B 2 6  ? 26.321  -4.075  11.201  1.00 92.98  ? 25  DA  C C5    1 
ATOM   645  C C6    . DA  B 2 6  ? 26.564  -5.077  10.241  1.00 90.32  ? 25  DA  C C6    1 
ATOM   646  N N6    . DA  B 2 6  ? 27.490  -4.981  9.285   1.00 91.77  ? 25  DA  C N6    1 
ATOM   647  N N1    . DA  B 2 6  ? 25.790  -6.184  10.280  1.00 89.94  ? 25  DA  C N1    1 
ATOM   648  C C2    . DA  B 2 6  ? 24.876  -6.295  11.252  1.00 90.41  ? 25  DA  C C2    1 
ATOM   649  N N3    . DA  B 2 6  ? 24.550  -5.421  12.205  1.00 93.29  ? 25  DA  C N3    1 
ATOM   650  C C4    . DA  B 2 6  ? 25.319  -4.320  12.124  1.00 91.35  ? 25  DA  C C4    1 
ATOM   651  P P     . DT  B 2 7  ? 24.110  -3.932  18.297  1.00 89.02  ? 26  DT  C P     1 
ATOM   652  O OP1   . DT  B 2 7  ? 23.316  -3.861  19.539  1.00 73.33  ? 26  DT  C OP1   1 
ATOM   653  O OP2   . DT  B 2 7  ? 25.583  -3.625  18.295  1.00 75.55  ? 26  DT  C OP2   1 
ATOM   654  O "O5'" . DT  B 2 7  ? 23.955  -5.408  17.720  1.00 92.62  ? 26  DT  C "O5'" 1 
ATOM   655  C "C5'" . DT  B 2 7  ? 22.901  -5.729  16.797  1.00 89.73  ? 26  DT  C "C5'" 1 
ATOM   656  C "C4'" . DT  B 2 7  ? 22.991  -7.177  16.381  1.00 92.31  ? 26  DT  C "C4'" 1 
ATOM   657  O "O4'" . DT  B 2 7  ? 23.709  -7.288  15.127  1.00 91.39  ? 26  DT  C "O4'" 1 
ATOM   658  C "C3'" . DT  B 2 7  ? 23.692  -8.122  17.361  1.00 91.31  ? 26  DT  C "C3'" 1 
ATOM   659  O "O3'" . DT  B 2 7  ? 22.982  -9.357  17.399  1.00 99.97  ? 26  DT  C "O3'" 1 
ATOM   660  C "C2'" . DT  B 2 7  ? 25.056  -8.325  16.732  1.00 92.62  ? 26  DT  C "C2'" 1 
ATOM   661  C "C1'" . DT  B 2 7  ? 24.725  -8.275  15.247  1.00 92.53  ? 26  DT  C "C1'" 1 
ATOM   662  N N1    . DT  B 2 7  ? 25.840  -7.881  14.360  1.00 90.77  ? 26  DT  C N1    1 
ATOM   663  C C2    . DT  B 2 7  ? 26.234  -8.700  13.320  1.00 88.63  ? 26  DT  C C2    1 
ATOM   664  O O2    . DT  B 2 7  ? 25.731  -9.791  13.095  1.00 82.71  ? 26  DT  C O2    1 
ATOM   665  N N3    . DT  B 2 7  ? 27.255  -8.193  12.553  1.00 80.08  ? 26  DT  C N3    1 
ATOM   666  C C4    . DT  B 2 7  ? 27.920  -6.994  12.736  1.00 80.33  ? 26  DT  C C4    1 
ATOM   667  O O4    . DT  B 2 7  ? 28.827  -6.676  11.978  1.00 79.63  ? 26  DT  C O4    1 
ATOM   668  C C5    . DT  B 2 7  ? 27.446  -6.186  13.832  1.00 87.18  ? 26  DT  C C5    1 
ATOM   669  C C7    . DT  B 2 7  ? 28.092  -4.861  14.090  1.00 91.49  ? 26  DT  C C7    1 
ATOM   670  C C6    . DT  B 2 7  ? 26.442  -6.661  14.576  1.00 91.94  ? 26  DT  C C6    1 
ATOM   671  P P     . DT  B 2 8  ? 23.328  -10.469 18.481  1.00 114.91 ? 27  DT  C P     1 
ATOM   672  O OP1   . DT  B 2 8  ? 22.056  -10.813 19.173  1.00 108.66 ? 27  DT  C OP1   1 
ATOM   673  O OP2   . DT  B 2 8  ? 24.526  -10.033 19.268  1.00 105.24 ? 27  DT  C OP2   1 
ATOM   674  O "O5'" . DT  B 2 8  ? 23.860  -11.688 17.601  1.00 101.23 ? 27  DT  C "O5'" 1 
ATOM   675  C "C5'" . DT  B 2 8  ? 23.370  -11.962 16.277  1.00 100.65 ? 27  DT  C "C5'" 1 
ATOM   676  C "C4'" . DT  B 2 8  ? 24.152  -13.086 15.635  1.00 103.44 ? 27  DT  C "C4'" 1 
ATOM   677  O "O4'" . DT  B 2 8  ? 25.191  -12.541 14.784  1.00 105.48 ? 27  DT  C "O4'" 1 
ATOM   678  C "C3'" . DT  B 2 8  ? 24.854  -14.061 16.586  1.00 104.61 ? 27  DT  C "C3'" 1 
ATOM   679  O "O3'" . DT  B 2 8  ? 24.651  -15.404 16.116  1.00 104.27 ? 27  DT  C "O3'" 1 
ATOM   680  C "C2'" . DT  B 2 8  ? 26.299  -13.584 16.557  1.00 113.99 ? 27  DT  C "C2'" 1 
ATOM   681  C "C1'" . DT  B 2 8  ? 26.445  -13.130 15.115  1.00 110.73 ? 27  DT  C "C1'" 1 
ATOM   682  N N1    . DT  B 2 8  ? 27.501  -12.138 14.786  1.00 106.56 ? 27  DT  C N1    1 
ATOM   683  C C2    . DT  B 2 8  ? 28.286  -12.371 13.677  1.00 106.18 ? 27  DT  C C2    1 
ATOM   684  O O2    . DT  B 2 8  ? 28.198  -13.381 12.998  1.00 109.46 ? 27  DT  C O2    1 
ATOM   685  N N3    . DT  B 2 8  ? 29.177  -11.367 13.384  1.00 110.25 ? 27  DT  C N3    1 
ATOM   686  C C4    . DT  B 2 8  ? 29.371  -10.192 14.088  1.00 104.87 ? 27  DT  C C4    1 
ATOM   687  O O4    . DT  B 2 8  ? 30.217  -9.388  13.714  1.00 99.37  ? 27  DT  C O4    1 
ATOM   688  C C5    . DT  B 2 8  ? 28.498  -10.002 15.224  1.00 108.29 ? 27  DT  C C5    1 
ATOM   689  C C7    . DT  B 2 8  ? 28.623  -8.749  16.032  1.00 111.07 ? 27  DT  C C7    1 
ATOM   690  C C6    . DT  B 2 8  ? 27.611  -10.966 15.506  1.00 110.00 ? 27  DT  C C6    1 
ATOM   691  P P     . DG  B 2 9  ? 25.341  -16.669 16.857  1.00 116.90 ? 28  DG  C P     1 
ATOM   692  O OP1   . DG  B 2 9  ? 24.362  -17.783 16.878  1.00 109.55 ? 28  DG  C OP1   1 
ATOM   693  O OP2   . DG  B 2 9  ? 25.924  -16.219 18.149  1.00 113.96 ? 28  DG  C OP2   1 
ATOM   694  O "O5'" . DG  B 2 9  ? 26.544  -17.029 15.870  1.00 106.99 ? 28  DG  C "O5'" 1 
ATOM   695  C "C5'" . DG  B 2 9  ? 26.303  -17.597 14.567  1.00 106.58 ? 28  DG  C "C5'" 1 
ATOM   696  C "C4'" . DG  B 2 9  ? 27.563  -18.230 14.025  1.00 105.83 ? 28  DG  C "C4'" 1 
ATOM   697  O "O4'" . DG  B 2 9  ? 28.471  -17.165 13.658  1.00 104.55 ? 28  DG  C "O4'" 1 
ATOM   698  C "C3'" . DG  B 2 9  ? 28.316  -19.125 15.018  1.00 103.35 ? 28  DG  C "C3'" 1 
ATOM   699  O "O3'" . DG  B 2 9  ? 28.854  -20.350 14.473  1.00 104.77 ? 28  DG  C "O3'" 1 
ATOM   700  C "C2'" . DG  B 2 9  ? 29.381  -18.196 15.568  1.00 103.70 ? 28  DG  C "C2'" 1 
ATOM   701  C "C1'" . DG  B 2 9  ? 29.677  -17.263 14.399  1.00 105.15 ? 28  DG  C "C1'" 1 
ATOM   702  N N9    . DG  B 2 9  ? 30.080  -15.911 14.796  1.00 99.84  ? 28  DG  C N9    1 
ATOM   703  C C8    . DG  B 2 9  ? 29.611  -15.197 15.874  1.00 96.93  ? 28  DG  C C8    1 
ATOM   704  N N7    . DG  B 2 9  ? 30.170  -14.024 15.994  1.00 80.24  ? 28  DG  C N7    1 
ATOM   705  C C5    . DG  B 2 9  ? 31.062  -13.958 14.935  1.00 79.21  ? 28  DG  C C5    1 
ATOM   706  C C6    . DG  B 2 9  ? 31.945  -12.924 14.549  1.00 87.93  ? 28  DG  C C6    1 
ATOM   707  O O6    . DG  B 2 9  ? 32.117  -11.820 15.079  1.00 100.00 ? 28  DG  C O6    1 
ATOM   708  N N1    . DG  B 2 9  ? 32.667  -13.267 13.411  1.00 85.26  ? 28  DG  C N1    1 
ATOM   709  C C2    . DG  B 2 9  ? 32.576  -14.464 12.748  1.00 73.83  ? 28  DG  C C2    1 
ATOM   710  N N2    . DG  B 2 9  ? 33.369  -14.608 11.679  1.00 78.15  ? 28  DG  C N2    1 
ATOM   711  N N3    . DG  B 2 9  ? 31.759  -15.442 13.102  1.00 72.56  ? 28  DG  C N3    1 
ATOM   712  C C4    . DG  B 2 9  ? 31.031  -15.120 14.193  1.00 83.49  ? 28  DG  C C4    1 
ATOM   713  P P     . DC  B 2 10 ? 29.652  -21.419 15.441  1.00 104.84 ? 29  DC  C P     1 
ATOM   714  O OP1   . DC  B 2 10 ? 29.669  -22.756 14.781  1.00 110.51 ? 29  DC  C OP1   1 
ATOM   715  O OP2   . DC  B 2 10 ? 29.095  -21.326 16.818  1.00 93.88  ? 29  DC  C OP2   1 
ATOM   716  O "O5'" . DC  B 2 10 ? 31.123  -20.805 15.469  1.00 92.75  ? 29  DC  C "O5'" 1 
ATOM   717  C "C5'" . DC  B 2 10 ? 32.291  -21.512 15.014  1.00 88.92  ? 29  DC  C "C5'" 1 
ATOM   718  C "C4'" . DC  B 2 10 ? 33.148  -20.600 14.167  1.00 88.63  ? 29  DC  C "C4'" 1 
ATOM   719  O "O4'" . DC  B 2 10 ? 32.688  -19.239 14.285  1.00 101.15 ? 29  DC  C "O4'" 1 
ATOM   720  C "C3'" . DC  B 2 10 ? 34.614  -20.523 14.561  1.00 84.90  ? 29  DC  C "C3'" 1 
ATOM   721  O "O3'" . DC  B 2 10 ? 35.350  -21.642 14.086  1.00 87.45  ? 29  DC  C "O3'" 1 
ATOM   722  C "C2'" . DC  B 2 10 ? 35.042  -19.222 13.917  1.00 90.40  ? 29  DC  C "C2'" 1 
ATOM   723  C "C1'" . DC  B 2 10 ? 33.789  -18.361 14.029  1.00 102.19 ? 29  DC  C "C1'" 1 
ATOM   724  N N1    . DC  B 2 10 ? 33.754  -17.240 15.006  1.00 97.84  ? 29  DC  C N1    1 
ATOM   725  C C2    . DC  B 2 10 ? 34.514  -16.100 14.718  1.00 92.33  ? 29  DC  C C2    1 
ATOM   726  O O2    . DC  B 2 10 ? 35.250  -16.108 13.722  1.00 93.55  ? 29  DC  C O2    1 
ATOM   727  N N3    . DC  B 2 10 ? 34.434  -15.025 15.535  1.00 89.97  ? 29  DC  C N3    1 
ATOM   728  C C4    . DC  B 2 10 ? 33.626  -15.051 16.597  1.00 93.43  ? 29  DC  C C4    1 
ATOM   729  N N4    . DC  B 2 10 ? 33.587  -13.969 17.381  1.00 90.98  ? 29  DC  C N4    1 
ATOM   730  C C5    . DC  B 2 10 ? 32.816  -16.187 16.899  1.00 95.49  ? 29  DC  C C5    1 
ATOM   731  C C6    . DC  B 2 10 ? 32.909  -17.249 16.084  1.00 94.35  ? 29  DC  C C6    1 
ATOM   732  P P     . DA  B 2 11 ? 36.758  -22.000 14.748  1.00 102.22 ? 30  DA  C P     1 
ATOM   733  O OP1   . DA  B 2 11 ? 37.295  -23.227 14.088  1.00 96.31  ? 30  DA  C OP1   1 
ATOM   734  O OP2   . DA  B 2 11 ? 36.589  -21.991 16.242  1.00 101.43 ? 30  DA  C OP2   1 
ATOM   735  O "O5'" . DA  B 2 11 ? 37.651  -20.772 14.271  1.00 89.16  ? 30  DA  C "O5'" 1 
ATOM   736  C "C5'" . DA  B 2 11 ? 37.802  -20.462 12.877  1.00 97.58  ? 30  DA  C "C5'" 1 
ATOM   737  C "C4'" . DA  B 2 11 ? 38.577  -19.176 12.706  1.00 102.71 ? 30  DA  C "C4'" 1 
ATOM   738  O "O4'" . DA  B 2 11 ? 37.991  -18.081 13.460  1.00 102.24 ? 30  DA  C "O4'" 1 
ATOM   739  C "C3'" . DA  B 2 11 ? 40.028  -19.280 13.174  1.00 100.58 ? 30  DA  C "C3'" 1 
ATOM   740  O "O3'" . DA  B 2 11 ? 40.873  -18.634 12.224  1.00 106.34 ? 30  DA  C "O3'" 1 
ATOM   741  C "C2'" . DA  B 2 11 ? 40.006  -18.600 14.531  1.00 101.40 ? 30  DA  C "C2'" 1 
ATOM   742  C "C1'" . DA  B 2 11 ? 38.984  -17.502 14.310  1.00 94.40  ? 30  DA  C "C1'" 1 
ATOM   743  N N9    . DA  B 2 11 ? 38.328  -16.980 15.518  1.00 76.65  ? 30  DA  C N9    1 
ATOM   744  C C8    . DA  B 2 11 ? 37.440  -17.616 16.353  1.00 71.43  ? 30  DA  C C8    1 
ATOM   745  N N7    . DA  B 2 11 ? 37.025  -16.871 17.348  1.00 65.64  ? 30  DA  C N7    1 
ATOM   746  C C5    . DA  B 2 11 ? 37.696  -15.670 17.166  1.00 73.49  ? 30  DA  C C5    1 
ATOM   747  C C6    . DA  B 2 11 ? 37.684  -14.462 17.887  1.00 75.70  ? 30  DA  C C6    1 
ATOM   748  N N6    . DA  B 2 11 ? 36.940  -14.258 18.974  1.00 77.16  ? 30  DA  C N6    1 
ATOM   749  N N1    . DA  B 2 11 ? 38.449  -13.448 17.428  1.00 78.12  ? 30  DA  C N1    1 
ATOM   750  C C2    . DA  B 2 11 ? 39.205  -13.659 16.342  1.00 83.44  ? 30  DA  C C2    1 
ATOM   751  N N3    . DA  B 2 11 ? 39.296  -14.746 15.577  1.00 81.99  ? 30  DA  C N3    1 
ATOM   752  C C4    . DA  B 2 11 ? 38.506  -15.726 16.048  1.00 71.23  ? 30  DA  C C4    1 
ATOM   753  P P     . DT  B 2 12 ? 42.444  -18.836 12.302  1.00 114.00 ? 31  DT  C P     1 
ATOM   754  O OP1   . DT  B 2 12 ? 42.882  -19.512 11.051  1.00 122.21 ? 31  DT  C OP1   1 
ATOM   755  O OP2   . DT  B 2 12 ? 42.766  -19.444 13.622  1.00 87.83  ? 31  DT  C OP2   1 
ATOM   756  O "O5'" . DT  B 2 12 ? 42.988  -17.338 12.235  1.00 129.06 ? 31  DT  C "O5'" 1 
ATOM   757  C "C5'" . DT  B 2 12 ? 42.213  -16.234 12.754  1.00 129.08 ? 31  DT  C "C5'" 1 
ATOM   758  C "C4'" . DT  B 2 12 ? 43.081  -15.181 13.406  1.00 118.98 ? 31  DT  C "C4'" 1 
ATOM   759  O "O4'" . DT  B 2 12 ? 42.441  -14.712 14.618  1.00 115.78 ? 31  DT  C "O4'" 1 
ATOM   760  C "C3'" . DT  B 2 12 ? 44.489  -15.599 13.832  1.00 115.79 ? 31  DT  C "C3'" 1 
ATOM   761  O "O3'" . DT  B 2 12 ? 45.263  -14.427 13.551  1.00 120.16 ? 31  DT  C "O3'" 1 
ATOM   762  C "C2'" . DT  B 2 12 ? 44.301  -15.978 15.294  1.00 108.82 ? 31  DT  C "C2'" 1 
ATOM   763  C "C1'" . DT  B 2 12 ? 43.298  -14.927 15.740  1.00 107.19 ? 31  DT  C "C1'" 1 
ATOM   764  N N1    . DT  B 2 12 ? 42.435  -15.227 16.909  1.00 91.23  ? 31  DT  C N1    1 
ATOM   765  C C2    . DT  B 2 12 ? 42.176  -14.200 17.787  1.00 85.78  ? 31  DT  C C2    1 
ATOM   766  O O2    . DT  B 2 12 ? 42.663  -13.088 17.675  1.00 82.27  ? 31  DT  C O2    1 
ATOM   767  N N3    . DT  B 2 12 ? 41.307  -14.519 18.800  1.00 83.41  ? 31  DT  C N3    1 
ATOM   768  C C4    . DT  B 2 12 ? 40.691  -15.735 19.022  1.00 84.13  ? 31  DT  C C4    1 
ATOM   769  O O4    . DT  B 2 12 ? 39.938  -15.873 19.986  1.00 74.54  ? 31  DT  C O4    1 
ATOM   770  C C5    . DT  B 2 12 ? 40.990  -16.762 18.048  1.00 84.19  ? 31  DT  C C5    1 
ATOM   771  C C7    . DT  B 2 12 ? 40.371  -18.115 18.201  1.00 89.72  ? 31  DT  C C7    1 
ATOM   772  C C6    . DT  B 2 12 ? 41.826  -16.456 17.048  1.00 85.58  ? 31  DT  C C6    1 
ATOM   773  P P     . DT  B 2 13 ? 46.768  -14.269 14.052  1.00 119.57 ? 32  DT  C P     1 
ATOM   774  O OP1   . DT  B 2 13 ? 47.545  -13.671 12.932  1.00 113.59 ? 32  DT  C OP1   1 
ATOM   775  O OP2   . DT  B 2 13 ? 47.205  -15.558 14.670  1.00 110.08 ? 32  DT  C OP2   1 
ATOM   776  O "O5'" . DT  B 2 13 ? 46.631  -13.157 15.181  1.00 97.22  ? 32  DT  C "O5'" 1 
ATOM   777  C "C5'" . DT  B 2 13 ? 45.895  -11.952 14.922  1.00 87.84  ? 32  DT  C "C5'" 1 
ATOM   778  C "C4'" . DT  B 2 13 ? 45.837  -11.124 16.182  1.00 89.49  ? 32  DT  C "C4'" 1 
ATOM   779  O "O4'" . DT  B 2 13 ? 44.986  -11.762 17.166  1.00 85.89  ? 32  DT  C "O4'" 1 
ATOM   780  C "C3'" . DT  B 2 13 ? 47.189  -10.913 16.866  1.00 87.24  ? 32  DT  C "C3'" 1 
ATOM   781  O "O3'" . DT  B 2 13 ? 47.263  -9.528  17.215  1.00 91.33  ? 32  DT  C "O3'" 1 
ATOM   782  C "C2'" . DT  B 2 13 ? 47.145  -11.876 18.042  1.00 86.50  ? 32  DT  C "C2'" 1 
ATOM   783  C "C1'" . DT  B 2 13 ? 45.672  -11.839 18.406  1.00 85.95  ? 32  DT  C "C1'" 1 
ATOM   784  N N1    . DT  B 2 13 ? 45.103  -12.980 19.177  1.00 84.47  ? 32  DT  C N1    1 
ATOM   785  C C2    . DT  B 2 13 ? 44.217  -12.689 20.194  1.00 83.26  ? 32  DT  C C2    1 
ATOM   786  O O2    . DT  B 2 13 ? 43.910  -11.551 20.510  1.00 81.99  ? 32  DT  C O2    1 
ATOM   787  N N3    . DT  B 2 13 ? 43.709  -13.787 20.842  1.00 84.06  ? 32  DT  C N3    1 
ATOM   788  C C4    . DT  B 2 13 ? 43.975  -15.117 20.576  1.00 87.46  ? 32  DT  C C4    1 
ATOM   789  O O4    . DT  B 2 13 ? 43.434  -15.997 21.250  1.00 75.03  ? 32  DT  C O4    1 
ATOM   790  C C5    . DT  B 2 13 ? 44.910  -15.351 19.493  1.00 85.77  ? 32  DT  C C5    1 
ATOM   791  C C7    . DT  B 2 13 ? 45.264  -16.758 19.129  1.00 88.78  ? 32  DT  C C7    1 
ATOM   792  C C6    . DT  B 2 13 ? 45.415  -14.285 18.854  1.00 83.24  ? 32  DT  C C6    1 
ATOM   793  P P     . DC  B 2 14 ? 48.559  -8.930  17.932  1.00 102.25 ? 33  DC  C P     1 
ATOM   794  O OP1   . DC  B 2 14 ? 48.820  -7.592  17.345  1.00 84.00  ? 33  DC  C OP1   1 
ATOM   795  O OP2   . DC  B 2 14 ? 49.632  -9.963  17.896  1.00 104.93 ? 33  DC  C OP2   1 
ATOM   796  O "O5'" . DC  B 2 14 ? 48.050  -8.720  19.430  1.00 94.65  ? 33  DC  C "O5'" 1 
ATOM   797  C "C5'" . DC  B 2 14 ? 46.999  -7.772  19.668  1.00 96.68  ? 33  DC  C "C5'" 1 
ATOM   798  C "C4'" . DC  B 2 14 ? 46.539  -7.805  21.105  1.00 96.13  ? 33  DC  C "C4'" 1 
ATOM   799  O "O4'" . DC  B 2 14 ? 46.014  -9.104  21.466  1.00 90.86  ? 33  DC  C "O4'" 1 
ATOM   800  C "C3'" . DC  B 2 14 ? 47.625  -7.489  22.131  1.00 99.55  ? 33  DC  C "C3'" 1 
ATOM   801  O "O3'" . DC  B 2 14 ? 47.023  -6.647  23.109  1.00 104.24 ? 33  DC  C "O3'" 1 
ATOM   802  C "C2'" . DC  B 2 14 ? 47.971  -8.845  22.715  1.00 93.14  ? 33  DC  C "C2'" 1 
ATOM   803  C "C1'" . DC  B 2 14 ? 46.620  -9.526  22.680  1.00 88.59  ? 33  DC  C "C1'" 1 
ATOM   804  N N1    . DC  B 2 14 ? 46.616  -10.998 22.697  1.00 81.62  ? 33  DC  C N1    1 
ATOM   805  C C2    . DC  B 2 14 ? 45.780  -11.647 23.605  1.00 79.30  ? 33  DC  C C2    1 
ATOM   806  O O2    . DC  B 2 14 ? 45.109  -10.968 24.399  1.00 91.93  ? 33  DC  C O2    1 
ATOM   807  N N3    . DC  B 2 14 ? 45.731  -12.995 23.609  1.00 79.61  ? 33  DC  C N3    1 
ATOM   808  C C4    . DC  B 2 14 ? 46.474  -13.696 22.753  1.00 72.71  ? 33  DC  C C4    1 
ATOM   809  N N4    . DC  B 2 14 ? 46.392  -15.031 22.808  1.00 83.27  ? 33  DC  C N4    1 
ATOM   810  C C5    . DC  B 2 14 ? 47.337  -13.063 21.813  1.00 74.51  ? 33  DC  C C5    1 
ATOM   811  C C6    . DC  B 2 14 ? 47.369  -11.723 21.812  1.00 80.60  ? 33  DC  C C6    1 
ATOM   812  P P     . DC  B 2 15 ? 47.889  -6.023  24.265  1.00 94.72  ? 34  DC  C P     1 
ATOM   813  O OP1   . DC  B 2 15 ? 47.377  -4.648  24.503  1.00 89.66  ? 34  DC  C OP1   1 
ATOM   814  O OP2   . DC  B 2 15 ? 49.330  -6.253  23.943  1.00 76.61  ? 34  DC  C OP2   1 
ATOM   815  O "O5'" . DC  B 2 15 ? 47.435  -6.891  25.511  1.00 87.20  ? 34  DC  C "O5'" 1 
ATOM   816  C "C5'" . DC  B 2 15 ? 46.490  -6.367  26.455  1.00 90.77  ? 34  DC  C "C5'" 1 
ATOM   817  C "C4'" . DC  B 2 15 ? 46.499  -7.247  27.678  1.00 93.53  ? 34  DC  C "C4'" 1 
ATOM   818  O "O4'" . DC  B 2 15 ? 46.204  -8.581  27.221  1.00 83.35  ? 34  DC  C "O4'" 1 
ATOM   819  C "C3'" . DC  B 2 15 ? 47.873  -7.349  28.350  1.00 101.28 ? 34  DC  C "C3'" 1 
ATOM   820  O "O3'" . DC  B 2 15 ? 48.180  -6.433  29.426  1.00 106.89 ? 34  DC  C "O3'" 1 
ATOM   821  C "C2'" . DC  B 2 15 ? 47.923  -8.785  28.826  1.00 95.32  ? 34  DC  C "C2'" 1 
ATOM   822  C "C1'" . DC  B 2 15 ? 46.742  -9.481  28.166  1.00 88.28  ? 34  DC  C "C1'" 1 
ATOM   823  N N1    . DC  B 2 15 ? 47.122  -10.718 27.473  1.00 84.95  ? 34  DC  C N1    1 
ATOM   824  C C2    . DC  B 2 15 ? 48.057  -10.671 26.433  1.00 90.21  ? 34  DC  C C2    1 
ATOM   825  O O2    . DC  B 2 15 ? 48.500  -9.570  26.070  1.00 113.16 ? 34  DC  C O2    1 
ATOM   826  N N3    . DC  B 2 15 ? 48.450  -11.825 25.847  1.00 82.60  ? 34  DC  C N3    1 
ATOM   827  C C4    . DC  B 2 15 ? 47.957  -12.989 26.273  1.00 82.71  ? 34  DC  C C4    1 
ATOM   828  N N4    . DC  B 2 15 ? 48.362  -14.104 25.661  1.00 89.09  ? 34  DC  C N4    1 
ATOM   829  C C5    . DC  B 2 15 ? 47.013  -13.062 27.336  1.00 78.59  ? 34  DC  C C5    1 
ATOM   830  C C6    . DC  B 2 15 ? 46.644  -11.918 27.916  1.00 81.26  ? 34  DC  C C6    1 
ATOM   831  P P     . DA  B 2 16 ? 47.313  -6.383  30.791  1.00 120.21 ? 35  DA  C P     1 
ATOM   832  O OP1   . DA  B 2 16 ? 46.245  -7.413  30.737  1.00 126.22 ? 35  DA  C OP1   1 
ATOM   833  O OP2   . DA  B 2 16 ? 46.942  -4.968  31.040  1.00 132.42 ? 35  DA  C OP2   1 
ATOM   834  O "O5'" . DA  B 2 16 ? 48.366  -6.776  31.919  1.00 127.00 ? 35  DA  C "O5'" 1 
ATOM   835  C "C5'" . DA  B 2 16 ? 48.852  -8.120  32.118  1.00 123.27 ? 35  DA  C "C5'" 1 
ATOM   836  C "C4'" . DA  B 2 16 ? 47.764  -9.035  32.640  1.00 118.22 ? 35  DA  C "C4'" 1 
ATOM   837  O "O4'" . DA  B 2 16 ? 47.393  -9.989  31.616  1.00 111.13 ? 35  DA  C "O4'" 1 
ATOM   838  C "C3'" . DA  B 2 16 ? 48.172  -9.876  33.849  1.00 118.14 ? 35  DA  C "C3'" 1 
ATOM   839  O "O3'" . DA  B 2 16 ? 47.075  -10.241 34.685  1.00 107.15 ? 35  DA  C "O3'" 1 
ATOM   840  C "C2'" . DA  B 2 16 ? 48.668  -11.162 33.226  1.00 118.24 ? 35  DA  C "C2'" 1 
ATOM   841  C "C1'" . DA  B 2 16 ? 47.832  -11.298 31.970  1.00 114.33 ? 35  DA  C "C1'" 1 
ATOM   842  N N9    . DA  B 2 16 ? 48.610  -11.849 30.861  1.00 104.26 ? 35  DA  C N9    1 
ATOM   843  C C8    . DA  B 2 16 ? 49.499  -11.218 30.025  1.00 97.43  ? 35  DA  C C8    1 
ATOM   844  N N7    . DA  B 2 16 ? 50.066  -12.018 29.157  1.00 90.97  ? 35  DA  C N7    1 
ATOM   845  C C5    . DA  B 2 16 ? 49.552  -13.267 29.470  1.00 92.33  ? 35  DA  C C5    1 
ATOM   846  C C6    . DA  B 2 16 ? 49.764  -14.541 28.921  1.00 92.42  ? 35  DA  C C6    1 
ATOM   847  N N6    . DA  B 2 16 ? 50.585  -14.777 27.895  1.00 101.02 ? 35  DA  C N6    1 
ATOM   848  N N1    . DA  B 2 16 ? 49.082  -15.577 29.455  1.00 88.57  ? 35  DA  C N1    1 
ATOM   849  C C2    . DA  B 2 16 ? 48.264  -15.343 30.490  1.00 96.54  ? 35  DA  C C2    1 
ATOM   850  N N3    . DA  B 2 16 ? 47.984  -14.191 31.096  1.00 96.22  ? 35  DA  C N3    1 
ATOM   851  C C4    . DA  B 2 16 ? 48.666  -13.180 30.529  1.00 95.56  ? 35  DA  C C4    1 
ATOM   852  P P     . DG  B 2 17 ? 47.347  -10.762 36.157  1.00 99.52  ? 36  DG  C P     1 
ATOM   853  O OP1   . DG  B 2 17 ? 46.370  -10.098 37.051  1.00 104.23 ? 36  DG  C OP1   1 
ATOM   854  O OP2   . DG  B 2 17 ? 48.794  -10.628 36.437  1.00 118.97 ? 36  DG  C OP2   1 
ATOM   855  O "O5'" . DG  B 2 17 ? 47.066  -12.323 36.059  1.00 94.56  ? 36  DG  C "O5'" 1 
ATOM   856  C "C5'" . DG  B 2 17 ? 45.801  -12.872 36.465  1.00 103.77 ? 36  DG  C "C5'" 1 
ATOM   857  C "C4'" . DG  B 2 17 ? 45.928  -14.352 36.744  1.00 110.15 ? 36  DG  C "C4'" 1 
ATOM   858  O "O4'" . DG  B 2 17 ? 46.605  -15.023 35.655  1.00 103.69 ? 36  DG  C "O4'" 1 
ATOM   859  C "C3'" . DG  B 2 17 ? 46.720  -14.714 38.000  1.00 108.51 ? 36  DG  C "C3'" 1 
ATOM   860  O "O3'" . DG  B 2 17 ? 46.118  -15.912 38.518  1.00 121.55 ? 36  DG  C "O3'" 1 
ATOM   861  C "C2'" . DG  B 2 17 ? 48.118  -14.937 37.459  1.00 104.97 ? 36  DG  C "C2'" 1 
ATOM   862  C "C1'" . DG  B 2 17 ? 47.824  -15.596 36.116  1.00 99.39  ? 36  DG  C "C1'" 1 
ATOM   863  N N9    . DG  B 2 17 ? 48.820  -15.382 35.075  1.00 91.21  ? 36  DG  C N9    1 
ATOM   864  C C8    . DG  B 2 17 ? 49.378  -14.183 34.701  1.00 89.49  ? 36  DG  C C8    1 
ATOM   865  N N7    . DG  B 2 17 ? 50.213  -14.294 33.703  1.00 82.21  ? 36  DG  C N7    1 
ATOM   866  C C5    . DG  B 2 17 ? 50.189  -15.645 33.386  1.00 76.79  ? 36  DG  C C5    1 
ATOM   867  C C6    . DG  B 2 17 ? 50.893  -16.366 32.390  1.00 71.79  ? 36  DG  C C6    1 
ATOM   868  O O6    . DG  B 2 17 ? 51.690  -15.940 31.545  1.00 73.02  ? 36  DG  C O6    1 
ATOM   869  N N1    . DG  B 2 17 ? 50.568  -17.716 32.413  1.00 76.43  ? 36  DG  C N1    1 
ATOM   870  C C2    . DG  B 2 17 ? 49.687  -18.306 33.285  1.00 87.00  ? 36  DG  C C2    1 
ATOM   871  N N2    . DG  B 2 17 ? 49.516  -19.632 33.145  1.00 90.50  ? 36  DG  C N2    1 
ATOM   872  N N3    . DG  B 2 17 ? 49.023  -17.646 34.222  1.00 83.35  ? 36  DG  C N3    1 
ATOM   873  C C4    . DG  B 2 17 ? 49.320  -16.327 34.214  1.00 84.37  ? 36  DG  C C4    1 
ATOM   874  P P     . DT  B 2 18 ? 46.436  -16.446 39.986  1.00 99.64  ? 37  DT  C P     1 
ATOM   875  O OP1   . DT  B 2 18 ? 45.279  -17.243 40.456  1.00 106.47 ? 37  DT  C OP1   1 
ATOM   876  O OP2   . DT  B 2 18 ? 46.908  -15.310 40.800  1.00 111.26 ? 37  DT  C OP2   1 
ATOM   877  O "O5'" . DT  B 2 18 ? 47.618  -17.480 39.728  1.00 125.66 ? 37  DT  C "O5'" 1 
ATOM   878  C "C5'" . DT  B 2 18 ? 47.342  -18.838 39.327  1.00 132.02 ? 37  DT  C "C5'" 1 
ATOM   879  C "C4'" . DT  B 2 18 ? 48.621  -19.555 38.957  1.00 137.83 ? 37  DT  C "C4'" 1 
ATOM   880  O "O4'" . DT  B 2 18 ? 49.143  -19.070 37.705  1.00 138.17 ? 37  DT  C "O4'" 1 
ATOM   881  C "C3'" . DT  B 2 18 ? 49.790  -19.423 39.930  1.00 129.70 ? 37  DT  C "C3'" 1 
ATOM   882  O "O3'" . DT  B 2 18 ? 49.661  -20.321 41.042  1.00 117.87 ? 37  DT  C "O3'" 1 
ATOM   883  C "C2'" . DT  B 2 18 ? 50.986  -19.749 39.048  1.00 124.10 ? 37  DT  C "C2'" 1 
ATOM   884  C "C1'" . DT  B 2 18 ? 50.489  -19.516 37.610  1.00 126.35 ? 37  DT  C "C1'" 1 
ATOM   885  N N1    . DT  B 2 18 ? 51.266  -18.492 36.881  1.00 109.14 ? 37  DT  C N1    1 
ATOM   886  C C2    . DT  B 2 18 ? 52.062  -18.881 35.824  1.00 106.81 ? 37  DT  C C2    1 
ATOM   887  O O2    . DT  B 2 18 ? 52.124  -20.032 35.422  1.00 117.80 ? 37  DT  C O2    1 
ATOM   888  N N3    . DT  B 2 18 ? 52.767  -17.862 35.232  1.00 100.43 ? 37  DT  C N3    1 
ATOM   889  C C4    . DT  B 2 18 ? 52.777  -16.530 35.605  1.00 96.50  ? 37  DT  C C4    1 
ATOM   890  O O4    . DT  B 2 18 ? 53.472  -15.726 34.987  1.00 98.39  ? 37  DT  C O4    1 
ATOM   891  C C5    . DT  B 2 18 ? 51.934  -16.199 36.732  1.00 88.65  ? 37  DT  C C5    1 
ATOM   892  C C7    . DT  B 2 18 ? 51.871  -14.781 37.199  1.00 89.90  ? 37  DT  C C7    1 
ATOM   893  C C6    . DT  B 2 18 ? 51.236  -17.184 37.308  1.00 93.07  ? 37  DT  C C6    1 
ATOM   894  P P     . DA  C 3 1  ? 60.455  -18.305 28.482  1.00 241.99 ? 1   DA  F P     1 
ATOM   895  O OP1   . DA  C 3 1  ? 61.688  -18.359 27.654  1.00 240.80 ? 1   DA  F OP1   1 
ATOM   896  O OP2   . DA  C 3 1  ? 59.560  -17.121 28.390  1.00 230.03 ? 1   DA  F OP2   1 
ATOM   897  O "O5'" . DA  C 3 1  ? 59.609  -19.633 28.223  1.00 224.72 ? 1   DA  F "O5'" 1 
ATOM   898  C "C5'" . DA  C 3 1  ? 60.179  -20.943 28.437  1.00 199.24 ? 1   DA  F "C5'" 1 
ATOM   899  C "C4'" . DA  C 3 1  ? 59.103  -21.952 28.773  1.00 183.69 ? 1   DA  F "C4'" 1 
ATOM   900  O "O4'" . DA  C 3 1  ? 58.243  -21.438 29.820  1.00 169.58 ? 1   DA  F "O4'" 1 
ATOM   901  C "C3'" . DA  C 3 1  ? 58.174  -22.329 27.619  1.00 175.85 ? 1   DA  F "C3'" 1 
ATOM   902  O "O3'" . DA  C 3 1  ? 57.890  -23.734 27.709  1.00 178.19 ? 1   DA  F "O3'" 1 
ATOM   903  C "C2'" . DA  C 3 1  ? 56.973  -21.422 27.836  1.00 165.71 ? 1   DA  F "C2'" 1 
ATOM   904  C "C1'" . DA  C 3 1  ? 56.905  -21.303 29.354  1.00 147.95 ? 1   DA  F "C1'" 1 
ATOM   905  N N9    . DA  C 3 1  ? 56.388  -20.032 29.866  1.00 122.41 ? 1   DA  F N9    1 
ATOM   906  C C8    . DA  C 3 1  ? 56.679  -18.768 29.411  1.00 124.72 ? 1   DA  F C8    1 
ATOM   907  N N7    . DA  C 3 1  ? 56.099  -17.813 30.098  1.00 117.06 ? 1   DA  F N7    1 
ATOM   908  C C5    . DA  C 3 1  ? 55.392  -18.491 31.081  1.00 110.19 ? 1   DA  F C5    1 
ATOM   909  C C6    . DA  C 3 1  ? 54.557  -18.045 32.124  1.00 103.66 ? 1   DA  F C6    1 
ATOM   910  N N6    . DA  C 3 1  ? 54.296  -16.757 32.362  1.00 98.10  ? 1   DA  F N6    1 
ATOM   911  N N1    . DA  C 3 1  ? 54.007  -18.979 32.932  1.00 105.02 ? 1   DA  F N1    1 
ATOM   912  C C2    . DA  C 3 1  ? 54.262  -20.274 32.682  1.00 107.65 ? 1   DA  F C2    1 
ATOM   913  N N3    . DA  C 3 1  ? 55.027  -20.815 31.732  1.00 100.22 ? 1   DA  F N3    1 
ATOM   914  C C4    . DA  C 3 1  ? 55.567  -19.859 30.955  1.00 107.56 ? 1   DA  F C4    1 
ATOM   915  P P     . DC  C 3 2  ? 56.994  -24.483 26.602  1.00 171.35 ? 2   DC  F P     1 
ATOM   916  O OP1   . DC  C 3 2  ? 57.625  -25.797 26.313  1.00 171.28 ? 2   DC  F OP1   1 
ATOM   917  O OP2   . DC  C 3 2  ? 56.723  -23.535 25.488  1.00 166.82 ? 2   DC  F OP2   1 
ATOM   918  O "O5'" . DC  C 3 2  ? 55.643  -24.776 27.389  1.00 153.96 ? 2   DC  F "O5'" 1 
ATOM   919  C "C5'" . DC  C 3 2  ? 54.391  -24.222 26.952  1.00 147.02 ? 2   DC  F "C5'" 1 
ATOM   920  C "C4'" . DC  C 3 2  ? 53.380  -24.306 28.070  1.00 137.89 ? 2   DC  F "C4'" 1 
ATOM   921  O "O4'" . DC  C 3 2  ? 53.709  -23.365 29.118  1.00 127.66 ? 2   DC  F "O4'" 1 
ATOM   922  C "C3'" . DC  C 3 2  ? 51.952  -23.959 27.670  1.00 133.04 ? 2   DC  F "C3'" 1 
ATOM   923  O "O3'" . DC  C 3 2  ? 51.263  -25.097 27.138  1.00 118.44 ? 2   DC  F "O3'" 1 
ATOM   924  C "C2'" . DC  C 3 2  ? 51.356  -23.519 28.991  1.00 136.85 ? 2   DC  F "C2'" 1 
ATOM   925  C "C1'" . DC  C 3 2  ? 52.511  -22.825 29.679  1.00 122.77 ? 2   DC  F "C1'" 1 
ATOM   926  N N1    . DC  C 3 2  ? 52.535  -21.360 29.497  1.00 101.91 ? 2   DC  F N1    1 
ATOM   927  C C2    . DC  C 3 2  ? 51.826  -20.547 30.395  1.00 92.28  ? 2   DC  F C2    1 
ATOM   928  O O2    . DC  C 3 2  ? 51.180  -21.078 31.316  1.00 88.82  ? 2   DC  F O2    1 
ATOM   929  N N3    . DC  C 3 2  ? 51.874  -19.206 30.246  1.00 80.28  ? 2   DC  F N3    1 
ATOM   930  C C4    . DC  C 3 2  ? 52.576  -18.666 29.247  1.00 82.52  ? 2   DC  F C4    1 
ATOM   931  N N4    . DC  C 3 2  ? 52.594  -17.332 29.147  1.00 78.34  ? 2   DC  F N4    1 
ATOM   932  C C5    . DC  C 3 2  ? 53.305  -19.466 28.320  1.00 87.63  ? 2   DC  F C5    1 
ATOM   933  C C6    . DC  C 3 2  ? 53.250  -20.797 28.475  1.00 91.57  ? 2   DC  F C6    1 
ATOM   934  P P     . DT  C 3 3  ? 49.936  -24.894 26.275  1.00 100.69 ? 3   DT  F P     1 
ATOM   935  O OP1   . DT  C 3 3  ? 49.341  -26.230 26.045  1.00 101.69 ? 3   DT  F OP1   1 
ATOM   936  O OP2   . DT  C 3 3  ? 50.273  -24.020 25.122  1.00 99.07  ? 3   DT  F OP2   1 
ATOM   937  O "O5'" . DT  C 3 3  ? 48.967  -24.126 27.274  1.00 85.29  ? 3   DT  F "O5'" 1 
ATOM   938  C "C5'" . DT  C 3 3  ? 48.388  -24.833 28.383  1.00 94.28  ? 3   DT  F "C5'" 1 
ATOM   939  C "C4'" . DT  C 3 3  ? 47.687  -23.878 29.319  1.00 94.00  ? 3   DT  F "C4'" 1 
ATOM   940  O "O4'" . DT  C 3 3  ? 48.559  -22.784 29.660  1.00 96.31  ? 3   DT  F "O4'" 1 
ATOM   941  C "C3'" . DT  C 3 3  ? 46.442  -23.224 28.741  1.00 96.26  ? 3   DT  F "C3'" 1 
ATOM   942  O "O3'" . DT  C 3 3  ? 45.346  -24.110 28.970  1.00 98.37  ? 3   DT  F "O3'" 1 
ATOM   943  C "C2'" . DT  C 3 3  ? 46.348  -21.937 29.536  1.00 98.47  ? 3   DT  F "C2'" 1 
ATOM   944  C "C1'" . DT  C 3 3  ? 47.798  -21.613 29.888  1.00 94.11  ? 3   DT  F "C1'" 1 
ATOM   945  N N1    . DT  C 3 3  ? 48.374  -20.525 29.084  1.00 89.28  ? 3   DT  F N1    1 
ATOM   946  C C2    . DT  C 3 3  ? 48.053  -19.239 29.456  1.00 99.02  ? 3   DT  F C2    1 
ATOM   947  O O2    . DT  C 3 3  ? 47.351  -18.975 30.421  1.00 103.29 ? 3   DT  F O2    1 
ATOM   948  N N3    . DT  C 3 3  ? 48.617  -18.262 28.676  1.00 97.15  ? 3   DT  F N3    1 
ATOM   949  C C4    . DT  C 3 3  ? 49.407  -18.437 27.559  1.00 94.26  ? 3   DT  F C4    1 
ATOM   950  O O4    . DT  C 3 3  ? 49.826  -17.458 26.949  1.00 96.83  ? 3   DT  F O4    1 
ATOM   951  C C5    . DT  C 3 3  ? 49.694  -19.811 27.217  1.00 94.86  ? 3   DT  F C5    1 
ATOM   952  C C7    . DT  C 3 3  ? 50.562  -20.098 26.032  1.00 103.37 ? 3   DT  F C7    1 
ATOM   953  C C6    . DT  C 3 3  ? 49.167  -20.774 27.984  1.00 86.94  ? 3   DT  F C6    1 
ATOM   954  P P     . DG  C 3 4  ? 43.945  -23.870 28.257  1.00 104.20 ? 4   DG  F P     1 
ATOM   955  O OP1   . DG  C 3 4  ? 43.110  -25.075 28.502  1.00 101.00 ? 4   DG  F OP1   1 
ATOM   956  O OP2   . DG  C 3 4  ? 44.200  -23.420 26.864  1.00 86.42  ? 4   DG  F OP2   1 
ATOM   957  O "O5'" . DG  C 3 4  ? 43.328  -22.647 29.075  1.00 110.31 ? 4   DG  F "O5'" 1 
ATOM   958  C "C5'" . DG  C 3 4  ? 42.799  -22.791 30.415  1.00 116.04 ? 4   DG  F "C5'" 1 
ATOM   959  C "C4'" . DG  C 3 4  ? 42.131  -21.510 30.870  1.00 119.64 ? 4   DG  F "C4'" 1 
ATOM   960  O "O4'" . DG  C 3 4  ? 42.979  -20.376 30.567  1.00 113.73 ? 4   DG  F "O4'" 1 
ATOM   961  C "C3'" . DG  C 3 4  ? 40.774  -21.199 30.231  1.00 116.05 ? 4   DG  F "C3'" 1 
ATOM   962  O "O3'" . DG  C 3 4  ? 39.896  -20.754 31.291  1.00 113.31 ? 4   DG  F "O3'" 1 
ATOM   963  C "C2'" . DG  C 3 4  ? 41.141  -20.258 29.090  1.00 108.70 ? 4   DG  F "C2'" 1 
ATOM   964  C "C1'" . DG  C 3 4  ? 42.380  -19.530 29.594  1.00 103.95 ? 4   DG  F "C1'" 1 
ATOM   965  N N9    . DG  C 3 4  ? 43.401  -19.254 28.589  1.00 97.61  ? 4   DG  F N9    1 
ATOM   966  C C8    . DG  C 3 4  ? 43.927  -20.138 27.677  1.00 107.65 ? 4   DG  F C8    1 
ATOM   967  N N7    . DG  C 3 4  ? 44.882  -19.621 26.953  1.00 105.09 ? 4   DG  F N7    1 
ATOM   968  C C5    . DG  C 3 4  ? 45.006  -18.324 27.426  1.00 93.42  ? 4   DG  F C5    1 
ATOM   969  C C6    . DG  C 3 4  ? 45.879  -17.285 27.027  1.00 88.88  ? 4   DG  F C6    1 
ATOM   970  O O6    . DG  C 3 4  ? 46.733  -17.298 26.132  1.00 89.63  ? 4   DG  F O6    1 
ATOM   971  N N1    . DG  C 3 4  ? 45.687  -16.136 27.788  1.00 86.18  ? 4   DG  F N1    1 
ATOM   972  C C2    . DG  C 3 4  ? 44.757  -15.996 28.792  1.00 91.01  ? 4   DG  F C2    1 
ATOM   973  N N2    . DG  C 3 4  ? 44.704  -14.801 29.403  1.00 85.37  ? 4   DG  F N2    1 
ATOM   974  N N3    . DG  C 3 4  ? 43.933  -16.960 29.170  1.00 100.91 ? 4   DG  F N3    1 
ATOM   975  C C4    . DG  C 3 4  ? 44.111  -18.088 28.449  1.00 99.07  ? 4   DG  F C4    1 
ATOM   976  P P     . DG  C 3 5  ? 38.587  -19.870 30.999  1.00 104.52 ? 5   DG  F P     1 
ATOM   977  O OP1   . DG  C 3 5  ? 37.806  -19.761 32.260  1.00 93.26  ? 5   DG  F OP1   1 
ATOM   978  O OP2   . DG  C 3 5  ? 37.933  -20.405 29.779  1.00 100.99 ? 5   DG  F OP2   1 
ATOM   979  O "O5'" . DG  C 3 5  ? 39.222  -18.464 30.616  1.00 101.81 ? 5   DG  F "O5'" 1 
ATOM   980  C "C5'" . DG  C 3 5  ? 39.175  -17.322 31.477  1.00 96.71  ? 5   DG  F "C5'" 1 
ATOM   981  C "C4'" . DG  C 3 5  ? 39.334  -16.085 30.627  1.00 95.74  ? 5   DG  F "C4'" 1 
ATOM   982  O "O4'" . DG  C 3 5  ? 40.437  -16.246 29.701  1.00 96.02  ? 5   DG  F "O4'" 1 
ATOM   983  C "C3'" . DG  C 3 5  ? 38.110  -15.731 29.770  1.00 100.04 ? 5   DG  F "C3'" 1 
ATOM   984  O "O3'" . DG  C 3 5  ? 37.762  -14.391 30.142  1.00 98.10  ? 5   DG  F "O3'" 1 
ATOM   985  C "C2'" . DG  C 3 5  ? 38.595  -15.950 28.342  1.00 98.87  ? 5   DG  F "C2'" 1 
ATOM   986  C "C1'" . DG  C 3 5  ? 40.068  -15.637 28.482  1.00 93.75  ? 5   DG  F "C1'" 1 
ATOM   987  N N9    . DG  C 3 5  ? 40.955  -16.130 27.429  1.00 89.87  ? 5   DG  F N9    1 
ATOM   988  C C8    . DG  C 3 5  ? 40.984  -17.381 26.860  1.00 101.12 ? 5   DG  F C8    1 
ATOM   989  N N7    . DG  C 3 5  ? 41.895  -17.502 25.931  1.00 100.72 ? 5   DG  F N7    1 
ATOM   990  C C5    . DG  C 3 5  ? 42.498  -16.253 25.878  1.00 97.18  ? 5   DG  F C5    1 
ATOM   991  C C6    . DG  C 3 5  ? 43.561  -15.775 25.065  1.00 100.61 ? 5   DG  F C6    1 
ATOM   992  O O6    . DG  C 3 5  ? 44.204  -16.376 24.192  1.00 105.66 ? 5   DG  F O6    1 
ATOM   993  N N1    . DG  C 3 5  ? 43.859  -14.448 25.347  1.00 96.44  ? 5   DG  F N1    1 
ATOM   994  C C2    . DG  C 3 5  ? 43.236  -13.678 26.295  1.00 97.47  ? 5   DG  F C2    1 
ATOM   995  N N2    . DG  C 3 5  ? 43.680  -12.415 26.416  1.00 94.10  ? 5   DG  F N2    1 
ATOM   996  N N3    . DG  C 3 5  ? 42.239  -14.106 27.054  1.00 92.90  ? 5   DG  F N3    1 
ATOM   997  C C4    . DG  C 3 5  ? 41.926  -15.395 26.796  1.00 90.55  ? 5   DG  F C4    1 
ATOM   998  P P     . DA  C 3 6  ? 36.516  -13.623 29.508  1.00 88.80  ? 6   DA  F P     1 
ATOM   999  O OP1   . DA  C 3 6  ? 35.709  -13.083 30.628  1.00 91.72  ? 6   DA  F OP1   1 
ATOM   1000 O OP2   . DA  C 3 6  ? 35.860  -14.511 28.499  1.00 96.54  ? 6   DA  F OP2   1 
ATOM   1001 O "O5'" . DA  C 3 6  ? 37.230  -12.373 28.832  1.00 78.08  ? 6   DA  F "O5'" 1 
ATOM   1002 C "C5'" . DA  C 3 6  ? 38.124  -11.579 29.620  1.00 79.95  ? 6   DA  F "C5'" 1 
ATOM   1003 C "C4'" . DA  C 3 6  ? 38.667  -10.405 28.839  1.00 84.59  ? 6   DA  F "C4'" 1 
ATOM   1004 O "O4'" . DA  C 3 6  ? 39.623  -10.852 27.851  1.00 83.12  ? 6   DA  F "O4'" 1 
ATOM   1005 C "C3'" . DA  C 3 6  ? 37.636  -9.585  28.076  1.00 80.47  ? 6   DA  F "C3'" 1 
ATOM   1006 O "O3'" . DA  C 3 6  ? 38.086  -8.224  28.136  1.00 88.59  ? 6   DA  F "O3'" 1 
ATOM   1007 C "C2'" . DA  C 3 6  ? 37.673  -10.216 26.697  1.00 81.11  ? 6   DA  F "C2'" 1 
ATOM   1008 C "C1'" . DA  C 3 6  ? 39.135  -10.618 26.541  1.00 80.65  ? 6   DA  F "C1'" 1 
ATOM   1009 N N9    . DA  C 3 6  ? 39.394  -11.830 25.763  1.00 81.78  ? 6   DA  F N9    1 
ATOM   1010 C C8    . DA  C 3 6  ? 38.796  -13.060 25.886  1.00 84.12  ? 6   DA  F C8    1 
ATOM   1011 N N7    . DA  C 3 6  ? 39.284  -13.969 25.077  1.00 78.27  ? 6   DA  F N7    1 
ATOM   1012 C C5    . DA  C 3 6  ? 40.285  -13.300 24.391  1.00 73.63  ? 6   DA  F C5    1 
ATOM   1013 C C6    . DA  C 3 6  ? 41.192  -13.715 23.402  1.00 84.04  ? 6   DA  F C6    1 
ATOM   1014 N N6    . DA  C 3 6  ? 41.226  -14.955 22.901  1.00 81.78  ? 6   DA  F N6    1 
ATOM   1015 N N1    . DA  C 3 6  ? 42.062  -12.797 22.924  1.00 83.22  ? 6   DA  F N1    1 
ATOM   1016 C C2    . DA  C 3 6  ? 42.029  -11.554 23.428  1.00 80.76  ? 6   DA  F C2    1 
ATOM   1017 N N3    . DA  C 3 6  ? 41.227  -11.047 24.364  1.00 73.51  ? 6   DA  F N3    1 
ATOM   1018 C C4    . DA  C 3 6  ? 40.371  -11.983 24.810  1.00 74.27  ? 6   DA  F C4    1 
ATOM   1019 P P     . DA  C 3 7  ? 37.326  -7.073  27.327  1.00 94.46  ? 7   DA  F P     1 
ATOM   1020 O OP1   . DA  C 3 7  ? 37.641  -5.768  27.972  1.00 91.15  ? 7   DA  F OP1   1 
ATOM   1021 O OP2   . DA  C 3 7  ? 35.902  -7.488  27.197  1.00 82.08  ? 7   DA  F OP2   1 
ATOM   1022 O "O5'" . DA  C 3 7  ? 38.122  -7.060  25.945  1.00 75.57  ? 7   DA  F "O5'" 1 
ATOM   1023 C "C5'" . DA  C 3 7  ? 39.546  -6.855  25.952  1.00 75.69  ? 7   DA  F "C5'" 1 
ATOM   1024 C "C4'" . DA  C 3 7  ? 40.101  -6.648  24.560  1.00 76.65  ? 7   DA  F "C4'" 1 
ATOM   1025 O "O4'" . DA  C 3 7  ? 40.272  -7.898  23.852  1.00 80.23  ? 7   DA  F "O4'" 1 
ATOM   1026 C "C3'" . DA  C 3 7  ? 39.272  -5.764  23.634  1.00 73.69  ? 7   DA  F "C3'" 1 
ATOM   1027 O "O3'" . DA  C 3 7  ? 40.236  -4.986  22.923  1.00 73.87  ? 7   DA  F "O3'" 1 
ATOM   1028 C "C2'" . DA  C 3 7  ? 38.499  -6.769  22.795  1.00 75.04  ? 7   DA  F "C2'" 1 
ATOM   1029 C "C1'" . DA  C 3 7  ? 39.504  -7.900  22.642  1.00 76.50  ? 7   DA  F "C1'" 1 
ATOM   1030 N N9    . DA  C 3 7  ? 38.978  -9.255  22.478  1.00 72.20  ? 7   DA  F N9    1 
ATOM   1031 C C8    . DA  C 3 7  ? 38.009  -9.871  23.228  1.00 75.57  ? 7   DA  F C8    1 
ATOM   1032 N N7    . DA  C 3 7  ? 37.842  -11.139 22.938  1.00 74.16  ? 7   DA  F N7    1 
ATOM   1033 C C5    . DA  C 3 7  ? 38.801  -11.386 21.969  1.00 67.50  ? 7   DA  F C5    1 
ATOM   1034 C C6    . DA  C 3 7  ? 39.136  -12.540 21.249  1.00 65.28  ? 7   DA  F C6    1 
ATOM   1035 N N6    . DA  C 3 7  ? 38.527  -13.716 21.409  1.00 63.39  ? 7   DA  F N6    1 
ATOM   1036 N N1    . DA  C 3 7  ? 40.141  -12.450 20.352  1.00 72.46  ? 7   DA  F N1    1 
ATOM   1037 C C2    . DA  C 3 7  ? 40.749  -11.269 20.185  1.00 73.71  ? 7   DA  F C2    1 
ATOM   1038 N N3    . DA  C 3 7  ? 40.524  -10.112 20.803  1.00 72.33  ? 7   DA  F N3    1 
ATOM   1039 C C4    . DA  C 3 7  ? 39.519  -10.238 21.686  1.00 69.40  ? 7   DA  F C4    1 
ATOM   1040 P P     . DT  C 3 8  ? 39.771  -3.974  21.806  1.00 78.49  ? 8   DT  F P     1 
ATOM   1041 O OP1   . DT  C 3 8  ? 40.859  -2.984  21.577  1.00 77.43  ? 8   DT  F OP1   1 
ATOM   1042 O OP2   . DT  C 3 8  ? 38.405  -3.490  22.160  1.00 67.82  ? 8   DT  F OP2   1 
ATOM   1043 O "O5'" . DT  C 3 8  ? 39.842  -4.904  20.521  1.00 84.30  ? 8   DT  F "O5'" 1 
ATOM   1044 C "C5'" . DT  C 3 8  ? 41.108  -5.480  20.155  1.00 93.16  ? 8   DT  F "C5'" 1 
ATOM   1045 C "C4'" . DT  C 3 8  ? 41.026  -6.105  18.784  1.00 98.70  ? 8   DT  F "C4'" 1 
ATOM   1046 O "O4'" . DT  C 3 8  ? 40.491  -7.440  18.903  1.00 94.84  ? 8   DT  F "O4'" 1 
ATOM   1047 C "C3'" . DT  C 3 8  ? 40.134  -5.357  17.786  1.00 100.46 ? 8   DT  F "C3'" 1 
ATOM   1048 O "O3'" . DT  C 3 8  ? 40.933  -5.023  16.642  1.00 106.48 ? 8   DT  F "O3'" 1 
ATOM   1049 C "C2'" . DT  C 3 8  ? 38.934  -6.274  17.607  1.00 93.12  ? 8   DT  F "C2'" 1 
ATOM   1050 C "C1'" . DT  C 3 8  ? 39.514  -7.647  17.904  1.00 90.06  ? 8   DT  F "C1'" 1 
ATOM   1051 N N1    . DT  C 3 8  ? 38.575  -8.675  18.404  1.00 79.67  ? 8   DT  F N1    1 
ATOM   1052 C C2    . DT  C 3 8  ? 38.684  -9.943  17.882  1.00 73.70  ? 8   DT  F C2    1 
ATOM   1053 O O2    . DT  C 3 8  ? 39.477  -10.235 17.001  1.00 76.77  ? 8   DT  F O2    1 
ATOM   1054 N N3    . DT  C 3 8  ? 37.812  -10.859 18.417  1.00 71.36  ? 8   DT  F N3    1 
ATOM   1055 C C4    . DT  C 3 8  ? 36.863  -10.632 19.397  1.00 71.57  ? 8   DT  F C4    1 
ATOM   1056 O O4    . DT  C 3 8  ? 36.139  -11.547 19.773  1.00 79.83  ? 8   DT  F O4    1 
ATOM   1057 C C5    . DT  C 3 8  ? 36.829  -9.291  19.921  1.00 70.75  ? 8   DT  F C5    1 
ATOM   1058 C C7    . DT  C 3 8  ? 35.854  -8.965  21.006  1.00 76.05  ? 8   DT  F C7    1 
ATOM   1059 C C6    . DT  C 3 8  ? 37.683  -8.393  19.416  1.00 74.12  ? 8   DT  F C6    1 
ATOM   1060 P P     . DG  C 3 9  ? 40.266  -4.469  15.308  1.00 109.70 ? 9   DG  F P     1 
ATOM   1061 O OP1   . DG  C 3 9  ? 41.246  -3.570  14.642  1.00 105.90 ? 9   DG  F OP1   1 
ATOM   1062 O OP2   . DG  C 3 9  ? 38.905  -3.960  15.634  1.00 99.88  ? 9   DG  F OP2   1 
ATOM   1063 O "O5'" . DG  C 3 9  ? 40.154  -5.797  14.443  1.00 102.49 ? 9   DG  F "O5'" 1 
ATOM   1064 C "C5'" . DG  C 3 9  ? 41.288  -6.676  14.284  1.00 98.22  ? 9   DG  F "C5'" 1 
