data_5NPK
# 
_entry.id   5NPK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5NPK         
WWPDB D_1200004479 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5NPK 
_pdbx_database_status.recvd_initial_deposition_date   2017-04-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bax, B.D.'       1 ? 
'Chan, P.F.'      2 ? 
'Stavenger, R.A.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                E4492 
_citation.page_last                 E4500 
_citation.title                     
'Thiophene antibacterials that allosterically stabilize DNA-cleavage complexes with DNA gyrase.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1700721114 
_citation.pdbx_database_id_PubMed   28507124 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chan, P.F.'         1  ? 
primary 'Germe, T.'          2  ? 
primary 'Bax, B.D.'          3  ? 
primary 'Huang, J.'          4  ? 
primary 'Thalji, R.K.'       5  ? 
primary 'Bacque, E.'         6  ? 
primary 'Checchia, A.'       7  ? 
primary 'Chen, D.'           8  ? 
primary 'Cui, H.'            9  ? 
primary 'Ding, X.'           10 ? 
primary 'Ingraham, K.'       11 ? 
primary 'McCloskey, L.'      12 ? 
primary 'Raha, K.'           13 ? 
primary 'Srikannathasan, V.' 14 ? 
primary 'Maxwell, A.'        15 ? 
primary 'Stavenger, R.A.'    16 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.050 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5NPK 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     89.442 
_cell.length_a_esd                 ? 
_cell.length_b                     120.680 
_cell.length_b_esd                 ? 
_cell.length_c                     168.899 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5NPK 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B,DNA gyrase subunit A'                                     78109.000 
4    5.99.1.3,5.99.1.3,5.99.1.3 ? ? ? 
2  polymer     man 
;DNA (5'-D(*AP*GP*CP*CP*GP*TP*AP*GP*GP*TP*AP*CP*CP*TP*AP*CP*GP*GP*CP*T)-3')
;
6134.967  4    ?                          ? ? ? 
3  non-polymer syn 'MANGANESE (II) ION'                                                                                 54.938    
5    ?                          ? ? ? 
4  non-polymer syn '~{N}-[(1~{R})-2-azanyl-1-phenyl-ethyl]-4-(1~{H}-pyrrolo[2,3-b]pyridin-3-yl)thiophene-2-carboxamide' 362.448   
6    ?                          ? ? ? 
5  non-polymer syn GLYCEROL                                                                                             92.094    
13   ?                          ? ? ? 
6  non-polymer syn 'CHLORIDE ION'                                                                                       35.453    
1    ?                          ? ? ? 
7  non-polymer syn 'SULFATE ION'                                                                                        96.063    
1    ?                          ? ? ? 
8  non-polymer syn 'SODIUM ION'                                                                                         22.990    
1    ?                          ? ? ? 
9  non-polymer syn '~{N}-[(1~{S})-2-azanyl-1-phenyl-ethyl]-4-(1~{H}-pyrrolo[2,3-b]pyridin-3-yl)thiophene-2-carboxamide' 362.448   
2    ?                          ? ? ? 
10 water       nat water                                                                                                18.015    
2664 ?                          ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTG
IGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRA
LLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDFAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVR
DGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAA
AMRFTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLS
KNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAE
LVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQ
KTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERD
KIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLG
;
;MDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTG
IGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRA
LLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDFAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVR
DGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAA
AMRFTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLS
KNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAE
LVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQ
KTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERD
KIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLG
;
B,D,b,d ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DC)(DG)(DT)(DA)(DG)(DG)(DT)(DA)(DC)(DC)(DT)(DA)(DC)(DG)(DG)(DC)(DT)' 
AGCCGTAGGTACCTACGGCT E,F,e,f ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   VAL n 
1 4   ALA n 
1 5   SER n 
1 6   LEU n 
1 7   PRO n 
1 8   GLY n 
1 9   LYS n 
1 10  LEU n 
1 11  ALA n 
1 12  ASP n 
1 13  CYS n 
1 14  SER n 
1 15  SER n 
1 16  LYS n 
1 17  SER n 
1 18  PRO n 
1 19  GLU n 
1 20  GLU n 
1 21  CYS n 
1 22  GLU n 
1 23  ILE n 
1 24  PHE n 
1 25  LEU n 
1 26  VAL n 
1 27  GLU n 
1 28  GLY n 
1 29  ASP n 
1 30  SER n 
1 31  ALA n 
1 32  GLY n 
1 33  GLY n 
1 34  SER n 
1 35  THR n 
1 36  LYS n 
1 37  SER n 
1 38  GLY n 
1 39  ARG n 
1 40  ASP n 
1 41  SER n 
1 42  ARG n 
1 43  THR n 
1 44  GLN n 
1 45  ALA n 
1 46  ILE n 
1 47  LEU n 
1 48  PRO n 
1 49  LEU n 
1 50  ARG n 
1 51  GLY n 
1 52  LYS n 
1 53  ILE n 
1 54  LEU n 
1 55  ASN n 
1 56  VAL n 
1 57  GLU n 
1 58  LYS n 
1 59  ALA n 
1 60  ARG n 
1 61  LEU n 
1 62  ASP n 
1 63  ARG n 
1 64  ILE n 
1 65  LEU n 
1 66  ASN n 
1 67  ASN n 
1 68  ASN n 
1 69  GLU n 
1 70  ILE n 
1 71  ARG n 
1 72  GLN n 
1 73  MET n 
1 74  ILE n 
1 75  THR n 
1 76  ALA n 
1 77  PHE n 
1 78  GLY n 
1 79  THR n 
1 80  GLY n 
1 81  ILE n 
1 82  GLY n 
1 83  GLY n 
1 84  ASP n 
1 85  PHE n 
1 86  ASP n 
1 87  LEU n 
1 88  ALA n 
1 89  LYS n 
1 90  ALA n 
1 91  ARG n 
1 92  TYR n 
1 93  HIS n 
1 94  LYS n 
1 95  ILE n 
1 96  VAL n 
1 97  ILE n 
1 98  MET n 
1 99  THR n 
1 100 ASP n 
1 101 ALA n 
1 102 ASP n 
1 103 VAL n 
1 104 ASP n 
1 105 GLY n 
1 106 ALA n 
1 107 HIS n 
1 108 ILE n 
1 109 ARG n 
1 110 THR n 
1 111 LEU n 
1 112 LEU n 
1 113 LEU n 
1 114 THR n 
1 115 PHE n 
1 116 PHE n 
1 117 TYR n 
1 118 ARG n 
1 119 PHE n 
1 120 MET n 
1 121 ARG n 
1 122 PRO n 
1 123 LEU n 
1 124 ILE n 
1 125 GLU n 
1 126 ALA n 
1 127 GLY n 
1 128 TYR n 
1 129 VAL n 
1 130 TYR n 
1 131 ILE n 
1 132 ALA n 
1 133 GLN n 
1 134 PRO n 
1 135 PRO n 
1 136 THR n 
1 137 GLY n 
1 138 TYR n 
1 139 LYS n 
1 140 GLY n 
1 141 LEU n 
1 142 GLY n 
1 143 GLU n 
1 144 MET n 
1 145 ASN n 
1 146 ALA n 
1 147 ASP n 
1 148 GLN n 
1 149 LEU n 
1 150 TRP n 
1 151 GLU n 
1 152 THR n 
1 153 THR n 
1 154 MET n 
1 155 ASN n 
1 156 PRO n 
1 157 GLU n 
1 158 HIS n 
1 159 ARG n 
1 160 ALA n 
1 161 LEU n 
1 162 LEU n 
1 163 GLN n 
1 164 VAL n 
1 165 LYS n 
1 166 LEU n 
1 167 GLU n 
1 168 ASP n 
1 169 ALA n 
1 170 ILE n 
1 171 GLU n 
1 172 ALA n 
1 173 ASP n 
1 174 GLN n 
1 175 THR n 
1 176 PHE n 
1 177 GLU n 
1 178 MET n 
1 179 LEU n 
1 180 MET n 
1 181 GLY n 
1 182 ASP n 
1 183 VAL n 
1 184 VAL n 
1 185 GLU n 
1 186 ASN n 
1 187 ARG n 
1 188 ARG n 
1 189 GLN n 
1 190 PHE n 
1 191 ILE n 
1 192 GLU n 
1 193 ASP n 
1 194 ASN n 
1 195 ALA n 
1 196 VAL n 
1 197 TYR n 
1 198 ALA n 
1 199 ASN n 
1 200 LEU n 
1 201 ASP n 
1 202 PHE n 
1 203 ALA n 
1 204 GLU n 
1 205 LEU n 
1 206 PRO n 
1 207 GLN n 
1 208 SER n 
1 209 ARG n 
1 210 ILE n 
1 211 ASN n 
1 212 GLU n 
1 213 ARG n 
1 214 ASN n 
1 215 ILE n 
1 216 THR n 
1 217 SER n 
1 218 GLU n 
1 219 MET n 
1 220 ARG n 
1 221 GLU n 
1 222 SER n 
1 223 PHE n 
1 224 LEU n 
1 225 ASP n 
1 226 TYR n 
1 227 ALA n 
1 228 MET n 
1 229 SER n 
1 230 VAL n 
1 231 ILE n 
1 232 VAL n 
1 233 ALA n 
1 234 ARG n 
1 235 ALA n 
1 236 LEU n 
1 237 PRO n 
1 238 ASP n 
1 239 VAL n 
1 240 ARG n 
1 241 ASP n 
1 242 GLY n 
1 243 LEU n 
1 244 LYS n 
1 245 PRO n 
1 246 VAL n 
1 247 HIS n 
1 248 ARG n 
1 249 ARG n 
1 250 ILE n 
1 251 LEU n 
1 252 TYR n 
1 253 GLY n 
1 254 LEU n 
1 255 ASN n 
1 256 GLU n 
1 257 GLN n 
1 258 GLY n 
1 259 MET n 
1 260 THR n 
1 261 PRO n 
1 262 ASP n 
1 263 LYS n 
1 264 SER n 
1 265 TYR n 
1 266 LYS n 
1 267 LYS n 
1 268 SER n 
1 269 ALA n 
1 270 ARG n 
1 271 ILE n 
1 272 VAL n 
1 273 GLY n 
1 274 ASP n 
1 275 VAL n 
1 276 MET n 
1 277 GLY n 
1 278 LYS n 
1 279 TYR n 
1 280 HIS n 
1 281 PRO n 
1 282 HIS n 
1 283 GLY n 
1 284 ASP n 
1 285 SER n 
1 286 SER n 
1 287 ILE n 
1 288 TYR n 
1 289 GLU n 
1 290 ALA n 
1 291 MET n 
1 292 VAL n 
1 293 ARG n 
1 294 MET n 
1 295 ALA n 
1 296 GLN n 
1 297 ASP n 
1 298 PHE n 
1 299 SER n 
1 300 TYR n 
1 301 ARG n 
1 302 TYR n 
1 303 PRO n 
1 304 LEU n 
1 305 VAL n 
1 306 ASP n 
1 307 GLY n 
1 308 GLN n 
1 309 GLY n 
1 310 ASN n 
1 311 PHE n 
1 312 GLY n 
1 313 SER n 
1 314 MET n 
1 315 ASP n 
1 316 GLY n 
1 317 ASP n 
1 318 GLY n 
1 319 ALA n 
1 320 ALA n 
1 321 ALA n 
1 322 MET n 
1 323 ARG n 
1 324 PHE n 
1 325 THR n 
1 326 GLU n 
1 327 ALA n 
1 328 ARG n 
1 329 MET n 
1 330 THR n 
1 331 LYS n 
1 332 ILE n 
1 333 THR n 
1 334 LEU n 
1 335 GLU n 
1 336 LEU n 
1 337 LEU n 
1 338 ARG n 
1 339 ASP n 
1 340 ILE n 
1 341 ASN n 
1 342 LYS n 
1 343 ASP n 
1 344 THR n 
1 345 ILE n 
1 346 ASP n 
1 347 PHE n 
1 348 ILE n 
1 349 ASP n 
1 350 ASN n 
1 351 TYR n 
1 352 ASP n 
1 353 GLY n 
1 354 ASN n 
1 355 GLU n 
1 356 ARG n 
1 357 GLU n 
1 358 PRO n 
1 359 SER n 
1 360 VAL n 
1 361 LEU n 
1 362 PRO n 
1 363 ALA n 
1 364 ARG n 
1 365 PHE n 
1 366 PRO n 
1 367 ASN n 
1 368 LEU n 
1 369 LEU n 
1 370 ALA n 
1 371 ASN n 
1 372 GLY n 
1 373 ALA n 
1 374 SER n 
1 375 GLY n 
1 376 ILE n 
1 377 ALA n 
1 378 VAL n 
1 379 GLY n 
1 380 MET n 
1 381 ALA n 
1 382 THR n 
1 383 ASN n 
1 384 ILE n 
1 385 PRO n 
1 386 PRO n 
1 387 HIS n 
1 388 ASN n 
1 389 LEU n 
1 390 THR n 
1 391 GLU n 
1 392 LEU n 
1 393 ILE n 
1 394 ASN n 
1 395 GLY n 
1 396 VAL n 
1 397 LEU n 
1 398 SER n 
1 399 LEU n 
1 400 SER n 
1 401 LYS n 
1 402 ASN n 
1 403 PRO n 
1 404 ASP n 
1 405 ILE n 
1 406 SER n 
1 407 ILE n 
1 408 ALA n 
1 409 GLU n 
1 410 LEU n 
1 411 MET n 
1 412 GLU n 
1 413 ASP n 
1 414 ILE n 
1 415 GLU n 
1 416 GLY n 
1 417 PRO n 
1 418 ASP n 
1 419 PHE n 
1 420 PRO n 
1 421 THR n 
1 422 ALA n 
1 423 GLY n 
1 424 LEU n 
1 425 ILE n 
1 426 LEU n 
1 427 GLY n 
1 428 LYS n 
1 429 SER n 
1 430 GLY n 
1 431 ILE n 
1 432 ARG n 
1 433 ARG n 
1 434 ALA n 
1 435 TYR n 
1 436 GLU n 
1 437 THR n 
1 438 GLY n 
1 439 ARG n 
1 440 GLY n 
1 441 SER n 
1 442 ILE n 
1 443 GLN n 
1 444 MET n 
1 445 ARG n 
1 446 SER n 
1 447 ARG n 
1 448 ALA n 
1 449 VAL n 
1 450 ILE n 
1 451 GLU n 
1 452 GLU n 
1 453 ARG n 
1 454 GLY n 
1 455 GLY n 
1 456 GLY n 
1 457 ARG n 
1 458 GLN n 
1 459 ARG n 
1 460 ILE n 
1 461 VAL n 
1 462 VAL n 
1 463 THR n 
1 464 GLU n 
1 465 ILE n 
1 466 PRO n 
1 467 PHE n 
1 468 GLN n 
1 469 VAL n 
1 470 ASN n 
1 471 LYS n 
1 472 ALA n 
1 473 ARG n 
1 474 MET n 
1 475 ILE n 
1 476 GLU n 
1 477 LYS n 
1 478 ILE n 
1 479 ALA n 
1 480 GLU n 
1 481 LEU n 
1 482 VAL n 
1 483 ARG n 
1 484 ASP n 
1 485 LYS n 
1 486 LYS n 
1 487 ILE n 
1 488 ASP n 
1 489 GLY n 
1 490 ILE n 
1 491 THR n 
1 492 ASP n 
1 493 LEU n 
1 494 ARG n 
1 495 ASP n 
1 496 GLU n 
1 497 THR n 
1 498 SER n 
1 499 LEU n 
1 500 ARG n 
1 501 THR n 
1 502 GLY n 
1 503 VAL n 
1 504 ARG n 
1 505 VAL n 
1 506 VAL n 
1 507 ILE n 
1 508 ASP n 
1 509 VAL n 
1 510 ARG n 
1 511 LYS n 
1 512 ASP n 
1 513 ALA n 
1 514 ASN n 
1 515 ALA n 
1 516 SER n 
1 517 VAL n 
1 518 ILE n 
1 519 LEU n 
1 520 ASN n 
1 521 ASN n 
1 522 LEU n 
1 523 TYR n 
1 524 LYS n 
1 525 GLN n 
1 526 THR n 
1 527 PRO n 
1 528 LEU n 
1 529 GLN n 
1 530 THR n 
1 531 SER n 
1 532 PHE n 
1 533 GLY n 
1 534 VAL n 
1 535 ASN n 
1 536 MET n 
1 537 ILE n 
1 538 ALA n 
1 539 LEU n 
1 540 VAL n 
1 541 ASN n 
1 542 GLY n 
1 543 ARG n 
1 544 PRO n 
1 545 LYS n 
1 546 LEU n 
1 547 ILE n 
1 548 ASN n 
1 549 LEU n 
1 550 LYS n 
1 551 GLU n 
1 552 ALA n 
1 553 LEU n 
1 554 VAL n 
1 555 HIS n 
1 556 TYR n 
1 557 LEU n 
1 558 GLU n 
1 559 HIS n 
1 560 GLN n 
1 561 LYS n 
1 562 THR n 
1 563 VAL n 
1 564 VAL n 
1 565 ARG n 
1 566 ARG n 
1 567 ARG n 
1 568 THR n 
1 569 GLN n 
1 570 TYR n 
1 571 ASN n 
1 572 LEU n 
1 573 ARG n 
1 574 LYS n 
1 575 ALA n 
1 576 LYS n 
1 577 ASP n 
1 578 ARG n 
1 579 ALA n 
1 580 HIS n 
1 581 ILE n 
1 582 LEU n 
1 583 GLU n 
1 584 GLY n 
1 585 LEU n 
1 586 ARG n 
1 587 ILE n 
1 588 ALA n 
1 589 LEU n 
1 590 ASP n 
1 591 HIS n 
1 592 ILE n 
1 593 ASP n 
1 594 GLU n 
1 595 ILE n 
1 596 ILE n 
1 597 SER n 
1 598 THR n 
1 599 ILE n 
1 600 ARG n 
1 601 GLU n 
1 602 SER n 
1 603 ASP n 
1 604 THR n 
1 605 ASP n 
1 606 LYS n 
1 607 VAL n 
1 608 ALA n 
1 609 MET n 
1 610 GLU n 
1 611 SER n 
1 612 LEU n 
1 613 GLN n 
1 614 GLN n 
1 615 ARG n 
1 616 PHE n 
1 617 LYS n 
1 618 LEU n 
1 619 SER n 
1 620 GLU n 
1 621 LYS n 
1 622 GLN n 
1 623 ALA n 
1 624 GLN n 
1 625 ALA n 
1 626 ILE n 
1 627 LEU n 
1 628 ASP n 
1 629 MET n 
1 630 ARG n 
1 631 LEU n 
1 632 ARG n 
1 633 ARG n 
1 634 LEU n 
1 635 THR n 
1 636 GLY n 
1 637 LEU n 
1 638 GLU n 
1 639 ARG n 
1 640 ASP n 
1 641 LYS n 
1 642 ILE n 
1 643 GLU n 
1 644 ALA n 
1 645 GLU n 
1 646 TYR n 
1 647 ASN n 
1 648 GLU n 
1 649 LEU n 
1 650 LEU n 
1 651 ASN n 
1 652 TYR n 
1 653 ILE n 
1 654 SER n 
1 655 GLU n 
1 656 LEU n 
1 657 GLU n 
1 658 THR n 
1 659 ILE n 
1 660 LEU n 
1 661 ALA n 
1 662 ASP n 
1 663 GLU n 
1 664 GLU n 
1 665 VAL n 
1 666 LEU n 
1 667 LEU n 
1 668 GLN n 
1 669 LEU n 
1 670 VAL n 
1 671 ARG n 
1 672 ASP n 
1 673 GLU n 
1 674 LEU n 
1 675 THR n 
1 676 GLU n 
1 677 ILE n 
1 678 ARG n 
1 679 ASP n 
1 680 ARG n 
1 681 PHE n 
1 682 GLY n 
1 683 ASP n 
1 684 ASP n 
1 685 ARG n 
1 686 ARG n 
1 687 THR n 
1 688 GLU n 
1 689 ILE n 
1 690 GLN n 
1 691 LEU n 
1 692 GLY n 
2 1   DA  n 
2 2   DG  n 
2 3   DC  n 
2 4   DC  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DT  n 
2 11  DA  n 
2 12  DC  n 
2 13  DC  n 
2 14  DT  n 
2 15  DA  n 
2 16  DC  n 
2 17  DG  n 
2 18  DG  n 
2 19  DC  n 
2 20  DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   137 ? ? 'gyrB, SA0005' ? N315 ? ? ? ? 'Staphylococcus aureus' 158879 ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 138 200 ? ? 'gyrB, SA0005' ? N315 ? ? ? ? 'Staphylococcus aureus' 158879 ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 3 sample 'Biological sequence' 201 692 ? ? 'gyrA, SA0006' ? N315 ? ? ? ? 'Staphylococcus aureus' 158879 ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   20  ? ? ?              ? ?    ? ? ? ? 'synthetic construct'   32630  ? ? ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GYRB_STAAN P66937 ? 1 
;DVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGI
GGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
410 
2 UNP GYRB_STAAN P66937 ? 1 YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANL 580 
3 UNP GYRA_STAAN Q99XG5 ? 1 
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
2   
4 PDB 5NPK       5NPK   ? 2 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5NPK B 2   ? 135 ? P66937 410 ? 543 ? 410  543  
2  2 5NPK B 138 ? 200 ? P66937 580 ? 642 ? 580  999  
3  3 5NPK B 203 ? 692 ? Q99XG5 2   ? 491 ? 1002 1491 
4  1 5NPK D 2   ? 135 ? P66937 410 ? 543 ? 410  543  
5  2 5NPK D 138 ? 200 ? P66937 580 ? 642 ? 580  642  
6  3 5NPK D 203 ? 692 ? Q99XG5 2   ? 491 ? 1002 1491 
7  4 5NPK E 1   ? 20  ? 5NPK   -8  ? 12  ? -8   12   
8  4 5NPK F 1   ? 20  ? 5NPK   -8  ? 12  ? -8   12   
9  1 5NPK b 2   ? 135 ? P66937 410 ? 543 ? 410  543  
10 2 5NPK b 138 ? 200 ? P66937 580 ? 642 ? 580  642  
11 3 5NPK b 203 ? 692 ? Q99XG5 2   ? 491 ? 1002 1491 
12 1 5NPK d 2   ? 135 ? P66937 410 ? 543 ? 410  543  
13 2 5NPK d 138 ? 200 ? P66937 580 ? 642 ? 580  999  
14 3 5NPK d 203 ? 692 ? Q99XG5 2   ? 491 ? 1002 1491 
15 4 5NPK e 1   ? 20  ? 5NPK   -8  ? 12  ? -8   12   
16 4 5NPK f 1   ? 20  ? 5NPK   -8  ? 12  ? -8   12   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5NPK MET B 1   ? UNP P66937 ?   ?   'initiating methionine' 409  1  
1  5NPK THR B 136 ? UNP P66937 ?   ?   linker                  544  2  
1  5NPK GLY B 137 ? UNP P66937 ?   ?   linker                  545  3  
2  5NPK ASP B 201 ? UNP P66937 ?   ?   linker                  1000 4  
2  5NPK PHE B 202 ? UNP P66937 ?   ?   linker                  1001 5  
3  5NPK PHE B 324 ? UNP Q99XG5 TYR 123 'engineered mutation'   1123 6  
4  5NPK MET D 1   ? UNP P66937 ?   ?   'initiating methionine' 409  7  
4  5NPK THR D 136 ? UNP P66937 ?   ?   linker                  544  8  
4  5NPK GLY D 137 ? UNP P66937 ?   ?   linker                  545  9  
5  5NPK ASP D 201 ? UNP P66937 ?   ?   linker                  1000 10 
5  5NPK PHE D 202 ? UNP P66937 ?   ?   linker                  1001 11 
6  5NPK PHE D 324 ? UNP Q99XG5 TYR 123 'engineered mutation'   1123 12 
9  5NPK MET b 1   ? UNP P66937 ?   ?   'initiating methionine' 409  13 
9  5NPK THR b 136 ? UNP P66937 ?   ?   linker                  544  14 
9  5NPK GLY b 137 ? UNP P66937 ?   ?   linker                  545  15 
10 5NPK ASP b 201 ? UNP P66937 ?   ?   linker                  1000 16 
10 5NPK PHE b 202 ? UNP P66937 ?   ?   linker                  1001 17 
11 5NPK PHE b 324 ? UNP Q99XG5 TYR 123 'engineered mutation'   1123 18 
12 5NPK MET d 1   ? UNP P66937 ?   ?   'initiating methionine' 409  19 
12 5NPK THR d 136 ? UNP P66937 ?   ?   linker                  544  20 
12 5NPK GLY d 137 ? UNP P66937 ?   ?   linker                  545  21 
13 5NPK ASP d 201 ? UNP P66937 ?   ?   linker                  1000 22 
13 5NPK PHE d 202 ? UNP P66937 ?   ?   linker                  1001 23 
14 5NPK PHE d 324 ? UNP Q99XG5 TYR 123 'engineered mutation'   1123 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
94H non-polymer         . '~{N}-[(1~{R})-2-azanyl-1-phenyl-ethyl]-4-(1~{H}-pyrrolo[2,3-b]pyridin-3-yl)thiophene-2-carboxamide' ? 
'C20 H18 N4 O S'  362.448 
9JN non-polymer         . '~{N}-[(1~{S})-2-azanyl-1-phenyl-ethyl]-4-(1~{H}-pyrrolo[2,3-b]pyridin-3-yl)thiophene-2-carboxamide' ? 
'C20 H18 N4 O S'  362.448 
ALA 'L-peptide linking' y ALANINE                                                                                              ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                             ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                           ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                      ? 
'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                                                       ? 
'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                                             ? 
'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                                 ? 
'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                                  ? 
'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                                 ? 
'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                         ? 
'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                            ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                      ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                              ? 
'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL                                                                                             
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                            ? 
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                                ? 
'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                           ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                              ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                               ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                           ? 
'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                                                                 ? 
'Mn 2'            54.938  
NA  non-polymer         . 'SODIUM ION'                                                                                         ? 
'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                        ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                              ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                               ? 
'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                                        ? 
'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                                                                            ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                           ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                             ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                               ? 
'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5NPK 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.76 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.45 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '11 % PEG 5000 MME, 150 mM Bis-Tris pH 6.2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-12-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5NPK 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.980 
_reflns.d_resolution_low                 19.970 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       245600 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.700 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.600 
_reflns.pdbx_Rmerge_I_obs                0.069 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             3 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.082 
_reflns.pdbx_Rpim_I_all                  0.043 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         891144 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.980 
_reflns_shell.d_res_low                   2.010 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        89.900 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.673 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.500 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.866 
_reflns_shell.pdbx_Rpim_I_all             0.533 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.542 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -13.6000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            2.9100 
_refine.aniso_B[2][2]                            23.2900 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -9.6900 
_refine.B_iso_max                                207.010 
_refine.B_iso_mean                               37.5770 
_refine.B_iso_min                                15.830 
_refine.correlation_coeff_Fo_to_Fc               0.9720 
_refine.correlation_coeff_Fo_to_Fc_free          0.9600 
_refine.details                                  'U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5NPK 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.9800 
_refine.ls_d_res_low                             19.9700 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     233267 
_refine.ls_number_reflns_R_free                  12302 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.4700 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1552 
_refine.ls_R_factor_R_free                       0.1832 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1538 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.0310 
_refine.pdbx_overall_ESU_R_Free                  0.0270 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             4.5110 
_refine.overall_SU_ML                            0.0710 
_refine.overall_SU_R_Cruickshank_DPI             0.0306 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.9800 
_refine_hist.d_res_low                        19.9700 
_refine_hist.pdbx_number_atoms_ligand         304 
_refine_hist.number_atoms_solvent             2683 
_refine_hist.number_atoms_total               25630 
_refine_hist.pdbx_number_residues_total       2767 
_refine_hist.pdbx_B_iso_mean_ligand           43.18 
_refine_hist.pdbx_B_iso_mean_solvent          45.70 
_refine_hist.pdbx_number_atoms_protein        21160 
_refine_hist.pdbx_number_atoms_nucleic_acid   1483 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.019  0.019  24907 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 1.894  1.913  34073 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 5.524  5.000  2904  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 32.515 23.443 1121  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 13.678 15.000 4207  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 18.685 15.000 265   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.107  0.200  3688  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.010  0.021  18853 ? r_gen_planes_refined   ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.9780 
_refine_ls_shell.d_res_low                        2.0290 
_refine_ls_shell.number_reflns_all                15866 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             767 
_refine_ls_shell.number_reflns_R_work             15099 
_refine_ls_shell.percent_reflns_obs               86.9600 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2750 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2480 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5NPK 
_struct.title                        '1.98A STRUCTURE OF THIOPHENE1 WITH S.AUREUS DNA GYRASE AND DNA' 
_struct.pdbx_descriptor              'DNA Gyrase Subunit B (GyrB), DNA gyrase subunit A/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5NPK 
_struct_keywords.text            'TYPE IIA TOPOISOMERASE, ANTIBACTERIAL, INHIBITOR, ISOMERASE' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 2  ? 
E  N N 1  ? 
F  N N 1  ? 
G  N N 2  ? 
H  N N 2  ? 
I  N N 3  ? 
J  N N 4  ? 
K  N N 5  ? 
L  N N 5  ? 
M  N N 5  ? 
N  N N 4  ? 
O  N N 3  ? 
P  N N 5  ? 
Q  N N 4  ? 
R  N N 5  ? 
S  N N 5  ? 
T  N N 5  ? 
U  N N 6  ? 
V  N N 3  ? 
W  N N 4  ? 
X  N N 5  ? 
Y  N N 5  ? 
Z  N N 5  ? 
AA N N 7  ? 
BA N N 8  ? 
CA N N 9  ? 
DA N N 4  ? 
EA N N 3  ? 
FA N N 4  ? 
GA N N 5  ? 
HA N N 5  ? 
IA N N 3  ? 
JA N N 9  ? 
KA N N 5  ? 
LA N N 10 ? 
MA N N 10 ? 
NA N N 10 ? 
OA N N 10 ? 
PA N N 10 ? 
QA N N 10 ? 
RA N N 10 ? 
SA N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 17  ? GLU A 20  ? SER B 425  GLU B 428  5 ? 4  
HELX_P HELX_P2   AA2 GLY A 28  ? ARG A 39  ? GLY B 436  ARG B 447  1 ? 12 
HELX_P HELX_P3   AA3 ARG A 60  ? ASN A 66  ? ARG B 468  ASN B 474  1 ? 7  
HELX_P HELX_P4   AA4 ASN A 67  ? GLY A 78  ? ASN B 475  GLY B 486  1 ? 12 
HELX_P HELX_P5   AA5 ILE A 81  ? PHE A 85  ? ILE B 489  PHE B 493  5 ? 5  
HELX_P HELX_P6   AA6 ASP A 86  ? ALA A 90  ? ASP B 494  ALA B 498  5 ? 5  
HELX_P HELX_P7   AA7 ASP A 102 ? MET A 120 ? ASP B 510  MET B 528  1 ? 19 
HELX_P HELX_P8   AA8 MET A 120 ? ALA A 126 ? MET B 528  ALA B 534  1 ? 7  
HELX_P HELX_P9   AA9 GLY A 140 ? MET A 144 ? GLY B 582  MET B 586  5 ? 5  
HELX_P HELX_P10  AB1 ASN A 145 ? MET A 154 ? ASN B 587  MET B 596  1 ? 10 
HELX_P HELX_P11  AB2 ASP A 168 ? GLY A 181 ? ASP B 610  GLY B 623  1 ? 14 
HELX_P HELX_P12  AB3 VAL A 183 ? ALA A 195 ? VAL B 625  ALA B 637  1 ? 13 
HELX_P HELX_P13  AB4 VAL A 196 ? ALA A 198 ? VAL B 638  ALA B 640  5 ? 3  
HELX_P HELX_P14  AB5 ILE A 215 ? ARG A 234 ? ILE B 1014 ARG B 1033 1 ? 20 
HELX_P HELX_P15  AB6 LYS A 244 ? GLN A 257 ? LYS B 1043 GLN B 1056 1 ? 14 
HELX_P HELX_P16  AB7 SER A 268 ? TYR A 279 ? SER B 1067 TYR B 1078 1 ? 12 
HELX_P HELX_P17  AB8 GLY A 283 ? ALA A 295 ? GLY B 1082 ALA B 1094 1 ? 13 
HELX_P HELX_P18  AB9 ILE A 332 ? ARG A 338 ? ILE B 1131 ARG B 1137 1 ? 7  
HELX_P HELX_P19  AC1 PRO A 366 ? GLY A 372 ? PRO B 1165 GLY B 1171 1 ? 7  
HELX_P HELX_P20  AC2 ASN A 388 ? LYS A 401 ? ASN B 1187 LYS B 1200 1 ? 14 
HELX_P HELX_P21  AC3 SER A 406 ? MET A 411 ? SER B 1205 MET B 1210 1 ? 6  
HELX_P HELX_P22  AC4 LYS A 428 ? GLY A 438 ? LYS B 1227 GLY B 1237 1 ? 11 
HELX_P HELX_P23  AC5 GLY A 454 ? GLY A 456 ? GLY B 1253 GLY B 1255 5 ? 3  
HELX_P HELX_P24  AC6 ASN A 470 ? ASP A 484 ? ASN B 1269 ASP B 1283 1 ? 15 
HELX_P HELX_P25  AC7 ASN A 514 ? THR A 526 ? ASN B 1313 THR B 1325 1 ? 13 
HELX_P HELX_P26  AC8 ASN A 548 ? HIS A 591 ? ASN B 1347 HIS B 1390 1 ? 44 
HELX_P HELX_P27  AC9 HIS A 591 ? GLU A 601 ? HIS B 1390 GLU B 1400 1 ? 11 
HELX_P HELX_P28  AD1 THR A 604 ? LYS A 617 ? THR B 1403 LYS B 1416 1 ? 14 
HELX_P HELX_P29  AD2 SER A 619 ? ASP A 628 ? SER B 1418 ASP B 1427 1 ? 10 
HELX_P HELX_P30  AD3 ARG A 630 ? LEU A 634 ? ARG B 1429 LEU B 1433 5 ? 5  
HELX_P HELX_P31  AD4 THR A 635 ? ASP A 662 ? THR B 1434 ASP B 1461 1 ? 28 
HELX_P HELX_P32  AD5 ASP A 662 ? GLY A 682 ? ASP B 1461 GLY B 1481 1 ? 21 
HELX_P HELX_P33  AD6 SER B 17  ? GLU B 20  ? SER D 425  GLU D 428  5 ? 4  
HELX_P HELX_P34  AD7 GLY B 28  ? ARG B 39  ? GLY D 436  ARG D 447  1 ? 12 
HELX_P HELX_P35  AD8 ARG B 60  ? ASN B 67  ? ARG D 468  ASN D 475  1 ? 8  
HELX_P HELX_P36  AD9 ASN B 67  ? GLY B 78  ? ASN D 475  GLY D 486  1 ? 12 
HELX_P HELX_P37  AE1 ASP B 86  ? ALA B 90  ? ASP D 494  ALA D 498  5 ? 5  
HELX_P HELX_P38  AE2 ASP B 102 ? MET B 120 ? ASP D 510  MET D 528  1 ? 19 
HELX_P HELX_P39  AE3 MET B 120 ? ALA B 126 ? MET D 528  ALA D 534  1 ? 7  
HELX_P HELX_P40  AE4 GLY B 140 ? MET B 144 ? GLY D 582  MET D 586  5 ? 5  
HELX_P HELX_P41  AE5 ASN B 145 ? MET B 154 ? ASN D 587  MET D 596  1 ? 10 
HELX_P HELX_P42  AE6 ASP B 168 ? GLY B 181 ? ASP D 610  GLY D 623  1 ? 14 
HELX_P HELX_P43  AE7 VAL B 183 ? ALA B 195 ? VAL D 625  ALA D 637  1 ? 13 
HELX_P HELX_P44  AE8 VAL B 196 ? ALA B 198 ? VAL D 638  ALA D 640  5 ? 3  
HELX_P HELX_P45  AE9 ILE B 215 ? ALA B 233 ? ILE D 1014 ALA D 1032 1 ? 19 
HELX_P HELX_P46  AF1 LYS B 244 ? GLN B 257 ? LYS D 1043 GLN D 1056 1 ? 14 
HELX_P HELX_P47  AF2 SER B 268 ? TYR B 279 ? SER D 1067 TYR D 1078 1 ? 12 
HELX_P HELX_P48  AF3 GLY B 283 ? ALA B 295 ? GLY D 1082 ALA D 1094 1 ? 13 
HELX_P HELX_P49  AF4 ILE B 332 ? ARG B 338 ? ILE D 1131 ARG D 1137 1 ? 7  
HELX_P HELX_P50  AF5 PRO B 366 ? GLY B 372 ? PRO D 1165 GLY D 1171 1 ? 7  
HELX_P HELX_P51  AF6 ASN B 388 ? LYS B 401 ? ASN D 1187 LYS D 1200 1 ? 14 
HELX_P HELX_P52  AF7 SER B 406 ? MET B 411 ? SER D 1205 MET D 1210 1 ? 6  
HELX_P HELX_P53  AF8 LYS B 428 ? GLY B 438 ? LYS D 1227 GLY D 1237 1 ? 11 
HELX_P HELX_P54  AF9 ASN B 470 ? ASP B 484 ? ASN D 1269 ASP D 1283 1 ? 15 
HELX_P HELX_P55  AG1 ASN B 514 ? THR B 526 ? ASN D 1313 THR D 1325 1 ? 13 
HELX_P HELX_P56  AG2 ASN B 548 ? HIS B 591 ? ASN D 1347 HIS D 1390 1 ? 44 
HELX_P HELX_P57  AG3 HIS B 591 ? SER B 602 ? HIS D 1390 SER D 1401 1 ? 12 
HELX_P HELX_P58  AG4 THR B 604 ? LYS B 617 ? THR D 1403 LYS D 1416 1 ? 14 
HELX_P HELX_P59  AG5 SER B 619 ? ASP B 628 ? SER D 1418 ASP D 1427 1 ? 10 
HELX_P HELX_P60  AG6 ARG B 630 ? LEU B 634 ? ARG D 1429 LEU D 1433 5 ? 5  
HELX_P HELX_P61  AG7 THR B 635 ? ASP B 662 ? THR D 1434 ASP D 1461 1 ? 28 
HELX_P HELX_P62  AG8 ASP B 662 ? GLY B 682 ? ASP D 1461 GLY D 1481 1 ? 21 
HELX_P HELX_P63  AG9 GLY E 28  ? ARG E 39  ? GLY b 436  ARG b 447  1 ? 12 
HELX_P HELX_P64  AH1 ARG E 60  ? ASN E 66  ? ARG b 468  ASN b 474  1 ? 7  
HELX_P HELX_P65  AH2 ASN E 67  ? GLY E 78  ? ASN b 475  GLY b 486  1 ? 12 
HELX_P HELX_P66  AH3 ILE E 81  ? PHE E 85  ? ILE b 489  PHE b 493  5 ? 5  
HELX_P HELX_P67  AH4 ASP E 86  ? ALA E 90  ? ASP b 494  ALA b 498  5 ? 5  
HELX_P HELX_P68  AH5 ASP E 102 ? MET E 120 ? ASP b 510  MET b 528  1 ? 19 
HELX_P HELX_P69  AH6 MET E 120 ? ALA E 126 ? MET b 528  ALA b 534  1 ? 7  
HELX_P HELX_P70  AH7 GLY E 140 ? MET E 144 ? GLY b 582  MET b 586  5 ? 5  
HELX_P HELX_P71  AH8 ASN E 145 ? MET E 154 ? ASN b 587  MET b 596  1 ? 10 
HELX_P HELX_P72  AH9 ASP E 168 ? GLY E 181 ? ASP b 610  GLY b 623  1 ? 14 
HELX_P HELX_P73  AI1 VAL E 183 ? ASN E 194 ? VAL b 625  ASN b 636  1 ? 12 
HELX_P HELX_P74  AI2 ALA E 195 ? ALA E 198 ? ALA b 637  ALA b 640  5 ? 4  
HELX_P HELX_P75  AI3 ILE E 215 ? ARG E 234 ? ILE b 1014 ARG b 1033 1 ? 20 
HELX_P HELX_P76  AI4 LYS E 244 ? GLN E 257 ? LYS b 1043 GLN b 1056 1 ? 14 
HELX_P HELX_P77  AI5 SER E 268 ? TYR E 279 ? SER b 1067 TYR b 1078 1 ? 12 
HELX_P HELX_P78  AI6 GLY E 283 ? MET E 294 ? GLY b 1082 MET b 1093 1 ? 12 
HELX_P HELX_P79  AI7 ILE E 332 ? ARG E 338 ? ILE b 1131 ARG b 1137 1 ? 7  
HELX_P HELX_P80  AI8 PRO E 366 ? GLY E 372 ? PRO b 1165 GLY b 1171 1 ? 7  
HELX_P HELX_P81  AI9 ASN E 388 ? ASN E 402 ? ASN b 1187 ASN b 1201 1 ? 15 
HELX_P HELX_P82  AJ1 SER E 406 ? MET E 411 ? SER b 1205 MET b 1210 1 ? 6  
HELX_P HELX_P83  AJ2 LYS E 428 ? GLY E 438 ? LYS b 1227 GLY b 1237 1 ? 11 
HELX_P HELX_P84  AJ3 ASN E 470 ? ASP E 484 ? ASN b 1269 ASP b 1283 1 ? 15 
HELX_P HELX_P85  AJ4 ASN E 514 ? THR E 526 ? ASN b 1313 THR b 1325 1 ? 13 
HELX_P HELX_P86  AJ5 ASN E 548 ? HIS E 591 ? ASN b 1347 HIS b 1390 1 ? 44 
HELX_P HELX_P87  AJ6 HIS E 591 ? GLU E 601 ? HIS b 1390 GLU b 1400 1 ? 11 
HELX_P HELX_P88  AJ7 THR E 604 ? LYS E 617 ? THR b 1403 LYS b 1416 1 ? 14 
HELX_P HELX_P89  AJ8 SER E 619 ? MET E 629 ? SER b 1418 MET b 1428 1 ? 11 
HELX_P HELX_P90  AJ9 ARG E 630 ? LEU E 634 ? ARG b 1429 LEU b 1433 5 ? 5  
HELX_P HELX_P91  AK1 THR E 635 ? ASP E 662 ? THR b 1434 ASP b 1461 1 ? 28 
HELX_P HELX_P92  AK2 ASP E 662 ? GLY E 682 ? ASP b 1461 GLY b 1481 1 ? 21 
HELX_P HELX_P93  AK3 GLY F 28  ? ARG F 39  ? GLY d 436  ARG d 447  1 ? 12 
HELX_P HELX_P94  AK4 ARG F 60  ? ASN F 67  ? ARG d 468  ASN d 475  1 ? 8  
HELX_P HELX_P95  AK5 ASN F 67  ? GLY F 78  ? ASN d 475  GLY d 486  1 ? 12 
HELX_P HELX_P96  AK6 ILE F 81  ? PHE F 85  ? ILE d 489  PHE d 493  5 ? 5  
HELX_P HELX_P97  AK7 ASP F 86  ? ALA F 90  ? ASP d 494  ALA d 498  5 ? 5  
HELX_P HELX_P98  AK8 ASP F 102 ? MET F 120 ? ASP d 510  MET d 528  1 ? 19 
HELX_P HELX_P99  AK9 MET F 120 ? ALA F 126 ? MET d 528  ALA d 534  1 ? 7  
HELX_P HELX_P100 AL1 GLY F 140 ? MET F 144 ? GLY d 582  MET d 586  5 ? 5  
HELX_P HELX_P101 AL2 ASN F 145 ? MET F 154 ? ASN d 587  MET d 596  1 ? 10 
HELX_P HELX_P102 AL3 ASP F 168 ? GLY F 181 ? ASP d 610  GLY d 623  1 ? 14 
HELX_P HELX_P103 AL4 VAL F 183 ? ASN F 194 ? VAL d 625  ASN d 636  1 ? 12 
HELX_P HELX_P104 AL5 ALA F 195 ? ALA F 198 ? ALA d 637  ALA d 640  5 ? 4  
HELX_P HELX_P105 AL6 ILE F 215 ? ARG F 234 ? ILE d 1014 ARG d 1033 1 ? 20 
HELX_P HELX_P106 AL7 LYS F 244 ? GLN F 257 ? LYS d 1043 GLN d 1056 1 ? 14 
HELX_P HELX_P107 AL8 SER F 268 ? TYR F 279 ? SER d 1067 TYR d 1078 1 ? 12 
HELX_P HELX_P108 AL9 GLY F 283 ? ALA F 295 ? GLY d 1082 ALA d 1094 1 ? 13 
HELX_P HELX_P109 AM1 THR F 330 ? ARG F 338 ? THR d 1129 ARG d 1137 1 ? 9  
HELX_P HELX_P110 AM2 PRO F 366 ? GLY F 372 ? PRO d 1165 GLY d 1171 1 ? 7  
HELX_P HELX_P111 AM3 ASN F 388 ? LYS F 401 ? ASN d 1187 LYS d 1200 1 ? 14 
HELX_P HELX_P112 AM4 SER F 406 ? MET F 411 ? SER d 1205 MET d 1210 1 ? 6  
HELX_P HELX_P113 AM5 LYS F 428 ? GLY F 438 ? LYS d 1227 GLY d 1237 1 ? 11 
HELX_P HELX_P114 AM6 ASN F 470 ? ASP F 484 ? ASN d 1269 ASP d 1283 1 ? 15 
HELX_P HELX_P115 AM7 ASN F 514 ? THR F 526 ? ASN d 1313 THR d 1325 1 ? 13 
HELX_P HELX_P116 AM8 ASN F 548 ? HIS F 591 ? ASN d 1347 HIS d 1390 1 ? 44 
HELX_P HELX_P117 AM9 HIS F 591 ? GLU F 601 ? HIS d 1390 GLU d 1400 1 ? 11 
HELX_P HELX_P118 AN1 THR F 604 ? LYS F 617 ? THR d 1403 LYS d 1416 1 ? 14 
HELX_P HELX_P119 AN2 SER F 619 ? ASP F 628 ? SER d 1418 ASP d 1427 1 ? 10 
HELX_P HELX_P120 AN3 ARG F 630 ? LEU F 634 ? ARG d 1429 LEU d 1433 5 ? 5  
HELX_P HELX_P121 AN4 THR F 635 ? ASP F 662 ? THR d 1434 ASP d 1461 1 ? 28 
HELX_P HELX_P122 AN5 ASP F 662 ? GLY F 682 ? ASP d 1461 GLY d 1481 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ?    ? A  ASP 100 OD2 ? ? ? 1_555 I  MN  .  MN ? ? B ASP 508  B MN  1501 1_555 ? ? ? ? ? ? ?               2.140 
? 
metalc2   metalc ?    ? A  ASP 102 OD2 ? ? ? 1_555 I  MN  .  MN ? ? B ASP 510  B MN  1501 1_555 ? ? ? ? ? ? ?               2.210 
? 
metalc3   metalc ?    ? B  ASP 100 OD2 ? ? ? 1_555 O  MN  .  MN ? ? D ASP 508  D MN  1501 1_555 ? ? ? ? ? ? ?               2.274 
? 
metalc4   metalc ?    ? B  ASP 102 OD2 ? ? ? 1_555 O  MN  .  MN ? ? D ASP 510  D MN  1501 1_555 ? ? ? ? ? ? ?               2.182 
? 
metalc5   metalc ?    ? E  ASP 100 OD2 ? ? ? 1_555 V  MN  .  MN ? ? b ASP 508  b MN  1501 1_555 ? ? ? ? ? ? ?               2.270 
? 
metalc6   metalc ?    ? E  ASP 102 OD2 ? ? ? 1_555 V  MN  .  MN ? ? b ASP 510  b MN  1501 1_555 ? ? ? ? ? ? ?               2.249 
? 
metalc7   metalc ?    ? E  TYR 523 O   ? ? ? 1_555 BA NA  .  NA ? ? b TYR 1322 b NA  1507 1_555 ? ? ? ? ? ? ?               2.538 
? 
metalc8   metalc ?    ? E  THR 526 O   ? ? ? 1_555 BA NA  .  NA ? ? b THR 1325 b NA  1507 1_555 ? ? ? ? ? ? ?               2.468 
? 
metalc9   metalc ?    ? E  GLN 529 O   ? ? ? 1_555 BA NA  .  NA ? ? b GLN 1328 b NA  1507 1_555 ? ? ? ? ? ? ?               2.412 
? 
covale1   covale none ? F  ARG 50  NH1 B ? ? 1_555 H  DG  9  N2 B ? d ARG 458  f DG  1    1_555 ? ? ? ? ? ? ?               1.442 
? 
metalc10  metalc ?    ? F  ASP 100 OD2 ? ? ? 1_555 EA MN  .  MN ? ? d ASP 508  d MN  1501 1_555 ? ? ? ? ? ? ?               2.306 
? 
metalc11  metalc ?    ? F  ASP 102 OD2 ? ? ? 1_555 EA MN  .  MN ? ? d ASP 510  d MN  1501 1_555 ? ? ? ? ? ? ?               2.240 
? 
metalc12  metalc ?    ? F  HIS 591 NE2 ? ? ? 1_555 IA MN  .  MN ? ? d HIS 1390 d MN  1505 1_555 ? ? ? ? ? ? ?               2.252 
? 
metalc13  metalc ?    ? I  MN  .   MN  ? ? ? 1_555 LA HOH .  O  ? ? B MN  1501 B HOH 1724 1_555 ? ? ? ? ? ? ?               2.181 
? 
metalc14  metalc ?    ? I  MN  .   MN  ? ? ? 1_555 NA HOH .  O  ? ? B MN  1501 E HOH 132  1_555 ? ? ? ? ? ? ?               2.399 
? 
metalc15  metalc ?    ? I  MN  .   MN  ? ? ? 1_555 LA HOH .  O  ? ? B MN  1501 B HOH 1840 1_555 ? ? ? ? ? ? ?               2.203 
? 
metalc16  metalc ?    ? I  MN  .   MN  ? ? ? 1_555 LA HOH .  O  ? ? B MN  1501 B HOH 1990 1_555 ? ? ? ? ? ? ?               2.213 
? 
metalc17  metalc ?    ? O  MN  .   MN  ? ? ? 1_555 MA HOH .  O  ? ? D MN  1501 D HOH 1968 1_555 ? ? ? ? ? ? ?               2.195 
? 
metalc18  metalc ?    ? O  MN  .   MN  ? ? ? 1_555 OA HOH .  O  ? ? D MN  1501 F HOH 106  1_555 ? ? ? ? ? ? ?               2.485 
? 
metalc19  metalc ?    ? O  MN  .   MN  ? ? ? 1_555 MA HOH .  O  ? ? D MN  1501 D HOH 1632 1_555 ? ? ? ? ? ? ?               2.234 
? 
metalc20  metalc ?    ? O  MN  .   MN  ? ? ? 1_555 MA HOH .  O  ? ? D MN  1501 D HOH 1961 1_555 ? ? ? ? ? ? ?               2.435 
? 
metalc21  metalc ?    ? V  MN  .   MN  ? ? ? 1_555 PA HOH .  O  ? ? b MN  1501 b HOH 1641 1_555 ? ? ? ? ? ? ?               2.207 
? 
metalc22  metalc ?    ? V  MN  .   MN  ? ? ? 1_555 PA HOH .  O  ? ? b MN  1501 b HOH 1962 1_555 ? ? ? ? ? ? ?               2.204 
? 
metalc23  metalc ?    ? V  MN  .   MN  ? ? ? 1_555 RA HOH .  O  ? ? b MN  1501 e HOH 224  1_555 ? ? ? ? ? ? ?               2.370 
? 
metalc24  metalc ?    ? V  MN  .   MN  ? ? ? 1_555 PA HOH .  O  ? ? b MN  1501 b HOH 1935 1_555 ? ? ? ? ? ? ?               2.166 
? 
metalc25  metalc ?    ? BA NA  .   NA  ? ? ? 1_555 PA HOH .  O  ? ? b NA  1507 b HOH 2074 1_555 ? ? ? ? ? ? ?               2.173 
? 
metalc26  metalc ?    ? BA NA  .   NA  ? ? ? 1_555 PA HOH .  O  ? ? b NA  1507 b HOH 1991 1_555 ? ? ? ? ? ? ?               2.655 
? 
metalc27  metalc ?    ? EA MN  .   MN  ? ? ? 1_555 QA HOH .  O  ? ? d MN  1501 d HOH 1649 1_555 ? ? ? ? ? ? ?               2.192 
? 
metalc28  metalc ?    ? EA MN  .   MN  ? ? ? 1_555 QA HOH .  O  ? ? d MN  1501 d HOH 1879 1_555 ? ? ? ? ? ? ?               1.987 
? 
metalc29  metalc ?    ? EA MN  .   MN  ? ? ? 1_555 QA HOH .  O  ? ? d MN  1501 d HOH 1843 1_555 ? ? ? ? ? ? ?               2.080 
? 
metalc30  metalc ?    ? EA MN  .   MN  ? ? ? 1_555 SA HOH .  O  ? ? d MN  1501 f HOH 131  1_555 ? ? ? ? ? ? ?               2.249 
? 
hydrog1   hydrog ?    ? C  DA  1   N1  A ? ? 1_555 D  DT  20 N3 A ? E DA  -8   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog2   hydrog ?    ? C  DA  1   N1  B ? ? 1_555 D  DT  20 N3 B ? E DA  -8   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog3   hydrog ?    ? C  DA  1   N6  A ? ? 1_555 D  DT  20 O4 A ? E DA  -8   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog4   hydrog ?    ? C  DA  1   N6  B ? ? 1_555 D  DT  20 O4 B ? E DA  -8   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog5   hydrog ?    ? C  DG  2   N1  A ? ? 1_555 D  DC  19 N3 ? ? E DG  -7   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog6   hydrog ?    ? C  DG  2   N1  B ? ? 1_555 D  DC  19 N3 ? ? E DG  -7   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog7   hydrog ?    ? C  DG  2   N2  A ? ? 1_555 D  DC  19 O2 ? ? E DG  -7   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog8   hydrog ?    ? C  DG  2   N2  B ? ? 1_555 D  DC  19 O2 ? ? E DG  -7   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog9   hydrog ?    ? C  DG  2   O6  A ? ? 1_555 D  DC  19 N4 ? ? E DG  -7   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog10  hydrog ?    ? C  DG  2   O6  B ? ? 1_555 D  DC  19 N4 ? ? E DG  -7   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog11  hydrog ?    ? C  DC  3   N3  ? ? ? 1_555 D  DG  18 N1 ? ? E DC  -6   F DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog12  hydrog ?    ? C  DC  3   N4  ? ? ? 1_555 D  DG  18 O6 ? ? E DC  -6   F DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog13  hydrog ?    ? C  DC  3   O2  ? ? ? 1_555 D  DG  18 N2 ? ? E DC  -6   F DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog14  hydrog ?    ? C  DC  4   N3  ? ? ? 1_555 D  DG  17 N1 ? ? E DC  -5   F DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog15  hydrog ?    ? C  DC  4   N4  ? ? ? 1_555 D  DG  17 O6 ? ? E DC  -5   F DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog16  hydrog ?    ? C  DC  4   O2  ? ? ? 1_555 D  DG  17 N2 ? ? E DC  -5   F DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog17  hydrog ?    ? C  DG  5   N1  ? ? ? 1_555 D  DC  16 N3 ? ? E DG  -4   F DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog18  hydrog ?    ? C  DG  5   N2  ? ? ? 1_555 D  DC  16 O2 ? ? E DG  -4   F DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog19  hydrog ?    ? C  DG  5   O6  ? ? ? 1_555 D  DC  16 N4 ? ? E DG  -4   F DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog20  hydrog ?    ? C  DT  6   N3  ? ? ? 1_555 D  DA  15 N1 ? ? E DT  -3   F DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog21  hydrog ?    ? C  DT  6   O4  ? ? ? 1_555 D  DA  15 N6 ? ? E DT  -3   F DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog22  hydrog ?    ? C  DA  7   N1  ? ? ? 1_555 D  DT  14 N3 ? ? E DA  -2   F DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog23  hydrog ?    ? C  DA  7   N6  ? ? ? 1_555 D  DT  14 O4 ? ? E DA  -2   F DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog24  hydrog ?    ? C  DG  8   N1  ? ? ? 1_555 D  DC  13 N3 ? ? E DG  -1   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog25  hydrog ?    ? C  DG  8   N2  ? ? ? 1_555 D  DC  13 O2 ? ? E DG  -1   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog26  hydrog ?    ? C  DG  8   O6  ? ? ? 1_555 D  DC  13 N4 ? ? E DG  -1   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog27  hydrog ?    ? C  DC  13  N3  A ? ? 1_555 D  DG  8  N1 ? ? E DC  5    F DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog28  hydrog ?    ? C  DC  13  N3  B ? ? 1_555 D  DG  8  N1 ? ? E DC  5    F DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog29  hydrog ?    ? C  DC  13  N4  A ? ? 1_555 D  DG  8  O6 ? ? E DC  5    F DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog30  hydrog ?    ? C  DC  13  N4  B ? ? 1_555 D  DG  8  O6 ? ? E DC  5    F DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog31  hydrog ?    ? C  DC  13  O2  A ? ? 1_555 D  DG  8  N2 ? ? E DC  5    F DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog32  hydrog ?    ? C  DC  13  O2  B ? ? 1_555 D  DG  8  N2 ? ? E DC  5    F DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog33  hydrog ?    ? C  DT  14  N3  A ? ? 1_555 D  DA  7  N1 ? ? E DT  6    F DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog34  hydrog ?    ? C  DT  14  N3  B ? ? 1_555 D  DA  7  N1 ? ? E DT  6    F DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog35  hydrog ?    ? C  DT  14  O4  A ? ? 1_555 D  DA  7  N6 ? ? E DT  6    F DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog36  hydrog ?    ? C  DT  14  O4  B ? ? 1_555 D  DA  7  N6 ? ? E DT  6    F DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog37  hydrog ?    ? C  DA  15  N1  ? ? ? 1_555 D  DT  6  N3 ? ? E DA  7    F DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog38  hydrog ?    ? C  DA  15  N6  ? ? ? 1_555 D  DT  6  O4 ? ? E DA  7    F DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog39  hydrog ?    ? C  DC  16  N3  ? ? ? 1_555 D  DG  5  N1 ? ? E DC  8    F DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog40  hydrog ?    ? C  DC  16  N4  ? ? ? 1_555 D  DG  5  O6 ? ? E DC  8    F DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog41  hydrog ?    ? C  DC  16  O2  ? ? ? 1_555 D  DG  5  N2 ? ? E DC  8    F DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog42  hydrog ?    ? C  DG  17  N1  ? ? ? 1_555 D  DC  4  N3 ? ? E DG  9    F DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog43  hydrog ?    ? C  DG  17  N2  ? ? ? 1_555 D  DC  4  O2 ? ? E DG  9    F DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog44  hydrog ?    ? C  DG  17  O6  ? ? ? 1_555 D  DC  4  N4 ? ? E DG  9    F DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog45  hydrog ?    ? C  DG  18  N1  ? ? ? 1_555 D  DC  3  N3 ? ? E DG  10   F DC  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog46  hydrog ?    ? C  DG  18  N2  ? ? ? 1_555 D  DC  3  O2 ? ? E DG  10   F DC  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog47  hydrog ?    ? C  DG  18  O6  ? ? ? 1_555 D  DC  3  N4 ? ? E DG  10   F DC  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog48  hydrog ?    ? C  DC  19  N3  ? ? ? 1_555 D  DG  2  N1 ? ? E DC  11   F DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog49  hydrog ?    ? C  DC  19  N4  ? ? ? 1_555 D  DG  2  O6 ? ? E DC  11   F DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog50  hydrog ?    ? C  DC  19  O2  ? ? ? 1_555 D  DG  2  N2 ? ? E DC  11   F DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog51  hydrog ?    ? C  DT  20  O4  ? ? ? 1_555 D  DA  1  N6 ? ? E DT  12   F DA  -8   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     
? 
hydrog52  hydrog ?    ? G  DA  1   N1  ? ? ? 1_555 H  DT  20 N3 ? ? e DA  -8   f DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog53  hydrog ?    ? G  DA  1   N6  ? ? ? 1_555 H  DT  20 O4 ? ? e DA  -8   f DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog54  hydrog ?    ? G  DG  2   N1  ? ? ? 1_555 H  DC  19 N3 ? ? e DG  -7   f DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog55  hydrog ?    ? G  DG  2   N2  ? ? ? 1_555 H  DC  19 O2 ? ? e DG  -7   f DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog56  hydrog ?    ? G  DG  2   O6  ? ? ? 1_555 H  DC  19 N4 ? ? e DG  -7   f DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog57  hydrog ?    ? G  DC  3   N3  ? ? ? 1_555 H  DG  18 N1 ? ? e DC  -6   f DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog58  hydrog ?    ? G  DC  3   N4  ? ? ? 1_555 H  DG  18 O6 ? ? e DC  -6   f DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog59  hydrog ?    ? G  DC  3   O2  ? ? ? 1_555 H  DG  18 N2 ? ? e DC  -6   f DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog60  hydrog ?    ? G  DC  4   N3  ? ? ? 1_555 H  DG  17 N1 ? ? e DC  -5   f DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog61  hydrog ?    ? G  DC  4   N4  ? ? ? 1_555 H  DG  17 O6 ? ? e DC  -5   f DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog62  hydrog ?    ? G  DC  4   O2  ? ? ? 1_555 H  DG  17 N2 ? ? e DC  -5   f DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog63  hydrog ?    ? G  DG  5   N1  ? ? ? 1_555 H  DC  16 N3 ? ? e DG  -4   f DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog64  hydrog ?    ? G  DG  5   N2  ? ? ? 1_555 H  DC  16 O2 ? ? e DG  -4   f DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog65  hydrog ?    ? G  DG  5   O6  ? ? ? 1_555 H  DC  16 N4 ? ? e DG  -4   f DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog66  hydrog ?    ? G  DT  6   N3  ? ? ? 1_555 H  DA  15 N1 ? ? e DT  -3   f DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog67  hydrog ?    ? G  DT  6   O4  ? ? ? 1_555 H  DA  15 N6 ? ? e DT  -3   f DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog68  hydrog ?    ? G  DA  7   N1  ? ? ? 1_555 H  DT  14 N3 ? ? e DA  -2   f DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog69  hydrog ?    ? G  DA  7   N6  ? ? ? 1_555 H  DT  14 O4 ? ? e DA  -2   f DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog70  hydrog ?    ? G  DG  8   N1  ? ? ? 1_555 H  DC  13 N3 A ? e DG  -1   f DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog71  hydrog ?    ? G  DG  8   N1  ? ? ? 1_555 H  DC  13 N3 B ? e DG  -1   f DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog72  hydrog ?    ? G  DG  8   N2  ? ? ? 1_555 H  DC  13 O2 A ? e DG  -1   f DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog73  hydrog ?    ? G  DG  8   N2  ? ? ? 1_555 H  DC  13 O2 B ? e DG  -1   f DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog74  hydrog ?    ? G  DG  8   O6  ? ? ? 1_555 H  DC  13 N4 A ? e DG  -1   f DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog75  hydrog ?    ? G  DG  8   O6  ? ? ? 1_555 H  DC  13 N4 B ? e DG  -1   f DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog76  hydrog ?    ? G  DG  9   N2  A ? ? 1_555 H  DC  12 N3 A ? e DG  1    f DC  4    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     
? 
hydrog77  hydrog ?    ? G  DT  10  N3  A ? ? 1_555 H  DA  11 N1 A ? e DT  2    f DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog78  hydrog ?    ? G  DT  10  O4  A ? ? 1_555 H  DA  11 N6 A ? e DT  2    f DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog79  hydrog ?    ? G  DA  11  N6  A ? ? 1_555 H  DT  10 O4 A ? e DA  3    f DT  2    1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     
? 
hydrog80  hydrog ?    ? G  DA  11  N6  A ? ? 1_555 H  DA  11 N3 A ? e DA  3    f DA  3    1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ?     
? 
hydrog81  hydrog ?    ? G  DC  12  N4  A ? ? 1_555 H  DG  9  O6 A ? e DC  4    f DG  1    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     
? 
hydrog82  hydrog ?    ? G  DC  13  N3  A ? ? 1_555 H  DG  8  N1 ? ? e DC  5    f DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog83  hydrog ?    ? G  DC  13  N3  B ? ? 1_555 H  DG  8  N1 ? ? e DC  5    f DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog84  hydrog ?    ? G  DC  13  N4  A ? ? 1_555 H  DG  8  O6 ? ? e DC  5    f DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog85  hydrog ?    ? G  DC  13  N4  B ? ? 1_555 H  DG  8  O6 ? ? e DC  5    f DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog86  hydrog ?    ? G  DC  13  O2  A ? ? 1_555 H  DG  8  N2 ? ? e DC  5    f DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog87  hydrog ?    ? G  DC  13  O2  B ? ? 1_555 H  DG  8  N2 ? ? e DC  5    f DG  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog88  hydrog ?    ? G  DT  14  N3  ? ? ? 1_555 H  DA  7  N1 ? ? e DT  6    f DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog89  hydrog ?    ? G  DT  14  O4  ? ? ? 1_555 H  DA  7  N6 ? ? e DT  6    f DA  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog90  hydrog ?    ? G  DA  15  N1  ? ? ? 1_555 H  DT  6  N3 ? ? e DA  7    f DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog91  hydrog ?    ? G  DA  15  N6  ? ? ? 1_555 H  DT  6  O4 ? ? e DA  7    f DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog92  hydrog ?    ? G  DC  16  N3  ? ? ? 1_555 H  DG  5  N1 ? ? e DC  8    f DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog93  hydrog ?    ? G  DC  16  N4  ? ? ? 1_555 H  DG  5  O6 ? ? e DC  8    f DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog94  hydrog ?    ? G  DC  16  O2  ? ? ? 1_555 H  DG  5  N2 ? ? e DC  8    f DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog95  hydrog ?    ? G  DG  17  N1  ? ? ? 1_555 H  DC  4  N3 ? ? e DG  9    f DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog96  hydrog ?    ? G  DG  17  N2  ? ? ? 1_555 H  DC  4  O2 ? ? e DG  9    f DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog97  hydrog ?    ? G  DG  17  O6  ? ? ? 1_555 H  DC  4  N4 ? ? e DG  9    f DC  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog98  hydrog ?    ? G  DG  18  N1  ? ? ? 1_555 H  DC  3  N3 ? ? e DG  10   f DC  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog99  hydrog ?    ? G  DG  18  N2  ? ? ? 1_555 H  DC  3  O2 ? ? e DG  10   f DC  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog100 hydrog ?    ? G  DG  18  O6  ? ? ? 1_555 H  DC  3  N4 ? ? e DG  10   f DC  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog101 hydrog ?    ? G  DC  19  N3  ? ? ? 1_555 H  DG  2  N1 ? ? e DC  11   f DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog102 hydrog ?    ? G  DC  19  N4  ? ? ? 1_555 H  DG  2  O6 ? ? e DC  11   f DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog103 hydrog ?    ? G  DC  19  O2  ? ? ? 1_555 H  DG  2  N2 ? ? e DC  11   f DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 82  B . ? GLY 490  D GLY 83  B ? GLY 491  D 1 5.25  
2 GLY 454 B . ? GLY 1253 D GLY 455 B ? GLY 1254 D 1 -1.31 
3 LEU 691 F . ? LEU 1490 d GLY 692 F ? GLY 1491 d 1 -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 6 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
AC3 ? 2 ? 
AC4 ? 6 ? 
AC5 ? 3 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? anti-parallel 
AA8 5 6 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? parallel      
AB6 2 3 ? parallel      
AB6 3 4 ? parallel      
AB6 4 5 ? anti-parallel 
AB6 5 6 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? parallel      
AC4 3 4 ? parallel      
AC4 4 5 ? anti-parallel 
AC4 5 6 ? parallel      
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 44  ? LEU A 49  ? GLN B 452  LEU B 457  
AA1 2 GLU A 22  ? GLU A 27  ? GLU B 430  GLU B 435  
AA1 3 LYS A 94  ? MET A 98  ? LYS B 502  MET B 506  
AA1 4 VAL A 129 ? ILE A 131 ? VAL B 537  ILE B 539  
AA1 5 LEU A 162 ? LYS A 165 ? LEU B 604  LYS B 607  
AA1 6 GLU A 212 ? ASN A 214 ? GLU B 1011 ASN B 1013 
AA2 1 LYS A 266 ? LYS A 267 ? LYS B 1065 LYS B 1066 
AA2 2 GLU A 326 ? MET A 329 ? GLU B 1125 MET B 1128 
AA2 3 VAL A 305 ? GLN A 308 ? VAL B 1104 GLN B 1107 
AA3 1 PHE A 347 ? ASP A 349 ? PHE B 1146 ASP B 1148 
AA3 2 ARG A 356 ? PRO A 358 ? ARG B 1155 PRO B 1157 
AA4 1 ALA A 373 ? ILE A 376 ? ALA B 1172 ILE B 1175 
AA4 2 ALA A 381 ? ILE A 384 ? ALA B 1180 ILE B 1183 
AA5 1 GLN A 529 ? ASN A 535 ? GLN B 1328 ASN B 1334 
AA5 2 ARG A 439 ? ARG A 445 ? ARG B 1238 ARG B 1244 
AA5 3 LEU A 424 ? LEU A 426 ? LEU B 1223 LEU B 1225 
AA5 4 GLU A 688 ? GLN A 690 ? GLU B 1487 GLN B 1489 
AA6 1 ARG A 447 ? ARG A 453 ? ARG B 1246 ARG B 1252 
AA6 2 ARG A 457 ? GLU A 464 ? ARG B 1256 GLU B 1263 
AA6 3 VAL A 505 ? VAL A 509 ? VAL B 1304 VAL B 1308 
AA6 4 ILE A 490 ? ASP A 495 ? ILE B 1289 ASP B 1294 
AA7 1 ILE A 537 ? VAL A 540 ? ILE B 1336 VAL B 1339 
AA7 2 ARG A 543 ? LEU A 546 ? ARG B 1342 LEU B 1345 
AA8 1 GLN B 44  ? LEU B 49  ? GLN D 452  LEU D 457  
AA8 2 GLU B 22  ? GLU B 27  ? GLU D 430  GLU D 435  
AA8 3 LYS B 94  ? MET B 98  ? LYS D 502  MET D 506  
AA8 4 VAL B 129 ? ALA B 132 ? VAL D 537  ALA D 540  
AA8 5 LEU B 161 ? LYS B 165 ? LEU D 603  LYS D 607  
AA8 6 GLU B 212 ? ASN B 214 ? GLU D 1011 ASN D 1013 
AA9 1 LYS B 266 ? LYS B 267 ? LYS D 1065 LYS D 1066 
AA9 2 GLU B 326 ? MET B 329 ? GLU D 1125 MET D 1128 
AA9 3 VAL B 305 ? GLN B 308 ? VAL D 1104 GLN D 1107 
AB1 1 PHE B 347 ? ASP B 349 ? PHE D 1146 ASP D 1148 
AB1 2 ARG B 356 ? PRO B 358 ? ARG D 1155 PRO D 1157 
AB2 1 ALA B 373 ? ILE B 376 ? ALA D 1172 ILE D 1175 
AB2 2 ALA B 381 ? ILE B 384 ? ALA D 1180 ILE D 1183 
AB3 1 GLN B 529 ? ASN B 535 ? GLN D 1328 ASN D 1334 
AB3 2 ARG B 439 ? ARG B 445 ? ARG D 1238 ARG D 1244 
AB3 3 LEU B 424 ? LEU B 426 ? LEU D 1223 LEU D 1225 
AB3 4 GLU B 688 ? GLN B 690 ? GLU D 1487 GLN D 1489 
AB4 1 ARG B 447 ? GLU B 452 ? ARG D 1246 GLU D 1251 
AB4 2 GLN B 458 ? GLU B 464 ? GLN D 1257 GLU D 1263 
AB4 3 VAL B 505 ? VAL B 509 ? VAL D 1304 VAL D 1308 
AB4 4 ILE B 490 ? ASP B 495 ? ILE D 1289 ASP D 1294 
AB5 1 ILE B 537 ? VAL B 540 ? ILE D 1336 VAL D 1339 
AB5 2 ARG B 543 ? LEU B 546 ? ARG D 1342 LEU D 1345 
AB6 1 GLN E 44  ? LEU E 49  ? GLN b 452  LEU b 457  
AB6 2 GLU E 22  ? GLU E 27  ? GLU b 430  GLU b 435  
AB6 3 LYS E 94  ? MET E 98  ? LYS b 502  MET b 506  
AB6 4 VAL E 129 ? ALA E 132 ? VAL b 537  ALA b 540  
AB6 5 LEU E 161 ? LYS E 165 ? LEU b 603  LYS b 607  
AB6 6 ILE E 210 ? ASN E 214 ? ILE b 1009 ASN b 1013 
AB7 1 LYS E 266 ? LYS E 267 ? LYS b 1065 LYS b 1066 
AB7 2 GLU E 326 ? MET E 329 ? GLU b 1125 MET b 1128 
AB7 3 VAL E 305 ? GLN E 308 ? VAL b 1104 GLN b 1107 
AB8 1 PHE E 347 ? ASP E 349 ? PHE b 1146 ASP b 1148 
AB8 2 ARG E 356 ? PRO E 358 ? ARG b 1155 PRO b 1157 
AB9 1 ALA E 373 ? ILE E 376 ? ALA b 1172 ILE b 1175 
AB9 2 ALA E 381 ? ILE E 384 ? ALA b 1180 ILE b 1183 
AC1 1 GLN E 529 ? ASN E 535 ? GLN b 1328 ASN b 1334 
AC1 2 ARG E 439 ? ARG E 445 ? ARG b 1238 ARG b 1244 
AC1 3 LEU E 424 ? LEU E 426 ? LEU b 1223 LEU b 1225 
AC1 4 GLU E 688 ? GLN E 690 ? GLU b 1487 GLN b 1489 
AC2 1 ARG E 447 ? GLU E 452 ? ARG b 1246 GLU b 1251 
AC2 2 GLN E 458 ? GLU E 464 ? GLN b 1257 GLU b 1263 
AC2 3 VAL E 505 ? VAL E 509 ? VAL b 1304 VAL b 1308 
AC2 4 ILE E 490 ? ASP E 495 ? ILE b 1289 ASP b 1294 
AC3 1 ILE E 537 ? VAL E 540 ? ILE b 1336 VAL b 1339 
AC3 2 ARG E 543 ? LEU E 546 ? ARG b 1342 LEU b 1345 
AC4 1 GLN F 44  ? LEU F 49  ? GLN d 452  LEU d 457  
AC4 2 GLU F 22  ? GLU F 27  ? GLU d 430  GLU d 435  
AC4 3 LYS F 94  ? MET F 98  ? LYS d 502  MET d 506  
AC4 4 VAL F 129 ? ALA F 132 ? VAL d 537  ALA d 540  
AC4 5 LEU F 161 ? LYS F 165 ? LEU d 603  LYS d 607  
AC4 6 GLU F 212 ? ASN F 214 ? GLU d 1011 ASN d 1013 
AC5 1 LYS F 266 ? LYS F 267 ? LYS d 1065 LYS d 1066 
AC5 2 GLU F 326 ? MET F 329 ? GLU d 1125 MET d 1128 
AC5 3 VAL F 305 ? GLN F 308 ? VAL d 1104 GLN d 1107 
AC6 1 PHE F 347 ? ASP F 349 ? PHE d 1146 ASP d 1148 
AC6 2 ARG F 356 ? PRO F 358 ? ARG d 1155 PRO d 1157 
AC7 1 ALA F 373 ? ILE F 376 ? ALA d 1172 ILE d 1175 
AC7 2 ALA F 381 ? ILE F 384 ? ALA d 1180 ILE d 1183 
AC8 1 GLN F 529 ? ASN F 535 ? GLN d 1328 ASN d 1334 
AC8 2 ARG F 439 ? ARG F 445 ? ARG d 1238 ARG d 1244 
AC8 3 LEU F 424 ? LEU F 426 ? LEU d 1223 LEU d 1225 
AC8 4 GLU F 688 ? GLN F 690 ? GLU d 1487 GLN d 1489 
AC9 1 ARG F 447 ? GLU F 452 ? ARG d 1246 GLU d 1251 
AC9 2 GLN F 458 ? GLU F 464 ? GLN d 1257 GLU d 1263 
AC9 3 VAL F 505 ? VAL F 509 ? VAL d 1304 VAL d 1308 
AC9 4 ILE F 490 ? ASP F 495 ? ILE d 1289 ASP d 1294 
AD1 1 ILE F 537 ? VAL F 540 ? ILE d 1336 VAL d 1339 
AD1 2 ARG F 543 ? LEU F 546 ? ARG d 1342 LEU d 1345 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ALA A 45  ? O ALA B 453  N PHE A 24  ? N PHE B 432  
AA1 2 3 N LEU A 25  ? N LEU B 433  O VAL A 96  ? O VAL B 504  
AA1 3 4 N ILE A 95  ? N ILE B 503  O TYR A 130 ? O TYR B 538  
AA1 4 5 N ILE A 131 ? N ILE B 539  O LEU A 162 ? O LEU B 604  
AA1 5 6 N LYS A 165 ? N LYS B 607  O ARG A 213 ? O ARG B 1012 
AA2 1 2 N LYS A 266 ? N LYS B 1065 O ALA A 327 ? O ALA B 1126 
AA2 2 3 O ARG A 328 ? O ARG B 1127 N ASP A 306 ? N ASP B 1105 
AA3 1 2 N ILE A 348 ? N ILE B 1147 O GLU A 357 ? O GLU B 1156 
AA4 1 2 N ALA A 373 ? N ALA B 1172 O ILE A 384 ? O ILE B 1183 
AA5 1 2 O PHE A 532 ? O PHE B 1331 N ILE A 442 ? N ILE B 1241 
AA5 2 3 O ARG A 445 ? O ARG B 1244 N LEU A 424 ? N LEU B 1223 
AA5 3 4 N ILE A 425 ? N ILE B 1224 O GLN A 690 ? O GLN B 1489 
AA6 1 2 N GLU A 451 ? N GLU B 1250 O ARG A 459 ? O ARG B 1258 
AA6 2 3 N VAL A 462 ? N VAL B 1261 O VAL A 505 ? O VAL B 1304 
AA6 3 4 O VAL A 506 ? O VAL B 1305 N ARG A 494 ? N ARG B 1293 
AA7 1 2 N VAL A 540 ? N VAL B 1339 O ARG A 543 ? O ARG B 1342 
AA8 1 2 O ALA B 45  ? O ALA D 453  N GLU B 22  ? N GLU D 430  
AA8 2 3 N ILE B 23  ? N ILE D 431  O VAL B 96  ? O VAL D 504  
AA8 3 4 N ILE B 97  ? N ILE D 505  O ALA B 132 ? O ALA D 540  
AA8 4 5 N VAL B 129 ? N VAL D 537  O VAL B 164 ? O VAL D 606  
AA8 5 6 N LYS B 165 ? N LYS D 607  O ARG B 213 ? O ARG D 1012 
AA9 1 2 N LYS B 266 ? N LYS D 1065 O ALA B 327 ? O ALA D 1126 
AA9 2 3 O GLU B 326 ? O GLU D 1125 N GLN B 308 ? N GLN D 1107 
AB1 1 2 N ILE B 348 ? N ILE D 1147 O GLU B 357 ? O GLU D 1156 
AB2 1 2 N ALA B 373 ? N ALA D 1172 O ILE B 384 ? O ILE D 1183 
AB3 1 2 O PHE B 532 ? O PHE D 1331 N ILE B 442 ? N ILE D 1241 
AB3 2 3 O ARG B 445 ? O ARG D 1244 N LEU B 424 ? N LEU D 1223 
AB3 3 4 N ILE B 425 ? N ILE D 1224 O GLN B 690 ? O GLN D 1489 
AB4 1 2 N GLU B 451 ? N GLU D 1250 O ARG B 459 ? O ARG D 1258 
AB4 2 3 N VAL B 462 ? N VAL D 1261 O VAL B 505 ? O VAL D 1304 
AB4 3 4 O VAL B 506 ? O VAL D 1305 N ARG B 494 ? N ARG D 1293 
AB5 1 2 N VAL B 540 ? N VAL D 1339 O ARG B 543 ? O ARG D 1342 
AB6 1 2 O LEU E 49  ? O LEU b 457  N VAL E 26  ? N VAL b 434  
AB6 2 3 N LEU E 25  ? N LEU b 433  O VAL E 96  ? O VAL b 504  
AB6 3 4 N ILE E 97  ? N ILE b 505  O ALA E 132 ? O ALA b 540  
AB6 4 5 N ILE E 131 ? N ILE b 539  O LEU E 162 ? O LEU b 604  
AB6 5 6 N GLN E 163 ? N GLN b 605  O ASN E 211 ? O ASN b 1010 
AB7 1 2 N LYS E 266 ? N LYS b 1065 O ALA E 327 ? O ALA b 1126 
AB7 2 3 O ARG E 328 ? O ARG b 1127 N ASP E 306 ? N ASP b 1105 
AB8 1 2 N ILE E 348 ? N ILE b 1147 O GLU E 357 ? O GLU b 1156 
AB9 1 2 N ALA E 373 ? N ALA b 1172 O ILE E 384 ? O ILE b 1183 
AC1 1 2 O THR E 530 ? O THR b 1329 N MET E 444 ? N MET b 1243 
AC1 2 3 O ARG E 445 ? O ARG b 1244 N LEU E 424 ? N LEU b 1223 
AC1 3 4 N ILE E 425 ? N ILE b 1224 O GLN E 690 ? O GLN b 1489 
AC2 1 2 N GLU E 451 ? N GLU b 1250 O ARG E 459 ? O ARG b 1258 
AC2 2 3 N ILE E 460 ? N ILE b 1259 O ILE E 507 ? O ILE b 1306 
AC2 3 4 O VAL E 506 ? O VAL b 1305 N ARG E 494 ? N ARG b 1293 
AC3 1 2 N VAL E 540 ? N VAL b 1339 O ARG E 543 ? O ARG b 1342 
AC4 1 2 O LEU F 49  ? O LEU d 457  N VAL F 26  ? N VAL d 434  
AC4 2 3 N ILE F 23  ? N ILE d 431  O VAL F 96  ? O VAL d 504  
AC4 3 4 N ILE F 95  ? N ILE d 503  O TYR F 130 ? O TYR d 538  
AC4 4 5 N VAL F 129 ? N VAL d 537  O VAL F 164 ? O VAL d 606  
AC4 5 6 N LYS F 165 ? N LYS d 607  O ARG F 213 ? O ARG d 1012 
AC5 1 2 N LYS F 266 ? N LYS d 1065 O ALA F 327 ? O ALA d 1126 
AC5 2 3 O ARG F 328 ? O ARG d 1127 N ASP F 306 ? N ASP d 1105 
AC6 1 2 N ILE F 348 ? N ILE d 1147 O GLU F 357 ? O GLU d 1156 
AC7 1 2 N ALA F 373 ? N ALA d 1172 O ILE F 384 ? O ILE d 1183 
AC8 1 2 O THR F 530 ? O THR d 1329 N MET F 444 ? N MET d 1243 
AC8 2 3 O ARG F 445 ? O ARG d 1244 N LEU F 424 ? N LEU d 1223 
AC8 3 4 N ILE F 425 ? N ILE d 1224 O GLU F 688 ? O GLU d 1487 
AC9 1 2 N GLU F 451 ? N GLU d 1250 O ARG F 459 ? O ARG d 1258 
AC9 2 3 N ILE F 460 ? N ILE d 1259 O ILE F 507 ? O ILE d 1306 
AC9 3 4 O VAL F 506 ? O VAL d 1305 N ARG F 494 ? N ARG d 1293 
AD1 1 2 N VAL F 540 ? N VAL d 1339 O ARG F 543 ? O ARG d 1342 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MN  1501 ? 6  'binding site for residue MN B 1501'                    
AC2 Software B 94H 1502 ? 13 'binding site for residue 94H B 1502'                   
AC3 Software B GOL 1503 ? 4  'binding site for residue GOL B 1503'                   
AC4 Software B GOL 1504 ? 5  'binding site for residue GOL B 1504'                   
AC5 Software B GOL 1505 ? 6  'binding site for residue GOL B 1505'                   
AC6 Software B 94H 1506 ? 9  'binding site for residue 94H B 1506'                   
AC7 Software D MN  1501 ? 6  'binding site for residue MN D 1501'                    
AC8 Software D GOL 1502 ? 6  'binding site for residue GOL D 1502'                   
AC9 Software D 94H 1503 ? 8  'binding site for residue 94H D 1503'                   
AD1 Software D GOL 1504 ? 9  'binding site for residue GOL D 1504'                   
AD2 Software D GOL 1505 ? 7  'binding site for residue GOL D 1505'                   
AD3 Software D GOL 1506 ? 7  'binding site for residue GOL D 1506'                   
AD4 Software D CL  1507 ? 4  'binding site for residue CL D 1507'                    
AD5 Software b MN  1501 ? 6  'binding site for residue MN b 1501'                    
AD6 Software b 94H 1502 ? 14 'binding site for residue 94H b 1502'                   
AD7 Software b GOL 1503 ? 9  'binding site for residue GOL b 1503'                   
AD8 Software b GOL 1504 ? 7  'binding site for residue GOL b 1504'                   
AD9 Software b GOL 1505 ? 8  'binding site for residue GOL b 1505'                   
AE1 Software b SO4 1506 ? 5  'binding site for residue SO4 b 1506'                   
AE2 Software b NA  1507 ? 6  'binding site for residue NA b 1507'                    
AE3 Software b 9JN 1508 ? 12 'binding site for residue 9JN b 1508'                   
AE4 Software b 94H 1509 ? 13 'binding site for residue 94H b 1509'                   
AE5 Software d MN  1501 ? 6  'binding site for residue MN d 1501'                    
AE6 Software d 94H 1502 ? 9  'binding site for residue 94H d 1502'                   
AE7 Software d GOL 1503 ? 4  'binding site for residue GOL d 1503'                   
AE8 Software d GOL 1504 ? 7  'binding site for residue GOL d 1504'                   
AE9 Software d MN  1505 ? 2  'binding site for residue MN d 1505'                    
AF1 Software e 9JN 101  ? 11 'binding site for residue 9JN e 101'                    
AF2 Software e GOL 102  ? 9  'binding site for residue GOL e 102'                    
AF3 Software b GLN 1413 ? 12 'binding site for Di-peptide GLN b 1413 and ARG b 1414' 
AF4 Software b GLN 1413 ? 12 'binding site for Di-peptide GLN b 1413 and ARG b 1414' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ASP A  100 ? ASP B 508  . ? 1_555 ? 