ATOM   1065 C "C4'" . DG  C 3 9  ? 40.984  -7.706  13.222  1.00 94.68  ? 9   DG  F "C4'" 1 
ATOM   1066 O "O4'" . DG  C 3 9  ? 40.238  -8.793  13.826  1.00 88.56  ? 9   DG  F "O4'" 1 
ATOM   1067 C "C3'" . DG  C 3 9  ? 40.115  -7.158  12.086  1.00 97.33  ? 9   DG  F "C3'" 1 
ATOM   1068 O "O3'" . DG  C 3 9  ? 40.570  -7.503  10.773  1.00 96.42  ? 9   DG  F "O3'" 1 
ATOM   1069 C "C2'" . DG  C 3 9  ? 38.728  -7.688  12.398  1.00 94.16  ? 9   DG  F "C2'" 1 
ATOM   1070 C "C1'" . DG  C 3 9  ? 38.988  -8.968  13.175  1.00 85.53  ? 9   DG  F "C1'" 1 
ATOM   1071 N N9    . DG  C 3 9  ? 37.980  -9.273  14.189  1.00 77.52  ? 9   DG  F N9    1 
ATOM   1072 C C8    . DG  C 3 9  ? 37.449  -8.414  15.123  1.00 81.52  ? 9   DG  F C8    1 
ATOM   1073 N N7    . DG  C 3 9  ? 36.548  -8.975  15.883  1.00 80.17  ? 9   DG  F N7    1 
ATOM   1074 C C5    . DG  C 3 9  ? 36.478  -10.283 15.423  1.00 86.98  ? 9   DG  F C5    1 
ATOM   1075 C C6    . DG  C 3 9  ? 35.694  -11.383 15.876  1.00 94.43  ? 9   DG  F C6    1 
ATOM   1076 O O6    . DG  C 3 9  ? 34.865  -11.417 16.796  1.00 101.77 ? 9   DG  F O6    1 
ATOM   1077 N N1    . DG  C 3 9  ? 35.945  -12.530 15.131  1.00 89.56  ? 9   DG  F N1    1 
ATOM   1078 C C2    . DG  C 3 9  ? 36.838  -12.617 14.094  1.00 86.85  ? 9   DG  F C2    1 
ATOM   1079 N N2    . DG  C 3 9  ? 36.934  -13.812 13.501  1.00 88.18  ? 9   DG  F N2    1 
ATOM   1080 N N3    . DG  C 3 9  ? 37.585  -11.609 13.672  1.00 84.06  ? 9   DG  F N3    1 
ATOM   1081 C C4    . DG  C 3 9  ? 37.354  -10.481 14.374  1.00 78.82  ? 9   DG  F C4    1 
ATOM   1082 P P     . DC  C 3 10 ? 39.886  -6.830  9.464   1.00 97.98  ? 10  DC  F P     1 
ATOM   1083 O OP1   . DC  C 3 10 ? 40.974  -6.459  8.519   1.00 89.34  ? 10  DC  F OP1   1 
ATOM   1084 O OP2   . DC  C 3 10 ? 38.889  -5.779  9.885   1.00 70.30  ? 10  DC  F OP2   1 
ATOM   1085 O "O5'" . DC  C 3 10 ? 39.091  -8.066  8.859   1.00 100.19 ? 10  DC  F "O5'" 1 
ATOM   1086 C "C5'" . DC  C 3 10 ? 39.577  -9.426  8.973   1.00 102.93 ? 10  DC  F "C5'" 1 
ATOM   1087 C "C4'" . DC  C 3 10 ? 38.473  -10.390 8.595   1.00 107.95 ? 10  DC  F "C4'" 1 
ATOM   1088 O "O4'" . DC  C 3 10 ? 37.686  -10.710 9.779   1.00 103.59 ? 10  DC  F "O4'" 1 
ATOM   1089 C "C3'" . DC  C 3 10 ? 37.484  -9.824  7.563   1.00 101.64 ? 10  DC  F "C3'" 1 
ATOM   1090 O "O3'" . DC  C 3 10 ? 37.018  -10.776 6.594   1.00 102.10 ? 10  DC  F "O3'" 1 
ATOM   1091 C "C2'" . DC  C 3 10 ? 36.338  -9.359  8.431   1.00 99.67  ? 10  DC  F "C2'" 1 
ATOM   1092 C "C1'" . DC  C 3 10 ? 36.325  -10.475 9.467   1.00 100.45 ? 10  DC  F "C1'" 1 
ATOM   1093 N N1    . DC  C 3 10 ? 35.590  -10.178 10.708  1.00 87.58  ? 10  DC  F N1    1 
ATOM   1094 C C2    . DC  C 3 10 ? 34.742  -11.156 11.239  1.00 91.81  ? 10  DC  F C2    1 
ATOM   1095 O O2    . DC  C 3 10 ? 34.697  -12.271 10.698  1.00 94.07  ? 10  DC  F O2    1 
ATOM   1096 N N3    . DC  C 3 10 ? 34.022  -10.874 12.350  1.00 92.12  ? 10  DC  F N3    1 
ATOM   1097 C C4    . DC  C 3 10 ? 34.096  -9.661  12.902  1.00 87.43  ? 10  DC  F C4    1 
ATOM   1098 N N4    . DC  C 3 10 ? 33.367  -9.426  13.994  1.00 95.33  ? 10  DC  F N4    1 
ATOM   1099 C C5    . DC  C 3 10 ? 34.933  -8.641  12.368  1.00 88.59  ? 10  DC  F C5    1 
ATOM   1100 C C6    . DC  C 3 10 ? 35.642  -8.933  11.271  1.00 86.85  ? 10  DC  F C6    1 
ATOM   1101 P P     . DA  C 3 11 ? 36.707  -10.302 5.085   1.00 116.84 ? 11  DA  F P     1 
ATOM   1102 O OP1   . DA  C 3 11 ? 37.881  -10.652 4.242   1.00 110.40 ? 11  DA  F OP1   1 
ATOM   1103 O OP2   . DA  C 3 11 ? 36.171  -8.908  5.125   1.00 101.55 ? 11  DA  F OP2   1 
ATOM   1104 O "O5'" . DA  C 3 11 ? 35.515  -11.244 4.618   1.00 107.07 ? 11  DA  F "O5'" 1 
ATOM   1105 C "C5'" . DA  C 3 11 ? 35.635  -12.672 4.637   1.00 111.24 ? 11  DA  F "C5'" 1 
ATOM   1106 C "C4'" . DA  C 3 11 ? 34.286  -13.250 4.992   1.00 117.97 ? 11  DA  F "C4'" 1 
ATOM   1107 O "O4'" . DA  C 3 11 ? 33.991  -12.916 6.372   1.00 114.03 ? 11  DA  F "O4'" 1 
ATOM   1108 C "C3'" . DA  C 3 11 ? 33.136  -12.698 4.137   1.00 118.45 ? 11  DA  F "C3'" 1 
ATOM   1109 O "O3'" . DA  C 3 11 ? 32.522  -13.715 3.317   1.00 112.72 ? 11  DA  F "O3'" 1 
ATOM   1110 C "C2'" . DA  C 3 11 ? 32.198  -12.045 5.138   1.00 113.35 ? 11  DA  F "C2'" 1 
ATOM   1111 C "C1'" . DA  C 3 11 ? 32.640  -12.530 6.509   1.00 116.49 ? 11  DA  F "C1'" 1 
ATOM   1112 N N9    . DA  C 3 11 ? 32.557  -11.471 7.521   1.00 118.87 ? 11  DA  F N9    1 
ATOM   1113 C C8    . DA  C 3 11 ? 33.190  -10.253 7.488   1.00 118.42 ? 11  DA  F C8    1 
ATOM   1114 N N7    . DA  C 3 11 ? 32.880  -9.468  8.491   1.00 99.13  ? 11  DA  F N7    1 
ATOM   1115 C C5    . DA  C 3 11 ? 31.957  -10.206 9.217   1.00 99.86  ? 11  DA  F C5    1 
ATOM   1116 C C6    . DA  C 3 11 ? 31.251  -9.931  10.398  1.00 104.44 ? 11  DA  F C6    1 
ATOM   1117 N N6    . DA  C 3 11 ? 31.375  -8.792  11.082  1.00 106.82 ? 11  DA  F N6    1 
ATOM   1118 N N1    . DA  C 3 11 ? 30.422  -10.887 10.873  1.00 110.61 ? 11  DA  F N1    1 
ATOM   1119 C C2    . DA  C 3 11 ? 30.289  -12.023 10.175  1.00 110.78 ? 11  DA  F C2    1 
ATOM   1120 N N3    . DA  C 3 11 ? 30.904  -12.399 9.054   1.00 111.19 ? 11  DA  F N3    1 
ATOM   1121 C C4    . DA  C 3 11 ? 31.739  -11.436 8.625   1.00 107.77 ? 11  DA  F C4    1 
ATOM   1122 P P     . DA  C 3 12 ? 31.245  -13.380 2.367   1.00 96.14  ? 12  DA  F P     1 
ATOM   1123 O OP1   . DA  C 3 12 ? 31.191  -14.415 1.311   1.00 112.29 ? 12  DA  F OP1   1 
ATOM   1124 O OP2   . DA  C 3 12 ? 31.236  -11.924 2.015   1.00 79.59  ? 12  DA  F OP2   1 
ATOM   1125 O "O5'" . DA  C 3 12 ? 30.005  -13.639 3.321   1.00 85.57  ? 12  DA  F "O5'" 1 
ATOM   1126 C "C5'" . DA  C 3 12 ? 30.007  -14.784 4.189   1.00 102.23 ? 12  DA  F "C5'" 1 
ATOM   1127 C "C4'" . DA  C 3 12 ? 28.764  -14.753 5.043   1.00 107.53 ? 12  DA  F "C4'" 1 
ATOM   1128 O "O4'" . DA  C 3 12 ? 28.986  -13.879 6.176   1.00 108.85 ? 12  DA  F "O4'" 1 
ATOM   1129 C "C3'" . DA  C 3 12 ? 27.530  -14.209 4.320   1.00 116.14 ? 12  DA  F "C3'" 1 
ATOM   1130 O "O3'" . DA  C 3 12 ? 26.370  -14.987 4.606   1.00 124.72 ? 12  DA  F "O3'" 1 
ATOM   1131 C "C2'" . DA  C 3 12 ? 27.376  -12.807 4.872   1.00 105.24 ? 12  DA  F "C2'" 1 
ATOM   1132 C "C1'" . DA  C 3 12 ? 27.911  -12.967 6.279   1.00 103.48 ? 12  DA  F "C1'" 1 
ATOM   1133 N N9    . DA  C 3 12 ? 28.413  -11.713 6.834   1.00 101.61 ? 12  DA  F N9    1 
ATOM   1134 C C8    . DA  C 3 12 ? 29.353  -10.875 6.287   1.00 94.74  ? 12  DA  F C8    1 
ATOM   1135 N N7    . DA  C 3 12 ? 29.554  -9.783  6.981   1.00 91.67  ? 12  DA  F N7    1 
ATOM   1136 C C5    . DA  C 3 12 ? 28.673  -9.900  8.046   1.00 87.76  ? 12  DA  F C5    1 
ATOM   1137 C C6    . DA  C 3 12 ? 28.384  -9.053  9.122   1.00 81.34  ? 12  DA  F C6    1 
ATOM   1138 N N6    . DA  C 3 12 ? 29.004  -7.893  9.322   1.00 83.91  ? 12  DA  F N6    1 
ATOM   1139 N N1    . DA  C 3 12 ? 27.468  -9.469  10.025  1.00 83.43  ? 12  DA  F N1    1 
ATOM   1140 C C2    . DA  C 3 12 ? 26.842  -10.633 9.810   1.00 88.47  ? 12  DA  F C2    1 
ATOM   1141 N N3    . DA  C 3 12 ? 27.017  -11.512 8.824   1.00 93.78  ? 12  DA  F N3    1 
ATOM   1142 C C4    . DA  C 3 12 ? 27.953  -11.077 7.962   1.00 96.26  ? 12  DA  F C4    1 
ATOM   1143 P P     . DT  C 3 13 ? 25.058  -14.816 3.717   1.00 117.23 ? 13  DT  F P     1 
ATOM   1144 O OP1   . DT  C 3 13 ? 24.561  -16.181 3.415   1.00 96.95  ? 13  DT  F OP1   1 
ATOM   1145 O OP2   . DT  C 3 13 ? 25.346  -13.840 2.621   1.00 92.70  ? 13  DT  F OP2   1 
ATOM   1146 O "O5'" . DT  C 3 13 ? 24.062  -14.021 4.674   1.00 109.74 ? 13  DT  F "O5'" 1 
ATOM   1147 C "C5'" . DT  C 3 13 ? 24.072  -14.177 6.105   1.00 101.99 ? 13  DT  F "C5'" 1 
ATOM   1148 C "C4'" . DT  C 3 13 ? 23.480  -12.959 6.779   1.00 104.45 ? 13  DT  F "C4'" 1 
ATOM   1149 O "O4'" . DT  C 3 13 ? 24.498  -11.962 7.025   1.00 109.67 ? 13  DT  F "O4'" 1 
ATOM   1150 C "C3'" . DT  C 3 13 ? 22.365  -12.231 6.018   1.00 98.42  ? 13  DT  F "C3'" 1 
ATOM   1151 O "O3'" . DT  C 3 13 ? 21.099  -12.530 6.617   1.00 100.36 ? 13  DT  F "O3'" 1 
ATOM   1152 C "C2'" . DT  C 3 13 ? 22.736  -10.758 6.129   1.00 96.70  ? 13  DT  F "C2'" 1 
ATOM   1153 C "C1'" . DT  C 3 13 ? 23.821  -10.735 7.183   1.00 98.55  ? 13  DT  F "C1'" 1 
ATOM   1154 N N1    . DT  C 3 13 ? 24.809  -9.632  7.064   1.00 103.80 ? 13  DT  F N1    1 
ATOM   1155 C C2    . DT  C 3 13 ? 24.765  -8.629  8.010   1.00 110.25 ? 13  DT  F C2    1 
ATOM   1156 O O2    . DT  C 3 13 ? 23.968  -8.616  8.935   1.00 120.34 ? 13  DT  F O2    1 
ATOM   1157 N N3    . DT  C 3 13 ? 25.710  -7.648  7.848   1.00 102.66 ? 13  DT  F N3    1 
ATOM   1158 C C4    . DT  C 3 13 ? 26.641  -7.545  6.834   1.00 97.15  ? 13  DT  F C4    1 
ATOM   1159 O O4    . DT  C 3 13 ? 27.421  -6.599  6.818   1.00 98.17  ? 13  DT  F O4    1 
ATOM   1160 C C5    . DT  C 3 13 ? 26.638  -8.631  5.881   1.00 96.97  ? 13  DT  F C5    1 
ATOM   1161 C C7    . DT  C 3 13 ? 27.630  -8.615  4.761   1.00 98.92  ? 13  DT  F C7    1 
ATOM   1162 C C6    . DT  C 3 13 ? 25.726  -9.601  6.033   1.00 100.37 ? 13  DT  F C6    1 
ATOM   1163 P P     . DA  C 3 14 ? 19.751  -11.816 6.100   1.00 118.23 ? 14  DA  F P     1 
ATOM   1164 O OP1   . DA  C 3 14 ? 18.631  -12.767 6.308   1.00 107.41 ? 14  DA  F OP1   1 
ATOM   1165 O OP2   . DA  C 3 14 ? 19.990  -11.196 4.761   1.00 107.91 ? 14  DA  F OP2   1 
ATOM   1166 O "O5'" . DA  C 3 14 ? 19.589  -10.609 7.116   1.00 113.61 ? 14  DA  F "O5'" 1 
ATOM   1167 C "C5'" . DA  C 3 14 ? 19.623  -10.854 8.525   1.00 123.62 ? 14  DA  F "C5'" 1 
ATOM   1168 C "C4'" . DA  C 3 14 ? 19.049  -9.663  9.251   1.00 124.75 ? 14  DA  F "C4'" 1 
ATOM   1169 O "O4'" . DA  C 3 14 ? 20.066  -8.644  9.373   1.00 125.11 ? 14  DA  F "O4'" 1 
ATOM   1170 C "C3'" . DA  C 3 14 ? 17.883  -8.997  8.528   1.00 123.91 ? 14  DA  F "C3'" 1 
ATOM   1171 O "O3'" . DA  C 3 14 ? 17.003  -8.442  9.504   1.00 122.50 ? 14  DA  F "O3'" 1 
ATOM   1172 C "C2'" . DA  C 3 14 ? 18.554  -7.903  7.723   1.00 115.54 ? 14  DA  F "C2'" 1 
ATOM   1173 C "C1'" . DA  C 3 14 ? 19.706  -7.492  8.628   1.00 111.17 ? 14  DA  F "C1'" 1 
ATOM   1174 N N9    . DA  C 3 14 ? 20.912  -6.991  7.964   1.00 105.40 ? 14  DA  F N9    1 
ATOM   1175 C C8    . DA  C 3 14 ? 21.604  -7.501  6.892   1.00 106.41 ? 14  DA  F C8    1 
ATOM   1176 N N7    . DA  C 3 14 ? 22.667  -6.802  6.566   1.00 93.11  ? 14  DA  F N7    1 
ATOM   1177 C C5    . DA  C 3 14 ? 22.675  -5.763  7.486   1.00 95.42  ? 14  DA  F C5    1 
ATOM   1178 C C6    . DA  C 3 14 ? 23.546  -4.678  7.683   1.00 97.75  ? 14  DA  F C6    1 
ATOM   1179 N N6    . DA  C 3 14 ? 24.621  -4.436  6.927   1.00 98.12  ? 14  DA  F N6    1 
ATOM   1180 N N1    . DA  C 3 14 ? 23.271  -3.833  8.698   1.00 97.67  ? 14  DA  F N1    1 
ATOM   1181 C C2    . DA  C 3 14 ? 22.191  -4.060  9.453   1.00 103.99 ? 14  DA  F C2    1 
ATOM   1182 N N3    . DA  C 3 14 ? 21.300  -5.042  9.369   1.00 104.97 ? 14  DA  F N3    1 
ATOM   1183 C C4    . DA  C 3 14 ? 21.602  -5.870  8.355   1.00 102.20 ? 14  DA  F C4    1 
ATOM   1184 P P     . DA  C 3 15 ? 15.457  -8.277  9.194   1.00 117.26 ? 15  DA  F P     1 
ATOM   1185 O OP1   . DA  C 3 15 ? 14.694  -8.908  10.304  1.00 109.41 ? 15  DA  F OP1   1 
ATOM   1186 O OP2   . DA  C 3 15 ? 15.203  -8.690  7.785   1.00 120.35 ? 15  DA  F OP2   1 
ATOM   1187 O "O5'" . DA  C 3 15 ? 15.269  -6.704  9.284   1.00 105.51 ? 15  DA  F "O5'" 1 
ATOM   1188 C "C5'" . DA  C 3 15 ? 15.611  -6.005  10.480  1.00 102.21 ? 15  DA  F "C5'" 1 
ATOM   1189 C "C4'" . DA  C 3 15 ? 16.097  -4.626  10.115  1.00 105.60 ? 15  DA  F "C4'" 1 
ATOM   1190 O "O4'" . DA  C 3 15 ? 17.340  -4.715  9.368   1.00 114.77 ? 15  DA  F "O4'" 1 
ATOM   1191 C "C3'" . DA  C 3 15 ? 15.131  -3.831  9.229   1.00 100.55 ? 15  DA  F "C3'" 1 
ATOM   1192 O "O3'" . DA  C 3 15 ? 14.955  -2.524  9.782   1.00 101.81 ? 15  DA  F "O3'" 1 
ATOM   1193 C "C2'" . DA  C 3 15 ? 15.868  -3.746  7.904   1.00 105.02 ? 15  DA  F "C2'" 1 
ATOM   1194 C "C1'" . DA  C 3 15 ? 17.293  -3.684  8.407   1.00 106.59 ? 15  DA  F "C1'" 1 
ATOM   1195 N N9    . DA  C 3 15 ? 18.377  -3.884  7.437   1.00 104.51 ? 15  DA  F N9    1 
ATOM   1196 C C8    . DA  C 3 15 ? 18.516  -4.847  6.466   1.00 109.39 ? 15  DA  F C8    1 
ATOM   1197 N N7    . DA  C 3 15 ? 19.602  -4.716  5.741   1.00 100.36 ? 15  DA  F N7    1 
ATOM   1198 C C5    . DA  C 3 15 ? 20.220  -3.591  6.268   1.00 93.13  ? 15  DA  F C5    1 
ATOM   1199 C C6    . DA  C 3 15 ? 21.416  -2.924  5.938   1.00 79.66  ? 15  DA  F C6    1 
ATOM   1200 N N6    . DA  C 3 15 ? 22.236  -3.309  4.961   1.00 70.74  ? 15  DA  F N6    1 
ATOM   1201 N N1    . DA  C 3 15 ? 21.729  -1.815  6.640   1.00 80.18  ? 15  DA  F N1    1 
ATOM   1202 C C2    . DA  C 3 15 ? 20.908  -1.425  7.624   1.00 87.99  ? 15  DA  F C2    1 
ATOM   1203 N N3    . DA  C 3 15 ? 19.764  -1.971  8.034   1.00 93.48  ? 15  DA  F N3    1 
ATOM   1204 C C4    . DA  C 3 15 ? 19.472  -3.063  7.306   1.00 97.66  ? 15  DA  F C4    1 
ATOM   1205 P P     . DA  C 3 16 ? 13.527  -1.812  9.759   1.00 107.60 ? 16  DA  F P     1 
ATOM   1206 O OP1   . DA  C 3 16 ? 12.795  -2.211  10.983  1.00 93.81  ? 16  DA  F OP1   1 
ATOM   1207 O OP2   . DA  C 3 16 ? 12.912  -2.046  8.429   1.00 117.73 ? 16  DA  F OP2   1 
ATOM   1208 O "O5'" . DA  C 3 16 ? 13.907  -0.272  9.867   1.00 95.22  ? 16  DA  F "O5'" 1 
ATOM   1209 C "C5'" . DA  C 3 16 ? 14.476  0.240   11.075  1.00 100.78 ? 16  DA  F "C5'" 1 
ATOM   1210 C "C4'" . DA  C 3 16 ? 15.411  1.390   10.780  1.00 108.52 ? 16  DA  F "C4'" 1 
ATOM   1211 O "O4'" . DA  C 3 16 ? 16.489  0.966   9.907   1.00 110.85 ? 16  DA  F "O4'" 1 
ATOM   1212 C "C3'" . DA  C 3 16 ? 14.764  2.594   10.099  1.00 103.39 ? 16  DA  F "C3'" 1 
ATOM   1213 O "O3'" . DA  C 3 16 ? 15.328  3.778   10.676  1.00 92.49  ? 16  DA  F "O3'" 1 
ATOM   1214 C "C2'" . DA  C 3 16 ? 15.110  2.379   8.635   1.00 112.17 ? 16  DA  F "C2'" 1 
ATOM   1215 C "C1'" . DA  C 3 16 ? 16.488  1.729   8.705   1.00 113.41 ? 16  DA  F "C1'" 1 
ATOM   1216 N N9    . DA  C 3 16 ? 16.823  0.813   7.611   1.00 113.25 ? 16  DA  F N9    1 
ATOM   1217 C C8    . DA  C 3 16 ? 16.096  -0.286  7.229   1.00 115.84 ? 16  DA  F C8    1 
ATOM   1218 N N7    . DA  C 3 16 ? 16.645  -0.973  6.256   1.00 107.24 ? 16  DA  F N7    1 
ATOM   1219 C C5    . DA  C 3 16 ? 17.826  -0.296  5.996   1.00 93.66  ? 16  DA  F C5    1 
ATOM   1220 C C6    . DA  C 3 16 ? 18.863  -0.530  5.078   1.00 92.08  ? 16  DA  F C6    1 
ATOM   1221 N N6    . DA  C 3 16 ? 18.866  -1.545  4.210   1.00 79.94  ? 16  DA  F N6    1 
ATOM   1222 N N1    . DA  C 3 16 ? 19.895  0.342   5.062   1.00 92.07  ? 16  DA  F N1    1 
ATOM   1223 C C2    . DA  C 3 16 ? 19.896  1.352   5.946   1.00 98.81  ? 16  DA  F C2    1 
ATOM   1224 N N3    . DA  C 3 16 ? 18.976  1.677   6.855   1.00 95.10  ? 16  DA  F N3    1 
ATOM   1225 C C4    . DA  C 3 16 ? 17.957  0.800   6.832   1.00 101.02 ? 16  DA  F C4    1 
ATOM   1226 P P     . DA  C 3 17 ? 14.655  5.213   10.459  1.00 108.24 ? 17  DA  F P     1 
ATOM   1227 O OP1   . DA  C 3 17 ? 14.407  5.809   11.789  1.00 105.11 ? 17  DA  F OP1   1 
ATOM   1228 O OP2   . DA  C 3 17 ? 13.532  5.071   9.499   1.00 111.28 ? 17  DA  F OP2   1 
ATOM   1229 O "O5'" . DA  C 3 17 ? 15.824  6.050   9.779   1.00 94.71  ? 17  DA  F "O5'" 1 
ATOM   1230 C "C5'" . DA  C 3 17 ? 16.915  5.348   9.173   1.00 104.56 ? 17  DA  F "C5'" 1 
ATOM   1231 C "C4'" . DA  C 3 17 ? 17.832  6.271   8.408   1.00 114.97 ? 17  DA  F "C4'" 1 
ATOM   1232 O "O4'" . DA  C 3 17 ? 18.403  5.513   7.316   1.00 122.02 ? 17  DA  F "O4'" 1 
ATOM   1233 C "C3'" . DA  C 3 17 ? 17.183  7.490   7.755   1.00 107.60 ? 17  DA  F "C3'" 1 
ATOM   1234 O "O3'" . DA  C 3 17 ? 18.189  8.505   7.687   1.00 104.67 ? 17  DA  F "O3'" 1 
ATOM   1235 C "C2'" . DA  C 3 17 ? 16.732  6.944   6.411   1.00 104.23 ? 17  DA  F "C2'" 1 
ATOM   1236 C "C1'" . DA  C 3 17 ? 17.794  5.889   6.084   1.00 112.93 ? 17  DA  F "C1'" 1 
ATOM   1237 N N9    . DA  C 3 17 ? 17.313  4.670   5.421   1.00 107.77 ? 17  DA  F N9    1 
ATOM   1238 C C8    . DA  C 3 17 ? 16.138  3.989   5.629   1.00 105.87 ? 17  DA  F C8    1 
ATOM   1239 N N7    . DA  C 3 17 ? 15.992  2.937   4.860   1.00 99.98  ? 17  DA  F N7    1 
ATOM   1240 C C5    . DA  C 3 17 ? 17.151  2.919   4.098   1.00 92.32  ? 17  DA  F C5    1 
ATOM   1241 C C6    . DA  C 3 17 ? 17.613  2.045   3.096   1.00 88.13  ? 17  DA  F C6    1 
ATOM   1242 N N6    . DA  C 3 17 ? 16.930  0.984   2.663   1.00 94.33  ? 17  DA  F N6    1 
ATOM   1243 N N1    . DA  C 3 17 ? 18.808  2.314   2.531   1.00 90.19  ? 17  DA  F N1    1 
ATOM   1244 C C2    . DA  C 3 17 ? 19.499  3.376   2.967   1.00 98.84  ? 17  DA  F C2    1 
ATOM   1245 N N3    . DA  C 3 17 ? 19.174  4.267   3.901   1.00 93.94  ? 17  DA  F N3    1 
ATOM   1246 C C4    . DA  C 3 17 ? 17.974  3.980   4.433   1.00 98.88  ? 17  DA  F C4    1 
ATOM   1247 P P     . DT  C 3 18 ? 17.869  9.933   7.066   1.00 117.02 ? 18  DT  F P     1 
ATOM   1248 O OP1   . DT  C 3 18 ? 18.845  10.907  7.614   1.00 97.53  ? 18  DT  F OP1   1 
ATOM   1249 O OP2   . DT  C 3 18 ? 16.415  10.189  7.211   1.00 116.61 ? 18  DT  F OP2   1 
ATOM   1250 O "O5'" . DT  C 3 18 ? 18.259  9.733   5.533   1.00 127.77 ? 18  DT  F "O5'" 1 
ATOM   1251 C "C5'" . DT  C 3 18 ? 19.632  9.467   5.169   1.00 131.05 ? 18  DT  F "C5'" 1 
ATOM   1252 C "C4'" . DT  C 3 18 ? 19.787  9.182   3.690   1.00 127.65 ? 18  DT  F "C4'" 1 
ATOM   1253 O "O4'" . DT  C 3 18 ? 19.372  7.837   3.381   1.00 118.32 ? 18  DT  F "O4'" 1 
ATOM   1254 C "C3'" . DT  C 3 18 ? 18.992  10.069  2.736   1.00 116.67 ? 18  DT  F "C3'" 1 
ATOM   1255 O "O3'" . DT  C 3 18 ? 19.742  11.248  2.418   1.00 97.37  ? 18  DT  F "O3'" 1 
ATOM   1256 C "C2'" . DT  C 3 18 ? 18.796  9.179   1.517   1.00 117.05 ? 18  DT  F "C2'" 1 
ATOM   1257 C "C1'" . DT  C 3 18 ? 19.062  7.754   2.000   1.00 109.01 ? 18  DT  F "C1'" 1 
ATOM   1258 N N1    . DT  C 3 18 ? 17.927  6.822   1.858   1.00 99.76  ? 18  DT  F N1    1 
ATOM   1259 C C2    . DT  C 3 18 ? 18.038  5.765   0.983   1.00 93.70  ? 18  DT  F C2    1 
ATOM   1260 O O2    . DT  C 3 18 ? 19.017  5.576   0.280   1.00 105.57 ? 18  DT  F O2    1 
ATOM   1261 N N3    . DT  C 3 18 ? 16.941  4.946   0.937   1.00 84.02  ? 18  DT  F N3    1 
ATOM   1262 C C4    . DT  C 3 18 ? 15.792  5.045   1.691   1.00 90.42  ? 18  DT  F C4    1 
ATOM   1263 O O4    . DT  C 3 18 ? 14.898  4.216   1.552   1.00 91.30  ? 18  DT  F O4    1 
ATOM   1264 C C5    . DT  C 3 18 ? 15.743  6.172   2.594   1.00 102.94 ? 18  DT  F C5    1 
ATOM   1265 C C7    . DT  C 3 18 ? 14.524  6.376   3.437   1.00 105.41 ? 18  DT  F C7    1 
ATOM   1266 C C6    . DT  C 3 18 ? 16.802  6.991   2.635   1.00 101.10 ? 18  DT  F C6    1 
ATOM   1267 N N     . ARG D 1 1  ? -0.535  6.399   -17.601 1.00 212.79 ? 217 ARG B N     1 
ATOM   1268 C CA    . ARG D 1 1  ? 0.539   6.600   -16.588 1.00 213.69 ? 217 ARG B CA    1 
ATOM   1269 C C     . ARG D 1 1  ? 1.306   5.274   -16.449 1.00 209.70 ? 217 ARG B C     1 
ATOM   1270 O O     . ARG D 1 1  ? 0.934   4.398   -15.663 1.00 210.63 ? 217 ARG B O     1 
ATOM   1271 C CB    . ARG D 1 1  ? -0.086  7.097   -15.269 1.00 215.68 ? 217 ARG B CB    1 
ATOM   1272 C CG    . ARG D 1 1  ? 0.728   6.962   -13.980 1.00 215.86 ? 217 ARG B CG    1 
ATOM   1273 C CD    . ARG D 1 1  ? 0.056   7.766   -12.866 1.00 218.32 ? 217 ARG B CD    1 
ATOM   1274 N NE    . ARG D 1 1  ? 0.336   9.211   -12.957 1.00 219.73 ? 217 ARG B NE    1 
ATOM   1275 C CZ    . ARG D 1 1  ? 0.415   10.070  -11.928 1.00 207.59 ? 217 ARG B CZ    1 
ATOM   1276 N NH1   . ARG D 1 1  ? 0.691   11.353  -12.172 1.00 190.80 ? 217 ARG B NH1   1 
ATOM   1277 N NH2   . ARG D 1 1  ? 0.175   9.691   -10.666 1.00 212.28 ? 217 ARG B NH2   1 
ATOM   1278 N N     . LYS D 1 2  ? 2.350   5.133   -17.266 1.00 198.27 ? 218 LYS B N     1 
ATOM   1279 C CA    . LYS D 1 2  ? 3.227   3.948   -17.263 1.00 189.22 ? 218 LYS B CA    1 
ATOM   1280 C C     . LYS D 1 2  ? 4.500   4.248   -16.476 1.00 178.64 ? 218 LYS B C     1 
ATOM   1281 O O     . LYS D 1 2  ? 4.998   5.375   -16.504 1.00 178.64 ? 218 LYS B O     1 
ATOM   1282 C CB    . LYS D 1 2  ? 3.594   3.481   -18.689 1.00 188.12 ? 218 LYS B CB    1 
ATOM   1283 C CG    . LYS D 1 2  ? 4.248   4.523   -19.603 1.00 190.08 ? 218 LYS B CG    1 
ATOM   1284 C CD    . LYS D 1 2  ? 5.769   4.378   -19.692 1.00 190.55 ? 218 LYS B CD    1 
ATOM   1285 C CE    . LYS D 1 2  ? 6.460   5.681   -20.105 1.00 186.88 ? 218 LYS B CE    1 
ATOM   1286 N NZ    . LYS D 1 2  ? 6.449   6.734   -19.042 1.00 184.85 ? 218 LYS B NZ    1 
ATOM   1287 N N     . LYS D 1 3  ? 5.012   3.240   -15.770 1.00 164.68 ? 219 LYS B N     1 
ATOM   1288 C CA    . LYS D 1 3  ? 6.298   3.343   -15.062 1.00 151.84 ? 219 LYS B CA    1 
ATOM   1289 C C     . LYS D 1 3  ? 7.423   3.861   -15.975 1.00 148.61 ? 219 LYS B C     1 
ATOM   1290 O O     . LYS D 1 3  ? 7.748   3.228   -16.984 1.00 152.49 ? 219 LYS B O     1 
ATOM   1291 C CB    . LYS D 1 3  ? 6.691   1.995   -14.405 1.00 145.76 ? 219 LYS B CB    1 
ATOM   1292 C CG    . LYS D 1 3  ? 6.724   0.751   -15.306 1.00 139.84 ? 219 LYS B CG    1 
ATOM   1293 C CD    . LYS D 1 3  ? 8.139   0.253   -15.609 1.00 137.44 ? 219 LYS B CD    1 
ATOM   1294 C CE    . LYS D 1 3  ? 8.151   -1.183  -16.133 1.00 132.86 ? 219 LYS B CE    1 
ATOM   1295 N NZ    . LYS D 1 3  ? 9.523   -1.770  -16.200 1.00 124.19 ? 219 LYS B NZ    1 
ATOM   1296 N N     . ARG D 1 4  ? 7.986   5.026   -15.635 1.00 138.65 ? 220 ARG B N     1 
ATOM   1297 C CA    . ARG D 1 4  ? 9.153   5.575   -16.353 1.00 135.20 ? 220 ARG B CA    1 
ATOM   1298 C C     . ARG D 1 4  ? 10.275  4.534   -16.459 1.00 137.81 ? 220 ARG B C     1 
ATOM   1299 O O     . ARG D 1 4  ? 10.415  3.676   -15.576 1.00 144.90 ? 220 ARG B O     1 
ATOM   1300 C CB    . ARG D 1 4  ? 9.673   6.867   -15.684 1.00 123.47 ? 220 ARG B CB    1 
ATOM   1301 C CG    . ARG D 1 4  ? 10.184  6.719   -14.246 1.00 121.51 ? 220 ARG B CG    1 
ATOM   1302 C CD    . ARG D 1 4  ? 11.120  7.847   -13.827 1.00 116.46 ? 220 ARG B CD    1 
ATOM   1303 N NE    . ARG D 1 4  ? 12.034  7.448   -12.747 1.00 114.56 ? 220 ARG B NE    1 
ATOM   1304 C CZ    . ARG D 1 4  ? 13.285  6.984   -12.886 1.00 104.93 ? 220 ARG B CZ    1 
ATOM   1305 N NH1   . ARG D 1 4  ? 13.864  6.821   -14.072 1.00 94.81  ? 220 ARG B NH1   1 
ATOM   1306 N NH2   . ARG D 1 4  ? 13.983  6.668   -11.801 1.00 115.63 ? 220 ARG B NH2   1 
ATOM   1307 N N     . ILE D 1 5  ? 11.040  4.583   -17.548 1.00 131.18 ? 221 ILE B N     1 
ATOM   1308 C CA    . ILE D 1 5  ? 12.211  3.715   -17.697 1.00 133.62 ? 221 ILE B CA    1 
ATOM   1309 C C     . ILE D 1 5  ? 13.462  4.575   -17.909 1.00 133.58 ? 221 ILE B C     1 
ATOM   1310 O O     . ILE D 1 5  ? 13.489  5.414   -18.818 1.00 123.42 ? 221 ILE B O     1 
ATOM   1311 C CB    . ILE D 1 5  ? 12.014  2.650   -18.802 1.00 135.55 ? 221 ILE B CB    1 
ATOM   1312 C CG1   . ILE D 1 5  ? 11.058  1.569   -18.271 1.00 132.33 ? 221 ILE B CG1   1 
ATOM   1313 C CG2   . ILE D 1 5  ? 13.353  2.035   -19.234 1.00 134.22 ? 221 ILE B CG2   1 
ATOM   1314 C CD1   . ILE D 1 5  ? 10.630  0.533   -19.286 1.00 132.29 ? 221 ILE B CD1   1 
ATOM   1315 N N     . PRO D 1 6  ? 14.496  4.374   -17.056 1.00 136.55 ? 222 PRO B N     1 
ATOM   1316 C CA    . PRO D 1 6  ? 15.704  5.205   -17.125 1.00 129.75 ? 222 PRO B CA    1 
ATOM   1317 C C     . PRO D 1 6  ? 16.521  5.013   -18.400 1.00 122.28 ? 222 PRO B C     1 
ATOM   1318 O O     . PRO D 1 6  ? 16.519  3.926   -19.006 1.00 105.14 ? 222 PRO B O     1 
ATOM   1319 C CB    . PRO D 1 6  ? 16.513  4.753   -15.906 1.00 133.67 ? 222 PRO B CB    1 
ATOM   1320 C CG    . PRO D 1 6  ? 16.025  3.379   -15.608 1.00 130.03 ? 222 PRO B CG    1 
ATOM   1321 C CD    . PRO D 1 6  ? 14.571  3.410   -15.938 1.00 126.80 ? 222 PRO B CD    1 
ATOM   1322 N N     . TYR D 1 7  ? 17.224  6.078   -18.769 1.00 116.19 ? 223 TYR B N     1 
ATOM   1323 C CA    . TYR D 1 7  ? 17.976  6.134   -20.010 1.00 123.27 ? 223 TYR B CA    1 
ATOM   1324 C C     . TYR D 1 7  ? 19.331  5.434   -19.845 1.00 128.57 ? 223 TYR B C     1 
ATOM   1325 O O     . TYR D 1 7  ? 19.927  5.484   -18.771 1.00 147.36 ? 223 TYR B O     1 
ATOM   1326 C CB    . TYR D 1 7  ? 18.194  7.598   -20.423 1.00 120.07 ? 223 TYR B CB    1 
ATOM   1327 C CG    . TYR D 1 7  ? 16.954  8.472   -20.602 1.00 111.98 ? 223 TYR B CG    1 
ATOM   1328 C CD1   . TYR D 1 7  ? 15.692  7.931   -20.902 1.00 110.23 ? 223 TYR B CD1   1 
ATOM   1329 C CD2   . TYR D 1 7  ? 17.065  9.862   -20.508 1.00 106.37 ? 223 TYR B CD2   1 
ATOM   1330 C CE1   . TYR D 1 7  ? 14.585  8.756   -21.075 1.00 112.15 ? 223 TYR B CE1   1 
ATOM   1331 C CE2   . TYR D 1 7  ? 15.970  10.691  -20.687 1.00 106.20 ? 223 TYR B CE2   1 
ATOM   1332 C CZ    . TYR D 1 7  ? 14.732  10.141  -20.972 1.00 112.33 ? 223 TYR B CZ    1 
ATOM   1333 O OH    . TYR D 1 7  ? 13.649  10.986  -21.133 1.00 111.65 ? 223 TYR B OH    1 
ATOM   1334 N N     . SER D 1 8  ? 19.808  4.787   -20.909 1.00 132.56 ? 224 SER B N     1 
ATOM   1335 C CA    . SER D 1 8  ? 21.113  4.102   -20.914 1.00 145.99 ? 224 SER B CA    1 
ATOM   1336 C C     . SER D 1 8  ? 22.312  5.075   -20.876 1.00 154.71 ? 224 SER B C     1 
ATOM   1337 O O     . SER D 1 8  ? 22.220  6.209   -21.351 1.00 148.89 ? 224 SER B O     1 
ATOM   1338 C CB    . SER D 1 8  ? 21.214  3.165   -22.131 1.00 151.02 ? 224 SER B CB    1 
ATOM   1339 O OG    . SER D 1 8  ? 22.502  2.575   -22.248 1.00 163.21 ? 224 SER B OG    1 
ATOM   1340 N N     . LYS D 1 9  ? 23.438  4.600   -20.329 1.00 163.59 ? 225 LYS B N     1 
ATOM   1341 C CA    . LYS D 1 9  ? 24.599  5.457   -20.009 1.00 158.35 ? 225 LYS B CA    1 
ATOM   1342 C C     . LYS D 1 9  ? 25.066  6.297   -21.195 1.00 149.69 ? 225 LYS B C     1 
ATOM   1343 O O     . LYS D 1 9  ? 25.413  7.482   -21.038 1.00 145.30 ? 225 LYS B O     1 
ATOM   1344 C CB    . LYS D 1 9  ? 25.777  4.657   -19.434 1.00 167.74 ? 225 LYS B CB    1 
ATOM   1345 C CG    . LYS D 1 9  ? 26.809  5.543   -18.738 1.00 172.21 ? 225 LYS B CG    1 
ATOM   1346 C CD    . LYS D 1 9  ? 27.901  4.752   -18.037 1.00 179.94 ? 225 LYS B CD    1 
ATOM   1347 C CE    . LYS D 1 9  ? 28.967  5.687   -17.482 1.00 182.26 ? 225 LYS B CE    1 
ATOM   1348 N NZ    . LYS D 1 9  ? 30.120  4.959   -16.886 1.00 182.93 ? 225 LYS B NZ    1 
ATOM   1349 N N     . GLY D 1 10 ? 25.063  5.680   -22.375 1.00 140.69 ? 226 GLY B N     1 
ATOM   1350 C CA    . GLY D 1 10 ? 25.398  6.379   -23.609 1.00 146.15 ? 226 GLY B CA    1 
ATOM   1351 C C     . GLY D 1 10 ? 24.523  7.599   -23.790 1.00 140.05 ? 226 GLY B C     1 
ATOM   1352 O O     . GLY D 1 10 ? 25.026  8.732   -23.960 1.00 130.90 ? 226 GLY B O     1 
ATOM   1353 N N     . GLN D 1 11 ? 23.213  7.362   -23.703 1.00 134.19 ? 227 GLN B N     1 
ATOM   1354 C CA    . GLN D 1 11 ? 22.216  8.399   -23.944 1.00 127.25 ? 227 GLN B CA    1 
ATOM   1355 C C     . GLN D 1 11 ? 22.549  9.619   -23.084 1.00 124.49 ? 227 GLN B C     1 
ATOM   1356 O O     . GLN D 1 11 ? 22.914  10.684  -23.614 1.00 114.55 ? 227 GLN B O     1 
ATOM   1357 C CB    . GLN D 1 11 ? 20.803  7.884   -23.628 1.00 123.78 ? 227 GLN B CB    1 
ATOM   1358 C CG    . GLN D 1 11 ? 20.222  6.957   -24.681 1.00 122.62 ? 227 GLN B CG    1 
ATOM   1359 C CD    . GLN D 1 11 ? 19.098  6.087   -24.139 1.00 123.41 ? 227 GLN B CD    1 
ATOM   1360 O OE1   . GLN D 1 11 ? 19.163  4.862   -24.220 1.00 134.65 ? 227 GLN B OE1   1 
ATOM   1361 N NE2   . GLN D 1 11 ? 18.069  6.711   -23.574 1.00 116.64 ? 227 GLN B NE2   1 
ATOM   1362 N N     . LEU D 1 12 ? 22.473  9.457   -21.760 1.00 127.31 ? 228 LEU B N     1 
ATOM   1363 C CA    . LEU D 1 12 ? 22.738  10.594  -20.873 1.00 125.59 ? 228 LEU B CA    1 
ATOM   1364 C C     . LEU D 1 12 ? 24.177  11.090  -20.900 1.00 115.38 ? 228 LEU B C     1 
ATOM   1365 O O     . LEU D 1 12 ? 24.376  12.264  -20.614 1.00 95.84  ? 228 LEU B O     1 
ATOM   1366 C CB    . LEU D 1 12 ? 22.187  10.459  -19.434 1.00 134.05 ? 228 LEU B CB    1 
ATOM   1367 C CG    . LEU D 1 12 ? 22.323  9.247   -18.514 1.00 141.55 ? 228 LEU B CG    1 
ATOM   1368 C CD1   . LEU D 1 12 ? 21.102  8.340   -18.537 1.00 134.87 ? 228 LEU B CD1   1 
ATOM   1369 C CD2   . LEU D 1 12 ? 23.564  8.465   -18.874 1.00 150.33 ? 228 LEU B CD2   1 
ATOM   1370 N N     . ARG D 1 13 ? 25.159  10.262  -21.287 1.00 119.86 ? 229 ARG B N     1 
ATOM   1371 C CA    . ARG D 1 13 ? 26.494  10.830  -21.595 1.00 131.03 ? 229 ARG B CA    1 
ATOM   1372 C C     . ARG D 1 13 ? 26.380  11.858  -22.747 1.00 133.56 ? 229 ARG B C     1 
ATOM   1373 O O     . ARG D 1 13 ? 26.798  13.025  -22.596 1.00 127.26 ? 229 ARG B O     1 
ATOM   1374 C CB    . ARG D 1 13 ? 27.553  9.765   -21.937 1.00 134.69 ? 229 ARG B CB    1 
ATOM   1375 C CG    . ARG D 1 13 ? 28.968  10.353  -22.060 1.00 137.94 ? 229 ARG B CG    1 
ATOM   1376 C CD    . ARG D 1 13 ? 30.122  9.363   -21.893 1.00 138.01 ? 229 ARG B CD    1 
ATOM   1377 N NE    . ARG D 1 13 ? 30.378  8.634   -23.140 1.00 142.29 ? 229 ARG B NE    1 
ATOM   1378 C CZ    . ARG D 1 13 ? 29.776  7.506   -23.537 1.00 147.64 ? 229 ARG B CZ    1 
ATOM   1379 N NH1   . ARG D 1 13 ? 28.895  6.861   -22.765 1.00 145.84 ? 229 ARG B NH1   1 
ATOM   1380 N NH2   . ARG D 1 13 ? 30.097  6.983   -24.719 1.00 148.46 ? 229 ARG B NH2   1 
ATOM   1381 N N     . GLU D 1 14 ? 25.785  11.429  -23.867 1.00 132.96 ? 230 GLU B N     1 
ATOM   1382 C CA    . GLU D 1 14 ? 25.582  12.314  -25.046 1.00 140.44 ? 230 GLU B CA    1 
ATOM   1383 C C     . GLU D 1 14 ? 24.771  13.591  -24.675 1.00 130.86 ? 230 GLU B C     1 
ATOM   1384 O O     . GLU D 1 14 ? 25.159  14.754  -25.016 1.00 111.63 ? 230 GLU B O     1 
ATOM   1385 C CB    . GLU D 1 14 ? 24.892  11.541  -26.201 1.00 147.37 ? 230 GLU B CB    1 
ATOM   1386 C CG    . GLU D 1 14 ? 25.510  11.734  -27.586 1.00 149.85 ? 230 GLU B CG    1 
ATOM   1387 C CD    . GLU D 1 14 ? 25.481  13.175  -28.075 1.00 154.81 ? 230 GLU B CD    1 
ATOM   1388 O OE1   . GLU D 1 14 ? 24.421  13.835  -27.964 1.00 146.07 ? 230 GLU B OE1   1 
ATOM   1389 O OE2   . GLU D 1 14 ? 26.522  13.643  -28.588 1.00 153.75 ? 230 GLU B OE2   1 
ATOM   1390 N N     . LEU D 1 15 ? 23.662  13.363  -23.956 1.00 118.24 ? 231 LEU B N     1 
ATOM   1391 C CA    . LEU D 1 15 ? 22.821  14.464  -23.467 1.00 118.06 ? 231 LEU B CA    1 
ATOM   1392 C C     . LEU D 1 15 ? 23.670  15.420  -22.651 1.00 117.53 ? 231 LEU B C     1 
ATOM   1393 O O     . LEU D 1 15 ? 23.805  16.586  -23.027 1.00 100.63 ? 231 LEU B O     1 
ATOM   1394 C CB    . LEU D 1 15 ? 21.640  13.965  -22.618 1.00 119.03 ? 231 LEU B CB    1 
ATOM   1395 C CG    . LEU D 1 15 ? 20.540  13.175  -23.337 1.00 125.51 ? 231 LEU B CG    1 
ATOM   1396 C CD1   . LEU D 1 15 ? 19.636  12.429  -22.361 1.00 121.68 ? 231 LEU B CD1   1 
ATOM   1397 C CD2   . LEU D 1 15 ? 19.728  14.113  -24.227 1.00 131.12 ? 231 LEU B CD2   1 
ATOM   1398 N N     . GLU D 1 16 ? 24.279  14.893  -21.578 1.00 125.72 ? 232 GLU B N     1 
ATOM   1399 C CA    . GLU D 1 16 ? 25.081  15.695  -20.635 1.00 120.03 ? 232 GLU B CA    1 
ATOM   1400 C C     . GLU D 1 16 ? 26.153  16.482  -21.365 1.00 124.30 ? 232 GLU B C     1 
ATOM   1401 O O     . GLU D 1 16 ? 26.286  17.690  -21.130 1.00 110.77 ? 232 GLU B O     1 
ATOM   1402 C CB    . GLU D 1 16 ? 25.734  14.831  -19.540 1.00 112.48 ? 232 GLU B CB    1 
ATOM   1403 C CG    . GLU D 1 16 ? 24.778  14.295  -18.478 1.00 104.69 ? 232 GLU B CG    1 
ATOM   1404 C CD    . GLU D 1 16 ? 24.474  15.282  -17.372 1.00 104.17 ? 232 GLU B CD    1 
ATOM   1405 O OE1   . GLU D 1 16 ? 24.123  14.832  -16.254 1.00 103.79 ? 232 GLU B OE1   1 
ATOM   1406 O OE2   . GLU D 1 16 ? 24.568  16.503  -17.616 1.00 103.34 ? 232 GLU B OE2   1 
ATOM   1407 N N     . ARG D 1 17 ? 26.892  15.806  -22.256 1.00 125.02 ? 233 ARG B N     1 
ATOM   1408 C CA    . ARG D 1 17 ? 27.950  16.480  -23.018 1.00 126.52 ? 233 ARG B CA    1 
ATOM   1409 C C     . ARG D 1 17 ? 27.393  17.547  -23.965 1.00 121.24 ? 233 ARG B C     1 
ATOM   1410 O O     . ARG D 1 17 ? 28.045  18.579  -24.178 1.00 104.23 ? 233 ARG B O     1 
ATOM   1411 C CB    . ARG D 1 17 ? 28.894  15.488  -23.735 1.00 134.27 ? 233 ARG B CB    1 
ATOM   1412 C CG    . ARG D 1 17 ? 28.345  14.741  -24.944 1.00 137.88 ? 233 ARG B CG    1 
ATOM   1413 C CD    . ARG D 1 17 ? 28.610  15.437  -26.277 1.00 139.00 ? 233 ARG B CD    1 
ATOM   1414 N NE    . ARG D 1 17 ? 30.037  15.559  -26.590 1.00 138.42 ? 233 ARG B NE    1 
ATOM   1415 C CZ    . ARG D 1 17 ? 30.549  16.228  -27.631 1.00 142.50 ? 233 ARG B CZ    1 
ATOM   1416 N NH1   . ARG D 1 17 ? 29.760  16.908  -28.466 1.00 142.45 ? 233 ARG B NH1   1 
ATOM   1417 N NH2   . ARG D 1 17 ? 31.856  16.157  -27.890 1.00 139.56 ? 233 ARG B NH2   1 
ATOM   1418 N N     . GLU D 1 18 ? 26.195  17.313  -24.513 1.00 126.43 ? 234 GLU B N     1 
ATOM   1419 C CA    . GLU D 1 18 ? 25.534  18.367  -25.299 1.00 131.94 ? 234 GLU B CA    1 
ATOM   1420 C C     . GLU D 1 18 ? 25.108  19.579  -24.425 1.00 130.33 ? 234 GLU B C     1 
ATOM   1421 O O     . GLU D 1 18 ? 25.437  20.742  -24.731 1.00 127.11 ? 234 GLU B O     1 
ATOM   1422 C CB    . GLU D 1 18 ? 24.354  17.788  -26.077 1.00 130.63 ? 234 GLU B CB    1 
ATOM   1423 C CG    . GLU D 1 18 ? 23.892  18.648  -27.245 1.00 138.44 ? 234 GLU B CG    1 
ATOM   1424 C CD    . GLU D 1 18 ? 24.858  18.661  -28.421 1.00 137.54 ? 234 GLU B CD    1 
ATOM   1425 O OE1   . GLU D 1 18 ? 24.869  17.687  -29.216 1.00 126.53 ? 234 GLU B OE1   1 
ATOM   1426 O OE2   . GLU D 1 18 ? 25.606  19.653  -28.550 1.00 143.95 ? 234 GLU B OE2   1 
ATOM   1427 N N     . TYR D 1 19 ? 24.421  19.300  -23.321 1.00 132.56 ? 235 TYR B N     1 
ATOM   1428 C CA    . TYR D 1 19 ? 24.025  20.342  -22.361 1.00 142.76 ? 235 TYR B CA    1 
ATOM   1429 C C     . TYR D 1 19 ? 25.212  21.135  -21.781 1.00 154.62 ? 235 TYR B C     1 
ATOM   1430 O O     . TYR D 1 19 ? 25.098  22.336  -21.508 1.00 154.16 ? 235 TYR B O     1 
ATOM   1431 C CB    . TYR D 1 19 ? 23.206  19.749  -21.213 1.00 142.78 ? 235 TYR B CB    1 
ATOM   1432 C CG    . TYR D 1 19 ? 23.051  20.707  -20.056 1.00 143.70 ? 235 TYR B CG    1 
ATOM   1433 C CD1   . TYR D 1 19 ? 22.330  21.896  -20.203 1.00 147.35 ? 235 TYR B CD1   1 
ATOM   1434 C CD2   . TYR D 1 19 ? 23.659  20.455  -18.832 1.00 140.71 ? 235 TYR B CD2   1 
ATOM   1435 C CE1   . TYR D 1 19 ? 22.200  22.790  -19.152 1.00 146.49 ? 235 TYR B CE1   1 
ATOM   1436 C CE2   . TYR D 1 19 ? 23.534  21.343  -17.777 1.00 145.34 ? 235 TYR B CE2   1 
ATOM   1437 C CZ    . TYR D 1 19 ? 22.802  22.502  -17.939 1.00 147.55 ? 235 TYR B CZ    1 
ATOM   1438 O OH    . TYR D 1 19 ? 22.684  23.370  -16.885 1.00 157.98 ? 235 TYR B OH    1 
ATOM   1439 N N     . ALA D 1 20 ? 26.334  20.453  -21.565 1.00 157.46 ? 236 ALA B N     1 
ATOM   1440 C CA    . ALA D 1 20 ? 27.587  21.122  -21.220 1.00 157.75 ? 236 ALA B CA    1 
ATOM   1441 C C     . ALA D 1 20 ? 28.008  22.047  -22.356 1.00 154.54 ? 236 ALA B C     1 
ATOM   1442 O O     . ALA D 1 20 ? 28.440  23.180  -22.109 1.00 140.67 ? 236 ALA B O     1 
ATOM   1443 C CB    . ALA D 1 20 ? 28.678  20.103  -20.939 1.00 159.69 ? 236 ALA B CB    1 
ATOM   1444 N N     . ALA D 1 21 ? 27.865  21.557  -23.593 1.00 153.45 ? 237 ALA B N     1 
ATOM   1445 C CA    . ALA D 1 21 ? 28.164  22.358  -24.781 1.00 157.31 ? 237 ALA B CA    1 
ATOM   1446 C C     . ALA D 1 21 ? 27.274  23.609  -24.870 1.00 156.13 ? 237 ALA B C     1 
ATOM   1447 O O     . ALA D 1 21 ? 27.767  24.681  -25.242 1.00 137.38 ? 237 ALA B O     1 
ATOM   1448 C CB    . ALA D 1 21 ? 28.074  21.521  -26.059 1.00 159.64 ? 237 ALA B CB    1 
ATOM   1449 N N     . ASN D 1 22 ? 25.986  23.485  -24.526 1.00 162.10 ? 238 ASN B N     1 
ATOM   1450 C CA    . ASN D 1 22 ? 25.129  24.687  -24.392 1.00 162.53 ? 238 ASN B CA    1 
ATOM   1451 C C     . ASN D 1 22 ? 23.918  24.511  -23.465 1.00 164.69 ? 238 ASN B C     1 
ATOM   1452 O O     . ASN D 1 22 ? 23.276  23.460  -23.459 1.00 168.13 ? 238 ASN B O     1 
ATOM   1453 C CB    . ASN D 1 22 ? 24.661  25.188  -25.769 1.00 163.33 ? 238 ASN B CB    1 
ATOM   1454 C CG    . ASN D 1 22 ? 24.406  26.693  -25.796 1.00 161.58 ? 238 ASN B CG    1 
ATOM   1455 O OD1   . ASN D 1 22 ? 23.955  27.287  -24.814 1.00 150.59 ? 238 ASN B OD1   1 
ATOM   1456 N ND2   . ASN D 1 22 ? 24.696  27.315  -26.932 1.00 164.57 ? 238 ASN B ND2   1 
ATOM   1457 N N     . LYS D 1 23 ? 23.606  25.582  -22.726 1.00 165.81 ? 239 LYS B N     1 
ATOM   1458 C CA    . LYS D 1 23 ? 22.556  25.605  -21.687 1.00 171.79 ? 239 LYS B CA    1 
ATOM   1459 C C     . LYS D 1 23 ? 21.182  25.228  -22.227 1.00 173.54 ? 239 LYS B C     1 
ATOM   1460 O O     . LYS D 1 23 ? 20.485  24.387  -21.654 1.00 172.45 ? 239 LYS B O     1 
ATOM   1461 C CB    . LYS D 1 23 ? 22.457  27.005  -21.047 1.00 168.52 ? 239 LYS B CB    1 
ATOM   1462 C CG    . LYS D 1 23 ? 23.651  27.431  -20.203 1.00 164.94 ? 239 LYS B CG    1 
ATOM   1463 C CD    . LYS D 1 23 ? 23.703  26.660  -18.893 1.00 167.95 ? 239 LYS B CD    1 
ATOM   1464 C CE    . LYS D 1 23 ? 24.944  26.993  -18.078 1.00 164.54 ? 239 LYS B CE    1 
ATOM   1465 N NZ    . LYS D 1 23 ? 25.444  25.802  -17.336 1.00 163.07 ? 239 LYS B NZ    1 
ATOM   1466 N N     . PHE D 1 24 ? 20.802  25.886  -23.319 1.00 167.37 ? 240 PHE B N     1 
ATOM   1467 C CA    . PHE D 1 24 ? 19.596  25.556  -24.059 1.00 157.04 ? 240 PHE B CA    1 
ATOM   1468 C C     . PHE D 1 24 ? 19.930  24.811  -25.345 1.00 160.22 ? 240 PHE B C     1 
ATOM   1469 O O     . PHE D 1 24 ? 21.022  24.947  -25.905 1.00 172.13 ? 240 PHE B O     1 
ATOM   1470 C CB    . PHE D 1 24 ? 18.816  26.819  -24.407 1.00 148.87 ? 240 PHE B CB    1 
ATOM   1471 C CG    . PHE D 1 24 ? 18.167  27.485  -23.231 1.00 139.00 ? 240 PHE B CG    1 
ATOM   1472 C CD1   . PHE D 1 24 ? 17.374  26.762  -22.354 1.00 138.64 ? 240 PHE B CD1   1 
ATOM   1473 C CD2   . PHE D 1 24 ? 18.311  28.854  -23.030 1.00 140.67 ? 240 PHE B CD2   1 
ATOM   1474 C CE1   . PHE D 1 24 ? 16.757  27.385  -21.279 1.00 146.77 ? 240 PHE B CE1   1 
ATOM   1475 C CE2   . PHE D 1 24 ? 17.697  29.485  -21.959 1.00 146.17 ? 240 PHE B CE2   1 
ATOM   1476 C CZ    . PHE D 1 24 ? 16.916  28.750  -21.082 1.00 147.88 ? 240 PHE B CZ    1 
ATOM   1477 N N     . ILE D 1 25 ? 18.956  24.029  -25.798 1.00 155.18 ? 241 ILE B N     1 
ATOM   1478 C CA    . ILE D 1 25 ? 19.034  23.271  -27.036 1.00 142.08 ? 241 ILE B CA    1 
ATOM   1479 C C     . ILE D 1 25 ? 18.348  24.123  -28.107 1.00 141.71 ? 241 ILE B C     1 
ATOM   1480 O O     . ILE D 1 25 ? 17.272  24.677  -27.862 1.00 147.13 ? 241 ILE B O     1 
ATOM   1481 C CB    . ILE D 1 25 ? 18.373  21.871  -26.830 1.00 134.69 ? 241 ILE B CB    1 
ATOM   1482 C CG1   . ILE D 1 25 ? 18.996  20.800  -27.726 1.00 131.69 ? 241 ILE B CG1   1 
ATOM   1483 C CG2   . ILE D 1 25 ? 16.847  21.888  -26.984 1.00 133.37 ? 241 ILE B CG2   1 
ATOM   1484 C CD1   . ILE D 1 25 ? 18.809  19.408  -27.161 1.00 125.65 ? 241 ILE B CD1   1 
ATOM   1485 N N     . THR D 1 26 ? 18.989  24.288  -29.263 1.00 138.94 ? 242 THR B N     1 
ATOM   1486 C CA    . THR D 1 26 ? 18.319  24.911  -30.407 1.00 133.65 ? 242 THR B CA    1 
ATOM   1487 C C     . THR D 1 26 ? 17.528  23.836  -31.129 1.00 130.86 ? 242 THR B C     1 
ATOM   1488 O O     . THR D 1 26 ? 17.917  22.651  -31.134 1.00 125.41 ? 242 THR B O     1 
ATOM   1489 C CB    . THR D 1 26 ? 19.281  25.570  -31.423 1.00 138.37 ? 242 THR B CB    1 
ATOM   1490 O OG1   . THR D 1 26 ? 19.986  24.563  -32.164 1.00 138.04 ? 242 THR B OG1   1 
ATOM   1491 C CG2   . THR D 1 26 ? 20.270  26.498  -30.731 1.00 143.58 ? 242 THR B CG2   1 
ATOM   1492 N N     . LYS D 1 27 ? 16.449  24.278  -31.772 1.00 126.63 ? 243 LYS B N     1 
ATOM   1493 C CA    . LYS D 1 27 ? 15.548  23.403  -32.542 1.00 120.33 ? 243 LYS B CA    1 
ATOM   1494 C C     . LYS D 1 27 ? 16.394  22.479  -33.427 1.00 111.28 ? 243 LYS B C     1 
ATOM   1495 O O     . LYS D 1 27 ? 16.243  21.252  -33.407 1.00 93.47  ? 243 LYS B O     1 
ATOM   1496 C CB    . LYS D 1 27 ? 14.576  24.232  -33.413 1.00 122.44 ? 243 LYS B CB    1 
ATOM   1497 C CG    . LYS D 1 27 ? 13.818  25.362  -32.705 1.00 125.76 ? 243 LYS B CG    1 
ATOM   1498 C CD    . LYS D 1 27 ? 12.974  26.207  -33.660 1.00 128.24 ? 243 LYS B CD    1 
ATOM   1499 C CE    . LYS D 1 27 ? 11.488  25.875  -33.587 1.00 126.83 ? 243 LYS B CE    1 
ATOM   1500 N NZ    . LYS D 1 27 ? 10.683  26.809  -34.422 1.00 128.18 ? 243 LYS B NZ    1 
ATOM   1501 N N     . ASP D 1 28 ? 17.306  23.114  -34.161 1.00 116.49 ? 244 ASP B N     1 
ATOM   1502 C CA    . ASP D 1 28 ? 18.312  22.470  -34.997 1.00 132.93 ? 244 ASP B CA    1 
ATOM   1503 C C     . ASP D 1 28 ? 19.101  21.393  -34.241 1.00 132.15 ? 244 ASP B C     1 
ATOM   1504 O O     . ASP D 1 28 ? 19.152  20.238  -34.676 1.00 124.16 ? 244 ASP B O     1 
ATOM   1505 C CB    . ASP D 1 28 ? 19.247  23.568  -35.554 1.00 145.42 ? 244 ASP B CB    1 
ATOM   1506 C CG    . ASP D 1 28 ? 20.502  23.018  -36.204 1.00 156.65 ? 244 ASP B CG    1 
ATOM   1507 O OD1   . ASP D 1 28 ? 20.392  22.128  -37.070 1.00 169.59 ? 244 ASP B OD1   1 
ATOM   1508 O OD2   . ASP D 1 28 ? 21.602  23.494  -35.848 1.00 161.84 ? 244 ASP B OD2   1 
ATOM   1509 N N     . LYS D 1 29 ? 19.699  21.777  -33.112 1.00 141.00 ? 245 LYS B N     1 
ATOM   1510 C CA    . LYS D 1 29 ? 20.537  20.856  -32.313 1.00 147.99 ? 245 LYS B CA    1 
ATOM   1511 C C     . LYS D 1 29 ? 19.747  19.660  -31.768 1.00 135.00 ? 245 LYS B C     1 
ATOM   1512 O O     . LYS D 1 29 ? 20.266  18.536  -31.732 1.00 118.38 ? 245 LYS B O     1 
ATOM   1513 C CB    . LYS D 1 29 ? 21.235  21.586  -31.144 1.00 159.04 ? 245 LYS B CB    1 
ATOM   1514 C CG    . LYS D 1 29 ? 22.504  22.362  -31.509 1.00 160.30 ? 245 LYS B CG    1 
ATOM   1515 C CD    . LYS D 1 29 ? 23.100  23.095  -30.305 1.00 164.22 ? 245 LYS B CD    1 
ATOM   1516 C CE    . LYS D 1 29 ? 23.852  22.162  -29.356 1.00 168.05 ? 245 LYS B CE    1 
ATOM   1517 N NZ    . LYS D 1 29 ? 24.233  22.796  -28.059 1.00 158.78 ? 245 LYS B NZ    1 
ATOM   1518 N N     . ARG D 1 30 ? 18.502  19.920  -31.355 1.00 128.11 ? 246 ARG B N     1 
ATOM   1519 C CA    . ARG D 1 30 ? 17.617  18.896  -30.778 1.00 123.12 ? 246 ARG B CA    1 
ATOM   1520 C C     . ARG D 1 30 ? 17.375  17.683  -31.683 1.00 126.58 ? 246 ARG B C     1 
ATOM   1521 O O     . ARG D 1 30 ? 17.251  16.557  -31.193 1.00 115.46 ? 246 ARG B O     1 
ATOM   1522 C CB    . ARG D 1 30 ? 16.276  19.515  -30.398 1.00 120.52 ? 246 ARG B CB    1 
ATOM   1523 C CG    . ARG D 1 30 ? 15.411  18.635  -29.509 1.00 124.01 ? 246 ARG B CG    1 
ATOM   1524 C CD    . ARG D 1 30 ? 13.947  19.005  -29.637 1.00 127.42 ? 246 ARG B CD    1 
ATOM   1525 N NE    . ARG D 1 30 ? 13.674  20.339  -29.122 1.00 127.15 ? 246 ARG B NE    1 
ATOM   1526 C CZ    . ARG D 1 30 ? 12.530  20.998  -29.284 1.00 132.06 ? 246 ARG B CZ    1 
ATOM   1527 N NH1   . ARG D 1 30 ? 11.511  20.462  -29.958 1.00 134.03 ? 246 ARG B NH1   1 
ATOM   1528 N NH2   . ARG D 1 30 ? 12.409  22.210  -28.757 1.00 145.05 ? 246 ARG B NH2   1 
ATOM   1529 N N     . ARG D 1 31 ? 17.298  17.914  -32.991 1.00 135.95 ? 247 ARG B N     1 
ATOM   1530 C CA    . ARG D 1 31 ? 17.093  16.830  -33.953 1.00 144.49 ? 247 ARG B CA    1 
ATOM   1531 C C     . ARG D 1 31 ? 18.265  15.837  -33.876 1.00 150.13 ? 247 ARG B C     1 
ATOM   1532 O O     . ARG D 1 31 ? 18.073  14.654  -33.549 1.00 139.63 ? 247 ARG B O     1 
ATOM   1533 C CB    . ARG D 1 31 ? 16.911  17.406  -35.376 1.00 152.18 ? 247 ARG B CB    1 
ATOM   1534 C CG    . ARG D 1 31 ? 16.375  16.415  -36.415 1.00 153.12 ? 247 ARG B CG    1 
ATOM   1535 C CD    . ARG D 1 31 ? 15.524  17.043  -37.525 1.00 150.00 ? 247 ARG B CD    1 
ATOM   1536 N NE    . ARG D 1 31 ? 16.257  17.273  -38.778 1.00 145.87 ? 247 ARG B NE    1 
ATOM   1537 C CZ    . ARG D 1 31 ? 16.406  16.397  -39.779 1.00 135.40 ? 247 ARG B CZ    1 
ATOM   1538 N NH1   . ARG D 1 31 ? 15.886  15.168  -39.729 1.00 134.45 ? 247 ARG B NH1   1 
ATOM   1539 N NH2   . ARG D 1 31 ? 17.100  16.757  -40.854 1.00 132.79 ? 247 ARG B NH2   1 
ATOM   1540 N N     . LYS D 1 32 ? 19.475  16.357  -34.098 1.00 156.52 ? 248 LYS B N     1 
ATOM   1541 C CA    . LYS D 1 32 ? 20.710  15.551  -34.197 1.00 161.47 ? 248 LYS B CA    1 
ATOM   1542 C C     . LYS D 1 32 ? 20.896  14.545  -33.067 1.00 154.54 ? 248 LYS B C     1 
ATOM   1543 O O     . LYS D 1 32 ? 21.280  13.394  -33.306 1.00 153.86 ? 248 LYS B O     1 
ATOM   1544 C CB    . LYS D 1 32 ? 21.946  16.458  -34.246 1.00 167.48 ? 248 LYS B CB    1 
ATOM   1545 C CG    . LYS D 1 32 ? 22.018  17.330  -35.485 1.00 173.79 ? 248 LYS B CG    1 
ATOM   1546 C CD    . LYS D 1 32 ? 23.442  17.727  -35.830 1.00 176.41 ? 248 LYS B CD    1 
ATOM   1547 C CE    . LYS D 1 32 ? 23.484  18.459  -37.162 1.00 177.08 ? 248 LYS B CE    1 
ATOM   1548 N NZ    . LYS D 1 32 ? 22.620  19.676  -37.168 1.00 176.37 ? 248 LYS B NZ    1 
ATOM   1549 N N     . ILE D 1 33 ? 20.611  14.995  -31.847 1.00 139.87 ? 249 ILE B N     1 
ATOM   1550 C CA    . ILE D 1 33 ? 20.744  14.164  -30.647 1.00 141.05 ? 249 ILE B CA    1 
ATOM   1551 C C     . ILE D 1 33 ? 19.736  13.019  -30.700 1.00 139.09 ? 249 ILE B C     1 
ATOM   1552 O O     . ILE D 1 33 ? 20.080  11.852  -30.403 1.00 137.82 ? 249 ILE B O     1 
ATOM   1553 C CB    . ILE D 1 33 ? 20.502  14.979  -29.357 1.00 144.74 ? 249 ILE B CB    1 
ATOM   1554 C CG1   . ILE D 1 33 ? 21.455  16.182  -29.274 1.00 144.04 ? 249 ILE B CG1   1 
ATOM   1555 C CG2   . ILE D 1 33 ? 20.704  14.114  -28.117 1.00 150.11 ? 249 ILE B CG2   1 
ATOM   1556 C CD1   . ILE D 1 33 ? 20.780  17.447  -28.810 1.00 139.34 ? 249 ILE B CD1   1 
ATOM   1557 N N     . SER D 1 34 ? 18.505  13.369  -31.096 1.00 129.67 ? 250 SER B N     1 
ATOM   1558 C CA    . SER D 1 34 ? 17.400  12.419  -31.173 1.00 110.35 ? 250 SER B CA    1 
ATOM   1559 C C     . SER D 1 34 ? 17.748  11.233  -32.048 1.00 101.93 ? 250 SER B C     1 
ATOM   1560 O O     . SER D 1 34 ? 17.349  10.115  -31.720 1.00 85.84  ? 250 SER B O     1 
ATOM   1561 C CB    . SER D 1 34 ? 16.123  13.085  -31.682 1.00 108.64 ? 250 SER B CB    1 
ATOM   1562 O OG    . SER D 1 34 ? 15.020  12.205  -31.555 1.00 111.97 ? 250 SER B OG    1 
ATOM   1563 N N     . ALA D 1 35 ? 18.505  11.473  -33.126 1.00 99.45  ? 251 ALA B N     1 
ATOM   1564 C CA    . ALA D 1 35 ? 18.951  10.397  -34.033 1.00 122.03 ? 251 ALA B CA    1 
ATOM   1565 C C     . ALA D 1 35 ? 19.745  9.289   -33.323 1.00 131.37 ? 251 ALA B C     1 
ATOM   1566 O O     . ALA D 1 35 ? 19.290  8.138   -33.239 1.00 125.38 ? 251 ALA B O     1 
ATOM   1567 C CB    . ALA D 1 35 ? 19.765  10.968  -35.197 1.00 124.08 ? 251 ALA B CB    1 
ATOM   1568 N N     . ALA D 1 36 ? 20.915  9.654   -32.801 1.00 143.57 ? 252 ALA B N     1 
ATOM   1569 C CA    . ALA D 1 36 ? 21.805  8.704   -32.130 1.00 152.96 ? 252 ALA B CA    1 
ATOM   1570 C C     . ALA D 1 36 ? 21.248  8.226   -30.786 1.00 145.45 ? 252 ALA B C     1 
ATOM   1571 O O     . ALA D 1 36 ? 21.409  7.048   -30.444 1.00 144.55 ? 252 ALA B O     1 
ATOM   1572 C CB    . ALA D 1 36 ? 23.191  9.308   -31.941 1.00 160.65 ? 252 ALA B CB    1 
ATOM   1573 N N     . THR D 1 37 ? 20.599  9.121   -30.033 1.00 130.18 ? 253 THR B N     1 
ATOM   1574 C CA    . THR D 1 37 ? 20.004  8.725   -28.746 1.00 127.31 ? 253 THR B CA    1 
ATOM   1575 C C     . THR D 1 37 ? 18.757  7.848   -28.879 1.00 133.00 ? 253 THR B C     1 
ATOM   1576 O O     . THR D 1 37 ? 18.491  7.034   -27.994 1.00 135.05 ? 253 THR B O     1 
ATOM   1577 C CB    . THR D 1 37 ? 19.627  9.936   -27.881 1.00 130.03 ? 253 THR B CB    1 
ATOM   1578 O OG1   . THR D 1 37 ? 18.703  10.772  -28.582 1.00 132.28 ? 253 THR B OG1   1 
ATOM   1579 C CG2   . THR D 1 37 ? 20.862  10.732  -27.518 1.00 142.99 ? 253 THR B CG2   1 
ATOM   1580 N N     . SER D 1 38 ? 18.006  8.030   -29.974 1.00 128.87 ? 254 SER B N     1 
ATOM   1581 C CA    . SER D 1 38 ? 16.705  7.376   -30.215 1.00 114.75 ? 254 SER B CA    1 
ATOM   1582 C C     . SER D 1 38 ? 15.659  7.680   -29.119 1.00 109.65 ? 254 SER B C     1 
ATOM   1583 O O     . SER D 1 38 ? 14.926  6.807   -28.663 1.00 108.79 ? 254 SER B O     1 
ATOM   1584 C CB    . SER D 1 38 ? 16.893  5.874   -30.449 1.00 111.67 ? 254 SER B CB    1 
ATOM   1585 O OG    . SER D 1 38 ? 17.849  5.661   -31.480 1.00 112.54 ? 254 SER B OG    1 
ATOM   1586 N N     . LEU D 1 39 ? 15.611  8.949   -28.726 1.00 111.18 ? 255 LEU B N     1 
ATOM   1587 C CA    . LEU D 1 39 ? 14.658  9.469   -27.759 1.00 111.10 ? 255 LEU B CA    1 
ATOM   1588 C C     . LEU D 1 39 ? 13.781  10.460  -28.482 1.00 117.34 ? 255 LEU B C     1 
ATOM   1589 O O     . LEU D 1 39 ? 14.284  11.252  -29.284 1.00 119.43 ? 255 LEU B O     1 
ATOM   1590 C CB    . LEU D 1 39 ? 15.384  10.235  -26.656 1.00 118.69 ? 255 LEU B CB    1 
ATOM   1591 C CG    . LEU D 1 39 ? 16.188  9.458   -25.615 1.00 118.36 ? 255 LEU B CG    1 
ATOM   1592 C CD1   . LEU D 1 39 ? 17.159  10.412  -24.936 1.00 121.95 ? 255 LEU B CD1   1 
ATOM   1593 C CD2   . LEU D 1 39 ? 15.271  8.791   -24.591 1.00 111.89 ? 255 LEU B CD2   1 
ATOM   1594 N N     . SER D 1 40 ? 12.482  10.433  -28.188 1.00 121.22 ? 256 SER B N     1 
ATOM   1595 C CA    . SER D 1 40 ? 11.559  11.489  -28.624 1.00 111.99 ? 256 SER B CA    1 
ATOM   1596 C C     . SER D 1 40 ? 12.190  12.854  -28.364 1.00 111.71 ? 256 SER B C     1 
ATOM   1597 O O     . SER D 1 40 ? 12.680  13.129  -27.268 1.00 112.81 ? 256 SER B O     1 
ATOM   1598 C CB    . SER D 1 40 ? 10.194  11.385  -27.914 1.00 104.95 ? 256 SER B CB    1 
ATOM   1599 O OG    . SER D 1 40 ? 9.712   12.661  -27.512 1.00 97.37  ? 256 SER B OG    1 
ATOM   1600 N N     . GLU D 1 41 ? 12.183  13.704  -29.382 1.00 114.33 ? 257 GLU B N     1 
ATOM   1601 C CA    . GLU D 1 41 ? 12.712  15.053  -29.243 1.00 121.69 ? 257 GLU B CA    1 
ATOM   1602 C C     . GLU D 1 41 ? 12.083  15.743  -28.023 1.00 114.82 ? 257 GLU B C     1 
ATOM   1603 O O     . GLU D 1 41 ? 12.743  16.544  -27.372 1.00 120.26 ? 257 GLU B O     1 
ATOM   1604 C CB    . GLU D 1 41 ? 12.532  15.883  -30.541 1.00 135.55 ? 257 GLU B CB    1 
ATOM   1605 C CG    . GLU D 1 41 ? 11.218  16.654  -30.687 1.00 155.54 ? 257 GLU B CG    1 
ATOM   1606 C CD    . GLU D 1 41 ? 10.008  15.751  -30.866 1.00 173.39 ? 257 GLU B CD    1 
ATOM   1607 O OE1   . GLU D 1 41 ? 9.778   15.319  -32.013 1.00 185.47 ? 257 GLU B OE1   1 
ATOM   1608 O OE2   . GLU D 1 41 ? 9.277   15.484  -29.880 1.00 170.66 ? 257 GLU B OE2   1 
ATOM   1609 N N     . ARG D 1 42 ? 10.825  15.428  -27.696 1.00 104.46 ? 258 ARG B N     1 
ATOM   1610 C CA    . ARG D 1 42 ? 10.220  16.041  -26.531 1.00 98.11  ? 258 ARG B CA    1 
ATOM   1611 C C     . ARG D 1 42 ? 10.957  15.599  -25.290 1.00 94.75  ? 258 ARG B C     1 
ATOM   1612 O O     . ARG D 1 42 ? 11.337  16.443  -24.480 1.00 101.51 ? 258 ARG B O     1 
ATOM   1613 C CB    . ARG D 1 42 ? 8.718   15.787  -26.393 1.00 97.54  ? 258 ARG B CB    1 
ATOM   1614 C CG    . ARG D 1 42 ? 8.070   17.026  -25.796 1.00 99.10  ? 258 ARG B CG    1 
ATOM   1615 C CD    . ARG D 1 42 ? 6.638   16.877  -25.322 1.00 105.13 ? 258 ARG B CD    1 
ATOM   1616 N NE    . ARG D 1 42 ? 6.452   17.372  -23.946 1.00 114.25 ? 258 ARG B NE    1 
ATOM   1617 C CZ    . ARG D 1 42 ? 6.724   18.607  -23.498 1.00 106.96 ? 258 ARG B CZ    1 
ATOM   1618 N NH1   . ARG D 1 42 ? 6.494   18.891  -22.216 1.00 109.57 ? 258 ARG B NH1   1 
ATOM   1619 N NH2   . ARG D 1 42 ? 7.234   19.558  -24.293 1.00 98.87  ? 258 ARG B NH2   1 
ATOM   1620 N N     . GLN D 1 43 ? 11.215  14.296  -25.184 1.00 89.55  ? 259 GLN B N     1 
ATOM   1621 C CA    . GLN D 1 43 ? 12.008  13.744  -24.076 1.00 83.73  ? 259 GLN B CA    1 
ATOM   1622 C C     . GLN D 1 43 ? 13.284  14.530  -23.813 1.00 88.64  ? 259 GLN B C     1 
ATOM   1623 O O     . GLN D 1 43 ? 13.617  14.820  -22.670 1.00 98.15  ? 259 GLN B O     1 
ATOM   1624 C CB    . GLN D 1 43 ? 12.406  12.318  -24.356 1.00 77.10  ? 259 GLN B CB    1 
ATOM   1625 C CG    . GLN D 1 43 ? 11.270  11.352  -24.254 1.00 83.22  ? 259 GLN B CG    1 
ATOM   1626 C CD    . GLN D 1 43 ? 11.690  9.977   -24.699 1.00 98.31  ? 259 GLN B CD    1 
ATOM   1627 O OE1   . GLN D 1 43 ? 12.215  9.807   -25.803 1.00 103.98 ? 259 GLN B OE1   1 
ATOM   1628 N NE2   . GLN D 1 43 ? 11.473  8.982   -23.840 1.00 100.91 ? 259 GLN B NE2   1 
ATOM   1629 N N     . ILE D 1 44 ? 13.977  14.865  -24.889 1.00 87.74  ? 260 ILE B N     1 
ATOM   1630 C CA    . ILE D 1 44 ? 15.180  15.682  -24.844 1.00 90.97  ? 260 ILE B CA    1 
ATOM   1631 C C     . ILE D 1 44 ? 14.869  17.053  -24.256 1.00 95.31  ? 260 ILE B C     1 
ATOM   1632 O O     . ILE D 1 44 ? 15.550  17.528  -23.318 1.00 122.52 ? 260 ILE B O     1 
ATOM   1633 C CB    . ILE D 1 44 ? 15.784  15.812  -26.269 1.00 96.53  ? 260 ILE B CB    1 
ATOM   1634 C CG1   . ILE D 1 44 ? 16.136  14.396  -26.799 1.00 107.34 ? 260 ILE B CG1   1 
ATOM   1635 C CG2   . ILE D 1 44 ? 16.963  16.782  -26.298 1.00 98.27  ? 260 ILE B CG2   1 
ATOM   1636 C CD1   . ILE D 1 44 ? 17.264  14.312  -27.808 1.00 112.82 ? 260 ILE B CD1   1 
ATOM   1637 N N     . THR D 1 45 ? 13.832  17.679  -24.798 1.00 98.85  ? 261 THR B N     1 
ATOM   1638 C CA    . THR D 1 45 ? 13.446  19.018  -24.372 1.00 104.57 ? 261 THR B CA    1 
ATOM   1639 C C     . THR D 1 45 ? 13.136  19.040  -22.886 1.00 107.14 ? 261 THR B C     1 
ATOM   1640 O O     . THR D 1 45 ? 13.599  19.931  -22.190 1.00 112.12 ? 261 THR B O     1 
ATOM   1641 C CB    . THR D 1 45 ? 12.238  19.550  -25.156 1.00 97.08  ? 261 THR B CB    1 
ATOM   1642 O OG1   . THR D 1 45 ? 12.310  19.081  -26.509 1.00 98.60  ? 261 THR B OG1   1 
ATOM   1643 C CG2   . THR D 1 45 ? 12.235  21.082  -25.135 1.00 94.35  ? 261 THR B CG2   1 
ATOM   1644 N N     . ILE D 1 46 ? 12.370  18.045  -22.428 1.00 111.88 ? 262 ILE B N     1 
ATOM   1645 C CA    . ILE D 1 46 ? 12.111  17.798  -20.998 1.00 111.38 ? 262 ILE B CA    1 
ATOM   1646 C C     . ILE D 1 46 ? 13.439  17.681  -20.267 1.00 112.53 ? 262 ILE B C     1 
ATOM   1647 O O     . ILE D 1 46 ? 13.751  18.485  -19.385 1.00 103.61 ? 262 ILE B O     1 
ATOM   1648 C CB    . ILE D 1 46 ? 11.236  16.515  -20.775 1.00 109.48 ? 262 ILE B CB    1 
ATOM   1649 C CG1   . ILE D 1 46 ? 9.742   16.870  -20.903 1.00 110.29 ? 262 ILE B CG1   1 
ATOM   1650 C CG2   . ILE D 1 46 ? 11.487  15.864  -19.411 1.00 113.08 ? 262 ILE B CG2   1 
ATOM   1651 C CD1   . ILE D 1 46 ? 8.802   15.688  -21.069 1.00 106.31 ? 262 ILE B CD1   1 
ATOM   1652 N N     . TRP D 1 47 ? 14.219  16.682  -20.668 1.00 119.59 ? 263 TRP B N     1 
ATOM   1653 C CA    . TRP D 1 47 ? 15.473  16.368  -20.012 1.00 115.29 ? 263 TRP B CA    1 
ATOM   1654 C C     . TRP D 1 47 ? 16.198  17.657  -19.742 1.00 108.73 ? 263 TRP B C     1 
ATOM   1655 O O     . TRP D 1 47 ? 16.505  17.972  -18.580 1.00 129.19 ? 263 TRP B O     1 
ATOM   1656 C CB    . TRP D 1 47 ? 16.351  15.439  -20.854 1.00 115.06 ? 263 TRP B CB    1 
ATOM   1657 C CG    . TRP D 1 47 ? 17.484  14.973  -20.074 1.00 124.10 ? 263 TRP B CG    1 
ATOM   1658 C CD1   . TRP D 1 47 ? 17.531  13.864  -19.293 1.00 131.33 ? 263 TRP B CD1   1 
ATOM   1659 C CD2   . TRP D 1 47 ? 18.738  15.635  -19.916 1.00 129.79 ? 263 TRP B CD2   1 
ATOM   1660 N NE1   . TRP D 1 47 ? 18.751  13.775  -18.674 1.00 133.50 ? 263 TRP B NE1   1 
ATOM   1661 C CE2   . TRP D 1 47 ? 19.511  14.854  -19.039 1.00 125.14 ? 263 TRP B CE2   1 
ATOM   1662 C CE3   . TRP D 1 47 ? 19.288  16.810  -20.437 1.00 135.96 ? 263 TRP B CE3   1 
ATOM   1663 C CZ2   . TRP D 1 47 ? 20.807  15.203  -18.675 1.00 118.59 ? 263 TRP B CZ2   1 
ATOM   1664 C CZ3   . TRP D 1 47 ? 20.578  17.156  -20.074 1.00 132.27 ? 263 TRP B CZ3   1 
ATOM   1665 C CH2   . TRP D 1 47 ? 21.323  16.352  -19.203 1.00 122.40 ? 263 TRP B CH2   1 
ATOM   1666 N N     . PHE D 1 48 ? 16.424  18.423  -20.805 1.00 100.98 ? 264 PHE B N     1 
ATOM   1667 C CA    . PHE D 1 48 ? 17.103  19.705  -20.635 1.00 113.45 ? 264 PHE B CA    1 
ATOM   1668 C C     . PHE D 1 48 ? 16.525  20.510  -19.463 1.00 118.03 ? 264 PHE B C     1 
ATOM   1669 O O     . PHE D 1 48 ? 17.233  20.753  -18.485 1.00 122.09 ? 264 PHE B O     1 
ATOM   1670 C CB    . PHE D 1 48 ? 17.135  20.520  -21.934 1.00 117.79 ? 264 PHE B CB    1 
ATOM   1671 C CG    . PHE D 1 48 ? 18.431  20.376  -22.693 1.00 121.35 ? 264 PHE B CG    1 
ATOM   1672 C CD1   . PHE D 1 48 ? 18.790  19.148  -23.257 1.00 115.99 ? 264 PHE B CD1   1 
ATOM   1673 C CD2   . PHE D 1 48 ? 19.307  21.460  -22.825 1.00 119.97 ? 264 PHE B CD2   1 
ATOM   1674 C CE1   . PHE D 1 48 ? 19.984  19.007  -23.944 1.00 113.47 ? 264 PHE B CE1   1 
ATOM   1675 C CE2   . PHE D 1 48 ? 20.500  21.326  -23.515 1.00 121.04 ? 264 PHE B CE2   1 
ATOM   1676 C CZ    . PHE D 1 48 ? 20.840  20.097  -24.074 1.00 125.87 ? 264 PHE B CZ    1 
ATOM   1677 N N     . GLN D 1 49 ? 15.241  20.851  -19.530 1.00 118.61 ? 265 GLN B N     1 
ATOM   1678 C CA    . GLN D 1 49 ? 14.544  21.561  -18.423 1.00 122.58 ? 265 GLN B CA    1 
ATOM   1679 C C     . GLN D 1 49 ? 14.937  20.993  -17.054 1.00 125.74 ? 265 GLN B C     1 
ATOM   1680 O O     . GLN D 1 49 ? 15.247  21.750  -16.112 1.00 135.76 ? 265 GLN B O     1 
ATOM   1681 C CB    . GLN D 1 49 ? 13.004  21.513  -18.559 1.00 123.60 ? 265 GLN B CB    1 
ATOM   1682 C CG    . GLN D 1 49 ? 12.465  21.576  -19.982 1.00 121.49 ? 265 GLN B CG    1 
ATOM   1683 C CD    . GLN D 1 49 ? 10.994  21.888  -20.086 1.00 115.59 ? 265 GLN B CD    1 
ATOM   1684 O OE1   . GLN D 1 49 ? 10.605  22.847  -20.752 1.00 120.45 ? 265 GLN B OE1   1 
ATOM   1685 N NE2   . GLN D 1 49 ? 10.163  21.064  -19.456 1.00 107.81 ? 265 GLN B NE2   1 
ATOM   1686 N N     . ASN D 1 50 ? 14.956  19.661  -16.965 1.00 119.15 ? 266 ASN B N     1 
ATOM   1687 C CA    . ASN D 1 50 ? 15.326  18.997  -15.728 1.00 116.75 ? 266 ASN B CA    1 
ATOM   1688 C C     . ASN D 1 50 ? 16.789  19.270  -15.358 1.00 122.63 ? 266 ASN B C     1 
ATOM   1689 O O     . ASN D 1 50 ? 17.071  19.690  -14.225 1.00 116.35 ? 266 ASN B O     1 
ATOM   1690 C CB    . ASN D 1 50 ? 15.002  17.502  -15.801 1.00 110.49 ? 266 ASN B CB    1 
ATOM   1691 C CG    . ASN D 1 50 ? 13.506  17.247  -15.881 1.00 111.00 ? 266 ASN B CG    1 
ATOM   1692 O OD1   . ASN D 1 50 ? 12.706  18.096  -15.478 1.00 95.32  ? 266 ASN B OD1   1 
ATOM   1693 N ND2   . ASN D 1 50 ? 13.118  16.080  -16.402 1.00 113.71 ? 266 ASN B ND2   1 
ATOM   1694 N N     . ARG D 1 51 ? 17.704  19.099  -16.311 1.00 124.63 ? 267 ARG B N     1 
ATOM   1695 C CA    . ARG D 1 51 ? 19.126  19.384  -16.046 1.00 132.33 ? 267 ARG B CA    1 
ATOM   1696 C C     . ARG D 1 51 ? 19.437  20.881  -15.788 1.00 134.39 ? 267 ARG B C     1 
ATOM   1697 O O     . ARG D 1 51 ? 20.437  21.188  -15.136 1.00 139.88 ? 267 ARG B O     1 
ATOM   1698 C CB    . ARG D 1 51 ? 20.020  18.808  -17.161 1.00 137.91 ? 267 ARG B CB    1 
ATOM   1699 C CG    . ARG D 1 51 ? 21.526  18.876  -16.903 1.00 138.00 ? 267 ARG B CG    1 
ATOM   1700 C CD    . ARG D 1 51 ? 21.992  18.048  -15.711 1.00 147.65 ? 267 ARG B CD    1 
ATOM   1701 N NE    . ARG D 1 51 ? 23.436  18.173  -15.476 1.00 154.45 ? 267 ARG B NE    1 
ATOM   1702 C CZ    . ARG D 1 51 ? 24.042  19.179  -14.830 1.00 160.92 ? 267 ARG B CZ    1 
ATOM   1703 N NH1   . ARG D 1 51 ? 23.359  20.204  -14.310 1.00 164.49 ? 267 ARG B NH1   1 
ATOM   1704 N NH2   . ARG D 1 51 ? 25.368  19.160  -14.700 1.00 156.90 ? 267 ARG B NH2   1 
ATOM   1705 N N     . ARG D 1 52 ? 18.591  21.799  -16.272 1.00 135.92 ? 268 ARG B N     1 
ATOM   1706 C CA    . ARG D 1 52 ? 18.734  23.241  -15.946 1.00 131.31 ? 268 ARG B CA    1 
ATOM   1707 C C     . ARG D 1 52 ? 18.146  23.516  -14.563 1.00 125.78 ? 268 ARG B C     1 
ATOM   1708 O O     . ARG D 1 52 ? 18.697  24.323  -13.814 1.00 112.65 ? 268 ARG B O     1 
ATOM   1709 C CB    . ARG D 1 52 ? 18.075  24.192  -16.972 1.00 137.78 ? 268 ARG B CB    1 
ATOM   1710 C CG    . ARG D 1 52 ? 17.950  23.675  -18.396 1.00 146.74 ? 268 ARG B CG    1 
ATOM   1711 C CD    . ARG D 1 52 ? 17.758  24.760  -19.443 1.00 146.81 ? 268 ARG B CD    1 
ATOM   1712 N NE    . ARG D 1 52 ? 17.034  24.218  -20.597 1.00 144.14 ? 268 ARG B NE    1 
ATOM   1713 C CZ    . ARG D 1 52 ? 15.706  24.179  -20.739 1.00 146.37 ? 268 ARG B CZ    1 
ATOM   1714 N NH1   . ARG D 1 52 ? 14.887  24.676  -19.810 1.00 142.00 ? 268 ARG B NH1   1 
ATOM   1715 N NH2   . ARG D 1 52 ? 15.186  23.651  -21.846 1.00 157.16 ? 268 ARG B NH2   1 
ATOM   1716 N N     . VAL D 1 53 ? 17.015  22.871  -14.244 1.00 133.67 ? 269 VAL B N     1 
ATOM   1717 C CA    . VAL D 1 53 ? 16.454  22.931  -12.877 1.00 138.75 ? 269 VAL B CA    1 
ATOM   1718 C C     . VAL D 1 53 ? 17.510  22.455  -11.870 1.00 131.94 ? 269 VAL B C     1 
ATOM   1719 O O     . VAL D 1 53 ? 17.911  23.210  -10.977 1.00 130.12 ? 269 VAL B O     1 
ATOM   1720 C CB    . VAL D 1 53 ? 15.130  22.118  -12.755 1.00 141.65 ? 269 VAL B CB    1 
ATOM   1721 C CG1   . VAL D 1 53 ? 14.784  21.787  -11.301 1.00 137.86 ? 269 VAL B CG1   1 
ATOM   1722 C CG2   . VAL D 1 53 ? 13.979  22.874  -13.422 1.00 141.24 ? 269 VAL B CG2   1 
ATOM   1723 N N     . LYS D 1 54 ? 17.969  21.221  -12.059 1.00 123.90 ? 270 LYS B N     1 
ATOM   1724 C CA    . LYS D 1 54 ? 19.053  20.626  -11.269 1.00 116.55 ? 270 LYS B CA    1 
ATOM   1725 C C     . LYS D 1 54 ? 20.207  21.587  -10.989 1.00 111.84 ? 270 LYS B C     1 
ATOM   1726 O O     . LYS D 1 54 ? 20.521  21.866  -9.824  1.00 115.81 ? 270 LYS B O     1 
ATOM   1727 C CB    . LYS D 1 54 ? 19.586  19.395  -11.995 1.00 118.32 ? 270 LYS B CB    1 
ATOM   1728 C CG    . LYS D 1 54 ? 20.821  18.788  -11.367 1.00 117.99 ? 270 LYS B CG    1 
ATOM   1729 C CD    . LYS D 1 54 ? 20.930  17.311  -11.679 1.00 124.40 ? 270 LYS B CD    1 
ATOM   1730 C CE    . LYS D 1 54 ? 22.022  16.682  -10.838 1.00 135.87 ? 270 LYS B CE    1 
ATOM   1731 N NZ    . LYS D 1 54 ? 21.937  15.205  -10.838 1.00 138.60 ? 270 LYS B NZ    1 
ATOM   1732 N N     . GLU D 1 55 ? 20.823  22.108  -12.046 1.00 116.08 ? 271 GLU B N     1 
ATOM   1733 C CA    . GLU D 1 55 ? 21.913  23.070  -11.882 1.00 133.38 ? 271 GLU B CA    1 
ATOM   1734 C C     . GLU D 1 55 ? 21.506  24.216  -10.974 1.00 141.93 ? 271 GLU B C     1 
ATOM   1735 O O     . GLU D 1 55 ? 22.302  24.649  -10.142 1.00 154.71 ? 271 GLU B O     1 
ATOM   1736 C CB    . GLU D 1 55 ? 22.385  23.651  -13.215 1.00 140.96 ? 271 GLU B CB    1 
ATOM   1737 C CG    . GLU D 1 55 ? 23.371  24.809  -13.037 1.00 146.76 ? 271 GLU B CG    1 
ATOM   1738 C CD    . GLU D 1 55 ? 24.160  25.148  -14.279 1.00 156.92 ? 271 GLU B CD    1 
ATOM   1739 O OE1   . GLU D 1 55 ? 24.434  26.354  -14.483 1.00 162.24 ? 271 GLU B OE1   1 
ATOM   1740 O OE2   . GLU D 1 55 ? 24.514  24.221  -15.042 1.00 164.97 ? 271 GLU B OE2   1 
ATOM   1741 N N     . LYS D 1 56 ? 20.277  24.704  -11.138 1.00 143.35 ? 272 LYS B N     1 
ATOM   1742 C CA    . LYS D 1 56 ? 19.787  25.813  -10.317 1.00 144.48 ? 272 LYS B CA    1 
ATOM   1743 C C     . LYS D 1 56 ? 19.661  25.397  -8.842  1.00 156.70 ? 272 LYS B C     1 
ATOM   1744 O O     . LYS D 1 56 ? 19.819  26.246  -7.962  1.00 164.41 ? 272 LYS B O     1 
ATOM   1745 C CB    . LYS D 1 56 ? 18.452  26.364  -10.853 1.00 137.52 ? 272 LYS B CB    1 
ATOM   1746 C CG    . LYS D 1 56 ? 18.406  27.883  -11.016 1.00 129.83 ? 272 LYS B CG    1 
ATOM   1747 C CD    . LYS D 1 56 ? 17.193  28.514  -10.342 1.00 126.01 ? 272 LYS B CD    1 
ATOM   1748 C CE    . LYS D 1 56 ? 16.732  29.760  -11.090 1.00 125.98 ? 272 LYS B CE    1 
ATOM   1749 N NZ    . LYS D 1 56 ? 15.496  30.331  -10.480 1.00 127.86 ? 272 LYS B NZ    1 
ATOM   1750 N N     . LYS D 1 57 ? 19.381  24.107  -8.585  1.00 170.57 ? 273 LYS B N     1 
ATOM   1751 C CA    . LYS D 1 57 ? 19.416  23.538  -7.215  1.00 173.91 ? 273 LYS B CA    1 
ATOM   1752 C C     . LYS D 1 57 ? 20.847  23.364  -6.687  1.00 172.32 ? 273 LYS B C     1 
ATOM   1753 O O     . LYS D 1 57 ? 21.101  23.557  -5.489  1.00 162.61 ? 273 LYS B O     1 
ATOM   1754 C CB    . LYS D 1 57 ? 18.679  22.188  -7.131  1.00 170.59 ? 273 LYS B CB    1 
ATOM   1755 C CG    . LYS D 1 57 ? 17.170  22.281  -7.232  1.00 168.75 ? 273 LYS B CG    1 
ATOM   1756 C CD    . LYS D 1 57 ? 16.538  20.902  -7.141  1.00 173.90 ? 273 LYS B CD    1 
ATOM   1757 C CE    . LYS D 1 57 ? 15.032  20.971  -7.322  1.00 178.65 ? 273 LYS B CE    1 
ATOM   1758 N NZ    . LYS D 1 57 ? 14.473  19.658  -7.738  1.00 181.49 ? 273 LYS B NZ    1 
ATOM   1759 N N     . VAL D 1 58 ? 21.767  22.980  -7.573  1.00 169.38 ? 274 VAL B N     1 
ATOM   1760 C CA    . VAL D 1 58 ? 23.194  22.901  -7.217  1.00 159.82 ? 274 VAL B CA    1 
ATOM   1761 C C     . VAL D 1 58 ? 23.818  24.309  -6.995  1.00 173.29 ? 274 VAL B C     1 
ATOM   1762 O O     . VAL D 1 58 ? 24.800  24.438  -6.259  1.00 187.94 ? 274 VAL B O     1 
ATOM   1763 C CB    . VAL D 1 58 ? 23.974  22.034  -8.242  1.00 146.40 ? 274 VAL B CB    1 
ATOM   1764 C CG1   . VAL D 1 58 ? 25.469  22.029  -7.955  1.00 145.00 ? 274 VAL B CG1   1 
ATOM   1765 C CG2   . VAL D 1 58 ? 23.444  20.602  -8.221  1.00 142.92 ? 274 VAL B CG2   1 
ATOM   1766 N N     . LEU D 1 59 ? 23.235  25.352  -7.599  1.00 182.26 ? 275 LEU B N     1 
ATOM   1767 C CA    . LEU D 1 59 ? 23.642  26.756  -7.335  1.00 182.52 ? 275 LEU B CA    1 
ATOM   1768 C C     . LEU D 1 59 ? 23.291  27.280  -5.932  1.00 183.74 ? 275 LEU B C     1 
ATOM   1769 O O     . LEU D 1 59 ? 23.881  28.266  -5.491  1.00 198.36 ? 275 LEU B O     1 
ATOM   1770 C CB    . LEU D 1 59 ? 23.086  27.732  -8.397  1.00 185.05 ? 275 LEU B CB    1 
ATOM   1771 C CG    . LEU D 1 59 ? 24.089  28.226  -9.451  1.00 188.92 ? 275 LEU B CG    1 
ATOM   1772 C CD1   . LEU D 1 59 ? 24.517  27.108  -10.397 1.00 191.07 ? 275 LEU B CD1   1 
ATOM   1773 C CD2   . LEU D 1 59 ? 23.514  29.402  -10.233 1.00 187.62 ? 275 LEU B CD2   1 
ATOM   1774 N N     . ALA D 1 60 ? 22.333  26.651  -5.249  1.00 177.58 ? 276 ALA B N     1 
ATOM   1775 C CA    . ALA D 1 60 ? 22.044  26.980  -3.849  1.00 176.80 ? 276 ALA B CA    1 
ATOM   1776 C C     . ALA D 1 60 ? 23.202  26.534  -2.933  1.00 180.33 ? 276 ALA B C     1 
ATOM   1777 O O     . ALA D 1 60 ? 23.388  25.337  -2.690  1.00 160.36 ? 276 ALA B O     1 
ATOM   1778 C CB    . ALA D 1 60 ? 20.730  26.347  -3.407  1.00 170.36 ? 276 ALA B CB    1 
ATOM   1779 N N     . LYS D 1 61 ? 23.983  27.513  -2.462  1.00 195.42 ? 277 LYS B N     1 
ATOM   1780 C CA    . LYS D 1 61 ? 25.087  27.303  -1.509  1.00 200.57 ? 277 LYS B CA    1 
ATOM   1781 C C     . LYS D 1 61 ? 24.683  27.802  -0.113  1.00 201.17 ? 277 LYS B C     1 
ATOM   1782 O O     . LYS D 1 61 ? 25.038  28.918  0.289   1.00 208.87 ? 277 LYS B O     1 
ATOM   1783 C CB    . LYS D 1 61 ? 26.356  28.027  -1.987  1.00 199.01 ? 277 LYS B CB    1 
ATOM   1784 C CG    . LYS D 1 61 ? 26.991  27.422  -3.229  1.00 198.35 ? 277 LYS B CG    1 
ATOM   1785 C CD    . LYS D 1 61 ? 27.842  26.202  -2.894  1.00 194.93 ? 277 LYS B CD    1 
ATOM   1786 C CE    . LYS D 1 61 ? 27.906  25.215  -4.051  1.00 190.19 ? 277 LYS B CE    1 
ATOM   1787 N NZ    . LYS D 1 61 ? 26.643  24.433  -4.194  1.00 185.76 ? 277 LYS B NZ    1 
ATOM   1788 N N     . VAL D 1 62 ? 23.947  26.956  0.612   1.00 188.50 ? 278 VAL B N     1 
ATOM   1789 C CA    . VAL D 1 62 ? 23.387  27.290  1.931   1.00 168.39 ? 278 VAL B CA    1 
ATOM   1790 C C     . VAL D 1 62 ? 24.420  27.002  3.020   1.00 155.01 ? 278 VAL B C     1 
ATOM   1791 O O     . VAL D 1 62 ? 25.429  27.701  3.135   1.00 139.51 ? 278 VAL B O     1 
ATOM   1792 C CB    . VAL D 1 62 ? 22.081  26.493  2.217   1.00 163.73 ? 278 VAL B CB    1 
ATOM   1793 C CG1   . VAL D 1 62 ? 21.467  26.904  3.558   1.00 160.10 ? 278 VAL B CG1   1 
ATOM   1794 C CG2   . VAL D 1 62 ? 21.076  26.668  1.077   1.00 154.17 ? 278 VAL B CG2   1 
ATOM   1795 P P     . DA  E 2 1  ? 11.965  9.414   4.881   1.00 236.11 ? 20  DA  D P     1 
ATOM   1796 O OP1   . DA  E 2 1  ? 10.706  10.097  5.287   1.00 226.96 ? 20  DA  D OP1   1 
ATOM   1797 O OP2   . DA  E 2 1  ? 12.766  8.673   5.893   1.00 245.47 ? 20  DA  D OP2   1 
ATOM   1798 O "O5'" . DA  E 2 1  ? 12.894  10.414  4.055   1.00 204.62 ? 20  DA  D "O5'" 1 
ATOM   1799 C "C5'" . DA  E 2 1  ? 14.084  10.996  4.625   1.00 170.41 ? 20  DA  D "C5'" 1 
ATOM   1800 C "C4'" . DA  E 2 1  ? 15.158  11.135  3.571   1.00 153.45 ? 20  DA  D "C4'" 1 
ATOM   1801 O "O4'" . DA  E 2 1  ? 15.261  9.919   2.790   1.00 136.87 ? 20  DA  D "O4'" 1 
ATOM   1802 C "C3'" . DA  E 2 1  ? 14.933  12.256  2.559   1.00 133.93 ? 20  DA  D "C3'" 1 
ATOM   1803 O "O3'" . DA  E 2 1  ? 16.223  12.808  2.289   1.00 126.68 ? 20  DA  D "O3'" 1 
ATOM   1804 C "C2'" . DA  E 2 1  ? 14.324  11.533  1.371   1.00 122.07 ? 20  DA  D "C2'" 1 
ATOM   1805 C "C1'" . DA  E 2 1  ? 15.036  10.196  1.416   1.00 124.93 ? 20  DA  D "C1'" 1 
ATOM   1806 N N9    . DA  E 2 1  ? 14.315  9.054   0.852   1.00 129.64 ? 20  DA  D N9    1 
ATOM   1807 C C8    . DA  E 2 1  ? 13.057  8.601   1.170   1.00 124.97 ? 20  DA  D C8    1 
ATOM   1808 N N7    . DA  E 2 1  ? 12.704  7.521   0.515   1.00 110.16 ? 20  DA  D N7    1 
ATOM   1809 C C5    . DA  E 2 1  ? 13.812  7.230   -0.268  1.00 108.40 ? 20  DA  D C5    1 
ATOM   1810 C C6    . DA  E 2 1  ? 14.076  6.198   -1.183  1.00 107.69 ? 20  DA  D C6    1 
ATOM   1811 N N6    . DA  E 2 1  ? 13.202  5.239   -1.487  1.00 107.22 ? 20  DA  D N6    1 
ATOM   1812 N N1    . DA  E 2 1  ? 15.273  6.205   -1.810  1.00 110.23 ? 20  DA  D N1    1 
ATOM   1813 C C2    . DA  E 2 1  ? 16.156  7.162   -1.496  1.00 117.76 ? 20  DA  D C2    1 
ATOM   1814 N N3    . DA  E 2 1  ? 16.025  8.182   -0.650  1.00 117.66 ? 20  DA  D N3    1 
ATOM   1815 C C4    . DA  E 2 1  ? 14.816  8.158   -0.061  1.00 121.62 ? 20  DA  D C4    1 
ATOM   1816 P P     . DT  E 2 2  ? 16.391  14.019  1.288   1.00 120.96 ? 21  DT  D P     1 
ATOM   1817 O OP1   . DT  E 2 2  ? 17.529  14.855  1.749   1.00 116.00 ? 21  DT  D OP1   1 
ATOM   1818 O OP2   . DT  E 2 2  ? 15.054  14.637  1.096   1.00 134.70 ? 21  DT  D OP2   1 
ATOM   1819 O "O5'" . DT  E 2 2  ? 16.906  13.297  -0.033  1.00 129.20 ? 21  DT  D "O5'" 1 
ATOM   1820 C "C5'" . DT  E 2 2  ? 18.134  12.545  -0.011  1.00 127.18 ? 21  DT  D "C5'" 1 
ATOM   1821 C "C4'" . DT  E 2 2  ? 18.647  12.272  -1.407  1.00 128.89 ? 21  DT  D "C4'" 1 
ATOM   1822 O "O4'" . DT  E 2 2  ? 17.917  11.174  -2.003  1.00 127.17 ? 21  DT  D "O4'" 1 
ATOM   1823 C "C3'" . DT  E 2 2  ? 18.539  13.428  -2.401  1.00 126.24 ? 21  DT  D "C3'" 1 
ATOM   1824 O "O3'" . DT  E 2 2  ? 19.727  13.377  -3.204  1.00 118.52 ? 21  DT  D "O3'" 1 
ATOM   1825 C "C2'" . DT  E 2 2  ? 17.227  13.141  -3.119  1.00 123.25 ? 21  DT  D "C2'" 1 
ATOM   1826 C "C1'" . DT  E 2 2  ? 17.208  11.615  -3.161  1.00 123.52 ? 21  DT  D "C1'" 1 
ATOM   1827 N N1    . DT  E 2 2  ? 15.890  10.926  -3.162  1.00 114.08 ? 21  DT  D N1    1 
ATOM   1828 C C2    . DT  E 2 2  ? 15.771  9.772   -3.915  1.00 110.88 ? 21  DT  D C2    1 
ATOM   1829 O O2    . DT  E 2 2  ? 16.663  9.344   -4.633  1.00 105.91 ? 21  DT  D O2    1 
ATOM   1830 N N3    . DT  E 2 2  ? 14.544  9.159   -3.833  1.00 97.49  ? 21  DT  D N3    1 
ATOM   1831 C C4    . DT  E 2 2  ? 13.474  9.537   -3.046  1.00 99.62  ? 21  DT  D C4    1 
ATOM   1832 O O4    . DT  E 2 2  ? 12.440  8.876   -3.065  1.00 98.55  ? 21  DT  D O4    1 
ATOM   1833 C C5    . DT  E 2 2  ? 13.676  10.739  -2.262  1.00 100.75 ? 21  DT  D C5    1 
ATOM   1834 C C7    . DT  E 2 2  ? 12.558  11.237  -1.400  1.00 99.97  ? 21  DT  D C7    1 
ATOM   1835 C C6    . DT  E 2 2  ? 14.862  11.358  -2.348  1.00 97.44  ? 21  DT  D C6    1 
ATOM   1836 P P     . DT  E 2 3  ? 19.912  14.344  -4.451  1.00 119.25 ? 22  DT  D P     1 
ATOM   1837 O OP1   . DT  E 2 3  ? 21.362  14.617  -4.616  1.00 114.26 ? 22  DT  D OP1   1 
ATOM   1838 O OP2   . DT  E 2 3  ? 18.964  15.481  -4.293  1.00 113.97 ? 22  DT  D OP2   1 
ATOM   1839 O "O5'" . DT  E 2 3  ? 19.499  13.404  -5.668  1.00 113.30 ? 22  DT  D "O5'" 1 
ATOM   1840 C "C5'" . DT  E 2 3  ? 20.142  12.132  -5.843  1.00 113.46 ? 22  DT  D "C5'" 1 
ATOM   1841 C "C4'" . DT  E 2 3  ? 19.738  11.493  -7.153  1.00 123.81 ? 22  DT  D "C4'" 1 
ATOM   1842 O "O4'" . DT  E 2 3  ? 18.419  10.904  -7.060  1.00 122.68 ? 22  DT  D "O4'" 1 
ATOM   1843 C "C3'" . DT  E 2 3  ? 19.688  12.424  -8.365  1.00 123.79 ? 22  DT  D "C3'" 1 
ATOM   1844 O "O3'" . DT  E 2 3  ? 20.169  11.654  -9.473  1.00 126.96 ? 22  DT  D "O3'" 1 
ATOM   1845 C "C2'" . DT  E 2 3  ? 18.209  12.743  -8.493  1.00 118.89 ? 22  DT  D "C2'" 1 
ATOM   1846 C "C1'" . DT  E 2 3  ? 17.590  11.412  -8.100  1.00 115.22 ? 22  DT  D "C1'" 1 
ATOM   1847 N N1    . DT  E 2 3  ? 16.196  11.404  -7.602  1.00 106.62 ? 22  DT  D N1    1 
ATOM   1848 C C2    . DT  E 2 3  ? 15.387  10.341  -7.957  1.00 107.61 ? 22  DT  D C2    1 
ATOM   1849 O O2    . DT  E 2 3  ? 15.743  9.451   -8.715  1.00 105.08 ? 22  DT  D O2    1 
ATOM   1850 N N3    . DT  E 2 3  ? 14.129  10.372  -7.408  1.00 104.76 ? 22  DT  D N3    1 
ATOM   1851 C C4    . DT  E 2 3  ? 13.619  11.321  -6.541  1.00 98.87  ? 22  DT  D C4    1 
ATOM   1852 O O4    . DT  E 2 3  ? 12.467  11.215  -6.130  1.00 105.71 ? 22  DT  D O4    1 
ATOM   1853 C C5    . DT  E 2 3  ? 14.526  12.397  -6.199  1.00 89.75  ? 22  DT  D C5    1 
ATOM   1854 C C7    . DT  E 2 3  ? 14.058  13.475  -5.273  1.00 90.69  ? 22  DT  D C7    1 
ATOM   1855 C C6    . DT  E 2 3  ? 15.757  12.376  -6.726  1.00 88.90  ? 22  DT  D C6    1 
ATOM   1856 P P     . DT  E 2 4  ? 20.356  12.316  -10.911 1.00 126.12 ? 23  DT  D P     1 
ATOM   1857 O OP1   . DT  E 2 4  ? 21.635  11.816  -11.478 1.00 126.05 ? 23  DT  D OP1   1 
ATOM   1858 O OP2   . DT  E 2 4  ? 20.145  13.781  -10.768 1.00 112.68 ? 23  DT  D OP2   1 
ATOM   1859 O "O5'" . DT  E 2 4  ? 19.145  11.689  -11.743 1.00 128.12 ? 23  DT  D "O5'" 1 
ATOM   1860 C "C5'" . DT  E 2 4  ? 19.134  10.291  -12.095 1.00 119.35 ? 23  DT  D "C5'" 1 
ATOM   1861 C "C4'" . DT  E 2 4  ? 17.770  9.856   -12.585 1.00 118.79 ? 23  DT  D "C4'" 1 
ATOM   1862 O "O4'" . DT  E 2 4  ? 16.750  10.221  -11.624 1.00 115.80 ? 23  DT  D "O4'" 1 
ATOM   1863 C "C3'" . DT  E 2 4  ? 17.321  10.452  -13.924 1.00 118.73 ? 23  DT  D "C3'" 1 
ATOM   1864 O "O3'" . DT  E 2 4  ? 16.701  9.433   -14.726 1.00 111.92 ? 23  DT  D "O3'" 1 
ATOM   1865 C "C2'" . DT  E 2 4  ? 16.276  11.477  -13.521 1.00 118.48 ? 23  DT  D "C2'" 1 
ATOM   1866 C "C1'" . DT  E 2 4  ? 15.656  10.778  -12.328 1.00 118.36 ? 23  DT  D "C1'" 1 
ATOM   1867 N N1    . DT  E 2 4  ? 14.867  11.596  -11.380 1.00 115.15 ? 23  DT  D N1    1 
ATOM   1868 C C2    . DT  E 2 4  ? 13.589  11.174  -11.086 1.00 114.13 ? 23  DT  D C2    1 
ATOM   1869 O O2    . DT  E 2 4  ? 13.081  10.183  -11.586 1.00 126.01 ? 23  DT  D O2    1 
ATOM   1870 N N3    . DT  E 2 4  ? 12.917  11.966  -10.188 1.00 107.36 ? 23  DT  D N3    1 
ATOM   1871 C C4    . DT  E 2 4  ? 13.384  13.109  -9.568  1.00 112.23 ? 23  DT  D C4    1 
ATOM   1872 O O4    . DT  E 2 4  ? 12.659  13.717  -8.783  1.00 114.50 ? 23  DT  D O4    1 
ATOM   1873 C C5    . DT  E 2 4  ? 14.738  13.488  -9.913  1.00 113.73 ? 23  DT  D C5    1 
ATOM   1874 C C7    . DT  E 2 4  ? 15.332  14.713  -9.290  1.00 111.95 ? 23  DT  D C7    1 
ATOM   1875 C C6    . DT  E 2 4  ? 15.404  12.721  -10.788 1.00 114.40 ? 23  DT  D C6    1 
ATOM   1876 P P     . DT  E 2 5  ? 17.137  9.195   -16.254 1.00 115.87 ? 24  DT  D P     1 
ATOM   1877 O OP1   . DT  E 2 5  ? 17.910  7.927   -16.336 1.00 111.33 ? 24  DT  D OP1   1 
ATOM   1878 O OP2   . DT  E 2 5  ? 17.703  10.462  -16.791 1.00 104.13 ? 24  DT  D OP2   1 
ATOM   1879 O "O5'" . DT  E 2 5  ? 15.749  8.916   -16.982 1.00 129.70 ? 24  DT  D "O5'" 1 
ATOM   1880 C "C5'" . DT  E 2 5  ? 14.801  9.979   -17.189 1.00 125.93 ? 24  DT  D "C5'" 1 
ATOM   1881 C "C4'" . DT  E 2 5  ? 13.394  9.466   -16.999 1.00 118.34 ? 24  DT  D "C4'" 1 
ATOM   1882 O "O4'" . DT  E 2 5  ? 12.914  9.905   -15.705 1.00 124.60 ? 24  DT  D "O4'" 1 
ATOM   1883 C "C3'" . DT  E 2 5  ? 12.373  9.967   -18.022 1.00 118.76 ? 24  DT  D "C3'" 1 
ATOM   1884 O "O3'" . DT  E 2 5  ? 11.478  8.906   -18.388 1.00 121.32 ? 24  DT  D "O3'" 1 
ATOM   1885 C "C2'" . DT  E 2 5  ? 11.705  11.122  -17.301 1.00 123.58 ? 24  DT  D "C2'" 1 
ATOM   1886 C "C1'" . DT  E 2 5  ? 11.718  10.652  -15.858 1.00 126.60 ? 24  DT  D "C1'" 1 
ATOM   1887 N N1    . DT  E 2 5  ? 11.729  11.748  -14.865 1.00 126.49 ? 24  DT  D N1    1 
ATOM   1888 C C2    . DT  E 2 5  ? 10.609  11.941  -14.079 1.00 124.42 ? 24  DT  D C2    1 
ATOM   1889 O O2    . DT  E 2 5  ? 9.614   11.233  -14.141 1.00 124.30 ? 24  DT  D O2    1 
ATOM   1890 N N3    . DT  E 2 5  ? 10.707  12.988  -13.195 1.00 122.71 ? 24  DT  D N3    1 
ATOM   1891 C C4    . DT  E 2 5  ? 11.777  13.855  -13.040 1.00 124.58 ? 24  DT  D C4    1 
ATOM   1892 O O4    . DT  E 2 5  ? 11.718  14.758  -12.208 1.00 120.65 ? 24  DT  D O4    1 
ATOM   1893 C C5    . DT  E 2 5  ? 12.911  13.602  -13.906 1.00 124.11 ? 24  DT  D C5    1 
ATOM   1894 C C7    . DT  E 2 5  ? 14.116  14.487  -13.808 1.00 131.56 ? 24  DT  D C7    1 
ATOM   1895 C C6    . DT  E 2 5  ? 12.830  12.576  -14.763 1.00 121.78 ? 24  DT  D C6    1 
ATOM   1896 P P     . DA  E 2 6  ? 10.459  9.066   -19.634 1.00 100.20 ? 25  DA  D P     1 
ATOM   1897 O OP1   . DA  E 2 6  ? 9.787   7.740   -19.858 1.00 80.10  ? 25  DA  D OP1   1 
ATOM   1898 O OP2   . DA  E 2 6  ? 11.189  9.732   -20.746 1.00 94.23  ? 25  DA  D OP2   1 
ATOM   1899 O "O5'" . DA  E 2 6  ? 9.350   10.035  -19.035 1.00 93.12  ? 25  DA  D "O5'" 1 
ATOM   1900 C "C5'" . DA  E 2 6  ? 8.606   9.596   -17.887 1.00 102.85 ? 25  DA  D "C5'" 1 
ATOM   1901 C "C4'" . DA  E 2 6  ? 7.524   10.571  -17.484 1.00 104.65 ? 25  DA  D "C4'" 1 
ATOM   1902 O "O4'" . DA  E 2 6  ? 7.969   11.393  -16.378 1.00 105.61 ? 25  DA  D "O4'" 1 
ATOM   1903 C "C3'" . DA  E 2 6  ? 6.996   11.529  -18.558 1.00 104.48 ? 25  DA  D "C3'" 1 
ATOM   1904 O "O3'" . DA  E 2 6  ? 5.576   11.439  -18.673 1.00 117.63 ? 25  DA  D "O3'" 1 
ATOM   1905 C "C2'" . DA  E 2 6  ? 7.414   12.895  -18.056 1.00 98.81  ? 25  DA  D "C2'" 1 