2   AC1 6  ASP A  102 ? ASP B 510  . ? 1_555 ? 
3   AC1 6  HOH LA .   ? HOH B 1724 . ? 1_555 ? 
4   AC1 6  HOH LA .   ? HOH B 1840 . ? 1_555 ? 
5   AC1 6  HOH LA .   ? HOH B 1990 . ? 1_555 ? 
6   AC1 6  HOH NA .   ? HOH E 132  . ? 1_555 ? 
7   AC2 13 ARG A  188 ? ARG B 630  . ? 1_555 ? 
8   AC2 13 GLU A  192 ? GLU B 634  . ? 1_555 ? 
9   AC2 13 ALA A  195 ? ALA B 637  . ? 1_555 ? 
10  AC2 13 MET A  228 ? MET B 1027 . ? 1_555 ? 
11  AC2 13 MET A  380 ? MET B 1179 . ? 1_555 ? 
12  AC2 13 ARG A  543 ? ARG B 1342 . ? 1_555 ? 
13  AC2 13 PRO A  544 ? PRO B 1343 . ? 1_555 ? 
14  AC2 13 HOH LA .   ? HOH B 1683 . ? 1_555 ? 
15  AC2 13 HOH LA .   ? HOH B 1926 . ? 1_555 ? 
16  AC2 13 HOH LA .   ? HOH B 1952 . ? 1_555 ? 
17  AC2 13 HOH LA .   ? HOH B 1970 . ? 1_555 ? 
18  AC2 13 HOH LA .   ? HOH B 2016 . ? 1_555 ? 
19  AC2 13 HOH MA .   ? HOH D 1611 . ? 1_455 ? 
20  AC3 4  ARG A  50  ? ARG B 458  . ? 1_555 ? 
21  AC3 4  HOH LA .   ? HOH B 1602 . ? 1_555 ? 
22  AC3 4  HOH LA .   ? HOH B 1870 . ? 1_555 ? 
23  AC3 4  DG  C  8   ? DG  E -1   . ? 1_555 ? 
24  AC4 5  GLY A  38  ? GLY B 446  . ? 1_555 ? 
25  AC4 5  ARG A  39  ? ARG B 447  . ? 1_555 ? 
26  AC4 5  TRP A  150 ? TRP B 592  . ? 1_555 ? 
27  AC4 5  HOH LA .   ? HOH B 1613 . ? 1_555 ? 
28  AC4 5  HOH LA .   ? HOH B 1978 . ? 1_555 ? 
29  AC5 6  MET A  314 ? MET B 1113 . ? 1_555 ? 
30  AC5 6  GLY A  316 ? GLY B 1115 . ? 1_555 ? 
31  AC5 6  GLN A  468 ? GLN B 1267 . ? 1_555 ? 
32  AC5 6  VAL A  469 ? VAL B 1268 . ? 1_555 ? 
33  AC5 6  DC  C  4   ? DC  E -5   . ? 1_555 ? 
34  AC5 6  HOH NA .   ? HOH E 143  . ? 1_555 ? 
35  AC6 9  ILE A  587 ? ILE B 1386 . ? 1_555 ? 
36  AC6 9  ASP A  590 ? ASP B 1389 . ? 1_555 ? 
37  AC6 9  HIS A  591 ? HIS B 1390 . ? 1_555 ? 
38  AC6 9  GLU A  594 ? GLU B 1393 . ? 1_555 ? 
39  AC6 9  ARG A  615 ? ARG B 1414 . ? 1_555 ? 
40  AC6 9  ARG E  60  ? ARG b 468  . ? 1_555 ? 
41  AC6 9  DA  G  1   ? DA  e -8   . ? 1_555 ? 
42  AC6 9  9JN JA .   ? 9JN e 101  . ? 1_555 ? 
43  AC6 9  DT  H  20  ? DT  f 12   . ? 1_555 ? 
44  AC7 6  ASP B  100 ? ASP D 508  . ? 1_555 ? 
45  AC7 6  ASP B  102 ? ASP D 510  . ? 1_555 ? 
46  AC7 6  HOH MA .   ? HOH D 1632 . ? 1_555 ? 
47  AC7 6  HOH MA .   ? HOH D 1961 . ? 1_555 ? 
48  AC7 6  HOH MA .   ? HOH D 1968 . ? 1_555 ? 
49  AC7 6  HOH OA .   ? HOH F 106  . ? 1_555 ? 
50  AC8 6  SER B  37  ? SER D 445  . ? 1_555 ? 
51  AC8 6  GLY B  38  ? GLY D 446  . ? 1_555 ? 
52  AC8 6  ASP B  147 ? ASP D 589  . ? 1_555 ? 
53  AC8 6  TRP B  150 ? TRP D 592  . ? 1_555 ? 
54  AC8 6  HOH MA .   ? HOH D 1636 . ? 1_555 ? 
55  AC8 6  HOH MA .   ? HOH D 2005 . ? 1_555 ? 
56  AC9 8  ARG B  188 ? ARG D 630  . ? 1_555 ? 
57  AC9 8  GLU B  192 ? GLU D 634  . ? 1_555 ? 
58  AC9 8  ALA B  195 ? ALA D 637  . ? 1_555 ? 
59  AC9 8  MET B  228 ? MET D 1027 . ? 1_555 ? 
60  AC9 8  MET B  380 ? MET D 1179 . ? 1_555 ? 
61  AC9 8  ARG B  543 ? ARG D 1342 . ? 1_555 ? 
62  AC9 8  PRO B  544 ? PRO D 1343 . ? 1_555 ? 
63  AC9 8  HOH MA .   ? HOH D 1656 . ? 1_555 ? 
64  AD1 9  LYS A  267 ? LYS B 1066 . ? 1_555 ? 
65  AD1 9  ARG A  323 ? ARG B 1122 . ? 1_555 ? 
66  AD1 9  HOH LA .   ? HOH B 1781 . ? 1_555 ? 
67  AD1 9  PRO B  281 ? PRO D 1080 . ? 1_555 ? 
68  AD1 9  HIS B  282 ? HIS D 1081 . ? 1_555 ? 
69  AD1 9  GLY B  283 ? GLY D 1082 . ? 1_555 ? 
70  AD1 9  HOH MA .   ? HOH D 1658 . ? 1_555 ? 
71  AD1 9  HOH MA .   ? HOH D 1680 . ? 1_555 ? 
72  AD1 9  HOH MA .   ? HOH D 1916 . ? 1_555 ? 
73  AD2 7  PRO B  245 ? PRO D 1044 . ? 1_555 ? 
74  AD2 7  ARG B  248 ? ARG D 1047 . ? 1_555 ? 
75  AD2 7  PRO B  358 ? PRO D 1157 . ? 1_555 ? 
76  AD2 7  HOH MA .   ? HOH D 1775 . ? 1_555 ? 
77  AD2 7  HOH MA .   ? HOH D 1783 . ? 1_555 ? 
78  AD2 7  HOH MA .   ? HOH D 1867 . ? 1_555 ? 
79  AD2 7  HOH MA .   ? HOH D 1937 . ? 1_555 ? 
80  AD3 7  TYR B  252 ? TYR D 1051 . ? 1_555 ? 
81  AD3 7  GLU B  256 ? GLU D 1055 . ? 1_555 ? 
82  AD3 7  TYR B  279 ? TYR D 1078 . ? 1_555 ? 
83  AD3 7  GLU B  355 ? GLU D 1154 . ? 1_555 ? 
84  AD3 7  ARG B  356 ? ARG D 1155 . ? 1_555 ? 
85  AD3 7  HOH MA .   ? HOH D 1606 . ? 1_555 ? 
86  AD3 7  HOH MA .   ? HOH D 1794 . ? 1_555 ? 
87  AD4 4  HIS B  591 ? HIS D 1390 . ? 1_555 ? 
88  AD4 4  HOH MA .   ? HOH D 2114 . ? 1_555 ? 
89  AD4 4  DA  H  1   ? DA  f -8   . ? 1_655 ? 
90  AD4 4  HOH SA .   ? HOH f 110  . ? 1_655 ? 
91  AD5 6  ASP E  100 ? ASP b 508  . ? 1_555 ? 
92  AD5 6  ASP E  102 ? ASP b 510  . ? 1_555 ? 
93  AD5 6  HOH PA .   ? HOH b 1641 . ? 1_555 ? 
94  AD5 6  HOH PA .   ? HOH b 1935 . ? 1_555 ? 
95  AD5 6  HOH PA .   ? HOH b 1962 . ? 1_555 ? 
96  AD5 6  HOH RA .   ? HOH e 224  . ? 1_555 ? 
97  AD6 14 ARG E  188 ? ARG b 630  . ? 1_555 ? 
98  AD6 14 GLU E  192 ? GLU b 634  . ? 1_555 ? 
99  AD6 14 ALA E  195 ? ALA b 637  . ? 1_555 ? 
100 AD6 14 MET E  228 ? MET b 1027 . ? 1_555 ? 
101 AD6 14 MET E  380 ? MET b 1179 . ? 1_555 ? 
102 AD6 14 ARG E  543 ? ARG b 1342 . ? 1_555 ? 
103 AD6 14 PRO E  544 ? PRO b 1343 . ? 1_555 ? 
104 AD6 14 HOH PA .   ? HOH b 1802 . ? 1_555 ? 
105 AD6 14 HOH PA .   ? HOH b 1845 . ? 1_555 ? 
106 AD6 14 HOH PA .   ? HOH b 1903 . ? 1_555 ? 
107 AD6 14 HOH PA .   ? HOH b 1986 . ? 1_555 ? 
108 AD6 14 HOH PA .   ? HOH b 2017 . ? 1_555 ? 
109 AD6 14 GLU F  436 ? GLU d 1235 . ? 1_655 ? 
110 AD6 14 HOH QA .   ? HOH d 1609 . ? 1_655 ? 
111 AD7 9  MET E  276 ? MET b 1075 . ? 1_555 ? 
112 AD7 9  PRO E  281 ? PRO b 1080 . ? 1_555 ? 
113 AD7 9  HIS E  282 ? HIS b 1081 . ? 1_555 ? 
114 AD7 9  HOH PA .   ? HOH b 1653 . ? 1_555 ? 
115 AD7 9  HOH PA .   ? HOH b 1697 . ? 1_555 ? 
116 AD7 9  HOH PA .   ? HOH b 1772 . ? 1_555 ? 
117 AD7 9  HOH PA .   ? HOH b 1841 . ? 1_555 ? 
118 AD7 9  ARG F  323 ? ARG d 1122 . ? 1_555 ? 
119 AD7 9  PHE F  324 ? PHE d 1123 . ? 1_555 ? 
120 AD8 7  PRO E  245 ? PRO b 1044 . ? 1_555 ? 
121 AD8 7  ARG E  248 ? ARG b 1047 . ? 1_555 ? 
122 AD8 7  HOH PA .   ? HOH b 1634 . ? 1_555 ? 
123 AD8 7  HOH PA .   ? HOH b 1656 . ? 1_555 ? 
124 AD8 7  HOH PA .   ? HOH b 1666 . ? 1_555 ? 
125 AD8 7  HOH PA .   ? HOH b 1758 . ? 1_555 ? 
126 AD8 7  HOH PA .   ? HOH b 1820 . ? 1_555 ? 
127 AD9 8  ARG E  323 ? ARG b 1122 . ? 1_555 ? 
128 AD9 8  PHE E  324 ? PHE b 1123 . ? 1_555 ? 
129 AD9 8  HOH PA .   ? HOH b 1655 . ? 1_555 ? 
130 AD9 8  HOH PA .   ? HOH b 1660 . ? 1_555 ? 
131 AD9 8  HOH PA .   ? HOH b 1706 . ? 1_555 ? 
132 AD9 8  MET F  276 ? MET d 1075 . ? 1_555 ? 
133 AD9 8  PRO F  281 ? PRO d 1080 . ? 1_555 ? 
134 AD9 8  HIS F  282 ? HIS d 1081 . ? 1_555 ? 
135 AE1 5  ARG E  630 ? ARG b 1429 . ? 1_555 ? 
136 AE1 5  HOH PA .   ? HOH b 1627 . ? 1_555 ? 
137 AE1 5  HOH PA .   ? HOH b 1973 . ? 1_555 ? 
138 AE1 5  ARG F  630 ? ARG d 1429 . ? 1_555 ? 
139 AE1 5  ARG F  633 ? ARG d 1432 . ? 1_555 ? 
140 AE2 6  TYR E  523 ? TYR b 1322 . ? 1_555 ? 
141 AE2 6  LYS E  524 ? LYS b 1323 . ? 1_555 ? 
142 AE2 6  THR E  526 ? THR b 1325 . ? 1_555 ? 
143 AE2 6  GLN E  529 ? GLN b 1328 . ? 1_555 ? 
144 AE2 6  HOH PA .   ? HOH b 1991 . ? 1_555 ? 
145 AE2 6  HOH PA .   ? HOH b 2074 . ? 1_555 ? 
146 AE3 12 ARG A  60  ? ARG B 468  . ? 1_556 ? 
147 AE3 12 HOH LA .   ? HOH B 2073 . ? 1_556 ? 
148 AE3 12 DA  C  1   ? DA  E -8   . ? 1_556 ? 
149 AE3 12 DT  D  20  ? DT  F 12   . ? 1_556 ? 
150 AE3 12 ARG E  586 ? ARG b 1385 . ? 1_555 ? 
151 AE3 12 ILE E  587 ? ILE b 1386 . ? 1_555 ? 
152 AE3 12 ASP E  590 ? ASP b 1389 . ? 1_555 ? 
153 AE3 12 HIS E  591 ? HIS b 1390 . ? 1_555 ? 
154 AE3 12 GLU E  594 ? GLU b 1393 . ? 1_555 ? 
155 AE3 12 ARG E  615 ? ARG b 1414 . ? 1_555 ? 
156 AE3 12 LYS E  617 ? LYS b 1416 . ? 1_555 ? 
157 AE3 12 94H DA .   ? 94H b 1509 . ? 1_555 ? 
158 AE4 13 ARG A  60  ? ARG B 468  . ? 1_556 ? 
159 AE4 13 HOH LA .   ? HOH B 2073 . ? 1_556 ? 
160 AE4 13 DA  C  1   ? DA  E -8   . ? 1_556 ? 
161 AE4 13 DT  D  20  ? DT  F 12   . ? 1_556 ? 
162 AE4 13 ILE E  587 ? ILE b 1386 . ? 1_555 ? 
163 AE4 13 ASP E  590 ? ASP b 1389 . ? 1_555 ? 
164 AE4 13 HIS E  591 ? HIS b 1390 . ? 1_555 ? 
165 AE4 13 GLU E  594 ? GLU b 1393 . ? 1_555 ? 
166 AE4 13 ARG E  615 ? ARG b 1414 . ? 1_555 ? 
167 AE4 13 PHE E  616 ? PHE b 1415 . ? 1_555 ? 
168 AE4 13 LYS E  617 ? LYS b 1416 . ? 1_555 ? 
169 AE4 13 9JN CA .   ? 9JN b 1508 . ? 1_555 ? 
170 AE4 13 HOH PA .   ? HOH b 1718 . ? 1_555 ? 
171 AE5 6  ASP F  100 ? ASP d 508  . ? 1_555 ? 
172 AE5 6  ASP F  102 ? ASP d 510  . ? 1_555 ? 
173 AE5 6  HOH QA .   ? HOH d 1649 . ? 1_555 ? 
174 AE5 6  HOH QA .   ? HOH d 1843 . ? 1_555 ? 
175 AE5 6  HOH QA .   ? HOH d 1879 . ? 1_555 ? 
176 AE5 6  HOH SA .   ? HOH f 131  . ? 1_555 ? 
177 AE6 9  ARG F  188 ? ARG d 630  . ? 1_555 ? 
178 AE6 9  ILE F  191 ? ILE d 633  . ? 1_555 ? 
179 AE6 9  GLU F  192 ? GLU d 634  . ? 1_555 ? 
180 AE6 9  ALA F  195 ? ALA d 637  . ? 1_555 ? 
181 AE6 9  MET F  228 ? MET d 1027 . ? 1_555 ? 
182 AE6 9  MET F  380 ? MET d 1179 . ? 1_555 ? 
183 AE6 9  ARG F  543 ? ARG d 1342 . ? 1_555 ? 
184 AE6 9  PRO F  544 ? PRO d 1343 . ? 1_555 ? 
185 AE6 9  HOH QA .   ? HOH d 1840 . ? 1_555 ? 
186 AE7 4  GLY F  38  ? GLY d 446  . ? 1_555 ? 
187 AE7 4  ARG F  39  ? ARG d 447  . ? 1_555 ? 
188 AE7 4  ASP F  147 ? ASP d 589  . ? 1_555 ? 
189 AE7 4  HOH QA .   ? HOH d 1607 . ? 1_555 ? 
190 AE8 7  PRO F  245 ? PRO d 1044 . ? 1_555 ? 
191 AE8 7  ARG F  248 ? ARG d 1047 . ? 1_555 ? 
192 AE8 7  ARG F  249 ? ARG d 1048 . ? 1_555 ? 
193 AE8 7  GLU F  357 ? GLU d 1156 . ? 1_555 ? 
194 AE8 7  HOH QA .   ? HOH d 1601 . ? 1_555 ? 
195 AE8 7  HOH QA .   ? HOH d 1653 . ? 1_555 ? 
196 AE8 7  HOH QA .   ? HOH d 1676 . ? 1_555 ? 
197 AE9 2  DA  D  1   ? DA  F -8   . ? 1_456 ? 
198 AE9 2  HIS F  591 ? HIS d 1390 . ? 1_555 ? 
199 AF1 11 ARG A  586 ? ARG B 1385 . ? 1_555 ? 
200 AF1 11 ILE A  587 ? ILE B 1386 . ? 1_555 ? 
201 AF1 11 ASP A  590 ? ASP B 1389 . ? 1_555 ? 
202 AF1 11 HIS A  591 ? HIS B 1390 . ? 1_555 ? 
203 AF1 11 GLU A  594 ? GLU B 1393 . ? 1_555 ? 
204 AF1 11 ARG A  615 ? ARG B 1414 . ? 1_555 ? 
205 AF1 11 94H N  .   ? 94H B 1506 . ? 1_555 ? 
206 AF1 11 HOH LA .   ? HOH B 1852 . ? 1_555 ? 
207 AF1 11 ARG E  60  ? ARG b 468  . ? 1_555 ? 
208 AF1 11 DA  G  1   ? DA  e -8   . ? 1_555 ? 
209 AF1 11 DT  H  20  ? DT  f 12   . ? 1_555 ? 
210 AF2 9  ARG E  50  ? ARG b 458  . ? 1_555 ? 
211 AF2 9  GLY E  51  ? GLY b 459  . ? 1_555 ? 
212 AF2 9  DG  G  8   ? DG  e -1   . ? 1_555 ? 
213 AF2 9  DG  G  9   ? DG  e 1    . ? 1_555 ? 
214 AF2 9  DT  G  10  ? DT  e 2    . ? 1_555 ? 
215 AF2 9  HOH RA .   ? HOH e 203  . ? 1_555 ? 
216 AF2 9  HOH RA .   ? HOH e 222  . ? 1_555 ? 
217 AF2 9  DA  H  11  ? DA  f 3    . ? 1_555 ? 
218 AF2 9  DC  H  12  ? DC  f 4    . ? 1_555 ? 
219 AF3 12 GLU E  594 ? GLU b 1393 . ? 1_555 ? 
220 AF3 12 THR E  598 ? THR b 1397 . ? 1_555 ? 
221 AF3 12 GLU E  610 ? GLU b 1409 . ? 1_555 ? 
222 AF3 12 SER E  611 ? SER b 1410 . ? 1_555 ? 
223 AF3 12 LEU E  612 ? LEU b 1411 . ? 1_555 ? 
224 AF3 12 GLN E  613 ? GLN b 1412 . ? 1_555 ? 
225 AF3 12 PHE E  616 ? PHE b 1415 . ? 1_555 ? 
226 AF3 12 LYS E  617 ? LYS b 1416 . ? 1_555 ? 
227 AF3 12 9JN CA .   ? 9JN b 1508 . ? 1_555 ? 
228 AF3 12 94H DA .   ? 94H b 1509 . ? 1_555 ? 
229 AF3 12 HOH PA .   ? HOH b 1741 . ? 1_555 ? 
230 AF3 12 HOH PA .   ? HOH b 2094 . ? 1_555 ? 
231 AF4 12 GLU E  594 ? GLU b 1393 . ? 1_555 ? 
232 AF4 12 THR E  598 ? THR b 1397 . ? 1_555 ? 
233 AF4 12 GLU E  610 ? GLU b 1409 . ? 1_555 ? 
234 AF4 12 SER E  611 ? SER b 1410 . ? 1_555 ? 
235 AF4 12 LEU E  612 ? LEU b 1411 . ? 1_555 ? 
236 AF4 12 GLN E  613 ? GLN b 1412 . ? 1_555 ? 
237 AF4 12 PHE E  616 ? PHE b 1415 . ? 1_555 ? 
238 AF4 12 LYS E  617 ? LYS b 1416 . ? 1_555 ? 
239 AF4 12 9JN CA .   ? 9JN b 1508 . ? 1_555 ? 
240 AF4 12 94H DA .   ? 94H b 1509 . ? 1_555 ? 
241 AF4 12 HOH PA .   ? HOH b 1741 . ? 1_555 ? 
242 AF4 12 HOH PA .   ? HOH b 2094 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5NPK 
_atom_sites.fract_transf_matrix[1][1]   0.011180 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000010 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008286 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005921 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1  9   ? 37.378  25.559 -26.558 1.00 53.24  ? 417  LYS B N     1 
ATOM   2     C  CA    . LYS A  1  9   ? 37.608  25.287 -25.105 1.00 48.73  ? 417  LYS B CA    1 
ATOM   3     C  C     . LYS A  1  9   ? 37.721  23.788 -24.875 1.00 47.08  ? 417  LYS B C     1 
ATOM   4     O  O     . LYS A  1  9   ? 38.064  23.369 -23.768 1.00 46.29  ? 417  LYS B O     1 
ATOM   5     C  CB    . LYS A  1  9   ? 36.454  25.861 -24.272 1.00 50.62  ? 417  LYS B CB    1 
ATOM   6     N  N     . LEU A  1  10  ? 37.415  22.986 -25.885 1.00 45.25  ? 418  LEU B N     1 
ATOM   7     C  CA    . LEU A  1  10  ? 37.439  21.537 -25.749 1.00 42.77  ? 418  LEU B CA    1 
ATOM   8     C  C     . LEU A  1  10  ? 38.871  21.016 -25.672 1.00 44.49  ? 418  LEU B C     1 
ATOM   9     O  O     . LEU A  1  10  ? 39.703  21.340 -26.521 1.00 46.34  ? 418  LEU B O     1 
ATOM   10    C  CB    . LEU A  1  10  ? 36.704  20.878 -26.914 1.00 41.32  ? 418  LEU B CB    1 
ATOM   11    C  CG    . LEU A  1  10  ? 36.923  19.362 -27.052 1.00 42.47  ? 418  LEU B CG    1 
ATOM   12    C  CD1   . LEU A  1  10  ? 36.016  18.582 -26.102 1.00 41.47  ? 418  LEU B CD1   1 
ATOM   13    C  CD2   . LEU A  1  10  ? 36.749  18.915 -28.516 1.00 45.66  ? 418  LEU B CD2   1 
ATOM   14    N  N     . ALA A  1  11  ? 39.148  20.218 -24.652 1.00 43.75  ? 419  ALA B N     1 
ATOM   15    C  CA    . ALA A  1  11  ? 40.413  19.484 -24.562 1.00 44.19  ? 419  ALA B CA    1 
ATOM   16    C  C     . ALA A  1  11  ? 40.096  18.039 -24.903 1.00 46.85  ? 419  ALA B C     1 
ATOM   17    O  O     . ALA A  1  11  ? 39.582  17.278 -24.075 1.00 45.89  ? 419  ALA B O     1 
ATOM   18    C  CB    . ALA A  1  11  ? 41.024  19.605 -23.165 1.00 43.48  ? 419  ALA B CB    1 
ATOM   19    N  N     . ASP A  1  12  ? 40.373  17.656 -26.148 1.00 45.94  ? 420  ASP B N     1 
ATOM   20    C  CA    . ASP A  1  12  ? 39.997  16.338 -26.637 1.00 45.80  ? 420  ASP B CA    1 
ATOM   21    C  C     . ASP A  1  12  ? 40.930  15.266 -26.100 1.00 46.99  ? 420  ASP B C     1 
ATOM   22    O  O     . ASP A  1  12  ? 41.981  15.556 -25.504 1.00 45.56  ? 420  ASP B O     1 
ATOM   23    C  CB    . ASP A  1  12  ? 39.987  16.338 -28.167 1.00 48.35  ? 420  ASP B CB    1 
ATOM   24    C  CG    . ASP A  1  12  ? 39.027  15.308 -28.740 1.00 48.70  ? 420  ASP B CG    1 
ATOM   25    O  OD1   . ASP A  1  12  ? 38.611  14.397 -28.006 1.00 45.50  ? 420  ASP B OD1   1 
ATOM   26    O  OD2   . ASP A  1  12  ? 38.708  15.443 -29.954 1.00 52.69  ? 420  ASP B OD2   1 
ATOM   27    N  N     . CYS A  1  13  ? 40.534  14.015 -26.279 1.00 43.54  ? 421  CYS B N     1 
ATOM   28    C  CA    . CYS A  1  13  ? 41.359  12.859 -25.970 1.00 47.28  ? 421  CYS B CA    1 
ATOM   29    C  C     . CYS A  1  13  ? 42.100  12.397 -27.223 1.00 48.13  ? 421  CYS B C     1 
ATOM   30    O  O     . CYS A  1  13  ? 41.729  12.740 -28.352 1.00 52.94  ? 421  CYS B O     1 
ATOM   31    C  CB    . CYS A  1  13  ? 40.534  11.725 -25.379 1.00 42.12  ? 421  CYS B CB    1 
ATOM   32    S  SG    . CYS A  1  13  ? 39.132  11.206 -26.395 1.00 48.38  ? 421  CYS B SG    1 
ATOM   33    N  N     . SER A  1  14  ? 43.159  11.617 -27.015 1.00 47.32  ? 422  SER B N     1 
ATOM   34    C  CA    . SER A  1  14  ? 44.018  11.207 -28.119 1.00 49.09  ? 422  SER B CA    1 
ATOM   35    C  C     . SER A  1  14  ? 43.409  10.065 -28.937 1.00 52.78  ? 422  SER B C     1 
ATOM   36    O  O     . SER A  1  14  ? 43.642  9.978  -30.148 1.00 55.18  ? 422  SER B O     1 
ATOM   37    C  CB    . SER A  1  14  ? 45.411  10.837 -27.589 1.00 48.38  ? 422  SER B CB    1 
ATOM   38    O  OG    . SER A  1  14  ? 45.316  9.775  -26.666 1.00 45.02  ? 422  SER B OG    1 
ATOM   39    N  N     . SER A  1  15  ? 42.637  9.187  -28.298 1.00 54.87  ? 423  SER B N     1 
ATOM   40    C  CA    . SER A  1  15  ? 41.989  8.104  -29.012 1.00 55.01  ? 423  SER B CA    1 
ATOM   41    C  C     . SER A  1  15  ? 40.919  8.625  -29.951 1.00 57.18  ? 423  SER B C     1 
ATOM   42    O  O     . SER A  1  15  ? 40.313  9.664  -29.718 1.00 52.80  ? 423  SER B O     1 
ATOM   43    C  CB    . SER A  1  15  ? 41.403  7.076  -28.040 1.00 53.10  ? 423  SER B CB    1 
ATOM   44    O  OG    . SER A  1  15  ? 40.586  6.135  -28.724 1.00 56.71  ? 423  SER B OG    1 
ATOM   45    N  N     . LYS A  1  16  ? 40.683  7.862  -31.023 1.00 58.38  ? 424  LYS B N     1 
ATOM   46    C  CA    . LYS A  1  16  ? 39.662  8.181  -32.005 1.00 58.53  ? 424  LYS B CA    1 
ATOM   47    C  C     . LYS A  1  16  ? 38.636  7.071  -32.153 1.00 59.72  ? 424  LYS B C     1 
ATOM   48    O  O     . LYS A  1  16  ? 37.868  7.076  -33.125 1.00 62.43  ? 424  LYS B O     1 
ATOM   49    C  CB    . LYS A  1  16  ? 40.307  8.521  -33.343 1.00 60.29  ? 424  LYS B CB    1 
ATOM   50    C  CG    . LYS A  1  16  ? 41.208  9.747  -33.294 1.00 60.87  ? 424  LYS B CG    1 
ATOM   51    C  CD    . LYS A  1  16  ? 40.488  10.945 -32.691 1.00 59.92  ? 424  LYS B CD    1 
ATOM   52    C  CE    . LYS A  1  16  ? 41.438  12.089 -32.423 1.00 59.96  ? 424  LYS B CE    1 
ATOM   53    N  NZ    . LYS A  1  16  ? 40.699  13.273 -31.860 1.00 56.96  ? 424  LYS B NZ    1 
ATOM   54    N  N     . SER A  1  17  ? 38.618  6.109  -31.223 1.00 59.96  ? 425  SER B N     1 
ATOM   55    C  CA    . SER A  1  17  ? 37.605  5.056  -31.194 1.00 60.08  ? 425  SER B CA    1 
ATOM   56    C  C     . SER A  1  17  ? 36.485  5.508  -30.255 1.00 56.23  ? 425  SER B C     1 
ATOM   57    O  O     . SER A  1  17  ? 36.629  5.409  -29.026 1.00 51.74  ? 425  SER B O     1 
ATOM   58    C  CB    . SER A  1  17  ? 38.180  3.725  -30.731 1.00 65.47  ? 425  SER B CB    1 
ATOM   59    O  OG    . SER A  1  17  ? 38.603  2.940  -31.814 1.00 76.26  ? 425  SER B OG    1 
ATOM   60    N  N     . PRO A  1  18  ? 35.343  6.019  -30.877 1.00 52.29  ? 426  PRO B N     1 
ATOM   61    C  CA    . PRO A  1  18  ? 34.326  6.492  -29.940 1.00 51.16  ? 426  PRO B CA    1 
ATOM   62    C  C     . PRO A  1  18  ? 33.812  5.533  -28.879 1.00 52.43  ? 426  PRO B C     1 
ATOM   63    O  O     . PRO A  1  18  ? 33.395  5.984  -27.816 1.00 50.86  ? 426  PRO B O     1 
ATOM   64    C  CB    . PRO A  1  18  ? 33.159  6.853  -30.855 1.00 50.23  ? 426  PRO B CB    1 
ATOM   65    C  CG    . PRO A  1  18  ? 33.794  7.301  -32.099 1.00 48.28  ? 426  PRO B CG    1 
ATOM   66    C  CD    . PRO A  1  18  ? 34.850  6.241  -32.293 1.00 53.27  ? 426  PRO B CD    1 
ATOM   67    N  N     . GLU A  1  19  ? 33.826  4.242  -29.154 1.00 49.75  ? 427  GLU B N     1 
ATOM   68    C  CA    . GLU A  1  19  ? 33.265  3.279  -28.229 1.00 49.18  ? 427  GLU B CA    1 
ATOM   69    C  C     . GLU A  1  19  ? 33.917  3.378  -26.842 1.00 48.23  ? 427  GLU B C     1 
ATOM   70    O  O     . GLU A  1  19  ? 33.257  3.132  -25.830 1.00 49.41  ? 427  GLU B O     1 
ATOM   71    C  CB    . GLU A  1  19  ? 33.469  1.843  -28.784 1.00 48.23  ? 427  GLU B CB    1 
ATOM   72    N  N     . GLU A  1  20  ? 35.203  3.732  -26.798 1.00 47.31  ? 428  GLU B N     1 
ATOM   73    C  CA    . GLU A  1  20  ? 35.920  3.852  -25.535 1.00 47.56  ? 428  GLU B CA    1 
ATOM   74    C  C     . GLU A  1  20  ? 36.145  5.298  -25.097 1.00 44.14  ? 428  GLU B C     1 
ATOM   75    O  O     . GLU A  1  20  ? 36.760  5.529  -24.058 1.00 45.76  ? 428  GLU B O     1 
ATOM   76    C  CB    . GLU A  1  20  ? 37.273  3.133  -25.623 1.00 48.63  ? 428  GLU B CB    1 
ATOM   77    C  CG    . GLU A  1  20  ? 38.268  3.789  -26.571 1.00 48.81  ? 428  GLU B CG    1 
ATOM   78    C  CD    . GLU A  1  20  ? 39.636  3.136  -26.512 1.00 54.38  ? 428  GLU B CD    1 
ATOM   79    O  OE1   . GLU A  1  20  ? 39.770  1.993  -25.988 1.00 54.26  ? 428  GLU B OE1   1 
ATOM   80    O  OE2   . GLU A  1  20  ? 40.605  3.727  -27.032 1.00 53.26  ? 428  GLU B OE2   1 
ATOM   81    N  N     . CYS A  1  21  ? 35.699  6.269  -25.887 1.00 45.13  ? 429  CYS B N     1 
ATOM   82    C  CA    . CYS A  1  21  ? 35.920  7.679  -25.573 1.00 45.72  ? 429  CYS B CA    1 
ATOM   83    C  C     . CYS A  1  21  ? 34.738  8.264  -24.818 1.00 45.08  ? 429  CYS B C     1 
ATOM   84    O  O     . CYS A  1  21  ? 33.578  7.878  -25.021 1.00 42.20  ? 429  CYS B O     1 
ATOM   85    C  CB    . CYS A  1  21  ? 36.190  8.486  -26.851 1.00 44.33  ? 429  CYS B CB    1 
ATOM   86    S  SG    . CYS A  1  21  ? 37.762  8.016  -27.656 1.00 49.32  ? 429  CYS B SG    1 
ATOM   87    N  N     . GLU A  1  22  ? 35.049  9.199  -23.923 1.00 43.15  ? 430  GLU B N     1 
ATOM   88    C  CA    . GLU A  1  22  ? 34.052  9.848  -23.060 1.00 41.10  ? 430  GLU B CA    1 
ATOM   89    C  C     . GLU A  1  22  ? 34.371  11.332 -23.013 1.00 39.87  ? 430  GLU B C     1 
ATOM   90    O  O     . GLU A  1  22  ? 35.538  11.715 -22.858 1.00 40.59  ? 430  GLU B O     1 
ATOM   91    C  CB    . GLU A  1  22  ? 34.032  9.264  -21.672 1.00 40.77  ? 430  GLU B CB    1 
ATOM   92    C  CG    . GLU A  1  22  ? 34.763  7.916  -21.545 1.00 41.70  ? 430  GLU B CG    1 
ATOM   93    C  CD    . GLU A  1  22  ? 34.811  7.364  -20.130 1.00 44.65  ? 430  GLU B CD    1 
ATOM   94    O  OE1   . GLU A  1  22  ? 34.354  6.254  -19.915 1.00 44.25  ? 430  GLU B OE1   1 
ATOM   95    O  OE2   . GLU A  1  22  ? 35.285  8.097  -19.223 1.00 44.04  ? 430  GLU B OE2   1 
ATOM   96    N  N     . ILE A  1  23  ? 33.339  12.167 -23.146 1.00 36.53  ? 431  ILE B N     1 
ATOM   97    C  CA    . ILE A  1  23  ? 33.488  13.611 -22.996 1.00 36.33  ? 431  ILE B CA    1 
ATOM   98    C  C     . ILE A  1  23  ? 32.755  14.036 -21.720 1.00 35.00  ? 431  ILE B C     1 
ATOM   99    O  O     . ILE A  1  23  ? 31.618  13.614 -21.463 1.00 31.91  ? 431  ILE B O     1 
ATOM   100   C  CB    . ILE A  1  23  ? 32.973  14.377 -24.227 1.00 36.41  ? 431  ILE B CB    1 
ATOM   101   C  CG1   . ILE A  1  23  ? 33.186  15.877 -24.038 1.00 35.44  ? 431  ILE B CG1   1 
ATOM   102   C  CG2   . ILE A  1  23  ? 31.504  14.061 -24.502 1.00 34.37  ? 431  ILE B CG2   1 
ATOM   103   C  CD1   . ILE A  1  23  ? 32.816  16.680 -25.289 1.00 36.88  ? 431  ILE B CD1   1 
ATOM   104   N  N     . PHE A  1  24  ? 33.430  14.863 -20.918 1.00 33.46  ? 432  PHE B N     1 
ATOM   105   C  CA    . PHE A  1  24  ? 32.855  15.380 -19.680 1.00 31.91  ? 432  PHE B CA    1 
ATOM   106   C  C     . PHE A  1  24  ? 32.480  16.831 -19.875 1.00 29.87  ? 432  PHE B C     1 
ATOM   107   O  O     . PHE A  1  24  ? 33.342  17.651 -20.218 1.00 29.91  ? 432  PHE B O     1 
ATOM   108   C  CB    . PHE A  1  24  ? 33.841  15.220 -18.519 1.00 34.98  ? 432  PHE B CB    1 
ATOM   109   C  CG    . PHE A  1  24  ? 34.030  13.791 -18.055 1.00 34.22  ? 432  PHE B CG    1 
ATOM   110   C  CD1   . PHE A  1  24  ? 34.814  12.952 -18.773 1.00 34.01  ? 432  PHE B CD1   1 
ATOM   111   C  CD2   . PHE A  1  24  ? 33.441  13.341 -16.922 1.00 31.59  ? 432  PHE B CD2   1 
ATOM   112   C  CE1   . PHE A  1  24  ? 35.014  11.614 -18.350 1.00 36.41  ? 432  PHE B CE1   1 
ATOM   113   C  CE2   . PHE A  1  24  ? 33.622  12.033 -16.472 1.00 33.98  ? 432  PHE B CE2   1 
ATOM   114   C  CZ    . PHE A  1  24  ? 34.412  11.177 -17.182 1.00 34.44  ? 432  PHE B CZ    1 
ATOM   115   N  N     . LEU A  1  25  ? 31.199  17.149 -19.671 1.00 28.93  ? 433  LEU B N     1 
ATOM   116   C  CA    . LEU A  1  25  ? 30.720  18.533 -19.689 1.00 29.03  ? 433  LEU B CA    1 
ATOM   117   C  C     . LEU A  1  25  ? 30.790  19.065 -18.268 1.00 28.15  ? 433  LEU B C     1 
ATOM   118   O  O     . LEU A  1  25  ? 29.964  18.699 -17.424 1.00 29.29  ? 433  LEU B O     1 
ATOM   119   C  CB    . LEU A  1  25  ? 29.288  18.595 -20.224 1.00 30.75  ? 433  LEU B CB    1 
ATOM   120   C  CG    . LEU A  1  25  ? 29.024  17.794 -21.525 1.00 33.04  ? 433  LEU B CG    1 
ATOM   121   C  CD1   . LEU A  1  25  ? 27.587  17.595 -21.784 1.00 33.75  ? 433  LEU B CD1   1 
ATOM   122   C  CD2   . LEU A  1  25  ? 29.637  18.557 -22.731 1.00 34.12  ? 433  LEU B CD2   1 
ATOM   123   N  N     . VAL A  1  26  ? 31.773  19.928 -18.002 1.00 28.05  ? 434  VAL B N     1 
ATOM   124   C  CA    . VAL A  1  26  ? 32.145  20.319 -16.639 1.00 26.85  ? 434  VAL B CA    1 
ATOM   125   C  C     . VAL A  1  26  ? 31.691  21.698 -16.326 1.00 25.75  ? 434  VAL B C     1 
ATOM   126   O  O     . VAL A  1  26  ? 31.879  22.624 -17.150 1.00 29.07  ? 434  VAL B O     1 
ATOM   127   C  CB    . VAL A  1  26  ? 33.671  20.168 -16.435 1.00 26.64  ? 434  VAL B CB    1 
ATOM   128   C  CG1   . VAL A  1  26  ? 34.070  20.544 -15.029 1.00 24.62  ? 434  VAL B CG1   1 
ATOM   129   C  CG2   . VAL A  1  26  ? 34.124  18.724 -16.742 1.00 25.53  ? 434  VAL B CG2   1 
ATOM   130   N  N     . GLU A  1  27  ? 31.047  21.877 -15.157 1.00 25.04  ? 435  GLU B N     1 
ATOM   131   C  CA    . GLU A  1  27  ? 30.593  23.207 -14.716 1.00 26.11  ? 435  GLU B CA    1 
ATOM   132   C  C     . GLU A  1  27  ? 31.838  23.971 -14.196 1.00 26.53  ? 435  GLU B C     1 
ATOM   133   O  O     . GLU A  1  27  ? 32.509  23.530 -13.203 1.00 27.52  ? 435  GLU B O     1 
ATOM   134   C  CB    . GLU A  1  27  ? 29.614  23.074 -13.575 1.00 24.27  ? 435  GLU B CB    1 
ATOM   135   C  CG    . GLU A  1  27  ? 29.239  24.407 -12.918 1.00 26.00  ? 435  GLU B CG    1 
ATOM   136   C  CD    . GLU A  1  27  ? 28.413  24.219 -11.644 1.00 24.74  ? 435  GLU B CD    1 
ATOM   137   O  OE1   . GLU A  1  27  ? 27.992  23.068 -11.381 1.00 26.84  ? 435  GLU B OE1   1 
ATOM   138   O  OE2   . GLU A  1  27  ? 28.232  25.243 -10.950 1.00 24.43  ? 435  GLU B OE2   1 
ATOM   139   N  N     . GLY A  1  28  ? 32.122  25.111 -14.819 1.00 26.80  ? 436  GLY B N     1 
ATOM   140   C  CA    . GLY A  1  28  ? 33.088  26.016 -14.254 1.00 30.19  ? 436  GLY B CA    1 
ATOM   141   C  C     . GLY A  1  28  ? 34.468  25.913 -14.934 1.00 30.65  ? 436  GLY B C     1 
ATOM   142   O  O     . GLY A  1  28  ? 34.930  24.812 -15.271 1.00 28.57  ? 436  GLY B O     1 
ATOM   143   N  N     . ASP A  1  29  ? 35.108  27.085 -15.143 1.00 31.53  ? 437  ASP B N     1 
ATOM   144   C  CA    . ASP A  1  29  ? 36.426  27.099 -15.707 1.00 33.94  ? 437  ASP B CA    1 
ATOM   145   C  C     . ASP A  1  29  ? 37.479  26.574 -14.740 1.00 31.91  ? 437  ASP B C     1 
ATOM   146   O  O     . ASP A  1  29  ? 38.457  25.941 -15.199 1.00 30.34  ? 437  ASP B O     1 
ATOM   147   C  CB    . ASP A  1  29  ? 36.797  28.528 -16.169 1.00 41.34  ? 437  ASP B CB    1 
ATOM   148   C  CG    . ASP A  1  29  ? 35.964  28.984 -17.348 1.00 49.36  ? 437  ASP B CG    1 
ATOM   149   O  OD1   . ASP A  1  29  ? 35.965  28.385 -18.477 1.00 53.39  ? 437  ASP B OD1   1 
ATOM   150   O  OD2   . ASP A  1  29  ? 35.238  29.985 -17.171 1.00 63.71  ? 437  ASP B OD2   1 
ATOM   151   N  N     . SER A  1  30  ? 37.314  26.828 -13.418 1.00 30.10  ? 438  SER B N     1 
ATOM   152   C  CA    . SER A  1  30  ? 38.242  26.276 -12.470 1.00 30.48  ? 438  SER B CA    1 
ATOM   153   C  C     . SER A  1  30  ? 38.208  24.740 -12.518 1.00 29.77  ? 438  SER B C     1 
ATOM   154   O  O     . SER A  1  30  ? 39.267  24.086 -12.642 1.00 29.27  ? 438  SER B O     1 
ATOM   155   C  CB    . SER A  1  30  ? 37.987  26.786 -11.061 1.00 30.01  ? 438  SER B CB    1 
ATOM   156   O  OG    . SER A  1  30  ? 38.631  28.090 -10.968 1.00 35.76  ? 438  SER B OG    1 
ATOM   157   N  N     . ALA A  1  31  ? 37.020  24.180 -12.407 1.00 28.14  ? 439  ALA B N     1 
ATOM   158   C  CA    . ALA A  1  31  ? 36.881  22.720 -12.494 1.00 29.71  ? 439  ALA B CA    1 
ATOM   159   C  C     . ALA A  1  31  ? 37.258  22.222 -13.863 1.00 29.29  ? 439  ALA B C     1 
ATOM   160   O  O     . ALA A  1  31  ? 37.758  21.112 -13.993 1.00 33.55  ? 439  ALA B O     1 
ATOM   161   C  CB    . ALA A  1  31  ? 35.400  22.327 -12.182 1.00 25.84  ? 439  ALA B CB    1 
ATOM   162   N  N     . GLY A  1  32  ? 37.056  23.018 -14.895 1.00 32.33  ? 440  GLY B N     1 
ATOM   163   C  CA    . GLY A  1  32  ? 37.488  22.602 -16.240 1.00 31.32  ? 440  GLY B CA    1 
ATOM   164   C  C     . GLY A  1  32  ? 38.974  22.390 -16.329 1.00 33.44  ? 440  GLY B C     1 
ATOM   165   O  O     . GLY A  1  32  ? 39.434  21.433 -16.963 1.00 31.72  ? 440  GLY B O     1 
ATOM   166   N  N     . GLY A  1  33  ? 39.758  23.278 -15.695 1.00 32.59  ? 441  GLY B N     1 
ATOM   167   C  CA    . GLY A  1  33  ? 41.206  23.122 -15.750 1.00 32.32  ? 441  GLY B CA    1 
ATOM   168   C  C     . GLY A  1  33  ? 41.683  21.954 -14.898 1.00 32.44  ? 441  GLY B C     1 
ATOM   169   O  O     . GLY A  1  33  ? 42.616  21.244 -15.270 1.00 33.96  ? 441  GLY B O     1 
ATOM   170   N  N     . SER A  1  34  ? 41.055  21.751 -13.744 1.00 33.84  ? 442  SER B N     1 
ATOM   171   C  CA    . SER A  1  34  ? 41.458  20.631 -12.896 1.00 30.96  ? 442  SER B CA    1 
ATOM   172   C  C     . SER A  1  34  ? 41.111  19.286 -13.501 1.00 30.24  ? 442  SER B C     1 
ATOM   173   O  O     . SER A  1  34  ? 41.914  18.348 -13.423 1.00 29.68  ? 442  SER B O     1 
ATOM   174   C  CB    . SER A  1  34  ? 40.789  20.775 -11.512 1.00 33.00  ? 442  SER B CB    1 
ATOM   175   O  OG    . SER A  1  34  ? 41.007  22.074 -10.989 1.00 37.98  ? 442  SER B OG    1 
ATOM   176   N  N     . THR A  1  35  ? 39.925  19.153 -14.087 1.00 27.63  ? 443  THR B N     1 
ATOM   177   C  CA    . THR A  1  35  ? 39.542  17.885 -14.750 1.00 27.85  ? 443  THR B CA    1 
ATOM   178   C  C     . THR A  1  35  ? 40.436  17.632 -15.963 1.00 29.53  ? 443  THR B C     1 
ATOM   179   O  O     . THR A  1  35  ? 40.718  16.466 -16.292 1.00 30.02  ? 443  THR B O     1 
ATOM   180   C  CB    . THR A  1  35  ? 38.080  17.870 -15.123 1.00 27.38  ? 443  THR B CB    1 
ATOM   181   O  OG1   . THR A  1  35  ? 37.796  18.975 -15.975 1.00 29.39  ? 443  THR B OG1   1 
ATOM   182   C  CG2   . THR A  1  35  ? 37.184  17.946 -13.885 1.00 27.28  ? 443  THR B CG2   1 
ATOM   183   N  N     . LYS A  1  36  ? 40.877  18.699 -16.663 1.00 32.13  ? 444  LYS B N     1 
ATOM   184   C  CA    . LYS A  1  36  ? 41.793  18.504 -17.776 1.00 33.56  ? 444  LYS B CA    1 
ATOM   185   C  C     . LYS A  1  36  ? 43.131  17.938 -17.311 1.00 35.56  ? 444  LYS B C     1 
ATOM   186   O  O     . LYS A  1  36  ? 43.767  17.172 -18.034 1.00 36.97  ? 444  LYS B O     1 
ATOM   187   C  CB    . LYS A  1  36  ? 42.011  19.830 -18.512 1.00 35.92  ? 444  LYS B CB    1 
ATOM   188   C  CG    . LYS A  1  36  ? 40.873  20.226 -19.448 1.00 37.01  ? 444  LYS B CG    1 
ATOM   189   C  CD    . LYS A  1  36  ? 41.176  21.617 -20.032 1.00 36.94  ? 444  LYS B CD    1 
ATOM   190   C  CE    . LYS A  1  36  ? 39.918  22.099 -20.800 1.00 38.91  ? 444  LYS B CE    1 
ATOM   191   N  NZ    . LYS A  1  36  ? 40.118  23.408 -21.490 1.00 38.66  ? 444  LYS B NZ    1 
ATOM   192   N  N     A SER A  1  37  ? 43.557  18.303 -16.113 0.50 36.23  ? 445  SER B N     1 
ATOM   193   N  N     B SER A  1  37  ? 43.549  18.285 -16.108 0.50 35.51  ? 445  SER B N     1 
ATOM   194   C  CA    A SER A  1  37  ? 44.803  17.772 -15.562 0.50 37.24  ? 445  SER B CA    1 
ATOM   195   C  CA    B SER A  1  37  ? 44.803  17.757 -15.577 0.50 36.06  ? 445  SER B CA    1 
ATOM   196   C  C     A SER A  1  37  ? 44.630  16.395 -14.932 0.50 37.31  ? 445  SER B C     1 
ATOM   197   C  C     B SER A  1  37  ? 44.638  16.396 -14.913 0.50 36.61  ? 445  SER B C     1 
ATOM   198   O  O     A SER A  1  37  ? 45.539  15.605 -14.964 0.50 36.57  ? 445  SER B O     1 
ATOM   199   O  O     B SER A  1  37  ? 45.558  15.621 -14.897 0.50 35.99  ? 445  SER B O     1 
ATOM   200   C  CB    A SER A  1  37  ? 45.376  18.748 -14.518 0.50 38.53  ? 445  SER B CB    1 
ATOM   201   C  CB    B SER A  1  37  ? 45.407  18.756 -14.576 0.50 36.32  ? 445  SER B CB    1 
ATOM   202   O  OG    A SER A  1  37  ? 46.512  18.216 -13.862 0.50 38.31  ? 445  SER B OG    1 
ATOM   203   O  OG    B SER A  1  37  ? 45.578  20.037 -15.186 0.50 33.87  ? 445  SER B OG    1 
ATOM   204   N  N     . GLY A  1  38  ? 43.475  16.133 -14.333 1.00 36.97  ? 446  GLY B N     1 
ATOM   205   C  CA    . GLY A  1  38  ? 43.225  14.860 -13.670 1.00 37.20  ? 446  GLY B CA    1 
ATOM   206   C  C     . GLY A  1  38  ? 42.664  13.752 -14.537 1.00 36.40  ? 446  GLY B C     1 
ATOM   207   O  O     . GLY A  1  38  ? 42.566  12.623 -14.087 1.00 38.96  ? 446  GLY B O     1 
ATOM   208   N  N     . ARG A  1  39  ? 42.271  14.065 -15.760 1.00 36.58  ? 447  ARG B N     1 
ATOM   209   C  CA    . ARG A  1  39  ? 41.642  13.076 -16.626 1.00 37.11  ? 447  ARG B CA    1 
ATOM   210   C  C     . ARG A  1  39  ? 42.685  12.027 -17.113 1.00 39.20  ? 447  ARG B C     1 
ATOM   211   O  O     . ARG A  1  39  ? 43.877  12.225 -17.035 1.00 37.13  ? 447  ARG B O     1 
ATOM   212   C  CB    . ARG A  1  39  ? 41.009  13.764 -17.853 1.00 35.43  ? 447  ARG B CB    1 
ATOM   213   C  CG    . ARG A  1  39  ? 42.041  14.251 -18.872 1.00 39.53  ? 447  ARG B CG    1 
ATOM   214   C  CD    . ARG A  1  39  ? 41.437  15.271 -19.801 1.00 39.98  ? 447  ARG B CD    1 
ATOM   215   N  NE    . ARG A  1  39  ? 42.505  16.052 -20.465 1.00 41.06  ? 447  ARG B NE    1 
ATOM   216   C  CZ    . ARG A  1  39  ? 42.634  16.142 -21.782 1.00 43.42  ? 447  ARG B CZ    1 
ATOM   217   N  NH1   . ARG A  1  39  ? 43.617  16.863 -22.280 1.00 44.84  ? 447  ARG B NH1   1 
ATOM   218   N  NH2   . ARG A  1  39  ? 41.783  15.520 -22.588 1.00 38.39  ? 447  ARG B NH2   1 
ATOM   219   N  N     . ASP A  1  40  ? 42.151  10.924 -17.604 1.00 38.29  ? 448  ASP B N     1 
ATOM   220   C  CA    . ASP A  1  40  ? 42.925  10.004 -18.433 1.00 40.22  ? 448  ASP B CA    1 
ATOM   221   C  C     . ASP A  1  40  ? 42.780  10.507 -19.855 1.00 39.64  ? 448  ASP B C     1 
ATOM   222   O  O     . ASP A  1  40  ? 41.778  10.251 -20.529 1.00 38.78  ? 448  ASP B O     1 
ATOM   223   C  CB    . ASP A  1  40  ? 42.401  8.556  -18.275 1.00 37.87  ? 448  ASP B CB    1 
ATOM   224   C  CG    . ASP A  1  40  ? 43.113  7.580  -19.205 1.00 41.02  ? 448  ASP B CG    1 
ATOM   225   O  OD1   . ASP A  1  40  ? 44.080  7.918  -19.849 1.00 38.51  ? 448  ASP B OD1   1 
ATOM   226   O  OD2   . ASP A  1  40  ? 42.652  6.451  -19.287 1.00 39.76  ? 448  ASP B OD2   1 
ATOM   227   N  N     . SER A  1  41  ? 43.806  11.228 -20.315 1.00 39.86  ? 449  SER B N     1 
ATOM   228   C  CA    . SER A  1  41  ? 43.696  11.991 -21.569 1.00 41.31  ? 449  SER B CA    1 
ATOM   229   C  C     . SER A  1  41  ? 43.694  11.095 -22.822 1.00 44.81  ? 449  SER B C     1 
ATOM   230   O  O     . SER A  1  41  ? 43.461  11.615 -23.905 1.00 49.16  ? 449  SER B O     1 
ATOM   231   C  CB    . SER A  1  41  ? 44.818  13.000 -21.683 1.00 42.01  ? 449  SER B CB    1 
ATOM   232   O  OG    . SER A  1  41  ? 46.101  12.348 -21.704 1.00 44.27  ? 449  SER B OG    1 
ATOM   233   N  N     A ARG A  1  42  ? 43.895  9.793  -22.654 0.50 44.77  ? 450  ARG B N     1 
ATOM   234   N  N     B ARG A  1  42  ? 43.911  9.794  -22.704 0.50 43.93  ? 450  ARG B N     1 
ATOM   235   C  CA    A ARG A  1  42  ? 43.807  8.867  -23.765 0.50 45.94  ? 450  ARG B CA    1 
ATOM   236   C  CA    B ARG A  1  42  ? 43.769  8.972  -23.894 0.50 44.38  ? 450  ARG B CA    1 
ATOM   237   C  C     A ARG A  1  42  ? 42.362  8.691  -24.216 0.50 45.05  ? 450  ARG B C     1 
ATOM   238   C  C     B ARG A  1  42  ? 42.299  8.810  -24.264 0.50 43.62  ? 450  ARG B C     1 
ATOM   239   O  O     A ARG A  1  42  ? 42.093  8.582  -25.418 0.50 44.24  ? 450  ARG B O     1 
ATOM   240   O  O     B ARG A  1  42  ? 41.951  8.818  -25.450 0.50 41.78  ? 450  ARG B O     1 
ATOM   241   C  CB    A ARG A  1  42  ? 44.395  7.491  -23.364 0.50 47.06  ? 450  ARG B CB    1 
ATOM   242   C  CB    B ARG A  1  42  ? 44.422  7.584  -23.723 0.50 44.85  ? 450  ARG B CB    1 
ATOM   243   C  CG    A ARG A  1  42  ? 45.786  7.545  -22.736 0.50 47.24  ? 450  ARG B CG    1 
ATOM   244   C  CG    B ARG A  1  42  ? 44.259  6.722  -24.983 0.50 44.38  ? 450  ARG B CG    1 
ATOM   245   C  CD    A ARG A  1  42  ? 46.230  6.188  -22.205 0.50 47.55  ? 450  ARG B CD    1 
ATOM   246   C  CD    B ARG A  1  42  ? 44.808  5.292  -24.959 0.50 44.88  ? 450  ARG B CD    1 
ATOM   247   N  NE    A ARG A  1  42  ? 45.672  5.890  -20.905 0.50 44.28  ? 450  ARG B NE    1 
ATOM   248   N  NE    B ARG A  1  42  ? 44.214  4.504  -23.880 0.50 43.55  ? 450  ARG B NE    1 
ATOM   249   C  CZ    A ARG A  1  42  ? 45.922  4.782  -20.228 0.50 43.96  ? 450  ARG B CZ    1 
ATOM   250   C  CZ    B ARG A  1  42  ? 43.196  3.696  -24.055 0.50 43.80  ? 450  ARG B CZ    1 
ATOM   251   N  NH1   A ARG A  1  42  ? 46.804  3.965  -20.719 0.50 44.56  ? 450  ARG B NH1   1 
ATOM   252   N  NH1   B ARG A  1  42  ? 42.680  3.586  -25.250 0.50 43.54  ? 450  ARG B NH1   1 
ATOM   253   N  NH2   A ARG A  1  42  ? 45.352  4.562  -19.036 0.50 42.57  ? 450  ARG B NH2   1 
ATOM   254   N  NH2   B ARG A  1  42  ? 42.658  3.032  -23.055 0.50 43.85  ? 450  ARG B NH2   1 
ATOM   255   N  N     . THR A  1  43  ? 41.431  8.671  -23.262 1.00 43.03  ? 451  THR B N     1 
ATOM   256   C  CA    . THR A  1  43  ? 40.041  8.328  -23.528 1.00 42.42  ? 451  THR B CA    1 
ATOM   257   C  C     . THR A  1  43  ? 39.008  9.306  -23.001 1.00 42.74  ? 451  THR B C     1 
ATOM   258   O  O     . THR A  1  43  ? 37.813  9.078  -23.200 1.00 37.70  ? 451  THR B O     1 
ATOM   259   C  CB    . THR A  1  43  ? 39.737  6.939  -22.950 1.00 45.32  ? 451  THR B CB    1 
ATOM   260   O  OG1   . THR A  1  43  ? 40.208  6.874  -21.596 1.00 46.24  ? 451  THR B OG1   1 
ATOM   261   C  CG2   . THR A  1  43  ? 40.417  5.842  -23.798 1.00 48.43  ? 451  THR B CG2   1 
ATOM   262   N  N     . GLN A  1  44  ? 39.421  10.390 -22.332 1.00 37.31  ? 452  GLN B N     1 
ATOM   263   C  CA    . GLN A  1  44  ? 38.465  11.320 -21.717 1.00 38.38  ? 452  GLN B CA    1 
ATOM   264   C  C     . GLN A  1  44  ? 38.721  12.726 -22.230 1.00 36.34  ? 452  GLN B C     1 
ATOM   265   O  O     . GLN A  1  44  ? 39.854  13.226 -22.170 1.00 37.31  ? 452  GLN B O     1 
ATOM   266   C  CB    . GLN A  1  44  ? 38.577  11.274 -20.193 1.00 35.75  ? 452  GLN B CB    1 
ATOM   267   C  CG    . GLN A  1  44  ? 38.086  9.962  -19.590 1.00 37.25  ? 452  GLN B CG    1 
ATOM   268   C  CD    . GLN A  1  44  ? 38.389  9.839  -18.113 1.00 36.83  ? 452  GLN B CD    1 
ATOM   269   O  OE1   . GLN A  1  44  ? 39.244  10.550 -17.577 1.00 38.53  ? 452  GLN B OE1   1 
ATOM   270   N  NE2   . GLN A  1  44  ? 37.677  8.964  -17.429 1.00 34.15  ? 452  GLN B NE2   1 
ATOM   271   N  N     . ALA A  1  45  ? 37.670  13.364 -22.747 1.00 37.04  ? 453  ALA B N     1 
ATOM   272   C  CA    . ALA A  1  45  ? 37.706  14.751 -23.205 1.00 35.20  ? 453  ALA B CA    1 
ATOM   273   C  C     . ALA A  1  45  ? 36.918  15.637 -22.237 1.00 37.11  ? 453  ALA B C     1 
ATOM   274   O  O     . ALA A  1  45  ? 35.994  15.175 -21.556 1.00 37.32  ? 453  ALA B O     1 
ATOM   275   C  CB    . ALA A  1  45  ? 37.110  14.880 -24.611 1.00 35.36  ? 453  ALA B CB    1 
ATOM   276   N  N     . ILE A  1  46  ? 37.298  16.917 -22.192 1.00 34.76  ? 454  ILE B N     1 
ATOM   277   C  CA    . ILE A  1  46  ? 36.677  17.876 -21.283 1.00 32.75  ? 454  ILE B CA    1 
ATOM   278   C  C     . ILE A  1  46  ? 36.149  19.030 -22.105 1.00 32.51  ? 454  ILE B C     1 
ATOM   279   O  O     . ILE A  1  46  ? 36.874  19.593 -22.945 1.00 30.28  ? 454  ILE B O     1 
ATOM   280   C  CB    . ILE A  1  46  ? 37.643  18.420 -20.223 1.00 32.87  ? 454  ILE B CB    1 
ATOM   281   C  CG1   . ILE A  1  46  ? 38.447  17.240 -19.577 1.00 33.52  ? 454  ILE B CG1   1 
ATOM   282   C  CG2   . ILE A  1  46  ? 36.928  19.247 -19.191 1.00 32.40  ? 454  ILE B CG2   1 
ATOM   283   C  CD1   . ILE A  1  46  ? 37.634  16.434 -18.601 1.00 31.94  ? 454  ILE B CD1   1 
ATOM   284   N  N     . LEU A  1  47  ? 34.875  19.377 -21.906 1.00 33.38  ? 455  LEU B N     1 
ATOM   285   C  CA    . LEU A  1  47  ? 34.333  20.631 -22.397 1.00 33.79  ? 455  LEU B CA    1 
ATOM   286   C  C     . LEU A  1  47  ? 33.830  21.427 -21.204 1.00 33.39  ? 455  LEU B C     1 
ATOM   287   O  O     . LEU A  1  47  ? 32.786  21.075 -20.636 1.00 33.28  ? 455  LEU B O     1 
ATOM   288   C  CB    . LEU A  1  47  ? 33.198  20.393 -23.390 1.00 37.01  ? 455  LEU B CB    1 
ATOM   289   C  CG    . LEU A  1  47  ? 32.551  21.720 -23.893 1.00 39.48  ? 455  LEU B CG    1 
ATOM   290   C  CD1   . LEU A  1  47  ? 33.579  22.548 -24.596 1.00 40.76  ? 455  LEU B CD1   1 
ATOM   291   C  CD2   . LEU A  1  47  ? 31.416  21.401 -24.834 1.00 43.09  ? 455  LEU B CD2   1 
ATOM   292   N  N     . PRO A  1  48  ? 34.536  22.475 -20.785 1.00 32.93  ? 456  PRO B N     1 
ATOM   293   C  CA    . PRO A  1  48  ? 34.057  23.287 -19.673 1.00 31.54  ? 456  PRO B CA    1 
ATOM   294   C  C     . PRO A  1  48  ? 32.901  24.193 -20.141 1.00 31.63  ? 456  PRO B C     1 
ATOM   295   O  O     . PRO A  1  48  ? 32.903  24.700 -21.268 1.00 31.72  ? 456  PRO B O     1 
ATOM   296   C  CB    . PRO A  1  48  ? 35.245  24.122 -19.239 1.00 31.63  ? 456  PRO B CB    1 
ATOM   297   C  CG    . PRO A  1  48  ? 36.432  23.527 -19.986 1.00 35.43  ? 456  PRO B CG    1 
ATOM   298   C  CD    . PRO A  1  48  ? 35.865  22.906 -21.228 1.00 33.63  ? 456  PRO B CD    1 
ATOM   299   N  N     . LEU A  1  49  ? 31.905  24.356 -19.253 1.00 29.87  ? 457  LEU B N     1 
ATOM   300   C  CA    . LEU A  1  49  ? 30.821  25.278 -19.505 1.00 31.88  ? 457  LEU B CA    1 
ATOM   301   C  C     . LEU A  1  49  ? 30.962  26.433 -18.507 1.00 30.57  ? 457  LEU B C     1 
ATOM   302   O  O     . LEU A  1  49  ? 31.233  26.210 -17.331 1.00 33.39  ? 457  LEU B O     1 
ATOM   303   C  CB    . LEU A  1  49  ? 29.469  24.576 -19.312 1.00 31.13  ? 457  LEU B CB    1 
ATOM   304   C  CG    . LEU A  1  49  ? 29.283  23.330 -20.149 1.00 32.60  ? 457  LEU B CG    1 
ATOM   305   C  CD1   . LEU A  1  49  ? 27.929  22.682 -19.753 1.00 32.03  ? 457  LEU B CD1   1 
ATOM   306   C  CD2   . LEU A  1  49  ? 29.315  23.697 -21.688 1.00 34.64  ? 457  LEU B CD2   1 
ATOM   307   N  N     . ARG A  1  50  ? 30.805  27.653 -18.961 1.00 32.87  ? 458  ARG B N     1 
ATOM   308   C  CA    . ARG A  1  50  ? 30.976  28.813 -18.100 1.00 33.53  ? 458  ARG B CA    1 
ATOM   309   C  C     . ARG A  1  50  ? 30.070  28.780 -16.892 1.00 30.90  ? 458  ARG B C     1 
ATOM   310   O  O     . ARG A  1  50  ? 30.533  29.082 -15.782 1.00 33.19  ? 458  ARG B O     1 
ATOM   311   C  CB    . ARG A  1  50  ? 30.779  30.106 -18.888 1.00 38.50  ? 458  ARG B CB    1 
ATOM   312   C  CG    . ARG A  1  50  ? 30.793  31.355 -18.019 1.00 42.04  ? 458  ARG B CG    1 
ATOM   313   C  CD    . ARG A  1  50  ? 30.308  32.593 -18.792 1.00 48.02  ? 458  ARG B CD    1 
ATOM   314   N  NE    . ARG A  1  50  ? 30.274  33.749 -17.885 1.00 48.22  ? 458  ARG B NE    1 
ATOM   315   C  CZ    . ARG A  1  50  ? 30.413  35.022 -18.247 1.00 46.65  ? 458  ARG B CZ    1 
ATOM   316   N  NH1   . ARG A  1  50  ? 30.371  35.926 -17.303 1.00 47.85  ? 458  ARG B NH1   1 
ATOM   317   N  NH2   . ARG A  1  50  ? 30.524  35.397 -19.511 1.00 47.92  ? 458  ARG B NH2   1 
ATOM   318   N  N     . GLY A  1  51  ? 28.823  28.411 -17.043 1.00 29.76  ? 459  GLY B N     1 
ATOM   319   C  CA    . GLY A  1  51  ? 27.932  28.339 -15.865 1.00 26.96  ? 459  GLY B CA    1 
ATOM   320   C  C     . GLY A  1  51  ? 26.536  27.963 -16.405 1.00 26.37  ? 459  GLY B C     1 
ATOM   321   O  O     . GLY A  1  51  ? 26.364  26.918 -16.997 1.00 25.46  ? 459  GLY B O     1 
ATOM   322   N  N     . LYS A  1  52  ? 25.570  28.811 -16.188 1.00 26.56  ? 460  LYS B N     1 
ATOM   323   C  CA    . LYS A  1  52  ? 24.255  28.569 -16.705 1.00 25.88  ? 460  LYS B CA    1 
ATOM   324   C  C     . LYS A  1  52  ? 24.275  28.678 -18.235 1.00 25.69  ? 460  LYS B C     1 
ATOM   325   O  O     . LYS A  1  52  ? 24.993  29.548 -18.824 1.00 27.14  ? 460  LYS B O     1 
ATOM   326   C  CB    . LYS A  1  52  ? 23.197  29.536 -16.161 1.00 24.37  ? 460  LYS B CB    1 
ATOM   327   C  CG    . LYS A  1  52  ? 23.149  29.583 -14.604 1.00 24.25  ? 460  LYS B CG    1 
ATOM   328   C  CD    . LYS A  1  52  ? 22.917  28.181 -14.069 1.00 23.84  ? 460  LYS B CD    1 
ATOM   329   C  CE    . LYS A  1  52  ? 22.929  28.196 -12.539 1.00 21.23  ? 460  LYS B CE    1 
ATOM   330   N  NZ    . LYS A  1  52  ? 21.679  28.878 -11.964 1.00 22.58  ? 460  LYS B NZ    1 
ATOM   331   N  N     . ILE A  1  53  ? 23.529  27.801 -18.888 1.00 26.67  ? 461  ILE B N     1 
ATOM   332   C  CA    . ILE A  1  53  ? 23.526  27.728 -20.352 1.00 27.07  ? 461  ILE B CA    1 
ATOM   333   C  C     . ILE A  1  53  ? 22.117  28.029 -20.828 1.00 27.54  ? 461  ILE B C     1 
ATOM   334   O  O     . ILE A  1  53  ? 21.124  28.034 -20.014 1.00 26.76  ? 461  ILE B O     1 
ATOM   335   C  CB    . ILE A  1  53  ? 23.937  26.336 -20.880 1.00 28.26  ? 461  ILE B CB    1 
ATOM   336   C  CG1   . ILE A  1  53  ? 22.901  25.306 -20.501 1.00 29.29  ? 461  ILE B CG1   1 
ATOM   337   C  CG2   . ILE A  1  53  ? 25.299  25.913 -20.270 1.00 30.27  ? 461  ILE B CG2   1 
ATOM   338   C  CD1   . ILE A  1  53  ? 22.879  24.111 -21.435 1.00 29.56  ? 461  ILE B CD1   1 
ATOM   339   N  N     . LEU A  1  54  ? 21.986  28.233 -22.130 1.00 25.33  ? 462  LEU B N     1 
ATOM   340   C  CA    . LEU A  1  54  ? 20.683  28.566 -22.725 1.00 26.42  ? 462  LEU B CA    1 
ATOM   341   C  C     . LEU A  1  54  ? 19.624  27.522 -22.403 1.00 25.83  ? 462  LEU B C     1 
ATOM   342   O  O     . LEU A  1  54  ? 19.884  26.309 -22.520 1.00 25.32  ? 462  LEU B O     1 
ATOM   343   C  CB    . LEU A  1  54  ? 20.902  28.627 -24.273 1.00 26.06  ? 462  LEU B CB    1 
ATOM   344   C  CG    . LEU A  1  54  ? 19.699  29.289 -25.027 1.00 27.99  ? 462  LEU B CG    1 
ATOM   345   C  CD1   . LEU A  1  54  ? 19.564  30.825 -24.797 1.00 29.90  ? 462  LEU B CD1   1 
ATOM   346   C  CD2   . LEU A  1  54  ? 19.894  28.962 -26.523 1.00 29.69  ? 462  LEU B CD2   1 
ATOM   347   N  N     . ASN A  1  55  ? 18.445  27.965 -22.060 1.00 26.19  ? 463  ASN B N     1 
ATOM   348   C  CA    . ASN A  1  55  ? 17.275  27.071 -21.926 1.00 27.13  ? 463  ASN B CA    1 
ATOM   349   C  C     . ASN A  1  55  ? 16.603  26.980 -23.298 1.00 29.78  ? 463  ASN B C     1 
ATOM   350   O  O     . ASN A  1  55  ? 15.955  27.986 -23.724 1.00 29.58  ? 463  ASN B O     1 
ATOM   351   C  CB    . ASN A  1  55  ? 16.312  27.520 -20.837 1.00 25.70  ? 463  ASN B CB    1 
ATOM   352   C  CG    . ASN A  1  55  ? 15.088  26.694 -20.720 1.00 26.14  ? 463  ASN B CG    1 
ATOM   353   O  OD1   . ASN A  1  55  ? 14.899  25.705 -21.419 1.00 27.53  ? 463  ASN B OD1   1 
ATOM   354   N  ND2   . ASN A  1  55  ? 14.219  27.093 -19.743 1.00 25.08  ? 463  ASN B ND2   1 
ATOM   355   N  N     . VAL A  1  56  ? 16.789  25.886 -24.000 1.00 30.81  ? 464  VAL B N     1 
ATOM   356   C  CA    . VAL A  1  56  ? 16.272  25.779 -25.364 1.00 30.25  ? 464  VAL B CA    1 
ATOM   357   C  C     . VAL A  1  56  ? 14.738  25.624 -25.370 1.00 31.09  ? 464  VAL B C     1 
ATOM   358   O  O     . VAL A  1  56  ? 14.110  25.844 -26.417 1.00 32.34  ? 464  VAL B O     1 
ATOM   359   C  CB    . VAL A  1  56  ? 16.914  24.625 -26.145 1.00 29.71  ? 464  VAL B CB    1 
ATOM   360   C  CG1   . VAL A  1  56  ? 18.428  24.853 -26.201 1.00 29.89  ? 464  VAL B CG1   1 
ATOM   361   C  CG2   . VAL A  1  56  ? 16.555  23.263 -25.465 1.00 31.52  ? 464  VAL B CG2   1 
ATOM   362   N  N     . GLU A  1  57  ? 14.134  25.264 -24.255 1.00 30.40  ? 465  GLU B N     1 
ATOM   363   C  CA    . GLU A  1  57  ? 12.683  25.164 -24.222 1.00 31.49  ? 465  GLU B CA    1 
ATOM   364   C  C     . GLU A  1  57  ? 12.011  26.549 -24.297 1.00 32.49  ? 465  GLU B C     1 
ATOM   365   O  O     . GLU A  1  57  ? 10.897  26.658 -24.793 1.00 32.28  ? 465  GLU B O     1 
ATOM   366   C  CB    . GLU A  1  57  ? 12.217  24.460 -22.897 1.00 33.76  ? 465  GLU B CB    1 
ATOM   367   C  CG    . GLU A  1  57  ? 10.809  23.996 -22.885 1.00 33.29  ? 465  GLU B CG    1 
ATOM   368   C  CD    . GLU A  1  57  ? 10.568  22.705 -23.682 1.00 36.79  ? 465  GLU B CD    1 
ATOM   369   O  OE1   . GLU A  1  57  ? 9.383   22.293 -23.834 1.00 36.14  ? 465  GLU B OE1   1 
ATOM   370   O  OE2   . GLU A  1  57  ? 11.548  22.122 -24.187 1.00 35.48  ? 465  GLU B OE2   1 
ATOM   371   N  N     . LYS A  1  58  ? 12.703  27.589 -23.857 1.00 31.87  ? 466  LYS B N     1 
ATOM   372   C  CA    . LYS A  1  58  ? 12.194  28.949 -23.948 1.00 32.02  ? 466  LYS B CA    1 
ATOM   373   C  C     . LYS A  1  58  ? 12.796  29.746 -25.121 1.00 34.86  ? 466  LYS B C     1 
ATOM   374   O  O     . LYS A  1  58  ? 12.385  30.873 -25.360 1.00 36.44  ? 466  LYS B O     1 
ATOM   375   C  CB    . LYS A  1  58  ? 12.513  29.734 -22.646 1.00 29.78  ? 466  LYS B CB    1 
ATOM   376   C  CG    . LYS A  1  58  ? 11.729  29.240 -21.427 1.00 29.15  ? 466  LYS B CG    1 
ATOM   377   C  CD    . LYS A  1  58  ? 12.282  29.953 -20.181 1.00 26.54  ? 466  LYS B CD    1 
ATOM   378   C  CE    . LYS A  1  58  ? 11.464  29.457 -18.956 1.00 25.03  ? 466  LYS B CE    1 
ATOM   379   N  NZ    . LYS A  1  58  ? 11.983  30.092 -17.695 1.00 24.44  ? 466  LYS B NZ    1 
ATOM   380   N  N     . ALA A  1  59  ? 13.778  29.190 -25.828 1.00 34.15  ? 467  ALA B N     1 
ATOM   381   C  CA    . ALA A  1  59  ? 14.557  29.962 -26.769 1.00 33.94  ? 467  ALA B CA    1 
ATOM   382   C  C     . ALA A  1  59  ? 14.042  29.713 -28.223 1.00 36.91  ? 467  ALA B C     1 
ATOM   383   O  O     . ALA A  1  59  ? 13.445  28.693 -28.537 1.00 34.94  ? 467  ALA B O     1 
ATOM   384   C  CB    . ALA A  1  59  ? 16.042  29.566 -26.698 1.00 31.91  ? 467  ALA B CB    1 
ATOM   385   N  N     . ARG A  1  60  ? 14.296  30.697 -29.064 1.00 38.48  ? 468  ARG B N     1 
ATOM   386   C  CA    . ARG A  1  60  ? 14.017  30.595 -30.475 1.00 44.29  ? 468  ARG B CA    1 
ATOM   387   C  C     . ARG A  1  60  ? 15.120  29.862 -31.189 1.00 40.61  ? 468  ARG B C     1 
ATOM   388   O  O     . ARG A  1  60  ? 16.278  29.855 -30.720 1.00 37.95  ? 468  ARG B O     1 
ATOM   389   C  CB    . ARG A  1  60  ? 13.819  31.992 -31.087 1.00 51.74  ? 468  ARG B CB    1 
ATOM   390   C  CG    . ARG A  1  60  ? 12.642  32.760 -30.504 1.00 54.18  ? 468  ARG B CG    1 
ATOM   391   C  CD    . ARG A  1  60  ? 11.340  32.477 -31.253 1.00 59.73  ? 468  ARG B CD    1 
ATOM   392   N  NE    . ARG A  1  60  ? 10.189  33.033 -30.553 1.00 66.42  ? 468  ARG B NE    1 
ATOM   393   C  CZ    . ARG A  1  60  ? 9.999   34.333 -30.286 1.00 70.06  ? 468  ARG B CZ    1 
ATOM   394   N  NH1   . ARG A  1  60  ? 10.904  35.257 -30.641 1.00 72.02  ? 468  ARG B NH1   1 
ATOM   395   N  NH2   . ARG A  1  60  ? 8.917   34.711 -29.631 1.00 71.89  ? 468  ARG B NH2   1 
ATOM   396   N  N     . LEU A  1  61  ? 14.785  29.220 -32.320 1.00 40.88  ? 469  LEU B N     1 
ATOM   397   C  CA    . LEU A  1  61  ? 15.774  28.386 -33.011 1.00 40.41  ? 469  LEU B CA    1 
ATOM   398   C  C     . LEU A  1  61  ? 17.009  29.207 -33.443 1.00 41.84  ? 469  LEU B C     1 
ATOM   399   O  O     . LEU A  1  61  ? 18.125  28.697 -33.422 1.00 39.06  ? 469  LEU B O     1 
ATOM   400   C  CB    . LEU A  1  61  ? 15.120  27.660 -34.185 1.00 44.81  ? 469  LEU B CB    1 
ATOM   401   C  CG    . LEU A  1  61  ? 15.979  26.651 -34.911 1.00 44.04  ? 469  LEU B CG    1 
ATOM   402   C  CD1   . LEU A  1  61  ? 16.326  25.528 -33.964 1.00 43.53  ? 469  LEU B CD1   1 
ATOM   403   C  CD2   . LEU A  1  61  ? 15.225  26.104 -36.146 1.00 46.42  ? 469  LEU B CD2   1 
ATOM   404   N  N     . ASP A  1  62  ? 16.823  30.466 -33.810 1.00 41.88  ? 470  ASP B N     1 
ATOM   405   C  CA    . ASP A  1  62  ? 17.940  31.295 -34.230 1.00 45.33  ? 470  ASP B CA    1 
ATOM   406   C  C     . ASP A  1  62  ? 18.921  31.537 -33.091 1.00 41.26  ? 470  ASP B C     1 
ATOM   407   O  O     . ASP A  1  62  ? 20.154  31.522 -33.291 1.00 40.61  ? 470  ASP B O     1 
ATOM   408   C  CB    . ASP A  1  62  ? 17.449  32.633 -34.805 1.00 51.29  ? 470  ASP B CB    1 
ATOM   409   C  CG    . ASP A  1  62  ? 15.969  32.905 -34.431 1.00 64.40  ? 470  ASP B CG    1 
ATOM   410   O  OD1   . ASP A  1  62  ? 15.107  31.988 -34.639 1.00 65.71  ? 470  ASP B OD1   1 
ATOM   411   O  OD2   . ASP A  1  62  ? 15.661  34.010 -33.933 1.00 61.13  ? 470  ASP B OD2   1 
ATOM   412   N  N     . ARG A  1  63  ? 18.408  31.733 -31.873 1.00 44.58  ? 471  ARG B N     1 
ATOM   413   C  CA    . ARG A  1  63  ? 19.310  31.925 -30.721 1.00 42.78  ? 471  ARG B CA    1 
ATOM   414   C  C     . ARG A  1  63  ? 19.981  30.644 -30.282 1.00 39.87  ? 471  ARG B C     1 
ATOM   415   O  O     . ARG A  1  63  ? 21.130  30.670 -29.846 1.00 44.40  ? 471  ARG B O     1 
ATOM   416   C  CB    . ARG A  1  63  ? 18.488  32.579 -29.587 1.00 46.73  ? 471  ARG B CB    1 
ATOM   417   C  CG    . ARG A  1  63  ? 19.302  33.001 -28.371 1.00 49.47  ? 471  ARG B CG    1 
ATOM   418   C  CD    . ARG A  1  63  ? 18.424  33.967 -27.559 1.00 58.63  ? 471  ARG B CD    1 
ATOM   419   N  NE    . ARG A  1  63  ? 19.070  34.446 -26.314 1.00 61.23  ? 471  ARG B NE    1 
ATOM   420   C  CZ    . ARG A  1  63  ? 18.550  34.228 -25.124 1.00 66.59  ? 471  ARG B CZ    1 
ATOM   421   N  NH1   . ARG A  1  63  ? 17.377  33.555 -24.997 1.00 64.82  ? 471  ARG B NH1   1 
ATOM   422   N  NH2   . ARG A  1  63  ? 19.190  34.679 -24.037 1.00 67.81  ? 471  ARG B NH2   1 
ATOM   423   N  N     . ILE A  1  64  ? 19.286  29.514 -30.402 1.00 36.39  ? 472  ILE B N     1 
ATOM   424   C  CA    . ILE A  1  64  ? 19.873  28.212 -30.047 1.00 35.95  ? 472  ILE B CA    1 
ATOM   425   C  C     . ILE A  1  64  ? 21.036  27.927 -30.964 1.00 38.83  ? 472  ILE B C     1 
ATOM   426   O  O     . ILE A  1  64  ? 22.151  27.559 -30.510 1.00 42.20  ? 472  ILE B O     1 
ATOM   427   C  CB    . ILE A  1  64  ? 18.825  27.107 -30.106 1.00 36.29  ? 472  ILE B CB    1 
ATOM   428   C  CG1   . ILE A  1  64  ? 17.658  27.435 -29.131 1.00 35.84  ? 472  ILE B CG1   1 
ATOM   429   C  CG2   . ILE A  1  64  ? 19.442  25.758 -29.756 1.00 36.01  ? 472  ILE B CG2   1 
ATOM   430   C  CD1   . ILE A  1  64  ? 16.490  26.468 -29.244 1.00 37.76  ? 472  ILE B CD1   1 
ATOM   431   N  N     . LEU A  1  65  ? 20.810  28.056 -32.287 1.00 39.13  ? 473  LEU B N     1 
ATOM   432   C  CA    . LEU A  1  65  ? 21.821  27.662 -33.256 1.00 40.32  ? 473  LEU B CA    1 
ATOM   433   C  C     . LEU A  1  65  ? 23.046  28.589 -33.199 1.00 41.46  ? 473  LEU B C     1 
ATOM   434   O  O     . LEU A  1  65  ? 24.160  28.143 -33.454 1.00 42.29  ? 473  LEU B O     1 
ATOM   435   C  CB    . LEU A  1  65  ? 21.210  27.619 -34.657 1.00 40.02  ? 473  LEU B CB    1 
ATOM   436   C  CG    . LEU A  1  65  ? 20.096  26.662 -34.852 1.00 41.28  ? 473  LEU B CG    1 
ATOM   437   C  CD1   . LEU A  1  65  ? 19.607  26.663 -36.317 1.00 44.29  ? 473  LEU B CD1   1 
ATOM   438   C  CD2   . LEU A  1  65  ? 20.545  25.241 -34.388 1.00 42.00  ? 473  LEU B CD2   1 
ATOM   439   N  N     . ASN A  1  66  ? 22.838  29.852 -32.876 1.00 43.41  ? 474  ASN B N     1 
ATOM   440   C  CA    . ASN A  1  66  ? 23.929  30.804 -32.793 1.00 47.37  ? 474  ASN B CA    1 
ATOM   441   C  C     . ASN A  1  66  ? 24.540  30.888 -31.387 1.00 46.59  ? 474  ASN B C     1 
ATOM   442   O  O     . ASN A  1  66  ? 25.453  31.685 -31.173 1.00 47.87  ? 474  ASN B O     1 
ATOM   443   C  CB    . ASN A  1  66  ? 23.451  32.206 -33.225 1.00 52.48  ? 474  ASN B CB    1 
ATOM   444   C  CG    . ASN A  1  66  ? 23.077  32.251 -34.716 1.00 59.53  ? 474  ASN B CG    1 
ATOM   445   O  OD1   . ASN A  1  66  ? 23.554  31.452 -35.533 1.00 59.12  ? 474  ASN B OD1   1 
ATOM   446   N  ND2   . ASN A  1  66  ? 22.205  33.177 -35.086 1.00 64.11  ? 474  ASN B ND2   1 
ATOM   447   N  N     . ASN A  1  67  ? 24.065  30.084 -30.440 1.00 41.74  ? 475  ASN B N     1 
ATOM   448   C  CA    . ASN A  1  67  ? 24.633  30.093 -29.101 1.00 40.93  ? 475  ASN B CA    1 
ATOM   449   C  C     . ASN A  1  67  ? 25.983  29.369 -29.104 1.00 40.80  ? 475  ASN B C     1 
ATOM   450   O  O     . ASN A  1  67  ? 26.091  28.258 -29.643 1.00 40.96  ? 475  ASN B O     1 
ATOM   451   C  CB    . ASN A  1  67  ? 23.682  29.417 -28.114 1.00 36.71  ? 475  ASN B CB    1 
ATOM   452   C  CG    . ASN A  1  67  ? 24.241  29.413 -26.681 1.00 36.24  ? 475  ASN B CG    1 
ATOM   453   O  OD1   . ASN A  1  67  ? 24.976  28.506 -26.300 1.00 33.40  ? 475  ASN B OD1   1 
ATOM   454   N  ND2   . ASN A  1  67  ? 23.863  30.381 -25.893 1.00 31.85  ? 475  ASN B ND2   1 
ATOM   455   N  N     . ASN A  1  68  ? 26.996  29.991 -28.511 1.00 43.74  ? 476  ASN B N     1 
ATOM   456   C  CA    . ASN A  1  68  ? 28.350  29.507 -28.617 1.00 46.77  ? 476  ASN B CA    1 
ATOM   457   C  C     . ASN A  1  68  ? 28.554  28.142 -27.954 1.00 44.63  ? 476  ASN B C     1 
ATOM   458   O  O     . ASN A  1  68  ? 29.229  27.255 -28.486 1.00 43.70  ? 476  ASN B O     1 
ATOM   459   C  CB    . ASN A  1  68  ? 29.343  30.516 -28.048 1.00 51.96  ? 476  ASN B CB    1 
ATOM   460   C  CG    . ASN A  1  68  ? 30.797  30.125 -28.368 1.00 59.30  ? 476  ASN B CG    1 
ATOM   461   O  OD1   . ASN A  1  68  ? 31.547  29.800 -27.453 1.00 62.87  ? 476  ASN B OD1   1 
ATOM   462   N  ND2   . ASN A  1  68  ? 31.178  30.138 -29.696 1.00 58.27  ? 476  ASN B ND2   1 
ATOM   463   N  N     . GLU A  1  69  ? 27.959  27.964 -26.771 1.00 43.12  ? 477  GLU B N     1 
ATOM   464   C  CA    . GLU A  1  69  ? 28.167  26.713 -26.044 1.00 40.62  ? 477  GLU B CA    1 
ATOM   465   C  C     . GLU A  1  69  ? 27.384  25.575 -26.675 1.00 40.04  ? 477  GLU B C     1 
ATOM   466   O  O     . GLU A  1  69  ? 27.893  24.440 -26.742 1.00 38.99  ? 477  GLU B O     1 
ATOM   467   C  CB    . GLU A  1  69  ? 27.832  26.908 -24.572 1.00 42.80  ? 477  GLU B CB    1 
ATOM   468   C  CG    . GLU A  1  69  ? 28.837  27.823 -23.870 1.00 48.00  ? 477  GLU B CG    1 
ATOM   469   C  CD    . GLU A  1  69  ? 28.756  27.727 -22.361 1.00 53.24  ? 477  GLU B CD    1 
ATOM   470   O  OE1   . GLU A  1  69  ? 27.620  27.483 -21.847 1.00 63.60  ? 477  GLU B OE1   1 
ATOM   471   O  OE2   . GLU A  1  69  ? 29.826  27.803 -21.726 1.00 55.93  ? 477  GLU B OE2   1 
ATOM   472   N  N     . ILE A  1  70  ? 26.154  25.841 -27.113 1.00 38.84  ? 478  ILE B N     1 
ATOM   473   C  CA    . ILE A  1  70  ? 25.413  24.858 -27.912 1.00 38.11  ? 478  ILE B CA    1 
ATOM   474   C  C     . ILE A  1  70  ? 26.244  24.425 -29.118 1.00 40.73  ? 478  ILE B C     1 
ATOM   475   O  O     . ILE A  1  70  ? 26.364  23.237 -29.420 1.00 40.21  ? 478  ILE B O     1 
ATOM   476   C  CB    . ILE A  1  70  ? 24.051  25.435 -28.348 1.00 36.80  ? 478  ILE B CB    1 
ATOM   477   C  CG1   . ILE A  1  70  ? 23.172  25.775 -27.147 1.00 39.38  ? 478  ILE B CG1   1 
ATOM   478   C  CG2   . ILE A  1  70  ? 23.335  24.482 -29.269 1.00 38.12  ? 478  ILE B CG2   1 
ATOM   479   C  CD1   . ILE A  1  70  ? 22.587  24.560 -26.469 1.00 40.30  ? 478  ILE B CD1   1 
ATOM   480   N  N     A ARG A  1  71  ? 26.895  25.373 -29.772 0.50 42.07  ? 479  ARG B N     1 
ATOM   481   N  N     B ARG A  1  71  ? 26.908  25.368 -29.763 0.50 41.37  ? 479  ARG B N     1 
ATOM   482   C  CA    A ARG A  1  71  ? 27.662  25.075 -30.985 0.50 42.88  ? 479  ARG B CA    1 
ATOM   483   C  CA    B ARG A  1  71  ? 27.654  25.078 -30.992 0.50 41.78  ? 479  ARG B CA    1 
ATOM   484   C  C     A ARG A  1  71  ? 28.889  24.252 -30.661 0.50 42.37  ? 479  ARG B C     1 
ATOM   485   C  C     B ARG A  1  71  ? 28.909  24.279 -30.684 0.50 41.72  ? 479  ARG B C     1 
ATOM   486   O  O     A ARG A  1  71  ? 29.115  23.220 -31.267 0.50 44.53  ? 479  ARG B O     1 
ATOM   487   O  O     B ARG A  1  71  ? 29.128  23.240 -31.281 0.50 43.84  ? 479  ARG B O     1 
ATOM   488   C  CB    A ARG A  1  71  ? 28.052  26.362 -31.696 0.50 44.36  ? 479  ARG B CB    1 
ATOM   489   C  CB    B ARG A  1  71  ? 27.972  26.373 -31.731 0.50 42.25  ? 479  ARG B CB    1 
ATOM   490   C  CG    A ARG A  1  71  ? 26.992  26.840 -32.670 0.50 47.83  ? 479  ARG B CG    1 
ATOM   491   C  CG    B ARG A  1  71  ? 28.729  26.218 -33.088 0.50 44.74  ? 479  ARG B CG    1 
ATOM   492   C  CD    A ARG A  1  71  ? 27.236  28.273 -33.096 0.50 49.88  ? 479  ARG B CD    1 
ATOM   493   C  CD    B ARG A  1  71  ? 28.062  25.310 -34.160 0.50 46.21  ? 479  ARG B CD    1 
ATOM   494   N  NE    A ARG A  1  71  ? 28.270  28.359 -34.117 0.50 52.32  ? 479  ARG B NE    1 
ATOM   495   N  NE    B ARG A  1  71  ? 26.630  25.631 -34.329 0.50 46.27  ? 479  ARG B NE    1 
ATOM   496   C  CZ    A ARG A  1  71  ? 29.365  29.100 -34.014 0.50 53.24  ? 479  ARG B CZ    1 
ATOM   497   C  CZ    B ARG A  1  71  ? 25.786  24.858 -35.001 0.50 44.79  ? 479  ARG B CZ    1 
ATOM   498   N  NH1   A ARG A  1  71  ? 29.556  29.848 -32.941 0.50 54.15  ? 479  ARG B NH1   1 
ATOM   499   N  NH1   B ARG A  1  71  ? 26.247  23.803 -35.572 0.50 46.61  ? 479  ARG B NH1   1 
ATOM   500   N  NH2   A ARG A  1  71  ? 30.270  29.100 -34.984 0.50 54.42  ? 479  ARG B NH2   1 
ATOM   501   N  NH2   B ARG A  1  71  ? 24.497  25.167 -35.092 0.50 43.41  ? 479  ARG B NH2   1 
ATOM   502   N  N     . GLN A  1  72  ? 29.541  24.586 -29.559 1.00 39.44  ? 480  GLN B N     1 
ATOM   503   C  CA    . GLN A  1  72  ? 30.690  23.787 -29.130 1.00 39.94  ? 480  GLN B CA    1 
ATOM   504   C  C     . GLN A  1  72  ? 30.282  22.350 -28.821 1.00 38.16  ? 480  GLN B C     1 
ATOM   505   O  O     . GLN A  1  72  ? 31.027  21.416 -29.136 1.00 37.95  ? 480  GLN B O     1 
ATOM   506   C  CB    . GLN A  1  72  ? 31.349  24.408 -27.903 1.00 43.20  ? 480  GLN B CB    1 
ATOM   507   C  CG    . GLN A  1  72  ? 32.140  25.663 -28.117 1.00 50.63  ? 480  GLN B CG    1 
ATOM   508   C  CD    . GLN A  1  72  ? 32.756  26.184 -26.824 1.00 59.70  ? 480  GLN B CD    1 
ATOM   509   O  OE1   . GLN A  1  72  ? 33.509  25.519 -26.132 1.00 65.00  ? 480  GLN B OE1   1 
ATOM   510   N  NE2   . GLN A  1  72  ? 32.423  27.426 -26.491 1.00 59.69  ? 480  GLN B NE2   1 
ATOM   511   N  N     . MET A  1  73  ? 29.110  22.167 -28.206 1.00 35.96  ? 481  MET B N     1 
ATOM   512   C  CA    . MET A  1  73  ? 28.662  20.815 -27.870 1.00 34.65  ? 481  MET B CA    1 
ATOM   513   C  C     . MET A  1  73  ? 28.282  20.019 -29.094 1.00 36.71  ? 481  MET B C     1 
ATOM   514   O  O     . MET A  1  73  ? 28.625  18.827 -29.196 1.00 35.66  ? 481  MET B O     1 
ATOM   515   C  CB    . MET A  1  73  ? 27.468  20.875 -26.895 1.00 32.38  ? 481  MET B CB    1 
ATOM   516   C  CG    . MET A  1  73  ? 27.976  21.055 -25.430 1.00 32.47  ? 481  MET B CG    1 
ATOM   517   S  SD    . MET A  1  73  ? 26.611  20.911 -24.251 1.00 37.17  ? 481  MET B SD    1 
ATOM   518   C  CE    . MET A  1  73  ? 25.694  22.421 -24.589 1.00 32.85  ? 481  MET B CE    1 
ATOM   519   N  N     . ILE A  1  74  ? 27.571  20.640 -30.032 1.00 36.65  ? 482  ILE B N     1 
ATOM   520   C  CA    . ILE A  1  74  ? 27.233  19.959 -31.300 1.00 39.41  ? 482  ILE B CA    1 
ATOM   521   C  C     . ILE A  1  74  ? 28.514  19.545 -31.999 1.00 39.98  ? 482  ILE B C     1 
ATOM   522   O  O     . ILE A  1  74  ? 28.667  18.403 -32.455 1.00 41.84  ? 482  ILE B O     1 
ATOM   523   C  CB    . ILE A  1  74  ? 26.345  20.835 -32.168 1.00 41.27  ? 482  ILE B CB    1 
ATOM   524   C  CG1   . ILE A  1  74  ? 25.006  21.099 -31.494 1.00 38.68  ? 482  ILE B CG1   1 
ATOM   525   C  CG2   . ILE A  1  74  ? 26.125  20.167 -33.511 1.00 41.71  ? 482  ILE B CG2   1 
ATOM   526   C  CD1   . ILE A  1  74  ? 24.114  22.104 -32.200 1.00 42.19  ? 482  ILE B CD1   1 
ATOM   527   N  N     . THR A  1  75  ? 29.445  20.482 -32.132 1.00 40.59  ? 483  THR B N     1 
ATOM   528   C  CA    . THR A  1  75  ? 30.684  20.211 -32.871 1.00 44.49  ? 483  THR B CA    1 
ATOM   529   C  C     . THR A  1  75  ? 31.496  19.117 -32.182 1.00 44.63  ? 483  THR B C     1 
ATOM   530   O  O     . THR A  1  75  ? 32.118  18.292 -32.833 1.00 42.30  ? 483  THR B O     1 
ATOM   531   C  CB    . THR A  1  75  ? 31.509  21.480 -33.000 1.00 46.02  ? 483  THR B CB    1 
ATOM   532   O  OG1   . THR A  1  75  ? 30.677  22.526 -33.533 1.00 51.45  ? 483  THR B OG1   1 
ATOM   533   C  CG2   . THR A  1  75  ? 32.650  21.112 -34.036 1.00 47.51  ? 483  THR B CG2   1 
ATOM   534   N  N     . ALA A  1  76  ? 31.510  19.108 -30.846 1.00 40.42  ? 484  ALA B N     1 
ATOM   535   C  CA    . ALA A  1  76  ? 32.255  18.094 -30.132 1.00 39.85  ? 484  ALA B CA    1 
ATOM   536   C  C     . ALA A  1  76  ? 31.639  16.708 -30.313 1.00 40.95  ? 484  ALA B C     1 
ATOM   537   O  O     . ALA A  1  76  ? 32.362  15.717 -30.459 1.00 42.50  ? 484  ALA B O     1 
ATOM   538   C  CB    . ALA A  1  76  ? 32.336  18.457 -28.637 1.00 39.76  ? 484  ALA B CB    1 
ATOM   539   N  N     . PHE A  1  77  ? 30.309  16.631 -30.324 1.00 40.56  ? 485  PHE B N     1 
ATOM   540   C  CA    . PHE A  1  77  ? 29.647  15.331 -30.429 1.00 42.74  ? 485  PHE B CA    1 
ATOM   541   C  C     . PHE A  1  77  ? 29.705  14.774 -31.865 1.00 44.54  ? 485  PHE B C     1 
ATOM   542   O  O     . PHE A  1  77  ? 29.873  13.575 -32.054 1.00 41.19  ? 485  PHE B O     1 
ATOM   543   C  CB    . PHE A  1  77  ? 28.189  15.439 -29.962 1.00 39.86  ? 485  PHE B CB    1 
ATOM   544   C  CG    . PHE A  1  77  ? 28.036  15.855 -28.526 1.00 40.76  ? 485  PHE B CG    1 
ATOM   545   C  CD1   . PHE A  1  77  ? 29.098  15.783 -27.621 1.00 40.62  ? 485  PHE B CD1   1 
ATOM   546   C  CD2   . PHE A  1  77  ? 26.790  16.325 -28.083 1.00 40.20  ? 485  PHE B CD2   1 
ATOM   547   C  CE1   . PHE A  1  77  ? 28.904  16.155 -26.302 1.00 41.22  ? 485  PHE B CE1   1 
ATOM   548   C  CE2   . PHE A  1  77  ? 26.606  16.706 -26.763 1.00 43.97  ? 485  PHE B CE2   1 
ATOM   549   C  CZ    . PHE A  1  77  ? 27.673  16.605 -25.881 1.00 41.26  ? 485  PHE B CZ    1 
ATOM   550   N  N     . GLY A  1  78  ? 29.578  15.641 -32.866 1.00 48.84  ? 486  GLY B N     1 
ATOM   551   C  CA    . GLY A  1  78  ? 29.656  15.240 -34.258 1.00 51.32  ? 486  GLY B CA    1 
ATOM   552   C  C     . GLY A  1  78  ? 28.403  14.610 -34.822 1.00 52.78  ? 486  GLY B C     1 
ATOM   553   O  O     . GLY A  1  78  ? 28.387  14.209 -35.986 1.00 56.31  ? 486  GLY B O     1 
ATOM   554   N  N     . THR A  1  79  ? 27.349  14.498 -34.037 1.00 50.44  ? 487  THR B N     1 
ATOM   555   C  CA    . THR A  1  79  ? 26.145  13.793 -34.450 1.00 53.71  ? 487  THR B CA    1 
ATOM   556   C  C     . THR A  1  79  ? 25.238  14.611 -35.337 1.00 57.57  ? 487  THR B C     1 
ATOM   557   O  O     . THR A  1  79  ? 24.469  14.043 -36.110 1.00 64.35  ? 487  THR B O     1 
ATOM   558   C  CB    . THR A  1  79  ? 25.349  13.350 -33.221 1.00 54.41  ? 487  THR B CB    1 
ATOM   559   O  OG1   . THR A  1  79  ? 25.115  14.493 -32.367 1.00 51.80  ? 487  THR B OG1   1 
ATOM   560   C  CG2   . THR A  1  79  ? 26.098  12.281 -32.442 1.00 49.87  ? 487  THR B CG2   1 
ATOM   561   N  N     . GLY A  1  80  ? 25.309  15.944 -35.243 1.00 57.21  ? 488  GLY B N     1 
ATOM   562   C  CA    . GLY A  1  80  ? 24.252  16.781 -35.780 1.00 58.40  ? 488  GLY B CA    1 
ATOM   563   C  C     . GLY A  1  80  ? 23.109  16.882 -34.794 1.00 57.63  ? 488  GLY B C     1 
ATOM   564   O  O     . GLY A  1  80  ? 23.146  16.339 -33.680 1.00 55.57  ? 488  GLY B O     1 
ATOM   565   N  N     . ILE A  1  81  ? 22.065  17.597 -35.210 1.00 57.82  ? 489  ILE B N     1 
ATOM   566   C  CA    . ILE A  1  81  ? 20.924  17.851 -34.325 1.00 57.52  ? 489  ILE B CA    1 
ATOM   567   C  C     . ILE A  1  81  ? 19.625  17.627 -35.045 1.00 60.12  ? 489  ILE B C     1 
ATOM   568   O  O     . ILE A  1  81  ? 19.547  17.680 -36.271 1.00 55.10  ? 489  ILE B O     1 
ATOM   569   C  CB    . ILE A  1  81  ? 20.963  19.299 -33.745 1.00 57.47  ? 489  ILE B CB    1 
ATOM   570   C  CG1   . ILE A  1  81  ? 21.345  20.303 -34.849 1.00 62.93  ? 489  ILE B CG1   1 
ATOM   571   C  CG2   . ILE A  1  81  ? 21.910  19.377 -32.577 1.00 53.88  ? 489  ILE B CG2   1 
ATOM   572   C  CD1   . ILE A  1  81  ? 20.852  21.704 -34.507 1.00 64.27  ? 489  ILE B CD1   1 
ATOM   573   N  N     . GLY A  1  82  ? 18.586  17.378 -34.253 1.00 61.92  ? 490  GLY B N     1 
ATOM   574   C  CA    . GLY A  1  82  ? 17.215  17.214 -34.747 1.00 65.99  ? 490  GLY B CA    1 
ATOM   575   C  C     . GLY A  1  82  ? 17.079  16.109 -35.775 1.00 69.28  ? 490  GLY B C     1 
ATOM   576   O  O     . GLY A  1  82  ? 17.275  14.929 -35.477 1.00 64.79  ? 490  GLY B O     1 
ATOM   577   N  N     . GLY A  1  83  ? 16.734  16.515 -37.002 1.00 75.46  ? 491  GLY B N     1 
ATOM   578   C  CA    . GLY A  1  83  ? 16.514  15.574 -38.091 1.00 75.78  ? 491  GLY B CA    1 
ATOM   579   C  C     . GLY A  1  83  ? 17.794  15.031 -38.672 1.00 80.53  ? 491  GLY B C     1 
ATOM   580   O  O     . GLY A  1  83  ? 17.879  13.842 -39.002 1.00 87.14  ? 491  GLY B O     1 
ATOM   581   N  N     . ASP A  1  84  ? 18.798  15.890 -38.809 1.00 77.38  ? 492  ASP B N     1 
ATOM   582   C  CA    . ASP A  1  84  ? 20.106  15.481 -39.328 1.00 79.25  ? 492  ASP B CA    1 
ATOM   583   C  C     . ASP A  1  84  ? 20.933  14.721 -38.308 1.00 75.81  ? 492  ASP B C     1 
ATOM   584   O  O     . ASP A  1  84  ? 22.113  14.470 -38.550 1.00 74.22  ? 492  ASP B O     1 
ATOM   585   C  CB    . ASP A  1  84  ? 20.875  16.700 -39.837 1.00 82.42  ? 492  ASP B CB    1 
ATOM   586   C  CG    . ASP A  1  84  ? 20.212  17.363 -41.018 1.00 87.81  ? 492  ASP B CG    1 
ATOM   587   O  OD1   . ASP A  1  84  ? 19.331  16.726 -41.626 1.00 93.41  ? 492  ASP B OD1   1 
ATOM   588   O  OD2   . ASP A  1  84  ? 20.584  18.505 -41.359 1.00 96.63  ? 492  ASP B OD2   1 
ATOM   589   N  N     . PHE A  1  85  ? 20.345  14.371 -37.164 1.00 75.97  ? 493  PHE B N     1 
ATOM   590   C  CA    . PHE A  1  85  ? 21.068  13.628 -36.134 1.00 69.53  ? 493  PHE B CA    1 
ATOM   591   C  C     . PHE A  1  85  ? 21.470  12.248 -36.657 1.00 70.91  ? 493  PHE B C     1 
ATOM   592   O  O     . PHE A  1  85  ? 20.639  11.491 -37.153 1.00 72.48  ? 493  PHE B O     1 
ATOM   593   C  CB    . PHE A  1  85  ? 20.205  13.488 -34.891 1.00 67.19  ? 493  PHE B CB    1 
ATOM   594   C  CG    . PHE A  1  85  ? 20.905  12.818 -33.741 1.00 64.14  ? 493  PHE B CG    1 
ATOM   595   C  CD1   . PHE A  1  85  ? 20.864  11.429 -33.595 1.00 60.70  ? 493  PHE B CD1   1 
ATOM   596   C  CD2   . PHE A  1  85  ? 21.593  13.571 -32.800 1.00 58.49  ? 493  PHE B CD2   1 
ATOM   597   C  CE1   . PHE A  1  85  ? 21.499  10.817 -32.549 1.00 58.11  ? 493  PHE B CE1   1 
ATOM   598   C  CE2   . PHE A  1  85  ? 22.231  12.961 -31.739 1.00 57.43  ? 493  PHE B CE2   1 
ATOM   599   C  CZ    . PHE A  1  85  ? 22.185  11.578 -31.617 1.00 57.54  ? 493  PHE B CZ    1 
ATOM   600   N  N     . ASP A  1  86  ? 22.759  11.937 -36.555 1.00 67.88  ? 494  ASP B N     1 
ATOM   601   C  CA    . ASP A  1  86  ? 23.300  10.655 -36.978 1.00 64.26  ? 494  ASP B CA    1 
ATOM   602   C  C     . ASP A  1  86  ? 24.042  10.061 -35.782 1.00 61.51  ? 494  ASP B C     1 
ATOM   603   O  O     . ASP A  1  86  ? 25.148  10.488 -35.453 1.00 62.81  ? 494  ASP B O     1 
ATOM   604   C  CB    . ASP A  1  86  ? 24.237  10.822 -38.182 1.00 66.70  ? 494  ASP B CB    1 
ATOM   605   C  CG    . ASP A  1  86  ? 24.542  9.493  -38.875 1.00 70.29  ? 494  ASP B CG    1 
ATOM   606   O  OD1   . ASP A  1  86  ? 24.438  8.418  -38.225 1.00 70.54  ? 494  ASP B OD1   1 
ATOM   607   O  OD2   . ASP A  1  86  ? 24.900  9.507  -40.063 1.00 73.12  ? 494  ASP B OD2   1 
ATOM   608   N  N     . LEU A  1  87  ? 23.418  9.103  -35.117 1.00 59.23  ? 495  LEU B N     1 
ATOM   609   C  CA    . LEU A  1  87  ? 23.983  8.465  -33.944 1.00 53.76  ? 495  LEU B CA    1 
ATOM   610   C  C     . LEU A  1  87  ? 25.290  7.736  -34.206 1.00 52.39  ? 495  LEU B C     1 
ATOM   611   O  O     . LEU A  1  87  ? 26.134  7.632  -33.327 1.00 51.37  ? 495  LEU B O     1 
ATOM   612   C  CB    . LEU A  1  87  ? 22.968  7.493  -33.339 1.00 54.21  ? 495  LEU B CB    1 
ATOM   613   C  CG    . LEU A  1  87  ? 23.505  6.752  -32.097 1.00 53.53  ? 495  LEU B CG    1 
ATOM   614   C  CD1   . LEU A  1  87  ? 23.791  7.738  -30.955 1.00 50.98  ? 495  LEU B CD1   1 
ATOM   615   C  CD2   . LEU A  1  87  ? 22.543  5.662  -31.688 1.00 51.53  ? 495  LEU B CD2   1 
ATOM   616   N  N     . ALA A  1  88  ? 25.446  7.233  -35.420 1.00 53.21  ? 496  ALA B N     1 
ATOM   617   C  CA    . ALA A  1  88  ? 26.647  6.511  -35.777 1.00 53.15  ? 496  ALA B CA    1 
ATOM   618   C  C     . ALA A  1  88  ? 27.840  7.451  -35.864 1.00 54.11  ? 496  ALA B C     1 
ATOM   619   O  O     . ALA A  1  88  ? 28.980  7.021  -35.737 1.00 59.19  ? 496  ALA B O     1 
ATOM   620   C  CB    . ALA A  1  88  ? 26.417  5.766  -37.104 1.00 56.40  ? 496  ALA B CB    1 
ATOM   621   N  N     . LYS A  1  89  ? 27.579  8.733  -36.049 1.00 52.42  ? 497  LYS B N     1 
ATOM   622   C  CA    . LYS A  1  89  ? 28.640  9.713  -36.178 1.00 52.02  ? 497  LYS B CA    1 
ATOM   623   C  C     . LYS A  1  89  ? 29.128  10.253 -34.833 1.00 51.84  ? 497  LYS B C     1 
ATOM   624   O  O     . LYS A  1  89  ? 29.928  11.180 -34.796 1.00 53.43  ? 497  LYS B O     1 
ATOM   625   C  CB    . LYS A  1  89  ? 28.172  10.894 -37.039 1.00 51.93  ? 497  LYS B CB    1 
ATOM   626   C  CG    . LYS A  1  89  ? 27.916  10.505 -38.510 1.00 50.79  ? 497  LYS B CG    1 
ATOM   627   N  N     . ALA A  1  90  ? 28.650  9.675  -33.733 1.00 48.42  ? 498  ALA B N     1 
ATOM   628   C  CA    . ALA A  1  90  ? 29.045  10.135 -32.404 1.00 48.76  ? 498  ALA B CA    1 
ATOM   629   C  C     . ALA A  1  90  ? 30.526  9.882  -32.096 1.00 49.26  ? 498  ALA B C     1 
ATOM   630   O  O     . ALA A  1  90  ? 31.022  8.780  -32.267 1.00 49.67  ? 498  ALA B O     1 
ATOM   631   C  CB    . ALA A  1  90  ? 28.173  9.498  -31.351 1.00 45.98  ? 498  ALA B CB    1 
ATOM   632   N  N     . ARG A  1  91  ? 31.223  10.920 -31.662 1.00 49.13  ? 499  ARG B N     1 
ATOM   633   C  CA    . ARG A  1  91  ? 32.637  10.813 -31.350 1.00 48.21  ? 499  ARG B CA    1 
ATOM   634   C  C     . ARG A  1  91  ? 32.904  10.277 -29.941 1.00 46.81  ? 499  ARG B C     1 
ATOM   635   O  O     . ARG A  1  91  ? 34.039  9.912  -29.636 1.00 46.05  ? 499  ARG B O     1 
ATOM   636   C  CB    . ARG A  1  91  ? 33.321  12.180 -31.514 1.00 48.19  ? 499  ARG B CB    1 
ATOM   637   C  CG    . ARG A  1  91  ? 33.055  12.829 -32.850 1.00 51.76  ? 499  ARG B CG    1 
ATOM   638   C  CD    . ARG A  1  91  ? 33.688  14.201 -32.973 1.00 54.53  ? 499  ARG B CD    1 
ATOM   639   N  NE    . ARG A  1  91  ? 35.155  14.163 -32.877 1.00 55.38  ? 499  ARG B NE    1 
ATOM   640   C  CZ    . ARG A  1  91  ? 35.846  14.578 -31.802 1.00 53.13  ? 499  ARG B CZ    1 
ATOM   641   N  NH1   . ARG A  1  91  ? 35.211  15.094 -30.760 1.00 51.61  ? 499  ARG B NH1   1 
ATOM   642   N  NH2   . ARG A  1  91  ? 37.154  14.556 -31.799 1.00 51.23  ? 499  ARG B NH2   1 
ATOM   643   N  N     . TYR A  1  92  ? 31.879  10.222 -29.092 1.00 42.91  ? 500  TYR B N     1 
ATOM   644   C  CA    . TYR A  1  92  ? 31.969  9.697  -27.743 1.00 42.78  ? 500  TYR B CA    1 
ATOM   645   C  C     . TYR A  1  92  ? 30.732  8.883  -27.441 1.00 44.02  ? 500  TYR B C     1 
ATOM   646   O  O     . TYR A  1  92  ? 29.608  9.316  -27.736 1.00 48.10  ? 500  TYR B O     1 
ATOM   647   C  CB    . TYR A  1  92  ? 32.111  10.829 -26.708 1.00 40.33  ? 500  TYR B CB    1 
ATOM   648   C  CG    . TYR A  1  92  ? 33.114  11.908 -27.081 1.00 38.91  ? 500  TYR B CG    1 
ATOM   649   C  CD1   . TYR A  1  92  ? 34.480  11.740 -26.819 1.00 39.87  ? 500  TYR B CD1   1 
ATOM   650   C  CD2   . TYR A  1  92  ? 32.699  13.090 -27.671 1.00 39.85  ? 500  TYR B CD2   1 
ATOM   651   C  CE1   . TYR A  1  92  ? 35.388  12.719 -27.144 1.00 42.14  ? 500  TYR B CE1   1 
ATOM   652   C  CE2   . TYR A  1  92  ? 33.604  14.073 -28.009 1.00 40.73  ? 500  TYR B CE2   1 
ATOM   653   C  CZ    . TYR A  1  92  ? 34.943  13.890 -27.748 1.00 43.16  ? 500  TYR B CZ    1 
ATOM   654   O  OH    . TYR A  1  92  ? 35.839  14.895 -28.074 1.00 45.27  ? 500  TYR B OH    1 
ATOM   655   N  N     . HIS A  1  93  ? 30.931  7.721  -26.815 1.00 43.75  ? 501  HIS B N     1 
ATOM   656   C  CA    . HIS A  1  93  ? 29.836  6.857  -26.439 1.00 44.33  ? 501  HIS B CA    1 
ATOM   657   C  C     . HIS A  1  93  ? 29.327  7.125  -25.038 1.00 44.66  ? 501  HIS B C     1 
ATOM   658   O  O     . HIS A  1  93  ? 28.292  6.618  -24.640 1.00 47.00  ? 501  HIS B O     1 
ATOM   659   C  CB    . HIS A  1  93  ? 30.181  5.392  -26.715 1.00 49.67  ? 501  HIS B CB    1 
ATOM   660   C  CG    . HIS A  1  93  ? 30.055  5.029  -28.159 1.00 49.21  ? 501  HIS B CG    1 
ATOM   661   N  ND1   . HIS A  1  93  ? 29.639  3.784  -28.583 1.00 55.03  ? 501  HIS B ND1   1 
ATOM   662   C  CD2   . HIS A  1  93  ? 30.276  5.750  -29.278 1.00 51.01  ? 501  HIS B CD2   1 
ATOM   663   C  CE1   . HIS A  1  93  ? 29.620  3.754  -29.904 1.00 53.04  ? 501  HIS B CE1   1 
ATOM   664   N  NE2   . HIS A  1  93  ? 30.003  4.935  -30.350 1.00 51.39  ? 501  HIS B NE2   1 
ATOM   665   N  N     . LYS A  1  94  ? 30.057  7.942  -24.291 1.00 44.76  ? 502  LYS B N     1 
ATOM   666   C  CA    . LYS A  1  94  ? 29.613  8.415  -22.978 1.00 43.68  ? 502  LYS B CA    1 
ATOM   667   C  C     . LYS A  1  94  ? 29.686  9.929  -22.984 1.00 41.80  ? 502  LYS B C     1 
ATOM   668   O  O     . LYS A  1  94  ? 30.765  10.497 -23.202 1.00 43.49  ? 502  LYS B O     1 
ATOM   669   C  CB    . LYS A  1  94  ? 30.472  7.862  -21.836 1.00 43.05  ? 502  LYS B CB    1 
ATOM   670   C  CG    . LYS A  1  94  ? 30.248  6.391  -21.515 1.00 44.01  ? 502  LYS B CG    1 
ATOM   671   C  CD    . LYS A  1  94  ? 30.969  6.031  -20.203 1.00 42.37  ? 502  LYS B CD    1 
ATOM   672   C  CE    . LYS A  1  94  ? 30.717  4.596  -19.795 1.00 43.51  ? 502  LYS B CE    1 
ATOM   673   N  NZ    . LYS A  1  94  ? 31.270  3.702  -20.844 1.00 45.45  ? 502  LYS B NZ    1 
ATOM   674   N  N     . ILE A  1  95  ? 28.554  10.582 -22.759 1.00 40.03  ? 503  ILE B N     1 
ATOM   675   C  CA    . ILE A  1  95  ? 28.491  12.016 -22.536 1.00 37.05  ? 503  ILE B CA    1 
ATOM   676   C  C     . ILE A  1  95  ? 28.111  12.205 -21.077 1.00 35.06  ? 503  ILE B C     1 
ATOM   677   O  O     . ILE A  1  95  ? 26.996  11.837 -20.661 1.00 34.53  ? 503  ILE B O     1 
ATOM   678   C  CB    . ILE A  1  95  ? 27.490  12.711 -23.479 1.00 39.70  ? 503  ILE B CB    1 
ATOM   679   C  CG1   . ILE A  1  95  ? 28.069  12.848 -24.890 1.00 43.78  ? 503  ILE B CG1   1 
ATOM   680   C  CG2   . ILE A  1  95  ? 27.091  14.075 -22.952 1.00 39.31  ? 503  ILE B CG2   1 
ATOM   681   C  CD1   . ILE A  1  95  ? 28.050  11.576 -25.725 1.00 42.50  ? 503  ILE B CD1   1 
ATOM   682   N  N     . VAL A  1  96  ? 29.028  12.767 -20.290 1.00 34.58  ? 504  VAL B N     1 
ATOM   683   C  CA    . VAL A  1  96  ? 28.918  12.760 -18.840 1.00 33.36  ? 504  VAL B CA    1 
ATOM   684   C  C     . VAL A  1  96  ? 28.690  14.202 -18.365 1.00 34.76  ? 504  VAL B C     1 
ATOM   685   O  O     . VAL A  1  96  ? 29.554  15.077 -18.541 1.00 34.35  ? 504  VAL B O     1 
ATOM   686   C  CB    . VAL A  1  96  ? 30.145  12.163 -18.155 1.00 33.66  ? 504  VAL B CB    1 
ATOM   687   C  CG1   . VAL A  1  96  ? 29.930  12.040 -16.659 1.00 31.57  ? 504  VAL B CG1   1 
ATOM   688   C  CG2   . VAL A  1  96  ? 30.467  10.800 -18.772 1.00 33.11  ? 504  VAL B CG2   1 
ATOM   689   N  N     . ILE A  1  97  ? 27.526  14.448 -17.768 1.00 29.55  ? 505  ILE B N     1 
ATOM   690   C  CA    . ILE A  1  97  ? 27.212  15.724 -17.162 1.00 30.79  ? 505  ILE B CA    1 
ATOM   691   C  C     . ILE A  1  97  ? 27.864  15.748 -15.757 1.00 27.13  ? 505  ILE B C     1 
ATOM   692   O  O     . ILE A  1  97  ? 27.551  14.905 -14.919 1.00 32.17  ? 505  ILE B O     1 
ATOM   693   C  CB    . ILE A  1  97  ? 25.693  15.931 -17.050 1.00 28.60  ? 505  ILE B CB    1 
ATOM   694   C  CG1   . ILE A  1  97  ? 25.109  15.988 -18.470 1.00 31.01  ? 505  ILE B CG1   1 
ATOM   695   C  CG2   . ILE A  1  97  ? 25.378  17.244 -16.304 1.00 30.38  ? 505  ILE B CG2   1 
ATOM   696   C  CD1   . ILE A  1  97  ? 23.581  15.898 -18.454 1.00 30.23  ? 505  ILE B CD1   1 
ATOM   697   N  N     . MET A  1  98  ? 28.751  16.706 -15.542 1.00 26.58  ? 506  MET B N     1 
ATOM   698   C  CA    . MET A  1  98  ? 29.525  16.791 -14.304 1.00 27.01  ? 506  MET B CA    1 
ATOM   699   C  C     . MET A  1  98  ? 29.416  18.236 -13.755 1.00 25.20  ? 506  MET B C     1 
ATOM   700   O  O     . MET A  1  98  ? 30.156  19.111 -14.168 1.00 26.69  ? 506  MET B O     1 
ATOM   701   C  CB    . MET A  1  98  ? 30.955  16.397 -14.555 1.00 27.24  ? 506  MET B CB    1 
ATOM   702   C  CG    . MET A  1  98  ? 31.818  16.432 -13.288 1.00 30.67  ? 506  MET B CG    1 
ATOM   703   S  SD    . MET A  1  98  ? 33.523  15.903 -13.638 1.00 38.69  ? 506  MET B SD    1 
ATOM   704   C  CE    . MET A  1  98  ? 34.234  16.210 -12.073 1.00 31.91  ? 506  MET B CE    1 
ATOM   705   N  N     . THR A  1  99  ? 28.533  18.444 -12.799 1.00 26.25  ? 507  THR B N     1 
ATOM   706   C  CA    . THR A  1  99  ? 28.302  19.719 -12.182 1.00 26.52  ? 507  THR B CA    1 
ATOM   707   C  C     . THR A  1  99  ? 28.535  19.633 -10.671 1.00 27.00  ? 507  THR B C     1 
ATOM   708   O  O     . THR A  1  99  ? 28.703  18.548 -10.132 1.00 28.84  ? 507  THR B O     1 
ATOM   709   C  CB    . THR A  1  99  ? 26.864  20.220 -12.498 1.00 27.15  ? 507  THR B CB    1 
ATOM   710   O  OG1   . THR A  1  99  ? 25.917  19.361 -11.846 1.00 29.55  ? 507  THR B OG1   1 
ATOM   711   C  CG2   . THR A  1  99  ? 26.597  20.220 -13.943 1.00 29.28  ? 507  THR B CG2   1 
ATOM   712   N  N     . ASP A  1  100 ? 28.535  20.788 -10.014 1.00 25.01  ? 508  ASP B N     1 
ATOM   713   C  CA    . ASP A  1  100 ? 28.612  20.809 -8.564  1.00 25.76  ? 508  ASP B CA    1 
ATOM   714   C  C     . ASP A  1  100 ? 27.429  20.054 -7.959  1.00 25.88  ? 508  ASP B C     1 
ATOM   715   O  O     . ASP A  1  100 ? 26.317  20.021 -8.528  1.00 23.61  ? 508  ASP B O     1 
ATOM   716   C  CB    . ASP A  1  100 ? 28.576  22.266 -8.037  1.00 23.99  ? 508  ASP B CB    1 
ATOM   717   C  CG    . ASP A  1  100 ? 29.851  22.986 -8.280  1.00 24.08  ? 508  ASP B CG    1 
ATOM   718   O  OD1   . ASP A  1  100 ? 30.828  22.363 -8.813  1.00 24.75  ? 508  ASP B OD1   1 
ATOM   719   O  OD2   . ASP A  1  100 ? 29.924  24.184 -7.965  1.00 24.65  ? 508  ASP B OD2   1 
ATOM   720   N  N     . ALA A  1  101 ? 27.650  19.420 -6.796  1.00 25.39  ? 509  ALA B N     1 
ATOM   721   C  CA    . ALA A  1  101 ? 26.562  18.809 -6.058  1.00 27.50  ? 509  ALA B CA    1 
ATOM   722   C  C     . ALA A  1  101 ? 25.879  19.887 -5.176  1.00 27.83  ? 509  ALA B C     1 
ATOM   723   O  O     . ALA A  1  101 ? 25.810  19.807 -3.954  1.00 28.22  ? 509  ALA B O     1 
ATOM   724   C  CB    . ALA A  1  101 ? 27.127  17.673 -5.191  1.00 26.87  ? 509  ALA B CB    1 
ATOM   725   N  N     . ASP A  1  102 ? 25.279  20.874 -5.883  1.00 26.21  ? 510  ASP B N     1 
ATOM   726   C  CA    . ASP A  1  102 ? 24.501  21.898 -5.230  1.00 23.94  ? 510  ASP B CA    1 
ATOM   727   C  C     . ASP A  1  102 ? 23.360  22.297 -6.142  1.00 23.74  ? 510  ASP B C     1 
ATOM   728   O  O     . ASP A  1  102 ? 23.168  21.686 -7.194  1.00 22.32  ? 510  ASP B O     1 
ATOM   729   C  CB    . ASP A  1  102 ? 25.424  23.120 -4.884  1.00 22.98  ? 510  ASP B CB    1 
ATOM   730   C  CG    . ASP A  1  102 ? 26.163  23.672 -6.026  1.00 23.07  ? 510  ASP B CG    1 
ATOM   731   O  OD1   . ASP A  1  102 ? 25.684  23.596 -7.173  1.00 22.69  ? 510  ASP B OD1   1 
ATOM   732   O  OD2   . ASP A  1  102 ? 27.252  24.193 -5.813  1.00 22.30  ? 510  ASP B OD2   1 
ATOM   733   N  N     . VAL A  1  103 ? 22.575  23.318 -5.715  1.00 21.46  ? 511  VAL B N     1 
ATOM   734   C  CA    . VAL A  1  103 ? 21.342  23.599 -6.456  1.00 22.33  ? 511  VAL B CA    1 
ATOM   735   C  C     . VAL A  1  103 ? 21.610  24.208 -7.799  1.00 21.63  ? 511  VAL B C     1 
ATOM   736   O  O     . VAL A  1  103 ? 20.823  24.021 -8.737  1.00 22.12  ? 511  VAL B O     1 
ATOM   737   C  CB    . VAL A  1  103 ? 20.403  24.516 -5.646  1.00 21.01  ? 511  VAL B CB    1 
ATOM   738   C  CG1   . VAL A  1  103 ? 19.959  23.714 -4.344  1.00 23.21  ? 511  VAL B CG1   1 
ATOM   739   C  CG2   . VAL A  1  103 ? 21.171  25.763 -5.164  1.00 20.27  ? 511  VAL B CG2   1 
ATOM   740   N  N     . ASP A  1  104 ? 22.682  24.968 -7.947  1.00 20.97  ? 512  ASP B N     1 
ATOM   741   C  CA    . ASP A  1  104 ? 22.988  25.557 -9.278  1.00 22.37  ? 512  ASP B CA    1 
ATOM   742   C  C     . ASP A  1  104 ? 23.512  24.512 -10.236 1.00 22.69  ? 512  ASP B C     1 
ATOM   743   O  O     . ASP A  1  104 ? 23.213  24.564 -11.430 1.00 22.34  ? 512  ASP B O     1 
ATOM   744   C  CB    . ASP A  1  104 ? 23.951  26.723 -9.148  1.00 22.60  ? 512  ASP B CB    1 
ATOM   745   C  CG    . ASP A  1  104 ? 23.303  27.931 -8.533  1.00 23.21  ? 512  ASP B CG    1 
ATOM   746   O  OD1   . ASP A  1  104 ? 22.477  28.591 -9.229  1.00 23.80  ? 512  ASP B OD1   1 
ATOM   747   O  OD2   . ASP A  1  104 ? 23.536  28.261 -7.343  1.00 23.43  ? 512  ASP B OD2   1 
ATOM   748   N  N     . GLY A  1  105 ? 24.307  23.571 -9.737  1.00 22.84  ? 513  GLY B N     1 
ATOM   749   C  CA    . GLY A  1  105 ? 24.723  22.474 -10.560 1.00 22.77  ? 513  GLY B CA    1 
ATOM   750   C  C     . GLY A  1  105 ? 23.509  21.627 -11.014 1.00 23.02  ? 513  GLY B C     1 
ATOM   751   O  O     . GLY A  1  105 ? 23.444  21.186 -12.174 1.00 22.55  ? 513  GLY B O     1 
ATOM   752   N  N     . ALA A  1  106 ? 22.563  21.426 -10.118 1.00 22.60  ? 514  ALA B N     1 
ATOM   753   C  CA    . ALA A  1  106 ? 21.346  20.731 -10.492 1.00 24.33  ? 514  ALA B CA    1 
ATOM   754   C  C     . ALA A  1  106 ? 20.562  21.496 -11.565 1.00 24.12  ? 514  ALA B C     1 
ATOM   755   O  O     . ALA A  1  106 ? 19.946  20.892 -12.442 1.00 24.02  ? 514  ALA B O     1 
ATOM   756   C  CB    . ALA A  1  106 ? 20.457  20.526 -9.253  1.00 24.79  ? 514  ALA B CB    1 
ATOM   757   N  N     . HIS A  1  107 ? 20.616  22.822 -11.513 1.00 24.49  ? 515  HIS B N     1 
ATOM   758   C  CA    . HIS A  1  107 ? 19.957  23.611 -12.546 1.00 24.25  ? 515  HIS B CA    1 
ATOM   759   C  C     . HIS A  1  107 ? 20.645  23.447 -13.877 1.00 24.58  ? 515  HIS B C     1 
ATOM   760   O  O     . HIS A  1  107 ? 19.980  23.218 -14.901 1.00 24.12  ? 515  HIS B O     1 
ATOM   761   C  CB    . HIS A  1  107 ? 19.941  25.116 -12.139 1.00 23.55  ? 515  HIS B CB    1 
ATOM   762   C  CG    . HIS A  1  107 ? 19.087  25.952 -13.025 1.00 22.77  ? 515  HIS B CG    1 
ATOM   763   N  ND1   . HIS A  1  107 ? 19.392  27.256 -13.299 1.00 21.57  ? 515  HIS B ND1   1 
ATOM   764   C  CD2   . HIS A  1  107 ? 17.938  25.683 -13.705 1.00 22.67  ? 515  HIS B CD2   1 
ATOM   765   C  CE1   . HIS A  1  107 ? 18.459  27.782 -14.134 1.00 21.48  ? 515  HIS B CE1   1 
ATOM   766   N  NE2   . HIS A  1  107 ? 17.559  26.839 -14.366 1.00 21.41  ? 515  HIS B NE2   1 
ATOM   767   N  N     . ILE A  1  108 ? 21.975  23.537 -13.895 1.00 23.87  ? 516  ILE B N     1 
ATOM   768   C  CA    . ILE A  1  108 ? 22.763  23.319 -15.114 1.00 22.92  ? 516  ILE B CA    1 
ATOM   769   C  C     . ILE A  1  108 ? 22.466  21.909 -15.659 1.00 26.09  ? 516  ILE B C     1 
ATOM   770   O  O     . ILE A  1  108 ? 22.433  21.718 -16.887 1.00 23.87  ? 516  ILE B O     1 
ATOM   771   C  CB    . ILE A  1  108 ? 24.239  23.523 -14.845 1.00 23.73  ? 516  ILE B CB    1 
ATOM   772   C  CG1   . ILE A  1  108 ? 24.539  24.993 -14.608 1.00 24.18  ? 516  ILE B CG1   1 
ATOM   773   C  CG2   . ILE A  1  108 ? 25.120  22.984 -15.982 1.00 23.41  ? 516  ILE B CG2   1 
ATOM   774   C  CD1   . ILE A  1  108 ? 25.851  25.309 -13.892 1.00 25.20  ? 516  ILE B CD1   1 
ATOM   775   N  N     . ARG A  1  109 ? 22.211  20.963 -14.765 1.00 26.37  ? 517  ARG B N     1 
ATOM   776   C  CA    . ARG A  1  109 ? 21.871  19.617 -15.204 1.00 28.57  ? 517  ARG B CA    1 
ATOM   777   C  C     . ARG A  1  109 ? 20.528  19.613 -15.940 1.00 28.26  ? 517  ARG B C     1 
ATOM   778   O  O     . ARG A  1  109 ? 20.410  19.010 -17.016 1.00 28.06  ? 517  ARG B O     1 
ATOM   779   C  CB    . ARG A  1  109 ? 21.812  18.680 -13.984 1.00 30.84  ? 517  ARG B CB    1 
ATOM   780   C  CG    . ARG A  1  109 ? 21.755  17.211 -14.328 1.00 39.23  ? 517  ARG B CG    1 
ATOM   781   C  CD    . ARG A  1  109 ? 22.274  16.342 -13.186 1.00 43.41  ? 517  ARG B CD    1 
ATOM   782   N  NE    . ARG A  1  109 ? 21.533  16.594 -11.976 1.00 45.14  ? 517  ARG B NE    1 
ATOM   783   C  CZ    . ARG A  1  109 ? 22.039  17.095 -10.843 1.00 40.93  ? 517  ARG B CZ    1 
ATOM   784   N  NH1   . ARG A  1  109 ? 23.296  17.474 -10.832 1.00 44.18  ? 517  ARG B NH1   1 
ATOM   785   N  NH2   . ARG A  1  109 ? 21.227  17.240 -9.786  1.00 38.38  ? 517  ARG B NH2   1 
ATOM   786   N  N     . THR A  1  110 ? 19.515  20.297 -15.385 1.00 27.73  ? 518  THR B N     1 
ATOM   787   C  CA    . THR A  1  110 ? 18.221  20.342 -16.041 1.00 27.72  ? 518  THR B CA    1 
ATOM   788   C  C     . THR A  1  110 ? 18.309  21.094 -17.370 1.00 27.33  ? 518  THR B C     1 
ATOM   789   O  O     . THR A  1  110 ? 17.539  20.775 -18.304 1.00 27.80  ? 518  THR B O     1 
ATOM   790   C  CB    . THR A  1  110 ? 17.165  20.973 -15.148 1.00 28.40  ? 518  THR B CB    1 
ATOM   791   O  OG1   . THR A  1  110 ? 17.506  22.367 -14.880 1.00 28.49  ? 518  THR B OG1   1 
ATOM   792   C  CG2   . THR A  1  110 ? 17.034  20.243 -13.834 1.00 30.56  ? 518  THR B CG2   1 
ATOM   793   N  N     . LEU A  1  111 ? 19.184  22.060 -17.487 1.00 24.53  ? 519  LEU B N     1 
ATOM   794   C  CA    . LEU A  1  111 ? 19.332  22.808 -18.729 1.00 25.15  ? 519  LEU B CA    1 
ATOM   795   C  C     . LEU A  1  111 ? 20.043  21.943 -19.799 1.00 26.38  ? 519  LEU B C     1 
ATOM   796   O  O     . LEU A  1  111 ? 19.708  21.995 -20.967 1.00 27.49  ? 519  LEU B O     1 
ATOM   797   C  CB    . LEU A  1  111 ? 20.103  24.118 -18.491 1.00 24.06  ? 519  LEU B CB    1 
ATOM   798   C  CG    . LEU A  1  111 ? 19.473  25.124 -17.572 1.00 23.49  ? 519  LEU B CG    1 
ATOM   799   C  CD1   . LEU A  1  111 ? 20.467  26.183 -17.103 1.00 21.41  ? 519  LEU B CD1   1 
ATOM   800   C  CD2   . LEU A  1  111 ? 18.286  25.789 -18.336 1.00 22.20  ? 519  LEU B CD2   1 
ATOM   801   N  N     . LEU A  1  112 ? 21.017  21.150 -19.400 1.00 26.47  ? 520  LEU B N     1 
ATOM   802   C  CA    . LEU A  1  112 ? 21.703  20.291 -20.347 1.00 26.77  ? 520  LEU B CA    1 
ATOM   803   C  C     . LEU A  1  112 ? 20.785  19.167 -20.835 1.00 29.93  ? 520  LEU B C     1 
ATOM   804   O  O     . LEU A  1  112 ? 20.777  18.846 -22.028 1.00 29.04  ? 520  LEU B O     1 
ATOM   805   C  CB    . LEU A  1  112 ? 22.961  19.658 -19.711 1.00 27.00  ? 520  LEU B CB    1 
ATOM   806   C  CG    . LEU A  1  112 ? 24.173  20.615 -19.597 1.00 27.19  ? 520  LEU B CG    1 
ATOM   807   C  CD1   . LEU A  1  112 ? 25.206  20.045 -18.648 1.00 26.69  ? 520  LEU B CD1   1 
ATOM   808   C  CD2   . LEU A  1  112 ? 24.788  20.836 -21.003 1.00 27.09  ? 520  LEU B CD2   1 
ATOM   809   N  N     . LEU A  1  113 ? 19.989  18.577 -19.922 1.00 27.52  ? 521  LEU B N     1 
ATOM   810   C  CA    . LEU A  1  113 ? 19.080  17.538 -20.333 1.00 29.28  ? 521  LEU B CA    1 
ATOM   811   C  C     . LEU A  1  113 ? 17.972  18.079 -21.230 1.00 30.01  ? 521  LEU B C     1 
ATOM   812   O  O     . LEU A  1  113 ? 17.486  17.350 -22.112 1.00 31.85  ? 521  LEU B O     1 
ATOM   813   C  CB    . LEU A  1  113 ? 18.451  16.870 -19.094 1.00 28.71  ? 521  LEU B CB    1 
ATOM   814   C  CG    . LEU A  1  113 ? 19.499  16.089 -18.253 1.00 30.41  ? 521  LEU B CG    1 
ATOM   815   C  CD1   . LEU A  1  113 ? 18.914  15.751 -16.893 1.00 29.52  ? 521  LEU B CD1   1 
ATOM   816   C  CD2   . LEU A  1  113 ? 19.966  14.840 -18.978 1.00 28.83  ? 521  LEU B CD2   1 
ATOM   817   N  N     . THR A  1  114 ? 17.554  19.325 -21.030 1.00 28.35  ? 522  THR B N     1 
ATOM   818   C  CA    . THR A  1  114 ? 16.559  19.929 -21.909 1.00 29.30  ? 522  THR B CA    1 
ATOM   819   C  C     . THR A  1  114 ? 17.094  20.058 -23.329 1.00 30.41  ? 522  THR B C     1 
ATOM   820   O  O     . THR A  1  114 ? 16.360  19.813 -24.295 1.00 31.79  ? 522  THR B O     1 
ATOM   821   C  CB    . THR A  1  114 ? 16.144  21.296 -21.366 1.00 29.11  ? 522  THR B CB    1 
ATOM   822   O  OG1   . THR A  1  114 ? 15.560  21.124 -20.064 1.00 26.95  ? 522  THR B OG1   1 
ATOM   823   C  CG2   . THR A  1  114 ? 15.062  21.920 -22.311 1.00 30.52  ? 522  THR B CG2   1 
ATOM   824   N  N     . PHE A  1  115 ? 18.365  20.428 -23.474 1.00 28.87  ? 523  PHE B N     1 
ATOM   825   C  CA    . PHE A  1  115 ? 18.967  20.507 -24.791 1.00 30.58  ? 523  PHE B CA    1 
ATOM   826   C  C     . PHE A  1  115 ? 19.082  19.121 -25.440 1.00 33.00  ? 523  PHE B C     1 
ATOM   827   O  O     . PHE A  1  115 ? 18.792  18.969 -26.627 1.00 35.48  ? 523  PHE B O     1 
ATOM   828   C  CB    . PHE A  1  115 ? 20.338  21.178 -24.712 1.00 29.99  ? 523  PHE B CB    1 
ATOM   829   C  CG    . PHE A  1  115 ? 21.144  21.087 -25.972 1.00 32.52  ? 523  PHE B CG    1 
ATOM   830   C  CD1   . PHE A  1  115 ? 20.696  21.670 -27.133 1.00 33.66  ? 523  PHE B CD1   1 
ATOM   831   C  CD2   . PHE A  1  115 ? 22.368  20.439 -25.943 1.00 31.82  ? 523  PHE B CD2   1 
ATOM   832   C  CE1   . PHE A  1  115 ? 21.461  21.574 -28.309 1.00 34.64  ? 523  PHE B CE1   1 
ATOM   833   C  CE2   . PHE A  1  115 ? 23.131  20.341 -27.148 1.00 33.44  ? 523  PHE B CE2   1 
ATOM   834   C  CZ    . PHE A  1  115 ? 22.638  20.936 -28.321 1.00 34.60  ? 523  PHE B CZ    1 
ATOM   835   N  N     . PHE A  1  116 ? 19.488  18.121 -24.673 1.00 34.50  ? 524  PHE B N     1 
ATOM   836   C  CA    . PHE A  1  116 ? 19.640  16.772 -25.226 1.00 34.05  ? 524  PHE B CA    1 
ATOM   837   C  C     . PHE A  1  116 ? 18.282  16.189 -25.617 1.00 34.39  ? 524  PHE B C     1 
ATOM   838   O  O     . PHE A  1  116 ? 18.182  15.514 -26.644 1.00 32.75  ? 524  PHE B O     1 
ATOM   839   C  CB    . PHE A  1  116 ? 20.322  15.845 -24.214 1.00 35.06  ? 524  PHE B CB    1 
ATOM   840   C  CG    . PHE A  1  116 ? 21.750  16.247 -23.900 1.00 39.19  ? 524  PHE B CG    1 
ATOM   841   C  CD1   . PHE A  1  116 ? 22.537  16.849 -24.827 1.00 38.24  ? 524  PHE B CD1   1 
ATOM   842   C  CD2   . PHE A  1  116 ? 22.288  15.977 -22.655 1.00 37.59  ? 524  PHE B CD2   1 
ATOM   843   C  CE1   . PHE A  1  116 ? 23.844  17.209 -24.484 1.00 41.99  ? 524  PHE B CE1   1 
ATOM   844   C  CE2   . PHE A  1  116 ? 23.582  16.323 -22.348 1.00 36.80  ? 524  PHE B CE2   1 
ATOM   845   C  CZ    . PHE A  1  116 ? 24.357  16.963 -23.249 1.00 38.59  ? 524  PHE B CZ    1 
ATOM   846   N  N     . TYR A  1  117 ? 17.246  16.446 -24.842 1.00 32.12  ? 525  TYR B N     1 
ATOM   847   C  CA    . TYR A  1  117 ? 15.954  15.820 -25.113 1.00 35.04  ? 525  TYR B CA    1 
ATOM   848   C  C     . TYR A  1  117 ? 15.260  16.427 -26.353 1.00 35.38  ? 525  TYR B C     1 
ATOM   849   O  O     . TYR A  1  117 ? 14.666  15.716 -27.129 1.00 37.60  ? 525  TYR B O     1 
ATOM   850   C  CB    . TYR A  1  117 ? 15.031  15.924 -23.867 1.00 35.52  ? 525  TYR B CB    1 
ATOM   851   C  CG    . TYR A  1  117 ? 13.765  15.143 -24.012 1.00 38.92  ? 525  TYR B CG    1 
ATOM   852   C  CD1   . TYR A  1  117 ? 13.758  13.755 -23.902 1.00 40.66  ? 525  TYR B CD1   1 
ATOM   853   C  CD2   . TYR A  1  117 ? 12.541  15.796 -24.287 1.00 41.40  ? 525  TYR B CD2   1 
ATOM   854   C  CE1   . TYR A  1  117 ? 12.581  13.018 -24.041 1.00 40.11  ? 525  TYR B CE1   1 
ATOM   855   C  CE2   . TYR A  1  117 ? 11.367  15.071 -24.430 1.00 42.22  ? 525  TYR B CE2   1 
ATOM   856   C  CZ    . TYR A  1  117 ? 11.393  13.705 -24.304 1.00 43.46  ? 525  TYR B CZ    1 
ATOM   857   O  OH    . TYR A  1  117 ? 10.234  12.975 -24.449 1.00 46.71  ? 525  TYR B OH    1 
ATOM   858   N  N     . ARG A  1  118 ? 15.389  17.736 -26.517 1.00 35.44  ? 526  ARG B N     1 
ATOM   859   C  CA    . ARG A  1  118 ? 14.735  18.414 -27.637 1.00 39.04  ? 526  ARG B CA    1 
ATOM   860   C  C     . ARG A  1  118 ? 15.515  18.396 -28.931 1.00 41.34  ? 526  ARG B C     1 
ATOM   861   O  O     . ARG A  1  118 ? 14.933  18.582 -29.990 1.00 46.50  ? 526  ARG B O     1 
ATOM   862   C  CB    . ARG A  1  118 ? 14.419  19.880 -27.253 1.00 40.22  ? 526  ARG B CB    1 
ATOM   863   C  CG    . ARG A  1  118 ? 13.431  20.023 -26.096 1.00 39.56  ? 526  ARG B CG    1 
ATOM   864   C  CD    . ARG A  1  118 ? 12.123  19.258 -26.357 1.00 38.87  ? 526  ARG B CD    1 
ATOM   865   N  NE    . ARG A  1  118 ? 11.065  19.663 -25.441 1.00 37.90  ? 526  ARG B NE    1 
ATOM   866   C  CZ    . ARG A  1  118 ? 9.886   19.063 -25.321 1.00 37.87  ? 526  ARG B CZ    1 
ATOM   867   N  NH1   . ARG A  1  118 ? 9.561   18.107 -26.091 1.00 38.21  ? 526  ARG B NH1   1 
ATOM   868   N  NH2   . ARG A  1  118 ? 9.012   19.438 -24.401 1.00 39.59  ? 526  ARG B NH2   1 
ATOM   869   N  N     . PHE A  1  119 ? 16.826  18.162 -28.866 1.00 39.24  ? 527  PHE B N     1 
ATOM   870   C  CA    . PHE A  1  119 ? 17.683  18.237 -30.063 1.00 41.31  ? 527  PHE B CA    1 
ATOM   871   C  C     . PHE A  1  119 ? 18.545  17.013 -30.309 1.00 42.09  ? 527  PHE B C     1 
ATOM   872   O  O     . PHE A  1  119 ? 19.019  16.861 -31.435 1.00 46.10  ? 527  PHE B O     1 
ATOM   873   C  CB    . PHE A  1  119 ? 18.577  19.473 -30.012 1.00 41.31  ? 527  PHE B CB    1 
ATOM   874   C  CG    . PHE A  1  119 ? 17.839  20.754 -30.215 1.00 45.05  ? 527  PHE B CG    1 
ATOM   875   C  CD1   . PHE A  1  119 ? 17.636  21.208 -31.552 1.00 42.42  ? 527  PHE B CD1   1 
ATOM   876   C  CD2   . PHE A  1  119 ? 17.334  21.455 -29.149 1.00 39.67  ? 527  PHE B CD2   1 
ATOM   877   C  CE1   . PHE A  1  119 ? 16.917  22.413 -31.742 1.00 43.87  ? 527  PHE B CE1   1 
ATOM   878   C  CE2   . PHE A  1  119 ? 16.618  22.636 -29.342 1.00 41.18  ? 527  PHE B CE2   1 
ATOM   879   C  CZ    . PHE A  1  119 ? 16.409  23.118 -30.631 1.00 39.82  ? 527  PHE B CZ    1 
ATOM   880   N  N     . MET A  1  120 ? 18.764  16.155 -29.314 1.00 41.92  ? 528  MET B N     1 
ATOM   881   C  CA    . MET A  1  120 ? 19.565  14.941 -29.502 1.00 40.97  ? 528  MET B CA    1 
ATOM   882   C  C     . MET A  1  120 ? 18.953  13.777 -28.772 1.00 38.66  ? 528  MET B C     1 
ATOM   883   O  O     . MET A  1  120 ? 19.625  13.040 -28.041 1.00 41.56  ? 528  MET B O     1 
ATOM   884   C  CB    . MET A  1  120 ? 21.013  15.182 -29.004 1.00 38.93  ? 528  MET B CB    1 
ATOM   885   C  CG    . MET A  1  120 ? 21.799  16.210 -29.823 1.00 42.55  ? 528  MET B CG    1 
ATOM   886   S  SD    . MET A  1  120 ? 23.311  16.619 -29.014 1.00 46.31  ? 528  MET B SD    1 
ATOM   887   C  CE    . MET A  1  120 ? 24.138  17.556 -30.344 1.00 48.15  ? 528  MET B CE    1 
ATOM   888   N  N     . ARG A  1  121 ? 17.644  13.591 -28.943 1.00 40.14  ? 529  ARG B N     1 
ATOM   889   C  CA    . ARG A  1  121 ? 16.929  12.550 -28.199 1.00 43.25  ? 529  ARG B CA    1 
ATOM   890   C  C     . ARG A  1  121 ? 17.531  11.148 -28.420 1.00 43.38  ? 529  ARG B C     1 
ATOM   891   O  O     . ARG A  1  121 ? 17.660  10.421 -27.419 1.00 41.57  ? 529  ARG B O     1 
ATOM   892   C  CB    . ARG A  1  121 ? 15.448  12.594 -28.528 1.00 45.13  ? 529  ARG B CB    1 
ATOM   893   C  CG    . ARG A  1  121 ? 14.554  12.123 -27.403 1.00 49.92  ? 529  ARG B CG    1 
ATOM   894   C  CD    . ARG A  1  121 ? 13.069  12.288 -27.739 1.00 54.66  ? 529  ARG B CD    1 
ATOM   895   N  NE    . ARG A  1  121 ? 12.417  11.012 -27.905 1.00 59.44  ? 529  ARG B NE    1 
ATOM   896   C  CZ    . ARG A  1  121 ? 11.099  10.856 -28.068 1.00 64.86  ? 529  ARG B CZ    1 
ATOM   897   N  NH1   . ARG A  1  121 ? 10.271  11.905 -28.023 1.00 65.57  ? 529  ARG B NH1   1 
ATOM   898   N  NH2   . ARG A  1  121 ? 10.587  9.634  -28.235 1.00 65.94  ? 529  ARG B NH2   1 
ATOM   899   N  N     . PRO A  1  122 ? 17.894  10.731 -29.645 1.00 43.95  ? 530  PRO B N     1 
ATOM   900   C  CA    . PRO A  1  122 ? 18.493  9.384  -29.769 1.00 42.74  ? 530  PRO B CA    1 
ATOM   901   C  C     . PRO A  1  122 ? 19.800  9.220  -29.012 1.00 41.05  ? 530  PRO B C     1 
ATOM   902   O  O     . PRO A  1  122 ? 20.190  8.074  -28.720 1.00 36.64  ? 530  PRO B O     1 
ATOM   903   C  CB    . PRO A  1  122 ? 18.731  9.231  -31.269 1.00 44.92  ? 530  PRO B CB    1 
ATOM   904   C  CG    . PRO A  1  122 ? 17.705  10.169 -31.887 1.00 47.64  ? 530  PRO B CG    1 
ATOM   905   C  CD    . PRO A  1  122 ? 17.631  11.347 -30.943 1.00 46.50  ? 530  PRO B CD    1 
ATOM   906   N  N     . LEU A  1  123 ? 20.508  10.320 -28.704 1.00 39.35  ? 531  LEU B N     1 
ATOM   907   C  CA    . LEU A  1  123 ? 21.655  10.227 -27.812 1.00 41.93  ? 531  LEU B CA    1 
ATOM   908   C  C     . LEU A  1  123 ? 21.251  9.627  -26.459 1.00 39.88  ? 531  LEU B C     1 
ATOM   909   O  O     . LEU A  1  123 ? 21.916  8.738  -25.937 1.00 40.43  ? 531  LEU B O     1 
ATOM   910   C  CB    . LEU A  1  123 ? 22.263  11.620 -27.593 1.00 43.19  ? 531  LEU B CB    1 
ATOM   911   C  CG    . LEU A  1  123 ? 23.686  11.930 -28.012 1.00 47.12  ? 531  LEU B CG    1 
ATOM   912   C  CD1   . LEU A  1  123 ? 24.167  13.208 -27.339 1.00 46.70  ? 531  LEU B CD1   1 
ATOM   913   C  CD2   . LEU A  1  123 ? 24.616  10.784 -27.683 1.00 50.51  ? 531  LEU B CD2   1 
ATOM   914   N  N     . ILE A  1  124 ? 20.152  10.116 -25.890 1.00 37.49  ? 532  ILE B N     1 
ATOM   915   C  CA    . ILE A  1  124 ? 19.651  9.581  -24.634 1.00 38.44  ? 532  ILE B CA    1 
ATOM   916   C  C     . ILE A  1  124 ? 19.150  8.157  -24.814 1.00 41.39  ? 532  ILE B C     1 
ATOM   917   O  O     . ILE A  1  124 ? 19.504  7.249  -24.031 1.00 39.09  ? 532  ILE B O     1 
ATOM   918   C  CB    . ILE A  1  124 ? 18.542  10.480 -24.073 1.00 38.97  ? 532  ILE B CB    1 
ATOM   919   C  CG1   . ILE A  1  124 ? 19.073  11.917 -23.892 1.00 39.45  ? 532  ILE B CG1   1 
ATOM   920   C  CG2   . ILE A  1  124 ? 17.972  9.917  -22.778 1.00 40.98  ? 532  ILE B CG2   1 
ATOM   921   C  CD1   . ILE A  1  124 ? 17.962  12.932 -23.717 1.00 37.47  ? 532  ILE B CD1   1 
ATOM   922   N  N     . GLU A  1  125 ? 18.327  7.932  -25.845 1.00 41.32  ? 533  GLU B N     1 
ATOM   923   C  CA    . GLU A  1  125 ? 17.749  6.604  -26.080 1.00 47.43  ? 533  GLU B CA    1 
ATOM   924   C  C     . GLU A  1  125 ? 18.835  5.548  -26.271 1.00 44.98  ? 533  GLU B C     1 
ATOM   925   O  O     . GLU A  1  125 ? 18.618  4.376  -25.958 1.00 51.03  ? 533  GLU B O     1 
ATOM   926   C  CB    . GLU A  1  125 ? 16.805  6.648  -27.269 1.00 46.58  ? 533  GLU B CB    1 
ATOM   927   C  CG    . GLU A  1  125 ? 15.550  7.481  -27.016 1.00 51.91  ? 533  GLU B CG    1 
ATOM   928   C  CD    . GLU A  1  125 ? 14.717  7.684  -28.289 1.00 57.87  ? 533  GLU B CD    1 
ATOM   929   O  OE1   . GLU A  1  125 ? 15.287  7.754  -29.423 1.00 60.00  ? 533  GLU B OE1   1 
ATOM   930   O  OE2   . GLU A  1  125 ? 13.491  7.785  -28.175 1.00 60.08  ? 533  GLU B OE2   1 
ATOM   931   N  N     . ALA A  1  126 ? 19.990  5.935  -26.801 1.00 44.71  ? 534  ALA B N     1 
ATOM   932   C  CA    . ALA A  1  126 ? 21.089  4.993  -26.982 1.00 46.41  ? 534  ALA B CA    1 
ATOM   933   C  C     . ALA A  1  126 ? 21.847  4.698  -25.692 1.00 46.63  ? 534  ALA B C     1 
ATOM   934   O  O     . ALA A  1  126 ? 22.703  3.821  -25.684 1.00 44.63  ? 534  ALA B O     1 
ATOM   935   C  CB    . ALA A  1  126 ? 22.070  5.522  -28.032 1.00 45.69  ? 534  ALA B CB    1 
ATOM   936   N  N     . GLY A  1  127 ? 21.560  5.432  -24.612 1.00 44.69  ? 535  GLY B N     1 
ATOM   937   C  CA    . GLY A  1  127 ? 22.262  5.214  -23.363 1.00 44.35  ? 535  GLY B CA    1 
ATOM   938   C  C     . GLY A  1  127 ? 23.599  5.938  -23.252 1.00 43.20  ? 535  GLY B C     1 
ATOM   939   O  O     . GLY A  1  127 ? 24.410  5.612  -22.377 1.00 43.53  ? 535  GLY B O     1 
ATOM   940   N  N     . TYR A  1  128 ? 23.826  6.932  -24.113 1.00 40.94  ? 536  TYR B N     1 
ATOM   941   C  CA    . TYR A  1  128 ? 25.127  7.597  -24.157 1.00 40.32  ? 536  TYR B CA    1 
ATOM   942   C  C     . TYR A  1  128 ? 25.248  8.740  -23.146 1.00 40.08  ? 536  TYR B C     1 
ATOM   943   O  O     . TYR A  1  128 ? 26.358  9.208  -22.888 1.00 38.45  ? 536  TYR B O     1 
ATOM   944   C  CB    . TYR A  1  128 ? 25.403  8.177  -25.547 1.00 42.02  ? 536  TYR B CB    1 
ATOM   945   C  CG    . TYR A  1  128 ? 25.676  7.191  -26.669 1.00 44.67  ? 536  TYR B CG    1 
ATOM   946   C  CD1   . TYR A  1  128 ? 25.385  5.842  -26.546 1.00 46.30  ? 536  TYR B CD1   1 