ATOM   1906 C "C1'" . DA  E 2 6  ? 7.466   12.693  -16.558 1.00 99.25  ? 25  DA  D "C1'" 1 
ATOM   1907 N N9    . DA  E 2 6  ? 8.366   13.640  -15.905 1.00 104.60 ? 25  DA  D N9    1 
ATOM   1908 C C8    . DA  E 2 6  ? 9.629   14.017  -16.296 1.00 109.75 ? 25  DA  D C8    1 
ATOM   1909 N N7    . DA  E 2 6  ? 10.146  14.973  -15.563 1.00 109.12 ? 25  DA  D N7    1 
ATOM   1910 C C5    . DA  E 2 6  ? 9.143   15.270  -14.650 1.00 105.58 ? 25  DA  D C5    1 
ATOM   1911 C C6    . DA  E 2 6  ? 9.068   16.199  -13.596 1.00 103.30 ? 25  DA  D C6    1 
ATOM   1912 N N6    . DA  E 2 6  ? 10.064  17.025  -13.267 1.00 100.71 ? 25  DA  D N6    1 
ATOM   1913 N N1    . DA  E 2 6  ? 7.934   16.225  -12.862 1.00 111.32 ? 25  DA  D N1    1 
ATOM   1914 C C2    . DA  E 2 6  ? 6.931   15.396  -13.198 1.00 113.93 ? 25  DA  D C2    1 
ATOM   1915 N N3    . DA  E 2 6  ? 6.887   14.474  -14.158 1.00 103.57 ? 25  DA  D N3    1 
ATOM   1916 C C4    . DA  E 2 6  ? 8.036   14.464  -14.858 1.00 103.12 ? 25  DA  D C4    1 
ATOM   1917 P P     . DT  E 2 7  ? 4.789   12.142  -19.888 1.00 115.06 ? 26  DT  D P     1 
ATOM   1918 O OP1   . DT  E 2 7  ? 4.086   11.069  -20.648 1.00 114.19 ? 26  DT  D OP1   1 
ATOM   1919 O OP2   . DT  E 2 7  ? 5.706   13.090  -20.588 1.00 97.76  ? 26  DT  D OP2   1 
ATOM   1920 O "O5'" . DT  E 2 7  ? 3.695   12.997  -19.119 1.00 98.07  ? 26  DT  D "O5'" 1 
ATOM   1921 C "C5'" . DT  E 2 7  ? 2.897   12.369  -18.104 1.00 102.98 ? 26  DT  D "C5'" 1 
ATOM   1922 C "C4'" . DT  E 2 7  ? 2.430   13.414  -17.120 1.00 112.09 ? 26  DT  D "C4'" 1 
ATOM   1923 O "O4'" . DT  E 2 7  ? 3.553   14.127  -16.562 1.00 113.32 ? 26  DT  D "O4'" 1 
ATOM   1924 C "C3'" . DT  E 2 7  ? 1.527   14.474  -17.747 1.00 113.39 ? 26  DT  D "C3'" 1 
ATOM   1925 O "O3'" . DT  E 2 7  ? 0.228   14.334  -17.185 1.00 118.85 ? 26  DT  D "O3'" 1 
ATOM   1926 C "C2'" . DT  E 2 7  ? 2.183   15.800  -17.398 1.00 112.43 ? 26  DT  D "C2'" 1 
ATOM   1927 C "C1'" . DT  E 2 7  ? 3.135   15.445  -16.279 1.00 109.78 ? 26  DT  D "C1'" 1 
ATOM   1928 N N1    . DT  E 2 7  ? 4.344   16.279  -16.157 1.00 110.78 ? 26  DT  D N1    1 
ATOM   1929 C C2    . DT  E 2 7  ? 4.425   17.188  -15.122 1.00 122.86 ? 26  DT  D C2    1 
ATOM   1930 O O2    . DT  E 2 7  ? 3.521   17.374  -14.325 1.00 139.66 ? 26  DT  D O2    1 
ATOM   1931 N N3    . DT  E 2 7  ? 5.617   17.871  -15.051 1.00 124.97 ? 26  DT  D N3    1 
ATOM   1932 C C4    . DT  E 2 7  ? 6.695   17.754  -15.910 1.00 124.63 ? 26  DT  D C4    1 
ATOM   1933 O O4    . DT  E 2 7  ? 7.691   18.449  -15.739 1.00 118.84 ? 26  DT  D O4    1 
ATOM   1934 C C5    . DT  E 2 7  ? 6.548   16.768  -16.958 1.00 127.01 ? 26  DT  D C5    1 
ATOM   1935 C C7    . DT  E 2 7  ? 7.672   16.561  -17.924 1.00 134.92 ? 26  DT  D C7    1 
ATOM   1936 C C6    . DT  E 2 7  ? 5.397   16.085  -17.024 1.00 114.92 ? 26  DT  D C6    1 
ATOM   1937 P P     . DT  E 2 8  ? -1.008  15.038  -17.868 1.00 124.54 ? 27  DT  D P     1 
ATOM   1938 O OP1   . DT  E 2 8  ? -2.154  14.085  -17.797 1.00 108.48 ? 27  DT  D OP1   1 
ATOM   1939 O OP2   . DT  E 2 8  ? -0.573  15.566  -19.189 1.00 109.34 ? 27  DT  D OP2   1 
ATOM   1940 O "O5'" . DT  E 2 8  ? -1.206  16.340  -16.970 1.00 112.71 ? 27  DT  D "O5'" 1 
ATOM   1941 C "C5'" . DT  E 2 8  ? -0.948  16.359  -15.550 1.00 114.83 ? 27  DT  D "C5'" 1 
ATOM   1942 C "C4'" . DT  E 2 8  ? -0.864  17.789  -15.071 1.00 116.52 ? 27  DT  D "C4'" 1 
ATOM   1943 O "O4'" . DT  E 2 8  ? 0.525   18.219  -15.054 1.00 122.22 ? 27  DT  D "O4'" 1 
ATOM   1944 C "C3'" . DT  E 2 8  ? -1.601  18.787  -15.968 1.00 119.73 ? 27  DT  D "C3'" 1 
ATOM   1945 O "O3'" . DT  E 2 8  ? -2.332  19.768  -15.219 1.00 127.85 ? 27  DT  D "O3'" 1 
ATOM   1946 C "C2'" . DT  E 2 8  ? -0.472  19.422  -16.753 1.00 124.59 ? 27  DT  D "C2'" 1 
ATOM   1947 C "C1'" . DT  E 2 8  ? 0.595   19.485  -15.676 1.00 121.00 ? 27  DT  D "C1'" 1 
ATOM   1948 N N1    . DT  E 2 8  ? 1.995   19.723  -16.129 1.00 125.72 ? 27  DT  D N1    1 
ATOM   1949 C C2    . DT  E 2 8  ? 2.752   20.663  -15.456 1.00 135.80 ? 27  DT  D C2    1 
ATOM   1950 O O2    . DT  E 2 8  ? 2.349   21.270  -14.477 1.00 152.34 ? 27  DT  D O2    1 
ATOM   1951 N N3    . DT  E 2 8  ? 4.022   20.841  -15.956 1.00 133.23 ? 27  DT  D N3    1 
ATOM   1952 C C4    . DT  E 2 8  ? 4.575   20.224  -17.064 1.00 129.49 ? 27  DT  D C4    1 
ATOM   1953 O O4    . DT  E 2 8  ? 5.718   20.495  -17.408 1.00 124.55 ? 27  DT  D O4    1 
ATOM   1954 C C5    . DT  E 2 8  ? 3.724   19.259  -17.726 1.00 125.83 ? 27  DT  D C5    1 
ATOM   1955 C C7    . DT  E 2 8  ? 4.246   18.536  -18.928 1.00 118.38 ? 27  DT  D C7    1 
ATOM   1956 C C6    . DT  E 2 8  ? 2.490   19.069  -17.239 1.00 127.67 ? 27  DT  D C6    1 
ATOM   1957 P P     . DG  E 2 9  ? -3.834  20.155  -15.649 1.00 142.19 ? 28  DG  D P     1 
ATOM   1958 O OP1   . DG  E 2 9  ? -4.770  19.611  -14.625 1.00 133.63 ? 28  DG  D OP1   1 
ATOM   1959 O OP2   . DG  E 2 9  ? -4.017  19.811  -17.083 1.00 149.49 ? 28  DG  D OP2   1 
ATOM   1960 O "O5'" . DG  E 2 9  ? -3.850  21.741  -15.548 1.00 115.49 ? 28  DG  D "O5'" 1 
ATOM   1961 C "C5'" . DG  E 2 9  ? -3.996  22.377  -14.279 1.00 112.14 ? 28  DG  D "C5'" 1 
ATOM   1962 C "C4'" . DG  E 2 9  ? -2.954  23.460  -14.167 1.00 116.67 ? 28  DG  D "C4'" 1 
ATOM   1963 O "O4'" . DG  E 2 9  ? -1.717  23.004  -14.743 1.00 110.73 ? 28  DG  D "O4'" 1 
ATOM   1964 C "C3'" . DG  E 2 9  ? -3.308  24.740  -14.920 1.00 117.14 ? 28  DG  D "C3'" 1 
ATOM   1965 O "O3'" . DG  E 2 9  ? -3.690  25.742  -13.978 1.00 126.61 ? 28  DG  D "O3'" 1 
ATOM   1966 C "C2'" . DG  E 2 9  ? -2.030  25.117  -15.649 1.00 112.81 ? 28  DG  D "C2'" 1 
ATOM   1967 C "C1'" . DG  E 2 9  ? -0.992  24.150  -15.131 1.00 118.34 ? 28  DG  D "C1'" 1 
ATOM   1968 N N9    . DG  E 2 9  ? -0.011  23.739  -16.126 1.00 129.94 ? 28  DG  D N9    1 
ATOM   1969 C C8    . DG  E 2 9  ? -0.200  22.799  -17.110 1.00 129.33 ? 28  DG  D C8    1 
ATOM   1970 N N7    . DG  E 2 9  ? 0.858   22.613  -17.851 1.00 129.98 ? 28  DG  D N7    1 
ATOM   1971 C C5    . DG  E 2 9  ? 1.804   23.483  -17.326 1.00 131.62 ? 28  DG  D C5    1 
ATOM   1972 C C6    . DG  E 2 9  ? 3.142   23.729  -17.722 1.00 131.40 ? 28  DG  D C6    1 
ATOM   1973 O O6    . DG  E 2 9  ? 3.783   23.202  -18.637 1.00 135.61 ? 28  DG  D O6    1 
ATOM   1974 N N1    . DG  E 2 9  ? 3.745   24.688  -16.916 1.00 133.50 ? 28  DG  D N1    1 
ATOM   1975 C C2    . DG  E 2 9  ? 3.134   25.350  -15.879 1.00 126.09 ? 28  DG  D C2    1 
ATOM   1976 N N2    . DG  E 2 9  ? 3.888   26.248  -15.226 1.00 127.84 ? 28  DG  D N2    1 
ATOM   1977 N N3    . DG  E 2 9  ? 1.885   25.128  -15.497 1.00 126.94 ? 28  DG  D N3    1 
ATOM   1978 C C4    . DG  E 2 9  ? 1.283   24.188  -16.261 1.00 133.93 ? 28  DG  D C4    1 
ATOM   1979 P P     . DC  E 2 10 ? -4.396  27.071  -14.477 1.00 124.60 ? 29  DC  D P     1 
ATOM   1980 O OP1   . DC  E 2 10 ? -4.760  27.873  -13.278 1.00 121.85 ? 29  DC  D OP1   1 
ATOM   1981 O OP2   . DC  E 2 10 ? -5.449  26.679  -15.462 1.00 131.34 ? 29  DC  D OP2   1 
ATOM   1982 O "O5'" . DC  E 2 10 ? -3.225  27.805  -15.262 1.00 96.03  ? 29  DC  D "O5'" 1 
ATOM   1983 C "C5'" . DC  E 2 10 ? -3.046  29.225  -15.244 1.00 86.75  ? 29  DC  D "C5'" 1 
ATOM   1984 C "C4'" . DC  E 2 10 ? -1.567  29.515  -15.301 1.00 89.13  ? 29  DC  D "C4'" 1 
ATOM   1985 O "O4'" . DC  E 2 10 ? -0.826  28.309  -15.586 1.00 91.43  ? 29  DC  D "O4'" 1 
ATOM   1986 C "C3'" . DC  E 2 10 ? -1.116  30.475  -16.387 1.00 85.20  ? 29  DC  D "C3'" 1 
ATOM   1987 O "O3'" . DC  E 2 10 ? -1.371  31.818  -16.011 1.00 86.41  ? 29  DC  D "O3'" 1 
ATOM   1988 C "C2'" . DC  E 2 10 ? 0.369   30.175  -16.465 1.00 86.36  ? 29  DC  D "C2'" 1 
ATOM   1989 C "C1'" . DC  E 2 10 ? 0.448   28.685  -16.115 1.00 95.82  ? 29  DC  D "C1'" 1 
ATOM   1990 N N1    . DC  E 2 10 ? 0.785   27.769  -17.226 1.00 103.29 ? 29  DC  D N1    1 
ATOM   1991 C C2    . DC  E 2 10 ? 2.089   27.791  -17.743 1.00 110.93 ? 29  DC  D C2    1 
ATOM   1992 O O2    . DC  E 2 10 ? 2.914   28.591  -17.271 1.00 108.60 ? 29  DC  D O2    1 
ATOM   1993 N N3    . DC  E 2 10 ? 2.417   26.939  -18.742 1.00 110.91 ? 29  DC  D N3    1 
ATOM   1994 C C4    . DC  E 2 10 ? 1.501   26.102  -19.234 1.00 92.18  ? 29  DC  D C4    1 
ATOM   1995 N N4    . DC  E 2 10 ? 1.872   25.280  -20.214 1.00 91.38  ? 29  DC  D N4    1 
ATOM   1996 C C5    . DC  E 2 10 ? 0.172   26.048  -18.719 1.00 94.51  ? 29  DC  D C5    1 
ATOM   1997 C C6    . DC  E 2 10 ? -0.141  26.893  -17.727 1.00 102.77 ? 29  DC  D C6    1 
ATOM   1998 P P     . DA  E 2 11 ? -1.208  32.954  -17.089 1.00 120.92 ? 30  DA  D P     1 
ATOM   1999 O OP1   . DA  E 2 11 ? -1.486  34.259  -16.434 1.00 115.71 ? 30  DA  D OP1   1 
ATOM   2000 O OP2   . DA  E 2 11 ? -1.972  32.550  -18.299 1.00 131.83 ? 30  DA  D OP2   1 
ATOM   2001 O "O5'" . DA  E 2 11 ? 0.339   32.896  -17.441 1.00 99.39  ? 30  DA  D "O5'" 1 
ATOM   2002 C "C5'" . DA  E 2 11 ? 1.287   33.542  -16.595 1.00 104.60 ? 30  DA  D "C5'" 1 
ATOM   2003 C "C4'" . DA  E 2 11 ? 2.655   33.401  -17.208 1.00 104.39 ? 30  DA  D "C4'" 1 
ATOM   2004 O "O4'" . DA  E 2 11 ? 2.760   32.062  -17.735 1.00 110.27 ? 30  DA  D "O4'" 1 
ATOM   2005 C "C3'" . DA  E 2 11 ? 2.920   34.361  -18.368 1.00 99.45  ? 30  DA  D "C3'" 1 
ATOM   2006 O "O3'" . DA  E 2 11 ? 4.090   35.142  -18.116 1.00 95.41  ? 30  DA  D "O3'" 1 
ATOM   2007 C "C2'" . DA  E 2 11 ? 3.084   33.461  -19.580 1.00 107.14 ? 30  DA  D "C2'" 1 
ATOM   2008 C "C1'" . DA  E 2 11 ? 3.355   32.084  -19.014 1.00 111.38 ? 30  DA  D "C1'" 1 
ATOM   2009 N N9    . DA  E 2 11 ? 2.793   30.976  -19.788 1.00 115.87 ? 30  DA  D N9    1 
ATOM   2010 C C8    . DA  E 2 11 ? 1.521   30.455  -19.742 1.00 119.62 ? 30  DA  D C8    1 
ATOM   2011 N N7    . DA  E 2 11 ? 1.337   29.437  -20.547 1.00 114.41 ? 30  DA  D N7    1 
ATOM   2012 C C5    . DA  E 2 11 ? 2.567   29.280  -21.170 1.00 115.27 ? 30  DA  D C5    1 
ATOM   2013 C C6    . DA  E 2 11 ? 3.025   28.376  -22.143 1.00 115.82 ? 30  DA  D C6    1 
ATOM   2014 N N6    . DA  E 2 11 ? 2.266   27.419  -22.682 1.00 115.78 ? 30  DA  D N6    1 
ATOM   2015 N N1    . DA  E 2 11 ? 4.309   28.485  -22.546 1.00 114.95 ? 30  DA  D N1    1 
ATOM   2016 C C2    . DA  E 2 11 ? 5.070   29.451  -22.014 1.00 123.67 ? 30  DA  D C2    1 
ATOM   2017 N N3    . DA  E 2 11 ? 4.754   30.359  -21.093 1.00 117.44 ? 30  DA  D N3    1 
ATOM   2018 C C4    . DA  E 2 11 ? 3.473   30.218  -20.710 1.00 114.31 ? 30  DA  D C4    1 
ATOM   2019 P P     . DT  E 2 12 ? 4.363   36.509  -18.927 1.00 114.89 ? 31  DT  D P     1 
ATOM   2020 O OP1   . DT  E 2 12 ? 5.334   37.321  -18.156 1.00 135.77 ? 31  DT  D OP1   1 
ATOM   2021 O OP2   . DT  E 2 12 ? 3.049   37.108  -19.277 1.00 118.97 ? 31  DT  D OP2   1 
ATOM   2022 O "O5'" . DT  E 2 12 ? 5.222   36.018  -20.177 1.00 108.01 ? 31  DT  D "O5'" 1 
ATOM   2023 C "C5'" . DT  E 2 12 ? 6.397   35.211  -19.941 1.00 122.70 ? 31  DT  D "C5'" 1 
ATOM   2024 C "C4'" . DT  E 2 12 ? 7.048   34.743  -21.224 1.00 125.30 ? 31  DT  D "C4'" 1 
ATOM   2025 O "O4'" . DT  E 2 12 ? 6.355   33.592  -21.764 1.00 128.71 ? 31  DT  D "O4'" 1 
ATOM   2026 C "C3'" . DT  E 2 12 ? 7.133   35.768  -22.359 1.00 116.92 ? 31  DT  D "C3'" 1 
ATOM   2027 O "O3'" . DT  E 2 12 ? 8.491   35.738  -22.811 1.00 110.73 ? 31  DT  D "O3'" 1 
ATOM   2028 C "C2'" . DT  E 2 12 ? 6.098   35.275  -23.360 1.00 124.65 ? 31  DT  D "C2'" 1 
ATOM   2029 C "C1'" . DT  E 2 12 ? 6.168   33.773  -23.161 1.00 130.58 ? 31  DT  D "C1'" 1 
ATOM   2030 N N1    . DT  E 2 12 ? 4.988   32.963  -23.569 1.00 121.50 ? 31  DT  D N1    1 
ATOM   2031 C C2    . DT  E 2 12 ? 5.187   31.956  -24.485 1.00 113.29 ? 31  DT  D C2    1 
ATOM   2032 O O2    . DT  E 2 12 ? 6.262   31.738  -25.019 1.00 122.93 ? 31  DT  D O2    1 
ATOM   2033 N N3    . DT  E 2 12 ? 4.069   31.217  -24.772 1.00 104.31 ? 31  DT  D N3    1 
ATOM   2034 C C4    . DT  E 2 12 ? 2.807   31.367  -24.239 1.00 103.32 ? 31  DT  D C4    1 
ATOM   2035 O O4    . DT  E 2 12 ? 1.903   30.615  -24.590 1.00 99.30  ? 31  DT  D O4    1 
ATOM   2036 C C5    . DT  E 2 12 ? 2.670   32.427  -23.270 1.00 110.77 ? 31  DT  D C5    1 
ATOM   2037 C C7    . DT  E 2 12 ? 1.334   32.663  -22.640 1.00 107.16 ? 31  DT  D C7    1 
ATOM   2038 C C6    . DT  E 2 12 ? 3.756   33.156  -22.978 1.00 121.58 ? 31  DT  D C6    1 
ATOM   2039 P P     . DT  E 2 13 ? 8.987   36.647  -24.035 1.00 129.08 ? 32  DT  D P     1 
ATOM   2040 O OP1   . DT  E 2 13 ? 10.362  37.117  -23.732 1.00 121.95 ? 32  DT  D OP1   1 
ATOM   2041 O OP2   . DT  E 2 13 ? 7.937   37.653  -24.327 1.00 114.85 ? 32  DT  D OP2   1 
ATOM   2042 O "O5'" . DT  E 2 13 ? 9.146   35.565  -25.198 1.00 138.80 ? 32  DT  D "O5'" 1 
ATOM   2043 C "C5'" . DT  E 2 13 ? 9.922   34.365  -24.945 1.00 135.59 ? 32  DT  D "C5'" 1 
ATOM   2044 C "C4'" . DT  E 2 13 ? 10.050  33.483  -26.168 1.00 126.29 ? 32  DT  D "C4'" 1 
ATOM   2045 O "O4'" . DT  E 2 13 ? 8.805   32.790  -26.396 1.00 117.65 ? 32  DT  D "O4'" 1 
ATOM   2046 C "C3'" . DT  E 2 13 ? 10.387  34.173  -27.492 1.00 123.67 ? 32  DT  D "C3'" 1 
ATOM   2047 O "O3'" . DT  E 2 13 ? 11.207  33.290  -28.270 1.00 125.42 ? 32  DT  D "O3'" 1 
ATOM   2048 C "C2'" . DT  E 2 13 ? 9.023   34.373  -28.124 1.00 116.00 ? 32  DT  D "C2'" 1 
ATOM   2049 C "C1'" . DT  E 2 13 ? 8.319   33.095  -27.697 1.00 118.18 ? 32  DT  D "C1'" 1 
ATOM   2050 N N1    . DT  E 2 13 ? 6.843   33.134  -27.625 1.00 109.80 ? 32  DT  D N1    1 
ATOM   2051 C C2    . DT  E 2 13 ? 6.153   32.047  -28.111 1.00 97.49  ? 32  DT  D C2    1 
ATOM   2052 O O2    . DT  E 2 13 ? 6.701   31.086  -28.630 1.00 84.84  ? 32  DT  D O2    1 
ATOM   2053 N N3    . DT  E 2 13 ? 4.790   32.127  -27.971 1.00 97.43  ? 32  DT  D N3    1 
ATOM   2054 C C4    . DT  E 2 13 ? 4.066   33.165  -27.413 1.00 103.49 ? 32  DT  D C4    1 
ATOM   2055 O O4    . DT  E 2 13 ? 2.842   33.097  -27.359 1.00 101.36 ? 32  DT  D O4    1 
ATOM   2056 C C5    . DT  E 2 13 ? 4.855   34.266  -26.914 1.00 111.30 ? 32  DT  D C5    1 
ATOM   2057 C C7    . DT  E 2 13 ? 4.158   35.428  -26.279 1.00 118.81 ? 32  DT  D C7    1 
ATOM   2058 C C6    . DT  E 2 13 ? 6.187   34.191  -27.029 1.00 110.53 ? 32  DT  D C6    1 
ATOM   2059 P P     . DC  E 2 14 ? 11.801  33.753  -29.686 1.00 139.50 ? 33  DC  D P     1 
ATOM   2060 O OP1   . DC  E 2 14 ? 13.207  33.288  -29.770 1.00 132.36 ? 33  DC  D OP1   1 
ATOM   2061 O OP2   . DC  E 2 14 ? 11.476  35.191  -29.888 1.00 129.04 ? 33  DC  D OP2   1 
ATOM   2062 O "O5'" . DC  E 2 14 ? 10.975  32.873  -30.721 1.00 135.72 ? 33  DC  D "O5'" 1 
ATOM   2063 C "C5'" . DC  E 2 14 ? 11.090  31.441  -30.698 1.00 134.71 ? 33  DC  D "C5'" 1 
ATOM   2064 C "C4'" . DC  E 2 14 ? 10.165  30.834  -31.725 1.00 129.18 ? 33  DC  D "C4'" 1 
ATOM   2065 O "O4'" . DC  E 2 14 ? 8.791   31.133  -31.382 1.00 120.81 ? 33  DC  D "O4'" 1 
ATOM   2066 C "C3'" . DC  E 2 14 ? 10.371  31.346  -33.154 1.00 127.14 ? 33  DC  D "C3'" 1 
ATOM   2067 O "O3'" . DC  E 2 14 ? 10.462  30.209  -34.026 1.00 119.43 ? 33  DC  D "O3'" 1 
ATOM   2068 C "C2'" . DC  E 2 14 ? 9.183   32.272  -33.378 1.00 126.53 ? 33  DC  D "C2'" 1 
ATOM   2069 C "C1'" . DC  E 2 14 ? 8.115   31.597  -32.538 1.00 129.25 ? 33  DC  D "C1'" 1 
ATOM   2070 N N1    . DC  E 2 14 ? 6.987   32.430  -32.090 1.00 128.81 ? 33  DC  D N1    1 
ATOM   2071 C C2    . DC  E 2 14 ? 5.682   31.948  -32.253 1.00 126.55 ? 33  DC  D C2    1 
ATOM   2072 O O2    . DC  E 2 14 ? 5.503   30.856  -32.819 1.00 121.79 ? 33  DC  D O2    1 
ATOM   2073 N N3    . DC  E 2 14 ? 4.646   32.687  -31.801 1.00 130.74 ? 33  DC  D N3    1 
ATOM   2074 C C4    . DC  E 2 14 ? 4.867   33.853  -31.195 1.00 132.76 ? 33  DC  D C4    1 
ATOM   2075 N N4    . DC  E 2 14 ? 3.803   34.542  -30.766 1.00 129.01 ? 33  DC  D N4    1 
ATOM   2076 C C5    . DC  E 2 14 ? 6.184   34.362  -30.999 1.00 141.54 ? 33  DC  D C5    1 
ATOM   2077 C C6    . DC  E 2 14 ? 7.207   33.618  -31.449 1.00 138.18 ? 33  DC  D C6    1 
ATOM   2078 P P     . DC  E 2 15 ? 10.615  30.387  -35.617 1.00 115.77 ? 34  DC  D P     1 
ATOM   2079 O OP1   . DC  E 2 15 ? 11.337  29.197  -36.148 1.00 102.93 ? 34  DC  D OP1   1 
ATOM   2080 O OP2   . DC  E 2 15 ? 11.122  31.757  -35.905 1.00 101.92 ? 34  DC  D OP2   1 
ATOM   2081 O "O5'" . DC  E 2 15 ? 9.103   30.326  -36.110 1.00 112.03 ? 34  DC  D "O5'" 1 
ATOM   2082 C "C5'" . DC  E 2 15 ? 8.293   29.171  -35.841 1.00 110.78 ? 34  DC  D "C5'" 1 
ATOM   2083 C "C4'" . DC  E 2 15 ? 6.953   29.322  -36.517 1.00 111.57 ? 34  DC  D "C4'" 1 
ATOM   2084 O "O4'" . DC  E 2 15 ? 6.108   30.185  -35.727 1.00 109.39 ? 34  DC  D "O4'" 1 
ATOM   2085 C "C3'" . DC  E 2 15 ? 7.021   29.942  -37.916 1.00 113.53 ? 34  DC  D "C3'" 1 
ATOM   2086 O "O3'" . DC  E 2 15 ? 6.579   29.001  -38.902 1.00 120.58 ? 34  DC  D "O3'" 1 
ATOM   2087 C "C2'" . DC  E 2 15 ? 6.097   31.146  -37.844 1.00 116.07 ? 34  DC  D "C2'" 1 
ATOM   2088 C "C1'" . DC  E 2 15 ? 5.286   30.936  -36.587 1.00 110.34 ? 34  DC  D "C1'" 1 
ATOM   2089 N N1    . DC  E 2 15 ? 4.921   32.174  -35.888 1.00 118.97 ? 34  DC  D N1    1 
ATOM   2090 C C2    . DC  E 2 15 ? 3.574   32.430  -35.626 1.00 125.09 ? 34  DC  D C2    1 
ATOM   2091 O O2    . DC  E 2 15 ? 2.723   31.607  -35.993 1.00 123.53 ? 34  DC  D O2    1 
ATOM   2092 N N3    . DC  E 2 15 ? 3.233   33.558  -34.963 1.00 135.20 ? 34  DC  D N3    1 
ATOM   2093 C C4    . DC  E 2 15 ? 4.177   34.418  -34.576 1.00 131.43 ? 34  DC  D C4    1 
ATOM   2094 N N4    . DC  E 2 15 ? 3.790   35.520  -33.929 1.00 120.20 ? 34  DC  D N4    1 
ATOM   2095 C C5    . DC  E 2 15 ? 5.560   34.181  -34.828 1.00 132.12 ? 34  DC  D C5    1 
ATOM   2096 C C6    . DC  E 2 15 ? 5.885   33.056  -35.478 1.00 130.31 ? 34  DC  D C6    1 
ATOM   2097 P P     . DA  E 2 16 ? 7.358   28.843  -40.290 1.00 127.67 ? 35  DA  D P     1 
ATOM   2098 O OP1   . DA  E 2 16 ? 7.926   27.474  -40.351 1.00 134.41 ? 35  DA  D OP1   1 
ATOM   2099 O OP2   . DA  E 2 16 ? 8.229   30.036  -40.498 1.00 119.74 ? 35  DA  D OP2   1 
ATOM   2100 O "O5'" . DA  E 2 16 ? 6.184   28.953  -41.349 1.00 112.14 ? 35  DA  D "O5'" 1 
ATOM   2101 C "C5'" . DA  E 2 16 ? 5.381   30.124  -41.351 1.00 101.22 ? 35  DA  D "C5'" 1 
ATOM   2102 C "C4'" . DA  E 2 16 ? 3.929   29.748  -41.192 1.00 101.64 ? 35  DA  D "C4'" 1 
ATOM   2103 O "O4'" . DA  E 2 16 ? 3.393   30.437  -40.041 1.00 100.82 ? 35  DA  D "O4'" 1 
ATOM   2104 C "C3'" . DA  E 2 16 ? 3.091   30.224  -42.371 1.00 113.86 ? 35  DA  D "C3'" 1 
ATOM   2105 O "O3'" . DA  E 2 16 ? 1.909   29.465  -42.659 1.00 99.87  ? 35  DA  D "O3'" 1 
ATOM   2106 C "C2'" . DA  E 2 16 ? 2.765   31.649  -41.969 1.00 119.30 ? 35  DA  D "C2'" 1 
ATOM   2107 C "C1'" . DA  E 2 16 ? 2.595   31.539  -40.463 1.00 114.67 ? 35  DA  D "C1'" 1 
ATOM   2108 N N9    . DA  E 2 16 ? 3.055   32.734  -39.762 1.00 116.61 ? 35  DA  D N9    1 
ATOM   2109 C C8    . DA  E 2 16 ? 4.339   33.205  -39.639 1.00 119.36 ? 35  DA  D C8    1 
ATOM   2110 N N7    . DA  E 2 16 ? 4.428   34.323  -38.962 1.00 123.26 ? 35  DA  D N7    1 
ATOM   2111 C C5    . DA  E 2 16 ? 3.112   34.628  -38.648 1.00 120.55 ? 35  DA  D C5    1 
ATOM   2112 C C6    . DA  E 2 16 ? 2.533   35.703  -37.955 1.00 122.19 ? 35  DA  D C6    1 
ATOM   2113 N N6    . DA  E 2 16 ? 3.241   36.702  -37.427 1.00 128.39 ? 35  DA  D N6    1 
ATOM   2114 N N1    . DA  E 2 16 ? 1.190   35.697  -37.793 1.00 119.82 ? 35  DA  D N1    1 
ATOM   2115 C C2    . DA  E 2 16 ? 0.483   34.704  -38.351 1.00 119.15 ? 35  DA  D C2    1 
ATOM   2116 N N3    . DA  E 2 16 ? 0.915   33.639  -39.026 1.00 122.36 ? 35  DA  D N3    1 
ATOM   2117 C C4    . DA  E 2 16 ? 2.255   33.664  -39.143 1.00 120.37 ? 35  DA  D C4    1 
ATOM   2118 P P     . DG  E 2 17 ? 1.099   29.796  -44.002 1.00 98.29  ? 36  DG  D P     1 
ATOM   2119 O OP1   . DG  E 2 17 ? 0.629   28.509  -44.588 1.00 99.37  ? 36  DG  D OP1   1 
ATOM   2120 O OP2   . DG  E 2 17 ? 1.910   30.755  -44.809 1.00 80.00  ? 36  DG  D OP2   1 
ATOM   2121 O "O5'" . DG  E 2 17 ? -0.160  30.610  -43.482 1.00 71.62  ? 36  DG  D "O5'" 1 
ATOM   2122 C "C5'" . DG  E 2 17 ? -1.253  29.902  -42.918 1.00 78.90  ? 36  DG  D "C5'" 1 
ATOM   2123 C "C4'" . DG  E 2 17 ? -2.507  30.728  -43.034 1.00 84.69  ? 36  DG  D "C4'" 1 
ATOM   2124 O "O4'" . DG  E 2 17 ? -2.370  31.933  -42.247 1.00 93.35  ? 36  DG  D "O4'" 1 
ATOM   2125 C "C3'" . DG  E 2 17 ? -2.872  31.184  -44.444 1.00 86.68  ? 36  DG  D "C3'" 1 
ATOM   2126 O "O3'" . DG  E 2 17 ? -4.300  31.134  -44.448 1.00 90.43  ? 36  DG  D "O3'" 1 
ATOM   2127 C "C2'" . DG  E 2 17 ? -2.276  32.580  -44.515 1.00 94.09  ? 36  DG  D "C2'" 1 
ATOM   2128 C "C1'" . DG  E 2 17 ? -2.414  33.082  -43.079 1.00 98.56  ? 36  DG  D "C1'" 1 
ATOM   2129 N N9    . DG  E 2 17 ? -1.372  33.996  -42.622 1.00 99.46  ? 36  DG  D N9    1 
ATOM   2130 C C8    . DG  E 2 17 ? -0.017  33.855  -42.797 1.00 100.66 ? 36  DG  D C8    1 
ATOM   2131 N N7    . DG  E 2 17 ? 0.672   34.829  -42.269 1.00 106.57 ? 36  DG  D N7    1 
ATOM   2132 C C5    . DG  E 2 17 ? -0.283  35.651  -41.688 1.00 114.44 ? 36  DG  D C5    1 
ATOM   2133 C C6    . DG  E 2 17 ? -0.135  36.860  -40.956 1.00 110.08 ? 36  DG  D C6    1 
ATOM   2134 O O6    . DG  E 2 17 ? 0.904   37.465  -40.673 1.00 102.27 ? 36  DG  D O6    1 
ATOM   2135 N N1    . DG  E 2 17 ? -1.366  37.364  -40.544 1.00 112.03 ? 36  DG  D N1    1 
ATOM   2136 C C2    . DG  E 2 17 ? -2.584  36.783  -40.805 1.00 122.67 ? 36  DG  D C2    1 
ATOM   2137 N N2    . DG  E 2 17 ? -3.662  37.423  -40.328 1.00 128.72 ? 36  DG  D N2    1 
ATOM   2138 N N3    . DG  E 2 17 ? -2.735  35.653  -41.482 1.00 122.07 ? 36  DG  D N3    1 
ATOM   2139 C C4    . DG  E 2 17 ? -1.551  35.146  -41.890 1.00 112.80 ? 36  DG  D C4    1 
ATOM   2140 P P     . DT  E 2 18 ? -5.163  31.589  -45.699 1.00 94.49  ? 37  DT  D P     1 
ATOM   2141 O OP1   . DT  E 2 18 ? -6.525  30.998  -45.534 1.00 83.45  ? 37  DT  D OP1   1 
ATOM   2142 O OP2   . DT  E 2 18 ? -4.372  31.317  -46.926 1.00 97.37  ? 37  DT  D OP2   1 
ATOM   2143 O "O5'" . DT  E 2 18 ? -5.287  33.162  -45.503 1.00 94.36  ? 37  DT  D "O5'" 1 
ATOM   2144 C "C5'" . DT  E 2 18 ? -6.580  33.789  -45.481 1.00 104.50 ? 37  DT  D "C5'" 1 
ATOM   2145 C "C4'" . DT  E 2 18 ? -6.438  35.292  -45.434 1.00 115.08 ? 37  DT  D "C4'" 1 
ATOM   2146 O "O4'" . DT  E 2 18 ? -5.284  35.666  -44.653 1.00 118.59 ? 37  DT  D "O4'" 1 
ATOM   2147 C "C3'" . DT  E 2 18 ? -6.214  35.978  -46.780 1.00 121.75 ? 37  DT  D "C3'" 1 
ATOM   2148 O "O3'" . DT  E 2 18 ? -7.427  36.219  -47.509 1.00 116.53 ? 37  DT  D "O3'" 1 
ATOM   2149 C "C2'" . DT  E 2 18 ? -5.529  37.276  -46.381 1.00 124.49 ? 37  DT  D "C2'" 1 
ATOM   2150 C "C1'" . DT  E 2 18 ? -5.022  37.028  -44.953 1.00 119.85 ? 37  DT  D "C1'" 1 
ATOM   2151 N N1    . DT  E 2 18 ? -3.574  37.279  -44.796 1.00 105.60 ? 37  DT  D N1    1 
ATOM   2152 C C2    . DT  E 2 18 ? -3.194  38.418  -44.120 1.00 109.43 ? 37  DT  D C2    1 
ATOM   2153 O O2    . DT  E 2 18 ? -3.993  39.186  -43.606 1.00 113.07 ? 37  DT  D O2    1 
ATOM   2154 N N3    . DT  E 2 18 ? -1.837  38.614  -44.045 1.00 104.16 ? 37  DT  D N3    1 
ATOM   2155 C C4    . DT  E 2 18 ? -0.848  37.813  -44.585 1.00 102.00 ? 37  DT  D C4    1 
ATOM   2156 O O4    . DT  E 2 18 ? 0.331   38.119  -44.442 1.00 100.61 ? 37  DT  D O4    1 
ATOM   2157 C C5    . DT  E 2 18 ? -1.320  36.646  -45.297 1.00 103.85 ? 37  DT  D C5    1 
ATOM   2158 C C7    . DT  E 2 18 ? -0.320  35.726  -45.923 1.00 115.97 ? 37  DT  D C7    1 
ATOM   2159 C C6    . DT  E 2 18 ? -2.642  36.448  -45.380 1.00 96.74  ? 37  DT  D C6    1 
ATOM   2160 P P     . DA  F 3 1  ? 4.145   47.307  -40.316 1.00 260.47 ? 1   DA  E P     1 
ATOM   2161 O OP1   . DA  F 3 1  ? 5.011   48.196  -39.497 1.00 268.25 ? 1   DA  E OP1   1 
ATOM   2162 O OP2   . DA  F 3 1  ? 4.762   46.380  -41.302 1.00 265.72 ? 1   DA  E OP2   1 
ATOM   2163 O "O5'" . DA  F 3 1  ? 3.178   46.488  -39.348 1.00 216.83 ? 1   DA  E "O5'" 1 
ATOM   2164 C "C5'" . DA  F 3 1  ? 2.268   47.159  -38.451 1.00 183.92 ? 1   DA  E "C5'" 1 
ATOM   2165 C "C4'" . DA  F 3 1  ? 0.856   46.649  -38.636 1.00 172.27 ? 1   DA  E "C4'" 1 
ATOM   2166 O "O4'" . DA  F 3 1  ? 0.597   46.376  -40.036 1.00 161.04 ? 1   DA  E "O4'" 1 
ATOM   2167 C "C3'" . DA  F 3 1  ? 0.541   45.334  -37.925 1.00 173.41 ? 1   DA  E "C3'" 1 
ATOM   2168 O "O3'" . DA  F 3 1  ? 0.317   45.396  -36.500 1.00 176.38 ? 1   DA  E "O3'" 1 
ATOM   2169 C "C2'" . DA  F 3 1  ? -0.622  44.809  -38.746 1.00 163.61 ? 1   DA  E "C2'" 1 
ATOM   2170 C "C1'" . DA  F 3 1  ? -0.205  45.199  -40.163 1.00 156.94 ? 1   DA  E "C1'" 1 
ATOM   2171 N N9    . DA  F 3 1  ? 0.582   44.182  -40.870 1.00 153.08 ? 1   DA  E N9    1 
ATOM   2172 C C8    . DA  F 3 1  ? 1.827   44.309  -41.440 1.00 144.43 ? 1   DA  E C8    1 
ATOM   2173 N N7    . DA  F 3 1  ? 2.266   43.208  -42.002 1.00 137.19 ? 1   DA  E N7    1 
ATOM   2174 C C5    . DA  F 3 1  ? 1.243   42.295  -41.791 1.00 137.87 ? 1   DA  E C5    1 
ATOM   2175 C C6    . DA  F 3 1  ? 1.092   40.941  -42.149 1.00 128.24 ? 1   DA  E C6    1 
ATOM   2176 N N6    . DA  F 3 1  ? 2.012   40.246  -42.820 1.00 123.69 ? 1   DA  E N6    1 
ATOM   2177 N N1    . DA  F 3 1  ? -0.055  40.320  -41.792 1.00 125.84 ? 1   DA  E N1    1 
ATOM   2178 C C2    . DA  F 3 1  ? -0.981  41.019  -41.122 1.00 124.66 ? 1   DA  E C2    1 
ATOM   2179 N N3    . DA  F 3 1  ? -0.954  42.292  -40.728 1.00 129.46 ? 1   DA  E N3    1 
ATOM   2180 C C4    . DA  F 3 1  ? 0.198   42.881  -41.098 1.00 143.43 ? 1   DA  E C4    1 
ATOM   2181 P P     . DC  F 3 2  ? -0.600  46.536  -35.829 1.00 182.23 ? 2   DC  E P     1 
ATOM   2182 O OP1   . DC  F 3 2  ? -1.910  46.580  -36.536 1.00 164.68 ? 2   DC  E OP1   1 
ATOM   2183 O OP2   . DC  F 3 2  ? 0.221   47.768  -35.705 1.00 193.62 ? 2   DC  E OP2   1 
ATOM   2184 O "O5'" . DC  F 3 2  ? -0.857  46.006  -34.344 1.00 188.81 ? 2   DC  E "O5'" 1 
ATOM   2185 C "C5'" . DC  F 3 2  ? -0.885  44.604  -33.982 1.00 178.63 ? 2   DC  E "C5'" 1 
ATOM   2186 C "C4'" . DC  F 3 2  ? -2.129  43.925  -34.513 1.00 166.74 ? 2   DC  E "C4'" 1 
ATOM   2187 O "O4'" . DC  F 3 2  ? -1.995  43.694  -35.938 1.00 163.86 ? 2   DC  E "O4'" 1 
ATOM   2188 C "C3'" . DC  F 3 2  ? -2.429  42.553  -33.900 1.00 147.64 ? 2   DC  E "C3'" 1 
ATOM   2189 O "O3'" . DC  F 3 2  ? -3.156  42.597  -32.650 1.00 123.50 ? 2   DC  E "O3'" 1 
ATOM   2190 C "C2'" . DC  F 3 2  ? -3.084  41.803  -35.049 1.00 149.86 ? 2   DC  E "C2'" 1 
ATOM   2191 C "C1'" . DC  F 3 2  ? -2.417  42.379  -36.284 1.00 155.27 ? 2   DC  E "C1'" 1 
ATOM   2192 N N1    . DC  F 3 2  ? -1.244  41.636  -36.809 1.00 150.79 ? 2   DC  E N1    1 
ATOM   2193 C C2    . DC  F 3 2  ? -1.456  40.574  -37.702 1.00 148.71 ? 2   DC  E C2    1 
ATOM   2194 O O2    . DC  F 3 2  ? -2.620  40.263  -38.007 1.00 148.74 ? 2   DC  E O2    1 
ATOM   2195 N N3    . DC  F 3 2  ? -0.387  39.912  -38.207 1.00 144.17 ? 2   DC  E N3    1 
ATOM   2196 C C4    . DC  F 3 2  ? 0.851   40.283  -37.863 1.00 140.60 ? 2   DC  E C4    1 
ATOM   2197 N N4    . DC  F 3 2  ? 1.876   39.606  -38.385 1.00 134.35 ? 2   DC  E N4    1 
ATOM   2198 C C5    . DC  F 3 2  ? 1.094   41.361  -36.961 1.00 148.28 ? 2   DC  E C5    1 
ATOM   2199 C C6    . DC  F 3 2  ? 0.029   42.005  -36.465 1.00 150.30 ? 2   DC  E C6    1 
ATOM   2200 P P     . DT  F 3 3  ? -4.761  42.890  -32.582 1.00 132.87 ? 3   DT  E P     1 
ATOM   2201 O OP1   . DT  F 3 3  ? -5.113  43.874  -33.634 1.00 142.63 ? 3   DT  E OP1   1 
ATOM   2202 O OP2   . DT  F 3 3  ? -5.159  43.125  -31.164 1.00 113.41 ? 3   DT  E OP2   1 
ATOM   2203 O "O5'" . DT  F 3 3  ? -5.438  41.513  -32.992 1.00 128.21 ? 3   DT  E "O5'" 1 
ATOM   2204 C "C5'" . DT  F 3 3  ? -4.893  40.269  -32.560 1.00 121.31 ? 3   DT  E "C5'" 1 
ATOM   2205 C "C4'" . DT  F 3 3  ? -5.289  39.187  -33.530 1.00 104.48 ? 3   DT  E "C4'" 1 
ATOM   2206 O "O4'" . DT  F 3 3  ? -4.379  39.205  -34.646 1.00 106.99 ? 3   DT  E "O4'" 1 
ATOM   2207 C "C3'" . DT  F 3 3  ? -5.186  37.796  -32.932 1.00 99.13  ? 3   DT  E "C3'" 1 
ATOM   2208 O "O3'" . DT  F 3 3  ? -6.467  37.543  -32.356 1.00 89.95  ? 3   DT  E "O3'" 1 
ATOM   2209 C "C2'" . DT  F 3 3  ? -4.777  36.932  -34.112 1.00 106.52 ? 3   DT  E "C2'" 1 
ATOM   2210 C "C1'" . DT  F 3 3  ? -4.044  37.889  -35.049 1.00 107.47 ? 3   DT  E "C1'" 1 
ATOM   2211 N N1    . DT  F 3 3  ? -2.570  37.779  -35.077 1.00 103.45 ? 3   DT  E N1    1 
ATOM   2212 C C2    . DT  F 3 3  ? -2.014  36.855  -35.931 1.00 115.34 ? 3   DT  E C2    1 
ATOM   2213 O O2    . DT  F 3 3  ? -2.679  36.121  -36.643 1.00 136.88 ? 3   DT  E O2    1 
ATOM   2214 N N3    . DT  F 3 3  ? -0.640  36.835  -35.937 1.00 115.57 ? 3   DT  E N3    1 
ATOM   2215 C C4    . DT  F 3 3  ? 0.207   37.611  -35.171 1.00 117.81 ? 3   DT  E C4    1 
ATOM   2216 O O4    . DT  F 3 3  ? 1.419   37.460  -35.258 1.00 128.04 ? 3   DT  E O4    1 
ATOM   2217 C C5    . DT  F 3 3  ? -0.443  38.562  -34.301 1.00 120.80 ? 3   DT  E C5    1 
ATOM   2218 C C7    . DT  F 3 3  ? 0.398   39.453  -33.442 1.00 123.84 ? 3   DT  E C7    1 
ATOM   2219 C C6    . DT  F 3 3  ? -1.781  38.599  -34.298 1.00 109.37 ? 3   DT  E C6    1 
ATOM   2220 P P     . DG  F 3 4  ? -6.588  36.584  -31.089 1.00 116.82 ? 4   DG  E P     1 
ATOM   2221 O OP1   . DG  F 3 4  ? -7.995  36.592  -30.612 1.00 95.47  ? 4   DG  E OP1   1 
ATOM   2222 O OP2   . DG  F 3 4  ? -5.481  36.900  -30.146 1.00 120.89 ? 4   DG  E OP2   1 
ATOM   2223 O "O5'" . DG  F 3 4  ? -6.323  35.156  -31.731 1.00 113.77 ? 4   DG  E "O5'" 1 
ATOM   2224 C "C5'" . DG  F 3 4  ? -7.189  34.678  -32.768 1.00 114.63 ? 4   DG  E "C5'" 1 
ATOM   2225 C "C4'" . DG  F 3 4  ? -6.691  33.361  -33.309 1.00 104.55 ? 4   DG  E "C4'" 1 
ATOM   2226 O "O4'" . DG  F 3 4  ? -5.344  33.487  -33.811 1.00 92.74  ? 4   DG  E "O4'" 1 
ATOM   2227 C "C3'" . DG  F 3 4  ? -6.646  32.231  -32.290 1.00 101.63 ? 4   DG  E "C3'" 1 
ATOM   2228 O "O3'" . DG  F 3 4  ? -7.090  31.076  -33.004 1.00 95.04  ? 4   DG  E "O3'" 1 
ATOM   2229 C "C2'" . DG  F 3 4  ? -5.203  32.258  -31.809 1.00 102.04 ? 4   DG  E "C2'" 1 
ATOM   2230 C "C1'" . DG  F 3 4  ? -4.446  32.695  -33.048 1.00 99.66  ? 4   DG  E "C1'" 1 
ATOM   2231 N N9    . DG  F 3 4  ? -3.242  33.493  -32.857 1.00 105.26 ? 4   DG  E N9    1 
ATOM   2232 C C8    . DG  F 3 4  ? -3.095  34.629  -32.098 1.00 112.53 ? 4   DG  E C8    1 
ATOM   2233 N N7    . DG  F 3 4  ? -1.916  35.175  -32.218 1.00 118.89 ? 4   DG  E N7    1 
ATOM   2234 C C5    . DG  F 3 4  ? -1.257  34.369  -33.135 1.00 110.59 ? 4   DG  E C5    1 
ATOM   2235 C C6    . DG  F 3 4  ? 0.056   34.460  -33.663 1.00 116.71 ? 4   DG  E C6    1 
ATOM   2236 O O6    . DG  F 3 4  ? 0.934   35.293  -33.408 1.00 110.87 ? 4   DG  E O6    1 
ATOM   2237 N N1    . DG  F 3 4  ? 0.320   33.425  -34.555 1.00 126.99 ? 4   DG  E N1    1 
ATOM   2238 C C2    . DG  F 3 4  ? -0.571  32.444  -34.916 1.00 126.24 ? 4   DG  E C2    1 
ATOM   2239 N N2    . DG  F 3 4  ? -0.131  31.536  -35.802 1.00 127.12 ? 4   DG  E N2    1 
ATOM   2240 N N3    . DG  F 3 4  ? -1.797  32.349  -34.432 1.00 116.06 ? 4   DG  E N3    1 
ATOM   2241 C C4    . DG  F 3 4  ? -2.071  33.339  -33.555 1.00 107.41 ? 4   DG  E C4    1 
ATOM   2242 P P     . DG  F 3 5  ? -7.115  29.660  -32.313 1.00 97.42  ? 5   DG  E P     1 
ATOM   2243 O OP1   . DG  F 3 5  ? -8.008  28.772  -33.107 1.00 105.59 ? 5   DG  E OP1   1 
ATOM   2244 O OP2   . DG  F 3 5  ? -7.365  29.852  -30.861 1.00 103.67 ? 5   DG  E OP2   1 
ATOM   2245 O "O5'" . DG  F 3 5  ? -5.615  29.191  -32.527 1.00 94.64  ? 5   DG  E "O5'" 1 
ATOM   2246 C "C5'" . DG  F 3 5  ? -5.135  28.900  -33.839 1.00 97.18  ? 5   DG  E "C5'" 1 
ATOM   2247 C "C4'" . DG  F 3 5  ? -3.869  28.093  -33.723 1.00 99.85  ? 5   DG  E "C4'" 1 
ATOM   2248 O "O4'" . DG  F 3 5  ? -2.764  28.988  -33.474 1.00 104.83 ? 5   DG  E "O4'" 1 
ATOM   2249 C "C3'" . DG  F 3 5  ? -3.872  27.081  -32.575 1.00 95.79  ? 5   DG  E "C3'" 1 
ATOM   2250 O "O3'" . DG  F 3 5  ? -3.416  25.850  -33.143 1.00 99.01  ? 5   DG  E "O3'" 1 
ATOM   2251 C "C2'" . DG  F 3 5  ? -3.059  27.773  -31.493 1.00 93.62  ? 5   DG  E "C2'" 1 
ATOM   2252 C "C1'" . DG  F 3 5  ? -2.077  28.591  -32.300 1.00 104.93 ? 5   DG  E "C1'" 1 
ATOM   2253 N N9    . DG  F 3 5  ? -1.554  29.796  -31.664 1.00 112.60 ? 5   DG  E N9    1 
ATOM   2254 C C8    . DG  F 3 5  ? -2.185  30.639  -30.779 1.00 111.86 ? 5   DG  E C8    1 
ATOM   2255 N N7    . DG  F 3 5  ? -1.442  31.650  -30.416 1.00 109.66 ? 5   DG  E N7    1 
ATOM   2256 C C5    . DG  F 3 5  ? -0.253  31.466  -31.108 1.00 110.96 ? 5   DG  E C5    1 
ATOM   2257 C C6    . DG  F 3 5  ? 0.933   32.242  -31.122 1.00 124.88 ? 5   DG  E C6    1 
ATOM   2258 O O6    . DG  F 3 5  ? 1.188   33.282  -30.498 1.00 134.17 ? 5   DG  E O6    1 
ATOM   2259 N N1    . DG  F 3 5  ? 1.892   31.688  -31.959 1.00 135.50 ? 5   DG  E N1    1 
ATOM   2260 C C2    . DG  F 3 5  ? 1.737   30.547  -32.703 1.00 130.00 ? 5   DG  E C2    1 
ATOM   2261 N N2    . DG  F 3 5  ? 2.792   30.180  -33.450 1.00 132.40 ? 5   DG  E N2    1 
ATOM   2262 N N3    . DG  F 3 5  ? 0.639   29.812  -32.698 1.00 117.71 ? 5   DG  E N3    1 
ATOM   2263 C C4    . DG  F 3 5  ? -0.310  30.330  -31.888 1.00 112.69 ? 5   DG  E C4    1 
ATOM   2264 P P     . DA  F 3 6  ? -2.735  24.733  -32.259 1.00 94.67  ? 6   DA  E P     1 
ATOM   2265 O OP1   . DA  F 3 6  ? -2.966  23.418  -32.907 1.00 98.70  ? 6   DA  E OP1   1 
ATOM   2266 O OP2   . DA  F 3 6  ? -3.172  24.926  -30.849 1.00 98.20  ? 6   DA  E OP2   1 
ATOM   2267 O "O5'" . DA  F 3 6  ? -1.192  25.043  -32.491 1.00 89.65  ? 6   DA  E "O5'" 1 
ATOM   2268 C "C5'" . DA  F 3 6  ? -0.640  25.076  -33.814 1.00 84.76  ? 6   DA  E "C5'" 1 
ATOM   2269 C "C4'" . DA  F 3 6  ? 0.869   25.011  -33.758 1.00 90.90  ? 6   DA  E "C4'" 1 
ATOM   2270 O "O4'" . DA  F 3 6  ? 1.397   26.193  -33.110 1.00 88.61  ? 6   DA  E "O4'" 1 
ATOM   2271 C "C3'" . DA  F 3 6  ? 1.442   23.829  -32.977 1.00 90.29  ? 6   DA  E "C3'" 1 
ATOM   2272 O "O3'" . DA  F 3 6  ? 2.680   23.453  -33.605 1.00 87.24  ? 6   DA  E "O3'" 1 
ATOM   2273 C "C2'" . DA  F 3 6  ? 1.602   24.401  -31.579 1.00 85.08  ? 6   DA  E "C2'" 1 
ATOM   2274 C "C1'" . DA  F 3 6  ? 2.016   25.835  -31.874 1.00 86.79  ? 6   DA  E "C1'" 1 
ATOM   2275 N N9    . DA  F 3 6  ? 1.629   26.839  -30.889 1.00 85.12  ? 6   DA  E N9    1 
ATOM   2276 C C8    . DA  F 3 6  ? 0.443   26.974  -30.211 1.00 84.14  ? 6   DA  E C8    1 
ATOM   2277 N N7    . DA  F 3 6  ? 0.397   28.028  -29.433 1.00 77.94  ? 6   DA  E N7    1 
ATOM   2278 C C5    . DA  F 3 6  ? 1.622   28.644  -29.636 1.00 81.90  ? 6   DA  E C5    1 
ATOM   2279 C C6    . DA  F 3 6  ? 2.183   29.821  -29.119 1.00 85.98  ? 6   DA  E C6    1 
ATOM   2280 N N6    . DA  F 3 6  ? 1.565   30.610  -28.238 1.00 84.40  ? 6   DA  E N6    1 
ATOM   2281 N N1    . DA  F 3 6  ? 3.426   30.156  -29.528 1.00 96.27  ? 6   DA  E N1    1 
ATOM   2282 C C2    . DA  F 3 6  ? 4.048   29.361  -30.410 1.00 92.96  ? 6   DA  E C2    1 
ATOM   2283 N N3    . DA  F 3 6  ? 3.621   28.236  -30.973 1.00 89.69  ? 6   DA  E N3    1 
ATOM   2284 C C4    . DA  F 3 6  ? 2.385   27.930  -30.540 1.00 86.50  ? 6   DA  E C4    1 
ATOM   2285 P P     . DA  F 3 7  ? 3.572   22.249  -33.036 1.00 93.27  ? 7   DA  E P     1 
ATOM   2286 O OP1   . DA  F 3 7  ? 4.162   21.527  -34.197 1.00 88.39  ? 7   DA  E OP1   1 
ATOM   2287 O OP2   . DA  F 3 7  ? 2.766   21.504  -32.012 1.00 71.50  ? 7   DA  E OP2   1 
ATOM   2288 O "O5'" . DA  F 3 7  ? 4.761   23.017  -32.302 1.00 96.17  ? 7   DA  E "O5'" 1 
ATOM   2289 C "C5'" . DA  F 3 7  ? 5.457   24.104  -32.946 1.00 99.54  ? 7   DA  E "C5'" 1 
ATOM   2290 C "C4'" . DA  F 3 7  ? 6.426   24.775  -31.998 1.00 105.23 ? 7   DA  E "C4'" 1 
ATOM   2291 O "O4'" . DA  F 3 7  ? 5.743   25.725  -31.141 1.00 103.19 ? 7   DA  E "O4'" 1 
ATOM   2292 C "C3'" . DA  F 3 7  ? 7.202   23.838  -31.069 1.00 105.48 ? 7   DA  E "C3'" 1 
ATOM   2293 O "O3'" . DA  F 3 7  ? 8.594   24.153  -31.173 1.00 106.44 ? 7   DA  E "O3'" 1 
ATOM   2294 C "C2'" . DA  F 3 7  ? 6.595   24.098  -29.697 1.00 99.57  ? 7   DA  E "C2'" 1 
ATOM   2295 C "C1'" . DA  F 3 7  ? 6.153   25.544  -29.794 1.00 92.36  ? 7   DA  E "C1'" 1 
ATOM   2296 N N9    . DA  F 3 7  ? 5.022   25.897  -28.940 1.00 83.32  ? 7   DA  E N9    1 
ATOM   2297 C C8    . DA  F 3 7  ? 3.822   25.244  -28.813 1.00 85.31  ? 7   DA  E C8    1 
ATOM   2298 N N7    . DA  F 3 7  ? 2.987   25.829  -27.990 1.00 82.80  ? 7   DA  E N7    1 
ATOM   2299 C C5    . DA  F 3 7  ? 3.676   26.953  -27.562 1.00 82.08  ? 7   DA  E C5    1 
ATOM   2300 C C6    . DA  F 3 7  ? 3.345   27.981  -26.665 1.00 88.17  ? 7   DA  E C6    1 
ATOM   2301 N N6    . DA  F 3 7  ? 2.178   28.059  -26.022 1.00 94.32  ? 7   DA  E N6    1 
ATOM   2302 N N1    . DA  F 3 7  ? 4.263   28.946  -26.453 1.00 85.48  ? 7   DA  E N1    1 
ATOM   2303 C C2    . DA  F 3 7  ? 5.432   28.873  -27.090 1.00 80.97  ? 7   DA  E C2    1 
ATOM   2304 N N3    . DA  F 3 7  ? 5.861   27.958  -27.955 1.00 91.05  ? 7   DA  E N3    1 
ATOM   2305 C C4    . DA  F 3 7  ? 4.927   27.011  -28.146 1.00 81.88  ? 7   DA  E C4    1 
ATOM   2306 P P     . DT  F 3 8  ? 9.666   23.364  -30.303 1.00 111.41 ? 8   DT  E P     1 
ATOM   2307 O OP1   . DT  F 3 8  ? 10.963  23.441  -31.013 1.00 117.37 ? 8   DT  E OP1   1 
ATOM   2308 O OP2   . DT  F 3 8  ? 9.108   22.037  -29.932 1.00 92.51  ? 8   DT  E OP2   1 
ATOM   2309 O "O5'" . DT  F 3 8  ? 9.791   24.264  -28.997 1.00 107.66 ? 8   DT  E "O5'" 1 
ATOM   2310 C "C5'" . DT  F 3 8  ? 10.409  25.558  -29.093 1.00 114.06 ? 8   DT  E "C5'" 1 
ATOM   2311 C "C4'" . DT  F 3 8  ? 10.342  26.284  -27.771 1.00 115.71 ? 8   DT  E "C4'" 1 
ATOM   2312 O "O4'" . DT  F 3 8  ? 8.959   26.458  -27.375 1.00 105.99 ? 8   DT  E "O4'" 1 
ATOM   2313 C "C3'" . DT  F 3 8  ? 11.043  25.573  -26.602 1.00 120.46 ? 8   DT  E "C3'" 1 
ATOM   2314 O "O3'" . DT  F 3 8  ? 12.128  26.373  -26.084 1.00 130.27 ? 8   DT  E "O3'" 1 
ATOM   2315 C "C2'" . DT  F 3 8  ? 9.921   25.330  -25.604 1.00 114.67 ? 8   DT  E "C2'" 1 
ATOM   2316 C "C1'" . DT  F 3 8  ? 8.925   26.409  -25.971 1.00 98.84  ? 8   DT  E "C1'" 1 
ATOM   2317 N N1    . DT  F 3 8  ? 7.539   26.146  -25.545 1.00 95.09  ? 8   DT  E N1    1 
ATOM   2318 C C2    . DT  F 3 8  ? 6.975   27.018  -24.642 1.00 97.88  ? 8   DT  E C2    1 
ATOM   2319 O O2    . DT  F 3 8  ? 7.558   27.998  -24.211 1.00 104.37 ? 8   DT  E O2    1 
ATOM   2320 N N3    . DT  F 3 8  ? 5.694   26.699  -24.260 1.00 95.53  ? 8   DT  E N3    1 
ATOM   2321 C C4    . DT  F 3 8  ? 4.945   25.614  -24.673 1.00 92.11  ? 8   DT  E C4    1 
ATOM   2322 O O4    . DT  F 3 8  ? 3.807   25.459  -24.242 1.00 93.26  ? 8   DT  E O4    1 
ATOM   2323 C C5    . DT  F 3 8  ? 5.599   24.738  -25.620 1.00 95.92  ? 8   DT  E C5    1 
ATOM   2324 C C7    . DT  F 3 8  ? 4.859   23.545  -26.135 1.00 102.66 ? 8   DT  E C7    1 
ATOM   2325 C C6    . DT  F 3 8  ? 6.849   25.040  -25.999 1.00 97.86  ? 8   DT  E C6    1 
ATOM   2326 P P     . DG  F 3 9  ? 13.030  25.880  -24.818 1.00 127.85 ? 9   DG  E P     1 
ATOM   2327 O OP1   . DG  F 3 9  ? 14.399  26.439  -24.978 1.00 129.96 ? 9   DG  E OP1   1 
ATOM   2328 O OP2   . DG  F 3 9  ? 12.825  24.423  -24.600 1.00 126.19 ? 9   DG  E OP2   1 
ATOM   2329 O "O5'" . DG  F 3 9  ? 12.376  26.645  -23.594 1.00 115.63 ? 9   DG  E "O5'" 1 
ATOM   2330 C "C5'" . DG  F 3 9  ? 12.231  28.072  -23.642 1.00 119.25 ? 9   DG  E "C5'" 1 
ATOM   2331 C "C4'" . DG  F 3 9  ? 11.702  28.547  -22.313 1.00 120.78 ? 9   DG  E "C4'" 1 
ATOM   2332 O "O4'" . DG  F 3 9  ? 10.277  28.293  -22.257 1.00 114.71 ? 9   DG  E "O4'" 1 
ATOM   2333 C "C3'" . DG  F 3 9  ? 12.313  27.807  -21.120 1.00 124.59 ? 9   DG  E "C3'" 1 
ATOM   2334 O "O3'" . DG  F 3 9  ? 12.558  28.712  -20.045 1.00 133.28 ? 9   DG  E "O3'" 1 
ATOM   2335 C "C2'" . DG  F 3 9  ? 11.242  26.802  -20.746 1.00 117.03 ? 9   DG  E "C2'" 1 
ATOM   2336 C "C1'" . DG  F 3 9  ? 9.989   27.592  -21.064 1.00 116.52 ? 9   DG  E "C1'" 1 
ATOM   2337 N N9    . DG  F 3 9  ? 8.811   26.768  -21.291 1.00 110.03 ? 9   DG  E N9    1 
ATOM   2338 C C8    . DG  F 3 9  ? 8.710   25.666  -22.106 1.00 109.05 ? 9   DG  E C8    1 
ATOM   2339 N N7    . DG  F 3 9  ? 7.536   25.098  -22.055 1.00 102.52 ? 9   DG  E N7    1 
ATOM   2340 C C5    . DG  F 3 9  ? 6.826   25.863  -21.142 1.00 105.10 ? 9   DG  E C5    1 
ATOM   2341 C C6    . DG  F 3 9  ? 5.497   25.729  -20.672 1.00 110.27 ? 9   DG  E C6    1 
ATOM   2342 O O6    . DG  F 3 9  ? 4.650   24.890  -20.991 1.00 114.13 ? 9   DG  E O6    1 
ATOM   2343 N N1    . DG  F 3 9  ? 5.180   26.718  -19.746 1.00 116.46 ? 9   DG  E N1    1 
ATOM   2344 C C2    . DG  F 3 9  ? 6.036   27.703  -19.316 1.00 120.10 ? 9   DG  E C2    1 
ATOM   2345 N N2    . DG  F 3 9  ? 5.541   28.568  -18.417 1.00 121.72 ? 9   DG  E N2    1 
ATOM   2346 N N3    . DG  F 3 9  ? 7.277   27.842  -19.753 1.00 109.13 ? 9   DG  E N3    1 
ATOM   2347 C C4    . DG  F 3 9  ? 7.604   26.892  -20.654 1.00 105.78 ? 9   DG  E C4    1 
ATOM   2348 P P     . DC  F 3 10 ? 13.480  28.275  -18.824 1.00 124.43 ? 10  DC  E P     1 
ATOM   2349 O OP1   . DC  F 3 10 ? 14.523  29.317  -18.656 1.00 127.18 ? 10  DC  E OP1   1 
ATOM   2350 O OP2   . DC  F 3 10 ? 13.847  26.844  -18.992 1.00 102.38 ? 10  DC  E OP2   1 
ATOM   2351 O "O5'" . DC  F 3 10 ? 12.490  28.338  -17.586 1.00 108.84 ? 10  DC  E "O5'" 1 
ATOM   2352 C "C5'" . DC  F 3 10 ? 11.489  29.360  -17.464 1.00 114.35 ? 10  DC  E "C5'" 1 
ATOM   2353 C "C4'" . DC  F 3 10 ? 10.596  29.000  -16.303 1.00 121.59 ? 10  DC  E "C4'" 1 
ATOM   2354 O "O4'" . DC  F 3 10 ? 9.464   28.223  -16.775 1.00 119.52 ? 10  DC  E "O4'" 1 
ATOM   2355 C "C3'" . DC  F 3 10 ? 11.299  28.129  -15.256 1.00 132.11 ? 10  DC  E "C3'" 1 
ATOM   2356 O "O3'" . DC  F 3 10 ? 10.894  28.491  -13.939 1.00 151.93 ? 10  DC  E "O3'" 1 
ATOM   2357 C "C2'" . DC  F 3 10 ? 10.787  26.739  -15.563 1.00 123.57 ? 10  DC  E "C2'" 1 
ATOM   2358 C "C1'" . DC  F 3 10 ? 9.357   27.068  -15.960 1.00 125.89 ? 10  DC  E "C1'" 1 
ATOM   2359 N N1    . DC  F 3 10 ? 8.651   26.010  -16.714 1.00 130.51 ? 10  DC  E N1    1 
ATOM   2360 C C2    . DC  F 3 10 ? 7.320   25.705  -16.380 1.00 136.76 ? 10  DC  E C2    1 
ATOM   2361 O O2    . DC  F 3 10 ? 6.737   26.388  -15.520 1.00 141.56 ? 10  DC  E O2    1 
ATOM   2362 N N3    . DC  F 3 10 ? 6.688   24.711  -17.043 1.00 142.54 ? 10  DC  E N3    1 
ATOM   2363 C C4    . DC  F 3 10 ? 7.346   23.993  -17.957 1.00 142.17 ? 10  DC  E C4    1 
ATOM   2364 N N4    . DC  F 3 10 ? 6.685   23.012  -18.575 1.00 149.94 ? 10  DC  E N4    1 
ATOM   2365 C C5    . DC  F 3 10 ? 8.703   24.267  -18.300 1.00 130.29 ? 10  DC  E C5    1 
ATOM   2366 C C6    . DC  F 3 10 ? 9.315   25.265  -17.651 1.00 133.51 ? 10  DC  E C6    1 
ATOM   2367 P P     . DA  F 3 11 ? 11.886  28.303  -12.706 1.00 142.62 ? 11  DA  E P     1 
ATOM   2368 O OP1   . DA  F 3 11 ? 12.550  29.612  -12.466 1.00 122.64 ? 11  DA  E OP1   1 
ATOM   2369 O OP2   . DA  F 3 11 ? 12.699  27.073  -12.935 1.00 125.23 ? 11  DA  E OP2   1 
ATOM   2370 O "O5'" . DA  F 3 11 ? 10.871  28.054  -11.509 1.00 129.62 ? 11  DA  E "O5'" 1 
ATOM   2371 C "C5'" . DA  F 3 11 ? 9.753   28.939  -11.319 1.00 131.35 ? 11  DA  E "C5'" 1 
ATOM   2372 C "C4'" . DA  F 3 11 ? 8.560   28.142  -10.853 1.00 145.41 ? 11  DA  E "C4'" 1 
ATOM   2373 O "O4'" . DA  F 3 11 ? 8.140   27.224  -11.892 1.00 145.33 ? 11  DA  E "O4'" 1 
ATOM   2374 C "C3'" . DA  F 3 11 ? 8.836   27.290  -9.612  1.00 153.97 ? 11  DA  E "C3'" 1 
ATOM   2375 O "O3'" . DA  F 3 11 ? 7.798   27.496  -8.647  1.00 155.14 ? 11  DA  E "O3'" 1 
ATOM   2376 C "C2'" . DA  F 3 11 ? 8.862   25.867  -10.144 1.00 156.83 ? 11  DA  E "C2'" 1 
ATOM   2377 C "C1'" . DA  F 3 11 ? 7.905   25.948  -11.318 1.00 150.10 ? 11  DA  E "C1'" 1 
ATOM   2378 N N9    . DA  F 3 11 ? 8.110   24.949  -12.363 1.00 139.24 ? 11  DA  E N9    1 
ATOM   2379 C C8    . DA  F 3 11 ? 9.270   24.736  -13.065 1.00 139.04 ? 11  DA  E C8    1 
ATOM   2380 N N7    . DA  F 3 11 ? 9.172   23.799  -13.976 1.00 133.45 ? 11  DA  E N7    1 
ATOM   2381 C C5    . DA  F 3 11 ? 7.855   23.372  -13.874 1.00 136.27 ? 11  DA  E C5    1 
ATOM   2382 C C6    . DA  F 3 11 ? 7.124   22.393  -14.568 1.00 138.51 ? 11  DA  E C6    1 
ATOM   2383 N N6    . DA  F 3 11 ? 7.645   21.638  -15.534 1.00 139.74 ? 11  DA  E N6    1 
ATOM   2384 N N1    . DA  F 3 11 ? 5.822   22.226  -14.241 1.00 131.86 ? 11  DA  E N1    1 
ATOM   2385 C C2    . DA  F 3 11 ? 5.313   22.969  -13.249 1.00 128.49 ? 11  DA  E C2    1 
ATOM   2386 N N3    . DA  F 3 11 ? 5.901   23.922  -12.523 1.00 134.75 ? 11  DA  E N3    1 
ATOM   2387 C C4    . DA  F 3 11 ? 7.186   24.077  -12.891 1.00 136.44 ? 11  DA  E C4    1 
ATOM   2388 P P     . DA  F 3 12 ? 7.992   27.026  -7.137  1.00 150.01 ? 12  DA  E P     1 
ATOM   2389 O OP1   . DA  F 3 12 ? 7.450   28.094  -6.259  1.00 146.19 ? 12  DA  E OP1   1 
ATOM   2390 O OP2   . DA  F 3 12 ? 9.394   26.555  -6.970  1.00 139.40 ? 12  DA  E OP2   1 
ATOM   2391 O "O5'" . DA  F 3 12 ? 7.059   25.740  -7.035  1.00 139.06 ? 12  DA  E "O5'" 1 
ATOM   2392 C "C5'" . DA  F 3 12 ? 5.635   25.835  -7.198  1.00 126.68 ? 12  DA  E "C5'" 1 
ATOM   2393 C "C4'" . DA  F 3 12 ? 5.058   24.475  -7.513  1.00 119.47 ? 12  DA  E "C4'" 1 
ATOM   2394 O "O4'" . DA  F 3 12 ? 5.561   23.999  -8.778  1.00 122.52 ? 12  DA  E "O4'" 1 
ATOM   2395 C "C3'" . DA  F 3 12 ? 5.396   23.384  -6.496  1.00 118.66 ? 12  DA  E "C3'" 1 
ATOM   2396 O "O3'" . DA  F 3 12 ? 4.251   23.122  -5.683  1.00 125.79 ? 12  DA  E "O3'" 1 
ATOM   2397 C "C2'" . DA  F 3 12 ? 5.818   22.190  -7.343  1.00 117.97 ? 12  DA  E "C2'" 1 
ATOM   2398 C "C1'" . DA  F 3 12 ? 5.467   22.591  -8.761  1.00 123.68 ? 12  DA  E "C1'" 1 
ATOM   2399 N N9    . DA  F 3 12 ? 6.392   22.059  -9.759  1.00 125.70 ? 12  DA  E N9    1 
ATOM   2400 C C8    . DA  F 3 12 ? 7.705   22.413  -9.955  1.00 120.27 ? 12  DA  E C8    1 
ATOM   2401 N N7    . DA  F 3 12 ? 8.294   21.747  -10.917 1.00 118.03 ? 12  DA  E N7    1 
ATOM   2402 C C5    . DA  F 3 12 ? 7.307   20.888  -11.380 1.00 120.71 ? 12  DA  E C5    1 
ATOM   2403 C C6    . DA  F 3 12 ? 7.305   19.909  -12.387 1.00 121.16 ? 12  DA  E C6    1 
ATOM   2404 N N6    . DA  F 3 12 ? 8.366   19.635  -13.145 1.00 124.31 ? 12  DA  E N6    1 
ATOM   2405 N N1    . DA  F 3 12 ? 6.150   19.244  -12.619 1.00 121.70 ? 12  DA  E N1    1 
ATOM   2406 C C2    . DA  F 3 12 ? 5.093   19.509  -11.838 1.00 122.41 ? 12  DA  E C2    1 
ATOM   2407 N N3    . DA  F 3 12 ? 4.976   20.402  -10.854 1.00 129.02 ? 12  DA  E N3    1 
ATOM   2408 C C4    . DA  F 3 12 ? 6.133   21.063  -10.670 1.00 125.25 ? 12  DA  E C4    1 
ATOM   2409 P P     . DT  F 3 13 ? 4.314   22.003  -4.542  1.00 144.18 ? 13  DT  E P     1 
ATOM   2410 O OP1   . DT  F 3 13 ? 3.176   22.228  -3.621  1.00 148.26 ? 13  DT  E OP1   1 
ATOM   2411 O OP2   . DT  F 3 13 ? 5.703   21.944  -4.010  1.00 124.49 ? 13  DT  E OP2   1 
ATOM   2412 O "O5'" . DT  F 3 13 ? 3.984   20.666  -5.337  1.00 136.49 ? 13  DT  E "O5'" 1 
ATOM   2413 C "C5'" . DT  F 3 13 ? 2.803   20.587  -6.143  1.00 132.99 ? 13  DT  E "C5'" 1 
ATOM   2414 C "C4'" . DT  F 3 13 ? 2.789   19.286  -6.908  1.00 136.17 ? 13  DT  E "C4'" 1 
ATOM   2415 O "O4'" . DT  F 3 13 ? 3.848   19.274  -7.897  1.00 142.06 ? 13  DT  E "O4'" 1 
ATOM   2416 C "C3'" . DT  F 3 13 ? 2.988   18.027  -6.056  1.00 127.20 ? 13  DT  E "C3'" 1 
ATOM   2417 O "O3'" . DT  F 3 13 ? 1.906   17.123  -6.297  1.00 130.61 ? 13  DT  E "O3'" 1 
ATOM   2418 C "C2'" . DT  F 3 13 ? 4.302   17.457  -6.561  1.00 129.66 ? 13  DT  E "C2'" 1 
ATOM   2419 C "C1'" . DT  F 3 13 ? 4.280   17.934  -7.994  1.00 138.39 ? 13  DT  E "C1'" 1 
ATOM   2420 N N1    . DT  F 3 13 ? 5.586   17.904  -8.690  1.00 135.84 ? 13  DT  E N1    1 
ATOM   2421 C C2    . DT  F 3 13 ? 5.750   16.998  -9.715  1.00 121.88 ? 13  DT  E C2    1 
ATOM   2422 O O2    . DT  F 3 13 ? 4.865   16.247  -10.091 1.00 117.39 ? 13  DT  E O2    1 
ATOM   2423 N N3    . DT  F 3 13 ? 6.991   17.017  -10.302 1.00 115.90 ? 13  DT  E N3    1 
ATOM   2424 C C4    . DT  F 3 13 ? 8.071   17.804  -9.949  1.00 120.79 ? 13  DT  E C4    1 
ATOM   2425 O O4    . DT  F 3 13 ? 9.129   17.702  -10.566 1.00 114.44 ? 13  DT  E O4    1 
ATOM   2426 C C5    . DT  F 3 13 ? 7.833   18.722  -8.856  1.00 117.99 ? 13  DT  E C5    1 
ATOM   2427 C C7    . DT  F 3 13 ? 8.938   19.629  -8.417  1.00 120.91 ? 13  DT  E C7    1 
ATOM   2428 C C6    . DT  F 3 13 ? 6.620   18.724  -8.288  1.00 125.38 ? 13  DT  E C6    1 
ATOM   2429 P P     . DA  F 3 14 ? 1.804   15.744  -5.495  1.00 137.77 ? 14  DA  E P     1 
ATOM   2430 O OP1   . DA  F 3 14 ? 0.383   15.314  -5.490  1.00 136.94 ? 14  DA  E OP1   1 
ATOM   2431 O OP2   . DA  F 3 14 ? 2.533   15.903  -4.210  1.00 135.41 ? 14  DA  E OP2   1 
ATOM   2432 O "O5'" . DA  F 3 14 ? 2.608   14.724  -6.419  1.00 139.65 ? 14  DA  E "O5'" 1 
ATOM   2433 C "C5'" . DA  F 3 14 ? 2.397   14.661  -7.844  1.00 139.36 ? 14  DA  E "C5'" 1 
ATOM   2434 C "C4'" . DA  F 3 14 ? 2.187   13.237  -8.313  1.00 142.91 ? 14  DA  E "C4'" 1 
ATOM   2435 O "O4'" . DA  F 3 14 ? 3.210   12.887  -9.270  1.00 147.57 ? 14  DA  E "O4'" 1 
ATOM   2436 C "C3'" . DA  F 3 14 ? 2.282   12.136  -7.264  1.00 137.20 ? 14  DA  E "C3'" 1 
ATOM   2437 O "O3'" . DA  F 3 14 ? 1.558   11.019  -7.797  1.00 137.27 ? 14  DA  E "O3'" 1 
ATOM   2438 C "C2'" . DA  F 3 14 ? 3.783   11.914  -7.180  1.00 136.86 ? 14  DA  E "C2'" 1 
ATOM   2439 C "C1'" . DA  F 3 14 ? 4.255   12.167  -8.615  1.00 129.75 ? 14  DA  E "C1'" 1 
ATOM   2440 N N9    . DA  F 3 14 ? 5.474   12.956  -8.771  1.00 120.37 ? 14  DA  E N9    1 
ATOM   2441 C C8    . DA  F 3 14 ? 5.865   14.070  -8.068  1.00 124.35 ? 14  DA  E C8    1 
ATOM   2442 N N7    . DA  F 3 14 ? 6.983   14.601  -8.500  1.00 124.70 ? 14  DA  E N7    1 
ATOM   2443 C C5    . DA  F 3 14 ? 7.329   13.810  -9.587  1.00 117.71 ? 14  DA  E C5    1 
ATOM   2444 C C6    . DA  F 3 14 ? 8.413   13.853  -10.482 1.00 111.59 ? 14  DA  E C6    1 
ATOM   2445 N N6    . DA  F 3 14 ? 9.386   14.764  -10.421 1.00 113.57 ? 14  DA  E N6    1 
ATOM   2446 N N1    . DA  F 3 14 ? 8.471   12.906  -11.445 1.00 116.02 ? 14  DA  E N1    1 
ATOM   2447 C C2    . DA  F 3 14 ? 7.494   11.989  -11.504 1.00 113.77 ? 14  DA  E C2    1 
ATOM   2448 N N3    . DA  F 3 14 ? 6.423   11.849  -10.723 1.00 110.27 ? 14  DA  E N3    1 
ATOM   2449 C C4    . DA  F 3 14 ? 6.398   12.803  -9.775  1.00 117.73 ? 14  DA  E C4    1 
ATOM   2450 P P     . DA  F 3 15 ? 1.610   9.579   -7.100  1.00 143.51 ? 15  DA  E P     1 
ATOM   2451 O OP1   . DA  F 3 15 ? 0.386   8.837   -7.498  1.00 150.51 ? 15  DA  E OP1   1 
ATOM   2452 O OP2   . DA  F 3 15 ? 1.916   9.769   -5.660  1.00 144.47 ? 15  DA  E OP2   1 
ATOM   2453 O "O5'" . DA  F 3 15 ? 2.851   8.879   -7.811  1.00 135.51 ? 15  DA  E "O5'" 1 
ATOM   2454 C "C5'" . DA  F 3 15 ? 2.803   8.552   -9.208  1.00 135.65 ? 15  DA  E "C5'" 1 
ATOM   2455 C "C4'" . DA  F 3 15 ? 4.024   7.763   -9.623  1.00 140.27 ? 15  DA  E "C4'" 1 
ATOM   2456 O "O4'" . DA  F 3 15 ? 5.194   8.614   -9.651  1.00 141.59 ? 15  DA  E "O4'" 1 
ATOM   2457 C "C3'" . DA  F 3 15 ? 4.399   6.584   -8.726  1.00 136.03 ? 15  DA  E "C3'" 1 
ATOM   2458 O "O3'" . DA  F 3 15 ? 4.879   5.567   -9.612  1.00 137.54 ? 15  DA  E "O3'" 1 
ATOM   2459 C "C2'" . DA  F 3 15 ? 5.492   7.164   -7.843  1.00 131.45 ? 15  DA  E "C2'" 1 
ATOM   2460 C "C1'" . DA  F 3 15 ? 6.214   8.063   -8.826  1.00 124.63 ? 15  DA  E "C1'" 1 
ATOM   2461 N N9    . DA  F 3 15 ? 6.982   9.183   -8.287  1.00 118.88 ? 15  DA  E N9    1 
ATOM   2462 C C8    . DA  F 3 15 ? 6.688   10.031  -7.246  1.00 121.88 ? 15  DA  E C8    1 
ATOM   2463 N N7    . DA  F 3 15 ? 7.560   10.998  -7.089  1.00 112.02 ? 15  DA  E N7    1 
ATOM   2464 C C5    . DA  F 3 15 ? 8.477   10.787  -8.109  1.00 113.43 ? 15  DA  E C5    1 
ATOM   2465 C C6    . DA  F 3 15 ? 9.641   11.478  -8.498  1.00 110.48 ? 15  DA  E C6    1 
ATOM   2466 N N6    . DA  F 3 15 ? 10.113  12.556  -7.866  1.00 103.52 ? 15  DA  E N6    1 
ATOM   2467 N N1    . DA  F 3 15 ? 10.321  11.008  -9.566  1.00 116.05 ? 15  DA  E N1    1 
ATOM   2468 C C2    . DA  F 3 15 ? 9.845   9.933   -10.211 1.00 123.63 ? 15  DA  E C2    1 
ATOM   2469 N N3    . DA  F 3 15 ? 8.767   9.200   -9.942  1.00 116.19 ? 15  DA  E N3    1 
ATOM   2470 C C4    . DA  F 3 15 ? 8.120   9.685   -8.868  1.00 115.31 ? 15  DA  E C4    1 
ATOM   2471 P P     . DA  F 3 16 ? 5.046   4.055   -9.125  1.00 145.50 ? 16  DA  E P     1 
ATOM   2472 O OP1   . DA  F 3 16 ? 4.093   3.213   -9.898  1.00 131.70 ? 16  DA  E OP1   1 
ATOM   2473 O OP2   . DA  F 3 16 ? 5.025   4.033   -7.635  1.00 130.92 ? 16  DA  E OP2   1 
ATOM   2474 O "O5'" . DA  F 3 16 ? 6.490   3.681   -9.680  1.00 133.51 ? 16  DA  E "O5'" 1 
ATOM   2475 C "C5'" . DA  F 3 16 ? 6.700   3.595   -11.098 1.00 126.87 ? 16  DA  E "C5'" 1 
ATOM   2476 C "C4'" . DA  F 3 16 ? 8.174   3.615   -11.423 1.00 122.80 ? 16  DA  E "C4'" 1 
ATOM   2477 O "O4'" . DA  F 3 16 ? 8.809   4.786   -10.855 1.00 124.18 ? 16  DA  E "O4'" 1 
ATOM   2478 C "C3'" . DA  F 3 16 ? 8.962   2.418   -10.900 1.00 114.63 ? 16  DA  E "C3'" 1 
ATOM   2479 O "O3'" . DA  F 3 16 ? 9.875   2.087   -11.954 1.00 111.68 ? 16  DA  E "O3'" 1 
ATOM   2480 C "C2'" . DA  F 3 16 ? 9.549   2.941   -9.598  1.00 118.09 ? 16  DA  E "C2'" 1 
ATOM   2481 C "C1'" . DA  F 3 16 ? 9.819   4.406   -9.924  1.00 124.40 ? 16  DA  E "C1'" 1 
ATOM   2482 N N9    . DA  F 3 16 ? 9.773   5.371   -8.823  1.00 123.12 ? 16  DA  E N9    1 
ATOM   2483 C C8    . DA  F 3 16 ? 8.821   5.478   -7.837  1.00 128.23 ? 16  DA  E C8    1 
ATOM   2484 N N7    . DA  F 3 16 ? 9.003   6.501   -7.035  1.00 128.82 ? 16  DA  E N7    1 
ATOM   2485 C C5    . DA  F 3 16 ? 10.134  7.126   -7.543  1.00 117.94 ? 16  DA  E C5    1 
ATOM   2486 C C6    . DA  F 3 16 ? 10.841  8.277   -7.144  1.00 110.10 ? 16  DA  E C6    1 
ATOM   2487 N N6    . DA  F 3 16 ? 10.504  9.025   -6.089  1.00 99.78  ? 16  DA  E N6    1 
ATOM   2488 N N1    . DA  F 3 16 ? 11.939  8.618   -7.855  1.00 116.04 ? 16  DA  E N1    1 
ATOM   2489 C C2    . DA  F 3 16 ? 12.274  7.870   -8.918  1.00 120.13 ? 16  DA  E C2    1 
ATOM   2490 N N3    . DA  F 3 16 ? 11.685  6.772   -9.396  1.00 116.24 ? 16  DA  E N3    1 
ATOM   2491 C C4    . DA  F 3 16 ? 10.609  6.450   -8.655  1.00 119.51 ? 16  DA  E C4    1 
ATOM   2492 P P     . DA  F 3 17 ? 10.764  0.757   -11.905 1.00 110.70 ? 17  DA  E P     1 
ATOM   2493 O OP1   . DA  F 3 17 ? 10.500  -0.029  -13.130 1.00 118.01 ? 17  DA  E OP1   1 
ATOM   2494 O OP2   . DA  F 3 17 ? 10.561  0.118   -10.583 1.00 118.48 ? 17  DA  E OP2   1 
ATOM   2495 O "O5'" . DA  F 3 17 ? 12.244  1.326   -12.075 1.00 104.76 ? 17  DA  E "O5'" 1 
ATOM   2496 C "C5'" . DA  F 3 17 ? 12.522  2.701   -11.724 1.00 104.38 ? 17  DA  E "C5'" 1 
ATOM   2497 C "C4'" . DA  F 3 17 ? 13.997  2.976   -11.542 1.00 100.69 ? 17  DA  E "C4'" 1 
ATOM   2498 O "O4'" . DA  F 3 17 ? 14.131  4.025   -10.553 1.00 97.19  ? 17  DA  E "O4'" 1 
ATOM   2499 C "C3'" . DA  F 3 17 ? 14.829  1.816   -11.004 1.00 98.74  ? 17  DA  E "C3'" 1 
ATOM   2500 O "O3'" . DA  F 3 17 ? 16.186  1.985   -11.402 1.00 97.42  ? 17  DA  E "O3'" 1 
ATOM   2501 C "C2'" . DA  F 3 17 ? 14.672  1.971   -9.507  1.00 96.36  ? 17  DA  E "C2'" 1 
ATOM   2502 C "C1'" . DA  F 3 17 ? 14.661  3.488   -9.347  1.00 91.34  ? 17  DA  E "C1'" 1 
ATOM   2503 N N9    . DA  F 3 17 ? 13.851  3.975   -8.229  1.00 85.39  ? 17  DA  E N9    1 
ATOM   2504 C C8    . DA  F 3 17 ? 12.760  3.378   -7.640  1.00 85.07  ? 17  DA  E C8    1 
ATOM   2505 N N7    . DA  F 3 17 ? 12.281  4.045   -6.617  1.00 83.97  ? 17  DA  E N7    1 
ATOM   2506 C C5    . DA  F 3 17 ? 13.110  5.154   -6.525  1.00 85.29  ? 17  DA  E C5    1 
ATOM   2507 C C6    . DA  F 3 17 ? 13.127  6.249   -5.645  1.00 91.51  ? 17  DA  E C6    1 
ATOM   2508 N N6    . DA  F 3 17 ? 12.248  6.415   -4.656  1.00 99.04  ? 17  DA  E N6    1 
ATOM   2509 N N1    . DA  F 3 17 ? 14.093  7.179   -5.818  1.00 96.16  ? 17  DA  E N1    1 
ATOM   2510 C C2    . DA  F 3 17 ? 14.965  7.020   -6.823  1.00 97.43  ? 17  DA  E C2    1 
ATOM   2511 N N3    . DA  F 3 17 ? 15.054  6.030   -7.712  1.00 89.19  ? 17  DA  E N3    1 
ATOM   2512 C C4    . DA  F 3 17 ? 14.089  5.118   -7.504  1.00 84.56  ? 17  DA  E C4    1 
ATOM   2513 P P     . DT  F 3 18 ? 17.297  0.981   -10.876 1.00 101.45 ? 18  DT  E P     1 
ATOM   2514 O OP1   . DT  F 3 18 ? 18.383  0.927   -11.893 1.00 95.99  ? 18  DT  E OP1   1 
ATOM   2515 O OP2   . DT  F 3 18 ? 16.617  -0.285  -10.457 1.00 81.79  ? 18  DT  E OP2   1 
ATOM   2516 O "O5'" . DT  F 3 18 ? 17.929  1.820   -9.680  1.00 99.41  ? 18  DT  E "O5'" 1 
ATOM   2517 C "C5'" . DT  F 3 18 ? 18.839  2.895   -9.991  1.00 102.74 ? 18  DT  E "C5'" 1 
ATOM   2518 C "C4'" . DT  F 3 18 ? 19.132  3.728   -8.766  1.00 104.06 ? 18  DT  E "C4'" 1 
ATOM   2519 O "O4'" . DT  F 3 18 ? 17.906  4.103   -8.107  1.00 99.97  ? 18  DT  E "O4'" 1 
ATOM   2520 C "C3'" . DT  F 3 18 ? 19.949  3.018   -7.693  1.00 107.22 ? 18  DT  E "C3'" 1 
ATOM   2521 O "O3'" . DT  F 3 18 ? 21.349  3.216   -7.908  1.00 109.00 ? 18  DT  E "O3'" 1 
ATOM   2522 C "C2'" . DT  F 3 18 ? 19.481  3.673   -6.403  1.00 110.39 ? 18  DT  E "C2'" 1 
ATOM   2523 C "C1'" . DT  F 3 18 ? 18.224  4.465   -6.779  1.00 98.09  ? 18  DT  E "C1'" 1 
ATOM   2524 N N1    . DT  F 3 18 ? 17.061  4.151   -5.925  1.00 88.45  ? 18  DT  E N1    1 
ATOM   2525 C C2    . DT  F 3 18 ? 16.716  5.039   -4.926  1.00 92.06  ? 18  DT  E C2    1 
ATOM   2526 O O2    . DT  F 3 18 ? 17.300  6.096   -4.739  1.00 86.34  ? 18  DT  E O2    1 
ATOM   2527 N N3    . DT  F 3 18 ? 15.650  4.644   -4.151  1.00 95.14  ? 18  DT  E N3    1 
ATOM   2528 C C4    . DT  F 3 18 ? 14.909  3.482   -4.281  1.00 99.89  ? 18  DT  E C4    1 
ATOM   2529 O O4    . DT  F 3 18 ? 13.967  3.267   -3.521  1.00 98.68  ? 18  DT  E O4    1 
ATOM   2530 C C5    . DT  F 3 18 ? 15.342  2.589   -5.336  1.00 92.42  ? 18  DT  E C5    1 
ATOM   2531 C C7    . DT  F 3 18 ? 14.612  1.300   -5.539  1.00 96.10  ? 18  DT  E C7    1 
ATOM   2532 C C6    . DT  F 3 18 ? 16.387  2.960   -6.088  1.00 82.65  ? 18  DT  E C6    1 
ATOM   2533 N N     . TRP G 4 4  ? -9.443  29.296  -15.455 1.00 138.10 ? 43  TRP I N     1 
ATOM   2534 C CA    . TRP G 4 4  ? -8.356  29.673  -14.501 1.00 145.47 ? 43  TRP I CA    1 
ATOM   2535 C C     . TRP G 4 4  ? -8.845  29.682  -13.051 1.00 150.98 ? 43  TRP I C     1 
ATOM   2536 O O     . TRP G 4 4  ? -8.326  28.933  -12.224 1.00 167.11 ? 43  TRP I O     1 
ATOM   2537 C CB    . TRP G 4 4  ? -7.731  31.021  -14.894 1.00 143.68 ? 43  TRP I CB    1 
ATOM   2538 C CG    . TRP G 4 4  ? -7.049  31.779  -13.789 1.00 143.03 ? 43  TRP I CG    1 
ATOM   2539 C CD1   . TRP G 4 4  ? -6.117  31.306  -12.912 1.00 145.36 ? 43  TRP I CD1   1 
ATOM   2540 C CD2   . TRP G 4 4  ? -7.239  33.158  -13.469 1.00 151.89 ? 43  TRP I CD2   1 
ATOM   2541 N NE1   . TRP G 4 4  ? -5.729  32.300  -12.049 1.00 150.24 ? 43  TRP I NE1   1 
ATOM   2542 C CE2   . TRP G 4 4  ? -6.397  33.452  -12.372 1.00 156.13 ? 43  TRP I CE2   1 
ATOM   2543 C CE3   . TRP G 4 4  ? -8.043  34.178  -14.001 1.00 155.54 ? 43  TRP I CE3   1 
ATOM   2544 C CZ2   . TRP G 4 4  ? -6.335  34.727  -11.794 1.00 161.12 ? 43  TRP I CZ2   1 
ATOM   2545 C CZ3   . TRP G 4 4  ? -7.981  35.447  -13.429 1.00 157.79 ? 43  TRP I CZ3   1 
ATOM   2546 C CH2   . TRP G 4 4  ? -7.134  35.707  -12.336 1.00 163.29 ? 43  TRP I CH2   1 
ATOM   2547 N N     . SER G 4 5  ? -9.814  30.540  -12.746 1.00 150.62 ? 44  SER I N     1 
ATOM   2548 C CA    . SER G 4 5  ? -10.357 30.662  -11.389 1.00 156.70 ? 44  SER I CA    1 
ATOM   2549 C C     . SER G 4 5  ? -11.831 30.266  -11.481 1.00 151.37 ? 44  SER I C     1 
ATOM   2550 O O     . SER G 4 5  ? -12.529 30.773  -12.337 1.00 161.44 ? 44  SER I O     1 
ATOM   2551 C CB    . SER G 4 5  ? -10.183 32.102  -10.884 1.00 166.78 ? 44  SER I CB    1 
ATOM   2552 O OG    . SER G 4 5  ? -9.132  32.195  -9.933  1.00 171.32 ? 44  SER I OG    1 
ATOM   2553 N N     . PRO G 4 6  ? -12.321 29.399  -10.577 1.00 149.69 ? 45  PRO I N     1 
ATOM   2554 C CA    . PRO G 4 6  ? -13.548 28.595  -10.803 1.00 157.83 ? 45  PRO I CA    1 
ATOM   2555 C C     . PRO G 4 6  ? -14.711 29.314  -11.541 1.00 153.52 ? 45  PRO I C     1 
ATOM   2556 O O     . PRO G 4 6  ? -14.845 29.143  -12.758 1.00 141.29 ? 45  PRO I O     1 
ATOM   2557 C CB    . PRO G 4 6  ? -13.932 28.127  -9.384  1.00 158.86 ? 45  PRO I CB    1 
ATOM   2558 C CG    . PRO G 4 6  ? -13.258 29.090  -8.466  1.00 158.18 ? 45  PRO I CG    1 
ATOM   2559 C CD    . PRO G 4 6  ? -11.970 29.448  -9.148  1.00 154.33 ? 45  PRO I CD    1 
ATOM   2560 N N     . ASP G 4 7  ? -15.519 30.114  -10.842 1.00 154.50 ? 46  ASP I N     1 
ATOM   2561 C CA    . ASP G 4 7  ? -16.550 30.947  -11.488 1.00 157.34 ? 46  ASP I CA    1 
ATOM   2562 C C     . ASP G 4 7  ? -16.116 31.461  -12.869 1.00 155.27 ? 46  ASP I C     1 
ATOM   2563 O O     . ASP G 4 7  ? -16.815 31.213  -13.865 1.00 158.41 ? 46  ASP I O     1 
ATOM   2564 C CB    . ASP G 4 7  ? -16.994 32.116  -10.576 1.00 168.50 ? 46  ASP I CB    1 
ATOM   2565 C CG    . ASP G 4 7  ? -15.842 32.739  -9.778  1.00 171.86 ? 46  ASP I CG    1 
ATOM   2566 O OD1   . ASP G 4 7  ? -14.721 32.868  -10.323 1.00 166.53 ? 46  ASP I OD1   1 
ATOM   2567 O OD2   . ASP G 4 7  ? -16.072 33.090  -8.596  1.00 169.37 ? 46  ASP I OD2   1 
ATOM   2568 N N     . ILE G 4 8  ? -14.930 32.083  -12.931 1.00 149.67 ? 47  ILE I N     1 
ATOM   2569 C CA    . ILE G 4 8  ? -14.377 32.649  -14.185 1.00 140.43 ? 47  ILE I CA    1 
ATOM   2570 C C     . ILE G 4 8  ? -14.423 31.617  -15.320 1.00 136.69 ? 47  ILE I C     1 
ATOM   2571 O O     . ILE G 4 8  ? -14.985 31.910  -16.378 1.00 127.93 ? 47  ILE I O     1 
ATOM   2572 C CB    . ILE G 4 8  ? -12.931 33.193  -14.031 1.00 132.09 ? 47  ILE I CB    1 
ATOM   2573 C CG1   . ILE G 4 8  ? -12.863 34.272  -12.941 1.00 129.87 ? 47  ILE I CG1   1 
ATOM   2574 C CG2   . ILE G 4 8  ? -12.410 33.770  -15.344 1.00 136.73 ? 47  ILE I CG2   1 
ATOM   2575 C CD1   . ILE G 4 8  ? -11.486 34.869  -12.741 1.00 133.21 ? 47  ILE I CD1   1 
ATOM   2576 N N     . GLU G 4 9  ? -13.891 30.411  -15.071 1.00 141.28 ? 48  GLU I N     1 
ATOM   2577 C CA    . GLU G 4 9  ? -13.933 29.282  -16.041 1.00 143.27 ? 48  GLU I CA    1 
ATOM   2578 C C     . GLU G 4 9  ? -15.321 29.091  -16.680 1.00 159.77 ? 48  GLU I C     1 
ATOM   2579 O O     . GLU G 4 9  ? -15.430 28.751  -17.877 1.00 155.45 ? 48  GLU I O     1 
ATOM   2580 C CB    . GLU G 4 9  ? -13.483 27.973  -15.350 1.00 138.02 ? 48  GLU I CB    1 
ATOM   2581 C CG    . GLU G 4 9  ? -13.762 26.648  -16.064 1.00 131.28 ? 48  GLU I CG    1 
ATOM   2582 C CD    . GLU G 4 9  ? -12.777 26.357  -17.170 1.00 130.76 ? 48  GLU I CD    1 
ATOM   2583 O OE1   . GLU G 4 9  ? -12.523 27.259  -17.993 1.00 129.17 ? 48  GLU I OE1   1 
ATOM   2584 O OE2   . GLU G 4 9  ? -12.255 25.223  -17.213 1.00 129.25 ? 48  GLU I OE2   1 
ATOM   2585 N N     . GLN G 4 10 ? -16.368 29.311  -15.878 1.00 168.44 ? 49  GLN I N     1 
ATOM   2586 C CA    . GLN G 4 10 ? -17.736 29.181  -16.361 1.00 160.70 ? 49  GLN I CA    1 
ATOM   2587 C C     . GLN G 4 10 ? -18.135 30.346  -17.280 1.00 158.48 ? 49  GLN I C     1 
ATOM   2588 O O     . GLN G 4 10 ? -18.824 30.113  -18.275 1.00 177.04 ? 49  GLN I O     1 
ATOM   2589 C CB    . GLN G 4 10 ? -18.723 29.048  -15.197 1.00 164.20 ? 49  GLN I CB    1 
ATOM   2590 C CG    . GLN G 4 10 ? -19.798 27.997  -15.437 1.00 169.73 ? 49  GLN I CG    1 
ATOM   2591 C CD    . GLN G 4 10 ? -21.173 28.399  -14.942 1.00 177.14 ? 49  GLN I CD    1 
ATOM   2592 O OE1   . GLN G 4 10 ? -21.331 29.318  -14.134 1.00 182.95 ? 49  GLN I OE1   1 
ATOM   2593 N NE2   . GLN G 4 10 ? -22.182 27.701  -15.432 1.00 180.03 ? 49  GLN I NE2   1 
ATOM   2594 N N     . SER G 4 11 ? -17.706 31.577  -16.964 1.00 151.46 ? 50  SER I N     1 
ATOM   2595 C CA    . SER G 4 11 ? -17.985 32.747  -17.838 1.00 142.09 ? 50  SER I CA    1 
ATOM   2596 C C     . SER G 4 11 ? -17.103 32.755  -19.097 1.00 131.23 ? 50  SER I C     1 
ATOM   2597 O O     . SER G 4 11 ? -17.496 33.279  -20.128 1.00 133.18 ? 50  SER I O     1 
ATOM   2598 C CB    . SER G 4 11 ? -17.882 34.074  -17.076 1.00 142.77 ? 50  SER I CB    1 
ATOM   2599 O OG    . SER G 4 11 ? -16.870 34.036  -16.091 1.00 156.84 ? 50  SER I OG    1 
ATOM   2600 N N     . PHE G 4 12 ? -15.915 32.172  -19.004 1.00 128.89 ? 51  PHE I N     1 
ATOM   2601 C CA    . PHE G 4 12 ? -15.143 31.768  -20.181 1.00 125.86 ? 51  PHE I CA    1 
ATOM   2602 C C     . PHE G 4 12 ? -15.937 30.756  -21.007 1.00 126.63 ? 51  PHE I C     1 
ATOM   2603 O O     . PHE G 4 12 ? -16.238 31.018  -22.166 1.00 137.52 ? 51  PHE I O     1 
ATOM   2604 C CB    . PHE G 4 12 ? -13.803 31.169  -19.743 1.00 122.88 ? 51  PHE I CB    1 
ATOM   2605 C CG    . PHE G 4 12 ? -13.025 30.507  -20.843 1.00 110.52 ? 51  PHE I CG    1 
ATOM   2606 C CD1   . PHE G 4 12 ? -12.158 31.246  -21.638 1.00 102.90 ? 51  PHE I CD1   1 
ATOM   2607 C CD2   . PHE G 4 12 ? -13.132 29.138  -21.060 1.00 109.50 ? 51  PHE I CD2   1 
ATOM   2608 C CE1   . PHE G 4 12 ? -11.423 30.638  -22.643 1.00 100.44 ? 51  PHE I CE1   1 
ATOM   2609 C CE2   . PHE G 4 12 ? -12.402 28.525  -22.065 1.00 106.29 ? 51  PHE I CE2   1 
ATOM   2610 C CZ    . PHE G 4 12 ? -11.545 29.277  -22.859 1.00 101.92 ? 51  PHE I CZ    1 
ATOM   2611 N N     . GLN G 4 13 ? -16.274 29.615  -20.405 1.00 117.96 ? 52  GLN I N     1 
ATOM   2612 C CA    . GLN G 4 13 ? -17.079 28.590  -21.082 1.00 130.43 ? 52  GLN I CA    1 
ATOM   2613 C C     . GLN G 4 13 ? -18.314 29.198  -21.805 1.00 141.21 ? 52  GLN I C     1 
ATOM   2614 O O     . GLN G 4 13 ? -18.511 28.989  -23.023 1.00 141.19 ? 52  GLN I O     1 
ATOM   2615 C CB    . GLN G 4 13 ? -17.513 27.514  -20.075 1.00 135.14 ? 52  GLN I CB    1 
ATOM   2616 C CG    . GLN G 4 13 ? -16.572 26.314  -20.008 1.00 138.40 ? 52  GLN I CG    1 
ATOM   2617 C CD    . GLN G 4 13 ? -16.716 25.356  -21.185 1.00 138.73 ? 52  GLN I CD    1 
ATOM   2618 O OE1   . GLN G 4 13 ? -17.828 25.013  -21.597 1.00 129.72 ? 52  GLN I OE1   1 
ATOM   2619 N NE2   . GLN G 4 13 ? -15.583 24.904  -21.721 1.00 139.80 ? 52  GLN I NE2   1 
ATOM   2620 N N     . GLU G 4 14 ? -19.107 29.977  -21.059 1.00 146.02 ? 53  GLU I N     1 
ATOM   2621 C CA    . GLU G 4 14 ? -20.219 30.771  -21.633 1.00 138.97 ? 53  GLU I CA    1 
ATOM   2622 C C     . GLU G 4 14 ? -19.756 31.581  -22.838 1.00 139.99 ? 53  GLU I C     1 
ATOM   2623 O O     . GLU G 4 14 ? -20.392 31.518  -23.886 1.00 151.97 ? 53  GLU I O     1 
ATOM   2624 C CB    . GLU G 4 14 ? -20.841 31.738  -20.611 1.00 135.59 ? 53  GLU I CB    1 
ATOM   2625 C CG    . GLU G 4 14 ? -22.111 31.258  -19.921 1.00 127.87 ? 53  GLU I CG    1 
ATOM   2626 C CD    . GLU G 4 14 ? -22.516 32.167  -18.768 1.00 126.53 ? 53  GLU I CD    1 
ATOM   2627 O OE1   . GLU G 4 14 ? -22.480 33.408  -18.935 1.00 121.76 ? 53  GLU I OE1   1 
ATOM   2628 O OE2   . GLU G 4 14 ? -22.860 31.641  -17.688 1.00 120.47 ? 53  GLU I OE2   1 
ATOM   2629 N N     . ALA G 4 15 ? -18.657 32.328  -22.689 1.00 133.65 ? 54  ALA I N     1 
ATOM   2630 C CA    . ALA G 4 15 ? -18.058 33.053  -23.829 1.00 140.14 ? 54  ALA I CA    1 
ATOM   2631 C C     . ALA G 4 15 ? -17.747 32.100  -25.001 1.00 148.72 ? 54  ALA I C     1 
ATOM   2632 O O     . ALA G 4 15 ? -17.946 32.455  -26.172 1.00 151.32 ? 54  ALA I O     1 
ATOM   2633 C CB    . ALA G 4 15 ? -16.801 33.819  -23.417 1.00 134.50 ? 54  ALA I CB    1 
ATOM   2634 N N     . LEU G 4 16 ? -17.282 30.890  -24.676 1.00 151.79 ? 55  LEU I N     1 
ATOM   2635 C CA    . LEU G 4 16 ? -17.001 29.873  -25.693 1.00 154.81 ? 55  LEU I CA    1 
ATOM   2636 C C     . LEU G 4 16 ? -18.289 29.494  -26.434 1.00 157.51 ? 55  LEU I C     1 
ATOM   2637 O O     . LEU G 4 16 ? -18.297 29.457  -27.670 1.00 159.00 ? 55  LEU I O     1 
ATOM   2638 C CB    . LEU G 4 16 ? -16.329 28.618  -25.087 1.00 153.14 ? 55  LEU I CB    1 
ATOM   2639 C CG    . LEU G 4 16 ? -15.119 27.987  -25.806 1.00 153.53 ? 55  LEU I CG    1 
ATOM   2640 C CD1   . LEU G 4 16 ? -15.204 28.064  -27.328 1.00 156.69 ? 55  LEU I CD1   1 
ATOM   2641 C CD2   . LEU G 4 16 ? -13.821 28.619  -25.329 1.00 152.93 ? 55  LEU I CD2   1 
ATOM   2642 N N     . ALA G 4 17 ? -19.365 29.234  -25.682 1.00 161.66 ? 56  ALA I N     1 
ATOM   2643 C CA    . ALA G 4 17 ? -20.678 28.896  -26.284 1.00 164.00 ? 56  ALA I CA    1 
ATOM   2644 C C     . ALA G 4 17 ? -21.293 30.054  -27.086 1.00 162.51 ? 56  ALA I C     1 
ATOM   2645 O O     . ALA G 4 17 ? -21.859 29.828  -28.156 1.00 161.21 ? 56  ALA I O     1 
ATOM   2646 C CB    . ALA G 4 17 ? -21.661 28.412  -25.219 1.00 159.94 ? 56  ALA I CB    1 
ATOM   2647 N N     . ILE G 4 18 ? -21.169 31.278  -26.565 1.00 159.47 ? 57  ILE I N     1 
ATOM   2648 C CA    . ILE G 4 18 ? -21.740 32.488  -27.188 1.00 151.34 ? 57  ILE I CA    1 
ATOM   2649 C C     . ILE G 4 18 ? -20.953 32.919  -28.430 1.00 138.06 ? 57  ILE I C     1 
ATOM   2650 O O     . ILE G 4 18 ? -21.555 33.288  -29.432 1.00 139.39 ? 57  ILE I O     1 
ATOM   2651 C CB    . ILE G 4 18 ? -21.863 33.665  -26.163 1.00 159.42 ? 57  ILE I CB    1 
ATOM   2652 C CG1   . ILE G 4 18 ? -22.946 33.364  -25.095 1.00 157.02 ? 57  ILE I CG1   1 
ATOM   2653 C CG2   . ILE G 4 18 ? -22.131 35.013  -26.841 1.00 162.19 ? 57  ILE I CG2   1 
ATOM   2654 C CD1   . ILE G 4 18 ? -24.389 33.305  -25.576 1.00 146.54 ? 57  ILE I CD1   1 
ATOM   2655 N N     . TYR G 4 19 ? -19.625 32.876  -28.375 1.00 142.33 ? 58  TYR I N     1 
ATOM   2656 C CA    . TYR G 4 19 ? -18.809 33.219  -29.554 1.00 144.83 ? 58  TYR I CA    1 
ATOM   2657 C C     . TYR G 4 19 ? -18.619 31.932  -30.366 1.00 153.78 ? 58  TYR I C     1 
ATOM   2658 O O     . TYR G 4 19 ? -19.208 30.920  -29.987 1.00 158.10 ? 58  TYR I O     1 
ATOM   2659 C CB    . TYR G 4 19 ? -17.548 33.943  -29.098 1.00 132.98 ? 58  TYR I CB    1 
ATOM   2660 C CG    . TYR G 4 19 ? -17.958 35.313  -28.666 1.00 136.12 ? 58  TYR I CG    1 
ATOM   2661 C CD1   . TYR G 4 19 ? -18.076 36.341  -29.585 1.00 140.48 ? 58  TYR I CD1   1 
ATOM   2662 C CD2   . TYR G 4 19 ? -18.348 35.558  -27.347 1.00 143.88 ? 58  TYR I CD2   1 
ATOM   2663 C CE1   . TYR G 4 19 ? -18.512 37.599  -29.195 1.00 149.42 ? 58  TYR I CE1   1 
ATOM   2664 C CE2   . TYR G 4 19 ? -18.780 36.810  -26.941 1.00 146.55 ? 58  TYR I CE2   1 
ATOM   2665 C CZ    . TYR G 4 19 ? -18.860 37.833  -27.865 1.00 151.88 ? 58  TYR I CZ    1 
ATOM   2666 O OH    . TYR G 4 19 ? -19.282 39.081  -27.457 1.00 154.48 ? 58  TYR I OH    1 
ATOM   2667 N N     . PRO G 4 20 ? -17.876 31.960  -31.502 1.00 157.46 ? 59  PRO I N     1 
ATOM   2668 C CA    . PRO G 4 20 ? -17.945 30.784  -32.392 1.00 165.95 ? 59  PRO I CA    1 
ATOM   2669 C C     . PRO G 4 20 ? -17.752 29.416  -31.689 1.00 194.13 ? 59  PRO I C     1 
ATOM   2670 O O     . PRO G 4 20 ? -16.610 29.042  -31.399 1.00 217.01 ? 59  PRO I O     1 
ATOM   2671 C CB    . PRO G 4 20 ? -16.814 31.049  -33.387 1.00 147.81 ? 59  PRO I CB    1 
ATOM   2672 C CG    . PRO G 4 20 ? -16.729 32.525  -33.464 1.00 142.34 ? 59  PRO I CG    1 
ATOM   2673 C CD    . PRO G 4 20 ? -16.992 33.000  -32.068 1.00 149.03 ? 59  PRO I CD    1 
ATOM   2674 N N     . PRO G 4 21 ? -18.855 28.658  -31.446 1.00 206.54 ? 60  PRO I N     1 
ATOM   2675 C CA    . PRO G 4 21 ? -18.773 27.459  -30.594 1.00 211.03 ? 60  PRO I CA    1 
ATOM   2676 C C     . PRO G 4 21 ? -17.962 26.308  -31.201 1.00 225.24 ? 60  PRO I C     1 
ATOM   2677 O O     . PRO G 4 21 ? -17.560 25.400  -30.468 1.00 231.39 ? 60  PRO I O     1 
ATOM   2678 C CB    . PRO G 4 21 ? -20.239 27.053  -30.421 1.00 204.18 ? 60  PRO I CB    1 
ATOM   2679 C CG    . PRO G 4 21 ? -20.884 27.492  -31.686 1.00 202.87 ? 60  PRO I CG    1 
ATOM   2680 C CD    . PRO G 4 21 ? -20.179 28.762  -32.093 1.00 203.62 ? 60  PRO I CD    1 
ATOM   2681 N N     . CYS G 4 22 ? -17.754 26.343  -32.521 1.00 227.76 ? 61  CYS I N     1 
ATOM   2682 C CA    . CYS G 4 22 ? -16.814 25.455  -33.208 1.00 217.69 ? 61  CYS I CA    1 
ATOM   2683 C C     . CYS G 4 22 ? -15.617 26.219  -33.810 1.00 189.90 ? 61  CYS I C     1 
ATOM   2684 O O     . CYS G 4 22 ? -14.936 25.693  -34.694 1.00 183.95 ? 61  CYS I O     1 
ATOM   2685 C CB    . CYS G 4 22 ? -17.550 24.660  -34.296 1.00 228.84 ? 61  CYS I CB    1 
ATOM   2686 S SG    . CYS G 4 22 ? -16.883 22.999  -34.567 1.00 249.42 ? 61  CYS I SG    1 
ATOM   2687 N N     . GLY G 4 23 ? -15.368 27.447  -33.340 1.00 164.12 ? 62  GLY I N     1 
ATOM   2688 C CA    . GLY G 4 23 ? -14.173 28.206  -33.718 1.00 169.23 ? 62  GLY I CA    1 
ATOM   2689 C C     . GLY G 4 23 ? -14.378 29.216  -34.832 1.00 176.16 ? 62  GLY I C     1 
ATOM   2690 O O     . GLY G 4 23 ? -14.106 30.404  -34.644 1.00 184.35 ? 62  GLY I O     1 
ATOM   2691 N N     . ARG G 4 24 ? -14.822 28.733  -35.993 1.00 183.68 ? 63  ARG I N     1 
ATOM   2692 C CA    . ARG G 4 24 ? -15.154 29.569  -37.164 1.00 188.64 ? 63  ARG I CA    1 
ATOM   2693 C C     . ARG G 4 24 ? -14.186 30.777  -37.310 1.00 194.89 ? 63  ARG I C     1 
ATOM   2694 O O     . ARG G 4 24 ? -12.987 30.560  -37.512 1.00 188.46 ? 63  ARG I O     1 
ATOM   2695 C CB    . ARG G 4 24 ? -16.658 29.936  -37.124 1.00 185.08 ? 63  ARG I CB    1 
ATOM   2696 C CG    . ARG G 4 24 ? -17.355 30.014  -38.482 1.00 185.24 ? 63  ARG I CG    1 
ATOM   2697 C CD    . ARG G 4 24 ? -16.742 30.999  -39.472 1.00 184.89 ? 63  ARG I CD    1 
ATOM   2698 N NE    . ARG G 4 24 ? -17.252 30.773  -40.827 1.00 185.49 ? 63  ARG I NE    1 
ATOM   2699 C CZ    . ARG G 4 24 ? -18.444 31.164  -41.288 1.00 186.20 ? 63  ARG I CZ    1 
ATOM   2700 N NH1   . ARG G 4 24 ? -19.307 31.834  -40.518 1.00 182.80 ? 63  ARG I NH1   1 
ATOM   2701 N NH2   . ARG G 4 24 ? -18.781 30.880  -42.546 1.00 184.77 ? 63  ARG I NH2   1 
ATOM   2702 N N     . ARG G 4 25 ? -14.691 32.014  -37.212 1.00 206.93 ? 64  ARG I N     1 
ATOM   2703 C CA    . ARG G 4 25 ? -13.888 33.243  -37.133 1.00 220.14 ? 64  ARG I CA    1 
ATOM   2704 C C     . ARG G 4 25 ? -13.175 33.562  -38.468 1.00 239.35 ? 64  ARG I C     1 
ATOM   2705 O O     . ARG G 4 25 ? -13.693 34.357  -39.259 1.00 247.81 ? 64  ARG I O     1 
ATOM   2706 C CB    . ARG G 4 25 ? -12.925 33.211  -35.924 1.00 215.69 ? 64  ARG I CB    1 
ATOM   2707 C CG    . ARG G 4 25 ? -12.104 34.481  -35.736 1.00 216.13 ? 64  ARG I CG    1 
ATOM   2708 C CD    . ARG G 4 25 ? -12.831 35.519  -34.885 1.00 217.47 ? 64  ARG I CD    1 
ATOM   2709 N NE    . ARG G 4 25 ? -12.841 36.858  -35.473 1.00 214.44 ? 64  ARG I NE    1 
ATOM   2710 C CZ    . ARG G 4 25 ? -11.770 37.615  -35.720 1.00 216.14 ? 64  ARG I CZ    1 
ATOM   2711 N NH1   . ARG G 4 25 ? -10.540 37.206  -35.407 1.00 218.63 ? 64  ARG I NH1   1 
ATOM   2712 N NH2   . ARG G 4 25 ? -11.925 38.763  -36.371 1.00 214.35 ? 64  ARG I NH2   1 
ATOM   2713 N N     . LYS G 4 26 ? -12.015 32.938  -38.709 1.00 248.22 ? 65  LYS I N     1 
ATOM   2714 C CA    . LYS G 4 26 ? -11.166 33.187  -39.897 1.00 236.37 ? 65  LYS I CA    1 
ATOM   2715 C C     . LYS G 4 26 ? -10.634 34.636  -40.009 1.00 244.87 ? 65  LYS I C     1 
ATOM   2716 O O     . LYS G 4 26 ? -10.656 35.234  -41.089 1.00 263.50 ? 65  LYS I O     1 
ATOM   2717 C CB    . LYS G 4 26 ? -11.891 32.760  -41.189 1.00 208.17 ? 65  LYS I CB    1 
ATOM   2718 C CG    . LYS G 4 26 ? -10.965 32.530  -42.385 1.00 177.27 ? 65  LYS I CG    1 
ATOM   2719 C CD    . LYS G 4 26 ? -11.530 33.110  -43.678 1.00 160.14 ? 65  LYS I CD    1 
ATOM   2720 C CE    . LYS G 4 26 ? -10.554 34.071  -44.331 1.00 151.16 ? 65  LYS I CE    1 
ATOM   2721 N NZ    . LYS G 4 26 ? -11.227 34.861  -45.394 1.00 150.61 ? 65  LYS I NZ    1 
ATOM   2722 N N     . ILE G 4 27 ? -10.156 35.177  -38.886 1.00 236.67 ? 66  ILE I N     1 
ATOM   2723 C CA    . ILE G 4 27 ? -9.456  36.478  -38.816 1.00 232.78 ? 66  ILE I CA    1 
ATOM   2724 C C     . ILE G 4 27 ? -10.046 37.669  -39.635 1.00 238.05 ? 66  ILE I C     1 
ATOM   2725 O O     . ILE G 4 27 ? -9.305  38.551  -40.082 1.00 246.19 ? 66  ILE I O     1 
ATOM   2726 C CB    . ILE G 4 27 ? -7.914  36.240  -39.036 1.00 230.25 ? 66  ILE I CB    1 
ATOM   2727 C CG1   . ILE G 4 27 ? -7.040  37.294  -38.333 1.00 226.36 ? 66  ILE I CG1   1 
ATOM   2728 C CG2   . ILE G 4 27 ? -7.519  36.183  -40.513 1.00 227.17 ? 66  ILE I CG2   1 
ATOM   2729 C CD1   . ILE G 4 27 ? -7.408  37.607  -36.899 1.00 221.76 ? 66  ILE I CD1   1 
ATOM   2730 N N     . ILE G 4 28 ? -11.381 37.719  -39.772 1.00 235.75 ? 67  ILE I N     1 
ATOM   2731 C CA    . ILE G 4 28 ? -12.065 38.784  -40.561 1.00 227.47 ? 67  ILE I CA    1 
ATOM   2732 C C     . ILE G 4 28 ? -12.263 40.096  -39.767 1.00 235.52 ? 67  ILE I C     1 
ATOM   2733 O O     . ILE G 4 28 ? -13.390 40.469  -39.417 1.00 245.38 ? 67  ILE I O     1 
ATOM   2734 C CB    . ILE G 4 28 ? -13.407 38.314  -41.244 1.00 208.13 ? 67  ILE I CB    1 
ATOM   2735 C CG1   . ILE G 4 28 ? -14.464 37.775  -40.257 1.00 190.85 ? 67  ILE I CG1   1 
ATOM   2736 C CG2   . ILE G 4 28 ? -13.132 37.257  -42.306 1.00 207.67 ? 67  ILE I CG2   1 
ATOM   2737 C CD1   . ILE G 4 28 ? -15.876 37.801  -40.812 1.00 171.79 ? 67  ILE I CD1   1 
ATOM   2738 N N     . LEU G 4 29 ? -11.160 40.809  -39.523 1.00 233.88 ? 68  LEU I N     1 
ATOM   2739 C CA    . LEU G 4 29 ? -11.185 42.066  -38.748 1.00 231.74 ? 68  LEU I CA    1 
ATOM   2740 C C     . LEU G 4 29 ? -11.110 43.340  -39.621 1.00 240.04 ? 68  LEU I C     1 
ATOM   2741 O O     . LEU G 4 29 ? -11.074 44.449  -39.073 1.00 246.27 ? 68  LEU I O     1 
ATOM   2742 C CB    . LEU G 4 29 ? -10.063 42.105  -37.680 1.00 232.85 ? 68  LEU I CB    1 
ATOM   2743 C CG    . LEU G 4 29 ? -9.131  40.918  -37.380 1.00 227.21 ? 68  LEU I CG    1 
ATOM   2744 C CD1   . LEU G 4 29 ? -7.866  41.016  -38.221 1.00 224.53 ? 68  LEU I CD1   1 
ATOM   2745 C CD2   . LEU G 4 29 ? -8.791  40.851  -35.894 1.00 219.65 ? 68  LEU I CD2   1 