ATOM   947   C  CD2   . TYR A  1  128 ? 26.233  7.635  -27.870 1.00 43.90  ? 536  TYR B CD2   1 
ATOM   948   C  CE1   . TYR A  1  128 ? 25.627  4.953  -27.586 1.00 47.76  ? 536  TYR B CE1   1 
ATOM   949   C  CE2   . TYR A  1  128 ? 26.490  6.764  -28.914 1.00 47.61  ? 536  TYR B CE2   1 
ATOM   950   C  CZ    . TYR A  1  128 ? 26.183  5.412  -28.770 1.00 48.38  ? 536  TYR B CZ    1 
ATOM   951   O  OH    . TYR A  1  128 ? 26.440  4.569  -29.813 1.00 47.41  ? 536  TYR B OH    1 
ATOM   952   N  N     . VAL A  1  129 ? 24.120  9.215  -22.588 1.00 38.37  ? 537  VAL B N     1 
ATOM   953   C  CA    . VAL A  1  129 ? 24.126  10.375 -21.713 1.00 35.13  ? 537  VAL B CA    1 
ATOM   954   C  C     . VAL A  1  129 ? 24.205  9.903  -20.264 1.00 35.51  ? 537  VAL B C     1 
ATOM   955   O  O     . VAL A  1  129 ? 23.429  9.050  -19.850 1.00 36.31  ? 537  VAL B O     1 
ATOM   956   C  CB    . VAL A  1  129 ? 22.870  11.229 -21.949 1.00 34.37  ? 537  VAL B CB    1 
ATOM   957   C  CG1   . VAL A  1  129 ? 22.886  12.448 -20.944 1.00 37.71  ? 537  VAL B CG1   1 
ATOM   958   C  CG2   . VAL A  1  129 ? 22.851  11.745 -23.372 1.00 34.93  ? 537  VAL B CG2   1 
ATOM   959   N  N     . TYR A  1  130 ? 25.133  10.461 -19.506 1.00 33.93  ? 538  TYR B N     1 
ATOM   960   C  CA    . TYR A  1  130 ? 25.313  10.069 -18.122 1.00 33.14  ? 538  TYR B CA    1 
ATOM   961   C  C     . TYR A  1  130 ? 25.430  11.286 -17.218 1.00 32.39  ? 538  TYR B C     1 
ATOM   962   O  O     . TYR A  1  130 ? 25.604  12.403 -17.684 1.00 31.40  ? 538  TYR B O     1 
ATOM   963   C  CB    . TYR A  1  130 ? 26.638  9.233  -17.959 1.00 35.77  ? 538  TYR B CB    1 
ATOM   964   C  CG    . TYR A  1  130 ? 26.642  7.952  -18.745 1.00 38.66  ? 538  TYR B CG    1 
ATOM   965   C  CD1   . TYR A  1  130 ? 26.888  7.955  -20.116 1.00 41.39  ? 538  TYR B CD1   1 
ATOM   966   C  CD2   . TYR A  1  130 ? 26.431  6.742  -18.119 1.00 40.78  ? 538  TYR B CD2   1 
ATOM   967   C  CE1   . TYR A  1  130 ? 26.904  6.778  -20.844 1.00 40.37  ? 538  TYR B CE1   1 
ATOM   968   C  CE2   . TYR A  1  130 ? 26.442  5.545  -18.847 1.00 40.48  ? 538  TYR B CE2   1 
ATOM   969   C  CZ    . TYR A  1  130 ? 26.687  5.575  -20.191 1.00 42.07  ? 538  TYR B CZ    1 
ATOM   970   O  OH    . TYR A  1  130 ? 26.710  4.400  -20.916 1.00 43.21  ? 538  TYR B OH    1 
ATOM   971   N  N     . ILE A  1  131 ? 25.292  11.035 -15.927 1.00 31.95  ? 539  ILE B N     1 
ATOM   972   C  CA    . ILE A  1  131 ? 25.438  12.053 -14.882 1.00 31.69  ? 539  ILE B CA    1 
ATOM   973   C  C     . ILE A  1  131 ? 26.548  11.558 -13.951 1.00 31.04  ? 539  ILE B C     1 
ATOM   974   O  O     . ILE A  1  131 ? 26.462  10.447 -13.410 1.00 29.68  ? 539  ILE B O     1 
ATOM   975   C  CB    . ILE A  1  131 ? 24.160  12.295 -14.095 1.00 32.76  ? 539  ILE B CB    1 
ATOM   976   C  CG1   . ILE A  1  131 ? 23.046  12.776 -15.030 1.00 33.67  ? 539  ILE B CG1   1 
ATOM   977   C  CG2   . ILE A  1  131 ? 24.373  13.300 -13.009 1.00 33.58  ? 539  ILE B CG2   1 
ATOM   978   C  CD1   . ILE A  1  131 ? 21.677  12.726 -14.339 1.00 33.49  ? 539  ILE B CD1   1 
ATOM   979   N  N     . ALA A  1  132 ? 27.594  12.366 -13.784 1.00 30.57  ? 540  ALA B N     1 
ATOM   980   C  CA    . ALA A  1  132 ? 28.649  12.037 -12.856 1.00 29.38  ? 540  ALA B CA    1 
ATOM   981   C  C     . ALA A  1  132 ? 28.152  12.125 -11.437 1.00 28.79  ? 540  ALA B C     1 
ATOM   982   O  O     . ALA A  1  132 ? 27.112  12.773 -11.150 1.00 28.05  ? 540  ALA B O     1 
ATOM   983   C  CB    . ALA A  1  132 ? 29.863  12.921 -13.078 1.00 29.63  ? 540  ALA B CB    1 
ATOM   984   N  N     . GLN A  1  133 ? 28.888  11.488 -10.497 1.00 29.36  ? 541  GLN B N     1 
ATOM   985   C  CA    . GLN A  1  133 ? 28.511  11.523 -9.086  1.00 31.63  ? 541  GLN B CA    1 
ATOM   986   C  C     . GLN A  1  133 ? 29.722  11.998 -8.267  1.00 32.46  ? 541  GLN B C     1 
ATOM   987   O  O     . GLN A  1  133 ? 30.413  11.192 -7.623  1.00 30.30  ? 541  GLN B O     1 
ATOM   988   C  CB    . GLN A  1  133 ? 28.052  10.157 -8.620  1.00 37.92  ? 541  GLN B CB    1 
ATOM   989   C  CG    . GLN A  1  133 ? 26.726  10.146 -7.867  1.00 44.36  ? 541  GLN B CG    1 
ATOM   990   C  CD    . GLN A  1  133 ? 25.519  10.141 -8.768  1.00 46.70  ? 541  GLN B CD    1 
ATOM   991   O  OE1   . GLN A  1  133 ? 24.560  9.442  -8.459  1.00 52.53  ? 541  GLN B OE1   1 
ATOM   992   N  NE2   . GLN A  1  133 ? 25.525  11.006 -9.797  1.00 50.36  ? 541  GLN B NE2   1 
ATOM   993   N  N     . PRO A  1  134 ? 29.982  13.305 -8.257  1.00 31.39  ? 542  PRO B N     1 
ATOM   994   C  CA    . PRO A  1  134 ? 31.054  13.825 -7.427  1.00 31.19  ? 542  PRO B CA    1 
ATOM   995   C  C     . PRO A  1  134 ? 30.672  13.762 -5.962  1.00 31.61  ? 542  PRO B C     1 
ATOM   996   O  O     . PRO A  1  134 ? 29.490  13.589 -5.629  1.00 33.00  ? 542  PRO B O     1 
ATOM   997   C  CB    . PRO A  1  134 ? 31.166  15.291 -7.896  1.00 30.85  ? 542  PRO B CB    1 
ATOM   998   C  CG    . PRO A  1  134 ? 29.781  15.621 -8.368  1.00 29.50  ? 542  PRO B CG    1 
ATOM   999   C  CD    . PRO A  1  134 ? 29.249  14.373 -8.954  1.00 30.24  ? 542  PRO B CD    1 
ATOM   1000  N  N     . PRO A  1  135 ? 31.651  13.899 -5.070  1.00 33.27  ? 543  PRO B N     1 
ATOM   1001  C  CA    . PRO A  1  135 ? 31.372  13.849 -3.631  1.00 35.01  ? 543  PRO B CA    1 
ATOM   1002  C  C     . PRO A  1  135 ? 30.294  14.840 -3.250  1.00 37.54  ? 543  PRO B C     1 
ATOM   1003  O  O     . PRO A  1  135 ? 30.358  16.012 -3.700  1.00 37.90  ? 543  PRO B O     1 
ATOM   1004  C  CB    . PRO A  1  135 ? 32.702  14.211 -3.004  1.00 36.22  ? 543  PRO B CB    1 
ATOM   1005  C  CG    . PRO A  1  135 ? 33.655  13.541 -3.916  1.00 33.12  ? 543  PRO B CG    1 
ATOM   1006  C  CD    . PRO A  1  135 ? 33.101  13.881 -5.318  1.00 32.19  ? 543  PRO B CD    1 
ATOM   1007  N  N     . THR A  1  136 ? 29.336  14.417 -2.432  1.00 36.67  ? 544  THR B N     1 
ATOM   1008  C  CA    . THR A  1  136 ? 28.313  15.361 -1.996  1.00 38.01  ? 544  THR B CA    1 
ATOM   1009  C  C     . THR A  1  136 ? 28.760  16.088 -0.751  1.00 39.56  ? 544  THR B C     1 
ATOM   1010  O  O     . THR A  1  136 ? 29.734  15.741 -0.121  1.00 38.67  ? 544  THR B O     1 
ATOM   1011  C  CB    . THR A  1  136 ? 26.956  14.654 -1.745  1.00 40.14  ? 544  THR B CB    1 
ATOM   1012  O  OG1   . THR A  1  136 ? 27.184  13.513 -0.957  1.00 41.40  ? 544  THR B OG1   1 
ATOM   1013  C  CG2   . THR A  1  136 ? 26.360  14.144 -3.024  1.00 40.54  ? 544  THR B CG2   1 
ATOM   1014  N  N     . GLY A  1  137 ? 28.038  17.154 -0.404  1.00 38.83  ? 545  GLY B N     1 
ATOM   1015  C  CA    . GLY A  1  137 ? 28.419  18.049 0.684   1.00 43.31  ? 545  GLY B CA    1 
ATOM   1016  C  C     . GLY A  1  137 ? 28.366  19.489 0.037   1.00 47.51  ? 545  GLY B C     1 
ATOM   1017  O  O     . GLY A  1  137 ? 27.702  19.795 -0.975  1.00 47.50  ? 545  GLY B O     1 
ATOM   1018  N  N     . TYR A  1  138 ? 29.154  20.362 0.744   1.00 49.10  ? 580  TYR B N     1 
ATOM   1019  C  CA    . TYR A  1  138 ? 29.164  21.762 0.406   1.00 48.54  ? 580  TYR B CA    1 
ATOM   1020  C  C     . TYR A  1  138 ? 30.317  22.190 -0.494  1.00 46.76  ? 580  TYR B C     1 
ATOM   1021  O  O     . TYR A  1  138 ? 30.298  23.305 -1.033  1.00 48.70  ? 580  TYR B O     1 
ATOM   1022  C  CB    . TYR A  1  138 ? 29.144  22.618 1.659   1.00 50.63  ? 580  TYR B CB    1 
ATOM   1023  C  CG    . TYR A  1  138 ? 30.312  22.369 2.584   1.00 53.71  ? 580  TYR B CG    1 
ATOM   1024  C  CD1   . TYR A  1  138 ? 31.541  23.063 2.447   1.00 55.66  ? 580  TYR B CD1   1 
ATOM   1025  C  CD2   . TYR A  1  138 ? 30.179  21.462 3.627   1.00 56.88  ? 580  TYR B CD2   1 
ATOM   1026  C  CE1   . TYR A  1  138 ? 32.588  22.790 3.285   1.00 58.28  ? 580  TYR B CE1   1 
ATOM   1027  C  CE2   . TYR A  1  138 ? 31.229  21.174 4.498   1.00 58.25  ? 580  TYR B CE2   1 
ATOM   1028  C  CZ    . TYR A  1  138 ? 32.430  21.844 4.320   1.00 57.95  ? 580  TYR B CZ    1 
ATOM   1029  O  OH    . TYR A  1  138 ? 33.477  21.619 5.183   1.00 62.14  ? 580  TYR B OH    1 
ATOM   1030  N  N     A LYS A  1  139 ? 31.317  21.314 -0.648  0.50 42.09  ? 581  LYS B N     1 
ATOM   1031  N  N     B LYS A  1  139 ? 31.392  21.391 -0.576  0.50 43.02  ? 581  LYS B N     1 
ATOM   1032  C  CA    A LYS A  1  139 ? 32.469  21.588 -1.505  0.50 39.21  ? 581  LYS B CA    1 
ATOM   1033  C  CA    B LYS A  1  139 ? 32.464  21.647 -1.535  0.50 40.26  ? 581  LYS B CA    1 
ATOM   1034  C  C     A LYS A  1  139 ? 32.181  21.319 -2.971  0.50 36.93  ? 581  LYS B C     1 
ATOM   1035  C  C     B LYS A  1  139 ? 32.070  21.357 -2.943  0.50 37.65  ? 581  LYS B C     1 
ATOM   1036  O  O     A LYS A  1  139 ? 31.833  20.198 -3.363  0.50 35.96  ? 581  LYS B O     1 
ATOM   1037  O  O     B LYS A  1  139 ? 31.855  20.206 -3.359  0.50 36.62  ? 581  LYS B O     1 
ATOM   1038  C  CB    A LYS A  1  139 ? 33.649  20.796 -1.043  0.50 43.25  ? 581  LYS B CB    1 
ATOM   1039  C  CB    B LYS A  1  139 ? 33.697  20.849 -1.199  0.50 44.93  ? 581  LYS B CB    1 
ATOM   1040  C  CG    A LYS A  1  139 ? 34.970  21.378 -1.469  0.50 43.43  ? 581  LYS B CG    1 
ATOM   1041  C  CG    B LYS A  1  139 ? 34.418  21.322 0.075   0.50 47.05  ? 581  LYS B CG    1 
ATOM   1042  C  CD    A LYS A  1  139 ? 36.123  20.690 -0.761  0.50 44.41  ? 581  LYS B CD    1 
ATOM   1043  C  CD    B LYS A  1  139 ? 35.917  20.889 0.009   0.50 49.41  ? 581  LYS B CD    1 
ATOM   1044  C  CE    A LYS A  1  139 ? 35.845  20.560 0.732   0.50 46.19  ? 581  LYS B CE    1 
ATOM   1045  C  CE    B LYS A  1  139 ? 36.850  21.608 1.009   0.50 51.87  ? 581  LYS B CE    1 
ATOM   1046  N  NZ    A LYS A  1  139 ? 36.157  21.834 1.462   0.50 45.91  ? 581  LYS B NZ    1 
ATOM   1047  N  NZ    B LYS A  1  139 ? 38.277  21.915 0.588   0.50 50.22  ? 581  LYS B NZ    1 
ATOM   1048  N  N     . GLY A  1  140 ? 32.312  22.342 -3.805  1.00 33.57  ? 582  GLY B N     1 
ATOM   1049  C  CA    . GLY A  1  140 ? 32.090  22.174 -5.223  1.00 30.61  ? 582  GLY B CA    1 
ATOM   1050  C  C     . GLY A  1  140 ? 33.259  21.664 -6.000  1.00 28.81  ? 582  GLY B C     1 
ATOM   1051  O  O     . GLY A  1  140 ? 34.340  21.576 -5.480  1.00 27.69  ? 582  GLY B O     1 
ATOM   1052  N  N     . LEU A  1  141 ? 32.999  21.307 -7.274  1.00 24.70  ? 583  LEU B N     1 
ATOM   1053  C  CA    . LEU A  1  141 ? 34.066  20.822 -8.159  1.00 26.05  ? 583  LEU B CA    1 
ATOM   1054  C  C     . LEU A  1  141 ? 35.269  21.732 -8.210  1.00 25.86  ? 583  LEU B C     1 
ATOM   1055  O  O     . LEU A  1  141 ? 36.409  21.228 -8.260  1.00 23.32  ? 583  LEU B O     1 
ATOM   1056  C  CB    . LEU A  1  141 ? 33.537  20.562 -9.541  1.00 24.72  ? 583  LEU B CB    1 
ATOM   1057  C  CG    . LEU A  1  141 ? 32.393  19.580 -9.779  1.00 24.72  ? 583  LEU B CG    1 
ATOM   1058  C  CD1   . LEU A  1  141 ? 32.012  19.512 -11.248 1.00 25.62  ? 583  LEU B CD1   1 
ATOM   1059  C  CD2   . LEU A  1  141 ? 32.784  18.169 -9.241  1.00 26.10  ? 583  LEU B CD2   1 
ATOM   1060  N  N     . GLY A  1  142 ? 35.069  23.042 -8.218  1.00 27.77  ? 584  GLY B N     1 
ATOM   1061  C  CA    . GLY A  1  142 ? 36.189  23.975 -8.318  1.00 27.48  ? 584  GLY B CA    1 
ATOM   1062  C  C     . GLY A  1  142 ? 37.105  23.986 -7.142  1.00 27.28  ? 584  GLY B C     1 
ATOM   1063  O  O     . GLY A  1  142 ? 38.221  24.560 -7.247  1.00 24.92  ? 584  GLY B O     1 
ATOM   1064  N  N     . GLU A  1  143 ? 36.696  23.433 -6.017  1.00 27.85  ? 585  GLU B N     1 
ATOM   1065  C  CA    . GLU A  1  143 ? 37.511  23.424 -4.793  1.00 27.83  ? 585  GLU B CA    1 
ATOM   1066  C  C     . GLU A  1  143 ? 38.324  22.141 -4.617  1.00 29.51  ? 585  GLU B C     1 
ATOM   1067  O  O     . GLU A  1  143 ? 39.070  22.051 -3.661  1.00 30.84  ? 585  GLU B O     1 
ATOM   1068  C  CB    . GLU A  1  143 ? 36.644  23.632 -3.570  1.00 28.68  ? 585  GLU B CB    1 
ATOM   1069  C  CG    . GLU A  1  143 ? 35.679  24.790 -3.643  1.00 30.10  ? 585  GLU B CG    1 
ATOM   1070  C  CD    . GLU A  1  143 ? 34.743  24.815 -2.441  1.00 30.55  ? 585  GLU B CD    1 
ATOM   1071  O  OE1   . GLU A  1  143 ? 35.230  24.735 -1.266  1.00 32.89  ? 585  GLU B OE1   1 
ATOM   1072  O  OE2   . GLU A  1  143 ? 33.517  24.902 -2.637  1.00 29.32  ? 585  GLU B OE2   1 
ATOM   1073  N  N     . MET A  1  144 ? 38.182  21.160 -5.535  1.00 28.26  ? 586  MET B N     1 
ATOM   1074  C  CA    . MET A  1  144 ? 38.916  19.933 -5.449  1.00 30.87  ? 586  MET B CA    1 
ATOM   1075  C  C     . MET A  1  144 ? 40.166  19.981 -6.333  1.00 31.14  ? 586  MET B C     1 
ATOM   1076  O  O     . MET A  1  144 ? 40.251  20.750 -7.291  1.00 30.61  ? 586  MET B O     1 
ATOM   1077  C  CB    . MET A  1  144 ? 38.015  18.766 -5.893  1.00 29.93  ? 586  MET B CB    1 
ATOM   1078  C  CG    . MET A  1  144 ? 36.744  18.647 -5.020  1.00 32.92  ? 586  MET B CG    1 
ATOM   1079  S  SD    . MET A  1  144 ? 35.474  17.605 -5.842  1.00 35.64  ? 586  MET B SD    1 
ATOM   1080  C  CE    . MET A  1  144 ? 36.482  16.069 -6.057  1.00 30.74  ? 586  MET B CE    1 
ATOM   1081  N  N     . ASN A  1  145 ? 41.167  19.165 -5.976  1.00 31.87  ? 587  ASN B N     1 
ATOM   1082  C  CA    . ASN A  1  145 ? 42.350  19.094 -6.792  1.00 31.50  ? 587  ASN B CA    1 
ATOM   1083  C  C     . ASN A  1  145 ? 42.164  18.033 -7.882  1.00 29.83  ? 587  ASN B C     1 
ATOM   1084  O  O     . ASN A  1  145 ? 41.184  17.319 -7.939  1.00 30.33  ? 587  ASN B O     1 
ATOM   1085  C  CB    . ASN A  1  145 ? 43.601  18.831 -5.961  1.00 31.30  ? 587  ASN B CB    1 
ATOM   1086  C  CG    . ASN A  1  145 ? 43.538  17.480 -5.228  1.00 32.99  ? 587  ASN B CG    1 
ATOM   1087  O  OD1   . ASN A  1  145 ? 43.401  16.418 -5.835  1.00 32.02  ? 587  ASN B OD1   1 
ATOM   1088  N  ND2   . ASN A  1  145 ? 43.670  17.542 -3.891  1.00 35.80  ? 587  ASN B ND2   1 
ATOM   1089  N  N     . ALA A  1  146 ? 43.151  17.974 -8.788  1.00 29.38  ? 588  ALA B N     1 
ATOM   1090  C  CA    . ALA A  1  146 ? 42.990  17.137 -9.972  1.00 33.75  ? 588  ALA B CA    1 
ATOM   1091  C  C     . ALA A  1  146 ? 42.961  15.648 -9.604  1.00 34.50  ? 588  ALA B C     1 
ATOM   1092  O  O     . ALA A  1  146 ? 42.215  14.890 -10.214 1.00 34.06  ? 588  ALA B O     1 
ATOM   1093  C  CB    . ALA A  1  146 ? 44.163  17.412 -10.922 1.00 34.10  ? 588  ALA B CB    1 
ATOM   1094  N  N     . ASP A  1  147 ? 43.738  15.226 -8.602  1.00 37.99  ? 589  ASP B N     1 
ATOM   1095  C  CA    . ASP A  1  147 ? 43.727  13.825 -8.218  1.00 37.35  ? 589  ASP B CA    1 
ATOM   1096  C  C     . ASP A  1  147 ? 42.404  13.422 -7.549  1.00 37.47  ? 589  ASP B C     1 
ATOM   1097  O  O     . ASP A  1  147 ? 41.915  12.313 -7.765  1.00 33.47  ? 589  ASP B O     1 
ATOM   1098  C  CB    . ASP A  1  147 ? 44.882  13.500 -7.288  1.00 43.54  ? 589  ASP B CB    1 
ATOM   1099  C  CG    . ASP A  1  147 ? 46.241  13.681 -8.020  1.00 50.21  ? 589  ASP B CG    1 
ATOM   1100  O  OD1   . ASP A  1  147 ? 46.249  13.489 -9.260  1.00 58.92  ? 589  ASP B OD1   1 
ATOM   1101  O  OD2   . ASP A  1  147 ? 47.268  14.026 -7.393  1.00 53.89  ? 589  ASP B OD2   1 
ATOM   1102  N  N     . GLN A  1  148 ? 41.823  14.325 -6.754  1.00 34.04  ? 590  GLN B N     1 
ATOM   1103  C  CA    . GLN A  1  148 ? 40.551  14.047 -6.131  1.00 34.51  ? 590  GLN B CA    1 
ATOM   1104  C  C     . GLN A  1  148 ? 39.452  13.878 -7.185  1.00 34.50  ? 590  GLN B C     1 
ATOM   1105  O  O     . GLN A  1  148 ? 38.655  12.938 -7.119  1.00 35.57  ? 590  GLN B O     1 
ATOM   1106  C  CB    . GLN A  1  148 ? 40.171  15.178 -5.155  1.00 35.42  ? 590  GLN B CB    1 
ATOM   1107  C  CG    . GLN A  1  148 ? 41.051  15.243 -3.924  1.00 41.19  ? 590  GLN B CG    1 
ATOM   1108  C  CD    . GLN A  1  148 ? 40.814  16.533 -3.116  1.00 38.13  ? 590  GLN B CD    1 
ATOM   1109  O  OE1   . GLN A  1  148 ? 40.414  17.552 -3.663  1.00 40.86  ? 590  GLN B OE1   1 
ATOM   1110  N  NE2   . GLN A  1  148 ? 41.031  16.481 -1.811  1.00 38.91  ? 590  GLN B NE2   1 
ATOM   1111  N  N     . LEU A  1  149 ? 39.408  14.776 -8.162  1.00 31.96  ? 591  LEU B N     1 
ATOM   1112  C  CA    . LEU A  1  149 ? 38.419  14.668 -9.225  1.00 32.91  ? 591  LEU B CA    1 
ATOM   1113  C  C     . LEU A  1  149 ? 38.568  13.380 -10.023 1.00 32.67  ? 591  LEU B C     1 
ATOM   1114  O  O     . LEU A  1  149 ? 37.568  12.804 -10.462 1.00 32.65  ? 591  LEU B O     1 
ATOM   1115  C  CB    . LEU A  1  149 ? 38.527  15.877 -10.175 1.00 30.65  ? 591  LEU B CB    1 
ATOM   1116  C  CG    . LEU A  1  149 ? 38.059  17.202 -9.559  1.00 30.07  ? 591  LEU B CG    1 
ATOM   1117  C  CD1   . LEU A  1  149 ? 38.526  18.364 -10.386 1.00 30.22  ? 591  LEU B CD1   1 
ATOM   1118  C  CD2   . LEU A  1  149 ? 36.549  17.241 -9.466  1.00 31.01  ? 591  LEU B CD2   1 
ATOM   1119  N  N     . TRP A  1  150 ? 39.805  12.907 -10.184 1.00 35.03  ? 592  TRP B N     1 
ATOM   1120  C  CA    . TRP A  1  150 ? 40.023  11.628 -10.849 1.00 35.88  ? 592  TRP B CA    1 
ATOM   1121  C  C     . TRP A  1  150 ? 39.520  10.461 -9.988  1.00 36.94  ? 592  TRP B C     1 
ATOM   1122  O  O     . TRP A  1  150 ? 38.680  9.677  -10.428 1.00 39.62  ? 592  TRP B O     1 
ATOM   1123  C  CB    . TRP A  1  150 ? 41.519  11.460 -11.171 1.00 36.32  ? 592  TRP B CB    1 
ATOM   1124  C  CG    . TRP A  1  150 ? 41.894  10.065 -11.613 1.00 37.83  ? 592  TRP B CG    1 
ATOM   1125  C  CD1   . TRP A  1  150 ? 42.661  9.174  -10.902 1.00 38.26  ? 592  TRP B CD1   1 
ATOM   1126  C  CD2   . TRP A  1  150 ? 41.540  9.410  -12.830 1.00 37.19  ? 592  TRP B CD2   1 
ATOM   1127  N  NE1   . TRP A  1  150 ? 42.799  7.997  -11.616 1.00 38.41  ? 592  TRP B NE1   1 
ATOM   1128  C  CE2   . TRP A  1  150 ? 42.131  8.116  -12.790 1.00 39.93  ? 592  TRP B CE2   1 
ATOM   1129  C  CE3   . TRP A  1  150 ? 40.782  9.768  -13.949 1.00 39.86  ? 592  TRP B CE3   1 
ATOM   1130  C  CZ2   . TRP A  1  150 ? 41.990  7.196  -13.839 1.00 39.09  ? 592  TRP B CZ2   1 
ATOM   1131  C  CZ3   . TRP A  1  150 ? 40.629  8.871  -14.980 1.00 40.16  ? 592  TRP B CZ3   1 
ATOM   1132  C  CH2   . TRP A  1  150 ? 41.244  7.583  -14.925 1.00 43.95  ? 592  TRP B CH2   1 
ATOM   1133  N  N     . GLU A  1  151 ? 40.010  10.369 -8.761  1.00 41.86  ? 593  GLU B N     1 
ATOM   1134  C  CA    . GLU A  1  151 ? 39.740  9.190  -7.936  1.00 44.49  ? 593  GLU B CA    1 
ATOM   1135  C  C     . GLU A  1  151 ? 38.269  9.050  -7.528  1.00 45.53  ? 593  GLU B C     1 
ATOM   1136  O  O     . GLU A  1  151 ? 37.767  7.929  -7.411  1.00 42.50  ? 593  GLU B O     1 
ATOM   1137  C  CB    . GLU A  1  151 ? 40.622  9.217  -6.675  1.00 47.02  ? 593  GLU B CB    1 
ATOM   1138  C  CG    . GLU A  1  151 ? 42.085  8.946  -6.959  1.00 52.22  ? 593  GLU B CG    1 
ATOM   1139  C  CD    . GLU A  1  151 ? 42.321  7.517  -7.521  1.00 58.16  ? 593  GLU B CD    1 
ATOM   1140  O  OE1   . GLU A  1  151 ? 41.444  6.631  -7.399  1.00 54.53  ? 593  GLU B OE1   1 
ATOM   1141  O  OE2   . GLU A  1  151 ? 43.422  7.299  -8.087  1.00 62.76  ? 593  GLU B OE2   1 
ATOM   1142  N  N     . THR A  1  152 ? 37.559  10.176 -7.372  1.00 41.65  ? 594  THR B N     1 
ATOM   1143  C  CA    . THR A  1  152 ? 36.196  10.109 -6.860  1.00 38.96  ? 594  THR B CA    1 
ATOM   1144  C  C     . THR A  1  152 ? 35.171  10.110 -8.011  1.00 39.13  ? 594  THR B C     1 
ATOM   1145  O  O     . THR A  1  152 ? 34.127  9.440  -7.901  1.00 41.02  ? 594  THR B O     1 
ATOM   1146  C  CB    . THR A  1  152 ? 35.884  11.268 -5.938  1.00 40.08  ? 594  THR B CB    1 
ATOM   1147  O  OG1   . THR A  1  152 ? 36.043  12.524 -6.634  1.00 35.86  ? 594  THR B OG1   1 
ATOM   1148  C  CG2   . THR A  1  152 ? 36.839  11.256 -4.743  1.00 43.55  ? 594  THR B CG2   1 
ATOM   1149  N  N     . THR A  1  153 ? 35.452  10.820 -9.117  1.00 35.10  ? 595  THR B N     1 
ATOM   1150  C  CA    . THR A  1  153 ? 34.438  11.057 -10.094 1.00 32.13  ? 595  THR B CA    1 
ATOM   1151  C  C     . THR A  1  153 ? 34.732  10.601 -11.515 1.00 31.84  ? 595  THR B C     1 
ATOM   1152  O  O     . THR A  1  153 ? 33.801  10.265 -12.234 1.00 31.74  ? 595  THR B O     1 
ATOM   1153  C  CB    . THR A  1  153 ? 34.154  12.631 -10.148 1.00 30.86  ? 595  THR B CB    1 
ATOM   1154  O  OG1   . THR A  1  153 ? 34.180  13.149 -8.839  1.00 30.19  ? 595  THR B OG1   1 
ATOM   1155  C  CG2   . THR A  1  153 ? 32.775  12.876 -10.793 1.00 28.20  ? 595  THR B CG2   1 
ATOM   1156  N  N     . MET A  1  154 ? 36.000  10.557 -11.924 1.00 31.53  ? 596  MET B N     1 
ATOM   1157  C  CA    . MET A  1  154 ? 36.331  10.256 -13.318 1.00 33.67  ? 596  MET B CA    1 
ATOM   1158  C  C     . MET A  1  154 ? 36.962  8.891  -13.524 1.00 35.36  ? 596  MET B C     1 
ATOM   1159  O  O     . MET A  1  154 ? 36.901  8.365  -14.637 1.00 34.79  ? 596  MET B O     1 
ATOM   1160  C  CB    . MET A  1  154 ? 37.279  11.304 -13.890 1.00 32.44  ? 596  MET B CB    1 
ATOM   1161  C  CG    . MET A  1  154 ? 36.709  12.761 -13.755 1.00 34.27  ? 596  MET B CG    1 
ATOM   1162  S  SD    . MET A  1  154 ? 37.900  13.955 -14.470 1.00 39.16  ? 596  MET B SD    1 
ATOM   1163  C  CE    . MET A  1  154 ? 37.748  13.512 -16.190 1.00 35.65  ? 596  MET B CE    1 
ATOM   1164  N  N     . ASN A  1  155 ? 37.564  8.305  -12.484 1.00 36.08  ? 597  ASN B N     1 
ATOM   1165  C  CA    . ASN A  1  155 ? 38.253  7.026  -12.633 1.00 38.47  ? 597  ASN B CA    1 
ATOM   1166  C  C     . ASN A  1  155 ? 37.215  5.912  -12.783 1.00 38.97  ? 597  ASN B C     1 
ATOM   1167  O  O     . ASN A  1  155 ? 36.389  5.733  -11.880 1.00 40.09  ? 597  ASN B O     1 
ATOM   1168  C  CB    . ASN A  1  155 ? 39.132  6.787  -11.421 1.00 38.02  ? 597  ASN B CB    1 
ATOM   1169  C  CG    . ASN A  1  155 ? 40.012  5.524  -11.568 1.00 40.23  ? 597  ASN B CG    1 
ATOM   1170  O  OD1   . ASN A  1  155 ? 39.955  4.831  -12.548 1.00 41.49  ? 597  ASN B OD1   1 
ATOM   1171  N  ND2   . ASN A  1  155 ? 40.834  5.271  -10.560 1.00 41.22  ? 597  ASN B ND2   1 
ATOM   1172  N  N     . PRO A  1  156 ? 37.229  5.166  -13.888 1.00 42.33  ? 598  PRO B N     1 
ATOM   1173  C  CA    . PRO A  1  156 ? 36.251  4.072  -14.036 1.00 45.88  ? 598  PRO B CA    1 
ATOM   1174  C  C     . PRO A  1  156 ? 36.341  3.013  -12.958 1.00 48.75  ? 598  PRO B C     1 
ATOM   1175  O  O     . PRO A  1  156 ? 35.338  2.335  -12.688 1.00 48.20  ? 598  PRO B O     1 
ATOM   1176  C  CB    . PRO A  1  156 ? 36.574  3.462  -15.398 1.00 45.01  ? 598  PRO B CB    1 
ATOM   1177  C  CG    . PRO A  1  156 ? 37.325  4.566  -16.141 1.00 48.71  ? 598  PRO B CG    1 
ATOM   1178  C  CD    . PRO A  1  156 ? 38.087  5.314  -15.079 1.00 44.40  ? 598  PRO B CD    1 
ATOM   1179  N  N     . GLU A  1  157 ? 37.495  2.864  -12.325 1.00 51.17  ? 599  GLU B N     1 
ATOM   1180  C  CA    . GLU A  1  157 ? 37.645  1.835  -11.288 1.00 52.73  ? 599  GLU B CA    1 
ATOM   1181  C  C     . GLU A  1  157 ? 36.845  2.160  -10.034 1.00 53.46  ? 599  GLU B C     1 
ATOM   1182  O  O     . GLU A  1  157 ? 36.470  1.260  -9.304  1.00 62.28  ? 599  GLU B O     1 
ATOM   1183  C  CB    . GLU A  1  157 ? 39.140  1.642  -10.960 1.00 50.04  ? 599  GLU B CB    1 
ATOM   1184  N  N     . HIS A  1  158 ? 36.613  3.436  -9.765  1.00 53.55  ? 600  HIS B N     1 
ATOM   1185  C  CA    . HIS A  1  158 ? 35.977  3.869  -8.518  1.00 49.58  ? 600  HIS B CA    1 
ATOM   1186  C  C     . HIS A  1  158 ? 34.703  4.692  -8.721  1.00 47.16  ? 600  HIS B C     1 
ATOM   1187  O  O     . HIS A  1  158 ? 33.906  4.778  -7.797  1.00 47.75  ? 600  HIS B O     1 
ATOM   1188  C  CB    . HIS A  1  158 ? 36.979  4.686  -7.681  1.00 54.18  ? 600  HIS B CB    1 
ATOM   1189  C  CG    . HIS A  1  158 ? 38.146  3.890  -7.206  1.00 63.60  ? 600  HIS B CG    1 
ATOM   1190  N  ND1   . HIS A  1  158 ? 39.384  3.942  -7.825  1.00 65.51  ? 600  HIS B ND1   1 
ATOM   1191  C  CD2   . HIS A  1  158 ? 38.287  3.002  -6.181  1.00 65.91  ? 600  HIS B CD2   1 
ATOM   1192  C  CE1   . HIS A  1  158 ? 40.232  3.139  -7.217  1.00 68.11  ? 600  HIS B CE1   1 
ATOM   1193  N  NE2   . HIS A  1  158 ? 39.591  2.550  -6.217  1.00 68.08  ? 600  HIS B NE2   1 
ATOM   1194  N  N     . ARG A  1  159 ? 34.516  5.300  -9.897  1.00 41.91  ? 601  ARG B N     1 
ATOM   1195  C  CA    . ARG A  1  159 ? 33.460  6.306  -10.024 1.00 41.26  ? 601  ARG B CA    1 
ATOM   1196  C  C     . ARG A  1  159 ? 32.090  5.636  -10.074 1.00 42.39  ? 601  ARG B C     1 
ATOM   1197  O  O     . ARG A  1  159 ? 31.966  4.378  -10.336 1.00 41.99  ? 601  ARG B O     1 
ATOM   1198  C  CB    . ARG A  1  159 ? 33.652  7.100  -11.306 1.00 38.14  ? 601  ARG B CB    1 
ATOM   1199  C  CG    . ARG A  1  159 ? 33.252  6.320  -12.550 1.00 39.51  ? 601  ARG B CG    1 
ATOM   1200  C  CD    . ARG A  1  159 ? 33.730  6.997  -13.817 1.00 39.09  ? 601  ARG B CD    1 
ATOM   1201  N  NE    . ARG A  1  159 ? 33.401  6.178  -14.982 1.00 39.11  ? 601  ARG B NE    1 
ATOM   1202  C  CZ    . ARG A  1  159 ? 33.853  6.420  -16.207 1.00 38.49  ? 601  ARG B CZ    1 
ATOM   1203  N  NH1   . ARG A  1  159 ? 34.666  7.455  -16.423 1.00 40.13  ? 601  ARG B NH1   1 
ATOM   1204  N  NH2   . ARG A  1  159 ? 33.501  5.629  -17.208 1.00 40.43  ? 601  ARG B NH2   1 
ATOM   1205  N  N     . ALA A  1  160 ? 31.058  6.451  -9.861  1.00 40.76  ? 602  ALA B N     1 
ATOM   1206  C  CA    . ALA A  1  160 ? 29.668  5.971  -10.043 1.00 40.34  ? 602  ALA B CA    1 
ATOM   1207  C  C     . ALA A  1  160 ? 28.974  6.903  -11.009 1.00 40.03  ? 602  ALA B C     1 
ATOM   1208  O  O     . ALA A  1  160 ? 28.885  8.095  -10.763 1.00 42.28  ? 602  ALA B O     1 
ATOM   1209  C  CB    . ALA A  1  160 ? 28.856  5.822  -8.722  1.00 40.51  ? 602  ALA B CB    1 
ATOM   1210  N  N     . LEU A  1  161 ? 28.523  6.365  -12.131 1.00 39.96  ? 603  LEU B N     1 
ATOM   1211  C  CA    . LEU A  1  161 ? 27.863  7.135  -13.156 1.00 38.87  ? 603  LEU B CA    1 
ATOM   1212  C  C     . LEU A  1  161 ? 26.404  6.778  -13.197 1.00 41.67  ? 603  LEU B C     1 
ATOM   1213  O  O     . LEU A  1  161 ? 26.025  5.619  -12.914 1.00 44.61  ? 603  LEU B O     1 
ATOM   1214  C  CB    . LEU A  1  161 ? 28.481  6.840  -14.500 1.00 38.43  ? 603  LEU B CB    1 
ATOM   1215  C  CG    . LEU A  1  161 ? 29.885  7.328  -14.803 1.00 37.97  ? 603  LEU B CG    1 
ATOM   1216  C  CD1   . LEU A  1  161 ? 30.228  7.065  -16.255 1.00 38.55  ? 603  LEU B CD1   1 
ATOM   1217  C  CD2   . LEU A  1  161 ? 30.021  8.884  -14.528 1.00 36.35  ? 603  LEU B CD2   1 
ATOM   1218  N  N     . LEU A  1  162 ? 25.548  7.755  -13.508 1.00 37.60  ? 604  LEU B N     1 
ATOM   1219  C  CA    . LEU A  1  162 ? 24.149  7.490  -13.651 1.00 38.87  ? 604  LEU B CA    1 
ATOM   1220  C  C     . LEU A  1  162 ? 23.838  7.542  -15.113 1.00 37.96  ? 604  LEU B C     1 
ATOM   1221  O  O     . LEU A  1  162 ? 24.126  8.533  -15.770 1.00 37.25  ? 604  LEU B O     1 
ATOM   1222  C  CB    . LEU A  1  162 ? 23.334  8.513  -12.896 1.00 40.63  ? 604  LEU B CB    1 
ATOM   1223  C  CG    . LEU A  1  162 ? 23.368  8.453  -11.367 1.00 42.49  ? 604  LEU B CG    1 
ATOM   1224  C  CD1   . LEU A  1  162 ? 22.550  9.567  -10.743 1.00 46.35  ? 604  LEU B CD1   1 
ATOM   1225  C  CD2   . LEU A  1  162 ? 22.911  7.140  -10.823 1.00 47.25  ? 604  LEU B CD2   1 
ATOM   1226  N  N     . GLN A  1  163 ? 23.254  6.484  -15.649 1.00 38.82  ? 605  GLN B N     1 
ATOM   1227  C  CA    . GLN A  1  163 ? 22.895  6.449  -17.048 1.00 37.83  ? 605  GLN B CA    1 
ATOM   1228  C  C     . GLN A  1  163 ? 21.487  6.977  -17.180 1.00 36.32  ? 605  GLN B C     1 
ATOM   1229  O  O     . GLN A  1  163 ? 20.561  6.446  -16.598 1.00 38.41  ? 605  GLN B O     1 
ATOM   1230  C  CB    . GLN A  1  163 ? 22.992  5.023  -17.596 1.00 40.08  ? 605  GLN B CB    1 
ATOM   1231  C  CG    . GLN A  1  163 ? 22.968  4.948  -19.111 1.00 40.39  ? 605  GLN B CG    1 
ATOM   1232  C  CD    . GLN A  1  163 ? 23.061  3.508  -19.610 1.00 42.50  ? 605  GLN B CD    1 
ATOM   1233  O  OE1   . GLN A  1  163 ? 22.590  2.585  -18.958 1.00 44.21  ? 605  GLN B OE1   1 
ATOM   1234  N  NE2   . GLN A  1  163 ? 23.644  3.328  -20.781 1.00 41.43  ? 605  GLN B NE2   1 
ATOM   1235  N  N     . VAL A  1  164 ? 21.323  8.052  -17.936 1.00 33.42  ? 606  VAL B N     1 
ATOM   1236  C  CA    . VAL A  1  164 ? 20.010  8.650  -18.115 1.00 33.66  ? 606  VAL B CA    1 
ATOM   1237  C  C     . VAL A  1  164 ? 19.156  7.774  -18.993 1.00 36.25  ? 606  VAL B C     1 
ATOM   1238  O  O     . VAL A  1  164 ? 19.587  7.377  -20.103 1.00 36.40  ? 606  VAL B O     1 
ATOM   1239  C  CB    . VAL A  1  164 ? 20.130  10.041 -18.725 1.00 31.58  ? 606  VAL B CB    1 
ATOM   1240  C  CG1   . VAL A  1  164 ? 18.770  10.668 -18.961 1.00 30.48  ? 606  VAL B CG1   1 
ATOM   1241  C  CG2   . VAL A  1  164 ? 20.992  10.934 -17.746 1.00 29.53  ? 606  VAL B CG2   1 
ATOM   1242  N  N     A LYS A  1  165 ? 17.959  7.436  -18.489 0.50 38.32  ? 607  LYS B N     1 
ATOM   1243  N  N     B LYS A  1  165 ? 17.951  7.455  -18.505 0.50 38.00  ? 607  LYS B N     1 
ATOM   1244  C  CA    A LYS A  1  165 ? 17.032  6.552  -19.212 0.50 40.80  ? 607  LYS B CA    1 
ATOM   1245  C  CA    B LYS A  1  165 ? 17.055  6.528  -19.219 0.50 40.24  ? 607  LYS B CA    1 
ATOM   1246  C  C     A LYS A  1  165 ? 15.678  7.189  -19.495 0.50 42.54  ? 607  LYS B C     1 
ATOM   1247  C  C     B LYS A  1  165 ? 15.691  7.170  -19.493 0.50 42.16  ? 607  LYS B C     1 
ATOM   1248  O  O     A LYS A  1  165 ? 15.061  7.846  -18.615 0.50 43.64  ? 607  LYS B O     1 
ATOM   1249  O  O     B LYS A  1  165 ? 15.061  7.802  -18.599 0.50 43.32  ? 607  LYS B O     1 
ATOM   1250  C  CB    A LYS A  1  165 ? 16.807  5.311  -18.394 0.50 41.16  ? 607  LYS B CB    1 
ATOM   1251  C  CB    B LYS A  1  165 ? 16.912  5.208  -18.441 0.50 40.15  ? 607  LYS B CB    1 
ATOM   1252  C  CG    A LYS A  1  165 ? 18.060  4.530  -18.075 0.50 42.08  ? 607  LYS B CG    1 
ATOM   1253  C  CG    B LYS A  1  165 ? 15.937  4.171  -19.047 0.50 41.93  ? 607  LYS B CG    1 
ATOM   1254  C  CD    A LYS A  1  165 ? 18.585  3.780  -19.289 0.50 43.06  ? 607  LYS B CD    1 
ATOM   1255  C  CD    B LYS A  1  165 ? 16.455  3.465  -20.303 0.50 40.22  ? 607  LYS B CD    1 
ATOM   1256  C  CE    A LYS A  1  165 ? 19.384  2.533  -18.926 0.50 42.79  ? 607  LYS B CE    1 
ATOM   1257  C  CE    B LYS A  1  165 ? 15.604  2.231  -20.669 0.50 42.05  ? 607  LYS B CE    1 
ATOM   1258  N  NZ    A LYS A  1  165 ? 19.584  1.694  -20.130 0.50 42.54  ? 607  LYS B NZ    1 
ATOM   1259  N  NZ    B LYS A  1  165 ? 14.542  2.577  -21.625 0.50 40.38  ? 607  LYS B NZ    1 
ATOM   1260  N  N     . LEU A  1  166 ? 15.203  6.993  -20.717 1.00 43.61  ? 608  LEU B N     1 
ATOM   1261  C  CA    . LEU A  1  166 ? 13.886  7.512  -21.104 1.00 43.84  ? 608  LEU B CA    1 
ATOM   1262  C  C     . LEU A  1  166 ? 12.892  6.367  -21.036 1.00 48.84  ? 608  LEU B C     1 
ATOM   1263  O  O     . LEU A  1  166 ? 12.967  5.460  -21.876 1.00 47.83  ? 608  LEU B O     1 
ATOM   1264  C  CB    . LEU A  1  166 ? 13.937  8.195  -22.460 1.00 42.73  ? 608  LEU B CB    1 
ATOM   1265  C  CG    . LEU A  1  166 ? 12.617  8.648  -23.056 1.00 46.52  ? 608  LEU B CG    1 
ATOM   1266  C  CD1   . LEU A  1  166 ? 12.001  9.747  -22.203 1.00 47.49  ? 608  LEU B CD1   1 
ATOM   1267  C  CD2   . LEU A  1  166 ? 12.787  9.110  -24.511 1.00 45.73  ? 608  LEU B CD2   1 
ATOM   1268  N  N     A GLU A  1  167 ? 11.959  6.436  -20.082 0.50 46.95  ? 609  GLU B N     1 
ATOM   1269  N  N     B GLU A  1  167 ? 12.192  6.291  -19.898 0.50 48.61  ? 609  GLU B N     1 
ATOM   1270  C  CA    A GLU A  1  167 ? 10.960  5.369  -19.920 0.50 49.68  ? 609  GLU B CA    1 
ATOM   1271  C  CA    B GLU A  1  167 ? 10.990  5.432  -19.726 0.50 51.97  ? 609  GLU B CA    1 
ATOM   1272  C  C     A GLU A  1  167 ? 9.606   5.689  -20.554 0.50 50.93  ? 609  GLU B C     1 
ATOM   1273  C  C     B GLU A  1  167 ? 9.650   5.707  -20.482 0.50 52.44  ? 609  GLU B C     1 
ATOM   1274  O  O     A GLU A  1  167 ? 8.936   4.776  -21.105 0.50 54.48  ? 609  GLU B O     1 
ATOM   1275  O  O     B GLU A  1  167 ? 9.074   4.782  -21.077 0.50 56.73  ? 609  GLU B O     1 
ATOM   1276  C  CB    A GLU A  1  167 ? 10.776  5.024  -18.450 0.50 49.27  ? 609  GLU B CB    1 
ATOM   1277  C  CB    B GLU A  1  167 ? 10.671  5.308  -18.239 0.50 52.84  ? 609  GLU B CB    1 
ATOM   1278  C  CG    A GLU A  1  167 ? 11.907  4.207  -17.861 0.50 49.83  ? 609  GLU B CG    1 
ATOM   1279  C  CG    B GLU A  1  167 ? 11.710  4.521  -17.480 0.50 55.34  ? 609  GLU B CG    1 
ATOM   1280  C  CD    A GLU A  1  167 ? 12.165  2.922  -18.634 0.50 49.69  ? 609  GLU B CD    1 
ATOM   1281  C  CD    B GLU A  1  167 ? 11.335  4.355  -16.007 0.50 56.76  ? 609  GLU B CD    1 
ATOM   1282  O  OE1   A GLU A  1  167 ? 13.350  2.526  -18.799 0.50 47.76  ? 609  GLU B OE1   1 
ATOM   1283  O  OE1   B GLU A  1  167 ? 10.171  4.014  -15.729 0.50 56.33  ? 609  GLU B OE1   1 
ATOM   1284  O  OE2   A GLU A  1  167 ? 11.175  2.345  -19.103 0.50 50.77  ? 609  GLU B OE2   1 
ATOM   1285  O  OE2   B GLU A  1  167 ? 12.189  4.607  -15.115 0.50 56.91  ? 609  GLU B OE2   1 
ATOM   1286  N  N     . ASP A  1  168 ? 9.185   6.951  -20.489 1.00 51.04  ? 610  ASP B N     1 
ATOM   1287  C  CA    . ASP A  1  168 ? 7.880   7.325  -21.073 1.00 51.50  ? 610  ASP B CA    1 
ATOM   1288  C  C     . ASP A  1  168 ? 8.083   8.675  -21.779 1.00 51.85  ? 610  ASP B C     1 
ATOM   1289  O  O     . ASP A  1  168 ? 8.324   9.705  -21.140 1.00 48.61  ? 610  ASP B O     1 
ATOM   1290  C  CB    . ASP A  1  168 ? 6.824   7.459  -19.962 1.00 53.93  ? 610  ASP B CB    1 
ATOM   1291  C  CG    . ASP A  1  168 ? 5.428   7.654  -20.521 1.00 54.92  ? 610  ASP B CG    1 
ATOM   1292  O  OD1   . ASP A  1  168 ? 5.285   7.840  -21.732 1.00 58.08  ? 610  ASP B OD1   1 
ATOM   1293  O  OD2   . ASP A  1  168 ? 4.470   7.627  -19.725 1.00 58.93  ? 610  ASP B OD2   1 
ATOM   1294  N  N     . ALA A  1  169 ? 7.987   8.646  -23.104 1.00 47.85  ? 611  ALA B N     1 
ATOM   1295  C  CA    . ALA A  1  169 ? 8.251   9.843  -23.894 1.00 49.26  ? 611  ALA B CA    1 
ATOM   1296  C  C     . ALA A  1  169 ? 7.111   10.870 -23.756 1.00 49.80  ? 611  ALA B C     1 
ATOM   1297  O  O     . ALA A  1  169 ? 7.363   12.074 -23.825 1.00 50.12  ? 611  ALA B O     1 
ATOM   1298  C  CB    . ALA A  1  169 ? 8.503   9.473  -25.349 1.00 48.34  ? 611  ALA B CB    1 
ATOM   1299  N  N     . ILE A  1  170 ? 5.872   10.416 -23.567 1.00 49.36  ? 612  ILE B N     1 
ATOM   1300  C  CA    . ILE A  1  170 ? 4.789   11.338 -23.359 1.00 48.83  ? 612  ILE B CA    1 
ATOM   1301  C  C     . ILE A  1  170 ? 4.930   12.027 -22.002 1.00 45.17  ? 612  ILE B C     1 
ATOM   1302  O  O     . ILE A  1  170 ? 4.746   13.262 -21.898 1.00 41.86  ? 612  ILE B O     1 
ATOM   1303  C  CB    . ILE A  1  170 ? 3.425   10.613 -23.445 1.00 51.93  ? 612  ILE B CB    1 
ATOM   1304  C  CG1   . ILE A  1  170 ? 3.261   9.986  -24.846 1.00 57.29  ? 612  ILE B CG1   1 
ATOM   1305  C  CG2   . ILE A  1  170 ? 2.295   11.639 -23.159 1.00 52.03  ? 612  ILE B CG2   1 
ATOM   1306  C  CD1   . ILE A  1  170 ? 3.222   11.003 -25.964 1.00 57.82  ? 612  ILE B CD1   1 
ATOM   1307  N  N     . GLU A  1  171 ? 5.261   11.281 -20.961 1.00 45.77  ? 613  GLU B N     1 
ATOM   1308  C  CA    . GLU A  1  171 ? 5.481   11.870 -19.649 1.00 45.34  ? 613  GLU B CA    1 
ATOM   1309  C  C     . GLU A  1  171 ? 6.692   12.811 -19.684 1.00 42.89  ? 613  GLU B C     1 
ATOM   1310  O  O     . GLU A  1  171 ? 6.665   13.884 -19.062 1.00 40.67  ? 613  GLU B O     1 
ATOM   1311  C  CB    . GLU A  1  171 ? 5.661   10.793 -18.584 1.00 47.27  ? 613  GLU B CB    1 
ATOM   1312  C  CG    . GLU A  1  171 ? 6.146   11.314 -17.256 1.00 54.22  ? 613  GLU B CG    1 
ATOM   1313  C  CD    . GLU A  1  171 ? 6.127   10.252 -16.157 1.00 59.08  ? 613  GLU B CD    1 
ATOM   1314  O  OE1   . GLU A  1  171 ? 5.678   10.621 -15.053 1.00 63.67  ? 613  GLU B OE1   1 
ATOM   1315  O  OE2   . GLU A  1  171 ? 6.581   9.109  -16.414 1.00 62.67  ? 613  GLU B OE2   1 
ATOM   1316  N  N     . ALA A  1  172 ? 7.745   12.428 -20.382 1.00 38.59  ? 614  ALA B N     1 
ATOM   1317  C  CA    . ALA A  1  172 ? 8.915   13.293 -20.483 1.00 39.43  ? 614  ALA B CA    1 
ATOM   1318  C  C     . ALA A  1  172 ? 8.574   14.594 -21.207 1.00 37.73  ? 614  ALA B C     1 
ATOM   1319  O  O     . ALA A  1  172 ? 8.997   15.669 -20.774 1.00 36.70  ? 614  ALA B O     1 
ATOM   1320  C  CB    . ALA A  1  172 ? 10.062  12.563 -21.195 1.00 36.52  ? 614  ALA B CB    1 
ATOM   1321  N  N     . ASP A  1  173 ? 7.793   14.509 -22.299 1.00 38.57  ? 615  ASP B N     1 
ATOM   1322  C  CA    . ASP A  1  173 ? 7.387   15.703 -23.033 1.00 37.39  ? 615  ASP B CA    1 
ATOM   1323  C  C     . ASP A  1  173 ? 6.668   16.689 -22.112 1.00 35.51  ? 615  ASP B C     1 
ATOM   1324  O  O     . ASP A  1  173 ? 6.960   17.891 -22.112 1.00 31.91  ? 615  ASP B O     1 
ATOM   1325  C  CB    . ASP A  1  173 ? 6.477   15.326 -24.206 1.00 40.21  ? 615  ASP B CB    1 
ATOM   1326  C  CG    . ASP A  1  173 ? 7.224   14.710 -25.358 1.00 47.00  ? 615  ASP B CG    1 
ATOM   1327  O  OD1   . ASP A  1  173 ? 8.448   14.457 -25.206 1.00 53.00  ? 615  ASP B OD1   1 
ATOM   1328  O  OD2   . ASP A  1  173 ? 6.497   14.458 -26.403 1.00 43.95  ? 615  ASP B OD2   1 
ATOM   1329  N  N     . GLN A  1  174 ? 5.711   16.199 -21.331 1.00 34.46  ? 616  GLN B N     1 
ATOM   1330  C  CA    . GLN A  1  174 ? 4.966   17.065 -20.429 1.00 35.71  ? 616  GLN B CA    1 
ATOM   1331  C  C     . GLN A  1  174 ? 5.858   17.582 -19.282 1.00 33.36  ? 616  GLN B C     1 
ATOM   1332  O  O     . GLN A  1  174 ? 5.616   18.683 -18.781 1.00 32.02  ? 616  GLN B O     1 
ATOM   1333  C  CB    . GLN A  1  174 ? 3.781   16.324 -19.830 1.00 40.37  ? 616  GLN B CB    1 
ATOM   1334  C  CG    . GLN A  1  174 ? 2.842   15.755 -20.897 1.00 48.95  ? 616  GLN B CG    1 
ATOM   1335  C  CD    . GLN A  1  174 ? 1.789   14.850 -20.252 1.00 52.80  ? 616  GLN B CD    1 
ATOM   1336  O  OE1   . GLN A  1  174 ? 1.953   14.419 -19.095 1.00 57.81  ? 616  GLN B OE1   1 
ATOM   1337  N  NE2   . GLN A  1  174 ? 0.702   14.611 -20.962 1.00 54.54  ? 616  GLN B NE2   1 
ATOM   1338  N  N     . THR A  1  175 ? 6.858   16.810 -18.872 1.00 32.32  ? 617  THR B N     1 
ATOM   1339  C  CA    . THR A  1  175 ? 7.719   17.223 -17.797 1.00 31.03  ? 617  THR B CA    1 
ATOM   1340  C  C     . THR A  1  175 ? 8.645   18.366 -18.247 1.00 31.45  ? 617  THR B C     1 
ATOM   1341  O  O     . THR A  1  175 ? 8.796   19.342 -17.538 1.00 30.26  ? 617  THR B O     1 
ATOM   1342  C  CB    . THR A  1  175 ? 8.565   16.032 -17.268 1.00 34.93  ? 617  THR B CB    1 
ATOM   1343  O  OG1   . THR A  1  175 ? 7.713   15.131 -16.587 1.00 33.73  ? 617  THR B OG1   1 
ATOM   1344  C  CG2   . THR A  1  175 ? 9.669   16.481 -16.338 1.00 30.38  ? 617  THR B CG2   1 
ATOM   1345  N  N     . PHE A  1  176 ? 9.253   18.258 -19.409 1.00 28.93  ? 618  PHE B N     1 
ATOM   1346  C  CA    . PHE A  1  176 ? 10.095  19.320 -19.885 1.00 28.26  ? 618  PHE B CA    1 
ATOM   1347  C  C     . PHE A  1  176 ? 9.305   20.595 -20.198 1.00 28.87  ? 618  PHE B C     1 
ATOM   1348  O  O     . PHE A  1  176 ? 9.783   21.699 -19.941 1.00 26.65  ? 618  PHE B O     1 
ATOM   1349  C  CB    . PHE A  1  176 ? 10.866  18.854 -21.166 1.00 27.89  ? 618  PHE B CB    1 
ATOM   1350  C  CG    . PHE A  1  176 ? 12.028  17.964 -20.846 1.00 29.03  ? 618  PHE B CG    1 
ATOM   1351  C  CD1   . PHE A  1  176 ? 13.243  18.515 -20.498 1.00 29.31  ? 618  PHE B CD1   1 
ATOM   1352  C  CD2   . PHE A  1  176 ? 11.891  16.602 -20.897 1.00 30.39  ? 618  PHE B CD2   1 
ATOM   1353  C  CE1   . PHE A  1  176 ? 14.347  17.663 -20.209 1.00 30.86  ? 618  PHE B CE1   1 
ATOM   1354  C  CE2   . PHE A  1  176 ? 12.955  15.744 -20.606 1.00 32.52  ? 618  PHE B CE2   1 
ATOM   1355  C  CZ    . PHE A  1  176 ? 14.208  16.275 -20.259 1.00 31.61  ? 618  PHE B CZ    1 
ATOM   1356  N  N     A GLU A  1  177 ? 8.102   20.442 -20.735 0.50 28.86  ? 619  GLU B N     1 
ATOM   1357  N  N     B GLU A  1  177 ? 8.098   20.460 -20.732 0.50 29.75  ? 619  GLU B N     1 
ATOM   1358  C  CA    A GLU A  1  177 ? 7.259   21.590 -21.030 0.50 28.63  ? 619  GLU B CA    1 
ATOM   1359  C  CA    B GLU A  1  177 ? 7.299   21.645 -21.014 0.50 30.18  ? 619  GLU B CA    1 
ATOM   1360  C  C     A GLU A  1  177 ? 6.837   22.326 -19.734 0.50 27.94  ? 619  GLU B C     1 
ATOM   1361  C  C     B GLU A  1  177 ? 6.860   22.356 -19.706 0.50 30.12  ? 619  GLU B C     1 
ATOM   1362  O  O     A GLU A  1  177 ? 6.841   23.559 -19.686 0.50 28.01  ? 619  GLU B O     1 
ATOM   1363  O  O     B GLU A  1  177 ? 6.920   23.583 -19.616 0.50 30.16  ? 619  GLU B O     1 
ATOM   1364  C  CB    A GLU A  1  177 ? 6.015   21.119 -21.819 0.50 30.38  ? 619  GLU B CB    1 
ATOM   1365  C  CB    B GLU A  1  177 ? 6.066   21.272 -21.862 0.50 32.21  ? 619  GLU B CB    1 
ATOM   1366  C  CG    A GLU A  1  177 ? 5.370   22.163 -22.704 0.50 31.26  ? 619  GLU B CG    1 
ATOM   1367  C  CG    B GLU A  1  177 ? 5.153   22.493 -21.993 0.50 32.55  ? 619  GLU B CG    1 
ATOM   1368  C  CD    A GLU A  1  177 ? 4.267   21.580 -23.583 0.50 33.08  ? 619  GLU B CD    1 
ATOM   1369  C  CD    B GLU A  1  177 ? 5.797   23.697 -22.719 0.50 33.68  ? 619  GLU B CD    1 
ATOM   1370  O  OE1   A GLU A  1  177 ? 3.883   20.426 -23.412 0.50 32.31  ? 619  GLU B OE1   1 
ATOM   1371  O  OE1   B GLU A  1  177 ? 6.741   23.583 -23.622 0.50 36.91  ? 619  GLU B OE1   1 
ATOM   1372  O  OE2   A GLU A  1  177 ? 3.857   22.292 -24.478 0.50 35.17  ? 619  GLU B OE2   1 
ATOM   1373  O  OE2   B GLU A  1  177 ? 5.297   24.795 -22.439 0.50 34.34  ? 619  GLU B OE2   1 
ATOM   1374  N  N     A MET A  1  178 ? 6.522   21.564 -18.685 0.50 26.62  ? 620  MET B N     1 
ATOM   1375  N  N     B MET A  1  178 ? 6.462   21.576 -18.697 0.50 29.48  ? 620  MET B N     1 
ATOM   1376  C  CA    A MET A  1  178 ? 6.070   22.168 -17.436 0.50 26.10  ? 620  MET B CA    1 
ATOM   1377  C  CA    B MET A  1  178 ? 6.065   22.146 -17.412 0.50 29.42  ? 620  MET B CA    1 
ATOM   1378  C  C     A MET A  1  178 ? 7.214   22.823 -16.660 0.50 25.92  ? 620  MET B C     1 
ATOM   1379  C  C     B MET A  1  178 ? 7.226   22.835 -16.699 0.50 28.06  ? 620  MET B C     1 
ATOM   1380  O  O     A MET A  1  178 ? 7.082   23.941 -16.196 0.50 26.51  ? 620  MET B O     1 
ATOM   1381  O  O     B MET A  1  178 ? 7.118   23.993 -16.324 0.50 28.80  ? 620  MET B O     1 
ATOM   1382  C  CB    A MET A  1  178 ? 5.389   21.104 -16.571 0.50 25.29  ? 620  MET B CB    1 
ATOM   1383  C  CB    B MET A  1  178 ? 5.489   21.046 -16.514 0.50 30.47  ? 620  MET B CB    1 
ATOM   1384  C  CG    A MET A  1  178 ? 4.847   21.634 -15.257 0.50 24.03  ? 620  MET B CG    1 
ATOM   1385  C  CG    B MET A  1  178 ? 5.296   21.498 -15.080 0.50 30.97  ? 620  MET B CG    1 
ATOM   1386  S  SD    A MET A  1  178 ? 6.097   21.589 -13.910 0.50 22.44  ? 620  MET B SD    1 
ATOM   1387  S  SD    B MET A  1  178 ? 4.701   20.185 -13.942 0.50 32.10  ? 620  MET B SD    1 
ATOM   1388  C  CE    A MET A  1  178 ? 6.124   19.779 -13.576 0.50 24.42  ? 620  MET B CE    1 
ATOM   1389  C  CE    B MET A  1  178 ? 6.225   19.262 -13.678 0.50 35.12  ? 620  MET B CE    1 
ATOM   1390  N  N     . LEU A  1  179 ? 8.339   22.130 -16.584 1.00 26.02  ? 621  LEU B N     1 
ATOM   1391  C  CA    . LEU A  1  179 ? 9.488   22.641 -15.786 1.00 26.70  ? 621  LEU B CA    1 
ATOM   1392  C  C     . LEU A  1  179 ? 10.200  23.754 -16.546 1.00 26.76  ? 621  LEU B C     1 
ATOM   1393  O  O     . LEU A  1  179 ? 10.537  24.805 -15.928 1.00 25.69  ? 621  LEU B O     1 
ATOM   1394  C  CB    . LEU A  1  179 ? 10.435  21.536 -15.451 1.00 25.79  ? 621  LEU B CB    1 
ATOM   1395  C  CG    . LEU A  1  179 ? 9.880   20.402 -14.544 1.00 26.19  ? 621  LEU B CG    1 
ATOM   1396  C  CD1   . LEU A  1  179 ? 10.915  19.225 -14.521 1.00 23.95  ? 621  LEU B CD1   1 
ATOM   1397  C  CD2   . LEU A  1  179 ? 9.645   20.965 -13.159 1.00 24.56  ? 621  LEU B CD2   1 
ATOM   1398  N  N     . MET A  1  180 ? 10.443  23.592 -17.839 1.00 25.86  ? 622  MET B N     1 
ATOM   1399  C  CA    . MET A  1  180 ? 11.347  24.469 -18.562 1.00 28.06  ? 622  MET B CA    1 
ATOM   1400  C  C     . MET A  1  180 ? 10.657  25.394 -19.567 1.00 29.15  ? 622  MET B C     1 
ATOM   1401  O  O     . MET A  1  180 ? 11.342  26.163 -20.251 1.00 29.48  ? 622  MET B O     1 
ATOM   1402  C  CB    . MET A  1  180 ? 12.401  23.624 -19.320 1.00 25.79  ? 622  MET B CB    1 
ATOM   1403  C  CG    . MET A  1  180 ? 12.986  22.489 -18.512 1.00 25.71  ? 622  MET B CG    1 
ATOM   1404  S  SD    . MET A  1  180 ? 13.883  23.030 -16.995 1.00 27.35  ? 622  MET B SD    1 
ATOM   1405  C  CE    . MET A  1  180 ? 15.257  23.935 -17.739 1.00 23.99  ? 622  MET B CE    1 
ATOM   1406  N  N     . GLY A  1  181 ? 9.334   25.348 -19.661 1.00 29.76  ? 623  GLY B N     1 
ATOM   1407  C  CA    . GLY A  1  181 ? 8.621   26.121 -20.687 1.00 31.40  ? 623  GLY B CA    1 
ATOM   1408  C  C     . GLY A  1  181 ? 8.194   27.502 -20.214 1.00 30.67  ? 623  GLY B C     1 
ATOM   1409  O  O     . GLY A  1  181 ? 8.524   27.924 -19.114 1.00 30.20  ? 623  GLY B O     1 
ATOM   1410  N  N     . ASP A  1  182 ? 7.431   28.169 -21.093 1.00 32.16  ? 624  ASP B N     1 
ATOM   1411  C  CA    . ASP A  1  182 ? 7.067   29.589 -20.784 1.00 34.01  ? 624  ASP B CA    1 
ATOM   1412  C  C     . ASP A  1  182 ? 5.959   29.787 -19.807 1.00 31.46  ? 624  ASP B C     1 
ATOM   1413  O  O     . ASP A  1  182 ? 5.802   30.888 -19.353 1.00 36.88  ? 624  ASP B O     1 
ATOM   1414  C  CB    . ASP A  1  182 ? 6.693   30.375 -22.030 1.00 38.48  ? 624  ASP B CB    1 
ATOM   1415  C  CG    . ASP A  1  182 ? 7.444   29.893 -23.302 1.00 50.95  ? 624  ASP B CG    1 
ATOM   1416  O  OD1   . ASP A  1  182 ? 8.653   30.119 -23.344 1.00 56.35  ? 624  ASP B OD1   1 
ATOM   1417  O  OD2   . ASP A  1  182 ? 6.698   29.399 -24.196 1.00 56.37  ? 624  ASP B OD2   1 
ATOM   1418  N  N     . VAL A  1  183 ? 5.177   28.737 -19.502 1.00 29.46  ? 625  VAL B N     1 
ATOM   1419  C  CA    . VAL A  1  183 ? 3.961   28.951 -18.638 1.00 28.49  ? 625  VAL B CA    1 
ATOM   1420  C  C     . VAL A  1  183 ? 4.480   28.889 -17.162 1.00 26.44  ? 625  VAL B C     1 
ATOM   1421  O  O     . VAL A  1  183 ? 4.817   27.810 -16.627 1.00 29.47  ? 625  VAL B O     1 
ATOM   1422  C  CB    . VAL A  1  183 ? 2.896   27.940 -18.895 1.00 27.33  ? 625  VAL B CB    1 
ATOM   1423  C  CG1   . VAL A  1  183 ? 1.730   28.158 -17.999 1.00 28.21  ? 625  VAL B CG1   1 
ATOM   1424  C  CG2   . VAL A  1  183 ? 2.512   28.035 -20.409 1.00 27.33  ? 625  VAL B CG2   1 
ATOM   1425  N  N     . VAL A  1  184 ? 4.507   30.042 -16.503 1.00 25.96  ? 626  VAL B N     1 
ATOM   1426  C  CA    . VAL A  1  184 ? 5.051   30.165 -15.205 1.00 24.48  ? 626  VAL B CA    1 
ATOM   1427  C  C     . VAL A  1  184 ? 4.160   29.463 -14.139 1.00 25.25  ? 626  VAL B C     1 
ATOM   1428  O  O     . VAL A  1  184 ? 4.629   28.859 -13.162 1.00 25.26  ? 626  VAL B O     1 
ATOM   1429  C  CB    . VAL A  1  184 ? 5.282   31.637 -14.828 1.00 23.84  ? 626  VAL B CB    1 
ATOM   1430  C  CG1   . VAL A  1  184 ? 5.659   31.739 -13.306 1.00 22.64  ? 626  VAL B CG1   1 
ATOM   1431  C  CG2   . VAL A  1  184 ? 6.349   32.240 -15.742 1.00 22.56  ? 626  VAL B CG2   1 
ATOM   1432  N  N     . GLU A  1  185 ? 2.817   29.540 -14.349 1.00 26.35  ? 627  GLU B N     1 
ATOM   1433  C  CA    . GLU A  1  185 ? 1.935   29.176 -13.243 1.00 25.66  ? 627  GLU B CA    1 
ATOM   1434  C  C     . GLU A  1  185 ? 1.935   27.664 -12.998 1.00 24.72  ? 627  GLU B C     1 
ATOM   1435  O  O     . GLU A  1  185 ? 1.914   27.227 -11.838 1.00 22.88  ? 627  GLU B O     1 
ATOM   1436  C  CB    . GLU A  1  185 ? 0.520   29.671 -13.563 1.00 29.59  ? 627  GLU B CB    1 
ATOM   1437  C  CG    . GLU A  1  185 ? -0.565  29.040 -12.682 1.00 28.13  ? 627  GLU B CG    1 
ATOM   1438  C  CD    . GLU A  1  185 ? -0.492  29.478 -11.258 1.00 27.84  ? 627  GLU B CD    1 
ATOM   1439  O  OE1   . GLU A  1  185 ? 0.319   30.418 -10.925 1.00 27.38  ? 627  GLU B OE1   1 
ATOM   1440  O  OE2   . GLU A  1  185 ? -1.227  28.911 -10.431 1.00 27.75  ? 627  GLU B OE2   1 
ATOM   1441  N  N     . ASN A  1  186 ? 1.974   26.858 -14.048 1.00 25.68  ? 628  ASN B N     1 
ATOM   1442  C  CA    . ASN A  1  186 ? 2.066   25.410 -13.867 1.00 28.07  ? 628  ASN B CA    1 
ATOM   1443  C  C     . ASN A  1  186 ? 3.336   24.993 -13.177 1.00 28.87  ? 628  ASN B C     1 
ATOM   1444  O  O     . ASN A  1  186 ? 3.341   24.051 -12.382 1.00 27.83  ? 628  ASN B O     1 
ATOM   1445  C  CB    . ASN A  1  186 ? 1.890   24.674 -15.193 1.00 31.24  ? 628  ASN B CB    1 
ATOM   1446  C  CG    . ASN A  1  186 ? 0.453   24.853 -15.765 1.00 32.72  ? 628  ASN B CG    1 
ATOM   1447  O  OD1   . ASN A  1  186 ? -0.486  24.931 -15.057 1.00 34.92  ? 628  ASN B OD1   1 
ATOM   1448  N  ND2   . ASN A  1  186 ? 0.322   24.950 -17.035 1.00 33.79  ? 628  ASN B ND2   1 
ATOM   1449  N  N     . ARG A  1  187 ? 4.425   25.714 -13.469 1.00 26.14  ? 629  ARG B N     1 
ATOM   1450  C  CA    . ARG A  1  187 ? 5.718   25.513 -12.788 1.00 24.71  ? 629  ARG B CA    1 
ATOM   1451  C  C     . ARG A  1  187 ? 5.596   25.903 -11.300 1.00 23.91  ? 629  ARG B C     1 
ATOM   1452  O  O     . ARG A  1  187 ? 6.089   25.182 -10.443 1.00 23.60  ? 629  ARG B O     1 
ATOM   1453  C  CB    . ARG A  1  187 ? 6.790   26.276 -13.518 1.00 24.92  ? 629  ARG B CB    1 
ATOM   1454  C  CG    . ARG A  1  187 ? 8.105   26.395 -12.768 1.00 24.01  ? 629  ARG B CG    1 
ATOM   1455  C  CD    . ARG A  1  187 ? 9.264   26.855 -13.684 1.00 23.15  ? 629  ARG B CD    1 
ATOM   1456  N  NE    . ARG A  1  187 ? 8.950   28.091 -14.500 1.00 24.49  ? 629  ARG B NE    1 
ATOM   1457  C  CZ    . ARG A  1  187 ? 8.558   28.046 -15.780 1.00 25.27  ? 629  ARG B CZ    1 
ATOM   1458  N  NH1   . ARG A  1  187 ? 8.485   26.886 -16.458 1.00 27.42  ? 629  ARG B NH1   1 
ATOM   1459  N  NH2   . ARG A  1  187 ? 8.280   29.161 -16.385 1.00 25.87  ? 629  ARG B NH2   1 
ATOM   1460  N  N     . ARG A  1  188 ? 4.937   27.016 -11.026 1.00 22.06  ? 630  ARG B N     1 
ATOM   1461  C  CA    . ARG A  1  188 ? 4.760   27.446 -9.635  1.00 23.32  ? 630  ARG B CA    1 
ATOM   1462  C  C     . ARG A  1  188 ? 3.912   26.421 -8.828  1.00 23.30  ? 630  ARG B C     1 
ATOM   1463  O  O     . ARG A  1  188 ? 4.262   26.109 -7.687  1.00 22.47  ? 630  ARG B O     1 
ATOM   1464  C  CB    . ARG A  1  188 ? 4.091   28.826 -9.564  1.00 22.18  ? 630  ARG B CB    1 
ATOM   1465  C  CG    . ARG A  1  188 ? 4.019   29.327 -8.121  1.00 21.39  ? 630  ARG B CG    1 
ATOM   1466  C  CD    . ARG A  1  188 ? 2.900   30.378 -7.937  1.00 20.85  ? 630  ARG B CD    1 
ATOM   1467  N  NE    . ARG A  1  188 ? 1.562   29.833 -8.156  1.00 22.10  ? 630  ARG B NE    1 
ATOM   1468  C  CZ    . ARG A  1  188 ? 0.909   29.078 -7.263  1.00 23.23  ? 630  ARG B CZ    1 
ATOM   1469  N  NH1   . ARG A  1  188 ? 1.398   28.799 -6.113  1.00 23.43  ? 630  ARG B NH1   1 
ATOM   1470  N  NH2   . ARG A  1  188 ? -0.305  28.582 -7.582  1.00 24.26  ? 630  ARG B NH2   1 
ATOM   1471  N  N     . GLN A  1  189 ? 2.856   25.887 -9.439  1.00 23.22  ? 631  GLN B N     1 
ATOM   1472  C  CA    . GLN A  1  189 ? 2.045   24.915 -8.732  1.00 25.18  ? 631  GLN B CA    1 
ATOM   1473  C  C     . GLN A  1  189 ? 2.863   23.630 -8.439  1.00 24.96  ? 631  GLN B C     1 
ATOM   1474  O  O     . GLN A  1  189 ? 2.762   23.076 -7.350  1.00 24.88  ? 631  GLN B O     1 
ATOM   1475  C  CB    . GLN A  1  189 ? 0.798   24.529 -9.586  1.00 26.08  ? 631  GLN B CB    1 
ATOM   1476  C  CG    . GLN A  1  189 ? -0.206  25.639 -9.680  1.00 26.15  ? 631  GLN B CG    1 
ATOM   1477  C  CD    . GLN A  1  189 ? -1.462  25.277 -10.456 1.00 27.40  ? 631  GLN B CD    1 
ATOM   1478  O  OE1   . GLN A  1  189 ? -1.702  24.094 -10.713 1.00 28.49  ? 631  GLN B OE1   1 
ATOM   1479  N  NE2   . GLN A  1  189 ? -2.273  26.240 -10.784 1.00 26.33  ? 631  GLN B NE2   1 
ATOM   1480  N  N     . PHE A  1  190 ? 3.676   23.186 -9.389  1.00 24.42  ? 632  PHE B N     1 
ATOM   1481  C  CA    . PHE A  1  190 ? 4.529   22.041 -9.132  1.00 23.50  ? 632  PHE B CA    1 
ATOM   1482  C  C     . PHE A  1  190 ? 5.484   22.303 -7.940  1.00 22.69  ? 632  PHE B C     1 
ATOM   1483  O  O     . PHE A  1  190 ? 5.650   21.440 -7.072  1.00 22.86  ? 632  PHE B O     1 
ATOM   1484  C  CB    . PHE A  1  190 ? 5.387   21.723 -10.383 1.00 23.48  ? 632  PHE B CB    1 
ATOM   1485  C  CG    . PHE A  1  190 ? 6.571   20.833 -10.105 1.00 24.80  ? 632  PHE B CG    1 
ATOM   1486  C  CD1   . PHE A  1  190 ? 6.417   19.428 -9.963  1.00 25.39  ? 632  PHE B CD1   1 
ATOM   1487  C  CD2   . PHE A  1  190 ? 7.805   21.337 -10.000 1.00 24.94  ? 632  PHE B CD2   1 
ATOM   1488  C  CE1   . PHE A  1  190 ? 7.500   18.671 -9.674  1.00 26.60  ? 632  PHE B CE1   1 
ATOM   1489  C  CE2   . PHE A  1  190 ? 8.944   20.590 -9.721  1.00 25.78  ? 632  PHE B CE2   1 
ATOM   1490  C  CZ    . PHE A  1  190 ? 8.777   19.183 -9.530  1.00 27.73  ? 632  PHE B CZ    1 
ATOM   1491  N  N     . ILE A  1  191 ? 6.077   23.505 -7.878  1.00 21.35  ? 633  ILE B N     1 
ATOM   1492  C  CA    . ILE A  1  191 ? 6.965   23.821 -6.788  1.00 20.67  ? 633  ILE B CA    1 
ATOM   1493  C  C     . ILE A  1  191 ? 6.195   23.832 -5.457  1.00 21.98  ? 633  ILE B C     1 
ATOM   1494  O  O     . ILE A  1  191 ? 6.668   23.265 -4.436  1.00 23.13  ? 633  ILE B O     1 
ATOM   1495  C  CB    . ILE A  1  191 ? 7.639   25.192 -7.012  1.00 18.96  ? 633  ILE B CB    1 
ATOM   1496  C  CG1   . ILE A  1  191 ? 8.542   25.110 -8.247  1.00 18.98  ? 633  ILE B CG1   1 
ATOM   1497  C  CG2   . ILE A  1  191 ? 8.499   25.549 -5.741  1.00 18.70  ? 633  ILE B CG2   1 
ATOM   1498  C  CD1   . ILE A  1  191 ? 8.863   26.485 -8.860  1.00 18.49  ? 633  ILE B CD1   1 
ATOM   1499  N  N     . GLU A  1  192 ? 5.049   24.491 -5.446  1.00 21.36  ? 634  GLU B N     1 
ATOM   1500  C  CA    . GLU A  1  192 ? 4.263   24.591 -4.213  1.00 23.56  ? 634  GLU B CA    1 
ATOM   1501  C  C     . GLU A  1  192 ? 3.819   23.237 -3.768  1.00 24.55  ? 634  GLU B C     1 
ATOM   1502  O  O     . GLU A  1  192 ? 3.793   22.951 -2.519  1.00 25.45  ? 634  GLU B O     1 
ATOM   1503  C  CB    . GLU A  1  192 ? 3.030   25.500 -4.425  1.00 23.63  ? 634  GLU B CB    1 
ATOM   1504  C  CG    . GLU A  1  192 ? 2.208   25.669 -3.171  1.00 24.28  ? 634  GLU B CG    1 
ATOM   1505  C  CD    . GLU A  1  192 ? 1.047   26.636 -3.354  1.00 23.94  ? 634  GLU B CD    1 
ATOM   1506  O  OE1   . GLU A  1  192 ? 0.795   27.366 -2.303  1.00 24.85  ? 634  GLU B OE1   1 
ATOM   1507  O  OE2   . GLU A  1  192 ? 0.462   26.752 -4.452  1.00 24.25  ? 634  GLU B OE2   1 
ATOM   1508  N  N     . ASP A  1  193 ? 3.464   22.342 -4.701  1.00 24.88  ? 635  ASP B N     1 
ATOM   1509  C  CA    . ASP A  1  193 ? 2.942   21.037 -4.337  1.00 26.45  ? 635  ASP B CA    1 
ATOM   1510  C  C     . ASP A  1  193 ? 4.006   20.050 -3.897  1.00 26.45  ? 635  ASP B C     1 
ATOM   1511  O  O     . ASP A  1  193 ? 3.668   19.042 -3.292  1.00 26.59  ? 635  ASP B O     1 
ATOM   1512  C  CB    . ASP A  1  193 ? 2.159   20.449 -5.540  1.00 27.83  ? 635  ASP B CB    1 
ATOM   1513  C  CG    . ASP A  1  193 ? 0.783   21.110 -5.697  1.00 29.22  ? 635  ASP B CG    1 
ATOM   1514  O  OD1   . ASP A  1  193 ? 0.363   21.904 -4.790  1.00 28.88  ? 635  ASP B OD1   1 
ATOM   1515  O  OD2   . ASP A  1  193 ? 0.137   20.823 -6.705  1.00 31.85  ? 635  ASP B OD2   1 
ATOM   1516  N  N     . ASN A  1  194 ? 5.248   20.309 -4.211  1.00 27.58  ? 636  ASN B N     1 
ATOM   1517  C  CA    . ASN A  1  194 ? 6.372   19.455 -3.796  1.00 28.88  ? 636  ASN B CA    1 
ATOM   1518  C  C     . ASN A  1  194 ? 7.398   20.080 -2.868  1.00 29.28  ? 636  ASN B C     1 
ATOM   1519  O  O     . ASN A  1  194 ? 8.465   19.503 -2.673  1.00 29.13  ? 636  ASN B O     1 
ATOM   1520  C  CB    . ASN A  1  194 ? 7.078   18.929 -5.056  1.00 28.40  ? 636  ASN B CB    1 
ATOM   1521  C  CG    . ASN A  1  194 ? 6.118   18.086 -5.896  1.00 31.59  ? 636  ASN B CG    1 
ATOM   1522  O  OD1   . ASN A  1  194 ? 5.986   16.920 -5.661  1.00 33.75  ? 636  ASN B OD1   1 
ATOM   1523  N  ND2   . ASN A  1  194 ? 5.457   18.692 -6.889  1.00 30.62  ? 636  ASN B ND2   1 
ATOM   1524  N  N     . ALA A  1  195 ? 7.091   21.243 -2.305  1.00 28.09  ? 637  ALA B N     1 
ATOM   1525  C  CA    . ALA A  1  195 ? 8.078   21.970 -1.503  1.00 29.85  ? 637  ALA B CA    1 
ATOM   1526  C  C     . ALA A  1  195 ? 8.608   21.193 -0.307  1.00 33.91  ? 637  ALA B C     1 
ATOM   1527  O  O     . ALA A  1  195 ? 9.753   21.275 0.016   1.00 34.04  ? 637  ALA B O     1 
ATOM   1528  C  CB    . ALA A  1  195 ? 7.476   23.297 -1.047  1.00 28.47  ? 637  ALA B CB    1 
ATOM   1529  N  N     . VAL A  1  196 ? 7.737   20.403 0.325   1.00 35.54  ? 638  VAL B N     1 
ATOM   1530  C  CA    . VAL A  1  196 ? 8.149   19.606 1.473   1.00 43.42  ? 638  VAL B CA    1 
ATOM   1531  C  C     . VAL A  1  196 ? 9.222   18.557 1.137   1.00 45.31  ? 638  VAL B C     1 
ATOM   1532  O  O     . VAL A  1  196 ? 10.006  18.209 1.986   1.00 42.30  ? 638  VAL B O     1 
ATOM   1533  C  CB    . VAL A  1  196 ? 6.923   18.887 2.060   1.00 40.95  ? 638  VAL B CB    1 
ATOM   1534  C  CG1   . VAL A  1  196 ? 5.985   19.937 2.643   1.00 41.30  ? 638  VAL B CG1   1 
ATOM   1535  C  CG2   . VAL A  1  196 ? 6.253   18.022 0.945   1.00 45.46  ? 638  VAL B CG2   1 
ATOM   1536  N  N     A TYR A  1  197 ? 9.269   18.094 -0.102  0.50 44.78  ? 639  TYR B N     1 
ATOM   1537  N  N     B TYR A  1  197 ? 9.248   18.130 -0.121  0.50 46.97  ? 639  TYR B N     1 
ATOM   1538  C  CA    A TYR A  1  197 ? 10.254  17.115 -0.536  0.50 43.92  ? 639  TYR B CA    1 
ATOM   1539  C  CA    B TYR A  1  197 ? 10.239  17.212 -0.667  0.50 47.26  ? 639  TYR B CA    1 
ATOM   1540  C  C     A TYR A  1  197 ? 11.591  17.686 -1.017  0.50 44.47  ? 639  TYR B C     1 
ATOM   1541  C  C     B TYR A  1  197 ? 11.654  17.729 -0.775  0.50 47.43  ? 639  TYR B C     1 
ATOM   1542  O  O     A TYR A  1  197 ? 12.530  16.916 -1.299  0.50 42.40  ? 639  TYR B O     1 
ATOM   1543  O  O     B TYR A  1  197 ? 12.598  16.909 -1.046  0.50 44.56  ? 639  TYR B O     1 
ATOM   1544  C  CB    A TYR A  1  197 ? 9.682   16.237 -1.661  0.50 43.14  ? 639  TYR B CB    1 
ATOM   1545  C  CB    B TYR A  1  197 ? 9.852   16.770 -2.090  0.50 49.21  ? 639  TYR B CB    1 
ATOM   1546  C  CG    A TYR A  1  197 ? 8.295   15.730 -1.344  0.50 41.69  ? 639  TYR B CG    1 
ATOM   1547  C  CG    B TYR A  1  197 ? 8.720   15.801 -2.103  0.50 52.53  ? 639  TYR B CG    1 
ATOM   1548  C  CD1   A TYR A  1  197 ? 8.062   14.834 -0.282  0.50 42.61  ? 639  TYR B CD1   1 
ATOM   1549  C  CD1   B TYR A  1  197 ? 7.402   16.273 -1.896  0.50 52.46  ? 639  TYR B CD1   1 
ATOM   1550  C  CD2   A TYR A  1  197 ? 7.200   16.165 -2.107  0.50 41.74  ? 639  TYR B CD2   1 
ATOM   1551  C  CD2   B TYR A  1  197 ? 8.958   14.428 -2.331  0.50 53.97  ? 639  TYR B CD2   1 
ATOM   1552  C  CE1   A TYR A  1  197 ? 6.766   14.382 0.027   0.50 42.91  ? 639  TYR B CE1   1 
ATOM   1553  C  CE1   B TYR A  1  197 ? 6.348   15.411 -1.875  0.50 56.31  ? 639  TYR B CE1   1 
ATOM   1554  C  CE2   A TYR A  1  197 ? 5.911   15.721 -1.835  0.50 43.43  ? 639  TYR B CE2   1 
ATOM   1555  C  CE2   B TYR A  1  197 ? 7.929   13.532 -2.341  0.50 54.65  ? 639  TYR B CE2   1 
ATOM   1556  C  CZ    A TYR A  1  197 ? 5.707   14.817 -0.748  0.50 43.12  ? 639  TYR B CZ    1 
ATOM   1557  C  CZ    B TYR A  1  197 ? 6.635   14.000 -2.128  0.50 56.17  ? 639  TYR B CZ    1 
ATOM   1558  O  OH    A TYR A  1  197 ? 4.452   14.341 -0.451  0.50 43.21  ? 639  TYR B OH    1 
ATOM   1559  O  OH    B TYR A  1  197 ? 5.699   13.010 -2.152  0.50 56.60  ? 639  TYR B OH    1 
ATOM   1560  N  N     . ALA A  1  198 ? 11.700  19.005 -1.074  1.00 43.51  ? 640  ALA B N     1 
ATOM   1561  C  CA    . ALA A  1  198 ? 12.928  19.644 -1.546  1.00 44.12  ? 640  ALA B CA    1 
ATOM   1562  C  C     . ALA A  1  198 ? 14.144  19.617 -0.627  1.00 46.68  ? 640  ALA B C     1 
ATOM   1563  O  O     . ALA A  1  198 ? 14.005  19.547 0.610   1.00 51.40  ? 640  ALA B O     1 
ATOM   1564  C  CB    . ALA A  1  198 ? 12.628  21.078 -1.983  1.00 44.76  ? 640  ALA B CB    1 
ATOM   1565  N  N     . ASN A  1  199 ? 15.313  19.711 -1.254  1.00 48.54  ? 641  ASN B N     1 
ATOM   1566  C  CA    . ASN A  1  199 ? 16.628  19.834 -0.589  1.00 52.38  ? 641  ASN B CA    1 
ATOM   1567  C  C     . ASN A  1  199 ? 16.804  19.144 0.788   1.00 52.01  ? 641  ASN B C     1 
ATOM   1568  O  O     . ASN A  1  199 ? 16.792  19.875 1.796   1.00 54.28  ? 641  ASN B O     1 
ATOM   1569  C  CB    . ASN A  1  199 ? 17.050  21.328 -0.468  1.00 51.98  ? 641  ASN B CB    1 
ATOM   1570  C  CG    . ASN A  1  199 ? 17.156  21.966 -1.817  1.00 51.24  ? 641  ASN B CG    1 
ATOM   1571  O  OD1   . ASN A  1  199 ? 17.941  21.456 -2.598  1.00 51.47  ? 641  ASN B OD1   1 
ATOM   1572  N  ND2   . ASN A  1  199 ? 16.347  23.002 -2.145  1.00 38.24  ? 641  ASN B ND2   1 
ATOM   1573  N  N     . ASN A  1  211 ? 24.633  2.539  -12.396 1.00 64.29  ? 1010 ASN B N     1 
ATOM   1574  C  CA    . ASN A  1  211 ? 23.230  2.771  -12.022 1.00 64.10  ? 1010 ASN B CA    1 
ATOM   1575  C  C     . ASN A  1  211 ? 22.473  3.505  -13.132 1.00 62.89  ? 1010 ASN B C     1 
ATOM   1576  O  O     . ASN A  1  211 ? 23.035  3.913  -14.128 1.00 59.49  ? 1010 ASN B O     1 
ATOM   1577  C  CB    . ASN A  1  211 ? 23.098  3.508  -10.707 1.00 68.83  ? 1010 ASN B CB    1 
ATOM   1578  C  CG    . ASN A  1  211 ? 21.858  3.072  -9.940  1.00 74.68  ? 1010 ASN B CG    1 
ATOM   1579  O  OD1   . ASN A  1  211 ? 21.464  1.888  -9.974  1.00 80.10  ? 1010 ASN B OD1   1 
ATOM   1580  N  ND2   . ASN A  1  211 ? 21.217  4.018  -9.227  1.00 77.15  ? 1010 ASN B ND2   1 
ATOM   1581  N  N     . GLU A  1  212 ? 21.169  3.566  -12.971 1.00 53.38  ? 1011 GLU B N     1 
ATOM   1582  C  CA    . GLU A  1  212 ? 20.252  4.048  -13.992 1.00 53.00  ? 1011 GLU B CA    1 
ATOM   1583  C  C     . GLU A  1  212 ? 19.430  5.160  -13.406 1.00 49.74  ? 1011 GLU B C     1 
ATOM   1584  O  O     . GLU A  1  212 ? 19.077  5.139  -12.196 1.00 46.70  ? 1011 GLU B O     1 
ATOM   1585  C  CB    . GLU A  1  212 ? 19.332  2.922  -14.412 1.00 57.98  ? 1011 GLU B CB    1 
ATOM   1586  C  CG    . GLU A  1  212 ? 18.580  3.120  -15.699 1.00 56.99  ? 1011 GLU B CG    1 
ATOM   1587  C  CD    . GLU A  1  212 ? 17.985  1.820  -16.240 1.00 65.26  ? 1011 GLU B CD    1 
ATOM   1588  O  OE1   . GLU A  1  212 ? 18.714  0.788  -16.397 1.00 59.42  ? 1011 GLU B OE1   1 
ATOM   1589  O  OE2   . GLU A  1  212 ? 16.761  1.863  -16.544 1.00 69.00  ? 1011 GLU B OE2   1 
ATOM   1590  N  N     . ARG A  1  213 ? 19.116  6.154  -14.248 1.00 48.07  ? 1012 ARG B N     1 
ATOM   1591  C  CA    . ARG A  1  213 ? 18.357  7.309  -13.747 1.00 44.77  ? 1012 ARG B CA    1 
ATOM   1592  C  C     . ARG A  1  213 ? 17.242  7.707  -14.710 1.00 40.54  ? 1012 ARG B C     1 
ATOM   1593  O  O     . ARG A  1  213 ? 17.524  8.131  -15.845 1.00 40.86  ? 1012 ARG B O     1 
ATOM   1594  C  CB    . ARG A  1  213 ? 19.324  8.474  -13.531 1.00 44.08  ? 1012 ARG B CB    1 
ATOM   1595  C  CG    . ARG A  1  213 ? 18.678  9.735  -12.983 1.00 47.42  ? 1012 ARG B CG    1 
ATOM   1596  C  CD    . ARG A  1  213 ? 17.886  9.497  -11.694 1.00 48.16  ? 1012 ARG B CD    1 
ATOM   1597  N  NE    . ARG A  1  213 ? 17.755  10.720 -10.934 1.00 48.59  ? 1012 ARG B NE    1 
ATOM   1598  C  CZ    . ARG A  1  213 ? 16.912  10.851 -9.897  1.00 52.08  ? 1012 ARG B CZ    1 
ATOM   1599  N  NH1   . ARG A  1  213 ? 16.179  9.834  -9.477  1.00 49.03  ? 1012 ARG B NH1   1 
ATOM   1600  N  NH2   . ARG A  1  213 ? 16.839  12.001 -9.247  1.00 55.67  ? 1012 ARG B NH2   1 
ATOM   1601  N  N     . ASN A  1  214 ? 16.012  7.627  -14.297 1.00 37.55  ? 1013 ASN B N     1 
ATOM   1602  C  CA    . ASN A  1  214 ? 14.868  8.001  -15.120 1.00 39.39  ? 1013 ASN B CA    1 
ATOM   1603  C  C     . ASN A  1  214 ? 14.981  9.523  -15.395 1.00 36.98  ? 1013 ASN B C     1 
ATOM   1604  O  O     . ASN A  1  214 ? 15.221  10.280 -14.487 1.00 37.64  ? 1013 ASN B O     1 
ATOM   1605  C  CB    . ASN A  1  214 ? 13.571  7.704  -14.345 1.00 39.44  ? 1013 ASN B CB    1 
ATOM   1606  C  CG    . ASN A  1  214 ? 12.346  7.999  -15.127 1.00 43.88  ? 1013 ASN B CG    1 
ATOM   1607  O  OD1   . ASN A  1  214 ? 12.217  9.051  -15.744 1.00 51.33  ? 1013 ASN B OD1   1 
ATOM   1608  N  ND2   . ASN A  1  214 ? 11.421  7.064  -15.117 1.00 46.06  ? 1013 ASN B ND2   1 
ATOM   1609  N  N     . ILE A  1  215 ? 14.810  9.932  -16.648 1.00 36.48  ? 1014 ILE B N     1 
ATOM   1610  C  CA    . ILE A  1  215 ? 15.053  11.322 -17.003 1.00 33.21  ? 1014 ILE B CA    1 
ATOM   1611  C  C     . ILE A  1  215 ? 13.950  12.225 -16.447 1.00 33.97  ? 1014 ILE B C     1 
ATOM   1612  O  O     . ILE A  1  215 ? 14.218  13.370 -16.071 1.00 31.86  ? 1014 ILE B O     1 
ATOM   1613  C  CB    . ILE A  1  215 ? 15.189  11.485 -18.533 1.00 34.48  ? 1014 ILE B CB    1 
ATOM   1614  C  CG1   . ILE A  1  215 ? 15.765  12.893 -18.824 1.00 32.65  ? 1014 ILE B CG1   1 
ATOM   1615  C  CG2   . ILE A  1  215 ? 13.835  11.325 -19.279 1.00 32.90  ? 1014 ILE B CG2   1 
ATOM   1616  C  CD1   . ILE A  1  215 ? 16.155  13.052 -20.300 1.00 34.04  ? 1014 ILE B CD1   1 
ATOM   1617  N  N     . THR A  1  216 ? 12.724  11.725 -16.349 1.00 34.18  ? 1015 THR B N     1 
ATOM   1618  C  CA    . THR A  1  216 ? 11.654  12.510 -15.798 1.00 33.14  ? 1015 THR B CA    1 
ATOM   1619  C  C     . THR A  1  216 ? 11.890  12.717 -14.278 1.00 33.22  ? 1015 THR B C     1 
ATOM   1620  O  O     . THR A  1  216 ? 11.724  13.814 -13.801 1.00 31.38  ? 1015 THR B O     1 
ATOM   1621  C  CB    . THR A  1  216 ? 10.267  11.829 -16.025 1.00 35.44  ? 1015 THR B CB    1 
ATOM   1622  O  OG1   . THR A  1  216 ? 9.894   12.043 -17.360 1.00 34.66  ? 1015 THR B OG1   1 
ATOM   1623  C  CG2   . THR A  1  216 ? 9.167   12.327 -15.151 1.00 35.97  ? 1015 THR B CG2   1 
ATOM   1624  N  N     . SER A  1  217 ? 12.287  11.681 -13.581 1.00 31.30  ? 1016 SER B N     1 
ATOM   1625  C  CA    . SER A  1  217 ? 12.525  11.814 -12.158 1.00 31.39  ? 1016 SER B CA    1 
ATOM   1626  C  C     . SER A  1  217 ? 13.715  12.722 -11.886 1.00 29.79  ? 1016 SER B C     1 
ATOM   1627  O  O     . SER A  1  217 ? 13.682  13.527 -10.939 1.00 28.51  ? 1016 SER B O     1 
ATOM   1628  C  CB    . SER A  1  217 ? 12.806  10.405 -11.527 1.00 33.89  ? 1016 SER B CB    1 
ATOM   1629  O  OG    . SER A  1  217 ? 11.675  9.562  -11.756 1.00 38.45  ? 1016 SER B OG    1 
ATOM   1630  N  N     . GLU A  1  218 ? 14.776  12.630 -12.693 1.00 29.24  ? 1017 GLU B N     1 
ATOM   1631  C  CA    . GLU A  1  218 ? 15.903  13.508 -12.519 1.00 29.79  ? 1017 GLU B CA    1 
ATOM   1632  C  C     . GLU A  1  218 ? 15.504  14.967 -12.733 1.00 28.97  ? 1017 GLU B C     1 
ATOM   1633  O  O     . GLU A  1  218 ? 15.910  15.855 -11.971 1.00 29.16  ? 1017 GLU B O     1 
ATOM   1634  C  CB    . GLU A  1  218 ? 17.041  13.115 -13.480 1.00 29.39  ? 1017 GLU B CB    1 
ATOM   1635  C  CG    . GLU A  1  218 ? 18.254  14.041 -13.424 1.00 31.74  ? 1017 GLU B CG    1 
ATOM   1636  C  CD    . GLU A  1  218 ? 19.033  13.938 -12.099 1.00 32.29  ? 1017 GLU B CD    1 
ATOM   1637  O  OE1   . GLU A  1  218 ? 18.862  12.927 -11.386 1.00 37.19  ? 1017 GLU B OE1   1 
ATOM   1638  O  OE2   . GLU A  1  218 ? 19.802  14.819 -11.734 1.00 36.67  ? 1017 GLU B OE2   1 
ATOM   1639  N  N     . MET A  1  219 ? 14.697  15.231 -13.772 1.00 29.43  ? 1018 MET B N     1 
ATOM   1640  C  CA    . MET A  1  219 ? 14.283  16.611 -14.078 1.00 28.12  ? 1018 MET B CA    1 
ATOM   1641  C  C     . MET A  1  219 ? 13.458  17.186 -12.950 1.00 28.60  ? 1018 MET B C     1 
ATOM   1642  O  O     . MET A  1  219 ? 13.709  18.317 -12.509 1.00 28.33  ? 1018 MET B O     1 
ATOM   1643  C  CB    . MET A  1  219 ? 13.527  16.648 -15.394 1.00 29.43  ? 1018 MET B CB    1 
ATOM   1644  C  CG    . MET A  1  219 ? 14.516  16.530 -16.612 1.00 27.58  ? 1018 MET B CG    1 
ATOM   1645  S  SD    . MET A  1  219 ? 15.591  17.917 -16.835 1.00 28.76  ? 1018 MET B SD    1 
ATOM   1646  C  CE    . MET A  1  219 ? 14.447  19.238 -16.959 1.00 27.00  ? 1018 MET B CE    1 
ATOM   1647  N  N     . ARG A  1  220 ? 12.467  16.456 -12.514 1.00 27.06  ? 1019 ARG B N     1 
ATOM   1648  C  CA    . ARG A  1  220 ? 11.577  16.933 -11.451 1.00 27.81  ? 1019 ARG B CA    1 
ATOM   1649  C  C     . ARG A  1  220 ? 12.362  17.188 -10.139 1.00 26.98  ? 1019 ARG B C     1 
ATOM   1650  O  O     . ARG A  1  220 ? 12.183  18.197 -9.506  1.00 24.93  ? 1019 ARG B O     1 
ATOM   1651  C  CB    . ARG A  1  220 ? 10.441  15.947 -11.203 1.00 29.18  ? 1019 ARG B CB    1 
ATOM   1652  C  CG    . ARG A  1  220 ? 9.415   15.983 -12.324 1.00 30.43  ? 1019 ARG B CG    1 
ATOM   1653  C  CD    . ARG A  1  220 ? 8.438   14.736 -12.234 1.00 34.30  ? 1019 ARG B CD    1 
ATOM   1654  N  NE    . ARG A  1  220 ? 7.651   14.728 -11.019 1.00 36.13  ? 1019 ARG B NE    1 
ATOM   1655  C  CZ    . ARG A  1  220 ? 6.510   15.389 -10.855 1.00 38.34  ? 1019 ARG B CZ    1 
ATOM   1656  N  NH1   . ARG A  1  220 ? 5.903   15.300 -9.637  1.00 37.63  ? 1019 ARG B NH1   1 
ATOM   1657  N  NH2   . ARG A  1  220 ? 5.954   16.169 -11.825 1.00 35.41  ? 1019 ARG B NH2   1 
ATOM   1658  N  N     . GLU A  1  221 ? 13.200  16.259 -9.743  1.00 27.06  ? 1020 GLU B N     1 
ATOM   1659  C  CA    . GLU A  1  221 ? 13.881  16.380 -8.484  1.00 28.98  ? 1020 GLU B CA    1 
ATOM   1660  C  C     . GLU A  1  221 ? 14.963  17.477 -8.523  1.00 26.92  ? 1020 GLU B C     1 
ATOM   1661  O  O     . GLU A  1  221 ? 15.077  18.243 -7.559  1.00 25.50  ? 1020 GLU B O     1 
ATOM   1662  C  CB    . GLU A  1  221 ? 14.547  15.028 -8.084  1.00 31.61  ? 1020 GLU B CB    1 
ATOM   1663  C  CG    . GLU A  1  221 ? 13.512  13.983 -7.669  1.00 37.77  ? 1020 GLU B CG    1 
ATOM   1664  C  CD    . GLU A  1  221 ? 14.140  12.645 -7.352  1.00 44.20  ? 1020 GLU B CD    1 
ATOM   1665  O  OE1   . GLU A  1  221 ? 15.338  12.618 -6.916  1.00 46.06  ? 1020 GLU B OE1   1 
ATOM   1666  O  OE2   . GLU A  1  221 ? 13.434  11.610 -7.534  1.00 48.35  ? 1020 GLU B OE2   1 
ATOM   1667  N  N     . SER A  1  222 ? 15.710  17.571 -9.608  1.00 26.83  ? 1021 SER B N     1 
ATOM   1668  C  CA    . SER A  1  222 ? 16.746  18.603 -9.685  1.00 25.86  ? 1021 SER B CA    1 
ATOM   1669  C  C     . SER A  1  222 ? 16.167  20.005 -9.844  1.00 24.81  ? 1021 SER B C     1 
ATOM   1670  O  O     . SER A  1  222 ? 16.649  20.946 -9.211  1.00 25.19  ? 1021 SER B O     1 
ATOM   1671  C  CB    . SER A  1  222 ? 17.720  18.295 -10.853 1.00 27.71  ? 1021 SER B CB    1 
ATOM   1672  O  OG    . SER A  1  222 ? 18.361  17.091 -10.703 1.00 32.97  ? 1021 SER B OG    1 
ATOM   1673  N  N     . PHE A  1  223 ? 15.124  20.169 -10.656 1.00 25.72  ? 1022 PHE B N     1 
ATOM   1674  C  CA    . PHE A  1  223 ? 14.516  21.494 -10.813 1.00 24.93  ? 1022 PHE B CA    1 
ATOM   1675  C  C     . PHE A  1  223 ? 13.845  21.935 -9.525  1.00 24.29  ? 1022 PHE B C     1 
ATOM   1676  O  O     . PHE A  1  223 ? 13.882  23.138 -9.178  1.00 22.96  ? 1022 PHE B O     1 
ATOM   1677  C  CB    . PHE A  1  223 ? 13.485  21.494 -11.946 1.00 23.81  ? 1022 PHE B CB    1 
ATOM   1678  C  CG    . PHE A  1  223 ? 13.168  22.880 -12.440 1.00 23.63  ? 1022 PHE B CG    1 
ATOM   1679  C  CD1   . PHE A  1  223 ? 14.068  23.566 -13.324 1.00 24.07  ? 1022 PHE B CD1   1 
ATOM   1680  C  CD2   . PHE A  1  223 ? 12.040  23.542 -11.907 1.00 23.82  ? 1022 PHE B CD2   1 
ATOM   1681  C  CE1   . PHE A  1  223 ? 13.742  24.840 -13.667 1.00 23.37  ? 1022 PHE B CE1   1 
ATOM   1682  C  CE2   . PHE A  1  223 ? 11.793  24.858 -12.295 1.00 23.23  ? 1022 PHE B CE2   1 
ATOM   1683  C  CZ    . PHE A  1  223 ? 12.699  25.491 -13.158 1.00 22.61  ? 1022 PHE B CZ    1 
ATOM   1684  N  N     . LEU A  1  224 ? 13.215  20.998 -8.806  1.00 23.89  ? 1023 LEU B N     1 
ATOM   1685  C  CA    . LEU A  1  224 ? 12.571  21.339 -7.541  1.00 23.43  ? 1023 LEU B CA    1 
ATOM   1686  C  C     . LEU A  1  224 ? 13.607  21.887 -6.557  1.00 22.24  ? 1023 LEU B C     1 
ATOM   1687  O  O     . LEU A  1  224 ? 13.375  22.916 -5.906  1.00 21.18  ? 1023 LEU B O     1 
ATOM   1688  C  CB    . LEU A  1  224 ? 11.860  20.130 -6.968  1.00 23.20  ? 1023 LEU B CB    1 
ATOM   1689  C  CG    . LEU A  1  224 ? 11.180  20.377 -5.582  1.00 24.59  ? 1023 LEU B CG    1 
ATOM   1690  C  CD1   . LEU A  1  224 ? 9.965   21.297 -5.785  1.00 23.41  ? 1023 LEU B CD1   1 
ATOM   1691  C  CD2   . LEU A  1  224 ? 10.851  19.017 -4.916  1.00 25.91  ? 1023 LEU B CD2   1 
ATOM   1692  N  N     . ASP A  1  225 ? 14.758  21.204 -6.436  1.00 24.20  ? 1024 ASP B N     1 
ATOM   1693  C  CA    . ASP A  1  225 ? 15.767  21.642 -5.501  1.00 25.03  ? 1024 ASP B CA    1 
ATOM   1694  C  C     . ASP A  1  225 ? 16.248  23.041 -5.854  1.00 22.82  ? 1024 ASP B C     1 
ATOM   1695  O  O     . ASP A  1  225 ? 16.435  23.881 -4.957  1.00 22.27  ? 1024 ASP B O     1 
ATOM   1696  C  CB    . ASP A  1  225 ? 16.969  20.682 -5.529  1.00 28.17  ? 1024 ASP B CB    1 
ATOM   1697  C  CG    . ASP A  1  225 ? 16.632  19.352 -4.821  1.00 33.94  ? 1024 ASP B CG    1 
ATOM   1698  O  OD1   . ASP A  1  225 ? 15.579  19.275 -4.052  1.00 33.02  ? 1024 ASP B OD1   1 
ATOM   1699  O  OD2   . ASP A  1  225 ? 17.423  18.411 -5.042  1.00 34.36  ? 1024 ASP B OD2   1 
ATOM   1700  N  N     . TYR A  1  226 ? 16.475  23.314 -7.140  1.00 21.04  ? 1025 TYR B N     1 
ATOM   1701  C  CA    . TYR A  1  226 ? 16.947  24.615 -7.532  1.00 21.28  ? 1025 TYR B CA    1 
ATOM   1702  C  C     . TYR A  1  226 ? 15.847  25.680 -7.297  1.00 20.14  ? 1025 TYR B C     1 
ATOM   1703  O  O     . TYR A  1  226 ? 16.123  26.705 -6.662  1.00 19.42  ? 1025 TYR B O     1 
ATOM   1704  C  CB    . TYR A  1  226 ? 17.310  24.637 -9.048  1.00 20.49  ? 1025 TYR B CB    1 
ATOM   1705  C  CG    . TYR A  1  226 ? 17.672  26.008 -9.520  1.00 21.27  ? 1025 TYR B CG    1 
ATOM   1706  C  CD1   . TYR A  1  226 ? 18.882  26.614 -9.085  1.00 21.50  ? 1025 TYR B CD1   1 
ATOM   1707  C  CD2   . TYR A  1  226 ? 16.794  26.759 -10.388 1.00 21.43  ? 1025 TYR B CD2   1 
ATOM   1708  C  CE1   . TYR A  1  226 ? 19.248  27.894 -9.519  1.00 22.01  ? 1025 TYR B CE1   1 
ATOM   1709  C  CE2   . TYR A  1  226 ? 17.265  28.010 -10.846 1.00 21.06  ? 1025 TYR B CE2   1 
ATOM   1710  C  CZ    . TYR A  1  226 ? 18.429  28.545 -10.384 1.00 21.36  ? 1025 TYR B CZ    1 
ATOM   1711  O  OH    . TYR A  1  226 ? 18.789  29.820 -10.790 1.00 20.96  ? 1025 TYR B OH    1 
ATOM   1712  N  N     . ALA A  1  227 ? 14.623  25.433 -7.793  1.00 20.34  ? 1026 ALA B N     1 
ATOM   1713  C  CA    . ALA A  1  227 ? 13.603  26.419 -7.657  1.00 20.18  ? 1026 ALA B CA    1 
ATOM   1714  C  C     . ALA A  1  227 ? 13.279  26.723 -6.173  1.00 20.61  ? 1026 ALA B C     1 
ATOM   1715  O  O     . ALA A  1  227 ? 13.080  27.909 -5.829  1.00 19.65  ? 1026 ALA B O     1 
ATOM   1716  C  CB    . ALA A  1  227 ? 12.267  25.913 -8.340  1.00 20.45  ? 1026 ALA B CB    1 
ATOM   1717  N  N     . MET A  1  228 ? 13.246  25.710 -5.326  1.00 20.61  ? 1027 MET B N     1 
ATOM   1718  C  CA    . MET A  1  228 ? 13.015  25.951 -3.916  1.00 22.03  ? 1027 MET B CA    1 
ATOM   1719  C  C     . MET A  1  228 ? 14.100  26.792 -3.278  1.00 21.23  ? 1027 MET B C     1 
ATOM   1720  O  O     . MET A  1  228 ? 13.808  27.699 -2.479  1.00 21.21  ? 1027 MET B O     1 
ATOM   1721  C  CB    . MET A  1  228 ? 12.870  24.602 -3.133  1.00 22.27  ? 1027 MET B CB    1 
ATOM   1722  C  CG    . MET A  1  228 ? 11.449  24.009 -3.320  1.00 24.16  ? 1027 MET B CG    1 
ATOM   1723  S  SD    . MET A  1  228 ? 10.266  24.975 -2.349  1.00 26.17  ? 1027 MET B SD    1 
ATOM   1724  C  CE    . MET A  1  228 ? 10.798  24.847 -0.652  1.00 26.41  ? 1027 MET B CE    1 
ATOM   1725  N  N     . SER A  1  229 ? 15.359  26.519 -3.618  1.00 20.51  ? 1028 SER B N     1 
ATOM   1726  C  CA    . SER A  1  229 ? 16.473  27.273 -3.030  1.00 20.62  ? 1028 SER B CA    1 
ATOM   1727  C  C     . SER A  1  229 ? 16.451  28.723 -3.505  1.00 20.15  ? 1028 SER B C     1 
ATOM   1728  O  O     . SER A  1  229 ? 16.797  29.638 -2.751  1.00 20.33  ? 1028 SER B O     1 
ATOM   1729  C  CB    . SER A  1  229 ? 17.809  26.600 -3.405  1.00 20.51  ? 1028 SER B CB    1 
ATOM   1730  O  OG    . SER A  1  229 ? 18.883  27.229 -2.709  1.00 21.96  ? 1028 SER B OG    1 
ATOM   1731  N  N     . VAL A  1  230 ? 16.084  28.970 -4.787  1.00 20.13  ? 1029 VAL B N     1 
ATOM   1732  C  CA    . VAL A  1  230 ? 15.961  30.333 -5.257  1.00 20.59  ? 1029 VAL B CA    1 
ATOM   1733  C  C     . VAL A  1  230 ? 14.841  31.072 -4.524  1.00 21.01  ? 1029 VAL B C     1 
ATOM   1734  O  O     . VAL A  1  230 ? 15.001  32.250 -4.132  1.00 20.32  ? 1029 VAL B O     1 
ATOM   1735  C  CB    . VAL A  1  230 ? 15.735  30.365 -6.757  1.00 20.74  ? 1029 VAL B CB    1 
ATOM   1736  C  CG1   . VAL A  1  230 ? 15.471  31.788 -7.250  1.00 20.95  ? 1029 VAL B CG1   1 
ATOM   1737  C  CG2   . VAL A  1  230 ? 16.928  29.806 -7.464  1.00 21.88  ? 1029 VAL B CG2   1 
ATOM   1738  N  N     . ILE A  1  231 ? 13.745  30.372 -4.295  1.00 20.68  ? 1030 ILE B N     1 
ATOM   1739  C  CA    . ILE A  1  231 ? 12.602  31.005 -3.622  1.00 20.85  ? 1030 ILE B CA    1 
ATOM   1740  C  C     . ILE A  1  231 ? 12.920  31.355 -2.164  1.00 20.66  ? 1030 ILE B C     1 
ATOM   1741  O  O     . ILE A  1  231 ? 12.710  32.493 -1.729  1.00 20.30  ? 1030 ILE B O     1 
ATOM   1742  C  CB    . ILE A  1  231 ? 11.360  30.068 -3.710  1.00 20.63  ? 1030 ILE B CB    1 
ATOM   1743  C  CG1   . ILE A  1  231 ? 10.811  30.133 -5.114  1.00 21.15  ? 1030 ILE B CG1   1 
ATOM   1744  C  CG2   . ILE A  1  231 ? 10.298  30.506 -2.740  1.00 20.43  ? 1030 ILE B CG2   1 
ATOM   1745  C  CD1   . ILE A  1  231 ? 9.756   29.008 -5.356  1.00 21.08  ? 1030 ILE B CD1   1 
ATOM   1746  N  N     . VAL A  1  232 ? 13.410  30.385 -1.419  1.00 20.39  ? 1031 VAL B N     1 
ATOM   1747  C  CA    . VAL A  1  232 ? 13.544  30.570 0.045   1.00 20.57  ? 1031 VAL B CA    1 
ATOM   1748  C  C     . VAL A  1  232 ? 14.938  30.965 0.494   1.00 20.64  ? 1031 VAL B C     1 
ATOM   1749  O  O     . VAL A  1  232 ? 15.076  31.329 1.635   1.00 19.59  ? 1031 VAL B O     1 
ATOM   1750  C  CB    . VAL A  1  232 ? 13.109  29.303 0.826   1.00 21.42  ? 1031 VAL B CB    1 
ATOM   1751  C  CG1   . VAL A  1  232 ? 11.717  28.826 0.307   1.00 21.54  ? 1031 VAL B CG1   1 
ATOM   1752  C  CG2   . VAL A  1  232 ? 14.164  28.170 0.707   1.00 22.12  ? 1031 VAL B CG2   1 
ATOM   1753  N  N     . ALA A  1  233 ? 15.924  30.915 -0.405  1.00 19.48  ? 1032 ALA B N     1 
ATOM   1754  C  CA    . ALA A  1  233 ? 17.320  31.227 0.020   1.00 20.58  ? 1032 ALA B CA    1 
ATOM   1755  C  C     . ALA A  1  233 ? 18.084  31.942 -1.047  1.00 19.99  ? 1032 ALA B C     1 
ATOM   1756  O  O     . ALA A  1  233 ? 19.270  31.665 -1.270  1.00 22.84  ? 1032 ALA B O     1 
ATOM   1757  C  CB    . ALA A  1  233 ? 18.003  29.892 0.398   1.00 20.35  ? 1032 ALA B CB    1 
ATOM   1758  N  N     . ARG A  1  234 ? 17.450  32.913 -1.736  1.00 19.08  ? 1033 ARG B N     1 
ATOM   1759  C  CA    . ARG A  1  234 ? 18.244  33.715 -2.720  1.00 19.19  ? 1033 ARG B CA    1 
ATOM   1760  C  C     . ARG A  1  234 ? 17.531  34.988 -3.153  1.00 19.05  ? 1033 ARG B C     1 
ATOM   1761  O  O     . ARG A  1  234 ? 17.995  36.077 -2.841  1.00 19.88  ? 1033 ARG B O     1 
ATOM   1762  C  CB    . ARG A  1  234 ? 18.564  32.892 -4.001  1.00 19.26  ? 1033 ARG B CB    1 
ATOM   1763  C  CG    . ARG A  1  234 ? 19.458  33.677 -4.926  1.00 19.57  ? 1033 ARG B CG    1 
ATOM   1764  C  CD    . ARG A  1  234 ? 20.086  32.858 -6.047  1.00 20.60  ? 1033 ARG B CD    1 
ATOM   1765  N  NE    . ARG A  1  234 ? 20.848  31.777 -5.480  1.00 20.04  ? 1033 ARG B NE    1 
ATOM   1766  C  CZ    . ARG A  1  234 ? 21.323  30.752 -6.227  1.00 20.27  ? 1033 ARG B CZ    1 
ATOM   1767  N  NH1   . ARG A  1  234 ? 21.274  30.775 -7.565  1.00 20.18  ? 1033 ARG B NH1   1 
ATOM   1768  N  NH2   . ARG A  1  234 ? 22.010  29.773 -5.611  1.00 19.90  ? 1033 ARG B NH2   1 
ATOM   1769  N  N     . ALA A  1  235 ? 16.380  34.872 -3.861  1.00 19.07  ? 1034 ALA B N     1 
ATOM   1770  C  CA    . ALA A  1  235 ? 15.835  35.988 -4.563  1.00 18.84  ? 1034 ALA B CA    1 
ATOM   1771  C  C     . ALA A  1  235 ? 14.686  36.702 -3.862  1.00 19.41  ? 1034 ALA B C     1 
ATOM   1772  O  O     . ALA A  1  235 ? 14.274  37.783 -4.345  1.00 19.57  ? 1034 ALA B O     1 
ATOM   1773  C  CB    . ALA A  1  235 ? 15.334  35.496 -5.954  1.00 19.79  ? 1034 ALA B CB    1 
ATOM   1774  N  N     . LEU A  1  236 ? 14.178  36.178 -2.757  1.00 19.15  ? 1035 LEU B N     1 
ATOM   1775  C  CA    . LEU A  1  236 ? 13.002  36.841 -2.164  1.00 20.48  ? 1035 LEU B CA    1 
ATOM   1776  C  C     . LEU A  1  236 ? 13.360  37.314 -0.732  1.00 21.22  ? 1035 LEU B C     1 
ATOM   1777  O  O     . LEU A  1  236 ? 14.062  36.611 0.011   1.00 22.53  ? 1035 LEU B O     1 
ATOM   1778  C  CB    . LEU A  1  236 ? 11.846  35.793 -1.989  1.00 20.45  ? 1035 LEU B CB    1 
ATOM   1779  C  CG    . LEU A  1  236 ? 11.243  35.311 -3.319  1.00 20.68  ? 1035 LEU B CG    1 
ATOM   1780  C  CD1   . LEU A  1  236 ? 10.125  34.320 -3.040  1.00 20.73  ? 1035 LEU B CD1   1 
ATOM   1781  C  CD2   . LEU A  1  236 ? 10.707  36.534 -3.997  1.00 21.75  ? 1035 LEU B CD2   1 
ATOM   1782  N  N     . PRO A  1  237 ? 12.904  38.510 -0.386  1.00 20.50  ? 1036 PRO B N     1 
ATOM   1783  C  CA    . PRO A  1  237 ? 13.207  39.025 0.962   1.00 20.49  ? 1036 PRO B CA    1 
ATOM   1784  C  C     . PRO A  1  237 ? 12.329  38.482 2.005   1.00 20.98  ? 1036 PRO B C     1 
ATOM   1785  O  O     . PRO A  1  237 ? 11.205  37.978 1.743   1.00 20.82  ? 1036 PRO B O     1 
ATOM   1786  C  CB    . PRO A  1  237 ? 12.935  40.535 0.812   1.00 19.99  ? 1036 PRO B CB    1 
ATOM   1787  C  CG    . PRO A  1  237 ? 11.823  40.581 -0.202  1.00 19.98  ? 1036 PRO B CG    1 
ATOM   1788  C  CD    . PRO A  1  237 ? 12.115  39.435 -1.178  1.00 19.80  ? 1036 PRO B CD    1 
ATOM   1789  N  N     . ASP A  1  238 ? 12.839  38.471 3.235   1.00 21.28  ? 1037 ASP B N     1 
ATOM   1790  C  CA    . ASP A  1  238 ? 12.008  38.113 4.385   1.00 22.12  ? 1037 ASP B CA    1 
ATOM   1791  C  C     . ASP A  1  238 ? 11.131  39.239 4.766   1.00 21.27  ? 1037 ASP B C     1 
ATOM   1792  O  O     . ASP A  1  238 ? 11.580  40.408 4.774   1.00 22.60  ? 1037 ASP B O     1 
ATOM   1793  C  CB    . ASP A  1  238 ? 12.926  37.700 5.542   1.00 22.63  ? 1037 ASP B CB    1 
ATOM   1794  C  CG    . ASP A  1  238 ? 12.195  36.977 6.636   1.00 24.20  ? 1037 ASP B CG    1 
ATOM   1795  O  OD1   . ASP A  1  238 ? 11.502  37.675 7.424   1.00 23.24  ? 1037 ASP B OD1   1 
ATOM   1796  O  OD2   . ASP A  1  238 ? 12.275  35.723 6.714   1.00 26.46  ? 1037 ASP B OD2   1 
ATOM   1797  N  N     . VAL A  1  239 ? 9.876   38.921 5.118   1.00 21.93  ? 1038 VAL B N     1 
ATOM   1798  C  CA    . VAL A  1  239 ? 8.875   39.967 5.478   1.00 22.20  ? 1038 VAL B CA    1 
ATOM   1799  C  C     . VAL A  1  239 ? 9.339   40.755 6.730   1.00 21.43  ? 1038 VAL B C     1 
ATOM   1800  O  O     . VAL A  1  239 ? 9.019   41.925 6.854   1.00 21.03  ? 1038 VAL B O     1 
ATOM   1801  C  CB    . VAL A  1  239 ? 7.505   39.378 5.634   1.00 22.62  ? 1038 VAL B CB    1 
ATOM   1802  C  CG1   . VAL A  1  239 ? 7.395   38.557 6.898   1.00 22.12  ? 1038 VAL B CG1   1 
ATOM   1803  C  CG2   . VAL A  1  239 ? 6.450   40.476 5.601   1.00 23.40  ? 1038 VAL B CG2   1 
ATOM   1804  N  N     . ARG A  1  240 ? 10.123  40.142 7.579   1.00 22.03  ? 1039 ARG B N     1 
ATOM   1805  C  CA    . ARG A  1  240 ? 10.382  40.694 8.909   1.00 23.08  ? 1039 ARG B CA    1 
ATOM   1806  C  C     . ARG A  1  240 ? 11.490  41.752 8.855   1.00 23.88  ? 1039 ARG B C     1 
ATOM   1807  O  O     . ARG A  1  240 ? 11.317  42.853 9.406   1.00 24.45  ? 1039 ARG B O     1 
ATOM   1808  C  CB    . ARG A  1  240 ? 10.785  39.572 9.904   1.00 24.18  ? 1039 ARG B CB    1 
ATOM   1809  C  CG    . ARG A  1  240 ? 9.637   38.630 10.225  1.00 23.40  ? 1039 ARG B CG    1 
ATOM   1810  C  CD    . ARG A  1  240 ? 10.180  37.401 10.949  1.00 24.38  ? 1039 ARG B CD    1 
ATOM   1811  N  NE    . ARG A  1  240 ? 11.045  36.600 10.085  1.00 25.14  ? 1039 ARG B NE    1 
ATOM   1812  C  CZ    . ARG A  1  240 ? 11.748  35.548 10.497  1.00 25.77  ? 1039 ARG B CZ    1 
ATOM   1813  N  NH1   . ARG A  1  240 ? 11.687  35.061 11.755  1.00 25.48  ? 1039 ARG B NH1   1 
ATOM   1814  N  NH2   . ARG A  1  240 ? 12.537  34.912 9.671   1.00 26.25  ? 1039 ARG B NH2   1 
ATOM   1815  N  N     . ASP A  1  241 ? 12.612  41.467 8.161   1.00 22.10  ? 1040 ASP B N     1 
ATOM   1816  C  CA    . ASP A  1  241 ? 13.699  42.413 8.052   1.00 23.58  ? 1040 ASP B CA    1 
ATOM   1817  C  C     . ASP A  1  241 ? 13.922  42.931 6.660   1.00 23.29  ? 1040 ASP B C     1 
ATOM   1818  O  O     . ASP A  1  241 ? 14.780  43.814 6.457   1.00 23.72  ? 1040 ASP B O     1 
ATOM   1819  C  CB    . ASP A  1  241 ? 15.007  41.817 8.645   1.00 23.45  ? 1040 ASP B CB    1 
ATOM   1820  C  CG    . ASP A  1  241 ? 15.472  40.600 7.869   1.00 23.18  ? 1040 ASP B CG    1 
ATOM   1821  O  OD1   . ASP A  1  241 ? 14.774  40.131 6.904   1.00 22.71  ? 1040 ASP B OD1   1 
ATOM   1822  O  OD2   . ASP A  1  241 ? 16.556  40.084 8.217   1.00 22.16  ? 1040 ASP B OD2   1 
ATOM   1823  N  N     . GLY A  1  242 ? 13.167  42.427 5.677   1.00 22.47  ? 1041 GLY B N     1 
ATOM   1824  C  CA    . GLY A  1  242 ? 13.260  42.949 4.296   1.00 21.32  ? 1041 GLY B CA    1 
ATOM   1825  C  C     . GLY A  1  242 ? 14.469  42.556 3.549   1.00 21.59  ? 1041 GLY B C     1 
ATOM   1826  O  O     . GLY A  1  242 ? 14.781  43.166 2.510   1.00 21.78  ? 1041 GLY B O     1 
ATOM   1827  N  N     . LEU A  1  243 ? 15.192  41.505 3.998   1.00 21.16  ? 1042 LEU B N     1 
ATOM   1828  C  CA    . LEU A  1  243 ? 16.492  41.201 3.422   1.00 20.38  ? 1042 LEU B CA    1 
ATOM   1829  C  C     . LEU A  1  243 ? 16.428  39.806 2.749   1.00 20.56  ? 1042 LEU B C     1 
ATOM   1830  O  O     . LEU A  1  243 ? 15.698  38.908 3.192   1.00 21.12  ? 1042 LEU B O     1 
ATOM   1831  C  CB    . LEU A  1  243 ? 17.550  41.190 4.543   1.00 19.57  ? 1042 LEU B CB    1 
ATOM   1832  C  CG    . LEU A  1  243 ? 17.776  42.517 5.244   1.00 19.38  ? 1042 LEU B CG    1 
ATOM   1833  C  CD1   . LEU A  1  243 ? 18.708  42.306 6.441   1.00 19.32  ? 1042 LEU B CD1   1 
ATOM   1834  C  CD2   . LEU A  1  243 ? 18.364  43.576 4.280   1.00 19.16  ? 1042 LEU B CD2   1 
ATOM   1835  N  N     . LYS A  1  244 ? 17.170  39.660 1.653   1.00 19.94  ? 1043 LYS B N     1 
ATOM   1836  C  CA    . LYS A  1  244 ? 17.602  38.455 1.026   1.00 19.95  ? 1043 LYS B CA    1 
ATOM   1837  C  C     . LYS A  1  244 ? 18.850  37.936 1.781   1.00 20.09  ? 1043 LYS B C     1 
ATOM   1838  O  O     . LYS A  1  244 ? 19.495  38.649 2.542   1.00 20.90  ? 1043 LYS B O     1 
ATOM   1839  C  CB    . LYS A  1  244 ? 17.986  38.685 -0.429  1.00 19.00  ? 1043 LYS B CB    1 
ATOM   1840  C  CG    . LYS A  1  244 ? 16.840  39.335 -1.242  1.00 19.01  ? 1043 LYS B CG    1 
ATOM   1841  C  CD    . LYS A  1  244 ? 17.368  39.505 -2.709  1.00 19.28  ? 1043 LYS B CD    1 
ATOM   1842  C  CE    . LYS A  1  244 ? 16.357  40.361 -3.486  1.00 19.46  ? 1043 LYS B CE    1 
ATOM   1843  N  NZ    . LYS A  1  244 ? 16.791  40.526 -4.885  1.00 21.32  ? 1043 LYS B NZ    1 
ATOM   1844  N  N     . PRO A  1  245 ? 19.145  36.634 1.657   1.00 20.95  ? 1044 PRO B N     1 
ATOM   1845  C  CA    . PRO A  1  245 ? 20.318  36.102 2.383   1.00 20.70  ? 1044 PRO B CA    1 
ATOM   1846  C  C     . PRO A  1  245 ? 21.616  36.838 2.086   1.00 21.18  ? 1044 PRO B C     1 
ATOM   1847  O  O     . PRO A  1  245 ? 22.421  37.019 3.010   1.00 21.56  ? 1044 PRO B O     1 
ATOM   1848  C  CB    . PRO A  1  245 ? 20.395  34.649 1.825   1.00 21.69  ? 1044 PRO B CB    1 
ATOM   1849  C  CG    . PRO A  1  245 ? 18.965  34.339 1.530   1.00 20.59  ? 1044 PRO B CG    1 
ATOM   1850  C  CD    . PRO A  1  245 ? 18.378  35.584 0.944   1.00 20.65  ? 1044 PRO B CD    1 
ATOM   1851  N  N     . VAL A  1  246 ? 21.903  37.245 0.818   1.00 20.91  ? 1045 VAL B N     1 
ATOM   1852  C  CA    . VAL A  1  246 ? 23.142  37.874 0.527   1.00 20.53  ? 1045 VAL B CA    1 
ATOM   1853  C  C     . VAL A  1  246 ? 23.293  39.232 1.317   1.00 21.35  ? 1045 VAL B C     1 
ATOM   1854  O  O     . VAL A  1  246 ? 24.356  39.557 1.868   1.00 19.65  ? 1045 VAL B O     1 
ATOM   1855  C  CB    . VAL A  1  246 ? 23.408  38.040 -0.946  1.00 20.52  ? 1045 VAL B CB    1 
ATOM   1856  C  CG1   . VAL A  1  246 ? 22.401  39.068 -1.580  1.00 19.89  ? 1045 VAL B CG1   1 
ATOM   1857  C  CG2   . VAL A  1  246 ? 24.850  38.504 -1.221  1.00 21.63  ? 1045 VAL B CG2   1 
ATOM   1858  N  N     . HIS A  1  247 ? 22.205  39.981 1.386   1.00 20.82  ? 1046 HIS B N     1 
ATOM   1859  C  CA    . HIS A  1  247 ? 22.240  41.255 2.082   1.00 22.65  ? 1046 HIS B CA    1 
ATOM   1860  C  C     . HIS A  1  247 ? 22.345  41.067 3.604   1.00 21.08  ? 1046 HIS B C     1 
ATOM   1861  O  O     . HIS A  1  247 ? 23.117  41.756 4.270   1.00 20.78  ? 1046 HIS B O     1 
ATOM   1862  C  CB    . HIS A  1  247 ? 21.005  42.085 1.757   1.00 24.81  ? 1046 HIS B CB    1 
ATOM   1863  C  CG    . HIS A  1  247 ? 20.847  42.340 0.283   1.00 28.65  ? 1046 HIS B CG    1 
ATOM   1864  N  ND1   . HIS A  1  247 ? 20.138  41.501 -0.531  1.00 30.25  ? 1046 HIS B ND1   1 
ATOM   1865  C  CD2   . HIS A  1  247 ? 21.338  43.340 -0.511  1.00 27.72  ? 1046 HIS B CD2   1 
ATOM   1866  C  CE1   . HIS A  1  247 ? 20.200  41.982 -1.766  1.00 29.35  ? 1046 HIS B CE1   1 
ATOM   1867  N  NE2   . HIS A  1  247 ? 20.918  43.075 -1.774  1.00 32.20  ? 1046 HIS B NE2   1 
ATOM   1868  N  N     . ARG A  1  248 ? 21.566  40.130 4.146   1.00 19.86  ? 1047 ARG B N     1 
ATOM   1869  C  CA    . ARG A  1  248 ? 21.625  39.842 5.567   1.00 20.45  ? 1047 ARG B CA    1 
ATOM   1870  C  C     . ARG A  1  248 ? 23.020  39.408 5.947   1.00 20.64  ? 1047 ARG B C     1 
ATOM   1871  O  O     . ARG A  1  248 ? 23.518  39.767 7.050   1.00 19.98  ? 1047 ARG B O     1 
ATOM   1872  C  CB    . ARG A  1  248 ? 20.607  38.783 5.941   1.00 19.61  ? 1047 ARG B CB    1 
ATOM   1873  C  CG    . ARG A  1  248 ? 20.400  38.618 7.465   1.00 20.27  ? 1047 ARG B CG    1 
ATOM   1874  C  CD    . ARG A  1  248 ? 19.358  37.564 7.793   1.00 19.70  ? 1047 ARG B CD    1 
ATOM   1875  N  NE    . ARG A  1  248 ? 18.025  37.943 7.293   1.00 21.49  ? 1047 ARG B NE    1 
ATOM   1876  C  CZ    . ARG A  1  248 ? 17.408  37.351 6.274   1.00 21.44  ? 1047 ARG B CZ    1 
ATOM   1877  N  NH1   . ARG A  1  248 ? 17.987  36.338 5.638   1.00 20.94  ? 1047 ARG B NH1   1 
ATOM   1878  N  NH2   . ARG A  1  248 ? 16.184  37.751 5.913   1.00 20.23  ? 1047 ARG B NH2   1 
ATOM   1879  N  N     . ARG A  1  249 ? 23.686  38.620 5.084   1.00 21.21  ? 1048 ARG B N     1 
ATOM   1880  C  CA    . ARG A  1  249 ? 25.040  38.137 5.400   1.00 21.08  ? 1048 ARG B CA    1 
ATOM   1881  C  C     . ARG A  1  249 ? 26.065  39.266 5.279   1.00 21.16  ? 1048 ARG B C     1 
ATOM   1882  O  O     . ARG A  1  249 ? 27.026  39.301 6.064   1.00 20.55  ? 1048 ARG B O     1 
ATOM   1883  C  CB    . ARG A  1  249 ? 25.393  36.987 4.476   1.00 21.53  ? 1048 ARG B CB    1 
ATOM   1884  C  CG    . ARG A  1  249 ? 24.688  35.680 4.913   1.00 21.50  ? 1048 ARG B CG    1 
ATOM   1885  C  CD    . ARG A  1  249 ? 24.615  34.696 3.739   1.00 21.35  ? 1048 ARG B CD    1 
ATOM   1886  N  NE    . ARG A  1  249 ? 23.967  33.471 4.203   1.00 22.21  ? 1048 ARG B NE    1 
ATOM   1887  C  CZ    . ARG A  1  249 ? 23.534  32.492 3.394   1.00 22.67  ? 1048 ARG B CZ    1 
ATOM   1888  N  NH1   . ARG A  1  249 ? 23.662  32.559 2.063   1.00 24.29  ? 1048 ARG B NH1   1 
ATOM   1889  N  NH2   . ARG A  1  249 ? 22.964  31.431 3.913   1.00 23.24  ? 1048 ARG B NH2   1 
ATOM   1890  N  N     . ILE A  1  250 ? 25.886  40.180 4.317   1.00 21.30  ? 1049 ILE B N     1 
ATOM   1891  C  CA    . ILE A  1  250 ? 26.734  41.351 4.236   1.00 20.32  ? 1049 ILE B CA    1 
ATOM   1892  C  C     . ILE A  1  250 ? 26.610  42.186 5.520   1.00 21.34  ? 1049 ILE B C     1 
ATOM   1893  O  O     . ILE A  1  250 ? 27.639  42.576 6.110   1.00 21.46  ? 1049 ILE B O     1 
ATOM   1894  C  CB    . ILE A  1  250 ? 26.353  42.212 3.006   1.00 20.53  ? 1049 ILE B CB    1 
ATOM   1895  C  CG1   . ILE A  1  250 ? 26.774  41.410 1.738   1.00 20.11  ? 1049 ILE B CG1   1 
ATOM   1896  C  CG2   . ILE A  1  250 ? 27.141  43.507 3.039   1.00 20.40  ? 1049 ILE B CG2   1 
ATOM   1897  C  CD1   . ILE A  1  250 ? 26.077  41.991 0.472   1.00 20.98  ? 1049 ILE B CD1   1 
ATOM   1898  N  N     . LEU A  1  251 ? 25.394  42.483 5.934   1.00 21.06  ? 1050 LEU B N     1 
ATOM   1899  C  CA    . LEU A  1  251 ? 25.191  43.346 7.111   1.00 21.95  ? 1050 LEU B CA    1 
ATOM   1900  C  C     . LEU A  1  251 ? 25.637  42.654 8.406   1.00 22.21  ? 1050 LEU B C     1 
ATOM   1901  O  O     . LEU A  1  251 ? 26.263  43.281 9.245   1.00 22.58  ? 1050 LEU B O     1 
ATOM   1902  C  CB    . LEU A  1  251 ? 23.679  43.738 7.215   1.00 22.17  ? 1050 LEU B CB    1 
ATOM   1903  C  CG    . LEU A  1  251 ? 23.170  44.471 5.960   1.00 22.94  ? 1050 LEU B CG    1 
ATOM   1904  C  CD1   . LEU A  1  251 ? 21.729  44.923 6.205   1.00 25.06  ? 1050 LEU B CD1   1 
ATOM   1905  C  CD2   . LEU A  1  251 ? 24.041  45.732 5.744   1.00 22.02  ? 1050 LEU B CD2   1 
ATOM   1906  N  N     . TYR A  1  252 ? 25.353  41.353 8.566   1.00 21.74  ? 1051 TYR B N     1 
ATOM   1907  C  CA    . TYR A  1  252 ? 25.861  40.623 9.721   1.00 22.67  ? 1051 TYR B CA    1 
ATOM   1908  C  C     . TYR A  1  252 ? 27.383  40.556 9.707   1.00 23.34  ? 1051 TYR B C     1 
ATOM   1909  O  O     . TYR A  1  252 ? 28.014  40.701 10.766  1.00 23.30  ? 1051 TYR B O     1 
ATOM   1910  C  CB    . TYR A  1  252 ? 25.296  39.173 9.697   1.00 22.58  ? 1051 TYR B CB    1 
ATOM   1911  C  CG    . TYR A  1  252 ? 25.780  38.272 10.816  1.00 23.52  ? 1051 TYR B CG    1 
ATOM   1912  C  CD1   . TYR A  1  252 ? 25.473  38.535 12.173  1.00 24.26  ? 1051 TYR B CD1   1 
ATOM   1913  C  CD2   . TYR A  1  252 ? 26.533  37.148 10.548  1.00 25.77  ? 1051 TYR B CD2   1 
ATOM   1914  C  CE1   . TYR A  1  252 ? 25.913  37.721 13.181  1.00 25.44  ? 1051 TYR B CE1   1 
ATOM   1915  C  CE2   . TYR A  1  252 ? 26.984  36.307 11.553  1.00 25.88  ? 1051 TYR B CE2   1 
ATOM   1916  C  CZ    . TYR A  1  252 ? 26.679  36.594 12.837  1.00 27.32  ? 1051 TYR B CZ    1 
ATOM   1917  O  OH    . TYR A  1  252 ? 27.143  35.740 13.846  1.00 31.09  ? 1051 TYR B OH    1 
ATOM   1918  N  N     . GLY A  1  253 ? 27.968  40.399 8.514   1.00 22.45  ? 1052 GLY B N     1 
ATOM   1919  C  CA    . GLY A  1  253 ? 29.425  40.365 8.421   1.00 22.86  ? 1052 GLY B CA    1 
ATOM   1920  C  C     . GLY A  1  253 ? 30.027  41.711 8.822   1.00 23.52  ? 1052 GLY B C     1 
ATOM   1921  O  O     . GLY A  1  253 ? 31.059  41.735 9.495   1.00 22.83  ? 1052 GLY B O     1 
ATOM   1922  N  N     . LEU A  1  254 ? 29.429  42.823 8.393   1.00 23.10  ? 1053 LEU B N     1 
ATOM   1923  C  CA    . LEU A  1  254 ? 29.909  44.119 8.836   1.00 25.07  ? 1053 LEU B CA    1 
ATOM   1924  C  C     . LEU A  1  254 ? 29.846  44.242 10.361  1.00 24.75  ? 1053 LEU B C     1 
ATOM   1925  O  O     . LEU A  1  254 ? 30.759  44.829 10.979  1.00 24.47  ? 1053 LEU B O     1 
ATOM   1926  C  CB    . LEU A  1  254 ? 29.061  45.245 8.209   1.00 24.92  ? 1053 LEU B CB    1 
ATOM   1927  C  CG    . LEU A  1  254 ? 29.254  45.518 6.704   1.00 26.17  ? 1053 LEU B CG    1 
ATOM   1928  C  CD1   . LEU A  1  254 ? 28.160  46.409 6.173   1.00 26.99  ? 1053 LEU B CD1   1 
ATOM   1929  C  CD2   . LEU A  1  254 ? 30.660  46.110 6.456   1.00 27.77  ? 1053 LEU B CD2   1 
ATOM   1930  N  N     . ASN A  1  255 ? 28.810  43.699 10.970  1.00 24.50  ? 1054 ASN B N     1 
ATOM   1931  C  CA    . ASN A  1  255 ? 28.671  43.770 12.427  1.00 26.12  ? 1054 ASN B CA    1 
ATOM   1932  C  C     . ASN A  1  255 ? 29.710  42.850 13.120  1.00 26.33  ? 1054 ASN B C     1 
ATOM   1933  O  O     . ASN A  1  255 ? 30.325  43.261 14.112  1.00 28.97  ? 1054 ASN B O     1 
ATOM   1934  C  CB    . ASN A  1  255 ? 27.259  43.358 12.830  1.00 27.13  ? 1054 ASN B CB    1 
ATOM   1935  C  CG    . ASN A  1  255 ? 26.884  43.863 14.203  1.00 31.53  ? 1054 ASN B CG    1 
ATOM   1936  O  OD1   . ASN A  1  255 ? 26.907  45.075 14.444  1.00 33.02  ? 1054 ASN B OD1   1 
ATOM   1937  N  ND2   . ASN A  1  255 ? 26.498  42.968 15.074  1.00 29.28  ? 1054 ASN B ND2   1 
ATOM   1938  N  N     . GLU A  1  256 ? 29.903  41.649 12.620  1.00 26.03  ? 1055 GLU B N     1 
ATOM   1939  C  CA    . GLU A  1  256 ? 30.886  40.781 13.201  1.00 28.40  ? 1055 GLU B CA    1 
ATOM   1940  C  C     . GLU A  1  256 ? 32.323  41.281 13.014  1.00 29.63  ? 1055 GLU B C     1 
ATOM   1941  O  O     . GLU A  1  256 ? 33.185  40.983 13.825  1.00 27.07  ? 1055 GLU B O     1 
ATOM   1942  C  CB    . GLU A  1  256 ? 30.804  39.361 12.502  1.00 30.74  ? 1055 GLU B CB    1 
ATOM   1943  C  CG    . GLU A  1  256 ? 29.604  38.572 12.884  1.00 35.02  ? 1055 GLU B CG    1 
ATOM   1944  C  CD    . GLU A  1  256 ? 29.608  38.251 14.354  1.00 39.83  ? 1055 GLU B CD    1 
ATOM   1945  O  OE1   . GLU A  1  256 ? 30.405  37.293 14.656  1.00 44.18  ? 1055 GLU B OE1   1 
ATOM   1946  O  OE2   . GLU A  1  256 ? 28.824  38.975 15.116  1.00 40.08  ? 1055 GLU B OE2   1 
ATOM   1947  N  N     . GLN A  1  257 ? 32.555  42.041 11.977  1.00 28.17  ? 1056 GLN B N     1 
ATOM   1948  C  CA    . GLN A  1  257 ? 33.882  42.654 11.729  1.00 29.67  ? 1056 GLN B CA    1 
ATOM   1949  C  C     . GLN A  1  257 ? 34.053  44.016 12.427  1.00 28.73  ? 1056 GLN B C     1 
ATOM   1950  O  O     . GLN A  1  257 ? 35.045  44.636 12.238  1.00 28.11  ? 1056 GLN B O     1 
ATOM   1951  C  CB    . GLN A  1  257 ? 34.097  42.828 10.205  1.00 31.11  ? 1056 GLN B CB    1 
ATOM   1952  C  CG    . GLN A  1  257 ? 34.096  41.514 9.455   1.00 32.21  ? 1056 GLN B CG    1 
ATOM   1953  C  CD    . GLN A  1  257 ? 33.823  41.692 7.948   1.00 31.25  ? 1056 GLN B CD    1 
ATOM   1954  O  OE1   . GLN A  1  257 ? 34.291  42.629 7.354   1.00 28.48  ? 1056 GLN B OE1   1 
ATOM   1955  N  NE2   . GLN A  1  257 ? 33.078  40.782 7.369   1.00 30.17  ? 1056 GLN B NE2   1 
ATOM   1956  N  N     . GLY A  1  258 ? 33.072  44.444 13.219  1.00 28.75  ? 1057 GLY B N     1 
ATOM   1957  C  CA    . GLY A  1  258 ? 33.217  45.687 13.942  1.00 30.65  ? 1057 GLY B CA    1 
ATOM   1958  C  C     . GLY A  1  258 ? 33.121  46.922 13.093  1.00 30.33  ? 1057 GLY B C     1 
ATOM   1959  O  O     . GLY A  1  258 ? 33.679  47.986 13.447  1.00 29.27  ? 1057 GLY B O     1 
ATOM   1960  N  N     . MET A  1  259 ? 32.447  46.830 11.917  1.00 29.17  ? 1058 MET B N     1 
ATOM   1961  C  CA    . MET A  1  259 ? 32.486  47.891 10.929  1.00 30.72  ? 1058 MET B CA    1 
ATOM   1962  C  C     . MET A  1  259 ? 31.401  48.944 11.191  1.00 30.84  ? 1058 MET B C     1 
ATOM   1963  O  O     . MET A  1  259 ? 30.641  49.327 10.276  1.00 30.84  ? 1058 MET B O     1 
ATOM   1964  C  CB    . MET A  1  259 ? 32.320  47.280 9.541   1.00 30.61  ? 1058 MET B CB    1 
ATOM   1965  C  CG    . MET A  1  259 ? 33.504  46.410 9.144   1.00 33.17  ? 1058 MET B CG    1 
ATOM   1966  S  SD    . MET A  1  259 ? 35.118  47.370 9.440   1.00 34.40  ? 1058 MET B SD    1 
ATOM   1967  C  CE    . MET A  1  259 ? 34.709  48.805 8.428   1.00 34.26  ? 1058 MET B CE    1 
ATOM   1968  N  N     . THR A  1  260 ? 31.339  49.413 12.430  1.00 29.31  ? 1059 THR B N     1 
ATOM   1969  C  CA    . THR A  1  260 ? 30.341  50.398 12.810  1.00 30.79  ? 1059 THR B CA    1 
ATOM   1970  C  C     . THR A  1  260 ? 30.728  51.777 12.262  1.00 30.50  ? 1059 THR B C     1 
ATOM   1971  O  O     . THR A  1  260 ? 31.863  51.999 11.859  1.00 31.50  ? 1059 THR B O     1 
ATOM   1972  C  CB    . THR A  1  260 ? 30.222  50.439 14.356  1.00 29.60  ? 1059 THR B CB    1 
ATOM   1973  O  OG1   . THR A  1  260 ? 31.506  50.670 14.931  1.00 33.64  ? 1059 THR B OG1   1 
ATOM   1974  C  CG2   . THR A  1  260 ? 29.641  49.110 14.832  1.00 29.41  ? 1059 THR B CG2   1 
ATOM   1975  N  N     . PRO A  1  261 ? 29.777  52.718 12.216  1.00 32.66  ? 1060 PRO B N     1 
ATOM   1976  C  CA    . PRO A  1  261 ? 30.062  54.016 11.599  1.00 32.47  ? 1060 PRO B CA    1 
ATOM   1977  C  C     . PRO A  1  261 ? 31.182  54.803 12.261  1.00 35.97  ? 1060 PRO B C     1 
ATOM   1978  O  O     . PRO A  1  261 ? 31.751  55.683 11.601  1.00 35.86  ? 1060 PRO B O     1 
ATOM   1979  C  CB    . PRO A  1  261 ? 28.727  54.775 11.765  1.00 33.01  ? 1060 PRO B CB    1 
ATOM   1980  C  CG    . PRO A  1  261 ? 27.691  53.687 11.847  1.00 31.53  ? 1060 PRO B CG    1 
ATOM   1981  C  CD    . PRO A  1  261 ? 28.333  52.592 12.575  1.00 31.63  ? 1060 PRO B CD    1 
ATOM   1982  N  N     . ASP A  1  262 ? 31.514  54.524 13.513  1.00 36.02  ? 1061 ASP B N     1 
ATOM   1983  C  CA    . ASP A  1  262 ? 32.594  55.266 14.182  1.00 40.44  ? 1061 ASP B CA    1 
ATOM   1984  C  C     . ASP A  1  262 ? 33.969  54.760 13.793  1.00 43.41  ? 1061 ASP B C     1 
ATOM   1985  O  O     . ASP A  1  262 ? 34.939  55.509 13.932  1.00 51.15  ? 1061 ASP B O     1 
ATOM   1986  C  CB    . ASP A  1  262 ? 32.454  55.222 15.701  1.00 39.71  ? 1061 ASP B CB    1 
ATOM   1987  C  CG    . ASP A  1  262 ? 32.293  53.741 16.209  1.00 46.12  ? 1061 ASP B CG    1 
ATOM   1988  O  OD1   . ASP A  1  262 ? 31.493  52.977 15.609  1.00 43.65  ? 1061 ASP B OD1   1 
ATOM   1989  O  OD2   . ASP A  1  262 ? 32.972  53.367 17.183  1.00 48.29  ? 1061 ASP B OD2   1 
ATOM   1990  N  N     . LYS A  1  263 ? 34.083  53.524 13.314  1.00 40.35  ? 1062 LYS B N     1 
ATOM   1991  C  CA    . LYS A  1  263 ? 35.376  53.012 12.904  1.00 39.30  ? 1062 LYS B CA    1 
ATOM   1992  C  C     . LYS A  1  263 ? 35.735  53.415 11.505  1.00 36.23  ? 1062 LYS B C     1 
ATOM   1993  O  O     . LYS A  1  263 ? 34.898  53.888 10.746  1.00 34.58  ? 1062 LYS B O     1 
ATOM   1994  C  CB    . LYS A  1  263 ? 35.391  51.468 13.060  1.00 41.86  ? 1062 LYS B CB    1 
ATOM   1995  C  CG    . LYS A  1  263 ? 34.770  50.927 14.332  1.00 43.03  ? 1062 LYS B CG    1 
ATOM   1996  C  CD    . LYS A  1  263 ? 35.652  51.200 15.512  1.00 41.85  ? 1062 LYS B CD    1 
ATOM   1997  N  N     A SER A  1  264 ? 37.015  53.282 11.151  0.50 35.74  ? 1063 SER B N     1 
ATOM   1998  N  N     B SER A  1  264 ? 37.014  53.283 11.148  0.50 34.37  ? 1063 SER B N     1 
ATOM   1999  C  CA    A SER A  1  264 ? 37.499  53.581 9.812   0.50 35.00  ? 1063 SER B CA    1 
ATOM   2000  C  CA    B SER A  1  264 ? 37.515  53.559 9.816   0.50 32.95  ? 1063 SER B CA    1 
ATOM   2001  C  C     A SER A  1  264 ? 36.915  52.647 8.744   0.50 34.31  ? 1063 SER B C     1 
ATOM   2002  C  C     B SER A  1  264 ? 36.931  52.643 8.742   0.50 33.03  ? 1063 SER B C     1 
ATOM   2003  O  O     A SER A  1  264 ? 36.537  51.510 9.030   0.50 35.38  ? 1063 SER B O     1 
ATOM   2004  O  O     B SER A  1  264 ? 36.581  51.496 9.029   0.50 34.02  ? 1063 SER B O     1 
ATOM   2005  C  CB    A SER A  1  264 ? 39.019  53.574 9.798   0.50 36.14  ? 1063 SER B CB    1 
ATOM   2006  C  CB    B SER A  1  264 ? 39.060  53.463 9.880   0.50 32.52  ? 1063 SER B CB    1 
ATOM   2007  O  OG    A SER A  1  264 ? 39.449  54.085 8.543   0.50 35.92  ? 1063 SER B OG    1 
ATOM   2008  O  OG    B SER A  1  264 ? 39.636  54.245 10.882  0.50 29.94  ? 1063 SER B OG    1 
ATOM   2009  N  N     . TYR A  1  265 ? 36.894  53.125 7.520   1.00 32.80  ? 1064 TYR B N     1 
ATOM   2010  C  CA    . TYR A  1  265 ? 36.503  52.280 6.387   1.00 31.35  ? 1064 TYR B CA    1 
ATOM   2011  C  C     . TYR A  1  265 ? 37.439  51.131 6.202   1.00 30.03  ? 1064 TYR B C     1 
ATOM   2012  O  O     . TYR A  1  265 ? 38.602  51.197 6.523   1.00 29.76  ? 1064 TYR B O     1 
ATOM   2013  C  CB    . TYR A  1  265 ? 36.515  53.114 5.073   1.00 33.16  ? 1064 TYR B CB    1 
ATOM   2014  C  CG    . TYR A  1  265 ? 35.417  54.181 4.964   1.00 32.36  ? 1064 TYR B CG    1 