ATOM   2746 N N     . SER G 4 30 ? -11.120 43.196  -40.953 1.00 241.88 ? 69  SER I N     1 
ATOM   2747 C CA    . SER G 4 30 ? -10.868 44.320  -41.882 1.00 226.13 ? 69  SER I CA    1 
ATOM   2748 C C     . SER G 4 30 ? -12.141 45.059  -42.354 1.00 232.35 ? 69  SER I C     1 
ATOM   2749 O O     . SER G 4 30 ? -12.438 45.115  -43.555 1.00 226.63 ? 69  SER I O     1 
ATOM   2750 C CB    . SER G 4 30 ? -10.029 43.844  -43.082 1.00 204.57 ? 69  SER I CB    1 
ATOM   2751 O OG    . SER G 4 30 ? -10.687 42.833  -43.824 1.00 185.05 ? 69  SER I OG    1 
ATOM   2752 N N     . ASP G 4 31 ? -12.880 45.608  -41.386 1.00 241.57 ? 70  ASP I N     1 
ATOM   2753 C CA    . ASP G 4 31 ? -13.987 46.550  -41.628 1.00 237.08 ? 70  ASP I CA    1 
ATOM   2754 C C     . ASP G 4 31 ? -13.685 47.873  -40.912 1.00 234.95 ? 70  ASP I C     1 
ATOM   2755 O O     . ASP G 4 31 ? -13.660 48.927  -41.553 1.00 232.51 ? 70  ASP I O     1 
ATOM   2756 C CB    . ASP G 4 31 ? -15.332 45.966  -41.151 1.00 230.54 ? 70  ASP I CB    1 
ATOM   2757 C CG    . ASP G 4 31 ? -16.547 46.684  -41.752 1.00 214.27 ? 70  ASP I CG    1 
ATOM   2758 O OD1   . ASP G 4 31 ? -16.726 46.648  -42.990 1.00 192.10 ? 70  ASP I OD1   1 
ATOM   2759 O OD2   . ASP G 4 31 ? -17.341 47.264  -40.979 1.00 204.26 ? 70  ASP I OD2   1 
ATOM   2760 N N     . GLU G 4 32 ? -13.448 47.807  -39.595 1.00 229.90 ? 71  GLU I N     1 
ATOM   2761 C CA    . GLU G 4 32 ? -13.138 48.987  -38.773 1.00 222.50 ? 71  GLU I CA    1 
ATOM   2762 C C     . GLU G 4 32 ? -11.742 48.933  -38.145 1.00 215.55 ? 71  GLU I C     1 
ATOM   2763 O O     . GLU G 4 32 ? -11.111 47.873  -38.077 1.00 198.71 ? 71  GLU I O     1 
ATOM   2764 C CB    . GLU G 4 32 ? -14.191 49.166  -37.675 1.00 223.07 ? 71  GLU I CB    1 
ATOM   2765 C CG    . GLU G 4 32 ? -15.617 49.321  -38.200 1.00 224.25 ? 71  GLU I CG    1 
ATOM   2766 C CD    . GLU G 4 32 ? -16.032 50.773  -38.396 1.00 221.63 ? 71  GLU I CD    1 
ATOM   2767 O OE1   . GLU G 4 32 ? -15.882 51.584  -37.454 1.00 218.88 ? 71  GLU I OE1   1 
ATOM   2768 O OE2   . GLU G 4 32 ? -16.514 51.105  -39.502 1.00 218.50 ? 71  GLU I OE2   1 
ATOM   2769 N N     . GLY G 4 33 ? -11.286 50.094  -37.677 1.00 221.64 ? 72  GLY I N     1 
ATOM   2770 C CA    . GLY G 4 33 ? -9.934  50.269  -37.138 1.00 228.73 ? 72  GLY I CA    1 
ATOM   2771 C C     . GLY G 4 33 ? -9.661  49.746  -35.732 1.00 230.98 ? 72  GLY I C     1 
ATOM   2772 O O     . GLY G 4 33 ? -8.495  49.699  -35.320 1.00 220.14 ? 72  GLY I O     1 
ATOM   2773 N N     . LYS G 4 34 ? -10.717 49.377  -34.994 1.00 238.71 ? 73  LYS I N     1 
ATOM   2774 C CA    . LYS G 4 34 ? -10.596 48.820  -33.633 1.00 230.34 ? 73  LYS I CA    1 
ATOM   2775 C C     . LYS G 4 34 ? -11.430 47.522  -33.542 1.00 229.24 ? 73  LYS I C     1 
ATOM   2776 O O     . LYS G 4 34 ? -12.496 47.503  -32.913 1.00 224.12 ? 73  LYS I O     1 
ATOM   2777 C CB    . LYS G 4 34 ? -11.059 49.868  -32.601 1.00 215.55 ? 73  LYS I CB    1 
ATOM   2778 C CG    . LYS G 4 34 ? -9.923  50.651  -31.964 1.00 207.21 ? 73  LYS I CG    1 
ATOM   2779 C CD    . LYS G 4 34 ? -9.209  49.857  -30.880 1.00 198.28 ? 73  LYS I CD    1 
ATOM   2780 C CE    . LYS G 4 34 ? -8.072  50.666  -30.270 1.00 193.13 ? 73  LYS I CE    1 
ATOM   2781 N NZ    . LYS G 4 34 ? -8.083  50.619  -28.780 1.00 193.50 ? 73  LYS I NZ    1 
ATOM   2782 N N     . MET G 4 35 ? -10.930 46.450  -34.174 1.00 227.54 ? 74  MET I N     1 
ATOM   2783 C CA    . MET G 4 35 ? -11.699 45.199  -34.396 1.00 218.79 ? 74  MET I CA    1 
ATOM   2784 C C     . MET G 4 35 ? -10.995 43.958  -33.804 1.00 213.59 ? 74  MET I C     1 
ATOM   2785 O O     . MET G 4 35 ? -9.823  43.678  -34.110 1.00 180.18 ? 74  MET I O     1 
ATOM   2786 C CB    . MET G 4 35 ? -11.987 45.018  -35.903 1.00 208.09 ? 74  MET I CB    1 
ATOM   2787 C CG    . MET G 4 35 ? -13.292 44.290  -36.243 1.00 190.35 ? 74  MET I CG    1 
ATOM   2788 S SD    . MET G 4 35 ? -14.140 44.974  -37.687 1.00 170.03 ? 74  MET I SD    1 
ATOM   2789 C CE    . MET G 4 35 ? -15.434 43.764  -37.943 1.00 167.82 ? 74  MET I CE    1 
ATOM   2790 N N     . TYR G 4 36 ? -11.754 43.197  -33.005 1.00 217.73 ? 75  TYR I N     1 
ATOM   2791 C CA    . TYR G 4 36 ? -11.205 42.264  -32.003 1.00 208.06 ? 75  TYR I CA    1 
ATOM   2792 C C     . TYR G 4 36 ? -11.255 40.791  -32.454 1.00 183.56 ? 75  TYR I C     1 
ATOM   2793 O O     . TYR G 4 36 ? -12.298 40.310  -32.911 1.00 175.17 ? 75  TYR I O     1 
ATOM   2794 C CB    . TYR G 4 36 ? -11.938 42.393  -30.637 1.00 212.21 ? 75  TYR I CB    1 
ATOM   2795 C CG    . TYR G 4 36 ? -12.732 43.680  -30.382 1.00 216.26 ? 75  TYR I CG    1 
ATOM   2796 C CD1   . TYR G 4 36 ? -12.102 44.932  -30.345 1.00 225.75 ? 75  TYR I CD1   1 
ATOM   2797 C CD2   . TYR G 4 36 ? -14.113 43.638  -30.151 1.00 211.25 ? 75  TYR I CD2   1 
ATOM   2798 C CE1   . TYR G 4 36 ? -12.829 46.098  -30.106 1.00 225.97 ? 75  TYR I CE1   1 
ATOM   2799 C CE2   . TYR G 4 36 ? -14.845 44.798  -29.911 1.00 211.80 ? 75  TYR I CE2   1 
ATOM   2800 C CZ    . TYR G 4 36 ? -14.202 46.026  -29.890 1.00 220.61 ? 75  TYR I CZ    1 
ATOM   2801 O OH    . TYR G 4 36 ? -14.925 47.176  -29.655 1.00 222.62 ? 75  TYR I OH    1 
ATOM   2802 N N     . GLY G 4 37 ? -10.136 40.082  -32.289 1.00 159.16 ? 76  GLY I N     1 
ATOM   2803 C CA    . GLY G 4 37 ? -10.067 38.644  -32.543 1.00 143.81 ? 76  GLY I CA    1 
ATOM   2804 C C     . GLY G 4 37 ? -10.715 37.772  -31.474 1.00 133.24 ? 76  GLY I C     1 
ATOM   2805 O O     . GLY G 4 37 ? -10.988 38.227  -30.354 1.00 143.11 ? 76  GLY I O     1 
ATOM   2806 N N     . ARG G 4 38 ? -10.904 36.496  -31.814 1.00 119.03 ? 77  ARG I N     1 
ATOM   2807 C CA    . ARG G 4 38 ? -11.634 35.523  -30.971 1.00 114.87 ? 77  ARG I CA    1 
ATOM   2808 C C     . ARG G 4 38 ? -11.187 35.516  -29.495 1.00 118.97 ? 77  ARG I C     1 
ATOM   2809 O O     . ARG G 4 38 ? -12.022 35.629  -28.561 1.00 117.76 ? 77  ARG I O     1 
ATOM   2810 C CB    . ARG G 4 38 ? -11.506 34.101  -31.566 1.00 115.27 ? 77  ARG I CB    1 
ATOM   2811 C CG    . ARG G 4 38 ? -12.706 33.193  -31.313 1.00 109.26 ? 77  ARG I CG    1 
ATOM   2812 C CD    . ARG G 4 38 ? -12.701 32.584  -29.930 1.00 105.83 ? 77  ARG I CD    1 
ATOM   2813 N NE    . ARG G 4 38 ? -12.516 31.138  -29.953 1.00 107.57 ? 77  ARG I NE    1 
ATOM   2814 C CZ    . ARG G 4 38 ? -13.489 30.224  -29.932 1.00 108.86 ? 77  ARG I CZ    1 
ATOM   2815 N NH1   . ARG G 4 38 ? -14.783 30.561  -29.984 1.00 109.25 ? 77  ARG I NH1   1 
ATOM   2816 N NH2   . ARG G 4 38 ? -13.160 28.949  -29.785 1.00 115.28 ? 77  ARG I NH2   1 
ATOM   2817 N N     . ASN G 4 39 ? -9.873  35.397  -29.294 1.00 114.79 ? 78  ASN I N     1 
ATOM   2818 C CA    . ASN G 4 39 ? -9.307  35.370  -27.949 1.00 110.90 ? 78  ASN I CA    1 
ATOM   2819 C C     . ASN G 4 39 ? -9.654  36.673  -27.211 1.00 113.10 ? 78  ASN I C     1 
ATOM   2820 O O     . ASN G 4 39 ? -9.940  36.639  -26.022 1.00 119.43 ? 78  ASN I O     1 
ATOM   2821 C CB    . ASN G 4 39 ? -7.787  35.186  -27.976 1.00 113.35 ? 78  ASN I CB    1 
ATOM   2822 C CG    . ASN G 4 39 ? -7.351  33.790  -28.417 1.00 113.72 ? 78  ASN I CG    1 
ATOM   2823 O OD1   . ASN G 4 39 ? -8.118  32.806  -28.355 1.00 99.89  ? 78  ASN I OD1   1 
ATOM   2824 N ND2   . ASN G 4 39 ? -6.086  33.690  -28.834 1.00 104.16 ? 78  ASN I ND2   1 
ATOM   2825 N N     . GLU G 4 40 ? -9.657  37.807  -27.922 1.00 115.64 ? 79  GLU I N     1 
ATOM   2826 C CA    . GLU G 4 40 ? -9.954  39.115  -27.304 1.00 110.68 ? 79  GLU I CA    1 
ATOM   2827 C C     . GLU G 4 40 ? -11.446 39.201  -26.965 1.00 109.90 ? 79  GLU I C     1 
ATOM   2828 O O     . GLU G 4 40 ? -11.830 39.496  -25.812 1.00 120.56 ? 79  GLU I O     1 
ATOM   2829 C CB    . GLU G 4 40 ? -9.518  40.271  -28.215 1.00 108.04 ? 79  GLU I CB    1 
ATOM   2830 C CG    . GLU G 4 40 ? -8.039  40.223  -28.612 1.00 107.88 ? 79  GLU I CG    1 
ATOM   2831 C CD    . GLU G 4 40 ? -7.598  41.387  -29.494 1.00 108.01 ? 79  GLU I CD    1 
ATOM   2832 O OE1   . GLU G 4 40 ? -8.118  42.520  -29.346 1.00 109.29 ? 79  GLU I OE1   1 
ATOM   2833 O OE2   . GLU G 4 40 ? -6.715  41.168  -30.340 1.00 96.06  ? 79  GLU I OE2   1 
ATOM   2834 N N     . LEU G 4 41 ? -12.278 38.875  -27.952 1.00 111.47 ? 80  LEU I N     1 
ATOM   2835 C CA    . LEU G 4 41 ? -13.718 38.759  -27.723 1.00 118.44 ? 80  LEU I CA    1 
ATOM   2836 C C     . LEU G 4 41 ? -14.014 37.930  -26.489 1.00 122.21 ? 80  LEU I C     1 
ATOM   2837 O O     . LEU G 4 41 ? -14.792 38.378  -25.636 1.00 118.40 ? 80  LEU I O     1 
ATOM   2838 C CB    . LEU G 4 41 ? -14.484 38.139  -28.909 1.00 119.21 ? 80  LEU I CB    1 
ATOM   2839 C CG    . LEU G 4 41 ? -15.212 39.077  -29.875 1.00 110.80 ? 80  LEU I CG    1 
ATOM   2840 C CD1   . LEU G 4 41 ? -15.775 38.266  -31.046 1.00 113.51 ? 80  LEU I CD1   1 
ATOM   2841 C CD2   . LEU G 4 41 ? -16.299 39.857  -29.138 1.00 108.00 ? 80  LEU I CD2   1 
ATOM   2842 N N     . ILE G 4 42 ? -13.413 36.735  -26.390 1.00 128.13 ? 81  ILE I N     1 
ATOM   2843 C CA    . ILE G 4 42 ? -13.663 35.909  -25.191 1.00 141.36 ? 81  ILE I CA    1 
ATOM   2844 C C     . ILE G 4 42 ? -13.069 36.514  -23.908 1.00 140.92 ? 81  ILE I C     1 
ATOM   2845 O O     . ILE G 4 42 ? -13.586 36.251  -22.828 1.00 146.87 ? 81  ILE I O     1 
ATOM   2846 C CB    . ILE G 4 42 ? -13.285 34.404  -25.333 1.00 150.96 ? 81  ILE I CB    1 
ATOM   2847 C CG1   . ILE G 4 42 ? -11.780 34.192  -25.488 1.00 164.58 ? 81  ILE I CG1   1 
ATOM   2848 C CG2   . ILE G 4 42 ? -14.034 33.755  -26.493 1.00 150.59 ? 81  ILE I CG2   1 
ATOM   2849 C CD1   . ILE G 4 42 ? -11.378 32.733  -25.562 1.00 173.42 ? 81  ILE I CD1   1 
ATOM   2850 N N     . ALA G 4 43 ? -12.025 37.342  -24.026 1.00 131.61 ? 82  ALA I N     1 
ATOM   2851 C CA    . ALA G 4 43 ? -11.476 38.052  -22.862 1.00 125.90 ? 82  ALA I CA    1 
ATOM   2852 C C     . ALA G 4 43 ? -12.461 39.109  -22.342 1.00 136.05 ? 82  ALA I C     1 
ATOM   2853 O O     . ALA G 4 43 ? -12.774 39.174  -21.122 1.00 136.75 ? 82  ALA I O     1 
ATOM   2854 C CB    . ALA G 4 43 ? -10.141 38.697  -23.211 1.00 121.40 ? 82  ALA I CB    1 
ATOM   2855 N N     . ARG G 4 44 ? -12.950 39.926  -23.278 1.00 134.46 ? 83  ARG I N     1 
ATOM   2856 C CA    . ARG G 4 44 ? -13.899 40.991  -22.944 1.00 134.83 ? 83  ARG I CA    1 
ATOM   2857 C C     . ARG G 4 44 ? -15.174 40.465  -22.287 1.00 128.36 ? 83  ARG I C     1 
ATOM   2858 O O     . ARG G 4 44 ? -15.637 41.053  -21.298 1.00 144.88 ? 83  ARG I O     1 
ATOM   2859 C CB    . ARG G 4 44 ? -14.231 41.832  -24.176 1.00 138.25 ? 83  ARG I CB    1 
ATOM   2860 C CG    . ARG G 4 44 ? -13.062 42.692  -24.612 1.00 140.47 ? 83  ARG I CG    1 
ATOM   2861 C CD    . ARG G 4 44 ? -13.438 43.647  -25.726 1.00 139.94 ? 83  ARG I CD    1 
ATOM   2862 N NE    . ARG G 4 44 ? -12.324 44.548  -26.019 1.00 144.68 ? 83  ARG I NE    1 
ATOM   2863 C CZ    . ARG G 4 44 ? -11.985 45.625  -25.305 1.00 149.80 ? 83  ARG I CZ    1 
ATOM   2864 N NH1   . ARG G 4 44 ? -12.671 45.989  -24.218 1.00 160.99 ? 83  ARG I NH1   1 
ATOM   2865 N NH2   . ARG G 4 44 ? -10.938 46.355  -25.684 1.00 151.79 ? 83  ARG I NH2   1 
ATOM   2866 N N     . TYR G 4 45 ? -15.713 39.358  -22.814 1.00 112.71 ? 84  TYR I N     1 
ATOM   2867 C CA    . TYR G 4 45 ? -16.893 38.704  -22.233 1.00 121.38 ? 84  TYR I CA    1 
ATOM   2868 C C     . TYR G 4 45 ? -16.714 38.378  -20.743 1.00 145.10 ? 84  TYR I C     1 
ATOM   2869 O O     . TYR G 4 45 ? -17.617 38.648  -19.934 1.00 161.38 ? 84  TYR I O     1 
ATOM   2870 C CB    . TYR G 4 45 ? -17.251 37.420  -22.990 1.00 121.93 ? 84  TYR I CB    1 
ATOM   2871 C CG    . TYR G 4 45 ? -18.529 36.768  -22.499 1.00 128.67 ? 84  TYR I CG    1 
ATOM   2872 C CD1   . TYR G 4 45 ? -18.522 35.907  -21.402 1.00 135.24 ? 84  TYR I CD1   1 
ATOM   2873 C CD2   . TYR G 4 45 ? -19.750 37.022  -23.119 1.00 139.61 ? 84  TYR I CD2   1 
ATOM   2874 C CE1   . TYR G 4 45 ? -19.691 35.313  -20.938 1.00 143.97 ? 84  TYR I CE1   1 
ATOM   2875 C CE2   . TYR G 4 45 ? -20.927 36.429  -22.664 1.00 149.10 ? 84  TYR I CE2   1 
ATOM   2876 C CZ    . TYR G 4 45 ? -20.892 35.574  -21.569 1.00 147.54 ? 84  TYR I CZ    1 
ATOM   2877 O OH    . TYR G 4 45 ? -22.047 34.982  -21.101 1.00 140.95 ? 84  TYR I OH    1 
ATOM   2878 N N     . ILE G 4 46 ? -15.559 37.812  -20.382 1.00 154.77 ? 85  ILE I N     1 
ATOM   2879 C CA    . ILE G 4 46 ? -15.313 37.430  -18.982 1.00 153.96 ? 85  ILE I CA    1 
ATOM   2880 C C     . ILE G 4 46 ? -14.981 38.694  -18.180 1.00 152.53 ? 85  ILE I C     1 
ATOM   2881 O O     . ILE G 4 46 ? -15.379 38.798  -17.001 1.00 160.40 ? 85  ILE I O     1 
ATOM   2882 C CB    . ILE G 4 46 ? -14.203 36.361  -18.756 1.00 153.64 ? 85  ILE I CB    1 
ATOM   2883 C CG1   . ILE G 4 46 ? -14.094 35.318  -19.886 1.00 152.01 ? 85  ILE I CG1   1 
ATOM   2884 C CG2   . ILE G 4 46 ? -14.475 35.601  -17.465 1.00 143.84 ? 85  ILE I CG2   1 
ATOM   2885 C CD1   . ILE G 4 46 ? -12.653 35.069  -20.300 1.00 157.82 ? 85  ILE I CD1   1 
ATOM   2886 N N     . LYS G 4 47 ? -14.281 39.655  -18.805 1.00 143.75 ? 86  LYS I N     1 
ATOM   2887 C CA    . LYS G 4 47 ? -14.082 40.960  -18.156 1.00 148.31 ? 86  LYS I CA    1 
ATOM   2888 C C     . LYS G 4 47 ? -15.405 41.616  -17.756 1.00 145.18 ? 86  LYS I C     1 
ATOM   2889 O O     . LYS G 4 47 ? -15.527 42.117  -16.635 1.00 144.77 ? 86  LYS I O     1 
ATOM   2890 C CB    . LYS G 4 47 ? -13.265 41.935  -19.005 1.00 156.09 ? 86  LYS I CB    1 
ATOM   2891 C CG    . LYS G 4 47 ? -12.783 43.126  -18.182 1.00 169.94 ? 86  LYS I CG    1 
ATOM   2892 C CD    . LYS G 4 47 ? -12.154 44.228  -19.015 1.00 184.79 ? 86  LYS I CD    1 
ATOM   2893 C CE    . LYS G 4 47 ? -11.951 45.491  -18.183 1.00 186.91 ? 86  LYS I CE    1 
ATOM   2894 N NZ    . LYS G 4 47 ? -11.090 45.273  -16.983 1.00 189.99 ? 86  LYS I NZ    1 
ATOM   2895 N N     . LEU G 4 48 ? -16.390 41.586  -18.651 1.00 146.43 ? 87  LEU I N     1 
ATOM   2896 C CA    . LEU G 4 48 ? -17.704 42.191  -18.363 1.00 141.24 ? 87  LEU I CA    1 
ATOM   2897 C C     . LEU G 4 48 ? -18.723 41.266  -17.671 1.00 125.91 ? 87  LEU I C     1 
ATOM   2898 O O     . LEU G 4 48 ? -19.738 41.757  -17.196 1.00 130.05 ? 87  LEU I O     1 
ATOM   2899 C CB    . LEU G 4 48 ? -18.302 42.831  -19.625 1.00 145.44 ? 87  LEU I CB    1 
ATOM   2900 C CG    . LEU G 4 48 ? -17.774 44.243  -19.962 1.00 157.97 ? 87  LEU I CG    1 
ATOM   2901 C CD1   . LEU G 4 48 ? -18.399 45.304  -19.063 1.00 161.61 ? 87  LEU I CD1   1 
ATOM   2902 C CD2   . LEU G 4 48 ? -16.250 44.349  -19.924 1.00 156.88 ? 87  LEU I CD2   1 
ATOM   2903 N N     . ARG G 4 49 ? -18.479 39.955  -17.609 1.00 114.03 ? 88  ARG I N     1 
ATOM   2904 C CA    . ARG G 4 49 ? -19.263 39.090  -16.703 1.00 124.32 ? 88  ARG I CA    1 
ATOM   2905 C C     . ARG G 4 49 ? -18.723 39.149  -15.258 1.00 142.04 ? 88  ARG I C     1 
ATOM   2906 O O     . ARG G 4 49 ? -19.511 39.357  -14.328 1.00 149.94 ? 88  ARG I O     1 
ATOM   2907 C CB    . ARG G 4 49 ? -19.332 37.626  -17.184 1.00 125.69 ? 88  ARG I CB    1 
ATOM   2908 C CG    . ARG G 4 49 ? -20.411 37.289  -18.212 1.00 126.03 ? 88  ARG I CG    1 
ATOM   2909 C CD    . ARG G 4 49 ? -21.813 37.668  -17.763 1.00 137.29 ? 88  ARG I CD    1 
ATOM   2910 N NE    . ARG G 4 49 ? -22.095 37.272  -16.380 1.00 154.35 ? 88  ARG I NE    1 
ATOM   2911 C CZ    . ARG G 4 49 ? -22.333 36.027  -15.957 1.00 167.39 ? 88  ARG I CZ    1 
ATOM   2912 N NH1   . ARG G 4 49 ? -22.378 34.995  -16.803 1.00 173.28 ? 88  ARG I NH1   1 
ATOM   2913 N NH2   . ARG G 4 49 ? -22.563 35.812  -14.663 1.00 171.81 ? 88  ARG I NH2   1 
ATOM   2914 N N     . THR G 4 50 ? -17.404 38.969  -15.068 1.00 148.00 ? 89  THR I N     1 
ATOM   2915 C CA    . THR G 4 50 ? -16.813 38.890  -13.702 1.00 134.67 ? 89  THR I CA    1 
ATOM   2916 C C     . THR G 4 50 ? -16.211 40.192  -13.170 1.00 131.57 ? 89  THR I C     1 
ATOM   2917 O O     . THR G 4 50 ? -16.234 40.423  -11.960 1.00 119.65 ? 89  THR I O     1 
ATOM   2918 C CB    . THR G 4 50 ? -15.718 37.796  -13.580 1.00 133.96 ? 89  THR I CB    1 
ATOM   2919 O OG1   . THR G 4 50 ? -14.502 38.216  -14.230 1.00 127.85 ? 89  THR I OG1   1 
ATOM   2920 C CG2   . THR G 4 50 ? -16.207 36.472  -14.153 1.00 125.66 ? 89  THR I CG2   1 
ATOM   2921 N N     . GLY G 4 51 ? -15.655 41.018  -14.060 1.00 130.89 ? 90  GLY I N     1 
ATOM   2922 C CA    . GLY G 4 51 ? -14.892 42.203  -13.649 1.00 127.01 ? 90  GLY I CA    1 
ATOM   2923 C C     . GLY G 4 51 ? -13.387 42.035  -13.770 1.00 126.57 ? 90  GLY I C     1 
ATOM   2924 O O     . GLY G 4 51 ? -12.671 43.039  -13.843 1.00 113.01 ? 90  GLY I O     1 
ATOM   2925 N N     . LYS G 4 52 ? -12.903 40.785  -13.805 1.00 134.01 ? 91  LYS I N     1 
ATOM   2926 C CA    . LYS G 4 52 ? -11.450 40.501  -13.819 1.00 147.69 ? 91  LYS I CA    1 
ATOM   2927 C C     . LYS G 4 52 ? -10.829 40.560  -15.230 1.00 144.23 ? 91  LYS I C     1 
ATOM   2928 O O     . LYS G 4 52 ? -11.488 40.231  -16.219 1.00 139.25 ? 91  LYS I O     1 
ATOM   2929 C CB    . LYS G 4 52 ? -11.128 39.142  -13.151 1.00 149.44 ? 91  LYS I CB    1 
ATOM   2930 C CG    . LYS G 4 52 ? -10.511 39.223  -11.745 1.00 145.32 ? 91  LYS I CG    1 
ATOM   2931 C CD    . LYS G 4 52 ? -9.093  38.647  -11.698 1.00 132.11 ? 91  LYS I CD    1 
ATOM   2932 C CE    . LYS G 4 52 ? -8.663  38.261  -10.290 1.00 118.32 ? 91  LYS I CE    1 
ATOM   2933 N NZ    . LYS G 4 52 ? -7.183  38.312  -10.105 1.00 116.38 ? 91  LYS I NZ    1 
ATOM   2934 N N     . THR G 4 53 ? -9.553  40.957  -15.293 1.00 138.31 ? 92  THR I N     1 
ATOM   2935 C CA    . THR G 4 53 ? -8.859  41.219  -16.571 1.00 139.11 ? 92  THR I CA    1 
ATOM   2936 C C     . THR G 4 53 ? -8.720  39.990  -17.507 1.00 144.71 ? 92  THR I C     1 
ATOM   2937 O O     . THR G 4 53 ? -9.452  39.921  -18.497 1.00 171.90 ? 92  THR I O     1 
ATOM   2938 C CB    . THR G 4 53 ? -7.513  41.996  -16.388 1.00 141.08 ? 92  THR I CB    1 
ATOM   2939 O OG1   . THR G 4 53 ? -6.933  42.285  -17.667 1.00 123.50 ? 92  THR I OG1   1 
ATOM   2940 C CG2   . THR G 4 53 ? -6.477  41.239  -15.535 1.00 154.03 ? 92  THR I CG2   1 
ATOM   2941 N N     . ARG G 4 54 ? -7.862  39.015  -17.184 1.00 128.16 ? 93  ARG I N     1 
ATOM   2942 C CA    . ARG G 4 54 ? -7.490  37.931  -18.113 1.00 119.86 ? 93  ARG I CA    1 
ATOM   2943 C C     . ARG G 4 54 ? -7.025  38.443  -19.487 1.00 125.07 ? 93  ARG I C     1 
ATOM   2944 O O     . ARG G 4 54 ? -7.846  38.721  -20.356 1.00 123.99 ? 93  ARG I O     1 
ATOM   2945 C CB    . ARG G 4 54 ? -8.629  36.900  -18.282 1.00 117.89 ? 93  ARG I CB    1 
ATOM   2946 C CG    . ARG G 4 54 ? -8.505  35.667  -17.385 1.00 130.66 ? 93  ARG I CG    1 
ATOM   2947 C CD    . ARG G 4 54 ? -9.122  34.389  -17.986 1.00 137.08 ? 93  ARG I CD    1 
ATOM   2948 N NE    . ARG G 4 54 ? -8.176  33.255  -18.014 1.00 134.54 ? 93  ARG I NE    1 
ATOM   2949 C CZ    . ARG G 4 54 ? -8.496  31.955  -18.088 1.00 123.42 ? 93  ARG I CZ    1 
ATOM   2950 N NH1   . ARG G 4 54 ? -9.766  31.535  -18.133 1.00 109.69 ? 93  ARG I NH1   1 
ATOM   2951 N NH2   . ARG G 4 54 ? -7.516  31.056  -18.097 1.00 118.71 ? 93  ARG I NH2   1 
ATOM   2952 N N     . THR G 4 55 ? -5.709  38.552  -19.681 1.00 132.11 ? 94  THR I N     1 
ATOM   2953 C CA    . THR G 4 55 ? -5.144  39.001  -20.963 1.00 125.19 ? 94  THR I CA    1 
ATOM   2954 C C     . THR G 4 55 ? -5.393  37.935  -22.010 1.00 119.96 ? 94  THR I C     1 
ATOM   2955 O O     . THR G 4 55 ? -5.478  36.749  -21.688 1.00 116.81 ? 94  THR I O     1 
ATOM   2956 C CB    . THR G 4 55 ? -3.613  39.277  -20.908 1.00 131.21 ? 94  THR I CB    1 
ATOM   2957 O OG1   . THR G 4 55 ? -2.882  38.043  -20.892 1.00 117.88 ? 94  THR I OG1   1 
ATOM   2958 C CG2   . THR G 4 55 ? -3.221  40.129  -19.685 1.00 133.84 ? 94  THR I CG2   1 
ATOM   2959 N N     . ARG G 4 56 ? -5.474  38.346  -23.266 1.00 122.04 ? 95  ARG I N     1 
ATOM   2960 C CA    . ARG G 4 56 ? -5.714  37.389  -24.343 1.00 128.60 ? 95  ARG I CA    1 
ATOM   2961 C C     . ARG G 4 56 ? -4.713  36.202  -24.321 1.00 133.26 ? 95  ARG I C     1 
ATOM   2962 O O     . ARG G 4 56 ? -5.095  35.024  -24.502 1.00 135.20 ? 95  ARG I O     1 
ATOM   2963 C CB    . ARG G 4 56 ? -5.743  38.107  -25.694 1.00 129.95 ? 95  ARG I CB    1 
ATOM   2964 C CG    . ARG G 4 56 ? -4.425  38.712  -26.157 1.00 127.63 ? 95  ARG I CG    1 
ATOM   2965 C CD    . ARG G 4 56 ? -3.744  37.840  -27.202 1.00 135.81 ? 95  ARG I CD    1 
ATOM   2966 N NE    . ARG G 4 56 ? -2.893  38.617  -28.105 1.00 139.90 ? 95  ARG I NE    1 
ATOM   2967 C CZ    . ARG G 4 56 ? -2.343  38.166  -29.238 1.00 136.92 ? 95  ARG I CZ    1 
ATOM   2968 N NH1   . ARG G 4 56 ? -2.573  36.927  -29.687 1.00 135.07 ? 95  ARG I NH1   1 
ATOM   2969 N NH2   . ARG G 4 56 ? -1.486  38.940  -29.897 1.00 139.50 ? 95  ARG I NH2   1 
ATOM   2970 N N     . LYS G 4 57 ? -3.450  36.499  -24.013 1.00 119.54 ? 96  LYS I N     1 
ATOM   2971 C CA    . LYS G 4 57 ? -2.428  35.459  -23.948 1.00 104.03 ? 96  LYS I CA    1 
ATOM   2972 C C     . LYS G 4 57 ? -2.666  34.464  -22.800 1.00 105.76 ? 96  LYS I C     1 
ATOM   2973 O O     . LYS G 4 57 ? -2.165  33.340  -22.851 1.00 119.36 ? 96  LYS I O     1 
ATOM   2974 C CB    . LYS G 4 57 ? -1.042  36.077  -23.843 1.00 104.71 ? 96  LYS I CB    1 
ATOM   2975 C CG    . LYS G 4 57 ? -0.496  36.595  -25.165 1.00 114.28 ? 96  LYS I CG    1 
ATOM   2976 C CD    . LYS G 4 57 ? -0.019  35.503  -26.125 1.00 117.86 ? 96  LYS I CD    1 
ATOM   2977 C CE    . LYS G 4 57 ? 0.418   36.123  -27.451 1.00 121.98 ? 96  LYS I CE    1 
ATOM   2978 N NZ    . LYS G 4 57 ? 0.601   35.145  -28.556 1.00 123.24 ? 96  LYS I NZ    1 
ATOM   2979 N N     . GLN G 4 58 ? -3.417  34.852  -21.769 1.00 115.86 ? 97  GLN I N     1 
ATOM   2980 C CA    . GLN G 4 58 ? -3.858  33.871  -20.770 1.00 121.92 ? 97  GLN I CA    1 
ATOM   2981 C C     . GLN G 4 58 ? -4.810  32.908  -21.454 1.00 121.80 ? 97  GLN I C     1 
ATOM   2982 O O     . GLN G 4 58 ? -4.709  31.687  -21.257 1.00 133.24 ? 97  GLN I O     1 
ATOM   2983 C CB    . GLN G 4 58 ? -4.563  34.506  -19.554 1.00 133.48 ? 97  GLN I CB    1 
ATOM   2984 C CG    . GLN G 4 58 ? -3.727  35.491  -18.728 1.00 138.99 ? 97  GLN I CG    1 
ATOM   2985 C CD    . GLN G 4 58 ? -4.359  35.872  -17.383 1.00 140.82 ? 97  GLN I CD    1 
ATOM   2986 O OE1   . GLN G 4 58 ? -5.042  35.066  -16.744 1.00 135.03 ? 97  GLN I OE1   1 
ATOM   2987 N NE2   . GLN G 4 58 ? -4.116  37.109  -16.943 1.00 139.87 ? 97  GLN I NE2   1 
ATOM   2988 N N     . VAL G 4 59 ? -5.724  33.454  -22.268 1.00 117.29 ? 98  VAL I N     1 
ATOM   2989 C CA    . VAL G 4 59 ? -6.724  32.609  -22.922 1.00 109.91 ? 98  VAL I CA    1 
ATOM   2990 C C     . VAL G 4 59 ? -6.129  31.749  -24.040 1.00 98.89  ? 98  VAL I C     1 
ATOM   2991 O O     . VAL G 4 59 ? -6.550  30.617  -24.170 1.00 92.36  ? 98  VAL I O     1 
ATOM   2992 C CB    . VAL G 4 59 ? -8.029  33.344  -23.339 1.00 113.78 ? 98  VAL I CB    1 
ATOM   2993 C CG1   . VAL G 4 59 ? -8.697  33.968  -22.123 1.00 121.63 ? 98  VAL I CG1   1 
ATOM   2994 C CG2   . VAL G 4 59 ? -7.813  34.396  -24.405 1.00 115.54 ? 98  VAL I CG2   1 
ATOM   2995 N N     . SER G 4 60 ? -5.137  32.236  -24.797 1.00 83.83  ? 99  SER I N     1 
ATOM   2996 C CA    . SER G 4 60 ? -4.391  31.333  -25.711 1.00 88.59  ? 99  SER I CA    1 
ATOM   2997 C C     . SER G 4 60 ? -3.958  30.024  -25.000 1.00 99.03  ? 99  SER I C     1 
ATOM   2998 O O     . SER G 4 60 ? -4.330  28.867  -25.415 1.00 97.56  ? 99  SER I O     1 
ATOM   2999 C CB    . SER G 4 60 ? -3.151  32.034  -26.281 1.00 86.27  ? 99  SER I CB    1 
ATOM   3000 O OG    . SER G 4 60 ? -3.497  33.263  -26.887 1.00 92.48  ? 99  SER I OG    1 
ATOM   3001 N N     . SER G 4 61 ? -3.207  30.244  -23.909 1.00 96.21  ? 100 SER I N     1 
ATOM   3002 C CA    . SER G 4 61 ? -2.699  29.186  -23.042 1.00 104.93 ? 100 SER I CA    1 
ATOM   3003 C C     . SER G 4 61 ? -3.835  28.343  -22.499 1.00 109.66 ? 100 SER I C     1 
ATOM   3004 O O     . SER G 4 61 ? -3.754  27.111  -22.510 1.00 113.29 ? 100 SER I O     1 
ATOM   3005 C CB    . SER G 4 61 ? -1.883  29.760  -21.870 1.00 112.55 ? 100 SER I CB    1 
ATOM   3006 O OG    . SER G 4 61 ? -1.686  28.797  -20.824 1.00 115.17 ? 100 SER I OG    1 
ATOM   3007 N N     . HIS G 4 62 ? -4.895  29.000  -22.034 1.00 114.67 ? 101 HIS I N     1 
ATOM   3008 C CA    . HIS G 4 62 ? -6.045  28.261  -21.497 1.00 115.12 ? 101 HIS I CA    1 
ATOM   3009 C C     . HIS G 4 62 ? -6.767  27.404  -22.548 1.00 105.27 ? 101 HIS I C     1 
ATOM   3010 O O     . HIS G 4 62 ? -7.288  26.337  -22.209 1.00 88.58  ? 101 HIS I O     1 
ATOM   3011 C CB    . HIS G 4 62 ? -7.035  29.194  -20.786 1.00 111.62 ? 101 HIS I CB    1 
ATOM   3012 C CG    . HIS G 4 62 ? -8.025  28.473  -19.925 1.00 106.13 ? 101 HIS I CG    1 
ATOM   3013 N ND1   . HIS G 4 62 ? -7.675  27.427  -19.099 1.00 111.23 ? 101 HIS I ND1   1 
ATOM   3014 C CD2   . HIS G 4 62 ? -9.350  28.669  -19.740 1.00 107.18 ? 101 HIS I CD2   1 
ATOM   3015 C CE1   . HIS G 4 62 ? -8.744  27.001  -18.453 1.00 112.98 ? 101 HIS I CE1   1 
ATOM   3016 N NE2   . HIS G 4 62 ? -9.774  27.740  -18.823 1.00 110.33 ? 101 HIS I NE2   1 
ATOM   3017 N N     . ILE G 4 63 ? -6.788  27.853  -23.807 1.00 104.77 ? 102 ILE I N     1 
ATOM   3018 C CA    . ILE G 4 63 ? -7.379  27.045  -24.876 1.00 110.81 ? 102 ILE I CA    1 
ATOM   3019 C C     . ILE G 4 63 ? -6.431  25.873  -25.000 1.00 102.58 ? 102 ILE I C     1 
ATOM   3020 O O     . ILE G 4 63 ? -6.838  24.718  -24.777 1.00 98.58  ? 102 ILE I O     1 
ATOM   3021 C CB    . ILE G 4 63 ? -7.574  27.762  -26.251 1.00 111.94 ? 102 ILE I CB    1 
ATOM   3022 C CG1   . ILE G 4 63 ? -8.159  29.178  -26.075 1.00 112.90 ? 102 ILE I CG1   1 
ATOM   3023 C CG2   . ILE G 4 63 ? -8.469  26.907  -27.152 1.00 110.66 ? 102 ILE I CG2   1 
ATOM   3024 C CD1   . ILE G 4 63 ? -8.884  29.798  -27.253 1.00 109.88 ? 102 ILE I CD1   1 
ATOM   3025 N N     . GLN G 4 64 ? -5.158  26.184  -25.266 1.00 102.47 ? 103 GLN I N     1 
ATOM   3026 C CA    . GLN G 4 64 ? -4.130  25.116  -25.373 1.00 105.23 ? 103 GLN I CA    1 
ATOM   3027 C C     . GLN G 4 64 ? -4.275  24.020  -24.296 1.00 100.07 ? 103 GLN I C     1 
ATOM   3028 O O     . GLN G 4 64 ? -4.257  22.805  -24.610 1.00 91.94  ? 103 GLN I O     1 
ATOM   3029 C CB    . GLN G 4 64 ? -2.712  25.709  -25.334 1.00 105.58 ? 103 GLN I CB    1 
ATOM   3030 C CG    . GLN G 4 64 ? -1.645  24.827  -25.957 1.00 102.24 ? 103 GLN I CG    1 
ATOM   3031 C CD    . GLN G 4 64 ? -0.343  25.579  -26.200 1.00 106.82 ? 103 GLN I CD    1 
ATOM   3032 O OE1   . GLN G 4 64 ? 0.116   26.344  -25.350 1.00 106.60 ? 103 GLN I OE1   1 
ATOM   3033 N NE2   . GLN G 4 64 ? 0.262   25.361  -27.361 1.00 112.89 ? 103 GLN I NE2   1 
ATOM   3034 N N     . VAL G 4 65 ? -4.463  24.454  -23.044 1.00 101.28 ? 104 VAL I N     1 
ATOM   3035 C CA    . VAL G 4 65 ? -4.619  23.518  -21.927 1.00 111.49 ? 104 VAL I CA    1 
ATOM   3036 C C     . VAL G 4 65 ? -5.816  22.622  -22.204 1.00 117.97 ? 104 VAL I C     1 
ATOM   3037 O O     . VAL G 4 65 ? -5.658  21.407  -22.257 1.00 114.54 ? 104 VAL I O     1 
ATOM   3038 C CB    . VAL G 4 65 ? -4.804  24.202  -20.537 1.00 122.12 ? 104 VAL I CB    1 
ATOM   3039 C CG1   . VAL G 4 65 ? -4.944  23.161  -19.420 1.00 119.81 ? 104 VAL I CG1   1 
ATOM   3040 C CG2   . VAL G 4 65 ? -3.662  25.175  -20.211 1.00 128.83 ? 104 VAL I CG2   1 
ATOM   3041 N N     . LEU G 4 66 ? -6.995  23.217  -22.414 1.00 131.06 ? 105 LEU I N     1 
ATOM   3042 C CA    . LEU G 4 66 ? -8.240  22.428  -22.486 1.00 123.35 ? 105 LEU I CA    1 
ATOM   3043 C C     . LEU G 4 66 ? -8.213  21.514  -23.700 1.00 122.06 ? 105 LEU I C     1 
ATOM   3044 O O     . LEU G 4 66 ? -8.627  20.345  -23.619 1.00 123.63 ? 105 LEU I O     1 
ATOM   3045 C CB    . LEU G 4 66 ? -9.483  23.322  -22.513 1.00 125.07 ? 105 LEU I CB    1 
ATOM   3046 C CG    . LEU G 4 66 ? -9.751  24.290  -21.344 1.00 136.71 ? 105 LEU I CG    1 
ATOM   3047 C CD1   . LEU G 4 66 ? -11.235 24.624  -21.257 1.00 141.75 ? 105 LEU I CD1   1 
ATOM   3048 C CD2   . LEU G 4 66 ? -9.266  23.769  -19.994 1.00 144.86 ? 105 LEU I CD2   1 
ATOM   3049 N N     . ALA G 4 67 ? -7.698  22.052  -24.809 1.00 114.53 ? 106 ALA I N     1 
ATOM   3050 C CA    . ALA G 4 67 ? -7.409  21.270  -25.997 1.00 110.03 ? 106 ALA I CA    1 
ATOM   3051 C C     . ALA G 4 67 ? -6.526  20.067  -25.674 1.00 122.31 ? 106 ALA I C     1 
ATOM   3052 O O     . ALA G 4 67 ? -6.853  18.948  -26.083 1.00 124.30 ? 106 ALA I O     1 
ATOM   3053 C CB    . ALA G 4 67 ? -6.754  22.134  -27.049 1.00 109.12 ? 106 ALA I CB    1 
ATOM   3054 N N     . ARG G 4 68 ? -5.433  20.278  -24.933 1.00 139.11 ? 107 ARG I N     1 
ATOM   3055 C CA    . ARG G 4 68 ? -4.586  19.130  -24.517 1.00 154.92 ? 107 ARG I CA    1 
ATOM   3056 C C     . ARG G 4 68 ? -5.313  18.139  -23.566 1.00 153.86 ? 107 ARG I C     1 
ATOM   3057 O O     . ARG G 4 68 ? -5.394  16.950  -23.884 1.00 163.40 ? 107 ARG I O     1 
ATOM   3058 C CB    . ARG G 4 68 ? -3.225  19.581  -23.945 1.00 166.76 ? 107 ARG I CB    1 
ATOM   3059 C CG    . ARG G 4 68 ? -2.080  19.648  -24.970 1.00 172.74 ? 107 ARG I CG    1 
ATOM   3060 C CD    . ARG G 4 68 ? -1.178  18.403  -24.995 1.00 175.37 ? 107 ARG I CD    1 
ATOM   3061 N NE    . ARG G 4 68 ? -1.624  17.328  -25.898 1.00 172.60 ? 107 ARG I NE    1 
ATOM   3062 C CZ    . ARG G 4 68 ? -1.014  16.143  -26.051 1.00 160.90 ? 107 ARG I CZ    1 
ATOM   3063 N NH1   . ARG G 4 68 ? 0.086   15.837  -25.358 1.00 160.18 ? 107 ARG I NH1   1 
ATOM   3064 N NH2   . ARG G 4 68 ? -1.507  15.246  -26.904 1.00 149.47 ? 107 ARG I NH2   1 
ATOM   3065 N N     . ARG G 4 69 ? -5.857  18.623  -22.443 1.00 148.91 ? 108 ARG I N     1 
ATOM   3066 C CA    . ARG G 4 69 ? -6.647  17.793  -21.493 1.00 146.44 ? 108 ARG I CA    1 
ATOM   3067 C C     . ARG G 4 69 ? -7.725  16.964  -22.179 1.00 160.24 ? 108 ARG I C     1 
ATOM   3068 O O     . ARG G 4 69 ? -7.907  15.788  -21.850 1.00 164.56 ? 108 ARG I O     1 
ATOM   3069 C CB    . ARG G 4 69 ? -7.326  18.656  -20.420 1.00 136.62 ? 108 ARG I CB    1 
ATOM   3070 C CG    . ARG G 4 69 ? -6.382  19.134  -19.340 1.00 142.84 ? 108 ARG I CG    1 
ATOM   3071 C CD    . ARG G 4 69 ? -6.881  20.378  -18.629 1.00 140.01 ? 108 ARG I CD    1 
ATOM   3072 N NE    . ARG G 4 69 ? -7.771  20.080  -17.518 1.00 140.29 ? 108 ARG I NE    1 
ATOM   3073 C CZ    . ARG G 4 69 ? -8.157  20.966  -16.596 1.00 146.67 ? 108 ARG I CZ    1 
ATOM   3074 N NH1   . ARG G 4 69 ? -7.743  22.236  -16.633 1.00 137.98 ? 108 ARG I NH1   1 
ATOM   3075 N NH2   . ARG G 4 69 ? -8.972  20.576  -15.619 1.00 157.30 ? 108 ARG I NH2   1 
ATOM   3076 N N     . LYS G 4 70 ? -8.448  17.594  -23.112 1.00 166.72 ? 109 LYS I N     1 
ATOM   3077 C CA    . LYS G 4 70 ? -9.427  16.883  -23.938 1.00 152.83 ? 109 LYS I CA    1 
ATOM   3078 C C     . LYS G 4 70 ? -8.765  15.787  -24.781 1.00 146.37 ? 109 LYS I C     1 
ATOM   3079 O O     . LYS G 4 70 ? -9.293  14.673  -24.865 1.00 145.23 ? 109 LYS I O     1 
ATOM   3080 C CB    . LYS G 4 70 ? -10.195 17.855  -24.844 1.00 156.20 ? 109 LYS I CB    1 
ATOM   3081 C CG    . LYS G 4 70 ? -11.104 17.167  -25.857 1.00 163.08 ? 109 LYS I CG    1 
ATOM   3082 C CD    . LYS G 4 70 ? -12.193 18.079  -26.392 1.00 165.25 ? 109 LYS I CD    1 
ATOM   3083 C CE    . LYS G 4 70 ? -13.114 17.310  -27.328 1.00 165.93 ? 109 LYS I CE    1 
ATOM   3084 N NZ    . LYS G 4 70 ? -14.074 18.189  -28.052 1.00 167.96 ? 109 LYS I NZ    1 
ATOM   3085 N N     . ALA G 4 71 ? -7.606  16.088  -25.370 1.00 132.47 ? 110 ALA I N     1 
ATOM   3086 C CA    . ALA G 4 71 ? -6.936  15.170  -26.302 1.00 134.40 ? 110 ALA I CA    1 
ATOM   3087 C C     . ALA G 4 71 ? -6.304  13.916  -25.665 1.00 142.86 ? 110 ALA I C     1 
ATOM   3088 O O     . ALA G 4 71 ? -5.209  13.509  -26.077 1.00 136.66 ? 110 ALA I O     1 
ATOM   3089 C CB    . ALA G 4 71 ? -5.901  15.924  -27.139 1.00 128.98 ? 110 ALA I CB    1 
ATOM   3090 N N     . ARG G 4 72 ? -6.989  13.310  -24.682 1.00 156.59 ? 111 ARG I N     1 
ATOM   3091 C CA    . ARG G 4 72 ? -6.705  11.937  -24.216 1.00 168.91 ? 111 ARG I CA    1 
ATOM   3092 C C     . ARG G 4 72 ? -7.842  10.985  -24.641 1.00 178.19 ? 111 ARG I C     1 
ATOM   3093 O O     . ARG G 4 72 ? -9.012  11.220  -24.312 1.00 187.29 ? 111 ARG I O     1 
ATOM   3094 C CB    . ARG G 4 72 ? -6.470  11.864  -22.690 1.00 166.77 ? 111 ARG I CB    1 
ATOM   3095 C CG    . ARG G 4 72 ? -7.583  12.397  -21.781 1.00 166.39 ? 111 ARG I CG    1 
ATOM   3096 C CD    . ARG G 4 72 ? -7.938  11.436  -20.646 1.00 160.88 ? 111 ARG I CD    1 
ATOM   3097 N NE    . ARG G 4 72 ? -8.783  10.324  -21.099 1.00 160.11 ? 111 ARG I NE    1 
ATOM   3098 C CZ    . ARG G 4 72 ? -10.088 10.404  -21.389 1.00 154.04 ? 111 ARG I CZ    1 
ATOM   3099 N NH1   . ARG G 4 72 ? -10.757 11.558  -21.293 1.00 152.12 ? 111 ARG I NH1   1 
ATOM   3100 N NH2   . ARG G 4 72 ? -10.736 9.311   -21.793 1.00 143.98 ? 111 ARG I NH2   1 
ATOM   3101 N N     . GLU G 4 73 ? -7.488  9.937   -25.396 1.00 174.97 ? 112 GLU I N     1 
ATOM   3102 C CA    . GLU G 4 73 ? -8.430  8.906   -25.870 1.00 166.98 ? 112 GLU I CA    1 
ATOM   3103 C C     . GLU G 4 73 ? -9.637  9.445   -26.652 1.00 166.04 ? 112 GLU I C     1 
ATOM   3104 O O     . GLU G 4 73 ? -9.689  10.615  -27.040 1.00 159.74 ? 112 GLU I O     1 
ATOM   3105 C CB    . GLU G 4 73 ? -8.927  8.050   -24.700 1.00 168.91 ? 112 GLU I CB    1 
ATOM   3106 C CG    . GLU G 4 73 ? -7.836  7.289   -23.960 1.00 167.09 ? 112 GLU I CG    1 
ATOM   3107 C CD    . GLU G 4 73 ? -8.373  6.558   -22.743 1.00 161.63 ? 112 GLU I CD    1 
ATOM   3108 O OE1   . GLU G 4 73 ? -8.860  7.235   -21.814 1.00 150.29 ? 112 GLU I OE1   1 
ATOM   3109 O OE2   . GLU G 4 73 ? -8.314  5.311   -22.714 1.00 159.89 ? 112 GLU I OE2   1 
ATOM   3110 N N     . GLU H 4 1  ? 22.571  -27.780 11.360  1.00 193.35 ? 40  GLU N N     1 
ATOM   3111 C CA    . GLU H 4 1  ? 23.738  -27.943 12.219  1.00 184.00 ? 40  GLU N CA    1 
ATOM   3112 C C     . GLU H 4 1  ? 24.910  -27.103 11.721  1.00 173.07 ? 40  GLU N C     1 
ATOM   3113 O O     . GLU H 4 1  ? 24.985  -26.763 10.541  1.00 167.51 ? 40  GLU N O     1 
ATOM   3114 C CB    . GLU H 4 1  ? 24.143  -29.416 12.299  1.00 183.17 ? 40  GLU N CB    1 
ATOM   3115 C CG    . GLU H 4 1  ? 23.048  -30.385 11.885  1.00 184.70 ? 40  GLU N CG    1 
ATOM   3116 C CD    . GLU H 4 1  ? 22.060  -30.659 13.002  1.00 187.55 ? 40  GLU N CD    1 
ATOM   3117 O OE1   . GLU H 4 1  ? 20.888  -30.246 12.875  1.00 195.04 ? 40  GLU N OE1   1 
ATOM   3118 O OE2   . GLU H 4 1  ? 22.455  -31.288 14.006  1.00 184.10 ? 40  GLU N OE2   1 
ATOM   3119 N N     . GLY H 4 2  ? 25.822  -26.772 12.630  1.00 162.31 ? 41  GLY N N     1 
ATOM   3120 C CA    . GLY H 4 2  ? 26.985  -25.975 12.287  1.00 157.91 ? 41  GLY N CA    1 
ATOM   3121 C C     . GLY H 4 2  ? 28.286  -26.655 12.666  1.00 161.31 ? 41  GLY N C     1 
ATOM   3122 O O     . GLY H 4 2  ? 28.403  -27.878 12.592  1.00 166.69 ? 41  GLY N O     1 
ATOM   3123 N N     . VAL H 4 3  ? 29.268  -25.856 13.073  1.00 159.63 ? 42  VAL N N     1 
ATOM   3124 C CA    . VAL H 4 3  ? 30.569  -26.382 13.466  1.00 149.11 ? 42  VAL N CA    1 
ATOM   3125 C C     . VAL H 4 3  ? 30.455  -27.274 14.698  1.00 136.55 ? 42  VAL N C     1 
ATOM   3126 O O     . VAL H 4 3  ? 30.886  -28.427 14.684  1.00 91.30  ? 42  VAL N O     1 
ATOM   3127 C CB    . VAL H 4 3  ? 31.571  -25.249 13.756  1.00 157.81 ? 42  VAL N CB    1 
ATOM   3128 C CG1   . VAL H 4 3  ? 32.376  -24.922 12.507  1.00 154.77 ? 42  VAL N CG1   1 
ATOM   3129 C CG2   . VAL H 4 3  ? 30.843  -24.015 14.267  1.00 153.85 ? 42  VAL N CG2   1 
ATOM   3130 N N     . TRP H 4 4  ? 29.871  -26.732 15.762  1.00 137.21 ? 43  TRP N N     1 
ATOM   3131 C CA    . TRP H 4 4  ? 29.698  -27.478 17.003  1.00 134.55 ? 43  TRP N CA    1 
ATOM   3132 C C     . TRP H 4 4  ? 28.454  -28.358 16.947  1.00 148.97 ? 43  TRP N C     1 
ATOM   3133 O O     . TRP H 4 4  ? 27.460  -28.089 17.622  1.00 165.57 ? 43  TRP N O     1 
ATOM   3134 C CB    . TRP H 4 4  ? 29.612  -26.522 18.195  1.00 127.67 ? 43  TRP N CB    1 
ATOM   3135 C CG    . TRP H 4 4  ? 30.907  -25.836 18.508  1.00 118.23 ? 43  TRP N CG    1 
ATOM   3136 C CD1   . TRP H 4 4  ? 31.377  -24.681 17.955  1.00 111.93 ? 43  TRP N CD1   1 
ATOM   3137 C CD2   . TRP H 4 4  ? 31.898  -26.262 19.450  1.00 116.39 ? 43  TRP N CD2   1 
ATOM   3138 N NE1   . TRP H 4 4  ? 32.600  -24.361 18.494  1.00 107.86 ? 43  TRP N NE1   1 
ATOM   3139 C CE2   . TRP H 4 4  ? 32.942  -25.317 19.414  1.00 117.02 ? 43  TRP N CE2   1 
ATOM   3140 C CE3   . TRP H 4 4  ? 32.005  -27.352 20.320  1.00 113.59 ? 43  TRP N CE3   1 
ATOM   3141 C CZ2   . TRP H 4 4  ? 34.078  -25.427 20.214  1.00 121.23 ? 43  TRP N CZ2   1 
ATOM   3142 C CZ3   . TRP H 4 4  ? 33.133  -27.460 21.114  1.00 116.46 ? 43  TRP N CZ3   1 
ATOM   3143 C CH2   . TRP H 4 4  ? 34.154  -26.503 21.055  1.00 113.26 ? 43  TRP N CH2   1 
ATOM   3144 N N     . SER H 4 5  ? 28.516  -29.410 16.137  1.00 145.23 ? 44  SER N N     1 
ATOM   3145 C CA    . SER H 4 5  ? 27.380  -30.344 15.988  1.00 129.64 ? 44  SER N CA    1 
ATOM   3146 C C     . SER H 4 5  ? 26.754  -30.638 17.344  1.00 125.96 ? 44  SER N C     1 
ATOM   3147 O O     . SER H 4 5  ? 27.468  -30.694 18.344  1.00 118.77 ? 44  SER N O     1 
ATOM   3148 C CB    . SER H 4 5  ? 27.838  -31.682 15.382  1.00 136.10 ? 44  SER N CB    1 
ATOM   3149 O OG    . SER H 4 5  ? 28.838  -31.526 14.395  1.00 149.05 ? 44  SER N OG    1 
ATOM   3150 N N     . PRO H 4 6  ? 25.434  -30.886 17.384  1.00 130.61 ? 45  PRO N N     1 
ATOM   3151 C CA    . PRO H 4 6  ? 24.781  -31.109 18.691  1.00 131.77 ? 45  PRO N CA    1 
ATOM   3152 C C     . PRO H 4 6  ? 25.372  -32.299 19.476  1.00 128.88 ? 45  PRO N C     1 
ATOM   3153 O O     . PRO H 4 6  ? 25.460  -32.266 20.710  1.00 116.47 ? 45  PRO N O     1 
ATOM   3154 C CB    . PRO H 4 6  ? 23.322  -31.374 18.310  1.00 135.57 ? 45  PRO N CB    1 
ATOM   3155 C CG    . PRO H 4 6  ? 23.387  -31.922 16.925  1.00 134.50 ? 45  PRO N CG    1 
ATOM   3156 C CD    . PRO H 4 6  ? 24.567  -31.274 16.254  1.00 128.54 ? 45  PRO N CD    1 
ATOM   3157 N N     . ASP H 4 7  ? 25.777  -33.334 18.745  1.00 136.36 ? 46  ASP N N     1 
ATOM   3158 C CA    . ASP H 4 7  ? 26.523  -34.456 19.319  1.00 143.57 ? 46  ASP N CA    1 
ATOM   3159 C C     . ASP H 4 7  ? 27.822  -34.003 20.009  1.00 138.10 ? 46  ASP N C     1 
ATOM   3160 O O     . ASP H 4 7  ? 28.151  -34.511 21.080  1.00 140.90 ? 46  ASP N O     1 
ATOM   3161 C CB    . ASP H 4 7  ? 26.789  -35.584 18.279  1.00 152.13 ? 46  ASP N CB    1 
ATOM   3162 C CG    . ASP H 4 7  ? 27.192  -35.060 16.884  1.00 159.93 ? 46  ASP N CG    1 
ATOM   3163 O OD1   . ASP H 4 7  ? 26.419  -34.274 16.290  1.00 159.09 ? 46  ASP N OD1   1 
ATOM   3164 O OD2   . ASP H 4 7  ? 28.259  -35.463 16.368  1.00 166.41 ? 46  ASP N OD2   1 
ATOM   3165 N N     . ILE H 4 8  ? 28.545  -33.048 19.419  1.00 134.16 ? 47  ILE N N     1 
ATOM   3166 C CA    . ILE H 4 8  ? 29.755  -32.517 20.064  1.00 123.21 ? 47  ILE N CA    1 