ATOM   2015  C  CD1   . TYR A  1  265 ? 34.136  53.844 4.505   1.00 31.72  ? 1064 TYR B CD1   1 
ATOM   2016  C  CD2   . TYR A  1  265 ? 35.718  55.523 5.227   1.00 33.69  ? 1064 TYR B CD2   1 
ATOM   2017  C  CE1   . TYR A  1  265 ? 33.178  54.779 4.360   1.00 30.87  ? 1064 TYR B CE1   1 
ATOM   2018  C  CE2   . TYR A  1  265 ? 34.742  56.493 5.069   1.00 32.08  ? 1064 TYR B CE2   1 
ATOM   2019  C  CZ    . TYR A  1  265 ? 33.501  56.160 4.652   1.00 29.53  ? 1064 TYR B CZ    1 
ATOM   2020  O  OH    . TYR A  1  265 ? 32.529  57.147 4.509   1.00 30.67  ? 1064 TYR B OH    1 
ATOM   2021  N  N     . LYS A  1  266 ? 36.901  50.016 5.702   1.00 27.90  ? 1065 LYS B N     1 
ATOM   2022  C  CA    . LYS A  1  266 ? 37.659  48.767 5.474   1.00 28.09  ? 1065 LYS B CA    1 
ATOM   2023  C  C     . LYS A  1  266 ? 37.552  48.433 3.981   1.00 27.50  ? 1065 LYS B C     1 
ATOM   2024  O  O     . LYS A  1  266 ? 36.486  48.606 3.364   1.00 26.07  ? 1065 LYS B O     1 
ATOM   2025  C  CB    . LYS A  1  266 ? 37.103  47.660 6.327   1.00 29.33  ? 1065 LYS B CB    1 
ATOM   2026  C  CG    . LYS A  1  266 ? 37.780  46.301 6.161   1.00 33.04  ? 1065 LYS B CG    1 
ATOM   2027  C  CD    . LYS A  1  266 ? 37.173  45.354 7.268   1.00 34.84  ? 1065 LYS B CD    1 
ATOM   2028  C  CE    . LYS A  1  266 ? 37.469  43.915 7.002   1.00 34.62  ? 1065 LYS B CE    1 
ATOM   2029  N  NZ    . LYS A  1  266 ? 36.767  43.111 7.974   1.00 34.67  ? 1065 LYS B NZ    1 
ATOM   2030  N  N     A LYS A  1  267 ? 38.679  47.962 3.416   0.50 27.07  ? 1066 LYS B N     1 
ATOM   2031  N  N     B LYS A  1  267 ? 38.638  47.858 3.441   0.50 26.96  ? 1066 LYS B N     1 
ATOM   2032  C  CA    A LYS A  1  267 ? 38.689  47.545 2.018   0.50 26.92  ? 1066 LYS B CA    1 
ATOM   2033  C  CA    B LYS A  1  267 ? 38.666  47.550 2.028   0.50 26.68  ? 1066 LYS B CA    1 
ATOM   2034  C  C     A LYS A  1  267 ? 37.557  46.560 1.717   0.50 25.18  ? 1066 LYS B C     1 
ATOM   2035  C  C     B LYS A  1  267 ? 37.560  46.552 1.699   0.50 25.03  ? 1066 LYS B C     1 
ATOM   2036  O  O     A LYS A  1  267 ? 37.298  45.628 2.492   0.50 23.82  ? 1066 LYS B O     1 
ATOM   2037  O  O     B LYS A  1  267 ? 37.281  45.659 2.475   0.50 23.61  ? 1066 LYS B O     1 
ATOM   2038  C  CB    A LYS A  1  267 ? 40.060  46.901 1.713   0.50 29.69  ? 1066 LYS B CB    1 
ATOM   2039  C  CB    B LYS A  1  267 ? 40.050  46.992 1.657   0.50 29.24  ? 1066 LYS B CB    1 
ATOM   2040  C  CG    A LYS A  1  267 ? 41.169  47.975 1.565   0.50 32.62  ? 1066 LYS B CG    1 
ATOM   2041  C  CG    B LYS A  1  267 ? 41.181  48.078 1.574   0.50 31.50  ? 1066 LYS B CG    1 
ATOM   2042  C  CD    A LYS A  1  267 ? 40.899  48.775 0.281   0.50 35.85  ? 1066 LYS B CD    1 
ATOM   2043  C  CD    B LYS A  1  267 ? 41.034  48.711 0.188   0.50 34.26  ? 1066 LYS B CD    1 
ATOM   2044  C  CE    A LYS A  1  267 ? 42.145  49.590 -0.130  0.50 39.19  ? 1066 LYS B CE    1 
ATOM   2045  C  CE    B LYS A  1  267 ? 41.670  50.088 0.189   0.50 36.68  ? 1066 LYS B CE    1 
ATOM   2046  N  NZ    A LYS A  1  267 ? 41.955  50.283 -1.451  0.50 41.21  ? 1066 LYS B NZ    1 
ATOM   2047  N  NZ    B LYS A  1  267 ? 42.803  50.211 1.160   0.50 38.62  ? 1066 LYS B NZ    1 
ATOM   2048  N  N     . SER A  1  268 ? 36.881  46.800 0.601   1.00 23.69  ? 1067 SER B N     1 
ATOM   2049  C  CA    . SER A  1  268 ? 35.702  45.973 0.251   1.00 23.81  ? 1067 SER B CA    1 
ATOM   2050  C  C     . SER A  1  268 ? 36.102  44.514 -0.005  1.00 23.18  ? 1067 SER B C     1 
ATOM   2051  O  O     . SER A  1  268 ? 35.303  43.610 0.242   1.00 22.63  ? 1067 SER B O     1 
ATOM   2052  C  CB    . SER A  1  268 ? 35.004  46.527 -0.978  1.00 22.59  ? 1067 SER B CB    1 
ATOM   2053  O  OG    . SER A  1  268 ? 34.553  47.862 -0.712  1.00 26.03  ? 1067 SER B OG    1 
ATOM   2054  N  N     . ALA A  1  269 ? 37.318  44.294 -0.540  1.00 23.53  ? 1068 ALA B N     1 
ATOM   2055  C  CA    . ALA A  1  269 ? 37.746  42.929 -0.789  1.00 24.06  ? 1068 ALA B CA    1 
ATOM   2056  C  C     . ALA A  1  269 ? 37.842  42.125 0.504   1.00 24.05  ? 1068 ALA B C     1 
ATOM   2057  O  O     . ALA A  1  269 ? 37.584  40.911 0.493   1.00 25.08  ? 1068 ALA B O     1 
ATOM   2058  C  CB    . ALA A  1  269 ? 39.130  42.977 -1.518  1.00 24.15  ? 1068 ALA B CB    1 
ATOM   2059  N  N     . ARG A  1  270 ? 38.223  42.778 1.606   1.00 24.41  ? 1069 ARG B N     1 
ATOM   2060  C  CA    . ARG A  1  270 ? 38.298  42.094 2.892   1.00 25.02  ? 1069 ARG B CA    1 
ATOM   2061  C  C     . ARG A  1  270 ? 36.867  41.809 3.425   1.00 23.52  ? 1069 ARG B C     1 
ATOM   2062  O  O     . ARG A  1  270 ? 36.579  40.717 3.913   1.00 23.59  ? 1069 ARG B O     1 
ATOM   2063  C  CB    . ARG A  1  270 ? 39.054  42.936 3.920   1.00 25.26  ? 1069 ARG B CB    1 
ATOM   2064  C  CG    . ARG A  1  270 ? 40.549  43.024 3.575   1.00 25.72  ? 1069 ARG B CG    1 
ATOM   2065  C  CD    . ARG A  1  270 ? 41.245  43.853 4.706   1.00 25.84  ? 1069 ARG B CD    1 
ATOM   2066  N  NE    . ARG A  1  270 ? 41.154  43.101 5.970   1.00 26.35  ? 1069 ARG B NE    1 
ATOM   2067  C  CZ    . ARG A  1  270 ? 41.371  43.656 7.144   1.00 27.65  ? 1069 ARG B CZ    1 
ATOM   2068  N  NH1   . ARG A  1  270 ? 41.712  44.950 7.263   1.00 26.34  ? 1069 ARG B NH1   1 
ATOM   2069  N  NH2   . ARG A  1  270 ? 41.203  42.918 8.259   1.00 29.70  ? 1069 ARG B NH2   1 
ATOM   2070  N  N     . ILE A  1  271 ? 35.980  42.797 3.339   1.00 23.53  ? 1070 ILE B N     1 
ATOM   2071  C  CA    . ILE A  1  271 ? 34.630  42.625 3.768   1.00 24.29  ? 1070 ILE B CA    1 
ATOM   2072  C  C     . ILE A  1  271 ? 33.961  41.461 2.945   1.00 24.26  ? 1070 ILE B C     1 
ATOM   2073  O  O     . ILE A  1  271 ? 33.368  40.524 3.516   1.00 23.13  ? 1070 ILE B O     1 
ATOM   2074  C  CB    . ILE A  1  271 ? 33.796  43.905 3.563   1.00 25.18  ? 1070 ILE B CB    1 
ATOM   2075  C  CG1   . ILE A  1  271 ? 34.344  44.998 4.508   1.00 25.40  ? 1070 ILE B CG1   1 
ATOM   2076  C  CG2   . ILE A  1  271 ? 32.303  43.656 3.807   1.00 23.98  ? 1070 ILE B CG2   1 
ATOM   2077  C  CD1   . ILE A  1  271 ? 33.856  46.392 4.162   1.00 24.92  ? 1070 ILE B CD1   1 
ATOM   2078  N  N     . VAL A  1  272 ? 34.083  41.526 1.606   1.00 22.40  ? 1071 VAL B N     1 
ATOM   2079  C  CA    . VAL A  1  272 ? 33.450  40.544 0.795   1.00 22.46  ? 1071 VAL B CA    1 
ATOM   2080  C  C     . VAL A  1  272 ? 34.047  39.166 0.963   1.00 22.73  ? 1071 VAL B C     1 
ATOM   2081  O  O     . VAL A  1  272 ? 33.345  38.154 1.022   1.00 25.15  ? 1071 VAL B O     1 
ATOM   2082  C  CB    . VAL A  1  272 ? 33.577  40.974 -0.723  1.00 22.05  ? 1071 VAL B CB    1 
ATOM   2083  C  CG1   . VAL A  1  272 ? 33.240  39.794 -1.677  1.00 22.09  ? 1071 VAL B CG1   1 
ATOM   2084  C  CG2   . VAL A  1  272 ? 32.653  42.215 -0.982  1.00 21.65  ? 1071 VAL B CG2   1 
ATOM   2085  N  N     . GLY A  1  273 ? 35.392  39.088 1.082   1.00 23.80  ? 1072 GLY B N     1 
ATOM   2086  C  CA    . GLY A  1  273 ? 36.057  37.811 1.263   1.00 24.68  ? 1072 GLY B CA    1 
ATOM   2087  C  C     . GLY A  1  273 ? 35.630  37.148 2.531   1.00 23.93  ? 1072 GLY B C     1 
ATOM   2088  O  O     . GLY A  1  273 ? 35.435  35.906 2.577   1.00 24.65  ? 1072 GLY B O     1 
ATOM   2089  N  N     . ASP A  1  274 ? 35.537  37.919 3.611   1.00 24.52  ? 1073 ASP B N     1 
ATOM   2090  C  CA    . ASP A  1  274 ? 35.084  37.353 4.903   1.00 23.95  ? 1073 ASP B CA    1 
ATOM   2091  C  C     . ASP A  1  274 ? 33.643  36.823 4.787   1.00 22.69  ? 1073 ASP B C     1 
ATOM   2092  O  O     . ASP A  1  274 ? 33.320  35.761 5.318   1.00 22.04  ? 1073 ASP B O     1 
ATOM   2093  C  CB    . ASP A  1  274 ? 35.132  38.403 5.994   1.00 25.49  ? 1073 ASP B CB    1 
ATOM   2094  C  CG    . ASP A  1  274 ? 36.602  38.606 6.464   1.00 28.96  ? 1073 ASP B CG    1 
ATOM   2095  O  OD1   . ASP A  1  274 ? 37.594  37.886 5.962   1.00 28.78  ? 1073 ASP B OD1   1 
ATOM   2096  O  OD2   . ASP A  1  274 ? 36.786  39.534 7.324   1.00 33.37  ? 1073 ASP B OD2   1 
ATOM   2097  N  N     . VAL A  1  275 ? 32.760  37.567 4.136   1.00 21.88  ? 1074 VAL B N     1 
ATOM   2098  C  CA    . VAL A  1  275 ? 31.400  37.124 3.985   1.00 21.55  ? 1074 VAL B CA    1 
ATOM   2099  C  C     . VAL A  1  275 ? 31.320  35.903 3.058   1.00 21.84  ? 1074 VAL B C     1 
ATOM   2100  O  O     . VAL A  1  275 ? 30.549  34.970 3.289   1.00 22.49  ? 1074 VAL B O     1 
ATOM   2101  C  CB    . VAL A  1  275 ? 30.508  38.284 3.419   1.00 20.89  ? 1074 VAL B CB    1 
ATOM   2102  C  CG1   . VAL A  1  275 ? 29.140  37.803 3.015   1.00 20.18  ? 1074 VAL B CG1   1 
ATOM   2103  C  CG2   . VAL A  1  275 ? 30.365  39.343 4.517   1.00 22.13  ? 1074 VAL B CG2   1 
ATOM   2104  N  N     . MET A  1  276 ? 32.126  35.888 1.978   1.00 21.52  ? 1075 MET B N     1 
ATOM   2105  C  CA    . MET A  1  276 ? 32.114  34.762 1.093   1.00 22.01  ? 1075 MET B CA    1 
ATOM   2106  C  C     . MET A  1  276 ? 32.576  33.523 1.797   1.00 23.29  ? 1075 MET B C     1 
ATOM   2107  O  O     . MET A  1  276 ? 32.055  32.387 1.530   1.00 22.21  ? 1075 MET B O     1 
ATOM   2108  C  CB    . MET A  1  276 ? 33.003  35.078 -0.119  1.00 22.59  ? 1075 MET B CB    1 
ATOM   2109  C  CG    . MET A  1  276 ? 33.033  33.962 -1.191  1.00 24.27  ? 1075 MET B CG    1 
ATOM   2110  S  SD    . MET A  1  276 ? 33.808  34.627 -2.676  1.00 27.39  ? 1075 MET B SD    1 
ATOM   2111  C  CE    . MET A  1  276 ? 35.507  35.284 -2.087  1.00 26.58  ? 1075 MET B CE    1 
ATOM   2112  N  N     . GLY A  1  277 ? 33.647  33.590 2.604   1.00 22.50  ? 1076 GLY B N     1 
ATOM   2113  C  CA    . GLY A  1  277 ? 34.178  32.410 3.273   1.00 22.23  ? 1076 GLY B CA    1 
ATOM   2114  C  C     . GLY A  1  277 ? 33.319  31.884 4.401   1.00 22.82  ? 1076 GLY B C     1 
ATOM   2115  O  O     . GLY A  1  277 ? 33.199  30.678 4.595   1.00 23.00  ? 1076 GLY B O     1 
ATOM   2116  N  N     . LYS A  1  278 ? 32.730  32.779 5.179   1.00 22.67  ? 1077 LYS B N     1 
ATOM   2117  C  CA    . LYS A  1  278 ? 32.022  32.423 6.410   1.00 23.12  ? 1077 LYS B CA    1 
ATOM   2118  C  C     . LYS A  1  278 ? 30.544  32.053 6.180   1.00 23.17  ? 1077 LYS B C     1 
ATOM   2119  O  O     . LYS A  1  278 ? 30.034  31.145 6.838   1.00 22.86  ? 1077 LYS B O     1 
ATOM   2120  C  CB    . LYS A  1  278 ? 32.100  33.558 7.404   1.00 23.44  ? 1077 LYS B CB    1 
ATOM   2121  C  CG    . LYS A  1  278 ? 33.572  33.751 7.933   1.00 24.37  ? 1077 LYS B CG    1 
ATOM   2122  C  CD    . LYS A  1  278 ? 33.509  34.741 9.146   1.00 27.73  ? 1077 LYS B CD    1 
ATOM   2123  C  CE    . LYS A  1  278 ? 34.956  34.779 9.698   1.00 30.81  ? 1077 LYS B CE    1 
ATOM   2124  N  NZ    . LYS A  1  278 ? 35.085  35.549 10.983  1.00 36.12  ? 1077 LYS B NZ    1 
ATOM   2125  N  N     . TYR A  1  279 ? 29.847  32.733 5.281   1.00 22.72  ? 1078 TYR B N     1 
ATOM   2126  C  CA    . TYR A  1  279 ? 28.401  32.572 5.201   1.00 22.83  ? 1078 TYR B CA    1 
ATOM   2127  C  C     . TYR A  1  279 ? 27.834  32.366 3.801   1.00 22.32  ? 1078 TYR B C     1 
ATOM   2128  O  O     . TYR A  1  279 ? 26.826  31.692 3.654   1.00 21.46  ? 1078 TYR B O     1 
ATOM   2129  C  CB    . TYR A  1  279 ? 27.710  33.824 5.808   1.00 24.37  ? 1078 TYR B CB    1 
ATOM   2130  C  CG    . TYR A  1  279 ? 28.373  34.381 7.029   1.00 27.08  ? 1078 TYR B CG    1 
ATOM   2131  C  CD1   . TYR A  1  279 ? 28.422  33.660 8.232   1.00 25.89  ? 1078 TYR B CD1   1 
ATOM   2132  C  CD2   . TYR A  1  279 ? 28.918  35.635 7.021   1.00 26.57  ? 1078 TYR B CD2   1 
ATOM   2133  C  CE1   . TYR A  1  279 ? 29.050  34.169 9.357   1.00 27.04  ? 1078 TYR B CE1   1 
ATOM   2134  C  CE2   . TYR A  1  279 ? 29.569  36.175 8.175   1.00 28.22  ? 1078 TYR B CE2   1 
ATOM   2135  C  CZ    . TYR A  1  279 ? 29.617  35.458 9.290   1.00 28.90  ? 1078 TYR B CZ    1 
ATOM   2136  O  OH    . TYR A  1  279 ? 30.238  35.974 10.419  1.00 36.66  ? 1078 TYR B OH    1 
ATOM   2137  N  N     . HIS A  1  280 ? 28.472  32.941 2.776   1.00 20.75  ? 1079 HIS B N     1 
ATOM   2138  C  CA    . HIS A  1  280 ? 27.905  33.054 1.443   1.00 20.17  ? 1079 HIS B CA    1 
ATOM   2139  C  C     . HIS A  1  280 ? 28.806  32.442 0.388   1.00 20.66  ? 1079 HIS B C     1 
ATOM   2140  O  O     . HIS A  1  280 ? 29.545  33.179 -0.280  1.00 20.51  ? 1079 HIS B O     1 
ATOM   2141  C  CB    . HIS A  1  280 ? 27.545  34.516 1.120   1.00 19.44  ? 1079 HIS B CB    1 
ATOM   2142  C  CG    . HIS A  1  280 ? 26.454  34.632 0.075   1.00 18.65  ? 1079 HIS B CG    1 
ATOM   2143  N  ND1   . HIS A  1  280 ? 25.176  34.311 0.330   1.00 18.55  ? 1079 HIS B ND1   1 
ATOM   2144  C  CD2   . HIS A  1  280 ? 26.523  35.097 -1.207  1.00 18.42  ? 1079 HIS B CD2   1 
ATOM   2145  C  CE1   . HIS A  1  280 ? 24.440  34.547 -0.757  1.00 18.09  ? 1079 HIS B CE1   1 
ATOM   2146  N  NE2   . HIS A  1  280 ? 25.251  35.041 -1.687  1.00 18.20  ? 1079 HIS B NE2   1 
ATOM   2147  N  N     . PRO A  1  281 ? 28.757  31.137 0.192   1.00 21.97  ? 1080 PRO B N     1 
ATOM   2148  C  CA    . PRO A  1  281 ? 29.734  30.468 -0.694  1.00 22.80  ? 1080 PRO B CA    1 
ATOM   2149  C  C     . PRO A  1  281 ? 29.350  30.607 -2.178  1.00 24.51  ? 1080 PRO B C     1 
ATOM   2150  O  O     . PRO A  1  281 ? 29.053  29.645 -2.876  1.00 25.41  ? 1080 PRO B O     1 
ATOM   2151  C  CB    . PRO A  1  281 ? 29.735  29.016 -0.205  1.00 22.94  ? 1080 PRO B CB    1 
ATOM   2152  C  CG    . PRO A  1  281 ? 28.284  28.822 0.261   1.00 23.00  ? 1080 PRO B CG    1 
ATOM   2153  C  CD    . PRO A  1  281 ? 27.819  30.189 0.825   1.00 21.93  ? 1080 PRO B CD    1 
ATOM   2154  N  N     . HIS A  1  282 ? 29.343  31.834 -2.653  1.00 22.36  ? 1081 HIS B N     1 
ATOM   2155  C  CA    . HIS A  1  282 ? 29.066  32.095 -4.057  1.00 22.81  ? 1081 HIS B CA    1 
ATOM   2156  C  C     . HIS A  1  282 ? 30.067  33.090 -4.609  1.00 22.63  ? 1081 HIS B C     1 
ATOM   2157  O  O     . HIS A  1  282 ? 30.885  33.613 -3.834  1.00 23.59  ? 1081 HIS B O     1 
ATOM   2158  C  CB    . HIS A  1  282 ? 27.587  32.642 -4.215  1.00 22.29  ? 1081 HIS B CB    1 
ATOM   2159  C  CG    . HIS A  1  282 ? 26.564  31.741 -3.636  1.00 22.71  ? 1081 HIS B CG    1 
ATOM   2160  N  ND1   . HIS A  1  282 ? 26.171  30.549 -4.285  1.00 22.61  ? 1081 HIS B ND1   1 
ATOM   2161  C  CD2   . HIS A  1  282 ? 25.854  31.817 -2.479  1.00 23.38  ? 1081 HIS B CD2   1 
ATOM   2162  C  CE1   . HIS A  1  282 ? 25.245  29.951 -3.517  1.00 23.88  ? 1081 HIS B CE1   1 
ATOM   2163  N  NE2   . HIS A  1  282 ? 25.056  30.659 -2.413  1.00 24.09  ? 1081 HIS B NE2   1 
ATOM   2164  N  N     . GLY A  1  283 ? 29.968  33.391 -5.886  1.00 23.25  ? 1082 GLY B N     1 
ATOM   2165  C  CA    . GLY A  1  283 ? 30.852  34.319 -6.582  1.00 23.70  ? 1082 GLY B CA    1 
ATOM   2166  C  C     . GLY A  1  283 ? 30.987  35.640 -5.839  1.00 23.83  ? 1082 GLY B C     1 
ATOM   2167  O  O     . GLY A  1  283 ? 29.965  36.169 -5.306  1.00 22.73  ? 1082 GLY B O     1 
ATOM   2168  N  N     . ASP A  1  284 ? 32.215  36.199 -5.684  1.00 24.16  ? 1083 ASP B N     1 
ATOM   2169  C  CA    . ASP A  1  284 ? 32.372  37.421 -4.969  1.00 25.01  ? 1083 ASP B CA    1 
ATOM   2170  C  C     . ASP A  1  284 ? 31.655  38.625 -5.690  1.00 24.70  ? 1083 ASP B C     1 
ATOM   2171  O  O     . ASP A  1  284 ? 31.256  39.572 -4.997  1.00 23.52  ? 1083 ASP B O     1 
ATOM   2172  C  CB    . ASP A  1  284 ? 33.851  37.756 -4.849  1.00 27.95  ? 1083 ASP B CB    1 
ATOM   2173  C  CG    . ASP A  1  284 ? 34.613  37.678 -6.164  1.00 30.90  ? 1083 ASP B CG    1 
ATOM   2174  O  OD1   . ASP A  1  284 ? 34.650  38.683 -6.888  1.00 32.09  ? 1083 ASP B OD1   1 
ATOM   2175  O  OD2   . ASP A  1  284 ? 35.135  36.585 -6.548  1.00 32.47  ? 1083 ASP B OD2   1 
ATOM   2176  N  N     . SER A  1  285 ? 31.458  38.524 -6.988  1.00 24.85  ? 1084 SER B N     1 
ATOM   2177  C  CA    . SER A  1  285 ? 30.768  39.566 -7.663  1.00 25.40  ? 1084 SER B CA    1 
ATOM   2178  C  C     . SER A  1  285 ? 29.308  39.665 -7.225  1.00 24.57  ? 1084 SER B C     1 
ATOM   2179  O  O     . SER A  1  285 ? 28.813  40.745 -6.985  1.00 25.00  ? 1084 SER B O     1 
ATOM   2180  C  CB    . SER A  1  285 ? 30.868  39.507 -9.208  1.00 26.64  ? 1084 SER B CB    1 
ATOM   2181  O  OG    . SER A  1  285 ? 30.043  38.384 -9.675  1.00 29.65  ? 1084 SER B OG    1 
ATOM   2182  N  N     A SER A  1  286 ? 28.641  38.598 -6.983  0.50 24.33  ? 1085 SER B N     1 
ATOM   2183  N  N     B SER A  1  286 ? 28.635  38.599 -6.987  0.50 23.10  ? 1085 SER B N     1 
ATOM   2184  C  CA    A SER A  1  286 ? 27.298  38.654 -6.461  0.50 24.50  ? 1085 SER B CA    1 
ATOM   2185  C  CA    B SER A  1  286 ? 27.296  38.676 -6.458  0.50 22.58  ? 1085 SER B CA    1 
ATOM   2186  C  C     A SER A  1  286 ? 27.239  39.330 -5.072  0.50 23.90  ? 1085 SER B C     1 
ATOM   2187  C  C     B SER A  1  286 ? 27.261  39.367 -5.085  0.50 22.73  ? 1085 SER B C     1 
ATOM   2188  O  O     A SER A  1  286 ? 26.311  40.107 -4.807  0.50 23.64  ? 1085 SER B O     1 
ATOM   2189  O  O     B SER A  1  286 ? 26.378  40.211 -4.843  0.50 22.90  ? 1085 SER B O     1 
ATOM   2190  C  CB    A SER A  1  286 ? 26.778  37.198 -6.458  0.50 26.71  ? 1085 SER B CB    1 
ATOM   2191  C  CB    B SER A  1  286 ? 26.708  37.306 -6.230  0.50 22.38  ? 1085 SER B CB    1 
ATOM   2192  O  OG    A SER A  1  286 ? 25.757  37.053 -5.636  0.50 26.22  ? 1085 SER B OG    1 
ATOM   2193  O  OG    B SER A  1  286 ? 26.222  36.864 -7.500  0.50 20.27  ? 1085 SER B OG    1 
ATOM   2194  N  N     . ILE A  1  287 ? 28.221  39.061 -4.210  1.00 22.82  ? 1086 ILE B N     1 
ATOM   2195  C  CA    . ILE A  1  287 ? 28.243  39.674 -2.915  1.00 21.98  ? 1086 ILE B CA    1 
ATOM   2196  C  C     . ILE A  1  287 ? 28.590  41.186 -3.053  1.00 21.02  ? 1086 ILE B C     1 
ATOM   2197  O  O     . ILE A  1  287 ? 27.904  42.042 -2.468  1.00 21.12  ? 1086 ILE B O     1 
ATOM   2198  C  CB    . ILE A  1  287 ? 29.295  38.997 -1.995  1.00 21.60  ? 1086 ILE B CB    1 
ATOM   2199  C  CG1   . ILE A  1  287 ? 28.919  37.514 -1.851  1.00 21.69  ? 1086 ILE B CG1   1 
ATOM   2200  C  CG2   . ILE A  1  287 ? 29.316  39.635 -0.606  1.00 23.21  ? 1086 ILE B CG2   1 
ATOM   2201  C  CD1   . ILE A  1  287 ? 30.019  36.677 -1.231  1.00 20.93  ? 1086 ILE B CD1   1 
ATOM   2202  N  N     . TYR A  1  288 ? 29.621  41.494 -3.822  1.00 20.35  ? 1087 TYR B N     1 
ATOM   2203  C  CA    . TYR A  1  288 ? 30.079  42.877 -3.879  1.00 21.24  ? 1087 TYR B CA    1 
ATOM   2204  C  C     . TYR A  1  288 ? 29.063  43.787 -4.572  1.00 20.82  ? 1087 TYR B C     1 
ATOM   2205  O  O     . TYR A  1  288 ? 28.835  44.917 -4.119  1.00 21.07  ? 1087 TYR B O     1 
ATOM   2206  C  CB    . TYR A  1  288 ? 31.448  42.937 -4.621  1.00 21.41  ? 1087 TYR B CB    1 
ATOM   2207  C  CG    . TYR A  1  288 ? 31.964  44.347 -4.823  1.00 22.03  ? 1087 TYR B CG    1 
ATOM   2208  C  CD1   . TYR A  1  288 ? 32.153  45.186 -3.713  1.00 22.86  ? 1087 TYR B CD1   1 
ATOM   2209  C  CD2   . TYR A  1  288 ? 32.303  44.806 -6.077  1.00 22.41  ? 1087 TYR B CD2   1 
ATOM   2210  C  CE1   . TYR A  1  288 ? 32.634  46.475 -3.855  1.00 22.50  ? 1087 TYR B CE1   1 
ATOM   2211  C  CE2   . TYR A  1  288 ? 32.790  46.090 -6.285  1.00 22.49  ? 1087 TYR B CE2   1 
ATOM   2212  C  CZ    . TYR A  1  288 ? 32.964  46.937 -5.143  1.00 22.73  ? 1087 TYR B CZ    1 
ATOM   2213  O  OH    . TYR A  1  288 ? 33.452  48.203 -5.319  1.00 21.93  ? 1087 TYR B OH    1 
ATOM   2214  N  N     A GLU A  1  289 ? 28.435  43.331 -5.659  0.50 20.49  ? 1088 GLU B N     1 
ATOM   2215  N  N     B GLU A  1  289 ? 28.452  43.336 -5.677  0.50 21.10  ? 1088 GLU B N     1 
ATOM   2216  C  CA    A GLU A  1  289 ? 27.450  44.169 -6.322  0.50 20.88  ? 1088 GLU B CA    1 
ATOM   2217  C  CA    B GLU A  1  289 ? 27.446  44.162 -6.330  0.50 22.02  ? 1088 GLU B CA    1 
ATOM   2218  C  C     A GLU A  1  289 ? 26.217  44.399 -5.445  0.50 20.84  ? 1088 GLU B C     1 
ATOM   2219  C  C     B GLU A  1  289 ? 26.254  44.418 -5.406  0.50 21.58  ? 1088 GLU B C     1 
ATOM   2220  O  O     A GLU A  1  289 ? 25.602  45.454 -5.514  0.50 21.25  ? 1088 GLU B O     1 
ATOM   2221  O  O     B GLU A  1  289 ? 25.703  45.508 -5.404  0.50 22.22  ? 1088 GLU B O     1 
ATOM   2222  C  CB    A GLU A  1  289 ? 26.984  43.495 -7.623  0.50 21.15  ? 1088 GLU B CB    1 
ATOM   2223  C  CB    B GLU A  1  289 ? 26.937  43.469 -7.627  0.50 23.46  ? 1088 GLU B CB    1 
ATOM   2224  C  CG    A GLU A  1  289 ? 27.817  44.077 -8.776  0.50 21.35  ? 1088 GLU B CG    1 
ATOM   2225  C  CG    B GLU A  1  289 ? 28.135  43.088 -8.602  0.50 24.83  ? 1088 GLU B CG    1 
ATOM   2226  C  CD    A GLU A  1  289 ? 28.042  43.068 -9.875  0.50 21.63  ? 1088 GLU B CD    1 
ATOM   2227  C  CD    B GLU A  1  289 ? 28.716  44.386 -9.075  0.50 27.49  ? 1088 GLU B CD    1 
ATOM   2228  O  OE1   A GLU A  1  289 ? 29.039  42.993 -10.524 0.50 22.56  ? 1088 GLU B OE1   1 
ATOM   2229  O  OE1   B GLU A  1  289 ? 28.110  45.460 -8.772  0.50 27.85  ? 1088 GLU B OE1   1 
ATOM   2230  O  OE2   A GLU A  1  289 ? 27.175  42.343 -10.147 0.50 22.56  ? 1088 GLU B OE2   1 
ATOM   2231  O  OE2   B GLU A  1  289 ? 29.687  44.493 -9.901  0.50 29.53  ? 1088 GLU B OE2   1 
ATOM   2232  N  N     . ALA A  1  290 ? 25.859  43.431 -4.617  1.00 20.38  ? 1089 ALA B N     1 
ATOM   2233  C  CA    . ALA A  1  290 ? 24.747  43.644 -3.682  1.00 21.01  ? 1089 ALA B CA    1 
ATOM   2234  C  C     . ALA A  1  290 ? 25.141  44.640 -2.570  1.00 21.18  ? 1089 ALA B C     1 
ATOM   2235  O  O     . ALA A  1  290 ? 24.300  45.413 -2.119  1.00 21.81  ? 1089 ALA B O     1 
ATOM   2236  C  CB    . ALA A  1  290 ? 24.315  42.329 -3.039  1.00 20.18  ? 1089 ALA B CB    1 
ATOM   2237  N  N     . MET A  1  291 ? 26.424  44.643 -2.167  1.00 21.10  ? 1090 MET B N     1 
ATOM   2238  C  CA    . MET A  1  291 ? 26.882  45.622 -1.201  1.00 22.46  ? 1090 MET B CA    1 
ATOM   2239  C  C     . MET A  1  291 ? 26.915  47.015 -1.829  1.00 21.93  ? 1090 MET B C     1 
ATOM   2240  O  O     . MET A  1  291 ? 26.532  48.006 -1.162  1.00 21.64  ? 1090 MET B O     1 
ATOM   2241  C  CB    . MET A  1  291 ? 28.263  45.264 -0.683  1.00 22.57  ? 1090 MET B CB    1 
ATOM   2242  C  CG    . MET A  1  291 ? 28.687  46.056 0.554   1.00 23.70  ? 1090 MET B CG    1 
ATOM   2243  S  SD    . MET A  1  291 ? 30.411  45.817 1.046   1.00 25.55  ? 1090 MET B SD    1 
ATOM   2244  C  CE    . MET A  1  291 ? 31.278  46.664 -0.232  1.00 25.16  ? 1090 MET B CE    1 
ATOM   2245  N  N     . VAL A  1  292 ? 27.374  47.105 -3.059  1.00 21.34  ? 1091 VAL B N     1 
ATOM   2246  C  CA    . VAL A  1  292 ? 27.438  48.394 -3.743  1.00 21.83  ? 1091 VAL B CA    1 
ATOM   2247  C  C     . VAL A  1  292 ? 26.057  49.027 -3.822  1.00 22.76  ? 1091 VAL B C     1 
ATOM   2248  O  O     . VAL A  1  292 ? 25.901  50.234 -3.572  1.00 23.36  ? 1091 VAL B O     1 
ATOM   2249  C  CB    . VAL A  1  292 ? 28.046  48.207 -5.155  1.00 21.88  ? 1091 VAL B CB    1 
ATOM   2250  C  CG1   . VAL A  1  292 ? 27.774  49.416 -6.003  1.00 22.05  ? 1091 VAL B CG1   1 
ATOM   2251  C  CG2   . VAL A  1  292 ? 29.568  47.941 -4.996  1.00 21.64  ? 1091 VAL B CG2   1 
ATOM   2252  N  N     A ARG A  1  293 ? 25.032  48.256 -4.179  0.50 22.21  ? 1092 ARG B N     1 
ATOM   2253  N  N     B ARG A  1  293 ? 25.028  48.258 -4.164  0.50 21.87  ? 1092 ARG B N     1 
ATOM   2254  C  CA    A ARG A  1  293 ? 23.684  48.785 -4.272  0.50 23.73  ? 1092 ARG B CA    1 
ATOM   2255  C  CA    B ARG A  1  293 ? 23.689  48.804 -4.277  0.50 23.08  ? 1092 ARG B CA    1 
ATOM   2256  C  C     A ARG A  1  293 ? 23.211  49.331 -2.937  0.50 23.52  ? 1092 ARG B C     1 
ATOM   2257  C  C     B ARG A  1  293 ? 23.189  49.322 -2.937  0.50 23.12  ? 1092 ARG B C     1 
ATOM   2258  O  O     A ARG A  1  293 ? 22.547  50.375 -2.895  0.50 23.74  ? 1092 ARG B O     1 
ATOM   2259  O  O     B ARG A  1  293 ? 22.490  50.342 -2.891  0.50 23.38  ? 1092 ARG B O     1 
ATOM   2260  C  CB    A ARG A  1  293 ? 22.715  47.687 -4.769  0.50 24.49  ? 1092 ARG B CB    1 
ATOM   2261  C  CB    B ARG A  1  293 ? 22.773  47.678 -4.910  0.50 23.27  ? 1092 ARG B CB    1 
ATOM   2262  C  CG    A ARG A  1  293 ? 22.199  47.884 -6.204  0.50 27.27  ? 1092 ARG B CG    1 
ATOM   2263  C  CG    B ARG A  1  293 ? 23.181  47.368 -6.381  0.50 24.44  ? 1092 ARG B CG    1 
ATOM   2264  C  CD    A ARG A  1  293 ? 21.276  46.626 -6.449  0.50 26.56  ? 1092 ARG B CD    1 
ATOM   2265  C  CD    B ARG A  1  293 ? 22.197  46.446 -7.104  0.50 24.98  ? 1092 ARG B CD    1 
ATOM   2266  N  NE    A ARG A  1  293 ? 20.047  46.693 -5.658  0.50 29.77  ? 1092 ARG B NE    1 
ATOM   2267  N  NE    B ARG A  1  293 ? 22.505  45.021 -6.928  0.50 24.70  ? 1092 ARG B NE    1 
ATOM   2268  C  CZ    A ARG A  1  293 ? 19.072  47.595 -5.765  0.50 28.99  ? 1092 ARG B CZ    1 
ATOM   2269  C  CZ    B ARG A  1  293 ? 23.228  44.260 -7.732  0.50 23.86  ? 1092 ARG B CZ    1 
ATOM   2270  N  NH1   A ARG A  1  293 ? 19.090  48.484 -6.701  0.50 30.90  ? 1092 ARG B NH1   1 
ATOM   2271  N  NH1   B ARG A  1  293 ? 23.848  44.726 -8.794  0.50 23.03  ? 1092 ARG B NH1   1 
ATOM   2272  N  NH2   A ARG A  1  293 ? 18.062  47.596 -4.941  0.50 28.17  ? 1092 ARG B NH2   1 
ATOM   2273  N  NH2   B ARG A  1  293 ? 23.399  42.973 -7.359  0.50 23.01  ? 1092 ARG B NH2   1 
ATOM   2274  N  N     . MET A  1  294 ? 23.531  48.651 -1.830  1.00 23.17  ? 1093 MET B N     1 
ATOM   2275  C  CA    . MET A  1  294 ? 23.111  49.112 -0.526  1.00 23.64  ? 1093 MET B CA    1 
ATOM   2276  C  C     . MET A  1  294 ? 23.768  50.454 -0.146  1.00 22.48  ? 1093 MET B C     1 
ATOM   2277  O  O     . MET A  1  294 ? 23.325  51.103 0.814   1.00 22.16  ? 1093 MET B O     1 
ATOM   2278  C  CB    . MET A  1  294 ? 23.414  48.062 0.539   1.00 23.33  ? 1093 MET B CB    1 
ATOM   2279  C  CG    . MET A  1  294 ? 22.455  46.859 0.462   1.00 26.52  ? 1093 MET B CG    1 
ATOM   2280  S  SD    . MET A  1  294 ? 22.617  45.713 1.902   1.00 31.73  ? 1093 MET B SD    1 
ATOM   2281  C  CE    . MET A  1  294 ? 24.145  44.975 1.457   1.00 25.56  ? 1093 MET B CE    1 
ATOM   2282  N  N     . ALA A  1  295 ? 24.813  50.877 -0.873  1.00 22.87  ? 1094 ALA B N     1 
ATOM   2283  C  CA    . ALA A  1  295 ? 25.525  52.112 -0.601  1.00 22.13  ? 1094 ALA B CA    1 
ATOM   2284  C  C     . ALA A  1  295 ? 25.171  53.234 -1.551  1.00 22.33  ? 1094 ALA B C     1 
ATOM   2285  O  O     . ALA A  1  295 ? 25.773  54.343 -1.463  1.00 23.38  ? 1094 ALA B O     1 
ATOM   2286  C  CB    . ALA A  1  295 ? 27.042  51.861 -0.644  1.00 22.48  ? 1094 ALA B CB    1 
ATOM   2287  N  N     . GLN A  1  296 ? 24.262  53.005 -2.497  1.00 22.34  ? 1095 GLN B N     1 
ATOM   2288  C  CA    . GLN A  1  296 ? 23.908  54.000 -3.508  1.00 22.53  ? 1095 GLN B CA    1 
ATOM   2289  C  C     . GLN A  1  296 ? 22.673  54.778 -3.088  1.00 23.24  ? 1095 GLN B C     1 
ATOM   2290  O  O     . GLN A  1  296 ? 21.628  54.112 -2.797  1.00 22.79  ? 1095 GLN B O     1 
ATOM   2291  C  CB    . GLN A  1  296 ? 23.695  53.328 -4.865  1.00 22.62  ? 1095 GLN B CB    1 
ATOM   2292  C  CG    . GLN A  1  296 ? 24.960  52.817 -5.500  1.00 21.61  ? 1095 GLN B CG    1 
ATOM   2293  C  CD    . GLN A  1  296 ? 24.694  51.979 -6.754  1.00 21.55  ? 1095 GLN B CD    1 
ATOM   2294  O  OE1   . GLN A  1  296 ? 23.595  51.435 -6.960  1.00 23.94  ? 1095 GLN B OE1   1 
ATOM   2295  N  NE2   . GLN A  1  296 ? 25.699  51.840 -7.593  1.00 21.28  ? 1095 GLN B NE2   1 
ATOM   2296  N  N     . ASP A  1  297 ? 22.773  56.091 -3.018  1.00 23.05  ? 1096 ASP B N     1 
ATOM   2297  C  CA    . ASP A  1  297 ? 21.580  56.843 -2.559  1.00 25.29  ? 1096 ASP B CA    1 
ATOM   2298  C  C     . ASP A  1  297 ? 20.521  57.013 -3.608  1.00 24.84  ? 1096 ASP B C     1 
ATOM   2299  O  O     . ASP A  1  297 ? 19.462  57.519 -3.310  1.00 26.18  ? 1096 ASP B O     1 
ATOM   2300  C  CB    . ASP A  1  297 ? 22.035  58.237 -2.018  1.00 28.23  ? 1096 ASP B CB    1 
ATOM   2301  C  CG    . ASP A  1  297 ? 22.767  59.039 -3.055  1.00 32.81  ? 1096 ASP B CG    1 
ATOM   2302  O  OD1   . ASP A  1  297 ? 23.114  58.508 -4.144  1.00 36.12  ? 1096 ASP B OD1   1 
ATOM   2303  O  OD2   . ASP A  1  297 ? 22.992  60.230 -2.776  1.00 39.92  ? 1096 ASP B OD2   1 
ATOM   2304  N  N     . PHE A  1  298 ? 20.847  56.586 -4.863  1.00 25.35  ? 1097 PHE B N     1 
ATOM   2305  C  CA    . PHE A  1  298 ? 19.820  56.560 -5.928  1.00 25.62  ? 1097 PHE B CA    1 
ATOM   2306  C  C     . PHE A  1  298 ? 19.136  55.165 -5.988  1.00 24.73  ? 1097 PHE B C     1 
ATOM   2307  O  O     . PHE A  1  298 ? 18.142  55.047 -6.684  1.00 24.39  ? 1097 PHE B O     1 
ATOM   2308  C  CB    . PHE A  1  298 ? 20.415  56.938 -7.244  1.00 25.24  ? 1097 PHE B CB    1 
ATOM   2309  C  CG    . PHE A  1  298 ? 21.669  56.172 -7.624  1.00 26.74  ? 1097 PHE B CG    1 
ATOM   2310  C  CD1   . PHE A  1  298 ? 21.579  54.992 -8.331  1.00 27.28  ? 1097 PHE B CD1   1 
ATOM   2311  C  CD2   . PHE A  1  298 ? 22.919  56.716 -7.263  1.00 26.49  ? 1097 PHE B CD2   1 
ATOM   2312  C  CE1   . PHE A  1  298 ? 22.752  54.287 -8.643  1.00 28.80  ? 1097 PHE B CE1   1 
ATOM   2313  C  CE2   . PHE A  1  298 ? 24.090  56.016 -7.590  1.00 28.62  ? 1097 PHE B CE2   1 
ATOM   2314  C  CZ    . PHE A  1  298 ? 23.986  54.782 -8.297  1.00 26.32  ? 1097 PHE B CZ    1 
ATOM   2315  N  N     . SER A  1  299 ? 19.660  54.181 -5.298  1.00 23.32  ? 1098 SER B N     1 
ATOM   2316  C  CA    . SER A  1  299 ? 19.040  52.865 -5.249  1.00 23.67  ? 1098 SER B CA    1 
ATOM   2317  C  C     . SER A  1  299 ? 18.329  52.550 -3.932  1.00 22.85  ? 1098 SER B C     1 
ATOM   2318  O  O     . SER A  1  299 ? 17.266  52.000 -3.956  1.00 21.10  ? 1098 SER B O     1 
ATOM   2319  C  CB    . SER A  1  299 ? 20.132  51.758 -5.414  1.00 23.66  ? 1098 SER B CB    1 
ATOM   2320  O  OG    . SER A  1  299 ? 20.874  52.026 -6.626  1.00 23.79  ? 1098 SER B OG    1 
ATOM   2321  N  N     . TYR A  1  300 ? 18.930  52.928 -2.796  1.00 24.10  ? 1099 TYR B N     1 
ATOM   2322  C  CA    . TYR A  1  300 ? 18.339  52.671 -1.491  1.00 23.72  ? 1099 TYR B CA    1 
ATOM   2323  C  C     . TYR A  1  300 ? 17.807  53.974 -0.888  1.00 24.12  ? 1099 TYR B C     1 
ATOM   2324  O  O     . TYR A  1  300 ? 18.531  54.945 -0.762  1.00 23.69  ? 1099 TYR B O     1 
ATOM   2325  C  CB    . TYR A  1  300 ? 19.394  52.030 -0.547  1.00 24.72  ? 1099 TYR B CB    1 
ATOM   2326  C  CG    . TYR A  1  300 ? 19.351  50.522 -0.621  1.00 25.85  ? 1099 TYR B CG    1 
ATOM   2327  C  CD1   . TYR A  1  300 ? 19.626  49.877 -1.794  1.00 26.93  ? 1099 TYR B CD1   1 
ATOM   2328  C  CD2   . TYR A  1  300 ? 19.039  49.767 0.491   1.00 26.51  ? 1099 TYR B CD2   1 
ATOM   2329  C  CE1   . TYR A  1  300 ? 19.591  48.490 -1.901  1.00 26.61  ? 1099 TYR B CE1   1 
ATOM   2330  C  CE2   . TYR A  1  300 ? 18.998  48.365 0.434   1.00 26.58  ? 1099 TYR B CE2   1 
ATOM   2331  C  CZ    . TYR A  1  300 ? 19.283  47.768 -0.760  1.00 28.94  ? 1099 TYR B CZ    1 
ATOM   2332  O  OH    . TYR A  1  300 ? 19.250  46.386 -0.859  1.00 33.69  ? 1099 TYR B OH    1 
ATOM   2333  N  N     . ARG A  1  301 ? 16.548  53.996 -0.559  1.00 23.98  ? 1100 ARG B N     1 
ATOM   2334  C  CA    . ARG A  1  301 ? 15.892  55.130 0.080   1.00 24.48  ? 1100 ARG B CA    1 
ATOM   2335  C  C     . ARG A  1  301 ? 16.529  55.443 1.426   1.00 24.73  ? 1100 ARG B C     1 
ATOM   2336  O  O     . ARG A  1  301 ? 16.587  56.609 1.833   1.00 25.53  ? 1100 ARG B O     1 
ATOM   2337  C  CB    . ARG A  1  301 ? 14.374  54.856 0.234   1.00 24.72  ? 1100 ARG B CB    1 
ATOM   2338  C  CG    . ARG A  1  301 ? 13.578  56.011 0.781   1.00 25.02  ? 1100 ARG B CG    1 
ATOM   2339  C  CD    . ARG A  1  301 ? 13.732  57.247 -0.115  1.00 25.67  ? 1100 ARG B CD    1 
ATOM   2340  N  NE    . ARG A  1  301 ? 12.918  58.362 0.374   1.00 27.42  ? 1100 ARG B NE    1 
ATOM   2341  C  CZ    . ARG A  1  301 ? 13.273  59.161 1.381   1.00 27.22  ? 1100 ARG B CZ    1 
ATOM   2342  N  NH1   . ARG A  1  301 ? 14.416  58.939 2.024   1.00 24.58  ? 1100 ARG B NH1   1 
ATOM   2343  N  NH2   . ARG A  1  301 ? 12.477  60.152 1.758   1.00 30.17  ? 1100 ARG B NH2   1 
ATOM   2344  N  N     . TYR A  1  302 ? 17.018  54.423 2.132   1.00 23.62  ? 1101 TYR B N     1 
ATOM   2345  C  CA    . TYR A  1  302 ? 17.787  54.577 3.365   1.00 23.10  ? 1101 TYR B CA    1 
ATOM   2346  C  C     . TYR A  1  302 ? 18.991  53.673 3.205   1.00 22.09  ? 1101 TYR B C     1 
ATOM   2347  O  O     . TYR A  1  302 ? 18.916  52.489 3.539   1.00 21.47  ? 1101 TYR B O     1 
ATOM   2348  C  CB    . TYR A  1  302 ? 16.955  54.282 4.605   1.00 22.55  ? 1101 TYR B CB    1 
ATOM   2349  C  CG    . TYR A  1  302 ? 15.694  55.127 4.658   1.00 22.80  ? 1101 TYR B CG    1 
ATOM   2350  C  CD1   . TYR A  1  302 ? 15.736  56.391 5.200   1.00 23.75  ? 1101 TYR B CD1   1 
ATOM   2351  C  CD2   . TYR A  1  302 ? 14.502  54.682 4.126   1.00 22.74  ? 1101 TYR B CD2   1 
ATOM   2352  C  CE1   . TYR A  1  302 ? 14.600  57.206 5.214   1.00 24.86  ? 1101 TYR B CE1   1 
ATOM   2353  C  CE2   . TYR A  1  302 ? 13.373  55.471 4.149   1.00 23.91  ? 1101 TYR B CE2   1 
ATOM   2354  C  CZ    . TYR A  1  302 ? 13.459  56.756 4.698   1.00 25.35  ? 1101 TYR B CZ    1 
ATOM   2355  O  OH    . TYR A  1  302 ? 12.333  57.555 4.716   1.00 27.05  ? 1101 TYR B OH    1 
ATOM   2356  N  N     . PRO A  1  303 ? 20.109  54.192 2.678   1.00 21.61  ? 1102 PRO B N     1 
ATOM   2357  C  CA    . PRO A  1  303 ? 21.253  53.333 2.412   1.00 22.11  ? 1102 PRO B CA    1 
ATOM   2358  C  C     . PRO A  1  303 ? 21.757  52.606 3.651   1.00 22.66  ? 1102 PRO B C     1 
ATOM   2359  O  O     . PRO A  1  303 ? 21.824  53.172 4.758   1.00 22.84  ? 1102 PRO B O     1 
ATOM   2360  C  CB    . PRO A  1  303 ? 22.353  54.346 1.941   1.00 22.01  ? 1102 PRO B CB    1 
ATOM   2361  C  CG    . PRO A  1  303 ? 21.507  55.357 1.253   1.00 22.01  ? 1102 PRO B CG    1 
ATOM   2362  C  CD    . PRO A  1  303 ? 20.305  55.564 2.191   1.00 20.99  ? 1102 PRO B CD    1 
ATOM   2363  N  N     . LEU A  1  304 ? 22.104  51.324 3.447   1.00 23.47  ? 1103 LEU B N     1 
ATOM   2364  C  CA    . LEU A  1  304 ? 22.556  50.464 4.522   1.00 22.97  ? 1103 LEU B CA    1 
ATOM   2365  C  C     . LEU A  1  304 ? 24.067  50.360 4.611   1.00 22.63  ? 1103 LEU B C     1 
ATOM   2366  O  O     . LEU A  1  304 ? 24.576  49.867 5.628   1.00 21.67  ? 1103 LEU B O     1 
ATOM   2367  C  CB    . LEU A  1  304 ? 21.943  49.062 4.347   1.00 23.08  ? 1103 LEU B CB    1 
ATOM   2368  C  CG    . LEU A  1  304 ? 20.431  49.020 4.269   1.00 23.32  ? 1103 LEU B CG    1 
ATOM   2369  C  CD1   . LEU A  1  304 ? 19.912  47.608 4.197   1.00 24.98  ? 1103 LEU B CD1   1 
ATOM   2370  C  CD2   . LEU A  1  304 ? 19.796  49.745 5.515   1.00 23.68  ? 1103 LEU B CD2   1 
ATOM   2371  N  N     . VAL A  1  305 ? 24.795  50.803 3.581   1.00 22.22  ? 1104 VAL B N     1 
ATOM   2372  C  CA    . VAL A  1  305 ? 26.262  50.720 3.554   1.00 23.27  ? 1104 VAL B CA    1 
ATOM   2373  C  C     . VAL A  1  305 ? 26.824  52.101 3.266   1.00 22.78  ? 1104 VAL B C     1 
ATOM   2374  O  O     . VAL A  1  305 ? 26.264  52.858 2.459   1.00 22.63  ? 1104 VAL B O     1 
ATOM   2375  C  CB    . VAL A  1  305 ? 26.731  49.726 2.505   1.00 23.03  ? 1104 VAL B CB    1 
ATOM   2376  C  CG1   . VAL A  1  305 ? 28.263  49.807 2.258   1.00 22.90  ? 1104 VAL B CG1   1 
ATOM   2377  C  CG2   . VAL A  1  305 ? 26.364  48.266 2.947   1.00 24.58  ? 1104 VAL B CG2   1 
ATOM   2378  N  N     . ASP A  1  306 ? 27.908  52.464 3.954   1.00 22.43  ? 1105 ASP B N     1 
ATOM   2379  C  CA    . ASP A  1  306 ? 28.599  53.729 3.734   1.00 23.95  ? 1105 ASP B CA    1 
ATOM   2380  C  C     . ASP A  1  306 ? 29.879  53.413 2.944   1.00 23.94  ? 1105 ASP B C     1 
ATOM   2381  O  O     . ASP A  1  306 ? 30.834  52.825 3.472   1.00 24.01  ? 1105 ASP B O     1 
ATOM   2382  C  CB    . ASP A  1  306 ? 28.951  54.345 5.123   1.00 24.68  ? 1105 ASP B CB    1 
ATOM   2383  C  CG    . ASP A  1  306 ? 29.723  55.679 5.003   1.00 26.64  ? 1105 ASP B CG    1 
ATOM   2384  O  OD1   . ASP A  1  306 ? 30.156  56.067 3.907   1.00 27.54  ? 1105 ASP B OD1   1 
ATOM   2385  O  OD2   . ASP A  1  306 ? 29.868  56.301 6.025   1.00 28.98  ? 1105 ASP B OD2   1 
ATOM   2386  N  N     . GLY A  1  307 ? 29.879  53.844 1.675   1.00 24.43  ? 1106 GLY B N     1 
ATOM   2387  C  CA    . GLY A  1  307 ? 30.987  53.511 0.775   1.00 24.30  ? 1106 GLY B CA    1 
ATOM   2388  C  C     . GLY A  1  307 ? 31.960  54.633 0.556   1.00 26.81  ? 1106 GLY B C     1 
ATOM   2389  O  O     . GLY A  1  307 ? 31.586  55.785 0.500   1.00 28.70  ? 1106 GLY B O     1 
ATOM   2390  N  N     . GLN A  1  308 ? 33.235  54.282 0.417   1.00 27.27  ? 1107 GLN B N     1 
ATOM   2391  C  CA    . GLN A  1  308 ? 34.303  55.217 0.032   1.00 27.67  ? 1107 GLN B CA    1 
ATOM   2392  C  C     . GLN A  1  308 ? 34.973  54.761 -1.237  1.00 25.48  ? 1107 GLN B C     1 
ATOM   2393  O  O     . GLN A  1  308 ? 35.388  53.616 -1.344  1.00 24.81  ? 1107 GLN B O     1 
ATOM   2394  C  CB    . GLN A  1  308 ? 35.318  55.376 1.190   1.00 30.12  ? 1107 GLN B CB    1 
ATOM   2395  C  CG    . GLN A  1  308 ? 36.459  56.333 0.826   1.00 34.52  ? 1107 GLN B CG    1 
ATOM   2396  C  CD    . GLN A  1  308 ? 37.199  56.795 2.081   1.00 39.87  ? 1107 GLN B CD    1 
ATOM   2397  O  OE1   . GLN A  1  308 ? 36.906  57.844 2.652   1.00 43.78  ? 1107 GLN B OE1   1 
ATOM   2398  N  NE2   . GLN A  1  308 ? 38.158  56.046 2.461   1.00 36.60  ? 1107 GLN B NE2   1 
ATOM   2399  N  N     . GLY A  1  309 ? 35.072  55.645 -2.183  1.00 25.77  ? 1108 GLY B N     1 
ATOM   2400  C  CA    . GLY A  1  309 ? 35.574  55.346 -3.553  1.00 26.19  ? 1108 GLY B CA    1 
ATOM   2401  C  C     . GLY A  1  309 ? 34.447  55.506 -4.550  1.00 26.65  ? 1108 GLY B C     1 
ATOM   2402  O  O     . GLY A  1  309 ? 33.411  56.089 -4.304  1.00 28.50  ? 1108 GLY B O     1 
ATOM   2403  N  N     . ASN A  1  310 ? 34.697  54.970 -5.737  1.00 26.56  ? 1109 ASN B N     1 
ATOM   2404  C  CA    . ASN A  1  310 ? 33.713  54.995 -6.831  1.00 27.58  ? 1109 ASN B CA    1 
ATOM   2405  C  C     . ASN A  1  310 ? 32.738  53.828 -6.673  1.00 24.62  ? 1109 ASN B C     1 
ATOM   2406  O  O     . ASN A  1  310 ? 33.090  52.677 -6.878  1.00 24.00  ? 1109 ASN B O     1 
ATOM   2407  C  CB    . ASN A  1  310 ? 34.478  54.889 -8.170  1.00 28.53  ? 1109 ASN B CB    1 
ATOM   2408  C  CG    . ASN A  1  310 ? 33.544  54.773 -9.335  1.00 33.22  ? 1109 ASN B CG    1 
ATOM   2409  O  OD1   . ASN A  1  310 ? 32.358  55.121 -9.253  1.00 29.02  ? 1109 ASN B OD1   1 
ATOM   2410  N  ND2   . ASN A  1  310 ? 34.094  54.244 -10.424 1.00 35.45  ? 1109 ASN B ND2   1 
ATOM   2411  N  N     . PHE A  1  311 ? 31.514  54.140 -6.329  1.00 23.14  ? 1110 PHE B N     1 
ATOM   2412  C  CA    . PHE A  1  311 ? 30.437  53.164 -6.130  1.00 23.96  ? 1110 PHE B CA    1 
ATOM   2413  C  C     . PHE A  1  311 ? 29.372  53.252 -7.219  1.00 23.46  ? 1110 PHE B C     1 
ATOM   2414  O  O     . PHE A  1  311 ? 28.268  52.763 -7.037  1.00 25.86  ? 1110 PHE B O     1 
ATOM   2415  C  CB    . PHE A  1  311 ? 29.812  53.347 -4.746  1.00 22.28  ? 1110 PHE B CB    1 
ATOM   2416  C  CG    . PHE A  1  311 ? 30.487  52.534 -3.683  1.00 22.25  ? 1110 PHE B CG    1 
ATOM   2417  C  CD1   . PHE A  1  311 ? 31.698  52.947 -3.145  1.00 21.84  ? 1110 PHE B CD1   1 
ATOM   2418  C  CD2   . PHE A  1  311 ? 29.925  51.376 -3.245  1.00 21.52  ? 1110 PHE B CD2   1 
ATOM   2419  C  CE1   . PHE A  1  311 ? 32.336  52.218 -2.168  1.00 21.84  ? 1110 PHE B CE1   1 
ATOM   2420  C  CE2   . PHE A  1  311 ? 30.575  50.617 -2.235  1.00 21.23  ? 1110 PHE B CE2   1 
ATOM   2421  C  CZ    . PHE A  1  311 ? 31.779  51.056 -1.719  1.00 21.56  ? 1110 PHE B CZ    1 
ATOM   2422  N  N     . GLY A  1  312 ? 29.710  53.813 -8.376  1.00 24.46  ? 1111 GLY B N     1 
ATOM   2423  C  CA    . GLY A  1  312 ? 28.777  53.806 -9.501  1.00 26.97  ? 1111 GLY B CA    1 
ATOM   2424  C  C     . GLY A  1  312 ? 27.985  55.074 -9.606  1.00 27.63  ? 1111 GLY B C     1 
ATOM   2425  O  O     . GLY A  1  312 ? 28.124  56.038 -8.809  1.00 31.95  ? 1111 GLY B O     1 
ATOM   2426  N  N     . SER A  1  313 ? 27.049  55.077 -10.543 1.00 29.54  ? 1112 SER B N     1 
ATOM   2427  C  CA    . SER A  1  313 ? 26.309  56.307 -10.849 1.00 29.27  ? 1112 SER B CA    1 
ATOM   2428  C  C     . SER A  1  313 ? 24.924  55.976 -11.371 1.00 29.88  ? 1112 SER B C     1 
ATOM   2429  O  O     . SER A  1  313 ? 24.605  54.809 -11.654 1.00 27.35  ? 1112 SER B O     1 
ATOM   2430  C  CB    . SER A  1  313 ? 27.059  57.162 -11.871 1.00 29.97  ? 1112 SER B CB    1 
ATOM   2431  O  OG    . SER A  1  313 ? 26.898  56.622 -13.186 1.00 31.59  ? 1112 SER B OG    1 
ATOM   2432  N  N     A MET A  1  314 ? 24.154  57.028 -11.530 0.50 31.27  ? 1113 MET B N     1 
ATOM   2433  N  N     B MET A  1  314 ? 24.113  57.023 -11.489 0.50 30.31  ? 1113 MET B N     1 
ATOM   2434  C  CA    A MET A  1  314 ? 22.814  56.890 -12.120 0.50 33.37  ? 1113 MET B CA    1 
ATOM   2435  C  CA    B MET A  1  314 ? 22.777  56.883 -12.090 0.50 31.83  ? 1113 MET B CA    1 
ATOM   2436  C  C     A MET A  1  314 ? 22.870  56.471 -13.557 0.50 32.12  ? 1113 MET B C     1 
ATOM   2437  C  C     B MET A  1  314 ? 22.840  56.553 -13.589 0.50 31.24  ? 1113 MET B C     1 
ATOM   2438  O  O     A MET A  1  314 ? 21.825  56.252 -14.185 0.50 34.28  ? 1113 MET B O     1 
ATOM   2439  O  O     B MET A  1  314 ? 21.800  56.206 -14.180 0.50 33.27  ? 1113 MET B O     1 
ATOM   2440  C  CB    A MET A  1  314 ? 22.104  58.260 -12.060 0.50 35.68  ? 1113 MET B CB    1 
ATOM   2441  C  CB    B MET A  1  314 ? 22.000  58.197 -11.874 0.50 32.86  ? 1113 MET B CB    1 
ATOM   2442  C  CG    A MET A  1  314 ? 21.730  58.603 -10.643 0.50 39.23  ? 1113 MET B CG    1 
ATOM   2443  C  CG    B MET A  1  314 ? 21.596  58.454 -10.422 0.50 33.94  ? 1113 MET B CG    1 
ATOM   2444  S  SD    A MET A  1  314 ? 20.367  59.814 -10.800 0.50 43.67  ? 1113 MET B SD    1 
ATOM   2445  S  SD    B MET A  1  314 ? 20.534  59.958 -10.141 0.50 36.83  ? 1113 MET B SD    1 
ATOM   2446  C  CE    A MET A  1  314 ? 20.456  60.410 -9.097  0.50 41.84  ? 1113 MET B CE    1 
ATOM   2447  C  CE    B MET A  1  314 ? 19.447  59.720 -11.510 0.50 35.54  ? 1113 MET B CE    1 
ATOM   2448  N  N     . ASP A  1  315 ? 24.006  56.664 -14.199 1.00 30.71  ? 1114 ASP B N     1 
ATOM   2449  C  CA    . ASP A  1  315 ? 24.161  56.374 -15.624 1.00 32.51  ? 1114 ASP B CA    1 
ATOM   2450  C  C     . ASP A  1  315 ? 24.532  54.924 -15.904 1.00 33.64  ? 1114 ASP B C     1 
ATOM   2451  O  O     . ASP A  1  315 ? 24.987  54.611 -16.994 1.00 36.17  ? 1114 ASP B O     1 
ATOM   2452  C  CB    . ASP A  1  315 ? 25.239  57.296 -16.234 1.00 35.01  ? 1114 ASP B CB    1 
ATOM   2453  C  CG    . ASP A  1  315 ? 24.809  58.741 -16.321 1.00 36.28  ? 1114 ASP B CG    1 
ATOM   2454  O  OD1   . ASP A  1  315 ? 23.587  59.002 -16.213 1.00 33.96  ? 1114 ASP B OD1   1 
ATOM   2455  O  OD2   . ASP A  1  315 ? 25.689  59.599 -16.479 1.00 40.93  ? 1114 ASP B OD2   1 
ATOM   2456  N  N     . GLY A  1  316 ? 24.344  54.041 -14.921 1.00 35.89  ? 1115 GLY B N     1 
ATOM   2457  C  CA    . GLY A  1  316 ? 24.683  52.654 -15.102 1.00 35.44  ? 1115 GLY B CA    1 
ATOM   2458  C  C     . GLY A  1  316 ? 26.151  52.318 -14.958 1.00 37.00  ? 1115 GLY B C     1 
ATOM   2459  O  O     . GLY A  1  316 ? 26.525  51.172 -15.192 1.00 37.81  ? 1115 GLY B O     1 
ATOM   2460  N  N     . ASP A  1  317 ? 26.967  53.268 -14.601 1.00 35.45  ? 1116 ASP B N     1 
ATOM   2461  C  CA    . ASP A  1  317 ? 28.387  52.981 -14.316 1.00 41.55  ? 1116 ASP B CA    1 
ATOM   2462  C  C     . ASP A  1  317 ? 28.457  52.025 -13.096 1.00 37.01  ? 1116 ASP B C     1 
ATOM   2463  O  O     . ASP A  1  317 ? 27.759  52.205 -12.118 1.00 45.06  ? 1116 ASP B O     1 
ATOM   2464  C  CB    . ASP A  1  317 ? 29.169  54.285 -14.024 1.00 40.93  ? 1116 ASP B CB    1 
ATOM   2465  C  CG    . ASP A  1  317 ? 29.218  55.177 -15.178 1.00 52.86  ? 1116 ASP B CG    1 
ATOM   2466  O  OD1   . ASP A  1  317 ? 29.610  54.627 -16.214 1.00 57.59  ? 1116 ASP B OD1   1 
ATOM   2467  O  OD2   . ASP A  1  317 ? 28.909  56.405 -15.064 1.00 56.39  ? 1116 ASP B OD2   1 
ATOM   2468  N  N     . GLY A  1  318 ? 29.332  51.081 -13.194 1.00 35.69  ? 1117 GLY B N     1 
ATOM   2469  C  CA    . GLY A  1  318 ? 29.519  50.155 -12.086 1.00 30.24  ? 1117 GLY B CA    1 
ATOM   2470  C  C     . GLY A  1  318 ? 30.504  50.813 -11.068 1.00 28.48  ? 1117 GLY B C     1 
ATOM   2471  O  O     . GLY A  1  318 ? 31.225  51.796 -11.316 1.00 28.89  ? 1117 GLY B O     1 
ATOM   2472  N  N     . ALA A  1  319 ? 30.504  50.216 -9.870  1.00 27.16  ? 1118 ALA B N     1 
ATOM   2473  C  CA    . ALA A  1  319 ? 31.510  50.545 -8.937  1.00 25.63  ? 1118 ALA B CA    1 
ATOM   2474  C  C     . ALA A  1  319 ? 32.881  50.081 -9.460  1.00 25.54  ? 1118 ALA B C     1 
ATOM   2475  O  O     . ALA A  1  319 ? 32.972  49.135 -10.230 1.00 28.09  ? 1118 ALA B O     1 
ATOM   2476  C  CB    . ALA A  1  319 ? 31.188  49.912 -7.572  1.00 25.35  ? 1118 ALA B CB    1 
ATOM   2477  N  N     . ALA A  1  320 ? 33.940  50.706 -8.976  1.00 25.48  ? 1119 ALA B N     1 
ATOM   2478  C  CA    . ALA A  1  320 ? 35.262  50.189 -9.231  1.00 27.06  ? 1119 ALA B CA    1 
ATOM   2479  C  C     . ALA A  1  320 ? 35.426  48.803 -8.615  1.00 27.74  ? 1119 ALA B C     1 
ATOM   2480  O  O     . ALA A  1  320 ? 34.594  48.388 -7.784  1.00 25.06  ? 1119 ALA B O     1 
ATOM   2481  C  CB    . ALA A  1  320 ? 36.321  51.167 -8.718  1.00 27.54  ? 1119 ALA B CB    1 
ATOM   2482  N  N     . ALA A  1  321 ? 36.496  48.106 -8.983  1.00 26.92  ? 1120 ALA B N     1 
ATOM   2483  C  CA    . ALA A  1  321 ? 36.725  46.758 -8.462  1.00 26.83  ? 1120 ALA B CA    1 
ATOM   2484  C  C     . ALA A  1  321 ? 36.923  46.877 -6.912  1.00 25.54  ? 1120 ALA B C     1 
ATOM   2485  O  O     . ALA A  1  321 ? 37.369  47.891 -6.349  1.00 24.66  ? 1120 ALA B O     1 
ATOM   2486  C  CB    . ALA A  1  321 ? 38.041  46.209 -9.093  1.00 27.09  ? 1120 ALA B CB    1 
ATOM   2487  N  N     . MET A  1  322 ? 36.535  45.778 -6.243  1.00 24.83  ? 1121 MET B N     1 
ATOM   2488  C  CA    . MET A  1  322 ? 36.415  45.850 -4.793  1.00 24.29  ? 1121 MET B CA    1 
ATOM   2489  C  C     . MET A  1  322 ? 37.770  46.020 -4.084  1.00 23.27  ? 1121 MET B C     1 
ATOM   2490  O  O     . MET A  1  322 ? 37.768  46.392 -2.895  1.00 22.35  ? 1121 MET B O     1 
ATOM   2491  C  CB    . MET A  1  322 ? 35.718  44.587 -4.272  1.00 24.36  ? 1121 MET B CB    1 
ATOM   2492  C  CG    . MET A  1  322 ? 36.499  43.288 -4.472  1.00 26.76  ? 1121 MET B CG    1 
ATOM   2493  S  SD    . MET A  1  322 ? 35.551  41.924 -3.772  1.00 26.41  ? 1121 MET B SD    1 
ATOM   2494  C  CE    . MET A  1  322 ? 36.648  40.549 -4.062  1.00 24.53  ? 1121 MET B CE    1 
ATOM   2495  N  N     . ARG A  1  323 ? 38.893  45.768 -4.788  1.00 23.25  ? 1122 ARG B N     1 
ATOM   2496  C  CA    . ARG A  1  323 ? 40.173  46.054 -4.170  1.00 24.57  ? 1122 ARG B CA    1 
ATOM   2497  C  C     . ARG A  1  323 ? 40.459  47.584 -4.104  1.00 24.92  ? 1122 ARG B C     1 
ATOM   2498  O  O     . ARG A  1  323 ? 41.380  47.985 -3.384  1.00 24.53  ? 1122 ARG B O     1 
ATOM   2499  C  CB    . ARG A  1  323 ? 41.348  45.378 -4.816  1.00 24.32  ? 1122 ARG B CB    1 
ATOM   2500  C  CG    . ARG A  1  323 ? 41.742  45.944 -6.233  1.00 26.01  ? 1122 ARG B CG    1 
ATOM   2501  C  CD    . ARG A  1  323 ? 42.643  44.911 -6.945  1.00 28.08  ? 1122 ARG B CD    1 
ATOM   2502  N  NE    . ARG A  1  323 ? 43.102  45.488 -8.210  1.00 30.80  ? 1122 ARG B NE    1 
ATOM   2503  C  CZ    . ARG A  1  323 ? 42.428  45.262 -9.338  1.00 35.90  ? 1122 ARG B CZ    1 
ATOM   2504  N  NH1   . ARG A  1  323 ? 41.198  44.594 -9.327  1.00 35.93  ? 1122 ARG B NH1   1 
ATOM   2505  N  NH2   . ARG A  1  323 ? 42.971  45.739 -10.516 1.00 35.08  ? 1122 ARG B NH2   1 
ATOM   2506  N  N     . PHE A  1  324 ? 39.647  48.386 -4.800  1.00 25.14  ? 1123 PHE B N     1 
ATOM   2507  C  CA    . PHE A  1  324 ? 39.840  49.814 -4.853  1.00 27.36  ? 1123 PHE B CA    1 
ATOM   2508  C  C     . PHE A  1  324 ? 38.844  50.622 -3.990  1.00 28.27  ? 1123 PHE B C     1 
ATOM   2509  O  O     . PHE A  1  324 ? 38.995  51.838 -3.880  1.00 33.08  ? 1123 PHE B O     1 
ATOM   2510  C  CB    . PHE A  1  324 ? 39.716  50.305 -6.318  1.00 27.00  ? 1123 PHE B CB    1 
ATOM   2511  C  CG    . PHE A  1  324 ? 40.774  49.828 -7.224  1.00 27.74  ? 1123 PHE B CG    1 
ATOM   2512  C  CD1   . PHE A  1  324 ? 42.112  50.151 -6.958  1.00 27.98  ? 1123 PHE B CD1   1 
ATOM   2513  C  CD2   . PHE A  1  324 ? 40.444  49.078 -8.353  1.00 28.41  ? 1123 PHE B CD2   1 
ATOM   2514  C  CE1   . PHE A  1  324 ? 43.129  49.673 -7.858  1.00 29.96  ? 1123 PHE B CE1   1 
ATOM   2515  C  CE2   . PHE A  1  324 ? 41.472  48.616 -9.241  1.00 28.85  ? 1123 PHE B CE2   1 
ATOM   2516  C  CZ    . PHE A  1  324 ? 42.793  48.947 -8.991  1.00 29.32  ? 1123 PHE B CZ    1 
ATOM   2517  N  N     . THR A  1  325 ? 37.842  49.977 -3.402  1.00 25.65  ? 1124 THR B N     1 
ATOM   2518  C  CA    . THR A  1  325 ? 36.842  50.671 -2.613  1.00 23.90  ? 1124 THR B CA    1 
ATOM   2519  C  C     . THR A  1  325 ? 36.892  50.216 -1.145  1.00 23.96  ? 1124 THR B C     1 
ATOM   2520  O  O     . THR A  1  325 ? 37.525  49.215 -0.807  1.00 24.42  ? 1124 THR B O     1 
ATOM   2521  C  CB    . THR A  1  325 ? 35.444  50.501 -3.170  1.00 22.84  ? 1124 THR B CB    1 
ATOM   2522  O  OG1   . THR A  1  325 ? 35.070  49.123 -3.115  1.00 25.25  ? 1124 THR B OG1   1 
ATOM   2523  C  CG2   . THR A  1  325 ? 35.383  51.012 -4.630  1.00 22.65  ? 1124 THR B CG2   1 
ATOM   2524  N  N     . GLU A  1  326 ? 36.205  50.950 -0.294  1.00 23.57  ? 1125 GLU B N     1 
ATOM   2525  C  CA    . GLU A  1  326 ? 36.140  50.670 1.120   1.00 24.14  ? 1125 GLU B CA    1 
ATOM   2526  C  C     . GLU A  1  326 ? 34.701  50.933 1.586   1.00 23.89  ? 1125 GLU B C     1 
ATOM   2527  O  O     . GLU A  1  326 ? 33.942  51.628 0.916   1.00 24.93  ? 1125 GLU B O     1 
ATOM   2528  C  CB    . GLU A  1  326 ? 37.139  51.514 1.935   1.00 25.49  ? 1125 GLU B CB    1 
ATOM   2529  C  CG    . GLU A  1  326 ? 38.571  51.322 1.509   1.00 29.30  ? 1125 GLU B CG    1 
ATOM   2530  C  CD    . GLU A  1  326 ? 39.566  52.231 2.257   1.00 33.75  ? 1125 GLU B CD    1 
ATOM   2531  O  OE1   . GLU A  1  326 ? 39.185  53.116 3.080   1.00 36.97  ? 1125 GLU B OE1   1 
ATOM   2532  O  OE2   . GLU A  1  326 ? 40.768  52.116 1.979   1.00 37.63  ? 1125 GLU B OE2   1 
ATOM   2533  N  N     . ALA A  1  327 ? 34.353  50.385 2.750   1.00 23.09  ? 1126 ALA B N     1 
ATOM   2534  C  CA    . ALA A  1  327 ? 32.993  50.551 3.221   1.00 22.59  ? 1126 ALA B CA    1 
ATOM   2535  C  C     . ALA A  1  327 ? 32.894  50.283 4.707   1.00 23.72  ? 1126 ALA B C     1 
ATOM   2536  O  O     . ALA A  1  327 ? 33.852  49.787 5.339   1.00 22.83  ? 1126 ALA B O     1 
ATOM   2537  C  CB    . ALA A  1  327 ? 32.009  49.583 2.444   1.00 22.18  ? 1126 ALA B CB    1 
ATOM   2538  N  N     . ARG A  1  328 ? 31.739  50.633 5.257   1.00 22.96  ? 1127 ARG B N     1 
ATOM   2539  C  CA    . ARG A  1  328 ? 31.352  50.362 6.639   1.00 23.46  ? 1127 ARG B CA    1 
ATOM   2540  C  C     . ARG A  1  328 ? 29.807  50.498 6.672   1.00 23.35  ? 1127 ARG B C     1 
ATOM   2541  O  O     . ARG A  1  328 ? 29.174  50.812 5.671   1.00 23.06  ? 1127 ARG B O     1 
ATOM   2542  C  CB    . ARG A  1  328 ? 32.020  51.304 7.611   1.00 24.74  ? 1127 ARG B CB    1 
ATOM   2543  C  CG    . ARG A  1  328 ? 31.596  52.741 7.383   1.00 25.07  ? 1127 ARG B CG    1 
ATOM   2544  C  CD    . ARG A  1  328 ? 32.493  53.721 8.211   1.00 27.93  ? 1127 ARG B CD    1 
ATOM   2545  N  NE    . ARG A  1  328 ? 32.184  55.095 7.808   1.00 28.56  ? 1127 ARG B NE    1 
ATOM   2546  C  CZ    . ARG A  1  328 ? 32.950  56.112 8.083   1.00 31.47  ? 1127 ARG B CZ    1 
ATOM   2547  N  NH1   . ARG A  1  328 ? 34.121  55.991 8.786   1.00 30.15  ? 1127 ARG B NH1   1 
ATOM   2548  N  NH2   . ARG A  1  328 ? 32.613  57.344 7.685   1.00 32.93  ? 1127 ARG B NH2   1 
ATOM   2549  N  N     . MET A  1  329 ? 29.238  50.292 7.857   1.00 23.78  ? 1128 MET B N     1 
ATOM   2550  C  CA    . MET A  1  329 ? 27.799  50.498 8.007   1.00 26.07  ? 1128 MET B CA    1 
ATOM   2551  C  C     . MET A  1  329 ? 27.424  51.969 7.964   1.00 26.29  ? 1128 MET B C     1 
ATOM   2552  O  O     . MET A  1  329 ? 28.249  52.842 8.287   1.00 27.12  ? 1128 MET B O     1 
ATOM   2553  C  CB    . MET A  1  329 ? 27.281  49.959 9.322   1.00 29.12  ? 1128 MET B CB    1 
ATOM   2554  C  CG    . MET A  1  329 ? 27.544  48.512 9.632   1.00 32.09  ? 1128 MET B CG    1 
ATOM   2555  S  SD    . MET A  1  329 ? 26.913  48.278 11.353  1.00 39.17  ? 1128 MET B SD    1 
ATOM   2556  C  CE    . MET A  1  329 ? 28.153  47.115 11.877  1.00 31.93  ? 1128 MET B CE    1 
ATOM   2557  N  N     . THR A  1  330 ? 26.192  52.248 7.610   1.00 23.97  ? 1129 THR B N     1 
ATOM   2558  C  CA    . THR A  1  330 ? 25.588  53.526 7.939   1.00 24.12  ? 1129 THR B CA    1 
ATOM   2559  C  C     . THR A  1  330 ? 25.006  53.461 9.367   1.00 24.69  ? 1129 THR B C     1 
ATOM   2560  O  O     . THR A  1  330 ? 24.910  52.386 9.990   1.00 23.79  ? 1129 THR B O     1 
ATOM   2561  C  CB    . THR A  1  330 ? 24.438  53.841 6.965   1.00 23.20  ? 1129 THR B CB    1 
ATOM   2562  O  OG1   . THR A  1  330 ? 23.457  52.794 7.019   1.00 23.61  ? 1129 THR B OG1   1 
ATOM   2563  C  CG2   . THR A  1  330 ? 24.984  53.907 5.546   1.00 21.90  ? 1129 THR B CG2   1 
ATOM   2564  N  N     . LYS A  1  331 ? 24.645  54.616 9.899   1.00 23.90  ? 1130 LYS B N     1 
ATOM   2565  C  CA    . LYS A  1  331 ? 24.063  54.671 11.228  1.00 25.99  ? 1130 LYS B CA    1 
ATOM   2566  C  C     . LYS A  1  331 ? 22.730  53.972 11.296  1.00 26.00  ? 1130 LYS B C     1 
ATOM   2567  O  O     . LYS A  1  331 ? 22.405  53.359 12.335  1.00 25.81  ? 1130 LYS B O     1 
ATOM   2568  C  CB    . LYS A  1  331 ? 23.899  56.158 11.634  1.00 27.23  ? 1130 LYS B CB    1 
ATOM   2569  C  CG    . LYS A  1  331 ? 25.226  56.744 12.129  1.00 30.29  ? 1130 LYS B CG    1 
ATOM   2570  C  CD    . LYS A  1  331 ? 25.114  58.267 12.230  1.00 32.60  ? 1130 LYS B CD    1 
ATOM   2571  C  CE    . LYS A  1  331 ? 26.423  58.813 12.848  1.00 36.48  ? 1130 LYS B CE    1 
ATOM   2572  N  NZ    . LYS A  1  331 ? 26.238  60.284 13.203  1.00 42.84  ? 1130 LYS B NZ    1 
ATOM   2573  N  N     . ILE A  1  332 ? 21.942  54.015 10.234  1.00 24.62  ? 1131 ILE B N     1 
ATOM   2574  C  CA    . ILE A  1  332 ? 20.619  53.386 10.290  1.00 26.23  ? 1131 ILE B CA    1 
ATOM   2575  C  C     . ILE A  1  332 ? 20.748  51.874 10.272  1.00 25.72  ? 1131 ILE B C     1 
ATOM   2576  O  O     . ILE A  1  332 ? 19.832  51.177 10.702  1.00 27.69  ? 1131 ILE B O     1 
ATOM   2577  C  CB    . ILE A  1  332 ? 19.695  53.905 9.187   1.00 26.24  ? 1131 ILE B CB    1 
ATOM   2578  C  CG1   . ILE A  1  332 ? 18.253  53.762 9.581   1.00 26.59  ? 1131 ILE B CG1   1 
ATOM   2579  C  CG2   . ILE A  1  332 ? 20.021  53.228 7.861   1.00 26.07  ? 1131 ILE B CG2   1 
ATOM   2580  C  CD1   . ILE A  1  332 ? 17.303  54.372 8.508   1.00 28.40  ? 1131 ILE B CD1   1 
ATOM   2581  N  N     . THR A  1  333 ? 21.848  51.331 9.729   1.00 25.28  ? 1132 THR B N     1 
ATOM   2582  C  CA    . THR A  1  333 ? 22.027  49.884 9.772   1.00 23.87  ? 1132 THR B CA    1 
ATOM   2583  C  C     . THR A  1  333 ? 22.249  49.397 11.221  1.00 24.24  ? 1132 THR B C     1 
ATOM   2584  O  O     . THR A  1  333 ? 21.869  48.263 11.523  1.00 23.07  ? 1132 THR B O     1 
ATOM   2585  C  CB    . THR A  1  333 ? 23.237  49.493 8.891   1.00 24.80  ? 1132 THR B CB    1 
ATOM   2586  O  OG1   . THR A  1  333 ? 22.798  49.630 7.524   1.00 22.93  ? 1132 THR B OG1   1 
ATOM   2587  C  CG2   . THR A  1  333 ? 23.683  48.055 9.115   1.00 23.89  ? 1132 THR B CG2   1 
ATOM   2588  N  N     . LEU A  1  334 ? 22.781  50.265 12.098  1.00 23.73  ? 1133 LEU B N     1 
ATOM   2589  C  CA    . LEU A  1  334 ? 22.840  49.905 13.494  1.00 25.81  ? 1133 LEU B CA    1 
ATOM   2590  C  C     . LEU A  1  334 ? 21.470  49.541 14.040  1.00 25.74  ? 1133 LEU B C     1 
ATOM   2591  O  O     . LEU A  1  334 ? 21.373  48.716 14.968  1.00 27.37  ? 1133 LEU B O     1 
ATOM   2592  C  CB    . LEU A  1  334 ? 23.416  51.012 14.390  1.00 25.92  ? 1133 LEU B CB    1 
ATOM   2593  C  CG    . LEU A  1  334 ? 24.904  51.380 14.117  1.00 28.42  ? 1133 LEU B CG    1 
ATOM   2594  C  CD1   . LEU A  1  334 ? 25.269  52.677 14.796  1.00 30.40  ? 1133 LEU B CD1   1 
ATOM   2595  C  CD2   . LEU A  1  334 ? 25.725  50.305 14.740  1.00 30.35  ? 1133 LEU B CD2   1 
ATOM   2596  N  N     . GLU A  1  335 ? 20.401  50.116 13.528  1.00 25.00  ? 1134 GLU B N     1 
ATOM   2597  C  CA    . GLU A  1  335 ? 19.073  49.785 14.006  1.00 25.76  ? 1134 GLU B CA    1 
ATOM   2598  C  C     . GLU A  1  335 ? 18.569  48.448 13.458  1.00 26.04  ? 1134 GLU B C     1 
ATOM   2599  O  O     . GLU A  1  335 ? 17.689  47.838 14.079  1.00 26.51  ? 1134 GLU B O     1 
ATOM   2600  C  CB    . GLU A  1  335 ? 18.060  50.890 13.612  1.00 26.72  ? 1134 GLU B CB    1 
ATOM   2601  C  CG    . GLU A  1  335 ? 18.420  52.261 14.217  1.00 28.98  ? 1134 GLU B CG    1 
ATOM   2602  C  CD    . GLU A  1  335 ? 18.560  52.224 15.709  1.00 33.25  ? 1134 GLU B CD    1 
ATOM   2603  O  OE1   . GLU A  1  335 ? 19.428  52.975 16.231  1.00 34.60  ? 1134 GLU B OE1   1 
ATOM   2604  O  OE2   . GLU A  1  335 ? 17.842  51.456 16.376  1.00 33.69  ? 1134 GLU B OE2   1 
ATOM   2605  N  N     . LEU A  1  336 ? 19.120  47.972 12.336  1.00 25.55  ? 1135 LEU B N     1 
ATOM   2606  C  CA    . LEU A  1  336 ? 18.787  46.625 11.885  1.00 24.70  ? 1135 LEU B CA    1 
ATOM   2607  C  C     . LEU A  1  336 ? 19.455  45.571 12.756  1.00 24.27  ? 1135 LEU B C     1 
ATOM   2608  O  O     . LEU A  1  336 ? 18.883  44.485 12.929  1.00 25.88  ? 1135 LEU B O     1 
ATOM   2609  C  CB    . LEU A  1  336 ? 19.223  46.443 10.398  1.00 24.72  ? 1135 LEU B CB    1 
ATOM   2610  C  CG    . LEU A  1  336 ? 18.386  47.072 9.333   1.00 24.25  ? 1135 LEU B CG    1 
ATOM   2611  C  CD1   . LEU A  1  336 ? 19.024  46.711 7.939   1.00 23.27  ? 1135 LEU B CD1   1 
ATOM   2612  C  CD2   . LEU A  1  336 ? 16.958  46.624 9.356   1.00 23.13  ? 1135 LEU B CD2   1 
ATOM   2613  N  N     . LEU A  1  337 ? 20.653  45.840 13.247  1.00 23.91  ? 1136 LEU B N     1 
ATOM   2614  C  CA    . LEU A  1  337 ? 21.426  44.899 14.029  1.00 23.77  ? 1136 LEU B CA    1 
ATOM   2615  C  C     . LEU A  1  337 ? 21.232  45.074 15.560  1.00 25.49  ? 1136 LEU B C     1 
ATOM   2616  O  O     . LEU A  1  337 ? 21.784  44.304 16.317  1.00 27.89  ? 1136 LEU B O     1 
ATOM   2617  C  CB    . LEU A  1  337 ? 22.905  45.021 13.733  1.00 24.22  ? 1136 LEU B CB    1 
ATOM   2618  C  CG    . LEU A  1  337 ? 23.220  44.608 12.254  1.00 22.19  ? 1136 LEU B CG    1 
ATOM   2619  C  CD1   . LEU A  1  337 ? 24.407  45.431 11.717  1.00 22.47  ? 1136 LEU B CD1   1 
ATOM   2620  C  CD2   . LEU A  1  337 ? 23.486  43.126 12.125  1.00 21.93  ? 1136 LEU B CD2   1 
ATOM   2621  N  N     . ARG A  1  338 ? 20.431  46.089 15.967  1.00 25.46  ? 1137 ARG B N     1 
ATOM   2622  C  CA    . ARG A  1  338 ? 20.289  46.394 17.372  1.00 26.94  ? 1137 ARG B CA    1 
ATOM   2623  C  C     . ARG A  1  338 ? 19.633  45.237 18.127  1.00 27.22  ? 1137 ARG B C     1 
ATOM   2624  O  O     . ARG A  1  338 ? 18.662  44.677 17.684  1.00 27.85  ? 1137 ARG B O     1 
ATOM   2625  C  CB    . ARG A  1  338 ? 19.442  47.655 17.499  1.00 27.85  ? 1137 ARG B CB    1 
ATOM   2626  C  CG    . ARG A  1  338 ? 19.264  48.180 18.960  1.00 33.55  ? 1137 ARG B CG    1 
ATOM   2627  C  CD    . ARG A  1  338 ? 18.671  49.577 18.892  1.00 34.94  ? 1137 ARG B CD    1 
ATOM   2628  N  NE    . ARG A  1  338 ? 17.743  49.812 19.952  1.00 38.42  ? 1137 ARG B NE    1 
ATOM   2629  C  CZ    . ARG A  1  338 ? 16.834  50.821 19.955  1.00 39.29  ? 1137 ARG B CZ    1 
ATOM   2630  N  NH1   . ARG A  1  338 ? 16.728  51.619 18.906  1.00 35.64  ? 1137 ARG B NH1   1 
ATOM   2631  N  NH2   . ARG A  1  338 ? 15.985  50.965 20.981  1.00 39.44  ? 1137 ARG B NH2   1 
ATOM   2632  N  N     . ASP A  1  339 ? 20.241  44.903 19.288  1.00 28.83  ? 1138 ASP B N     1 
ATOM   2633  C  CA    . ASP A  1  339 ? 19.777  43.832 20.179  1.00 29.85  ? 1138 ASP B CA    1 
ATOM   2634  C  C     . ASP A  1  339 ? 19.979  42.435 19.615  1.00 28.51  ? 1138 ASP B C     1 
ATOM   2635  O  O     . ASP A  1  339 ? 19.380  41.474 20.092  1.00 25.43  ? 1138 ASP B O     1 
ATOM   2636  C  CB    . ASP A  1  339 ? 18.246  43.984 20.542  1.00 32.94  ? 1138 ASP B CB    1 
ATOM   2637  C  CG    . ASP A  1  339 ? 17.941  45.402 21.042  1.00 34.46  ? 1138 ASP B CG    1 
ATOM   2638  O  OD1   . ASP A  1  339 ? 18.699  45.958 21.749  1.00 38.15  ? 1138 ASP B OD1   1 
ATOM   2639  O  OD2   . ASP A  1  339 ? 16.870  45.922 20.681  1.00 42.57  ? 1138 ASP B OD2   1 
ATOM   2640  N  N     . ILE A  1  340 ? 20.838  42.286 18.609  1.00 27.82  ? 1139 ILE B N     1 
ATOM   2641  C  CA    . ILE A  1  340 ? 21.033  40.950 18.012  1.00 27.18  ? 1139 ILE B CA    1 
ATOM   2642  C  C     . ILE A  1  340 ? 21.729  39.999 18.971  1.00 28.30  ? 1139 ILE B C     1 
ATOM   2643  O  O     . ILE A  1  340 ? 21.572  38.789 18.859  1.00 28.36  ? 1139 ILE B O     1 
ATOM   2644  C  CB    . ILE A  1  340 ? 21.806  41.086 16.668  1.00 28.02  ? 1139 ILE B CB    1 
ATOM   2645  C  CG1   . ILE A  1  340 ? 21.638  39.781 15.886  1.00 28.11  ? 1139 ILE B CG1   1 
ATOM   2646  C  CG2   . ILE A  1  340 ? 23.246  41.382 16.856  1.00 28.68  ? 1139 ILE B CG2   1 
ATOM   2647  C  CD1   . ILE A  1  340 ? 22.149  39.910 14.421  1.00 29.20  ? 1139 ILE B CD1   1 
ATOM   2648  N  N     . ASN A  1  341 ? 22.487  40.521 19.931  1.00 29.59  ? 1140 ASN B N     1 
ATOM   2649  C  CA    . ASN A  1  341 ? 23.213  39.718 20.898  1.00 31.93  ? 1140 ASN B CA    1 
ATOM   2650  C  C     . ASN A  1  341 ? 22.466  39.583 22.209  1.00 30.03  ? 1140 ASN B C     1 
ATOM   2651  O  O     . ASN A  1  341 ? 23.068  39.282 23.244  1.00 30.53  ? 1140 ASN B O     1 
ATOM   2652  C  CB    . ASN A  1  341 ? 24.611  40.282 21.145  1.00 33.92  ? 1140 ASN B CB    1 
ATOM   2653  C  CG    . ASN A  1  341 ? 25.465  40.312 19.875  1.00 38.16  ? 1140 ASN B CG    1 
ATOM   2654  O  OD1   . ASN A  1  341 ? 25.574  39.308 19.144  1.00 40.74  ? 1140 ASN B OD1   1 
ATOM   2655  N  ND2   . ASN A  1  341 ? 26.077  41.475 19.591  1.00 39.63  ? 1140 ASN B ND2   1 
ATOM   2656  N  N     . LYS A  1  342 ? 21.147  39.763 22.184  1.00 30.96  ? 1141 LYS B N     1 
ATOM   2657  C  CA    . LYS A  1  342 ? 20.277  39.665 23.347  1.00 33.12  ? 1141 LYS B CA    1 
ATOM   2658  C  C     . LYS A  1  342 ? 19.210  38.613 23.143  1.00 31.58  ? 1141 LYS B C     1 
ATOM   2659  O  O     . LYS A  1  342 ? 18.060  38.772 23.600  1.00 29.58  ? 1141 LYS B O     1 
ATOM   2660  C  CB    . LYS A  1  342 ? 19.640  41.026 23.654  1.00 34.21  ? 1141 LYS B CB    1 
ATOM   2661  C  CG    . LYS A  1  342 ? 20.675  42.116 23.976  1.00 39.81  ? 1141 LYS B CG    1 
ATOM   2662  C  CD    . LYS A  1  342 ? 20.068  43.476 24.147  1.00 44.31  ? 1141 LYS B CD    1 
ATOM   2663  C  CE    . LYS A  1  342 ? 21.211  44.515 24.270  1.00 49.41  ? 1141 LYS B CE    1 
ATOM   2664  N  NZ    . LYS A  1  342 ? 20.733  45.939 24.366  1.00 60.18  ? 1141 LYS B NZ    1 
ATOM   2665  N  N     . ASP A  1  343 ? 19.578  37.526 22.433  1.00 30.60  ? 1142 ASP B N     1 
ATOM   2666  C  CA    . ASP A  1  343 ? 18.697  36.388 22.135  1.00 31.27  ? 1142 ASP B CA    1 
ATOM   2667  C  C     . ASP A  1  343 ? 17.329  36.872 21.606  1.00 31.52  ? 1142 ASP B C     1 
ATOM   2668  O  O     . ASP A  1  343 ? 16.251  36.363 21.971  1.00 32.57  ? 1142 ASP B O     1 
ATOM   2669  C  CB    . ASP A  1  343 ? 18.503  35.559 23.444  1.00 33.52  ? 1142 ASP B CB    1 
ATOM   2670  C  CG    . ASP A  1  343 ? 17.803  34.224 23.167  1.00 34.31  ? 1142 ASP B CG    1 
ATOM   2671  O  OD1   . ASP A  1  343 ? 17.832  33.745 22.055  1.00 32.42  ? 1142 ASP B OD1   1 
ATOM   2672  O  OD2   . ASP A  1  343 ? 17.159  33.706 24.108  1.00 33.85  ? 1142 ASP B OD2   1 
ATOM   2673  N  N     . THR A  1  344 ? 17.381  37.861 20.740  1.00 30.78  ? 1143 THR B N     1 
ATOM   2674  C  CA    . THR A  1  344 ? 16.159  38.373 20.110  1.00 28.95  ? 1143 THR B CA    1 
ATOM   2675  C  C     . THR A  1  344 ? 15.787  37.628 18.836  1.00 28.01  ? 1143 THR B C     1 
ATOM   2676  O  O     . THR A  1  344 ? 14.609  37.614 18.455  1.00 27.92  ? 1143 THR B O     1 
ATOM   2677  C  CB    . THR A  1  344 ? 16.316  39.872 19.762  1.00 28.03  ? 1143 THR B CB    1 
ATOM   2678  O  OG1   . THR A  1  344 ? 17.501  40.054 18.993  1.00 26.66  ? 1143 THR B OG1   1 
ATOM   2679  C  CG2   . THR A  1  344 ? 16.426  40.674 21.057  1.00 29.31  ? 1143 THR B CG2   1 
ATOM   2680  N  N     . ILE A  1  345 ? 16.748  37.009 18.165  1.00 27.87  ? 1144 ILE B N     1 
ATOM   2681  C  CA    . ILE A  1  345 ? 16.506  36.283 16.925  1.00 25.41  ? 1144 ILE B CA    1 
ATOM   2682  C  C     . ILE A  1  345 ? 17.251  34.945 16.982  1.00 24.71  ? 1144 ILE B C     1 
ATOM   2683  O  O     . ILE A  1  345 ? 18.246  34.793 17.678  1.00 24.10  ? 1144 ILE B O     1 
ATOM   2684  C  CB    . ILE A  1  345 ? 16.963  37.118 15.694  1.00 25.78  ? 1144 ILE B CB    1 
ATOM   2685  C  CG1   . ILE A  1  345 ? 18.410  37.579 15.844  1.00 25.53  ? 1144 ILE B CG1   1 
ATOM   2686  C  CG2   . ILE A  1  345 ? 16.054  38.315 15.513  1.00 24.06  ? 1144 ILE B CG2   1 
ATOM   2687  C  CD1   . ILE A  1  345 ? 19.420  36.672 15.146  1.00 27.30  ? 1144 ILE B CD1   1 
ATOM   2688  N  N     . ASP A  1  346 ? 16.734  33.978 16.222  1.00 24.77  ? 1145 ASP B N     1 
ATOM   2689  C  CA    . ASP A  1  346 ? 17.344  32.655 16.164  1.00 25.52  ? 1145 ASP B CA    1 
ATOM   2690  C  C     . ASP A  1  346 ? 18.546  32.625 15.271  1.00 26.92  ? 1145 ASP B C     1 
ATOM   2691  O  O     . ASP A  1  346 ? 18.471  33.119 14.130  1.00 27.03  ? 1145 ASP B O     1 
ATOM   2692  C  CB    . ASP A  1  346 ? 16.321  31.606 15.699  1.00 25.57  ? 1145 ASP B CB    1 
ATOM   2693  C  CG    . ASP A  1  346 ? 15.180  31.403 16.737  1.00 28.05  ? 1145 ASP B CG    1 
ATOM   2694  O  OD1   . ASP A  1  346 ? 15.324  31.845 17.884  1.00 27.78  ? 1145 ASP B OD1   1 
ATOM   2695  O  OD2   . ASP A  1  346 ? 14.189  30.784 16.364  1.00 29.93  ? 1145 ASP B OD2   1 
ATOM   2696  N  N     . PHE A  1  347 ? 19.656  32.047 15.768  1.00 26.24  ? 1146 PHE B N     1 
ATOM   2697  C  CA    . PHE A  1  347 ? 20.830  31.804 14.902  1.00 26.49  ? 1146 PHE B CA    1 
ATOM   2698  C  C     . PHE A  1  347 ? 20.764  30.393 14.339  1.00 26.21  ? 1146 PHE B C     1 
ATOM   2699  O  O     . PHE A  1  347 ? 20.061  29.495 14.892  1.00 26.68  ? 1146 PHE B O     1 
ATOM   2700  C  CB    . PHE A  1  347 ? 22.105  31.950 15.709  1.00 27.39  ? 1146 PHE B CB    1 
ATOM   2701  C  CG    . PHE A  1  347 ? 22.541  33.398 15.872  1.00 28.08  ? 1146 PHE B CG    1 
ATOM   2702  C  CD1   . PHE A  1  347 ? 21.979  34.198 16.911  1.00 29.14  ? 1146 PHE B CD1   1 
ATOM   2703  C  CD2   . PHE A  1  347 ? 23.487  33.929 15.026  1.00 27.70  ? 1146 PHE B CD2   1 
ATOM   2704  C  CE1   . PHE A  1  347 ? 22.348  35.474 17.053  1.00 29.12  ? 1146 PHE B CE1   1 
ATOM   2705  C  CE2   . PHE A  1  347 ? 23.886  35.238 15.178  1.00 28.99  ? 1146 PHE B CE2   1 
ATOM   2706  C  CZ    . PHE A  1  347 ? 23.302  36.042 16.203  1.00 28.59  ? 1146 PHE B CZ    1 
ATOM   2707  N  N     . ILE A  1  348 ? 21.460  30.189 13.237  1.00 25.12  ? 1147 ILE B N     1 
ATOM   2708  C  CA    . ILE A  1  348 ? 21.521  28.876 12.580  1.00 25.77  ? 1147 ILE B CA    1 
ATOM   2709  C  C     . ILE A  1  348 ? 22.964  28.568 12.221  1.00 25.27  ? 1147 ILE B C     1 
ATOM   2710  O  O     . ILE A  1  348 ? 23.839  29.461 12.204  1.00 29.35  ? 1147 ILE B O     1 
ATOM   2711  C  CB    . ILE A  1  348 ? 20.639  28.781 11.330  1.00 26.35  ? 1147 ILE B CB    1 
ATOM   2712  C  CG1   . ILE A  1  348 ? 21.013  29.894 10.316  1.00 24.42  ? 1147 ILE B CG1   1 
ATOM   2713  C  CG2   . ILE A  1  348 ? 19.136  28.804 11.716  1.00 28.48  ? 1147 ILE B CG2   1 
ATOM   2714  C  CD1   . ILE A  1  348 ? 20.245  29.790 9.002   1.00 26.44  ? 1147 ILE B CD1   1 
ATOM   2715  N  N     . ASP A  1  349 ? 23.252  27.313 11.959  1.00 25.66  ? 1148 ASP B N     1 
ATOM   2716  C  CA    . ASP A  1  349 ? 24.554  26.932 11.426  1.00 26.64  ? 1148 ASP B CA    1 
ATOM   2717  C  C     . ASP A  1  349 ? 24.721  27.441 10.010  1.00 24.97  ? 1148 ASP B C     1 
ATOM   2718  O  O     . ASP A  1  349 ? 23.744  27.477 9.220   1.00 25.26  ? 1148 ASP B O     1 
ATOM   2719  C  CB    . ASP A  1  349 ? 24.667  25.388 11.415  1.00 27.04  ? 1148 ASP B CB    1 
ATOM   2720  C  CG    . ASP A  1  349 ? 24.791  24.817 12.831  1.00 31.30  ? 1148 ASP B CG    1 
ATOM   2721  O  OD1   . ASP A  1  349 ? 25.001  25.573 13.786  1.00 30.43  ? 1148 ASP B OD1   1 
ATOM   2722  O  OD2   . ASP A  1  349 ? 24.668  23.560 12.782  1.00 34.17  ? 1148 ASP B OD2   1 
ATOM   2723  N  N     . ASN A  1  350 ? 25.938  27.810 9.679   1.00 26.43  ? 1149 ASN B N     1 
ATOM   2724  C  CA    . ASN A  1  350 ? 26.213  28.348 8.317   1.00 25.82  ? 1149 ASN B CA    1 
ATOM   2725  C  C     . ASN A  1  350 ? 26.291  27.133 7.368   1.00 27.43  ? 1149 ASN B C     1 
ATOM   2726  O  O     . ASN A  1  350 ? 25.936  26.009 7.714   1.00 26.84  ? 1149 ASN B O     1 
ATOM   2727  C  CB    . ASN A  1  350 ? 27.484  29.193 8.333   1.00 26.46  ? 1149 ASN B CB    1 
ATOM   2728  C  CG    . ASN A  1  350 ? 28.760  28.308 8.376   1.00 28.43  ? 1149 ASN B CG    1 
ATOM   2729  O  OD1   . ASN A  1  350 ? 28.749  27.226 8.989   1.00 33.09  ? 1149 ASN B OD1   1 
ATOM   2730  N  ND2   . ASN A  1  350 ? 29.812  28.757 7.743   1.00 25.42  ? 1149 ASN B ND2   1 
ATOM   2731  N  N     . TYR A  1  351 ? 26.788  27.381 6.167   1.00 25.43  ? 1150 TYR B N     1 
ATOM   2732  C  CA    . TYR A  1  351 ? 26.726  26.358 5.132   1.00 28.15  ? 1150 TYR B CA    1 
ATOM   2733  C  C     . TYR A  1  351 ? 27.639  25.147 5.457   1.00 29.45  ? 1150 TYR B C     1 
ATOM   2734  O  O     . TYR A  1  351 ? 27.315  24.021 5.061   1.00 31.90  ? 1150 TYR B O     1 
ATOM   2735  C  CB    . TYR A  1  351 ? 27.090  26.961 3.766   1.00 25.62  ? 1150 TYR B CB    1 
ATOM   2736  C  CG    . TYR A  1  351 ? 28.525  27.374 3.612   1.00 26.06  ? 1150 TYR B CG    1 
ATOM   2737  C  CD1   . TYR A  1  351 ? 28.961  28.629 4.045   1.00 25.80  ? 1150 TYR B CD1   1 
ATOM   2738  C  CD2   . TYR A  1  351 ? 29.467  26.518 2.989   1.00 26.93  ? 1150 TYR B CD2   1 
ATOM   2739  C  CE1   . TYR A  1  351 ? 30.300  29.016 3.885   1.00 25.05  ? 1150 TYR B CE1   1 
ATOM   2740  C  CE2   . TYR A  1  351 ? 30.799  26.898 2.844   1.00 27.84  ? 1150 TYR B CE2   1 
ATOM   2741  C  CZ    . TYR A  1  351 ? 31.179  28.150 3.309   1.00 27.17  ? 1150 TYR B CZ    1 
ATOM   2742  O  OH    . TYR A  1  351 ? 32.523  28.523 3.162   1.00 27.47  ? 1150 TYR B OH    1 
ATOM   2743  N  N     . ASP A  1  352 ? 28.746  25.346 6.156   1.00 30.07  ? 1151 ASP B N     1 
ATOM   2744  C  CA    . ASP A  1  352 ? 29.657  24.257 6.422   1.00 34.03  ? 1151 ASP B CA    1 
ATOM   2745  C  C     . ASP A  1  352 ? 29.710  23.836 7.905   1.00 33.71  ? 1151 ASP B C     1 
ATOM   2746  O  O     . ASP A  1  352 ? 30.538  22.984 8.260   1.00 37.23  ? 1151 ASP B O     1 
ATOM   2747  C  CB    . ASP A  1  352 ? 31.096  24.595 5.956   1.00 36.12  ? 1151 ASP B CB    1 
ATOM   2748  C  CG    . ASP A  1  352 ? 31.640  25.861 6.624   1.00 35.70  ? 1151 ASP B CG    1 
ATOM   2749  O  OD1   . ASP A  1  352 ? 30.958  26.427 7.492   1.00 35.92  ? 1151 ASP B OD1   1 
ATOM   2750  O  OD2   . ASP A  1  352 ? 32.749  26.274 6.267   1.00 32.89  ? 1151 ASP B OD2   1 
ATOM   2751  N  N     . GLY A  1  353 ? 28.863  24.412 8.736   1.00 32.92  ? 1152 GLY B N     1 
ATOM   2752  C  CA    . GLY A  1  353 ? 28.839  24.048 10.144  1.00 34.05  ? 1152 GLY B CA    1 
ATOM   2753  C  C     . GLY A  1  353 ? 29.952  24.668 10.982  1.00 34.96  ? 1152 GLY B C     1 
ATOM   2754  O  O     . GLY A  1  353 ? 29.985  24.417 12.165  1.00 40.37  ? 1152 GLY B O     1 
ATOM   2755  N  N     . ASN A  1  354 ? 30.829  25.450 10.376  1.00 34.13  ? 1153 ASN B N     1 
ATOM   2756  C  CA    . ASN A  1  354 ? 31.919  26.104 11.094  1.00 35.28  ? 1153 ASN B CA    1 
ATOM   2757  C  C     . ASN A  1  354 ? 31.544  27.454 11.687  1.00 35.43  ? 1153 ASN B C     1 
ATOM   2758  O  O     . ASN A  1  354 ? 32.305  27.971 12.504  1.00 33.41  ? 1153 ASN B O     1 
ATOM   2759  C  CB    . ASN A  1  354 ? 33.135  26.306 10.172  1.00 40.30  ? 1153 ASN B CB    1 
ATOM   2760  C  CG    . ASN A  1  354 ? 33.651  24.988 9.612   1.00 44.80  ? 1153 ASN B CG    1 
ATOM   2761  O  OD1   . ASN A  1  354 ? 33.541  23.937 10.268  1.00 44.36  ? 1153 ASN B OD1   1 
ATOM   2762  N  ND2   . ASN A  1  354 ? 34.201  25.029 8.397   1.00 38.19  ? 1153 ASN B ND2   1 
ATOM   2763  N  N     . GLU A  1  355 ? 30.414  28.052 11.268  1.00 30.32  ? 1154 GLU B N     1 
ATOM   2764  C  CA    . GLU A  1  355 ? 30.031  29.349 11.763  1.00 29.30  ? 1154 GLU B CA    1 
ATOM   2765  C  C     . GLU A  1  355 ? 28.568  29.344 12.136  1.00 29.16  ? 1154 GLU B C     1 
ATOM   2766  O  O     . GLU A  1  355 ? 27.826  28.385 11.871  1.00 27.98  ? 1154 GLU B O     1 
ATOM   2767  C  CB    . GLU A  1  355 ? 30.285  30.451 10.694  1.00 28.70  ? 1154 GLU B CB    1 
ATOM   2768  C  CG    . GLU A  1  355 ? 31.709  30.448 10.100  1.00 27.80  ? 1154 GLU B CG    1 
ATOM   2769  C  CD    . GLU A  1  355 ? 32.733  31.084 11.051  1.00 31.61  ? 1154 GLU B CD    1 
ATOM   2770  O  OE1   . GLU A  1  355 ? 32.398  31.472 12.191  1.00 29.11  ? 1154 GLU B OE1   1 
ATOM   2771  O  OE2   . GLU A  1  355 ? 33.888  31.240 10.717  1.00 29.57  ? 1154 GLU B OE2   1 
ATOM   2772  N  N     . ARG A  1  356 ? 28.117  30.421 12.756  1.00 28.68  ? 1155 ARG B N     1 
ATOM   2773  C  CA    . ARG A  1  356 ? 26.714  30.650 13.063  1.00 27.03  ? 1155 ARG B CA    1 
ATOM   2774  C  C     . ARG A  1  356 ? 26.309  31.959 12.374  1.00 26.02  ? 1155 ARG B C     1 
ATOM   2775  O  O     . ARG A  1  356 ? 27.099  32.905 12.303  1.00 26.98  ? 1155 ARG B O     1 
ATOM   2776  C  CB    . ARG A  1  356 ? 26.498  30.802 14.572  1.00 29.42  ? 1155 ARG B CB    1 
ATOM   2777  C  CG    . ARG A  1  356 ? 26.873  29.511 15.319  1.00 33.68  ? 1155 ARG B CG    1 
ATOM   2778  C  CD    . ARG A  1  356 ? 25.803  28.445 15.208  1.00 32.65  ? 1155 ARG B CD    1 
ATOM   2779  N  NE    . ARG A  1  356 ? 24.667  28.801 16.072  1.00 35.36  ? 1155 ARG B NE    1 
ATOM   2780  C  CZ    . ARG A  1  356 ? 23.539  28.104 16.149  1.00 37.42  ? 1155 ARG B CZ    1 
ATOM   2781  N  NH1   . ARG A  1  356 ? 23.392  27.021 15.428  1.00 38.79  ? 1155 ARG B NH1   1 
ATOM   2782  N  NH2   . ARG A  1  356 ? 22.567  28.487 16.935  1.00 36.38  ? 1155 ARG B NH2   1 
ATOM   2783  N  N     . GLU A  1  357 ? 25.087  31.979 11.859  1.00 23.55  ? 1156 GLU B N     1 
ATOM   2784  C  CA    . GLU A  1  357 ? 24.560  33.178 11.214  1.00 23.23  ? 1156 GLU B CA    1 
ATOM   2785  C  C     . GLU A  1  357 ? 23.117  33.410 11.606  1.00 23.06  ? 1156 GLU B C     1 
ATOM   2786  O  O     . GLU A  1  357 ? 22.409  32.460 11.969  1.00 25.08  ? 1156 GLU B O     1 
ATOM   2787  C  CB    . GLU A  1  357 ? 24.667  33.039 9.670   1.00 22.77  ? 1156 GLU B CB    1 
ATOM   2788  C  CG    . GLU A  1  357 ? 23.844  31.850 9.093   1.00 22.24  ? 1156 GLU B CG    1 
ATOM   2789  C  CD    . GLU A  1  357 ? 23.828  31.932 7.581   1.00 25.00  ? 1156 GLU B CD    1 
ATOM   2790  O  OE1   . GLU A  1  357 ? 23.642  30.880 6.933   1.00 25.37  ? 1156 GLU B OE1   1 
ATOM   2791  O  OE2   . GLU A  1  357 ? 23.918  33.037 7.042   1.00 23.13  ? 1156 GLU B OE2   1 
ATOM   2792  N  N     . PRO A  1  358 ? 22.659  34.640 11.547  1.00 22.60  ? 1157 PRO B N     1 
ATOM   2793  C  CA    . PRO A  1  358 ? 21.254  34.930 11.960  1.00 23.34  ? 1157 PRO B CA    1 
ATOM   2794  C  C     . PRO A  1  358 ? 20.269  34.532 10.912  1.00 22.71  ? 1157 PRO B C     1 
ATOM   2795  O  O     . PRO A  1  358 ? 20.513  34.652 9.681   1.00 24.69  ? 1157 PRO B O     1 
ATOM   2796  C  CB    . PRO A  1  358 ? 21.260  36.475 12.147  1.00 22.60  ? 1157 PRO B CB    1 
ATOM   2797  C  CG    . PRO A  1  358 ? 22.283  36.937 11.116  1.00 23.78  ? 1157 PRO B CG    1 
ATOM   2798  C  CD    . PRO A  1  358 ? 23.374  35.891 11.212  1.00 22.81  ? 1157 PRO B CD    1 
ATOM   2799  N  N     . SER A  1  359 ? 19.139  33.966 11.357  1.00 22.76  ? 1158 SER B N     1 
ATOM   2800  C  CA    . SER A  1  359 ? 18.041  33.653 10.419  1.00 23.44  ? 1158 SER B CA    1 
ATOM   2801  C  C     . SER A  1  359 ? 17.327  34.921 10.012  1.00 22.40  ? 1158 SER B C     1 
ATOM   2802  O  O     . SER A  1  359 ? 16.750  34.960 8.899   1.00 22.50  ? 1158 SER B O     1 
ATOM   2803  C  CB    . SER A  1  359 ? 17.118  32.606 11.051  1.00 22.23  ? 1158 SER B CB    1 
ATOM   2804  O  OG    . SER A  1  359 ? 16.401  33.261 12.177  1.00 23.15  ? 1158 SER B OG    1 
ATOM   2805  N  N     . VAL A  1  360 ? 17.341  35.948 10.826  1.00 22.51  ? 1159 VAL B N     1 
ATOM   2806  C  CA    . VAL A  1  360 ? 16.647  37.217 10.537  1.00 22.24  ? 1159 VAL B CA    1 
ATOM   2807  C  C     . VAL A  1  360 ? 17.310  38.299 11.410  1.00 23.16  ? 1159 VAL B C     1 
ATOM   2808  O  O     . VAL A  1  360 ? 17.889  38.001 12.441  1.00 22.65  ? 1159 VAL B O     1 
ATOM   2809  C  CB    . VAL A  1  360 ? 15.155  37.074 10.776  1.00 22.27  ? 1159 VAL B CB    1 
ATOM   2810  C  CG1   . VAL A  1  360 ? 14.847  36.880 12.288  1.00 23.71  ? 1159 VAL B CG1   1 
ATOM   2811  C  CG2   . VAL A  1  360 ? 14.384  38.321 10.276  1.00 22.55  ? 1159 VAL B CG2   1 
ATOM   2812  N  N     . LEU A  1  361 ? 17.241  39.523 10.971  1.00 22.02  ? 1160 LEU B N     1 
ATOM   2813  C  CA    . LEU A  1  361 ? 17.801  40.565 11.847  1.00 22.44  ? 1160 LEU B CA    1 
ATOM   2814  C  C     . LEU A  1  361 ? 16.693  41.172 12.698  1.00 23.54  ? 1160 LEU B C     1 
ATOM   2815  O  O     . LEU A  1  361 ? 15.518  41.160 12.317  1.00 23.96  ? 1160 LEU B O     1 
ATOM   2816  C  CB    . LEU A  1  361 ? 18.482  41.668 11.032  1.00 21.71  ? 1160 LEU B CB    1 
ATOM   2817  C  CG    . LEU A  1  361 ? 19.634  41.285 10.107  1.00 20.81  ? 1160 LEU B CG    1 
ATOM   2818  C  CD1   . LEU A  1  361 ? 20.337  42.525 9.555   1.00 20.30  ? 1160 LEU B CD1   1 
ATOM   2819  C  CD2   . LEU A  1  361 ? 20.618  40.371 10.843  1.00 20.86  ? 1160 LEU B CD2   1 
ATOM   2820  N  N     . PRO A  1  362 ? 17.032  41.688 13.893  1.00 22.85  ? 1161 PRO B N     1 
ATOM   2821  C  CA    . PRO A  1  362 ? 16.009  42.336 14.753  1.00 22.98  ? 1161 PRO B CA    1 
ATOM   2822  C  C     . PRO A  1  362 ? 15.218  43.427 14.035  1.00 23.89  ? 1161 PRO B C     1 
ATOM   2823  O  O     . PRO A  1  362 ? 14.012  43.569 14.261  1.00 23.31  ? 1161 PRO B O     1 
ATOM   2824  C  CB    . PRO A  1  362 ? 16.810  42.902 15.893  1.00 23.39  ? 1161 PRO B CB    1 
ATOM   2825  C  CG    . PRO A  1  362 ? 18.029  41.986 15.983  1.00 22.79  ? 1161 PRO B CG    1 
ATOM   2826  C  CD    . PRO A  1  362 ? 18.360  41.630 14.551  1.00 22.10  ? 1161 PRO B CD    1 
ATOM   2827  N  N     . ALA A  1  363 ? 15.861  44.178 13.141  1.00 22.78  ? 1162 ALA B N     1 
ATOM   2828  C  CA    . ALA A  1  363 ? 15.194  45.111 12.236  1.00 23.41  ? 1162 ALA B CA    1 
ATOM   2829  C  C     . ALA A  1  363 ? 14.277  46.060 12.943  1.00 24.74  ? 1162 ALA B C     1 
ATOM   2830  O  O     . ALA A  1  363 ? 13.051  46.013 12.846  1.00 24.90  ? 1162 ALA B O     1 
ATOM   2831  C  CB    . ALA A  1  363 ? 14.453  44.348 11.107  1.00 22.24  ? 1162 ALA B CB    1 
ATOM   2832  N  N     . ARG A  1  364 ? 14.900  46.968 13.702  1.00 26.68  ? 1163 ARG B N     1 
ATOM   2833  C  CA    . ARG A  1  364 ? 14.102  47.861 14.539  1.00 26.52  ? 1163 ARG B CA    1 
ATOM   2834  C  C     . ARG A  1  364 ? 13.410  48.966 13.764  1.00 25.69  ? 1163 ARG B C     1 
ATOM   2835  O  O     . ARG A  1  364 ? 12.748  49.782 14.372  1.00 24.69  ? 1163 ARG B O     1 
ATOM   2836  C  CB    . ARG A  1  364 ? 14.993  48.451 15.648  1.00 27.03  ? 1163 ARG B CB    1 
ATOM   2837  C  CG    . ARG A  1  364 ? 15.717  47.402 16.491  1.00 26.25  ? 1163 ARG B CG    1 
ATOM   2838  C  CD    . ARG A  1  364 ? 14.762  46.334 17.030  1.00 27.23  ? 1163 ARG B CD    1 
ATOM   2839  N  NE    . ARG A  1  364 ? 13.543  46.866 17.617  1.00 27.97  ? 1163 ARG B NE    1 
ATOM   2840  C  CZ    . ARG A  1  364 ? 13.489  47.432 18.829  1.00 28.14  ? 1163 ARG B CZ    1 
ATOM   2841  N  NH1   . ARG A  1  364 ? 14.593  47.495 19.620  1.00 28.23  ? 1163 ARG B NH1   1 
ATOM   2842  N  NH2   . ARG A  1  364 ? 12.376  47.965 19.260  1.00 27.41  ? 1163 ARG B NH2   1 
ATOM   2843  N  N     . PHE A  1  365 ? 13.546  49.011 12.441  1.00 25.43  ? 1164 PHE B N     1 
ATOM   2844  C  CA    . PHE A  1  365 ? 12.688  49.819 11.583  1.00 25.74  ? 1164 PHE B CA    1 
ATOM   2845  C  C     . PHE A  1  365 ? 12.165  49.000 10.448  1.00 25.41  ? 1164 PHE B C     1 
ATOM   2846  O  O     . PHE A  1  365 ? 12.817  48.041 10.040  1.00 27.73  ? 1164 PHE B O     1 
ATOM   2847  C  CB    . PHE A  1  365 ? 13.401  51.101 11.118  1.00 26.13  ? 1164 PHE B CB    1 
ATOM   2848  C  CG    . PHE A  1  365 ? 14.451  50.867 10.085  1.00 25.18  ? 1164 PHE B CG    1 
ATOM   2849  C  CD1   . PHE A  1  365 ? 15.728  50.536 10.487  1.00 25.42  ? 1164 PHE B CD1   1 
ATOM   2850  C  CD2   . PHE A  1  365 ? 14.170  50.983 8.728   1.00 26.07  ? 1164 PHE B CD2   1 
ATOM   2851  C  CE1   . PHE A  1  365 ? 16.730  50.290 9.521   1.00 26.46  ? 1164 PHE B CE1   1 
ATOM   2852  C  CE2   . PHE A  1  365 ? 15.132  50.791 7.753   1.00 24.59  ? 1164 PHE B CE2   1 
ATOM   2853  C  CZ    . PHE A  1  365 ? 16.480  50.417 8.159   1.00 24.56  ? 1164 PHE B CZ    1 
ATOM   2854  N  N     . PRO A  1  366 ? 10.972  49.308 9.929   1.00 25.74  ? 1165 PRO B N     1 
ATOM   2855  C  CA    . PRO A  1  366 ? 10.343  48.459 8.868   1.00 24.35  ? 1165 PRO B CA    1 
ATOM   2856  C  C     . PRO A  1  366 ? 11.112  48.520 7.550   1.00 24.66  ? 1165 PRO B C     1 
ATOM   2857  O  O     . PRO A  1  366 ? 10.737  49.293 6.682   1.00 23.82  ? 1165 PRO B O     1 
ATOM   2858  C  CB    . PRO A  1  366 ? 8.945   49.057 8.763   1.00 24.79  ? 1165 PRO B CB    1 
ATOM   2859  C  CG    . PRO A  1  366 ? 9.016   50.432 9.342   1.00 25.48  ? 1165 PRO B CG    1 
ATOM   2860  C  CD    . PRO A  1  366 ? 10.031  50.345 10.421  1.00 25.50  ? 1165 PRO B CD    1 
ATOM   2861  N  N     . ASN A  1  367 ? 12.108  47.671 7.390   1.00 23.62  ? 1166 ASN B N     1 
ATOM   2862  C  CA    . ASN A  1  367 ? 13.049  47.835 6.282   1.00 23.88  ? 1166 ASN B CA    1 
ATOM   2863  C  C     . ASN A  1  367 ? 12.476  47.320 4.958   1.00 22.25  ? 1166 ASN B C     1 
ATOM   2864  O  O     . ASN A  1  367 ? 12.778  47.892 3.908   1.00 20.62  ? 1166 ASN B O     1 
ATOM   2865  C  CB    . ASN A  1  367 ? 14.365  47.115 6.631   1.00 23.71  ? 1166 ASN B CB    1 
ATOM   2866  C  CG    . ASN A  1  367 ? 15.387  47.236 5.529   1.00 23.95  ? 1166 ASN B CG    1 
ATOM   2867  O  OD1   . ASN A  1  367 ? 15.823  48.337 5.194   1.00 25.19  ? 1166 ASN B OD1   1 
ATOM   2868  N  ND2   . ASN A  1  367 ? 15.795  46.104 4.966   1.00 24.15  ? 1166 ASN B ND2   1 
ATOM   2869  N  N     . LEU A  1  368 ? 11.660  46.247 4.966   1.00 22.70  ? 1167 LEU B N     1 
ATOM   2870  C  CA    . LEU A  1  368 ? 11.098  45.742 3.762   1.00 23.59  ? 1167 LEU B CA    1 
ATOM   2871  C  C     . LEU A  1  368 ? 10.396  46.823 2.972   1.00 24.07  ? 1167 LEU B C     1 
ATOM   2872  O  O     . LEU A  1  368 ? 10.610  46.988 1.745   1.00 24.28  ? 1167 LEU B O     1 
ATOM   2873  C  CB    . LEU A  1  368 ? 10.168  44.562 4.020   1.00 24.11  ? 1167 LEU B CB    1 
ATOM   2874  C  CG    . LEU A  1  368 ? 9.455   44.057 2.725   1.00 25.70  ? 1167 LEU B CG    1 
ATOM   2875  C  CD1   . LEU A  1  368 ? 10.425  43.219 1.980   1.00 25.69  ? 1167 LEU B CD1   1 
ATOM   2876  C  CD2   . LEU A  1  368 ? 8.214   43.255 3.109   1.00 26.75  ? 1167 LEU B CD2   1 
ATOM   2877  N  N     . LEU A  1  369 ? 9.491   47.572 3.620   1.00 24.59  ? 1168 LEU B N     1 
ATOM   2878  C  CA    . LEU A  1  369 ? 8.783   48.638 2.903   1.00 24.45  ? 1168 LEU B CA    1 
ATOM   2879  C  C     . LEU A  1  369 ? 9.630   49.899 2.748   1.00 23.11  ? 1168 LEU B C     1 
ATOM   2880  O  O     . LEU A  1  369 ? 9.452   50.638 1.774   1.00 24.00  ? 1168 LEU B O     1 
ATOM   2881  C  CB    . LEU A  1  369 ? 7.506   48.973 3.663   1.00 24.78  ? 1168 LEU B CB    1 
ATOM   2882  C  CG    . LEU A  1  369 ? 6.420   47.828 3.568   1.00 25.01  ? 1168 LEU B CG    1 
ATOM   2883  C  CD1   . LEU A  1  369 ? 5.320   48.101 4.610   1.00 25.31  ? 1168 LEU B CD1   1 
ATOM   2884  C  CD2   . LEU A  1  369 ? 5.825   47.853 2.172   1.00 25.29  ? 1168 LEU B CD2   1 
ATOM   2885  N  N     . ALA A  1  370 ? 10.553  50.157 3.691   1.00 23.12  ? 1169 ALA B N     1 
ATOM   2886  C  CA    . ALA A  1  370 ? 11.337  51.380 3.640   1.00 21.80  ? 1169 ALA B CA    1 
ATOM   2887  C  C     . ALA A  1  370 ? 12.259  51.397 2.384   1.00 21.82  ? 1169 ALA B C     1 
ATOM   2888  O  O     . ALA A  1  370 ? 12.278  52.367 1.625   1.00 20.25  ? 1169 ALA B O     1 
ATOM   2889  C  CB    . ALA A  1  370 ? 12.171  51.540 4.895   1.00 22.01  ? 1169 ALA B CB    1 
ATOM   2890  N  N     . ASN A  1  371 ? 13.019  50.344 2.207   1.00 21.64  ? 1170 ASN B N     1 
ATOM   2891  C  CA    . ASN A  1  371 ? 13.940  50.284 1.075   1.00 22.75  ? 1170 ASN B CA    1 
ATOM   2892  C  C     . ASN A  1  371 ? 13.425  49.478 -0.121  1.00 24.22  ? 1170 ASN B C     1 
ATOM   2893  O  O     . ASN A  1  371 ? 14.022  49.542 -1.183  1.00 26.43  ? 1170 ASN B O     1 
ATOM   2894  C  CB    . ASN A  1  371 ? 15.288  49.676 1.549   1.00 22.28  ? 1170 ASN B CB    1 
ATOM   2895  C  CG    . ASN A  1  371 ? 16.164  50.693 2.202   1.00 23.09  ? 1170 ASN B CG    1 
ATOM   2896  O  OD1   . ASN A  1  371 ? 16.252  51.834 1.739   1.00 23.53  ? 1170 ASN B OD1   1 
ATOM   2897  N  ND2   . ASN A  1  371 ? 16.824  50.303 3.287   1.00 21.90  ? 1170 ASN B ND2   1 
ATOM   2898  N  N     . GLY A  1  372 ? 12.341  48.758 0.063   1.00 24.84  ? 1171 GLY B N     1 
ATOM   2899  C  CA    . GLY A  1  372 ? 11.736  47.985 -0.998  1.00 24.79  ? 1171 GLY B CA    1 
ATOM   2900  C  C     . GLY A  1  372 ? 12.565  46.757 -1.349  1.00 25.19  ? 1171 GLY B C     1 
ATOM   2901  O  O     . GLY A  1  372 ? 13.497  46.383 -0.648  1.00 22.14  ? 1171 GLY B O     1 
ATOM   2902  N  N     . ALA A  1  373 ? 12.180  46.132 -2.478  1.00 24.91  ? 1172 ALA B N     1 
ATOM   2903  C  CA    . ALA A  1  373 ? 12.830  44.896 -2.899  1.00 27.37  ? 1172 ALA B CA    1 
ATOM   2904  C  C     . ALA A  1  373 ? 12.444  44.610 -4.333  1.00 27.40  ? 1172 ALA B C     1 
ATOM   2905  O  O     . ALA A  1  373 ? 11.310  44.857 -4.774  1.00 28.98  ? 1172 ALA B O     1 
ATOM   2906  C  CB    . ALA A  1  373 ? 12.483  43.661 -2.088  1.00 27.74  ? 1172 ALA B CB    1 
ATOM   2907  N  N     . SER A  1  374 ? 13.438  44.058 -5.053  1.00 27.87  ? 1173 SER B N     1 
ATOM   2908  C  CA    . SER A  1  374 ? 13.201  43.524 -6.417  1.00 29.96  ? 1173 SER B CA    1 
ATOM   2909  C  C     . SER A  1  374 ? 13.943  42.229 -6.512  1.00 26.75  ? 1173 SER B C     1 
ATOM   2910  O  O     . SER A  1  374 ? 15.152  42.182 -6.212  1.00 26.22  ? 1173 SER B O     1 
ATOM   2911  C  CB    . SER A  1  374 ? 13.592  44.499 -7.541  1.00 31.00  ? 1173 SER B CB    1 
ATOM   2912  O  OG    . SER A  1  374 ? 14.933  44.903 -7.360  1.00 51.26  ? 1173 SER B OG    1 
ATOM   2913  N  N     . GLY A  1  375 ? 13.247  41.172 -6.937  1.00 22.98  ? 1174 GLY B N     1 
ATOM   2914  C  CA    . GLY A  1  375 ? 13.884  39.876 -7.074  1.00 23.88  ? 1174 GLY B CA    1 
ATOM   2915  C  C     . GLY A  1  375 ? 13.135  38.978 -8.022  1.00 23.00  ? 1174 GLY B C     1 
ATOM   2916  O  O     . GLY A  1  375 ? 11.906  38.839 -7.915  1.00 28.29  ? 1174 GLY B O     1 
ATOM   2917  N  N     . ILE A  1  376 ? 13.839  38.357 -8.965  1.00 21.70  ? 1175 ILE B N     1 
ATOM   2918  C  CA    . ILE A  1  376 ? 13.297  37.381 -9.871  1.00 20.88  ? 1175 ILE B CA    1 
ATOM   2919  C  C     . ILE A  1  376 ? 13.608  36.014 -9.337  1.00 20.34  ? 1175 ILE B C     1 
ATOM   2920  O  O     . ILE A  1  376 ? 14.747  35.606 -9.276  1.00 20.25  ? 1175 ILE B O     1 
ATOM   2921  C  CB    . ILE A  1  376 ? 13.838  37.594 -11.291 1.00 20.71  ? 1175 ILE B CB    1 
ATOM   2922  C  CG1   . ILE A  1  376 ? 13.607  39.081 -11.729 1.00 20.40  ? 1175 ILE B CG1   1 
ATOM   2923  C  CG2   . ILE A  1  376 ? 13.228  36.605 -12.286 1.00 20.72  ? 1175 ILE B CG2   1 
ATOM   2924  C  CD1   . ILE A  1  376 ? 14.577  39.426 -12.898 1.00 20.20  ? 1175 ILE B CD1   1 
ATOM   2925  N  N     . ALA A  1  377 ? 12.556  35.279 -8.924  1.00 20.75  ? 1176 ALA B N     1 
ATOM   2926  C  CA    . ALA A  1  377 ? 12.797  33.920 -8.377  1.00 19.93  ? 1176 ALA B CA    1 
ATOM   2927  C  C     . ALA A  1  377 ? 12.512  32.892 -9.382  1.00 20.24  ? 1176 ALA B C     1 
ATOM   2928  O  O     . ALA A  1  377 ? 12.878  33.066 -10.592 1.00 19.72  ? 1176 ALA B O     1 
ATOM   2929  C  CB    . ALA A  1  377 ? 11.892  33.728 -7.136  1.00 20.13  ? 1176 ALA B CB    1 
ATOM   2930  N  N     . VAL A  1  378 ? 11.903  31.777 -9.018  1.00 20.30  ? 1177 VAL B N     1 
ATOM   2931  C  CA    . VAL A  1  378 ? 11.359  30.760 -9.933  1.00 20.36  ? 1177 VAL B CA    1 
ATOM   2932  C  C     . VAL A  1  378 ? 9.936   30.555 -9.591  1.00 20.38  ? 1177 VAL B C     1 
ATOM   2933  O  O     . VAL A  1  378 ? 9.569   30.411 -8.404  1.00 20.60  ? 1177 VAL B O     1 
ATOM   2934  C  CB    . VAL A  1  378 ? 12.139  29.450 -9.815  1.00 20.33  ? 1177 VAL B CB    1 
ATOM   2935  C  CG1   . VAL A  1  378 ? 11.524  28.479 -10.918 1.00 20.23  ? 1177 VAL B CG1   1 
ATOM   2936  C  CG2   . VAL A  1  378 ? 13.653  29.662 -10.109 1.00 20.06  ? 1177 VAL B CG2   1 
ATOM   2937  N  N     . GLY A  1  379 ? 9.074   30.518 -10.642 1.00 20.75  ? 1178 GLY B N     1 
ATOM   2938  C  CA    . GLY A  1  379 ? 7.578   30.477 -10.349 1.00 20.83  ? 1178 GLY B CA    1 
ATOM   2939  C  C     . GLY A  1  379 ? 6.953   31.736 -9.920  1.00 20.36  ? 1178 GLY B C     1 
ATOM   2940  O  O     . GLY A  1  379 ? 5.754   31.778 -9.820  1.00 20.07  ? 1178 GLY B O     1 
ATOM   2941  N  N     . MET A  1  380 ? 7.759   32.801 -9.626  1.00 19.59  ? 1179 MET B N     1 
ATOM   2942  C  CA    . MET A  1  380 ? 7.222   34.046 -9.063  1.00 20.16  ? 1179 MET B CA    1 
ATOM   2943  C  C     . MET A  1  380 ? 8.332   35.029 -9.033  1.00 19.86  ? 1179 MET B C     1 
ATOM   2944  O  O     . MET A  1  380 ? 9.533   34.661 -9.255  1.00 19.48  ? 1179 MET B O     1 
ATOM   2945  C  CB    . MET A  1  380 ? 6.697   33.832 -7.615  1.00 20.36  ? 1179 MET B CB    1 
ATOM   2946  C  CG    . MET A  1  380 ? 7.805   33.286 -6.647  1.00 20.39  ? 1179 MET B CG    1 
ATOM   2947  S  SD    . MET A  1  380 ? 7.160   32.794 -5.030  1.00 23.58  ? 1179 MET B SD    1 
ATOM   2948  C  CE    . MET A  1  380 ? 6.052   31.458 -5.616  1.00 21.22  ? 1179 MET B CE    1 
ATOM   2949  N  N     . ALA A  1  381 ? 7.991   36.300 -8.808  1.00 20.96  ? 1180 ALA B N     1 
ATOM   2950  C  CA    . ALA A  1  381 ? 8.988   37.372 -8.653  1.00 20.93  ? 1180 ALA B CA    1 
ATOM   2951  C  C     . ALA A  1  381 ? 8.433   38.350 -7.670  1.00 21.24  ? 1180 ALA B C     1 
ATOM   2952  O  O     . ALA A  1  381 ? 7.257   38.256 -7.239  1.00 21.76  ? 1180 ALA B O     1 
ATOM   2953  C  CB    . ALA A  1  381 ? 9.298   38.064 -10.000 1.00 21.05  ? 1180 ALA B CB    1 
ATOM   2954  N  N     . THR A  1  382 ? 9.259   39.324 -7.242  1.00 20.43  ? 1181 THR B N     1 
ATOM   2955  C  CA    . THR A  1  382 ? 8.785   40.318 -6.284  1.00 20.54  ? 1181 THR B CA    1 
ATOM   2956  C  C     . THR A  1  382 ? 9.244   41.695 -6.691  1.00 20.88  ? 1181 THR B C     1 
ATOM   2957  O  O     . THR A  1  382 ? 10.308  41.875 -7.298  1.00 20.02  ? 1181 THR B O     1 
ATOM   2958  C  CB    . THR A  1  382 ? 9.282   39.986 -4.854  1.00 19.71  ? 1181 THR B CB    1 
ATOM   2959  O  OG1   . THR A  1  382 ? 8.573   40.805 -3.924  1.00 20.33  ? 1181 THR B OG1   1 
ATOM   2960  C  CG2   . THR A  1  382 ? 10.782  40.257 -4.704  1.00 18.74  ? 1181 THR B CG2   1 
ATOM   2961  N  N     . ASN A  1  383 ? 8.395   42.704 -6.396  1.00 22.41  ? 1182 ASN B N     1 
ATOM   2962  C  CA    . ASN A  1  383 ? 8.699   44.064 -6.788  1.00 23.07  ? 1182 ASN B CA    1 
ATOM   2963  C  C     . ASN A  1  383 ? 7.956   44.968 -5.787  1.00 22.92  ? 1182 ASN B C     1 
ATOM   2964  O  O     . ASN A  1  383 ? 6.752   45.199 -5.926  1.00 23.60  ? 1182 ASN B O     1 
ATOM   2965  C  CB    . ASN A  1  383 ? 8.256   44.350 -8.236  1.00 26.07  ? 1182 ASN B CB    1 
ATOM   2966  C  CG    . ASN A  1  383 ? 9.036   45.475 -8.872  1.00 27.18  ? 1182 ASN B CG    1 
ATOM   2967  O  OD1   . ASN A  1  383 ? 10.179  45.682 -8.581  1.00 26.23  ? 1182 ASN B OD1   1 
ATOM   2968  N  ND2   . ASN A  1  383 ? 8.389   46.210 -9.770  1.00 29.84  ? 1182 ASN B ND2   1 
ATOM   2969  N  N     . ILE A  1  384 ? 8.680   45.446 -4.790  1.00 22.44  ? 1183 ILE B N     1 
ATOM   2970  C  CA    . ILE A  1  384 ? 8.125   46.217 -3.699  1.00 23.38  ? 1183 ILE B CA    1 
ATOM   2971  C  C     . ILE A  1  384 ? 8.799   47.611 -3.725  1.00 23.14  ? 1183 ILE B C     1 
ATOM   2972  O  O     . ILE A  1  384 ? 10.028  47.695 -3.694  1.00 22.92  ? 1183 ILE B O     1 
ATOM   2973  C  CB    . ILE A  1  384 ? 8.365   45.559 -2.346  1.00 23.12  ? 1183 ILE B CB    1 
ATOM   2974  C  CG1   . ILE A  1  384 ? 7.733   44.153 -2.372  1.00 23.75  ? 1183 ILE B CG1   1 
ATOM   2975  C  CG2   . ILE A  1  384 ? 7.749   46.398 -1.208  1.00 22.62  ? 1183 ILE B CG2   1 
ATOM   2976  C  CD1   . ILE A  1  384 ? 8.046   43.307 -1.153  1.00 24.79  ? 1183 ILE B CD1   1 
ATOM   2977  N  N     . PRO A  1  385 ? 8.043   48.692 -3.814  1.00 23.84  ? 1184 PRO B N     1 
ATOM   2978  C  CA    . PRO A  1  385 ? 8.691   50.009 -3.914  1.00 23.54  ? 1184 PRO B CA    1 
ATOM   2979  C  C     . PRO A  1  385 ? 9.122   50.514 -2.532  1.00 22.87  ? 1184 PRO B C     1 
ATOM   2980  O  O     . PRO A  1  385 ? 8.554   50.124 -1.522  1.00 24.09  ? 1184 PRO B O     1 
ATOM   2981  C  CB    . PRO A  1  385 ? 7.540   50.896 -4.478  1.00 23.17  ? 1184 PRO B CB    1 
ATOM   2982  C  CG    . PRO A  1  385 ? 6.284   50.229 -4.019  1.00 24.27  ? 1184 PRO B CG    1 
ATOM   2983  C  CD    . PRO A  1  385 ? 6.591   48.748 -4.017  1.00 23.79  ? 1184 PRO B CD    1 
ATOM   2984  N  N     . PRO A  1  386 ? 10.131  51.391 -2.484  1.00 23.76  ? 1185 PRO B N     1 
ATOM   2985  C  CA    . PRO A  1  386 ? 10.510  51.981 -1.223  1.00 22.61  ? 1185 PRO B CA    1 
ATOM   2986  C  C     . PRO A  1  386 ? 9.458   52.977 -0.709  1.00 23.23  ? 1185 PRO B C     1 
ATOM   2987  O  O     . PRO A  1  386 ? 8.588   53.424 -1.420  1.00 22.51  ? 1185 PRO B O     1 
ATOM   2988  C  CB    . PRO A  1  386 ? 11.838  52.709 -1.561  1.00 22.14  ? 1185 PRO B CB    1 
ATOM   2989  C  CG    . PRO A  1  386 ? 11.734  53.009 -3.021  1.00 23.73  ? 1185 PRO B CG    1 
ATOM   2990  C  CD    . PRO A  1  386 ? 10.947  51.871 -3.614  1.00 23.94  ? 1185 PRO B CD    1 
ATOM   2991  N  N     . HIS A  1  387 ? 9.582   53.308 0.584   1.00 23.48  ? 1186 HIS B N     1 
ATOM   2992  C  CA    . HIS A  1  387 ? 8.593   54.142 1.260   1.00 24.02  ? 1186 HIS B CA    1 
ATOM   2993  C  C     . HIS A  1  387 ? 9.292   55.135 2.187   1.00 25.43  ? 1186 HIS B C     1 
ATOM   2994  O  O     . HIS A  1  387 ? 10.475  54.993 2.498   1.00 26.30  ? 1186 HIS B O     1 
ATOM   2995  C  CB    . HIS A  1  387 ? 7.587   53.308 2.039   1.00 23.71  ? 1186 HIS B CB    1 
ATOM   2996  C  CG    . HIS A  1  387 ? 6.649   52.514 1.158   1.00 24.34  ? 1186 HIS B CG    1 
ATOM   2997  N  ND1   . HIS A  1  387 ? 7.006   51.348 0.543   1.00 24.18  ? 1186 HIS B ND1   1 
ATOM   2998  C  CD2   . HIS A  1  387 ? 5.364   52.757 0.794   1.00 25.47  ? 1186 HIS B CD2   1 
ATOM   2999  C  CE1   . HIS A  1  387 ? 5.985   50.898 -0.163  1.00 24.86  ? 1186 HIS B CE1   1 
ATOM   3000  N  NE2   . HIS A  1  387 ? 4.975   51.730 -0.030  1.00 24.69  ? 1186 HIS B NE2   1 
ATOM   3001  N  N     . ASN A  1  388 ? 8.536   56.133 2.628   1.00 25.73  ? 1187 ASN B N     1 
ATOM   3002  C  CA    . ASN A  1  388 ? 9.052   57.122 3.556   1.00 26.83  ? 1187 ASN B CA    1 
ATOM   3003  C  C     . ASN A  1  388 ? 8.974   56.562 4.978   1.00 26.34  ? 1187 ASN B C     1 
ATOM   3004  O  O     . ASN A  1  388 ? 7.940   56.051 5.407   1.00 26.89  ? 1187 ASN B O     1 
ATOM   3005  C  CB    . ASN A  1  388 ? 8.223   58.413 3.460   1.00 26.87  ? 1187 ASN B CB    1 
ATOM   3006  C  CG    . ASN A  1  388 ? 8.766   59.506 4.367   1.00 27.53  ? 1187 ASN B CG    1 
ATOM   3007  O  OD1   . ASN A  1  388 ? 8.350   59.634 5.510   1.00 26.47  ? 1187 ASN B OD1   1 
ATOM   3008  N  ND2   . ASN A  1  388 ? 9.717   60.284 3.858   1.00 27.50  ? 1187 ASN B ND2   1 
ATOM   3009  N  N     . LEU A  1  389 ? 10.107  56.659 5.701   1.00 26.54  ? 1188 LEU B N     1 
ATOM   3010  C  CA    . LEU A  1  389 ? 10.194  55.977 6.981   1.00 28.27  ? 1188 LEU B CA    1 
ATOM   3011  C  C     . LEU A  1  389 ? 9.323   56.686 8.055   1.00 28.38  ? 1188 LEU B C     1 
ATOM   3012  O  O     . LEU A  1  389 ? 8.764   56.009 8.921   1.00 27.76  ? 1188 LEU B O     1 
ATOM   3013  C  CB    . LEU A  1  389 ? 11.640  55.967 7.475   1.00 29.33  ? 1188 LEU B CB    1 
ATOM   3014  C  CG    . LEU A  1  389 ? 11.932  55.324 8.827   1.00 29.44  ? 1188 LEU B CG    1 
ATOM   3015  C  CD1   . LEU A  1  389 ? 11.587  53.810 8.689   1.00 30.45  ? 1188 LEU B CD1   1 
ATOM   3016  C  CD2   . LEU A  1  389 ? 13.371  55.558 9.194   1.00 31.24  ? 1188 LEU B CD2   1 
ATOM   3017  N  N     . THR A  1  390 ? 9.187   58.021 7.975   1.00 28.42  ? 1189 THR B N     1 
ATOM   3018  C  CA    . THR A  1  390 ? 8.288   58.674 8.896   1.00 29.43  ? 1189 THR B CA    1 
ATOM   3019  C  C     . THR A  1  390 ? 6.866   58.219 8.706   1.00 29.05  ? 1189 THR B C     1 
ATOM   3020  O  O     . THR A  1  390 ? 6.149   57.984 9.695   1.00 28.07  ? 1189 THR B O     1 
ATOM   3021  C  CB    . THR A  1  390 ? 8.376   60.218 8.700   1.00 28.99  ? 1189 THR B CB    1 
ATOM   3022  O  OG1   . THR A  1  390 ? 9.699   60.641 8.804   1.00 29.36  ? 1189 THR B OG1   1 
ATOM   3023  C  CG2   . THR A  1  390 ? 7.534   60.949 9.778   1.00 31.09  ? 1189 THR B CG2   1 
ATOM   3024  N  N     . GLU A  1  391 ? 6.451   58.075 7.450   1.00 30.15  ? 1190 GLU B N     1 
ATOM   3025  C  CA    . GLU A  1  391 ? 5.089   57.590 7.158   1.00 31.36  ? 1190 GLU B CA    1 
ATOM   3026  C  C     . GLU A  1  391 ? 4.923   56.153 7.603   1.00 30.76  ? 1190 GLU B C     1 
ATOM   3027  O  O     . GLU A  1  391 ? 3.882   55.796 8.177   1.00 32.56  ? 1190 GLU B O     1 
ATOM   3028  C  CB    . GLU A  1  391 ? 4.781   57.740 5.680   1.00 30.98  ? 1190 GLU B CB    1 
ATOM   3029  C  CG    . GLU A  1  391 ? 4.814   59.206 5.206   1.00 32.95  ? 1190 GLU B CG    1 
ATOM   3030  C  CD    . GLU A  1  391 ? 4.426   59.328 3.724   1.00 31.16  ? 1190 GLU B CD    1 
ATOM   3031  O  OE1   . GLU A  1  391 ? 3.961   58.348 3.140   1.00 30.14  ? 1190 GLU B OE1   1 
ATOM   3032  O  OE2   . GLU A  1  391 ? 4.584   60.410 3.164   1.00 34.86  ? 1190 GLU B OE2   1 
ATOM   3033  N  N     . LEU A  1  392 ? 5.923   55.300 7.348   1.00 29.99  ? 1191 LEU B N     1 
ATOM   3034  C  CA    . LEU A  1  392 ? 5.807   53.889 7.668   1.00 27.53  ? 1191 LEU B CA    1 
ATOM   3035  C  C     . LEU A  1  392 ? 5.633   53.692 9.175   1.00 27.80  ? 1191 LEU B C     1 
ATOM   3036  O  O     . LEU A  1  392 ? 4.746   52.945 9.607   1.00 28.13  ? 1191 LEU B O     1 
ATOM   3037  C  CB    . LEU A  1  392 ? 7.054   53.135 7.183   1.00 26.15  ? 1191 LEU B CB    1 
ATOM   3038  C  CG    . LEU A  1  392 ? 7.119   52.788 5.713   1.00 26.29  ? 1191 LEU B CG    1 
ATOM   3039  C  CD1   . LEU A  1  392 ? 8.438   51.993 5.490   1.00 24.81  ? 1191 LEU B CD1   1 
ATOM   3040  C  CD2   . LEU A  1  392 ? 6.004   51.947 5.288   1.00 25.54  ? 1191 LEU B CD2   1 
ATOM   3041  N  N     . ILE A  1  393 ? 6.483   54.315 9.979   1.00 27.54  ? 1192 ILE B N     1 
ATOM   3042  C  CA    . ILE A  1  393 ? 6.423   54.128 11.420  1.00 28.60  ? 1192 ILE B CA    1 
ATOM   3043  C  C     . ILE A  1  393 ? 5.118   54.718 11.998  1.00 29.75  ? 1192 ILE B C     1 
ATOM   3044  O  O     . ILE A  1  393 ? 4.527   54.166 12.920  1.00 31.25  ? 1192 ILE B O     1 
ATOM   3045  C  CB    . ILE A  1  393 ? 7.671   54.732 12.094  1.00 27.30  ? 1192 ILE B CB    1 
ATOM   3046  C  CG1   . ILE A  1  393 ? 8.902   53.899 11.734  1.00 28.19  ? 1192 ILE B CG1   1 
ATOM   3047  C  CG2   . ILE A  1  393 ? 7.459   54.799 13.629  1.00 27.54  ? 1192 ILE B CG2   1 
ATOM   3048  C  CD1   . ILE A  1  393 ? 10.198  54.588 12.118  1.00 27.08  ? 1192 ILE B CD1   1 
ATOM   3049  N  N     . ASN A  1  394 ? 4.638   55.817 11.405  1.00 31.11  ? 1193 ASN B N     1 
ATOM   3050  C  CA    . ASN A  1  394 ? 3.312   56.302 11.758  1.00 32.30  ? 1193 ASN B CA    1 
ATOM   3051  C  C     . ASN A  1  394 ? 2.238   55.289 11.484  1.00 32.01  ? 1193 ASN B C     1 
ATOM   3052  O  O     . ASN A  1  394 ? 1.305   55.110 12.280  1.00 34.14  ? 1193 ASN B O     1 
ATOM   3053  C  CB    . ASN A  1  394 ? 3.031   57.613 11.004  1.00 31.92  ? 1193 ASN B CB    1 
ATOM   3054  C  CG    . ASN A  1  394 ? 3.721   58.815 11.624  1.00 34.45  ? 1193 ASN B CG    1 
ATOM   3055  O  OD1   . ASN A  1  394 ? 4.238   58.757 12.735  1.00 32.98  ? 1193 ASN B OD1   1 
ATOM   3056  N  ND2   . ASN A  1  394 ? 3.676   59.922 10.918  1.00 34.17  ? 1193 ASN B ND2   1 
ATOM   3057  N  N     . GLY A  1  395 ? 2.328   54.601 10.347  1.00 31.29  ? 1194 GLY B N     1 
ATOM   3058  C  CA    . GLY A  1  395 ? 1.347   53.549 10.003  1.00 29.65  ? 1194 GLY B CA    1 
ATOM   3059  C  C     . GLY A  1  395 ? 1.421   52.407 10.985  1.00 31.96  ? 1194 GLY B C     1 
ATOM   3060  O  O     . GLY A  1  395 ? 0.394   51.811 11.339  1.00 33.25  ? 1194 GLY B O     1 
ATOM   3061  N  N     . VAL A  1  396 ? 2.643   52.039 11.412  1.00 29.89  ? 1195 VAL B N     1 
ATOM   3062  C  CA    . VAL A  1  396 ? 2.797   50.966 12.394  1.00 29.84  ? 1195 VAL B CA    1 
ATOM   3063  C  C     . VAL A  1  396 ? 2.251   51.393 13.746  1.00 31.35  ? 1195 VAL B C     1 
ATOM   3064  O  O     . VAL A  1  396 ? 1.641   50.602 14.457  1.00 29.83  ? 1195 VAL B O     1 
ATOM   3065  C  CB    . VAL A  1  396 ? 4.271   50.568 12.509  1.00 28.36  ? 1195 VAL B CB    1 
ATOM   3066  C  CG1   . VAL A  1  396 ? 4.431   49.478 13.588  1.00 27.67  ? 1195 VAL B CG1   1 
ATOM   3067  C  CG2   . VAL A  1  396 ? 4.721   49.955 11.141  1.00 28.94  ? 1195 VAL B CG2   1 
ATOM   3068  N  N     . LEU A  1  397 ? 2.446   52.648 14.109  1.00 32.23  ? 1196 LEU B N     1 
ATOM   3069  C  CA    . LEU A  1  397 ? 1.871   53.172 15.363  1.00 33.18  ? 1196 LEU B CA    1 
ATOM   3070  C  C     . LEU A  1  397 ? 0.352   53.171 15.309  1.00 33.56  ? 1196 LEU B C     1 
ATOM   3071  O  O     . LEU A  1  397 ? -0.307  52.766 16.274  1.00 32.14  ? 1196 LEU B O     1 
ATOM   3072  C  CB    . LEU A  1  397 ? 2.405   54.561 15.662  1.00 35.37  ? 1196 LEU B CB    1 
ATOM   3073  C  CG    . LEU A  1  397 ? 3.892   54.701 16.004  1.00 34.07  ? 1196 LEU B CG    1 
ATOM   3074  C  CD1   . LEU A  1  397 ? 4.296   56.132 16.080  1.00 34.95  ? 1196 LEU B CD1   1 
ATOM   3075  C  CD2   . LEU A  1  397 ? 4.216   53.955 17.285  1.00 33.76  ? 1196 LEU B CD2   1 
ATOM   3076  N  N     . SER A  1  398 ? -0.219  53.613 14.184  1.00 33.01  ? 1197 SER B N     1 
ATOM   3077  C  CA    . SER A  1  398 ? -1.674  53.559 14.028  1.00 37.91  ? 1197 SER B CA    1 
ATOM   3078  C  C     . SER A  1  398 ? -2.173  52.110 14.097  1.00 38.83  ? 1197 SER B C     1 
ATOM   3079  O  O     . SER A  1  398 ? -3.222  51.839 14.716  1.00 41.28  ? 1197 SER B O     1 
ATOM   3080  C  CB    . SER A  1  398 ? -2.102  54.200 12.717  1.00 37.29  ? 1197 SER B CB    1 
ATOM   3081  O  OG    . SER A  1  398 ? -1.934  55.623 12.789  1.00 38.09  ? 1197 SER B OG    1 
ATOM   3082  N  N     . LEU A  1  399 ? -1.440  51.184 13.490  1.00 35.42  ? 1198 LEU B N     1 