ATOM   3167 C C     . ILE H 4 8  ? 29.329  -31.641 21.236  1.00 120.86 ? 47  ILE N C     1 
ATOM   3168 O O     . ILE H 4 8  ? 29.872  -31.785 22.332  1.00 134.32 ? 47  ILE N O     1 
ATOM   3169 C CB    . ILE H 4 8  ? 30.668  -31.676 19.131  1.00 120.57 ? 47  ILE N CB    1 
ATOM   3170 C CG1   . ILE H 4 8  ? 31.118  -32.458 17.886  1.00 114.91 ? 47  ILE N CG1   1 
ATOM   3171 C CG2   . ILE H 4 8  ? 31.904  -31.196 19.899  1.00 122.10 ? 47  ILE N CG2   1 
ATOM   3172 C CD1   . ILE H 4 8  ? 31.771  -31.592 16.821  1.00 106.28 ? 47  ILE N CD1   1 
ATOM   3173 N N     . GLU H 4 9  ? 28.364  -30.748 20.996  1.00 106.78 ? 48  GLU N N     1 
ATOM   3174 C CA    . GLU H 4 9  ? 27.850  -29.840 22.016  1.00 106.43 ? 48  GLU N CA    1 
ATOM   3175 C C     . GLU H 4 9  ? 27.651  -30.601 23.321  1.00 110.58 ? 48  GLU N C     1 
ATOM   3176 O O     . GLU H 4 9  ? 28.262  -30.249 24.334  1.00 124.57 ? 48  GLU N O     1 
ATOM   3177 C CB    . GLU H 4 9  ? 26.537  -29.186 21.565  1.00 128.44 ? 48  GLU N CB    1 
ATOM   3178 C CG    . GLU H 4 9  ? 26.132  -27.941 22.354  1.00 144.13 ? 48  GLU N CG    1 
ATOM   3179 C CD    . GLU H 4 9  ? 26.815  -26.668 21.861  1.00 147.88 ? 48  GLU N CD    1 
ATOM   3180 O OE1   . GLU H 4 9  ? 26.331  -26.033 20.893  1.00 149.42 ? 48  GLU N OE1   1 
ATOM   3181 O OE2   . GLU H 4 9  ? 27.836  -26.290 22.461  1.00 139.79 ? 48  GLU N OE2   1 
ATOM   3182 N N     . GLN H 4 10 ? 26.879  -31.691 23.289  1.00 109.44 ? 49  GLN N N     1 
ATOM   3183 C CA    . GLN H 4 10 ? 26.634  -32.467 24.526  1.00 106.73 ? 49  GLN N CA    1 
ATOM   3184 C C     . GLN H 4 10 ? 27.924  -32.992 25.183  1.00 98.45  ? 49  GLN N C     1 
ATOM   3185 O O     . GLN H 4 10 ? 28.047  -32.942 26.410  1.00 88.81  ? 49  GLN N O     1 
ATOM   3186 C CB    . GLN H 4 10 ? 25.599  -33.588 24.337  1.00 116.19 ? 49  GLN N CB    1 
ATOM   3187 C CG    . GLN H 4 10 ? 25.949  -34.675 23.331  1.00 125.62 ? 49  GLN N CG    1 
ATOM   3188 C CD    . GLN H 4 10 ? 24.974  -35.840 23.380  1.00 124.89 ? 49  GLN N CD    1 
ATOM   3189 O OE1   . GLN H 4 10 ? 23.830  -35.728 22.930  1.00 117.92 ? 49  GLN N OE1   1 
ATOM   3190 N NE2   . GLN H 4 10 ? 25.422  -36.967 23.930  1.00 123.52 ? 49  GLN N NE2   1 
ATOM   3191 N N     . SER H 4 11 ? 28.900  -33.428 24.382  1.00 98.58  ? 50  SER N N     1 
ATOM   3192 C CA    . SER H 4 11 ? 30.223  -33.797 24.931  1.00 101.04 ? 50  SER N CA    1 
ATOM   3193 C C     . SER H 4 11 ? 30.873  -32.604 25.644  1.00 103.24 ? 50  SER N C     1 
ATOM   3194 O O     . SER H 4 11 ? 31.475  -32.757 26.713  1.00 105.99 ? 50  SER N O     1 
ATOM   3195 C CB    . SER H 4 11 ? 31.162  -34.409 23.867  1.00 98.84  ? 50  SER N CB    1 
ATOM   3196 O OG    . SER H 4 11 ? 30.986  -35.823 23.786  1.00 96.28  ? 50  SER N OG    1 
ATOM   3197 N N     . PHE H 4 12 ? 30.706  -31.417 25.072  1.00 103.92 ? 51  PHE N N     1 
ATOM   3198 C CA    . PHE H 4 12 ? 31.153  -30.186 25.722  1.00 106.42 ? 51  PHE N CA    1 
ATOM   3199 C C     . PHE H 4 12 ? 30.344  -29.946 27.048  1.00 108.01 ? 51  PHE N C     1 
ATOM   3200 O O     . PHE H 4 12 ? 30.933  -29.609 28.092  1.00 104.78 ? 51  PHE N O     1 
ATOM   3201 C CB    . PHE H 4 12 ? 31.103  -29.050 24.665  1.00 104.85 ? 51  PHE N CB    1 
ATOM   3202 C CG    . PHE H 4 12 ? 31.368  -27.666 25.189  1.00 106.71 ? 51  PHE N CG    1 
ATOM   3203 C CD1   . PHE H 4 12 ? 30.342  -26.917 25.774  1.00 98.78  ? 51  PHE N CD1   1 
ATOM   3204 C CD2   . PHE H 4 12 ? 32.620  -27.073 25.027  1.00 108.48 ? 51  PHE N CD2   1 
ATOM   3205 C CE1   . PHE H 4 12 ? 30.573  -25.630 26.228  1.00 96.42  ? 51  PHE N CE1   1 
ATOM   3206 C CE2   . PHE H 4 12 ? 32.858  -25.780 25.488  1.00 106.69 ? 51  PHE N CE2   1 
ATOM   3207 C CZ    . PHE H 4 12 ? 31.831  -25.058 26.083  1.00 99.59  ? 51  PHE N CZ    1 
ATOM   3208 N N     . GLN H 4 13 ? 29.029  -30.193 27.028  1.00 109.54 ? 52  GLN N N     1 
ATOM   3209 C CA    . GLN H 4 13 ? 28.174  -30.026 28.230  1.00 118.46 ? 52  GLN N CA    1 
ATOM   3210 C C     . GLN H 4 13 ? 28.425  -31.080 29.332  1.00 120.37 ? 52  GLN N C     1 
ATOM   3211 O O     . GLN H 4 13 ? 28.107  -30.854 30.502  1.00 117.80 ? 52  GLN N O     1 
ATOM   3212 C CB    . GLN H 4 13 ? 26.674  -30.028 27.870  1.00 123.81 ? 52  GLN N CB    1 
ATOM   3213 C CG    . GLN H 4 13 ? 26.203  -29.032 26.803  1.00 127.76 ? 52  GLN N CG    1 
ATOM   3214 C CD    . GLN H 4 13 ? 26.462  -27.577 27.145  1.00 127.25 ? 52  GLN N CD    1 
ATOM   3215 O OE1   . GLN H 4 13 ? 26.711  -27.228 28.297  1.00 129.13 ? 52  GLN N OE1   1 
ATOM   3216 N NE2   . GLN H 4 13 ? 26.393  -26.714 26.133  1.00 128.88 ? 52  GLN N NE2   1 
ATOM   3217 N N     . GLU H 4 14 ? 28.963  -32.235 28.959  1.00 116.39 ? 53  GLU N N     1 
ATOM   3218 C CA    . GLU H 4 14 ? 29.493  -33.178 29.938  1.00 117.06 ? 53  GLU N CA    1 
ATOM   3219 C C     . GLU H 4 14 ? 30.829  -32.652 30.411  1.00 112.54 ? 53  GLU N C     1 
ATOM   3220 O O     . GLU H 4 14 ? 30.969  -32.348 31.578  1.00 109.84 ? 53  GLU N O     1 
ATOM   3221 C CB    . GLU H 4 14 ? 29.669  -34.562 29.330  1.00 126.74 ? 53  GLU N CB    1 
ATOM   3222 C CG    . GLU H 4 14 ? 28.357  -35.288 29.099  1.00 130.41 ? 53  GLU N CG    1 
ATOM   3223 C CD    . GLU H 4 14 ? 28.511  -36.545 28.270  1.00 128.40 ? 53  GLU N CD    1 
ATOM   3224 O OE1   . GLU H 4 14 ? 29.645  -36.881 27.863  1.00 125.79 ? 53  GLU N OE1   1 
ATOM   3225 O OE2   . GLU H 4 14 ? 27.482  -37.203 28.024  1.00 141.35 ? 53  GLU N OE2   1 
ATOM   3226 N N     . ALA H 4 15 ? 31.788  -32.509 29.487  1.00 113.79 ? 54  ALA N N     1 
ATOM   3227 C CA    . ALA H 4 15 ? 33.144  -31.994 29.791  1.00 107.74 ? 54  ALA N CA    1 
ATOM   3228 C C     . ALA H 4 15 ? 33.103  -30.868 30.805  1.00 108.65 ? 54  ALA N C     1 
ATOM   3229 O O     . ALA H 4 15 ? 33.839  -30.905 31.796  1.00 116.59 ? 54  ALA N O     1 
ATOM   3230 C CB    . ALA H 4 15 ? 33.845  -31.522 28.532  1.00 112.70 ? 54  ALA N CB    1 
ATOM   3231 N N     . LEU H 4 16 ? 32.216  -29.893 30.569  1.00 117.00 ? 55  LEU N N     1 
ATOM   3232 C CA    . LEU H 4 16 ? 32.004  -28.791 31.522  1.00 123.58 ? 55  LEU N CA    1 
ATOM   3233 C C     . LEU H 4 16 ? 31.656  -29.334 32.915  1.00 132.03 ? 55  LEU N C     1 
ATOM   3234 O O     . LEU H 4 16 ? 32.461  -29.219 33.861  1.00 148.68 ? 55  LEU N O     1 
ATOM   3235 C CB    . LEU H 4 16 ? 30.896  -27.826 31.046  1.00 121.64 ? 55  LEU N CB    1 
ATOM   3236 C CG    . LEU H 4 16 ? 31.060  -26.866 29.847  1.00 117.54 ? 55  LEU N CG    1 
ATOM   3237 C CD1   . LEU H 4 16 ? 29.939  -25.830 29.882  1.00 123.57 ? 55  LEU N CD1   1 
ATOM   3238 C CD2   . LEU H 4 16 ? 32.402  -26.148 29.777  1.00 109.83 ? 55  LEU N CD2   1 
ATOM   3239 N N     . ALA H 4 17 ? 30.492  -29.978 33.005  1.00 138.37 ? 56  ALA N N     1 
ATOM   3240 C CA    . ALA H 4 17 ? 29.931  -30.451 34.277  1.00 144.82 ? 56  ALA N CA    1 
ATOM   3241 C C     . ALA H 4 17 ? 30.839  -31.415 35.039  1.00 149.91 ? 56  ALA N C     1 
ATOM   3242 O O     . ALA H 4 17 ? 30.872  -31.363 36.270  1.00 149.39 ? 56  ALA N O     1 
ATOM   3243 C CB    . ALA H 4 17 ? 28.569  -31.093 34.052  1.00 146.30 ? 56  ALA N CB    1 
ATOM   3244 N N     . ILE H 4 18 ? 31.560  -32.281 34.312  1.00 160.63 ? 57  ILE N N     1 
ATOM   3245 C CA    . ILE H 4 18 ? 32.520  -33.234 34.920  1.00 164.40 ? 57  ILE N CA    1 
ATOM   3246 C C     . ILE H 4 18 ? 33.997  -32.770 34.864  1.00 151.60 ? 57  ILE N C     1 
ATOM   3247 O O     . ILE H 4 18 ? 34.903  -33.563 35.148  1.00 141.99 ? 57  ILE N O     1 
ATOM   3248 C CB    . ILE H 4 18 ? 32.343  -34.734 34.449  1.00 170.16 ? 57  ILE N CB    1 
ATOM   3249 C CG1   . ILE H 4 18 ? 32.248  -34.907 32.926  1.00 164.86 ? 57  ILE N CG1   1 
ATOM   3250 C CG2   . ILE H 4 18 ? 31.117  -35.372 35.109  1.00 170.12 ? 57  ILE N CG2   1 
ATOM   3251 C CD1   . ILE H 4 18 ? 33.416  -34.348 32.152  1.00 159.58 ? 57  ILE N CD1   1 
ATOM   3252 N N     . TYR H 4 19 ? 34.259  -31.508 34.503  1.00 149.97 ? 58  TYR N N     1 
ATOM   3253 C CA    . TYR H 4 19 ? 35.513  -30.884 34.968  1.00 157.49 ? 58  TYR N CA    1 
ATOM   3254 C C     . TYR H 4 19 ? 35.281  -29.823 36.046  1.00 166.17 ? 58  TYR N C     1 
ATOM   3255 O O     . TYR H 4 19 ? 35.877  -29.936 37.125  1.00 185.68 ? 58  TYR N O     1 
ATOM   3256 C CB    . TYR H 4 19 ? 36.425  -30.434 33.821  1.00 151.35 ? 58  TYR N CB    1 
ATOM   3257 C CG    . TYR H 4 19 ? 37.265  -31.580 33.313  1.00 152.41 ? 58  TYR N CG    1 
ATOM   3258 C CD1   . TYR H 4 19 ? 38.317  -32.081 34.082  1.00 151.40 ? 58  TYR N CD1   1 
ATOM   3259 C CD2   . TYR H 4 19 ? 36.989  -32.195 32.088  1.00 152.86 ? 58  TYR N CD2   1 
ATOM   3260 C CE1   . TYR H 4 19 ? 39.078  -33.147 33.642  1.00 149.54 ? 58  TYR N CE1   1 
ATOM   3261 C CE2   . TYR H 4 19 ? 37.753  -33.258 31.635  1.00 150.28 ? 58  TYR N CE2   1 
ATOM   3262 C CZ    . TYR H 4 19 ? 38.795  -33.726 32.417  1.00 153.41 ? 58  TYR N CZ    1 
ATOM   3263 O OH    . TYR H 4 19 ? 39.555  -34.777 31.979  1.00 170.05 ? 58  TYR N OH    1 
ATOM   3264 N N     . PRO H 4 20 ? 34.480  -28.776 35.763  1.00 165.60 ? 59  PRO N N     1 
ATOM   3265 C CA    . PRO H 4 20 ? 33.965  -28.066 36.949  1.00 185.46 ? 59  PRO N CA    1 
ATOM   3266 C C     . PRO H 4 20 ? 32.434  -27.859 37.001  1.00 227.67 ? 59  PRO N C     1 
ATOM   3267 O O     . PRO H 4 20 ? 31.834  -27.534 35.974  1.00 257.73 ? 59  PRO N O     1 
ATOM   3268 C CB    . PRO H 4 20 ? 34.675  -26.725 36.849  1.00 174.29 ? 59  PRO N CB    1 
ATOM   3269 C CG    . PRO H 4 20 ? 34.746  -26.470 35.388  1.00 167.96 ? 59  PRO N CG    1 
ATOM   3270 C CD    . PRO H 4 20 ? 34.929  -27.818 34.737  1.00 157.55 ? 59  PRO N CD    1 
ATOM   3271 N N     . PRO H 4 21 ? 31.802  -28.049 38.192  1.00 250.46 ? 60  PRO N N     1 
ATOM   3272 C CA    . PRO H 4 21 ? 30.405  -27.597 38.387  1.00 250.91 ? 60  PRO N CA    1 
ATOM   3273 C C     . PRO H 4 21 ? 30.235  -26.069 38.246  1.00 253.55 ? 60  PRO N C     1 
ATOM   3274 O O     . PRO H 4 21 ? 29.247  -25.613 37.661  1.00 258.03 ? 60  PRO N O     1 
ATOM   3275 C CB    . PRO H 4 21 ? 30.072  -28.062 39.814  1.00 241.42 ? 60  PRO N CB    1 
ATOM   3276 C CG    . PRO H 4 21 ? 30.998  -29.199 40.070  1.00 239.48 ? 60  PRO N CG    1 
ATOM   3277 C CD    . PRO H 4 21 ? 32.266  -28.863 39.335  1.00 243.69 ? 60  PRO N CD    1 
ATOM   3278 N N     . CYS H 4 22 ? 31.182  -25.306 38.801  1.00 243.72 ? 61  CYS N N     1 
ATOM   3279 C CA    . CYS H 4 22 ? 31.349  -23.868 38.514  1.00 214.44 ? 61  CYS N CA    1 
ATOM   3280 C C     . CYS H 4 22 ? 32.855  -23.501 38.581  1.00 199.59 ? 61  CYS N C     1 
ATOM   3281 O O     . CYS H 4 22 ? 33.380  -23.180 39.656  1.00 175.62 ? 61  CYS N O     1 
ATOM   3282 C CB    . CYS H 4 22 ? 30.498  -22.991 39.468  1.00 207.20 ? 61  CYS N CB    1 
ATOM   3283 S SG    . CYS H 4 22 ? 28.809  -22.570 38.918  1.00 180.63 ? 61  CYS N SG    1 
ATOM   3284 N N     . GLY H 4 23 ? 33.529  -23.595 37.426  1.00 188.77 ? 62  GLY N N     1 
ATOM   3285 C CA    . GLY H 4 23 ? 34.944  -23.217 37.244  1.00 178.92 ? 62  GLY N CA    1 
ATOM   3286 C C     . GLY H 4 23 ? 35.924  -23.728 38.286  1.00 173.46 ? 62  GLY N C     1 
ATOM   3287 O O     . GLY H 4 23 ? 36.542  -24.774 38.106  1.00 159.26 ? 62  GLY N O     1 
ATOM   3288 N N     . ARG H 4 24 ? 36.075  -22.952 39.360  1.00 177.19 ? 63  ARG N N     1 
ATOM   3289 C CA    . ARG H 4 24 ? 36.829  -23.332 40.570  1.00 188.37 ? 63  ARG N CA    1 
ATOM   3290 C C     . ARG H 4 24 ? 38.322  -23.664 40.357  1.00 197.13 ? 63  ARG N C     1 
ATOM   3291 O O     . ARG H 4 24 ? 38.846  -23.540 39.245  1.00 201.24 ? 63  ARG N O     1 
ATOM   3292 C CB    . ARG H 4 24 ? 36.089  -24.460 41.332  1.00 185.97 ? 63  ARG N CB    1 
ATOM   3293 C CG    . ARG H 4 24 ? 35.110  -23.958 42.396  1.00 183.46 ? 63  ARG N CG    1 
ATOM   3294 C CD    . ARG H 4 24 ? 35.780  -23.528 43.705  1.00 176.81 ? 63  ARG N CD    1 
ATOM   3295 N NE    . ARG H 4 24 ? 36.332  -22.161 43.694  1.00 169.46 ? 63  ARG N NE    1 
ATOM   3296 C CZ    . ARG H 4 24 ? 35.627  -21.022 43.771  1.00 155.99 ? 63  ARG N CZ    1 
ATOM   3297 N NH1   . ARG H 4 24 ? 34.292  -21.026 43.846  1.00 152.43 ? 63  ARG N NH1   1 
ATOM   3298 N NH2   . ARG H 4 24 ? 36.269  -19.852 43.761  1.00 143.62 ? 63  ARG N NH2   1 
ATOM   3299 N N     . ARG H 4 25 ? 38.995  -24.015 41.460  1.00 206.28 ? 64  ARG N N     1 
ATOM   3300 C CA    . ARG H 4 25 ? 40.377  -24.543 41.495  1.00 210.97 ? 64  ARG N CA    1 
ATOM   3301 C C     . ARG H 4 25 ? 41.486  -23.503 41.279  1.00 218.36 ? 64  ARG N C     1 
ATOM   3302 O O     . ARG H 4 25 ? 41.301  -22.509 40.573  1.00 227.33 ? 64  ARG N O     1 
ATOM   3303 C CB    . ARG H 4 25 ? 40.567  -25.743 40.541  1.00 206.21 ? 64  ARG N CB    1 
ATOM   3304 C CG    . ARG H 4 25 ? 40.299  -27.095 41.185  1.00 199.82 ? 64  ARG N CG    1 
ATOM   3305 C CD    . ARG H 4 25 ? 41.468  -27.531 42.048  1.00 193.56 ? 64  ARG N CD    1 
ATOM   3306 N NE    . ARG H 4 25 ? 41.342  -28.917 42.494  1.00 187.60 ? 64  ARG N NE    1 
ATOM   3307 C CZ    . ARG H 4 25 ? 40.604  -29.338 43.525  1.00 189.44 ? 64  ARG N CZ    1 
ATOM   3308 N NH1   . ARG H 4 25 ? 39.877  -28.488 44.256  1.00 186.72 ? 64  ARG N NH1   1 
ATOM   3309 N NH2   . ARG H 4 25 ? 40.588  -30.637 43.829  1.00 191.40 ? 64  ARG N NH2   1 
ATOM   3310 N N     . LYS H 4 26 ? 42.634  -23.758 41.911  1.00 214.00 ? 65  LYS N N     1 
ATOM   3311 C CA    . LYS H 4 26 ? 43.837  -22.947 41.748  1.00 220.49 ? 65  LYS N CA    1 
ATOM   3312 C C     . LYS H 4 26 ? 44.947  -23.831 41.182  1.00 231.83 ? 65  LYS N C     1 
ATOM   3313 O O     . LYS H 4 26 ? 45.679  -24.484 41.925  1.00 245.22 ? 65  LYS N O     1 
ATOM   3314 C CB    . LYS H 4 26 ? 44.241  -22.307 43.085  1.00 223.67 ? 65  LYS N CB    1 
ATOM   3315 C CG    . LYS H 4 26 ? 45.429  -21.344 43.013  1.00 224.12 ? 65  LYS N CG    1 
ATOM   3316 C CD    . LYS H 4 26 ? 46.685  -21.889 43.689  1.00 217.91 ? 65  LYS N CD    1 
ATOM   3317 C CE    . LYS H 4 26 ? 46.593  -21.809 45.207  1.00 212.08 ? 65  LYS N CE    1 
ATOM   3318 N NZ    . LYS H 4 26 ? 47.528  -22.756 45.881  1.00 208.16 ? 65  LYS N NZ    1 
ATOM   3319 N N     . ILE H 4 27 ? 44.998  -23.884 39.850  1.00 241.99 ? 66  ILE N N     1 
ATOM   3320 C CA    . ILE H 4 27 ? 46.103  -24.459 39.050  1.00 239.72 ? 66  ILE N CA    1 
ATOM   3321 C C     . ILE H 4 27 ? 46.803  -25.748 39.546  1.00 252.19 ? 66  ILE N C     1 
ATOM   3322 O O     . ILE H 4 27 ? 48.022  -25.892 39.395  1.00 253.60 ? 66  ILE N O     1 
ATOM   3323 C CB    . ILE H 4 27 ? 47.170  -23.368 38.729  1.00 222.36 ? 66  ILE N CB    1 
ATOM   3324 C CG1   . ILE H 4 27 ? 47.996  -22.994 39.986  1.00 215.09 ? 66  ILE N CG1   1 
ATOM   3325 C CG2   . ILE H 4 27 ? 46.495  -22.164 38.069  1.00 211.57 ? 66  ILE N CG2   1 
ATOM   3326 C CD1   . ILE H 4 27 ? 49.496  -23.078 39.772  1.00 206.71 ? 66  ILE N CD1   1 
ATOM   3327 N N     . ILE H 4 28 ? 46.042  -26.700 40.091  1.00 258.64 ? 67  ILE N N     1 
ATOM   3328 C CA    . ILE H 4 28 ? 46.612  -28.006 40.492  1.00 257.15 ? 67  ILE N CA    1 
ATOM   3329 C C     . ILE H 4 28 ? 46.550  -29.006 39.311  1.00 277.51 ? 67  ILE N C     1 
ATOM   3330 O O     . ILE H 4 28 ? 46.044  -30.127 39.437  1.00 299.20 ? 67  ILE N O     1 
ATOM   3331 C CB    . ILE H 4 28 ? 45.979  -28.534 41.820  1.00 238.34 ? 67  ILE N CB    1 
ATOM   3332 C CG1   . ILE H 4 28 ? 46.887  -29.578 42.496  1.00 222.28 ? 67  ILE N CG1   1 
ATOM   3333 C CG2   . ILE H 4 28 ? 44.556  -29.058 41.629  1.00 236.87 ? 67  ILE N CG2   1 
ATOM   3334 C CD1   . ILE H 4 28 ? 48.149  -29.007 43.113  1.00 212.23 ? 67  ILE N CD1   1 
ATOM   3335 N N     . LEU H 4 29 ? 47.101  -28.578 38.170  1.00 277.39 ? 68  LEU N N     1 
ATOM   3336 C CA    . LEU H 4 29 ? 47.136  -29.355 36.919  1.00 264.76 ? 68  LEU N CA    1 
ATOM   3337 C C     . LEU H 4 29 ? 48.520  -29.993 36.674  1.00 263.35 ? 68  LEU N C     1 
ATOM   3338 O O     . LEU H 4 29 ? 48.598  -31.074 36.081  1.00 258.13 ? 68  LEU N O     1 
ATOM   3339 C CB    . LEU H 4 29 ? 46.742  -28.467 35.721  1.00 253.35 ? 68  LEU N CB    1 
ATOM   3340 C CG    . LEU H 4 29 ? 45.254  -28.164 35.452  1.00 241.85 ? 68  LEU N CG    1 
ATOM   3341 C CD1   . LEU H 4 29 ? 44.554  -29.333 34.761  1.00 233.74 ? 68  LEU N CD1   1 
ATOM   3342 C CD2   . LEU H 4 29 ? 44.514  -27.753 36.720  1.00 240.05 ? 68  LEU N CD2   1 
ATOM   3343 N N     . SER H 4 30 ? 49.592  -29.323 37.121  1.00 258.91 ? 69  SER N N     1 
ATOM   3344 C CA    . SER H 4 30 ? 50.976  -29.822 37.012  1.00 253.01 ? 69  SER N CA    1 
ATOM   3345 C C     . SER H 4 30 ? 51.533  -30.333 38.349  1.00 266.75 ? 69  SER N C     1 
ATOM   3346 O O     . SER H 4 30 ? 51.632  -29.565 39.311  1.00 287.29 ? 69  SER N O     1 
ATOM   3347 C CB    . SER H 4 30 ? 51.908  -28.720 36.480  1.00 237.52 ? 69  SER N CB    1 
ATOM   3348 O OG    . SER H 4 30 ? 52.055  -28.801 35.077  1.00 228.81 ? 69  SER N OG    1 
ATOM   3349 N N     . ASP H 4 31 ? 51.873  -31.626 38.398  1.00 261.74 ? 70  ASP N N     1 
ATOM   3350 C CA    . ASP H 4 31 ? 52.756  -32.194 39.449  1.00 237.90 ? 70  ASP N CA    1 
ATOM   3351 C C     . ASP H 4 31 ? 54.083  -32.724 38.864  1.00 239.65 ? 70  ASP N C     1 
ATOM   3352 O O     . ASP H 4 31 ? 55.139  -32.566 39.484  1.00 229.89 ? 70  ASP N O     1 
ATOM   3353 C CB    . ASP H 4 31 ? 52.041  -33.257 40.319  1.00 216.52 ? 70  ASP N CB    1 
ATOM   3354 C CG    . ASP H 4 31 ? 51.410  -34.394 39.508  1.00 198.78 ? 70  ASP N CG    1 
ATOM   3355 O OD1   . ASP H 4 31 ? 52.108  -35.043 38.699  1.00 170.40 ? 70  ASP N OD1   1 
ATOM   3356 O OD2   . ASP H 4 31 ? 50.206  -34.659 39.711  1.00 185.89 ? 70  ASP N OD2   1 
ATOM   3357 N N     . GLU H 4 32 ? 54.012  -33.357 37.688  1.00 245.42 ? 71  GLU N N     1 
ATOM   3358 C CA    . GLU H 4 32 ? 55.185  -33.706 36.873  1.00 244.02 ? 71  GLU N CA    1 
ATOM   3359 C C     . GLU H 4 32 ? 55.213  -32.765 35.642  1.00 239.78 ? 71  GLU N C     1 
ATOM   3360 O O     . GLU H 4 32 ? 54.798  -31.607 35.753  1.00 235.78 ? 71  GLU N O     1 
ATOM   3361 C CB    . GLU H 4 32 ? 55.127  -35.199 36.483  1.00 245.34 ? 71  GLU N CB    1 
ATOM   3362 C CG    . GLU H 4 32 ? 56.493  -35.876 36.350  1.00 238.49 ? 71  GLU N CG    1 
ATOM   3363 C CD    . GLU H 4 32 ? 56.585  -36.854 35.184  1.00 226.50 ? 71  GLU N CD    1 
ATOM   3364 O OE1   . GLU H 4 32 ? 55.949  -37.930 35.231  1.00 213.99 ? 71  GLU N OE1   1 
ATOM   3365 O OE2   . GLU H 4 32 ? 57.320  -36.545 34.222  1.00 210.40 ? 71  GLU N OE2   1 
ATOM   3366 N N     . GLY H 4 33 ? 55.705  -33.234 34.490  1.00 233.89 ? 72  GLY N N     1 
ATOM   3367 C CA    . GLY H 4 33 ? 55.671  -32.463 33.244  1.00 222.54 ? 72  GLY N CA    1 
ATOM   3368 C C     . GLY H 4 33 ? 54.311  -32.295 32.572  1.00 219.23 ? 72  GLY N C     1 
ATOM   3369 O O     . GLY H 4 33 ? 54.194  -31.501 31.636  1.00 218.26 ? 72  GLY N O     1 
ATOM   3370 N N     . LYS H 4 34 ? 53.295  -33.038 33.023  1.00 217.56 ? 73  LYS N N     1 
ATOM   3371 C CA    . LYS H 4 34 ? 51.927  -32.914 32.482  1.00 219.71 ? 73  LYS N CA    1 
ATOM   3372 C C     . LYS H 4 34 ? 51.271  -31.572 32.853  1.00 226.46 ? 73  LYS N C     1 
ATOM   3373 O O     . LYS H 4 34 ? 50.682  -31.435 33.928  1.00 223.46 ? 73  LYS N O     1 
ATOM   3374 C CB    . LYS H 4 34 ? 51.034  -34.089 32.942  1.00 212.75 ? 73  LYS N CB    1 
ATOM   3375 C CG    . LYS H 4 34 ? 51.188  -35.390 32.150  1.00 205.33 ? 73  LYS N CG    1 
ATOM   3376 C CD    . LYS H 4 34 ? 50.642  -35.279 30.723  1.00 203.82 ? 73  LYS N CD    1 
ATOM   3377 C CE    . LYS H 4 34 ? 51.727  -35.034 29.681  1.00 206.79 ? 73  LYS N CE    1 
ATOM   3378 N NZ    . LYS H 4 34 ? 51.283  -34.048 28.646  1.00 213.33 ? 73  LYS N NZ    1 
ATOM   3379 N N     . MET H 4 35 ? 51.381  -30.599 31.944  1.00 235.43 ? 74  MET N N     1 
ATOM   3380 C CA    . MET H 4 35 ? 50.790  -29.262 32.101  1.00 244.64 ? 74  MET N CA    1 
ATOM   3381 C C     . MET H 4 35 ? 49.466  -29.171 31.326  1.00 242.36 ? 74  MET N C     1 
ATOM   3382 O O     . MET H 4 35 ? 49.466  -28.904 30.119  1.00 257.82 ? 74  MET N O     1 
ATOM   3383 C CB    . MET H 4 35 ? 51.794  -28.200 31.613  1.00 248.59 ? 74  MET N CB    1 
ATOM   3384 C CG    . MET H 4 35 ? 51.415  -26.742 31.863  1.00 253.76 ? 74  MET N CG    1 
ATOM   3385 S SD    . MET H 4 35 ? 51.764  -26.163 33.539  1.00 260.64 ? 74  MET N SD    1 
ATOM   3386 C CE    . MET H 4 35 ? 50.163  -26.338 34.324  1.00 260.66 ? 74  MET N CE    1 
ATOM   3387 N N     . TYR H 4 36 ? 48.348  -29.394 32.028  1.00 222.44 ? 75  TYR N N     1 
ATOM   3388 C CA    . TYR H 4 36 ? 46.996  -29.342 31.431  1.00 195.60 ? 75  TYR N CA    1 
ATOM   3389 C C     . TYR H 4 36 ? 46.246  -28.062 31.747  1.00 168.09 ? 75  TYR N C     1 
ATOM   3390 O O     . TYR H 4 36 ? 46.646  -27.282 32.610  1.00 187.80 ? 75  TYR N O     1 
ATOM   3391 C CB    . TYR H 4 36 ? 46.142  -30.541 31.883  1.00 192.26 ? 75  TYR N CB    1 
ATOM   3392 C CG    . TYR H 4 36 ? 46.511  -31.836 31.204  1.00 192.23 ? 75  TYR N CG    1 
ATOM   3393 C CD1   . TYR H 4 36 ? 46.625  -31.910 29.811  1.00 182.61 ? 75  TYR N CD1   1 
ATOM   3394 C CD2   . TYR H 4 36 ? 46.755  -32.993 31.948  1.00 192.48 ? 75  TYR N CD2   1 
ATOM   3395 C CE1   . TYR H 4 36 ? 46.972  -33.089 29.182  1.00 183.96 ? 75  TYR N CE1   1 
ATOM   3396 C CE2   . TYR H 4 36 ? 47.098  -34.183 31.322  1.00 197.51 ? 75  TYR N CE2   1 
ATOM   3397 C CZ    . TYR H 4 36 ? 47.205  -34.224 29.935  1.00 194.79 ? 75  TYR N CZ    1 
ATOM   3398 O OH    . TYR H 4 36 ? 47.548  -35.393 29.296  1.00 202.74 ? 75  TYR N OH    1 
ATOM   3399 N N     . GLY H 4 37 ? 45.151  -27.865 31.022  1.00 134.87 ? 76  GLY N N     1 
ATOM   3400 C CA    . GLY H 4 37 ? 44.249  -26.743 31.243  1.00 126.12 ? 76  GLY N CA    1 
ATOM   3401 C C     . GLY H 4 37 ? 42.820  -27.150 30.974  1.00 118.68 ? 76  GLY N C     1 
ATOM   3402 O O     . GLY H 4 37 ? 42.574  -28.132 30.273  1.00 137.67 ? 76  GLY N O     1 
ATOM   3403 N N     . ARG H 4 38 ? 41.881  -26.404 31.543  1.00 107.71 ? 77  ARG N N     1 
ATOM   3404 C CA    . ARG H 4 38 ? 40.443  -26.593 31.284  1.00 112.98 ? 77  ARG N CA    1 
ATOM   3405 C C     . ARG H 4 38 ? 40.088  -26.888 29.809  1.00 113.11 ? 77  ARG N C     1 
ATOM   3406 O O     . ARG H 4 38 ? 39.645  -27.986 29.508  1.00 119.04 ? 77  ARG N O     1 
ATOM   3407 C CB    . ARG H 4 38 ? 39.645  -25.367 31.767  1.00 117.55 ? 77  ARG N CB    1 
ATOM   3408 C CG    . ARG H 4 38 ? 39.018  -25.527 33.137  1.00 124.28 ? 77  ARG N CG    1 
ATOM   3409 C CD    . ARG H 4 38 ? 37.585  -26.022 33.039  1.00 124.10 ? 77  ARG N CD    1 
ATOM   3410 N NE    . ARG H 4 38 ? 36.628  -24.926 32.852  1.00 130.89 ? 77  ARG N NE    1 
ATOM   3411 C CZ    . ARG H 4 38 ? 35.370  -25.060 32.425  1.00 140.02 ? 77  ARG N CZ    1 
ATOM   3412 N NH1   . ARG H 4 38 ? 34.877  -26.252 32.110  1.00 142.77 ? 77  ARG N NH1   1 
ATOM   3413 N NH2   . ARG H 4 38 ? 34.592  -23.985 32.301  1.00 144.63 ? 77  ARG N NH2   1 
ATOM   3414 N N     . ASN H 4 39 ? 40.316  -25.921 28.913  1.00 104.97 ? 78  ASN N N     1 
ATOM   3415 C CA    . ASN H 4 39 ? 39.974  -26.040 27.486  1.00 102.34 ? 78  ASN N CA    1 
ATOM   3416 C C     . ASN H 4 39 ? 40.550  -27.307 26.884  1.00 113.19 ? 78  ASN N C     1 
ATOM   3417 O O     . ASN H 4 39 ? 39.815  -28.111 26.323  1.00 98.01  ? 78  ASN N O     1 
ATOM   3418 C CB    . ASN H 4 39 ? 40.505  -24.859 26.669  1.00 102.50 ? 78  ASN N CB    1 
ATOM   3419 C CG    . ASN H 4 39 ? 39.970  -23.518 27.136  1.00 104.89 ? 78  ASN N CG    1 
ATOM   3420 O OD1   . ASN H 4 39 ? 38.990  -23.431 27.890  1.00 99.06  ? 78  ASN N OD1   1 
ATOM   3421 N ND2   . ASN H 4 39 ? 40.615  -22.451 26.671  1.00 103.74 ? 78  ASN N ND2   1 
ATOM   3422 N N     . GLU H 4 40 ? 41.862  -27.493 27.053  1.00 125.07 ? 79  GLU N N     1 
ATOM   3423 C CA    . GLU H 4 40 ? 42.580  -28.691 26.572  1.00 122.02 ? 79  GLU N CA    1 
ATOM   3424 C C     . GLU H 4 40 ? 41.999  -29.996 27.109  1.00 120.15 ? 79  GLU N C     1 
ATOM   3425 O O     . GLU H 4 40 ? 41.782  -30.941 26.335  1.00 135.80 ? 79  GLU N O     1 
ATOM   3426 C CB    . GLU H 4 40 ? 44.072  -28.600 26.899  1.00 118.59 ? 79  GLU N CB    1 
ATOM   3427 C CG    . GLU H 4 40 ? 44.782  -27.590 26.010  1.00 124.01 ? 79  GLU N CG    1 
ATOM   3428 C CD    . GLU H 4 40 ? 46.223  -27.311 26.405  1.00 124.64 ? 79  GLU N CD    1 
ATOM   3429 O OE1   . GLU H 4 40 ? 46.820  -26.400 25.782  1.00 117.75 ? 79  GLU N OE1   1 
ATOM   3430 O OE2   . GLU H 4 40 ? 46.755  -27.985 27.321  1.00 117.74 ? 79  GLU N OE2   1 
ATOM   3431 N N     . LEU H 4 41 ? 41.718  -30.043 28.412  1.00 104.99 ? 80  LEU N N     1 
ATOM   3432 C CA    . LEU H 4 41 ? 40.987  -31.188 28.987  1.00 114.46 ? 80  LEU N CA    1 
ATOM   3433 C C     . LEU H 4 41 ? 39.551  -31.363 28.410  1.00 118.20 ? 80  LEU N C     1 
ATOM   3434 O O     . LEU H 4 41 ? 38.999  -32.484 28.451  1.00 117.81 ? 80  LEU N O     1 
ATOM   3435 C CB    . LEU H 4 41 ? 40.932  -31.117 30.531  1.00 115.81 ? 80  LEU N CB    1 
ATOM   3436 C CG    . LEU H 4 41 ? 42.174  -31.365 31.417  1.00 110.81 ? 80  LEU N CG    1 
ATOM   3437 C CD1   . LEU H 4 41 ? 41.759  -31.459 32.884  1.00 107.02 ? 80  LEU N CD1   1 
ATOM   3438 C CD2   . LEU H 4 41 ? 42.978  -32.600 31.024  1.00 109.27 ? 80  LEU N CD2   1 
ATOM   3439 N N     . ILE H 4 42 ? 38.960  -30.272 27.894  1.00 114.92 ? 81  ILE N N     1 
ATOM   3440 C CA    . ILE H 4 42 ? 37.633  -30.311 27.248  1.00 106.58 ? 81  ILE N CA    1 
ATOM   3441 C C     . ILE H 4 42 ? 37.827  -30.957 25.873  1.00 98.47  ? 81  ILE N C     1 
ATOM   3442 O O     . ILE H 4 42 ? 37.243  -31.998 25.567  1.00 102.97 ? 81  ILE N O     1 
ATOM   3443 C CB    . ILE H 4 42 ? 36.999  -28.884 27.131  1.00 107.63 ? 81  ILE N CB    1 
ATOM   3444 C CG1   . ILE H 4 42 ? 36.965  -28.161 28.517  1.00 108.15 ? 81  ILE N CG1   1 
ATOM   3445 C CG2   . ILE H 4 42 ? 35.648  -28.938 26.422  1.00 103.57 ? 81  ILE N CG2   1 
ATOM   3446 C CD1   . ILE H 4 42 ? 35.623  -27.897 29.167  1.00 103.77 ? 81  ILE N CD1   1 
ATOM   3447 N N     . ALA H 4 43 ? 38.694  -30.348 25.077  1.00 93.61  ? 82  ALA N N     1 
ATOM   3448 C CA    . ALA H 4 43 ? 39.111  -30.857 23.782  1.00 103.98 ? 82  ALA N CA    1 
ATOM   3449 C C     . ALA H 4 43 ? 39.505  -32.347 23.814  1.00 114.54 ? 82  ALA N C     1 
ATOM   3450 O O     . ALA H 4 43 ? 39.202  -33.109 22.881  1.00 108.09 ? 82  ALA N O     1 
ATOM   3451 C CB    . ALA H 4 43 ? 40.271  -30.011 23.276  1.00 100.60 ? 82  ALA N CB    1 
ATOM   3452 N N     . ARG H 4 44 ? 40.186  -32.737 24.894  1.00 129.04 ? 83  ARG N N     1 
ATOM   3453 C CA    . ARG H 4 44 ? 40.571  -34.133 25.141  1.00 136.15 ? 83  ARG N CA    1 
ATOM   3454 C C     . ARG H 4 44 ? 39.318  -35.012 25.263  1.00 126.10 ? 83  ARG N C     1 
ATOM   3455 O O     . ARG H 4 44 ? 39.131  -35.962 24.492  1.00 126.09 ? 83  ARG N O     1 
ATOM   3456 C CB    . ARG H 4 44 ? 41.443  -34.210 26.413  1.00 145.86 ? 83  ARG N CB    1 
ATOM   3457 C CG    . ARG H 4 44 ? 42.169  -35.533 26.665  1.00 155.97 ? 83  ARG N CG    1 
ATOM   3458 C CD    . ARG H 4 44 ? 43.306  -35.350 27.671  1.00 151.41 ? 83  ARG N CD    1 
ATOM   3459 N NE    . ARG H 4 44 ? 44.379  -34.529 27.095  1.00 146.39 ? 83  ARG N NE    1 
ATOM   3460 C CZ    . ARG H 4 44 ? 45.496  -34.981 26.516  1.00 138.75 ? 83  ARG N CZ    1 
ATOM   3461 N NH1   . ARG H 4 44 ? 45.770  -36.283 26.432  1.00 136.15 ? 83  ARG N NH1   1 
ATOM   3462 N NH2   . ARG H 4 44 ? 46.367  -34.107 26.018  1.00 139.02 ? 83  ARG N NH2   1 
ATOM   3463 N N     . TYR H 4 45 ? 38.445  -34.653 26.204  1.00 120.62 ? 84  TYR N N     1 
ATOM   3464 C CA    . TYR H 4 45 ? 37.181  -35.374 26.443  1.00 114.59 ? 84  TYR N CA    1 
ATOM   3465 C C     . TYR H 4 45 ? 36.274  -35.429 25.190  1.00 117.69 ? 84  TYR N C     1 
ATOM   3466 O O     . TYR H 4 45 ? 35.569  -36.433 24.959  1.00 113.93 ? 84  TYR N O     1 
ATOM   3467 C CB    . TYR H 4 45 ? 36.446  -34.737 27.624  1.00 107.40 ? 84  TYR N CB    1 
ATOM   3468 C CG    . TYR H 4 45 ? 35.230  -35.490 28.089  1.00 102.59 ? 84  TYR N CG    1 
ATOM   3469 C CD1   . TYR H 4 45 ? 35.344  -36.584 28.958  1.00 107.88 ? 84  TYR N CD1   1 
ATOM   3470 C CD2   . TYR H 4 45 ? 33.959  -35.102 27.686  1.00 100.00 ? 84  TYR N CD2   1 
ATOM   3471 C CE1   . TYR H 4 45 ? 34.217  -37.277 29.399  1.00 105.58 ? 84  TYR N CE1   1 
ATOM   3472 C CE2   . TYR H 4 45 ? 32.827  -35.772 28.129  1.00 101.79 ? 84  TYR N CE2   1 
ATOM   3473 C CZ    . TYR H 4 45 ? 32.954  -36.861 28.979  1.00 104.69 ? 84  TYR N CZ    1 
ATOM   3474 O OH    . TYR H 4 45 ? 31.821  -37.524 29.398  1.00 100.72 ? 84  TYR N OH    1 
ATOM   3475 N N     . ILE H 4 46 ? 36.316  -34.364 24.380  1.00 122.72 ? 85  ILE N N     1 
ATOM   3476 C CA    . ILE H 4 46 ? 35.645  -34.358 23.070  1.00 108.70 ? 85  ILE N CA    1 
ATOM   3477 C C     . ILE H 4 46 ? 36.233  -35.464 22.194  1.00 105.38 ? 85  ILE N C     1 
ATOM   3478 O O     . ILE H 4 46 ? 35.481  -36.179 21.536  1.00 116.27 ? 85  ILE N O     1 
ATOM   3479 C CB    . ILE H 4 46 ? 35.724  -32.970 22.368  1.00 106.19 ? 85  ILE N CB    1 
ATOM   3480 C CG1   . ILE H 4 46 ? 34.882  -31.944 23.141  1.00 102.50 ? 85  ILE N CG1   1 
ATOM   3481 C CG2   . ILE H 4 46 ? 35.226  -33.044 20.925  1.00 108.86 ? 85  ILE N CG2   1 
ATOM   3482 C CD1   . ILE H 4 46 ? 35.176  -30.499 22.811  1.00 96.11  ? 85  ILE N CD1   1 
ATOM   3483 N N     . LYS H 4 47 ? 37.560  -35.611 22.199  1.00 104.77 ? 86  LYS N N     1 
ATOM   3484 C CA    . LYS H 4 47 ? 38.222  -36.707 21.476  1.00 108.00 ? 86  LYS N CA    1 
ATOM   3485 C C     . LYS H 4 47 ? 37.796  -38.061 22.045  1.00 119.28 ? 86  LYS N C     1 
ATOM   3486 O O     . LYS H 4 47 ? 37.368  -38.942 21.285  1.00 122.22 ? 86  LYS N O     1 
ATOM   3487 C CB    . LYS H 4 47 ? 39.750  -36.575 21.533  1.00 106.54 ? 86  LYS N CB    1 
ATOM   3488 C CG    . LYS H 4 47 ? 40.534  -37.526 20.627  1.00 111.66 ? 86  LYS N CG    1 
ATOM   3489 C CD    . LYS H 4 47 ? 40.944  -36.882 19.305  1.00 119.75 ? 86  LYS N CD    1 
ATOM   3490 C CE    . LYS H 4 47 ? 42.302  -37.366 18.805  1.00 124.59 ? 86  LYS N CE    1 
ATOM   3491 N NZ    . LYS H 4 47 ? 42.930  -36.370 17.882  1.00 125.22 ? 86  LYS N NZ    1 
ATOM   3492 N N     . LEU H 4 48 ? 37.894  -38.214 23.370  1.00 137.32 ? 87  LEU N N     1 
ATOM   3493 C CA    . LEU H 4 48 ? 37.552  -39.494 24.030  1.00 148.06 ? 87  LEU N CA    1 
ATOM   3494 C C     . LEU H 4 48 ? 36.081  -39.911 23.836  1.00 145.08 ? 87  LEU N C     1 
ATOM   3495 O O     . LEU H 4 48 ? 35.806  -41.108 23.720  1.00 149.32 ? 87  LEU N O     1 
ATOM   3496 C CB    . LEU H 4 48 ? 37.918  -39.494 25.537  1.00 156.31 ? 87  LEU N CB    1 
ATOM   3497 C CG    . LEU H 4 48 ? 39.408  -39.453 25.952  1.00 167.94 ? 87  LEU N CG    1 
ATOM   3498 C CD1   . LEU H 4 48 ? 39.562  -39.279 27.461  1.00 170.62 ? 87  LEU N CD1   1 
ATOM   3499 C CD2   . LEU H 4 48 ? 40.181  -40.684 25.491  1.00 163.62 ? 87  LEU N CD2   1 
ATOM   3500 N N     . ARG H 4 49 ? 35.153  -38.946 23.786  1.00 141.21 ? 88  ARG N N     1 
ATOM   3501 C CA    . ARG H 4 49 ? 33.714  -39.264 23.610  1.00 135.68 ? 88  ARG N CA    1 
ATOM   3502 C C     . ARG H 4 49 ? 33.183  -39.236 22.166  1.00 127.39 ? 88  ARG N C     1 
ATOM   3503 O O     . ARG H 4 49 ? 32.301  -40.033 21.841  1.00 125.49 ? 88  ARG N O     1 
ATOM   3504 C CB    . ARG H 4 49 ? 32.842  -38.345 24.472  1.00 136.30 ? 88  ARG N CB    1 
ATOM   3505 C CG    . ARG H 4 49 ? 33.064  -38.474 25.971  1.00 138.44 ? 88  ARG N CG    1 
ATOM   3506 C CD    . ARG H 4 49 ? 32.545  -39.774 26.580  1.00 139.43 ? 88  ARG N CD    1 
ATOM   3507 N NE    . ARG H 4 49 ? 31.084  -39.798 26.696  1.00 138.20 ? 88  ARG N NE    1 
ATOM   3508 C CZ    . ARG H 4 49 ? 30.375  -40.797 27.229  1.00 142.36 ? 88  ARG N CZ    1 
ATOM   3509 N NH1   . ARG H 4 49 ? 30.975  -41.889 27.720  1.00 141.49 ? 88  ARG N NH1   1 
ATOM   3510 N NH2   . ARG H 4 49 ? 29.046  -40.702 27.275  1.00 141.74 ? 88  ARG N NH2   1 
ATOM   3511 N N     . THR H 4 50 ? 33.673  -38.310 21.328  1.00 120.62 ? 89  THR N N     1 
ATOM   3512 C CA    . THR H 4 50 ? 33.226  -38.208 19.923  1.00 108.16 ? 89  THR N CA    1 
ATOM   3513 C C     . THR H 4 50 ? 34.180  -38.839 18.917  1.00 98.65  ? 89  THR N C     1 
ATOM   3514 O O     . THR H 4 50 ? 33.733  -39.299 17.860  1.00 98.85  ? 89  THR N O     1 
ATOM   3515 C CB    . THR H 4 50 ? 32.992  -36.743 19.470  1.00 113.04 ? 89  THR N CB    1 
ATOM   3516 O OG1   . THR H 4 50 ? 34.224  -36.008 19.493  1.00 113.95 ? 89  THR N OG1   1 
ATOM   3517 C CG2   . THR H 4 50 ? 31.956  -36.053 20.347  1.00 114.15 ? 89  THR N CG2   1 
ATOM   3518 N N     . GLY H 4 51 ? 35.478  -38.826 19.219  1.00 87.74  ? 90  GLY N N     1 
ATOM   3519 C CA    . GLY H 4 51 ? 36.509  -39.066 18.204  1.00 98.12  ? 90  GLY N CA    1 
ATOM   3520 C C     . GLY H 4 51 ? 36.884  -37.811 17.403  1.00 108.43 ? 90  GLY N C     1 
ATOM   3521 O O     . GLY H 4 51 ? 38.054  -37.642 16.988  1.00 94.64  ? 90  GLY N O     1 
ATOM   3522 N N     . LYS H 4 52 ? 35.893  -36.944 17.157  1.00 117.77 ? 91  LYS N N     1 
ATOM   3523 C CA    . LYS H 4 52 ? 36.132  -35.612 16.597  1.00 118.64 ? 91  LYS N CA    1 
ATOM   3524 C C     . LYS H 4 52 ? 37.082  -34.837 17.545  1.00 126.95 ? 91  LYS N C     1 
ATOM   3525 O O     . LYS H 4 52 ? 36.981  -34.970 18.782  1.00 104.06 ? 91  LYS N O     1 
ATOM   3526 C CB    . LYS H 4 52 ? 34.794  -34.871 16.349  1.00 111.49 ? 91  LYS N CB    1 
ATOM   3527 C CG    . LYS H 4 52 ? 33.915  -35.473 15.242  1.00 111.38 ? 91  LYS N CG    1 
ATOM   3528 C CD    . LYS H 4 52 ? 34.420  -35.146 13.818  1.00 117.24 ? 91  LYS N CD    1 
ATOM   3529 C CE    . LYS H 4 52 ? 33.746  -33.918 13.167  1.00 109.30 ? 91  LYS N CE    1 
ATOM   3530 N NZ    . LYS H 4 52 ? 34.471  -33.333 11.994  1.00 94.04  ? 91  LYS N NZ    1 
ATOM   3531 N N     . THR H 4 53 ? 38.001  -34.061 16.948  1.00 138.14 ? 92  THR N N     1 
ATOM   3532 C CA    . THR H 4 53 ? 39.184  -33.474 17.637  1.00 133.95 ? 92  THR N CA    1 
ATOM   3533 C C     . THR H 4 53 ? 38.905  -32.108 18.309  1.00 137.79 ? 92  THR N C     1 
ATOM   3534 O O     . THR H 4 53 ? 38.700  -32.045 19.535  1.00 134.35 ? 92  THR N O     1 
ATOM   3535 C CB    . THR H 4 53 ? 40.396  -33.396 16.657  1.00 127.19 ? 92  THR N CB    1 
ATOM   3536 O OG1   . THR H 4 53 ? 40.836  -34.724 16.345  1.00 135.35 ? 92  THR N OG1   1 
ATOM   3537 C CG2   . THR H 4 53 ? 41.585  -32.601 17.229  1.00 121.49 ? 92  THR N CG2   1 
ATOM   3538 N N     . ARG H 4 54 ? 38.914  -31.039 17.509  1.00 134.21 ? 93  ARG N N     1 
ATOM   3539 C CA    . ARG H 4 54 ? 38.678  -29.654 17.968  1.00 140.84 ? 93  ARG N CA    1 
ATOM   3540 C C     . ARG H 4 54 ? 39.701  -29.042 19.008  1.00 140.40 ? 93  ARG N C     1 
ATOM   3541 O O     . ARG H 4 54 ? 39.707  -29.430 20.181  1.00 145.29 ? 93  ARG N O     1 
ATOM   3542 C CB    . ARG H 4 54 ? 37.213  -29.492 18.446  1.00 142.47 ? 93  ARG N CB    1 
ATOM   3543 C CG    . ARG H 4 54 ? 36.140  -29.938 17.440  1.00 140.37 ? 93  ARG N CG    1 
ATOM   3544 C CD    . ARG H 4 54 ? 35.888  -28.928 16.326  1.00 133.16 ? 93  ARG N CD    1 
ATOM   3545 N NE    . ARG H 4 54 ? 35.397  -29.558 15.096  1.00 140.02 ? 93  ARG N NE    1 
ATOM   3546 C CZ    . ARG H 4 54 ? 36.156  -30.080 14.120  1.00 145.38 ? 93  ARG N CZ    1 
ATOM   3547 N NH1   . ARG H 4 54 ? 37.491  -30.089 14.184  1.00 145.81 ? 93  ARG N NH1   1 
ATOM   3548 N NH2   . ARG H 4 54 ? 35.568  -30.617 13.053  1.00 142.65 ? 93  ARG N NH2   1 
ATOM   3549 N N     . THR H 4 55 ? 40.524  -28.069 18.562  1.00 129.47 ? 94  THR N N     1 
ATOM   3550 C CA    . THR H 4 55 ? 41.641  -27.465 19.354  1.00 110.43 ? 94  THR N CA    1 
ATOM   3551 C C     . THR H 4 55 ? 41.222  -26.457 20.435  1.00 104.94 ? 94  THR N C     1 
ATOM   3552 O O     . THR H 4 55 ? 40.095  -25.986 20.432  1.00 100.81 ? 94  THR N O     1 
ATOM   3553 C CB    . THR H 4 55 ? 42.659  -26.723 18.442  1.00 111.77 ? 94  THR N CB    1 
ATOM   3554 O OG1   . THR H 4 55 ? 42.013  -25.636 17.758  1.00 105.61 ? 94  THR N OG1   1 
ATOM   3555 C CG2   . THR H 4 55 ? 43.321  -27.678 17.431  1.00 109.65 ? 94  THR N CG2   1 
ATOM   3556 N N     . ARG H 4 56 ? 42.163  -26.105 21.322  1.00 111.10 ? 95  ARG N N     1 
ATOM   3557 C CA    . ARG H 4 56 ? 41.906  -25.263 22.521  1.00 107.92 ? 95  ARG N CA    1 
ATOM   3558 C C     . ARG H 4 56 ? 41.336  -23.874 22.226  1.00 107.06 ? 95  ARG N C     1 
ATOM   3559 O O     . ARG H 4 56 ? 40.592  -23.323 23.046  1.00 104.03 ? 95  ARG N O     1 
ATOM   3560 C CB    . ARG H 4 56 ? 43.168  -25.135 23.405  1.00 109.46 ? 95  ARG N CB    1 
ATOM   3561 C CG    . ARG H 4 56 ? 44.252  -24.175 22.906  1.00 112.20 ? 95  ARG N CG    1 
ATOM   3562 C CD    . ARG H 4 56 ? 45.559  -24.296 23.704  1.00 111.03 ? 95  ARG N CD    1 
ATOM   3563 N NE    . ARG H 4 56 ? 46.415  -23.108 23.550  1.00 107.65 ? 95  ARG N NE    1 
ATOM   3564 C CZ    . ARG H 4 56 ? 46.442  -22.040 24.361  1.00 115.59 ? 95  ARG N CZ    1 
ATOM   3565 N NH1   . ARG H 4 56 ? 45.673  -21.961 25.448  1.00 125.72 ? 95  ARG N NH1   1 
ATOM   3566 N NH2   . ARG H 4 56 ? 47.263  -21.021 24.091  1.00 112.33 ? 95  ARG N NH2   1 
ATOM   3567 N N     . LYS H 4 57 ? 41.682  -23.313 21.066  1.00 108.50 ? 96  LYS N N     1 
ATOM   3568 C CA    . LYS H 4 57 ? 41.064  -22.057 20.599  1.00 106.46 ? 96  LYS N CA    1 
ATOM   3569 C C     . LYS H 4 57 ? 39.589  -22.212 20.189  1.00 91.38  ? 96  LYS N C     1 
ATOM   3570 O O     . LYS H 4 57 ? 38.815  -21.259 20.253  1.00 95.35  ? 96  LYS N O     1 
ATOM   3571 C CB    . LYS H 4 57 ? 41.885  -21.405 19.466  1.00 110.52 ? 96  LYS N CB    1 
ATOM   3572 C CG    . LYS H 4 57 ? 42.757  -20.225 19.901  1.00 109.72 ? 96  LYS N CG    1 
ATOM   3573 C CD    . LYS H 4 57 ? 43.630  -20.497 21.129  1.00 110.22 ? 96  LYS N CD    1 
ATOM   3574 C CE    . LYS H 4 57 ? 44.563  -19.321 21.405  1.00 110.00 ? 96  LYS N CE    1 
ATOM   3575 N NZ    . LYS H 4 57 ? 44.599  -18.941 22.847  1.00 116.17 ? 96  LYS N NZ    1 
ATOM   3576 N N     . GLN H 4 58 ? 39.198  -23.411 19.802  1.00 76.78  ? 97  GLN N N     1 
ATOM   3577 C CA    . GLN H 4 58 ? 37.820  -23.662 19.438  1.00 78.68  ? 97  GLN N CA    1 
ATOM   3578 C C     . GLN H 4 58 ? 37.002  -23.653 20.707  1.00 77.06  ? 97  GLN N C     1 
ATOM   3579 O O     . GLN H 4 58 ? 35.989  -22.935 20.805  1.00 83.46  ? 97  GLN N O     1 
ATOM   3580 C CB    . GLN H 4 58 ? 37.726  -24.949 18.633  1.00 76.24  ? 97  GLN N CB    1 
ATOM   3581 C CG    . GLN H 4 58 ? 38.538  -24.784 17.341  1.00 82.26  ? 97  GLN N CG    1 
ATOM   3582 C CD    . GLN H 4 58 ? 38.584  -25.994 16.439  1.00 80.98  ? 97  GLN N CD    1 
ATOM   3583 O OE1   . GLN H 4 58 ? 38.382  -27.106 16.881  1.00 70.13  ? 97  GLN N OE1   1 
ATOM   3584 N NE2   . GLN H 4 58 ? 38.878  -25.770 15.159  1.00 84.73  ? 97  GLN N NE2   1 
ATOM   3585 N N     . VAL H 4 59 ? 37.505  -24.378 21.703  1.00 90.53  ? 98  VAL N N     1 
ATOM   3586 C CA    . VAL H 4 59 ? 36.948  -24.369 23.076  1.00 95.66  ? 98  VAL N CA    1 
ATOM   3587 C C     . VAL H 4 59 ? 36.962  -22.966 23.705  1.00 98.24  ? 98  VAL N C     1 
ATOM   3588 O O     . VAL H 4 59 ? 35.964  -22.584 24.315  1.00 93.24  ? 98  VAL N O     1 
ATOM   3589 C CB    . VAL H 4 59 ? 37.662  -25.366 24.022  1.00 91.85  ? 98  VAL N CB    1 
ATOM   3590 C CG1   . VAL H 4 59 ? 37.072  -25.286 25.425  1.00 96.65  ? 98  VAL N CG1   1 
ATOM   3591 C CG2   . VAL H 4 59 ? 37.543  -26.792 23.490  1.00 96.53  ? 98  VAL N CG2   1 
ATOM   3592 N N     . SER H 4 60 ? 38.069  -22.217 23.561  1.00 103.68 ? 99  SER N N     1 
ATOM   3593 C CA    . SER H 4 60 ? 38.087  -20.769 23.881  1.00 96.04  ? 99  SER N CA    1 
ATOM   3594 C C     . SER H 4 60 ? 36.917  -20.046 23.206  1.00 102.56 ? 99  SER N C     1 
ATOM   3595 O O     . SER H 4 60 ? 36.072  -19.488 23.916  1.00 110.16 ? 99  SER N O     1 
ATOM   3596 C CB    . SER H 4 60 ? 39.393  -20.077 23.449  1.00 94.74  ? 99  SER N CB    1 
ATOM   3597 O OG    . SER H 4 60 ? 40.387  -20.093 24.457  1.00 106.92 ? 99  SER N OG    1 
ATOM   3598 N N     . SER H 4 61 ? 36.858  -20.067 21.862  1.00 87.32  ? 100 SER N N     1 
ATOM   3599 C CA    . SER H 4 61 ? 35.874  -19.250 21.121  1.00 88.08  ? 100 SER N CA    1 
ATOM   3600 C C     . SER H 4 61 ? 34.463  -19.624 21.553  1.00 93.92  ? 100 SER N C     1 
ATOM   3601 O O     . SER H 4 61 ? 33.717  -18.776 22.092  1.00 106.32 ? 100 SER N O     1 
ATOM   3602 C CB    . SER H 4 61 ? 36.023  -19.385 19.597  1.00 88.53  ? 100 SER N CB    1 
ATOM   3603 O OG    . SER H 4 61 ? 35.338  -18.350 18.902  1.00 76.77  ? 100 SER N OG    1 
ATOM   3604 N N     . HIS H 4 62 ? 34.142  -20.909 21.395  1.00 86.53  ? 101 HIS N N     1 
ATOM   3605 C CA    . HIS H 4 62 ? 32.819  -21.433 21.753  1.00 84.80  ? 101 HIS N CA    1 
ATOM   3606 C C     . HIS H 4 62 ? 32.266  -20.910 23.109  1.00 86.13  ? 101 HIS N C     1 
ATOM   3607 O O     . HIS H 4 62 ? 31.186  -20.305 23.127  1.00 84.79  ? 101 HIS N O     1 
ATOM   3608 C CB    . HIS H 4 62 ? 32.861  -22.956 21.731  1.00 87.24  ? 101 HIS N CB    1 
ATOM   3609 C CG    . HIS H 4 62 ? 31.517  -23.616 21.778  1.00 99.03  ? 101 HIS N CG    1 
ATOM   3610 N ND1   . HIS H 4 62 ? 30.511  -23.331 20.877  1.00 110.90 ? 101 HIS N ND1   1 
ATOM   3611 C CD2   . HIS H 4 62 ? 31.034  -24.593 22.584  1.00 99.21  ? 101 HIS N CD2   1 
ATOM   3612 C CE1   . HIS H 4 62 ? 29.459  -24.085 21.144  1.00 112.73 ? 101 HIS N CE1   1 
ATOM   3613 N NE2   . HIS H 4 62 ? 29.751  -24.859 22.176  1.00 104.08 ? 101 HIS N NE2   1 
ATOM   3614 N N     . ILE H 4 63 ? 33.016  -21.101 24.206  1.00 83.72  ? 102 ILE N N     1 
ATOM   3615 C CA    . ILE H 4 63 ? 32.650  -20.559 25.539  1.00 96.26  ? 102 ILE N CA    1 
ATOM   3616 C C     . ILE H 4 63 ? 32.319  -19.050 25.477  1.00 97.85  ? 102 ILE N C     1 
ATOM   3617 O O     . ILE H 4 63 ? 31.287  -18.606 26.043  1.00 105.54 ? 102 ILE N O     1 
ATOM   3618 C CB    . ILE H 4 63 ? 33.761  -20.780 26.629  1.00 104.90 ? 102 ILE N CB    1 
ATOM   3619 C CG1   . ILE H 4 63 ? 33.979  -22.277 26.941  1.00 108.67 ? 102 ILE N CG1   1 
ATOM   3620 C CG2   . ILE H 4 63 ? 33.408  -20.070 27.942  1.00 102.58 ? 102 ILE N CG2   1 
ATOM   3621 C CD1   . ILE H 4 63 ? 35.232  -22.588 27.757  1.00 101.36 ? 102 ILE N CD1   1 
ATOM   3622 N N     . GLN H 4 64 ? 33.182  -18.277 24.801  1.00 85.22  ? 103 GLN N N     1 
ATOM   3623 C CA    . GLN H 4 64 ? 32.961  -16.837 24.668  1.00 85.35  ? 103 GLN N CA    1 
ATOM   3624 C C     . GLN H 4 64 ? 31.644  -16.590 23.886  1.00 87.41  ? 103 GLN N C     1 
ATOM   3625 O O     . GLN H 4 64 ? 30.829  -15.739 24.274  1.00 90.50  ? 103 GLN N O     1 
ATOM   3626 C CB    . GLN H 4 64 ? 34.169  -16.127 24.003  1.00 85.37  ? 103 GLN N CB    1 
ATOM   3627 C CG    . GLN H 4 64 ? 34.044  -14.593 23.907  1.00 87.33  ? 103 GLN N CG    1 
ATOM   3628 C CD    . GLN H 4 64 ? 35.248  -13.863 23.271  1.00 88.40  ? 103 GLN N CD    1 
ATOM   3629 O OE1   . GLN H 4 64 ? 36.279  -14.458 22.948  1.00 79.98  ? 103 GLN N OE1   1 
ATOM   3630 N NE2   . GLN H 4 64 ? 35.110  -12.550 23.102  1.00 89.75  ? 103 GLN N NE2   1 
ATOM   3631 N N     . VAL H 4 65 ? 31.417  -17.348 22.814  1.00 84.43  ? 104 VAL N N     1 
ATOM   3632 C CA    . VAL H 4 65 ? 30.220  -17.120 22.004  1.00 92.82  ? 104 VAL N CA    1 
ATOM   3633 C C     . VAL H 4 65 ? 29.003  -17.454 22.824  1.00 92.63  ? 104 VAL N C     1 
ATOM   3634 O O     . VAL H 4 65 ? 27.983  -16.786 22.700  1.00 102.95 ? 104 VAL N O     1 
ATOM   3635 C CB    . VAL H 4 65 ? 30.125  -17.951 20.696  1.00 99.80  ? 104 VAL N CB    1 
ATOM   3636 C CG1   . VAL H 4 65 ? 29.007  -17.380 19.805  1.00 96.20  ? 104 VAL N CG1   1 
ATOM   3637 C CG2   . VAL H 4 65 ? 31.465  -18.014 19.941  1.00 100.68 ? 104 VAL N CG2   1 
ATOM   3638 N N     . LEU H 4 66 ? 29.108  -18.497 23.640  1.00 92.04  ? 105 LEU N N     1 
ATOM   3639 C CA    . LEU H 4 66 ? 28.001  -18.883 24.505  1.00 94.57  ? 105 LEU N CA    1 
ATOM   3640 C C     . LEU H 4 66 ? 27.723  -17.812 25.557  1.00 97.31  ? 105 LEU N C     1 
ATOM   3641 O O     . LEU H 4 66 ? 26.593  -17.310 25.647  1.00 107.05 ? 105 LEU N O     1 
ATOM   3642 C CB    . LEU H 4 66 ? 28.275  -20.235 25.154  1.00 90.11  ? 105 LEU N CB    1 
ATOM   3643 C CG    . LEU H 4 66 ? 28.245  -21.405 24.174  1.00 88.84  ? 105 LEU N CG    1 
ATOM   3644 C CD1   . LEU H 4 66 ? 28.705  -22.676 24.867  1.00 93.18  ? 105 LEU N CD1   1 
ATOM   3645 C CD2   . LEU H 4 66 ? 26.860  -21.595 23.575  1.00 91.61  ? 105 LEU N CD2   1 
ATOM   3646 N N     . ALA H 4 67 ? 28.754  -17.433 26.310  1.00 89.93  ? 106 ALA N N     1 
ATOM   3647 C CA    . ALA H 4 67 ? 28.633  -16.318 27.256  1.00 91.19  ? 106 ALA N CA    1 
ATOM   3648 C C     . ALA H 4 67 ? 27.868  -15.129 26.666  1.00 87.63  ? 106 ALA N C     1 
ATOM   3649 O O     . ALA H 4 67 ? 26.875  -14.692 27.228  1.00 83.89  ? 106 ALA N O     1 
ATOM   3650 C CB    . ALA H 4 67 ? 30.009  -15.863 27.720  1.00 95.36  ? 106 ALA N CB    1 
ATOM   3651 N N     . ARG H 4 68 ? 28.342  -14.620 25.533  1.00 94.13  ? 107 ARG N N     1 
ATOM   3652 C CA    . ARG H 4 68 ? 27.651  -13.551 24.773  1.00 98.97  ? 107 ARG N CA    1 
ATOM   3653 C C     . ARG H 4 68 ? 26.152  -13.814 24.618  1.00 87.98  ? 107 ARG N C     1 
ATOM   3654 O O     . ARG H 4 68 ? 25.316  -12.931 24.879  1.00 87.04  ? 107 ARG N O     1 
ATOM   3655 C CB    . ARG H 4 68 ? 28.321  -13.406 23.391  1.00 109.70 ? 107 ARG N CB    1 
ATOM   3656 C CG    . ARG H 4 68 ? 27.544  -12.715 22.268  1.00 112.03 ? 107 ARG N CG    1 
ATOM   3657 C CD    . ARG H 4 68 ? 27.587  -11.203 22.385  1.00 117.19 ? 107 ARG N CD    1 
ATOM   3658 N NE    . ARG H 4 68 ? 28.944  -10.665 22.230  1.00 119.43 ? 107 ARG N NE    1 
ATOM   3659 C CZ    . ARG H 4 68 ? 29.248  -9.379  22.025  1.00 122.38 ? 107 ARG N CZ    1 
ATOM   3660 N NH1   . ARG H 4 68 ? 28.303  -8.443  21.904  1.00 123.34 ? 107 ARG N NH1   1 
ATOM   3661 N NH2   . ARG H 4 68 ? 30.525  -9.024  21.916  1.00 122.99 ? 107 ARG N NH2   1 
ATOM   3662 N N     . ARG H 4 69 ? 25.830  -15.036 24.195  1.00 94.63  ? 108 ARG N N     1 
ATOM   3663 C CA    . ARG H 4 69 ? 24.448  -15.417 23.925  1.00 98.77  ? 108 ARG N CA    1 
ATOM   3664 C C     . ARG H 4 69 ? 23.672  -15.323 25.212  1.00 96.73  ? 108 ARG N C     1 
ATOM   3665 O O     . ARG H 4 69 ? 22.645  -14.662 25.271  1.00 90.67  ? 108 ARG N O     1 
ATOM   3666 C CB    . ARG H 4 69 ? 24.332  -16.846 23.368  1.00 103.21 ? 108 ARG N CB    1 
ATOM   3667 C CG    . ARG H 4 69 ? 25.039  -17.087 22.039  1.00 108.60 ? 108 ARG N CG    1 
ATOM   3668 C CD    . ARG H 4 69 ? 24.117  -17.635 20.958  1.00 110.76 ? 108 ARG N CD    1 
ATOM   3669 N NE    . ARG H 4 69 ? 24.848  -18.472 20.002  1.00 116.95 ? 108 ARG N NE    1 
ATOM   3670 C CZ    . ARG H 4 69 ? 25.056  -19.789 20.124  1.00 116.19 ? 108 ARG N CZ    1 
ATOM   3671 N NH1   . ARG H 4 69 ? 24.610  -20.483 21.180  1.00 106.17 ? 108 ARG N NH1   1 
ATOM   3672 N NH2   . ARG H 4 69 ? 25.730  -20.430 19.166  1.00 117.27 ? 108 ARG N NH2   1 
ATOM   3673 N N     . LYS H 4 70 ? 24.200  -15.983 26.240  1.00 104.54 ? 109 LYS N N     1 
ATOM   3674 C CA    . LYS H 4 70 ? 23.618  -15.969 27.580  1.00 107.02 ? 109 LYS N CA    1 
ATOM   3675 C C     . LYS H 4 70 ? 23.345  -14.513 28.016  1.00 108.73 ? 109 LYS N C     1 
ATOM   3676 O O     . LYS H 4 70 ? 22.186  -14.147 28.236  1.00 101.88 ? 109 LYS N O     1 
ATOM   3677 C CB    . LYS H 4 70 ? 24.541  -16.705 28.575  1.00 110.89 ? 109 LYS N CB    1 
ATOM   3678 C CG    . LYS H 4 70 ? 23.836  -17.255 29.805  1.00 115.84 ? 109 LYS N CG    1 
ATOM   3679 C CD    . LYS H 4 70 ? 24.824  -17.718 30.872  1.00 121.76 ? 109 LYS N CD    1 
ATOM   3680 C CE    . LYS H 4 70 ? 24.121  -17.957 32.204  1.00 127.13 ? 109 LYS N CE    1 
ATOM   3681 N NZ    . LYS H 4 70 ? 25.020  -18.506 33.257  1.00 129.58 ? 109 LYS N NZ    1 
ATOM   3682 N N     . ALA H 4 71 ? 24.403  -13.690 28.074  1.00 103.98 ? 110 ALA N N     1 
ATOM   3683 C CA    . ALA H 4 71 ? 24.306  -12.276 28.472  1.00 97.39  ? 110 ALA N CA    1 
ATOM   3684 C C     . ALA H 4 71 ? 23.240  -11.541 27.650  1.00 105.04 ? 110 ALA N C     1 
ATOM   3685 O O     . ALA H 4 71 ? 22.332  -10.946 28.235  1.00 106.35 ? 110 ALA N O     1 
ATOM   3686 C CB    . ALA H 4 71 ? 25.661  -11.570 28.380  1.00 90.86  ? 110 ALA N CB    1 
ATOM   3687 N N     . ARG H 4 72 ? 23.299  -11.605 26.315  1.00 113.21 ? 111 ARG N N     1 
ATOM   3688 C CA    . ARG H 4 72 ? 22.167  -11.067 25.540  1.00 119.28 ? 111 ARG N CA    1 
ATOM   3689 C C     . ARG H 4 72 ? 21.038  -12.108 25.615  1.00 123.21 ? 111 ARG N C     1 
ATOM   3690 O O     . ARG H 4 72 ? 20.845  -12.883 24.686  1.00 141.17 ? 111 ARG N O     1 
ATOM   3691 C CB    . ARG H 4 72 ? 22.559  -10.719 24.094  1.00 127.20 ? 111 ARG N CB    1 
ATOM   3692 C CG    . ARG H 4 72 ? 23.367  -9.427  23.929  1.00 132.62 ? 111 ARG N CG    1 
ATOM   3693 C CD    . ARG H 4 72 ? 24.882  -9.631  24.006  1.00 146.68 ? 111 ARG N CD    1 
ATOM   3694 N NE    . ARG H 4 72 ? 25.498  -9.160  25.264  1.00 165.83 ? 111 ARG N NE    1 
ATOM   3695 C CZ    . ARG H 4 72 ? 26.263  -8.065  25.422  1.00 171.06 ? 111 ARG N CZ    1 
ATOM   3696 N NH1   . ARG H 4 72 ? 26.553  -7.244  24.409  1.00 176.85 ? 111 ARG N NH1   1 
ATOM   3697 N NH2   . ARG H 4 72 ? 26.751  -7.777  26.631  1.00 167.25 ? 111 ARG N NH2   1 
ATOM   3698 N N     . GLU H 4 73 ? 20.304  -12.115 26.731  1.00 129.64 ? 112 GLU N N     1 
ATOM   3699 C CA    . GLU H 4 73 ? 19.416  -13.246 27.101  1.00 133.95 ? 112 GLU N CA    1 
ATOM   3700 C C     . GLU H 4 73 ? 18.288  -13.422 26.107  1.00 133.00 ? 112 GLU N C     1 
ATOM   3701 O O     . GLU H 4 73 ? 17.448  -12.537 25.973  1.00 151.75 ? 112 GLU N O     1 
ATOM   3702 C CB    . GLU H 4 73 ? 18.797  -13.098 28.515  1.00 139.86 ? 112 GLU N CB    1 
ATOM   3703 C CG    . GLU H 4 73 ? 19.687  -12.539 29.637  1.00 141.40 ? 112 GLU N CG    1 
ATOM   3704 C CD    . GLU H 4 73 ? 19.393  -11.083 30.014  1.00 136.56 ? 112 GLU N CD    1 
ATOM   3705 O OE1   . GLU H 4 73 ? 18.932  -10.297 29.151  1.00 120.44 ? 112 GLU N OE1   1 
ATOM   3706 O OE2   . GLU H 4 73 ? 19.638  -10.721 31.189  1.00 131.64 ? 112 GLU N OE2   1 
HETATM 3707 O O     . HOH I 5 .  ? 29.373  -6.341  -16.966 1.00 88.73  ? 301 HOH A O     1 
HETATM 3708 O O     . HOH I 5 .  ? 43.029  14.587  17.273  1.00 80.60  ? 302 HOH A O     1 
HETATM 3709 O O     . HOH J 5 .  ? 50.797  -8.648  24.528  1.00 85.62  ? 101 HOH C O     1 
HETATM 3710 O O     . HOH J 5 .  ? 26.832  -21.163 12.601  1.00 96.00  ? 102 HOH C O     1 
HETATM 3711 O O     . HOH K 5 .  ? 38.733  -20.712 27.389  1.00 87.56  ? 101 HOH F O     1 
HETATM 3712 O O     . HOH K 5 .  ? 40.292  -18.715 -0.526  1.00 72.40  ? 102 HOH F O     1 
HETATM 3713 O O     . HOH L 5 .  ? 11.139  -1.902  -21.431 1.00 102.96 ? 301 HOH B O     1 
HETATM 3714 O O     . HOH L 5 .  ? 34.426  26.645  -2.030  1.00 85.20  ? 302 HOH B O     1 
HETATM 3715 O O     . HOH M 5 .  ? -1.324  31.783  -39.162 1.00 74.17  ? 101 HOH D O     1 
HETATM 3716 O O     . HOH M 5 .  ? 5.291   15.986  -21.300 1.00 71.76  ? 102 HOH D O     1 
HETATM 3717 O O     . HOH N 5 .  ? 0.887   18.723  -10.732 1.00 86.67  ? 101 HOH E O     1 
HETATM 3718 O O     . HOH O 5 .  ? -23.858 28.977  -16.581 1.00 83.00  ? 201 HOH I O     1 
HETATM 3719 O O     . HOH O 5 .  ? -6.189  41.368  -12.369 1.00 101.35 ? 202 HOH I O     1 
HETATM 3720 O O     . HOH P 5 .  ? 30.256  -20.961 19.736  1.00 67.02  ? 201 HOH N O     1 
HETATM 3721 O O     . HOH P 5 .  ? 56.866  -38.303 32.142  1.00 103.07 ? 202 HOH N O     1 
HETATM 3722 O O     . HOH P 5 .  ? 28.851  -5.613  26.961  1.00 80.77  ? 203 HOH N O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  217 217 ARG ARG A . n 
A 1 2  LYS 2  218 218 LYS LYS A . n 
A 1 3  LYS 3  219 219 LYS LYS A . n 
A 1 4  ARG 4  220 220 ARG ARG A . n 
A 1 5  ILE 5  221 221 ILE ILE A . n 
A 1 6  PRO 6  222 222 PRO PRO A . n 
A 1 7  TYR 7  223 223 TYR TYR A . n 
A 1 8  SER 8  224 224 SER SER A . n 
A 1 9  LYS 9  225 225 LYS LYS A . n 
A 1 10 GLY 10 226 226 GLY GLY A . n 
A 1 11 GLN 11 227 227 GLN GLN A . n 
A 1 12 LEU 12 228 228 LEU LEU A . n 
A 1 13 ARG 13 229 229 ARG ARG A . n 
A 1 14 GLU 14 230 230 GLU GLU A . n 
A 1 15 LEU 15 231 231 LEU LEU A . n 
A 1 16 GLU 16 232 232 GLU GLU A . n 
A 1 17 ARG 17 233 233 ARG ARG A . n 
A 1 18 GLU 18 234 234 GLU GLU A . n 
A 1 19 TYR 19 235 235 TYR TYR A . n 
A 1 20 ALA 20 236 236 ALA ALA A . n 
A 1 21 ALA 21 237 237 ALA ALA A . n 
A 1 22 ASN 22 238 238 ASN ASN A . n 
A 1 23 LYS 23 239 239 LYS LYS A . n 
A 1 24 PHE 24 240 240 PHE PHE A . n 
A 1 25 ILE 25 241 241 ILE ILE A . n 
A 1 26 THR 26 242 242 THR THR A . n 
A 1 27 LYS 27 243 243 LYS LYS A . n 
A 1 28 ASP 28 244 244 ASP ASP A . n 
A 1 29 LYS 29 245 245 LYS LYS A . n 
A 1 30 ARG 30 246 246 ARG ARG A . n 
A 1 31 ARG 31 247 247 ARG ARG A . n 
A 1 32 LYS 32 248 248 LYS LYS A . n 
A 1 33 ILE 33 249 249 ILE ILE A . n 
A 1 34 SER 34 250 250 SER SER A . n 
A 1 35 ALA 35 251 251 ALA ALA A . n 
A 1 36 ALA 36 252 252 ALA ALA A . n 
A 1 37 THR 37 253 253 THR THR A . n 
A 1 38 SER 38 254 254 SER SER A . n 
A 1 39 LEU 39 255 255 LEU LEU A . n 
A 1 40 SER 40 256 256 SER SER A . n 
A 1 41 GLU 41 257 257 GLU GLU A . n 
A 1 42 ARG 42 258 258 ARG ARG A . n 
A 1 43 GLN 43 259 259 GLN GLN A . n 
A 1 44 ILE 44 260 260 ILE ILE A . n 
A 1 45 THR 45 261 261 THR THR A . n 
A 1 46 ILE 46 262 262 ILE ILE A . n 
A 1 47 TRP 47 263 263 TRP TRP A . n 
A 1 48 PHE 48 264 264 PHE PHE A . n 
A 1 49 GLN 49 265 265 GLN GLN A . n 
A 1 50 ASN 50 266 266 ASN ASN A . n 
A 1 51 ARG 51 267 267 ARG ARG A . n 
A 1 52 ARG 52 268 268 ARG ARG A . n 
A 1 53 VAL 53 269 269 VAL VAL A . n 
A 1 54 LYS 54 270 270 LYS LYS A . n 
A 1 55 GLU 55 271 271 GLU GLU A . n 
A 1 56 LYS 56 272 272 LYS LYS A . n 
A 1 57 LYS 57 273 273 LYS LYS A . n 
A 1 58 VAL 58 274 274 VAL VAL A . n 
A 1 59 LEU 59 275 275 LEU LEU A . n 
A 1 60 ALA 60 276 276 ALA ALA A . n 
A 1 61 LYS 61 277 277 LYS LYS A . n 
A 1 62 VAL 62 278 278 VAL VAL A . n 
B 2 1  DA  1  20  20  DA  DA  C . n 
B 2 2  DT  2  21  21  DT  DT  C . n 
B 2 3  DT  3  22  22  DT  DT  C . n 
B 2 4  DT  4  23  23  DT  DT  C . n 
B 2 5  DT  5  24  24  DT  DT  C . n 
B 2 6  DA  6  25  25  DA  DA  C . n 
B 2 7  DT  7  26  26  DT  DT  C . n 
B 2 8  DT  8  27  27  DT  DT  C . n 
B 2 9  DG  9  28  28  DG  DG  C . n 
B 2 10 DC  10 29  29  DC  DC  C . n 
B 2 11 DA  11 30  30  DA  DA  C . n 
B 2 12 DT  12 31  31  DT  DT  C . n 
B 2 13 DT  13 32  32  DT  DT  C . n 
B 2 14 DC  14 33  33  DC  DC  C . n 
B 2 15 DC  15 34  34  DC  DC  C . n 
B 2 16 DA  16 35  35  DA  DA  C . n 
B 2 17 DG  17 36  36  DG  DG  C . n 
B 2 18 DT  18 37  37  DT  DT  C . n 
C 3 1  DA  1  1   1   DA  DA  F . n 
C 3 2  DC  2  2   2   DC  DC  F . n 
C 3 3  DT  3  3   3   DT  DT  F . n 
C 3 4  DG  4  4   4   DG  DG  F . n 
C 3 5  DG  5  5   5   DG  DG  F . n 
C 3 6  DA  6  6   6   DA  DA  F . n 
C 3 7  DA  7  7   7   DA  DA  F . n 
C 3 8  DT  8  8   8   DT  DT  F . n 
C 3 9  DG  9  9   9   DG  DG  F . n 
C 3 10 DC  10 10  10  DC  DC  F . n 
C 3 11 DA  11 11  11  DA  DA  F . n 
C 3 12 DA  12 12  12  DA  DA  F . n 
C 3 13 DT  13 13  13  DT  DT  F . n 
C 3 14 DA  14 14  14  DA  DA  F . n 
C 3 15 DA  15 15  15  DA  DA  F . n 
C 3 16 DA  16 16  16  DA  DA  F . n 
C 3 17 DA  17 17  17  DA  DA  F . n 
C 3 18 DT  18 18  18  DT  DT  F . n 
D 1 1  ARG 1  217 217 ARG ARG B . n 
D 1 2  LYS 2  218 218 LYS LYS B . n 
D 1 3  LYS 3  219 219 LYS LYS B . n 
D 1 4  ARG 4  220 220 ARG ARG B . n 
D 1 5  ILE 5  221 221 ILE ILE B . n 
D 1 6  PRO 6  222 222 PRO PRO B . n 
D 1 7  TYR 7  223 223 TYR TYR B . n 
D 1 8  SER 8  224 224 SER SER B . n 
D 1 9  LYS 9  225 225 LYS LYS B . n 
D 1 10 GLY 10 226 226 GLY GLY B . n 
D 1 11 GLN 11 227 227 GLN GLN B . n 
D 1 12 LEU 12 228 228 LEU LEU B . n 
D 1 13 ARG 13 229 229 ARG ARG B . n 
D 1 14 GLU 14 230 230 GLU GLU B . n 
D 1 15 LEU 15 231 231 LEU LEU B . n 
D 1 16 GLU 16 232 232 GLU GLU B . n 
D 1 17 ARG 17 233 233 ARG ARG B . n 
D 1 18 GLU 18 234 234 GLU GLU B . n 
D 1 19 TYR 19 235 235 TYR TYR B . n 
D 1 20 ALA 20 236 236 ALA ALA B . n 
D 1 21 ALA 21 237 237 ALA ALA B . n 
D 1 22 ASN 22 238 238 ASN ASN B . n 
D 1 23 LYS 23 239 239 LYS LYS B . n 
D 1 24 PHE 24 240 240 PHE PHE B . n 
D 1 25 ILE 25 241 241 ILE ILE B . n 
D 1 26 THR 26 242 242 THR THR B . n 
D 1 27 LYS 27 243 243 LYS LYS B . n 
D 1 28 ASP 28 244 244 ASP ASP B . n 
D 1 29 LYS 29 245 245 LYS LYS B . n 
D 1 30 ARG 30 246 246 ARG ARG B . n 
D 1 31 ARG 31 247 247 ARG ARG B . n 
D 1 32 LYS 32 248 248 LYS LYS B . n 
D 1 33 ILE 33 249 249 ILE ILE B . n 
D 1 34 SER 34 250 250 SER SER B . n 
D 1 35 ALA 35 251 251 ALA ALA B . n 
D 1 36 ALA 36 252 252 ALA ALA B . n 
D 1 37 THR 37 253 253 THR THR B . n 
D 1 38 SER 38 254 254 SER SER B . n 
D 1 39 LEU 39 255 255 LEU LEU B . n 
D 1 40 SER 40 256 256 SER SER B . n 
D 1 41 GLU 41 257 257 GLU GLU B . n 
D 1 42 ARG 42 258 258 ARG ARG B . n 
D 1 43 GLN 43 259 259 GLN GLN B . n 
D 1 44 ILE 44 260 260 ILE ILE B . n 
D 1 45 THR 45 261 261 THR THR B . n 
D 1 46 ILE 46 262 262 ILE ILE B . n 
D 1 47 TRP 47 263 263 TRP TRP B . n 
D 1 48 PHE 48 264 264 PHE PHE B . n 
D 1 49 GLN 49 265 265 GLN GLN B . n 
D 1 50 ASN 50 266 266 ASN ASN B . n 
D 1 51 ARG 51 267 267 ARG ARG B . n 
D 1 52 ARG 52 268 268 ARG ARG B . n 
D 1 53 VAL 53 269 269 VAL VAL B . n 
D 1 54 LYS 54 270 270 LYS LYS B . n 
D 1 55 GLU 55 271 271 GLU GLU B . n 
D 1 56 LYS 56 272 272 LYS LYS B . n 
D 1 57 LYS 57 273 273 LYS LYS B . n 
D 1 58 VAL 58 274 274 VAL VAL B . n 
D 1 59 LEU 59 275 275 LEU LEU B . n 
D 1 60 ALA 60 276 276 ALA ALA B . n 
D 1 61 LYS 61 277 277 LYS LYS B . n 
D 1 62 VAL 62 278 278 VAL VAL B . n 
E 2 1  DA  1  20  20  DA  DA  D . n 
E 2 2  DT  2  21  21  DT  DT  D . n 
E 2 3  DT  3  22  22  DT  DT  D . n 
E 2 4  DT  4  23  23  DT  DT  D . n 
E 2 5  DT  5  24  24  DT  DT  D . n 
E 2 6  DA  6  25  25  DA  DA  D . n 
E 2 7  DT  7  26  26  DT  DT  D . n 
E 2 8  DT  8  27  27  DT  DT  D . n 
E 2 9  DG  9  28  28  DG  DG  D . n 
E 2 10 DC  10 29  29  DC  DC  D . n 
E 2 11 DA  11 30  30  DA  DA  D . n 
E 2 12 DT  12 31  31  DT  DT  D . n 
E 2 13 DT  13 32  32  DT  DT  D . n 
E 2 14 DC  14 33  33  DC  DC  D . n 
E 2 15 DC  15 34  34  DC  DC  D . n 
E 2 16 DA  16 35  35  DA  DA  D . n 
E 2 17 DG  17 36  36  DG  DG  D . n 
E 2 18 DT  18 37  37  DT  DT  D . n 
F 3 1  DA  1  1   1   DA  DA  E . n 
F 3 2  DC  2  2   2   DC  DC  E . n 
F 3 3  DT  3  3   3   DT  DT  E . n 
F 3 4  DG  4  4   4   DG  DG  E . n 
F 3 5  DG  5  5   5   DG  DG  E . n 
F 3 6  DA  6  6   6   DA  DA  E . n 
F 3 7  DA  7  7   7   DA  DA  E . n 
F 3 8  DT  8  8   8   DT  DT  E . n 
F 3 9  DG  9  9   9   DG  DG  E . n 
F 3 10 DC  10 10  10  DC  DC  E . n 
F 3 11 DA  11 11  11  DA  DA  E . n 
F 3 12 DA  12 12  12  DA  DA  E . n 
F 3 13 DT  13 13  13  DT  DT  E . n 
F 3 14 DA  14 14  14  DA  DA  E . n 
F 3 15 DA  15 15  15  DA  DA  E . n 
F 3 16 DA  16 16  16  DA  DA  E . n 
F 3 17 DA  17 17  17  DA  DA  E . n 
F 3 18 DT  18 18  18  DT  DT  E . n 
G 4 1  GLU 1  40  ?   ?   ?   I . n 
G 4 2  GLY 2  41  ?   ?   ?   I . n 
G 4 3  VAL 3  42  ?   ?   ?   I . n 
G 4 4  TRP 4  43  43  TRP TRP I . n 
G 4 5  SER 5  44  44  SER SER I . n 
G 4 6  PRO 6  45  45  PRO PRO I . n 
G 4 7  ASP 7  46  46  ASP ASP I . n 
G 4 8  ILE 8  47  47  ILE ILE I . n 
G 4 9  GLU 9  48  48  GLU GLU I . n 
G 4 10 GLN 10 49  49  GLN GLN I . n 
G 4 11 SER 11 50  50  SER SER I . n 
G 4 12 PHE 12 51  51  PHE PHE I . n 
G 4 13 GLN 13 52  52  GLN GLN I . n 
G 4 14 GLU 14 53  53  GLU GLU I . n 
G 4 15 ALA 15 54  54  ALA ALA I . n 
G 4 16 LEU 16 55  55  LEU LEU I . n 
G 4 17 ALA 17 56  56  ALA ALA I . n 
G 4 18 ILE 18 57  57  ILE ILE I . n 
G 4 19 TYR 19 58  58  TYR TYR I . n 
G 4 20 PRO 20 59  59  PRO PRO I . n 
G 4 21 PRO 21 60  60  PRO PRO I . n 
G 4 22 CYS 22 61  61  CYS CYS I . n 
G 4 23 GLY 23 62  62  GLY GLY I . n 
G 4 24 ARG 24 63  63  ARG ARG I . n 
G 4 25 ARG 25 64  64  ARG ARG I . n 
G 4 26 LYS 26 65  65  LYS LYS I . n 
G 4 27 ILE 27 66  66  ILE ILE I . n 
G 4 28 ILE 28 67  67  ILE ILE I . n 
G 4 29 LEU 29 68  68  LEU LEU I . n 
G 4 30 SER 30 69  69  SER SER I . n 
G 4 31 ASP 31 70  70  ASP ASP I . n 
G 4 32 GLU 32 71  71  GLU GLU I . n 
G 4 33 GLY 33 72  72  GLY GLY I . n 
G 4 34 LYS 34 73  73  LYS LYS I . n 
G 4 35 MET 35 74  74  MET MET I . n 
G 4 36 TYR 36 75  75  TYR TYR I . n 
G 4 37 GLY 37 76  76  GLY GLY I . n 
G 4 38 ARG 38 77  77  ARG ARG I . n 
G 4 39 ASN 39 78  78  ASN ASN I . n 
G 4 40 GLU 40 79  79  GLU GLU I . n 
G 4 41 LEU 41 80  80  LEU LEU I . n 
G 4 42 ILE 42 81  81  ILE ILE I . n 
G 4 43 ALA 43 82  82  ALA ALA I . n 
G 4 44 ARG 44 83  83  ARG ARG I . n 
G 4 45 TYR 45 84  84  TYR TYR I . n 
G 4 46 ILE 46 85  85  ILE ILE I . n 
G 4 47 LYS 47 86  86  LYS LYS I . n 
G 4 48 LEU 48 87  87  LEU LEU I . n 
G 4 49 ARG 49 88  88  ARG ARG I . n 
G 4 50 THR 50 89  89  THR THR I . n 
G 4 51 GLY 51 90  90  GLY GLY I . n 
G 4 52 LYS 52 91  91  LYS LYS I . n 
G 4 53 THR 53 92  92  THR THR I . n 
G 4 54 ARG 54 93  93  ARG ARG I . n 
G 4 55 THR 55 94  94  THR THR I . n 
G 4 56 ARG 56 95  95  ARG ARG I . n 
G 4 57 LYS 57 96  96  LYS LYS I . n 
G 4 58 GLN 58 97  97  GLN GLN I . n 
G 4 59 VAL 59 98  98  VAL VAL I . n 
G 4 60 SER 60 99  99  SER SER I . n 
G 4 61 SER 61 100 100 SER SER I . n 
G 4 62 HIS 62 101 101 HIS HIS I . n 
G 4 63 ILE 63 102 102 ILE ILE I . n 
G 4 64 GLN 64 103 103 GLN GLN I . n 
G 4 65 VAL 65 104 104 VAL VAL I . n 
G 4 66 LEU 66 105 105 LEU LEU I . n 
G 4 67 ALA 67 106 106 ALA ALA I . n 
G 4 68 ARG 68 107 107 ARG ARG I . n 
G 4 69 ARG 69 108 108 ARG ARG I . n 
G 4 70 LYS 70 109 109 LYS LYS I . n 
G 4 71 ALA 71 110 110 ALA ALA I . n 
G 4 72 ARG 72 111 111 ARG ARG I . n 
G 4 73 GLU 73 112 112 GLU GLU I . n 
H 4 1  GLU 1  40  40  GLU GLU N . n 
H 4 2  GLY 2  41  41  GLY GLY N . n 
H 4 3  VAL 3  42  42  VAL VAL N . n 
H 4 4  TRP 4  43  43  TRP TRP N . n 
H 4 5  SER 5  44  44  SER SER N . n 
H 4 6  PRO 6  45  45  PRO PRO N . n 
H 4 7  ASP 7  46  46  ASP ASP N . n 
H 4 8  ILE 8  47  47  ILE ILE N . n 
H 4 9  GLU 9  48  48  GLU GLU N . n 
H 4 10 GLN 10 49  49  GLN GLN N . n 
H 4 11 SER 11 50  50  SER SER N . n 
H 4 12 PHE 12 51  51  PHE PHE N . n 
H 4 13 GLN 13 52  52  GLN GLN N . n 
H 4 14 GLU 14 53  53  GLU GLU N . n 
H 4 15 ALA 15 54  54  ALA ALA N . n 
H 4 16 LEU 16 55  55  LEU LEU N . n 
H 4 17 ALA 17 56  56  ALA ALA N . n 
H 4 18 ILE 18 57  57  ILE ILE N . n 
H 4 19 TYR 19 58  58  TYR TYR N . n 
H 4 20 PRO 20 59  59  PRO PRO N . n 
H 4 21 PRO 21 60  60  PRO PRO N . n 
H 4 22 CYS 22 61  61  CYS CYS N . n 
H 4 23 GLY 23 62  62  GLY GLY N . n 
H 4 24 ARG 24 63  63  ARG ARG N . n 
H 4 25 ARG 25 64  64  ARG ARG N . n 
H 4 26 LYS 26 65  65  LYS LYS N . n 
H 4 27 ILE 27 66  66  ILE ILE N . n 
H 4 28 ILE 28 67  67  ILE ILE N . n 
H 4 29 LEU 29 68  68  LEU LEU N . n 
H 4 30 SER 30 69  69  SER SER N . n 
H 4 31 ASP 31 70  70  ASP ASP N . n 
H 4 32 GLU 32 71  71  GLU GLU N . n 
H 4 33 GLY 33 72  72  GLY GLY N . n 
H 4 34 LYS 34 73  73  LYS LYS N . n 
H 4 35 MET 35 74  74  MET MET N . n 
H 4 36 TYR 36 75  75  TYR TYR N . n 
H 4 37 GLY 37 76  76  GLY GLY N . n 
H 4 38 ARG 38 77  77  ARG ARG N . n 
H 4 39 ASN 39 78  78  ASN ASN N . n 
H 4 40 GLU 40 79  79  GLU GLU N . n 
H 4 41 LEU 41 80  80  LEU LEU N . n 
H 4 42 ILE 42 81  81  ILE ILE N . n 
H 4 43 ALA 43 82  82  ALA ALA N . n 
H 4 44 ARG 44 83  83  ARG ARG N . n 
H 4 45 TYR 45 84  84  TYR TYR N . n 
H 4 46 ILE 46 85  85  ILE ILE N . n 
H 4 47 LYS 47 86  86  LYS LYS N . n 
H 4 48 LEU 48 87  87  LEU LEU N . n 
H 4 49 ARG 49 88  88  ARG ARG N . n 
H 4 50 THR 50 89  89  THR THR N . n 
H 4 51 GLY 51 90  90  GLY GLY N . n 
H 4 52 LYS 52 91  91  LYS LYS N . n 
H 4 53 THR 53 92  92  THR THR N . n 
H 4 54 ARG 54 93  93  ARG ARG N . n 
H 4 55 THR 55 94  94  THR THR N . n 
H 4 56 ARG 56 95  95  ARG ARG N . n 
H 4 57 LYS 57 96  96  LYS LYS N . n 
H 4 58 GLN 58 97  97  GLN GLN N . n 
H 4 59 VAL 59 98  98  VAL VAL N . n 
H 4 60 SER 60 99  99  SER SER N . n 
H 4 61 SER 61 100 100 SER SER N . n 
H 4 62 HIS 62 101 101 HIS HIS N . n 
H 4 63 ILE 63 102 102 ILE ILE N . n 
H 4 64 GLN 64 103 103 GLN GLN N . n 
H 4 65 VAL 65 104 104 VAL VAL N . n 
H 4 66 LEU 66 105 105 LEU LEU N . n 
H 4 67 ALA 67 106 106 ALA ALA N . n 
H 4 68 ARG 68 107 107 ARG ARG N . n 
H 4 69 ARG 69 108 108 ARG ARG N . n 
H 4 70 LYS 70 109 109 LYS LYS N . n 
H 4 71 ALA 71 110 110 ALA ALA N . n 
H 4 72 ARG 72 111 111 ARG ARG N . n 
H 4 73 GLU 73 112 112 GLU GLU N . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 5 HOH 1 301 3  HOH HOH A . 
I 5 HOH 2 302 6  HOH HOH A . 
J 5 HOH 1 101 15 HOH HOH C . 
J 5 HOH 2 102 4  HOH HOH C . 
K 5 HOH 1 101 13 HOH HOH F . 
K 5 HOH 2 102 2  HOH HOH F . 
L 5 HOH 1 301 7  HOH HOH B . 
L 5 HOH 2 302 11 HOH HOH B . 
M 5 HOH 1 101 14 HOH HOH D . 
M 5 HOH 2 102 10 HOH HOH D . 
N 5 HOH 1 101 1  HOH HOH E . 
O 5 HOH 1 201 12 HOH HOH I . 
O 5 HOH 2 202 8  HOH HOH I . 
P 5 HOH 1 201 9  HOH HOH N . 
P 5 HOH 2 202 16 HOH HOH N . 
P 5 HOH 3 203 5  HOH HOH N . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,H,I,J,K,P 
2 1 D,E,F,G,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5480  ? 
1 MORE         -26   ? 
1 'SSA (A^2)'  14300 ? 
2 'ABSA (A^2)' 5280  ? 
2 MORE         -26   ? 
2 'SSA (A^2)'  14310 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2018-05-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0135 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.9    2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22     4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OP1 
_pdbx_validate_close_contact.auth_asym_id_1   C 
_pdbx_validate_close_contact.auth_comp_id_1   DC 
_pdbx_validate_close_contact.auth_seq_id_1    29 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   CG2 
_pdbx_validate_close_contact.auth_asym_id_2   N 
_pdbx_validate_close_contact.auth_comp_id_2   VAL 
_pdbx_validate_close_contact.auth_seq_id_2    42 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.80 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 218 ? ? -132.77 -71.68  
2  1 LEU A 275 ? ? -105.77 66.88   
3  1 ALA A 276 ? ? -137.36 -79.70  
4  1 PRO I 45  ? ? -38.69  -81.51  
5  1 PRO I 59  ? ? -49.14  102.59  
6  1 ARG I 63  ? ? 36.60   -117.09 
7  1 ARG I 64  ? ? 69.87   -83.07  
8  1 SER I 69  ? ? -92.54  59.60   
9  1 ASP I 70  ? ? -120.78 -55.88  
10 1 THR I 92  ? ? -62.60  -72.02  
11 1 ARG I 93  ? ? 51.56   97.07   
12 1 ALA I 110 ? ? -71.53  39.87   
13 1 ARG N 63  ? ? 59.59   -179.63 
14 1 ARG N 64  ? ? 75.76   148.89  
15 1 ILE N 66  ? ? 38.60   39.40   
16 1 GLU N 71  ? ? -107.48 -147.68 
17 1 LYS N 73  ? ? -68.86  94.73   
18 1 THR N 92  ? ? -87.28  -80.38  
19 1 ARG N 93  ? ? 62.27   109.57  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? F HOH 102 ? 9.67 . 
2 1 O ? B HOH 302 ? 8.38 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 I GLU 40 ? G GLU 1 
2 1 Y 1 I GLY 41 ? G GLY 2 
3 1 Y 1 I VAL 42 ? G VAL 3 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5NO6 'double helix'        
5NO6 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DA 1  1_555 B DT 18 1_555 -0.384 -0.252 0.489  0.248   -12.942 -2.724  1  F_DA1:DT37_C  F 1  ? C 37 ? 20 1 
1 C DC 2  1_555 B DG 17 1_555 0.323  -0.158 0.413  -5.214  -11.495 -2.097  2  F_DC2:DG36_C  F 2  ? C 36 ? 19 1 
1 C DT 3  1_555 B DA 16 1_555 -0.678 -0.211 0.887  -8.598  -6.770  -2.051  3  F_DT3:DA35_C  F 3  ? C 35 ? 20 1 
1 C DG 4  1_555 B DC 15 1_555 0.651  5.779  -0.214 9.992   -10.554 -71.615 4  F_DG4:DC34_C  F 4  ? C 34 ? ?  ? 
1 C DG 5  1_555 B DC 14 1_555 0.043  -0.056 0.195  12.632  -10.505 -0.400  5  F_DG5:DC33_C  F 5  ? C 33 ? 19 1 
1 C DA 6  1_555 B DT 13 1_555 -0.405 -0.219 0.093  5.010   -17.231 -0.184  6  F_DA6:DT32_C  F 6  ? C 32 ? 20 1 
1 C DA 7  1_555 B DT 12 1_555 0.317  -0.131 0.616  10.018  -4.859  -0.729  7  F_DA7:DT31_C  F 7  ? C 31 ? 20 1 
1 C DT 8  1_555 B DA 11 1_555 0.238  -0.231 0.552  6.924   -7.096  -1.593  8  F_DT8:DA30_C  F 8  ? C 30 ? 20 1 
1 C DG 9  1_555 B DC 10 1_555 0.158  -0.048 0.057  4.230   -6.609  -0.581  9  F_DG9:DC29_C  F 9  ? C 29 ? 19 1 
1 C DC 10 1_555 B DG 9  1_555 0.459  -0.200 0.447  4.249   -2.790  -1.508  10 F_DC10:DG28_C F 10 ? C 28 ? 19 1 
1 C DA 11 1_555 B DT 8  1_555 0.678  -0.215 0.853  4.156   -3.174  -1.631  11 F_DA11:DT27_C F 11 ? C 27 ? 20 1 
1 C DA 12 1_555 B DT 7  1_555 -0.023 -0.233 0.829  4.548   -1.469  -1.456  12 F_DA12:DT26_C F 12 ? C 26 ? 20 1 
1 C DT 13 1_555 B DA 6  1_555 0.339  -0.282 0.723  5.612   1.289   1.513   13 F_DT13:DA25_C F 13 ? C 25 ? 20 1 
1 C DA 14 1_555 B DT 5  1_555 -0.161 -0.153 0.519  11.578  0.657   1.864   14 F_DA14:DT24_C F 14 ? C 24 ? 20 1 
1 C DA 15 1_555 B DT 4  1_555 -0.014 -0.104 0.058  14.418  -5.107  0.666   15 F_DA15:DT23_C F 15 ? C 23 ? 20 1 
1 C DA 16 1_555 B DT 3  1_555 0.425  -0.135 -0.303 8.909   -13.002 1.279   16 F_DA16:DT22_C F 16 ? C 22 ? 20 1 
1 C DA 17 1_555 B DT 2  1_555 0.113  -0.150 -0.461 2.331   -15.413 2.448   17 F_DA17:DT21_C F 17 ? C 21 ? 20 1 
1 C DT 18 1_555 B DA 1  1_555 0.151  -0.203 -0.461 -4.432  -15.056 2.689   18 F_DT18:DA20_C F 18 ? C 20 ? 20 1 
1 E DA 1  1_555 F DT 18 1_555 -0.051 -0.176 -0.414 5.855   -15.822 1.897   19 D_DA20:DT18_E D 20 ? E 18 ? 20 1 
1 E DT 2  1_555 F DA 17 1_555 0.064  -0.163 -0.382 -1.072  -17.044 1.428   20 D_DT21:DA17_E D 21 ? E 17 ? 20 1 
1 E DT 3  1_555 F DA 16 1_555 -0.691 -0.125 -0.123 -6.198  -16.524 0.174   21 D_DT22:DA16_E D 22 ? E 16 ? 20 1 
1 E DT 4  1_555 F DA 15 1_555 0.042  -0.111 0.060  -12.718 -6.590  1.031   22 D_DT23:DA15_E D 23 ? E 15 ? 20 1 
1 E DT 5  1_555 F DA 14 1_555 0.290  -0.160 0.271  -8.721  3.232   0.358   23 D_DT24:DA14_E D 24 ? E 14 ? 20 1 
1 E DA 6  1_555 F DT 13 1_555 1.004  -0.284 0.853  1.338   -4.198  -1.315  24 D_DA25:DT13_E D 25 ? E 13 ? 20 1 
1 E DT 7  1_555 F DA 12 1_555 -0.150 -0.223 0.792  2.018   -5.843  -2.646  25 D_DT26:DA12_E D 26 ? E 12 ? 20 1 
1 E DT 8  1_555 F DA 11 1_555 -0.083 -0.211 0.740  0.199   -6.734  -3.124  26 D_DT27:DA11_E D 27 ? E 11 ? 20 1 
1 E DG 9  1_555 F DC 10 1_555 -0.133 -0.226 0.887  0.375   -6.247  -3.262  27 D_DG28:DC10_E D 28 ? E 10 ? 19 1 
1 E DC 10 1_555 F DG 9  1_555 -0.047 -0.084 0.342  -0.236  -7.121  -1.956  28 D_DC29:DG9_E  D 29 ? E 9  ? 19 1 
1 E DA 11 1_555 F DT 8  1_555 0.204  -0.119 0.261  -1.668  -6.779  -0.330  29 D_DA30:DT8_E  D 30 ? E 8  ? 20 1 
1 E DT 12 1_555 F DA 7  1_555 -0.308 -0.117 0.289  -5.561  -8.769  -0.155  30 D_DT31:DA7_E  D 31 ? E 7  ? 20 1 
1 E DT 13 1_555 F DA 6  1_555 0.170  -0.193 -0.371 -5.652  -20.369 1.372   31 D_DT32:DA6_E  D 32 ? E 6  ? 20 1 
1 E DC 14 1_555 F DG 5  1_555 -0.040 -0.054 0.138  -16.136 -10.754 -0.046  32 D_DC33:DG5_E  D 33 ? E 5  ? 19 1 
1 E DC 15 1_555 F DG 4  1_555 0.728  -0.214 0.047  -17.509 -1.230  -0.488  33 D_DC34:DG4_E  D 34 ? E 4  ? 19 1 
1 E DA 16 1_555 F DT 3  1_555 0.853  -0.251 0.726  -6.897  -11.634 -5.008  34 D_DA35:DT3_E  D 35 ? E 3  ? 20 1 
1 E DT 18 1_555 F DA 1  1_555 -0.771 -0.023 1.207  21.386  16.055  1.075   35 D_DT37:DA1_E  D 37 ? E 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DA 1  1_555 B DT 18 1_555 C DC 2  1_555 B DG 17 1_555 0.158  -0.544 3.432 -0.245  -0.111  36.549  -0.851  -0.287 3.433 -0.176  
0.391  36.550  1  FF_DA1DC2:DG36DT37_CC   F 1  ? C 37 ? F 2  ? C 36 ? 
1 C DC 2  1_555 B DG 17 1_555 C DT 3  1_555 B DA 16 1_555 1.366  -0.816 3.400 0.255   -0.210  33.469  -1.381  -2.328 3.415 -0.364  
-0.443 33.471  2  FF_DC2DT3:DA35DG36_CC   F 2  ? C 36 ? F 3  ? C 35 ? 
1 C DT 3  1_555 B DA 16 1_555 C DG 4  1_555 B DC 15 1_555 1.184  -2.038 2.913 8.902   1.190   71.963  -1.760  -0.735 2.993 1.009   
-7.546 72.446  3  FF_DT3DG4:DC34DA35_CC   F 3  ? C 35 ? F 4  ? C 34 ? 
1 C DG 4  1_555 B DC 15 1_555 C DG 5  1_555 B DC 14 1_555 -0.077 2.128  3.105 -0.348  2.236   -5.719  -28.988 -2.138 2.110 -21.341 
-3.320 -6.150  4  FF_DG4DG5:DC33DC34_CC   F 4  ? C 34 ? F 5  ? C 33 ? 
1 C DG 5  1_555 B DC 14 1_555 C DA 6  1_555 B DT 13 1_555 -0.508 -0.097 3.289 -0.761  2.286   40.299  -0.400  0.649  3.287 3.314   
1.103  40.368  5  FF_DG5DA6:DT32DC33_CC   F 5  ? C 33 ? F 6  ? C 32 ? 
1 C DA 6  1_555 B DT 13 1_555 C DA 7  1_555 B DT 12 1_555 -0.001 -0.238 2.936 -5.559  -7.136  40.511  0.352   -0.535 2.910 -10.154 
7.910  41.467  6  FF_DA6DA7:DT31DT32_CC   F 6  ? C 32 ? F 7  ? C 31 ? 
1 C DA 7  1_555 B DT 12 1_555 C DT 8  1_555 B DA 11 1_555 0.213  -0.920 3.312 -1.102  -0.257  33.344  -1.560  -0.556 3.311 -0.448  
1.920  33.362  7  FF_DA7DT8:DA30DT31_CC   F 7  ? C 31 ? F 8  ? C 30 ? 
1 C DT 8  1_555 B DA 11 1_555 C DG 9  1_555 B DC 10 1_555 -0.221 -0.715 3.300 -1.365  1.705   34.685  -1.458  0.161  3.268 2.857   
2.287  34.752  8  FF_DT8DG9:DC29DA30_CC   F 8  ? C 30 ? F 9  ? C 29 ? 
1 C DG 9  1_555 B DC 10 1_555 C DC 10 1_555 B DG 9  1_555 -0.241 -0.444 3.328 -1.132  2.295   28.760  -1.407  0.229  3.290 4.609   
2.274  28.871  9  FF_DG9DC10:DG28DC29_CC  F 9  ? C 29 ? F 10 ? C 28 ? 
1 C DC 10 1_555 B DG 9  1_555 C DA 11 1_555 B DT 8  1_555 0.058  0.360  3.367 -1.277  3.970   41.097  0.070   -0.224 3.382 5.637   
1.813  41.299  10 FF_DC10DA11:DT27DG28_CC F 10 ? C 28 ? F 11 ? C 27 ? 
1 C DA 11 1_555 B DT 8  1_555 C DA 12 1_555 B DT 7  1_555 0.230  -0.906 3.144 -0.584  2.426   29.611  -2.250  -0.565 3.057 4.735   
1.140  29.713  11 FF_DA11DA12:DT26DT27_CC F 11 ? C 27 ? F 12 ? C 26 ? 
1 C DA 12 1_555 B DT 7  1_555 C DT 13 1_555 B DA 6  1_555 0.819  -1.470 3.210 -0.406  2.046   31.311  -3.089  -1.588 3.100 3.785   
0.750  31.379  12 FF_DA12DT13:DA25DT26_CC F 12 ? C 26 ? F 13 ? C 25 ? 
1 C DT 13 1_555 B DA 6  1_555 C DA 14 1_555 B DT 5  1_555 -0.577 -1.157 2.968 -0.570  4.402   31.129  -2.866  0.970  2.792 8.151   
1.055  31.436  13 FF_DT13DA14:DT24DA25_CC F 13 ? C 25 ? F 14 ? C 24 ? 
1 C DA 14 1_555 B DT 5  1_555 C DA 15 1_555 B DT 4  1_555 0.140  -0.265 3.420 0.363   1.927   31.482  -0.861  -0.188 3.400 3.548   
-0.668 31.541  14 FF_DA14DA15:DT23DT24_CC F 14 ? C 24 ? F 15 ? C 23 ? 
1 C DA 15 1_555 B DT 4  1_555 C DA 16 1_555 B DT 3  1_555 -0.724 0.423  3.356 0.978   0.274   45.177  0.526   1.032  3.343 0.356   
-1.273 45.188  15 FF_DA15DA16:DT22DT23_CC F 15 ? C 23 ? F 16 ? C 22 ? 
1 C DA 16 1_555 B DT 3  1_555 C DA 17 1_555 B DT 2  1_555 -0.234 -0.289 3.400 0.634   -1.004  35.464  -0.321  0.480  3.402 -1.647  
-1.040 35.483  16 FF_DA16DA17:DT21DT22_CC F 16 ? C 22 ? F 17 ? C 21 ? 
1 C DA 17 1_555 B DT 2  1_555 C DT 18 1_555 B DA 1  1_555 0.186  -0.308 3.460 0.082   -1.853  36.559  -0.220  -0.284 3.471 -2.952  
-0.131 36.604  17 FF_DA17DT18:DA20DT21_CC F 17 ? C 21 ? F 18 ? C 20 ? 
1 C DT 18 1_555 B DA 1  1_555 E DA 1  1_555 F DT 18 1_555 -0.156 0.994  3.327 -0.485  -1.515  -25.640 -1.798  -0.491 3.375 3.410   
-1.092 -25.688 18 FD_DT18DA20:DT18DA20_EC F 18 ? C 20 ? D 20 ? E 18 ? 
1 E DA 1  1_555 F DT 18 1_555 E DT 2  1_555 F DA 17 1_555 -0.662 -0.446 3.346 -0.754  -1.551  37.560  -0.485  0.926  3.373 -2.408  
1.170  37.598  19 DD_DA20DT21:DA17DT18_EE D 20 ? E 18 ? D 21 ? E 17 ? 
1 E DT 2  1_555 F DA 17 1_555 E DT 3  1_555 F DA 16 1_555 -0.065 -0.156 3.376 -1.361  -0.830  34.374  -0.130  -0.109 3.379 -1.404  
2.302  34.410  20 DD_DT21DT22:DA16DA17_EE D 21 ? E 17 ? D 22 ? E 16 ? 
1 E DT 3  1_555 F DA 16 1_555 E DT 4  1_555 F DA 15 1_555 0.772  0.503  3.419 -1.003  1.155   43.011  0.567   -1.156 3.413 1.575   
1.367  43.037  21 DD_DT22DT23:DA15DA16_EE D 22 ? E 16 ? D 23 ? E 15 ? 
1 E DT 4  1_555 F DA 15 1_555 E DT 5  1_555 F DA 14 1_555 -0.123 -0.049 3.344 1.278   2.080   33.968  -0.422  0.417  3.328 3.555   
-2.184 34.053  22 DD_DT23DT24:DA14DA15_EE D 23 ? E 15 ? D 24 ? E 14 ? 
1 E DT 5  1_555 F DA 14 1_555 E DA 6  1_555 F DT 13 1_555 0.809  -1.131 2.605 -0.987  8.359   36.625  -2.583  -1.355 2.279 13.090  
1.546  37.547  23 DD_DT24DA25:DT13DA14_EE D 24 ? E 14 ? D 25 ? E 13 ? 
1 E DA 6  1_555 F DT 13 1_555 E DT 7  1_555 F DA 12 1_555 -0.515 -1.270 3.272 0.877   0.326   26.363  -2.870  1.361  3.238 0.716   
-1.922 26.380  24 DD_DA25DT26:DA12DT13_EE D 25 ? E 13 ? D 26 ? E 12 ? 
1 E DT 7  1_555 F DA 12 1_555 E DT 8  1_555 F DA 11 1_555 0.096  -0.715 3.208 0.772   1.200   32.520  -1.479  -0.039 3.181 2.142   
-1.377 32.551  25 DD_DT26DT27:DA11DA12_EE D 26 ? E 12 ? D 27 ? E 11 ? 
1 E DT 8  1_555 F DA 11 1_555 E DG 9  1_555 F DC 10 1_555 0.012  0.380  3.339 -0.991  2.367   38.173  0.275   -0.146 3.354 3.614   
1.513  38.256  26 DD_DT27DG28:DC10DA11_EE D 27 ? E 11 ? D 28 ? E 10 ? 
1 E DG 9  1_555 F DC 10 1_555 E DC 10 1_555 F DG 9  1_555 0.095  -0.954 3.345 0.842   3.062   31.685  -2.303  -0.018 3.242 5.590   
-1.538 31.840  27 DD_DG28DC29:DG9DC10_EE  D 28 ? E 10 ? D 29 ? E 9  ? 
1 E DC 10 1_555 F DG 9  1_555 E DA 11 1_555 F DT 8  1_555 0.088  -1.105 3.133 1.196   3.682   36.131  -2.256  0.017  3.011 5.916   
-1.921 36.331  28 DD_DC29DA30:DT8DG9_EE   D 29 ? E 9  ? D 30 ? E 8  ? 
1 E DA 11 1_555 F DT 8  1_555 E DT 12 1_555 F DA 7  1_555 -0.413 -1.055 3.408 0.633   -0.768  31.084  -1.815  0.897  3.423 -1.432  
-1.181 31.100  29 DD_DA30DT31:DA7DT8_EE   D 30 ? E 8  ? D 31 ? E 7  ? 
1 E DT 12 1_555 F DA 7  1_555 E DT 13 1_555 F DA 6  1_555 -0.380 -0.264 3.043 5.347   -6.649  41.359  0.270   1.039  2.979 -9.294  
-7.475 42.192  30 DD_DT31DT32:DA6DA7_EE   D 31 ? E 7  ? D 32 ? E 6  ? 
1 E DT 13 1_555 F DA 6  1_555 E DC 14 1_555 F DG 5  1_555 0.097  -0.039 3.502 -1.590  0.151   39.356  -0.077  -0.345 3.496 0.224   
2.360  39.387  31 DD_DT32DC33:DG5DA6_EE   D 32 ? E 6  ? D 33 ? E 5  ? 
1 E DC 14 1_555 F DG 5  1_555 E DC 15 1_555 F DG 4  1_555 0.015  -0.431 3.394 0.294   1.433   35.654  -0.918  0.020  3.375 2.339   
-0.480 35.683  32 DD_DC33DC34:DG4DG5_EE   D 33 ? E 5  ? D 34 ? E 4  ? 
1 E DC 15 1_555 F DG 4  1_555 E DA 16 1_555 F DT 3  1_555 0.011  0.477  3.325 -5.311  9.608   32.603  -0.755  -0.882 3.288 16.541  
9.142  34.354  33 DD_DC34DA35:DT3DG4_EE   D 34 ? E 4  ? D 35 ? E 3  ? 
1 E DA 16 1_555 F DT 3  1_555 E DT 18 1_555 F DA 1  1_555 -0.260 -0.822 6.759 -10.562 -12.592 57.453  0.508   -0.859 6.741 -12.813 
10.748 59.564  34 DD_DA35DT37:DA1DT3_EE   D 35 ? E 3  ? D 37 ? E 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#