ATOM   3083  C  CA    . LEU A  1  399 ? -1.835  49.782 13.532  1.00 33.96  ? 1198 LEU B CA    1 
ATOM   3084  C  C     . LEU A  1  399 ? -1.768  49.228 14.946  1.00 33.91  ? 1198 LEU B C     1 
ATOM   3085  O  O     . LEU A  1  399 ? -2.652  48.471 15.365  1.00 34.09  ? 1198 LEU B O     1 
ATOM   3086  C  CB    . LEU A  1  399 ? -0.915  48.958 12.597  1.00 30.07  ? 1198 LEU B CB    1 
ATOM   3087  C  CG    . LEU A  1  399 ? -1.052  47.427 12.722  1.00 29.70  ? 1198 LEU B CG    1 
ATOM   3088  C  CD1   . LEU A  1  399 ? -2.355  46.973 12.102  1.00 27.90  ? 1198 LEU B CD1   1 
ATOM   3089  C  CD2   . LEU A  1  399 ? 0.117   46.747 12.030  1.00 28.45  ? 1198 LEU B CD2   1 
ATOM   3090  N  N     . SER A  1  400 ? -0.723  49.582 15.703  1.00 33.89  ? 1199 SER B N     1 
ATOM   3091  C  CA    . SER A  1  400 ? -0.576  49.062 17.063  1.00 34.41  ? 1199 SER B CA    1 
ATOM   3092  C  C     . SER A  1  400 ? -1.716  49.495 17.965  1.00 34.62  ? 1199 SER B C     1 
ATOM   3093  O  O     . SER A  1  400 ? -2.008  48.815 18.943  1.00 33.57  ? 1199 SER B O     1 
ATOM   3094  C  CB    . SER A  1  400 ? 0.749   49.525 17.673  1.00 35.00  ? 1199 SER B CB    1 
ATOM   3095  O  OG    . SER A  1  400 ? 0.714   50.926 17.982  1.00 37.71  ? 1199 SER B OG    1 
ATOM   3096  N  N     . LYS A  1  401 ? -2.348  50.614 17.611  1.00 36.40  ? 1200 LYS B N     1 
ATOM   3097  C  CA    . LYS A  1  401 ? -3.476  51.119 18.376  1.00 38.89  ? 1200 LYS B CA    1 
ATOM   3098  C  C     . LYS A  1  401 ? -4.829  50.720 17.797  1.00 40.95  ? 1200 LYS B C     1 
ATOM   3099  O  O     . LYS A  1  401 ? -5.856  51.025 18.406  1.00 44.50  ? 1200 LYS B O     1 
ATOM   3100  C  CB    . LYS A  1  401 ? -3.372  52.639 18.506  1.00 41.08  ? 1200 LYS B CB    1 
ATOM   3101  C  CG    . LYS A  1  401 ? -2.106  53.150 19.147  1.00 42.77  ? 1200 LYS B CG    1 
ATOM   3102  C  CD    . LYS A  1  401 ? -1.904  54.615 18.807  1.00 45.67  ? 1200 LYS B CD    1 
ATOM   3103  C  CE    . LYS A  1  401 ? -0.533  55.105 19.307  1.00 50.42  ? 1200 LYS B CE    1 
ATOM   3104  N  NZ    . LYS A  1  401 ? -0.309  56.547 18.990  1.00 49.77  ? 1200 LYS B NZ    1 
ATOM   3105  N  N     . ASN A  1  402 ? -4.842  49.948 16.719  1.00 38.59  ? 1201 ASN B N     1 
ATOM   3106  C  CA    . ASN A  1  402 ? -6.087  49.532 16.081  1.00 40.62  ? 1201 ASN B CA    1 
ATOM   3107  C  C     . ASN A  1  402 ? -5.842  48.311 15.190  1.00 38.11  ? 1201 ASN B C     1 
ATOM   3108  O  O     . ASN A  1  402 ? -5.605  48.461 13.985  1.00 37.50  ? 1201 ASN B O     1 
ATOM   3109  C  CB    . ASN A  1  402 ? -6.681  50.699 15.259  1.00 41.31  ? 1201 ASN B CB    1 
ATOM   3110  C  CG    . ASN A  1  402 ? -8.077  50.411 14.765  1.00 38.30  ? 1201 ASN B CG    1 
ATOM   3111  O  OD1   . ASN A  1  402 ? -8.648  49.381 15.041  1.00 39.33  ? 1201 ASN B OD1   1 
ATOM   3112  N  ND2   . ASN A  1  402 ? -8.655  51.338 14.031  1.00 41.05  ? 1201 ASN B ND2   1 
ATOM   3113  N  N     . PRO A  1  403 ? -5.900  47.102 15.755  1.00 36.90  ? 1202 PRO B N     1 
ATOM   3114  C  CA    . PRO A  1  403 ? -5.689  45.903 14.932  1.00 36.74  ? 1202 PRO B CA    1 
ATOM   3115  C  C     . PRO A  1  403 ? -6.666  45.769 13.785  1.00 36.18  ? 1202 PRO B C     1 
ATOM   3116  O  O     . PRO A  1  403 ? -6.360  45.111 12.792  1.00 34.99  ? 1202 PRO B O     1 
ATOM   3117  C  CB    . PRO A  1  403 ? -5.778  44.742 15.923  1.00 37.91  ? 1202 PRO B CB    1 
ATOM   3118  C  CG    . PRO A  1  403 ? -5.720  45.379 17.309  1.00 39.19  ? 1202 PRO B CG    1 
ATOM   3119  C  CD    . PRO A  1  403 ? -6.175  46.792 17.164  1.00 38.54  ? 1202 PRO B CD    1 
ATOM   3120  N  N     . ASP A  1  404 ? -7.836  46.363 13.891  1.00 36.10  ? 1203 ASP B N     1 
ATOM   3121  C  CA    . ASP A  1  404 ? -8.846  46.330 12.855  1.00 37.44  ? 1203 ASP B CA    1 
ATOM   3122  C  C     . ASP A  1  404 ? -8.759  47.517 11.912  1.00 37.02  ? 1203 ASP B C     1 
ATOM   3123  O  O     . ASP A  1  404 ? -9.723  47.752 11.160  1.00 36.53  ? 1203 ASP B O     1 
ATOM   3124  C  CB    . ASP A  1  404 ? -10.253 46.274 13.489  1.00 40.99  ? 1203 ASP B CB    1 
ATOM   3125  C  CG    . ASP A  1  404 ? -10.433 45.089 14.396  1.00 46.89  ? 1203 ASP B CG    1 
ATOM   3126  O  OD1   . ASP A  1  404 ? -10.054 43.953 13.989  1.00 49.60  ? 1203 ASP B OD1   1 
ATOM   3127  O  OD2   . ASP A  1  404 ? -10.962 45.305 15.516  1.00 53.89  ? 1203 ASP B OD2   1 
ATOM   3128  N  N     . ILE A  1  405 ? -7.627  48.223 11.906  1.00 34.82  ? 1204 ILE B N     1 
ATOM   3129  C  CA    . ILE A  1  405 ? -7.473  49.386 11.034  1.00 35.98  ? 1204 ILE B CA    1 
ATOM   3130  C  C     . ILE A  1  405 ? -7.609  48.931 9.584   1.00 34.63  ? 1204 ILE B C     1 
ATOM   3131  O  O     . ILE A  1  405 ? -7.161  47.834 9.215   1.00 32.40  ? 1204 ILE B O     1 
ATOM   3132  C  CB    . ILE A  1  405 ? -6.156  50.104 11.312  1.00 37.39  ? 1204 ILE B CB    1 
ATOM   3133  C  CG1   . ILE A  1  405 ? -6.099  51.455 10.618  1.00 39.57  ? 1204 ILE B CG1   1 
ATOM   3134  C  CG2   . ILE A  1  405 ? -4.962  49.210 10.900  1.00 37.56  ? 1204 ILE B CG2   1 
ATOM   3135  C  CD1   . ILE A  1  405 ? -4.909  52.315 11.027  1.00 39.19  ? 1204 ILE B CD1   1 
ATOM   3136  N  N     . SER A  1  406 ? -8.201  49.798 8.770   1.00 34.39  ? 1205 SER B N     1 
ATOM   3137  C  CA    . SER A  1  406 ? -8.378  49.458 7.354   1.00 34.77  ? 1205 SER B CA    1 
ATOM   3138  C  C     . SER A  1  406 ? -7.170  50.005 6.567   1.00 34.61  ? 1205 SER B C     1 
ATOM   3139  O  O     . SER A  1  406 ? -6.409  50.860 7.030   1.00 36.73  ? 1205 SER B O     1 
ATOM   3140  C  CB    . SER A  1  406 ? -9.653  50.015 6.782   1.00 35.25  ? 1205 SER B CB    1 
ATOM   3141  O  OG    . SER A  1  406 ? -9.617  51.456 6.820   1.00 34.99  ? 1205 SER B OG    1 
ATOM   3142  N  N     . ILE A  1  407 ? -7.012  49.477 5.353   1.00 33.22  ? 1206 ILE B N     1 
ATOM   3143  C  CA    . ILE A  1  407 ? -5.954  49.930 4.480   1.00 32.81  ? 1206 ILE B CA    1 
ATOM   3144  C  C     . ILE A  1  407 ? -6.167  51.388 4.075   1.00 33.71  ? 1206 ILE B C     1 
ATOM   3145  O  O     . ILE A  1  407 ? -5.210  52.154 3.941   1.00 31.64  ? 1206 ILE B O     1 
ATOM   3146  C  CB    . ILE A  1  407 ? -5.846  48.987 3.252   1.00 32.84  ? 1206 ILE B CB    1 
ATOM   3147  C  CG1   . ILE A  1  407 ? -5.262  47.640 3.697   1.00 33.68  ? 1206 ILE B CG1   1 
ATOM   3148  C  CG2   . ILE A  1  407 ? -5.011  49.606 2.144   1.00 30.52  ? 1206 ILE B CG2   1 
ATOM   3149  C  CD1   . ILE A  1  407 ? -5.513  46.505 2.748   1.00 38.37  ? 1206 ILE B CD1   1 
ATOM   3150  N  N     . ALA A  1  408 ? -7.409  51.789 3.900   1.00 30.76  ? 1207 ALA B N     1 
ATOM   3151  C  CA    . ALA A  1  408 ? -7.692  53.194 3.553   1.00 33.73  ? 1207 ALA B CA    1 
ATOM   3152  C  C     . ALA A  1  408 ? -7.253  54.134 4.676   1.00 33.85  ? 1207 ALA B C     1 
ATOM   3153  O  O     . ALA A  1  408 ? -6.713  55.207 4.415   1.00 33.32  ? 1207 ALA B O     1 
ATOM   3154  C  CB    . ALA A  1  408 ? -9.191  53.391 3.243   1.00 36.69  ? 1207 ALA B CB    1 
ATOM   3155  N  N     . GLU A  1  409 ? -7.463  53.736 5.948   1.00 33.64  ? 1208 GLU B N     1 
ATOM   3156  C  CA    . GLU A  1  409 ? -6.992  54.549 7.034   1.00 36.49  ? 1208 GLU B CA    1 
ATOM   3157  C  C     . GLU A  1  409 ? -5.464  54.494 7.189   1.00 34.50  ? 1208 GLU B C     1 
ATOM   3158  O  O     . GLU A  1  409 ? -4.848  55.485 7.591   1.00 35.36  ? 1208 GLU B O     1 
ATOM   3159  C  CB    . GLU A  1  409 ? -7.688  54.148 8.354   1.00 40.65  ? 1208 GLU B CB    1 
ATOM   3160  C  CG    . GLU A  1  409 ? -7.149  54.972 9.558   1.00 46.14  ? 1208 GLU B CG    1 
ATOM   3161  C  CD    . GLU A  1  409 ? -7.954  54.737 10.822  1.00 53.53  ? 1208 GLU B CD    1 
ATOM   3162  O  OE1   . GLU A  1  409 ? -7.410  55.153 11.896  1.00 51.64  ? 1208 GLU B OE1   1 
ATOM   3163  O  OE2   . GLU A  1  409 ? -9.104  54.140 10.822  1.00 50.24  ? 1208 GLU B OE2   1 
ATOM   3164  N  N     . LEU A  1  410 ? -4.864  53.349 6.885   1.00 34.14  ? 1209 LEU B N     1 
ATOM   3165  C  CA    . LEU A  1  410 ? -3.409  53.280 6.873   1.00 33.14  ? 1209 LEU B CA    1 
ATOM   3166  C  C     . LEU A  1  410 ? -2.816  54.238 5.856   1.00 30.98  ? 1209 LEU B C     1 
ATOM   3167  O  O     . LEU A  1  410 ? -1.732  54.798 6.076   1.00 32.06  ? 1209 LEU B O     1 
ATOM   3168  C  CB    . LEU A  1  410 ? -2.938  51.841 6.587   1.00 33.67  ? 1209 LEU B CB    1 
ATOM   3169  C  CG    . LEU A  1  410 ? -3.109  50.882 7.773   1.00 34.16  ? 1209 LEU B CG    1 
ATOM   3170  C  CD1   . LEU A  1  410 ? -2.871  49.446 7.306   1.00 34.10  ? 1209 LEU B CD1   1 
ATOM   3171  C  CD2   . LEU A  1  410 ? -2.150  51.205 8.892   1.00 32.54  ? 1209 LEU B CD2   1 
ATOM   3172  N  N     . MET A  1  411 ? -3.535  54.471 4.739   1.00 31.89  ? 1210 MET B N     1 
ATOM   3173  C  CA    . MET A  1  411 ? -3.096  55.407 3.723   1.00 32.81  ? 1210 MET B CA    1 
ATOM   3174  C  C     . MET A  1  411 ? -3.223  56.860 4.163   1.00 35.61  ? 1210 MET B C     1 
ATOM   3175  O  O     . MET A  1  411 ? -2.793  57.758 3.415   1.00 34.98  ? 1210 MET B O     1 
ATOM   3176  C  CB    . MET A  1  411 ? -3.859  55.177 2.437   1.00 34.30  ? 1210 MET B CB    1 
ATOM   3177  C  CG    . MET A  1  411 ? -3.495  53.864 1.729   1.00 34.69  ? 1210 MET B CG    1 
ATOM   3178  S  SD    . MET A  1  411 ? -4.320  53.640 0.120   1.00 40.50  ? 1210 MET B SD    1 
ATOM   3179  C  CE    . MET A  1  411 ? -3.565  55.051 -0.763  1.00 36.14  ? 1210 MET B CE    1 
ATOM   3180  N  N     . GLU A  1  412 ? -3.801  57.128 5.335   1.00 35.22  ? 1211 GLU B N     1 
ATOM   3181  C  CA    . GLU A  1  412 ? -3.731  58.476 5.889   1.00 37.66  ? 1211 GLU B CA    1 
ATOM   3182  C  C     . GLU A  1  412 ? -2.337  58.778 6.414   1.00 36.73  ? 1211 GLU B C     1 
ATOM   3183  O  O     . GLU A  1  412 ? -1.925  59.932 6.453   1.00 38.94  ? 1211 GLU B O     1 
ATOM   3184  C  CB    . GLU A  1  412 ? -4.781  58.655 6.998   1.00 37.54  ? 1211 GLU B CB    1 
ATOM   3185  C  CG    . GLU A  1  412 ? -6.204  58.570 6.541   1.00 39.67  ? 1211 GLU B CG    1 
ATOM   3186  C  CD    . GLU A  1  412 ? -7.206  58.629 7.671   1.00 42.66  ? 1211 GLU B CD    1 
ATOM   3187  O  OE1   . GLU A  1  412 ? -8.324  58.073 7.509   1.00 46.63  ? 1211 GLU B OE1   1 
ATOM   3188  O  OE2   . GLU A  1  412 ? -6.866  59.144 8.758   1.00 41.86  ? 1211 GLU B OE2   1 
ATOM   3189  N  N     . ASP A  1  413 ? -1.602  57.736 6.798   1.00 35.56  ? 1212 ASP B N     1 
ATOM   3190  C  CA    . ASP A  1  413 ? -0.196  57.867 7.156   1.00 32.55  ? 1212 ASP B CA    1 
ATOM   3191  C  C     . ASP A  1  413 ? 0.729   57.557 5.978   1.00 32.88  ? 1212 ASP B C     1 
ATOM   3192  O  O     . ASP A  1  413 ? 1.660   58.306 5.713   1.00 32.76  ? 1212 ASP B O     1 
ATOM   3193  C  CB    . ASP A  1  413 ? 0.142   56.921 8.330   1.00 32.83  ? 1212 ASP B CB    1 
ATOM   3194  C  CG    . ASP A  1  413 ? -0.542  57.346 9.627   1.00 34.15  ? 1212 ASP B CG    1 
ATOM   3195  O  OD1   . ASP A  1  413 ? -0.530  58.519 9.961   1.00 33.81  ? 1212 ASP B OD1   1 
ATOM   3196  O  OD2   . ASP A  1  413 ? -1.095  56.443 10.310  1.00 33.43  ? 1212 ASP B OD2   1 
ATOM   3197  N  N     . ILE A  1  414 ? 0.450   56.455 5.267   1.00 32.50  ? 1213 ILE B N     1 
ATOM   3198  C  CA    . ILE A  1  414 ? 1.321   55.991 4.182   1.00 31.21  ? 1213 ILE B CA    1 
ATOM   3199  C  C     . ILE A  1  414 ? 0.638   56.453 2.887   1.00 31.56  ? 1213 ILE B C     1 
ATOM   3200  O  O     . ILE A  1  414 ? -0.201  55.757 2.310   1.00 31.13  ? 1213 ILE B O     1 
ATOM   3201  C  CB    . ILE A  1  414 ? 1.541   54.493 4.237   1.00 30.29  ? 1213 ILE B CB    1 
ATOM   3202  C  CG1   . ILE A  1  414 ? 2.184   54.121 5.564   1.00 29.79  ? 1213 ILE B CG1   1 
ATOM   3203  C  CG2   . ILE A  1  414 ? 2.429   54.044 3.080   1.00 29.57  ? 1213 ILE B CG2   1 
ATOM   3204  C  CD1   . ILE A  1  414 ? 2.176   52.594 5.823   1.00 32.35  ? 1213 ILE B CD1   1 
ATOM   3205  N  N     . GLU A  1  415 ? 1.046   57.630 2.398   1.00 33.99  ? 1214 GLU B N     1 
ATOM   3206  C  CA    . GLU A  1  415 ? 0.465   58.157 1.172   1.00 35.52  ? 1214 GLU B CA    1 
ATOM   3207  C  C     . GLU A  1  415 ? 0.732   57.279 -0.046  1.00 32.98  ? 1214 GLU B C     1 
ATOM   3208  O  O     . GLU A  1  415 ? -0.072  57.221 -0.968  1.00 31.81  ? 1214 GLU B O     1 
ATOM   3209  C  CB    . GLU A  1  415 ? 1.042   59.564 0.883   1.00 39.16  ? 1214 GLU B CB    1 
ATOM   3210  C  CG    . GLU A  1  415 ? 0.608   60.626 1.862   1.00 46.47  ? 1214 GLU B CG    1 
ATOM   3211  C  CD    . GLU A  1  415 ? 1.223   61.971 1.536   1.00 50.25  ? 1214 GLU B CD    1 
ATOM   3212  O  OE1   . GLU A  1  415 ? 1.451   62.254 0.316   1.00 55.84  ? 1214 GLU B OE1   1 
ATOM   3213  O  OE2   . GLU A  1  415 ? 1.518   62.676 2.546   1.00 60.41  ? 1214 GLU B OE2   1 
ATOM   3214  N  N     . GLY A  1  416 ? 1.841   56.574 -0.035  1.00 31.32  ? 1215 GLY B N     1 
ATOM   3215  C  CA    . GLY A  1  416 ? 2.291   55.826 -1.201  1.00 29.64  ? 1215 GLY B CA    1 
ATOM   3216  C  C     . GLY A  1  416 ? 3.807   55.659 -1.162  1.00 29.33  ? 1215 GLY B C     1 
ATOM   3217  O  O     . GLY A  1  416 ? 4.454   56.000 -0.183  1.00 30.31  ? 1215 GLY B O     1 
ATOM   3218  N  N     . PRO A  1  417 ? 4.365   55.174 -2.237  1.00 29.00  ? 1216 PRO B N     1 
ATOM   3219  C  CA    . PRO A  1  417 ? 5.834   55.013 -2.304  1.00 28.52  ? 1216 PRO B CA    1 
ATOM   3220  C  C     . PRO A  1  417 ? 6.540   56.336 -2.217  1.00 27.42  ? 1216 PRO B C     1 
ATOM   3221  O  O     . PRO A  1  417 ? 5.976   57.402 -2.533  1.00 27.19  ? 1216 PRO B O     1 
ATOM   3222  C  CB    . PRO A  1  417 ? 6.066   54.363 -3.701  1.00 26.69  ? 1216 PRO B CB    1 
ATOM   3223  C  CG    . PRO A  1  417 ? 4.750   53.712 -4.022  1.00 27.13  ? 1216 PRO B CG    1 
ATOM   3224  C  CD    . PRO A  1  417 ? 3.701   54.611 -3.451  1.00 27.89  ? 1216 PRO B CD    1 
ATOM   3225  N  N     . ASP A  1  418 ? 7.792   56.288 -1.787  1.00 26.88  ? 1217 ASP B N     1 
ATOM   3226  C  CA    . ASP A  1  418 ? 8.672   57.456 -1.691  1.00 26.71  ? 1217 ASP B CA    1 
ATOM   3227  C  C     . ASP A  1  418 ? 10.021  57.034 -2.262  1.00 25.10  ? 1217 ASP B C     1 
ATOM   3228  O  O     . ASP A  1  418 ? 10.807  56.380 -1.560  1.00 24.84  ? 1217 ASP B O     1 
ATOM   3229  C  CB    . ASP A  1  418 ? 8.749   57.925 -0.272  1.00 27.17  ? 1217 ASP B CB    1 
ATOM   3230  C  CG    . ASP A  1  418 ? 9.402   59.319 -0.145  1.00 26.64  ? 1217 ASP B CG    1 
ATOM   3231  O  OD1   . ASP A  1  418 ? 9.353   60.074 -1.121  1.00 27.51  ? 1217 ASP B OD1   1 
ATOM   3232  O  OD2   . ASP A  1  418 ? 9.925   59.637 0.937   1.00 29.50  ? 1217 ASP B OD2   1 
ATOM   3233  N  N     . PHE A  1  419 ? 10.289  57.369 -3.523  1.00 23.88  ? 1218 PHE B N     1 
ATOM   3234  C  CA    . PHE A  1  419 ? 11.509  56.883 -4.115  1.00 25.24  ? 1218 PHE B CA    1 
ATOM   3235  C  C     . PHE A  1  419 ? 12.716  57.710 -3.800  1.00 26.88  ? 1218 PHE B C     1 
ATOM   3236  O  O     . PHE A  1  419 ? 12.593  58.949 -3.628  1.00 28.82  ? 1218 PHE B O     1 
ATOM   3237  C  CB    . PHE A  1  419 ? 11.351  56.814 -5.663  1.00 25.61  ? 1218 PHE B CB    1 
ATOM   3238  C  CG    . PHE A  1  419 ? 10.182  55.985 -6.135  1.00 25.11  ? 1218 PHE B CG    1 
ATOM   3239  C  CD1   . PHE A  1  419 ? 10.208  54.618 -6.006  1.00 25.39  ? 1218 PHE B CD1   1 
ATOM   3240  C  CD2   . PHE A  1  419 ? 9.107   56.580 -6.706  1.00 26.44  ? 1218 PHE B CD2   1 
ATOM   3241  C  CE1   . PHE A  1  419 ? 9.147   53.827 -6.428  1.00 25.21  ? 1218 PHE B CE1   1 
ATOM   3242  C  CE2   . PHE A  1  419 ? 7.995   55.831 -7.144  1.00 27.00  ? 1218 PHE B CE2   1 
ATOM   3243  C  CZ    . PHE A  1  419 ? 8.010   54.373 -7.026  1.00 27.16  ? 1218 PHE B CZ    1 
ATOM   3244  N  N     . PRO A  1  420 ? 13.895  57.090 -3.671  1.00 24.98  ? 1219 PRO B N     1 
ATOM   3245  C  CA    . PRO A  1  420 ? 15.120  57.865 -3.401  1.00 25.66  ? 1219 PRO B CA    1 
ATOM   3246  C  C     . PRO A  1  420 ? 15.403  58.905 -4.477  1.00 26.81  ? 1219 PRO B C     1 
ATOM   3247  O  O     . PRO A  1  420 ? 16.013  59.930 -4.189  1.00 26.71  ? 1219 PRO B O     1 
ATOM   3248  C  CB    . PRO A  1  420 ? 16.212  56.802 -3.317  1.00 26.18  ? 1219 PRO B CB    1 
ATOM   3249  C  CG    . PRO A  1  420 ? 15.688  55.666 -4.048  1.00 25.61  ? 1219 PRO B CG    1 
ATOM   3250  C  CD    . PRO A  1  420 ? 14.174  55.671 -3.814  1.00 24.76  ? 1219 PRO B CD    1 
ATOM   3251  N  N     . THR A  1  421 ? 14.912  58.683 -5.679  1.00 25.20  ? 1220 THR B N     1 
ATOM   3252  C  CA    . THR A  1  421 ? 15.138  59.581 -6.796  1.00 27.31  ? 1220 THR B CA    1 
ATOM   3253  C  C     . THR A  1  421 ? 14.011  60.585 -6.969  1.00 28.02  ? 1220 THR B C     1 
ATOM   3254  O  O     . THR A  1  421 ? 13.984  61.293 -7.972  1.00 30.73  ? 1220 THR B O     1 
ATOM   3255  C  CB    . THR A  1  421 ? 15.210  58.749 -8.116  1.00 27.42  ? 1220 THR B CB    1 
ATOM   3256  O  OG1   . THR A  1  421 ? 14.158  57.736 -8.060  1.00 26.97  ? 1220 THR B OG1   1 
ATOM   3257  C  CG2   . THR A  1  421 ? 16.564  58.034 -8.239  1.00 27.12  ? 1220 THR B CG2   1 
ATOM   3258  N  N     . ALA A  1  422 ? 13.134  60.754 -5.966  1.00 27.94  ? 1221 ALA B N     1 
ATOM   3259  C  CA    . ALA A  1  422 ? 12.034  61.723 -5.987  1.00 28.69  ? 1221 ALA B CA    1 
ATOM   3260  C  C     . ALA A  1  422 ? 11.047  61.501 -7.101  1.00 28.12  ? 1221 ALA B C     1 
ATOM   3261  O  O     . ALA A  1  422 ? 10.478  60.387 -7.260  1.00 25.99  ? 1221 ALA B O     1 
ATOM   3262  C  CB    . ALA A  1  422 ? 12.560  63.156 -6.084  1.00 28.91  ? 1221 ALA B CB    1 
ATOM   3263  N  N     . GLY A  1  423 ? 10.791  62.562 -7.866  1.00 29.57  ? 1222 GLY B N     1 
ATOM   3264  C  CA    . GLY A  1  423 ? 9.895   62.464 -9.029  1.00 28.97  ? 1222 GLY B CA    1 
ATOM   3265  C  C     . GLY A  1  423 ? 8.417   62.589 -8.586  1.00 28.48  ? 1222 GLY B C     1 
ATOM   3266  O  O     . GLY A  1  423 ? 8.077   62.966 -7.468  1.00 31.13  ? 1222 GLY B O     1 
ATOM   3267  N  N     . LEU A  1  424 ? 7.561   62.245 -9.517  1.00 30.75  ? 1223 LEU B N     1 
ATOM   3268  C  CA    . LEU A  1  424 ? 6.115   62.311 -9.322  1.00 31.74  ? 1223 LEU B CA    1 
ATOM   3269  C  C     . LEU A  1  424 ? 5.476   60.948 -9.529  1.00 32.06  ? 1223 LEU B C     1 
ATOM   3270  O  O     . LEU A  1  424 ? 5.968   60.119 -10.287 1.00 35.23  ? 1223 LEU B O     1 
ATOM   3271  C  CB    . LEU A  1  424 ? 5.431   63.266 -10.339 1.00 34.31  ? 1223 LEU B CB    1 
ATOM   3272  C  CG    . LEU A  1  424 ? 5.799   64.761 -10.437 1.00 36.94  ? 1223 LEU B CG    1 
ATOM   3273  C  CD1   . LEU A  1  424 ? 6.201   65.352 -9.085  1.00 36.10  ? 1223 LEU B CD1   1 
ATOM   3274  C  CD2   . LEU A  1  424 ? 6.910   64.979 -11.433 1.00 37.91  ? 1223 LEU B CD2   1 
ATOM   3275  N  N     . ILE A  1  425 ? 4.362   60.736 -8.856  1.00 31.07  ? 1224 ILE B N     1 
ATOM   3276  C  CA    . ILE A  1  425 ? 3.462   59.614 -9.093  1.00 30.18  ? 1224 ILE B CA    1 
ATOM   3277  C  C     . ILE A  1  425 ? 2.120   60.193 -9.554  1.00 32.10  ? 1224 ILE B C     1 
ATOM   3278  O  O     . ILE A  1  425 ? 1.639   61.200 -9.016  1.00 31.38  ? 1224 ILE B O     1 
ATOM   3279  C  CB    . ILE A  1  425 ? 3.235   58.808 -7.824  1.00 28.75  ? 1224 ILE B CB    1 
ATOM   3280  C  CG1   . ILE A  1  425 ? 4.569   58.031 -7.471  1.00 28.86  ? 1224 ILE B CG1   1 
ATOM   3281  C  CG2   . ILE A  1  425 ? 2.134   57.820 -7.946  1.00 30.05  ? 1224 ILE B CG2   1 
ATOM   3282  C  CD1   . ILE A  1  425 ? 4.467   57.161 -6.238  1.00 28.60  ? 1224 ILE B CD1   1 
ATOM   3283  N  N     . LEU A  1  426 ? 1.542   59.542 -10.567 1.00 33.52  ? 1225 LEU B N     1 
ATOM   3284  C  CA    . LEU A  1  426 ? 0.304   60.029 -11.224 1.00 37.23  ? 1225 LEU B CA    1 
ATOM   3285  C  C     . LEU A  1  426 ? -0.916  59.312 -10.648 1.00 36.46  ? 1225 LEU B C     1 
ATOM   3286  O  O     . LEU A  1  426 ? -1.175  58.147 -11.015 1.00 39.26  ? 1225 LEU B O     1 
ATOM   3287  C  CB    . LEU A  1  426 ? 0.420   59.848 -12.730 1.00 36.10  ? 1225 LEU B CB    1 
ATOM   3288  C  CG    . LEU A  1  426 ? 1.540   60.555 -13.447 1.00 38.67  ? 1225 LEU B CG    1 
ATOM   3289  C  CD1   . LEU A  1  426 ? 1.483   60.232 -14.940 1.00 37.41  ? 1225 LEU B CD1   1 
ATOM   3290  C  CD2   . LEU A  1  426 ? 1.469   62.096 -13.200 1.00 38.44  ? 1225 LEU B CD2   1 
ATOM   3291  N  N     . GLY A  1  427 ? -1.623  59.964 -9.751  1.00 39.47  ? 1226 GLY B N     1 
ATOM   3292  C  CA    . GLY A  1  427 ? -2.876  59.419 -9.208  1.00 39.64  ? 1226 GLY B CA    1 
ATOM   3293  C  C     . GLY A  1  427 ? -2.594  58.458 -8.025  1.00 38.45  ? 1226 GLY B C     1 
ATOM   3294  O  O     . GLY A  1  427 ? -1.477  58.026 -7.765  1.00 35.17  ? 1226 GLY B O     1 
ATOM   3295  N  N     . LYS A  1  428 ? -3.656  58.146 -7.307  1.00 37.08  ? 1227 LYS B N     1 
ATOM   3296  C  CA    . LYS A  1  428 ? -3.622  57.206 -6.210  1.00 38.40  ? 1227 LYS B CA    1 
ATOM   3297  C  C     . LYS A  1  428 ? -4.322  55.880 -6.539  1.00 39.21  ? 1227 LYS B C     1 
ATOM   3298  O  O     . LYS A  1  428 ? -4.365  54.987 -5.673  1.00 38.16  ? 1227 LYS B O     1 
ATOM   3299  C  CB    . LYS A  1  428 ? -4.285  57.790 -4.949  1.00 42.95  ? 1227 LYS B CB    1 
ATOM   3300  C  CG    . LYS A  1  428 ? -3.397  58.636 -4.097  1.00 49.71  ? 1227 LYS B CG    1 
ATOM   3301  C  CD    . LYS A  1  428 ? -3.635  58.343 -2.617  1.00 58.41  ? 1227 LYS B CD    1 
ATOM   3302  C  CE    . LYS A  1  428 ? -2.685  59.177 -1.720  1.00 60.22  ? 1227 LYS B CE    1 
ATOM   3303  N  NZ    . LYS A  1  428 ? -2.847  58.778 -0.286  1.00 63.49  ? 1227 LYS B NZ    1 
ATOM   3304  N  N     . SER A  1  429 ? -4.871  55.736 -7.745  1.00 36.18  ? 1228 SER B N     1 
ATOM   3305  C  CA    . SER A  1  429 ? -5.602  54.512 -8.043  1.00 40.04  ? 1228 SER B CA    1 
ATOM   3306  C  C     . SER A  1  429 ? -4.654  53.297 -8.073  1.00 38.23  ? 1228 SER B C     1 
ATOM   3307  O  O     . SER A  1  429 ? -4.957  52.240 -7.496  1.00 34.60  ? 1228 SER B O     1 
ATOM   3308  C  CB    . SER A  1  429 ? -6.411  54.648 -9.327  1.00 43.39  ? 1228 SER B CB    1 
ATOM   3309  O  OG    . SER A  1  429 ? -5.496  55.056 -10.376 1.00 52.72  ? 1228 SER B OG    1 
ATOM   3310  N  N     . GLY A  1  430 ? -3.486  53.469 -8.744  1.00 37.94  ? 1229 GLY B N     1 
ATOM   3311  C  CA    . GLY A  1  430 ? -2.505  52.414 -8.746  1.00 32.79  ? 1229 GLY B CA    1 
ATOM   3312  C  C     . GLY A  1  430 ? -1.946  52.083 -7.336  1.00 30.83  ? 1229 GLY B C     1 
ATOM   3313  O  O     . GLY A  1  430 ? -1.754  50.937 -6.954  1.00 30.68  ? 1229 GLY B O     1 
ATOM   3314  N  N     . ILE A  1  431 ? -1.664  53.128 -6.585  1.00 30.62  ? 1230 ILE B N     1 
ATOM   3315  C  CA    . ILE A  1  431 ? -1.198  53.019 -5.229  1.00 30.32  ? 1230 ILE B CA    1 
ATOM   3316  C  C     . ILE A  1  431 ? -2.234  52.214 -4.387  1.00 31.49  ? 1230 ILE B C     1 
ATOM   3317  O  O     . ILE A  1  431 ? -1.880  51.259 -3.675  1.00 28.01  ? 1230 ILE B O     1 
ATOM   3318  C  CB    . ILE A  1  431 ? -0.949  54.374 -4.566  1.00 30.87  ? 1230 ILE B CB    1 
ATOM   3319  C  CG1   . ILE A  1  431 ? 0.232   55.053 -5.214  1.00 30.50  ? 1230 ILE B CG1   1 
ATOM   3320  C  CG2   . ILE A  1  431 ? -0.675  54.226 -3.098  1.00 30.38  ? 1230 ILE B CG2   1 
ATOM   3321  C  CD1   . ILE A  1  431 ? 0.549   56.432 -4.674  1.00 32.17  ? 1230 ILE B CD1   1 
ATOM   3322  N  N     . ARG A  1  432 ? -3.493  52.627 -4.494  1.00 29.30  ? 1231 ARG B N     1 
ATOM   3323  C  CA    . ARG A  1  432 ? -4.548  52.002 -3.749  1.00 32.20  ? 1231 ARG B CA    1 
ATOM   3324  C  C     . ARG A  1  432 ? -4.734  50.523 -4.145  1.00 31.52  ? 1231 ARG B C     1 
ATOM   3325  O  O     . ARG A  1  432 ? -4.845  49.654 -3.294  1.00 29.98  ? 1231 ARG B O     1 
ATOM   3326  C  CB    . ARG A  1  432 ? -5.864  52.778 -3.903  1.00 36.09  ? 1231 ARG B CB    1 
ATOM   3327  C  CG    . ARG A  1  432 ? -7.036  52.262 -3.110  1.00 41.96  ? 1231 ARG B CG    1 
ATOM   3328  C  CD    . ARG A  1  432 ? -8.101  53.320 -2.881  1.00 46.79  ? 1231 ARG B CD    1 
ATOM   3329  N  NE    . ARG A  1  432 ? -8.211  54.393 -3.861  1.00 53.86  ? 1231 ARG B NE    1 
ATOM   3330  C  CZ    . ARG A  1  432 ? -7.864  55.672 -3.655  1.00 56.38  ? 1231 ARG B CZ    1 
ATOM   3331  N  NH1   . ARG A  1  432 ? -8.006  56.528 -4.663  1.00 57.10  ? 1231 ARG B NH1   1 
ATOM   3332  N  NH2   . ARG A  1  432 ? -7.379  56.116 -2.473  1.00 54.11  ? 1231 ARG B NH2   1 
ATOM   3333  N  N     A ARG A  1  433 ? -4.635  50.214 -5.437  0.50 30.73  ? 1232 ARG B N     1 
ATOM   3334  N  N     B ARG A  1  433 ? -4.617  50.205 -5.433  0.50 30.72  ? 1232 ARG B N     1 
ATOM   3335  C  CA    A ARG A  1  433 ? -4.700  48.836 -5.897  0.50 30.99  ? 1232 ARG B CA    1 
ATOM   3336  C  CA    B ARG A  1  433 ? -4.717  48.822 -5.864  0.50 30.94  ? 1232 ARG B CA    1 
ATOM   3337  C  C     A ARG A  1  433 ? -3.559  47.997 -5.324  0.50 30.18  ? 1232 ARG B C     1 
ATOM   3338  C  C     B ARG A  1  433 ? -3.552  47.977 -5.345  0.50 30.14  ? 1232 ARG B C     1 
ATOM   3339  O  O     A ARG A  1  433 ? -3.778  46.881 -4.831  0.50 29.25  ? 1232 ARG B O     1 
ATOM   3340  O  O     B ARG A  1  433 ? -3.754  46.836 -4.904  0.50 29.16  ? 1232 ARG B O     1 
ATOM   3341  C  CB    A ARG A  1  433 ? -4.653  48.824 -7.429  0.50 32.03  ? 1232 ARG B CB    1 
ATOM   3342  C  CB    B ARG A  1  433 ? -4.778  48.774 -7.392  0.50 32.20  ? 1232 ARG B CB    1 
ATOM   3343  C  CG    A ARG A  1  433 ? -4.941  47.482 -8.086  0.50 35.24  ? 1232 ARG B CG    1 
ATOM   3344  C  CG    B ARG A  1  433 ? -5.348  47.478 -7.950  0.50 35.24  ? 1232 ARG B CG    1 
ATOM   3345  C  CD    A ARG A  1  433 ? -6.237  47.550 -8.874  0.50 35.27  ? 1232 ARG B CD    1 
ATOM   3346  C  CD    B ARG A  1  433 ? -5.552  47.750 -9.449  0.50 34.05  ? 1232 ARG B CD    1 
ATOM   3347  N  NE    A ARG A  1  433 ? -7.237  47.160 -7.866  0.50 36.34  ? 1232 ARG B NE    1 
ATOM   3348  N  NE    B ARG A  1  433 ? -6.647  48.649 -9.680  0.50 37.03  ? 1232 ARG B NE    1 
ATOM   3349  C  CZ    A ARG A  1  433 ? -7.628  45.907 -7.568  0.50 32.78  ? 1232 ARG B CZ    1 
ATOM   3350  C  CZ    B ARG A  1  433 ? -6.513  49.821 -10.284 0.50 37.97  ? 1232 ARG B CZ    1 
ATOM   3351  N  NH1   A ARG A  1  433 ? -8.507  45.841 -6.567  0.50 31.87  ? 1232 ARG B NH1   1 
ATOM   3352  N  NH1   B ARG A  1  433 ? -5.304  50.201 -10.626 0.50 37.03  ? 1232 ARG B NH1   1 
ATOM   3353  N  NH2   A ARG A  1  433 ? -7.262  44.853 -8.318  0.50 29.54  ? 1232 ARG B NH2   1 
ATOM   3354  N  NH2   B ARG A  1  433 ? -7.557  50.595 -10.507 0.50 34.41  ? 1232 ARG B NH2   1 
ATOM   3355  N  N     . ALA A  1  434 ? -2.343  48.528 -5.377  1.00 28.21  ? 1233 ALA B N     1 
ATOM   3356  C  CA    . ALA A  1  434 ? -1.181  47.802 -4.874  1.00 27.77  ? 1233 ALA B CA    1 
ATOM   3357  C  C     . ALA A  1  434 ? -1.300  47.546 -3.367  1.00 26.97  ? 1233 ALA B C     1 
ATOM   3358  O  O     . ALA A  1  434 ? -0.929  46.474 -2.878  1.00 28.07  ? 1233 ALA B O     1 
ATOM   3359  C  CB    . ALA A  1  434 ? 0.099   48.564 -5.198  1.00 24.16  ? 1233 ALA B CB    1 
ATOM   3360  N  N     . TYR A  1  435 ? -1.788  48.534 -2.605  1.00 27.10  ? 1234 TYR B N     1 
ATOM   3361  C  CA    . TYR A  1  435 ? -1.857  48.390 -1.172  1.00 27.55  ? 1234 TYR B CA    1 
ATOM   3362  C  C     . TYR A  1  435 ? -3.005  47.471 -0.729  1.00 27.33  ? 1234 TYR B C     1 
ATOM   3363  O  O     . TYR A  1  435 ? -2.882  46.781 0.280   1.00 27.17  ? 1234 TYR B O     1 
ATOM   3364  C  CB    . TYR A  1  435 ? -1.988  49.756 -0.491  1.00 28.85  ? 1234 TYR B CB    1 
ATOM   3365  C  CG    . TYR A  1  435 ? -0.733  50.564 -0.508  1.00 29.44  ? 1234 TYR B CG    1 
ATOM   3366  C  CD1   . TYR A  1  435 ? 0.510   49.985 -0.902  1.00 29.20  ? 1234 TYR B CD1   1 
ATOM   3367  C  CD2   . TYR A  1  435 ? -0.754  51.925 -0.129  1.00 30.31  ? 1234 TYR B CD2   1 
ATOM   3368  C  CE1   . TYR A  1  435 ? 1.663   50.687 -0.866  1.00 27.56  ? 1234 TYR B CE1   1 
ATOM   3369  C  CE2   . TYR A  1  435 ? 0.422   52.677 -0.117  1.00 30.67  ? 1234 TYR B CE2   1 
ATOM   3370  C  CZ    . TYR A  1  435 ? 1.602   52.091 -0.516  1.00 29.69  ? 1234 TYR B CZ    1 
ATOM   3371  O  OH    . TYR A  1  435 ? 2.745   52.836 -0.551  1.00 29.57  ? 1234 TYR B OH    1 
ATOM   3372  N  N     . GLU A  1  436 ? -4.115  47.459 -1.476  1.00 27.81  ? 1235 GLU B N     1 
ATOM   3373  C  CA    . GLU A  1  436 ? -5.222  46.611 -1.095  1.00 29.32  ? 1235 GLU B CA    1 
ATOM   3374  C  C     . GLU A  1  436 ? -5.005  45.154 -1.496  1.00 27.90  ? 1235 GLU B C     1 
ATOM   3375  O  O     . GLU A  1  436 ? -5.527  44.251 -0.803  1.00 25.40  ? 1235 GLU B O     1 
ATOM   3376  C  CB    . GLU A  1  436 ? -6.531  47.110 -1.753  1.00 31.07  ? 1235 GLU B CB    1 
ATOM   3377  C  CG    . GLU A  1  436 ? -6.982  48.500 -1.235  1.00 34.95  ? 1235 GLU B CG    1 
ATOM   3378  C  CD    . GLU A  1  436 ? -7.957  48.375 -0.038  1.00 41.33  ? 1235 GLU B CD    1 
ATOM   3379  O  OE1   . GLU A  1  436 ? -8.363  47.291 0.345   1.00 43.23  ? 1235 GLU B OE1   1 
ATOM   3380  O  OE2   . GLU A  1  436 ? -8.274  49.442 0.517   1.00 47.13  ? 1235 GLU B OE2   1 
ATOM   3381  N  N     . THR A  1  437 ? -4.260  44.885 -2.573  1.00 27.96  ? 1236 THR B N     1 
ATOM   3382  C  CA    . THR A  1  437 ? -4.142  43.545 -3.107  1.00 27.23  ? 1236 THR B CA    1 
ATOM   3383  C  C     . THR A  1  437 ? -2.688  43.033 -3.230  1.00 28.20  ? 1236 THR B C     1 
ATOM   3384  O  O     . THR A  1  437 ? -2.501  41.858 -3.590  1.00 28.10  ? 1236 THR B O     1 
ATOM   3385  C  CB    . THR A  1  437 ? -4.762  43.444 -4.485  1.00 27.54  ? 1236 THR B CB    1 
ATOM   3386  O  OG1   . THR A  1  437 ? -3.959  44.189 -5.430  1.00 27.84  ? 1236 THR B OG1   1 
ATOM   3387  C  CG2   . THR A  1  437 ? -6.179  44.031 -4.495  1.00 27.27  ? 1236 THR B CG2   1 
ATOM   3388  N  N     . GLY A  1  438 ? -1.678  43.860 -3.021  1.00 25.91  ? 1237 GLY B N     1 
ATOM   3389  C  CA    . GLY A  1  438 ? -0.313  43.469 -3.284  1.00 26.00  ? 1237 GLY B CA    1 
ATOM   3390  C  C     . GLY A  1  438 ? 0.148   43.700 -4.717  1.00 24.60  ? 1237 GLY B C     1 
ATOM   3391  O  O     . GLY A  1  438 ? 1.340   43.596 -5.004  1.00 22.91  ? 1237 GLY B O     1 
ATOM   3392  N  N     . ARG A  1  439 ? -0.774  43.983 -5.635  1.00 26.13  ? 1238 ARG B N     1 
ATOM   3393  C  CA    . ARG A  1  439 ? -0.425  44.224 -7.019  1.00 27.51  ? 1238 ARG B CA    1 
ATOM   3394  C  C     . ARG A  1  439 ? -1.114  45.498 -7.529  1.00 28.91  ? 1238 ARG B C     1 
ATOM   3395  O  O     . ARG A  1  439 ? -2.256  45.777 -7.161  1.00 29.40  ? 1238 ARG B O     1 
ATOM   3396  C  CB    . ARG A  1  439 ? -0.849  43.044 -7.904  1.00 28.27  ? 1238 ARG B CB    1 
ATOM   3397  C  CG    . ARG A  1  439 ? -0.073  41.768 -7.611  1.00 30.78  ? 1238 ARG B CG    1 
ATOM   3398  C  CD    . ARG A  1  439 ? -0.632  40.578 -8.367  1.00 29.44  ? 1238 ARG B CD    1 
ATOM   3399  N  NE    . ARG A  1  439 ? -0.758  40.819 -9.793  1.00 35.31  ? 1238 ARG B NE    1 
ATOM   3400  C  CZ    . ARG A  1  439 ? 0.235   40.861 -10.693 1.00 35.57  ? 1238 ARG B CZ    1 
ATOM   3401  N  NH1   . ARG A  1  439 ? 1.532   40.617 -10.343 1.00 34.44  ? 1238 ARG B NH1   1 
ATOM   3402  N  NH2   . ARG A  1  439 ? -0.085  41.221 -11.933 1.00 34.57  ? 1238 ARG B NH2   1 
ATOM   3403  N  N     . GLY A  1  440 ? -0.387  46.252 -8.351  1.00 28.66  ? 1239 GLY B N     1 
ATOM   3404  C  CA    . GLY A  1  440 ? -0.915  47.489 -8.912  1.00 29.77  ? 1239 GLY B CA    1 
ATOM   3405  C  C     . GLY A  1  440 ? 0.155   48.155 -9.775  1.00 30.42  ? 1239 GLY B C     1 
ATOM   3406  O  O     . GLY A  1  440 ? 1.356   48.002 -9.504  1.00 29.60  ? 1239 GLY B O     1 
ATOM   3407  N  N     . SER A  1  441 ? -0.249  48.918 -10.773 1.00 30.56  ? 1240 SER B N     1 
ATOM   3408  C  CA    . SER A  1  441 ? 0.684   49.595 -11.659 1.00 32.21  ? 1240 SER B CA    1 
ATOM   3409  C  C     . SER A  1  441 ? 0.756   51.073 -11.256 1.00 32.13  ? 1240 SER B C     1 
ATOM   3410  O  O     . SER A  1  441 ? -0.280  51.785 -11.213 1.00 33.42  ? 1240 SER B O     1 
ATOM   3411  C  CB    . SER A  1  441 ? 0.251   49.490 -13.125 1.00 35.90  ? 1240 SER B CB    1 
ATOM   3412  O  OG    . SER A  1  441 ? 1.125   50.231 -13.946 1.00 43.76  ? 1240 SER B OG    1 
ATOM   3413  N  N     . ILE A  1  442 ? 1.952   51.554 -10.902 1.00 29.24  ? 1241 ILE B N     1 
ATOM   3414  C  CA    . ILE A  1  442 ? 2.152   52.885 -10.415 1.00 31.30  ? 1241 ILE B CA    1 
ATOM   3415  C  C     . ILE A  1  442 ? 2.948   53.671 -11.502 1.00 32.25  ? 1241 ILE B C     1 
ATOM   3416  O  O     . ILE A  1  442 ? 4.085   53.310 -11.835 1.00 33.97  ? 1241 ILE B O     1 
ATOM   3417  C  CB    . ILE A  1  442 ? 2.907   52.887 -9.089  1.00 31.99  ? 1241 ILE B CB    1 
ATOM   3418  C  CG1   . ILE A  1  442 ? 2.062   52.213 -8.021  1.00 32.57  ? 1241 ILE B CG1   1 
ATOM   3419  C  CG2   . ILE A  1  442 ? 3.269   54.353 -8.655  1.00 31.86  ? 1241 ILE B CG2   1 
ATOM   3420  C  CD1   . ILE A  1  442 ? 2.648   52.326 -6.611  1.00 33.27  ? 1241 ILE B CD1   1 
ATOM   3421  N  N     . GLN A  1  443 ? 2.351   54.743 -11.985 1.00 31.47  ? 1242 GLN B N     1 
ATOM   3422  C  CA    . GLN A  1  443 ? 2.998   55.557 -12.976 1.00 33.01  ? 1242 GLN B CA    1 
ATOM   3423  C  C     . GLN A  1  443 ? 3.935   56.555 -12.346 1.00 32.92  ? 1242 GLN B C     1 
ATOM   3424  O  O     . GLN A  1  443 ? 3.513   57.406 -11.528 1.00 32.62  ? 1242 GLN B O     1 
ATOM   3425  C  CB    . GLN A  1  443 ? 1.871   56.339 -13.786 1.00 35.09  ? 1242 GLN B CB    1 
ATOM   3426  C  CG    . GLN A  1  443 ? 1.052   55.427 -14.682 1.00 39.46  ? 1242 GLN B CG    1 
ATOM   3427  C  CD    . GLN A  1  443 ? 1.912   54.603 -15.612 1.00 43.15  ? 1242 GLN B CD    1 
ATOM   3428  O  OE1   . GLN A  1  443 ? 2.816   55.138 -16.305 1.00 42.34  ? 1242 GLN B OE1   1 
ATOM   3429  N  NE2   . GLN A  1  443 ? 1.719   53.264 -15.586 1.00 46.91  ? 1242 GLN B NE2   1 
ATOM   3430  N  N     . MET A  1  444 ? 5.199   56.449 -12.703 1.00 30.58  ? 1243 MET B N     1 
ATOM   3431  C  CA    . MET A  1  444 ? 6.261   57.368 -12.201 1.00 30.67  ? 1243 MET B CA    1 
ATOM   3432  C  C     . MET A  1  444 ? 6.618   58.310 -13.349 1.00 33.18  ? 1243 MET B C     1 
ATOM   3433  O  O     . MET A  1  444 ? 6.961   57.853 -14.441 1.00 36.18  ? 1243 MET B O     1 
ATOM   3434  C  CB    . MET A  1  444 ? 7.512   56.644 -11.737 1.00 28.33  ? 1243 MET B CB    1 
ATOM   3435  C  CG    . MET A  1  444 ? 7.213   55.485 -10.757 1.00 29.31  ? 1243 MET B CG    1 
ATOM   3436  S  SD    . MET A  1  444 ? 8.816   54.640 -10.351 1.00 31.19  ? 1243 MET B SD    1 
ATOM   3437  C  CE    . MET A  1  444 ? 9.249   53.893 -11.895 1.00 29.13  ? 1243 MET B CE    1 
ATOM   3438  N  N     . ARG A  1  445 ? 6.571   59.624 -13.082 1.00 31.38  ? 1244 ARG B N     1 
ATOM   3439  C  CA    . ARG A  1  445 ? 6.900   60.616 -14.084 1.00 29.76  ? 1244 ARG B CA    1 
ATOM   3440  C  C     . ARG A  1  445 ? 8.067   61.479 -13.602 1.00 28.26  ? 1244 ARG B C     1 
ATOM   3441  O  O     . ARG A  1  445 ? 8.125   61.819 -12.424 1.00 27.49  ? 1244 ARG B O     1 
ATOM   3442  C  CB    . ARG A  1  445 ? 5.685   61.498 -14.415 1.00 30.52  ? 1244 ARG B CB    1 
ATOM   3443  C  CG    . ARG A  1  445 ? 5.953   62.594 -15.421 1.00 33.32  ? 1244 ARG B CG    1 
ATOM   3444  C  CD    . ARG A  1  445 ? 4.675   63.331 -15.785 1.00 34.07  ? 1244 ARG B CD    1 
ATOM   3445  N  NE    . ARG A  1  445 ? 3.760   62.500 -16.538 1.00 35.17  ? 1244 ARG B NE    1 
ATOM   3446  C  CZ    . ARG A  1  445 ? 2.616   62.959 -17.076 1.00 38.50  ? 1244 ARG B CZ    1 
ATOM   3447  N  NH1   . ARG A  1  445 ? 2.252   64.264 -16.960 1.00 36.27  ? 1244 ARG B NH1   1 
ATOM   3448  N  NH2   . ARG A  1  445 ? 1.823   62.145 -17.770 1.00 39.78  ? 1244 ARG B NH2   1 
ATOM   3449  N  N     . SER A  1  446 ? 8.949   61.824 -14.524 1.00 26.29  ? 1245 SER B N     1 
ATOM   3450  C  CA    . SER A  1  446 ? 10.041  62.730 -14.206 1.00 27.37  ? 1245 SER B CA    1 
ATOM   3451  C  C     . SER A  1  446 ? 9.471   64.115 -13.846 1.00 29.45  ? 1245 SER B C     1 
ATOM   3452  O  O     . SER A  1  446 ? 8.390   64.527 -14.275 1.00 32.25  ? 1245 SER B O     1 
ATOM   3453  C  CB    . SER A  1  446 ? 10.933  62.919 -15.470 1.00 26.66  ? 1245 SER B CB    1 
ATOM   3454  O  OG    . SER A  1  446 ? 11.540  61.686 -15.789 1.00 27.00  ? 1245 SER B OG    1 
ATOM   3455  N  N     . ARG A  1  447 ? 10.239  64.838 -12.998 1.00 29.63  ? 1246 ARG B N     1 
ATOM   3456  C  CA    . ARG A  1  447 ? 9.928   66.233 -12.737 1.00 30.47  ? 1246 ARG B CA    1 
ATOM   3457  C  C     . ARG A  1  447 ? 10.561  67.076 -13.836 1.00 30.27  ? 1246 ARG B C     1 
ATOM   3458  O  O     . ARG A  1  447 ? 11.759  67.218 -13.901 1.00 29.26  ? 1246 ARG B O     1 
ATOM   3459  C  CB    . ARG A  1  447 ? 10.379  66.658 -11.350 1.00 31.50  ? 1246 ARG B CB    1 
ATOM   3460  C  CG    . ARG A  1  447 ? 9.841   68.060 -10.986 1.00 34.34  ? 1246 ARG B CG    1 
ATOM   3461  C  CD    . ARG A  1  447 ? 10.243  68.500 -9.577  1.00 32.54  ? 1246 ARG B CD    1 
ATOM   3462  N  NE    . ARG A  1  447 ? 9.464   67.881 -8.528  1.00 34.02  ? 1246 ARG B NE    1 
ATOM   3463  C  CZ    . ARG A  1  447 ? 8.245   68.239 -8.178  1.00 35.88  ? 1246 ARG B CZ    1 
ATOM   3464  N  NH1   . ARG A  1  447 ? 7.629   69.238 -8.861  1.00 35.89  ? 1246 ARG B NH1   1 
ATOM   3465  N  NH2   . ARG A  1  447 ? 7.631   67.560 -7.185  1.00 33.08  ? 1246 ARG B NH2   1 
ATOM   3466  N  N     . ALA A  1  448 ? 9.747   67.639 -14.715 1.00 33.23  ? 1247 ALA B N     1 
ATOM   3467  C  CA    . ALA A  1  448 ? 10.157  68.470 -15.810 1.00 33.71  ? 1247 ALA B CA    1 
ATOM   3468  C  C     . ALA A  1  448 ? 9.321   69.745 -15.843 1.00 35.33  ? 1247 ALA B C     1 
ATOM   3469  O  O     . ALA A  1  448 ? 8.110   69.705 -15.653 1.00 36.69  ? 1247 ALA B O     1 
ATOM   3470  C  CB    . ALA A  1  448 ? 9.986   67.709 -17.159 1.00 33.35  ? 1247 ALA B CB    1 
ATOM   3471  N  N     . VAL A  1  449 ? 10.004  70.861 -16.112 1.00 35.12  ? 1248 VAL B N     1 
ATOM   3472  C  CA    . VAL A  1  449 ? 9.353   72.154 -16.261 1.00 36.18  ? 1248 VAL B CA    1 
ATOM   3473  C  C     . VAL A  1  449 ? 9.696   72.700 -17.642 1.00 33.10  ? 1248 VAL B C     1 
ATOM   3474  O  O     . VAL A  1  449 ? 10.754  72.414 -18.207 1.00 29.27  ? 1248 VAL B O     1 
ATOM   3475  C  CB    . VAL A  1  449 ? 9.763   73.141 -15.147 1.00 36.94  ? 1248 VAL B CB    1 
ATOM   3476  C  CG1   . VAL A  1  449 ? 9.367   72.596 -13.798 1.00 41.39  ? 1248 VAL B CG1   1 
ATOM   3477  C  CG2   . VAL A  1  449 ? 11.245  73.514 -15.252 1.00 38.58  ? 1248 VAL B CG2   1 
ATOM   3478  N  N     . ILE A  1  450 ? 8.784   73.526 -18.161 1.00 31.69  ? 1249 ILE B N     1 
ATOM   3479  C  CA    . ILE A  1  450 ? 9.004   74.226 -19.421 1.00 30.15  ? 1249 ILE B CA    1 
ATOM   3480  C  C     . ILE A  1  450 ? 9.367   75.679 -19.069 1.00 29.15  ? 1249 ILE B C     1 
ATOM   3481  O  O     . ILE A  1  450 ? 8.620   76.372 -18.390 1.00 29.86  ? 1249 ILE B O     1 
ATOM   3482  C  CB    . ILE A  1  450 ? 7.771   74.184 -20.321 1.00 32.39  ? 1249 ILE B CB    1 
ATOM   3483  C  CG1   . ILE A  1  450 ? 7.484   72.719 -20.728 1.00 31.42  ? 1249 ILE B CG1   1 
ATOM   3484  C  CG2   . ILE A  1  450 ? 7.988   75.033 -21.561 1.00 30.78  ? 1249 ILE B CG2   1 
ATOM   3485  C  CD1   . ILE A  1  450 ? 6.079   72.538 -21.351 1.00 34.78  ? 1249 ILE B CD1   1 
ATOM   3486  N  N     . GLU A  1  451 ? 10.539  76.104 -19.520 1.00 29.33  ? 1250 GLU B N     1 
ATOM   3487  C  CA    . GLU A  1  451 ? 10.938  77.450 -19.321 1.00 30.47  ? 1250 GLU B CA    1 
ATOM   3488  C  C     . GLU A  1  451 ? 10.733  78.277 -20.564 1.00 30.23  ? 1250 GLU B C     1 
ATOM   3489  O  O     . GLU A  1  451 ? 11.165  77.898 -21.617 1.00 33.18  ? 1250 GLU B O     1 
ATOM   3490  C  CB    . GLU A  1  451 ? 12.437  77.471 -18.973 1.00 29.53  ? 1250 GLU B CB    1 
ATOM   3491  C  CG    . GLU A  1  451 ? 12.746  76.784 -17.668 1.00 30.71  ? 1250 GLU B CG    1 
ATOM   3492  C  CD    . GLU A  1  451 ? 14.168  76.981 -17.243 1.00 31.01  ? 1250 GLU B CD    1 
ATOM   3493  O  OE1   . GLU A  1  451 ? 14.419  76.773 -16.056 1.00 31.95  ? 1250 GLU B OE1   1 
ATOM   3494  O  OE2   . GLU A  1  451 ? 14.995  77.345 -18.108 1.00 32.04  ? 1250 GLU B OE2   1 
ATOM   3495  N  N     . GLU A  1  452 ? 10.095  79.424 -20.386 1.00 30.98  ? 1251 GLU B N     1 
ATOM   3496  C  CA    . GLU A  1  452 ? 9.932   80.385 -21.458 1.00 33.85  ? 1251 GLU B CA    1 
ATOM   3497  C  C     . GLU A  1  452 ? 11.242  81.146 -21.600 1.00 32.25  ? 1251 GLU B C     1 
ATOM   3498  O  O     . GLU A  1  452 ? 11.833  81.510 -20.611 1.00 31.82  ? 1251 GLU B O     1 
ATOM   3499  C  CB    . GLU A  1  452 ? 8.768   81.311 -21.243 1.00 36.83  ? 1251 GLU B CB    1 
ATOM   3500  C  CG    . GLU A  1  452 ? 7.447   80.589 -21.028 1.00 39.38  ? 1251 GLU B CG    1 
ATOM   3501  C  CD    . GLU A  1  452 ? 7.009   79.735 -22.206 1.00 44.23  ? 1251 GLU B CD    1 
ATOM   3502  O  OE1   . GLU A  1  452 ? 7.449   80.029 -23.325 1.00 49.13  ? 1251 GLU B OE1   1 
ATOM   3503  O  OE2   . GLU A  1  452 ? 6.247   78.830 -22.031 1.00 47.84  ? 1251 GLU B OE2   1 
ATOM   3504  N  N     . ARG A  1  453 ? 11.675  81.390 -22.834 1.00 30.91  ? 1252 ARG B N     1 
ATOM   3505  C  CA    . ARG A  1  453 ? 12.856  82.125 -23.129 1.00 31.22  ? 1252 ARG B CA    1 
ATOM   3506  C  C     . ARG A  1  453 ? 12.626  83.186 -24.180 1.00 33.60  ? 1252 ARG B C     1 
ATOM   3507  O  O     . ARG A  1  453 ? 11.566  83.209 -24.830 1.00 32.15  ? 1252 ARG B O     1 
ATOM   3508  C  CB    . ARG A  1  453 ? 13.946  81.155 -23.551 1.00 34.29  ? 1252 ARG B CB    1 
ATOM   3509  C  CG    . ARG A  1  453 ? 14.377  80.209 -22.409 1.00 36.52  ? 1252 ARG B CG    1 
ATOM   3510  C  CD    . ARG A  1  453 ? 15.400  79.203 -22.799 1.00 40.74  ? 1252 ARG B CD    1 
ATOM   3511  N  NE    . ARG A  1  453 ? 16.636  79.828 -23.176 1.00 39.24  ? 1252 ARG B NE    1 
ATOM   3512  C  CZ    . ARG A  1  453 ? 17.557  80.304 -22.327 1.00 42.85  ? 1252 ARG B CZ    1 
ATOM   3513  N  NH1   . ARG A  1  453 ? 17.426  80.252 -21.038 1.00 42.87  ? 1252 ARG B NH1   1 
ATOM   3514  N  NH2   . ARG A  1  453 ? 18.652  80.844 -22.777 1.00 44.86  ? 1252 ARG B NH2   1 
ATOM   3515  N  N     . GLY A  1  454 ? 13.621  84.082 -24.352 1.00 32.38  ? 1253 GLY B N     1 
ATOM   3516  C  CA    . GLY A  1  454 ? 13.508  85.153 -25.318 1.00 35.69  ? 1253 GLY B CA    1 
ATOM   3517  C  C     . GLY A  1  454 ? 13.379  84.635 -26.742 1.00 36.42  ? 1253 GLY B C     1 
ATOM   3518  O  O     . GLY A  1  454 ? 13.828  83.538 -27.029 1.00 36.34  ? 1253 GLY B O     1 
ATOM   3519  N  N     . GLY A  1  455 ? 12.791  85.413 -27.613 1.00 40.47  ? 1254 GLY B N     1 
ATOM   3520  C  CA    . GLY A  1  455 ? 12.650  85.059 -29.015 1.00 38.84  ? 1254 GLY B CA    1 
ATOM   3521  C  C     . GLY A  1  455 ? 11.624  83.969 -29.222 1.00 41.10  ? 1254 GLY B C     1 
ATOM   3522  O  O     . GLY A  1  455 ? 11.683  83.217 -30.171 1.00 41.75  ? 1254 GLY B O     1 
ATOM   3523  N  N     . GLY A  1  456 ? 10.679  83.892 -28.296 1.00 41.07  ? 1255 GLY B N     1 
ATOM   3524  C  CA    . GLY A  1  456 ? 9.678   82.844 -28.350 1.00 41.21  ? 1255 GLY B CA    1 
ATOM   3525  C  C     . GLY A  1  456 ? 10.312  81.473 -27.996 1.00 41.21  ? 1255 GLY B C     1 
ATOM   3526  O  O     . GLY A  1  456 ? 9.934   80.509 -28.444 1.00 45.56  ? 1255 GLY B O     1 
ATOM   3527  N  N     A ARG A  1  457 ? 11.533  81.247 -27.714 0.50 40.28  ? 1256 ARG B N     1 
ATOM   3528  N  N     B ARG A  1  457 ? 11.548  81.228 -27.773 0.50 39.93  ? 1256 ARG B N     1 
ATOM   3529  C  CA    A ARG A  1  457 ? 12.124  79.951 -27.512 0.50 39.08  ? 1256 ARG B CA    1 
ATOM   3530  C  CA    B ARG A  1  457 ? 12.145  79.938 -27.542 0.50 38.37  ? 1256 ARG B CA    1 
ATOM   3531  C  C     A ARG A  1  457 ? 11.647  79.303 -26.225 0.50 38.84  ? 1256 ARG B C     1 
ATOM   3532  C  C     B ARG A  1  457 ? 11.695  79.311 -26.228 0.50 38.47  ? 1256 ARG B C     1 
ATOM   3533  O  O     A ARG A  1  457 ? 11.136  79.954 -25.305 0.50 36.45  ? 1256 ARG B O     1 
ATOM   3534  O  O     B ARG A  1  457 ? 11.115  79.965 -25.355 0.50 36.32  ? 1256 ARG B O     1 
ATOM   3535  C  CB    A ARG A  1  457 ? 13.646  80.042 -27.517 0.50 42.37  ? 1256 ARG B CB    1 
ATOM   3536  C  CB    B ARG A  1  457 ? 13.660  80.062 -27.575 0.50 40.69  ? 1256 ARG B CB    1 
ATOM   3537  C  CG    A ARG A  1  457 ? 14.275  80.640 -28.780 0.50 46.18  ? 1256 ARG B CG    1 
ATOM   3538  C  CG    B ARG A  1  457 ? 14.243  80.658 -28.858 0.50 43.35  ? 1256 ARG B CG    1 
ATOM   3539  C  CD    A ARG A  1  457 ? 13.393  80.340 -30.039 0.50 50.04  ? 1256 ARG B CD    1 
ATOM   3540  C  CD    B ARG A  1  457 ? 13.974  79.798 -30.072 0.50 45.02  ? 1256 ARG B CD    1 
ATOM   3541  N  NE    A ARG A  1  457 ? 13.465  79.098 -30.810 0.50 52.15  ? 1256 ARG B NE    1 
ATOM   3542  N  NE    B ARG A  1  457 ? 14.407  78.409 -29.827 0.50 47.05  ? 1256 ARG B NE    1 
ATOM   3543  C  CZ    A ARG A  1  457 ? 13.904  78.996 -32.066 0.50 52.71  ? 1256 ARG B CZ    1 
ATOM   3544  C  CZ    B ARG A  1  457 ? 15.439  77.818 -30.426 0.50 46.59  ? 1256 ARG B CZ    1 
ATOM   3545  N  NH1   A ARG A  1  457 ? 13.871  77.810 -32.679 0.50 55.40  ? 1256 ARG B NH1   1 
ATOM   3546  N  NH1   B ARG A  1  457 ? 15.740  76.583 -30.087 0.50 45.04  ? 1256 ARG B NH1   1 
ATOM   3547  N  NH2   A ARG A  1  457 ? 14.416  80.057 -32.690 0.50 53.74  ? 1256 ARG B NH2   1 
ATOM   3548  N  NH2   B ARG A  1  457 ? 16.152  78.450 -31.354 0.50 45.33  ? 1256 ARG B NH2   1 
ATOM   3549  N  N     . GLN A  1  458 ? 11.787  77.983 -26.165 1.00 36.14  ? 1257 GLN B N     1 
ATOM   3550  C  CA    . GLN A  1  458 ? 11.395  77.255 -24.996 1.00 36.28  ? 1257 GLN B CA    1 
ATOM   3551  C  C     . GLN A  1  458 ? 12.401  76.155 -24.760 1.00 35.76  ? 1257 GLN B C     1 
ATOM   3552  O  O     . GLN A  1  458 ? 13.052  75.672 -25.695 1.00 39.68  ? 1257 GLN B O     1 
ATOM   3553  C  CB    . GLN A  1  458 ? 10.039  76.608 -25.248 1.00 37.35  ? 1257 GLN B CB    1 
ATOM   3554  C  CG    . GLN A  1  458 ? 8.824   77.462 -24.973 1.00 36.96  ? 1257 GLN B CG    1 
ATOM   3555  C  CD    . GLN A  1  458 ? 7.534   76.764 -25.324 1.00 39.22  ? 1257 GLN B CD    1 
ATOM   3556  O  OE1   . GLN A  1  458 ? 7.474   76.047 -26.316 1.00 39.22  ? 1257 GLN B OE1   1 
ATOM   3557  N  NE2   . GLN A  1  458 ? 6.512   76.978 -24.525 1.00 39.56  ? 1257 GLN B NE2   1 
ATOM   3558  N  N     . ARG A  1  459 ? 12.554  75.758 -23.495 1.00 33.74  ? 1258 ARG B N     1 
ATOM   3559  C  CA    . ARG A  1  459 ? 13.357  74.585 -23.204 1.00 33.63  ? 1258 ARG B CA    1 
ATOM   3560  C  C     . ARG A  1  459 ? 12.768  73.830 -22.041 1.00 34.95  ? 1258 ARG B C     1 
ATOM   3561  O  O     . ARG A  1  459 ? 12.122  74.408 -21.157 1.00 33.02  ? 1258 ARG B O     1 
ATOM   3562  C  CB    . ARG A  1  459 ? 14.810  74.973 -22.947 1.00 37.96  ? 1258 ARG B CB    1 
ATOM   3563  C  CG    . ARG A  1  459 ? 15.091  75.684 -21.654 1.00 36.23  ? 1258 ARG B CG    1 
ATOM   3564  C  CD    . ARG A  1  459 ? 16.566  75.548 -21.288 1.00 38.57  ? 1258 ARG B CD    1 
ATOM   3565  N  NE    . ARG A  1  459 ? 16.918  76.305 -20.112 1.00 43.02  ? 1258 ARG B NE    1 
ATOM   3566  C  CZ    . ARG A  1  459 ? 18.007  77.048 -19.992 1.00 47.46  ? 1258 ARG B CZ    1 
ATOM   3567  N  NH1   . ARG A  1  459 ? 18.821  77.202 -21.060 1.00 41.70  ? 1258 ARG B NH1   1 
ATOM   3568  N  NH2   . ARG A  1  459 ? 18.268  77.651 -18.827 1.00 41.56  ? 1258 ARG B NH2   1 
ATOM   3569  N  N     . ILE A  1  460 ? 12.993  72.518 -22.039 1.00 31.60  ? 1259 ILE B N     1 
ATOM   3570  C  CA    . ILE A  1  460 ? 12.485  71.618 -21.010 1.00 31.44  ? 1259 ILE B CA    1 
ATOM   3571  C  C     . ILE A  1  460 ? 13.688  71.305 -20.065 1.00 28.34  ? 1259 ILE B C     1 
ATOM   3572  O  O     . ILE A  1  460 ? 14.774  70.956 -20.531 1.00 30.29  ? 1259 ILE B O     1 
ATOM   3573  C  CB    . ILE A  1  460 ? 11.922  70.341 -21.621 1.00 31.23  ? 1259 ILE B CB    1 
ATOM   3574  C  CG1   . ILE A  1  460 ? 10.771  70.675 -22.527 1.00 31.73  ? 1259 ILE B CG1   1 
ATOM   3575  C  CG2   . ILE A  1  460 ? 11.521  69.364 -20.529 1.00 30.31  ? 1259 ILE B CG2   1 
ATOM   3576  C  CD1   . ILE A  1  460 ? 10.380  69.565 -23.546 1.00 30.51  ? 1259 ILE B CD1   1 
ATOM   3577  N  N     . VAL A  1  461 ? 13.452  71.422 -18.768 1.00 27.61  ? 1260 VAL B N     1 
ATOM   3578  C  CA    . VAL A  1  461 ? 14.480  71.160 -17.791 1.00 27.24  ? 1260 VAL B CA    1 
ATOM   3579  C  C     . VAL A  1  461 ? 13.952  70.016 -16.879 1.00 26.03  ? 1260 VAL B C     1 
ATOM   3580  O  O     . VAL A  1  461 ? 12.921  70.161 -16.203 1.00 28.27  ? 1260 VAL B O     1 
ATOM   3581  C  CB    . VAL A  1  461 ? 14.801  72.372 -16.906 1.00 25.33  ? 1260 VAL B CB    1 
ATOM   3582  C  CG1   . VAL A  1  461 ? 15.925  72.014 -15.913 1.00 24.61  ? 1260 VAL B CG1   1 
ATOM   3583  C  CG2   . VAL A  1  461 ? 15.249  73.516 -17.805 1.00 24.90  ? 1260 VAL B CG2   1 
ATOM   3584  N  N     . VAL A  1  462 ? 14.662  68.882 -16.882 1.00 26.67  ? 1261 VAL B N     1 
ATOM   3585  C  CA    . VAL A  1  462 ? 14.302  67.756 -16.090 1.00 25.62  ? 1261 VAL B CA    1 
ATOM   3586  C  C     . VAL A  1  462 ? 15.274  67.631 -14.921 1.00 25.95  ? 1261 VAL B C     1 
ATOM   3587  O  O     . VAL A  1  462 ? 16.483  67.529 -15.113 1.00 24.26  ? 1261 VAL B O     1 
ATOM   3588  C  CB    . VAL A  1  462 ? 14.340  66.443 -16.963 1.00 27.29  ? 1261 VAL B CB    1 
ATOM   3589  C  CG1   . VAL A  1  462 ? 13.963  65.225 -16.101 1.00 24.62  ? 1261 VAL B CG1   1 
ATOM   3590  C  CG2   . VAL A  1  462 ? 13.440  66.562 -18.148 1.00 25.99  ? 1261 VAL B CG2   1 
ATOM   3591  N  N     . THR A  1  463 ? 14.748  67.700 -13.716 1.00 26.17  ? 1262 THR B N     1 
ATOM   3592  C  CA    . THR A  1  463 ? 15.528  67.675 -12.498 1.00 26.60  ? 1262 THR B CA    1 
ATOM   3593  C  C     . THR A  1  463 ? 15.328  66.409 -11.649 1.00 25.52  ? 1262 THR B C     1 
ATOM   3594  O  O     . THR A  1  463 ? 16.057  66.172 -10.710 1.00 26.00  ? 1262 THR B O     1 
ATOM   3595  C  CB    . THR A  1  463 ? 15.230  68.927 -11.626 1.00 27.86  ? 1262 THR B CB    1 
ATOM   3596  O  OG1   . THR A  1  463 ? 13.858  68.971 -11.320 1.00 27.17  ? 1262 THR B OG1   1 
ATOM   3597  C  CG2   . THR A  1  463 ? 15.579  70.180 -12.387 1.00 26.21  ? 1262 THR B CG2   1 
ATOM   3598  N  N     . GLU A  1  464 ? 14.367  65.579 -12.017 1.00 27.15  ? 1263 GLU B N     1 
ATOM   3599  C  CA    . GLU A  1  464 ? 14.146  64.321 -11.273 1.00 28.90  ? 1263 GLU B CA    1 
ATOM   3600  C  C     . GLU A  1  464 ? 13.632  63.288 -12.318 1.00 27.97  ? 1263 GLU B C     1 
ATOM   3601  O  O     . GLU A  1  464 ? 12.829  63.592 -13.175 1.00 26.49  ? 1263 GLU B O     1 
ATOM   3602  C  CB    . GLU A  1  464 ? 13.050  64.510 -10.184 1.00 29.24  ? 1263 GLU B CB    1 
ATOM   3603  C  CG    . GLU A  1  464 ? 13.454  65.466 -9.102  1.00 31.19  ? 1263 GLU B CG    1 
ATOM   3604  C  CD    . GLU A  1  464 ? 12.280  65.906 -8.235  1.00 33.90  ? 1263 GLU B CD    1 
ATOM   3605  O  OE1   . GLU A  1  464 ? 12.404  66.895 -7.510  1.00 36.21  ? 1263 GLU B OE1   1 
ATOM   3606  O  OE2   . GLU A  1  464 ? 11.203  65.260 -8.244  1.00 35.53  ? 1263 GLU B OE2   1 
ATOM   3607  N  N     . ILE A  1  465 ? 14.126  62.065 -12.212 1.00 27.73  ? 1264 ILE B N     1 
ATOM   3608  C  CA    . ILE A  1  465 ? 13.741  61.031 -13.163 1.00 27.65  ? 1264 ILE B CA    1 
ATOM   3609  C  C     . ILE A  1  465 ? 13.192  59.845 -12.395 1.00 27.42  ? 1264 ILE B C     1 
ATOM   3610  O  O     . ILE A  1  465 ? 13.287  59.824 -11.155 1.00 27.17  ? 1264 ILE B O     1 
ATOM   3611  C  CB    . ILE A  1  465 ? 14.919  60.560 -14.064 1.00 29.14  ? 1264 ILE B CB    1 
ATOM   3612  C  CG1   . ILE A  1  465 ? 16.035  59.924 -13.171 1.00 29.86  ? 1264 ILE B CG1   1 
ATOM   3613  C  CG2   . ILE A  1  465 ? 15.520  61.796 -14.831 1.00 27.06  ? 1264 ILE B CG2   1 
ATOM   3614  C  CD1   . ILE A  1  465 ? 17.057  59.235 -14.146 1.00 35.82  ? 1264 ILE B CD1   1 
ATOM   3615  N  N     . PRO A  1  466 ? 12.524  58.875 -13.051 1.00 25.64  ? 1265 PRO B N     1 
ATOM   3616  C  CA    . PRO A  1  466 ? 11.862  57.810 -12.260 1.00 26.03  ? 1265 PRO B CA    1 
ATOM   3617  C  C     . PRO A  1  466 ? 12.877  56.845 -11.651 1.00 26.09  ? 1265 PRO B C     1 
ATOM   3618  O  O     . PRO A  1  466 ? 14.070  56.806 -12.020 1.00 28.80  ? 1265 PRO B O     1 
ATOM   3619  C  CB    . PRO A  1  466 ? 11.017  57.072 -13.313 1.00 25.56  ? 1265 PRO B CB    1 
ATOM   3620  C  CG    . PRO A  1  466 ? 10.785  58.111 -14.394 1.00 25.36  ? 1265 PRO B CG    1 
ATOM   3621  C  CD    . PRO A  1  466 ? 12.077  58.900 -14.452 1.00 24.86  ? 1265 PRO B CD    1 
ATOM   3622  N  N     . PHE A  1  467 ? 12.394  56.078 -10.690 1.00 25.70  ? 1266 PHE B N     1 
ATOM   3623  C  CA    . PHE A  1  467 ? 13.176  55.103 -9.953  1.00 26.54  ? 1266 PHE B CA    1 
ATOM   3624  C  C     . PHE A  1  467 ? 13.713  54.028 -10.889 1.00 25.44  ? 1266 PHE B C     1 
ATOM   3625  O  O     . PHE A  1  467 ? 13.004  53.563 -11.786 1.00 24.16  ? 1266 PHE B O     1 
ATOM   3626  C  CB    . PHE A  1  467 ? 12.324  54.490 -8.846  1.00 25.06  ? 1266 PHE B CB    1 
ATOM   3627  C  CG    . PHE A  1  467 ? 13.070  53.611 -7.893  1.00 26.29  ? 1266 PHE B CG    1 
ATOM   3628  C  CD1   . PHE A  1  467 ? 14.307  54.013 -7.357  1.00 25.07  ? 1266 PHE B CD1   1 
ATOM   3629  C  CD2   . PHE A  1  467 ? 12.538  52.384 -7.516  1.00 26.16  ? 1266 PHE B CD2   1 
ATOM   3630  C  CE1   . PHE A  1  467 ? 14.980  53.220 -6.474  1.00 26.72  ? 1266 PHE B CE1   1 
ATOM   3631  C  CE2   . PHE A  1  467 ? 13.154  51.545 -6.640  1.00 26.18  ? 1266 PHE B CE2   1 
ATOM   3632  C  CZ    . PHE A  1  467 ? 14.436  51.950 -6.072  1.00 27.75  ? 1266 PHE B CZ    1 
ATOM   3633  N  N     . GLN A  1  468 ? 14.978  53.662 -10.689 1.00 26.15  ? 1267 GLN B N     1 
ATOM   3634  C  CA    . GLN A  1  468 ? 15.653  52.596 -11.467 1.00 27.65  ? 1267 GLN B CA    1 
ATOM   3635  C  C     . GLN A  1  468 ? 15.801  52.891 -12.928 1.00 29.85  ? 1267 GLN B C     1 
ATOM   3636  O  O     . GLN A  1  468 ? 16.044  51.972 -13.721 1.00 34.34  ? 1267 GLN B O     1 
ATOM   3637  C  CB    . GLN A  1  468 ? 15.009  51.240 -11.220 1.00 29.68  ? 1267 GLN B CB    1 
ATOM   3638  C  CG    . GLN A  1  468 ? 15.092  50.724 -9.782  1.00 30.50  ? 1267 GLN B CG    1 
ATOM   3639  C  CD    . GLN A  1  468 ? 14.200  49.502 -9.555  1.00 35.11  ? 1267 GLN B CD    1 
ATOM   3640  O  OE1   . GLN A  1  468 ? 13.029  49.453 -9.867  1.00 33.58  ? 1267 GLN B OE1   1 
ATOM   3641  N  NE2   . GLN A  1  468 ? 14.843  48.479 -8.925  1.00 40.54  ? 1267 GLN B NE2   1 
ATOM   3642  N  N     . VAL A  1  469 ? 15.653  54.147 -13.366 1.00 29.06  ? 1268 VAL B N     1 
ATOM   3643  C  CA    . VAL A  1  469 ? 15.867  54.528 -14.768 1.00 27.65  ? 1268 VAL B CA    1 
ATOM   3644  C  C     . VAL A  1  469 ? 17.352  54.949 -14.909 1.00 28.46  ? 1268 VAL B C     1 
ATOM   3645  O  O     . VAL A  1  469 ? 17.844  55.834 -14.186 1.00 29.67  ? 1268 VAL B O     1 
ATOM   3646  C  CB    . VAL A  1  469 ? 14.927  55.664 -15.160 1.00 28.08  ? 1268 VAL B CB    1 
ATOM   3647  C  CG1   . VAL A  1  469 ? 15.335  56.278 -16.473 1.00 28.33  ? 1268 VAL B CG1   1 
ATOM   3648  C  CG2   . VAL A  1  469 ? 13.513  55.177 -15.238 1.00 25.17  ? 1268 VAL B CG2   1 
ATOM   3649  N  N     . ASN A  1  470 ? 18.018  54.375 -15.890 1.00 27.41  ? 1269 ASN B N     1 
ATOM   3650  C  CA    . ASN A  1  470 ? 19.378  54.739 -16.201 1.00 27.10  ? 1269 ASN B CA    1 
ATOM   3651  C  C     . ASN A  1  470 ? 19.298  56.074 -16.955 1.00 25.91  ? 1269 ASN B C     1 
ATOM   3652  O  O     . ASN A  1  470 ? 18.730  56.125 -18.044 1.00 27.45  ? 1269 ASN B O     1 
ATOM   3653  C  CB    . ASN A  1  470 ? 19.999  53.667 -17.097 1.00 27.20  ? 1269 ASN B CB    1 
ATOM   3654  C  CG    . ASN A  1  470 ? 21.433  53.997 -17.497 1.00 29.38  ? 1269 ASN B CG    1 
ATOM   3655  O  OD1   . ASN A  1  470 ? 21.766  55.135 -17.781 1.00 29.39  ? 1269 ASN B OD1   1 
ATOM   3656  N  ND2   . ASN A  1  470 ? 22.274  52.990 -17.528 1.00 29.09  ? 1269 ASN B ND2   1 
ATOM   3657  N  N     . LYS A  1  471 ? 19.854  57.114 -16.373 1.00 25.16  ? 1270 LYS B N     1 
ATOM   3658  C  CA    . LYS A  1  471 ? 19.781  58.439 -16.975 1.00 27.57  ? 1270 LYS B CA    1 
ATOM   3659  C  C     . LYS A  1  471 ? 20.457  58.569 -18.326 1.00 29.24  ? 1270 LYS B C     1 
ATOM   3660  O  O     . LYS A  1  471 ? 19.882  59.142 -19.239 1.00 28.84  ? 1270 LYS B O     1 
ATOM   3661  C  CB    . LYS A  1  471 ? 20.328  59.512 -16.001 1.00 26.89  ? 1270 LYS B CB    1 
ATOM   3662  C  CG    . LYS A  1  471 ? 20.437  60.885 -16.611 1.00 29.49  ? 1270 LYS B CG    1 
ATOM   3663  C  CD    . LYS A  1  471 ? 20.655  61.951 -15.539 1.00 28.72  ? 1270 LYS B CD    1 
ATOM   3664  C  CE    . LYS A  1  471 ? 21.919  61.676 -14.706 1.00 27.56  ? 1270 LYS B CE    1 
ATOM   3665  N  NZ    . LYS A  1  471 ? 23.165  61.759 -15.556 1.00 32.22  ? 1270 LYS B NZ    1 
ATOM   3666  N  N     . ALA A  1  472 ? 21.662  58.028 -18.453 1.00 31.25  ? 1271 ALA B N     1 
ATOM   3667  C  CA    . ALA A  1  472 ? 22.368  58.120 -19.723 1.00 32.94  ? 1271 ALA B CA    1 
ATOM   3668  C  C     . ALA A  1  472 ? 21.594  57.355 -20.795 1.00 34.31  ? 1271 ALA B C     1 
ATOM   3669  O  O     . ALA A  1  472 ? 21.499  57.816 -21.908 1.00 35.39  ? 1271 ALA B O     1 
ATOM   3670  C  CB    . ALA A  1  472 ? 23.783  57.592 -19.586 1.00 33.42  ? 1271 ALA B CB    1 
ATOM   3671  N  N     A ARG A  1  473 ? 21.030  56.212 -20.437 0.50 34.04  ? 1272 ARG B N     1 
ATOM   3672  N  N     B ARG A  1  473 ? 21.046  56.193 -20.497 0.50 34.41  ? 1272 ARG B N     1 
ATOM   3673  C  CA    A ARG A  1  473 ? 20.249  55.427 -21.359 0.50 35.42  ? 1272 ARG B CA    1 
ATOM   3674  C  CA    B ARG A  1  473 ? 20.245  55.469 -21.449 0.50 36.02  ? 1272 ARG B CA    1 
ATOM   3675  C  C     A ARG A  1  473 ? 18.996  56.158 -21.777 0.50 34.96  ? 1272 ARG B C     1 
ATOM   3676  C  C     B ARG A  1  473 ? 18.976  56.201 -21.816 0.50 35.22  ? 1272 ARG B C     1 
ATOM   3677  O  O     A ARG A  1  473 ? 18.599  56.106 -22.927 0.50 35.33  ? 1272 ARG B O     1 
ATOM   3678  O  O     B ARG A  1  473 ? 18.500  56.090 -22.931 0.50 35.18  ? 1272 ARG B O     1 
ATOM   3679  C  CB    A ARG A  1  473 ? 19.851  54.065 -20.758 0.50 37.66  ? 1272 ARG B CB    1 
ATOM   3680  C  CB    B ARG A  1  473 ? 19.929  54.056 -20.936 0.50 39.13  ? 1272 ARG B CB    1 
ATOM   3681  C  CG    A ARG A  1  473 ? 18.921  53.256 -21.721 0.50 38.90  ? 1272 ARG B CG    1 
ATOM   3682  C  CG    B ARG A  1  473 ? 21.190  53.187 -20.830 0.50 40.68  ? 1272 ARG B CG    1 
ATOM   3683  C  CD    A ARG A  1  473 ? 18.290  51.928 -21.266 0.50 40.43  ? 1272 ARG B CD    1 
ATOM   3684  C  CD    B ARG A  1  473 ? 20.926  51.689 -21.033 0.50 45.15  ? 1272 ARG B CD    1 
ATOM   3685  N  NE    A ARG A  1  473 ? 19.257  51.045 -20.623 0.50 44.51  ? 1272 ARG B NE    1 
ATOM   3686  N  NE    B ARG A  1  473 ? 20.729  50.991 -19.750 0.50 47.89  ? 1272 ARG B NE    1 
ATOM   3687  C  CZ    A ARG A  1  473 ? 19.280  50.816 -19.291 0.50 47.58  ? 1272 ARG B CZ    1 
ATOM   3688  C  CZ    B ARG A  1  473 ? 19.539  50.736 -19.166 0.50 48.27  ? 1272 ARG B CZ    1 
ATOM   3689  N  NH1   A ARG A  1  473 ? 20.187  49.968 -18.774 0.50 50.13  ? 1272 ARG B NH1   1 
ATOM   3690  N  NH1   B ARG A  1  473 ? 18.352  51.101 -19.703 0.50 48.83  ? 1272 ARG B NH1   1 
ATOM   3691  N  NH2   A ARG A  1  473 ? 18.295  51.309 -18.544 0.50 47.99  ? 1272 ARG B NH2   1 
ATOM   3692  N  NH2   B ARG A  1  473 ? 19.520  50.097 -18.023 0.50 46.79  ? 1272 ARG B NH2   1 
ATOM   3693  N  N     . MET A  1  474 ? 18.363  56.848 -20.834 1.00 32.30  ? 1273 MET B N     1 
ATOM   3694  C  CA    . MET A  1  474 ? 17.156  57.588 -21.129 1.00 33.17  ? 1273 MET B CA    1 
ATOM   3695  C  C     . MET A  1  474 ? 17.477  58.665 -22.144 1.00 33.75  ? 1273 MET B C     1 
ATOM   3696  O  O     . MET A  1  474 ? 16.718  58.905 -23.087 1.00 33.05  ? 1273 MET B O     1 
ATOM   3697  C  CB    . MET A  1  474 ? 16.581  58.200 -19.885 1.00 34.07  ? 1273 MET B CB    1 
ATOM   3698  C  CG    . MET A  1  474 ? 15.350  59.051 -20.122 1.00 36.90  ? 1273 MET B CG    1 
ATOM   3699  S  SD    . MET A  1  474 ? 14.840  60.011 -18.654 1.00 42.06  ? 1273 MET B SD    1 
ATOM   3700  C  CE    . MET A  1  474 ? 16.028  61.383 -18.783 1.00 36.89  ? 1273 MET B CE    1 
ATOM   3701  N  N     . ILE A  1  475 ? 18.607  59.313 -21.950 1.00 33.02  ? 1274 ILE B N     1 
ATOM   3702  C  CA    . ILE A  1  475 ? 19.040  60.375 -22.831 1.00 36.73  ? 1274 ILE B CA    1 
ATOM   3703  C  C     . ILE A  1  475 ? 19.381  59.793 -24.194 1.00 40.37  ? 1274 ILE B C     1 
ATOM   3704  O  O     . ILE A  1  475 ? 19.000  60.306 -25.213 1.00 40.85  ? 1274 ILE B O     1 
ATOM   3705  C  CB    . ILE A  1  475 ? 20.215  61.156 -22.257 1.00 32.33  ? 1274 ILE B CB    1 
ATOM   3706  C  CG1   . ILE A  1  475 ? 19.751  61.942 -21.031 1.00 30.60  ? 1274 ILE B CG1   1 
ATOM   3707  C  CG2   . ILE A  1  475 ? 20.822  62.047 -23.341 1.00 33.91  ? 1274 ILE B CG2   1 
ATOM   3708  C  CD1   . ILE A  1  475 ? 20.928  62.489 -20.193 1.00 30.07  ? 1274 ILE B CD1   1 
ATOM   3709  N  N     A GLU A  1  476 ? 19.904  58.645 -24.298 0.50 40.43  ? 1275 GLU B N     1 
ATOM   3710  N  N     B GLU A  1  476 ? 19.912  58.647 -24.298 0.50 39.82  ? 1275 GLU B N     1 
ATOM   3711  C  CA    A GLU A  1  476 ? 20.197  58.108 -25.572 0.50 41.82  ? 1275 GLU B CA    1 
ATOM   3712  C  CA    B GLU A  1  476 ? 20.195  58.101 -25.574 0.50 40.81  ? 1275 GLU B CA    1 
ATOM   3713  C  C     A GLU A  1  476 ? 18.935  57.769 -26.369 0.50 41.96  ? 1275 GLU B C     1 
ATOM   3714  C  C     B GLU A  1  476 ? 18.923  57.801 -26.368 0.50 41.21  ? 1275 GLU B C     1 
ATOM   3715  O  O     A GLU A  1  476 ? 18.913  57.844 -27.585 0.50 41.61  ? 1275 GLU B O     1 
ATOM   3716  O  O     B GLU A  1  476 ? 18.875  57.930 -27.581 0.50 40.55  ? 1275 GLU B O     1 
ATOM   3717  C  CB    A GLU A  1  476 ? 21.009  56.856 -25.362 0.50 44.06  ? 1275 GLU B CB    1 
ATOM   3718  C  CB    B GLU A  1  476 ? 21.027  56.857 -25.371 0.50 42.26  ? 1275 GLU B CB    1 
ATOM   3719  C  CG    A GLU A  1  476 ? 21.749  56.465 -26.629 0.50 46.87  ? 1275 GLU B CG    1 
ATOM   3720  C  CG    B GLU A  1  476 ? 22.491  57.151 -25.022 0.50 42.90  ? 1275 GLU B CG    1 
ATOM   3721  C  CD    A GLU A  1  476 ? 22.745  57.574 -26.984 0.50 47.71  ? 1275 GLU B CD    1 
ATOM   3722  C  CD    B GLU A  1  476 ? 23.423  55.980 -24.772 0.50 45.65  ? 1275 GLU B CD    1 
ATOM   3723  O  OE1   A GLU A  1  476 ? 23.630  57.876 -26.156 0.50 50.00  ? 1275 GLU B OE1   1 
ATOM   3724  O  OE1   B GLU A  1  476 ? 22.976  54.859 -24.399 0.50 45.49  ? 1275 GLU B OE1   1 
ATOM   3725  O  OE2   A GLU A  1  476 ? 22.639  58.185 -28.043 0.50 48.89  ? 1275 GLU B OE2   1 
ATOM   3726  O  OE2   B GLU A  1  476 ? 24.658  56.219 -25.018 0.50 45.49  ? 1275 GLU B OE2   1 
ATOM   3727  N  N     . LYS A  1  477 ? 17.891  57.257 -25.805 1.00 40.84  ? 1276 LYS B N     1 
ATOM   3728  C  CA    . LYS A  1  477 ? 16.557  57.035 -26.287 1.00 41.79  ? 1276 LYS B CA    1 
ATOM   3729  C  C     . LYS A  1  477 ? 15.981  58.330 -26.905 1.00 43.68  ? 1276 LYS B C     1 
ATOM   3730  O  O     . LYS A  1  477 ? 15.452  58.300 -27.998 1.00 41.48  ? 1276 LYS B O     1 
ATOM   3731  C  CB    . LYS A  1  477 ? 15.692  56.519 -25.175 1.00 38.60  ? 1276 LYS B CB    1 
ATOM   3732  N  N     . ILE A  1  478 ? 16.092  59.436 -26.206 1.00 41.45  ? 1277 ILE B N     1 
ATOM   3733  C  CA    . ILE A  1  478 ? 15.612  60.693 -26.739 1.00 40.51  ? 1277 ILE B CA    1 
ATOM   3734  C  C     . ILE A  1  478 ? 16.420  61.086 -27.979 1.00 43.12  ? 1277 ILE B C     1 
ATOM   3735  O  O     . ILE A  1  478 ? 15.866  61.506 -29.000 1.00 44.87  ? 1277 ILE B O     1 
ATOM   3736  C  CB    . ILE A  1  478 ? 15.666  61.814 -25.679 1.00 37.56  ? 1277 ILE B CB    1 
ATOM   3737  C  CG1   . ILE A  1  478 ? 14.763  61.446 -24.504 1.00 38.44  ? 1277 ILE B CG1   1 
ATOM   3738  C  CG2   . ILE A  1  478 ? 15.262  63.149 -26.290 1.00 36.93  ? 1277 ILE B CG2   1 
ATOM   3739  C  CD1   . ILE A  1  478 ? 15.048  62.307 -23.268 1.00 40.37  ? 1277 ILE B CD1   1 
ATOM   3740  N  N     . ALA A  1  479 ? 17.736  60.912 -27.896 1.00 40.37  ? 1278 ALA B N     1 
ATOM   3741  C  CA    . ALA A  1  479 ? 18.599  61.211 -29.011 1.00 42.80  ? 1278 ALA B CA    1 
ATOM   3742  C  C     . ALA A  1  479 ? 18.209  60.320 -30.185 1.00 47.41  ? 1278 ALA B C     1 
ATOM   3743  O  O     . ALA A  1  479 ? 18.185  60.763 -31.321 1.00 48.92  ? 1278 ALA B O     1 
ATOM   3744  C  CB    . ALA A  1  479 ? 20.043  61.008 -28.654 1.00 40.14  ? 1278 ALA B CB    1 
ATOM   3745  N  N     . GLU A  1  480 ? 17.914  59.065 -29.913 1.00 47.57  ? 1279 GLU B N     1 
ATOM   3746  C  CA    . GLU A  1  480 ? 17.513  58.113 -30.944 1.00 52.84  ? 1279 GLU B CA    1 
ATOM   3747  C  C     . GLU A  1  480 ? 16.268  58.589 -31.680 1.00 50.86  ? 1279 GLU B C     1 
ATOM   3748  O  O     . GLU A  1  480 ? 16.211  58.551 -32.912 1.00 51.35  ? 1279 GLU B O     1 
ATOM   3749  C  CB    . GLU A  1  480 ? 17.269  56.731 -30.331 1.00 54.53  ? 1279 GLU B CB    1 
ATOM   3750  C  CG    . GLU A  1  480 ? 18.309  55.690 -30.768 1.00 66.30  ? 1279 GLU B CG    1 
ATOM   3751  C  CD    . GLU A  1  480 ? 18.314  54.471 -29.861 1.00 73.05  ? 1279 GLU B CD    1 
ATOM   3752  O  OE1   . GLU A  1  480 ? 17.161  53.996 -29.627 1.00 76.65  ? 1279 GLU B OE1   1 
ATOM   3753  O  OE2   . GLU A  1  480 ? 19.435  54.037 -29.392 1.00 72.87  ? 1279 GLU B OE2   1 
ATOM   3754  N  N     . LEU A  1  481 ? 15.269  59.052 -30.940 1.00 47.62  ? 1280 LEU B N     1 
ATOM   3755  C  CA    . LEU A  1  481 ? 14.032  59.529 -31.554 1.00 53.68  ? 1280 LEU B CA    1 
ATOM   3756  C  C     . LEU A  1  481 ? 14.274  60.769 -32.408 1.00 55.90  ? 1280 LEU B C     1 
ATOM   3757  O  O     . LEU A  1  481 ? 13.681  60.927 -33.482 1.00 58.09  ? 1280 LEU B O     1 
ATOM   3758  C  CB    . LEU A  1  481 ? 12.977  59.803 -30.486 1.00 49.83  ? 1280 LEU B CB    1 
ATOM   3759  C  CG    . LEU A  1  481 ? 12.461  58.564 -29.726 1.00 54.40  ? 1280 LEU B CG    1 
ATOM   3760  C  CD1   . LEU A  1  481 ? 11.515  58.985 -28.604 1.00 51.41  ? 1280 LEU B CD1   1 
ATOM   3761  C  CD2   . LEU A  1  481 ? 11.756  57.572 -30.676 1.00 54.07  ? 1280 LEU B CD2   1 
ATOM   3762  N  N     . VAL A  1  482 ? 15.151  61.648 -31.920 1.00 53.86  ? 1281 VAL B N     1 
ATOM   3763  C  CA    . VAL A  1  482 ? 15.499  62.858 -32.625 1.00 54.20  ? 1281 VAL B CA    1 
ATOM   3764  C  C     . VAL A  1  482 ? 16.312  62.485 -33.872 1.00 58.91  ? 1281 VAL B C     1 
ATOM   3765  O  O     . VAL A  1  482 ? 15.934  62.787 -34.980 1.00 55.36  ? 1281 VAL B O     1 
ATOM   3766  C  CB    . VAL A  1  482 ? 16.271  63.817 -31.733 1.00 52.06  ? 1281 VAL B CB    1 
ATOM   3767  C  CG1   . VAL A  1  482 ? 16.845  64.974 -32.562 1.00 51.07  ? 1281 VAL B CG1   1 
ATOM   3768  C  CG2   . VAL A  1  482 ? 15.376  64.358 -30.660 1.00 51.32  ? 1281 VAL B CG2   1 
ATOM   3769  N  N     A ARG A  1  483 ? 17.234  61.550 -33.810 0.50 56.85  ? 1282 ARG B N     1 
ATOM   3770  N  N     B ARG A  1  483 ? 17.229  61.551 -33.821 0.50 57.11  ? 1282 ARG B N     1 
ATOM   3771  C  CA    A ARG A  1  483 ? 18.060  61.129 -34.945 0.50 59.00  ? 1282 ARG B CA    1 
ATOM   3772  C  CA    B ARG A  1  483 ? 18.049  61.162 -34.971 0.50 59.32  ? 1282 ARG B CA    1 
ATOM   3773  C  C     A ARG A  1  483 ? 17.226  60.405 -36.025 0.50 62.78  ? 1282 ARG B C     1 
ATOM   3774  C  C     B ARG A  1  483 ? 17.214  60.416 -36.036 0.50 62.98  ? 1282 ARG B C     1 
ATOM   3775  O  O     A ARG A  1  483 ? 17.446  60.600 -37.218 0.50 66.18  ? 1282 ARG B O     1 
ATOM   3776  O  O     B ARG A  1  483 ? 17.425  60.605 -37.233 0.50 66.29  ? 1282 ARG B O     1 
ATOM   3777  C  CB    A ARG A  1  483 ? 19.191  60.238 -34.431 0.50 58.29  ? 1282 ARG B CB    1 
ATOM   3778  C  CB    B ARG A  1  483 ? 19.220  60.309 -34.488 0.50 58.99  ? 1282 ARG B CB    1 
ATOM   3779  C  CG    A ARG A  1  483 ? 19.951  59.446 -35.468 0.50 59.63  ? 1282 ARG B CG    1 
ATOM   3780  C  CG    B ARG A  1  483 ? 20.244  59.781 -35.477 0.50 60.71  ? 1282 ARG B CG    1 
ATOM   3781  C  CD    A ARG A  1  483 ? 21.207  58.841 -34.840 0.50 59.09  ? 1282 ARG B CD    1 
ATOM   3782  C  CD    B ARG A  1  483 ? 21.095  58.687 -34.812 0.50 60.53  ? 1282 ARG B CD    1 
ATOM   3783  N  NE    A ARG A  1  483 ? 20.915  57.959 -33.722 0.50 57.48  ? 1282 ARG B NE    1 
ATOM   3784  N  NE    B ARG A  1  483 ? 22.020  58.084 -35.775 0.50 61.35  ? 1282 ARG B NE    1 
ATOM   3785  C  CZ    A ARG A  1  483 ? 21.211  58.232 -32.450 0.50 56.66  ? 1282 ARG B CZ    1 
ATOM   3786  C  CZ    B ARG A  1  483 ? 23.079  57.343 -35.461 0.50 60.13  ? 1282 ARG B CZ    1 
ATOM   3787  N  NH1   A ARG A  1  483 ? 21.794  59.366 -32.098 0.50 55.64  ? 1282 ARG B NH1   1 
ATOM   3788  N  NH1   B ARG A  1  483 ? 23.364  57.077 -34.187 0.50 57.29  ? 1282 ARG B NH1   1 
ATOM   3789  N  NH2   A ARG A  1  483 ? 20.899  57.374 -31.526 0.50 55.90  ? 1282 ARG B NH2   1 
ATOM   3790  N  NH2   B ARG A  1  483 ? 23.842  56.849 -36.436 0.50 58.09  ? 1282 ARG B NH2   1 
ATOM   3791  N  N     . ASP A  1  484 ? 16.262  59.598 -35.599 1.00 62.30  ? 1283 ASP B N     1 
ATOM   3792  C  CA    . ASP A  1  484 ? 15.394  58.883 -36.506 1.00 63.93  ? 1283 ASP B CA    1 
ATOM   3793  C  C     . ASP A  1  484 ? 14.158  59.678 -36.922 1.00 66.75  ? 1283 ASP B C     1 
ATOM   3794  O  O     . ASP A  1  484 ? 13.274  59.130 -37.586 1.00 69.65  ? 1283 ASP B O     1 
ATOM   3795  C  CB    . ASP A  1  484 ? 14.949  57.550 -35.878 1.00 59.66  ? 1283 ASP B CB    1 
ATOM   3796  C  CG    . ASP A  1  484 ? 16.126  56.634 -35.570 1.00 59.65  ? 1283 ASP B CG    1 
ATOM   3797  O  OD1   . ASP A  1  484 ? 17.235  56.859 -36.130 1.00 64.36  ? 1283 ASP B OD1   1 
ATOM   3798  O  OD2   . ASP A  1  484 ? 15.928  55.690 -34.780 1.00 53.50  ? 1283 ASP B OD2   1 
ATOM   3799  N  N     . LYS A  1  485 ? 14.083  60.945 -36.551 1.00 65.20  ? 1284 LYS B N     1 
ATOM   3800  C  CA    . LYS A  1  485 ? 12.960  61.769 -36.953 1.00 66.67  ? 1284 LYS B CA    1 
ATOM   3801  C  C     . LYS A  1  485 ? 11.627  61.322 -36.390 1.00 69.75  ? 1284 LYS B C     1 
ATOM   3802  O  O     . LYS A  1  485 ? 10.580  61.709 -36.898 1.00 71.14  ? 1284 LYS B O     1 
ATOM   3803  C  CB    . LYS A  1  485 ? 12.838  61.892 -38.478 1.00 66.62  ? 1284 LYS B CB    1 
ATOM   3804  C  CG    . LYS A  1  485 ? 13.938  62.688 -39.148 1.00 61.51  ? 1284 LYS B CG    1 
ATOM   3805  N  N     . LYS A  1  486 ? 11.668  60.518 -35.335 1.00 69.23  ? 1285 LYS B N     1 
ATOM   3806  C  CA    . LYS A  1  486 ? 10.450  60.047 -34.675 1.00 67.50  ? 1285 LYS B CA    1 
ATOM   3807  C  C     . LYS A  1  486 ? 9.818   61.137 -33.783 1.00 70.11  ? 1285 LYS B C     1 
ATOM   3808  O  O     . LYS A  1  486 ? 8.685   61.005 -33.355 1.00 73.45  ? 1285 LYS B O     1 
ATOM   3809  C  CB    . LYS A  1  486 ? 10.691  58.742 -33.966 1.00 64.64  ? 1285 LYS B CB    1 
ATOM   3810  C  CG    . LYS A  1  486 ? 10.948  57.618 -34.972 1.00 72.97  ? 1285 LYS B CG    1 
ATOM   3811  C  CD    . LYS A  1  486 ? 11.295  56.270 -34.338 1.00 75.45  ? 1285 LYS B CD    1 
ATOM   3812  C  CE    . LYS A  1  486 ? 11.517  55.249 -35.447 1.00 73.70  ? 1285 LYS B CE    1 
ATOM   3813  N  NZ    . LYS A  1  486 ? 12.226  54.011 -34.963 1.00 70.66  ? 1285 LYS B NZ    1 
ATOM   3814  N  N     . ILE A  1  487 ? 10.552  62.215 -33.544 1.00 66.82  ? 1286 ILE B N     1 
ATOM   3815  C  CA    . ILE A  1  487 ? 10.006  63.304 -32.768 1.00 59.74  ? 1286 ILE B CA    1 
ATOM   3816  C  C     . ILE A  1  487 ? 10.590  64.582 -33.351 1.00 58.10  ? 1286 ILE B C     1 
ATOM   3817  O  O     . ILE A  1  487 ? 11.681  64.601 -33.856 1.00 53.23  ? 1286 ILE B O     1 
ATOM   3818  C  CB    . ILE A  1  487 ? 10.355  63.176 -31.235 1.00 63.29  ? 1286 ILE B CB    1 
ATOM   3819  C  CG1   . ILE A  1  487 ? 9.639   64.268 -30.461 1.00 61.82  ? 1286 ILE B CG1   1 
ATOM   3820  C  CG2   . ILE A  1  487 ? 11.869  63.135 -31.006 1.00 64.06  ? 1286 ILE B CG2   1 
ATOM   3821  C  CD1   . ILE A  1  487 ? 9.340   63.896 -29.071 1.00 66.44  ? 1286 ILE B CD1   1 
ATOM   3822  N  N     A ASP A  1  488 ? 9.857   65.683 -33.203 0.50 58.32  ? 1287 ASP B N     1 
ATOM   3823  N  N     B ASP A  1  488 ? 9.858   65.655 -33.264 0.50 60.10  ? 1287 ASP B N     1 
ATOM   3824  C  CA    A ASP A  1  488 ? 10.115  66.904 -33.960 0.50 59.22  ? 1287 ASP B CA    1 
ATOM   3825  C  CA    B ASP A  1  488 ? 10.239  66.896 -33.941 0.50 61.96  ? 1287 ASP B CA    1 
ATOM   3826  C  C     A ASP A  1  488 ? 10.234  68.092 -33.023 0.50 57.56  ? 1287 ASP B C     1 
ATOM   3827  C  C     B ASP A  1  488 ? 10.314  68.079 -32.984 0.50 59.20  ? 1287 ASP B C     1 
ATOM   3828  O  O     A ASP A  1  488 ? 9.392   68.243 -32.107 0.50 58.38  ? 1287 ASP B O     1 
ATOM   3829  O  O     B ASP A  1  488 ? 9.595   68.159 -32.009 0.50 59.44  ? 1287 ASP B O     1 
ATOM   3830  C  CB    A ASP A  1  488 ? 8.945   67.138 -34.929 0.50 61.00  ? 1287 ASP B CB    1 
ATOM   3831  C  CB    B ASP A  1  488 ? 9.284   67.157 -35.123 0.50 66.89  ? 1287 ASP B CB    1 
ATOM   3832  C  CG    A ASP A  1  488 ? 8.648   65.951 -35.821 0.50 60.86  ? 1287 ASP B CG    1 
ATOM   3833  C  CG    B ASP A  1  488 ? 9.595   68.451 -35.888 0.50 69.17  ? 1287 ASP B CG    1 
ATOM   3834  O  OD1   A ASP A  1  488 ? 9.573   65.159 -36.060 0.50 65.18  ? 1287 ASP B OD1   1 
ATOM   3835  O  OD1   B ASP A  1  488 ? 10.591  69.178 -35.630 0.50 69.73  ? 1287 ASP B OD1   1 
ATOM   3836  O  OD2   A ASP A  1  488 ? 7.499   65.810 -36.314 0.50 58.66  ? 1287 ASP B OD2   1 
ATOM   3837  O  OD2   B ASP A  1  488 ? 8.793   68.761 -36.762 0.50 74.70  ? 1287 ASP B OD2   1 
ATOM   3838  N  N     . GLY A  1  489 ? 11.141  69.014 -33.341 1.00 57.78  ? 1288 GLY B N     1 
ATOM   3839  C  CA    . GLY A  1  489 ? 11.297  70.222 -32.552 1.00 55.74  ? 1288 GLY B CA    1 
ATOM   3840  C  C     . GLY A  1  489 ? 12.417  70.283 -31.526 1.00 51.54  ? 1288 GLY B C     1 
ATOM   3841  O  O     . GLY A  1  489 ? 12.595  71.316 -30.894 1.00 53.38  ? 1288 GLY B O     1 
ATOM   3842  N  N     . ILE A  1  490 ? 13.185  69.209 -31.369 1.00 48.33  ? 1289 ILE B N     1 
ATOM   3843  C  CA    . ILE A  1  490 ? 14.287  69.255 -30.410 1.00 45.18  ? 1289 ILE B CA    1 
ATOM   3844  C  C     . ILE A  1  490 ? 15.573  69.740 -31.065 1.00 42.75  ? 1289 ILE B C     1 
ATOM   3845  O  O     . ILE A  1  490 ? 16.070  69.121 -31.979 1.00 44.43  ? 1289 ILE B O     1 
ATOM   3846  C  CB    . ILE A  1  490 ? 14.503  67.861 -29.761 1.00 44.58  ? 1289 ILE B CB    1 
ATOM   3847  C  CG1   . ILE A  1  490 ? 13.303  67.533 -28.862 1.00 46.00  ? 1289 ILE B CG1   1 
ATOM   3848  C  CG2   . ILE A  1  490 ? 15.766  67.837 -28.942 1.00 42.87  ? 1289 ILE B CG2   1 
ATOM   3849  C  CD1   . ILE A  1  490 ? 13.405  66.229 -28.145 1.00 45.18  ? 1289 ILE B CD1   1 
ATOM   3850  N  N     . THR A  1  491 ? 16.093  70.855 -30.578 1.00 44.13  ? 1290 THR B N     1 
ATOM   3851  C  CA    . THR A  1  491 ? 17.308  71.446 -31.120 1.00 47.02  ? 1290 THR B CA    1 
ATOM   3852  C  C     . THR A  1  491 ? 18.591  71.020 -30.421 1.00 48.02  ? 1290 THR B C     1 
ATOM   3853  O  O     . THR A  1  491 ? 19.631  70.871 -31.077 1.00 44.53  ? 1290 THR B O     1 
ATOM   3854  C  CB    . THR A  1  491 ? 17.218  72.950 -31.185 1.00 46.39  ? 1290 THR B CB    1 
ATOM   3855  O  OG1   . THR A  1  491 ? 16.786  73.462 -29.928 1.00 47.60  ? 1290 THR B OG1   1 
ATOM   3856  C  CG2   . THR A  1  491 ? 16.168  73.322 -32.233 1.00 48.47  ? 1290 THR B CG2   1 
ATOM   3857  N  N     . ASP A  1  492 ? 18.538  70.812 -29.108 1.00 43.66  ? 1291 ASP B N     1 
ATOM   3858  C  CA    . ASP A  1  492 ? 19.700  70.359 -28.343 1.00 40.21  ? 1291 ASP B CA    1 
ATOM   3859  C  C     . ASP A  1  492 ? 19.245  69.534 -27.130 1.00 37.99  ? 1291 ASP B C     1 
ATOM   3860  O  O     . ASP A  1  492 ? 18.140  69.704 -26.624 1.00 37.22  ? 1291 ASP B O     1 
ATOM   3861  C  CB    . ASP A  1  492 ? 20.575  71.517 -27.901 1.00 40.28  ? 1291 ASP B CB    1 
ATOM   3862  C  CG    . ASP A  1  492 ? 21.965  71.085 -27.499 1.00 44.08  ? 1291 ASP B CG    1 
ATOM   3863  O  OD1   . ASP A  1  492 ? 22.418  70.042 -27.959 1.00 46.38  ? 1291 ASP B OD1   1 
ATOM   3864  O  OD2   . ASP A  1  492 ? 22.627  71.801 -26.725 1.00 46.34  ? 1291 ASP B OD2   1 
ATOM   3865  N  N     . LEU A  1  493 ? 20.120  68.634 -26.680 1.00 35.52  ? 1292 LEU B N     1 
ATOM   3866  C  CA    . LEU A  1  493 ? 19.866  67.767 -25.538 1.00 34.94  ? 1292 LEU B CA    1 
ATOM   3867  C  C     . LEU A  1  493 ? 21.169  67.699 -24.767 1.00 35.46  ? 1292 LEU B C     1 
ATOM   3868  O  O     . LEU A  1  493 ? 22.201  67.293 -25.319 1.00 33.78  ? 1292 LEU B O     1 
ATOM   3869  C  CB    . LEU A  1  493 ? 19.433  66.379 -26.003 1.00 36.71  ? 1292 LEU B CB    1 
ATOM   3870  C  CG    . LEU A  1  493 ? 19.321  65.214 -25.056 1.00 36.63  ? 1292 LEU B CG    1 
ATOM   3871  C  CD1   . LEU A  1  493 ? 18.145  65.436 -24.114 1.00 36.05  ? 1292 LEU B CD1   1 
ATOM   3872  C  CD2   . LEU A  1  493 ? 19.048  63.964 -25.868 1.00 34.68  ? 1292 LEU B CD2   1 
ATOM   3873  N  N     . ARG A  1  494 ? 21.139  68.103 -23.496 1.00 31.28  ? 1293 ARG B N     1 
ATOM   3874  C  CA    . ARG A  1  494 ? 22.339  68.160 -22.680 1.00 32.79  ? 1293 ARG B CA    1 
ATOM   3875  C  C     . ARG A  1  494 ? 22.074  67.591 -21.302 1.00 29.20  ? 1293 ARG B C     1 
ATOM   3876  O  O     . ARG A  1  494 ? 21.042  67.874 -20.700 1.00 29.52  ? 1293 ARG B O     1 
ATOM   3877  C  CB    . ARG A  1  494 ? 22.896  69.590 -22.575 1.00 31.82  ? 1293 ARG B CB    1 
ATOM   3878  C  CG    . ARG A  1  494 ? 23.081  70.283 -23.900 1.00 40.61  ? 1293 ARG B CG    1 
ATOM   3879  C  CD    . ARG A  1  494 ? 23.713  71.665 -23.728 1.00 39.22  ? 1293 ARG B CD    1 
ATOM   3880  N  NE    . ARG A  1  494 ? 22.927  72.583 -22.905 1.00 37.71  ? 1293 ARG B NE    1 
ATOM   3881  C  CZ    . ARG A  1  494 ? 21.879  73.277 -23.352 1.00 40.30  ? 1293 ARG B CZ    1 
ATOM   3882  N  NH1   . ARG A  1  494 ? 21.558  73.236 -24.642 1.00 40.39  ? 1293 ARG B NH1   1 
ATOM   3883  N  NH2   . ARG A  1  494 ? 21.193  74.063 -22.528 1.00 39.70  ? 1293 ARG B NH2   1 
ATOM   3884  N  N     . ASP A  1  495 ? 23.034  66.788 -20.789 1.00 28.40  ? 1294 ASP B N     1 
ATOM   3885  C  CA    . ASP A  1  495 ? 23.031  66.368 -19.392 1.00 29.58  ? 1294 ASP B CA    1 
ATOM   3886  C  C     . ASP A  1  495 ? 23.955  67.302 -18.611 1.00 29.66  ? 1294 ASP B C     1 
ATOM   3887  O  O     . ASP A  1  495 ? 25.181  67.215 -18.724 1.00 29.89  ? 1294 ASP B O     1 
ATOM   3888  C  CB    . ASP A  1  495 ? 23.512  64.928 -19.281 1.00 29.56  ? 1294 ASP B CB    1 
ATOM   3889  C  CG    . ASP A  1  495 ? 23.305  64.351 -17.872 1.00 33.15  ? 1294 ASP B CG    1 
ATOM   3890  O  OD1   . ASP A  1  495 ? 22.896  65.119 -16.972 1.00 32.41  ? 1294 ASP B OD1   1 
ATOM   3891  O  OD2   . ASP A  1  495 ? 23.530  63.144 -17.657 1.00 35.35  ? 1294 ASP B OD2   1 
ATOM   3892  N  N     . GLU A  1  496 ? 23.355  68.185 -17.814 1.00 30.95  ? 1295 GLU B N     1 
ATOM   3893  C  CA    . GLU A  1  496 ? 24.125  69.114 -16.986 1.00 30.60  ? 1295 GLU B CA    1 
ATOM   3894  C  C     . GLU A  1  496 ? 24.070  68.737 -15.502 1.00 31.58  ? 1295 GLU B C     1 
ATOM   3895  O  O     . GLU A  1  496 ? 24.216  69.595 -14.636 1.00 32.06  ? 1295 GLU B O     1 
ATOM   3896  C  CB    . GLU A  1  496 ? 23.617  70.531 -17.200 1.00 30.68  ? 1295 GLU B CB    1 
ATOM   3897  C  CG    . GLU A  1  496 ? 23.608  70.914 -18.667 1.00 32.40  ? 1295 GLU B CG    1 
ATOM   3898  C  CD    . GLU A  1  496 ? 23.221  72.377 -18.890 1.00 34.49  ? 1295 GLU B CD    1 
ATOM   3899  O  OE1   . GLU A  1  496 ? 22.567  73.054 -18.007 1.00 36.94  ? 1295 GLU B OE1   1 
ATOM   3900  O  OE2   . GLU A  1  496 ? 23.515  72.833 -19.980 1.00 34.45  ? 1295 GLU B OE2   1 
ATOM   3901  N  N     . THR A  1  497 ? 23.870  67.470 -15.200 1.00 31.36  ? 1296 THR B N     1 
ATOM   3902  C  CA    . THR A  1  497 ? 23.807  67.046 -13.830 1.00 29.92  ? 1296 THR B CA    1 
ATOM   3903  C  C     . THR A  1  497 ? 25.118  67.368 -13.145 1.00 31.14  ? 1296 THR B C     1 
ATOM   3904  O  O     . THR A  1  497 ? 26.176  67.214 -13.720 1.00 31.08  ? 1296 THR B O     1 
ATOM   3905  C  CB    . THR A  1  497 ? 23.594  65.510 -13.792 1.00 28.98  ? 1296 THR B CB    1 
ATOM   3906  O  OG1   . THR A  1  497 ? 22.335  65.196 -14.392 1.00 27.96  ? 1296 THR B OG1   1 
ATOM   3907  C  CG2   . THR A  1  497 ? 23.603  64.994 -12.391 1.00 28.98  ? 1296 THR B CG2   1 
ATOM   3908  N  N     . SER A  1  498 ? 25.064  67.806 -11.909 1.00 30.35  ? 1297 SER B N     1 
ATOM   3909  C  CA    . SER A  1  498 ? 26.272  68.119 -11.150 1.00 31.23  ? 1297 SER B CA    1 
ATOM   3910  C  C     . SER A  1  498 ? 26.015  67.793 -9.687  1.00 29.42  ? 1297 SER B C     1 
ATOM   3911  O  O     . SER A  1  498 ? 24.875  67.526 -9.278  1.00 29.43  ? 1297 SER B O     1 
ATOM   3912  C  CB    . SER A  1  498 ? 26.678  69.604 -11.316 1.00 29.87  ? 1297 SER B CB    1 
ATOM   3913  O  OG    . SER A  1  498 ? 25.647  70.458 -10.851 1.00 30.03  ? 1297 SER B OG    1 
ATOM   3914  N  N     . LEU A  1  499 ? 27.092  67.792 -8.892  1.00 29.46  ? 1298 LEU B N     1 
ATOM   3915  C  CA    . LEU A  1  499 ? 26.923  67.610 -7.463  1.00 31.34  ? 1298 LEU B CA    1 
ATOM   3916  C  C     . LEU A  1  499 ? 26.184  68.795 -6.880  1.00 32.79  ? 1298 LEU B C     1 
ATOM   3917  O  O     . LEU A  1  499 ? 25.373  68.605 -5.911  1.00 32.09  ? 1298 LEU B O     1 
ATOM   3918  C  CB    . LEU A  1  499 ? 28.282  67.487 -6.765  1.00 33.87  ? 1298 LEU B CB    1 
ATOM   3919  C  CG    . LEU A  1  499 ? 28.372  67.018 -5.331  1.00 34.60  ? 1298 LEU B CG    1 
ATOM   3920  C  CD1   . LEU A  1  499 ? 27.786  65.590 -5.227  1.00 39.64  ? 1298 LEU B CD1   1 
ATOM   3921  C  CD2   . LEU A  1  499 ? 29.885  67.100 -4.951  1.00 37.05  ? 1298 LEU B CD2   1 
ATOM   3922  N  N     . ARG A  1  500 ? 26.395  69.998 -7.402  1.00 29.15  ? 1299 ARG B N     1 
ATOM   3923  C  CA    . ARG A  1  500 ? 25.735  71.189 -6.867  1.00 29.64  ? 1299 ARG B CA    1 
ATOM   3924  C  C     . ARG A  1  500 ? 24.194  71.191 -7.193  1.00 28.57  ? 1299 ARG B C     1 
ATOM   3925  O  O     . ARG A  1  500 ? 23.414  71.537 -6.341  1.00 30.30  ? 1299 ARG B O     1 
ATOM   3926  C  CB    . ARG A  1  500 ? 26.401  72.450 -7.442  1.00 27.90  ? 1299 ARG B CB    1 
ATOM   3927  C  CG    . ARG A  1  500 ? 25.705  73.748 -7.169  1.00 26.87  ? 1299 ARG B CG    1 
ATOM   3928  C  CD    . ARG A  1  500 ? 26.534  74.910 -7.735  1.00 26.59  ? 1299 ARG B CD    1 
ATOM   3929  N  NE    . ARG A  1  500 ? 26.564  74.831 -9.222  1.00 25.25  ? 1299 ARG B NE    1 
ATOM   3930  C  CZ    . ARG A  1  500 ? 25.611  75.236 -10.059 1.00 24.63  ? 1299 ARG B CZ    1 
ATOM   3931  N  NH1   . ARG A  1  500 ? 24.518  75.953 -9.706  1.00 23.27  ? 1299 ARG B NH1   1 
ATOM   3932  N  NH2   . ARG A  1  500 ? 25.821  74.926 -11.350 1.00 23.20  ? 1299 ARG B NH2   1 
ATOM   3933  N  N     . THR A  1  501 ? 23.829  70.839 -8.401  1.00 28.50  ? 1300 THR B N     1 
ATOM   3934  C  CA    . THR A  1  501 ? 22.465  70.924 -8.786  1.00 30.36  ? 1300 THR B CA    1 
ATOM   3935  C  C     . THR A  1  501 ? 21.683  69.623 -8.778  1.00 30.20  ? 1300 THR B C     1 
ATOM   3936  O  O     . THR A  1  501 ? 20.461  69.688 -8.970  1.00 32.44  ? 1300 THR B O     1 
ATOM   3937  C  CB    . THR A  1  501 ? 22.326  71.414 -10.242 1.00 31.74  ? 1300 THR B CB    1 
ATOM   3938  O  OG1   . THR A  1  501 ? 22.993  70.487 -11.127 1.00 33.45  ? 1300 THR B OG1   1 
ATOM   3939  C  CG2   . THR A  1  501 ? 22.985  72.744 -10.427 1.00 33.06  ? 1300 THR B CG2   1 
ATOM   3940  N  N     . GLY A  1  502 ? 22.348  68.482 -8.629  1.00 27.37  ? 1301 GLY B N     1 
ATOM   3941  C  CA    . GLY A  1  502 ? 21.602  67.267 -8.823  1.00 27.53  ? 1301 GLY B CA    1 
ATOM   3942  C  C     . GLY A  1  502 ? 21.310  66.997 -10.267 1.00 26.49  ? 1301 GLY B C     1 
ATOM   3943  O  O     . GLY A  1  502 ? 21.911  67.589 -11.159 1.00 28.37  ? 1301 GLY B O     1 
ATOM   3944  N  N     . VAL A  1  503 ? 20.375  66.118 -10.524 1.00 27.25  ? 1302 VAL B N     1 
ATOM   3945  C  CA    . VAL A  1  503 ? 19.960  65.774 -11.890 1.00 27.26  ? 1302 VAL B CA    1 
ATOM   3946  C  C     . VAL A  1  503 ? 19.528  67.077 -12.594 1.00 26.11  ? 1302 VAL B C     1 
ATOM   3947  O  O     . VAL A  1  503 ? 18.759  67.889 -12.032 1.00 26.24  ? 1302 VAL B O     1 
ATOM   3948  C  CB    . VAL A  1  503 ? 18.850  64.730 -11.872 1.00 27.52  ? 1302 VAL B CB    1 
ATOM   3949  C  CG1   . VAL A  1  503 ? 18.254  64.554 -13.260 1.00 29.18  ? 1302 VAL B CG1   1 
ATOM   3950  C  CG2   . VAL A  1  503 ? 19.484  63.409 -11.414 1.00 29.10  ? 1302 VAL B CG2   1 
ATOM   3951  N  N     . ARG A  1  504 ? 20.019  67.252 -13.817 1.00 26.46  ? 1303 ARG B N     1 
ATOM   3952  C  CA    . ARG A  1  504 ? 19.569  68.384 -14.638 1.00 27.67  ? 1303 ARG B CA    1 
ATOM   3953  C  C     . ARG A  1  504 ? 19.800  67.988 -16.109 1.00 28.41  ? 1303 ARG B C     1 
ATOM   3954  O  O     . ARG A  1  504 ? 20.934  67.944 -16.604 1.00 30.67  ? 1303 ARG B O     1 
ATOM   3955  C  CB    . ARG A  1  504 ? 20.397  69.628 -14.311 1.00 28.04  ? 1303 ARG B CB    1 
ATOM   3956  C  CG    . ARG A  1  504 ? 20.097  70.785 -15.257 1.00 27.27  ? 1303 ARG B CG    1 
ATOM   3957  C  CD    . ARG A  1  504 ? 20.880  72.057 -14.899 1.00 26.91  ? 1303 ARG B CD    1 
ATOM   3958  N  NE    . ARG A  1  504 ? 20.769  73.034 -15.995 1.00 26.98  ? 1303 ARG B NE    1 
ATOM   3959  C  CZ    . ARG A  1  504 ? 19.717  73.844 -16.120 1.00 26.73  ? 1303 ARG B CZ    1 
ATOM   3960  N  NH1   . ARG A  1  504 ? 18.719  73.916 -15.173 1.00 27.18  ? 1303 ARG B NH1   1 
ATOM   3961  N  NH2   . ARG A  1  504 ? 19.655  74.680 -17.161 1.00 27.10  ? 1303 ARG B NH2   1 
ATOM   3962  N  N     . VAL A  1  505 ? 18.698  67.677 -16.802 1.00 28.66  ? 1304 VAL B N     1 
ATOM   3963  C  CA    . VAL A  1  505 ? 18.741  67.299 -18.213 1.00 26.81  ? 1304 VAL B CA    1 
ATOM   3964  C  C     . VAL A  1  505 ? 17.952  68.370 -18.971 1.00 27.54  ? 1304 VAL B C     1 
ATOM   3965  O  O     . VAL A  1  505 ? 16.786  68.615 -18.675 1.00 28.34  ? 1304 VAL B O     1 
ATOM   3966  C  CB    . VAL A  1  505 ? 18.149  65.917 -18.458 1.00 27.23  ? 1304 VAL B CB    1 
ATOM   3967  C  CG1   . VAL A  1  505 ? 18.114  65.624 -19.962 1.00 29.82  ? 1304 VAL B CG1   1 
ATOM   3968  C  CG2   . VAL A  1  505 ? 18.960  64.856 -17.730 1.00 28.78  ? 1304 VAL B CG2   1 
ATOM   3969  N  N     . VAL A  1  506 ? 18.610  69.018 -19.930 1.00 29.74  ? 1305 VAL B N     1 
ATOM   3970  C  CA    . VAL A  1  506 ? 18.030  70.131 -20.662 1.00 29.38  ? 1305 VAL B CA    1 
ATOM   3971  C  C     . VAL A  1  506 ? 17.751  69.731 -22.077 1.00 29.39  ? 1305 VAL B C     1 
ATOM   3972  O  O     . VAL A  1  506 ? 18.578  69.079 -22.723 1.00 31.97  ? 1305 VAL B O     1 
ATOM   3973  C  CB    . VAL A  1  506 ? 19.000  71.363 -20.627 1.00 29.49  ? 1305 VAL B CB    1 
ATOM   3974  C  CG1   . VAL A  1  506 ? 18.356  72.560 -21.309 1.00 30.14  ? 1305 VAL B CG1   1 
ATOM   3975  C  CG2   . VAL A  1  506 ? 19.371  71.708 -19.186 1.00 30.19  ? 1305 VAL B CG2   1 
ATOM   3976  N  N     . ILE A  1  507 ? 16.573  70.101 -22.582 1.00 30.78  ? 1306 ILE B N     1 
ATOM   3977  C  CA    . ILE A  1  507 ? 16.161  69.824 -23.957 1.00 33.00  ? 1306 ILE B CA    1 
ATOM   3978  C  C     . ILE A  1  507 ? 15.738  71.147 -24.580 1.00 33.96  ? 1306 ILE B C     1 
ATOM   3979  O  O     . ILE A  1  507 ? 14.761  71.748 -24.142 1.00 32.85  ? 1306 ILE B O     1 
ATOM   3980  C  CB    . ILE A  1  507 ? 15.010  68.813 -24.009 1.00 33.88  ? 1306 ILE B CB    1 
ATOM   3981  C  CG1   . ILE A  1  507 ? 15.342  67.595 -23.126 1.00 36.18  ? 1306 ILE B CG1   1 
ATOM   3982  C  CG2   . ILE A  1  507 ? 14.753  68.392 -25.453 1.00 34.64  ? 1306 ILE B CG2   1 
ATOM   3983  C  CD1   . ILE A  1  507 ? 14.130  66.726 -22.872 1.00 36.74  ? 1306 ILE B CD1   1 
ATOM   3984  N  N     . ASP A  1  508 ? 16.477  71.588 -25.602 1.00 36.07  ? 1307 ASP B N     1 
ATOM   3985  C  CA    . ASP A  1  508 ? 16.153  72.830 -26.287 1.00 38.25  ? 1307 ASP B CA    1 
ATOM   3986  C  C     . ASP A  1  508 ? 15.103  72.593 -27.368 1.00 40.49  ? 1307 ASP B C     1 
ATOM   3987  O  O     . ASP A  1  508 ? 15.125  71.569 -28.055 1.00 39.67  ? 1307 ASP B O     1 
ATOM   3988  C  CB    . ASP A  1  508 ? 17.430  73.450 -26.886 1.00 40.00  ? 1307 ASP B CB    1 
ATOM   3989  C  CG    . ASP A  1  508 ? 18.246  74.207 -25.899 1.00 42.04  ? 1307 ASP B CG    1 
ATOM   3990  O  OD1   . ASP A  1  508 ? 17.682  74.609 -24.826 1.00 44.14  ? 1307 ASP B OD1   1 
ATOM   3991  O  OD2   . ASP A  1  508 ? 19.449  74.401 -26.122 1.00 43.05  ? 1307 ASP B OD2   1 
ATOM   3992  N  N     . VAL A  1  509 ? 14.176  73.526 -27.501 1.00 41.59  ? 1308 VAL B N     1 
ATOM   3993  C  CA    . VAL A  1  509 ? 13.094  73.396 -28.466 1.00 46.51  ? 1308 VAL B CA    1 
ATOM   3994  C  C     . VAL A  1  509 ? 13.115  74.445 -29.598 1.00 47.89  ? 1308 VAL B C     1 
ATOM   3995  O  O     . VAL A  1  509 ? 13.404  75.607 -29.375 1.00 49.79  ? 1308 VAL B O     1 
ATOM   3996  C  CB    . VAL A  1  509 ? 11.761  73.503 -27.753 1.00 44.13  ? 1308 VAL B CB    1 
ATOM   3997  C  CG1   . VAL A  1  509 ? 10.611  73.335 -28.733 1.00 46.21  ? 1308 VAL B CG1   1 
ATOM   3998  C  CG2   . VAL A  1  509 ? 11.698  72.462 -26.653 1.00 43.85  ? 1308 VAL B CG2   1 
ATOM   3999  N  N     A ARG A  1  510 ? 12.780  73.997 -30.792 0.50 50.82  ? 1309 ARG B N     1 
ATOM   4000  N  N     B ARG A  1  510 ? 12.767  74.005 -30.797 0.50 51.95  ? 1309 ARG B N     1 
ATOM   4001  C  CA    A ARG A  1  510 ? 12.740  74.875 -31.957 0.50 51.89  ? 1309 ARG B CA    1 
ATOM   4002  C  CA    B ARG A  1  510 ? 12.700  74.883 -31.974 0.50 53.78  ? 1309 ARG B CA    1 
ATOM   4003  C  C     A ARG A  1  510 ? 11.682  75.947 -31.734 0.50 50.83  ? 1309 ARG B C     1 
ATOM   4004  C  C     B ARG A  1  510 ? 11.632  75.948 -31.754 0.50 53.26  ? 1309 ARG B C     1 
ATOM   4005  O  O     A ARG A  1  510 ? 10.667  75.710 -31.072 0.50 50.39  ? 1309 ARG B O     1 
ATOM   4006  O  O     B ARG A  1  510 ? 10.616  75.686 -31.114 0.50 52.89  ? 1309 ARG B O     1 
ATOM   4007  C  CB    A ARG A  1  510 ? 12.418  74.053 -33.221 0.50 54.31  ? 1309 ARG B CB    1 
ATOM   4008  C  CB    B ARG A  1  510 ? 12.388  74.049 -33.234 0.50 56.45  ? 1309 ARG B CB    1 
ATOM   4009  C  CG    A ARG A  1  510 ? 13.229  74.401 -34.483 0.50 55.57  ? 1309 ARG B CG    1 
ATOM   4010  C  CG    B ARG A  1  510 ? 13.090  74.462 -34.526 0.50 58.04  ? 1309 ARG B CG    1 
ATOM   4011  C  CD    A ARG A  1  510 ? 13.006  73.448 -35.663 0.50 58.87  ? 1309 ARG B CD    1 
ATOM   4012  C  CD    B ARG A  1  510 ? 12.861  73.463 -35.665 0.50 61.25  ? 1309 ARG B CD    1 
ATOM   4013  N  NE    A ARG A  1  510 ? 11.604  73.079 -35.772 0.50 59.05  ? 1309 ARG B NE    1 
ATOM   4014  N  NE    B ARG A  1  510 ? 13.507  72.167 -35.442 0.50 60.97  ? 1309 ARG B NE    1 
ATOM   4015  C  CZ    A ARG A  1  510 ? 11.144  71.841 -35.712 0.50 59.89  ? 1309 ARG B CZ    1 
ATOM   4016  C  CZ    B ARG A  1  510 ? 14.823  71.942 -35.554 0.50 60.37  ? 1309 ARG B CZ    1 
ATOM   4017  N  NH1   A ARG A  1  510 ? 12.010  70.849 -35.667 0.50 60.15  ? 1309 ARG B NH1   1 
ATOM   4018  N  NH1   B ARG A  1  510 ? 15.652  72.914 -35.869 0.50 59.69  ? 1309 ARG B NH1   1 
ATOM   4019  N  NH2   A ARG A  1  510 ? 9.837   71.601 -35.776 0.50 59.65  ? 1309 ARG B NH2   1 
ATOM   4020  N  NH2   B ARG A  1  510 ? 15.317  70.738 -35.334 0.50 59.86  ? 1309 ARG B NH2   1 
ATOM   4021  N  N     A LYS A  1  511 ? 11.898  77.140 -32.289 0.50 50.28  ? 1310 LYS B N     1 
ATOM   4022  N  N     B LYS A  1  511 ? 11.850  77.170 -32.241 0.50 53.46  ? 1310 LYS B N     1 
ATOM   4023  C  CA    A LYS A  1  511 ? 10.966  78.304 -32.100 0.50 48.73  ? 1310 LYS B CA    1 
ATOM   4024  C  CA    B LYS A  1  511 ? 10.859  78.272 -32.008 0.50 51.78  ? 1310 LYS B CA    1 
ATOM   4025  C  C     A LYS A  1  511 ? 9.579   77.915 -32.627 0.50 50.05  ? 1310 LYS B C     1 
ATOM   4026  C  C     B LYS A  1  511 ? 9.510   77.857 -32.598 0.50 52.04  ? 1310 LYS B C     1 
ATOM   4027  O  O     A LYS A  1  511 ? 8.547   78.266 -32.057 0.50 48.91  ? 1310 LYS B O     1 
ATOM   4028  O  O     B LYS A  1  511 ? 8.455   78.241 -32.101 0.50 50.79  ? 1310 LYS B O     1 
ATOM   4029  C  CB    A LYS A  1  511 ? 11.417  79.491 -32.936 0.50 46.65  ? 1310 LYS B CB    1 
ATOM   4030  C  CB    B LYS A  1  511 ? 11.290  79.582 -32.677 0.50 51.18  ? 1310 LYS B CB    1 
ATOM   4031  C  CG    A LYS A  1  511 ? 10.513  80.700 -32.872 0.50 44.71  ? 1310 LYS B CG    1 
ATOM   4032  C  CG    B LYS A  1  511 ? 12.672  80.047 -32.241 0.50 49.99  ? 1310 LYS B CG    1 
ATOM   4033  C  CD    A LYS A  1  511 ? 11.409  81.840 -33.358 0.50 44.96  ? 1310 LYS B CD    1 
ATOM   4034  C  CD    B LYS A  1  511 ? 12.887  81.493 -32.610 0.50 49.85  ? 1310 LYS B CD    1 
ATOM   4035  C  CE    A LYS A  1  511 ? 10.676  83.001 -33.944 0.50 42.90  ? 1310 LYS B CE    1 
ATOM   4036  C  CE    B LYS A  1  511 ? 13.823  82.170 -31.624 0.50 44.84  ? 1310 LYS B CE    1 
ATOM   4037  N  NZ    A LYS A  1  511 ? 9.466   83.235 -33.165 0.50 41.54  ? 1310 LYS B NZ    1 
ATOM   4038  N  NZ    B LYS A  1  511 ? 13.722  83.593 -31.888 0.50 42.95  ? 1310 LYS B NZ    1 
ATOM   4039  N  N     . ASP A  1  512 ? 9.596   77.170 -33.720 1.00 52.96  ? 1311 ASP B N     1 
ATOM   4040  C  CA    . ASP A  1  512 ? 8.401   76.695 -34.383 1.00 61.47  ? 1311 ASP B CA    1 
ATOM   4041  C  C     . ASP A  1  512 ? 7.582   75.757 -33.497 1.00 61.19  ? 1311 ASP B C     1 
ATOM   4042  O  O     . ASP A  1  512 ? 6.362   75.811 -33.439 1.00 60.43  ? 1311 ASP B O     1 
ATOM   4043  C  CB    . ASP A  1  512 ? 8.808   75.952 -35.649 1.00 67.27  ? 1311 ASP B CB    1 
ATOM   4044  C  CG    . ASP A  1  512 ? 7.825   76.108 -36.784 1.00 77.19  ? 1311 ASP B CG    1 
ATOM   4045  O  OD1   . ASP A  1  512 ? 6.580   76.009 -36.541 1.00 86.17  ? 1311 ASP B OD1   1 
ATOM   4046  O  OD2   . ASP A  1  512 ? 8.302   76.276 -37.957 1.00 79.93  ? 1311 ASP B OD2   1 
ATOM   4047  N  N     . ALA A  1  513 ? 8.284   74.867 -32.817 1.00 59.44  ? 1312 ALA B N     1 
ATOM   4048  C  CA    . ALA A  1  513 ? 7.688   73.799 -31.988 1.00 54.57  ? 1312 ALA B CA    1 
ATOM   4049  C  C     . ALA A  1  513 ? 6.987   74.164 -30.685 1.00 51.47  ? 1312 ALA B C     1 
ATOM   4050  O  O     . ALA A  1  513 ? 7.229   75.220 -30.102 1.00 53.15  ? 1312 ALA B O     1 
ATOM   4051  C  CB    . ALA A  1  513 ? 8.705   72.727 -31.740 1.00 56.94  ? 1312 ALA B CB    1 
ATOM   4052  N  N     . ASN A  1  514 ? 6.116   73.276 -30.237 1.00 46.72  ? 1313 ASN B N     1 
ATOM   4053  C  CA    . ASN A  1  514 ? 5.375   73.435 -28.984 1.00 45.63  ? 1313 ASN B CA    1 
ATOM   4054  C  C     . ASN A  1  514 ? 6.015   72.493 -27.951 1.00 44.37  ? 1313 ASN B C     1 
ATOM   4055  O  O     . ASN A  1  514 ? 6.071   71.267 -28.138 1.00 38.35  ? 1313 ASN B O     1 
ATOM   4056  C  CB    . ASN A  1  514 ? 3.899   73.017 -29.211 1.00 44.91  ? 1313 ASN B CB    1 
ATOM   4057  C  CG    . ASN A  1  514 ? 3.033   73.263 -27.986 1.00 48.13  ? 1313 ASN B CG    1 
ATOM   4058  O  OD1   . ASN A  1  514 ? 3.461   73.066 -26.835 1.00 49.07  ? 1313 ASN B OD1   1 
ATOM   4059  N  ND2   . ASN A  1  514 ? 1.795   73.704 -28.232 1.00 51.07  ? 1313 ASN B ND2   1 
ATOM   4060  N  N     . ALA A  1  515 ? 6.500   73.090 -26.864 1.00 43.97  ? 1314 ALA B N     1 
ATOM   4061  C  CA    . ALA A  1  515 ? 7.231   72.327 -25.845 1.00 41.81  ? 1314 ALA B CA    1 
ATOM   4062  C  C     . ALA A  1  515 ? 6.331   71.329 -25.115 1.00 39.01  ? 1314 ALA B C     1 
ATOM   4063  O  O     . ALA A  1  515 ? 6.779   70.239 -24.758 1.00 38.14  ? 1314 ALA B O     1 
ATOM   4064  C  CB    . ALA A  1  515 ? 7.924   73.244 -24.871 1.00 37.18  ? 1314 ALA B CB    1 
ATOM   4065  N  N     . SER A  1  516 ? 5.074   71.700 -24.891 1.00 40.83  ? 1315 SER B N     1 
ATOM   4066  C  CA    . SER A  1  516 ? 4.146   70.801 -24.189 1.00 41.25  ? 1315 SER B CA    1 
ATOM   4067  C  C     . SER A  1  516 ? 3.871   69.542 -25.008 1.00 43.30  ? 1315 SER B C     1 
ATOM   4068  O  O     . SER A  1  516 ? 3.805   68.447 -24.435 1.00 48.89  ? 1315 SER B O     1 
ATOM   4069  C  CB    . SER A  1  516 ? 2.840   71.535 -23.876 1.00 49.14  ? 1315 SER B CB    1 
ATOM   4070  O  OG    . SER A  1  516 ? 3.061   72.654 -23.066 1.00 56.92  ? 1315 SER B OG    1 
ATOM   4071  N  N     . VAL A  1  517 ? 3.728   69.684 -26.321 1.00 43.53  ? 1316 VAL B N     1 
ATOM   4072  C  CA    . VAL A  1  517 ? 3.515   68.526 -27.185 1.00 42.19  ? 1316 VAL B CA    1 
ATOM   4073  C  C     . VAL A  1  517 ? 4.732   67.608 -27.132 1.00 39.80  ? 1316 VAL B C     1 
ATOM   4074  O  O     . VAL A  1  517 ? 4.607   66.375 -27.020 1.00 36.95  ? 1316 VAL B O     1 
ATOM   4075  C  CB    . VAL A  1  517 ? 3.229   68.959 -28.634 1.00 43.14  ? 1316 VAL B CB    1 
ATOM   4076  C  CG1   . VAL A  1  517 ? 2.999   67.767 -29.522 1.00 41.41  ? 1316 VAL B CG1   1 
ATOM   4077  C  CG2   . VAL A  1  517 ? 2.005   69.893 -28.646 1.00 46.01  ? 1316 VAL B CG2   1 
ATOM   4078  N  N     . ILE A  1  518 ? 5.929   68.195 -27.203 1.00 40.26  ? 1317 ILE B N     1 
ATOM   4079  C  CA    . ILE A  1  518 ? 7.158   67.410 -27.187 1.00 38.22  ? 1317 ILE B CA    1 
ATOM   4080  C  C     . ILE A  1  518 ? 7.280   66.688 -25.839 1.00 37.17  ? 1317 ILE B C     1 
ATOM   4081  O  O     . ILE A  1  518 ? 7.572   65.486 -25.791 1.00 36.46  ? 1317 ILE B O     1 
ATOM   4082  C  CB    . ILE A  1  518 ? 8.377   68.303 -27.452 1.00 38.33  ? 1317 ILE B CB    1 
ATOM   4083  C  CG1   . ILE A  1  518 ? 8.247   68.969 -28.815 1.00 41.01  ? 1317 ILE B CG1   1 
ATOM   4084  C  CG2   . ILE A  1  518 ? 9.671   67.513 -27.359 1.00 39.82  ? 1317 ILE B CG2   1 
ATOM   4085  C  CD1   . ILE A  1  518 ? 9.374   69.930 -29.176 1.00 42.47  ? 1317 ILE B CD1   1 
ATOM   4086  N  N     . LEU A  1  519 ? 7.048   67.411 -24.746 1.00 37.50  ? 1318 LEU B N     1 
ATOM   4087  C  CA    . LEU A  1  519 ? 7.185   66.817 -23.429 1.00 36.66  ? 1318 LEU B CA    1 
ATOM   4088  C  C     . LEU A  1  519 ? 6.182   65.691 -23.238 1.00 36.09  ? 1318 LEU B C     1 
ATOM   4089  O  O     . LEU A  1  519 ? 6.529   64.619 -22.725 1.00 34.21  ? 1318 LEU B O     1 
ATOM   4090  C  CB    . LEU A  1  519 ? 7.004   67.902 -22.343 1.00 36.74  ? 1318 LEU B CB    1 
ATOM   4091  C  CG    . LEU A  1  519 ? 7.193   67.482 -20.895 1.00 35.81  ? 1318 LEU B CG    1 
ATOM   4092  C  CD1   . LEU A  1  519 ? 8.493   66.733 -20.716 1.00 37.27  ? 1318 LEU B CD1   1 
ATOM   4093  C  CD2   . LEU A  1  519 ? 7.185   68.690 -19.997 1.00 34.93  ? 1318 LEU B CD2   1 
ATOM   4094  N  N     . ASN A  1  520 ? 4.926   65.913 -23.648 1.00 37.29  ? 1319 ASN B N     1 
ATOM   4095  C  CA    . ASN A  1  520 ? 3.922   64.866 -23.536 1.00 38.75  ? 1319 ASN B CA    1 
ATOM   4096  C  C     . ASN A  1  520 ? 4.309   63.638 -24.369 1.00 38.30  ? 1319 ASN B C     1 
ATOM   4097  O  O     . ASN A  1  520 ? 4.107   62.503 -23.937 1.00 35.83  ? 1319 ASN B O     1 
ATOM   4098  C  CB    . ASN A  1  520 ? 2.547   65.388 -23.963 1.00 41.70  ? 1319 ASN B CB    1 
ATOM   4099  C  CG    . ASN A  1  520 ? 1.983   66.385 -22.949 1.00 45.93  ? 1319 ASN B CG    1 
ATOM   4100  O  OD1   . ASN A  1  520 ? 2.503   66.530 -21.833 1.00 45.84  ? 1319 ASN B OD1   1 
ATOM   4101  N  ND2   . ASN A  1  520 ? 0.916   67.074 -23.303 1.00 49.90  ? 1319 ASN B ND2   1 
ATOM   4102  N  N     . ASN A  1  521 ? 4.867   63.859 -25.565 1.00 35.63  ? 1320 ASN B N     1 
ATOM   4103  C  CA    . ASN A  1  521 ? 5.329   62.729 -26.352 1.00 37.57  ? 1320 ASN B CA    1 
ATOM   4104  C  C     . ASN A  1  521 ? 6.539   62.042 -25.725 1.00 37.08  ? 1320 ASN B C     1 
ATOM   4105  O  O     . ASN A  1  521 ? 6.714   60.834 -25.886 1.00 37.43  ? 1320 ASN B O     1 
ATOM   4106  C  CB    . ASN A  1  521 ? 5.662   63.175 -27.772 1.00 39.76  ? 1320 ASN B CB    1 
ATOM   4107  C  CG    . ASN A  1  521 ? 4.388   63.391 -28.606 1.00 45.65  ? 1320 ASN B CG    1 
ATOM   4108  O  OD1   . ASN A  1  521 ? 3.338   63.861 -28.114 1.00 49.61  ? 1320 ASN B OD1   1 
ATOM   4109  N  ND2   . ASN A  1  521 ? 4.481   63.088 -29.898 1.00 48.09  ? 1320 ASN B ND2   1 
ATOM   4110  N  N     . LEU A  1  522 ? 7.357   62.789 -24.999 1.00 34.59  ? 1321 LEU B N     1 
ATOM   4111  C  CA    . LEU A  1  522 ? 8.540   62.182 -24.360 1.00 35.74  ? 1321 LEU B CA    1 
ATOM   4112  C  C     . LEU A  1  522 ? 8.150   61.252 -23.228 1.00 34.73  ? 1321 LEU B C     1 
ATOM   4113  O  O     . LEU A  1  522 ? 8.742   60.164 -23.070 1.00 36.85  ? 1321 LEU B O     1 
ATOM   4114  C  CB    . LEU A  1  522 ? 9.484   63.283 -23.871 1.00 34.20  ? 1321 LEU B CB    1 
ATOM   4115  C  CG    . LEU A  1  522 ? 10.297  63.968 -24.990 1.00 35.15  ? 1321 LEU B CG    1 
ATOM   4116  C  CD1   . LEU A  1  522 ? 11.127  65.105 -24.366 1.00 34.74  ? 1321 LEU B CD1   1 
ATOM   4117  C  CD2   . LEU A  1  522 ? 11.177  62.913 -25.730 1.00 36.41  ? 1321 LEU B CD2   1 
ATOM   4118  N  N     . TYR A  1  523 ? 7.169   61.656 -22.407 1.00 34.45  ? 1322 TYR B N     1 
ATOM   4119  C  CA    . TYR A  1  523 ? 6.647   60.747 -21.389 1.00 37.49  ? 1322 TYR B CA    1 
ATOM   4120  C  C     . TYR A  1  523 ? 6.153   59.422 -21.999 1.00 40.74  ? 1322 TYR B C     1 
ATOM   4121  O  O     . TYR A  1  523 ? 6.333   58.376 -21.412 1.00 43.32  ? 1322 TYR B O     1 
ATOM   4122  C  CB    . TYR A  1  523 ? 5.479   61.395 -20.648 1.00 38.60  ? 1322 TYR B CB    1 
ATOM   4123  C  CG    . TYR A  1  523 ? 5.798   62.654 -19.876 1.00 37.28  ? 1322 TYR B CG    1 
ATOM   4124  C  CD1   . TYR A  1  523 ? 6.993   62.801 -19.194 1.00 35.02  ? 1322 TYR B CD1   1 
ATOM   4125  C  CD2   . TYR A  1  523 ? 4.881   63.696 -19.830 1.00 37.72  ? 1322 TYR B CD2   1 
ATOM   4126  C  CE1   . TYR A  1  523 ? 7.268   63.963 -18.491 1.00 36.94  ? 1322 TYR B CE1   1 
ATOM   4127  C  CE2   . TYR A  1  523 ? 5.166   64.853 -19.119 1.00 40.20  ? 1322 TYR B CE2   1 
ATOM   4128  C  CZ    . TYR A  1  523 ? 6.305   64.989 -18.482 1.00 37.87  ? 1322 TYR B CZ    1 
ATOM   4129  O  OH    . TYR A  1  523 ? 6.595   66.152 -17.758 1.00 40.55  ? 1322 TYR B OH    1 
ATOM   4130  N  N     . LYS A  1  524 ? 5.557   59.498 -23.183 1.00 40.38  ? 1323 LYS B N     1 
ATOM   4131  C  CA    . LYS A  1  524 ? 4.908   58.328 -23.775 1.00 43.41  ? 1323 LYS B CA    1 
ATOM   4132  C  C     . LYS A  1  524 ? 5.909   57.424 -24.470 1.00 44.66  ? 1323 LYS B C     1 
ATOM   4133  O  O     . LYS A  1  524 ? 5.723   56.186 -24.484 1.00 50.52  ? 1323 LYS B O     1 
ATOM   4134  C  CB    . LYS A  1  524 ? 3.827   58.715 -24.763 1.00 40.04  ? 1323 LYS B CB    1 
ATOM   4135  N  N     . GLN A  1  525 ? 6.935   57.992 -25.113 1.00 43.41  ? 1324 GLN B N     1 
ATOM   4136  C  CA    . GLN A  1  525 ? 7.892   57.196 -25.863 1.00 39.97  ? 1324 GLN B CA    1 
ATOM   4137  C  C     . GLN A  1  525 ? 9.262   56.931 -25.279 1.00 37.82  ? 1324 GLN B C     1 
ATOM   4138  O  O     . GLN A  1  525 ? 10.076  56.263 -25.901 1.00 39.15  ? 1324 GLN B O     1 
ATOM   4139  C  CB    . GLN A  1  525 ? 8.089   57.829 -27.234 1.00 41.01  ? 1324 GLN B CB    1 
ATOM   4140  C  CG    . GLN A  1  525 ? 6.786   58.323 -27.861 1.00 44.39  ? 1324 GLN B CG    1 
ATOM   4141  C  CD    . GLN A  1  525 ? 7.035   59.005 -29.181 1.00 48.13  ? 1324 GLN B CD    1 
ATOM   4142  O  OE1   . GLN A  1  525 ? 6.700   60.169 -29.362 1.00 52.70  ? 1324 GLN B OE1   1 
ATOM   4143  N  NE2   . GLN A  1  525 ? 7.659   58.267 -30.101 1.00 46.46  ? 1324 GLN B NE2   1 
ATOM   4144  N  N     . THR A  1  526 ? 9.532   57.470 -24.086 1.00 37.97  ? 1325 THR B N     1 
ATOM   4145  C  CA    . THR A  1  526 ? 10.818  57.290 -23.431 1.00 35.86  ? 1325 THR B CA    1 
ATOM   4146  C  C     . THR A  1  526 ? 10.603  56.912 -21.996 1.00 35.83  ? 1325 THR B C     1 
ATOM   4147  O  O     . THR A  1  526 ? 9.508   57.009 -21.478 1.00 32.99  ? 1325 THR B O     1 
ATOM   4148  C  CB    . THR A  1  526 ? 11.672  58.594 -23.520 1.00 36.99  ? 1325 THR B CB    1 
ATOM   4149  O  OG1   . THR A  1  526 ? 11.124  59.573 -22.602 1.00 35.18  ? 1325 THR B OG1   1 
ATOM   4150  C  CG2   . THR A  1  526 ? 11.639  59.181 -24.922 1.00 37.07  ? 1325 THR B CG2   1 
ATOM   4151  N  N     . PRO A  1  527 ? 11.666  56.501 -21.280 1.00 34.20  ? 1326 PRO B N     1 
ATOM   4152  C  CA    . PRO A  1  527 ? 11.579  56.311 -19.835 1.00 34.02  ? 1326 PRO B CA    1 
ATOM   4153  C  C     . PRO A  1  527 ? 11.406  57.567 -19.018 1.00 32.21  ? 1326 PRO B C     1 
ATOM   4154  O  O     . PRO A  1  527 ? 11.462  57.505 -17.800 1.00 33.86  ? 1326 PRO B O     1 
ATOM   4155  C  CB    . PRO A  1  527 ? 12.873  55.565 -19.491 1.00 34.58  ? 1326 PRO B CB    1 
ATOM   4156  C  CG    . PRO A  1  527 ? 13.343  54.984 -20.762 1.00 36.42  ? 1326 PRO B CG    1 
ATOM   4157  C  CD    . PRO A  1  527 ? 12.949  55.968 -21.810 1.00 36.39  ? 1326 PRO B CD    1 
ATOM   4158  N  N     . LEU A  1  528 ? 11.192  58.708 -19.677 1.00 33.78  ? 1327 LEU B N     1 
ATOM   4159  C  CA    . LEU A  1  528 ? 10.873  59.952 -18.944 1.00 30.21  ? 1327 LEU B CA    1 
ATOM   4160  C  C     . LEU A  1  528 ? 9.661   59.740 -18.052 1.00 30.77  ? 1327 LEU B C     1 
ATOM   4161  O  O     . LEU A  1  528 ? 9.504   60.398 -17.023 1.00 27.15  ? 1327 LEU B O     1 
ATOM   4162  C  CB    . LEU A  1  528 ? 10.687  61.102 -19.900 1.00 31.43  ? 1327 LEU B CB    1 
ATOM   4163  C  CG    . LEU A  1  528 ? 10.929  62.490 -19.329 1.00 34.14  ? 1327 LEU B CG    1 
ATOM   4164  C  CD1   . LEU A  1  528 ? 12.405  62.729 -19.057 1.00 33.20  ? 1327 LEU B CD1   1 
ATOM   4165  C  CD2   . LEU A  1  528 ? 10.394  63.564 -20.303 1.00 36.70  ? 1327 LEU B CD2   1 
ATOM   4166  N  N     . GLN A  1  529 ? 8.768   58.835 -18.467 1.00 33.16  ? 1328 GLN B N     1 
ATOM   4167  C  CA    . GLN A  1  529 ? 7.724   58.308 -17.597 1.00 34.26  ? 1328 GLN B CA    1 
ATOM   4168  C  C     . GLN A  1  529 ? 7.768   56.778 -17.710 1.00 34.20  ? 1328 GLN B C     1 
ATOM   4169  O  O     . GLN A  1  529 ? 7.795   56.234 -18.798 1.00 32.86  ? 1328 GLN B O     1 
ATOM   4170  C  CB    . GLN A  1  529 ? 6.331   58.821 -17.987 1.00 36.24  ? 1328 GLN B CB    1 
ATOM   4171  C  CG    . GLN A  1  529 ? 5.213   58.286 -17.144 1.00 38.81  ? 1328 GLN B CG    1 
ATOM   4172  C  CD    . GLN A  1  529 ? 3.844   58.824 -17.560 1.00 39.76  ? 1328 GLN B CD    1 
ATOM   4173  O  OE1   . GLN A  1  529 ? 3.714   59.967 -17.958 1.00 42.52  ? 1328 GLN B OE1   1 
ATOM   4174  N  NE2   . GLN A  1  529 ? 2.806   57.992 -17.412 1.00 37.68  ? 1328 GLN B NE2   1 
ATOM   4175  N  N     A THR A  1  530 ? 7.768   56.113 -16.553 0.50 33.98  ? 1329 THR B N     1 
ATOM   4176  N  N     B THR A  1  530 ? 7.857   56.100 -16.565 0.50 33.94  ? 1329 THR B N     1 
ATOM   4177  C  CA    A THR A  1  530 ? 7.899   54.672 -16.443 0.50 35.16  ? 1329 THR B CA    1 
ATOM   4178  C  CA    B THR A  1  530 ? 7.798   54.655 -16.542 0.50 34.89  ? 1329 THR B CA    1 
ATOM   4179  C  C     A THR A  1  530 ? 6.955   54.189 -15.347 0.50 35.25  ? 1329 THR B C     1 
ATOM   4180  C  C     B THR A  1  530 ? 6.880   54.215 -15.415 0.50 35.50  ? 1329 THR B C     1 
ATOM   4181  O  O     A THR A  1  530 ? 6.659   54.924 -14.399 0.50 34.86  ? 1329 THR B O     1 
ATOM   4182  O  O     B THR A  1  530 ? 6.551   54.987 -14.508 0.50 36.58  ? 1329 THR B O     1 
ATOM   4183  C  CB    A THR A  1  530 ? 9.353   54.314 -16.066 0.50 36.28  ? 1329 THR B CB    1 
ATOM   4184  C  CB    B THR A  1  530 ? 9.163   53.954 -16.346 0.50 35.87  ? 1329 THR B CB    1 
ATOM   4185  O  OG1   A THR A  1  530 ? 10.187  54.783 -17.068 0.50 37.30  ? 1329 THR B OG1   1 
ATOM   4186  O  OG1   B THR A  1  530 ? 9.662   54.238 -15.050 0.50 32.85  ? 1329 THR B OG1   1 
ATOM   4187  C  CG2   A THR A  1  530 ? 9.642   52.736 -15.904 0.50 36.14  ? 1329 THR B CG2   1 
ATOM   4188  C  CG2   B THR A  1  530 ? 10.131  54.424 -17.310 0.50 35.85  ? 1329 THR B CG2   1 
ATOM   4189  N  N     . SER A  1  531 ? 6.461   52.945 -15.511 1.00 34.41  ? 1330 SER B N     1 
ATOM   4190  C  CA    . SER A  1  531 ? 5.555   52.381 -14.516 1.00 32.88  ? 1330 SER B CA    1 
ATOM   4191  C  C     . SER A  1  531 ? 6.339   51.459 -13.572 1.00 30.74  ? 1330 SER B C     1 
ATOM   4192  O  O     . SER A  1  531 ? 7.250   50.776 -13.988 1.00 30.36  ? 1330 SER B O     1 
ATOM   4193  C  CB    . SER A  1  531 ? 4.408   51.618 -15.230 1.00 37.77  ? 1330 SER B CB    1 
ATOM   4194  O  OG    . SER A  1  531 ? 4.961   50.572 -16.011 1.00 44.24  ? 1330 SER B OG    1 
ATOM   4195  N  N     . PHE A  1  532 ? 5.953   51.472 -12.309 1.00 28.73  ? 1331 PHE B N     1 
ATOM   4196  C  CA    . PHE A  1  532 ? 6.432   50.507 -11.331 1.00 29.33  ? 1331 PHE B CA    1 
ATOM   4197  C  C     . PHE A  1  532 ? 5.321   49.449 -11.150 1.00 27.45  ? 1331 PHE B C     1 
ATOM   4198  O  O     . PHE A  1  532 ? 4.309   49.735 -10.542 1.00 26.99  ? 1331 PHE B O     1 
ATOM   4199  C  CB    . PHE A  1  532 ? 6.771   51.215 -10.005 1.00 28.31  ? 1331 PHE B CB    1 
ATOM   4200  C  CG    . PHE A  1  532 ? 7.533   50.335 -9.040  1.00 30.08  ? 1331 PHE B CG    1 
ATOM   4201  C  CD1   . PHE A  1  532 ? 6.893   49.333 -8.320  1.00 28.21  ? 1331 PHE B CD1   1 
ATOM   4202  C  CD2   . PHE A  1  532 ? 8.896   50.523 -8.915  1.00 26.82  ? 1331 PHE B CD2   1 
ATOM   4203  C  CE1   . PHE A  1  532 ? 7.606   48.524 -7.454  1.00 26.10  ? 1331 PHE B CE1   1 
ATOM   4204  C  CE2   . PHE A  1  532 ? 9.630   49.696 -7.993  1.00 25.76  ? 1331 PHE B CE2   1 
ATOM   4205  C  CZ    . PHE A  1  532 ? 8.986   48.709 -7.283  1.00 24.50  ? 1331 PHE B CZ    1 
ATOM   4206  N  N     . GLY A  1  533 ? 5.616   48.241 -11.621 1.00 26.31  ? 1332 GLY B N     1 
ATOM   4207  C  CA    . GLY A  1  533 ? 4.641   47.137 -11.391 1.00 25.75  ? 1332 GLY B CA    1 
ATOM   4208  C  C     . GLY A  1  533 ? 4.778   46.524 -10.035 1.00 25.58  ? 1332 GLY B C     1 
ATOM   4209  O  O     . GLY A  1  533 ? 5.622   45.656 -9.822  1.00 26.31  ? 1332 GLY B O     1 
ATOM   4210  N  N     . VAL A  1  534 ? 3.957   46.976 -9.106  1.00 26.22  ? 1333 VAL B N     1 
ATOM   4211  C  CA    . VAL A  1  534 ? 4.017   46.459 -7.717  1.00 25.38  ? 1333 VAL B CA    1 
ATOM   4212  C  C     . VAL A  1  534 ? 3.541   45.035 -7.699  1.00 25.33  ? 1333 VAL B C     1 
ATOM   4213  O  O     . VAL A  1  534 ? 2.545   44.669 -8.397  1.00 24.48  ? 1333 VAL B O     1 
ATOM   4214  C  CB    . VAL A  1  534 ? 3.194   47.366 -6.779  1.00 25.49  ? 1333 VAL B CB    1 
ATOM   4215  C  CG1   . VAL A  1  534 ? 3.262   46.820 -5.355  1.00 24.07  ? 1333 VAL B CG1   1 
ATOM   4216  C  CG2   . VAL A  1  534 ? 3.709   48.812 -6.823  1.00 23.94  ? 1333 VAL B CG2   1 
ATOM   4217  N  N     . ASN A  1  535 ? 4.275   44.180 -6.980  1.00 25.05  ? 1334 ASN B N     1 
ATOM   4218  C  CA    . ASN A  1  535 ? 3.995   42.744 -6.857  1.00 25.65  ? 1334 ASN B CA    1 
ATOM   4219  C  C     . ASN A  1  535 ? 4.665   42.285 -5.549  1.00 24.31  ? 1334 ASN B C     1 
ATOM   4220  O  O     . ASN A  1  535 ? 5.740   41.706 -5.555  1.00 23.89  ? 1334 ASN B O     1 
ATOM   4221  C  CB    . ASN A  1  535 ? 4.538   42.005 -8.062  1.00 26.00  ? 1334 ASN B CB    1 
ATOM   4222  C  CG    . ASN A  1  535 ? 4.164   40.512 -8.046  1.00 26.64  ? 1334 ASN B CG    1 
ATOM   4223  O  OD1   . ASN A  1  535 ? 3.096   40.128 -7.535  1.00 28.12  ? 1334 ASN B OD1   1 
ATOM   4224  N  ND2   . ASN A  1  535 ? 5.047   39.702 -8.630  1.00 26.87  ? 1334 ASN B ND2   1 
ATOM   4225  N  N     . MET A  1  536 ? 3.998   42.572 -4.426  1.00 25.36  ? 1335 MET B N     1 
ATOM   4226  C  CA    . MET A  1  536 ? 4.587   42.474 -3.104  1.00 25.05  ? 1335 MET B CA    1 
ATOM   4227  C  C     . MET A  1  536 ? 4.612   41.025 -2.629  1.00 24.96  ? 1335 MET B C     1 
ATOM   4228  O  O     . MET A  1  536 ? 3.641   40.512 -2.085  1.00 26.69  ? 1335 MET B O     1 
ATOM   4229  C  CB    . MET A  1  536 ? 3.859   43.362 -2.109  1.00 25.86  ? 1335 MET B CB    1 
ATOM   4230  C  CG    . MET A  1  536 ? 3.813   44.843 -2.564  1.00 25.97  ? 1335 MET B CG    1 
ATOM   4231  S  SD    . MET A  1  536 ? 3.722   45.999 -1.222  1.00 28.93  ? 1335 MET B SD    1 
ATOM   4232  C  CE    . MET A  1  536 ? 2.001   45.652 -0.599  1.00 25.81  ? 1335 MET B CE    1 
ATOM   4233  N  N     . ILE A  1  537 ? 5.718   40.324 -2.873  1.00 22.88  ? 1336 ILE B N     1 
ATOM   4234  C  CA    . ILE A  1  537 ? 5.898   38.960 -2.479  1.00 22.46  ? 1336 ILE B CA    1 
ATOM   4235  C  C     . ILE A  1  537 ? 7.138   38.872 -1.558  1.00 22.24  ? 1336 ILE B C     1 
ATOM   4236  O  O     . ILE A  1  537 ? 8.213   39.389 -1.896  1.00 21.90  ? 1336 ILE B O     1 
ATOM   4237  C  CB    . ILE A  1  537 ? 6.078   38.030 -3.682  1.00 21.74  ? 1336 ILE B CB    1 
ATOM   4238  C  CG1   . ILE A  1  537 ? 4.755   37.923 -4.458  1.00 22.55  ? 1336 ILE B CG1   1 
ATOM   4239  C  CG2   . ILE A  1  537 ? 6.582   36.623 -3.179  1.00 21.27  ? 1336 ILE B CG2   1 
ATOM   4240  C  CD1   . ILE A  1  537 ? 4.834   36.988 -5.644  1.00 22.22  ? 1336 ILE B CD1   1 
ATOM   4241  N  N     . ALA A  1  538 ? 6.934   38.297 -0.367  1.00 22.66  ? 1337 ALA B N     1 
ATOM   4242  C  CA    . ALA A  1  538 ? 8.011   38.201 0.592   1.00 23.41  ? 1337 ALA B CA    1 
ATOM   4243  C  C     . ALA A  1  538 ? 7.860   36.857 1.342   1.00 23.26  ? 1337 ALA B C     1 
ATOM   4244  O  O     . ALA A  1  538 ? 6.801   36.224 1.300   1.00 23.88  ? 1337 ALA B O     1 
ATOM   4245  C  CB    . ALA A  1  538 ? 8.018   39.355 1.582   1.00 25.25  ? 1337 ALA B CB    1 
ATOM   4246  N  N     . LEU A  1  539 ? 8.930   36.455 2.059   1.00 21.20  ? 1338 LEU B N     1 
ATOM   4247  C  CA    . LEU A  1  539 ? 8.884   35.240 2.779   1.00 20.36  ? 1338 LEU B CA    1 
ATOM   4248  C  C     . LEU A  1  539 ? 8.197   35.445 4.137   1.00 20.67  ? 1338 LEU B C     1 
ATOM   4249  O  O     . LEU A  1  539 ? 8.644   36.276 4.963   1.00 20.96  ? 1338 LEU B O     1 
ATOM   4250  C  CB    . LEU A  1  539 ? 10.320  34.712 3.069   1.00 19.12  ? 1338 LEU B CB    1 
ATOM   4251  C  CG    . LEU A  1  539 ? 11.072  34.322 1.736   1.00 19.49  ? 1338 LEU B CG    1 
ATOM   4252  C  CD1   . LEU A  1  539 ? 12.457  33.828 2.138   1.00 18.88  ? 1338 LEU B CD1   1 
ATOM   4253  C  CD2   . LEU A  1  539 ? 10.336  33.220 1.004   1.00 19.77  ? 1338 LEU B CD2   1 
ATOM   4254  N  N     . VAL A  1  540 ? 7.070   34.746 4.340   1.00 21.14  ? 1339 VAL B N     1 
ATOM   4255  C  CA    . VAL A  1  540 ? 6.356   34.781 5.617   1.00 22.31  ? 1339 VAL B CA    1 
ATOM   4256  C  C     . VAL A  1  540 ? 6.424   33.379 6.183   1.00 23.61  ? 1339 VAL B C     1 
ATOM   4257  O  O     . VAL A  1  540 ? 6.014   32.388 5.528   1.00 22.25  ? 1339 VAL B O     1 
ATOM   4258  C  CB    . VAL A  1  540 ? 4.870   35.170 5.403   1.00 23.17  ? 1339 VAL B CB    1 
ATOM   4259  C  CG1   . VAL A  1  540 ? 4.086   35.102 6.738   1.00 23.89  ? 1339 VAL B CG1   1 
ATOM   4260  C  CG2   . VAL A  1  540 ? 4.764   36.574 4.757   1.00 21.64  ? 1339 VAL B CG2   1 
ATOM   4261  N  N     . ASN A  1  541 ? 6.984   33.278 7.401   1.00 25.67  ? 1340 ASN B N     1 
ATOM   4262  C  CA    . ASN A  1  541 ? 7.278   31.997 8.048   1.00 28.17  ? 1340 ASN B CA    1 
ATOM   4263  C  C     . ASN A  1  541 ? 8.081   31.102 7.075   1.00 27.60  ? 1340 ASN B C     1 
ATOM   4264  O  O     . ASN A  1  541 ? 7.855   29.882 7.003   1.00 28.23  ? 1340 ASN B O     1 
ATOM   4265  C  CB    . ASN A  1  541 ? 6.021   31.241 8.519   1.00 32.98  ? 1340 ASN B CB    1 
ATOM   4266  C  CG    . ASN A  1  541 ? 5.145   32.071 9.387   1.00 37.07  ? 1340 ASN B CG    1 
ATOM   4267  O  OD1   . ASN A  1  541 ? 5.691   32.896 10.188  1.00 40.32  ? 1340 ASN B OD1   1 
ATOM   4268  N  ND2   . ASN A  1  541 ? 3.799   31.864 9.261   1.00 41.05  ? 1340 ASN B ND2   1 
ATOM   4269  N  N     . GLY A  1  542 ? 8.995   31.702 6.352   1.00 26.09  ? 1341 GLY B N     1 
ATOM   4270  C  CA    . GLY A  1  542 ? 9.859   30.942 5.505   1.00 26.37  ? 1341 GLY B CA    1 
ATOM   4271  C  C     . GLY A  1  542 ? 9.253   30.572 4.128   1.00 26.05  ? 1341 GLY B C     1 
ATOM   4272  O  O     . GLY A  1  542 ? 9.907   29.857 3.373   1.00 25.70  ? 1341 GLY B O     1 
ATOM   4273  N  N     . ARG A  1  543 ? 8.019   31.012 3.851   1.00 25.01  ? 1342 ARG B N     1 
ATOM   4274  C  CA    . ARG A  1  543 ? 7.396   30.649 2.617   1.00 26.10  ? 1342 ARG B CA    1 
ATOM   4275  C  C     . ARG A  1  543 ? 6.913   31.893 1.885   1.00 24.50  ? 1342 ARG B C     1 
ATOM   4276  O  O     . ARG A  1  543 ? 6.551   32.895 2.531   1.00 23.87  ? 1342 ARG B O     1 
ATOM   4277  C  CB    . ARG A  1  543 ? 6.154   29.731 2.924   1.00 28.41  ? 1342 ARG B CB    1 
ATOM   4278  C  CG    . ARG A  1  543 ? 6.498   28.513 3.763   1.00 29.96  ? 1342 ARG B CG    1 
ATOM   4279  C  CD    . ARG A  1  543 ? 5.259   27.737 4.093   1.00 34.29  ? 1342 ARG B CD    1 
ATOM   4280  N  NE    . ARG A  1  543 ? 5.551   26.575 4.975   1.00 39.52  ? 1342 ARG B NE    1 
ATOM   4281  C  CZ    . ARG A  1  543 ? 4.624   25.677 5.314   1.00 41.57  ? 1342 ARG B CZ    1 
ATOM   4282  N  NH1   . ARG A  1  543 ? 4.979   24.691 6.125   1.00 43.81  ? 1342 ARG B NH1   1 
ATOM   4283  N  NH2   . ARG A  1  543 ? 3.396   25.882 4.765   1.00 37.97  ? 1342 ARG B NH2   1 
ATOM   4284  N  N     . PRO A  1  544 ? 6.931   31.868 0.537   1.00 23.44  ? 1343 PRO B N     1 
ATOM   4285  C  CA    . PRO A  1  544 ? 6.526   33.077 -0.198  1.00 23.94  ? 1343 PRO B CA    1 
ATOM   4286  C  C     . PRO A  1  544 ? 5.019   33.311 -0.182  1.00 24.55  ? 1343 PRO B C     1 
ATOM   4287  O  O     . PRO A  1  544 ? 4.236   32.395 -0.303  1.00 23.29  ? 1343 PRO B O     1 
ATOM   4288  C  CB    . PRO A  1  544 ? 6.967   32.747 -1.628  1.00 23.09  ? 1343 PRO B CB    1 
ATOM   4289  C  CG    . PRO A  1  544 ? 6.833   31.193 -1.700  1.00 23.10  ? 1343 PRO B CG    1 
ATOM   4290  C  CD    . PRO A  1  544 ? 7.332   30.777 -0.333  1.00 23.55  ? 1343 PRO B CD    1 
ATOM   4291  N  N     A LYS A  1  545 ? 4.628   34.569 0.019   0.60 24.92  ? 1344 LYS B N     1 
ATOM   4292  N  N     B LYS A  1  545 ? 4.658   34.563 0.017   0.40 25.52  ? 1344 LYS B N     1 
ATOM   4293  C  CA    A LYS A  1  545 ? 3.226   34.968 0.014   0.60 25.69  ? 1344 LYS B CA    1 
ATOM   4294  C  CA    B LYS A  1  545 ? 3.275   34.969 -0.067  0.40 26.67  ? 1344 LYS B CA    1 
ATOM   4295  C  C     A LYS A  1  545 ? 3.108   36.339 -0.675  0.60 24.92  ? 1344 LYS B C     1 
ATOM   4296  C  C     B LYS A  1  545 ? 3.136   36.325 -0.737  0.40 25.79  ? 1344 LYS B C     1 
ATOM   4297  O  O     A LYS A  1  545 ? 3.956   37.208 -0.514  0.60 22.24  ? 1344 LYS B O     1 
ATOM   4298  O  O     B LYS A  1  545 ? 3.949   37.204 -0.564  0.40 23.73  ? 1344 LYS B O     1 
ATOM   4299  C  CB    A LYS A  1  545 ? 2.677   35.152 1.462   0.60 26.42  ? 1344 LYS B CB    1 
ATOM   4300  C  CB    B LYS A  1  545 ? 2.664   35.112 1.328   0.40 28.37  ? 1344 LYS B CB    1 
ATOM   4301  C  CG    A LYS A  1  545 ? 2.915   34.011 2.412   0.60 27.49  ? 1344 LYS B CG    1 
ATOM   4302  C  CG    B LYS A  1  545 ? 2.635   33.829 2.136   0.40 30.74  ? 1344 LYS B CG    1 
ATOM   4303  C  CD    A LYS A  1  545 ? 2.184   32.709 1.996   0.60 26.92  ? 1344 LYS B CD    1 
ATOM   4304  C  CD    B LYS A  1  545 ? 1.903   34.204 3.498   0.40 31.17  ? 1344 LYS B CD    1 
ATOM   4305  C  CE    A LYS A  1  545 ? 2.095   31.803 3.223   0.60 27.23  ? 1344 LYS B CE    1 
ATOM   4306  C  CE    B LYS A  1  545 ? 1.021   33.143 4.088   0.40 30.91  ? 1344 LYS B CE    1 
ATOM   4307  N  NZ    A LYS A  1  545 ? 2.246   30.390 2.712   0.60 25.40  ? 1344 LYS B NZ    1 
ATOM   4308  N  NZ    B LYS A  1  545 ? 0.190   33.929 5.056   0.40 32.56  ? 1344 LYS B NZ    1 
ATOM   4309  N  N     . LEU A  1  546 ? 2.040   36.493 -1.469  1.00 25.45  ? 1345 LEU B N     1 
ATOM   4310  C  CA    . LEU A  1  546 ? 1.627   37.821 -1.884  1.00 25.77  ? 1345 LEU B CA    1 
ATOM   4311  C  C     . LEU A  1  546 ? 0.874   38.495 -0.768  1.00 26.83  ? 1345 LEU B C     1 
ATOM   4312  O  O     . LEU A  1  546 ? -0.092  37.932 -0.213  1.00 29.68  ? 1345 LEU B O     1 
ATOM   4313  C  CB    . LEU A  1  546 ? 0.719   37.714 -3.142  1.00 26.03  ? 1345 LEU B CB    1 
ATOM   4314  C  CG    . LEU A  1  546 ? 0.256   39.023 -3.749  1.00 26.85  ? 1345 LEU B CG    1 
ATOM   4315  C  CD1   . LEU A  1  546 ? 1.414   39.771 -4.382  1.00 26.18  ? 1345 LEU B CD1   1 
ATOM   4316  C  CD2   . LEU A  1  546 ? -0.868  38.694 -4.772  1.00 26.27  ? 1345 LEU B CD2   1 
ATOM   4317  N  N     . ILE A  1  547 ? 1.331   39.688 -0.378  1.00 25.38  ? 1346 ILE B N     1 
ATOM   4318  C  CA    . ILE A  1  547 ? 0.827   40.349 0.839   1.00 26.44  ? 1346 ILE B CA    1 
ATOM   4319  C  C     . ILE A  1  547 ? 0.404   41.771 0.442   1.00 28.58  ? 1346 ILE B C     1 
ATOM   4320  O  O     . ILE A  1  547 ? 0.984   42.404 -0.465  1.00 29.68  ? 1346 ILE B O     1 
ATOM   4321  C  CB    . ILE A  1  547 ? 1.828   40.371 1.964   1.00 24.89  ? 1346 ILE B CB    1 
ATOM   4322  C  CG1   . ILE A  1  547 ? 3.051   41.186 1.583   1.00 25.98  ? 1346 ILE B CG1   1 
ATOM   4323  C  CG2   . ILE A  1  547 ? 2.222   38.923 2.345   1.00 25.89  ? 1346 ILE B CG2   1 
ATOM   4324  C  CD1   . ILE A  1  547 ? 4.171   41.257 2.644   1.00 26.14  ? 1346 ILE B CD1   1 
ATOM   4325  N  N     . ASN A  1  548 ? -0.623  42.278 1.136   1.00 28.55  ? 1347 ASN B N     1 
ATOM   4326  C  CA    . ASN A  1  548 ? -1.023  43.662 0.985   1.00 28.25  ? 1347 ASN B CA    1 
ATOM   4327  C  C     . ASN A  1  548 ? -0.322  44.511 2.028   1.00 26.61  ? 1347 ASN B C     1 
ATOM   4328  O  O     . ASN A  1  548 ? 0.435   44.011 2.856   1.00 23.53  ? 1347 ASN B O     1 
ATOM   4329  C  CB    . ASN A  1  548 ? -2.560  43.772 1.064   1.00 30.63  ? 1347 ASN B CB    1 
ATOM   4330  C  CG    . ASN A  1  548 ? -3.141  43.268 2.375   1.00 30.53  ? 1347 ASN B CG    1 
ATOM   4331  O  OD1   . ASN A  1  548 ? -2.663  43.588 3.457   1.00 30.92  ? 1347 ASN B OD1   1 
ATOM   4332  N  ND2   . ASN A  1  548 ? -4.201  42.475 2.279   1.00 33.43  ? 1347 ASN B ND2   1 
ATOM   4333  N  N     . LEU A  1  549 ? -0.569  45.822 2.006   1.00 26.05  ? 1348 LEU B N     1 
ATOM   4334  C  CA    . LEU A  1  549 ? 0.177   46.740 2.874   1.00 25.70  ? 1348 LEU B CA    1 
ATOM   4335  C  C     . LEU A  1  549 ? -0.085  46.409 4.331   1.00 26.31  ? 1348 LEU B C     1 
ATOM   4336  O  O     . LEU A  1  549 ? 0.863   46.419 5.157   1.00 26.06  ? 1348 LEU B O     1 
ATOM   4337  C  CB    . LEU A  1  549 ? -0.220  48.184 2.576   1.00 25.96  ? 1348 LEU B CB    1 
ATOM   4338  C  CG    . LEU A  1  549 ? 0.364   49.222 3.546   1.00 26.80  ? 1348 LEU B CG    1 
ATOM   4339  C  CD1   . LEU A  1  549 ? 1.885   49.242 3.415   1.00 26.36  ? 1348 LEU B CD1   1 
ATOM   4340  C  CD2   . LEU A  1  549 ? -0.267  50.606 3.276   1.00 28.09  ? 1348 LEU B CD2   1 
ATOM   4341  N  N     . LYS A  1  550 ? -1.356  46.145 4.715   1.00 26.55  ? 1349 LYS B N     1 
ATOM   4342  C  CA    . LYS A  1  550 ? -1.602  45.874 6.125   1.00 26.48  ? 1349 LYS B CA    1 
ATOM   4343  C  C     . LYS A  1  550 ? -0.961  44.560 6.583   1.00 25.34  ? 1349 LYS B C     1 
ATOM   4344  O  O     . LYS A  1  550 ? -0.430  44.508 7.695   1.00 23.72  ? 1349 LYS B O     1 
ATOM   4345  C  CB    . LYS A  1  550 ? -3.108  45.821 6.402   1.00 27.12  ? 1349 LYS B CB    1 
ATOM   4346  C  CG    . LYS A  1  550 ? -3.400  45.671 7.904   1.00 26.58  ? 1349 LYS B CG    1 
ATOM   4347  C  CD    . LYS A  1  550 ? -4.894  45.555 8.194   1.00 27.65  ? 1349 LYS B CD    1 
ATOM   4348  C  CE    . LYS A  1  550 ? -5.075  45.202 9.687   1.00 28.05  ? 1349 LYS B CE    1 
ATOM   4349  N  NZ    . LYS A  1  550 ? -6.505  45.297 10.103  1.00 30.28  ? 1349 LYS B NZ    1 
ATOM   4350  N  N     A GLU A  1  551 ? -0.991  43.529 5.748   0.50 25.72  ? 1350 GLU B N     1 
ATOM   4351  N  N     B GLU A  1  551 ? -0.971  43.533 5.749   0.50 26.16  ? 1350 GLU B N     1 
ATOM   4352  C  CA    A GLU A  1  551 ? -0.325  42.273 6.079   0.50 26.99  ? 1350 GLU B CA    1 
ATOM   4353  C  CA    B GLU A  1  551 ? -0.325  42.281 6.126   0.50 27.81  ? 1350 GLU B CA    1 
ATOM   4354  C  C     A GLU A  1  551 ? 1.163   42.487 6.299   0.50 26.34  ? 1350 GLU B C     1 
ATOM   4355  C  C     B GLU A  1  551 ? 1.175   42.474 6.299   0.50 26.87  ? 1350 GLU B C     1 
ATOM   4356  O  O     A GLU A  1  551 ? 1.734   41.919 7.238   0.50 25.91  ? 1350 GLU B O     1 
ATOM   4357  O  O     B GLU A  1  551 ? 1.764   41.891 7.216   0.50 26.53  ? 1350 GLU B O     1 
ATOM   4358  C  CB    A GLU A  1  551 ? -0.519  41.237 4.956   0.50 27.73  ? 1350 GLU B CB    1 
ATOM   4359  C  CB    B GLU A  1  551 ? -0.585  41.185 5.080   0.50 29.41  ? 1350 GLU B CB    1 
ATOM   4360  C  CG    A GLU A  1  551 ? -1.958  40.763 4.759   0.50 29.64  ? 1350 GLU B CG    1 
ATOM   4361  C  CG    B GLU A  1  551 ? 0.247   39.948 5.338   0.50 32.02  ? 1350 GLU B CG    1 
ATOM   4362  C  CD    A GLU A  1  551 ? -2.089  39.758 3.651   0.50 31.18  ? 1350 GLU B CD    1 
ATOM   4363  C  CD    B GLU A  1  551 ? -0.322  38.702 4.721   0.50 35.29  ? 1350 GLU B CD    1 
ATOM   4364  O  OE1   A GLU A  1  551 ? -2.281  38.599 3.871   0.50 34.36  ? 1350 GLU B OE1   1 
ATOM   4365  O  OE1   B GLU A  1  551 ? -1.419  38.786 4.092   0.50 38.41  ? 1350 GLU B OE1   1 
ATOM   4366  O  OE2   A GLU A  1  551 ? -2.350  40.160 2.516   0.50 33.16  ? 1350 GLU B OE2   1 
ATOM   4367  O  OE2   B GLU A  1  551 ? 0.289   37.631 4.894   0.50 36.85  ? 1350 GLU B OE2   1 
ATOM   4368  N  N     . ALA A  1  552 ? 1.795   43.281 5.440   1.00 26.66  ? 1351 ALA B N     1 
ATOM   4369  C  CA    . ALA A  1  552 ? 3.229   43.558 5.602   1.00 24.61  ? 1351 ALA B CA    1 
ATOM   4370  C  C     . ALA A  1  552 ? 3.513   44.262 6.932   1.00 25.02  ? 1351 ALA B C     1 
ATOM   4371  O  O     . ALA A  1  552 ? 4.498   43.982 7.587   1.00 24.02  ? 1351 ALA B O     1 
ATOM   4372  C  CB    . ALA A  1  552 ? 3.738   44.397 4.409   1.00 23.92  ? 1351 ALA B CB    1 
ATOM   4373  N  N     . LEU A  1  553 ? 2.651   45.186 7.312   1.00 25.41  ? 1352 LEU B N     1 
ATOM   4374  C  CA    . LEU A  1  553 ? 2.834   45.920 8.580   1.00 26.29  ? 1352 LEU B CA    1 
ATOM   4375  C  C     . LEU A  1  553 ? 2.516   45.034 9.783   1.00 25.69  ? 1352 LEU B C     1 
ATOM   4376  O  O     . LEU A  1  553 ? 3.172   45.180 10.835  1.00 26.05  ? 1352 LEU B O     1 
ATOM   4377  C  CB    . LEU A  1  553 ? 1.966   47.176 8.605   1.00 25.37  ? 1352 LEU B CB    1 
ATOM   4378  C  CG    . LEU A  1  553 ? 2.316   48.217 7.535   1.00 27.10  ? 1352 LEU B CG    1 
ATOM   4379  C  CD1   . LEU A  1  553 ? 1.251   49.332 7.552   1.00 25.76  ? 1352 LEU B CD1   1 
ATOM   4380  C  CD2   . LEU A  1  553 ? 3.746   48.763 7.755   1.00 25.72  ? 1352 LEU B CD2   1 
ATOM   4381  N  N     . VAL A  1  554 ? 1.533   44.119 9.667   1.00 25.67  ? 1353 VAL B N     1 
ATOM   4382  C  CA    . VAL A  1  554 ? 1.208   43.249 10.776  1.00 27.09  ? 1353 VAL B CA    1 
ATOM   4383  C  C     . VAL A  1  554 ? 2.360   42.289 11.075  1.00 26.53  ? 1353 VAL B C     1 
ATOM   4384  O  O     . VAL A  1  554 ? 2.747   42.106 12.238  1.00 25.71  ? 1353 VAL B O     1 
ATOM   4385  C  CB    . VAL A  1  554 ? -0.098  42.468 10.471  1.00 27.95  ? 1353 VAL B CB    1 
ATOM   4386  C  CG1   . VAL A  1  554 ? -0.224  41.265 11.467  1.00 29.22  ? 1353 VAL B CG1   1 
ATOM   4387  C  CG2   . VAL A  1  554 ? -1.310  43.397 10.649  1.00 30.15  ? 1353 VAL B CG2   1 
ATOM   4388  N  N     . HIS A  1  555 ? 2.914   41.667 10.042  1.00 25.90  ? 1354 HIS B N     1 
ATOM   4389  C  CA    . HIS A  1  555 ? 4.045   40.753 10.265  1.00 25.46  ? 1354 HIS B CA    1 
ATOM   4390  C  C     . HIS A  1  555 ? 5.262   41.511 10.823  1.00 24.51  ? 1354 HIS B C     1 
ATOM   4391  O  O     . HIS A  1  555 ? 5.998   40.965 11.639  1.00 26.91  ? 1354 HIS B O     1 
ATOM   4392  C  CB    . HIS A  1  555 ? 4.459   40.089 8.932   1.00 24.79  ? 1354 HIS B CB    1 
ATOM   4393  C  CG    . HIS A  1  555 ? 3.458   39.119 8.413   1.00 27.93  ? 1354 HIS B CG    1 
ATOM   4394  N  ND1   . HIS A  1  555 ? 2.981   38.100 9.188   1.00 27.99  ? 1354 HIS B ND1   1 
ATOM   4395  C  CD2   . HIS A  1  555 ? 2.820   39.023 7.237   1.00 26.38  ? 1354 HIS B CD2   1 
ATOM   4396  C  CE1   . HIS A  1  555 ? 2.056   37.411 8.529   1.00 28.80  ? 1354 HIS B CE1   1 
ATOM   4397  N  NE2   . HIS A  1  555 ? 1.954   37.935 7.323   1.00 29.28  ? 1354 HIS B NE2   1 
ATOM   4398  N  N     . TYR A  1  556 ? 5.487   42.744 10.390  1.00 24.29  ? 1355 TYR B N     1 
ATOM   4399  C  CA    . TYR A  1  556 ? 6.604   43.486 10.949  1.00 24.44  ? 1355 TYR B CA    1 
ATOM   4400  C  C     . TYR A  1  556 ? 6.361   43.878 12.404  1.00 24.44  ? 1355 TYR B C     1 
ATOM   4401  O  O     . TYR A  1  556 ? 7.267   43.792 13.233  1.00 24.39  ? 1355 TYR B O     1 
ATOM   4402  C  CB    . TYR A  1  556 ? 6.882   44.785 10.137  1.00 26.07  ? 1355 TYR B CB    1 
ATOM   4403  C  CG    . TYR A  1  556 ? 7.934   45.591 10.800  1.00 25.76  ? 1355 TYR B CG    1 
ATOM   4404  C  CD1   . TYR A  1  556 ? 9.262   45.195 10.860  1.00 25.86  ? 1355 TYR B CD1   1 
ATOM   4405  C  CD2   . TYR A  1  556 ? 7.547   46.773 11.552  1.00 26.46  ? 1355 TYR B CD2   1 
ATOM   4406  C  CE1   . TYR A  1  556 ? 10.203  45.963 11.542  1.00 26.54  ? 1355 TYR B CE1   1 
ATOM   4407  C  CE2   . TYR A  1  556 ? 8.491   47.512 12.226  1.00 25.77  ? 1355 TYR B CE2   1 
ATOM   4408  C  CZ    . TYR A  1  556 ? 9.830   47.090 12.211  1.00 26.50  ? 1355 TYR B CZ    1 
ATOM   4409  O  OH    . TYR A  1  556 ? 10.767  47.831 12.890  1.00 27.71  ? 1355 TYR B OH    1 
ATOM   4410  N  N     . LEU A  1  557 ? 5.137   44.295 12.716  1.00 25.54  ? 1356 LEU B N     1 
ATOM   4411  C  CA    . LEU A  1  557 ? 4.830   44.644 14.108  1.00 25.54  ? 1356 LEU B CA    1 
ATOM   4412  C  C     . LEU A  1  557 ? 4.953   43.429 15.017  1.00 25.67  ? 1356 LEU B C     1 
ATOM   4413  O  O     . LEU A  1  557 ? 5.460   43.528 16.126  1.00 26.41  ? 1356 LEU B O     1 
ATOM   4414  C  CB    . LEU A  1  557 ? 3.403   45.240 14.211  1.00 24.61  ? 1356 LEU B CB    1 
ATOM   4415  C  CG    . LEU A  1  557 ? 2.984   45.575 15.628  1.00 25.90  ? 1356 LEU B CG    1 
ATOM   4416  C  CD1   . LEU A  1  557 ? 3.926   46.496 16.406  1.00 25.97  ? 1356 LEU B CD1   1 
ATOM   4417  C  CD2   . LEU A  1  557 ? 1.514   46.161 15.557  1.00 26.71  ? 1356 LEU B CD2   1 
ATOM   4418  N  N     . GLU A  1  558 ? 4.484   42.251 14.554  1.00 27.09  ? 1357 GLU B N     1 
ATOM   4419  C  CA    . GLU A  1  558 ? 4.641   41.048 15.324  1.00 26.30  ? 1357 GLU B CA    1 
ATOM   4420  C  C     . GLU A  1  558 ? 6.111   40.701 15.521  1.00 27.69  ? 1357 GLU B C     1 
ATOM   4421  O  O     . GLU A  1  558 ? 6.499   40.193 16.600  1.00 26.51  ? 1357 GLU B O     1 
ATOM   4422  C  CB    . GLU A  1  558 ? 3.929   39.880 14.669  1.00 28.61  ? 1357 GLU B CB    1 
ATOM   4423  C  CG    . GLU A  1  558 ? 2.398   39.961 14.780  1.00 31.55  ? 1357 GLU B CG    1 
ATOM   4424  C  CD    . GLU A  1  558 ? 1.953   40.198 16.210  1.00 35.76  ? 1357 GLU B CD    1 
ATOM   4425  O  OE1   . GLU A  1  558 ? 1.295   41.199 16.447  1.00 38.11  ? 1357 GLU B OE1   1 
ATOM   4426  O  OE2   . GLU A  1  558 ? 2.311   39.392 17.098  1.00 36.20  ? 1357 GLU B OE2   1 
ATOM   4427  N  N     . HIS A  1  559 ? 6.936   40.967 14.500  1.00 25.96  ? 1358 HIS B N     1 
ATOM   4428  C  CA    . HIS A  1  559 ? 8.370   40.761 14.640  1.00 25.01  ? 1358 HIS B CA    1 
ATOM   4429  C  C     . HIS A  1  559 ? 8.956   41.635 15.738  1.00 24.90  ? 1358 HIS B C     1 
ATOM   4430  O  O     . HIS A  1  559 ? 9.795   41.174 16.527  1.00 24.16  ? 1358 HIS B O     1 
ATOM   4431  C  CB    . HIS A  1  559 ? 9.059   41.031 13.292  1.00 24.80  ? 1358 HIS B CB    1 
ATOM   4432  C  CG    . HIS A  1  559 ? 10.542  40.791 13.319  1.00 24.66  ? 1358 HIS B CG    1 
ATOM   4433  N  ND1   . HIS A  1  559 ? 11.109  39.651 13.851  1.00 25.35  ? 1358 HIS B ND1   1 
ATOM   4434  C  CD2   . HIS A  1  559 ? 11.560  41.545 12.846  1.00 25.05  ? 1358 HIS B CD2   1 
ATOM   4435  C  CE1   . HIS A  1  559 ? 12.426  39.717 13.707  1.00 25.44  ? 1358 HIS B CE1   1 
ATOM   4436  N  NE2   . HIS A  1  559 ? 12.732  40.867 13.104  1.00 25.98  ? 1358 HIS B NE2   1 
ATOM   4437  N  N     . GLN A  1  560 ? 8.516   42.892 15.819  1.00 24.61  ? 1359 GLN B N     1 
ATOM   4438  C  CA    . GLN A  1  560 ? 9.052   43.800 16.829  1.00 25.97  ? 1359 GLN B CA    1 
ATOM   4439  C  C     . GLN A  1  560 ? 8.588   43.406 18.241  1.00 27.29  ? 1359 GLN B C     1 
ATOM   4440  O  O     . GLN A  1  560 ? 9.371   43.469 19.193  1.00 27.81  ? 1359 GLN B O     1 
ATOM   4441  C  CB    . GLN A  1  560 ? 8.622   45.231 16.532  1.00 25.99  ? 1359 GLN B CB    1 
ATOM   4442  C  CG    . GLN A  1  560 ? 9.169   45.751 15.227  1.00 25.60  ? 1359 GLN B CG    1 
ATOM   4443  C  CD    . GLN A  1  560 ? 10.681  45.561 15.135  1.00 25.91  ? 1359 GLN B CD    1 
ATOM   4444  O  OE1   . GLN A  1  560 ? 11.454  46.251 15.846  1.00 27.07  ? 1359 GLN B OE1   1 
ATOM   4445  N  NE2   . GLN A  1  560 ? 11.114  44.629 14.289  1.00 25.71  ? 1359 GLN B NE2   1 
ATOM   4446  N  N     . LYS A  1  561 ? 7.311   42.998 18.388  1.00 27.17  ? 1360 LYS B N     1 
ATOM   4447  C  CA    . LYS A  1  561 ? 6.849   42.552 19.684  1.00 28.87  ? 1360 LYS B CA    1 
ATOM   4448  C  C     . LYS A  1  561 ? 7.668   41.344 20.156  1.00 29.10  ? 1360 LYS B C     1 
ATOM   4449  O  O     . LYS A  1  561 ? 8.015   41.254 21.342  1.00 27.55  ? 1360 LYS B O     1 
ATOM   4450  C  CB    . LYS A  1  561 ? 5.358   42.148 19.593  1.00 30.60  ? 1360 LYS B CB    1 
ATOM   4451  C  CG    . LYS A  1  561 ? 4.458   43.367 19.335  1.00 31.81  ? 1360 LYS B CG    1 
ATOM   4452  C  CD    . LYS A  1  561 ? 3.115   42.931 18.762  1.00 34.03  ? 1360 LYS B CD    1 
ATOM   4453  C  CE    . LYS A  1  561 ? 2.283   42.178 19.766  1.00 36.64  ? 1360 LYS B CE    1 
ATOM   4454  N  NZ    . LYS A  1  561 ? 0.918   41.906 19.187  1.00 40.12  ? 1360 LYS B NZ    1 
ATOM   4455  N  N     . THR A  1  562 ? 7.990   40.418 19.256  1.00 27.55  ? 1361 THR B N     1 
ATOM   4456  C  CA    . THR A  1  562 ? 8.755   39.257 19.634  1.00 30.31  ? 1361 THR B CA    1 
ATOM   4457  C  C     . THR A  1  562 ? 10.197  39.593 19.958  1.00 29.97  ? 1361 THR B C     1 
ATOM   4458  O  O     . THR A  1  562 ? 10.771  39.020 20.900  1.00 28.15  ? 1361 THR B O     1 
ATOM   4459  C  CB    . THR A  1  562 ? 8.744   38.211 18.483  1.00 31.55  ? 1361 THR B CB    1 
ATOM   4460  O  OG1   . THR A  1  562 ? 7.367   37.882 18.200  1.00 34.31  ? 1361 THR B OG1   1 
ATOM   4461  C  CG2   . THR A  1  562 ? 9.510   36.967 18.819  1.00 32.67  ? 1361 THR B CG2   1 
ATOM   4462  N  N     . VAL A  1  563 ? 10.808  40.524 19.191  1.00 32.09  ? 1362 VAL B N     1 
ATOM   4463  C  CA    . VAL A  1  563 ? 12.166  40.927 19.462  1.00 30.43  ? 1362 VAL B CA    1 
ATOM   4464  C  C     . VAL A  1  563 ? 12.261  41.605 20.838  1.00 30.53  ? 1362 VAL B C     1 
ATOM   4465  O  O     . VAL A  1  563 ? 13.113  41.261 21.655  1.00 28.91  ? 1362 VAL B O     1 
ATOM   4466  C  CB    . VAL A  1  563 ? 12.678  41.873 18.360  1.00 29.82  ? 1362 VAL B CB    1 
ATOM   4467  C  CG1   . VAL A  1  563 ? 13.940  42.628 18.820  1.00 28.97  ? 1362 VAL B CG1   1 
ATOM   4468  C  CG2   . VAL A  1  563 ? 12.999  41.053 17.099  1.00 28.27  ? 1362 VAL B CG2   1 
ATOM   4469  N  N     . VAL A  1  564 ? 11.358  42.560 21.099  1.00 31.56  ? 1363 VAL B N     1 
ATOM   4470  C  CA    . VAL A  1  564 ? 11.421  43.311 22.339  1.00 32.52  ? 1363 VAL B CA    1 
ATOM   4471  C  C     . VAL A  1  564 ? 11.073  42.403 23.529  1.00 33.98  ? 1363 VAL B C     1 
ATOM   4472  O  O     . VAL A  1  564 ? 11.658  42.521 24.614  1.00 33.02  ? 1363 VAL B O     1 
ATOM   4473  C  CB    . VAL A  1  564 ? 10.543  44.542 22.276  1.00 32.53  ? 1363 VAL B CB    1 
ATOM   4474  C  CG1   . VAL A  1  564 ? 10.618  45.308 23.634  1.00 35.03  ? 1363 VAL B CG1   1 
ATOM   4475  C  CG2   . VAL A  1  564 ? 11.016  45.460 21.128  1.00 36.40  ? 1363 VAL B CG2   1 
ATOM   4476  N  N     . ARG A  1  565 ? 10.129  41.487 23.335  1.00 32.84  ? 1364 ARG B N     1 
ATOM   4477  C  CA    . ARG A  1  565 ? 9.814   40.532 24.398  1.00 32.99  ? 1364 ARG B CA    1 
ATOM   4478  C  C     . ARG A  1  565 ? 11.022  39.648 24.700  1.00 32.39  ? 1364 ARG B C     1 
ATOM   4479  O  O     . ARG A  1  565 ? 11.358  39.419 25.861  1.00 31.25  ? 1364 ARG B O     1 
ATOM   4480  C  CB    . ARG A  1  565 ? 8.613   39.661 23.992  1.00 34.44  ? 1364 ARG B CB    1 
ATOM   4481  C  CG    . ARG A  1  565 ? 8.172   38.706 25.080  1.00 37.80  ? 1364 ARG B CG    1 
ATOM   4482  C  CD    . ARG A  1  565 ? 7.041   37.793 24.673  1.00 41.43  ? 1364 ARG B CD    1 
ATOM   4483  N  NE    . ARG A  1  565 ? 5.844   38.442 24.123  1.00 45.81  ? 1364 ARG B NE    1 
ATOM   4484  C  CZ    . ARG A  1  565 ? 5.511   38.454 22.819  1.00 52.58  ? 1364 ARG B CZ    1 
ATOM   4485  N  NH1   . ARG A  1  565 ? 6.178   37.763 21.930  1.00 52.50  ? 1364 ARG B NH1   1 
ATOM   4486  N  NH2   . ARG A  1  565 ? 4.488   39.133 22.383  1.00 58.55  ? 1364 ARG B NH2   1 
ATOM   4487  N  N     . ARG A  1  566 ? 11.669  39.108 23.654  1.00 31.41  ? 1365 ARG B N     1 
ATOM   4488  C  CA    . ARG A  1  566 ? 12.814  38.237 23.867  1.00 31.41  ? 1365 ARG B CA    1 
ATOM   4489  C  C     . ARG A  1  566 ? 14.001  39.000 24.454  1.00 30.31  ? 1365 ARG B C     1 
ATOM   4490  O  O     . ARG A  1  566 ? 14.755  38.451 25.267  1.00 32.59  ? 1365 ARG B O     1 
ATOM   4491  C  CB    . ARG A  1  566 ? 13.230  37.575 22.541  1.00 29.45  ? 1365 ARG B CB    1 
ATOM   4492  C  CG    . ARG A  1  566 ? 12.306  36.416 22.151  1.00 31.64  ? 1365 ARG B CG    1 
ATOM   4493  C  CD    . ARG A  1  566 ? 12.750  35.772 20.839  1.00 31.18  ? 1365 ARG B CD    1 
ATOM   4494  N  NE    . ARG A  1  566 ? 14.113  35.204 20.936  1.00 30.89  ? 1365 ARG B NE    1 
ATOM   4495  C  CZ    . ARG A  1  566 ? 14.654  34.389 20.051  1.00 30.20  ? 1365 ARG B CZ    1 
ATOM   4496  N  NH1   . ARG A  1  566 ? 13.925  34.020 18.957  1.00 29.88  ? 1365 ARG B NH1   1 
ATOM   4497  N  NH2   . ARG A  1  566 ? 15.874  33.941 20.222  1.00 29.07  ? 1365 ARG B NH2   1 
ATOM   4498  N  N     . ARG A  1  567 ? 14.198  40.258 24.040  1.00 29.60  ? 1366 ARG B N     1 
ATOM   4499  C  CA    . ARG A  1  567 ? 15.240  41.069 24.635  1.00 30.64  ? 1366 ARG B CA    1 
ATOM   4500  C  C     . ARG A  1  567 ? 14.990  41.290 26.126  1.00 31.56  ? 1366 ARG B C     1 
ATOM   4501  O  O     . ARG A  1  567 ? 15.920  41.236 26.934  1.00 31.27  ? 1366 ARG B O     1 
ATOM   4502  C  CB    . ARG A  1  567 ? 15.319  42.419 23.923  1.00 31.54  ? 1366 ARG B CB    1 
ATOM   4503  C  CG    . ARG A  1  567 ? 16.438  43.319 24.412  1.00 32.78  ? 1366 ARG B CG    1 
ATOM   4504  C  CD    . ARG A  1  567 ? 16.239  44.706 23.878  1.00 33.10  ? 1366 ARG B CD    1 
ATOM   4505  N  NE    . ARG A  1  567 ? 15.170  45.451 24.599  1.00 34.08  ? 1366 ARG B NE    1 
ATOM   4506  C  CZ    . ARG A  1  567 ? 14.496  46.451 24.051  1.00 34.17  ? 1366 ARG B CZ    1 
ATOM   4507  N  NH1   . ARG A  1  567 ? 14.730  46.835 22.805  1.00 31.30  ? 1366 ARG B NH1   1 
ATOM   4508  N  NH2   . ARG A  1  567 ? 13.555  47.049 24.740  1.00 36.29  ? 1366 ARG B NH2   1 
ATOM   4509  N  N     . THR A  1  568 ? 13.730  41.541 26.493  1.00 31.73  ? 1367 THR B N     1 
ATOM   4510  C  CA    . THR A  1  568 ? 13.363  41.774 27.898  1.00 31.11  ? 1367 THR B CA    1 
ATOM   4511  C  C     . THR A  1  568 ? 13.612  40.522 28.725  1.00 32.53  ? 1367 THR B C     1 
ATOM   4512  O  O     . THR A  1  568 ? 14.130  40.606 29.858  1.00 32.67  ? 1367 THR B O     1 
ATOM   4513  C  CB    . THR A  1  568 ? 11.935  42.225 27.988  1.00 32.06  ? 1367 THR B CB    1 
ATOM   4514  O  OG1   . THR A  1  568 ? 11.784  43.481 27.251  1.00 33.20  ? 1367 THR B OG1   1 
ATOM   4515  C  CG2   . THR A  1  568 ? 11.541  42.478 29.441  1.00 32.23  ? 1367 THR B CG2   1 
ATOM   4516  N  N     . GLN A  1  569 ? 13.233  39.348 28.205  1.00 32.03  ? 1368 GLN B N     1 
ATOM   4517  C  CA    . GLN A  1  569 ? 13.486  38.111 28.910  1.00 32.82  ? 1368 GLN B CA    1 
ATOM   4518  C  C     . GLN A  1  569 ? 14.991  37.844 29.054  1.00 31.73  ? 1368 GLN B C     1 
ATOM   4519  O  O     . GLN A  1  569 ? 15.452  37.394 30.103  1.00 30.71  ? 1368 GLN B O     1 
ATOM   4520  C  CB    . GLN A  1  569 ? 12.797  36.945 28.196  1.00 32.42  ? 1368 GLN B CB    1 
ATOM   4521  C  CG    . GLN A  1  569 ? 11.301  37.027 28.218  1.00 36.17  ? 1368 GLN B CG    1 
ATOM   4522  C  CD    . GLN A  1  569 ? 10.630  36.035 27.265  1.00 39.80  ? 1368 GLN B CD    1 
ATOM   4523  O  OE1   . GLN A  1  569 ? 11.105  35.766 26.137  1.00 42.71  ? 1368 GLN B OE1   1 
ATOM   4524  N  NE2   . GLN A  1  569 ? 9.450   35.641 27.594  1.00 42.14  ? 1368 GLN B NE2   1 
ATOM   4525  N  N     . TYR A  1  570 ? 15.756  38.121 27.989  1.00 32.20  ? 1369 TYR B N     1 
ATOM   4526  C  CA    . TYR A  1  570 ? 17.197  37.999 28.065  1.00 30.81  ? 1369 TYR B CA    1 
ATOM   4527  C  C     . TYR A  1  570 ? 17.767  38.899 29.143  1.00 32.34  ? 1369 TYR B C     1 
ATOM   4528  O  O     . TYR A  1  570 ? 18.527  38.437 30.019  1.00 30.92  ? 1369 TYR B O     1 
ATOM   4529  C  CB    . TYR A  1  570 ? 17.827  38.331 26.695  1.00 31.01  ? 1369 TYR B CB    1 
ATOM   4530  C  CG    . TYR A  1  570 ? 19.345  38.382 26.697  1.00 31.52  ? 1369 TYR B CG    1 
ATOM   4531  C  CD1   . TYR A  1  570 ? 20.014  39.578 26.980  1.00 31.50  ? 1369 TYR B CD1   1 
ATOM   4532  C  CD2   . TYR A  1  570 ? 20.109  37.252 26.405  1.00 30.81  ? 1369 TYR B CD2   1 
ATOM   4533  C  CE1   . TYR A  1  570 ? 21.391  39.640 26.988  1.00 33.05  ? 1369 TYR B CE1   1 
ATOM   4534  C  CE2   . TYR A  1  570 ? 21.485  37.295 26.397  1.00 33.71  ? 1369 TYR B CE2   1 
ATOM   4535  C  CZ    . TYR A  1  570 ? 22.122  38.504 26.705  1.00 33.80  ? 1369 TYR B CZ    1 
ATOM   4536  O  OH    . TYR A  1  570 ? 23.501  38.577 26.731  1.00 36.25  ? 1369 TYR B OH    1 
ATOM   4537  N  N     . ASN A  1  571 ? 17.412  40.185 29.104  1.00 29.92  ? 1370 ASN B N     1 
ATOM   4538  C  CA    . ASN A  1  571 ? 17.910  41.121 30.103  1.00 32.43  ? 1370 ASN B CA    1 
ATOM   4539  C  C     . ASN A  1  571 ? 17.495  40.717 31.491  1.00 32.06  ? 1370 ASN B C     1 
ATOM   4540  O  O     . ASN A  1  571 ? 18.276  40.889 32.445  1.00 31.27  ? 1370 ASN B O     1 
ATOM   4541  C  CB    . ASN A  1  571 ? 17.432  42.541 29.769  1.00 33.25  ? 1370 ASN B CB    1 
ATOM   4542  C  CG    . ASN A  1  571 ? 18.076  43.103 28.520  1.00 35.00  ? 1370 ASN B CG    1 
ATOM   4543  O  OD1   . ASN A  1  571 ? 19.194  42.828 28.235  1.00 39.82  ? 1370 ASN B OD1   1 
ATOM   4544  N  ND2   . ASN A  1  571 ? 17.357  43.907 27.799  1.00 35.12  ? 1370 ASN B ND2   1 
ATOM   4545  N  N     . LEU A  1  572 ? 16.277  40.167 31.632  1.00 30.75  ? 1371 LEU B N     1 
ATOM   4546  C  CA    . LEU A  1  572 ? 15.804  39.716 32.948  1.00 31.62  ? 1371 LEU B CA    1 
ATOM   4547  C  C     . LEU A  1  572 ? 16.669  38.559 33.471  1.00 32.08  ? 1371 LEU B C     1 
ATOM   4548  O  O     . LEU A  1  572 ? 17.083  38.599 34.636  1.00 32.96  ? 1371 LEU B O     1 
ATOM   4549  C  CB    . LEU A  1  572 ? 14.337  39.311 32.860  1.00 31.88  ? 1371 LEU B CB    1 
ATOM   4550  C  CG    . LEU A  1  572 ? 13.728  38.892 34.211  1.00 30.46  ? 1371 LEU B CG    1 
ATOM   4551  C  CD1   . LEU A  1  572 ? 13.864  39.939 35.260  1.00 29.47  ? 1371 LEU B CD1   1 
ATOM   4552  C  CD2   . LEU A  1  572 ? 12.254  38.392 33.978  1.00 31.86  ? 1371 LEU B CD2   1 
ATOM   4553  N  N     . ARG A  1  573 ? 17.075  37.553 32.590  1.00 34.69  ? 1372 ARG B N     1 
ATOM   4554  C  CA    . ARG A  1  573 ? 17.952  36.436 33.003  1.00 34.50  ? 1372 ARG B CA    1 
ATOM   4555  C  C     . ARG A  1  573 ? 19.280  37.000 33.517  1.00 33.61  ? 1372 ARG B C     1 
ATOM   4556  O  O     . ARG A  1  573 ? 19.808  36.544 34.542  1.00 34.30  ? 1372 ARG B O     1 
ATOM   4557  C  CB    . ARG A  1  573 ? 18.230  35.466 31.829  1.00 37.90  ? 1372 ARG B CB    1 
ATOM   4558  C  CG    . ARG A  1  573 ? 17.028  34.667 31.408  1.00 44.68  ? 1372 ARG B CG    1 
ATOM   4559  C  CD    . ARG A  1  573 ? 17.368  33.500 30.474  1.00 43.91  ? 1372 ARG B CD    1 
ATOM   4560  N  NE    . ARG A  1  573 ? 17.956  33.911 29.199  1.00 45.43  ? 1372 ARG B NE    1 
ATOM   4561  C  CZ    . ARG A  1  573 ? 17.200  34.319 28.160  1.00 46.95  ? 1372 ARG B CZ    1 
ATOM   4562  N  NH1   . ARG A  1  573 ? 15.880  34.280 28.207  1.00 46.93  ? 1372 ARG B NH1   1 
ATOM   4563  N  NH2   . ARG A  1  573 ? 17.793  34.720 27.040  1.00 48.15  ? 1372 ARG B NH2   1 
ATOM   4564  N  N     . LYS A  1  574 ? 19.748  37.909 32.629  1.00 32.95  ? 1373 LYS B N     1 
ATOM   4565  C  CA    . LYS A  1  574 ? 21.069  38.439 32.914  1.00 32.24  ? 1373 LYS B CA    1 
ATOM   4566  C  C     . LYS A  1  574 ? 21.090  39.249 34.196  1.00 32.83  ? 1373 LYS B C     1 
ATOM   4567  O  O     . LYS A  1  574 ? 22.035  39.132 34.989  1.00 32.98  ? 1373 LYS B O     1 
ATOM   4568  C  CB    . LYS A  1  574 ? 21.563  39.290 31.738  1.00 31.26  ? 1373 LYS B CB    1 
ATOM   4569  N  N     . ALA A  1  575 ? 20.054  40.036 34.430  1.00 33.70  ? 1374 ALA B N     1 
ATOM   4570  C  CA    . ALA A  1  575 ? 19.991  40.841 35.668  1.00 32.58  ? 1374 ALA B CA    1 
ATOM   4571  C  C     . ALA A  1  575 ? 19.844  39.969 36.889  1.00 32.24  ? 1374 ALA B C     1 
ATOM   4572  O  O     . ALA A  1  575 ? 20.448  40.255 37.929  1.00 31.96  ? 1374 ALA B O     1 
ATOM   4573  C  CB    . ALA A  1  575 ? 18.820  41.849 35.563  1.00 29.82  ? 1374 ALA B CB    1 
ATOM   4574  N  N     . LYS A  1  576 ? 19.052  38.906 36.808  1.00 33.08  ? 1375 LYS B N     1 
ATOM   4575  C  CA    . LYS A  1  576 ? 18.894  38.002 37.973  1.00 35.15  ? 1375 LYS B CA    1 
ATOM   4576  C  C     . LYS A  1  576 ? 20.211  37.287 38.277  1.00 33.49  ? 1375 LYS B C     1 
ATOM   4577  O  O     . LYS A  1  576 ? 20.574  37.118 39.430  1.00 34.04  ? 1375 LYS B O     1 
ATOM   4578  C  CB    . LYS A  1  576 ? 17.799  36.993 37.728  1.00 37.62  ? 1375 LYS B CB    1 
ATOM   4579  C  CG    . LYS A  1  576 ? 16.391  37.566 37.713  1.00 42.07  ? 1375 LYS B CG    1 
ATOM   4580  C  CD    . LYS A  1  576 ? 15.391  36.388 37.424  1.00 41.53  ? 1375 LYS B CD    1 
ATOM   4581  C  CE    . LYS A  1  576 ? 13.957  36.919 37.480  1.00 46.06  ? 1375 LYS B CE    1 
ATOM   4582  N  NZ    . LYS A  1  576 ? 13.710  37.642 38.760  1.00 49.04  ? 1375 LYS B NZ    1 
ATOM   4583  N  N     . ASP A  1  577 ? 20.926  36.863 37.235  1.00 33.51  ? 1376 ASP B N     1 
ATOM   4584  C  CA    . ASP A  1  577 ? 22.209  36.193 37.470  1.00 32.38  ? 1376 ASP B CA    1 
ATOM   4585  C  C     . ASP A  1  577 ? 23.201  37.141 38.134  1.00 31.68  ? 1376 ASP B C     1 
ATOM   4586  O  O     . ASP A  1  577 ? 23.939  36.736 39.032  1.00 31.96  ? 1376 ASP B O     1 
ATOM   4587  C  CB    . ASP A  1  577 ? 22.780  35.655 36.135  1.00 34.40  ? 1376 ASP B CB    1 
ATOM   4588  C  CG    . ASP A  1  577 ? 22.016  34.516 35.561  1.00 36.87  ? 1376 ASP B CG    1 
ATOM   4589  O  OD1   . ASP A  1  577 ? 21.167  33.958 36.293  1.00 36.09  ? 1376 ASP B OD1   1 
ATOM   4590  O  OD2   . ASP A  1  577 ? 22.277  34.181 34.372  1.00 36.54  ? 1376 ASP B OD2   1 
ATOM   4591  N  N     . ARG A  1  578 ? 23.224  38.404 37.697  1.00 32.02  ? 1377 ARG B N     1 
ATOM   4592  C  CA    . ARG A  1  578 ? 24.150  39.376 38.279  1.00 31.20  ? 1377 ARG B CA    1 
ATOM   4593  C  C     . ARG A  1  578 ? 23.734  39.727 39.727  1.00 31.73  ? 1377 ARG B C     1 
ATOM   4594  O  O     . ARG A  1  578 ? 24.594  39.891 40.596  1.00 31.97  ? 1377 ARG B O     1 
ATOM   4595  C  CB    . ARG A  1  578 ? 24.199  40.625 37.408  1.00 31.54  ? 1377 ARG B CB    1 
ATOM   4596  C  CG    . ARG A  1  578 ? 25.104  41.733 37.904  1.00 33.45  ? 1377 ARG B CG    1 
ATOM   4597  C  CD    . ARG A  1  578 ? 26.546  41.276 38.047  1.00 34.99  ? 1377 ARG B CD    1 
ATOM   4598  N  NE    . ARG A  1  578 ? 27.383  42.382 38.494  1.00 39.03  ? 1377 ARG B NE    1 
ATOM   4599  C  CZ    . ARG A  1  578 ? 28.640  42.244 38.891  1.00 41.69  ? 1377 ARG B CZ    1 
ATOM   4600  N  NH1   . ARG A  1  578 ? 29.233  40.991 38.917  1.00 43.15  ? 1377 ARG B NH1   1 
ATOM   4601  N  NH2   . ARG A  1  578 ? 29.324  43.312 39.289  1.00 44.46  ? 1377 ARG B NH2   1 
ATOM   4602  N  N     . ALA A  1  579 ? 22.428  39.827 39.982  1.00 32.79  ? 1378 ALA B N     1 
ATOM   4603  C  CA    . ALA A  1  579 ? 21.973  40.050 41.338  1.00 32.00  ? 1378 ALA B CA    1 
ATOM   4604  C  C     . ALA A  1  579 ? 22.365  38.894 42.262  1.00 32.47  ? 1378 ALA B C     1 
ATOM   4605  O  O     . ALA A  1  579 ? 22.754  39.112 43.412  1.00 33.33  ? 1378 ALA B O     1 
ATOM   4606  C  CB    . ALA A  1  579 ? 20.447  40.244 41.360  1.00 30.92  ? 1378 ALA B CB    1 
ATOM   4607  N  N     . HIS A  1  580 ? 22.274  37.669 41.748  1.00 33.37  ? 1379 HIS B N     1 
ATOM   4608  C  CA    . HIS A  1  580 ? 22.706  36.510 42.522  1.00 32.64  ? 1379 HIS B CA    1 
ATOM   4609  C  C     . HIS A  1  580 ? 24.183  36.615 42.868  1.00 33.86  ? 1379 HIS B C     1 
ATOM   4610  O  O     . HIS A  1  580 ? 24.597  36.350 43.994  1.00 31.49  ? 1379 HIS B O     1 
ATOM   4611  C  CB    . HIS A  1  580 ? 22.407  35.226 41.735  1.00 35.22  ? 1379 HIS B CB    1 
ATOM   4612  C  CG    . HIS A  1  580 ? 22.672  33.976 42.503  1.00 33.32  ? 1379 HIS B CG    1 
ATOM   4613  N  ND1   . HIS A  1  580 ? 21.891  33.540 43.533  1.00 35.75  ? 1379 HIS B ND1   1 
ATOM   4614  C  CD2   . HIS A  1  580 ? 23.654  33.046 42.367  1.00 35.29  ? 1379 HIS B CD2   1 
ATOM   4615  C  CE1   . HIS A  1  580 ? 22.369  32.408 44.019  1.00 36.11  ? 1379 HIS B CE1   1 
ATOM   4616  N  NE2   . HIS A  1  580 ? 23.443  32.082 43.323  1.00 34.20  ? 1379 HIS B NE2   1 
ATOM   4617  N  N     . ILE A  1  581 ? 24.997  36.993 41.885  1.00 34.07  ? 1380 ILE B N     1 
ATOM   4618  C  CA    . ILE A  1  581 ? 26.417  37.117 42.116  1.00 33.18  ? 1380 ILE B CA    1 
ATOM   4619  C  C     . ILE A  1  581 ? 26.685  38.237 43.158  1.00 33.01  ? 1380 ILE B C     1 
ATOM   4620  O  O     . ILE A  1  581 ? 27.445  38.039 44.090  1.00 32.19  ? 1380 ILE B O     1 
ATOM   4621  C  CB    . ILE A  1  581 ? 27.191  37.408 40.836  1.00 34.68  ? 1380 ILE B CB    1 
ATOM   4622  C  CG1   . ILE A  1  581 ? 27.105  36.209 39.881  1.00 37.90  ? 1380 ILE B CG1   1 
ATOM   4623  C  CG2   . ILE A  1  581 ? 28.638  37.730 41.149  1.00 33.48  ? 1380 ILE B CG2   1 
ATOM   4624  C  CD1   . ILE A  1  581 ? 27.496  34.895 40.504  1.00 37.58  ? 1380 ILE B CD1   1 
ATOM   4625  N  N     . LEU A  1  582 ? 26.066  39.413 42.987  1.00 30.52  ? 1381 LEU B N     1 
ATOM   4626  C  CA    . LEU A  1  582 ? 26.267  40.484 43.899  1.00 30.37  ? 1381 LEU B CA    1 
ATOM   4627  C  C     . LEU A  1  582 ? 25.826  40.134 45.331  1.00 30.92  ? 1381 LEU B C     1 
ATOM   4628  O  O     . LEU A  1  582 ? 26.441  40.586 46.302  1.00 30.52  ? 1381 LEU B O     1 
ATOM   4629  C  CB    . LEU A  1  582 ? 25.488  41.733 43.442  1.00 29.78  ? 1381 LEU B CB    1 
ATOM   4630  C  CG    . LEU A  1  582 ? 25.998  42.400 42.133  1.00 31.31  ? 1381 LEU B CG    1 
ATOM   4631  C  CD1   . LEU A  1  582 ? 25.024  43.510 41.729  1.00 29.61  ? 1381 LEU B CD1   1 
ATOM   4632  C  CD2   . LEU A  1  582 ? 27.377  43.015 42.334  1.00 32.17  ? 1381 LEU B CD2   1 
ATOM   4633  N  N     . GLU A  1  583 ? 24.799  39.304 45.463  1.00 31.98  ? 1382 GLU B N     1 
ATOM   4634  C  CA    . GLU A  1  583 ? 24.392  38.857 46.789  1.00 33.77  ? 1382 GLU B CA    1 
ATOM   4635  C  C     . GLU A  1  583 ? 25.489  38.053 47.460  1.00 34.60  ? 1382 GLU B C     1 
ATOM   4636  O  O     . GLU A  1  583 ? 25.710  38.179 48.677  1.00 31.66  ? 1382 GLU B O     1 
ATOM   4637  C  CB    . GLU A  1  583 ? 23.086  38.057 46.696  1.00 34.61  ? 1382 GLU B CB    1 
ATOM   4638  C  CG    . GLU A  1  583 ? 21.855  38.928 46.533  1.00 34.38  ? 1382 GLU B CG    1 
ATOM   4639  C  CD    . GLU A  1  583 ? 20.701  38.234 45.876  1.00 34.50  ? 1382 GLU B CD    1 
ATOM   4640  O  OE1   . GLU A  1  583 ? 20.791  36.999 45.641  1.00 37.38  ? 1382 GLU B OE1   1 
ATOM   4641  O  OE2   . GLU A  1  583 ? 19.700  38.904 45.579  1.00 36.27  ? 1382 GLU B OE2   1 
ATOM   4642  N  N     . GLY A  1  584 ? 26.214  37.247 46.701  1.00 33.90  ? 1383 GLY B N     1 
ATOM   4643  C  CA    . GLY A  1  584 ? 27.298  36.473 47.272  1.00 31.98  ? 1383 GLY B CA    1 
ATOM   4644  C  C     . GLY A  1  584 ? 28.474  37.382 47.595  1.00 34.76  ? 1383 GLY B C     1 
ATOM   4645  O  O     . GLY A  1  584 ? 29.199  37.161 48.546  1.00 34.73  ? 1383 GLY B O     1 
ATOM   4646  N  N     . LEU A  1  585 ? 28.684  38.417 46.769  1.00 34.27  ? 1384 LEU B N     1 
ATOM   4647  C  CA    . LEU A  1  585 ? 29.777  39.324 46.957  1.00 34.47  ? 1384 LEU B CA    1 
ATOM   4648  C  C     . LEU A  1  585 ? 29.571  40.185 48.211  1.00 36.61  ? 1384 LEU B C     1 
ATOM   4649  O  O     . LEU A  1  585 ? 30.526  40.501 48.918  1.00 32.58  ? 1384 LEU B O     1 
ATOM   4650  C  CB    . LEU A  1  585 ? 29.952  40.210 45.738  1.00 34.18  ? 1384 LEU B CB    1 
ATOM   4651  C  CG    . LEU A  1  585 ? 30.492  39.463 44.479  1.00 33.55  ? 1384 LEU B CG    1 
ATOM   4652  C  CD1   . LEU A  1  585 ? 30.947  40.470 43.408  1.00 35.19  ? 1384 LEU B CD1   1 
ATOM   4653  C  CD2   . LEU A  1  585 ? 31.667  38.595 44.812  1.00 34.07  ? 1384 LEU B CD2   1 
ATOM   4654  N  N     . ARG A  1  586 ? 28.330  40.560 48.464  1.00 34.97  ? 1385 ARG B N     1 
ATOM   4655  C  CA    . ARG A  1  586 ? 28.002  41.354 49.618  1.00 36.54  ? 1385 ARG B CA    1 
ATOM   4656  C  C     . ARG A  1  586 ? 28.299  40.564 50.893  1.00 38.14  ? 1385 ARG B C     1 
ATOM   4657  O  O     . ARG A  1  586 ? 28.910  41.081 51.823  1.00 36.79  ? 1385 ARG B O     1 
ATOM   4658  C  CB    . ARG A  1  586 ? 26.522  41.738 49.579  1.00 36.33  ? 1385 ARG B CB    1 
ATOM   4659  C  CG    . ARG A  1  586 ? 26.232  42.839 48.589  1.00 38.73  ? 1385 ARG B CG    1 
ATOM   4660  C  CD    . ARG A  1  586 ? 24.791  42.790 48.153  1.00 38.36  ? 1385 ARG B CD    1 
ATOM   4661  N  NE    . ARG A  1  586 ? 23.956  43.723 48.932  1.00 40.17  ? 1385 ARG B NE    1 
ATOM   4662  C  CZ    . ARG A  1  586 ? 22.847  43.365 49.554  1.00 37.91  ? 1385 ARG B CZ    1 
ATOM   4663  N  NH1   . ARG A  1  586 ? 22.438  42.102 49.494  1.00 37.40  ? 1385 ARG B NH1   1 
ATOM   4664  N  NH2   . ARG A  1  586 ? 22.146  44.260 50.203  1.00 35.68  ? 1385 ARG B NH2   1 
ATOM   4665  N  N     . ILE A  1  587 ? 27.844  39.328 50.932  1.00 35.45  ? 1386 ILE B N     1 
ATOM   4666  C  CA    . ILE A  1  587 ? 28.051  38.462 52.049  1.00 37.16  ? 1386 ILE B CA    1 
ATOM   4667  C  C     . ILE A  1  587 ? 29.536  38.307 52.279  1.00 35.69  ? 1386 ILE B C     1 
ATOM   4668  O  O     . ILE A  1  587 ? 29.979  38.443 53.387  1.00 38.43  ? 1386 ILE B O     1 
ATOM   4669  C  CB    . ILE A  1  587 ? 27.440  37.071 51.797  1.00 39.20  ? 1386 ILE B CB    1 
ATOM   4670  C  CG1   . ILE A  1  587 ? 25.915  37.183 51.798  1.00 39.19  ? 1386 ILE B CG1   1 
ATOM   4671  C  CG2   . ILE A  1  587 ? 27.933  35.980 52.733  1.00 40.43  ? 1386 ILE B CG2   1 
ATOM   4672  C  CD1   . ILE A  1  587 ? 25.275  35.926 51.217  1.00 40.48  ? 1386 ILE B CD1   1 
ATOM   4673  N  N     . ALA A  1  588 ? 30.295  38.040 51.238  1.00 34.45  ? 1387 ALA B N     1 
ATOM   4674  C  CA    . ALA A  1  588 ? 31.700  37.851 51.405  1.00 35.89  ? 1387 ALA B CA    1 
ATOM   4675  C  C     . ALA A  1  588 ? 32.409  39.112 51.934  1.00 35.91  ? 1387 ALA B C     1 
ATOM   4676  O  O     . ALA A  1  588 ? 33.213  39.021 52.813  1.00 36.83  ? 1387 ALA B O     1 
ATOM   4677  C  CB    . ALA A  1  588 ? 32.317  37.444 50.080  1.00 34.54  ? 1387 ALA B CB    1 
ATOM   4678  N  N     . LEU A  1  589 ? 32.092  40.269 51.385  1.00 38.06  ? 1388 LEU B N     1 
ATOM   4679  C  CA    . LEU A  1  589 ? 32.721  41.476 51.832  1.00 36.90  ? 1388 LEU B CA    1 
ATOM   4680  C  C     . LEU A  1  589 ? 32.352  41.833 53.277  1.00 39.33  ? 1388 LEU B C     1 
ATOM   4681  O  O     . LEU A  1  589 ? 33.158  42.362 54.010  1.00 36.19  ? 1388 LEU B O     1 
ATOM   4682  C  CB    . LEU A  1  589 ? 32.411  42.639 50.877  1.00 36.15  ? 1388 LEU B CB    1 
ATOM   4683  C  CG    . LEU A  1  589 ? 33.116  42.581 49.541  1.00 35.40  ? 1388 LEU B CG    1 
ATOM   4684  C  CD1   . LEU A  1  589 ? 32.590  43.678 48.658  1.00 36.53  ? 1388 LEU B CD1   1 
ATOM   4685  C  CD2   . LEU A  1  589 ? 34.645  42.747 49.799  1.00 37.31  ? 1388 LEU B CD2   1 
ATOM   4686  N  N     . ASP A  1  590 ? 31.121  41.534 53.656  1.00 39.00  ? 1389 ASP B N     1 
ATOM   4687  C  CA    . ASP A  1  590 ? 30.650  41.774 54.986  1.00 39.29  ? 1389 ASP B CA    1 
ATOM   4688  C  C     . ASP A  1  590 ? 31.337  40.881 56.016  1.00 40.92  ? 1389 ASP B C     1 
ATOM   4689  O  O     . ASP A  1  590 ? 31.332  41.172 57.170  1.00 40.16  ? 1389 ASP B O     1 
ATOM   4690  C  CB    . ASP A  1  590 ? 29.131  41.655 55.054  1.00 41.93  ? 1389 ASP B CB    1 
ATOM   4691  C  CG    . ASP A  1  590 ? 28.435  42.869 54.389  1.00 42.73  ? 1389 ASP B CG    1 
ATOM   4692  O  OD1   . ASP A  1  590 ? 29.088  43.858 54.062  1.00 43.76  ? 1389 ASP B OD1   1 
ATOM   4693  O  OD2   . ASP A  1  590 ? 27.223  42.827 54.194  1.00 43.74  ? 1389 ASP B OD2   1 
ATOM   4694  N  N     . HIS A  1  591 ? 31.911  39.773 55.585  1.00 38.90  ? 1390 HIS B N     1 
ATOM   4695  C  CA    . HIS A  1  591 ? 32.593  38.854 56.466  1.00 40.64  ? 1390 HIS B CA    1 
ATOM   4696  C  C     . HIS A  1  591 ? 33.887  38.417 55.867  1.00 38.03  ? 1390 HIS B C     1 
ATOM   4697  O  O     . HIS A  1  591 ? 34.177  37.237 55.783  1.00 39.91  ? 1390 HIS B O     1 
ATOM   4698  C  CB    . HIS A  1  591 ? 31.681  37.676 56.683  1.00 41.61  ? 1390 HIS B CB    1 
ATOM   4699  C  CG    . HIS A  1  591 ? 30.318  38.088 57.132  1.00 44.29  ? 1390 HIS B CG    1 
ATOM   4700  N  ND1   . HIS A  1  591 ? 29.990  38.162 58.476  1.00 43.84  ? 1390 HIS B ND1   1 
ATOM   4701  C  CD2   . HIS A  1  591 ? 29.250  38.526 56.435  1.00 42.71  ? 1390 HIS B CD2   1 
ATOM   4702  C  CE1   . HIS A  1  591 ? 28.734  38.572 58.565  1.00 43.79  ? 1390 HIS B CE1   1 
ATOM   4703  N  NE2   . HIS A  1  591 ? 28.277  38.811 57.357  1.00 43.65  ? 1390 HIS B NE2   1 
ATOM   4704  N  N     . ILE A  1  592 ? 34.665  39.386 55.443  1.00 38.51  ? 1391 ILE B N     1 
ATOM   4705  C  CA    . ILE A  1  592 ? 35.876  39.084 54.702  1.00 37.91  ? 1391 ILE B CA    1 
ATOM   4706  C  C     . ILE A  1  592 ? 36.956  38.293 55.451  1.00 39.92  ? 1391 ILE B C     1 
ATOM   4707  O  O     . ILE A  1  592 ? 37.558  37.442 54.859  1.00 38.30  ? 1391 ILE B O     1 
ATOM   4708  C  CB    . ILE A  1  592 ? 36.404  40.329 53.986  1.00 37.09  ? 1391 ILE B CB    1 
ATOM   4709  C  CG1   . ILE A  1  592 ? 37.358  39.934 52.899  1.00 34.93  ? 1391 ILE B CG1   1 
ATOM   4710  C  CG2   . ILE A  1  592 ? 37.030  41.310 54.977  1.00 37.81  ? 1391 ILE B CG2   1 
ATOM   4711  C  CD1   . ILE A  1  592 ? 36.707  39.071 51.843  1.00 39.13  ? 1391 ILE B CD1   1 
ATOM   4712  N  N     . ASP A  1  593 ? 37.167  38.556 56.734  1.00 40.95  ? 1392 ASP B N     1 
ATOM   4713  C  CA    . ASP A  1  593 ? 38.184  37.844 57.447  1.00 42.55  ? 1392 ASP B CA    1 
ATOM   4714  C  C     . ASP A  1  593 ? 37.866  36.362 57.475  1.00 42.03  ? 1392 ASP B C     1 
ATOM   4715  O  O     . ASP A  1  593 ? 38.722  35.550 57.308  1.00 41.23  ? 1392 ASP B O     1 
ATOM   4716  C  CB    . ASP A  1  593 ? 38.274  38.380 58.885  1.00 48.12  ? 1392 ASP B CB    1 
ATOM   4717  C  CG    . ASP A  1  593 ? 38.679  39.794 58.931  1.00 50.49  ? 1392 ASP B CG    1 
ATOM   4718  O  OD1   . ASP A  1  593 ? 39.432  40.258 58.064  1.00 56.89  ? 1392 ASP B OD1   1 
ATOM   4719  O  OD2   . ASP A  1  593 ? 38.240  40.507 59.815  1.00 60.82  ? 1392 ASP B OD2   1 
ATOM   4720  N  N     . GLU A  1  594 ? 36.606  36.038 57.660  1.00 43.47  ? 1393 GLU B N     1 
ATOM   4721  C  CA    . GLU A  1  594 ? 36.163  34.678 57.677  1.00 42.72  ? 1393 GLU B CA    1 
ATOM   4722  C  C     . GLU A  1  594 ? 36.339  34.048 56.313  1.00 40.43  ? 1393 GLU B C     1 
ATOM   4723  O  O     . GLU A  1  594 ? 36.712  32.897 56.181  1.00 39.38  ? 1393 GLU B O     1 
ATOM   4724  C  CB    . GLU A  1  594 ? 34.708  34.624 58.117  1.00 46.18  ? 1393 GLU B CB    1 
ATOM   4725  C  CG    . GLU A  1  594 ? 34.498  34.923 59.596  1.00 55.07  ? 1393 GLU B CG    1 
ATOM   4726  C  CD    . GLU A  1  594 ? 34.615  36.430 59.919  1.00 60.21  ? 1393 GLU B CD    1 
ATOM   4727  O  OE1   . GLU A  1  594 ? 34.541  37.334 58.994  1.00 51.29  ? 1393 GLU B OE1   1 
ATOM   4728  O  OE2   . GLU A  1  594 ? 34.831  36.707 61.141  1.00 62.04  ? 1393 GLU B OE2   1 
ATOM   4729  N  N     . ILE A  1  595 ? 36.044  34.847 55.285  1.00 36.49  ? 1394 ILE B N     1 
ATOM   4730  C  CA    . ILE A  1  595 ? 36.180  34.399 53.922  1.00 35.80  ? 1394 ILE B CA    1 
ATOM   4731  C  C     . ILE A  1  595 ? 37.658  34.124 53.644  1.00 34.19  ? 1394 ILE B C     1 
ATOM   4732  O  O     . ILE A  1  595 ? 37.983  33.079 53.161  1.00 34.55  ? 1394 ILE B O     1 
ATOM   4733  C  CB    . ILE A  1  595 ? 35.654  35.469 52.948  1.00 34.47  ? 1394 ILE B CB    1 
ATOM   4734  C  CG1   . ILE A  1  595 ? 34.149  35.652 53.124  1.00 35.71  ? 1394 ILE B CG1   1 
ATOM   4735  C  CG2   . ILE A  1  595 ? 35.969  35.117 51.496  1.00 31.47  ? 1394 ILE B CG2   1 
ATOM   4736  C  CD1   . ILE A  1  595 ? 33.361  34.503 52.504  1.00 35.65  ? 1394 ILE B CD1   1 
ATOM   4737  N  N     . ILE A  1  596 ? 38.536  35.086 53.932  1.00 36.34  ? 1395 ILE B N     1 
ATOM   4738  C  CA    . ILE A  1  596 ? 39.944  34.933 53.627  1.00 43.02  ? 1395 ILE B CA    1 
ATOM   4739  C  C     . ILE A  1  596 ? 40.523  33.725 54.383  1.00 42.31  ? 1395 ILE B C     1 
ATOM   4740  O  O     . ILE A  1  596 ? 41.280  32.930 53.811  1.00 40.51  ? 1395 ILE B O     1 
ATOM   4741  C  CB    . ILE A  1  596 ? 40.718  36.217 53.986  1.00 47.01  ? 1395 ILE B CB    1 
ATOM   4742  C  CG1   . ILE A  1  596 ? 40.158  37.423 53.244  1.00 49.91  ? 1395 ILE B CG1   1 
ATOM   4743  C  CG2   . ILE A  1  596 ? 42.197  36.057 53.652  1.00 48.87  ? 1395 ILE B CG2   1 
ATOM   4744  C  CD1   . ILE A  1  596 ? 40.362  37.381 51.759  1.00 53.25  ? 1395 ILE B CD1   1 
ATOM   4745  N  N     . SER A  1  597 ? 40.167  33.572 55.662  1.00 41.67  ? 1396 SER B N     1 
ATOM   4746  C  CA    . SER A  1  597 ? 40.711  32.469 56.435  1.00 44.63  ? 1396 SER B CA    1 
ATOM   4747  C  C     . SER A  1  597 ? 40.231  31.111 55.902  1.00 42.84  ? 1396 SER B C     1 
ATOM   4748  O  O     . SER A  1  597 ? 41.002  30.161 55.834  1.00 45.91  ? 1396 SER B O     1 
ATOM   4749  C  CB    . SER A  1  597 ? 40.343  32.626 57.920  1.00 44.39  ? 1396 SER B CB    1 
ATOM   4750  O  OG    . SER A  1  597 ? 38.940  32.706 58.088  1.00 53.74  ? 1396 SER B OG    1 
ATOM   4751  N  N     . THR A  1  598 ? 38.965  31.036 55.494  1.00 44.67  ? 1397 THR B N     1 
ATOM   4752  C  CA    . THR A  1  598 ? 38.468  29.829 54.838  1.00 44.26  ? 1397 THR B CA    1 
ATOM   4753  C  C     . THR A  1  598 ? 39.307  29.469 53.629  1.00 45.42  ? 1397 THR B C     1 
ATOM   4754  O  O     . THR A  1  598 ? 39.673  28.307 53.419  1.00 45.20  ? 1397 THR B O     1 
ATOM   4755  C  CB    . THR A  1  598 ? 37.006  30.014 54.438  1.00 45.01  ? 1397 THR B CB    1 
ATOM   4756  O  OG1   . THR A  1  598 ? 36.200  30.162 55.607  1.00 44.07  ? 1397 THR B OG1   1 
ATOM   4757  C  CG2   . THR A  1  598 ? 36.534  28.792 53.649  1.00 45.01  ? 1397 THR B CG2   1 
ATOM   4758  N  N     . ILE A  1  599 ? 39.610  30.472 52.795  1.00 42.02  ? 1398 ILE B N     1 
ATOM   4759  C  CA    . ILE A  1  599 ? 40.336  30.231 51.547  1.00 42.19  ? 1398 ILE B CA    1 
ATOM   4760  C  C     . ILE A  1  599 ? 41.794  29.856 51.851  1.00 42.84  ? 1398 ILE B C     1 
ATOM   4761  O  O     . ILE A  1  599 ? 42.350  28.941 51.240  1.00 44.61  ? 1398 ILE B O     1 
ATOM   4762  C  CB    . ILE A  1  599 ? 40.236  31.444 50.634  1.00 37.38  ? 1398 ILE B CB    1 
ATOM   4763  C  CG1   . ILE A  1  599 ? 38.765  31.677 50.264  1.00 37.06  ? 1398 ILE B CG1   1 
ATOM   4764  C  CG2   . ILE A  1  599 ? 41.080  31.264 49.380  1.00 37.72  ? 1398 ILE B CG2   1 
ATOM   4765  C  CD1   . ILE A  1  599 ? 38.536  33.027 49.564  1.00 36.18  ? 1398 ILE B CD1   1 
ATOM   4766  N  N     . ARG A  1  600 ? 42.413  30.555 52.791  1.00 43.13  ? 1399 ARG B N     1 
ATOM   4767  C  CA    . ARG A  1  600 ? 43.805  30.270 53.107  1.00 44.69  ? 1399 ARG B CA    1 
ATOM   4768  C  C     . ARG A  1  600 ? 44.001  28.860 53.669  1.00 46.49  ? 1399 ARG B C     1 
ATOM   4769  O  O     . ARG A  1  600 ? 44.995  28.206 53.376  1.00 44.78  ? 1399 ARG B O     1 
ATOM   4770  C  CB    . ARG A  1  600 ? 44.337  31.313 54.113  1.00 44.75  ? 1399 ARG B CB    1 
ATOM   4771  C  CG    . ARG A  1  600 ? 44.460  32.705 53.590  1.00 46.21  ? 1399 ARG B CG    1 
ATOM   4772  C  CD    . ARG A  1  600 ? 44.701  33.658 54.760  1.00 47.75  ? 1399 ARG B CD    1 
ATOM   4773  N  NE    . ARG A  1  600 ? 45.926  33.359 55.512  1.00 52.10  ? 1399 ARG B NE    1 
ATOM   4774  C  CZ    . ARG A  1  600 ? 46.230  34.034 56.609  1.00 50.58  ? 1399 ARG B CZ    1 
ATOM   4775  N  NH1   . ARG A  1  600 ? 47.392  33.900 57.236  1.00 55.08  ? 1399 ARG B NH1   1 
ATOM   4776  N  NH2   . ARG A  1  600 ? 45.353  34.936 56.988  1.00 52.63  ? 1399 ARG B NH2   1 
ATOM   4777  N  N     A GLU A  1  601 ? 43.058  28.385 54.479  0.50 50.22  ? 1400 GLU B N     1 
ATOM   4778  N  N     B GLU A  1  601 ? 43.045  28.394 54.480  0.50 48.85  ? 1400 GLU B N     1 
ATOM   4779  C  CA    A GLU A  1  601 ? 43.184  27.037 55.027  0.50 53.19  ? 1400 GLU B CA    1 
ATOM   4780  C  CA    B GLU A  1  601 ? 43.119  27.038 55.031  0.50 51.08  ? 1400 GLU B CA    1 
ATOM   4781  C  C     A GLU A  1  601 ? 42.767  25.953 54.042  0.50 52.36  ? 1400 GLU B C     1 
ATOM   4782  C  C     B GLU A  1  601 ? 43.007  25.982 53.944  0.50 51.40  ? 1400 GLU B C     1 
ATOM   4783  O  O     A GLU A  1  601 ? 42.799  24.776 54.395  0.50 49.88  ? 1400 GLU B O     1 
ATOM   4784  O  O     B GLU A  1  601 ? 43.471  24.863 54.121  0.50 50.87  ? 1400 GLU B O     1 
ATOM   4785  C  CB    A GLU A  1  601 ? 42.376  26.902 56.322  0.50 55.45  ? 1400 GLU B CB    1 
ATOM   4786  C  CB    B GLU A  1  601 ? 42.011  26.808 56.062  0.50 50.32  ? 1400 GLU B CB    1 
ATOM   4787  C  CG    A GLU A  1  601 ? 40.871  26.986 56.129  0.50 58.48  ? 1400 GLU B CG    1 
ATOM   4788  C  CG    B GLU A  1  601 ? 42.216  27.717 57.283  0.50 50.13  ? 1400 GLU B CG    1 
ATOM   4789  C  CD    A GLU A  1  601 ? 40.114  26.990 57.434  0.50 62.67  ? 1400 GLU B CD    1 
ATOM   4790  C  CD    B GLU A  1  601 ? 41.123  27.669 58.243  0.50 51.10  ? 1400 GLU B CD    1 
ATOM   4791  O  OE1   A GLU A  1  601 ? 39.091  26.291 57.478  0.50 64.89  ? 1400 GLU B OE1   1 
ATOM   4792  O  OE1   B GLU A  1  601 ? 40.228  26.829 58.048  0.50 53.95  ? 1400 GLU B OE1   1 
ATOM   4793  O  OE2   A GLU A  1  601 ? 40.420  27.906 58.248  0.50 63.15  ? 1400 GLU B OE2   1 
ATOM   4794  O  OE2   B GLU A  1  601 ? 41.207  28.450 59.194  0.50 51.85  ? 1400 GLU B OE2   1 
ATOM   4795  N  N     . SER A  1  602 ? 42.378  26.324 52.823  1.00 50.96  ? 1401 SER B N     1 
ATOM   4796  C  CA    . SER A  1  602 ? 42.084  25.348 51.781  1.00 50.33  ? 1401 SER B CA    1 
ATOM   4797  C  C     . SER A  1  602 ? 43.316  25.073 50.952  1.00 52.33  ? 1401 SER B C     1 
ATOM   4798  O  O     . SER A  1  602 ? 44.036  26.007 50.573  1.00 51.33  ? 1401 SER B O     1 
ATOM   4799  C  CB    . SER A  1  602 ? 40.930  25.837 50.905  1.00 51.25  ? 1401 SER B CB    1 
ATOM   4800  O  OG    . SER A  1  602 ? 39.723  25.925 51.654  1.00 47.29  ? 1401 SER B OG    1 
ATOM   4801  N  N     . ASP A  1  603 ? 43.566  23.788 50.669  1.00 55.51  ? 1402 ASP B N     1 
ATOM   4802  C  CA    . ASP A  1  603 ? 44.726  23.418 49.862  1.00 54.69  ? 1402 ASP B CA    1 
ATOM   4803  C  C     . ASP A  1  603 ? 44.465  23.616 48.363  1.00 53.77  ? 1402 ASP B C     1 
ATOM   4804  O  O     . ASP A  1  603 ? 45.376  23.955 47.626  1.00 52.94  ? 1402 ASP B O     1 
ATOM   4805  C  CB    . ASP A  1  603 ? 45.214  22.025 50.184  1.00 55.79  ? 1402 ASP B CB    1 
ATOM   4806  N  N     . THR A  1  604 ? 43.228  23.390 47.916  1.00 55.01  ? 1403 THR B N     1 
ATOM   4807  C  CA    . THR A  1  604 ? 42.890  23.444 46.509  1.00 54.08  ? 1403 THR B CA    1 
ATOM   4808  C  C     . THR A  1  604 ? 41.683  24.326 46.295  1.00 53.03  ? 1403 THR B C     1 
ATOM   4809  O  O     . THR A  1  604 ? 40.991  24.718 47.252  1.00 48.53  ? 1403 THR B O     1 
ATOM   4810  C  CB    . THR A  1  604 ? 42.589  22.036 45.941  1.00 57.84  ? 1403 THR B CB    1 
ATOM   4811  O  OG1   . THR A  1  604 ? 41.400  21.529 46.542  1.00 57.62  ? 1403 THR B OG1   1 
ATOM   4812  C  CG2   . THR A  1  604 ? 43.738  21.065 46.250  1.00 58.47  ? 1403 THR B CG2   1 
ATOM   4813  N  N     . ASP A  1  605 ? 41.403  24.618 45.023  1.00 53.98  ? 1404 ASP B N     1 
ATOM   4814  C  CA    . ASP A  1  605 ? 40.273  25.431 44.647  1.00 57.88  ? 1404 ASP B CA    1 
ATOM   4815  C  C     . ASP A  1  605 ? 38.965  24.728 44.964  1.00 52.77  ? 1404 ASP B C     1 
ATOM   4816  O  O     . ASP A  1  605 ? 37.979  25.345 45.329  1.00 48.25  ? 1404 ASP B O     1 
ATOM   4817  C  CB    . ASP A  1  605 ? 40.354  25.800 43.170  1.00 59.39  ? 1404 ASP B CB    1 
ATOM   4818  C  CG    . ASP A  1  605 ? 41.178  27.081 42.948  1.00 66.67  ? 1404 ASP B CG    1 
ATOM   4819  O  OD1   . ASP A  1  605 ? 41.762  27.627 43.916  1.00 71.95  ? 1404 ASP B OD1   1 
ATOM   4820  O  OD2   . ASP A  1  605 ? 41.195  27.615 41.820  1.00 62.79  ? 1404 ASP B OD2   1 
ATOM   4821  N  N     . LYS A  1  606 ? 38.957  23.426 44.772  1.00 50.85  ? 1405 LYS B N     1 
ATOM   4822  C  CA    . LYS A  1  606 ? 37.740  22.641 45.015  1.00 52.24  ? 1405 LYS B CA    1 
ATOM   4823  C  C     . LYS A  1  606 ? 37.386  22.639 46.498  1.00 51.78  ? 1405 LYS B C     1 
ATOM   4824  O  O     . LYS A  1  606 ? 36.206  22.764 46.852  1.00 55.44  ? 1405 LYS B O     1 
ATOM   4825  C  CB    . LYS A  1  606 ? 37.913  21.226 44.481  1.00 52.42  ? 1405 LYS B CB    1 
ATOM   4826  C  CG    . LYS A  1  606 ? 36.703  20.350 44.615  1.00 51.19  ? 1405 LYS B CG    1 
ATOM   4827  N  N     . VAL A  1  607 ? 38.386  22.488 47.375  1.00 51.78  ? 1406 VAL B N     1 
ATOM   4828  C  CA    . VAL A  1  607 ? 38.133  22.515 48.809  1.00 50.61  ? 1406 VAL B CA    1 
ATOM   4829  C  C     . VAL A  1  607 ? 37.615  23.886 49.229  1.00 49.19  ? 1406 VAL B C     1 
ATOM   4830  O  O     . VAL A  1  607 ? 36.643  23.985 49.993  1.00 50.42  ? 1406 VAL B O     1 
ATOM   4831  C  CB    . VAL A  1  607 ? 39.414  22.135 49.588  1.00 51.82  ? 1406 VAL B CB    1 
ATOM   4832  C  CG1   . VAL A  1  607 ? 39.247  22.414 51.074  1.00 51.62  ? 1406 VAL B CG1   1 
ATOM   4833  C  CG2   . VAL A  1  607 ? 39.738  20.663 49.349  1.00 53.48  ? 1406 VAL B CG2   1 
ATOM   4834  N  N     . ALA A  1  608 ? 38.237  24.956 48.722  1.00 46.54  ? 1407 ALA B N     1 
ATOM   4835  C  CA    . ALA A  1  608 ? 37.785  26.303 49.047  1.00 47.35  ? 1407 ALA B CA    1 
ATOM   4836  C  C     . ALA A  1  608 ? 36.364  26.540 48.564  1.00 46.70  ? 1407 ALA B C     1 
ATOM   4837  O  O     . ALA A  1  608 ? 35.560  27.164 49.283  1.00 51.49  ? 1407 ALA B O     1 
ATOM   4838  C  CB    . ALA A  1  608 ? 38.729  27.339 48.450  1.00 42.68  ? 1407 ALA B CB    1 
ATOM   4839  N  N     . MET A  1  609 ? 36.046  26.064 47.369  1.00 49.49  ? 1408 MET B N     1 
ATOM   4840  C  CA    . MET A  1  609 ? 34.672  26.152 46.865  1.00 50.72  ? 1408 MET B CA    1 
ATOM   4841  C  C     . MET A  1  609 ? 33.703  25.462 47.817  1.00 49.99  ? 1408 MET B C     1 
ATOM   4842  O  O     . MET A  1  609 ? 32.674  26.036 48.182  1.00 47.10  ? 1408 MET B O     1 
ATOM   4843  C  CB    . MET A  1  609 ? 34.578  25.520 45.472  1.00 52.48  ? 1408 MET B CB    1 
ATOM   4844  C  CG    . MET A  1  609 ? 35.084  26.365 44.339  1.00 53.54  ? 1408 MET B CG    1 
ATOM   4845  S  SD    . MET A  1  609 ? 33.936  27.626 43.837  1.00 54.42  ? 1408 MET B SD    1 
ATOM   4846  C  CE    . MET A  1  609 ? 32.548  26.576 43.406  1.00 52.06  ? 1408 MET B CE    1 
ATOM   4847  N  N     . GLU A  1  610 ? 34.022  24.225 48.217  1.00 51.57  ? 1409 GLU B N     1 
ATOM   4848  C  CA    . GLU A  1  610 ? 33.130  23.476 49.091  1.00 52.42  ? 1409 GLU B CA    1 
ATOM   4849  C  C     . GLU A  1  610 ? 33.034  24.114 50.477  1.00 50.34  ? 1409 GLU B C     1 
ATOM   4850  O  O     . GLU A  1  610 ? 31.954  24.168 51.063  1.00 51.46  ? 1409 GLU B O     1 
ATOM   4851  C  CB    . GLU A  1  610 ? 33.598  22.033 49.208  1.00 60.62  ? 1409 GLU B CB    1 
ATOM   4852  C  CG    . GLU A  1  610 ? 33.578  21.272 47.890  1.00 69.01  ? 1409 GLU B CG    1 
ATOM   4853  C  CD    . GLU A  1  610 ? 34.414  19.998 47.958  1.00 75.96  ? 1409 GLU B CD    1 
ATOM   4854  O  OE1   . GLU A  1  610 ? 35.232  19.860 48.940  1.00 81.45  ? 1409 GLU B OE1   1 
ATOM   4855  O  OE2   . GLU A  1  610 ? 34.220  19.173 47.022  1.00 77.42  ? 1409 GLU B OE2   1 
ATOM   4856  N  N     . SER A  1  611 ? 34.150  24.605 51.002  1.00 47.32  ? 1410 SER B N     1 
ATOM   4857  C  CA    . SER A  1  611 ? 34.136  25.211 52.328  1.00 46.07  ? 1410 SER B CA    1 
ATOM   4858  C  C     . SER A  1  611 ? 33.329  26.526 52.333  1.00 44.88  ? 1410 SER B C     1 
ATOM   4859  O  O     . SER A  1  611 ? 32.620  26.818 53.291  1.00 40.17  ? 1410 SER B O     1 
ATOM   4860  C  CB    . SER A  1  611 ? 35.561  25.476 52.808  1.00 44.93  ? 1410 SER B CB    1 
ATOM   4861  O  OG    . SER A  1  611 ? 36.290  24.282 52.918  1.00 44.64  ? 1410 SER B OG    1 
ATOM   4862  N  N     . LEU A  1  612 ? 33.433  27.306 51.261  1.00 43.07  ? 1411 LEU B N     1 
ATOM   4863  C  CA    . LEU A  1  612 ? 32.668  28.545 51.193  1.00 41.22  ? 1411 LEU B CA    1 
ATOM   4864  C  C     . LEU A  1  612 ? 31.172  28.284 51.051  1.00 43.03  ? 1411 LEU B C     1 
ATOM   4865  O  O     . LEU A  1  612 ? 30.357  28.975 51.655  1.00 45.60  ? 1411 LEU B O     1 
ATOM   4866  C  CB    . LEU A  1  612 ? 33.161  29.422 50.020  1.00 37.94  ? 1411 LEU B CB    1 
ATOM   4867  C  CG    . LEU A  1  612 ? 34.489  30.149 50.258  1.00 35.89  ? 1411 LEU B CG    1 
ATOM   4868  C  CD1   . LEU A  1  612 ? 34.880  30.789 48.874  1.00 36.53  ? 1411 LEU B CD1   1 
ATOM   4869  C  CD2   . LEU A  1  612 ? 34.414  31.174 51.311  1.00 37.89  ? 1411 LEU B CD2   1 
ATOM   4870  N  N     . GLN A  1  613 ? 30.805  27.291 50.246  1.00 41.68  ? 1412 GLN B N     1 
ATOM   4871  C  CA    . GLN A  1  613 ? 29.385  26.966 50.071  1.00 44.23  ? 1412 GLN B CA    1 
ATOM   4872  C  C     . GLN A  1  613 ? 28.754  26.392 51.343  1.00 45.16  ? 1412 GLN B C     1 
ATOM   4873  O  O     . GLN A  1  613 ? 27.627  26.724 51.667  1.00 45.48  ? 1412 GLN B O     1 
ATOM   4874  C  CB    . GLN A  1  613 ? 29.198  25.986 48.912  1.00 42.98  ? 1412 GLN B CB    1 
ATOM   4875  C  CG    . GLN A  1  613 ? 29.611  26.545 47.559  1.00 42.12  ? 1412 GLN B CG    1 
ATOM   4876  C  CD    . GLN A  1  613 ? 29.481  25.470 46.462  1.00 43.06  ? 1412 GLN B CD    1 
ATOM   4877  O  OE1   . GLN A  1  613 ? 28.447  24.908 46.263  1.00 43.44  ? 1412 GLN B OE1   1 
ATOM   4878  N  NE2   . GLN A  1  613 ? 30.574  25.194 45.769  1.00 44.09  ? 1412 GLN B NE2   1 
ATOM   4879  N  N     . GLN A  1  614 ? 29.517  25.578 52.083  1.00 47.33  ? 1413 GLN B N     1 
ATOM   4880  C  CA    . GLN A  1  614 ? 28.969  24.920 53.274  1.00 47.26  ? 1413 GLN B CA    1 
ATOM   4881  C  C     . GLN A  1  614 ? 28.858  25.872 54.468  1.00 48.96  ? 1413 GLN B C     1 
ATOM   4882  O  O     . GLN A  1  614 ? 27.943  25.736 55.277  1.00 51.08  ? 1413 GLN B O     1 
ATOM   4883  C  CB    . GLN A  1  614 ? 29.791  23.673 53.621  1.00 47.61  ? 1413 GLN B CB    1 
ATOM   4884  N  N     . ARG A  1  615 ? 29.793  26.782 54.597  1.00 50.98  ? 1414 ARG B N     1 
ATOM   4885  C  CA    . ARG A  1  615 ? 29.786  27.677 55.733  1.00 49.15  ? 1414 ARG B CA    1 
ATOM   4886  C  C     . ARG A  1  615 ? 28.882  28.890 55.583  1.00 47.79  ? 1414 ARG B C     1 
ATOM   4887  O  O     . ARG A  1  615 ? 28.177  29.242 56.514  1.00 46.36  ? 1414 ARG B O     1 
ATOM   4888  C  CB    . ARG A  1  615 ? 31.213  28.122 56.048  1.00 54.07  ? 1414 ARG B CB    1 
ATOM   4889  C  CG    . ARG A  1  615 ? 31.292  29.245 57.050  1.00 60.05  ? 1414 ARG B CG    1 
ATOM   4890  C  CD    . ARG A  1  615 ? 32.724  29.551 57.401  1.00 63.54  ? 1414 ARG B CD    1 
ATOM   4891  N  NE    . ARG A  1  615 ? 33.432  28.434 57.959  1.00 72.71  ? 1414 ARG B NE    1 
ATOM   4892  C  CZ    . ARG A  1  615 ? 34.330  28.565 58.924  1.00 77.95  ? 1414 ARG B CZ    1 
ATOM   4893  N  NH1   . ARG A  1  615 ? 34.636  29.793 59.407  1.00 79.44  ? 1414 ARG B NH1   1 
ATOM   4894  N  NH2   . ARG A  1  615 ? 34.957  27.476 59.407  1.00 82.47  ? 1414 ARG B NH2   1 
ATOM   4895  N  N     . PHE A  1  616 ? 28.881  29.536 54.421  1.00 44.58  ? 1415 PHE B N     1 
ATOM   4896  C  CA    . PHE A  1  616 ? 28.036  30.716 54.240  1.00 44.53  ? 1415 PHE B CA    1 
ATOM   4897  C  C     . PHE A  1  616 ? 26.787  30.517 53.459  1.00 42.29  ? 1415 PHE B C     1 
ATOM   4898  O  O     . PHE A  1  616 ? 26.108  31.475 53.104  1.00 47.58  ? 1415 PHE B O     1 
ATOM   4899  C  CB    . PHE A  1  616 ? 28.882  31.857 53.638  1.00 43.78  ? 1415 PHE B CB    1 
ATOM   4900  C  CG    . PHE A  1  616 ? 30.213  32.053 54.305  1.00 41.28  ? 1415 PHE B CG    1 
ATOM   4901  C  CD1   . PHE A  1  616 ? 31.304  31.342 53.923  1.00 40.30  ? 1415 PHE B CD1   1 
ATOM   4902  C  CD2   . PHE A  1  616 ? 30.343  32.971 55.298  1.00 44.88  ? 1415 PHE B CD2   1 
ATOM   4903  C  CE1   . PHE A  1  616 ? 32.512  31.530 54.543  1.00 42.50  ? 1415 PHE B CE1   1 
ATOM   4904  C  CE2   . PHE A  1  616 ? 31.551  33.159 55.951  1.00 43.33  ? 1415 PHE B CE2   1 
ATOM   4905  C  CZ    . PHE A  1  616 ? 32.630  32.445 55.567  1.00 42.83  ? 1415 PHE B CZ    1 
ATOM   4906  N  N     . LYS A  1  617 ? 26.458  29.253 53.190  1.00 42.95  ? 1416 LYS B N     1 
ATOM   4907  C  CA    . LYS A  1  617 ? 25.241  28.880 52.433  1.00 43.81  ? 1416 LYS B CA    1 
ATOM   4908  C  C     . LYS A  1  617 ? 25.219  29.585 51.076  1.00 45.29  ? 1416 LYS B C     1 
ATOM   4909  O  O     . LYS A  1  617 ? 24.179  30.095 50.626  1.00 46.03  ? 1416 LYS B O     1 
ATOM   4910  C  CB    . LYS A  1  617 ? 23.972  28.991 53.200  1.00 46.59  ? 1416 LYS B CB    1 
ATOM   4911  N  N     . LEU A  1  618 ? 26.365  29.616 50.409  1.00 42.22  ? 1417 LEU B N     1 
ATOM   4912  C  CA    . LEU A  1  618 ? 26.473  30.221 49.082  1.00 40.94  ? 1417 LEU B CA    1 
ATOM   4913  C  C     . LEU A  1  618 ? 26.288  29.179 47.988  1.00 42.45  ? 1417 LEU B C     1 
ATOM   4914  O  O     . LEU A  1  618 ? 26.473  27.976 48.210  1.00 45.14  ? 1417 LEU B O     1 
ATOM   4915  C  CB    . LEU A  1  618 ? 27.840  30.911 48.930  1.00 37.87  ? 1417 LEU B CB    1 
ATOM   4916  C  CG    . LEU A  1  618 ? 28.104  32.059 49.890  1.00 38.54  ? 1417 LEU B CG    1 
ATOM   4917  C  CD1   . LEU A  1  618 ? 29.607  32.304 49.967  1.00 35.03  ? 1417 LEU B CD1   1 
ATOM   4918  C  CD2   . LEU A  1  618 ? 27.340  33.321 49.474  1.00 39.24  ? 1417 LEU B CD2   1 
ATOM   4919  N  N     . SER A  1  619 ? 25.934  29.663 46.806  1.00 42.20  ? 1418 SER B N     1 
ATOM   4920  C  CA    . SER A  1  619 ? 25.846  28.782 45.642  1.00 42.87  ? 1418 SER B CA    1 
ATOM   4921  C  C     . SER A  1  619 ? 27.229  28.550 45.053  1.00 42.75  ? 1418 SER B C     1 
ATOM   4922  O  O     . SER A  1  619 ? 28.201  29.247 45.384  1.00 40.81  ? 1418 SER B O     1 
ATOM   4923  C  CB    . SER A  1  619 ? 24.905  29.364 44.600  1.00 40.86  ? 1418 SER B CB    1 
ATOM   4924  O  OG    . SER A  1  619 ? 25.520  30.451 43.916  1.00 40.66  ? 1418 SER B OG    1 
ATOM   4925  N  N     . GLU A  1  620 ? 27.320  27.561 44.180  1.00 44.60  ? 1419 GLU B N     1 
ATOM   4926  C  CA    . GLU A  1  620 ? 28.575  27.305 43.469  1.00 45.32  ? 1419 GLU B CA    1 
ATOM   4927  C  C     . GLU A  1  620 ? 28.965  28.507 42.607  1.00 44.56  ? 1419 GLU B C     1 
ATOM   4928  O  O     . GLU A  1  620 ? 30.144  28.871 42.542  1.00 42.70  ? 1419 GLU B O     1 
ATOM   4929  C  CB    . GLU A  1  620 ? 28.451  26.045 42.621  1.00 48.48  ? 1419 GLU B CB    1 
ATOM   4930  C  CG    . GLU A  1  620 ? 29.608  25.879 41.650  1.00 53.02  ? 1419 GLU B CG    1 
ATOM   4931  C  CD    . GLU A  1  620 ? 29.843  24.435 41.275  1.00 56.74  ? 1419 GLU B CD    1 
ATOM   4932  O  OE1   . GLU A  1  620 ? 30.995  24.030 41.035  1.00 60.30  ? 1419 GLU B OE1   1 
ATOM   4933  O  OE2   . GLU A  1  620 ? 28.839  23.699 41.162  1.00 60.34  ? 1419 GLU B OE2   1 
ATOM   4934  N  N     . LYS A  1  621 ? 27.993  29.144 41.979  1.00 41.70  ? 1420 LYS B N     1 
ATOM   4935  C  CA    . LYS A  1  621 ? 28.282  30.316 41.185  1.00 39.01  ? 1420 LYS B CA    1 
ATOM   4936  C  C     . LYS A  1  621 ? 28.769  31.453 42.075  1.00 35.57  ? 1420 LYS B C     1 
ATOM   4937  O  O     . LYS A  1  621 ? 29.672  32.188 41.712  1.00 31.94  ? 1420 LYS B O     1 
ATOM   4938  C  CB    . LYS A  1  621 ? 27.028  30.760 40.415  1.00 39.52  ? 1420 LYS B CB    1 
ATOM   4939  C  CG    . LYS A  1  621 ? 27.026  30.197 38.945  1.00 42.54  ? 1420 LYS B CG    1 
ATOM   4940  C  CD    . LYS A  1  621 ? 25.635  30.502 38.354  1.00 43.49  ? 1420 LYS B CD    1 
ATOM   4941  C  CE    . LYS A  1  621 ? 25.322  29.529 37.239  1.00 52.07  ? 1420 LYS B CE    1 
ATOM   4942  N  NZ    . LYS A  1  621 ? 23.872  29.159 37.439  1.00 57.34  ? 1420 LYS B NZ    1 
ATOM   4943  N  N     . GLN A  1  622 ? 28.169  31.591 43.250  1.00 34.94  ? 1421 GLN B N     1 
ATOM   4944  C  CA    . GLN A  1  622 ? 28.556  32.646 44.169  1.00 34.67  ? 1421 GLN B CA    1 
ATOM   4945  C  C     . GLN A  1  622 ? 29.945  32.409 44.695  1.00 35.88  ? 1421 GLN B C     1 
ATOM   4946  O  O     . GLN A  1  622 ? 30.752  33.336 44.767  1.00 33.58  ? 1421 GLN B O     1 
ATOM   4947  C  CB    . GLN A  1  622 ? 27.550  32.742 45.324  1.00 33.72  ? 1421 GLN B CB    1 
ATOM   4948  C  CG    . GLN A  1  622 ? 26.382  33.672 45.005  1.00 33.89  ? 1421 GLN B CG    1 
ATOM   4949  C  CD    . GLN A  1  622 ? 25.195  33.428 45.912  1.00 35.76  ? 1421 GLN B CD    1 
ATOM   4950  O  OE1   . GLN A  1  622 ? 25.129  32.428 46.640  1.00 35.84  ? 1421 GLN B OE1   1 
ATOM   4951  N  NE2   . GLN A  1  622 ? 24.243  34.335 45.878  1.00 32.08  ? 1421 GLN B NE2   1 
ATOM   4952  N  N     . ALA A  1  623 ? 30.234  31.161 45.077  1.00 37.30  ? 1422 ALA B N     1 
ATOM   4953  C  CA    . ALA A  1  623 ? 31.533  30.810 45.618  1.00 35.77  ? 1422 ALA B CA    1 
ATOM   4954  C  C     . ALA A  1  623 ? 32.607  31.041 44.576  1.00 36.70  ? 1422 ALA B C     1 
ATOM   4955  O  O     . ALA A  1  623 ? 33.712  31.461 44.912  1.00 37.45  ? 1422 ALA B O     1 
ATOM   4956  C  CB    . ALA A  1  623 ? 31.537  29.393 46.104  1.00 35.27  ? 1422 ALA B CB    1 
ATOM   4957  N  N     . GLN A  1  624 ? 32.298  30.754 43.315  1.00 35.22  ? 1423 GLN B N     1 
ATOM   4958  C  CA    . GLN A  1  624 ? 33.262  30.938 42.240  1.00 38.02  ? 1423 GLN B CA    1 
ATOM   4959  C  C     . GLN A  1  624 ? 33.605  32.413 42.056  1.00 36.24  ? 1423 GLN B C     1 
ATOM   4960  O  O     . GLN A  1  624 ? 34.758  32.754 41.892  1.00 36.29  ? 1423 GLN B O     1 
ATOM   4961  C  CB    . GLN A  1  624 ? 32.753  30.343 40.938  1.00 38.37  ? 1423 GLN B CB    1 
ATOM   4962  C  CG    . GLN A  1  624 ? 33.837  30.114 39.902  1.00 44.59  ? 1423 GLN B CG    1 
ATOM   4963  C  CD    . GLN A  1  624 ? 34.680  28.879 40.282  1.00 50.64  ? 1423 GLN B CD    1 
ATOM   4964  O  OE1   . GLN A  1  624 ? 35.739  28.990 40.900  1.00 52.69  ? 1423 GLN B OE1   1 
ATOM   4965  N  NE2   . GLN A  1  624 ? 34.173  27.689 39.930  1.00 53.19  ? 1423 GLN B NE2   1 
ATOM   4966  N  N     . ALA A  1  625 ? 32.594  33.264 42.105  1.00 33.65  ? 1424 ALA B N     1 
ATOM   4967  C  CA    . ALA A  1  625 ? 32.798  34.708 41.939  1.00 31.87  ? 1424 ALA B CA    1 
ATOM   4968  C  C     . ALA A  1  625 ? 33.627  35.276 43.095  1.00 29.83  ? 1424 ALA B C     1 
ATOM   4969  O  O     . ALA A  1  625 ? 34.379  36.191 42.896  1.00 28.50  ? 1424 ALA B O     1 
ATOM   4970  C  CB    . ALA A  1  625 ? 31.467  35.414 41.837  1.00 29.86  ? 1424 ALA B CB    1 
ATOM   4971  N  N     . ILE A  1  626 ? 33.481  34.705 44.303  1.00 31.23  ? 1425 ILE B N     1 
ATOM   4972  C  CA    . ILE A  1  626 ? 34.222  35.167 45.440  1.00 31.43  ? 1425 ILE B CA    1 
ATOM   4973  C  C     . ILE A  1  626 ? 35.708  34.826 45.280  1.00 33.76  ? 1425 ILE B C     1 
ATOM   4974  O  O     . ILE A  1  626 ? 36.564  35.656 45.567  1.00 31.59  ? 1425 ILE B O     1 
ATOM   4975  C  CB    . ILE A  1  626 ? 33.657  34.591 46.757  1.00 30.90  ? 1425 ILE B CB    1 
ATOM   4976  C  CG1   . ILE A  1  626 ? 32.337  35.281 47.083  1.00 29.97  ? 1425 ILE B CG1   1 
ATOM   4977  C  CG2   . ILE A  1  626 ? 34.643  34.763 47.934  1.00 34.18  ? 1425 ILE B CG2   1 
ATOM   4978  C  CD1   . ILE A  1  626 ? 31.476  34.508 48.093  1.00 32.16  ? 1425 ILE B CD1   1 
ATOM   4979  N  N     . LEU A  1  627 ? 35.986  33.624 44.790  1.00 32.96  ? 1426 LEU B N     1 
ATOM   4980  C  CA    . LEU A  1  627 ? 37.358  33.212 44.557  1.00 35.24  ? 1426 LEU B CA    1 
ATOM   4981  C  C     . LEU A  1  627 ? 37.997  34.029 43.446  1.00 33.79  ? 1426 LEU B C     1 
ATOM   4982  O  O     . LEU A  1  627 ? 39.203  34.178 43.404  1.00 33.70  ? 1426 LEU B O     1 
ATOM   4983  C  CB    . LEU A  1  627 ? 37.424  31.724 44.216  1.00 35.02  ? 1426 LEU B CB    1 
ATOM   4984  C  CG    . LEU A  1  627 ? 37.166  30.723 45.330  1.00 39.52  ? 1426 LEU B CG    1 
ATOM   4985  C  CD1   . LEU A  1  627 ? 37.009  29.325 44.765  1.00 38.81  ? 1426 LEU B CD1   1 
ATOM   4986  C  CD2   . LEU A  1  627 ? 38.275  30.750 46.323  1.00 40.64  ? 1426 LEU B CD2   1 
ATOM   4987  N  N     . ASP A  1  628 ? 37.187  34.564 42.546  1.00 35.39  ? 1427 ASP B N     1 
ATOM   4988  C  CA    . ASP A  1  628 ? 37.685  35.359 41.428  1.00 34.07  ? 1427 ASP B CA    1 
ATOM   4989  C  C     . ASP A  1  628 ? 37.790  36.828 41.781  1.00 31.44  ? 1427 ASP B C     1 
ATOM   4990  O  O     . ASP A  1  628 ? 38.263  37.610 40.970  1.00 31.15  ? 1427 ASP B O     1 
ATOM   4991  C  CB    . ASP A  1  628 ? 36.736  35.227 40.229  1.00 37.67  ? 1427 ASP B CB    1 
ATOM   4992  C  CG    . ASP A  1  628 ? 36.814  33.860 39.554  1.00 45.79  ? 1427 ASP B CG    1 
ATOM   4993  O  OD1   . ASP A  1  628 ? 37.874  33.221 39.608  1.00 48.91  ? 1427 ASP B OD1   1 
ATOM   4994  O  OD2   . ASP A  1  628 ? 35.797  33.472 38.953  1.00 48.79  ? 1427 ASP B OD2   1 
ATOM   4995  N  N     . MET A  1  629 ? 37.364  37.205 42.977  1.00 29.48  ? 1428 MET B N     1 
ATOM   4996  C  CA    . MET A  1  629 ? 37.354  38.610 43.369  1.00 30.40  ? 1428 MET B CA    1 
ATOM   4997  C  C     . MET A  1  629 ? 38.766  39.078 43.727  1.00 30.70  ? 1428 MET B C     1 
ATOM   4998  O  O     . MET A  1  629 ? 39.501  38.388 44.448  1.00 32.62  ? 1428 MET B O     1 
ATOM   4999  C  CB    . MET A  1  629 ? 36.415  38.787 44.578  1.00 33.55  ? 1428 MET B CB    1 
ATOM   5000  C  CG    . MET A  1  629 ? 36.203  40.190 45.023  1.00 35.83  ? 1428 MET B CG    1 
ATOM   5001  S  SD    . MET A  1  629 ? 34.856  40.336 46.158  1.00 40.21  ? 1428 MET B SD    1 
ATOM   5002  C  CE    . MET A  1  629 ? 35.322  39.379 47.547  1.00 34.13  ? 1428 MET B CE    1 
ATOM   5003  N  N     . ARG A  1  630 ? 39.153  40.226 43.224  1.00 30.94  ? 1429 ARG B N     1 
ATOM   5004  C  CA    . ARG A  1  630 ? 40.505  40.751 43.449  1.00 32.27  ? 1429 ARG B CA    1 
ATOM   5005  C  C     . ARG A  1  630 ? 40.570  41.511 44.775  1.00 34.15  ? 1429 ARG B C     1 
ATOM   5006  O  O     . ARG A  1  630 ? 39.545  41.974 45.295  1.00 32.96  ? 1429 ARG B O     1 
ATOM   5007  C  CB    . ARG A  1  630 ? 40.967  41.665 42.323  1.00 32.79  ? 1429 ARG B CB    1 
ATOM   5008  C  CG    . ARG A  1  630 ? 40.839  41.103 40.908  1.00 36.30  ? 1429 ARG B CG    1 
ATOM   5009  C  CD    . ARG A  1  630 ? 41.297  42.107 39.871  1.00 37.49  ? 1429 ARG B CD    1 
ATOM   5010  N  NE    . ARG A  1  630 ? 41.084  41.548 38.537  1.00 43.14  ? 1429 ARG B NE    1 
ATOM   5011  C  CZ    . ARG A  1  630 ? 41.867  40.684 37.875  1.00 49.53  ? 1429 ARG B CZ    1 
ATOM   5012  N  NH1   . ARG A  1  630 ? 43.060  40.210 38.307  1.00 47.21  ? 1429 ARG B NH1   1 
ATOM   5013  N  NH2   . ARG A  1  630 ? 41.448  40.341 36.656  1.00 48.62  ? 1429 ARG B NH2   1 
ATOM   5014  N  N     . LEU A  1  631 ? 41.776  41.627 45.331  1.00 31.24  ? 1430 LEU B N     1 
ATOM   5015  C  CA    . LEU A  1  631 ? 41.962  42.259 46.632  1.00 31.64  ? 1430 LEU B CA    1 
ATOM   5016  C  C     . LEU A  1  631 ? 41.562  43.742 46.669  1.00 33.05  ? 1430 LEU B C     1 
ATOM   5017  O  O     . LEU A  1  631 ? 41.193  44.239 47.707  1.00 34.41  ? 1430 LEU B O     1 
ATOM   5018  C  CB    . LEU A  1  631 ? 43.417  42.147 47.078  1.00 30.87  ? 1430 LEU B CB    1 
ATOM   5019  C  CG    . LEU A  1  631 ? 43.877  40.719 47.504  1.00 30.90  ? 1430 LEU B CG    1 
ATOM   5020  C  CD1   . LEU A  1  631 ? 45.331  40.831 48.016  1.00 32.02  ? 1430 LEU B CD1   1 
ATOM   5021  C  CD2   . LEU A  1  631 ? 42.989  40.231 48.641  1.00 32.26  ? 1430 LEU B CD2   1 
ATOM   5022  N  N     . ARG A  1  632 ? 41.599  44.405 45.539  1.00 31.00  ? 1431 ARG B N     1 
ATOM   5023  C  CA    . ARG A  1  632 ? 41.185  45.816 45.454  1.00 32.07  ? 1431 ARG B CA    1 
ATOM   5024  C  C     . ARG A  1  632 ? 39.678  46.044 45.713  1.00 32.59  ? 1431 ARG B C     1 
ATOM   5025  O  O     . ARG A  1  632 ? 39.303  47.121 46.142  1.00 33.32  ? 1431 ARG B O     1 
ATOM   5026  C  CB    . ARG A  1  632 ? 41.598  46.449 44.132  1.00 33.41  ? 1431 ARG B CB    1 
ATOM   5027  C  CG    . ARG A  1  632 ? 40.941  45.779 42.901  1.00 34.15  ? 1431 ARG B CG    1 
ATOM   5028  C  CD    . ARG A  1  632 ? 41.275  46.520 41.611  1.00 35.62  ? 1431 ARG B CD    1 
ATOM   5029  N  NE    . ARG A  1  632 ? 42.685  46.452 41.276  1.00 36.66  ? 1431 ARG B NE    1 
ATOM   5030  C  CZ    . ARG A  1  632 ? 43.540  47.480 41.360  1.00 38.71  ? 1431 ARG B CZ    1 
ATOM   5031  N  NH1   . ARG A  1  632 ? 43.103  48.642 41.810  1.00 43.00  ? 1431 ARG B NH1   1 
ATOM   5032  N  NH2   . ARG A  1  632 ? 44.812  47.346 40.969  1.00 36.86  ? 1431 ARG B NH2   1 
ATOM   5033  N  N     . ARG A  1  633 ? 38.867  45.015 45.536  1.00 35.64  ? 1432 ARG B N     1 
ATOM   5034  C  CA    . ARG A  1  633 ? 37.440  45.136 45.888  1.00 39.53  ? 1432 ARG B CA    1 
ATOM   5035  C  C     . ARG A  1  633 ? 37.236  45.338 47.383  1.00 40.86  ? 1432 ARG B C     1 
ATOM   5036  O  O     . ARG A  1  633 ? 36.118  45.676 47.795  1.00 37.93  ? 1432 ARG B O     1 
ATOM   5037  C  CB    . ARG A  1  633 ? 36.655  43.900 45.408  1.00 43.55  ? 1432 ARG B CB    1 
ATOM   5038  C  CG    . ARG A  1  633 ? 36.878  43.492 43.979  1.00 50.48  ? 1432 ARG B CG    1 
ATOM   5039  C  CD    . ARG A  1  633 ? 36.288  44.507 42.985  1.00 57.70  ? 1432 ARG B CD    1 
ATOM   5040  N  NE    . ARG A  1  633 ? 34.851  44.492 42.915  1.00 59.67  ? 1432 ARG B NE    1 
ATOM   5041  C  CZ    . ARG A  1  633 ? 34.088  43.526 42.318  1.00 62.21  ? 1432 ARG B CZ    1 
ATOM   5042  N  NH1   . ARG A  1  633 ? 34.569  42.352 41.846  1.00 62.86  ? 1432 ARG B NH1   1 
ATOM   5043  N  NH2   . ARG A  1  633 ? 32.765  43.673 42.319  1.00 62.36  ? 1432 ARG B NH2   1 
ATOM   5044  N  N     . LEU A  1  634 ? 38.266  45.133 48.193  1.00 37.50  ? 1433 LEU B N     1 
ATOM   5045  C  CA    . LEU A  1  634 ? 38.154  45.249 49.658  1.00 37.31  ? 1433 LEU B CA    1 
ATOM   5046  C  C     . LEU A  1  634 ? 38.225  46.696 50.144  1.00 37.98  ? 1433 LEU B C     1 
ATOM   5047  O  O     . LEU A  1  634 ? 38.105  46.926 51.330  1.00 40.07  ? 1433 LEU B O     1 
ATOM   5048  C  CB    . LEU A  1  634 ? 39.242  44.440 50.352  1.00 35.63  ? 1433 LEU B CB    1 
ATOM   5049  C  CG    . LEU A  1  634 ? 38.999  42.911 50.519  1.00 35.09  ? 1433 LEU B CG    1 
ATOM   5050  C  CD1   . LEU A  1  634 ? 38.889  42.173 49.158  1.00 34.13  ? 1433 LEU B CD1   1 
ATOM   5051  C  CD2   . LEU A  1  634 ? 40.114  42.251 51.270  1.00 35.40  ? 1433 LEU B CD2   1 
ATOM   5052  N  N     . THR A  1  635 ? 38.425  47.649 49.236  1.00 37.52  ? 1434 THR B N     1 
ATOM   5053  C  CA    . THR A  1  635 ? 38.524  49.042 49.615  1.00 38.69  ? 1434 THR B CA    1 
ATOM   5054  C  C     . THR A  1  635 ? 37.164  49.600 49.946  1.00 40.37  ? 1434 THR B C     1 
ATOM   5055  O  O     . THR A  1  635 ? 36.151  48.994 49.590  1.00 39.11  ? 1434 THR B O     1 
ATOM   5056  C  CB    . THR A  1  635 ? 39.190  49.890 48.506  1.00 38.76  ? 1434 THR B CB    1 
ATOM   5057  O  OG1   . THR A  1  635 ? 38.423  49.751 47.296  1.00 40.37  ? 1434 THR B OG1   1 
ATOM   5058  C  CG2   . THR A  1  635 ? 40.615  49.396 48.253  1.00 39.62  ? 1434 THR B CG2   1 
ATOM   5059  N  N     . GLY A  1  636 ? 37.109  50.725 50.667  1.00 41.70  ? 1435 GLY B N     1 
ATOM   5060  C  CA    . GLY A  1  636 ? 35.840  51.287 51.094  1.00 44.19  ? 1435 GLY B CA    1 
ATOM   5061  C  C     . GLY A  1  636 ? 34.832  51.657 49.995  1.00 43.01  ? 1435 GLY B C     1 
ATOM   5062  O  O     . GLY A  1  636 ? 33.670  51.316 50.086  1.00 47.68  ? 1435 GLY B O     1 
ATOM   5063  N  N     . LEU A  1  637 ? 35.285  52.308 48.962  1.00 45.70  ? 1436 LEU B N     1 
ATOM   5064  C  CA    . LEU A  1  637 ? 34.342  52.716 47.914  1.00 47.99  ? 1436 LEU B CA    1 
ATOM   5065  C  C     . LEU A  1  637 ? 33.780  51.538 47.192  1.00 48.77  ? 1436 LEU B C     1 
ATOM   5066  O  O     . LEU A  1  637 ? 32.633  51.612 46.776  1.00 44.89  ? 1436 LEU B O     1 
ATOM   5067  C  CB    . LEU A  1  637 ? 34.926  53.657 46.861  1.00 50.17  ? 1436 LEU B CB    1 
ATOM   5068  C  CG    . LEU A  1  637 ? 35.557  54.966 47.257  1.00 55.22  ? 1436 LEU B CG    1 
ATOM   5069  C  CD1   . LEU A  1  637 ? 35.420  55.862 46.023  1.00 58.36  ? 1436 LEU B CD1   1 
ATOM   5070  C  CD2   . LEU A  1  637 ? 35.145  55.669 48.583  1.00 59.34  ? 1436 LEU B CD2   1 
ATOM   5071  N  N     . GLU A  1  638 ? 34.545  50.465 47.066  1.00 46.67  ? 1437 GLU B N     1 
ATOM   5072  C  CA    . GLU A  1  638 ? 34.043  49.262 46.406  1.00 47.56  ? 1437 GLU B CA    1 
ATOM   5073  C  C     . GLU A  1  638 ? 32.826  48.662 47.047  1.00 47.67  ? 1437 GLU B C     1 
ATOM   5074  O  O     . GLU A  1  638 ? 31.947  48.210 46.338  1.00 46.73  ? 1437 GLU B O     1 
ATOM   5075  C  CB    . GLU A  1  638 ? 35.160  48.228 46.245  1.00 51.07  ? 1437 GLU B CB    1 
ATOM   5076  C  CG    . GLU A  1  638 ? 35.995  48.468 45.009  1.00 55.48  ? 1437 GLU B CG    1 
ATOM   5077  C  CD    . GLU A  1  638 ? 35.169  48.373 43.737  1.00 58.50  ? 1437 GLU B CD    1 
ATOM   5078  O  OE1   . GLU A  1  638 ? 34.130  47.678 43.769  1.00 62.04  ? 1437 GLU B OE1   1 
ATOM   5079  O  OE2   . GLU A  1  638 ? 35.560  48.992 42.727  1.00 57.00  ? 1437 GLU B OE2   1 
ATOM   5080  N  N     . ARG A  1  639 ? 32.746  48.658 48.374  1.00 46.64  ? 1438 ARG B N     1 
ATOM   5081  C  CA    . ARG A  1  639 ? 31.566  48.101 49.027  1.00 46.94  ? 1438 ARG B CA    1 
ATOM   5082  C  C     . ARG A  1  639 ? 30.342  48.903 48.587  1.00 45.87  ? 1438 ARG B C     1 
ATOM   5083  O  O     . ARG A  1  639 ? 29.310  48.350 48.262  1.00 46.85  ? 1438 ARG B O     1 
ATOM   5084  C  CB    . ARG A  1  639 ? 31.695  48.139 50.538  1.00 45.72  ? 1438 ARG B CB    1 
ATOM   5085  C  CG    . ARG A  1  639 ? 30.503  47.545 51.277  1.00 46.93  ? 1438 ARG B CG    1 
ATOM   5086  C  CD    . ARG A  1  639 ? 30.408  46.022 50.971  1.00 51.05  ? 1438 ARG B CD    1 
ATOM   5087  N  NE    . ARG A  1  639 ? 29.184  45.390 51.424  1.00 50.35  ? 1438 ARG B NE    1 
ATOM   5088  C  CZ    . ARG A  1  639 ? 27.991  45.577 50.850  1.00 51.13  ? 1438 ARG B CZ    1 
ATOM   5089  N  NH1   . ARG A  1  639 ? 27.881  46.314 49.748  1.00 45.98  ? 1438 ARG B NH1   1 
ATOM   5090  N  NH2   . ARG A  1  639 ? 26.909  45.014 51.370  1.00 48.72  ? 1438 ARG B NH2   1 
ATOM   5091  N  N     . ASP A  1  640 ? 30.483  50.219 48.570  1.00 46.00  ? 1439 ASP B N     1 
ATOM   5092  C  CA    . ASP A  1  640 ? 29.376  51.085 48.164  1.00 45.48  ? 1439 ASP B CA    1 
ATOM   5093  C  C     . ASP A  1  640 ? 29.004  50.918 46.710  1.00 41.66  ? 1439 ASP B C     1 
ATOM   5094  O  O     . ASP A  1  640 ? 27.830  50.980 46.371  1.00 44.21  ? 1439 ASP B O     1 
ATOM   5095  C  CB    . ASP A  1  640 ? 29.684  52.545 48.406  1.00 45.67  ? 1439 ASP B CB    1 
ATOM   5096  C  CG    . ASP A  1  640 ? 29.949  52.838 49.886  1.00 48.93  ? 1439 ASP B CG    1 
ATOM   5097  O  OD1   . ASP A  1  640 ? 29.243  52.212 50.764  1.00 48.21  ? 1439 ASP B OD1   1 
ATOM   5098  O  OD2   . ASP A  1  640 ? 30.877  53.715 50.041  1.00 49.94  ? 1439 ASP B OD2   1 
ATOM   5099  N  N     . LYS A  1  641 ? 29.994  50.715 45.872  1.00 40.32  ? 1440 LYS B N     1 
ATOM   5100  C  CA    . LYS A  1  641 ? 29.747  50.516 44.453  1.00 40.99  ? 1440 LYS B CA    1 
ATOM   5101  C  C     . LYS A  1  641 ? 28.954  49.256 44.252  1.00 39.85  ? 1440 LYS B C     1 
ATOM   5102  O  O     . LYS A  1  641 ? 28.034  49.240 43.448  1.00 39.62  ? 1440 LYS B O     1 
ATOM   5103  C  CB    . LYS A  1  641 ? 31.072  50.443 43.673  1.00 39.46  ? 1440 LYS B CB    1 
ATOM   5104  C  CG    . LYS A  1  641 ? 31.827  51.788 43.619  1.00 42.14  ? 1440 LYS B CG    1 
ATOM   5105  N  N     . ILE A  1  642 ? 29.292  48.206 44.995  1.00 39.29  ? 1441 ILE B N     1 
ATOM   5106  C  CA    . ILE A  1  642 ? 28.569  46.941 44.867  1.00 39.28  ? 1441 ILE B CA    1 
ATOM   5107  C  C     . ILE A  1  642 ? 27.148  47.107 45.372  1.00 36.46  ? 1441 ILE B C     1 
ATOM   5108  O  O     . ILE A  1  642 ? 26.205  46.536 44.787  1.00 37.28  ? 1441 ILE B O     1 
ATOM   5109  C  CB    . ILE A  1  642 ? 29.326  45.826 45.621  1.00 39.33  ? 1441 ILE B CB    1 
ATOM   5110  C  CG1   . ILE A  1  642 ? 30.576  45.447 44.809  1.00 41.60  ? 1441 ILE B CG1   1 
ATOM   5111  C  CG2   . ILE A  1  642 ? 28.405  44.613 45.824  1.00 37.97  ? 1441 ILE B CG2   1 
ATOM   5112  C  CD1   . ILE A  1  642 ? 31.333  44.274 45.384  1.00 45.04  ? 1441 ILE B CD1   1 
ATOM   5113  N  N     . GLU A  1  643 ? 26.949  47.880 46.443  1.00 35.49  ? 1442 GLU B N     1 
ATOM   5114  C  CA    . GLU A  1  643 ? 25.605  48.068 46.961  1.00 34.28  ? 1442 GLU B CA    1 
ATOM   5115  C  C     . GLU A  1  643 ? 24.771  48.907 46.014  1.00 33.92  ? 1442 GLU B C     1 
ATOM   5116  O  O     . GLU A  1  643 ? 23.587  48.593 45.788  1.00 33.74  ? 1442 GLU B O     1 
ATOM   5117  C  CB    . GLU A  1  643 ? 25.673  48.732 48.359  1.00 36.00  ? 1442 GLU B CB    1 
ATOM   5118  C  CG    . GLU A  1  643 ? 24.380  48.606 49.158  1.00 37.36  ? 1442 GLU B CG    1 
ATOM   5119  C  CD    . GLU A  1  643 ? 24.077  47.144 49.528  1.00 37.06  ? 1442 GLU B CD    1 
ATOM   5120  O  OE1   . GLU A  1  643 ? 25.035  46.333 49.625  1.00 36.94  ? 1442 GLU B OE1   1 
ATOM   5121  O  OE2   . GLU A  1  643 ? 22.876  46.807 49.666  1.00 41.04  ? 1442 GLU B OE2   1 
ATOM   5122  N  N     . ALA A  1  644 ? 25.364  49.957 45.435  1.00 33.05  ? 1443 ALA B N     1 
ATOM   5123  C  CA    . ALA A  1  644 ? 24.618  50.816 44.515  1.00 34.62  ? 1443 ALA B CA    1 
ATOM   5124  C  C     . ALA A  1  644 ? 24.260  50.066 43.221  1.00 35.29  ? 1443 ALA B C     1 
ATOM   5125  O  O     . ALA A  1  644 ? 23.187  50.303 42.662  1.00 33.78  ? 1443 ALA B O     1 
ATOM   5126  C  CB    . ALA A  1  644 ? 25.429  52.071 44.185  1.00 34.94  ? 1443 ALA B CB    1 
ATOM   5127  N  N     . GLU A  1  645 ? 25.133  49.173 42.767  1.00 36.82  ? 1444 GLU B N     1 
ATOM   5128  C  CA    . GLU A  1  645 ? 24.781  48.359 41.601  1.00 35.41  ? 1444 GLU B CA    1 
ATOM   5129  C  C     . GLU A  1  645 ? 23.679  47.373 41.942  1.00 34.59  ? 1444 GLU B C     1 
ATOM   5130  O  O     . GLU A  1  645 ? 22.763  47.175 41.127  1.00 32.31  ? 1444 GLU B O     1 
ATOM   5131  C  CB    . GLU A  1  645 ? 26.010  47.597 41.067  1.00 37.58  ? 1444 GLU B CB    1 
ATOM   5132  C  CG    . GLU A  1  645 ? 25.701  46.860 39.768  1.00 37.87  ? 1444 GLU B CG    1 
ATOM   5133  C  CD    . GLU A  1  645 ? 26.764  45.911 39.312  1.00 39.84  ? 1444 GLU B CD    1 
ATOM   5134  O  OE1   . GLU A  1  645 ? 26.503  45.141 38.355  1.00 39.24  ? 1444 GLU B OE1   1 
ATOM   5135  O  OE2   . GLU A  1  645 ? 27.850  45.929 39.879  1.00 38.46  ? 1444 GLU B OE2   1 
ATOM   5136  N  N     . TYR A  1  646 ? 23.729  46.785 43.136  1.00 34.07  ? 1445 TYR B N     1 
ATOM   5137  C  CA    . TYR A  1  646 ? 22.704  45.829 43.535  1.00 34.90  ? 1445 TYR B CA    1 
ATOM   5138  C  C     . TYR A  1  646 ? 21.333  46.473 43.583  1.00 37.06  ? 1445 TYR B C     1 
ATOM   5139  O  O     . TYR A  1  646 ? 20.366  45.928 43.035  1.00 36.59  ? 1445 TYR B O     1 
ATOM   5140  C  CB    . TYR A  1  646 ? 23.067  45.209 44.901  1.00 33.71  ? 1445 TYR B CB    1 
ATOM   5141  C  CG    . TYR A  1  646 ? 22.090  44.161 45.355  1.00 34.56  ? 1445 TYR B CG    1 
ATOM   5142  C  CD1   . TYR A  1  646 ? 21.946  42.958 44.669  1.00 33.14  ? 1445 TYR B CD1   1 
ATOM   5143  C  CD2   . TYR A  1  646 ? 21.268  44.394 46.492  1.00 33.37  ? 1445 TYR B CD2   1 
ATOM   5144  C  CE1   . TYR A  1  646 ? 21.034  41.995 45.072  1.00 34.70  ? 1445 TYR B CE1   1 
ATOM   5145  C  CE2   . TYR A  1  646 ? 20.365  43.432 46.903  1.00 36.78  ? 1445 TYR B CE2   1 
ATOM   5146  C  CZ    . TYR A  1  646 ? 20.279  42.222 46.193  1.00 35.69  ? 1445 TYR B CZ    1 
ATOM   5147  O  OH    . TYR A  1  646 ? 19.387  41.267 46.611  1.00 38.34  ? 1445 TYR B OH    1 
ATOM   5148  N  N     . ASN A  1  647 ? 21.233  47.648 44.219  1.00 36.21  ? 1446 ASN B N     1 
ATOM   5149  C  CA    . ASN A  1  647 ? 19.933  48.329 44.333  1.00 39.10  ? 1446 ASN B CA    1 
ATOM   5150  C  C     . ASN A  1  647 ? 19.403  48.754 42.954  1.00 36.49  ? 1446 ASN B C     1 
ATOM   5151  O  O     . ASN A  1  647 ? 18.217  48.620 42.684  1.00 38.88  ? 1446 ASN B O     1 
ATOM   5152  C  CB    . ASN A  1  647 ? 20.037  49.520 45.267  1.00 39.90  ? 1446 ASN B CB    1 
ATOM   5153  C  CG    . ASN A  1  647 ? 20.355  49.119 46.679  1.00 45.40  ? 1446 ASN B CG    1 
ATOM   5154  O  OD1   . ASN A  1  647 ? 19.809  48.161 47.199  1.00 45.55  ? 1446 ASN B OD1   1 
ATOM   5155  N  ND2   . ASN A  1  647 ? 21.282  49.864 47.320  1.00 46.08  ? 1446 ASN B ND2   1 
ATOM   5156  N  N     . GLU A  1  648 ? 20.286  49.246 42.097  1.00 36.71  ? 1447 GLU B N     1 
ATOM   5157  C  CA    . GLU A  1  648 ? 19.867  49.617 40.743  1.00 38.62  ? 1447 GLU B CA    1 
ATOM   5158  C  C     . GLU A  1  648 ? 19.394  48.389 39.975  1.00 35.86  ? 1447 GLU B C     1 
ATOM   5159  O  O     . GLU A  1  648 ? 18.458  48.474 39.170  1.00 36.74  ? 1447 GLU B O     1 
ATOM   5160  C  CB    . GLU A  1  648 ? 21.024  50.322 40.008  1.00 40.40  ? 1447 GLU B CB    1 
ATOM   5161  C  CG    . GLU A  1  648 ? 20.765  50.763 38.604  1.00 40.35  ? 1447 GLU B CG    1 
ATOM   5162  N  N     . LEU A  1  649 ? 20.032  47.229 40.202  1.00 36.69  ? 1448 LEU B N     1 
ATOM   5163  C  CA    . LEU A  1  649 ? 19.616  46.008 39.528  1.00 35.06  ? 1448 LEU B CA    1 
ATOM   5164  C  C     . LEU A  1  649 ? 18.217  45.570 40.000  1.00 34.71  ? 1448 LEU B C     1 
ATOM   5165  O  O     . LEU A  1  649 ? 17.417  45.078 39.201  1.00 35.70  ? 1448 LEU B O     1 
ATOM   5166  C  CB    . LEU A  1  649 ? 20.622  44.893 39.805  1.00 36.44  ? 1448 LEU B CB    1 
ATOM   5167  C  CG    . LEU A  1  649 ? 21.661  44.612 38.770  1.00 41.52  ? 1448 LEU B CG    1 
ATOM   5168  C  CD1   . LEU A  1  649 ? 22.425  43.384 39.186  1.00 43.63  ? 1448 LEU B CD1   1 
ATOM   5169  C  CD2   . LEU A  1  649 ? 20.996  44.432 37.351  1.00 36.13  ? 1448 LEU B CD2   1 
ATOM   5170  N  N     . LEU A  1  650 ? 17.925  45.730 41.296  1.00 33.22  ? 1449 LEU B N     1 
ATOM   5171  C  CA    . LEU A  1  650 ? 16.625  45.354 41.782  1.00 35.15  ? 1449 LEU B CA    1 
ATOM   5172  C  C     . LEU A  1  650 ? 15.519  46.200 41.142  1.00 34.58  ? 1449 LEU B C     1 
ATOM   5173  O  O     . LEU A  1  650 ? 14.454  45.663 40.778  1.00 35.65  ? 1449 LEU B O     1 
ATOM   5174  C  CB    . LEU A  1  650 ? 16.562  45.524 43.322  1.00 32.49  ? 1449 LEU B CB    1 
ATOM   5175  C  CG    . LEU A  1  650 ? 17.461  44.529 44.122  1.00 33.11  ? 1449 LEU B CG    1 
ATOM   5176  C  CD1   . LEU A  1  650 ? 17.351  44.970 45.624  1.00 33.09  ? 1449 LEU B CD1   1 
ATOM   5177  C  CD2   . LEU A  1  650 ? 17.087  43.082 43.923  1.00 33.24  ? 1449 LEU B CD2   1 
ATOM   5178  N  N     . ASN A  1  651 ? 15.739  47.502 41.006  1.00 35.07  ? 1450 ASN B N     1 
ATOM   5179  C  CA    . ASN A  1  651 ? 14.773  48.340 40.305  1.00 38.00  ? 1450 ASN B CA    1 
ATOM   5180  C  C     . ASN A  1  651 ? 14.652  47.940 38.832  1.00 36.14  ? 1450 ASN B C     1 
ATOM   5181  O  O     . ASN A  1  651 ? 13.557  47.954 38.276  1.00 36.17  ? 1450 ASN B O     1 
ATOM   5182  C  CB    . ASN A  1  651 ? 15.186  49.826 40.376  1.00 41.43  ? 1450 ASN B CB    1 
ATOM   5183  C  CG    . ASN A  1  651 ? 15.122  50.365 41.779  1.00 49.84  ? 1450 ASN B CG    1 
ATOM   5184  O  OD1   . ASN A  1  651 ? 14.371  49.820 42.652  1.00 50.49  ? 1450 ASN B OD1   1 
ATOM   5185  N  ND2   . ASN A  1  651 ? 15.895  51.421 42.016  1.00 56.04  ? 1450 ASN B ND2   1 
ATOM   5186  N  N     . TYR A  1  652 ? 15.776  47.586 38.211  1.00 32.53  ? 1451 TYR B N     1 
ATOM   5187  C  CA    . TYR A  1  652 ? 15.748  47.172 36.812  1.00 33.20  ? 1451 TYR B CA    1 
ATOM   5188  C  C     . TYR A  1  652 ? 15.007  45.856 36.628  1.00 32.08  ? 1451 TYR B C     1 
ATOM   5189  O  O     . TYR A  1  652 ? 14.230  45.705 35.689  1.00 32.04  ? 1451 TYR B O     1 
ATOM   5190  C  CB    . TYR A  1  652 ? 17.199  47.056 36.294  1.00 32.05  ? 1451 TYR B CB    1 
ATOM   5191  C  CG    . TYR A  1  652 ? 17.344  46.739 34.828  1.00 33.37  ? 1451 TYR B CG    1 
ATOM   5192  C  CD1   . TYR A  1  652 ? 16.598  47.430 33.847  1.00 34.46  ? 1451 TYR B CD1   1 
ATOM   5193  C  CD2   . TYR A  1  652 ? 18.274  45.793 34.428  1.00 32.36  ? 1451 TYR B CD2   1 
ATOM   5194  C  CE1   . TYR A  1  652 ? 16.790  47.173 32.506  1.00 33.31  ? 1451 TYR B CE1   1 
ATOM   5195  C  CE2   . TYR A  1  652 ? 18.452  45.493 33.044  1.00 33.44  ? 1451 TYR B CE2   1 
ATOM   5196  C  CZ    . TYR A  1  652 ? 17.707  46.173 32.120  1.00 33.80  ? 1451 TYR B CZ    1 
ATOM   5197  O  OH    . TYR A  1  652 ? 17.870  45.893 30.798  1.00 33.52  ? 1451 TYR B OH    1 
ATOM   5198  N  N     . ILE A  1  653 ? 15.224  44.885 37.530  1.00 34.01  ? 1452 ILE B N     1 
ATOM   5199  C  CA    . ILE A  1  653 ? 14.515  43.611 37.454  1.00 33.62  ? 1452 ILE B CA    1 
ATOM   5200  C  C     . ILE A  1  653 ? 12.993  43.827 37.573  1.00 34.47  ? 1452 ILE B C     1 
ATOM   5201  O  O     . ILE A  1  653 ? 12.213  43.255 36.820  1.00 32.68  ? 1452 ILE B O     1 
ATOM   5202  C  CB    . ILE A  1  653 ? 15.027  42.658 38.535  1.00 33.81  ? 1452 ILE B CB    1 
ATOM   5203  C  CG1   . ILE A  1  653 ? 16.439  42.217 38.236  1.00 33.24  ? 1452 ILE B CG1   1 
ATOM   5204  C  CG2   . ILE A  1  653 ? 14.088  41.470 38.730  1.00 36.05  ? 1452 ILE B CG2   1 
ATOM   5205  C  CD1   . ILE A  1  653 ? 17.145  41.497 39.344  1.00 33.39  ? 1452 ILE B CD1   1 
ATOM   5206  N  N     . SER A  1  654 ? 12.582  44.659 38.521  1.00 38.41  ? 1453 SER B N     1 
ATOM   5207  C  CA    . SER A  1  654 ? 11.168  44.958 38.677  1.00 37.56  ? 1453 SER B CA    1 
ATOM   5208  C  C     . SER A  1  654 ? 10.577  45.595 37.422  1.00 37.65  ? 1453 SER B C     1 
ATOM   5209  O  O     . SER A  1  654 ? 9.446   45.314 37.036  1.00 35.89  ? 1453 SER B O     1 
ATOM   5210  C  CB    . SER A  1  654 ? 10.963  45.883 39.904  1.00 38.39  ? 1453 SER B CB    1 
ATOM   5211  O  OG    . SER A  1  654 ? 9.795   46.642 39.761  1.00 48.30  ? 1453 SER B OG    1 
ATOM   5212  N  N     . GLU A  1  655 ? 11.347  46.457 36.763  1.00 36.76  ? 1454 GLU B N     1 
ATOM   5213  C  CA    . GLU A  1  655 ? 10.867  47.106 35.539  1.00 40.35  ? 1454 GLU B CA    1 
ATOM   5214  C  C     . GLU A  1  655 ? 10.726  46.103 34.409  1.00 37.18  ? 1454 GLU B C     1 
ATOM   5215  O  O     . GLU A  1  655 ? 9.745   46.146 33.659  1.00 36.91  ? 1454 GLU B O     1 
ATOM   5216  C  CB    . GLU A  1  655 ? 11.786  48.254 35.162  1.00 43.58  ? 1454 GLU B CB    1 
ATOM   5217  C  CG    . GLU A  1  655 ? 11.574  49.493 36.045  1.00 53.27  ? 1454 GLU B CG    1 
ATOM   5218  C  CD    . GLU A  1  655 ? 12.749  50.446 36.053  1.00 60.70  ? 1454 GLU B CD    1 
ATOM   5219  O  OE1   . GLU A  1  655 ? 13.705  50.186 35.234  1.00 70.59  ? 1454 GLU B OE1   1 
ATOM   5220  O  OE2   . GLU A  1  655 ? 12.686  51.400 36.856  1.00 64.86  ? 1454 GLU B OE2   1 
ATOM   5221  N  N     . LEU A  1  656 ? 11.685  45.187 34.274  1.00 36.61  ? 1455 LEU B N     1 
ATOM   5222  C  CA    . LEU A  1  656 ? 11.611  44.170 33.229  1.00 35.05  ? 1455 LEU B CA    1 
ATOM   5223  C  C     . LEU A  1  656 ? 10.419  43.250 33.460  1.00 35.33  ? 1455 LEU B C     1 
ATOM   5224  O  O     . LEU A  1  656 ? 9.747   42.826 32.503  1.00 32.16  ? 1455 LEU B O     1 
ATOM   5225  C  CB    . LEU A  1  656 ? 12.901  43.358 33.170  1.00 35.14  ? 1455 LEU B CB    1 
ATOM   5226  C  CG    . LEU A  1  656 ? 14.152  44.154 32.687  1.00 37.02  ? 1455 LEU B CG    1 
ATOM   5227  C  CD1   . LEU A  1  656 ? 15.420  43.326 33.020  1.00 39.29  ? 1455 LEU B CD1   1 
ATOM   5228  C  CD2   . LEU A  1  656 ? 14.078  44.482 31.188  1.00 36.82  ? 1455 LEU B CD2   1 
ATOM   5229  N  N     . GLU A  1  657 ? 10.141  42.899 34.719  1.00 32.95  ? 1456 GLU B N     1 
ATOM   5230  C  CA    . GLU A  1  657 ? 9.024   42.019 35.015  1.00 34.18  ? 1456 GLU B CA    1 
ATOM   5231  C  C     . GLU A  1  657 ? 7.684   42.707 34.719  1.00 34.75  ? 1456 GLU B C     1 
ATOM   5232  O  O     . GLU A  1  657 ? 6.717   42.045 34.316  1.00 36.06  ? 1456 GLU B O     1 
ATOM   5233  C  CB    . GLU A  1  657 ? 9.086   41.563 36.481  1.00 35.21  ? 1456 GLU B CB    1 
ATOM   5234  C  CG    . GLU A  1  657 ? 10.303  40.707 36.786  1.00 35.02  ? 1456 GLU B CG    1 
ATOM   5235  C  CD    . GLU A  1  657 ? 10.421  40.397 38.266  1.00 41.82  ? 1456 GLU B CD    1 
ATOM   5236  O  OE1   . GLU A  1  657 ? 11.021  39.332 38.561  1.00 45.49  ? 1456 GLU B OE1   1 
ATOM   5237  O  OE2   . GLU A  1  657 ? 9.913   41.206 39.081  1.00 40.69  ? 1456 GLU B OE2   1 
ATOM   5238  N  N     . THR A  1  658 ? 7.607   44.021 34.913  1.00 37.69  ? 1457 THR B N     1 
ATOM   5239  C  CA    . THR A  1  658 ? 6.394   44.746 34.588  1.00 41.45  ? 1457 THR B CA    1 
ATOM   5240  C  C     . THR A  1  658 ? 6.087   44.682 33.099  1.00 41.58  ? 1457 THR B C     1 
ATOM   5241  O  O     . THR A  1  658 ? 4.911   44.544 32.698  1.00 41.23  ? 1457 THR B O     1 
ATOM   5242  C  CB    . THR A  1  658 ? 6.522   46.220 35.038  1.00 43.21  ? 1457 THR B CB    1 
ATOM   5243  O  OG1   . THR A  1  658 ? 6.622   46.265 36.463  1.00 43.56  ? 1457 THR B OG1   1 
ATOM   5244  C  CG2   . THR A  1  658 ? 5.335   47.043 34.593  1.00 46.74  ? 1457 THR B CG2   1 
ATOM   5245  N  N     . ILE A  1  659 ? 7.136   44.773 32.263  1.00 37.38  ? 1458 ILE B N     1 
ATOM   5246  C  CA    . ILE A  1  659 ? 6.963   44.661 30.817  1.00 37.77  ? 1458 ILE B CA    1 
ATOM   5247  C  C     . ILE A  1  659 ? 6.449   43.264 30.432  1.00 38.01  ? 1458 ILE B C     1 
ATOM   5248  O  O     . ILE A  1  659 ? 5.531   43.134 29.632  1.00 38.68  ? 1458 ILE B O     1 
ATOM   5249  C  CB    . ILE A  1  659 ? 8.283   44.980 30.109  1.00 37.24  ? 1458 ILE B CB    1 
ATOM   5250  C  CG1   . ILE A  1  659 ? 8.683   46.418 30.335  1.00 35.43  ? 1458 ILE B CG1   1 
ATOM   5251  C  CG2   . ILE A  1  659 ? 8.173   44.648 28.608  1.00 38.28  ? 1458 ILE B CG2   1 
ATOM   5252  C  CD1   . ILE A  1  659 ? 10.204  46.607 29.964  1.00 37.45  ? 1458 ILE B CD1   1 
ATOM   5253  N  N     . LEU A  1  660 ? 7.050   42.232 31.010  1.00 37.13  ? 1459 LEU B N     1 
ATOM   5254  C  CA    . LEU A  1  660 ? 6.652   40.875 30.676  1.00 36.92  ? 1459 LEU B CA    1 
ATOM   5255  C  C     . LEU A  1  660 ? 5.307   40.492 31.255  1.00 40.26  ? 1459 LEU B C     1 
ATOM   5256  O  O     . LEU A  1  660 ? 4.690   39.516 30.774  1.00 42.24  ? 1459 LEU B O     1 
ATOM   5257  C  CB    . LEU A  1  660 ? 7.725   39.872 31.151  1.00 35.78  ? 1459 LEU B CB    1 
ATOM   5258  C  CG    . LEU A  1  660 ? 9.086   39.998 30.458  1.00 35.56  ? 1459 LEU B CG    1 
ATOM   5259  C  CD1   . LEU A  1  660 ? 10.076  39.050 31.062  1.00 36.02  ? 1459 LEU B CD1   1 
ATOM   5260  C  CD2   . LEU A  1  660 ? 8.910   39.698 28.952  1.00 34.77  ? 1459 LEU B CD2   1 
ATOM   5261  N  N     . ALA A  1  661 ? 4.815   41.241 32.254  1.00 38.94  ? 1460 ALA B N     1 
ATOM   5262  C  CA    . ALA A  1  661 ? 3.540   40.914 32.906  1.00 41.16  ? 1460 ALA B CA    1 
ATOM   5263  C  C     . ALA A  1  661 ? 2.341   41.559 32.208  1.00 43.14  ? 1460 ALA B C     1 
ATOM   5264  O  O     . ALA A  1  661 ? 1.221   41.099 32.392  1.00 44.84  ? 1460 ALA B O     1 
ATOM   5265  C  CB    . ALA A  1  661 ? 3.570   41.319 34.356  1.00 39.30  ? 1460 ALA B CB    1 
ATOM   5266  N  N     . ASP A  1  662 ? 2.560   42.622 31.433  1.00 44.24  ? 1461 ASP B N     1 
ATOM   5267  C  CA    . ASP A  1  662 ? 1.449   43.364 30.843  1.00 43.56  ? 1461 ASP B CA    1 
ATOM   5268  C  C     . ASP A  1  662 ? 1.789   43.535 29.324  1.00 43.03  ? 1461 ASP B C     1 
ATOM   5269  O  O     . ASP A  1  662 ? 2.769   44.179 28.964  1.00 42.91  ? 1461 ASP B O     1 
ATOM   5270  C  CB    . ASP A  1  662 ? 1.320   44.749 31.477  1.00 45.87  ? 1461 ASP B CB    1 
ATOM   5271  C  CG    . ASP A  1  662 ? 0.046   45.445 31.099  1.00 47.93  ? 1461 ASP B CG    1 
ATOM   5272  O  OD1   . ASP A  1  662 ? -0.537  45.120 30.041  1.00 47.47  ? 1461 ASP B OD1   1 
ATOM   5273  O  OD2   . ASP A  1  662 ? -0.402  46.334 31.868  1.00 51.28  ? 1461 ASP B OD2   1 
ATOM   5274  N  N     . GLU A  1  663 ? 0.940   42.966 28.484  1.00 42.81  ? 1462 GLU B N     1 
ATOM   5275  C  CA    . GLU A  1  663 ? 1.126   43.084 27.055  1.00 43.29  ? 1462 GLU B CA    1 
ATOM   5276  C  C     . GLU A  1  663 ? 1.032   44.538 26.586  1.00 40.81  ? 1462 GLU B C     1 
ATOM   5277  O  O     . GLU A  1  663 ? 1.712   44.935 25.633  1.00 36.99  ? 1462 GLU B O     1 
ATOM   5278  C  CB    . GLU A  1  663 ? 0.135   42.210 26.272  1.00 48.44  ? 1462 GLU B CB    1 
ATOM   5279  C  CG    . GLU A  1  663 ? 0.676   40.833 25.922  1.00 59.68  ? 1462 GLU B CG    1 
ATOM   5280  C  CD    . GLU A  1  663 ? -0.402  39.842 25.537  1.00 65.80  ? 1462 GLU B CD    1 
ATOM   5281  O  OE1   . GLU A  1  663 ? -1.517  40.272 25.182  1.00 72.98  ? 1462 GLU B OE1   1 
ATOM   5282  O  OE2   . GLU A  1  663 ? -0.134  38.620 25.634  1.00 73.39  ? 1462 GLU B OE2   1 
ATOM   5283  N  N     . GLU A  1  664 ? 0.229   45.353 27.262  1.00 37.90  ? 1463 GLU B N     1 
ATOM   5284  C  CA    . GLU A  1  664 ? 0.152   46.756 26.903  1.00 40.29  ? 1463 GLU B CA    1 
ATOM   5285  C  C     . GLU A  1  664 ? 1.439   47.495 27.206  1.00 38.76  ? 1463 GLU B C     1 
ATOM   5286  O  O     . GLU A  1  664 ? 1.868   48.355 26.426  1.00 38.21  ? 1463 GLU B O     1 
ATOM   5287  C  CB    . GLU A  1  664 ? -1.034  47.417 27.617  1.00 42.46  ? 1463 GLU B CB    1 
ATOM   5288  C  CG    . GLU A  1  664 ? -1.278  48.865 27.215  1.00 47.27  ? 1463 GLU B CG    1 
ATOM   5289  C  CD    . GLU A  1  664 ? -1.471  49.011 25.704  1.00 46.19  ? 1463 GLU B CD    1 
ATOM   5290  O  OE1   . GLU A  1  664 ? -0.917  49.998 25.166  1.00 49.18  ? 1463 GLU B OE1   1 
ATOM   5291  O  OE2   . GLU A  1  664 ? -2.128  48.111 25.083  1.00 49.64  ? 1463 GLU B OE2   1 
ATOM   5292  N  N     . VAL A  1  665 ? 2.075   47.178 28.339  1.00 38.81  ? 1464 VAL B N     1 
ATOM   5293  C  CA    . VAL A  1  665 ? 3.355   47.809 28.684  1.00 37.60  ? 1464 VAL B CA    1 
ATOM   5294  C  C     . VAL A  1  665 ? 4.396   47.442 27.643  1.00 37.47  ? 1464 VAL B C     1 
ATOM   5295  O  O     . VAL A  1  665 ? 5.212   48.278 27.234  1.00 37.97  ? 1464 VAL B O     1 
ATOM   5296  C  CB    . VAL A  1  665 ? 3.790   47.407 30.100  1.00 37.53  ? 1464 VAL B CB    1 
ATOM   5297  C  CG1   . VAL A  1  665 ? 5.198   47.882 30.396  1.00 38.11  ? 1464 VAL B CG1   1 
ATOM   5298  C  CG2   . VAL A  1  665 ? 2.790   48.055 31.121  1.00 39.45  ? 1464 VAL B CG2   1 
ATOM   5299  N  N     A LEU A  1  666 ? 4.385   46.192 27.202  0.50 37.32  ? 1465 LEU B N     1 
ATOM   5300  N  N     B LEU A  1  666 ? 4.386   46.194 27.204  0.50 36.71  ? 1465 LEU B N     1 
ATOM   5301  C  CA    A LEU A  1  666 ? 5.325   45.751 26.156  0.50 36.81  ? 1465 LEU B CA    1 
ATOM   5302  C  CA    B LEU A  1  666 ? 5.329   45.762 26.160  0.50 35.89  ? 1465 LEU B CA    1 
ATOM   5303  C  C     A LEU A  1  666 ? 5.035   46.490 24.840  0.50 36.34  ? 1465 LEU B C     1 
ATOM   5304  C  C     B LEU A  1  666 ? 5.034   46.508 24.847  0.50 35.73  ? 1465 LEU B C     1 
ATOM   5305  O  O     A LEU A  1  666 ? 5.958   46.955 24.158  0.50 36.61  ? 1465 LEU B O     1 
ATOM   5306  O  O     B LEU A  1  666 ? 5.950   47.015 24.185  0.50 36.14  ? 1465 LEU B O     1 
ATOM   5307  C  CB    A LEU A  1  666 ? 5.255   44.249 25.967  0.50 37.06  ? 1465 LEU B CB    1 
ATOM   5308  C  CB    B LEU A  1  666 ? 5.270   44.260 25.976  0.50 35.07  ? 1465 LEU B CB    1 
ATOM   5309  C  CG    A LEU A  1  666 ? 6.182   43.688 24.863  0.50 38.13  ? 1465 LEU B CG    1 
ATOM   5310  C  CG    B LEU A  1  666 ? 6.165   43.638 24.887  0.50 35.18  ? 1465 LEU B CG    1 
ATOM   5311  C  CD1   A LEU A  1  666 ? 6.683   42.342 25.293  0.50 40.34  ? 1465 LEU B CD1   1 
ATOM   5312  C  CD1   B LEU A  1  666 ? 7.495   44.281 24.857  0.50 33.09  ? 1465 LEU B CD1   1 
ATOM   5313  C  CD2   A LEU A  1  666 ? 5.396   43.446 23.586  0.50 36.50  ? 1465 LEU B CD2   1 
ATOM   5314  C  CD2   B LEU A  1  666 ? 6.296   42.156 25.077  0.50 36.18  ? 1465 LEU B CD2   1 
ATOM   5315  N  N     . LEU A  1  667 ? 3.751   46.583 24.464  1.00 35.73  ? 1466 LEU B N     1 
ATOM   5316  C  CA    . LEU A  1  667 ? 3.405   47.239 23.226  1.00 35.90  ? 1466 LEU B CA    1 
ATOM   5317  C  C     . LEU A  1  667 ? 3.780   48.721 23.247  1.00 34.95  ? 1466 LEU B C     1 
ATOM   5318  O  O     . LEU A  1  667 ? 4.262   49.260 22.246  1.00 34.24  ? 1466 LEU B O     1 
ATOM   5319  C  CB    . LEU A  1  667 ? 1.890   47.079 22.971  1.00 36.27  ? 1466 LEU B CB    1 
ATOM   5320  C  CG    . LEU A  1  667 ? 1.342   47.413 21.576  1.00 39.07  ? 1466 LEU B CG    1 
ATOM   5321  C  CD1   . LEU A  1  667 ? 2.210   46.749 20.464  1.00 38.16  ? 1466 LEU B CD1   1 
ATOM   5322  C  CD2   . LEU A  1  667 ? -0.092  46.964 21.497  1.00 38.40  ? 1466 LEU B CD2   1 
ATOM   5323  N  N     . GLN A  1  668 ? 3.610   49.372 24.391  1.00 34.84  ? 1467 GLN B N     1 
ATOM   5324  C  CA    . GLN A  1  668 ? 4.012   50.771 24.503  1.00 34.51  ? 1467 GLN B CA    1 
ATOM   5325  C  C     . GLN A  1  668 ? 5.525   50.944 24.416  1.00 32.98  ? 1467 GLN B C     1 
ATOM   5326  O  O     . GLN A  1  668 ? 6.002   51.963 23.902  1.00 33.68  ? 1467 GLN B O     1 
ATOM   5327  C  CB    . GLN A  1  668 ? 3.468   51.366 25.832  1.00 35.48  ? 1467 GLN B CB    1 
ATOM   5328  C  CG    . GLN A  1  668 ? 3.675   52.867 25.893  1.00 34.79  ? 1467 GLN B CG    1 
ATOM   5329  C  CD    . GLN A  1  668 ? 2.987   53.601 24.798  1.00 34.51  ? 1467 GLN B CD    1 
ATOM   5330  O  OE1   . GLN A  1  668 ? 1.804   53.333 24.499  1.00 34.05  ? 1467 GLN B OE1   1 
ATOM   5331  N  NE2   . GLN A  1  668 ? 3.705   54.526 24.160  1.00 35.60  ? 1467 GLN B NE2   1 
ATOM   5332  N  N     . LEU A  1  669 ? 6.284   49.966 24.903  1.00 33.56  ? 1468 LEU B N     1 
ATOM   5333  C  CA    . LEU A  1  669 ? 7.716   50.034 24.821  1.00 31.86  ? 1468 LEU B CA    1 
ATOM   5334  C  C     . LEU A  1  669 ? 8.116   49.992 23.346  1.00 34.20  ? 1468 LEU B C     1 
ATOM   5335  O  O     . LEU A  1  669 ? 8.991   50.727 22.909  1.00 31.60  ? 1468 LEU B O     1 
ATOM   5336  C  CB    . LEU A  1  669 ? 8.361   48.880 25.568  1.00 33.79  ? 1468 LEU B CB    1 
ATOM   5337  C  CG    . LEU A  1  669 ? 9.893   48.862 25.569  1.00 33.67  ? 1468 LEU B CG    1 
ATOM   5338  C  CD1   . LEU A  1  669 ? 10.503  50.152 26.029  1.00 37.82  ? 1468 LEU B CD1   1 
ATOM   5339  C  CD2   . LEU A  1  669 ? 10.417  47.724 26.428  1.00 33.80  ? 1468 LEU B CD2   1 
ATOM   5340  N  N     . VAL A  1  670 ? 7.438   49.139 22.586  1.00 32.47  ? 1469 VAL B N     1 
ATOM   5341  C  CA    . VAL A  1  670 ? 7.679   49.024 21.159  1.00 31.85  ? 1469 VAL B CA    1 
ATOM   5342  C  C     . VAL A  1  670 ? 7.358   50.344 20.475  1.00 31.63  ? 1469 VAL B C     1 
ATOM   5343  O  O     . VAL A  1  670 ? 8.146   50.788 19.639  1.00 33.30  ? 1469 VAL B O     1 
ATOM   5344  C  CB    . VAL A  1  670 ? 6.846   47.885 20.545  1.00 30.07  ? 1469 VAL B CB    1 
ATOM   5345  C  CG1   . VAL A  1  670 ? 6.904   47.948 19.012  1.00 30.47  ? 1469 VAL B CG1   1 
ATOM   5346  C  CG2   . VAL A  1  670 ? 7.370   46.552 21.066  1.00 29.17  ? 1469 VAL B CG2   1 
ATOM   5347  N  N     . ARG A  1  671 ? 6.260   50.966 20.862  1.00 32.44  ? 1470 ARG B N     1 
ATOM   5348  C  CA    . ARG A  1  671 ? 5.862   52.243 20.289  1.00 33.83  ? 1470 ARG B CA    1 
ATOM   5349  C  C     . ARG A  1  671 ? 6.898   53.321 20.609  1.00 33.73  ? 1470 ARG B C     1 
ATOM   5350  O  O     . ARG A  1  671 ? 7.245   54.103 19.741  1.00 35.67  ? 1470 ARG B O     1 
ATOM   5351  C  CB    . ARG A  1  671 ? 4.512   52.722 20.832  1.00 34.10  ? 1470 ARG B CB    1 
ATOM   5352  C  CG    . ARG A  1  671 ? 3.296   51.903 20.445  1.00 35.60  ? 1470 ARG B CG    1 
ATOM   5353  C  CD    . ARG A  1  671 ? 2.014   52.523 21.001  1.00 39.11  ? 1470 ARG B CD    1 
ATOM   5354  N  NE    . ARG A  1  671 ? 0.845   51.729 20.719  1.00 39.90  ? 1470 ARG B NE    1 
ATOM   5355  C  CZ    . ARG A  1  671 ? 0.079   51.151 21.656  1.00 41.85  ? 1470 ARG B CZ    1 
ATOM   5356  N  NH1   . ARG A  1  671 ? 0.350   51.308 22.943  1.00 40.15  ? 1470 ARG B NH1   1 
ATOM   5357  N  NH2   . ARG A  1  671 ? -0.980  50.438 21.291  1.00 42.42  ? 1470 ARG B NH2   1 
ATOM   5358  N  N     . ASP A  1  672 ? 7.386   53.361 21.852  1.00 33.60  ? 1471 ASP B N     1 
ATOM   5359  C  CA    . ASP A  1  672 ? 8.349   54.369 22.231  1.00 34.56  ? 1471 ASP B CA    1 
ATOM   5360  C  C     . ASP A  1  672 ? 9.648   54.200 21.443  1.00 33.66  ? 1471 ASP B C     1 
ATOM   5361  O  O     . ASP A  1  672 ? 10.258  55.181 21.010  1.00 32.39  ? 1471 ASP B O     1 
ATOM   5362  C  CB    . ASP A  1  672 ? 8.653   54.287 23.725  1.00 35.16  ? 1471 ASP B CB    1 
ATOM   5363  C  CG    . ASP A  1  672 ? 7.416   54.636 24.580  1.00 39.90  ? 1471 ASP B CG    1 
ATOM   5364  O  OD1   . ASP A  1  672 ? 6.455   55.221 24.025  1.00 39.10  ? 1471 ASP B OD1   1 
ATOM   5365  O  OD2   . ASP A  1  672 ? 7.441   54.306 25.790  1.00 40.78  ? 1471 ASP B OD2   1 
ATOM   5366  N  N     . GLU A  1  673 ? 10.078  52.965 21.241  1.00 32.42  ? 1472 GLU B N     1 
ATOM   5367  C  CA    . GLU A  1  673 ? 11.341  52.738 20.546  1.00 33.16  ? 1472 GLU B CA    1 
ATOM   5368  C  C     . GLU A  1  673 ? 11.200  52.990 19.048  1.00 32.85  ? 1472 GLU B C     1 
ATOM   5369  O  O     . GLU A  1  673 ? 12.136  53.459 18.409  1.00 32.35  ? 1472 GLU B O     1 
ATOM   5370  C  CB    . GLU A  1  673 ? 11.866  51.329 20.842  1.00 33.19  ? 1472 GLU B CB    1 
ATOM   5371  C  CG    . GLU A  1  673 ? 12.237  51.127 22.304  1.00 37.24  ? 1472 GLU B CG    1 
ATOM   5372  C  CD    . GLU A  1  673 ? 12.888  49.777 22.565  1.00 39.48  ? 1472 GLU B CD    1 
ATOM   5373  O  OE1   . GLU A  1  673 ? 12.984  48.955 21.615  1.00 36.97  ? 1472 GLU B OE1   1 
ATOM   5374  O  OE2   . GLU A  1  673 ? 13.326  49.535 23.726  1.00 38.59  ? 1472 GLU B OE2   1 
ATOM   5375  N  N     . LEU A  1  674 ? 10.033  52.675 18.468  1.00 32.36  ? 1473 LEU B N     1 
ATOM   5376  C  CA    . LEU A  1  674 ? 9.796   53.027 17.069  1.00 33.33  ? 1473 LEU B CA    1 
ATOM   5377  C  C     . LEU A  1  674 ? 9.718   54.548 16.896  1.00 33.14  ? 1473 LEU B C     1 
ATOM   5378  O  O     . LEU A  1  674 ? 10.153  55.077 15.876  1.00 32.38  ? 1473 LEU B O     1 
ATOM   5379  C  CB    . LEU A  1  674 ? 8.528   52.354 16.568  1.00 31.90  ? 1473 LEU B CB    1 
ATOM   5380  C  CG    . LEU A  1  674 ? 8.598   50.916 16.144  1.00 32.08  ? 1473 LEU B CG    1 
ATOM   5381  C  CD1   . LEU A  1  674 ? 7.105   50.384 16.040  1.00 30.73  ? 1473 LEU B CD1   1 
ATOM   5382  C  CD2   . LEU A  1  674 ? 9.397   50.842 14.774  1.00 30.10  ? 1473 LEU B CD2   1 
ATOM   5383  N  N     . THR A  1  675 ? 9.164   55.254 17.880  1.00 33.16  ? 1474 THR B N     1 
ATOM   5384  C  CA    . THR A  1  675 ? 9.052   56.692 17.799  1.00 32.94  ? 1474 THR B CA    1 
ATOM   5385  C  C     . THR A  1  675 ? 10.403  57.387 17.908  1.00 32.18  ? 1474 THR B C     1 
ATOM   5386  O  O     . THR A  1  675 ? 10.657  58.369 17.198  1.00 32.62  ? 1474 THR B O     1 
ATOM   5387  C  CB    . THR A  1  675 ? 8.117   57.211 18.923  1.00 33.38  ? 1474 THR B CB    1 
ATOM   5388  O  OG1   . THR A  1  675 ? 6.815   56.650 18.745  1.00 32.20  ? 1474 THR B OG1   1 
ATOM   5389  C  CG2   . THR A  1  675 ? 7.963   58.717 18.850  1.00 35.86  ? 1474 THR B CG2   1 
ATOM   5390  N  N     A GLU A  1  676 ? 11.280  56.846 18.734  0.50 32.93  ? 1475 GLU B N     1 
ATOM   5391  N  N     B GLU A  1  676 ? 11.273  56.862 18.751  0.50 32.41  ? 1475 GLU B N     1 
ATOM   5392  C  CA    A GLU A  1  676 ? 12.651  57.375 18.837  0.50 33.55  ? 1475 GLU B CA    1 
ATOM   5393  C  CA    B GLU A  1  676 ? 12.647  57.387 18.828  0.50 32.67  ? 1475 GLU B CA    1 
ATOM   5394  C  C     A GLU A  1  676 ? 13.377  57.217 17.512  0.50 33.06  ? 1475 GLU B C     1 
ATOM   5395  C  C     B GLU A  1  676 ? 13.341  57.240 17.485  0.50 32.39  ? 1475 GLU B C     1 
ATOM   5396  O  O     A GLU A  1  676 ? 14.152  58.099 17.111  0.50 32.49  ? 1475 GLU B O     1 
ATOM   5397  O  O     B GLU A  1  676 ? 14.057  58.152 17.045  0.50 31.76  ? 1475 GLU B O     1 
ATOM   5398  C  CB    A GLU A  1  676 ? 13.407  56.675 19.952  0.50 34.99  ? 1475 GLU B CB    1 
ATOM   5399  C  CB    B GLU A  1  676 ? 13.435  56.675 19.915  0.50 33.24  ? 1475 GLU B CB    1 
ATOM   5400  C  CG    A GLU A  1  676 ? 14.669  57.423 20.416  0.50 36.14  ? 1475 GLU B CG    1 
ATOM   5401  C  CG    B GLU A  1  676 ? 12.893  56.831 21.369  0.50 33.96  ? 1475 GLU B CG    1 
ATOM   5402  C  CD    A GLU A  1  676 ? 15.845  57.152 19.533  0.50 37.66  ? 1475 GLU B CD    1 
ATOM   5403  C  CD    B GLU A  1  676 ? 13.529  55.840 22.334  0.50 35.11  ? 1475 GLU B CD    1 
ATOM   5404  O  OE1   A GLU A  1  676 ? 16.579  58.095 19.236  0.50 39.07  ? 1475 GLU B OE1   1 
ATOM   5405  O  OE1   B GLU A  1  676 ? 14.487  55.111 21.921  0.50 34.19  ? 1475 GLU B OE1   1 
ATOM   5406  O  OE2   A GLU A  1  676 ? 16.057  55.976 19.145  0.50 37.03  ? 1475 GLU B OE2   1 
ATOM   5407  O  OE2   B GLU A  1  676 ? 13.054  55.717 23.517  0.50 35.53  ? 1475 GLU B OE2   1 
ATOM   5408  N  N     . ILE A  1  677 ? 13.159  56.087 16.819  1.00 31.19  ? 1476 ILE B N     1 
ATOM   5409  C  CA    . ILE A  1  677 ? 13.807  55.862 15.534  1.00 31.08  ? 1476 ILE B CA    1 
ATOM   5410  C  C     . ILE A  1  677 ? 13.226  56.804 14.494  1.00 30.68  ? 1476 ILE B C     1 
ATOM   5411  O  O     . ILE A  1  677 ? 13.966  57.360 13.667  1.00 32.73  ? 1476 ILE B O     1 
ATOM   5412  C  CB    . ILE A  1  677 ? 13.639  54.384 15.130  1.00 30.52  ? 1476 ILE B CB    1 
ATOM   5413  C  CG1   . ILE A  1  677 ? 14.649  53.537 15.947  1.00 30.08  ? 1476 ILE B CG1   1 
ATOM   5414  C  CG2   . ILE A  1  677 ? 13.855  54.225 13.569  1.00 29.27  ? 1476 ILE B CG2   1 
ATOM   5415  C  CD1   . ILE A  1  677 ? 14.281  52.055 15.948  1.00 30.42  ? 1476 ILE B CD1   1 
ATOM   5416  N  N     . ARG A  1  678 ? 11.908  57.003 14.504  1.00 31.51  ? 1477 ARG B N     1 
ATOM   5417  C  CA    . ARG A  1  678 ? 11.269  57.934 13.579  1.00 32.38  ? 1477 ARG B CA    1 
ATOM   5418  C  C     . ARG A  1  678 ? 11.830  59.347 13.750  1.00 35.67  ? 1477 ARG B C     1 
ATOM   5419  O  O     . ARG A  1  678 ? 12.176  60.005 12.755  1.00 34.48  ? 1477 ARG B O     1 
ATOM   5420  C  CB    . ARG A  1  678 ? 9.758   57.924 13.769  1.00 32.75  ? 1477 ARG B CB    1 
ATOM   5421  C  CG    . ARG A  1  678 ? 8.999   58.788 12.773  1.00 33.91  ? 1477 ARG B CG    1 
ATOM   5422  C  CD    . ARG A  1  678 ? 7.639   59.235 13.333  1.00 34.88  ? 1477 ARG B CD    1 
ATOM   5423  N  NE    . ARG A  1  678 ? 7.751   60.174 14.422  1.00 38.56  ? 1477 ARG B NE    1 
ATOM   5424  C  CZ    . ARG A  1  678 ? 6.765   60.385 15.298  1.00 37.64  ? 1477 ARG B CZ    1 
ATOM   5425  N  NH1   . ARG A  1  678 ? 5.555   59.815 15.164  1.00 35.55  ? 1477 ARG B NH1   1 
ATOM   5426  N  NH2   . ARG A  1  678 ? 6.943   61.232 16.344  1.00 36.93  ? 1477 ARG B NH2   1 
ATOM   5427  N  N     . ASP A  1  679 ? 11.944  59.806 14.997  1.00 34.88  ? 1478 ASP B N     1 
ATOM   5428  C  CA    . ASP A  1  679 ? 12.476  61.152 15.244  1.00 35.35  ? 1478 ASP B CA    1 
ATOM   5429  C  C     . ASP A  1  679 ? 13.920  61.269 14.770  1.00 37.63  ? 1478 ASP B C     1 
ATOM   5430  O  O     . ASP A  1  679 ? 14.314  62.302 14.220  1.00 40.09  ? 1478 ASP B O     1 
ATOM   5431  C  CB    . ASP A  1  679 ? 12.375  61.496 16.730  1.00 37.65  ? 1478 ASP B CB    1 
ATOM   5432  C  CG    . ASP A  1  679 ? 10.939  61.537 17.216  1.00 40.44  ? 1478 ASP B CG    1 
ATOM   5433  O  OD1   . ASP A  1  679 ? 10.038  61.731 16.394  1.00 41.95  ? 1478 ASP B OD1   1 
ATOM   5434  O  OD2   . ASP A  1  679 ? 10.628  61.389 18.390  1.00 43.28  ? 1478 ASP B OD2   1 
ATOM   5435  N  N     . ARG A  1  680 ? 14.715  60.222 14.958  1.00 36.96  ? 1479 ARG B N     1 
ATOM   5436  C  CA    . ARG A  1  680 ? 16.146  60.306 14.671  1.00 37.43  ? 1479 ARG B CA    1 
ATOM   5437  C  C     . ARG A  1  680 ? 16.453  60.139 13.181  1.00 36.91  ? 1479 ARG B C     1 
ATOM   5438  O  O     . ARG A  1  680 ? 17.361  60.791 12.663  1.00 34.96  ? 1479 ARG B O     1 
ATOM   5439  C  CB    . ARG A  1  680 ? 16.904  59.231 15.480  1.00 41.04  ? 1479 ARG B CB    1 
ATOM   5440  C  CG    . ARG A  1  680 ? 18.388  59.180 15.226  1.00 45.59  ? 1479 ARG B CG    1 
ATOM   5441  C  CD    . ARG A  1  680 ? 19.133  58.669 16.452  1.00 49.92  ? 1479 ARG B CD    1 
ATOM   5442  N  NE    . ARG A  1  680 ? 18.496  57.505 17.030  1.00 54.49  ? 1479 ARG B NE    1 
ATOM   5443  C  CZ    . ARG A  1  680 ? 18.986  56.268 17.003  1.00 57.85  ? 1479 ARG B CZ    1 
ATOM   5444  N  NH1   . ARG A  1  680 ? 18.284  55.260 17.535  1.00 51.85  ? 1479 ARG B NH1   1 
ATOM   5445  N  NH2   . ARG A  1  680 ? 20.187  56.049 16.445  1.00 55.12  ? 1479 ARG B NH2   1 
ATOM   5446  N  N     . PHE A  1  681 ? 15.685  59.284 12.477  1.00 33.19  ? 1480 PHE B N     1 
ATOM   5447  C  CA    . PHE A  1  681 ? 15.979  58.983 11.090  1.00 33.18  ? 1480 PHE B CA    1 
ATOM   5448  C  C     . PHE A  1  681 ? 14.916  59.360 10.090  1.00 32.23  ? 1480 PHE B C     1 
ATOM   5449  O  O     . PHE A  1  681 ? 15.158  59.335 8.897   1.00 32.81  ? 1480 PHE B O     1 
ATOM   5450  C  CB    . PHE A  1  681 ? 16.285  57.461 10.949  1.00 32.44  ? 1480 PHE B CB    1 
ATOM   5451  C  CG    . PHE A  1  681 ? 17.529  57.018 11.627  1.00 31.03  ? 1480 PHE B CG    1 
ATOM   5452  C  CD1   . PHE A  1  681 ? 18.760  57.304 11.030  1.00 32.73  ? 1480 PHE B CD1   1 
ATOM   5453  C  CD2   . PHE A  1  681 ? 17.455  56.323 12.810  1.00 31.39  ? 1480 PHE B CD2   1 
ATOM   5454  C  CE1   . PHE A  1  681 ? 19.954  56.870 11.686  1.00 34.35  ? 1480 PHE B CE1   1 
ATOM   5455  C  CE2   . PHE A  1  681 ? 18.642  55.898 13.465  1.00 32.65  ? 1480 PHE B CE2   1 
ATOM   5456  C  CZ    . PHE A  1  681 ? 19.860  56.150 12.913  1.00 34.64  ? 1480 PHE B CZ    1 
ATOM   5457  N  N     . GLY A  1  682 ? 13.715  59.687 10.546  1.00 32.36  ? 1481 GLY B N     1 
ATOM   5458  C  CA    . GLY A  1  682 ? 12.614  60.069 9.636   1.00 31.89  ? 1481 GLY B CA    1 
ATOM   5459  C  C     . GLY A  1  682 ? 12.985  61.295 8.838   1.00 33.18  ? 1481 GLY B C     1 
ATOM   5460  O  O     . GLY A  1  682 ? 13.689  62.226 9.348   1.00 35.64  ? 1481 GLY B O     1 
ATOM   5461  N  N     . ASP A  1  683 ? 12.569  61.331 7.570   1.00 30.62  ? 1482 ASP B N     1 
ATOM   5462  C  CA    . ASP A  1  683 ? 12.933  62.451 6.691   1.00 30.39  ? 1482 ASP B CA    1 
ATOM   5463  C  C     . ASP A  1  683 ? 11.752  62.807 5.799   1.00 32.14  ? 1482 ASP B C     1 
ATOM   5464  O  O     . ASP A  1  683 ? 10.714  62.110 5.773   1.00 34.29  ? 1482 ASP B O     1 
ATOM   5465  C  CB    . ASP A  1  683 ? 14.150  62.131 5.811   1.00 30.99  ? 1482 ASP B CB    1 
ATOM   5466  C  CG    . ASP A  1  683 ? 13.910  60.912 4.908   1.00 28.33  ? 1482 ASP B CG    1 
ATOM   5467  O  OD1   . ASP A  1  683 ? 12.858  60.239 5.034   1.00 29.48  ? 1482 ASP B OD1   1 
ATOM   5468  O  OD2   . ASP A  1  683 ? 14.771  60.662 4.058   1.00 32.07  ? 1482 ASP B OD2   1 
ATOM   5469  N  N     . ASP A  1  684 ? 11.901  63.902 5.075   1.00 31.88  ? 1483 ASP B N     1 
ATOM   5470  C  CA    . ASP A  1  684 ? 10.788  64.408 4.248   1.00 33.45  ? 1483 ASP B CA    1 
ATOM   5471  C  C     . ASP A  1  684 ? 10.496  63.455 3.100   1.00 31.87  ? 1483 ASP B C     1 
ATOM   5472  O  O     . ASP A  1  684 ? 11.371  62.734 2.609   1.00 32.56  ? 1483 ASP B O     1 
ATOM   5473  C  CB    . ASP A  1  684 ? 11.144  65.777 3.664   1.00 36.16  ? 1483 ASP B CB    1 
ATOM   5474  C  CG    . ASP A  1  684 ? 11.171  66.892 4.683   1.00 38.67  ? 1483 ASP B CG    1 
ATOM   5475  O  OD1   . ASP A  1  684 ? 10.652  66.664 5.796   1.00 40.50  ? 1483 ASP B OD1   1 
ATOM   5476  O  OD2   . ASP A  1  684 ? 11.722  67.945 4.313   1.00 40.18  ? 1483 ASP B OD2   1 
ATOM   5477  N  N     . ARG A  1  685 ? 9.238   63.456 2.697   1.00 30.96  ? 1484 ARG B N     1 
ATOM   5478  C  CA    . ARG A  1  685 ? 8.820   62.784 1.468   1.00 30.60  ? 1484 ARG B CA    1 
ATOM   5479  C  C     . ARG A  1  685 ? 9.513   63.469 0.272   1.00 30.56  ? 1484 ARG B C     1 
ATOM   5480  O  O     . ARG A  1  685 ? 9.565   64.676 0.186   1.00 31.63  ? 1484 ARG B O     1 
ATOM   5481  C  CB    . ARG A  1  685 ? 7.309   62.816 1.324   1.00 30.62  ? 1484 ARG B CB    1 
ATOM   5482  C  CG    . ARG A  1  685 ? 6.798   62.659 -0.088  1.00 30.60  ? 1484 ARG B CG    1 
ATOM   5483  C  CD    . ARG A  1  685 ? 5.255   62.388 -0.074  1.00 30.09  ? 1484 ARG B CD    1 
ATOM   5484  N  NE    . ARG A  1  685 ? 4.971   61.062 0.447   1.00 28.92  ? 1484 ARG B NE    1 
ATOM   5485  C  CZ    . ARG A  1  685 ? 5.075   59.920 -0.245  1.00 30.02  ? 1484 ARG B CZ    1 
ATOM   5486  N  NH1   . ARG A  1  685 ? 5.434   59.938 -1.527  1.00 28.72  ? 1484 ARG B NH1   1 
ATOM   5487  N  NH2   . ARG A  1  685 ? 4.791   58.766 0.332   1.00 30.32  ? 1484 ARG B NH2   1 
ATOM   5488  N  N     . ARG A  1  686 ? 10.044  62.661 -0.635  1.00 28.03  ? 1485 ARG B N     1 
ATOM   5489  C  CA    . ARG A  1  686 ? 10.704  63.128 -1.830  1.00 28.23  ? 1485 ARG B CA    1 
ATOM   5490  C  C     . ARG A  1  686 ? 9.779   63.051 -3.072  1.00 28.90  ? 1485 ARG B C     1 
ATOM   5491  O  O     . ARG A  1  686 ? 9.700   63.997 -3.847  1.00 28.52  ? 1485 ARG B O     1 
ATOM   5492  C  CB    . ARG A  1  686 ? 11.968  62.331 -2.131  1.00 29.05  ? 1485 ARG B CB    1 
ATOM   5493  C  CG    . ARG A  1  686 ? 13.017  62.489 -1.027  1.00 28.89  ? 1485 ARG B CG    1 
ATOM   5494  C  CD    . ARG A  1  686 ? 14.231  61.609 -1.400  1.00 27.15  ? 1485 ARG B CD    1 
ATOM   5495  N  NE    . ARG A  1  686 ? 15.184  61.616 -0.287  1.00 27.44  ? 1485 ARG B NE    1 
ATOM   5496  C  CZ    . ARG A  1  686 ? 16.291  60.926 -0.290  1.00 28.67  ? 1485 ARG B CZ    1 
ATOM   5497  N  NH1   . ARG A  1  686 ? 16.643  60.111 -1.333  1.00 27.03  ? 1485 ARG B NH1   1 
ATOM   5498  N  NH2   . ARG A  1  686 ? 17.100  60.979 0.803   1.00 31.03  ? 1485 ARG B NH2   1 
ATOM   5499  N  N     . THR A  1  687 ? 9.079   61.933 -3.258  1.00 27.84  ? 1486 THR B N     1 
ATOM   5500  C  CA    . THR A  1  687 ? 8.225   61.798 -4.405  1.00 27.38  ? 1486 THR B CA    1 
ATOM   5501  C  C     . THR A  1  687 ? 6.890   62.469 -4.171  1.00 28.10  ? 1486 THR B C     1 
ATOM   5502  O  O     . THR A  1  687 ? 6.234   62.238 -3.164  1.00 29.66  ? 1486 THR B O     1 
ATOM   5503  C  CB    . THR A  1  687 ? 7.993   60.264 -4.691  1.00 26.65  ? 1486 THR B CB    1 
ATOM   5504  O  OG1   . THR A  1  687 ? 9.253   59.635 -4.924  1.00 26.23  ? 1486 THR B OG1   1 
ATOM   5505  C  CG2   . THR A  1  687 ? 7.097   60.056 -5.905  1.00 26.18  ? 1486 THR B CG2   1 
ATOM   5506  N  N     . GLU A  1  688 ? 6.485   63.305 -5.117  1.00 30.01  ? 1487 GLU B N     1 
ATOM   5507  C  CA    . GLU A  1  688 ? 5.179   63.996 -5.054  1.00 30.15  ? 1487 GLU B CA    1 
ATOM   5508  C  C     . GLU A  1  688 ? 4.128   63.157 -5.697  1.00 30.21  ? 1487 GLU B C     1 
ATOM   5509  O  O     . GLU A  1  688 ? 4.232   62.799 -6.864  1.00 31.20  ? 1487 GLU B O     1 
ATOM   5510  C  CB    . GLU A  1  688 ? 5.264   65.363 -5.702  1.00 31.33  ? 1487 GLU B CB    1 
ATOM   5511  C  CG    . GLU A  1  688 ? 3.914   66.113 -5.536  1.00 33.73  ? 1487 GLU B CG    1 
ATOM   5512  C  CD    . GLU A  1  688 ? 3.941   67.417 -6.456  1.00 35.86  ? 1487 GLU B CD    1 
ATOM   5513  O  OE1   . GLU A  1  688 ? 4.993   67.932 -6.868  1.00 36.57  ? 1487 GLU B OE1   1 
ATOM   5514  O  OE2   . GLU A  1  688 ? 2.895   67.889 -6.836  1.00 42.31  ? 1487 GLU B OE2   1 
ATOM   5515  N  N     . ILE A  1  689 ? 3.076   62.837 -4.952  1.00 30.55  ? 1488 ILE B N     1 
ATOM   5516  C  CA    . ILE A  1  689 ? 1.904   62.129 -5.445  1.00 33.68  ? 1488 ILE B CA    1 
ATOM   5517  C  C     . ILE A  1  689 ? 0.850   63.119 -5.927  1.00 35.08  ? 1488 ILE B C     1 
ATOM   5518  O  O     . ILE A  1  689 ? 0.187   63.792 -5.148  1.00 32.51  ? 1488 ILE B O     1 
ATOM   5519  C  CB    . ILE A  1  689 ? 1.344   61.248 -4.328  1.00 34.38  ? 1488 ILE B CB    1 
ATOM   5520  C  CG1   . ILE A  1  689 ? 2.405   60.162 -3.963  1.00 34.98  ? 1488 ILE B CG1   1 
ATOM   5521  C  CG2   . ILE A  1  689 ? 0.078   60.524 -4.834  1.00 35.63  ? 1488 ILE B CG2   1 
ATOM   5522  C  CD1   . ILE A  1  689 ? 1.977   59.336 -2.803  1.00 35.09  ? 1488 ILE B CD1   1 
ATOM   5523  N  N     . GLN A  1  690 ? 0.735   63.237 -7.238  1.00 36.92  ? 1489 GLN B N     1 
ATOM   5524  C  CA    . GLN A  1  690 ? -0.254  64.135 -7.867  1.00 44.14  ? 1489 GLN B CA    1 
ATOM   5525  C  C     . GLN A  1  690 ? -1.653  63.571 -7.982  1.00 45.19  ? 1489 GLN B C     1 
ATOM   5526  O  O     . GLN A  1  690 ? -1.834  62.374 -8.141  1.00 46.79  ? 1489 GLN B O     1 
ATOM   5527  C  CB    . GLN A  1  690 ? 0.258   64.564 -9.256  1.00 47.75  ? 1489 GLN B CB    1 
ATOM   5528  C  CG    . GLN A  1  690 ? 1.458   65.502 -9.190  1.00 55.77  ? 1489 GLN B CG    1 
ATOM   5529  C  CD    . GLN A  1  690 ? 1.815   66.025 -10.585 1.00 61.22  ? 1489 GLN B CD    1 
ATOM   5530  O  OE1   . GLN A  1  690 ? 1.519   65.404 -11.594 1.00 61.56  ? 1489 GLN B OE1   1 
ATOM   5531  N  NE2   . GLN A  1  690 ? 2.478   67.170 -10.625 1.00 62.34  ? 1489 GLN B NE2   1 
ATOM   5532  N  N     . LEU A  1  691 ? -2.638  64.449 -7.925  1.00 54.80  ? 1490 LEU B N     1 
ATOM   5533  C  CA    . LEU A  1  691 ? -4.074  64.104 -8.072  1.00 62.35  ? 1490 LEU B CA    1 
ATOM   5534  C  C     . LEU A  1  691 ? -4.638  63.079 -7.100  1.00 75.27  ? 1490 LEU B C     1 
ATOM   5535  O  O     . LEU A  1  691 ? -4.405  63.216 -5.861  1.00 83.74  ? 1490 LEU B O     1 
ATOM   5536  C  CB    . LEU A  1  691 ? -4.371  63.691 -9.521  1.00 58.54  ? 1490 LEU B CB    1 
ATOM   5537  C  CG    . LEU A  1  691 ? -4.123  64.693 -10.645 1.00 59.61  ? 1490 LEU B CG    1 
ATOM   5538  C  CD1   . LEU A  1  691 ? -5.335  64.585 -11.657 1.00 59.97  ? 1490 LEU B CD1   1 
ATOM   5539  C  CD2   . LEU A  1  691 ? -3.931  66.187 -10.314 1.00 59.52  ? 1490 LEU B CD2   1 
ATOM   5540  N  N     . GLY A  1  692 ? -5.346  62.068 -7.605  1.00 82.42  ? 1491 GLY B N     1 
ATOM   5541  C  CA    . GLY A  1  692 ? -5.895  60.993 -6.751  1.00 73.19  ? 1491 GLY B CA    1 
ATOM   5542  C  C     . GLY A  1  692 ? -6.355  59.764 -7.507  1.00 70.59  ? 1491 GLY B C     1 
ATOM   5543  O  O     . GLY A  1  692 ? -6.869  58.832 -6.875  1.00 73.56  ? 1491 GLY B O     1 
ATOM   5544  O  OXT   . GLY A  1  692 ? -6.199  59.687 -8.723  1.00 64.25  ? 1491 GLY B OXT   1 
ATOM   5545  N  N     . LYS B  1  9   ? 38.347  51.753 -24.595 1.00 56.58  ? 417  LYS D N     1 
ATOM   5546  C  CA    . LYS B  1  9   ? 38.273  52.601 -25.831 1.00 52.01  ? 417  LYS D CA    1 
ATOM   5547  C  C     . LYS B  1  9   ? 38.270  54.081 -25.384 1.00 51.13  ? 417  LYS D C     1 
ATOM   5548  O  O     . LYS B  1  9   ? 37.920  54.436 -24.220 1.00 53.53  ? 417  LYS D O     1 
ATOM   5549  C  CB    . LYS B  1  9   ? 36.994  52.307 -26.631 1.00 46.76  ? 417  LYS D CB    1 
ATOM   5550  N  N     . LEU B  1  10  ? 38.535  54.944 -26.346 1.00 49.15  ? 418  LEU D N     1 
ATOM   5551  C  CA    . LEU B  1  10  ? 38.507  56.380 -26.141 1.00 45.43  ? 418  LEU D CA    1 
ATOM   5552  C  C     . LEU B  1  10  ? 37.063  56.848 -25.856 1.00 45.68  ? 418  LEU D C     1 
ATOM   5553  O  O     . LEU B  1  10  ? 36.119  56.431 -26.528 1.00 44.82  ? 418  LEU D O     1 
ATOM   5554  C  CB    . LEU B  1  10  ? 39.090  57.108 -27.347 1.00 44.96  ? 418  LEU D CB    1 
ATOM   5555  C  CG    . LEU B  1  10  ? 38.784  58.592 -27.547 1.00 42.47  ? 418  LEU D CG    1 
ATOM   5556  C  CD1   . LEU B  1  10  ? 39.693  59.432 -26.694 1.00 43.19  ? 418  LEU D CD1   1 
ATOM   5557  C  CD2   . LEU B  1  10  ? 38.930  58.954 -29.042 1.00 47.88  ? 418  LEU D CD2   1 
ATOM   5558  N  N     . ALA B  1  11  ? 36.918  57.718 -24.858 1.00 43.01  ? 419  ALA D N     1 
ATOM   5559  C  CA    . ALA B  1  11  ? 35.664  58.412 -24.598 1.00 44.34  ? 419  ALA D CA    1 
ATOM   5560  C  C     . ALA B  1  11  ? 35.852  59.865 -24.999 1.00 42.31  ? 419  ALA D C     1 
ATOM   5561  O  O     . ALA B  1  11  ? 36.374  60.688 -24.225 1.00 42.32  ? 419  ALA D O     1 
ATOM   5562  C  CB    . ALA B  1  11  ? 35.266  58.300 -23.111 1.00 39.77  ? 419  ALA D CB    1 
ATOM   5563  N  N     . ASP B  1  12  ? 35.438  60.176 -26.234 1.00 42.92  ? 420  ASP D N     1 
ATOM   5564  C  CA    . ASP B  1  12  ? 35.695  61.499 -26.804 1.00 44.01  ? 420  ASP D CA    1 
ATOM   5565  C  C     . ASP B  1  12  ? 34.823  62.546 -26.125 1.00 42.60  ? 420  ASP D C     1 
ATOM   5566  O  O     . ASP B  1  12  ? 33.867  62.244 -25.397 1.00 44.82  ? 420  ASP D O     1 
ATOM   5567  C  CB    . ASP B  1  12  ? 35.451  61.465 -28.308 1.00 44.39  ? 420  ASP D CB    1 
ATOM   5568  C  CG    . ASP B  1  12  ? 36.437  62.291 -29.086 1.00 44.38  ? 420  ASP D CG    1 
ATOM   5569  O  OD1   . ASP B  1  12  ? 36.995  63.236 -28.504 1.00 43.69  ? 420  ASP D OD1   1 
ATOM   5570  O  OD2   . ASP B  1  12  ? 36.666  62.005 -30.287 1.00 49.95  ? 420  ASP D OD2   1 
ATOM   5571  N  N     . CYS B  1  13  ? 35.172  63.810 -26.368 1.00 42.55  ? 421  CYS D N     1 
ATOM   5572  C  CA    . CYS B  1  13  ? 34.380  64.952 -25.935 1.00 42.06  ? 421  CYS D CA    1 
ATOM   5573  C  C     . CYS B  1  13  ? 33.507  65.440 -27.093 1.00 44.37  ? 421  CYS D C     1 
ATOM   5574  O  O     . CYS B  1  13  ? 33.731  65.130 -28.243 1.00 45.86  ? 421  CYS D O     1 
ATOM   5575  C  CB    . CYS B  1  13  ? 35.277  66.072 -25.425 1.00 40.94  ? 421  CYS D CB    1 
ATOM   5576  S  SG    . CYS B  1  13  ? 36.447  66.733 -26.639 1.00 43.43  ? 421  CYS D SG    1 
ATOM   5577  N  N     . SER B  1  14  ? 32.485  66.221 -26.740 1.00 44.82  ? 422  SER D N     1 
ATOM   5578  C  CA    . SER B  1  14  ? 31.492  66.639 -27.734 1.00 47.32  ? 422  SER D CA    1 
ATOM   5579  C  C     . SER B  1  14  ? 32.040  67.744 -28.664 1.00 47.81  ? 422  SER D C     1 
ATOM   5580  O  O     . SER B  1  14  ? 31.703  67.768 -29.843 1.00 48.58  ? 422  SER D O     1 
ATOM   5581  C  CB    . SER B  1  14  ? 30.177  67.038 -27.052 1.00 44.31  ? 422  SER D CB    1 
ATOM   5582  O  OG    . SER B  1  14  ? 30.448  68.146 -26.156 1.00 46.12  ? 422  SER D OG    1 
ATOM   5583  N  N     . SER B  1  15  ? 32.832  68.660 -28.137 1.00 49.56  ? 423  SER D N     1 
ATOM   5584  C  CA    . SER B  1  15  ? 33.325  69.794 -28.921 1.00 51.36  ? 423  SER D CA    1 
ATOM   5585  C  C     . SER B  1  15  ? 34.296  69.311 -30.042 1.00 52.96  ? 423  SER D C     1 
ATOM   5586  O  O     . SER B  1  15  ? 35.051  68.419 -29.913 1.00 56.10  ? 423  SER D O     1 
ATOM   5587  C  CB    . SER B  1  15  ? 34.128  70.752 -28.030 1.00 49.35  ? 423  SER D CB    1 
ATOM   5588  O  OG    . SER B  1  15  ? 34.853  71.672 -28.784 1.00 47.65  ? 423  SER D OG    1 
ATOM   5589  N  N     A LYS B  1  16  ? 34.327  69.944 -31.168 0.50 53.13  ? 424  LYS D N     1 
ATOM   5590  N  N     B LYS B  1  16  ? 34.323  69.866 -31.213 0.50 53.77  ? 424  LYS D N     1 
ATOM   5591  C  CA    A LYS B  1  16  ? 35.407  69.524 -32.136 0.50 52.68  ? 424  LYS D CA    1 
ATOM   5592  C  CA    B LYS B  1  16  ? 35.528  69.470 -32.073 0.50 53.50  ? 424  LYS D CA    1 
ATOM   5593  C  C     A LYS B  1  16  ? 36.367  70.674 -32.405 0.50 54.99  ? 424  LYS D C     1 
ATOM   5594  C  C     B LYS B  1  16  ? 36.532  70.608 -32.296 0.50 55.74  ? 424  LYS D C     1 
ATOM   5595  O  O     A LYS B  1  16  ? 36.999  70.715 -33.461 0.50 55.24  ? 424  LYS D O     1 
ATOM   5596  O  O     B LYS B  1  16  ? 37.235  70.624 -33.290 0.50 56.25  ? 424  LYS D O     1 
ATOM   5597  C  CB    A LYS B  1  16  ? 34.820  68.959 -33.390 0.50 53.07  ? 424  LYS D CB    1 
ATOM   5598  C  CB    B LYS B  1  16  ? 35.089  68.835 -33.368 0.50 54.44  ? 424  LYS D CB    1 
ATOM   5599  C  CG    A LYS B  1  16  ? 34.000  67.694 -33.186 0.50 50.32  ? 424  LYS D CG    1 
ATOM   5600  C  CG    B LYS B  1  16  ? 36.158  68.324 -34.359 0.50 53.36  ? 424  LYS D CG    1 
ATOM   5601  C  CD    A LYS B  1  16  ? 34.861  66.575 -32.643 0.50 47.65  ? 424  LYS D CD    1 
ATOM   5602  C  CD    B LYS B  1  16  ? 37.476  67.831 -33.749 0.50 50.17  ? 424  LYS D CD    1 
ATOM   5603  C  CE    A LYS B  1  16  ? 33.942  65.514 -32.064 0.50 46.29  ? 424  LYS D CE    1 
ATOM   5604  C  CE    B LYS B  1  16  ? 38.041  66.603 -34.452 0.50 49.50  ? 424  LYS D CE    1 
ATOM   5605  N  NZ    A LYS B  1  16  ? 34.718  64.405 -31.482 0.50 45.23  ? 424  LYS D NZ    1 
ATOM   5606  N  NZ    B LYS B  1  16  ? 38.906  67.106 -35.560 0.50 50.70  ? 424  LYS D NZ    1 
ATOM   5607  N  N     . SER B  1  17  ? 36.416  71.637 -31.481 1.00 54.62  ? 425  SER D N     1 
ATOM   5608  C  CA    . SER B  1  17  ? 37.347  72.771 -31.557 1.00 56.56  ? 425  SER D CA    1 
ATOM   5609  C  C     . SER B  1  17  ? 38.606  72.384 -30.783 1.00 53.24  ? 425  SER D C     1 
ATOM   5610  O  O     . SER B  1  17  ? 38.611  72.493 -29.543 1.00 52.50  ? 425  SER D O     1 
ATOM   5611  C  CB    . SER B  1  17  ? 36.712  74.042 -31.020 1.00 57.38  ? 425  SER D CB    1 
ATOM   5612  O  OG    . SER B  1  17  ? 37.678  75.079 -30.914 1.00 62.55  ? 425  SER D OG    1 
ATOM   5613  N  N     . PRO B  1  18  ? 39.635  71.848 -31.528 1.00 52.31  ? 426  PRO D N     1 
ATOM   5614  C  CA    . PRO B  1  18  ? 40.789  71.387 -30.747 1.00 48.75  ? 426  PRO D CA    1 
ATOM   5615  C  C     . PRO B  1  18  ? 41.400  72.242 -29.674 1.00 46.88  ? 426  PRO D C     1 
ATOM   5616  O  O     . PRO B  1  18  ? 41.793  71.732 -28.648 1.00 45.98  ? 426  PRO D O     1 
ATOM   5617  C  CB    . PRO B  1  18  ? 41.833  71.147 -31.821 1.00 49.86  ? 426  PRO D CB    1 
ATOM   5618  C  CG    . PRO B  1  18  ? 41.060  70.534 -32.891 1.00 49.30  ? 426  PRO D CG    1 
ATOM   5619  C  CD    . PRO B  1  18  ? 39.897  71.531 -32.993 1.00 49.73  ? 426  PRO D CD    1 
ATOM   5620  N  N     . GLU B  1  19  ? 41.488  73.531 -29.887 1.00 47.67  ? 427  GLU D N     1 
ATOM   5621  C  CA    . GLU B  1  19  ? 42.190  74.381 -28.938 1.00 48.54  ? 427  GLU D CA    1 
ATOM   5622  C  C     . GLU B  1  19  ? 41.497  74.474 -27.569 1.00 45.78  ? 427  GLU D C     1 
ATOM   5623  O  O     . GLU B  1  19  ? 42.117  74.942 -26.611 1.00 44.32  ? 427  GLU D O     1 
ATOM   5624  C  CB    . GLU B  1  19  ? 42.402  75.777 -29.530 1.00 54.85  ? 427  GLU D CB    1 
ATOM   5625  C  CG    . GLU B  1  19  ? 41.163  76.435 -30.077 1.00 58.71  ? 427  GLU D CG    1 
ATOM   5626  C  CD    . GLU B  1  19  ? 41.395  77.925 -30.345 1.00 65.47  ? 427  GLU D CD    1 
ATOM   5627  O  OE1   . GLU B  1  19  ? 42.243  78.290 -31.220 1.00 68.00  ? 427  GLU D OE1   1 
ATOM   5628  O  OE2   . GLU B  1  19  ? 40.727  78.738 -29.667 1.00 66.25  ? 427  GLU D OE2   1 
ATOM   5629  N  N     . GLU B  1  20  ? 40.221  74.071 -27.473 1.00 41.90  ? 428  GLU D N     1 
ATOM   5630  C  CA    . GLU B  1  20  ? 39.538  74.041 -26.204 1.00 44.05  ? 428  GLU D CA    1 
ATOM   5631  C  C     . GLU B  1  20  ? 39.409  72.578 -25.637 1.00 42.88  ? 428  GLU D C     1 
ATOM   5632  O  O     . GLU B  1  20  ? 38.883  72.393 -24.556 1.00 42.97  ? 428  GLU D O     1 
ATOM   5633  C  CB    . GLU B  1  20  ? 38.163  74.667 -26.300 1.00 44.17  ? 428  GLU D CB    1 
ATOM   5634  C  CG    . GLU B  1  20  ? 37.132  73.851 -27.032 1.00 47.29  ? 428  GLU D CG    1 
ATOM   5635  C  CD    . GLU B  1  20  ? 35.711  74.454 -26.914 1.00 51.51  ? 428  GLU D CD    1 
ATOM   5636  O  OE1   . GLU B  1  20  ? 34.770  73.918 -27.531 1.00 50.46  ? 428  GLU D OE1   1 
ATOM   5637  O  OE2   . GLU B  1  20  ? 35.501  75.464 -26.188 1.00 50.09  ? 428  GLU D OE2   1 
ATOM   5638  N  N     . CYS B  1  21  ? 39.845  71.590 -26.390 1.00 41.77  ? 429  CYS D N     1 
ATOM   5639  C  CA    . CYS B  1  21  ? 39.719  70.236 -25.968 1.00 40.78  ? 429  CYS D CA    1 
ATOM   5640  C  C     . CYS B  1  21  ? 40.984  69.627 -25.379 1.00 38.95  ? 429  CYS D C     1 
ATOM   5641  O  O     . CYS B  1  21  ? 42.076  69.961 -25.760 1.00 36.63  ? 429  CYS D O     1 
ATOM   5642  C  CB    . CYS B  1  21  ? 39.319  69.373 -27.162 1.00 43.00  ? 429  CYS D CB    1 
ATOM   5643  S  SG    . CYS B  1  21  ? 37.722  69.820 -27.838 1.00 44.85  ? 429  CYS D SG    1 
ATOM   5644  N  N     . GLU B  1  22  ? 40.790  68.729 -24.408 1.00 37.61  ? 430  GLU D N     1 
ATOM   5645  C  CA    . GLU B  1  22  ? 41.885  68.086 -23.714 1.00 35.01  ? 430  GLU D CA    1 
ATOM   5646  C  C     . GLU B  1  22  ? 41.624  66.590 -23.695 1.00 34.33  ? 430  GLU D C     1 
ATOM   5647  O  O     . GLU B  1  22  ? 40.467  66.148 -23.587 1.00 33.11  ? 430  GLU D O     1 
ATOM   5648  C  CB    . GLU B  1  22  ? 41.986  68.583 -22.261 1.00 37.40  ? 430  GLU D CB    1 
ATOM   5649  C  CG    . GLU B  1  22  ? 41.779  70.113 -22.115 1.00 38.24  ? 430  GLU D CG    1 
ATOM   5650  C  CD    . GLU B  1  22  ? 41.576  70.520 -20.689 1.00 40.53  ? 430  GLU D CD    1 
ATOM   5651  O  OE1   . GLU B  1  22  ? 41.077  69.682 -19.873 1.00 43.88  ? 430  GLU D OE1   1 
ATOM   5652  O  OE2   . GLU B  1  22  ? 41.827  71.681 -20.363 1.00 39.17  ? 430  GLU D OE2   1 
ATOM   5653  N  N     . ILE B  1  23  ? 42.688  65.798 -23.856 1.00 33.27  ? 431  ILE D N     1 
ATOM   5654  C  CA    . ILE B  1  23  ? 42.588  64.346 -23.743 1.00 34.60  ? 431  ILE D CA    1 
ATOM   5655  C  C     . ILE B  1  23  ? 43.452  63.919 -22.563 1.00 33.72  ? 431  ILE D C     1 
ATOM   5656  O  O     . ILE B  1  23  ? 44.605  64.349 -22.444 1.00 35.24  ? 431  ILE D O     1 
ATOM   5657  C  CB    . ILE B  1  23  ? 42.988  63.620 -25.044 1.00 37.22  ? 431  ILE D CB    1 
ATOM   5658  C  CG1   . ILE B  1  23  ? 42.823  62.105 -24.873 1.00 37.24  ? 431  ILE D CG1   1 
ATOM   5659  C  CG2   . ILE B  1  23  ? 44.430  63.951 -25.445 1.00 36.27  ? 431  ILE D CG2   1 
ATOM   5660  C  CD1   . ILE B  1  23  ? 42.963  61.358 -26.181 1.00 41.63  ? 431  ILE D CD1   1 
ATOM   5661  N  N     . PHE B  1  24  ? 42.879  63.093 -21.694 1.00 32.44  ? 432  PHE D N     1 
ATOM   5662  C  CA    . PHE B  1  24  ? 43.571  62.587 -20.519 1.00 29.16  ? 432  PHE D CA    1 
ATOM   5663  C  C     . PHE B  1  24  ? 43.934  61.126 -20.771 1.00 28.53  ? 432  PHE D C     1 
ATOM   5664  O  O     . PHE B  1  24  ? 43.066  60.314 -21.111 1.00 28.64  ? 432  PHE D O     1 
ATOM   5665  C  CB    . PHE B  1  24  ? 42.699  62.698 -19.267 1.00 30.15  ? 432  PHE D CB    1 
ATOM   5666  C  CG    . PHE B  1  24  ? 42.460  64.105 -18.803 1.00 31.07  ? 432  PHE D CG    1 
ATOM   5667  C  CD1   . PHE B  1  24  ? 41.590  64.944 -19.447 1.00 30.78  ? 432  PHE D CD1   1 
ATOM   5668  C  CD2   . PHE B  1  24  ? 43.164  64.599 -17.697 1.00 30.15  ? 432  PHE D CD2   1 
ATOM   5669  C  CE1   . PHE B  1  24  ? 41.395  66.244 -19.007 1.00 30.32  ? 432  PHE D CE1   1 
ATOM   5670  C  CE2   . PHE B  1  24  ? 42.990  65.858 -17.220 1.00 30.56  ? 432  PHE D CE2   1 
ATOM   5671  C  CZ    . PHE B  1  24  ? 42.090  66.726 -17.913 1.00 32.89  ? 432  PHE D CZ    1 
ATOM   5672  N  N     . LEU B  1  25  ? 45.211  60.802 -20.622 1.00 27.51  ? 433  LEU D N     1 
ATOM   5673  C  CA    . LEU B  1  25  ? 45.669  59.419 -20.650 1.00 28.59  ? 433  LEU D CA    1 
ATOM   5674  C  C     . LEU B  1  25  ? 45.714  58.930 -19.203 1.00 26.53  ? 433  LEU D C     1 
ATOM   5675  O  O     . LEU B  1  25  ? 46.535  59.387 -18.405 1.00 26.10  ? 433  LEU D O     1 
ATOM   5676  C  CB    . LEU B  1  25  ? 47.050  59.326 -21.309 1.00 28.39  ? 433  LEU D CB    1 
ATOM   5677  C  CG    . LEU B  1  25  ? 47.119  60.011 -22.690 1.00 30.72  ? 433  LEU D CG    1 
ATOM   5678  C  CD1   . LEU B  1  25  ? 48.559  60.180 -23.123 1.00 32.54  ? 433  LEU D CD1   1 
ATOM   5679  C  CD2   . LEU B  1  25  ? 46.306  59.206 -23.726 1.00 32.13  ? 433  LEU D CD2   1 
ATOM   5680  N  N     . VAL B  1  26  ? 44.778  58.025 -18.858 1.00 26.45  ? 434  VAL D N     1 
ATOM   5681  C  CA    . VAL B  1  26  ? 44.476  57.716 -17.461 1.00 25.41  ? 434  VAL D CA    1 
ATOM   5682  C  C     . VAL B  1  26  ? 45.010  56.288 -17.195 1.00 27.09  ? 434  VAL D C     1 
ATOM   5683  O  O     . VAL B  1  26  ? 44.820  55.373 -18.030 1.00 29.00  ? 434  VAL D O     1 
ATOM   5684  C  CB    . VAL B  1  26  ? 42.963  57.751 -17.224 1.00 24.59  ? 434  VAL D CB    1 
ATOM   5685  C  CG1   . VAL B  1  26  ? 42.657  57.415 -15.730 1.00 23.49  ? 434  VAL D CG1   1 
ATOM   5686  C  CG2   . VAL B  1  26  ? 42.442  59.201 -17.491 1.00 24.81  ? 434  VAL D CG2   1 
ATOM   5687  N  N     . GLU B  1  27  ? 45.657  56.112 -16.049 1.00 27.69  ? 435  GLU D N     1 
ATOM   5688  C  CA    . GLU B  1  27  ? 46.173  54.803 -15.665 1.00 27.45  ? 435  GLU D CA    1 
ATOM   5689  C  C     . GLU B  1  27  ? 45.061  53.980 -15.014 1.00 26.82  ? 435  GLU D C     1 
ATOM   5690  O  O     . GLU B  1  27  ? 44.512  54.364 -13.974 1.00 30.47  ? 435  GLU D O     1 
ATOM   5691  C  CB    . GLU B  1  27  ? 47.307  54.957 -14.633 1.00 25.24  ? 435  GLU D CB    1 
ATOM   5692  C  CG    . GLU B  1  27  ? 47.754  53.620 -14.035 1.00 25.53  ? 435  GLU D CG    1 
ATOM   5693  C  CD    . GLU B  1  27  ? 48.732  53.821 -12.888 1.00 26.21  ? 435  GLU D CD    1 
ATOM   5694  O  OE1   . GLU B  1  27  ? 49.115  54.978 -12.610 1.00 24.67  ? 435  GLU D OE1   1 
ATOM   5695  O  OE2   . GLU B  1  27  ? 49.104  52.769 -12.261 1.00 26.65  ? 435  GLU D OE2   1 
ATOM   5696  N  N     . GLY B  1  28  ? 44.765  52.880 -15.668 1.00 28.15  ? 436  GLY D N     1 
ATOM   5697  C  CA    . GLY B  1  28  ? 43.862  51.872 -15.174 1.00 29.45  ? 436  GLY D CA    1 
ATOM   5698  C  C     . GLY B  1  28  ? 42.408  51.995 -15.591 1.00 31.69  ? 436  GLY D C     1 
ATOM   5699  O  O     . GLY B  1  28  ? 41.874  53.083 -15.804 1.00 28.15  ? 436  GLY D O     1 
ATOM   5700  N  N     . ASP B  1  29  ? 41.782  50.841 -15.676 1.00 31.21  ? 437  ASP D N     1 
ATOM   5701  C  CA    . ASP B  1  29  ? 40.413  50.821 -16.104 1.00 35.41  ? 437  ASP D CA    1 
ATOM   5702  C  C     . ASP B  1  29  ? 39.470  51.381 -15.070 1.00 30.19  ? 437  ASP D C     1 
ATOM   5703  O  O     . ASP B  1  29  ? 38.501  52.002 -15.434 1.00 29.37  ? 437  ASP D O     1 
ATOM   5704  C  CB    . ASP B  1  29  ? 39.992  49.417 -16.599 1.00 42.93  ? 437  ASP D CB    1 
ATOM   5705  C  CG    . ASP B  1  29  ? 40.576  49.142 -18.023 1.00 49.83  ? 437  ASP D CG    1 
ATOM   5706  O  OD1   . ASP B  1  29  ? 40.411  49.941 -18.940 1.00 50.16  ? 437  ASP D OD1   1 
ATOM   5707  O  OD2   . ASP B  1  29  ? 41.330  48.171 -18.167 1.00 62.43  ? 437  ASP D OD2   1 
ATOM   5708  N  N     . SER B  1  30  ? 39.746  51.157 -13.782 1.00 31.61  ? 438  SER D N     1 
ATOM   5709  C  CA    . SER B  1  30  ? 38.889  51.685 -12.757 1.00 34.48  ? 438  SER D CA    1 
ATOM   5710  C  C     . SER B  1  30  ? 38.912  53.200 -12.773 1.00 34.04  ? 438  SER D C     1 
ATOM   5711  O  O     . SER B  1  30  ? 37.877  53.821 -12.793 1.00 28.60  ? 438  SER D O     1 
ATOM   5712  C  CB    . SER B  1  30  ? 39.385  51.223 -11.418 1.00 39.22  ? 438  SER D CB    1 
ATOM   5713  O  OG    . SER B  1  30  ? 39.097  49.824 -11.281 1.00 49.32  ? 438  SER D OG    1 
ATOM   5714  N  N     . ALA B  1  31  ? 40.108  53.781 -12.777 1.00 29.94  ? 439  ALA D N     1 
ATOM   5715  C  CA    . ALA B  1  31  ? 40.253  55.233 -12.855 1.00 28.93  ? 439  ALA D CA    1 
ATOM   5716  C  C     . ALA B  1  31  ? 39.747  55.759 -14.208 1.00 30.35  ? 439  ALA D C     1 
ATOM   5717  O  O     . ALA B  1  31  ? 39.240  56.889 -14.283 1.00 29.69  ? 439  ALA D O     1 
ATOM   5718  C  CB    . ALA B  1  31  ? 41.701  55.634 -12.609 1.00 26.96  ? 439  ALA D CB    1 
ATOM   5719  N  N     . GLY B  1  32  ? 39.886  54.965 -15.286 1.00 29.21  ? 440  GLY D N     1 
ATOM   5720  C  CA    . GLY B  1  32  ? 39.345  55.407 -16.541 1.00 32.67  ? 440  GLY D CA    1 
ATOM   5721  C  C     . GLY B  1  32  ? 37.833  55.575 -16.534 1.00 30.08  ? 440  GLY D C     1 
ATOM   5722  O  O     . GLY B  1  32  ? 37.300  56.521 -17.112 1.00 31.07  ? 440  GLY D O     1 
ATOM   5723  N  N     . GLY B  1  33  ? 37.149  54.674 -15.847 1.00 31.56  ? 441  GLY D N     1 
ATOM   5724  C  CA    . GLY B  1  33  ? 35.689  54.770 -15.768 1.00 32.50  ? 441  GLY D CA    1 
ATOM   5725  C  C     . GLY B  1  33  ? 35.205  55.939 -14.932 1.00 32.87  ? 441  GLY D C     1 
ATOM   5726  O  O     . GLY B  1  33  ? 34.196  56.547 -15.234 1.00 33.42  ? 441  GLY D O     1 
ATOM   5727  N  N     . SER B  1  34  ? 35.909  56.243 -13.855 1.00 32.31  ? 442  SER D N     1 
ATOM   5728  C  CA    . SER B  1  34  ? 35.487  57.329 -12.963 1.00 35.65  ? 442  SER D CA    1 
ATOM   5729  C  C     . SER B  1  34  ? 35.890  58.708 -13.531 1.00 35.71  ? 442  SER D C     1 
ATOM   5730  O  O     . SER B  1  34  ? 35.180  59.689 -13.296 1.00 34.26  ? 442  SER D O     1 
ATOM   5731  C  CB    . SER B  1  34  ? 36.017  57.129 -11.553 1.00 37.30  ? 442  SER D CB    1 
ATOM   5732  O  OG    . SER B  1  34  ? 37.353  56.694 -11.602 1.00 43.13  ? 442  SER D OG    1 
ATOM   5733  N  N     . THR B  1  35  ? 37.016  58.793 -14.254 1.00 31.68  ? 443  THR D N     1 
ATOM   5734  C  CA    . THR B  1  35  ? 37.316  60.022 -14.938 1.00 33.17  ? 443  THR D CA    1 
ATOM   5735  C  C     . THR B  1  35  ? 36.334  60.284 -16.083 1.00 33.80  ? 443  THR D C     1 
ATOM   5736  O  O     . THR B  1  35  ? 36.026  61.442 -16.396 1.00 33.56  ? 443  THR D O     1 
ATOM   5737  C  CB    . THR B  1  35  ? 38.754  60.003 -15.494 1.00 32.53  ? 443  THR D CB    1 
ATOM   5738  O  OG1   . THR B  1  35  ? 38.949  58.809 -16.264 1.00 31.78  ? 443  THR D OG1   1 
ATOM   5739  C  CG2   . THR B  1  35  ? 39.780  60.053 -14.321 1.00 33.26  ? 443  THR D CG2   1 
ATOM   5740  N  N     . LYS B  1  36  ? 35.813  59.228 -16.721 1.00 33.18  ? 444  LYS D N     1 
ATOM   5741  C  CA    . LYS B  1  36  ? 34.819  59.405 -17.775 1.00 33.81  ? 444  LYS D CA    1 
ATOM   5742  C  C     . LYS B  1  36  ? 33.518  59.974 -17.225 1.00 36.74  ? 444  LYS D C     1 
ATOM   5743  O  O     . LYS B  1  36  ? 32.830  60.735 -17.924 1.00 34.76  ? 444  LYS D O     1 
ATOM   5744  C  CB    . LYS B  1  36  ? 34.529  58.090 -18.484 1.00 34.59  ? 444  LYS D CB    1 
ATOM   5745  C  CG    . LYS B  1  36  ? 35.630  57.688 -19.483 1.00 35.67  ? 444  LYS D CG    1 
ATOM   5746  C  CD    . LYS B  1  36  ? 35.329  56.276 -20.043 1.00 35.95  ? 444  LYS D CD    1 
ATOM   5747  C  CE    . LYS B  1  36  ? 36.539  55.855 -20.903 1.00 35.75  ? 444  LYS D CE    1 
ATOM   5748  N  NZ    . LYS B  1  36  ? 36.282  54.483 -21.494 1.00 40.98  ? 444  LYS D NZ    1 
ATOM   5749  N  N     . SER B  1  37  ? 33.216  59.650 -15.985 1.00 34.16  ? 445  SER D N     1 
ATOM   5750  C  CA    . SER B  1  37  ? 32.033  60.148 -15.376 1.00 37.12  ? 445  SER D CA    1 
ATOM   5751  C  C     . SER B  1  37  ? 32.190  61.502 -14.771 1.00 35.88  ? 445  SER D C     1 
ATOM   5752  O  O     . SER B  1  37  ? 31.272  62.284 -14.788 1.00 35.03  ? 445  SER D O     1 
ATOM   5753  C  CB    . SER B  1  37  ? 31.492  59.145 -14.387 1.00 39.34  ? 445  SER D CB    1 
ATOM   5754  O  OG    . SER B  1  37  ? 32.331  59.059 -13.276 1.00 51.84  ? 445  SER D OG    1 
ATOM   5755  N  N     . GLY B  1  38  ? 33.352  61.811 -14.242 1.00 34.57  ? 446  GLY D N     1 
ATOM   5756  C  CA    . GLY B  1  38  ? 33.633  63.088 -13.600 1.00 35.46  ? 446  GLY D CA    1 
ATOM   5757  C  C     . GLY B  1  38  ? 34.160  64.164 -14.490 1.00 35.32  ? 446  GLY D C     1 
ATOM   5758  O  O     . GLY B  1  38  ? 34.369  65.315 -14.019 1.00 38.08  ? 446  GLY D O     1 
ATOM   5759  N  N     . ARG B  1  39  ? 34.377  63.898 -15.757 1.00 36.59  ? 447  ARG D N     1 
ATOM   5760  C  CA    . ARG B  1  39  ? 34.934  64.899 -16.632 1.00 35.02  ? 447  ARG D CA    1 
ATOM   5761  C  C     . ARG B  1  39  ? 33.872  65.817 -17.200 1.00 35.96  ? 447  ARG D C     1 
ATOM   5762  O  O     . ARG B  1  39  ? 32.706  65.487 -17.199 1.00 36.12  ? 447  ARG D O     1 
ATOM   5763  C  CB    . ARG B  1  39  ? 35.513  64.204 -17.823 1.00 34.50  ? 447  ARG D CB    1 
ATOM   5764  C  CG    . ARG B  1  39  ? 34.456  63.380 -18.555 1.00 34.92  ? 447  ARG D CG    1 
ATOM   5765  C  CD    . ARG B  1  39  ? 34.918  62.846 -19.874 1.00 35.01  ? 447  ARG D CD    1 
ATOM   5766  N  NE    . ARG B  1  39  ? 33.841  62.019 -20.390 1.00 37.49  ? 447  ARG D NE    1 
ATOM   5767  C  CZ    . ARG B  1  39  ? 33.670  61.769 -21.674 1.00 38.14  ? 447  ARG D CZ    1 
ATOM   5768  N  NH1   . ARG B  1  39  ? 34.466  62.316 -22.562 1.00 39.08  ? 447  ARG D NH1   1 
ATOM   5769  N  NH2   . ARG B  1  39  ? 32.698  61.023 -22.056 1.00 42.37  ? 447  ARG D NH2   1 
ATOM   5770  N  N     . ASP B  1  40  ? 34.351  66.949 -17.712 1.00 36.49  ? 448  ASP D N     1 
ATOM   5771  C  CA    . ASP B  1  40  ? 33.512  67.848 -18.512 1.00 36.60  ? 448  ASP D CA    1 
ATOM   5772  C  C     . ASP B  1  40  ? 33.427  67.234 -19.911 1.00 37.05  ? 448  ASP D C     1 
ATOM   5773  O  O     . ASP B  1  40  ? 34.304  67.459 -20.759 1.00 39.54  ? 448  ASP D O     1 
ATOM   5774  C  CB    . ASP B  1  40  ? 34.155  69.248 -18.513 1.00 35.13  ? 448  ASP D CB    1 
ATOM   5775  C  CG    . ASP B  1  40  ? 33.303  70.283 -19.282 1.00 36.42  ? 448  ASP D CG    1 
ATOM   5776  O  OD1   . ASP B  1  40  ? 32.343  69.902 -19.972 1.00 31.91  ? 448  ASP D OD1   1 
ATOM   5777  O  OD2   . ASP B  1  40  ? 33.612  71.458 -19.175 1.00 39.39  ? 448  ASP D OD2   1 
ATOM   5778  N  N     . SER B  1  41  ? 32.351  66.500 -20.139 1.00 36.06  ? 449  SER D N     1 
ATOM   5779  C  CA    . SER B  1  41  ? 32.223  65.762 -21.433 1.00 39.02  ? 449  SER D CA    1 
ATOM   5780  C  C     . SER B  1  41  ? 32.213  66.701 -22.633 1.00 40.76  ? 449  SER D C     1 
ATOM   5781  O  O     . SER B  1  41  ? 32.380  66.211 -23.755 1.00 41.07  ? 449  SER D O     1 
ATOM   5782  C  CB    . SER B  1  41  ? 30.924  64.927 -21.463 1.00 37.35  ? 449  SER D CB    1 
ATOM   5783  O  OG    . SER B  1  41  ? 29.795  65.752 -21.303 1.00 38.44  ? 449  SER D OG    1 
ATOM   5784  N  N     . ARG B  1  42  ? 32.059  67.997 -22.426 1.00 42.13  ? 450  ARG D N     1 
ATOM   5785  C  CA    . ARG B  1  42  ? 32.090  68.931 -23.558 1.00 45.11  ? 450  ARG D CA    1 
ATOM   5786  C  C     . ARG B  1  42  ? 33.496  69.072 -24.126 1.00 44.78  ? 450  ARG D C     1 
ATOM   5787  O  O     . ARG B  1  42  ? 33.673  69.080 -25.353 1.00 44.13  ? 450  ARG D O     1 
ATOM   5788  C  CB    . ARG B  1  42  ? 31.554  70.308 -23.142 1.00 46.71  ? 450  ARG D CB    1 
ATOM   5789  C  CG    . ARG B  1  42  ? 30.068  70.330 -22.806 1.00 51.08  ? 450  ARG D CG    1 
ATOM   5790  C  CD    . ARG B  1  42  ? 29.676  71.649 -22.179 1.00 55.57  ? 450  ARG D CD    1 
ATOM   5791  N  NE    . ARG B  1  42  ? 30.215  71.778 -20.832 1.00 59.66  ? 450  ARG D NE    1 
ATOM   5792  C  CZ    . ARG B  1  42  ? 30.522  72.931 -20.228 1.00 64.26  ? 450  ARG D CZ    1 
ATOM   5793  N  NH1   . ARG B  1  42  ? 30.302  74.102 -20.798 1.00 67.17  ? 450  ARG D NH1   1 
ATOM   5794  N  NH2   . ARG B  1  42  ? 30.989  72.937 -18.999 1.00 67.92  ? 450  ARG D NH2   1 
ATOM   5795  N  N     . THR B  1  43  ? 34.510  69.175 -23.257 1.00 41.86  ? 451  THR D N     1 
ATOM   5796  C  CA    . THR B  1  43  ? 35.844  69.522 -23.692 1.00 42.26  ? 451  THR D CA    1 
ATOM   5797  C  C     . THR B  1  43  ? 36.929  68.555 -23.251 1.00 42.45  ? 451  THR D C     1 
ATOM   5798  O  O     . THR B  1  43  ? 38.110  68.805 -23.535 1.00 39.88  ? 451  THR D O     1 
ATOM   5799  C  CB    . THR B  1  43  ? 36.235  70.919 -23.212 1.00 43.13  ? 451  THR D CB    1 
ATOM   5800  O  OG1   . THR B  1  43  ? 36.014  70.995 -21.773 1.00 39.74  ? 451  THR D OG1   1 
ATOM   5801  C  CG2   . THR B  1  43  ? 35.389  71.984 -23.920 1.00 43.02  ? 451  THR D CG2   1 
ATOM   5802  N  N     . GLN B  1  44  ? 36.565  67.462 -22.556 1.00 38.49  ? 452  GLN D N     1 
ATOM   5803  C  CA    . GLN B  1  44  ? 37.566  66.557 -21.999 1.00 38.73  ? 452  GLN D CA    1 
ATOM   5804  C  C     . GLN B  1  44  ? 37.308  65.145 -22.475 1.00 37.94  ? 452  GLN D C     1 
ATOM   5805  O  O     . GLN B  1  44  ? 36.191  64.614 -22.322 1.00 37.92  ? 452  GLN D O     1 
ATOM   5806  C  CB    . GLN B  1  44  ? 37.562  66.620 -20.471 1.00 35.31  ? 452  GLN D CB    1 
ATOM   5807  C  CG    . GLN B  1  44  ? 38.131  67.932 -19.932 1.00 36.02  ? 452  GLN D CG    1 
ATOM   5808  C  CD    . GLN B  1  44  ? 38.060  68.054 -18.432 1.00 35.93  ? 452  GLN D CD    1 
ATOM   5809  O  OE1   . GLN B  1  44  ? 37.305  67.306 -17.779 1.00 35.74  ? 452  GLN D OE1   1 
ATOM   5810  N  NE2   . GLN B  1  44  ? 38.848  68.951 -17.858 1.00 33.87  ? 452  GLN D NE2   1 
ATOM   5811  N  N     . ALA B  1  45  ? 38.335  64.522 -23.082 1.00 35.01  ? 453  ALA D N     1 
ATOM   5812  C  CA    . ALA B  1  45  ? 38.253  63.150 -23.527 1.00 33.98  ? 453  ALA D CA    1 
ATOM   5813  C  C     . ALA B  1  45  ? 39.174  62.275 -22.639 1.00 35.00  ? 453  ALA D C     1 
ATOM   5814  O  O     . ALA B  1  45  ? 40.176  62.742 -22.087 1.00 37.21  ? 453  ALA D O     1 
ATOM   5815  C  CB    . ALA B  1  45  ? 38.661  63.024 -24.979 1.00 33.26  ? 453  ALA D CB    1 
ATOM   5816  N  N     . ILE B  1  46  ? 38.795  60.995 -22.508 1.00 33.97  ? 454  ILE D N     1 
ATOM   5817  C  CA    . ILE B  1  46  ? 39.535  60.056 -21.703 1.00 34.69  ? 454  ILE D CA    1 
ATOM   5818  C  C     . ILE B  1  46  ? 40.013  58.912 -22.566 1.00 37.00  ? 454  ILE D C     1 
ATOM   5819  O  O     . ILE B  1  46  ? 39.223  58.315 -23.310 1.00 38.94  ? 454  ILE D O     1 
ATOM   5820  C  CB    . ILE B  1  46  ? 38.676  59.516 -20.525 1.00 34.08  ? 454  ILE D CB    1 
ATOM   5821  C  CG1   . ILE B  1  46  ? 38.070  60.688 -19.717 1.00 33.38  ? 454  ILE D CG1   1 
ATOM   5822  C  CG2   . ILE B  1  46  ? 39.503  58.572 -19.654 1.00 33.32  ? 454  ILE D CG2   1 
ATOM   5823  C  CD1   . ILE B  1  46  ? 39.096  61.596 -19.071 1.00 32.54  ? 454  ILE D CD1   1 
ATOM   5824  N  N     . LEU B  1  47  ? 41.300  58.601 -22.464 1.00 35.28  ? 455  LEU D N     1 
ATOM   5825  C  CA    . LEU B  1  47  ? 41.878  57.385 -23.064 1.00 34.95  ? 455  LEU D CA    1 
ATOM   5826  C  C     . LEU B  1  47  ? 42.514  56.557 -21.966 1.00 32.78  ? 455  LEU D C     1 
ATOM   5827  O  O     . LEU B  1  47  ? 43.641  56.844 -21.554 1.00 31.97  ? 455  LEU D O     1 
ATOM   5828  C  CB    . LEU B  1  47  ? 42.865  57.756 -24.167 1.00 34.61  ? 455  LEU D CB    1 
ATOM   5829  C  CG    . LEU B  1  47  ? 43.496  56.570 -24.917 1.00 39.82  ? 455  LEU D CG    1 
ATOM   5830  C  CD1   . LEU B  1  47  ? 42.447  55.615 -25.434 1.00 44.97  ? 455  LEU D CD1   1 
ATOM   5831  C  CD2   . LEU B  1  47  ? 44.350  57.088 -26.080 1.00 39.89  ? 455  LEU D CD2   1 
ATOM   5832  N  N     . PRO B  1  48  ? 41.832  55.528 -21.455 1.00 33.52  ? 456  PRO D N     1 
ATOM   5833  C  CA    . PRO B  1  48  ? 42.398  54.734 -20.365 1.00 33.68  ? 456  PRO D CA    1 
ATOM   5834  C  C     . PRO B  1  48  ? 43.467  53.757 -20.919 1.00 36.42  ? 456  PRO D C     1 
ATOM   5835  O  O     . PRO B  1  48  ? 43.314  53.190 -22.000 1.00 39.14  ? 456  PRO D O     1 
ATOM   5836  C  CB    . PRO B  1  48  ? 41.211  53.967 -19.812 1.00 32.10  ? 456  PRO D CB    1 
ATOM   5837  C  CG    . PRO B  1  48  ? 40.037  54.383 -20.603 1.00 34.46  ? 456  PRO D CG    1 
ATOM   5838  C  CD    . PRO B  1  48  ? 40.535  55.000 -21.865 1.00 33.44  ? 456  PRO D CD    1 
ATOM   5839  N  N     . LEU B  1  49  ? 44.527  53.594 -20.138 1.00 36.67  ? 457  LEU D N     1 
ATOM   5840  C  CA    . LEU B  1  49  ? 45.593  52.667 -20.473 1.00 34.73  ? 457  LEU D CA    1 
ATOM   5841  C  C     . LEU B  1  49  ? 45.549  51.506 -19.452 1.00 31.77  ? 457  LEU D C     1 
ATOM   5842  O  O     . LEU B  1  49  ? 45.440  51.740 -18.241 1.00 34.32  ? 457  LEU D O     1 
ATOM   5843  C  CB    . LEU B  1  49  ? 46.970  53.357 -20.423 1.00 33.52  ? 457  LEU D CB    1 
ATOM   5844  C  CG    . LEU B  1  49  ? 47.137  54.575 -21.275 1.00 36.97  ? 457  LEU D CG    1 
ATOM   5845  C  CD1   . LEU B  1  49  ? 48.374  55.377 -20.790 1.00 39.09  ? 457  LEU D CD1   1 
ATOM   5846  C  CD2   . LEU B  1  49  ? 47.228  54.265 -22.752 1.00 31.94  ? 457  LEU D CD2   1 
ATOM   5847  N  N     A ARG B  1  50  ? 45.633  50.280 -19.964 0.50 33.17  ? 458  ARG D N     1 
ATOM   5848  N  N     B ARG B  1  50  ? 45.717  50.291 -19.937 0.50 31.69  ? 458  ARG D N     1 
ATOM   5849  C  CA    A ARG B  1  50  ? 45.509  49.096 -19.155 0.50 33.64  ? 458  ARG D CA    1 
ATOM   5850  C  CA    B ARG B  1  50  ? 45.503  49.134 -19.116 0.50 31.12  ? 458  ARG D CA    1 
ATOM   5851  C  C     A ARG B  1  50  ? 46.508  49.130 -17.998 0.50 31.93  ? 458  ARG D C     1 
ATOM   5852  C  C     B ARG B  1  50  ? 46.501  49.168 -17.988 0.50 30.49  ? 458  ARG D C     1 
ATOM   5853  O  O     A ARG B  1  50  ? 46.183  48.800 -16.841 0.50 32.56  ? 458  ARG D O     1 
ATOM   5854  O  O     B ARG B  1  50  ? 46.155  48.899 -16.843 0.50 31.47  ? 458  ARG D O     1 
ATOM   5855  C  CB    A ARG B  1  50  ? 45.731  47.835 -20.059 0.50 37.09  ? 458  ARG D CB    1 
ATOM   5856  C  CB    B ARG B  1  50  ? 45.664  47.838 -19.951 0.50 32.17  ? 458  ARG D CB    1 
ATOM   5857  C  CG    A ARG B  1  50  ? 44.600  47.621 -21.037 0.50 39.06  ? 458  ARG D CG    1 
ATOM   5858  C  CG    B ARG B  1  50  ? 45.761  46.564 -19.072 0.50 30.04  ? 458  ARG D CG    1 
ATOM   5859  C  CD    A ARG B  1  50  ? 43.535  46.707 -20.474 0.50 40.90  ? 458  ARG D CD    1 
ATOM   5860  C  CD    B ARG B  1  50  ? 46.015  45.276 -19.870 0.50 31.54  ? 458  ARG D CD    1 
ATOM   5861  N  NE    A ARG B  1  50  ? 42.661  46.359 -21.570 0.50 40.69  ? 458  ARG D NE    1 
ATOM   5862  N  NE    B ARG B  1  50  ? 46.111  44.197 -18.889 0.50 30.28  ? 458  ARG D NE    1 
ATOM   5863  C  CZ    A ARG B  1  50  ? 42.334  45.124 -21.937 0.50 42.73  ? 458  ARG D CZ    1 
ATOM   5864  C  CZ    B ARG B  1  50  ? 46.020  42.926 -19.218 0.50 31.68  ? 458  ARG D CZ    1 
ATOM   5865  N  NH1   A ARG B  1  50  ? 42.744  44.081 -21.253 0.50 41.58  ? 458  ARG D NH1   1 
ATOM   5866  N  NH1   B ARG B  1  50  ? 45.892  42.592 -20.492 0.50 32.35  ? 458  ARG D NH1   1 
ATOM   5867  N  NH2   A ARG B  1  50  ? 41.494  44.940 -22.951 0.50 44.98  ? 458  ARG D NH2   1 
ATOM   5868  N  NH2   B ARG B  1  50  ? 46.136  42.001 -18.284 0.50 33.53  ? 458  ARG D NH2   1 
ATOM   5869  N  N     . GLY B  1  51  ? 47.754  49.480 -18.284 1.00 30.85  ? 459  GLY D N     1 
ATOM   5870  C  CA    . GLY B  1  51  ? 48.765  49.456 -17.223 1.00 27.93  ? 459  GLY D CA    1 
ATOM   5871  C  C     . GLY B  1  51  ? 50.104  49.945 -17.797 1.00 26.89  ? 459  GLY D C     1 
ATOM   5872  O  O     . GLY B  1  51  ? 50.180  51.042 -18.432 1.00 25.08  ? 459  GLY D O     1 
ATOM   5873  N  N     . LYS B  1  52  ? 51.119  49.055 -17.652 1.00 23.68  ? 460  LYS D N     1 
ATOM   5874  C  CA    . LYS B  1  52  ? 52.389  49.408 -18.336 1.00 24.10  ? 460  LYS D CA    1 
ATOM   5875  C  C     . LYS B  1  52  ? 52.196  49.290 -19.835 1.00 24.57  ? 460  LYS D C     1 
ATOM   5876  O  O     . LYS B  1  52  ? 51.464  48.409 -20.331 1.00 26.53  ? 460  LYS D O     1 
ATOM   5877  C  CB    . LYS B  1  52  ? 53.516  48.459 -17.888 1.00 24.01  ? 460  LYS D CB    1 
ATOM   5878  C  CG    . LYS B  1  52  ? 53.787  48.415 -16.368 1.00 24.13  ? 460  LYS D CG    1 
ATOM   5879  C  CD    . LYS B  1  52  ? 54.047  49.839 -15.890 1.00 25.45  ? 460  LYS D CD    1 
ATOM   5880  C  CE    . LYS B  1  52  ? 54.234  49.903 -14.378 1.00 23.10  ? 460  LYS D CE    1 
ATOM   5881  N  NZ    . LYS B  1  52  ? 55.463  49.103 -13.908 1.00 23.77  ? 460  LYS D NZ    1 
ATOM   5882  N  N     . ILE B  1  53  ? 52.859  50.141 -20.560 1.00 27.48  ? 461  ILE D N     1 
ATOM   5883  C  CA    . ILE B  1  53  ? 52.724  50.240 -22.045 1.00 30.76  ? 461  ILE D CA    1 
ATOM   5884  C  C     . ILE B  1  53  ? 54.100  49.950 -22.619 1.00 29.50  ? 461  ILE D C     1 
ATOM   5885  O  O     . ILE B  1  53  ? 55.116  49.986 -21.936 1.00 28.26  ? 461  ILE D O     1 
ATOM   5886  C  CB    . ILE B  1  53  ? 52.202  51.584 -22.539 1.00 32.43  ? 461  ILE D CB    1 
ATOM   5887  C  CG1   . ILE B  1  53  ? 53.248  52.680 -22.323 1.00 35.24  ? 461  ILE D CG1   1 
ATOM   5888  C  CG2   . ILE B  1  53  ? 50.875  51.931 -21.869 1.00 35.81  ? 461  ILE D CG2   1 
ATOM   5889  C  CD1   . ILE B  1  53  ? 52.968  53.959 -23.087 1.00 34.44  ? 461  ILE D CD1   1 
ATOM   5890  N  N     . LEU B  1  54  ? 54.105  49.682 -23.932 1.00 29.60  ? 462  LEU D N     1 
ATOM   5891  C  CA    . LEU B  1  54  ? 55.347  49.383 -24.658 1.00 30.22  ? 462  LEU D CA    1 
ATOM   5892  C  C     . LEU B  1  54  ? 56.406  50.475 -24.437 1.00 29.37  ? 462  LEU D C     1 
ATOM   5893  O  O     . LEU B  1  54  ? 56.115  51.654 -24.589 1.00 29.49  ? 462  LEU D O     1 
ATOM   5894  C  CB    . LEU B  1  54  ? 55.007  49.287 -26.152 1.00 31.08  ? 462  LEU D CB    1 
ATOM   5895  C  CG    . LEU B  1  54  ? 56.069  48.653 -27.092 1.00 33.35  ? 462  LEU D CG    1 
ATOM   5896  C  CD1   . LEU B  1  54  ? 56.280  47.164 -26.851 1.00 32.65  ? 462  LEU D CD1   1 
ATOM   5897  C  CD2   . LEU B  1  54  ? 55.624  48.927 -28.540 1.00 34.11  ? 462  LEU D CD2   1 
ATOM   5898  N  N     . ASN B  1  55  ? 57.617  50.072 -24.139 1.00 27.98  ? 463  ASN D N     1 
ATOM   5899  C  CA    . ASN B  1  55  ? 58.786  50.945 -24.187 1.00 29.00  ? 463  ASN D CA    1 
ATOM   5900  C  C     . ASN B  1  55  ? 59.277  51.053 -25.624 1.00 31.59  ? 463  ASN D C     1 
ATOM   5901  O  O     . ASN B  1  55  ? 59.885  50.116 -26.123 1.00 31.31  ? 463  ASN D O     1 
ATOM   5902  C  CB    . ASN B  1  55  ? 59.879  50.450 -23.218 1.00 28.56  ? 463  ASN D CB    1 
ATOM   5903  C  CG    . ASN B  1  55  ? 61.127  51.311 -23.246 1.00 31.16  ? 463  ASN D CG    1 
ATOM   5904  O  OD1   . ASN B  1  55  ? 61.239  52.301 -23.999 1.00 32.80  ? 463  ASN D OD1   1 
ATOM   5905  N  ND2   . ASN B  1  55  ? 62.103  50.938 -22.392 1.00 30.40  ? 463  ASN D ND2   1 
ATOM   5906  N  N     . VAL B  1  56  ? 59.023  52.177 -26.274 1.00 31.64  ? 464  VAL D N     1 
ATOM   5907  C  CA    . VAL B  1  56  ? 59.388  52.313 -27.694 1.00 33.21  ? 464  VAL D CA    1 
ATOM   5908  C  C     . VAL B  1  56  ? 60.891  52.480 -27.876 1.00 35.59  ? 464  VAL D C     1 
ATOM   5909  O  O     . VAL B  1  56  ? 61.396  52.277 -28.987 1.00 37.02  ? 464  VAL D O     1 
ATOM   5910  C  CB    . VAL B  1  56  ? 58.655  53.489 -28.365 1.00 34.51  ? 464  VAL D CB    1 
ATOM   5911  C  CG1   . VAL B  1  56  ? 57.117  53.245 -28.261 1.00 32.68  ? 464  VAL D CG1   1 
ATOM   5912  C  CG2   . VAL B  1  56  ? 59.063  54.805 -27.716 1.00 34.94  ? 464  VAL D CG2   1 
ATOM   5913  N  N     . GLU B  1  57  ? 61.638  52.817 -26.821 1.00 33.96  ? 465  GLU D N     1 
ATOM   5914  C  CA    . GLU B  1  57  ? 63.076  52.911 -26.955 1.00 35.87  ? 465  GLU D CA    1 
ATOM   5915  C  C     . GLU B  1  57  ? 63.720  51.537 -27.155 1.00 38.09  ? 465  GLU D C     1 
ATOM   5916  O  O     . GLU B  1  57  ? 64.784  51.444 -27.777 1.00 41.38  ? 465  GLU D O     1 
ATOM   5917  C  CB    . GLU B  1  57  ? 63.686  53.578 -25.728 1.00 34.03  ? 465  GLU D CB    1 
ATOM   5918  C  CG    . GLU B  1  57  ? 65.129  54.040 -25.909 1.00 35.93  ? 465  GLU D CG    1 
ATOM   5919  C  CD    . GLU B  1  57  ? 65.235  55.329 -26.736 1.00 36.53  ? 465  GLU D CD    1 
ATOM   5920  O  OE1   . GLU B  1  57  ? 66.333  55.638 -27.201 1.00 38.87  ? 465  GLU D OE1   1 
ATOM   5921  O  OE2   . GLU B  1  57  ? 64.232  56.003 -26.924 1.00 37.16  ? 465  GLU D OE2   1 
ATOM   5922  N  N     . LYS B  1  58  ? 63.064  50.488 -26.671 1.00 34.64  ? 466  LYS D N     1 
ATOM   5923  C  CA    . LYS B  1  58  ? 63.585  49.121 -26.799 1.00 34.26  ? 466  LYS D CA    1 
ATOM   5924  C  C     . LYS B  1  58  ? 62.952  48.345 -27.963 1.00 35.53  ? 466  LYS D C     1 
ATOM   5925  O  O     . LYS B  1  58  ? 63.557  47.401 -28.433 1.00 38.82  ? 466  LYS D O     1 
ATOM   5926  C  CB    . LYS B  1  58  ? 63.384  48.328 -25.535 1.00 32.61  ? 466  LYS D CB    1 
ATOM   5927  C  CG    . LYS B  1  58  ? 64.259  48.806 -24.350 1.00 30.12  ? 466  LYS D CG    1 
ATOM   5928  C  CD    . LYS B  1  58  ? 63.964  47.998 -23.057 1.00 30.36  ? 466  LYS D CD    1 
ATOM   5929  C  CE    . LYS B  1  58  ? 64.827  48.485 -21.960 1.00 27.89  ? 466  LYS D CE    1 
ATOM   5930  N  NZ    . LYS B  1  58  ? 64.482  47.775 -20.630 1.00 31.13  ? 466  LYS D NZ    1 
ATOM   5931  N  N     . ALA B  1  59  ? 61.738  48.760 -28.425 1.00 33.60  ? 467  ALA D N     1 
ATOM   5932  C  CA    . ALA B  1  59  ? 61.023  47.984 -29.406 1.00 33.87  ? 467  ALA D CA    1 
ATOM   5933  C  C     . ALA B  1  59  ? 61.446  48.458 -30.836 1.00 34.20  ? 467  ALA D C     1 
ATOM   5934  O  O     . ALA B  1  59  ? 61.792  49.657 -31.051 1.00 30.79  ? 467  ALA D O     1 
ATOM   5935  C  CB    . ALA B  1  59  ? 59.538  48.138 -29.218 1.00 32.40  ? 467  ALA D CB    1 
ATOM   5936  N  N     . ARG B  1  60  ? 61.398  47.517 -31.772 1.00 34.21  ? 468  ARG D N     1 
ATOM   5937  C  CA    . ARG B  1  60  ? 61.605  47.877 -33.156 1.00 35.63  ? 468  ARG D CA    1 
ATOM   5938  C  C     . ARG B  1  60  ? 60.282  48.414 -33.741 1.00 36.92  ? 468  ARG D C     1 
ATOM   5939  O  O     . ARG B  1  60  ? 59.223  48.345 -33.110 1.00 35.81  ? 468  ARG D O     1 
ATOM   5940  C  CB    . ARG B  1  60  ? 62.120  46.687 -33.962 1.00 36.36  ? 468  ARG D CB    1 
ATOM   5941  C  CG    . ARG B  1  60  ? 63.499  46.229 -33.494 1.00 38.48  ? 468  ARG D CG    1 
ATOM   5942  C  CD    . ARG B  1  60  ? 64.013  45.023 -34.282 1.00 37.30  ? 468  ARG D CD    1 
ATOM   5943  N  NE    . ARG B  1  60  ? 65.404  44.710 -33.911 1.00 37.76  ? 468  ARG D NE    1 
ATOM   5944  C  CZ    . ARG B  1  60  ? 66.506  45.290 -34.427 1.00 37.23  ? 468  ARG D CZ    1 
ATOM   5945  N  NH1   . ARG B  1  60  ? 67.672  44.860 -33.947 1.00 36.42  ? 468  ARG D NH1   1 
ATOM   5946  N  NH2   . ARG B  1  60  ? 66.476  46.253 -35.431 1.00 35.90  ? 468  ARG D NH2   1 
ATOM   5947  N  N     . LEU B  1  61  ? 60.359  48.948 -34.967 1.00 35.87  ? 469  LEU D N     1 
ATOM   5948  C  CA    . LEU B  1  61  ? 59.256  49.742 -35.492 1.00 36.06  ? 469  LEU D CA    1 
ATOM   5949  C  C     . LEU B  1  61  ? 58.023  48.898 -35.730 1.00 36.65  ? 469  LEU D C     1 
ATOM   5950  O  O     . LEU B  1  61  ? 56.884  49.374 -35.502 1.00 38.09  ? 469  LEU D O     1 
ATOM   5951  C  CB    . LEU B  1  61  ? 59.628  50.439 -36.785 1.00 33.94  ? 469  LEU D CB    1 
ATOM   5952  C  CG    . LEU B  1  61  ? 58.570  51.420 -37.276 1.00 33.98  ? 469  LEU D CG    1 
ATOM   5953  C  CD1   . LEU B  1  61  ? 58.222  52.485 -36.272 1.00 33.58  ? 469  LEU D CD1   1 
ATOM   5954  C  CD2   . LEU B  1  61  ? 58.904  52.138 -38.563 1.00 34.04  ? 469  LEU D CD2   1 
ATOM   5955  N  N     . ASP B  1  62  ? 58.191  47.651 -36.209 1.00 36.65  ? 470  ASP D N     1 
ATOM   5956  C  CA    . ASP B  1  62  ? 57.000  46.844 -36.493 1.00 37.61  ? 470  ASP D CA    1 
ATOM   5957  C  C     . ASP B  1  62  ? 56.229  46.500 -35.229 1.00 36.83  ? 470  ASP D C     1 
ATOM   5958  O  O     . ASP B  1  62  ? 55.003  46.371 -35.266 1.00 34.81  ? 470  ASP D O     1 
ATOM   5959  C  CB    . ASP B  1  62  ? 57.340  45.580 -37.219 1.00 37.30  ? 470  ASP D CB    1 
ATOM   5960  C  CG    . ASP B  1  62  ? 58.421  44.741 -36.522 1.00 42.33  ? 470  ASP D CG    1 
ATOM   5961  O  OD1   . ASP B  1  62  ? 59.118  45.276 -35.587 1.00 42.39  ? 470  ASP D OD1   1 
ATOM   5962  O  OD2   . ASP B  1  62  ? 58.530  43.547 -36.890 1.00 41.99  ? 470  ASP D OD2   1 
ATOM   5963  N  N     . ARG B  1  63  ? 56.922  46.348 -34.093 1.00 36.57  ? 471  ARG D N     1 
ATOM   5964  C  CA    . ARG B  1  63  ? 56.211  46.062 -32.835 1.00 37.59  ? 471  ARG D CA    1 
ATOM   5965  C  C     . ARG B  1  63  ? 55.490  47.275 -32.314 1.00 36.81  ? 471  ARG D C     1 
ATOM   5966  O  O     . ARG B  1  63  ? 54.406  47.160 -31.738 1.00 44.16  ? 471  ARG D O     1 
ATOM   5967  C  CB    . ARG B  1  63  ? 57.236  45.521 -31.809 1.00 37.52  ? 471  ARG D CB    1 
ATOM   5968  C  CG    . ARG B  1  63  ? 56.614  45.288 -30.420 1.00 41.58  ? 471  ARG D CG    1 
ATOM   5969  C  CD    . ARG B  1  63  ? 57.182  44.026 -29.773 1.00 45.46  ? 471  ARG D CD    1 
ATOM   5970  N  NE    . ARG B  1  63  ? 56.463  43.683 -28.560 1.00 46.20  ? 471  ARG D NE    1 
ATOM   5971  C  CZ    . ARG B  1  63  ? 56.971  43.765 -27.327 1.00 50.94  ? 471  ARG D CZ    1 
ATOM   5972  N  NH1   . ARG B  1  63  ? 58.194  44.266 -27.111 1.00 48.49  ? 471  ARG D NH1   1 
ATOM   5973  N  NH2   . ARG B  1  63  ? 56.215  43.413 -26.281 1.00 45.55  ? 471  ARG D NH2   1 
ATOM   5974  N  N     . ILE B  1  64  ? 56.077  48.461 -32.488 1.00 35.95  ? 472  ILE D N     1 
ATOM   5975  C  CA    . ILE B  1  64  ? 55.421  49.697 -32.028 1.00 38.34  ? 472  ILE D CA    1 
ATOM   5976  C  C     . ILE B  1  64  ? 54.134  49.936 -32.817 1.00 39.37  ? 472  ILE D C     1 
ATOM   5977  O  O     . ILE B  1  64  ? 53.064  50.109 -32.243 1.00 36.71  ? 472  ILE D O     1 
ATOM   5978  C  CB    . ILE B  1  64  ? 56.384  50.883 -32.140 1.00 38.96  ? 472  ILE D CB    1 
ATOM   5979  C  CG1   . ILE B  1  64  ? 57.623  50.630 -31.288 1.00 39.67  ? 472  ILE D CG1   1 
ATOM   5980  C  CG2   . ILE B  1  64  ? 55.702  52.182 -31.767 1.00 40.05  ? 472  ILE D CG2   1 
ATOM   5981  C  CD1   . ILE B  1  64  ? 58.743  51.627 -31.569 1.00 37.20  ? 472  ILE D CD1   1 
ATOM   5982  N  N     . LEU B  1  65  ? 54.253  49.958 -34.149 1.00 38.58  ? 473  LEU D N     1 
ATOM   5983  C  CA    . LEU B  1  65  ? 53.092  50.221 -34.986 1.00 40.81  ? 473  LEU D CA    1 
ATOM   5984  C  C     . LEU B  1  65  ? 51.987  49.171 -34.821 1.00 40.68  ? 473  LEU D C     1 
ATOM   5985  O  O     . LEU B  1  65  ? 50.837  49.459 -35.069 1.00 42.07  ? 473  LEU D O     1 
ATOM   5986  C  CB    . LEU B  1  65  ? 53.523  50.272 -36.470 1.00 41.87  ? 473  LEU D CB    1 
ATOM   5987  C  CG    . LEU B  1  65  ? 54.503  51.401 -36.774 1.00 42.45  ? 473  LEU D CG    1 
ATOM   5988  C  CD1   . LEU B  1  65  ? 54.789  51.374 -38.316 1.00 42.28  ? 473  LEU D CD1   1 
ATOM   5989  C  CD2   . LEU B  1  65  ? 53.737  52.644 -36.387 1.00 41.92  ? 473  LEU D CD2   1 
ATOM   5990  N  N     . ASN B  1  66  ? 52.366  47.984 -34.417 1.00 43.18  ? 474  ASN D N     1 
ATOM   5991  C  CA    . ASN B  1  66  ? 51.396  46.914 -34.204 1.00 43.74  ? 474  ASN D CA    1 
ATOM   5992  C  C     . ASN B  1  66  ? 50.750  46.935 -32.806 1.00 41.38  ? 474  ASN D C     1 
ATOM   5993  O  O     . ASN B  1  66  ? 49.792  46.234 -32.560 1.00 39.47  ? 474  ASN D O     1 
ATOM   5994  C  CB    . ASN B  1  66  ? 52.045  45.546 -34.447 1.00 50.23  ? 474  ASN D CB    1 
ATOM   5995  C  CG    . ASN B  1  66  ? 51.083  44.548 -35.022 1.00 58.18  ? 474  ASN D CG    1 
ATOM   5996  O  OD1   . ASN B  1  66  ? 50.196  44.099 -34.346 1.00 63.64  ? 474  ASN D OD1   1 
ATOM   5997  N  ND2   . ASN B  1  66  ? 51.295  44.177 -36.297 1.00 64.18  ? 474  ASN D ND2   1 
ATOM   5998  N  N     . ASN B  1  67  ? 51.296  47.744 -31.905 1.00 39.13  ? 475  ASN D N     1 
ATOM   5999  C  CA    . ASN B  1  67  ? 50.794  47.813 -30.545 1.00 40.02  ? 475  ASN D CA    1 
ATOM   6000  C  C     . ASN B  1  67  ? 49.387  48.426 -30.481 1.00 40.87  ? 475  ASN D C     1 
ATOM   6001  O  O     . ASN B  1  67  ? 49.181  49.582 -30.859 1.00 39.41  ? 475  ASN D O     1 
ATOM   6002  C  CB    . ASN B  1  67  ? 51.735  48.633 -29.661 1.00 35.59  ? 475  ASN D CB    1 
ATOM   6003  C  CG    . ASN B  1  67  ? 51.356  48.602 -28.193 1.00 36.48  ? 475  ASN D CG    1 
ATOM   6004  O  OD1   . ASN B  1  67  ? 50.880  49.587 -27.655 1.00 34.46  ? 475  ASN D OD1   1 
ATOM   6005  N  ND2   . ASN B  1  67  ? 51.576  47.459 -27.523 1.00 32.38  ? 475  ASN D ND2   1 
ATOM   6006  N  N     A ASN B  1  68  ? 48.425  47.774 -29.835 0.50 40.13  ? 476  ASN D N     1 
ATOM   6007  N  N     B ASN B  1  68  ? 48.450  47.784 -29.812 0.50 41.79  ? 476  ASN D N     1 
ATOM   6008  C  CA    A ASN B  1  68  ? 47.063  48.380 -29.849 0.50 41.76  ? 476  ASN D CA    1 
ATOM   6009  C  CA    B ASN B  1  68  ? 47.081  48.380 -29.860 0.50 44.95  ? 476  ASN D CA    1 
ATOM   6010  C  C     A ASN B  1  68  ? 46.976  49.758 -29.161 0.50 39.22  ? 476  ASN D C     1 
ATOM   6011  C  C     B ASN B  1  68  ? 46.950  49.736 -29.129 0.50 43.61  ? 476  ASN D C     1 
ATOM   6012  O  O     A ASN B  1  68  ? 46.283  50.669 -29.610 0.50 43.10  ? 476  ASN D O     1 
ATOM   6013  O  O     B ASN B  1  68  ? 46.182  50.600 -29.534 0.50 48.70  ? 476  ASN D O     1 
ATOM   6014  C  CB    A ASN B  1  68  ? 46.084  47.450 -29.193 0.50 43.14  ? 476  ASN D CB    1 
ATOM   6015  C  CB    B ASN B  1  68  ? 46.072  47.352 -29.373 0.50 46.17  ? 476  ASN D CB    1 
ATOM   6016  C  CG    A ASN B  1  68  ? 46.027  46.070 -29.843 0.50 45.63  ? 476  ASN D CG    1 
ATOM   6017  C  CG    B ASN B  1  68  ? 44.619  47.860 -29.302 0.50 48.57  ? 476  ASN D CG    1 
ATOM   6018  O  OD1   A ASN B  1  68  ? 46.099  45.953 -31.074 0.50 48.25  ? 476  ASN D OD1   1 
ATOM   6019  O  OD1   B ASN B  1  68  ? 43.788  47.240 -28.672 0.50 52.59  ? 476  ASN D OD1   1 
ATOM   6020  N  ND2   A ASN B  1  68  ? 45.917  45.010 -29.008 0.50 48.27  ? 476  ASN D ND2   1 
ATOM   6021  N  ND2   B ASN B  1  68  ? 44.315  48.929 -29.938 0.50 48.15  ? 476  ASN D ND2   1 
ATOM   6022  N  N     A GLU B  1  69  ? 47.681  49.899 -28.051 0.50 37.10  ? 477  GLU D N     1 
ATOM   6023  N  N     B GLU B  1  69  ? 47.697  49.895 -28.055 0.50 42.86  ? 477  GLU D N     1 
ATOM   6024  C  CA    A GLU B  1  69  ? 47.577  51.111 -27.292 0.50 34.97  ? 477  GLU D CA    1 
ATOM   6025  C  CA    B GLU B  1  69  ? 47.618  51.094 -27.239 0.50 40.78  ? 477  GLU D CA    1 
ATOM   6026  C  C     A GLU B  1  69  ? 48.287  52.280 -27.949 0.50 35.68  ? 477  GLU D C     1 
ATOM   6027  C  C     B GLU B  1  69  ? 48.301  52.270 -27.917 0.50 39.31  ? 477  GLU D C     1 
ATOM   6028  O  O     A GLU B  1  69  ? 47.807  53.411 -27.930 0.50 33.25  ? 477  GLU D O     1 
ATOM   6029  O  O     B GLU B  1  69  ? 47.822  53.400 -27.863 0.50 36.31  ? 477  GLU D O     1 
ATOM   6030  C  CB    A GLU B  1  69  ? 48.105  50.934 -25.901 0.50 33.36  ? 477  GLU D CB    1 
ATOM   6031  C  CB    B GLU B  1  69  ? 48.248  50.894 -25.851 0.50 43.20  ? 477  GLU D CB    1 
ATOM   6032  C  CG    A GLU B  1  69  ? 47.013  50.426 -24.999 0.50 31.74  ? 477  GLU D CG    1 
ATOM   6033  C  CG    B GLU B  1  69  ? 47.558  49.911 -24.899 0.50 46.34  ? 477  GLU D CG    1 
ATOM   6034  C  CD    A GLU B  1  69  ? 47.477  50.184 -23.610 0.50 30.35  ? 477  GLU D CD    1 
ATOM   6035  C  CD    B GLU B  1  69  ? 47.527  48.496 -25.433 0.50 47.26  ? 477  GLU D CD    1 
ATOM   6036  O  OE1   A GLU B  1  69  ? 48.741  50.090 -23.333 0.50 30.75  ? 477  GLU D OE1   1 
ATOM   6037  O  OE1   B GLU B  1  69  ? 48.617  47.958 -25.805 0.50 48.26  ? 477  GLU D OE1   1 
ATOM   6038  O  OE2   A GLU B  1  69  ? 46.534  50.249 -22.821 0.50 28.23  ? 477  GLU D OE2   1 
ATOM   6039  O  OE2   B GLU B  1  69  ? 46.399  47.947 -25.562 0.50 49.38  ? 477  GLU D OE2   1 
ATOM   6040  N  N     . ILE B  1  70  ? 49.417  52.121 -28.487 1.00 35.32  ? 478  ILE D N     1 
ATOM   6041  C  CA    . ILE B  1  70  ? 50.078  53.080 -29.306 1.00 35.24  ? 478  ILE D CA    1 
ATOM   6042  C  C     . ILE B  1  70  ? 49.178  53.554 -30.464 1.00 35.57  ? 478  ILE D C     1 
ATOM   6043  O  O     . ILE B  1  70  ? 49.075  54.741 -30.718 1.00 37.56  ? 478  ILE D O     1 
ATOM   6044  C  CB    . ILE B  1  70  ? 51.359  52.469 -29.880 1.00 35.64  ? 478  ILE D CB    1 
ATOM   6045  C  CG1   . ILE B  1  70  ? 52.308  52.018 -28.773 1.00 39.10  ? 478  ILE D CG1   1 
ATOM   6046  C  CG2   . ILE B  1  70  ? 52.082  53.492 -30.818 1.00 37.44  ? 478  ILE D CG2   1 
ATOM   6047  C  CD1   . ILE B  1  70  ? 52.884  53.141 -27.907 1.00 40.02  ? 478  ILE D CD1   1 
ATOM   6048  N  N     A ARG B  1  71  ? 48.553  52.613 -31.157 0.50 37.88  ? 479  ARG D N     1 
ATOM   6049  N  N     B ARG B  1  71  ? 48.554  52.623 -31.166 0.50 37.83  ? 479  ARG D N     1 
ATOM   6050  C  CA    A ARG B  1  71  ? 47.648  52.922 -32.234 0.50 41.99  ? 479  ARG D CA    1 
ATOM   6051  C  CA    B ARG B  1  71  ? 47.651  52.939 -32.250 0.50 41.95  ? 479  ARG D CA    1 
ATOM   6052  C  C     A ARG B  1  71  ? 46.472  53.793 -31.813 0.50 42.66  ? 479  ARG D C     1 
ATOM   6053  C  C     B ARG B  1  71  ? 46.455  53.792 -31.823 0.50 42.59  ? 479  ARG D C     1 
ATOM   6054  O  O     A ARG B  1  71  ? 46.100  54.736 -32.503 0.50 42.32  ? 479  ARG D O     1 
ATOM   6055  O  O     B ARG B  1  71  ? 46.085  54.748 -32.497 0.50 42.15  ? 479  ARG D O     1 
ATOM   6056  C  CB    A ARG B  1  71  ? 47.082  51.650 -32.847 0.50 44.72  ? 479  ARG D CB    1 
ATOM   6057  C  CB    B ARG B  1  71  ? 47.160  51.661 -32.925 0.50 44.74  ? 479  ARG D CB    1 
ATOM   6058  C  CG    A ARG B  1  71  ? 48.098  50.771 -33.567 0.50 50.89  ? 479  ARG D CG    1 
ATOM   6059  C  CG    B ARG B  1  71  ? 48.308  50.850 -33.534 0.50 50.40  ? 479  ARG D CG    1 
ATOM   6060  C  CD    A ARG B  1  71  ? 47.350  49.566 -34.135 0.50 52.72  ? 479  ARG D CD    1 
ATOM   6061  C  CD    B ARG B  1  71  ? 47.996  49.358 -33.635 0.50 52.44  ? 479  ARG D CD    1 
ATOM   6062  N  NE    A ARG B  1  71  ? 48.176  48.753 -35.022 0.50 53.40  ? 479  ARG D NE    1 
ATOM   6063  N  NE    B ARG B  1  71  ? 47.506  49.086 -34.988 0.50 54.01  ? 479  ARG D NE    1 
ATOM   6064  C  CZ    A ARG B  1  71  ? 47.693  47.818 -35.833 0.50 54.86  ? 479  ARG D CZ    1 
ATOM   6065  C  CZ    B ARG B  1  71  ? 46.232  48.898 -35.332 0.50 53.98  ? 479  ARG D CZ    1 
ATOM   6066  N  NH1   A ARG B  1  71  ? 46.386  47.563 -35.844 0.50 54.50  ? 479  ARG D NH1   1 
ATOM   6067  N  NH1   B ARG B  1  71  ? 45.919  48.678 -36.615 0.50 56.08  ? 479  ARG D NH1   1 
ATOM   6068  N  NH2   A ARG B  1  71  ? 48.503  47.145 -36.621 0.50 55.15  ? 479  ARG D NH2   1 
ATOM   6069  N  NH2   B ARG B  1  71  ? 45.280  48.927 -34.421 0.50 53.74  ? 479  ARG D NH2   1 
ATOM   6070  N  N     . GLN B  1  72  ? 45.899  53.469 -30.673 1.00 43.38  ? 480  GLN D N     1 
ATOM   6071  C  CA    . GLN B  1  72  ? 44.754  54.221 -30.170 1.00 42.81  ? 480  GLN D CA    1 
ATOM   6072  C  C     . GLN B  1  72  ? 45.160  55.657 -29.898 1.00 39.07  ? 480  GLN D C     1 
ATOM   6073  O  O     . GLN B  1  72  ? 44.421  56.575 -30.217 1.00 39.65  ? 480  GLN D O     1 
ATOM   6074  C  CB    . GLN B  1  72  ? 44.201  53.581 -28.889 1.00 45.58  ? 480  GLN D CB    1 
ATOM   6075  C  CG    . GLN B  1  72  ? 43.715  52.166 -29.041 1.00 54.77  ? 480  GLN D CG    1 
ATOM   6076  C  CD    . GLN B  1  72  ? 42.949  51.671 -27.849 1.00 59.60  ? 480  GLN D CD    1 
ATOM   6077  O  OE1   . GLN B  1  72  ? 43.431  50.843 -27.086 1.00 61.05  ? 480  GLN D OE1   1 
ATOM   6078  N  NE2   . GLN B  1  72  ? 41.678  52.162 -27.689 1.00 66.61  ? 480  GLN D NE2   1 
ATOM   6079  N  N     . MET B  1  73  ? 46.337  55.839 -29.304 1.00 37.07  ? 481  MET D N     1 
ATOM   6080  C  CA    . MET B  1  73  ? 46.825  57.178 -29.015 1.00 36.47  ? 481  MET D CA    1 
ATOM   6081  C  C     . MET B  1  73  ? 47.070  57.957 -30.291 1.00 37.58  ? 481  MET D C     1 
ATOM   6082  O  O     . MET B  1  73  ? 46.756  59.133 -30.379 1.00 37.39  ? 481  MET D O     1 
ATOM   6083  C  CB    . MET B  1  73  ? 48.117  57.118 -28.187 1.00 37.88  ? 481  MET D CB    1 
ATOM   6084  C  CG    . MET B  1  73  ? 47.897  56.709 -26.730 1.00 36.97  ? 481  MET D CG    1 
ATOM   6085  S  SD    . MET B  1  73  ? 49.355  57.012 -25.738 1.00 36.85  ? 481  MET D SD    1 
ATOM   6086  C  CE    . MET B  1  73  ? 50.464  55.734 -26.398 1.00 39.39  ? 481  MET D CE    1 
ATOM   6087  N  N     . ILE B  1  74  ? 47.643  57.285 -31.285 1.00 38.51  ? 482  ILE D N     1 
ATOM   6088  C  CA    . ILE B  1  74  ? 47.925  57.921 -32.571 1.00 39.13  ? 482  ILE D CA    1 
ATOM   6089  C  C     . ILE B  1  74  ? 46.630  58.337 -33.242 1.00 39.91  ? 482  ILE D C     1 
ATOM   6090  O  O     . ILE B  1  74  ? 46.545  59.422 -33.824 1.00 38.76  ? 482  ILE D O     1 
ATOM   6091  C  CB    . ILE B  1  74  ? 48.741  57.021 -33.485 1.00 37.18  ? 482  ILE D CB    1 
ATOM   6092  C  CG1   . ILE B  1  74  ? 50.135  56.768 -32.869 1.00 37.30  ? 482  ILE D CG1   1 
ATOM   6093  C  CG2   . ILE B  1  74  ? 48.884  57.623 -34.878 1.00 41.69  ? 482  ILE D CG2   1 
ATOM   6094  C  CD1   . ILE B  1  74  ? 50.998  55.828 -33.700 1.00 36.91  ? 482  ILE D CD1   1 
ATOM   6095  N  N     . THR B  1  75  ? 45.623  57.476 -33.165 1.00 40.90  ? 483  THR D N     1 
ATOM   6096  C  CA    . THR B  1  75  ? 44.337  57.758 -33.783 1.00 43.21  ? 483  THR D CA    1 
ATOM   6097  C  C     . THR B  1  75  ? 43.608  58.864 -33.025 1.00 43.98  ? 483  THR D C     1 
ATOM   6098  O  O     . THR B  1  75  ? 42.975  59.713 -33.628 1.00 46.02  ? 483  THR D O     1 
ATOM   6099  C  CB    . THR B  1  75  ? 43.441  56.514 -33.831 1.00 44.02  ? 483  THR D CB    1 
ATOM   6100  O  OG1   . THR B  1  75  ? 44.058  55.535 -34.688 1.00 49.79  ? 483  THR D OG1   1 
ATOM   6101  C  CG2   . THR B  1  75  ? 42.098  56.886 -34.420 1.00 44.97  ? 483  THR D CG2   1 
ATOM   6102  N  N     . ALA B  1  76  ? 43.694  58.845 -31.702 1.00 41.85  ? 484  ALA D N     1 
ATOM   6103  C  CA    . ALA B  1  76  ? 43.027  59.848 -30.890 1.00 41.94  ? 484  ALA D CA    1 
ATOM   6104  C  C     . ALA B  1  76  ? 43.595  61.241 -31.147 1.00 42.36  ? 484  ALA D C     1 
ATOM   6105  O  O     . ALA B  1  76  ? 42.836  62.223 -31.208 1.00 43.21  ? 484  ALA D O     1 
ATOM   6106  C  CB    . ALA B  1  76  ? 43.150  59.507 -29.408 1.00 39.11  ? 484  ALA D CB    1 
ATOM   6107  N  N     . PHE B  1  77  ? 44.920  61.338 -31.315 1.00 41.11  ? 485  PHE D N     1 
ATOM   6108  C  CA    . PHE B  1  77  ? 45.547  62.642 -31.476 1.00 43.71  ? 485  PHE D CA    1 
ATOM   6109  C  C     . PHE B  1  77  ? 45.321  63.205 -32.899 1.00 44.47  ? 485  PHE D C     1 
ATOM   6110  O  O     . PHE B  1  77  ? 45.070  64.399 -33.051 1.00 46.32  ? 485  PHE D O     1 
ATOM   6111  C  CB    . PHE B  1  77  ? 47.037  62.561 -31.172 1.00 43.92  ? 485  PHE D CB    1 
ATOM   6112  C  CG    . PHE B  1  77  ? 47.368  62.133 -29.784 1.00 46.54  ? 485  PHE D CG    1 
ATOM   6113  C  CD1   . PHE B  1  77  ? 46.449  62.274 -28.753 1.00 45.00  ? 485  PHE D CD1   1 
ATOM   6114  C  CD2   . PHE B  1  77  ? 48.603  61.596 -29.469 1.00 49.11  ? 485  PHE D CD2   1 
ATOM   6115  C  CE1   . PHE B  1  77  ? 46.751  61.879 -27.450 1.00 46.68  ? 485  PHE D CE1   1 
ATOM   6116  C  CE2   . PHE B  1  77  ? 48.901  61.213 -28.178 1.00 49.71  ? 485  PHE D CE2   1 
ATOM   6117  C  CZ    . PHE B  1  77  ? 47.964  61.351 -27.162 1.00 47.84  ? 485  PHE D CZ    1 
ATOM   6118  N  N     . GLY B  1  78  ? 45.422  62.364 -33.905 1.00 45.41  ? 486  GLY D N     1 
ATOM   6119  C  CA    . GLY B  1  78  ? 45.193  62.779 -35.283 1.00 46.98  ? 486  GLY D CA    1 
ATOM   6120  C  C     . GLY B  1  78  ? 46.376  63.431 -35.978 1.00 49.59  ? 486  GLY D C     1 
ATOM   6121  O  O     . GLY B  1  78  ? 46.240  63.891 -37.111 1.00 46.88  ? 486  GLY D O     1 
ATOM   6122  N  N     . THR B  1  79  ? 47.537  63.479 -35.326 1.00 48.56  ? 487  THR D N     1 
ATOM   6123  C  CA    . THR B  1  79  ? 48.683  64.187 -35.858 1.00 51.27  ? 487  THR D CA    1 
ATOM   6124  C  C     . THR B  1  79  ? 49.532  63.345 -36.819 1.00 51.96  ? 487  THR D C     1 
ATOM   6125  O  O     . THR B  1  79  ? 50.231  63.901 -37.658 1.00 56.53  ? 487  THR D O     1 
ATOM   6126  C  CB    . THR B  1  79  ? 49.571  64.695 -34.726 1.00 50.77  ? 487  THR D CB    1 
ATOM   6127  O  OG1   . THR B  1  79  ? 49.858  63.600 -33.830 1.00 48.94  ? 487  THR D OG1   1 
ATOM   6128  C  CG2   . THR B  1  79  ? 48.907  65.804 -33.975 1.00 49.67  ? 487  THR D CG2   1 
ATOM   6129  N  N     . GLY B  1  80  ? 49.489  62.031 -36.696 1.00 55.28  ? 488  GLY D N     1 
ATOM   6130  C  CA    . GLY B  1  80  ? 50.438  61.159 -37.347 1.00 54.00  ? 488  GLY D CA    1 
ATOM   6131  C  C     . GLY B  1  80  ? 51.718  61.047 -36.542 1.00 51.89  ? 488  GLY D C     1 
ATOM   6132  O  O     . GLY B  1  80  ? 51.828  61.556 -35.423 1.00 48.76  ? 488  GLY D O     1 
ATOM   6133  N  N     . ILE B  1  81  ? 52.698  60.367 -37.119 1.00 51.81  ? 489  ILE D N     1 
ATOM   6134  C  CA    . ILE B  1  81  ? 54.008  60.195 -36.504 1.00 54.52  ? 489  ILE D CA    1 
ATOM   6135  C  C     . ILE B  1  81  ? 55.073  60.421 -37.579 1.00 60.53  ? 489  ILE D C     1 
ATOM   6136  O  O     . ILE B  1  81  ? 54.861  60.064 -38.735 1.00 66.30  ? 489  ILE D O     1 
ATOM   6137  C  CB    . ILE B  1  81  ? 54.182  58.801 -35.854 1.00 53.36  ? 489  ILE D CB    1 
ATOM   6138  C  CG1   . ILE B  1  81  ? 53.917  57.711 -36.886 1.00 56.14  ? 489  ILE D CG1   1 
ATOM   6139  C  CG2   . ILE B  1  81  ? 53.263  58.661 -34.679 1.00 53.92  ? 489  ILE D CG2   1 
ATOM   6140  C  CD1   . ILE B  1  81  ? 53.945  56.321 -36.328 1.00 52.83  ? 489  ILE D CD1   1 
ATOM   6141  N  N     . GLY B  1  82  ? 56.195  61.010 -37.199 1.00 65.50  ? 490  GLY D N     1 
ATOM   6142  C  CA    . GLY B  1  82  ? 57.251  61.296 -38.159 1.00 72.00  ? 490  GLY D CA    1 
ATOM   6143  C  C     . GLY B  1  82  ? 57.728  62.735 -38.093 1.00 75.89  ? 490  GLY D C     1 
ATOM   6144  O  O     . GLY B  1  82  ? 57.682  63.379 -37.059 1.00 72.74  ? 490  GLY D O     1 
ATOM   6145  N  N     . GLY B  1  83  ? 58.168  63.242 -39.240 1.00 87.29  ? 491  GLY D N     1 
ATOM   6146  C  CA    . GLY B  1  83  ? 58.089  62.510 -40.503 1.00 84.79  ? 491  GLY D CA    1 
ATOM   6147  C  C     . GLY B  1  83  ? 56.819  62.860 -41.247 1.00 84.22  ? 491  GLY D C     1 
ATOM   6148  O  O     . GLY B  1  83  ? 56.689  63.946 -41.814 1.00 85.56  ? 491  GLY D O     1 
ATOM   6149  N  N     . ASP B  1  84  ? 55.881  61.917 -41.251 1.00 82.76  ? 492  ASP D N     1 
ATOM   6150  C  CA    . ASP B  1  84  ? 54.527  62.142 -41.776 1.00 79.09  ? 492  ASP D CA    1 
ATOM   6151  C  C     . ASP B  1  84  ? 53.611  62.724 -40.701 1.00 77.91  ? 492  ASP D C     1 
ATOM   6152  O  O     . ASP B  1  84  ? 52.440  62.369 -40.618 1.00 78.28  ? 492  ASP D O     1 
ATOM   6153  C  CB    . ASP B  1  84  ? 53.969  60.843 -42.327 1.00 77.92  ? 492  ASP D CB    1 
ATOM   6154  N  N     . PHE B  1  85  ? 54.149  63.631 -39.887 1.00 71.67  ? 493  PHE D N     1 
ATOM   6155  C  CA    . PHE B  1  85  ? 53.470  64.175 -38.727 1.00 67.75  ? 493  PHE D CA    1 
ATOM   6156  C  C     . PHE B  1  85  ? 53.099  65.638 -38.983 1.00 68.12  ? 493  PHE D C     1 
ATOM   6157  O  O     . PHE B  1  85  ? 53.851  66.364 -39.627 1.00 68.08  ? 493  PHE D O     1 
ATOM   6158  C  CB    . PHE B  1  85  ? 54.391  64.041 -37.501 1.00 64.25  ? 493  PHE D CB    1 
ATOM   6159  C  CG    . PHE B  1  85  ? 53.951  64.805 -36.275 1.00 63.17  ? 493  PHE D CG    1 
ATOM   6160  C  CD1   . PHE B  1  85  ? 54.279  66.157 -36.118 1.00 65.41  ? 493  PHE D CD1   1 
ATOM   6161  C  CD2   . PHE B  1  85  ? 53.260  64.173 -35.254 1.00 61.99  ? 493  PHE D CD2   1 
ATOM   6162  C  CE1   . PHE B  1  85  ? 53.894  66.858 -35.004 1.00 63.41  ? 493  PHE D CE1   1 
ATOM   6163  C  CE2   . PHE B  1  85  ? 52.876  64.870 -34.121 1.00 59.96  ? 493  PHE D CE2   1 
ATOM   6164  C  CZ    . PHE B  1  85  ? 53.182  66.211 -33.992 1.00 65.37  ? 493  PHE D CZ    1 
ATOM   6165  N  N     . ASP B  1  86  ? 51.947  66.061 -38.475 1.00 63.85  ? 494  ASP D N     1 
ATOM   6166  C  CA    . ASP B  1  86  ? 51.464  67.421 -38.689 1.00 61.51  ? 494  ASP D CA    1 
ATOM   6167  C  C     . ASP B  1  86  ? 50.751  67.915 -37.425 1.00 55.66  ? 494  ASP D C     1 
ATOM   6168  O  O     . ASP B  1  86  ? 49.725  67.363 -37.033 1.00 49.80  ? 494  ASP D O     1 
ATOM   6169  C  CB    . ASP B  1  86  ? 50.504  67.461 -39.883 1.00 64.09  ? 494  ASP D CB    1 
ATOM   6170  C  CG    . ASP B  1  86  ? 50.015  68.890 -40.183 1.00 70.71  ? 494  ASP D CG    1 
ATOM   6171  O  OD1   . ASP B  1  86  ? 50.631  69.857 -39.683 1.00 77.20  ? 494  ASP D OD1   1 
ATOM   6172  O  OD2   . ASP B  1  86  ? 49.033  69.029 -40.918 1.00 71.35  ? 494  ASP D OD2   1 
ATOM   6173  N  N     . LEU B  1  87  ? 51.283  68.966 -36.824 1.00 53.58  ? 495  LEU D N     1 
ATOM   6174  C  CA    . LEU B  1  87  ? 50.739  69.519 -35.607 1.00 52.20  ? 495  LEU D CA    1 
ATOM   6175  C  C     . LEU B  1  87  ? 49.354  70.135 -35.834 1.00 54.19  ? 495  LEU D C     1 
ATOM   6176  O  O     . LEU B  1  87  ? 48.491  70.078 -34.937 1.00 50.08  ? 495  LEU D O     1 
ATOM   6177  C  CB    . LEU B  1  87  ? 51.687  70.587 -35.023 1.00 52.09  ? 495  LEU D CB    1 
ATOM   6178  C  CG    . LEU B  1  87  ? 51.314  71.048 -33.582 1.00 55.78  ? 495  LEU D CG    1 
ATOM   6179  C  CD1   . LEU B  1  87  ? 51.862  70.054 -32.537 1.00 53.37  ? 495  LEU D CD1   1 
ATOM   6180  C  CD2   . LEU B  1  87  ? 51.788  72.471 -33.342 1.00 55.23  ? 495  LEU D CD2   1 
ATOM   6181  N  N     . ALA B  1  88  ? 49.131  70.714 -37.007 1.00 55.15  ? 496  ALA D N     1 
ATOM   6182  C  CA    . ALA B  1  88  ? 47.867  71.386 -37.272 1.00 54.22  ? 496  ALA D CA    1 
ATOM   6183  C  C     . ALA B  1  88  ? 46.687  70.442 -37.291 1.00 53.09  ? 496  ALA D C     1 
ATOM   6184  O  O     . ALA B  1  88  ? 45.543  70.894 -37.218 1.00 54.13  ? 496  ALA D O     1 
ATOM   6185  C  CB    . ALA B  1  88  ? 47.932  72.139 -38.622 1.00 54.61  ? 496  ALA D CB    1 
ATOM   6186  N  N     . LYS B  1  89  ? 46.939  69.131 -37.387 1.00 56.42  ? 497  LYS D N     1 
ATOM   6187  C  CA    . LYS B  1  89  ? 45.881  68.128 -37.366 1.00 54.79  ? 497  LYS D CA    1 
ATOM   6188  C  C     . LYS B  1  89  ? 45.607  67.597 -35.978 1.00 53.66  ? 497  LYS D C     1 
ATOM   6189  O  O     . LYS B  1  89  ? 44.854  66.616 -35.842 1.00 51.85  ? 497  LYS D O     1 
ATOM   6190  C  CB    . LYS B  1  89  ? 46.219  66.991 -38.329 1.00 58.08  ? 497  LYS D CB    1 
ATOM   6191  C  CG    . LYS B  1  89  ? 46.159  67.398 -39.820 1.00 65.96  ? 497  LYS D CG    1 
ATOM   6192  C  CD    . LYS B  1  89  ? 45.306  66.421 -40.696 1.00 68.56  ? 497  LYS D CD    1 
ATOM   6193  C  CE    . LYS B  1  89  ? 46.150  65.296 -41.288 1.00 70.60  ? 497  LYS D CE    1 
ATOM   6194  N  NZ    . LYS B  1  89  ? 47.001  65.861 -42.389 1.00 75.99  ? 497  LYS D NZ    1 
ATOM   6195  N  N     . ALA B  1  90  ? 46.183  68.214 -34.937 1.00 49.56  ? 498  ALA D N     1 
ATOM   6196  C  CA    . ALA B  1  90  ? 45.980  67.752 -33.557 1.00 48.10  ? 498  ALA D CA    1 
ATOM   6197  C  C     . ALA B  1  90  ? 44.540  67.968 -33.145 1.00 47.60  ? 498  ALA D C     1 
ATOM   6198  O  O     . ALA B  1  90  ? 43.970  69.068 -33.343 1.00 44.35  ? 498  ALA D O     1 
ATOM   6199  C  CB    . ALA B  1  90  ? 46.919  68.463 -32.610 1.00 46.02  ? 498  ALA D CB    1 
ATOM   6200  N  N     . ARG B  1  91  ? 43.956  66.925 -32.558 1.00 45.52  ? 499  ARG D N     1 
ATOM   6201  C  CA    . ARG B  1  91  ? 42.562  66.954 -32.126 1.00 47.12  ? 499  ARG D CA    1 
ATOM   6202  C  C     . ARG B  1  91  ? 42.369  67.476 -30.724 1.00 43.81  ? 499  ARG D C     1 
ATOM   6203  O  O     . ARG B  1  91  ? 41.267  67.708 -30.328 1.00 44.98  ? 499  ARG D O     1 
ATOM   6204  C  CB    . ARG B  1  91  ? 41.914  65.605 -32.315 1.00 47.34  ? 499  ARG D CB    1 
ATOM   6205  C  CG    . ARG B  1  91  ? 41.892  65.185 -33.750 1.00 47.94  ? 499  ARG D CG    1 
ATOM   6206  C  CD    . ARG B  1  91  ? 41.320  63.810 -33.953 1.00 50.42  ? 499  ARG D CD    1 
ATOM   6207  N  NE    . ARG B  1  91  ? 39.908  63.753 -33.654 1.00 52.98  ? 499  ARG D NE    1 
ATOM   6208  C  CZ    . ARG B  1  91  ? 39.405  63.349 -32.496 1.00 52.33  ? 499  ARG D CZ    1 
ATOM   6209  N  NH1   . ARG B  1  91  ? 40.220  62.919 -31.530 1.00 50.52  ? 499  ARG D NH1   1 
ATOM   6210  N  NH2   . ARG B  1  91  ? 38.095  63.344 -32.308 1.00 48.54  ? 499  ARG D NH2   1 
ATOM   6211  N  N     . TYR B  1  92  ? 43.453  67.642 -29.991 1.00 40.71  ? 500  TYR D N     1 
ATOM   6212  C  CA    . TYR B  1  92  ? 43.433  68.212 -28.659 1.00 41.19  ? 500  TYR D CA    1 
ATOM   6213  C  C     . TYR B  1  92  ? 44.677  69.057 -28.497 1.00 40.45  ? 500  TYR D C     1 
ATOM   6214  O  O     . TYR B  1  92  ? 45.764  68.633 -28.857 1.00 43.42  ? 500  TYR D O     1 
ATOM   6215  C  CB    . TYR B  1  92  ? 43.420  67.107 -27.560 1.00 39.08  ? 500  TYR D CB    1 
ATOM   6216  C  CG    . TYR B  1  92  ? 42.437  65.988 -27.788 1.00 40.88  ? 500  TYR D CG    1 
ATOM   6217  C  CD1   . TYR B  1  92  ? 42.774  64.882 -28.542 1.00 40.14  ? 500  TYR D CD1   1 
ATOM   6218  C  CD2   . TYR B  1  92  ? 41.153  66.037 -27.237 1.00 38.19  ? 500  TYR D CD2   1 
ATOM   6219  C  CE1   . TYR B  1  92  ? 41.866  63.847 -28.762 1.00 39.88  ? 500  TYR D CE1   1 
ATOM   6220  C  CE2   . TYR B  1  92  ? 40.234  65.018 -27.454 1.00 38.48  ? 500  TYR D CE2   1 
ATOM   6221  C  CZ    . TYR B  1  92  ? 40.607  63.925 -28.222 1.00 39.43  ? 500  TYR D CZ    1 
ATOM   6222  O  OH    . TYR B  1  92  ? 39.717  62.902 -28.443 1.00 41.32  ? 500  TYR D OH    1 
ATOM   6223  N  N     . HIS B  1  93  ? 44.524  70.247 -27.940 1.00 40.74  ? 501  HIS D N     1 
ATOM   6224  C  CA    . HIS B  1  93  ? 45.670  71.095 -27.627 1.00 40.88  ? 501  HIS D CA    1 
ATOM   6225  C  C     . HIS B  1  93  ? 46.187  70.877 -26.222 1.00 41.16  ? 501  HIS D C     1 
ATOM   6226  O  O     . HIS B  1  93  ? 47.152  71.525 -25.817 1.00 40.04  ? 501  HIS D O     1 
ATOM   6227  C  CB    . HIS B  1  93  ? 45.341  72.571 -27.867 1.00 44.17  ? 501  HIS D CB    1 
ATOM   6228  C  CG    . HIS B  1  93  ? 45.264  72.946 -29.312 1.00 46.84  ? 501  HIS D CG    1 
ATOM   6229  N  ND1   . HIS B  1  93  ? 45.351  74.261 -29.753 1.00 51.43  ? 501  HIS D ND1   1 
ATOM   6230  C  CD2   . HIS B  1  93  ? 45.115  72.186 -30.423 1.00 46.63  ? 501  HIS D CD2   1 
ATOM   6231  C  CE1   . HIS B  1  93  ? 45.258  74.289 -31.071 1.00 50.26  ? 501  HIS D CE1   1 
ATOM   6232  N  NE2   . HIS B  1  93  ? 45.115  73.047 -31.510 1.00 52.46  ? 501  HIS D NE2   1 
ATOM   6233  N  N     . LYS B  1  94  ? 45.587  69.940 -25.476 1.00 44.13  ? 502  LYS D N     1 
ATOM   6234  C  CA    . LYS B  1  94  ? 46.116  69.496 -24.186 1.00 42.22  ? 502  LYS D CA    1 
ATOM   6235  C  C     . LYS B  1  94  ? 46.063  67.973 -24.158 1.00 39.48  ? 502  LYS D C     1 
ATOM   6236  O  O     . LYS B  1  94  ? 44.981  67.376 -24.219 1.00 38.87  ? 502  LYS D O     1 
ATOM   6237  C  CB    . LYS B  1  94  ? 45.318  70.092 -23.020 1.00 43.55  ? 502  LYS D CB    1 
ATOM   6238  C  CG    . LYS B  1  94  ? 45.617  71.556 -22.750 1.00 45.05  ? 502  LYS D CG    1 
ATOM   6239  C  CD    . LYS B  1  94  ? 45.526  71.894 -21.282 1.00 45.14  ? 502  LYS D CD    1 
ATOM   6240  C  CE    . LYS B  1  94  ? 45.968  73.303 -20.986 1.00 45.32  ? 502  LYS D CE    1 
ATOM   6241  N  NZ    . LYS B  1  94  ? 45.093  74.380 -21.515 1.00 44.95  ? 502  LYS D NZ    1 
ATOM   6242  N  N     . ILE B  1  95  ? 47.232  67.350 -24.063 1.00 38.11  ? 503  ILE D N     1 
ATOM   6243  C  CA    . ILE B  1  95  ? 47.348  65.919 -23.813 1.00 38.34  ? 503  ILE D CA    1 
ATOM   6244  C  C     . ILE B  1  95  ? 47.903  65.788 -22.385 1.00 36.20  ? 503  ILE D C     1 
ATOM   6245  O  O     . ILE B  1  95  ? 49.040  66.188 -22.117 1.00 36.61  ? 503  ILE D O     1 
ATOM   6246  C  CB    . ILE B  1  95  ? 48.275  65.222 -24.830 1.00 39.30  ? 503  ILE D CB    1 
ATOM   6247  C  CG1   . ILE B  1  95  ? 47.635  65.148 -26.192 1.00 40.25  ? 503  ILE D CG1   1 
ATOM   6248  C  CG2   . ILE B  1  95  ? 48.640  63.832 -24.353 1.00 37.91  ? 503  ILE D CG2   1 
ATOM   6249  C  CD1   . ILE B  1  95  ? 47.733  66.453 -27.032 1.00 37.28  ? 503  ILE D CD1   1 
ATOM   6250  N  N     . VAL B  1  96  ? 47.100  65.232 -21.485 1.00 35.50  ? 504  VAL D N     1 
ATOM   6251  C  CA    . VAL B  1  96  ? 47.428  65.220 -20.075 1.00 31.84  ? 504  VAL D CA    1 
ATOM   6252  C  C     . VAL B  1  96  ? 47.734  63.802 -19.622 1.00 31.25  ? 504  VAL D C     1 
ATOM   6253  O  O     . VAL B  1  96  ? 46.915  62.897 -19.791 1.00 29.74  ? 504  VAL D O     1 
ATOM   6254  C  CB    . VAL B  1  96  ? 46.255  65.795 -19.217 1.00 30.57  ? 504  VAL D CB    1 
ATOM   6255  C  CG1   . VAL B  1  96  ? 46.690  65.987 -17.773 1.00 29.54  ? 504  VAL D CG1   1 
ATOM   6256  C  CG2   . VAL B  1  96  ? 45.818  67.140 -19.794 1.00 32.96  ? 504  VAL D CG2   1 
ATOM   6257  N  N     . ILE B  1  97  ? 48.925  63.622 -19.049 1.00 30.64  ? 505  ILE D N     1 
ATOM   6258  C  CA    . ILE B  1  97  ? 49.334  62.340 -18.464 1.00 28.75  ? 505  ILE D CA    1 
ATOM   6259  C  C     . ILE B  1  97  ? 48.820  62.282 -17.037 1.00 25.44  ? 505  ILE D C     1 
ATOM   6260  O  O     . ILE B  1  97  ? 49.193  63.101 -16.189 1.00 26.26  ? 505  ILE D O     1 
ATOM   6261  C  CB    . ILE B  1  97  ? 50.864  62.168 -18.513 1.00 28.57  ? 505  ILE D CB    1 
ATOM   6262  C  CG1   . ILE B  1  97  ? 51.317  62.023 -19.976 1.00 28.59  ? 505  ILE D CG1   1 
ATOM   6263  C  CG2   . ILE B  1  97  ? 51.281  60.958 -17.720 1.00 31.48  ? 505  ILE D CG2   1 
ATOM   6264  C  CD1   . ILE B  1  97  ? 52.832  62.092 -20.126 1.00 28.53  ? 505  ILE D CD1   1 
ATOM   6265  N  N     . MET B  1  98  ? 47.929  61.312 -16.773 1.00 25.88  ? 506  MET D N     1 
ATOM   6266  C  CA    . MET B  1  98  ? 47.268  61.191 -15.481 1.00 28.10  ? 506  MET D CA    1 
ATOM   6267  C  C     . MET B  1  98  ? 47.488  59.765 -14.947 1.00 28.04  ? 506  MET D C     1 
ATOM   6268  O  O     . MET B  1  98  ? 46.787  58.834 -15.342 1.00 27.94  ? 506  MET D O     1 
ATOM   6269  C  CB    . MET B  1  98  ? 45.802  61.522 -15.629 1.00 27.83  ? 506  MET D CB    1 
ATOM   6270  C  CG    . MET B  1  98  ? 45.051  61.467 -14.262 1.00 30.70  ? 506  MET D CG    1 
ATOM   6271  S  SD    . MET B  1  98  ? 43.361  62.097 -14.508 1.00 37.21  ? 506  MET D SD    1 
ATOM   6272  C  CE    . MET B  1  98  ? 42.777  61.805 -12.851 1.00 35.16  ? 506  MET D CE    1 
ATOM   6273  N  N     . THR B  1  99  ? 48.462  59.616 -14.049 1.00 28.70  ? 507  THR D N     1 
ATOM   6274  C  CA    . THR B  1  99  ? 48.798  58.327 -13.474 1.00 28.34  ? 507  THR D CA    1 
ATOM   6275  C  C     . THR B  1  99  ? 48.755  58.415 -11.954 1.00 30.00  ? 507  THR D C     1 
ATOM   6276  O  O     . THR B  1  99  ? 48.743  59.561 -11.385 1.00 28.97  ? 507  THR D O     1 
ATOM   6277  C  CB    . THR B  1  99  ? 50.186  57.845 -13.922 1.00 31.52  ? 507  THR D CB    1 
ATOM   6278  O  OG1   . THR B  1  99  ? 51.190  58.718 -13.392 1.00 32.66  ? 507  THR D OG1   1 
ATOM   6279  C  CG2   . THR B  1  99  ? 50.299  57.858 -15.428 1.00 30.69  ? 507  THR D CG2   1 
ATOM   6280  N  N     . ASP B  1  100 ? 48.755  57.260 -11.289 1.00 26.19  ? 508  ASP D N     1 
ATOM   6281  C  CA    . ASP B  1  100 ? 48.864  57.241 -9.857  1.00 26.95  ? 508  ASP D CA    1 
ATOM   6282  C  C     . ASP B  1  100 ? 50.127  57.970 -9.403  1.00 28.52  ? 508  ASP D C     1 
ATOM   6283  O  O     . ASP B  1  100 ? 51.127  57.923 -10.058 1.00 28.70  ? 508  ASP D O     1 
ATOM   6284  C  CB    . ASP B  1  100 ? 48.911  55.747 -9.346  1.00 27.14  ? 508  ASP D CB    1 
ATOM   6285  C  CG    . ASP B  1  100 ? 47.603  55.078 -9.449  1.00 26.96  ? 508  ASP D CG    1 
ATOM   6286  O  OD1   . ASP B  1  100 ? 46.621  55.658 -10.021 1.00 26.21  ? 508  ASP D OD1   1 
ATOM   6287  O  OD2   . ASP B  1  100 ? 47.503  53.930 -8.995  1.00 24.53  ? 508  ASP D OD2   1 
ATOM   6288  N  N     . ALA B  1  101 ? 50.050  58.620 -8.242  1.00 27.28  ? 509  ALA D N     1 
ATOM   6289  C  CA    . ALA B  1  101 ? 51.217  59.222 -7.644  1.00 29.17  ? 509  ALA D CA    1 
ATOM   6290  C  C     . ALA B  1  101 ? 52.011  58.205 -6.818  1.00 29.11  ? 509  ALA D C     1 
ATOM   6291  O  O     . ALA B  1  101 ? 52.249  58.359 -5.626  1.00 32.66  ? 509  ALA D O     1 
ATOM   6292  C  CB    . ALA B  1  101 ? 50.794  60.417 -6.755  1.00 29.94  ? 509  ALA D CB    1 
ATOM   6293  N  N     . ASP B  1  102 ? 52.415  57.134 -7.511  1.00 29.62  ? 510  ASP D N     1 
ATOM   6294  C  CA    . ASP B  1  102 ? 53.283  56.110 -6.909  1.00 27.37  ? 510  ASP D CA    1 
ATOM   6295  C  C     . ASP B  1  102 ? 54.325  55.750 -7.971  1.00 26.85  ? 510  ASP D C     1 
ATOM   6296  O  O     . ASP B  1  102 ? 54.365  56.308 -9.060  1.00 26.00  ? 510  ASP D O     1 
ATOM   6297  C  CB    . ASP B  1  102 ? 52.430  54.900 -6.458  1.00 25.03  ? 510  ASP D CB    1 
ATOM   6298  C  CG    . ASP B  1  102 ? 51.559  54.311 -7.539  1.00 25.78  ? 510  ASP D CG    1 
ATOM   6299  O  OD1   . ASP B  1  102 ? 51.919  54.360 -8.743  1.00 23.61  ? 510  ASP D OD1   1 
ATOM   6300  O  OD2   . ASP B  1  102 ? 50.500  53.772 -7.202  1.00 22.69  ? 510  ASP D OD2   1 
ATOM   6301  N  N     . VAL B  1  103 ? 55.210  54.829 -7.594  1.00 26.04  ? 511  VAL D N     1 
ATOM   6302  C  CA    . VAL B  1  103 ? 56.308  54.485 -8.464  1.00 25.33  ? 511  VAL D CA    1 
ATOM   6303  C  C     . VAL B  1  103 ? 55.900  53.864 -9.772  1.00 23.76  ? 511  VAL D C     1 
ATOM   6304  O  O     . VAL B  1  103 ? 56.562  54.114 -10.764 1.00 22.25  ? 511  VAL D O     1 
ATOM   6305  C  CB    . VAL B  1  103 ? 57.280  53.518 -7.734  1.00 26.19  ? 511  VAL D CB    1 
ATOM   6306  C  CG1   . VAL B  1  103 ? 57.890  54.185 -6.536  1.00 30.23  ? 511  VAL D CG1   1 
ATOM   6307  C  CG2   . VAL B  1  103 ? 56.598  52.137 -7.282  1.00 25.79  ? 511  VAL D CG2   1 
ATOM   6308  N  N     . ASP B  1  104 ? 54.835  53.077 -9.812  1.00 22.66  ? 512  ASP D N     1 
ATOM   6309  C  CA    . ASP B  1  104 ? 54.414  52.481 -11.068 1.00 22.16  ? 512  ASP D CA    1 
ATOM   6310  C  C     . ASP B  1  104 ? 53.725  53.510 -11.983 1.00 22.93  ? 512  ASP D C     1 
ATOM   6311  O  O     . ASP B  1  104 ? 53.860  53.433 -13.203 1.00 21.86  ? 512  ASP D O     1 
ATOM   6312  C  CB    . ASP B  1  104 ? 53.452  51.325 -10.828 1.00 22.45  ? 512  ASP D CB    1 
ATOM   6313  C  CG    . ASP B  1  104 ? 54.148  50.108 -10.241 1.00 22.85  ? 512  ASP D CG    1 
ATOM   6314  O  OD1   . ASP B  1  104 ? 54.869  49.433 -11.004 1.00 22.72  ? 512  ASP D OD1   1 
ATOM   6315  O  OD2   . ASP B  1  104 ? 54.035  49.803 -9.044  1.00 22.14  ? 512  ASP D OD2   1 
ATOM   6316  N  N     . GLY B  1  105 ? 52.994  54.455 -11.391 1.00 23.07  ? 513  GLY D N     1 
ATOM   6317  C  CA    . GLY B  1  105 ? 52.505  55.579 -12.181 1.00 22.91  ? 513  GLY D CA    1 
ATOM   6318  C  C     . GLY B  1  105 ? 53.662  56.413 -12.759 1.00 25.18  ? 513  GLY D C     1 
ATOM   6319  O  O     . GLY B  1  105 ? 53.592  56.880 -13.889 1.00 26.72  ? 513  GLY D O     1 
ATOM   6320  N  N     . ALA B  1  106 ? 54.732  56.584 -11.973 1.00 26.77  ? 514  ALA D N     1 
ATOM   6321  C  CA    . ALA B  1  106 ? 55.918  57.268 -12.464 1.00 25.92  ? 514  ALA D CA    1 
ATOM   6322  C  C     . ALA B  1  106 ? 56.554  56.499 -13.637 1.00 26.74  ? 514  ALA D C     1 
ATOM   6323  O  O     . ALA B  1  106 ? 57.034  57.096 -14.596 1.00 27.70  ? 514  ALA D O     1 
ATOM   6324  C  CB    . ALA B  1  106 ? 56.933  57.455 -11.360 1.00 25.23  ? 514  ALA D CB    1 
ATOM   6325  N  N     . HIS B  1  107 ? 56.539  55.167 -13.562 1.00 27.56  ? 515  HIS D N     1 
ATOM   6326  C  CA    . HIS B  1  107 ? 57.053  54.373 -14.664 1.00 26.75  ? 515  HIS D CA    1 
ATOM   6327  C  C     . HIS B  1  107 ? 56.220  54.597 -15.925 1.00 27.06  ? 515  HIS D C     1 
ATOM   6328  O  O     . HIS B  1  107 ? 56.761  54.784 -17.023 1.00 29.02  ? 515  HIS D O     1 
ATOM   6329  C  CB    . HIS B  1  107 ? 57.025  52.890 -14.301 1.00 25.66  ? 515  HIS D CB    1 
ATOM   6330  C  CG    . HIS B  1  107 ? 57.786  52.021 -15.256 1.00 24.80  ? 515  HIS D CG    1 
ATOM   6331  N  ND1   . HIS B  1  107 ? 57.441  50.714 -15.479 1.00 24.12  ? 515  HIS D ND1   1 
ATOM   6332  C  CD2   . HIS B  1  107 ? 58.895  52.277 -16.005 1.00 25.61  ? 515  HIS D CD2   1 
ATOM   6333  C  CE1   . HIS B  1  107 ? 58.313  50.202 -16.353 1.00 24.82  ? 515  HIS D CE1   1 
ATOM   6334  N  NE2   . HIS B  1  107 ? 59.200  51.143 -16.699 1.00 23.86  ? 515  HIS D NE2   1 
ATOM   6335  N  N     . ILE B  1  108 ? 54.879  54.567 -15.795 1.00 29.54  ? 516  ILE D N     1 
ATOM   6336  C  CA    . ILE B  1  108 ? 54.019  54.763 -16.934 1.00 27.26  ? 516  ILE D CA    1 
ATOM   6337  C  C     . ILE B  1  108 ? 54.230  56.163 -17.530 1.00 28.45  ? 516  ILE D C     1 
ATOM   6338  O  O     . ILE B  1  108 ? 54.150  56.366 -18.751 1.00 29.21  ? 516  ILE D O     1 
ATOM   6339  C  CB    . ILE B  1  108 ? 52.560  54.529 -16.538 1.00 26.64  ? 516  ILE D CB    1 
ATOM   6340  C  CG1   . ILE B  1  108 ? 52.349  53.053 -16.210 1.00 25.78  ? 516  ILE D CG1   1 
ATOM   6341  C  CG2   . ILE B  1  108 ? 51.592  54.982 -17.689 1.00 27.16  ? 516  ILE D CG2   1 
ATOM   6342  C  CD1   . ILE B  1  108 ? 51.063  52.789 -15.411 1.00 27.20  ? 516  ILE D CD1   1 
ATOM   6343  N  N     . ARG B  1  109 ? 54.537  57.125 -16.679 1.00 29.91  ? 517  ARG D N     1 
ATOM   6344  C  CA    . ARG B  1  109 ? 54.836  58.472 -17.164 1.00 29.92  ? 517  ARG D CA    1 
ATOM   6345  C  C     . ARG B  1  109 ? 56.116  58.478 -18.025 1.00 30.61  ? 517  ARG D C     1 
ATOM   6346  O  O     . ARG B  1  109 ? 56.118  59.071 -19.122 1.00 30.92  ? 517  ARG D O     1 
ATOM   6347  C  CB    . ARG B  1  109 ? 54.961  59.421 -15.982 1.00 31.66  ? 517  ARG D CB    1 
ATOM   6348  C  CG    . ARG B  1  109 ? 54.961  60.880 -16.346 1.00 40.20  ? 517  ARG D CG    1 
ATOM   6349  C  CD    . ARG B  1  109 ? 54.621  61.770 -15.162 1.00 42.33  ? 517  ARG D CD    1 
ATOM   6350  N  NE    . ARG B  1  109 ? 55.436  61.493 -14.002 1.00 47.54  ? 517  ARG D NE    1 
ATOM   6351  C  CZ    . ARG B  1  109 ? 55.013  60.890 -12.893 1.00 48.70  ? 517  ARG D CZ    1 
ATOM   6352  N  NH1   . ARG B  1  109 ? 53.746  60.469 -12.810 1.00 54.79  ? 517  ARG D NH1   1 
ATOM   6353  N  NH2   . ARG B  1  109 ? 55.880  60.706 -11.885 1.00 42.00  ? 517  ARG D NH2   1 
ATOM   6354  N  N     . THR B  1  110 ? 57.160  57.794 -17.564 1.00 28.55  ? 518  THR D N     1 
ATOM   6355  C  CA    . THR B  1  110 ? 58.398  57.734 -18.347 1.00 29.03  ? 518  THR D CA    1 
ATOM   6356  C  C     . THR B  1  110 ? 58.192  56.997 -19.650 1.00 28.95  ? 518  THR D C     1 
ATOM   6357  O  O     . THR B  1  110 ? 58.799  57.330 -20.674 1.00 29.24  ? 518  THR D O     1 
ATOM   6358  C  CB    . THR B  1  110 ? 59.531  57.075 -17.552 1.00 28.14  ? 518  THR D CB    1 
ATOM   6359  O  OG1   . THR B  1  110 ? 59.183  55.736 -17.210 1.00 30.73  ? 518  THR D OG1   1 
ATOM   6360  C  CG2   . THR B  1  110 ? 59.795  57.794 -16.250 1.00 28.28  ? 518  THR D CG2   1 
ATOM   6361  N  N     . LEU B  1  111 ? 57.339  55.962 -19.640 1.00 28.32  ? 519  LEU D N     1 
ATOM   6362  C  CA    . LEU B  1  111 ? 57.050  55.224 -20.862 1.00 26.49  ? 519  LEU D CA    1 
ATOM   6363  C  C     . LEU B  1  111 ? 56.271  56.105 -21.848 1.00 30.54  ? 519  LEU D C     1 
ATOM   6364  O  O     . LEU B  1  111 ? 56.565  56.099 -23.062 1.00 29.78  ? 519  LEU D O     1 
ATOM   6365  C  CB    . LEU B  1  111 ? 56.252  53.981 -20.537 1.00 26.90  ? 519  LEU D CB    1 
ATOM   6366  C  CG    . LEU B  1  111 ? 56.984  52.952 -19.649 1.00 26.55  ? 519  LEU D CG    1 
ATOM   6367  C  CD1   . LEU B  1  111 ? 56.008  51.953 -19.066 1.00 23.84  ? 519  LEU D CD1   1 
ATOM   6368  C  CD2   . LEU B  1  111 ? 58.060  52.247 -20.469 1.00 26.34  ? 519  LEU D CD2   1 
ATOM   6369  N  N     . LEU B  1  112 ? 55.305  56.870 -21.353 1.00 28.76  ? 520  LEU D N     1 
ATOM   6370  C  CA    . LEU B  1  112 ? 54.533  57.726 -22.248 1.00 29.03  ? 520  LEU D CA    1 
ATOM   6371  C  C     . LEU B  1  112 ? 55.379  58.882 -22.790 1.00 30.21  ? 520  LEU D C     1 
ATOM   6372  O  O     . LEU B  1  112 ? 55.290  59.188 -23.992 1.00 30.78  ? 520  LEU D O     1 
ATOM   6373  C  CB    . LEU B  1  112 ? 53.314  58.297 -21.502 1.00 28.09  ? 520  LEU D CB    1 
ATOM   6374  C  CG    . LEU B  1  112 ? 52.130  57.309 -21.361 1.00 28.72  ? 520  LEU D CG    1 
ATOM   6375  C  CD1   . LEU B  1  112 ? 51.206  57.814 -20.301 1.00 29.04  ? 520  LEU D CD1   1 
ATOM   6376  C  CD2   . LEU B  1  112 ? 51.380  57.222 -22.673 1.00 28.66  ? 520  LEU D CD2   1 
ATOM   6377  N  N     . LEU B  1  113 ? 56.175  59.509 -21.942 1.00 31.82  ? 521  LEU D N     1 
ATOM   6378  C  CA    . LEU B  1  113 ? 57.052  60.583 -22.415 1.00 33.21  ? 521  LEU D CA    1 
ATOM   6379  C  C     . LEU B  1  113 ? 58.065  60.073 -23.433 1.00 33.63  ? 521  LEU D C     1 
ATOM   6380  O  O     . LEU B  1  113 ? 58.491  60.838 -24.318 1.00 32.84  ? 521  LEU D O     1 
ATOM   6381  C  CB    . LEU B  1  113 ? 57.791  61.240 -21.230 1.00 32.16  ? 521  LEU D CB    1 
ATOM   6382  C  CG    . LEU B  1  113 ? 56.877  62.059 -20.310 1.00 34.98  ? 521  LEU D CG    1 
ATOM   6383  C  CD1   . LEU B  1  113 ? 57.526  62.454 -19.040 1.00 36.05  ? 521  LEU D CD1   1 
ATOM   6384  C  CD2   . LEU B  1  113 ? 56.378  63.346 -21.068 1.00 34.81  ? 521  LEU D CD2   1 
ATOM   6385  N  N     . THR B  1  114 ? 58.468  58.806 -23.320 1.00 32.08  ? 522  THR D N     1 
ATOM   6386  C  CA    . THR B  1  114 ? 59.391  58.246 -24.296 1.00 30.90  ? 522  THR D CA    1 
ATOM   6387  C  C     . THR B  1  114 ? 58.717  58.101 -25.662 1.00 30.91  ? 522  THR D C     1 
ATOM   6388  O  O     . THR B  1  114 ? 59.349  58.366 -26.690 1.00 32.38  ? 522  THR D O     1 
ATOM   6389  C  CB    . THR B  1  114 ? 59.884  56.871 -23.797 1.00 28.21  ? 522  THR D CB    1 
ATOM   6390  O  OG1   . THR B  1  114 ? 60.583  57.048 -22.575 1.00 28.08  ? 522  THR D OG1   1 
ATOM   6391  C  CG2   . THR B  1  114 ? 60.836  56.253 -24.832 1.00 28.33  ? 522  THR D CG2   1 
ATOM   6392  N  N     . PHE B  1  115 ? 57.451  57.694 -25.692 1.00 29.65  ? 523  PHE D N     1 
ATOM   6393  C  CA    . PHE B  1  115 ? 56.732  57.618 -26.950 1.00 33.67  ? 523  PHE D CA    1 
ATOM   6394  C  C     . PHE B  1  115 ? 56.516  58.998 -27.567 1.00 36.74  ? 523  PHE D C     1 
ATOM   6395  O  O     . PHE B  1  115 ? 56.637  59.162 -28.781 1.00 39.37  ? 523  PHE D O     1 
ATOM   6396  C  CB    . PHE B  1  115 ? 55.374  56.916 -26.760 1.00 32.40  ? 523  PHE D CB    1 
ATOM   6397  C  CG    . PHE B  1  115 ? 54.463  57.032 -27.928 1.00 36.30  ? 523  PHE D CG    1 
ATOM   6398  C  CD1   . PHE B  1  115 ? 54.813  56.464 -29.171 1.00 38.13  ? 523  PHE D CD1   1 
ATOM   6399  C  CD2   . PHE B  1  115 ? 53.264  57.716 -27.829 1.00 38.10  ? 523  PHE D CD2   1 
ATOM   6400  C  CE1   . PHE B  1  115 ? 53.967  56.611 -30.274 1.00 38.10  ? 523  PHE D CE1   1 
ATOM   6401  C  CE2   . PHE B  1  115 ? 52.413  57.835 -28.932 1.00 40.35  ? 523  PHE D CE2   1 
ATOM   6402  C  CZ    . PHE B  1  115 ? 52.806  57.296 -30.147 1.00 40.13  ? 523  PHE D CZ    1 
ATOM   6403  N  N     . PHE B  1  116 ? 56.209  59.984 -26.730 1.00 34.91  ? 524  PHE D N     1 
ATOM   6404  C  CA    . PHE B  1  116 ? 56.019  61.352 -27.247 1.00 37.26  ? 524  PHE D CA    1 
ATOM   6405  C  C     . PHE B  1  116 ? 57.335  61.928 -27.777 1.00 39.96  ? 524  PHE D C     1 
ATOM   6406  O  O     . PHE B  1  116 ? 57.348  62.583 -28.827 1.00 40.15  ? 524  PHE D O     1 
ATOM   6407  C  CB    . PHE B  1  116 ? 55.450  62.251 -26.164 1.00 36.62  ? 524  PHE D CB    1 
ATOM   6408  C  CG    . PHE B  1  116 ? 54.080  61.843 -25.700 1.00 40.45  ? 524  PHE D CG    1 
ATOM   6409  C  CD1   . PHE B  1  116 ? 53.187  61.204 -26.586 1.00 45.13  ? 524  PHE D CD1   1 
ATOM   6410  C  CD2   . PHE B  1  116 ? 53.677  62.071 -24.393 1.00 40.30  ? 524  PHE D CD2   1 
ATOM   6411  C  CE1   . PHE B  1  116 ? 51.943  60.812 -26.141 1.00 45.37  ? 524  PHE D CE1   1 
ATOM   6412  C  CE2   . PHE B  1  116 ? 52.411  61.693 -23.991 1.00 40.55  ? 524  PHE D CE2   1 
ATOM   6413  C  CZ    . PHE B  1  116 ? 51.547  61.043 -24.823 1.00 43.29  ? 524  PHE D CZ    1 
ATOM   6414  N  N     . TYR B  1  117 ? 58.443  61.695 -27.085 1.00 38.68  ? 525  TYR D N     1 
ATOM   6415  C  CA    . TYR B  1  117 ? 59.690  62.315 -27.521 1.00 41.37  ? 525  TYR D CA    1 
ATOM   6416  C  C     . TYR B  1  117 ? 60.252  61.676 -28.757 1.00 40.76  ? 525  TYR D C     1 
ATOM   6417  O  O     . TYR B  1  117 ? 60.924  62.348 -29.557 1.00 44.06  ? 525  TYR D O     1 
ATOM   6418  C  CB    . TYR B  1  117 ? 60.733  62.264 -26.389 1.00 41.23  ? 525  TYR D CB    1 
ATOM   6419  C  CG    . TYR B  1  117 ? 61.982  63.046 -26.718 1.00 46.13  ? 525  TYR D CG    1 
ATOM   6420  C  CD1   . TYR B  1  117 ? 61.975  64.446 -26.715 1.00 48.22  ? 525  TYR D CD1   1 
ATOM   6421  C  CD2   . TYR B  1  117 ? 63.163  62.402 -27.048 1.00 45.27  ? 525  TYR D CD2   1 
ATOM   6422  C  CE1   . TYR B  1  117 ? 63.099  65.174 -27.007 1.00 49.73  ? 525  TYR D CE1   1 
ATOM   6423  C  CE2   . TYR B  1  117 ? 64.313  63.116 -27.361 1.00 49.67  ? 525  TYR D CE2   1 
ATOM   6424  C  CZ    . TYR B  1  117 ? 64.293  64.491 -27.350 1.00 51.70  ? 525  TYR D CZ    1 
ATOM   6425  O  OH    . TYR B  1  117 ? 65.425  65.211 -27.653 1.00 53.86  ? 525  TYR D OH    1 
ATOM   6426  N  N     . ARG B  1  118 ? 60.004  60.375 -28.964 1.00 38.95  ? 526  ARG D N     1 
ATOM   6427  C  CA    . ARG B  1  118 ? 60.571  59.666 -30.109 1.00 41.66  ? 526  ARG D CA    1 
ATOM   6428  C  C     . ARG B  1  118 ? 59.679  59.705 -31.340 1.00 41.35  ? 526  ARG D C     1 
ATOM   6429  O  O     . ARG B  1  118 ? 60.187  59.567 -32.454 1.00 41.21  ? 526  ARG D O     1 
ATOM   6430  C  CB    . ARG B  1  118 ? 60.901  58.230 -29.723 1.00 40.93  ? 526  ARG D CB    1 
ATOM   6431  C  CG    . ARG B  1  118 ? 62.046  58.084 -28.747 1.00 42.89  ? 526  ARG D CG    1 
ATOM   6432  C  CD    . ARG B  1  118 ? 63.306  58.854 -29.210 1.00 42.54  ? 526  ARG D CD    1 
ATOM   6433  N  NE    . ARG B  1  118 ? 64.461  58.550 -28.376 1.00 44.38  ? 526  ARG D NE    1 
ATOM   6434  C  CZ    . ARG B  1  118 ? 65.626  59.181 -28.448 1.00 45.98  ? 526  ARG D CZ    1 
ATOM   6435  N  NH1   . ARG B  1  118 ? 65.805  60.158 -29.304 1.00 48.05  ? 526  ARG D NH1   1 
ATOM   6436  N  NH2   . ARG B  1  118 ? 66.630  58.834 -27.624 1.00 42.03  ? 526  ARG D NH2   1 
ATOM   6437  N  N     . PHE B  1  119 ? 58.378  59.872 -31.166 1.00 38.58  ? 527  PHE D N     1 
ATOM   6438  C  CA    . PHE B  1  119 ? 57.439  59.811 -32.282 1.00 38.68  ? 527  PHE D CA    1 
ATOM   6439  C  C     . PHE B  1  119 ? 56.575  61.050 -32.468 1.00 40.17  ? 527  PHE D C     1 
ATOM   6440  O  O     . PHE B  1  119 ? 55.945  61.171 -33.502 1.00 43.13  ? 527  PHE D O     1 
ATOM   6441  C  CB    . PHE B  1  119 ? 56.545  58.574 -32.157 1.00 39.63  ? 527  PHE D CB    1 
ATOM   6442  C  CG    . PHE B  1  119 ? 57.221  57.297 -32.468 1.00 39.39  ? 527  PHE D CG    1 
ATOM   6443  C  CD1   . PHE B  1  119 ? 57.243  56.814 -33.783 1.00 42.10  ? 527  PHE D CD1   1 
ATOM   6444  C  CD2   . PHE B  1  119 ? 57.884  56.567 -31.444 1.00 40.38  ? 527  PHE D CD2   1 
ATOM   6445  C  CE1   . PHE B  1  119 ? 57.916  55.613 -34.070 1.00 43.80  ? 527  PHE D CE1   1 
ATOM   6446  C  CE2   . PHE B  1  119 ? 58.540  55.389 -31.714 1.00 41.35  ? 527  PHE D CE2   1 
ATOM   6447  C  CZ    . PHE B  1  119 ? 58.569  54.891 -33.013 1.00 41.68  ? 527  PHE D CZ    1 
ATOM   6448  N  N     . MET B  1  120 ? 56.509  61.933 -31.489 1.00 40.69  ? 528  MET D N     1 
ATOM   6449  C  CA    . MET B  1  120 ? 55.649  63.125 -31.550 1.00 43.00  ? 528  MET D CA    1 
ATOM   6450  C  C     . MET B  1  120 ? 56.334  64.331 -30.932 1.00 41.32  ? 528  MET D C     1 
ATOM   6451  O  O     . MET B  1  120 ? 55.713  65.121 -30.244 1.00 41.62  ? 528  MET D O     1 
ATOM   6452  C  CB    . MET B  1  120 ? 54.299  62.877 -30.915 1.00 43.16  ? 528  MET D CB    1 
ATOM   6453  C  CG    . MET B  1  120 ? 53.444  61.866 -31.685 1.00 50.97  ? 528  MET D CG    1 
ATOM   6454  S  SD    . MET B  1  120 ? 51.892  61.492 -30.824 1.00 59.20  ? 528  MET D SD    1 
ATOM   6455  C  CE    . MET B  1  120 ? 51.052  60.540 -32.053 1.00 57.62  ? 528  MET D CE    1 
ATOM   6456  N  N     . ARG B  1  121 ? 57.639  64.472 -31.155 1.00 40.85  ? 529  ARG D N     1 
ATOM   6457  C  CA    . ARG B  1  121 ? 58.406  65.513 -30.481 1.00 43.11  ? 529  ARG D CA    1 
ATOM   6458  C  C     . ARG B  1  121 ? 57.870  66.950 -30.677 1.00 43.85  ? 529  ARG D C     1 
ATOM   6459  O  O     . ARG B  1  121 ? 57.892  67.710 -29.695 1.00 45.18  ? 529  ARG D O     1 
ATOM   6460  C  CB    . ARG B  1  121 ? 59.870  65.463 -30.923 1.00 44.85  ? 529  ARG D CB    1 
ATOM   6461  C  CG    . ARG B  1  121 ? 60.807  66.144 -29.951 1.00 47.37  ? 529  ARG D CG    1 
ATOM   6462  C  CD    . ARG B  1  121 ? 62.267  65.991 -30.357 1.00 52.02  ? 529  ARG D CD    1 
ATOM   6463  N  NE    . ARG B  1  121 ? 62.815  67.213 -30.860 1.00 53.42  ? 529  ARG D NE    1 
ATOM   6464  C  CZ    . ARG B  1  121 ? 64.113  67.455 -31.056 1.00 57.61  ? 529  ARG D CZ    1 
ATOM   6465  N  NH1   . ARG B  1  121 ? 65.045  66.522 -30.753 1.00 54.57  ? 529  ARG D NH1   1 
ATOM   6466  N  NH2   . ARG B  1  121 ? 64.508  68.634 -31.557 1.00 59.76  ? 529  ARG D NH2   1 
ATOM   6467  N  N     . PRO B  1  122 ? 57.340  67.319 -31.867 1.00 42.71  ? 530  PRO D N     1 
ATOM   6468  C  CA    . PRO B  1  122 ? 56.758  68.684 -31.945 1.00 42.02  ? 530  PRO D CA    1 
ATOM   6469  C  C     . PRO B  1  122 ? 55.561  68.879 -31.049 1.00 42.14  ? 530  PRO D C     1 
ATOM   6470  O  O     . PRO B  1  122 ? 55.251  70.019 -30.707 1.00 39.61  ? 530  PRO D O     1 
ATOM   6471  C  CB    . PRO B  1  122 ? 56.317  68.808 -33.391 1.00 45.06  ? 530  PRO D CB    1 
ATOM   6472  C  CG    . PRO B  1  122 ? 57.256  67.852 -34.131 1.00 46.33  ? 530  PRO D CG    1 
ATOM   6473  C  CD    . PRO B  1  122 ? 57.430  66.659 -33.157 1.00 42.84  ? 530  PRO D CD    1 
ATOM   6474  N  N     . LEU B  1  123 ? 54.878  67.814 -30.648 1.00 40.24  ? 531  LEU D N     1 
ATOM   6475  C  CA    . LEU B  1  123 ? 53.800  67.933 -29.659 1.00 42.32  ? 531  LEU D CA    1 
ATOM   6476  C  C     . LEU B  1  123 ? 54.339  68.468 -28.344 1.00 41.88  ? 531  LEU D C     1 
ATOM   6477  O  O     . LEU B  1  123 ? 53.673  69.275 -27.675 1.00 45.57  ? 531  LEU D O     1 
ATOM   6478  C  CB    . LEU B  1  123 ? 53.104  66.596 -29.464 1.00 44.52  ? 531  LEU D CB    1 
ATOM   6479  C  CG    . LEU B  1  123 ? 51.636  66.529 -29.116 1.00 46.77  ? 531  LEU D CG    1 
ATOM   6480  C  CD1   . LEU B  1  123 ? 50.777  66.709 -30.346 1.00 45.45  ? 531  LEU D CD1   1 
ATOM   6481  C  CD2   . LEU B  1  123 ? 51.332  65.157 -28.433 1.00 42.60  ? 531  LEU D CD2   1 
ATOM   6482  N  N     . ILE B  1  124 ? 55.545  68.053 -27.975 1.00 39.92  ? 532  ILE D N     1 
ATOM   6483  C  CA    . ILE B  1  124 ? 56.132  68.541 -26.729 1.00 40.05  ? 532  ILE D CA    1 
ATOM   6484  C  C     . ILE B  1  124 ? 56.614  69.982 -26.900 1.00 41.81  ? 532  ILE D C     1 
ATOM   6485  O  O     . ILE B  1  124 ? 56.394  70.821 -26.026 1.00 39.16  ? 532  ILE D O     1 
ATOM   6486  C  CB    . ILE B  1  124 ? 57.324  67.679 -26.291 1.00 40.34  ? 532  ILE D CB    1 
ATOM   6487  C  CG1   . ILE B  1  124 ? 56.847  66.245 -26.024 1.00 40.79  ? 532  ILE D CG1   1 
ATOM   6488  C  CG2   . ILE B  1  124 ? 57.967  68.278 -25.060 1.00 42.57  ? 532  ILE D CG2   1 
ATOM   6489  C  CD1   . ILE B  1  124 ? 57.968  65.307 -25.621 1.00 41.59  ? 532  ILE D CD1   1 
ATOM   6490  N  N     . GLU B  1  125 ? 57.270  70.258 -28.023 1.00 43.31  ? 533  GLU D N     1 
ATOM   6491  C  CA    . GLU B  1  125 ? 57.770  71.591 -28.284 1.00 47.84  ? 533  GLU D CA    1 
ATOM   6492  C  C     . GLU B  1  125 ? 56.652  72.617 -28.344 1.00 45.57  ? 533  GLU D C     1 
ATOM   6493  O  O     . GLU B  1  125 ? 56.808  73.722 -27.821 1.00 50.17  ? 533  GLU D O     1 
ATOM   6494  C  CB    . GLU B  1  125 ? 58.606  71.618 -29.574 1.00 48.64  ? 533  GLU D CB    1 
ATOM   6495  C  CG    . GLU B  1  125 ? 60.019  71.060 -29.345 1.00 55.71  ? 533  GLU D CG    1 
ATOM   6496  C  CD    . GLU B  1  125 ? 60.749  70.763 -30.630 1.00 60.06  ? 533  GLU D CD    1 
ATOM   6497  O  OE1   . GLU B  1  125 ? 60.161  70.927 -31.708 1.00 67.23  ? 533  GLU D OE1   1 
ATOM   6498  O  OE2   . GLU B  1  125 ? 61.922  70.397 -30.583 1.00 61.34  ? 533  GLU D OE2   1 
ATOM   6499  N  N     . ALA B  1  126 ? 55.519  72.219 -28.890 1.00 44.80  ? 534  ALA D N     1 
ATOM   6500  C  CA    . ALA B  1  126 ? 54.347  73.106 -28.957 1.00 44.96  ? 534  ALA D CA    1 
ATOM   6501  C  C     . ALA B  1  126 ? 53.744  73.374 -27.585 1.00 46.16  ? 534  ALA D C     1 
ATOM   6502  O  O     . ALA B  1  126 ? 52.895  74.239 -27.454 1.00 50.50  ? 534  ALA D O     1 
ATOM   6503  C  CB    . ALA B  1  126 ? 53.285  72.531 -29.879 1.00 41.95  ? 534  ALA D CB    1 
ATOM   6504  N  N     . GLY B  1  127 ? 54.170  72.637 -26.553 1.00 45.84  ? 535  GLY D N     1 
ATOM   6505  C  CA    . GLY B  1  127 ? 53.620  72.810 -25.231 1.00 42.26  ? 535  GLY D CA    1 
ATOM   6506  C  C     . GLY B  1  127 ? 52.319  72.078 -24.970 1.00 41.66  ? 535  GLY D C     1 
ATOM   6507  O  O     . GLY B  1  127 ? 51.683  72.340 -23.944 1.00 42.71  ? 535  GLY D O     1 
ATOM   6508  N  N     . TYR B  1  128 ? 51.893  71.183 -25.879 1.00 38.09  ? 536  TYR D N     1 
ATOM   6509  C  CA    . TYR B  1  128 ? 50.631  70.488 -25.744 1.00 39.65  ? 536  TYR D CA    1 
ATOM   6510  C  C     . TYR B  1  128 ? 50.650  69.359 -24.711 1.00 41.50  ? 536  TYR D C     1 
ATOM   6511  O  O     . TYR B  1  128 ? 49.571  68.852 -24.361 1.00 40.90  ? 536  TYR D O     1 
ATOM   6512  C  CB    . TYR B  1  128 ? 50.199  69.899 -27.089 1.00 38.26  ? 536  TYR D CB    1 
ATOM   6513  C  CG    . TYR B  1  128 ? 49.763  70.905 -28.152 1.00 40.25  ? 536  TYR D CG    1 
ATOM   6514  C  CD1   . TYR B  1  128 ? 49.927  72.269 -27.982 1.00 40.11  ? 536  TYR D CD1   1 
ATOM   6515  C  CD2   . TYR B  1  128 ? 49.179  70.457 -29.336 1.00 41.24  ? 536  TYR D CD2   1 
ATOM   6516  C  CE1   . TYR B  1  128 ? 49.524  73.180 -28.948 1.00 43.96  ? 536  TYR D CE1   1 
ATOM   6517  C  CE2   . TYR B  1  128 ? 48.780  71.331 -30.320 1.00 44.86  ? 536  TYR D CE2   1 
ATOM   6518  C  CZ    . TYR B  1  128 ? 48.959  72.703 -30.133 1.00 46.38  ? 536  TYR D CZ    1 
ATOM   6519  O  OH    . TYR B  1  128 ? 48.555  73.565 -31.121 1.00 50.01  ? 536  TYR D OH    1 
ATOM   6520  N  N     . VAL B  1  129 ? 51.830  68.954 -24.222 1.00 37.81  ? 537  VAL D N     1 
ATOM   6521  C  CA    . VAL B  1  129 ? 51.934  67.770 -23.365 1.00 37.29  ? 537  VAL D CA    1 
ATOM   6522  C  C     . VAL B  1  129 ? 51.997  68.225 -21.913 1.00 36.25  ? 537  VAL D C     1 
ATOM   6523  O  O     . VAL B  1  129 ? 52.794  69.113 -21.549 1.00 38.56  ? 537  VAL D O     1 
ATOM   6524  C  CB    . VAL B  1  129 ? 53.171  66.932 -23.727 1.00 36.17  ? 537  VAL D CB    1 
ATOM   6525  C  CG1   . VAL B  1  129 ? 53.352  65.804 -22.665 1.00 36.45  ? 537  VAL D CG1   1 
ATOM   6526  C  CG2   . VAL B  1  129 ? 53.012  66.370 -25.151 1.00 36.85  ? 537  VAL D CG2   1 
ATOM   6527  N  N     . TYR B  1  130 ? 51.142  67.623 -21.068 1.00 33.51  ? 538  TYR D N     1 
ATOM   6528  C  CA    . TYR B  1  130 ? 51.016  68.009 -19.682 1.00 33.43  ? 538  TYR D CA    1 
ATOM   6529  C  C     . TYR B  1  130 ? 51.046  66.771 -18.781 1.00 32.89  ? 538  TYR D C     1 
ATOM   6530  O  O     . TYR B  1  130 ? 50.825  65.637 -19.220 1.00 32.71  ? 538  TYR D O     1 
ATOM   6531  C  CB    . TYR B  1  130 ? 49.671  68.770 -19.445 1.00 33.02  ? 538  TYR D CB    1 
ATOM   6532  C  CG    . TYR B  1  130 ? 49.585  70.085 -20.207 1.00 34.96  ? 538  TYR D CG    1 
ATOM   6533  C  CD1   . TYR B  1  130 ? 49.178  70.122 -21.534 1.00 34.76  ? 538  TYR D CD1   1 
ATOM   6534  C  CD2   . TYR B  1  130 ? 49.901  71.294 -19.581 1.00 36.23  ? 538  TYR D CD2   1 
ATOM   6535  C  CE1   . TYR B  1  130 ? 49.087  71.314 -22.223 1.00 37.06  ? 538  TYR D CE1   1 
ATOM   6536  C  CE2   . TYR B  1  130 ? 49.812  72.501 -20.259 1.00 36.68  ? 538  TYR D CE2   1 
ATOM   6537  C  CZ    . TYR B  1  130 ? 49.407  72.514 -21.571 1.00 38.36  ? 538  TYR D CZ    1 
ATOM   6538  O  OH    . TYR B  1  130 ? 49.317  73.703 -22.263 1.00 39.28  ? 538  TYR D OH    1 
ATOM   6539  N  N     . ILE B  1  131 ? 51.367  66.997 -17.495 1.00 33.97  ? 539  ILE D N     1 
ATOM   6540  C  CA    . ILE B  1  131 ? 51.299  65.987 -16.470 1.00 32.10  ? 539  ILE D CA    1 
ATOM   6541  C  C     . ILE B  1  131 ? 50.300  66.426 -15.400 1.00 33.55  ? 539  ILE D C     1 
ATOM   6542  O  O     . ILE B  1  131 ? 50.469  67.500 -14.804 1.00 32.37  ? 539  ILE D O     1 
ATOM   6543  C  CB    . ILE B  1  131 ? 52.687  65.776 -15.832 1.00 32.46  ? 539  ILE D CB    1 
ATOM   6544  C  CG1   . ILE B  1  131 ? 53.668  65.229 -16.880 1.00 30.52  ? 539  ILE D CG1   1 
ATOM   6545  C  CG2   . ILE B  1  131 ? 52.584  64.803 -14.646 1.00 32.67  ? 539  ILE D CG2   1 
ATOM   6546  C  CD1   . ILE B  1  131 ? 55.115  65.220 -16.342 1.00 28.66  ? 539  ILE D CD1   1 
ATOM   6547  N  N     . ALA B  1  132 ? 49.292  65.583 -15.160 1.00 31.53  ? 540  ALA D N     1 
ATOM   6548  C  CA    . ALA B  1  132 ? 48.326  65.872 -14.123 1.00 34.79  ? 540  ALA D CA    1 
ATOM   6549  C  C     . ALA B  1  132 ? 48.935  65.755 -12.743 1.00 35.43  ? 540  ALA D C     1 
ATOM   6550  O  O     . ALA B  1  132 ? 49.888  65.002 -12.539 1.00 35.28  ? 540  ALA D O     1 
ATOM   6551  C  CB    . ALA B  1  132 ? 47.106  64.938 -14.238 1.00 31.65  ? 540  ALA D CB    1 
ATOM   6552  N  N     . GLN B  1  133 ? 48.373  66.492 -11.783 1.00 35.50  ? 541  GLN D N     1 
ATOM   6553  C  CA    . GLN B  1  133 ? 48.876  66.488 -10.400 1.00 36.31  ? 541  GLN D CA    1 
ATOM   6554  C  C     . GLN B  1  133 ? 47.726  66.034 -9.484  1.00 35.52  ? 541  GLN D C     1 
ATOM   6555  O  O     . GLN B  1  133 ? 47.080  66.865 -8.819  1.00 34.86  ? 541  GLN D O     1 
ATOM   6556  C  CB    . GLN B  1  133 ? 49.341  67.888 -9.986  1.00 38.73  ? 541  GLN D CB    1 
ATOM   6557  C  CG    . GLN B  1  133 ? 50.506  68.412 -10.809 1.00 40.78  ? 541  GLN D CG    1 
ATOM   6558  C  CD    . GLN B  1  133 ? 51.826  67.727 -10.536 1.00 41.69  ? 541  GLN D CD    1 
ATOM   6559  O  OE1   . GLN B  1  133 ? 52.024  66.542 -10.866 1.00 46.94  ? 541  GLN D OE1   1 
ATOM   6560  N  NE2   . GLN B  1  133 ? 52.754  68.457 -9.972  1.00 44.91  ? 541  GLN D NE2   1 
ATOM   6561  N  N     . PRO B  1  134 ? 47.449  64.740 -9.434  1.00 32.52  ? 542  PRO D N     1 
ATOM   6562  C  CA    . PRO B  1  134 ? 46.447  64.244 -8.502  1.00 32.59  ? 542  PRO D CA    1 
ATOM   6563  C  C     . PRO B  1  134 ? 46.978  64.280 -7.088  1.00 31.55  ? 542  PRO D C     1 
ATOM   6564  O  O     . PRO B  1  134 ? 48.173  64.448 -6.875  1.00 32.50  ? 542  PRO D O     1 
ATOM   6565  C  CB    . PRO B  1  134 ? 46.256  62.775 -8.971  1.00 32.07  ? 542  PRO D CB    1 
ATOM   6566  C  CG    . PRO B  1  134 ? 47.561  62.396 -9.544  1.00 31.84  ? 542  PRO D CG    1 
ATOM   6567  C  CD    . PRO B  1  134 ? 48.079  63.653 -10.202 1.00 33.01  ? 542  PRO D CD    1 
ATOM   6568  N  N     . PRO B  1  135 ? 46.093  64.186 -6.086  1.00 35.02  ? 543  PRO D N     1 
ATOM   6569  C  CA    . PRO B  1  135 ? 46.546  64.254 -4.689  1.00 37.30  ? 543  PRO D CA    1 
ATOM   6570  C  C     . PRO B  1  135 ? 47.641  63.242 -4.402  1.00 42.07  ? 543  PRO D C     1 
ATOM   6571  O  O     . PRO B  1  135 ? 47.506  62.034 -4.756  1.00 44.10  ? 543  PRO D O     1 
ATOM   6572  C  CB    . PRO B  1  135 ? 45.281  63.920 -3.900  1.00 38.32  ? 543  PRO D CB    1 
ATOM   6573  C  CG    . PRO B  1  135 ? 44.179  64.455 -4.789  1.00 38.20  ? 543  PRO D CG    1 
ATOM   6574  C  CD    . PRO B  1  135 ? 44.612  64.133 -6.189  1.00 33.64  ? 543  PRO D CD    1 
ATOM   6575  N  N     . THR B  1  136 ? 48.733  63.679 -3.790  1.00 43.26  ? 544  THR D N     1 
ATOM   6576  C  CA    . THR B  1  136 ? 49.815  62.769 -3.454  1.00 45.08  ? 544  THR D CA    1 
ATOM   6577  C  C     . THR B  1  136 ? 49.516  62.018 -2.175  1.00 44.86  ? 544  THR D C     1 
ATOM   6578  O  O     . THR B  1  136 ? 48.629  62.368 -1.400  1.00 44.89  ? 544  THR D O     1 
ATOM   6579  C  CB    . THR B  1  136 ? 51.148  63.512 -3.292  1.00 48.61  ? 544  THR D CB    1 
ATOM   6580  O  OG1   . THR B  1  136 ? 50.923  64.691 -2.497  1.00 55.04  ? 544  THR D OG1   1 
ATOM   6581  C  CG2   . THR B  1  136 ? 51.682  63.939 -4.680  1.00 45.88  ? 544  THR D CG2   1 
ATOM   6582  N  N     . GLY B  1  137 ? 50.217  60.917 -1.935  1.00 43.69  ? 545  GLY D N     1 
ATOM   6583  C  CA    . GLY B  1  137 ? 49.940  60.044 -0.820  1.00 47.65  ? 545  GLY D CA    1 
ATOM   6584  C  C     . GLY B  1  137 ? 49.998  58.575 -1.324  1.00 51.87  ? 545  GLY D C     1 
ATOM   6585  O  O     . GLY B  1  137 ? 50.687  58.209 -2.275  1.00 47.98  ? 545  GLY D O     1 
ATOM   6586  N  N     . TYR B  1  138 ? 49.188  57.740 -0.563  1.00 42.00  ? 580  TYR D N     1 
ATOM   6587  C  CA    . TYR B  1  138 ? 49.165  56.320 -0.892  1.00 43.09  ? 580  TYR D CA    1 
ATOM   6588  C  C     . TYR B  1  138 ? 47.937  55.908 -1.716  1.00 42.17  ? 580  TYR D C     1 
ATOM   6589  O  O     . TYR B  1  138 ? 47.936  54.843 -2.327  1.00 44.70  ? 580  TYR D O     1 
ATOM   6590  C  CB    . TYR B  1  138 ? 49.296  55.471 0.352   1.00 43.26  ? 580  TYR D CB    1 
ATOM   6591  C  CG    . TYR B  1  138 ? 48.246  55.728 1.360   1.00 42.94  ? 580  TYR D CG    1 
ATOM   6592  C  CD1   . TYR B  1  138 ? 46.969  55.076 1.307   1.00 42.56  ? 580  TYR D CD1   1 
ATOM   6593  C  CD2   . TYR B  1  138 ? 48.503  56.622 2.430   1.00 43.37  ? 580  TYR D CD2   1 
ATOM   6594  C  CE1   . TYR B  1  138 ? 46.004  55.368 2.261   1.00 41.53  ? 580  TYR D CE1   1 
ATOM   6595  C  CE2   . TYR B  1  138 ? 47.532  56.873 3.404   1.00 44.59  ? 580  TYR D CE2   1 
ATOM   6596  C  CZ    . TYR B  1  138 ? 46.284  56.280 3.257   1.00 43.28  ? 580  TYR D CZ    1 
ATOM   6597  O  OH    . TYR B  1  138 ? 45.308  56.550 4.191   1.00 50.13  ? 580  TYR D OH    1 
ATOM   6598  N  N     A LYS B  1  139 ? 46.825  56.630 -1.582  0.50 39.21  ? 581  LYS D N     1 
ATOM   6599  N  N     B LYS B  1  139 ? 46.858  56.675 -1.617  0.50 41.62  ? 581  LYS D N     1 
ATOM   6600  C  CA    A LYS B  1  139 ? 45.684  56.349 -2.443  0.50 35.82  ? 581  LYS D CA    1 
ATOM   6601  C  CA    B LYS B  1  139 ? 45.689  56.399 -2.440  0.50 39.53  ? 581  LYS D CA    1 
ATOM   6602  C  C     A LYS B  1  139 ? 45.995  56.653 -3.905  0.50 36.48  ? 581  LYS D C     1 
ATOM   6603  C  C     B LYS B  1  139 ? 45.992  56.666 -3.913  0.50 38.72  ? 581  LYS D C     1 
ATOM   6604  O  O     A LYS B  1  139 ? 46.270  57.795 -4.326  0.50 37.65  ? 581  LYS D O     1 
ATOM   6605  O  O     B LYS B  1  139 ? 46.286  57.794 -4.354  0.50 39.57  ? 581  LYS D O     1 
ATOM   6606  C  CB    A LYS B  1  139 ? 44.453  57.093 -1.982  0.50 36.15  ? 581  LYS D CB    1 
ATOM   6607  C  CB    B LYS B  1  139 ? 44.521  57.226 -1.967  0.50 43.59  ? 581  LYS D CB    1 
ATOM   6608  C  CG    A LYS B  1  139 ? 43.804  56.462 -0.732  0.50 35.30  ? 581  LYS D CG    1 
ATOM   6609  C  CG    B LYS B  1  139 ? 43.157  56.647 -2.322  0.50 46.83  ? 581  LYS D CG    1 
ATOM   6610  C  CD    A LYS B  1  139 ? 42.267  56.666 -0.643  0.50 35.18  ? 581  LYS D CD    1 
ATOM   6611  C  CD    B LYS B  1  139 ? 42.118  57.108 -1.300  0.50 50.68  ? 581  LYS D CD    1 
ATOM   6612  C  CE    A LYS B  1  139 ? 41.628  55.531 0.195   0.50 38.80  ? 581  LYS D CE    1 
ATOM   6613  C  CE    B LYS B  1  139 ? 42.463  56.550 0.075   0.50 52.66  ? 581  LYS D CE    1 
ATOM   6614  N  NZ    A LYS B  1  139 ? 42.021  55.680 1.647   0.50 37.15  ? 581  LYS D NZ    1 
ATOM   6615  N  NZ    B LYS B  1  139 ? 42.160  55.072 0.264   0.50 56.94  ? 581  LYS D NZ    1 
ATOM   6616  N  N     . GLY B  1  140 ? 45.634  55.696 -4.729  1.00 34.85  ? 582  GLY D N     1 
ATOM   6617  C  CA    . GLY B  1  140 ? 45.736  55.840 -6.171  1.00 29.70  ? 582  GLY D CA    1 
ATOM   6618  C  C     . GLY B  1  140 ? 44.503  56.402 -6.836  1.00 27.66  ? 582  GLY D C     1 
ATOM   6619  O  O     . GLY B  1  140 ? 43.478  56.608 -6.193  1.00 28.12  ? 582  GLY D O     1 
ATOM   6620  N  N     . LEU B  1  141 ? 44.614  56.650 -8.114  1.00 25.99  ? 583  LEU D N     1 
ATOM   6621  C  CA    . LEU B  1  141 ? 43.476  57.193 -8.896  1.00 27.38  ? 583  LEU D CA    1 
ATOM   6622  C  C     . LEU B  1  141 ? 42.266  56.251 -8.805  1.00 27.52  ? 583  LEU D C     1 
ATOM   6623  O  O     . LEU B  1  141 ? 41.133  56.703 -8.698  1.00 28.23  ? 583  LEU D O     1 
ATOM   6624  C  CB    . LEU B  1  141 ? 43.845  57.381 -10.353 1.00 24.76  ? 583  LEU D CB    1 
ATOM   6625  C  CG    . LEU B  1  141 ? 44.995  58.420 -10.615 1.00 27.51  ? 583  LEU D CG    1 
ATOM   6626  C  CD1   . LEU B  1  141 ? 45.284  58.333 -12.164 1.00 26.12  ? 583  LEU D CD1   1 
ATOM   6627  C  CD2   . LEU B  1  141 ? 44.588  59.850 -10.194 1.00 25.44  ? 583  LEU D CD2   1 
ATOM   6628  N  N     . GLY B  1  142 ? 42.525  54.926 -8.847  1.00 26.72  ? 584  GLY D N     1 
ATOM   6629  C  CA    . GLY B  1  142 ? 41.425  53.994 -8.848  1.00 28.29  ? 584  GLY D CA    1 
ATOM   6630  C  C     . GLY B  1  142 ? 40.619  53.989 -7.554  1.00 28.29  ? 584  GLY D C     1 
ATOM   6631  O  O     . GLY B  1  142 ? 39.518  53.418 -7.517  1.00 28.18  ? 584  GLY D O     1 
ATOM   6632  N  N     . GLU B  1  143 ? 41.147  54.570 -6.503  1.00 27.65  ? 585  GLU D N     1 
ATOM   6633  C  CA    . GLU B  1  143 ? 40.468  54.609 -5.199  1.00 26.37  ? 585  GLU D CA    1 
ATOM   6634  C  C     . GLU B  1  143 ? 39.618  55.875 -4.981  1.00 28.12  ? 585  GLU D C     1 
ATOM   6635  O  O     . GLU B  1  143 ? 38.908  55.946 -3.991  1.00 27.96  ? 585  GLU D O     1 
ATOM   6636  C  CB    . GLU B  1  143 ? 41.488  54.497 -4.072  1.00 27.21  ? 585  GLU D CB    1 
ATOM   6637  C  CG    . GLU B  1  143 ? 42.331  53.215 -4.185  1.00 30.10  ? 585  GLU D CG    1 
ATOM   6638  C  CD    . GLU B  1  143 ? 43.442  53.190 -3.121  1.00 31.39  ? 585  GLU D CD    1 
ATOM   6639  O  OE1   . GLU B  1  143 ? 43.131  53.297 -1.932  1.00 33.57  ? 585  GLU D OE1   1 
ATOM   6640  O  OE2   . GLU B  1  143 ? 44.629  53.099 -3.473  1.00 29.45  ? 585  GLU D OE2   1 
ATOM   6641  N  N     . MET B  1  144 ? 39.665  56.849 -5.896  1.00 27.06  ? 586  MET D N     1 
ATOM   6642  C  CA    . MET B  1  144 ? 38.954  58.077 -5.717  1.00 30.55  ? 586  MET D CA    1 
ATOM   6643  C  C     . MET B  1  144 ? 37.584  58.006 -6.456  1.00 29.95  ? 586  MET D C     1 
ATOM   6644  O  O     . MET B  1  144 ? 37.431  57.263 -7.446  1.00 29.71  ? 586  MET D O     1 
ATOM   6645  C  CB    . MET B  1  144 ? 39.757  59.242 -6.286  1.00 31.86  ? 586  MET D CB    1 
ATOM   6646  C  CG    . MET B  1  144 ? 41.175  59.297 -5.707  1.00 34.40  ? 586  MET D CG    1 
ATOM   6647  S  SD    . MET B  1  144 ? 42.289  60.451 -6.587  1.00 39.13  ? 586  MET D SD    1 
ATOM   6648  C  CE    . MET B  1  144 ? 41.281  61.990 -6.442  1.00 38.20  ? 586  MET D CE    1 
ATOM   6649  N  N     . ASN B  1  145 ? 36.600  58.763 -5.980  1.00 29.14  ? 587  ASN D N     1 
ATOM   6650  C  CA    . ASN B  1  145 ? 35.384  58.869 -6.705  1.00 29.94  ? 587  ASN D CA    1 
ATOM   6651  C  C     . ASN B  1  145 ? 35.450  59.877 -7.822  1.00 29.98  ? 587  ASN D C     1 
ATOM   6652  O  O     . ASN B  1  145 ? 36.416  60.605 -7.967  1.00 30.63  ? 587  ASN D O     1 
ATOM   6653  C  CB    . ASN B  1  145 ? 34.195  59.160 -5.754  1.00 32.26  ? 587  ASN D CB    1 
ATOM   6654  C  CG    . ASN B  1  145 ? 34.344  60.493 -5.055  1.00 33.76  ? 587  ASN D CG    1 
ATOM   6655  O  OD1   . ASN B  1  145 ? 34.390  61.545 -5.688  1.00 36.59  ? 587  ASN D OD1   1 
ATOM   6656  N  ND2   . ASN B  1  145 ? 34.371  60.459 -3.723  1.00 33.21  ? 587  ASN D ND2   1 
ATOM   6657  N  N     . ALA B  1  146 ? 34.375  59.917 -8.657  1.00 30.11  ? 588  ALA D N     1 
ATOM   6658  C  CA    . ALA B  1  146 ? 34.371  60.753 -9.836  1.00 31.91  ? 588  ALA D CA    1 
ATOM   6659  C  C     . ALA B  1  146 ? 34.482  62.246 -9.503  1.00 31.82  ? 588  ALA D C     1 
ATOM   6660  O  O     . ALA B  1  146 ? 35.122  63.018 -10.204 1.00 31.03  ? 588  ALA D O     1 
ATOM   6661  C  CB    . ALA B  1  146 ? 33.158  60.466 -10.682 1.00 32.56  ? 588  ALA D CB    1 
ATOM   6662  N  N     . ASP B  1  147 ? 33.845  62.660 -8.412  1.00 34.48  ? 589  ASP D N     1 
ATOM   6663  C  CA    . ASP B  1  147 ? 33.882  64.086 -8.053  1.00 33.73  ? 589  ASP D CA    1 
ATOM   6664  C  C     . ASP B  1  147 ? 35.234  64.489 -7.522  1.00 32.89  ? 589  ASP D C     1 
ATOM   6665  O  O     . ASP B  1  147 ? 35.685  65.613 -7.788  1.00 31.72  ? 589  ASP D O     1 
ATOM   6666  C  CB    . ASP B  1  147 ? 32.764  64.351 -6.996  1.00 37.31  ? 589  ASP D CB    1 
ATOM   6667  C  CG    . ASP B  1  147 ? 31.377  64.243 -7.625  1.00 42.12  ? 589  ASP D CG    1 
ATOM   6668  O  OD1   . ASP B  1  147 ? 31.128  64.858 -8.675  1.00 43.48  ? 589  ASP D OD1   1 
ATOM   6669  O  OD2   . ASP B  1  147 ? 30.565  63.514 -7.067  1.00 46.82  ? 589  ASP D OD2   1 
ATOM   6670  N  N     . GLN B  1  148 ? 35.910  63.606 -6.765  1.00 35.72  ? 590  GLN D N     1 
ATOM   6671  C  CA    . GLN B  1  148 ? 37.256  63.915 -6.282  1.00 35.16  ? 590  GLN D CA    1 
ATOM   6672  C  C     . GLN B  1  148 ? 38.225  64.085 -7.443  1.00 35.31  ? 590  GLN D C     1 
ATOM   6673  O  O     . GLN B  1  148 ? 39.018  65.032 -7.459  1.00 38.06  ? 590  GLN D O     1 
ATOM   6674  C  CB    . GLN B  1  148 ? 37.740  62.809 -5.343  1.00 38.42  ? 590  GLN D CB    1 
ATOM   6675  C  CG    . GLN B  1  148 ? 36.980  62.767 -4.013  1.00 42.18  ? 590  GLN D CG    1 
ATOM   6676  C  CD    . GLN B  1  148 ? 37.295  61.468 -3.257  1.00 44.13  ? 590  GLN D CD    1 
ATOM   6677  O  OE1   . GLN B  1  148 ? 37.669  60.471 -3.832  1.00 39.23  ? 590  GLN D OE1   1 
ATOM   6678  N  NE2   . GLN B  1  148 ? 37.148  61.491 -1.946  1.00 44.98  ? 590  GLN D NE2   1 
ATOM   6679  N  N     . LEU B  1  149 ? 38.188  63.177 -8.410  1.00 31.79  ? 591  LEU D N     1 
ATOM   6680  C  CA    . LEU B  1  149 ? 39.055  63.291 -9.579  1.00 30.33  ? 591  LEU D CA    1 
ATOM   6681  C  C     . LEU B  1  149 ? 38.789  64.595 -10.334 1.00 31.05  ? 591  LEU D C     1 
ATOM   6682  O  O     . LEU B  1  149 ? 39.731  65.250 -10.812 1.00 29.77  ? 591  LEU D O     1 
ATOM   6683  C  CB    . LEU B  1  149 ? 38.838  62.103 -10.539 1.00 30.36  ? 591  LEU D CB    1 
ATOM   6684  C  CG    . LEU B  1  149 ? 39.368  60.758 -9.957  1.00 30.45  ? 591  LEU D CG    1 
ATOM   6685  C  CD1   . LEU B  1  149 ? 38.710  59.579 -10.661 1.00 32.20  ? 591  LEU D CD1   1 
ATOM   6686  C  CD2   . LEU B  1  149 ? 40.889  60.652 -10.081 1.00 32.62  ? 591  LEU D CD2   1 
ATOM   6687  N  N     . TRP B  1  150 ? 37.514  64.988 -10.449 1.00 30.50  ? 592  TRP D N     1 
ATOM   6688  C  CA    . TRP B  1  150 ? 37.194  66.248 -11.084 1.00 31.65  ? 592  TRP D CA    1 
ATOM   6689  C  C     . TRP B  1  150 ? 37.733  67.437 -10.271 1.00 34.35  ? 592  TRP D C     1 
ATOM   6690  O  O     . TRP B  1  150 ? 38.409  68.321 -10.826 1.00 34.96  ? 592  TRP D O     1 
ATOM   6691  C  CB    . TRP B  1  150 ? 35.687  66.367 -11.268 1.00 33.32  ? 592  TRP D CB    1 
ATOM   6692  C  CG    . TRP B  1  150 ? 35.241  67.772 -11.614 1.00 33.43  ? 592  TRP D CG    1 
ATOM   6693  C  CD1   . TRP B  1  150 ? 34.598  68.640 -10.802 1.00 34.72  ? 592  TRP D CD1   1 
ATOM   6694  C  CD2   . TRP B  1  150 ? 35.428  68.420 -12.871 1.00 33.60  ? 592  TRP D CD2   1 
ATOM   6695  N  NE1   . TRP B  1  150 ? 34.361  69.812 -11.476 1.00 37.26  ? 592  TRP D NE1   1 
ATOM   6696  C  CE2   . TRP B  1  150 ? 34.850  69.712 -12.746 1.00 36.54  ? 592  TRP D CE2   1 
ATOM   6697  C  CE3   . TRP B  1  150 ? 36.010  68.055 -14.087 1.00 31.70  ? 592  TRP D CE3   1 
ATOM   6698  C  CZ2   . TRP B  1  150 ? 34.841  70.639 -13.788 1.00 37.17  ? 592  TRP D CZ2   1 
ATOM   6699  C  CZ3   . TRP B  1  150 ? 36.013  68.968 -15.128 1.00 37.35  ? 592  TRP D CZ3   1 
ATOM   6700  C  CH2   . TRP B  1  150 ? 35.417  70.264 -14.976 1.00 35.69  ? 592  TRP D CH2   1 
ATOM   6701  N  N     . GLU B  1  151 ? 37.446  67.461 -8.972  1.00 36.76  ? 593  GLU D N     1 
ATOM   6702  C  CA    . GLU B  1  151 ? 37.755  68.660 -8.197  1.00 39.10  ? 593  GLU D CA    1 
ATOM   6703  C  C     . GLU B  1  151 ? 39.242  68.812 -7.917  1.00 38.84  ? 593  GLU D C     1 
ATOM   6704  O  O     . GLU B  1  151 ? 39.733  69.938 -7.764  1.00 36.05  ? 593  GLU D O     1 
ATOM   6705  C  CB    . GLU B  1  151 ? 36.959  68.663 -6.873  1.00 42.39  ? 593  GLU D CB    1 
ATOM   6706  C  CG    . GLU B  1  151 ? 35.492  69.006 -7.051  1.00 50.66  ? 593  GLU D CG    1 
ATOM   6707  C  CD    . GLU B  1  151 ? 35.275  70.405 -7.707  1.00 56.09  ? 593  GLU D CD    1 
ATOM   6708  O  OE1   . GLU B  1  151 ? 36.185  71.254 -7.685  1.00 56.37  ? 593  GLU D OE1   1 
ATOM   6709  O  OE2   . GLU B  1  151 ? 34.172  70.624 -8.244  1.00 60.03  ? 593  GLU D OE2   1 
ATOM   6710  N  N     . THR B  1  152 ? 39.987  67.710 -7.832  1.00 36.65  ? 594  THR D N     1 
ATOM   6711  C  CA    . THR B  1  152 ? 41.395  67.807 -7.525  1.00 38.55  ? 594  THR D CA    1 
ATOM   6712  C  C     . THR B  1  152 ? 42.286  67.811 -8.752  1.00 37.92  ? 594  THR D C     1 
ATOM   6713  O  O     . THR B  1  152 ? 43.382  68.398 -8.720  1.00 39.38  ? 594  THR D O     1 
ATOM   6714  C  CB    . THR B  1  152 ? 41.821  66.654 -6.607  1.00 40.06  ? 594  THR D CB    1 
ATOM   6715  O  OG1   . THR B  1  152 ? 41.642  65.409 -7.288  1.00 32.74  ? 594  THR D OG1   1 
ATOM   6716  C  CG2   . THR B  1  152 ? 40.992  66.673 -5.317  1.00 39.18  ? 594  THR D CG2   1 
ATOM   6717  N  N     . THR B  1  153 ? 41.839  67.206 -9.860  1.00 34.66  ? 595  THR D N     1 
ATOM   6718  C  CA    . THR B  1  153 ? 42.745  66.906 -10.936 1.00 32.77  ? 595  THR D CA    1 
ATOM   6719  C  C     . THR B  1  153 ? 42.324  67.370 -12.301 1.00 33.59  ? 595  THR D C     1 
ATOM   6720  O  O     . THR B  1  153 ? 43.159  67.713 -13.149 1.00 32.22  ? 595  THR D O     1 
ATOM   6721  C  CB    . THR B  1  153 ? 42.999  65.364 -10.964 1.00 32.09  ? 595  THR D CB    1 
ATOM   6722  O  OG1   . THR B  1  153 ? 43.144  64.884 -9.617  1.00 34.83  ? 595  THR D OG1   1 
ATOM   6723  C  CG2   . THR B  1  153 ? 44.279  65.060 -11.705 1.00 33.47  ? 595  THR D CG2   1 
ATOM   6724  N  N     . MET B  1  154 ? 41.001  67.417 -12.551 1.00 31.12  ? 596  MET D N     1 
ATOM   6725  C  CA    . MET B  1  154 ? 40.511  67.675 -13.913 1.00 33.15  ? 596  MET D CA    1 
ATOM   6726  C  C     . MET B  1  154 ? 39.854  69.034 -14.087 1.00 34.85  ? 596  MET D C     1 
ATOM   6727  O  O     . MET B  1  154 ? 39.827  69.540 -15.224 1.00 35.42  ? 596  MET D O     1 
ATOM   6728  C  CB    . MET B  1  154 ? 39.542  66.599 -14.329 1.00 33.52  ? 596  MET D CB    1 
ATOM   6729  C  CG    . MET B  1  154 ? 40.110  65.168 -14.187 1.00 37.64  ? 596  MET D CG    1 
ATOM   6730  S  SD    . MET B  1  154 ? 38.915  63.918 -14.758 1.00 38.66  ? 596  MET D SD    1 
ATOM   6731  C  CE    . MET B  1  154 ? 38.839  64.251 -16.478 1.00 40.59  ? 596  MET D CE    1 
ATOM   6732  N  N     . ASN B  1  155 ? 39.308  69.620 -13.020 1.00 35.77  ? 597  ASN D N     1 
ATOM   6733  C  CA    . ASN B  1  155 ? 38.626  70.912 -13.136 1.00 39.04  ? 597  ASN D CA    1 
ATOM   6734  C  C     . ASN B  1  155 ? 39.648  72.001 -13.521 1.00 39.16  ? 597  ASN D C     1 
ATOM   6735  O  O     . ASN B  1  155 ? 40.608  72.208 -12.776 1.00 39.08  ? 597  ASN D O     1 
ATOM   6736  C  CB    . ASN B  1  155 ? 37.957  71.267 -11.810 1.00 37.45  ? 597  ASN D CB    1 
ATOM   6737  C  CG    . ASN B  1  155 ? 37.103  72.539 -11.888 1.00 38.49  ? 597  ASN D CG    1 
ATOM   6738  O  OD1   . ASN B  1  155 ? 37.211  73.328 -12.820 1.00 36.35  ? 597  ASN D OD1   1 
ATOM   6739  N  ND2   . ASN B  1  155 ? 36.252  72.742 -10.898 1.00 37.13  ? 597  ASN D ND2   1 
ATOM   6740  N  N     . PRO B  1  156 ? 39.436  72.682 -14.619 1.00 44.05  ? 598  PRO D N     1 
ATOM   6741  C  CA    . PRO B  1  156 ? 40.392  73.720 -15.047 1.00 47.56  ? 598  PRO D CA    1 
ATOM   6742  C  C     . PRO B  1  156 ? 40.529  74.807 -14.011 1.00 49.83  ? 598  PRO D C     1 
ATOM   6743  O  O     . PRO B  1  156 ? 41.622  75.320 -13.782 1.00 53.90  ? 598  PRO D O     1 
ATOM   6744  C  CB    . PRO B  1  156 ? 39.757  74.287 -16.320 1.00 48.14  ? 598  PRO D CB    1 
ATOM   6745  C  CG    . PRO B  1  156 ? 38.936  73.166 -16.860 1.00 49.14  ? 598  PRO D CG    1 
ATOM   6746  C  CD    . PRO B  1  156 ? 38.428  72.393 -15.659 1.00 44.10  ? 598  PRO D CD    1 
ATOM   6747  N  N     . GLU B  1  157 ? 39.429  75.146 -13.373 1.00 51.47  ? 599  GLU D N     1 
ATOM   6748  C  CA    . GLU B  1  157 ? 39.428  76.168 -12.317 1.00 55.77  ? 599  GLU D CA    1 
ATOM   6749  C  C     . GLU B  1  157 ? 40.245  75.852 -11.075 1.00 53.38  ? 599  GLU D C     1 
ATOM   6750  O  O     . GLU B  1  157 ? 40.832  76.743 -10.506 1.00 58.75  ? 599  GLU D O     1 
ATOM   6751  C  CB    . GLU B  1  157 ? 37.994  76.593 -11.986 1.00 59.77  ? 599  GLU D CB    1 
ATOM   6752  C  CG    . GLU B  1  157 ? 37.283  77.166 -13.239 1.00 63.01  ? 599  GLU D CG    1 
ATOM   6753  C  CD    . GLU B  1  157 ? 35.935  77.777 -13.050 1.00 67.44  ? 599  GLU D CD    1 
ATOM   6754  O  OE1   . GLU B  1  157 ? 35.667  78.816 -13.725 1.00 68.71  ? 599  GLU D OE1   1 
ATOM   6755  O  OE2   . GLU B  1  157 ? 35.032  77.268 -12.319 1.00 68.78  ? 599  GLU D OE2   1 
ATOM   6756  N  N     . HIS B  1  158 ? 40.313  74.612 -10.637 1.00 52.79  ? 600  HIS D N     1 
ATOM   6757  C  CA    . HIS B  1  158 ? 41.079  74.265 -9.423  1.00 55.25  ? 600  HIS D CA    1 
ATOM   6758  C  C     . HIS B  1  158 ? 42.327  73.408 -9.555  1.00 55.15  ? 600  HIS D C     1 
ATOM   6759  O  O     . HIS B  1  158 ? 43.074  73.237 -8.596  1.00 56.54  ? 600  HIS D O     1 
ATOM   6760  C  CB    . HIS B  1  158 ? 40.117  73.619 -8.411  1.00 63.76  ? 600  HIS D CB    1 
ATOM   6761  C  CG    . HIS B  1  158 ? 39.116  74.573 -7.840  1.00 71.58  ? 600  HIS D CG    1 
ATOM   6762  N  ND1   . HIS B  1  158 ? 38.917  74.704 -6.481  1.00 77.66  ? 600  HIS D ND1   1 
ATOM   6763  C  CD2   . HIS B  1  158 ? 38.273  75.455 -8.440  1.00 78.26  ? 600  HIS D CD2   1 
ATOM   6764  C  CE1   . HIS B  1  158 ? 37.986  75.619 -6.270  1.00 79.28  ? 600  HIS D CE1   1 
ATOM   6765  N  NE2   . HIS B  1  158 ? 37.585  76.090 -7.442  1.00 82.99  ? 600  HIS D NE2   1 
ATOM   6766  N  N     . ARG B  1  159 ? 42.546  72.817 -10.722 1.00 50.08  ? 601  ARG D N     1 
ATOM   6767  C  CA    . ARG B  1  159 ? 43.679  71.872 -10.943 1.00 44.52  ? 601  ARG D CA    1 
ATOM   6768  C  C     . ARG B  1  159 ? 45.071  72.530 -11.151 1.00 42.64  ? 601  ARG D C     1 
ATOM   6769  O  O     . ARG B  1  159 ? 45.192  73.665 -11.546 1.00 46.15  ? 601  ARG D O     1 
ATOM   6770  C  CB    . ARG B  1  159 ? 43.372  71.035 -12.167 1.00 41.43  ? 601  ARG D CB    1 
ATOM   6771  C  CG    . ARG B  1  159 ? 43.549  71.803 -13.481 1.00 39.12  ? 601  ARG D CG    1 
ATOM   6772  C  CD    . ARG B  1  159 ? 43.025  71.030 -14.681 1.00 37.07  ? 601  ARG D CD    1 
ATOM   6773  N  NE    . ARG B  1  159 ? 43.312  71.770 -15.900 1.00 34.29  ? 601  ARG D NE    1 
ATOM   6774  C  CZ    . ARG B  1  159 ? 42.817  71.438 -17.098 1.00 33.26  ? 601  ARG D CZ    1 
ATOM   6775  N  NH1   . ARG B  1  159 ? 41.989  70.395 -17.222 1.00 32.59  ? 601  ARG D NH1   1 
ATOM   6776  N  NH2   . ARG B  1  159 ? 43.137  72.157 -18.169 1.00 33.06  ? 601  ARG D NH2   1 
ATOM   6777  N  N     . ALA B  1  160 ? 46.106  71.763 -10.906 1.00 40.95  ? 602  ALA D N     1 
ATOM   6778  C  CA    . ALA B  1  160 ? 47.475  72.132 -11.173 1.00 42.83  ? 602  ALA D CA    1 
ATOM   6779  C  C     . ALA B  1  160 ? 48.029  71.191 -12.223 1.00 42.78  ? 602  ALA D C     1 
ATOM   6780  O  O     . ALA B  1  160 ? 48.011  69.991 -12.015 1.00 47.76  ? 602  ALA D O     1 
ATOM   6781  C  CB    . ALA B  1  160 ? 48.343  72.080 -9.917  1.00 41.42  ? 602  ALA D CB    1 
ATOM   6782  N  N     . LEU B  1  161 ? 48.500  71.720 -13.338 1.00 40.24  ? 603  LEU D N     1 
ATOM   6783  C  CA    . LEU B  1  161 ? 49.090  70.935 -14.392 1.00 38.82  ? 603  LEU D CA    1 
ATOM   6784  C  C     . LEU B  1  161 ? 50.559  71.308 -14.552 1.00 40.87  ? 603  LEU D C     1 
ATOM   6785  O  O     . LEU B  1  161 ? 50.937  72.478 -14.364 1.00 39.95  ? 603  LEU D O     1 
ATOM   6786  C  CB    . LEU B  1  161 ? 48.352  71.137 -15.733 1.00 38.10  ? 603  LEU D CB    1 
ATOM   6787  C  CG    . LEU B  1  161 ? 46.931  70.684 -15.881 1.00 40.96  ? 603  LEU D CG    1 
ATOM   6788  C  CD1   . LEU B  1  161 ? 46.413  71.148 -17.258 1.00 40.20  ? 603  LEU D CD1   1 
ATOM   6789  C  CD2   . LEU B  1  161 ? 46.894  69.130 -15.630 1.00 40.83  ? 603  LEU D CD2   1 
ATOM   6790  N  N     . LEU B  1  162 ? 51.398  70.312 -14.880 1.00 40.82  ? 604  LEU D N     1 
ATOM   6791  C  CA    . LEU B  1  162 ? 52.758  70.561 -15.291 1.00 39.99  ? 604  LEU D CA    1 
ATOM   6792  C  C     . LEU B  1  162 ? 52.818  70.489 -16.815 1.00 39.93  ? 604  LEU D C     1 
ATOM   6793  O  O     . LEU B  1  162 ? 52.467  69.469 -17.425 1.00 40.45  ? 604  LEU D O     1 
ATOM   6794  C  CB    . LEU B  1  162 ? 53.704  69.499 -14.691 1.00 43.08  ? 604  LEU D CB    1 
ATOM   6795  C  CG    . LEU B  1  162 ? 53.781  69.434 -13.162 1.00 45.20  ? 604  LEU D CG    1 
ATOM   6796  C  CD1   . LEU B  1  162 ? 54.734  68.339 -12.731 1.00 45.25  ? 604  LEU D CD1   1 
ATOM   6797  C  CD2   . LEU B  1  162 ? 54.177  70.802 -12.557 1.00 47.84  ? 604  LEU D CD2   1 
ATOM   6798  N  N     . GLN B  1  163 ? 53.290  71.567 -17.432 1.00 39.52  ? 605  GLN D N     1 
ATOM   6799  C  CA    . GLN B  1  163 ? 53.443  71.590 -18.871 1.00 38.40  ? 605  GLN D CA    1 
ATOM   6800  C  C     . GLN B  1  163 ? 54.821  71.079 -19.169 1.00 37.84  ? 605  GLN D C     1 
ATOM   6801  O  O     . GLN B  1  163 ? 55.811  71.663 -18.689 1.00 38.72  ? 605  GLN D O     1 
ATOM   6802  C  CB    . GLN B  1  163 ? 53.277  73.002 -19.414 1.00 39.39  ? 605  GLN D CB    1 
ATOM   6803  C  CG    . GLN B  1  163 ? 53.499  73.069 -20.919 1.00 40.95  ? 605  GLN D CG    1 
ATOM   6804  C  CD    . GLN B  1  163 ? 53.198  74.425 -21.492 1.00 44.96  ? 605  GLN D CD    1 
ATOM   6805  O  OE1   . GLN B  1  163 ? 53.571  75.447 -20.901 1.00 43.84  ? 605  GLN D OE1   1 
ATOM   6806  N  NE2   . GLN B  1  163 ? 52.580  74.442 -22.655 1.00 46.32  ? 605  GLN D NE2   1 
ATOM   6807  N  N     . VAL B  1  164 ? 54.909  70.010 -19.949 1.00 36.53  ? 606  VAL D N     1 
ATOM   6808  C  CA    . VAL B  1  164 ? 56.205  69.413 -20.254 1.00 37.16  ? 606  VAL D CA    1 
ATOM   6809  C  C     . VAL B  1  164 ? 56.970  70.315 -21.248 1.00 40.69  ? 606  VAL D C     1 
ATOM   6810  O  O     . VAL B  1  164 ? 56.481  70.602 -22.344 1.00 39.08  ? 606  VAL D O     1 
ATOM   6811  C  CB    . VAL B  1  164 ? 56.033  68.007 -20.875 1.00 35.57  ? 606  VAL D CB    1 
ATOM   6812  C  CG1   . VAL B  1  164 ? 57.374  67.417 -21.215 1.00 36.86  ? 606  VAL D CG1   1 
ATOM   6813  C  CG2   . VAL B  1  164 ? 55.310  67.128 -19.864 1.00 33.89  ? 606  VAL D CG2   1 
ATOM   6814  N  N     . LYS B  1  165 ? 58.186  70.685 -20.841 1.00 40.83  ? 607  LYS D N     1 
ATOM   6815  C  CA    . LYS B  1  165 ? 59.041  71.496 -21.713 1.00 45.20  ? 607  LYS D CA    1 
ATOM   6816  C  C     . LYS B  1  165 ? 60.375  70.868 -22.045 1.00 46.56  ? 607  LYS D C     1 
ATOM   6817  O  O     . LYS B  1  165 ? 61.061  70.340 -21.170 1.00 46.31  ? 607  LYS D O     1 
ATOM   6818  C  CB    . LYS B  1  165 ? 59.245  72.890 -21.090 1.00 46.14  ? 607  LYS D CB    1 
ATOM   6819  C  CG    . LYS B  1  165 ? 60.275  73.724 -21.822 1.00 51.75  ? 607  LYS D CG    1 
ATOM   6820  C  CD    . LYS B  1  165 ? 59.937  75.186 -21.923 1.00 57.64  ? 607  LYS D CD    1 
ATOM   6821  C  CE    . LYS B  1  165 ? 60.933  75.886 -22.878 1.00 56.73  ? 607  LYS D CE    1 
ATOM   6822  N  NZ    . LYS B  1  165 ? 62.265  76.069 -22.270 1.00 63.57  ? 607  LYS D NZ    1 
ATOM   6823  N  N     . LEU B  1  166 ? 60.771  70.947 -23.307 1.00 47.09  ? 608  LEU D N     1 
ATOM   6824  C  CA    . LEU B  1  166 ? 62.073  70.419 -23.746 1.00 47.86  ? 608  LEU D CA    1 
ATOM   6825  C  C     . LEU B  1  166 ? 63.149  71.502 -23.852 1.00 52.91  ? 608  LEU D C     1 
ATOM   6826  O  O     . LEU B  1  166 ? 63.233  72.224 -24.864 1.00 51.62  ? 608  LEU D O     1 
ATOM   6827  C  CB    . LEU B  1  166 ? 61.881  69.753 -25.094 1.00 44.81  ? 608  LEU D CB    1 
ATOM   6828  C  CG    . LEU B  1  166 ? 63.174  69.514 -25.912 1.00 47.31  ? 608  LEU D CG    1 
ATOM   6829  C  CD1   . LEU B  1  166 ? 64.004  68.510 -25.141 1.00 44.98  ? 608  LEU D CD1   1 
ATOM   6830  C  CD2   . LEU B  1  166 ? 62.826  68.959 -27.261 1.00 49.07  ? 608  LEU D CD2   1 
ATOM   6831  N  N     . GLU B  1  167 ? 63.911  71.703 -22.782 1.00 56.36  ? 609  GLU D N     1 
ATOM   6832  C  CA    . GLU B  1  167 ? 65.004  72.687 -22.768 1.00 58.57  ? 609  GLU D CA    1 
ATOM   6833  C  C     . GLU B  1  167 ? 66.221  72.437 -23.681 1.00 62.80  ? 609  GLU D C     1 
ATOM   6834  O  O     . GLU B  1  167 ? 66.678  73.336 -24.356 1.00 70.22  ? 609  GLU D O     1 
ATOM   6835  C  CB    . GLU B  1  167 ? 65.464  72.902 -21.336 1.00 64.08  ? 609  GLU D CB    1 
ATOM   6836  C  CG    . GLU B  1  167 ? 64.356  73.437 -20.430 1.00 70.51  ? 609  GLU D CG    1 
ATOM   6837  C  CD    . GLU B  1  167 ? 64.128  74.914 -20.546 1.00 76.57  ? 609  GLU D CD    1 
ATOM   6838  O  OE1   . GLU B  1  167 ? 65.102  75.657 -20.671 1.00 80.59  ? 609  GLU D OE1   1 
ATOM   6839  O  OE2   . GLU B  1  167 ? 62.987  75.330 -20.434 1.00 80.51  ? 609  GLU D OE2   1 
ATOM   6840  N  N     . ASP B  1  168 ? 66.770  71.248 -23.689 1.00 59.23  ? 610  ASP D N     1 
ATOM   6841  C  CA    . ASP B  1  168 ? 67.959  70.904 -24.470 1.00 57.02  ? 610  ASP D CA    1 
ATOM   6842  C  C     . ASP B  1  168 ? 67.751  69.549 -25.156 1.00 56.18  ? 610  ASP D C     1 
ATOM   6843  O  O     . ASP B  1  168 ? 67.622  68.511 -24.492 1.00 55.97  ? 610  ASP D O     1 
ATOM   6844  C  CB    . ASP B  1  168 ? 69.161  70.795 -23.517 1.00 57.90  ? 610  ASP D CB    1 
ATOM   6845  C  CG    . ASP B  1  168 ? 70.460  70.434 -24.227 1.00 62.07  ? 610  ASP D CG    1 
ATOM   6846  O  OD1   . ASP B  1  168 ? 70.419  69.913 -25.364 1.00 66.02  ? 610  ASP D OD1   1 
ATOM   6847  O  OD2   . ASP B  1  168 ? 71.524  70.661 -23.621 1.00 59.21  ? 610  ASP D OD2   1 
ATOM   6848  N  N     . ALA B  1  169 ? 67.733  69.554 -26.488 1.00 52.39  ? 611  ALA D N     1 
ATOM   6849  C  CA    . ALA B  1  169 ? 67.501  68.339 -27.252 1.00 50.16  ? 611  ALA D CA    1 
ATOM   6850  C  C     . ALA B  1  169 ? 68.579  67.256 -27.105 1.00 51.79  ? 611  ALA D C     1 
ATOM   6851  O  O     . ALA B  1  169 ? 68.278  66.063 -27.024 1.00 44.49  ? 611  ALA D O     1 
ATOM   6852  C  CB    . ALA B  1  169 ? 67.234  68.644 -28.697 1.00 51.81  ? 611  ALA D CB    1 
ATOM   6853  N  N     . ILE B  1  170 ? 69.846  67.675 -27.103 1.00 51.33  ? 612  ILE D N     1 
ATOM   6854  C  CA    . ILE B  1  170 ? 70.934  66.712 -26.997 1.00 52.54  ? 612  ILE D CA    1 
ATOM   6855  C  C     . ILE B  1  170 ? 70.902  65.994 -25.657 1.00 51.97  ? 612  ILE D C     1 
ATOM   6856  O  O     . ILE B  1  170 ? 71.081  64.789 -25.587 1.00 51.35  ? 612  ILE D O     1 
ATOM   6857  C  CB    . ILE B  1  170 ? 72.292  67.372 -27.225 1.00 53.72  ? 612  ILE D CB    1 
ATOM   6858  C  CG1   . ILE B  1  170 ? 72.313  68.084 -28.579 1.00 58.15  ? 612  ILE D CG1   1 
ATOM   6859  C  CG2   . ILE B  1  170 ? 73.395  66.308 -27.169 1.00 52.55  ? 612  ILE D CG2   1 
ATOM   6860  C  CD1   . ILE B  1  170 ? 71.955  67.222 -29.804 1.00 59.07  ? 612  ILE D CD1   1 
ATOM   6861  N  N     . GLU B  1  171 ? 70.663  66.757 -24.593 1.00 55.93  ? 613  GLU D N     1 
ATOM   6862  C  CA    . GLU B  1  171 ? 70.606  66.213 -23.248 1.00 53.31  ? 613  GLU D CA    1 
ATOM   6863  C  C     . GLU B  1  171 ? 69.436  65.232 -23.164 1.00 50.45  ? 613  GLU D C     1 
ATOM   6864  O  O     . GLU B  1  171 ? 69.538  64.184 -22.546 1.00 49.97  ? 613  GLU D O     1 
ATOM   6865  C  CB    . GLU B  1  171 ? 70.425  67.335 -22.239 1.00 56.39  ? 613  GLU D CB    1 
ATOM   6866  C  CG    . GLU B  1  171 ? 70.634  66.929 -20.790 1.00 61.70  ? 613  GLU D CG    1 
ATOM   6867  C  CD    . GLU B  1  171 ? 70.229  68.049 -19.837 1.00 68.67  ? 613  GLU D CD    1 
ATOM   6868  O  OE1   . GLU B  1  171 ? 69.123  68.649 -20.018 1.00 76.61  ? 613  GLU D OE1   1 
ATOM   6869  O  OE2   . GLU B  1  171 ? 70.986  68.350 -18.867 1.00 74.69  ? 613  GLU D OE2   1 
ATOM   6870  N  N     . ALA B  1  172 ? 68.337  65.591 -23.803 1.00 49.21  ? 614  ALA D N     1 
ATOM   6871  C  CA    . ALA B  1  172 ? 67.155  64.753 -23.817 1.00 48.93  ? 614  ALA D CA    1 
ATOM   6872  C  C     . ALA B  1  172 ? 67.422  63.469 -24.579 1.00 47.41  ? 614  ALA D C     1 
ATOM   6873  O  O     . ALA B  1  172 ? 67.061  62.393 -24.128 1.00 45.65  ? 614  ALA D O     1 
ATOM   6874  C  CB    . ALA B  1  172 ? 65.974  65.501 -24.433 1.00 49.89  ? 614  ALA D CB    1 
ATOM   6875  N  N     . ASP B  1  173 ? 68.065  63.562 -25.728 1.00 46.75  ? 615  ASP D N     1 
ATOM   6876  C  CA    . ASP B  1  173 ? 68.317  62.354 -26.516 1.00 44.24  ? 615  ASP D CA    1 
ATOM   6877  C  C     . ASP B  1  173 ? 69.134  61.367 -25.707 1.00 42.03  ? 615  ASP D C     1 
ATOM   6878  O  O     . ASP B  1  173 ? 68.860  60.180 -25.706 1.00 41.99  ? 615  ASP D O     1 
ATOM   6879  C  CB    . ASP B  1  173 ? 69.077  62.695 -27.807 1.00 49.18  ? 615  ASP D CB    1 
ATOM   6880  C  CG    . ASP B  1  173 ? 68.154  63.219 -28.897 1.00 53.64  ? 615  ASP D CG    1 
ATOM   6881  O  OD1   . ASP B  1  173 ? 66.944  63.347 -28.662 1.00 55.84  ? 615  ASP D OD1   1 
ATOM   6882  O  OD2   . ASP B  1  173 ? 68.665  63.492 -30.006 1.00 59.79  ? 615  ASP D OD2   1 
ATOM   6883  N  N     . GLN B  1  174 ? 70.158  61.852 -25.015 1.00 41.85  ? 616  GLN D N     1 
ATOM   6884  C  CA    . GLN B  1  174 ? 70.992  61.001 -24.197 1.00 43.53  ? 616  GLN D CA    1 
ATOM   6885  C  C     . GLN B  1  174 ? 70.246  60.418 -23.011 1.00 40.75  ? 616  GLN D C     1 
ATOM   6886  O  O     . GLN B  1  174 ? 70.430  59.248 -22.671 1.00 39.92  ? 616  GLN D O     1 
ATOM   6887  C  CB    . GLN B  1  174 ? 72.235  61.769 -23.738 1.00 46.27  ? 616  GLN D CB    1 
ATOM   6888  C  CG    . GLN B  1  174 ? 73.136  62.169 -24.929 1.00 53.60  ? 616  GLN D CG    1 
ATOM   6889  C  CD    . GLN B  1  174 ? 74.246  63.083 -24.560 1.00 59.56  ? 616  GLN D CD    1 
ATOM   6890  O  OE1   . GLN B  1  174 ? 74.287  63.614 -23.449 1.00 62.71  ? 616  GLN D OE1   1 
ATOM   6891  N  NE2   . GLN B  1  174 ? 75.192  63.242 -25.474 1.00 60.37  ? 616  GLN D NE2   1 
ATOM   6892  N  N     . THR B  1  175 ? 69.400  61.232 -22.385 1.00 40.39  ? 617  THR D N     1 
ATOM   6893  C  CA    . THR B  1  175 ? 68.614  60.803 -21.221 1.00 38.95  ? 617  THR D CA    1 
ATOM   6894  C  C     . THR B  1  175 ? 67.660  59.681 -21.576 1.00 38.19  ? 617  THR D C     1 
ATOM   6895  O  O     . THR B  1  175 ? 67.548  58.705 -20.849 1.00 35.49  ? 617  THR D O     1 
ATOM   6896  C  CB    . THR B  1  175 ? 67.853  61.962 -20.601 1.00 40.98  ? 617  THR D CB    1 
ATOM   6897  O  OG1   . THR B  1  175 ? 68.770  62.927 -20.101 1.00 47.36  ? 617  THR D OG1   1 
ATOM   6898  C  CG2   . THR B  1  175 ? 66.974  61.500 -19.462 1.00 41.36  ? 617  THR D CG2   1 
ATOM   6899  N  N     . PHE B  1  176 ? 66.938  59.829 -22.672 1.00 34.55  ? 618  PHE D N     1 
ATOM   6900  C  CA    . PHE B  1  176 ? 66.002  58.789 -23.092 1.00 35.34  ? 618  PHE D CA    1 
ATOM   6901  C  C     . PHE B  1  176 ? 66.773  57.532 -23.426 1.00 34.45  ? 618  PHE D C     1 
ATOM   6902  O  O     . PHE B  1  176 ? 66.355  56.426 -23.121 1.00 33.06  ? 618  PHE D O     1 
ATOM   6903  C  CB    . PHE B  1  176 ? 65.099  59.246 -24.219 1.00 35.56  ? 618  PHE D CB    1 
ATOM   6904  C  CG    . PHE B  1  176 ? 63.929  60.068 -23.778 1.00 37.10  ? 618  PHE D CG    1 
ATOM   6905  C  CD1   . PHE B  1  176 ? 62.758  59.465 -23.242 1.00 34.64  ? 618  PHE D CD1   1 
ATOM   6906  C  CD2   . PHE B  1  176 ? 63.984  61.435 -23.822 1.00 38.39  ? 618  PHE D CD2   1 
ATOM   6907  C  CE1   . PHE B  1  176 ? 61.678  60.217 -22.881 1.00 34.43  ? 618  PHE D CE1   1 
ATOM   6908  C  CE2   . PHE B  1  176 ? 62.889  62.214 -23.388 1.00 38.23  ? 618  PHE D CE2   1 
ATOM   6909  C  CZ    . PHE B  1  176 ? 61.712  61.643 -22.916 1.00 34.72  ? 618  PHE D CZ    1 
ATOM   6910  N  N     . GLU B  1  177 ? 67.931  57.704 -24.102 1.00 33.79  ? 619  GLU D N     1 
ATOM   6911  C  CA    . GLU B  1  177 ? 68.724  56.606 -24.499 1.00 36.04  ? 619  GLU D CA    1 
ATOM   6912  C  C     . GLU B  1  177 ? 69.268  55.829 -23.296 1.00 35.67  ? 619  GLU D C     1 
ATOM   6913  O  O     . GLU B  1  177 ? 69.247  54.594 -23.298 1.00 35.04  ? 619  GLU D O     1 
ATOM   6914  C  CB    . GLU B  1  177 ? 69.895  57.099 -25.343 1.00 38.34  ? 619  GLU D CB    1 
ATOM   6915  C  CG    . GLU B  1  177 ? 70.734  55.958 -25.982 1.00 43.94  ? 619  GLU D CG    1 
ATOM   6916  C  CD    . GLU B  1  177 ? 71.943  56.544 -26.718 1.00 45.09  ? 619  GLU D CD    1 
ATOM   6917  O  OE1   . GLU B  1  177 ? 71.739  57.654 -27.371 1.00 52.85  ? 619  GLU D OE1   1 
ATOM   6918  O  OE2   . GLU B  1  177 ? 73.058  55.985 -26.566 1.00 49.20  ? 619  GLU D OE2   1 
ATOM   6919  N  N     . MET B  1  178 ? 69.726  56.547 -22.279 1.00 37.14  ? 620  MET D N     1 
ATOM   6920  C  CA    . MET B  1  178 ? 70.287  55.903 -21.100 1.00 40.89  ? 620  MET D CA    1 
ATOM   6921  C  C     . MET B  1  178 ? 69.213  55.233 -20.255 1.00 38.05  ? 620  MET D C     1 
ATOM   6922  O  O     . MET B  1  178 ? 69.368  54.049 -19.860 1.00 34.07  ? 620  MET D O     1 
ATOM   6923  C  CB    . MET B  1  178 ? 71.059  56.911 -20.262 1.00 42.07  ? 620  MET D CB    1 
ATOM   6924  C  CG    . MET B  1  178 ? 71.546  56.391 -18.920 1.00 51.11  ? 620  MET D CG    1 
ATOM   6925  S  SD    . MET B  1  178 ? 72.130  57.758 -17.861 1.00 58.80  ? 620  MET D SD    1 
ATOM   6926  C  CE    . MET B  1  178 ? 70.615  58.732 -17.673 1.00 57.21  ? 620  MET D CE    1 
ATOM   6927  N  N     . LEU B  1  179 ? 68.135  55.942 -19.956 1.00 36.28  ? 621  LEU D N     1 
ATOM   6928  C  CA    . LEU B  1  179 ? 67.121  55.415 -19.044 1.00 35.28  ? 621  LEU D CA    1 
ATOM   6929  C  C     . LEU B  1  179 ? 66.300  54.316 -19.690 1.00 34.93  ? 621  LEU D C     1 
ATOM   6930  O  O     . LEU B  1  179 ? 65.998  53.313 -19.049 1.00 34.78  ? 621  LEU D O     1 
ATOM   6931  C  CB    . LEU B  1  179 ? 66.207  56.560 -18.564 1.00 35.66  ? 621  LEU D CB    1 
ATOM   6932  C  CG    . LEU B  1  179 ? 66.854  57.691 -17.763 1.00 35.00  ? 621  LEU D CG    1 
ATOM   6933  C  CD1   . LEU B  1  179 ? 65.900  58.753 -17.416 1.00 33.34  ? 621  LEU D CD1   1 
ATOM   6934  C  CD2   . LEU B  1  179 ? 67.422  57.149 -16.474 1.00 34.12  ? 621  LEU D CD2   1 
ATOM   6935  N  N     . MET B  1  180 ? 65.926  54.487 -20.960 1.00 33.26  ? 622  MET D N     1 
ATOM   6936  C  CA    . MET B  1  180 ? 64.947  53.597 -21.583 1.00 31.28  ? 622  MET D CA    1 
ATOM   6937  C  C     . MET B  1  180 ? 65.534  52.680 -22.630 1.00 32.14  ? 622  MET D C     1 
ATOM   6938  O  O     . MET B  1  180 ? 64.814  51.824 -23.149 1.00 34.29  ? 622  MET D O     1 
ATOM   6939  C  CB    . MET B  1  180 ? 63.808  54.416 -22.204 1.00 31.78  ? 622  MET D CB    1 
ATOM   6940  C  CG    . MET B  1  180 ? 63.302  55.567 -21.324 1.00 30.90  ? 622  MET D CG    1 
ATOM   6941  S  SD    . MET B  1  180 ? 62.743  55.057 -19.718 1.00 32.00  ? 622  MET D SD    1 
ATOM   6942  C  CE    . MET B  1  180 ? 61.253  54.055 -20.153 1.00 27.85  ? 622  MET D CE    1 
ATOM   6943  N  N     . GLY B  1  181 ? 66.812  52.828 -22.956 1.00 33.17  ? 623  GLY D N     1 
ATOM   6944  C  CA    . GLY B  1  181 ? 67.371  52.036 -24.091 1.00 35.45  ? 623  GLY D CA    1 
ATOM   6945  C  C     . GLY B  1  181 ? 67.824  50.641 -23.567 1.00 38.85  ? 623  GLY D C     1 
ATOM   6946  O  O     . GLY B  1  181 ? 67.525  50.214 -22.480 1.00 35.41  ? 623  GLY D O     1 
ATOM   6947  N  N     . ASP B  1  182 ? 68.516  49.966 -24.501 1.00 41.30  ? 624  ASP D N     1 
ATOM   6948  C  CA    . ASP B  1  182 ? 68.803  48.531 -24.265 1.00 40.81  ? 624  ASP D CA    1 
ATOM   6949  C  C     . ASP B  1  182 ? 70.096  48.256 -23.511 1.00 39.07  ? 624  ASP D C     1 
ATOM   6950  O  O     . ASP B  1  182 ? 70.293  47.118 -23.108 1.00 40.36  ? 624  ASP D O     1 
ATOM   6951  C  CB    . ASP B  1  182 ? 68.815  47.755 -25.580 1.00 44.88  ? 624  ASP D CB    1 
ATOM   6952  C  CG    . ASP B  1  182 ? 69.758  48.391 -26.602 1.00 50.77  ? 624  ASP D CG    1 
ATOM   6953  O  OD1   . ASP B  1  182 ? 70.732  49.149 -26.194 1.00 51.40  ? 624  ASP D OD1   1 
ATOM   6954  O  OD2   . ASP B  1  182 ? 69.534  48.091 -27.827 1.00 59.00  ? 624  ASP D OD2   1 
ATOM   6955  N  N     . VAL B  1  183 ? 70.938  49.259 -23.288 1.00 35.47  ? 625  VAL D N     1 
ATOM   6956  C  CA    . VAL B  1  183 ? 72.234  49.017 -22.614 1.00 36.12  ? 625  VAL D CA    1 
ATOM   6957  C  C     . VAL B  1  183 ? 71.946  49.085 -21.099 1.00 33.06  ? 625  VAL D C     1 
ATOM   6958  O  O     . VAL B  1  183 ? 71.766  50.172 -20.514 1.00 31.17  ? 625  VAL D O     1 
ATOM   6959  C  CB    . VAL B  1  183 ? 73.248  50.103 -22.994 1.00 35.12  ? 625  VAL D CB    1 
ATOM   6960  C  CG1   . VAL B  1  183 ? 74.573  49.843 -22.251 1.00 34.98  ? 625  VAL D CG1   1 
ATOM   6961  C  CG2   . VAL B  1  183 ? 73.529  49.976 -24.530 1.00 36.67  ? 625  VAL D CG2   1 
ATOM   6962  N  N     . VAL B  1  184 ? 71.921  47.905 -20.468 1.00 32.92  ? 626  VAL D N     1 
ATOM   6963  C  CA    . VAL B  1  184 ? 71.520  47.811 -19.083 1.00 32.95  ? 626  VAL D CA    1 
ATOM   6964  C  C     . VAL B  1  184 ? 72.517  48.500 -18.160 1.00 34.81  ? 626  VAL D C     1 
ATOM   6965  O  O     . VAL B  1  184 ? 72.144  49.149 -17.178 1.00 36.14  ? 626  VAL D O     1 
ATOM   6966  C  CB    . VAL B  1  184 ? 71.291  46.323 -18.682 1.00 31.97  ? 626  VAL D CB    1 
ATOM   6967  C  CG1   . VAL B  1  184 ? 71.158  46.125 -17.189 1.00 28.39  ? 626  VAL D CG1   1 
ATOM   6968  C  CG2   . VAL B  1  184 ? 70.135  45.737 -19.462 1.00 31.48  ? 626  VAL D CG2   1 
ATOM   6969  N  N     . GLU B  1  185 ? 73.828  48.354 -18.471 1.00 36.97  ? 627  GLU D N     1 
ATOM   6970  C  CA    . GLU B  1  185 ? 74.851  48.714 -17.498 1.00 38.48  ? 627  GLU D CA    1 
ATOM   6971  C  C     . GLU B  1  185 ? 74.872  50.247 -17.257 1.00 37.81  ? 627  GLU D C     1 
ATOM   6972  O  O     . GLU B  1  185 ? 75.061  50.681 -16.126 1.00 39.95  ? 627  GLU D O     1 
ATOM   6973  C  CB    . GLU B  1  185 ? 76.219  48.245 -18.007 1.00 40.53  ? 627  GLU D CB    1 
ATOM   6974  C  CG    . GLU B  1  185 ? 77.436  48.736 -17.192 1.00 39.96  ? 627  GLU D CG    1 
ATOM   6975  C  CD    . GLU B  1  185 ? 77.396  48.336 -15.744 1.00 42.82  ? 627  GLU D CD    1 
ATOM   6976  O  OE1   . GLU B  1  185 ? 76.669  47.344 -15.401 1.00 45.17  ? 627  GLU D OE1   1 
ATOM   6977  O  OE2   . GLU B  1  185 ? 78.080  48.981 -14.929 1.00 46.09  ? 627  GLU D OE2   1 
ATOM   6978  N  N     . ASN B  1  186 ? 74.688  51.050 -18.281 1.00 37.99  ? 628  ASN D N     1 
ATOM   6979  C  CA    . ASN B  1  186 ? 74.643  52.478 -18.076 1.00 37.66  ? 628  ASN D CA    1 
ATOM   6980  C  C     . ASN B  1  186 ? 73.417  52.901 -17.285 1.00 35.81  ? 628  ASN D C     1 
ATOM   6981  O  O     . ASN B  1  186 ? 73.492  53.821 -16.473 1.00 36.14  ? 628  ASN D O     1 
ATOM   6982  C  CB    . ASN B  1  186 ? 74.649  53.291 -19.391 1.00 38.32  ? 628  ASN D CB    1 
ATOM   6983  C  CG    . ASN B  1  186 ? 75.938  53.062 -20.209 1.00 44.53  ? 628  ASN D CG    1 
ATOM   6984  O  OD1   . ASN B  1  186 ? 77.019  52.933 -19.645 1.00 44.40  ? 628  ASN D OD1   1 
ATOM   6985  N  ND2   . ASN B  1  186 ? 75.796  53.024 -21.521 1.00 44.67  ? 628  ASN D ND2   1 
ATOM   6986  N  N     . ARG B  1  187 ? 72.294  52.220 -17.481 1.00 34.20  ? 629  ARG D N     1 
ATOM   6987  C  CA    . ARG B  1  187 ? 71.106  52.444 -16.664 1.00 32.23  ? 629  ARG D CA    1 
ATOM   6988  C  C     . ARG B  1  187 ? 71.376  52.063 -15.203 1.00 31.93  ? 629  ARG D C     1 
ATOM   6989  O  O     . ARG B  1  187 ? 71.003  52.821 -14.289 1.00 33.35  ? 629  ARG D O     1 
ATOM   6990  C  CB    . ARG B  1  187 ? 69.934  51.666 -17.238 1.00 30.87  ? 629  ARG D CB    1 
ATOM   6991  C  CG    . ARG B  1  187 ? 68.710  51.603 -16.303 1.00 29.00  ? 629  ARG D CG    1 
ATOM   6992  C  CD    . ARG B  1  187 ? 67.448  51.133 -17.020 1.00 29.49  ? 629  ARG D CD    1 
ATOM   6993  N  NE    . ARG B  1  187 ? 67.688  49.872 -17.862 1.00 30.96  ? 629  ARG D NE    1 
ATOM   6994  C  CZ    . ARG B  1  187 ? 67.813  49.863 -19.173 1.00 31.62  ? 629  ARG D CZ    1 
ATOM   6995  N  NH1   . ARG B  1  187 ? 67.751  50.977 -19.877 1.00 30.88  ? 629  ARG D NH1   1 
ATOM   6996  N  NH2   . ARG B  1  187 ? 67.975  48.759 -19.777 1.00 32.24  ? 629  ARG D NH2   1 
ATOM   6997  N  N     . ARG B  1  188 ? 72.040  50.939 -14.976 1.00 33.72  ? 630  ARG D N     1 
ATOM   6998  C  CA    . ARG B  1  188 ? 72.386  50.543 -13.614 1.00 32.24  ? 630  ARG D CA    1 
ATOM   6999  C  C     . ARG B  1  188 ? 73.326  51.568 -12.945 1.00 35.03  ? 630  ARG D C     1 
ATOM   7000  O  O     . ARG B  1  188 ? 73.143  51.911 -11.772 1.00 33.80  ? 630  ARG D O     1 
ATOM   7001  C  CB    . ARG B  1  188 ? 73.040  49.152 -13.603 1.00 31.65  ? 630  ARG D CB    1 
ATOM   7002  C  CG    . ARG B  1  188 ? 73.211  48.594 -12.206 1.00 31.16  ? 630  ARG D CG    1 
ATOM   7003  C  CD    . ARG B  1  188 ? 74.381  47.620 -12.135 1.00 33.64  ? 630  ARG D CD    1 
ATOM   7004  N  NE    . ARG B  1  188 ? 75.629  48.241 -12.624 1.00 33.68  ? 630  ARG D NE    1 
ATOM   7005  C  CZ    . ARG B  1  188 ? 76.333  49.132 -11.943 1.00 35.11  ? 630  ARG D CZ    1 
ATOM   7006  N  NH1   . ARG B  1  188 ? 75.933  49.520 -10.731 1.00 31.30  ? 630  ARG D NH1   1 
ATOM   7007  N  NH2   . ARG B  1  188 ? 77.442  49.633 -12.470 1.00 35.18  ? 630  ARG D NH2   1 
ATOM   7008  N  N     . GLN B  1  189 ? 74.319  52.059 -13.683 1.00 37.51  ? 631  GLN D N     1 
ATOM   7009  C  CA    . GLN B  1  189 ? 75.227  53.041 -13.122 1.00 36.98  ? 631  GLN D CA    1 
ATOM   7010  C  C     . GLN B  1  189 ? 74.512  54.310 -12.713 1.00 34.90  ? 631  GLN D C     1 
ATOM   7011  O  O     . GLN B  1  189 ? 74.815  54.890 -11.662 1.00 32.78  ? 631  GLN D O     1 
ATOM   7012  C  CB    . GLN B  1  189 ? 76.336  53.374 -14.159 1.00 42.06  ? 631  GLN D CB    1 
ATOM   7013  C  CG    . GLN B  1  189 ? 77.490  54.182 -13.589 1.00 48.76  ? 631  GLN D CG    1 
ATOM   7014  C  CD    . GLN B  1  189 ? 78.323  53.390 -12.597 1.00 52.43  ? 631  GLN D CD    1 
ATOM   7015  O  OE1   . GLN B  1  189 ? 78.923  52.390 -12.956 1.00 59.19  ? 631  GLN D OE1   1 
ATOM   7016  N  NE2   . GLN B  1  189 ? 78.336  53.821 -11.348 1.00 52.22  ? 631  GLN D NE2   1 
ATOM   7017  N  N     . PHE B  1  190 ? 73.540  54.736 -13.510 1.00 36.69  ? 632  PHE D N     1 
ATOM   7018  C  CA    . PHE B  1  190 ? 72.745  55.923 -13.154 1.00 35.42  ? 632  PHE D CA    1 
ATOM   7019  C  C     . PHE B  1  190 ? 72.010  55.689 -11.842 1.00 34.97  ? 632  PHE D C     1 
ATOM   7020  O  O     . PHE B  1  190 ? 71.967  56.565 -10.978 1.00 34.95  ? 632  PHE D O     1 
ATOM   7021  C  CB    . PHE B  1  190 ? 71.780  56.266 -14.273 1.00 36.35  ? 632  PHE D CB    1 
ATOM   7022  C  CG    . PHE B  1  190 ? 70.692  57.194 -13.849 1.00 37.42  ? 632  PHE D CG    1 
ATOM   7023  C  CD1   . PHE B  1  190 ? 70.916  58.558 -13.704 1.00 39.06  ? 632  PHE D CD1   1 
ATOM   7024  C  CD2   . PHE B  1  190 ? 69.408  56.696 -13.584 1.00 36.33  ? 632  PHE D CD2   1 
ATOM   7025  C  CE1   . PHE B  1  190 ? 69.879  59.382 -13.281 1.00 37.56  ? 632  PHE D CE1   1 
ATOM   7026  C  CE2   . PHE B  1  190 ? 68.404  57.493 -13.099 1.00 35.65  ? 632  PHE D CE2   1 
ATOM   7027  C  CZ    . PHE B  1  190 ? 68.638  58.884 -12.970 1.00 36.13  ? 632  PHE D CZ    1 
ATOM   7028  N  N     . ILE B  1  191 ? 71.370  54.514 -11.695 1.00 33.75  ? 633  ILE D N     1 
ATOM   7029  C  CA    . ILE B  1  191 ? 70.634  54.205 -10.469 1.00 30.91  ? 633  ILE D CA    1 
ATOM   7030  C  C     . ILE B  1  191 ? 71.554  54.238 -9.268  1.00 32.01  ? 633  ILE D C     1 
ATOM   7031  O  O     . ILE B  1  191 ? 71.236  54.832 -8.231  1.00 31.32  ? 633  ILE D O     1 
ATOM   7032  C  CB    . ILE B  1  191 ? 69.921  52.864 -10.606 1.00 30.49  ? 633  ILE D CB    1 
ATOM   7033  C  CG1   . ILE B  1  191 ? 68.906  52.901 -11.758 1.00 30.76  ? 633  ILE D CG1   1 
ATOM   7034  C  CG2   . ILE B  1  191 ? 69.197  52.596 -9.220  1.00 28.24  ? 633  ILE D CG2   1 
ATOM   7035  C  CD1   . ILE B  1  191 ? 68.446  51.533 -12.190 1.00 29.82  ? 633  ILE D CD1   1 
ATOM   7036  N  N     . GLU B  1  192 ? 72.711  53.583 -9.377  1.00 32.33  ? 634  GLU D N     1 
ATOM   7037  C  CA    . GLU B  1  192 ? 73.651  53.544 -8.261  1.00 36.20  ? 634  GLU D CA    1 
ATOM   7038  C  C     . GLU B  1  192 ? 74.131  54.956 -7.898  1.00 39.15  ? 634  GLU D C     1 
ATOM   7039  O  O     . GLU B  1  192 ? 74.229  55.298 -6.729  1.00 40.83  ? 634  GLU D O     1 
ATOM   7040  C  CB    . GLU B  1  192 ? 74.859  52.665 -8.606  1.00 35.47  ? 634  GLU D CB    1 
ATOM   7041  C  CG    . GLU B  1  192 ? 75.790  52.485 -7.426  1.00 36.02  ? 634  GLU D CG    1 
ATOM   7042  C  CD    . GLU B  1  192 ? 77.005  51.622 -7.743  1.00 38.00  ? 634  GLU D CD    1 
ATOM   7043  O  OE1   . GLU B  1  192 ? 77.296  51.403 -8.969  1.00 36.01  ? 634  GLU D OE1   1 
ATOM   7044  O  OE2   . GLU B  1  192 ? 77.621  51.124 -6.766  1.00 38.12  ? 634  GLU D OE2   1 
ATOM   7045  N  N     . ASP B  1  193 ? 74.419  55.777 -8.901  1.00 41.22  ? 635  ASP D N     1 
ATOM   7046  C  CA    . ASP B  1  193 ? 74.965  57.101 -8.637  1.00 42.72  ? 635  ASP D CA    1 
ATOM   7047  C  C     . ASP B  1  193 ? 73.974  58.035 -7.961  1.00 42.58  ? 635  ASP D C     1 
ATOM   7048  O  O     . ASP B  1  193 ? 74.374  58.889 -7.165  1.00 42.71  ? 635  ASP D O     1 
ATOM   7049  C  CB    . ASP B  1  193 ? 75.474  57.736 -9.950  1.00 44.57  ? 635  ASP D CB    1 
ATOM   7050  C  CG    . ASP B  1  193 ? 76.726  57.047 -10.486 1.00 48.88  ? 635  ASP D CG    1 
ATOM   7051  O  OD1   . ASP B  1  193 ? 77.494  56.422 -9.679  1.00 46.07  ? 635  ASP D OD1   1 
ATOM   7052  O  OD2   . ASP B  1  193 ? 76.952  57.128 -11.705 1.00 48.15  ? 635  ASP D OD2   1 
ATOM   7053  N  N     . ASN B  1  194 ? 72.682  57.894 -8.255  1.00 40.18  ? 636  ASN D N     1 
ATOM   7054  C  CA    . ASN B  1  194 ? 71.659  58.800 -7.731  1.00 39.47  ? 636  ASN D CA    1 
ATOM   7055  C  C     . ASN B  1  194 ? 70.762  58.139 -6.694  1.00 37.84  ? 636  ASN D C     1 
ATOM   7056  O  O     . ASN B  1  194 ? 69.690  58.706 -6.384  1.00 36.56  ? 636  ASN D O     1 
ATOM   7057  C  CB    . ASN B  1  194 ? 70.833  59.351 -8.867  1.00 40.41  ? 636  ASN D CB    1 
ATOM   7058  C  CG    . ASN B  1  194 ? 71.662  60.204 -9.818  1.00 42.59  ? 636  ASN D CG    1 
ATOM   7059  O  OD1   . ASN B  1  194 ? 71.699  61.423 -9.689  1.00 46.57  ? 636  ASN D OD1   1 
ATOM   7060  N  ND2   . ASN B  1  194 ? 72.352  59.547 -10.769 1.00 40.53  ? 636  ASN D ND2   1 
ATOM   7061  N  N     . ALA B  1  195 ? 71.148  56.980 -6.156  1.00 37.38  ? 637  ALA D N     1 
ATOM   7062  C  CA    . ALA B  1  195 ? 70.253  56.215 -5.299  1.00 39.40  ? 637  ALA D CA    1 
ATOM   7063  C  C     . ALA B  1  195 ? 69.827  57.000 -4.078  1.00 41.03  ? 637  ALA D C     1 
ATOM   7064  O  O     . ALA B  1  195 ? 68.692  56.839 -3.567  1.00 43.32  ? 637  ALA D O     1 
ATOM   7065  C  CB    . ALA B  1  195 ? 70.918  54.882 -4.915  1.00 34.99  ? 637  ALA D CB    1 
ATOM   7066  N  N     . VAL B  1  196 ? 70.731  57.834 -3.565  1.00 44.21  ? 638  VAL D N     1 
ATOM   7067  C  CA    . VAL B  1  196 ? 70.481  58.608 -2.344  1.00 46.40  ? 638  VAL D CA    1 
ATOM   7068  C  C     . VAL B  1  196 ? 69.307  59.574 -2.544  1.00 47.48  ? 638  VAL D C     1 
ATOM   7069  O  O     . VAL B  1  196 ? 68.561  59.865 -1.606  1.00 49.91  ? 638  VAL D O     1 
ATOM   7070  C  CB    . VAL B  1  196 ? 71.781  59.275 -1.886  1.00 49.65  ? 638  VAL D CB    1 
ATOM   7071  C  CG1   . VAL B  1  196 ? 71.546  60.531 -1.043  1.00 51.42  ? 638  VAL D CG1   1 
ATOM   7072  C  CG2   . VAL B  1  196 ? 72.628  58.268 -1.112  1.00 47.17  ? 638  VAL D CG2   1 
ATOM   7073  N  N     . TYR B  1  197 ? 69.136  60.049 -3.769  1.00 50.10  ? 639  TYR D N     1 
ATOM   7074  C  CA    . TYR B  1  197 ? 68.078  60.998 -4.085  1.00 50.59  ? 639  TYR D CA    1 
ATOM   7075  C  C     . TYR B  1  197 ? 66.739  60.387 -4.465  1.00 52.62  ? 639  TYR D C     1 
ATOM   7076  O  O     . TYR B  1  197 ? 65.871  61.090 -4.941  1.00 49.56  ? 639  TYR D O     1 
ATOM   7077  C  CB    . TYR B  1  197 ? 68.526  61.908 -5.218  1.00 53.28  ? 639  TYR D CB    1 
ATOM   7078  C  CG    . TYR B  1  197 ? 69.919  62.424 -5.062  1.00 56.91  ? 639  TYR D CG    1 
ATOM   7079  C  CD1   . TYR B  1  197 ? 70.261  63.252 -3.988  1.00 61.18  ? 639  TYR D CD1   1 
ATOM   7080  C  CD2   . TYR B  1  197 ? 70.911  62.066 -5.965  1.00 57.21  ? 639  TYR D CD2   1 
ATOM   7081  C  CE1   . TYR B  1  197 ? 71.546  63.684 -3.813  1.00 63.52  ? 639  TYR D CE1   1 
ATOM   7082  C  CE2   . TYR B  1  197 ? 72.198  62.522 -5.825  1.00 60.52  ? 639  TYR D CE2   1 
ATOM   7083  C  CZ    . TYR B  1  197 ? 72.506  63.335 -4.756  1.00 65.35  ? 639  TYR D CZ    1 
ATOM   7084  O  OH    . TYR B  1  197 ? 73.809  63.771 -4.597  1.00 69.22  ? 639  TYR D OH    1 
ATOM   7085  N  N     . ALA B  1  198 ? 66.565  59.099 -4.213  1.00 48.37  ? 640  ALA D N     1 
ATOM   7086  C  CA    . ALA B  1  198 ? 65.309  58.453 -4.582  1.00 53.06  ? 640  ALA D CA    1 
ATOM   7087  C  C     . ALA B  1  198 ? 64.193  58.485 -3.533  1.00 56.54  ? 640  ALA D C     1 
ATOM   7088  O  O     . ALA B  1  198 ? 64.447  58.508 -2.331  1.00 57.56  ? 640  ALA D O     1 
ATOM   7089  C  CB    . ALA B  1  198 ? 65.581  57.027 -5.045  1.00 50.13  ? 640  ALA D CB    1 
ATOM   7090  N  N     . ASN B  1  199 ? 62.971  58.474 -4.039  1.00 59.53  ? 641  ASN D N     1 
ATOM   7091  C  CA    . ASN B  1  199 ? 61.750  58.454 -3.236  1.00 62.26  ? 641  ASN D CA    1 
ATOM   7092  C  C     . ASN B  1  199 ? 61.859  59.199 -1.899  1.00 65.46  ? 641  ASN D C     1 
ATOM   7093  O  O     . ASN B  1  199 ? 61.769  58.590 -0.843  1.00 66.95  ? 641  ASN D O     1 
ATOM   7094  C  CB    . ASN B  1  199 ? 61.304  56.999 -2.973  1.00 54.80  ? 641  ASN D CB    1 
ATOM   7095  C  CG    . ASN B  1  199 ? 61.101  56.233 -4.265  1.00 55.64  ? 641  ASN D CG    1 
ATOM   7096  O  OD1   . ASN B  1  199 ? 61.907  55.339 -4.634  1.00 49.32  ? 641  ASN D OD1   1 
ATOM   7097  N  ND2   . ASN B  1  199 ? 60.051  56.639 -5.015  1.00 51.35  ? 641  ASN D ND2   1 
ATOM   7098  N  N     . LEU B  1  200 ? 62.044  60.507 -1.972  1.00 55.88  ? 642  LEU D N     1 
ATOM   7099  C  CA    . LEU B  1  200 ? 62.131  61.330 -0.773  1.00 61.63  ? 642  LEU D CA    1 
ATOM   7100  C  C     . LEU B  1  200 ? 60.854  62.121 -0.595  1.00 62.39  ? 642  LEU D C     1 
ATOM   7101  O  O     . LEU B  1  200 ? 60.201  62.444 -1.581  1.00 62.34  ? 642  LEU D O     1 
ATOM   7102  C  CB    . LEU B  1  200 ? 63.319  62.288 -0.843  1.00 65.56  ? 642  LEU D CB    1 
ATOM   7103  C  CG    . LEU B  1  200 ? 64.717  61.675 -0.924  1.00 64.86  ? 642  LEU D CG    1 
ATOM   7104  C  CD1   . LEU B  1  200 ? 65.782  62.726 -1.072  1.00 52.71  ? 642  LEU D CD1   1 
ATOM   7105  C  CD2   . LEU B  1  200 ? 64.956  60.755 0.275   1.00 62.54  ? 642  LEU D CD2   1 
ATOM   7106  N  N     . ASN B  1  211 ? 52.443  75.157 -14.839 1.00 57.45  ? 1010 ASN D N     1 
ATOM   7107  C  CA    . ASN B  1  211 ? 53.814  75.120 -14.305 1.00 54.29  ? 1010 ASN D CA    1 
ATOM   7108  C  C     . ASN B  1  211 ? 54.746  74.345 -15.208 1.00 52.26  ? 1010 ASN D C     1 
ATOM   7109  O  O     . ASN B  1  211 ? 54.482  73.210 -15.511 1.00 53.86  ? 1010 ASN D O     1 
ATOM   7110  C  CB    . ASN B  1  211 ? 53.834  74.563 -12.879 1.00 57.62  ? 1010 ASN D CB    1 
ATOM   7111  C  CG    . ASN B  1  211 ? 54.143  75.652 -11.855 1.00 62.80  ? 1010 ASN D CG    1 
ATOM   7112  O  OD1   . ASN B  1  211 ? 53.365  76.581 -11.642 1.00 68.92  ? 1010 ASN D OD1   1 
ATOM   7113  N  ND2   . ASN B  1  211 ? 55.300  75.558 -11.234 1.00 58.69  ? 1010 ASN D ND2   1 
ATOM   7114  N  N     . GLU B  1  212 ? 55.864  74.937 -15.594 1.00 47.94  ? 1011 GLU D N     1 
ATOM   7115  C  CA    . GLU B  1  212 ? 56.816  74.301 -16.494 1.00 46.33  ? 1011 GLU D CA    1 
ATOM   7116  C  C     . GLU B  1  212 ? 57.532  73.158 -15.772 1.00 48.68  ? 1011 GLU D C     1 
ATOM   7117  O  O     . GLU B  1  212 ? 57.795  73.205 -14.536 1.00 52.72  ? 1011 GLU D O     1 
ATOM   7118  C  CB    . GLU B  1  212 ? 57.834  75.337 -17.020 1.00 47.10  ? 1011 GLU D CB    1 
ATOM   7119  N  N     . ARG B  1  213 ? 57.827  72.097 -16.530 1.00 45.59  ? 1012 ARG D N     1 
ATOM   7120  C  CA    . ARG B  1  213 ? 58.531  70.942 -15.982 1.00 44.98  ? 1012 ARG D CA    1 
ATOM   7121  C  C     . ARG B  1  213 ? 59.480  70.419 -17.061 1.00 42.42  ? 1012 ARG D C     1 
ATOM   7122  O  O     . ARG B  1  213 ? 59.044  69.946 -18.128 1.00 41.27  ? 1012 ARG D O     1 
ATOM   7123  C  CB    . ARG B  1  213 ? 57.510  69.857 -15.605 1.00 44.54  ? 1012 ARG D CB    1 
ATOM   7124  C  CG    . ARG B  1  213 ? 58.128  68.528 -15.154 1.00 46.73  ? 1012 ARG D CG    1 
ATOM   7125  C  CD    . ARG B  1  213 ? 59.068  68.669 -13.982 1.00 46.67  ? 1012 ARG D CD    1 
ATOM   7126  N  NE    . ARG B  1  213 ? 59.235  67.423 -13.266 1.00 45.80  ? 1012 ARG D NE    1 
ATOM   7127  C  CZ    . ARG B  1  213 ? 60.234  67.195 -12.390 1.00 45.92  ? 1012 ARG D CZ    1 
ATOM   7128  N  NH1   . ARG B  1  213 ? 61.148  68.131 -12.168 1.00 42.71  ? 1012 ARG D NH1   1 
ATOM   7129  N  NH2   . ARG B  1  213 ? 60.327  66.016 -11.775 1.00 43.48  ? 1012 ARG D NH2   1 
ATOM   7130  N  N     . ASN B  1  214 ? 60.767  70.499 -16.796 1.00 44.24  ? 1013 ASN D N     1 
ATOM   7131  C  CA    . ASN B  1  214 ? 61.770  70.073 -17.747 1.00 45.74  ? 1013 ASN D CA    1 
ATOM   7132  C  C     . ASN B  1  214 ? 61.608  68.547 -17.964 1.00 42.85  ? 1013 ASN D C     1 
ATOM   7133  O  O     . ASN B  1  214 ? 61.495  67.790 -17.019 1.00 40.26  ? 1013 ASN D O     1 
ATOM   7134  C  CB    . ASN B  1  214 ? 63.160  70.369 -17.218 1.00 46.04  ? 1013 ASN D CB    1 
ATOM   7135  C  CG    . ASN B  1  214 ? 64.263  69.938 -18.193 1.00 51.55  ? 1013 ASN D CG    1 
ATOM   7136  O  OD1   . ASN B  1  214 ? 64.142  68.937 -18.911 1.00 51.23  ? 1013 ASN D OD1   1 
ATOM   7137  N  ND2   . ASN B  1  214 ? 65.348  70.711 -18.218 1.00 52.47  ? 1013 ASN D ND2   1 
ATOM   7138  N  N     . ILE B  1  215 ? 61.608  68.133 -19.244 1.00 41.08  ? 1014 ILE D N     1 
ATOM   7139  C  CA    . ILE B  1  215 ? 61.398  66.763 -19.585 1.00 38.80  ? 1014 ILE D CA    1 
ATOM   7140  C  C     . ILE B  1  215 ? 62.580  65.862 -19.100 1.00 39.42  ? 1014 ILE D C     1 
ATOM   7141  O  O     . ILE B  1  215 ? 62.372  64.751 -18.651 1.00 38.86  ? 1014 ILE D O     1 
ATOM   7142  C  CB    . ILE B  1  215 ? 61.161  66.567 -21.079 1.00 37.38  ? 1014 ILE D CB    1 
ATOM   7143  C  CG1   . ILE B  1  215 ? 60.614  65.141 -21.352 1.00 36.86  ? 1014 ILE D CG1   1 
ATOM   7144  C  CG2   . ILE B  1  215 ? 62.520  66.712 -21.849 1.00 37.22  ? 1014 ILE D CG2   1 
ATOM   7145  C  CD1   . ILE B  1  215 ? 59.827  65.078 -22.693 1.00 34.51  ? 1014 ILE D CD1   1 
ATOM   7146  N  N     . THR B  1  216 ? 63.798  66.377 -19.187 1.00 39.64  ? 1015 THR D N     1 
ATOM   7147  C  CA    . THR B  1  216 ? 64.916  65.603 -18.723 1.00 39.74  ? 1015 THR D CA    1 
ATOM   7148  C  C     . THR B  1  216 ? 64.892  65.401 -17.226 1.00 38.49  ? 1015 THR D C     1 
ATOM   7149  O  O     . THR B  1  216 ? 65.094  64.288 -16.741 1.00 38.55  ? 1015 THR D O     1 
ATOM   7150  C  CB    . THR B  1  216 ? 66.265  66.345 -19.103 1.00 39.07  ? 1015 THR D CB    1 
ATOM   7151  O  OG1   . THR B  1  216 ? 66.418  66.303 -20.525 1.00 38.51  ? 1015 THR D OG1   1 
ATOM   7152  C  CG2   . THR B  1  216 ? 67.466  65.717 -18.415 1.00 37.83  ? 1015 THR D CG2   1 
ATOM   7153  N  N     . SER B  1  217 ? 64.604  66.460 -16.479 1.00 37.20  ? 1016 SER D N     1 
ATOM   7154  C  CA    . SER B  1  217 ? 64.450  66.351 -15.029 1.00 38.47  ? 1016 SER D CA    1 
ATOM   7155  C  C     . SER B  1  217 ? 63.336  65.358 -14.694 1.00 38.12  ? 1016 SER D C     1 
ATOM   7156  O  O     . SER B  1  217 ? 63.488  64.529 -13.796 1.00 35.07  ? 1016 SER D O     1 
ATOM   7157  C  CB    . SER B  1  217 ? 64.153  67.718 -14.430 1.00 41.57  ? 1016 SER D CB    1 
ATOM   7158  O  OG    . SER B  1  217 ? 65.173  68.649 -14.718 1.00 43.74  ? 1016 SER D OG    1 
ATOM   7159  N  N     . GLU B  1  218 ? 62.206  65.428 -15.412 1.00 37.22  ? 1017 GLU D N     1 
ATOM   7160  C  CA    . GLU B  1  218 ? 61.098  64.536 -15.124 1.00 36.43  ? 1017 GLU D CA    1 
ATOM   7161  C  C     . GLU B  1  218 ? 61.475  63.078 -15.387 1.00 35.27  ? 1017 GLU D C     1 
ATOM   7162  O  O     . GLU B  1  218 ? 61.136  62.197 -14.594 1.00 33.10  ? 1017 GLU D O     1 
ATOM   7163  C  CB    . GLU B  1  218 ? 59.880  64.924 -15.967 1.00 36.01  ? 1017 GLU D CB    1 
ATOM   7164  C  CG    . GLU B  1  218 ? 58.687  64.002 -15.814 1.00 36.91  ? 1017 GLU D CG    1 
ATOM   7165  C  CD    . GLU B  1  218 ? 58.102  64.011 -14.383 1.00 37.61  ? 1017 GLU D CD    1 
ATOM   7166  O  OE1   . GLU B  1  218 ? 58.074  65.095 -13.768 1.00 40.31  ? 1017 GLU D OE1   1 
ATOM   7167  O  OE2   . GLU B  1  218 ? 57.679  62.931 -13.939 1.00 37.43  ? 1017 GLU D OE2   1 
ATOM   7168  N  N     . MET B  1  219 ? 62.189  62.821 -16.482 1.00 36.40  ? 1018 MET D N     1 
ATOM   7169  C  CA    . MET B  1  219 ? 62.575  61.450 -16.822 1.00 34.00  ? 1018 MET D CA    1 
ATOM   7170  C  C     . MET B  1  219 ? 63.532  60.883 -15.793 1.00 34.54  ? 1018 MET D C     1 
ATOM   7171  O  O     . MET B  1  219 ? 63.360  59.729 -15.353 1.00 29.64  ? 1018 MET D O     1 
ATOM   7172  C  CB    . MET B  1  219 ? 63.195  61.411 -18.218 1.00 32.38  ? 1018 MET D CB    1 
ATOM   7173  C  CG    . MET B  1  219 ? 62.197  61.509 -19.356 1.00 33.98  ? 1018 MET D CG    1 
ATOM   7174  S  SD    . MET B  1  219 ? 60.994  60.172 -19.378 1.00 32.91  ? 1018 MET D SD    1 
ATOM   7175  C  CE    . MET B  1  219 ? 62.091  58.746 -19.696 1.00 32.35  ? 1018 MET D CE    1 
ATOM   7176  N  N     A ARG B  1  220 ? 64.542  61.656 -15.375 0.50 34.26  ? 1019 ARG D N     1 
ATOM   7177  N  N     B ARG B  1  220 ? 64.554  61.653 -15.396 0.50 33.88  ? 1019 ARG D N     1 
ATOM   7178  C  CA    A ARG B  1  220 ? 65.535  61.149 -14.440 0.50 36.13  ? 1019 ARG D CA    1 
ATOM   7179  C  CA    B ARG B  1  220 ? 65.537  61.179 -14.436 0.50 35.47  ? 1019 ARG D CA    1 
ATOM   7180  C  C     A ARG B  1  220 ? 64.946  60.929 -13.061 0.50 35.24  ? 1019 ARG D C     1 
ATOM   7181  C  C     B ARG B  1  220 ? 64.902  60.902 -13.090 0.50 34.88  ? 1019 ARG D C     1 
ATOM   7182  O  O     A ARG B  1  220 ? 65.273  59.937 -12.411 0.50 34.47  ? 1019 ARG D O     1 
ATOM   7183  O  O     B ARG B  1  220 ? 65.157  59.852 -12.493 0.50 34.37  ? 1019 ARG D O     1 
ATOM   7184  C  CB    A ARG B  1  220 ? 66.716  62.109 -14.338 0.50 37.48  ? 1019 ARG D CB    1 
ATOM   7185  C  CB    B ARG B  1  220 ? 66.649  62.211 -14.246 0.50 35.96  ? 1019 ARG D CB    1 
ATOM   7186  C  CG    A ARG B  1  220 ? 67.477  62.302 -15.629 0.50 38.86  ? 1019 ARG D CG    1 
ATOM   7187  C  CG    B ARG B  1  220 ? 67.572  62.580 -15.398 0.50 36.97  ? 1019 ARG D CG    1 
ATOM   7188  C  CD    A ARG B  1  220 ? 68.585  63.378 -15.449 0.50 39.56  ? 1019 ARG D CD    1 
ATOM   7189  C  CD    B ARG B  1  220 ? 68.597  63.602 -14.871 0.50 36.17  ? 1019 ARG D CD    1 
ATOM   7190  N  NE    A ARG B  1  220 ? 69.840  62.678 -15.309 0.50 43.71  ? 1019 ARG D NE    1 
ATOM   7191  N  NE    B ARG B  1  220 ? 69.749  62.805 -14.598 0.50 38.32  ? 1019 ARG D NE    1 
ATOM   7192  C  CZ    A ARG B  1  220 ? 70.600  62.286 -16.325 0.50 43.27  ? 1019 ARG D CZ    1 
ATOM   7193  C  CZ    B ARG B  1  220 ? 70.550  62.888 -13.572 0.50 38.27  ? 1019 ARG D CZ    1 
ATOM   7194  N  NH1   A ARG B  1  220 ? 71.686  61.611 -16.045 0.50 43.72  ? 1019 ARG D NH1   1 
ATOM   7195  N  NH1   B ARG B  1  220 ? 71.523  62.066 -13.568 0.50 38.20  ? 1019 ARG D NH1   1 
ATOM   7196  N  NH2   A ARG B  1  220 ? 70.281  62.548 -17.599 0.50 42.04  ? 1019 ARG D NH2   1 
ATOM   7197  N  NH2   B ARG B  1  220 ? 70.379  63.779 -12.588 0.50 41.22  ? 1019 ARG D NH2   1 
ATOM   7198  N  N     . GLU B  1  221 ? 64.070  61.811 -12.614 1.00 34.75  ? 1020 GLU D N     1 
ATOM   7199  C  CA    . GLU B  1  221 ? 63.503  61.692 -11.266 1.00 34.73  ? 1020 GLU D CA    1 
ATOM   7200  C  C     . GLU B  1  221 ? 62.448  60.581 -11.194 1.00 33.43  ? 1020 GLU D C     1 
ATOM   7201  O  O     . GLU B  1  221 ? 62.419  59.827 -10.211 1.00 30.03  ? 1020 GLU D O     1 
ATOM   7202  C  CB    . GLU B  1  221 ? 62.909  63.013 -10.810 1.00 38.09  ? 1020 GLU D CB    1 
ATOM   7203  C  CG    . GLU B  1  221 ? 63.978  64.089 -10.590 1.00 42.43  ? 1020 GLU D CG    1 
ATOM   7204  C  CD    . GLU B  1  221 ? 63.377  65.450 -10.271 1.00 45.10  ? 1020 GLU D CD    1 
ATOM   7205  O  OE1   . GLU B  1  221 ? 64.079  66.454 -10.457 1.00 48.46  ? 1020 GLU D OE1   1 
ATOM   7206  O  OE2   . GLU B  1  221 ? 62.181  65.557 -9.761  1.00 45.71  ? 1020 GLU D OE2   1 
ATOM   7207  N  N     . SER B  1  222 ? 61.601  60.480 -12.206 1.00 32.85  ? 1021 SER D N     1 
ATOM   7208  C  CA    . SER B  1  222 ? 60.549  59.446 -12.180 1.00 32.40  ? 1021 SER D CA    1 
ATOM   7209  C  C     . SER B  1  222 ? 61.105  58.026 -12.385 1.00 30.34  ? 1021 SER D C     1 
ATOM   7210  O  O     . SER B  1  222 ? 60.660  57.099 -11.784 1.00 28.18  ? 1021 SER D O     1 
ATOM   7211  C  CB    . SER B  1  222 ? 59.463  59.771 -13.215 1.00 35.83  ? 1021 SER D CB    1 
ATOM   7212  O  OG    . SER B  1  222 ? 58.748  60.921 -12.852 1.00 38.46  ? 1021 SER D OG    1 
ATOM   7213  N  N     . PHE B  1  223 ? 62.103  57.890 -13.248 1.00 29.35  ? 1022 PHE D N     1 
ATOM   7214  C  CA    . PHE B  1  223 ? 62.674  56.548 -13.471 1.00 29.22  ? 1022 PHE D CA    1 
ATOM   7215  C  C     . PHE B  1  223 ? 63.530  56.103 -12.303 1.00 28.69  ? 1022 PHE D C     1 
ATOM   7216  O  O     . PHE B  1  223 ? 63.502  54.923 -11.939 1.00 31.39  ? 1022 PHE D O     1 
ATOM   7217  C  CB    . PHE B  1  223 ? 63.516  56.537 -14.788 1.00 27.96  ? 1022 PHE D CB    1 
ATOM   7218  C  CG    . PHE B  1  223 ? 63.818  55.158 -15.241 1.00 29.50  ? 1022 PHE D CG    1 
ATOM   7219  C  CD1   . PHE B  1  223 ? 62.894  54.471 -16.011 1.00 27.64  ? 1022 PHE D CD1   1 
ATOM   7220  C  CD2   . PHE B  1  223 ? 64.997  54.508 -14.865 1.00 29.69  ? 1022 PHE D CD2   1 
ATOM   7221  C  CE1   . PHE B  1  223 ? 63.035  53.136 -16.332 1.00 27.60  ? 1022 PHE D CE1   1 
ATOM   7222  C  CE2   . PHE B  1  223 ? 65.190  53.157 -15.279 1.00 28.58  ? 1022 PHE D CE2   1 
ATOM   7223  C  CZ    . PHE B  1  223 ? 64.173  52.473 -15.937 1.00 27.41  ? 1022 PHE D CZ    1 
ATOM   7224  N  N     . LEU B  1  224 ? 64.256  57.043 -11.666 1.00 28.43  ? 1023 LEU D N     1 
ATOM   7225  C  CA    . LEU B  1  224 ? 65.027  56.698 -10.485 1.00 30.57  ? 1023 LEU D CA    1 
ATOM   7226  C  C     . LEU B  1  224 ? 64.110  56.176 -9.382  1.00 30.60  ? 1023 LEU D C     1 
ATOM   7227  O  O     . LEU B  1  224 ? 64.409  55.175 -8.717  1.00 29.52  ? 1023 LEU D O     1 
ATOM   7228  C  CB    . LEU B  1  224 ? 65.845  57.868 -10.018 1.00 30.52  ? 1023 LEU D CB    1 
ATOM   7229  C  CG    . LEU B  1  224 ? 66.630  57.644 -8.702  1.00 30.33  ? 1023 LEU D CG    1 
ATOM   7230  C  CD1   . LEU B  1  224 ? 67.740  56.665 -8.884  1.00 31.72  ? 1023 LEU D CD1   1 
ATOM   7231  C  CD2   . LEU B  1  224 ? 67.180  59.007 -8.243  1.00 32.19  ? 1023 LEU D CD2   1 
ATOM   7232  N  N     . ASP B  1  225 ? 63.000  56.858 -9.184  1.00 32.17  ? 1024 ASP D N     1 
ATOM   7233  C  CA    . ASP B  1  225 ? 62.036  56.468 -8.177  1.00 30.63  ? 1024 ASP D CA    1 
ATOM   7234  C  C     . ASP B  1  225 ? 61.538  55.044 -8.458  1.00 29.10  ? 1024 ASP D C     1 
ATOM   7235  O  O     . ASP B  1  225 ? 61.521  54.217 -7.569  1.00 27.93  ? 1024 ASP D O     1 
ATOM   7236  C  CB    . ASP B  1  225 ? 60.827  57.433 -8.188  1.00 33.52  ? 1024 ASP D CB    1 
ATOM   7237  C  CG    . ASP B  1  225 ? 61.202  58.767 -7.495  1.00 38.10  ? 1024 ASP D CG    1 
ATOM   7238  O  OD1   . ASP B  1  225 ? 62.305  58.888 -6.803  1.00 37.51  ? 1024 ASP D OD1   1 
ATOM   7239  O  OD2   . ASP B  1  225 ? 60.460  59.728 -7.637  1.00 40.63  ? 1024 ASP D OD2   1 
ATOM   7240  N  N     . TYR B  1  226 ? 61.140  54.772 -9.698  1.00 26.29  ? 1025 TYR D N     1 
ATOM   7241  C  CA    . TYR B  1  226 ? 60.658  53.453 -10.081 1.00 25.36  ? 1025 TYR D CA    1 
ATOM   7242  C  C     . TYR B  1  226 ? 61.768  52.412 -9.925  1.00 25.01  ? 1025 TYR D C     1 
ATOM   7243  O  O     . TYR B  1  226 ? 61.579  51.363 -9.267  1.00 23.60  ? 1025 TYR D O     1 
ATOM   7244  C  CB    . TYR B  1  226 ? 60.103  53.453 -11.481 1.00 25.75  ? 1025 TYR D CB    1 
ATOM   7245  C  CG    . TYR B  1  226 ? 59.658  52.058 -11.900 1.00 25.04  ? 1025 TYR D CG    1 
ATOM   7246  C  CD1   . TYR B  1  226 ? 58.541  51.471 -11.324 1.00 23.94  ? 1025 TYR D CD1   1 
ATOM   7247  C  CD2   . TYR B  1  226 ? 60.358  51.361 -12.876 1.00 24.25  ? 1025 TYR D CD2   1 
ATOM   7248  C  CE1   . TYR B  1  226 ? 58.203  50.175 -11.640 1.00 24.79  ? 1025 TYR D CE1   1 
ATOM   7249  C  CE2   . TYR B  1  226 ? 59.914  50.114 -13.294 1.00 23.50  ? 1025 TYR D CE2   1 
ATOM   7250  C  CZ    . TYR B  1  226 ? 58.816  49.577 -12.778 1.00 23.40  ? 1025 TYR D CZ    1 
ATOM   7251  O  OH    . TYR B  1  226 ? 58.366  48.305 -13.044 1.00 24.34  ? 1025 TYR D OH    1 
ATOM   7252  N  N     . ALA B  1  227 ? 62.929  52.687 -10.540 1.00 24.21  ? 1026 ALA D N     1 
ATOM   7253  C  CA    . ALA B  1  227 ? 64.011  51.714 -10.544 1.00 25.64  ? 1026 ALA D CA    1 
ATOM   7254  C  C     . ALA B  1  227 ? 64.443  51.372 -9.108  1.00 27.25  ? 1026 ALA D C     1 
ATOM   7255  O  O     . ALA B  1  227 ? 64.636  50.202 -8.777  1.00 28.19  ? 1026 ALA D O     1 
ATOM   7256  C  CB    . ALA B  1  227 ? 65.206  52.269 -11.342 1.00 24.24  ? 1026 ALA D CB    1 
ATOM   7257  N  N     . MET B  1  228 ? 64.591  52.353 -8.261  1.00 28.44  ? 1027 MET D N     1 
ATOM   7258  C  CA    . MET B  1  228 ? 64.990  52.095 -6.911  1.00 28.27  ? 1027 MET D CA    1 
ATOM   7259  C  C     . MET B  1  228 ? 63.960  51.253 -6.172  1.00 27.45  ? 1027 MET D C     1 
ATOM   7260  O  O     . MET B  1  228 ? 64.310  50.343 -5.433  1.00 25.91  ? 1027 MET D O     1 
ATOM   7261  C  CB    . MET B  1  228 ? 65.199  53.423 -6.141  1.00 28.56  ? 1027 MET D CB    1 
ATOM   7262  C  CG    . MET B  1  228 ? 66.637  53.997 -6.417  1.00 30.00  ? 1027 MET D CG    1 
ATOM   7263  S  SD    . MET B  1  228 ? 67.915  52.978 -5.714  1.00 34.39  ? 1027 MET D SD    1 
ATOM   7264  C  CE    . MET B  1  228 ? 67.573  53.170 -3.913  1.00 30.83  ? 1027 MET D CE    1 
ATOM   7265  N  N     . SER B  1  229 ? 62.665  51.539 -6.378  1.00 26.59  ? 1028 SER D N     1 
ATOM   7266  C  CA    . SER B  1  229 ? 61.621  50.825 -5.696  1.00 27.46  ? 1028 SER D CA    1 
ATOM   7267  C  C     . SER B  1  229 ? 61.598  49.312 -6.131  1.00 26.23  ? 1028 SER D C     1 
ATOM   7268  O  O     . SER B  1  229 ? 61.415  48.458 -5.302  1.00 22.77  ? 1028 SER D O     1 
ATOM   7269  C  CB    . SER B  1  229 ? 60.296  51.466 -5.930  1.00 27.75  ? 1028 SER D CB    1 
ATOM   7270  O  OG    . SER B  1  229 ? 59.341  50.971 -5.024  1.00 32.74  ? 1028 SER D OG    1 
ATOM   7271  N  N     . VAL B  1  230 ? 61.786  49.062 -7.407  1.00 24.24  ? 1029 VAL D N     1 
ATOM   7272  C  CA    . VAL B  1  230 ? 61.809  47.691 -7.826  1.00 25.54  ? 1029 VAL D CA    1 
ATOM   7273  C  C     . VAL B  1  230 ? 62.992  46.953 -7.268  1.00 25.64  ? 1029 VAL D C     1 
ATOM   7274  O  O     . VAL B  1  230 ? 62.921  45.746 -6.939  1.00 25.26  ? 1029 VAL D O     1 
ATOM   7275  C  CB    . VAL B  1  230 ? 61.855  47.615 -9.404  1.00 25.50  ? 1029 VAL D CB    1 
ATOM   7276  C  CG1   . VAL B  1  230 ? 61.974  46.177 -9.880  1.00 24.90  ? 1029 VAL D CG1   1 
ATOM   7277  C  CG2   . VAL B  1  230 ? 60.538  48.249 -9.955  1.00 26.51  ? 1029 VAL D CG2   1 
ATOM   7278  N  N     . ILE B  1  231 ? 64.136  47.649 -7.115  1.00 25.64  ? 1030 ILE D N     1 
ATOM   7279  C  CA    . ILE B  1  231 ? 65.353  47.025 -6.630  1.00 25.15  ? 1030 ILE D CA    1 
ATOM   7280  C  C     . ILE B  1  231 ? 65.210  46.696 -5.136  1.00 25.91  ? 1030 ILE D C     1 
ATOM   7281  O  O     . ILE B  1  231 ? 65.472  45.552 -4.723  1.00 24.98  ? 1030 ILE D O     1 
ATOM   7282  C  CB    . ILE B  1  231 ? 66.549  47.922 -6.895  1.00 25.75  ? 1030 ILE D CB    1 
ATOM   7283  C  CG1   . ILE B  1  231 ? 66.892  47.840 -8.400  1.00 26.50  ? 1030 ILE D CG1   1 
ATOM   7284  C  CG2   . ILE B  1  231 ? 67.762  47.476 -6.038  1.00 24.37  ? 1030 ILE D CG2   1 
ATOM   7285  C  CD1   . ILE B  1  231 ? 67.904  48.893 -8.876  1.00 28.73  ? 1030 ILE D CD1   1 
ATOM   7286  N  N     . VAL B  1  232 ? 64.764  47.662 -4.339  1.00 26.14  ? 1031 VAL D N     1 
ATOM   7287  C  CA    . VAL B  1  232 ? 64.825  47.512 -2.882  1.00 25.87  ? 1031 VAL D CA    1 
ATOM   7288  C  C     . VAL B  1  232 ? 63.465  47.126 -2.264  1.00 25.90  ? 1031 VAL D C     1 
ATOM   7289  O  O     . VAL B  1  232 ? 63.433  46.814 -1.055  1.00 24.22  ? 1031 VAL D O     1 
ATOM   7290  C  CB    . VAL B  1  232 ? 65.321  48.780 -2.180  1.00 27.14  ? 1031 VAL D CB    1 
ATOM   7291  C  CG1   . VAL B  1  232 ? 66.650  49.237 -2.783  1.00 28.60  ? 1031 VAL D CG1   1 
ATOM   7292  C  CG2   . VAL B  1  232 ? 64.311  49.893 -2.282  1.00 27.95  ? 1031 VAL D CG2   1 
ATOM   7293  N  N     . ALA B  1  233 ? 62.373  47.109 -3.035  1.00 24.13  ? 1032 ALA D N     1 
ATOM   7294  C  CA    . ALA B  1  233 ? 61.097  46.795 -2.442  1.00 25.16  ? 1032 ALA D CA    1 
ATOM   7295  C  C     . ALA B  1  233 ? 60.150  46.113 -3.424  1.00 23.75  ? 1032 ALA D C     1 
ATOM   7296  O  O     . ALA B  1  233 ? 58.967  46.409 -3.515  1.00 23.90  ? 1032 ALA D O     1 
ATOM   7297  C  CB    . ALA B  1  233 ? 60.427  48.130 -1.922  1.00 26.16  ? 1032 ALA D CB    1 
ATOM   7298  N  N     . ARG B  1  234 ? 60.708  45.144 -4.118  1.00 23.13  ? 1033 ARG D N     1 
ATOM   7299  C  CA    . ARG B  1  234 ? 59.911  44.354 -5.023  1.00 22.59  ? 1033 ARG D CA    1 
ATOM   7300  C  C     . ARG B  1  234 ? 60.583  43.066 -5.562  1.00 23.56  ? 1033 ARG D C     1 
ATOM   7301  O  O     . ARG B  1  234 ? 60.113  41.981 -5.269  1.00 23.34  ? 1033 ARG D O     1 
ATOM   7302  C  CB    . ARG B  1  234 ? 59.374  45.158 -6.209  1.00 23.75  ? 1033 ARG D CB    1 
ATOM   7303  C  CG    . ARG B  1  234 ? 58.462  44.334 -7.092  1.00 23.06  ? 1033 ARG D CG    1 
ATOM   7304  C  CD    . ARG B  1  234 ? 57.663  45.190 -8.110  1.00 23.64  ? 1033 ARG D CD    1 
ATOM   7305  N  NE    . ARG B  1  234 ? 56.966  46.243 -7.451  1.00 23.98  ? 1033 ARG D NE    1 
ATOM   7306  C  CZ    . ARG B  1  234 ? 56.348  47.191 -8.131  1.00 24.29  ? 1033 ARG D CZ    1 
ATOM   7307  N  NH1   . ARG B  1  234 ? 56.398  47.235 -9.454  1.00 24.06  ? 1033 ARG D NH1   1 
ATOM   7308  N  NH2   . ARG B  1  234 ? 55.650  48.138 -7.507  1.00 22.70  ? 1033 ARG D NH2   1 
ATOM   7309  N  N     . ALA B  1  235 ? 61.600  43.195 -6.391  1.00 21.72  ? 1034 ALA D N     1 
ATOM   7310  C  CA    . ALA B  1  235 ? 62.098  42.062 -7.140  1.00 21.38  ? 1034 ALA D CA    1 
ATOM   7311  C  C     . ALA B  1  235 ? 63.293  41.325 -6.529  1.00 22.10  ? 1034 ALA D C     1 
ATOM   7312  O  O     . ALA B  1  235 ? 63.651  40.257 -7.003  1.00 23.58  ? 1034 ALA D O     1 
ATOM   7313  C  CB    . ALA B  1  235 ? 62.533  42.555 -8.570  1.00 21.82  ? 1034 ALA D CB    1 
ATOM   7314  N  N     . LEU B  1  236 ? 63.904  41.874 -5.497  1.00 21.54  ? 1035 LEU D N     1 
ATOM   7315  C  CA    . LEU B  1  236 ? 65.130  41.214 -5.011  1.00 21.84  ? 1035 LEU D CA    1 
ATOM   7316  C  C     . LEU B  1  236 ? 64.919  40.785 -3.546  1.00 22.35  ? 1035 LEU D C     1 
ATOM   7317  O  O     . LEU B  1  236 ? 64.289  41.496 -2.740  1.00 24.07  ? 1035 LEU D O     1 
ATOM   7318  C  CB    . LEU B  1  236 ? 66.303  42.197 -5.047  1.00 21.26  ? 1035 LEU D CB    1 
ATOM   7319  C  CG    . LEU B  1  236 ? 66.697  42.618 -6.486  1.00 21.42  ? 1035 LEU D CG    1 
ATOM   7320  C  CD1   . LEU B  1  236 ? 67.900  43.586 -6.412  1.00 20.72  ? 1035 LEU D CD1   1 
ATOM   7321  C  CD2   . LEU B  1  236 ? 67.036  41.354 -7.277  1.00 21.42  ? 1035 LEU D CD2   1 
ATOM   7322  N  N     . PRO B  1  237 ? 65.434  39.591 -3.206  1.00 22.06  ? 1036 PRO D N     1 
ATOM   7323  C  CA    . PRO B  1  237 ? 65.222  39.092 -1.854  1.00 22.02  ? 1036 PRO D CA    1 
ATOM   7324  C  C     . PRO B  1  237 ? 66.232  39.672 -0.883  1.00 22.00  ? 1036 PRO D C     1 
ATOM   7325  O  O     . PRO B  1  237 ? 67.334  40.085 -1.275  1.00 22.06  ? 1036 PRO D O     1 
ATOM   7326  C  CB    . PRO B  1  237 ? 65.455  37.576 -2.035  1.00 20.94  ? 1036 PRO D CB    1 
ATOM   7327  C  CG    . PRO B  1  237 ? 66.540  37.538 -3.071  1.00 21.78  ? 1036 PRO D CG    1 
ATOM   7328  C  CD    . PRO B  1  237 ? 66.254  38.716 -4.032  1.00 21.97  ? 1036 PRO D CD    1 
ATOM   7329  N  N     . ASP B  1  238 ? 65.838  39.702 0.401   1.00 21.12  ? 1037 ASP D N     1 
ATOM   7330  C  CA    . ASP B  1  238 ? 66.768  40.062 1.445   1.00 22.31  ? 1037 ASP D CA    1 
ATOM   7331  C  C     . ASP B  1  238 ? 67.709  38.906 1.744   1.00 21.47  ? 1037 ASP D C     1 
ATOM   7332  O  O     . ASP B  1  238 ? 67.280  37.751 1.808   1.00 21.69  ? 1037 ASP D O     1 
ATOM   7333  C  CB    . ASP B  1  238 ? 66.001  40.473 2.717   1.00 22.39  ? 1037 ASP D CB    1 
ATOM   7334  C  CG    . ASP B  1  238 ? 66.879  41.270 3.674   1.00 23.90  ? 1037 ASP D CG    1 
ATOM   7335  O  OD1   . ASP B  1  238 ? 67.655  40.628 4.399   1.00 23.52  ? 1037 ASP D OD1   1 
ATOM   7336  O  OD2   . ASP B  1  238 ? 66.786  42.527 3.712   1.00 23.47  ? 1037 ASP D OD2   1 
ATOM   7337  N  N     . VAL B  1  239 ? 68.984  39.231 1.957   1.00 22.21  ? 1038 VAL D N     1 
ATOM   7338  C  CA    . VAL B  1  239 ? 69.988  38.195 2.228   1.00 22.54  ? 1038 VAL D CA    1 
ATOM   7339  C  C     . VAL B  1  239 ? 69.686  37.480 3.549   1.00 23.04  ? 1038 VAL D C     1 
ATOM   7340  O  O     . VAL B  1  239 ? 70.016  36.299 3.713   1.00 22.68  ? 1038 VAL D O     1 
ATOM   7341  C  CB    . VAL B  1  239 ? 71.394  38.790 2.204   1.00 22.76  ? 1038 VAL D CB    1 
ATOM   7342  C  CG1   . VAL B  1  239 ? 71.671  39.620 3.461   1.00 23.10  ? 1038 VAL D CG1   1 
ATOM   7343  C  CG2   . VAL B  1  239 ? 72.456  37.689 2.055   1.00 22.24  ? 1038 VAL D CG2   1 
ATOM   7344  N  N     . ARG B  1  240 ? 69.030  38.166 4.473   1.00 21.73  ? 1039 ARG D N     1 
ATOM   7345  C  CA    . ARG B  1  240 ? 68.912  37.624 5.837   1.00 23.03  ? 1039 ARG D CA    1 
ATOM   7346  C  C     . ARG B  1  240 ? 67.805  36.524 5.888   1.00 22.51  ? 1039 ARG D C     1 
ATOM   7347  O  O     . ARG B  1  240 ? 68.028  35.472 6.446   1.00 23.20  ? 1039 ARG D O     1 
ATOM   7348  C  CB    . ARG B  1  240 ? 68.571  38.749 6.808   1.00 23.57  ? 1039 ARG D CB    1 
ATOM   7349  C  CG    . ARG B  1  240 ? 69.721  39.756 6.924   1.00 25.79  ? 1039 ARG D CG    1 
ATOM   7350  C  CD    . ARG B  1  240 ? 69.223  41.044 7.645   1.00 24.91  ? 1039 ARG D CD    1 
ATOM   7351  N  NE    . ARG B  1  240 ? 68.286  41.811 6.821   1.00 24.23  ? 1039 ARG D NE    1 
ATOM   7352  C  CZ    . ARG B  1  240 ? 67.619  42.852 7.261   1.00 24.43  ? 1039 ARG D CZ    1 
ATOM   7353  N  NH1   . ARG B  1  240 ? 67.735  43.256 8.520   1.00 24.55  ? 1039 ARG D NH1   1 
ATOM   7354  N  NH2   . ARG B  1  240 ? 66.805  43.526 6.432   1.00 24.77  ? 1039 ARG D NH2   1 
ATOM   7355  N  N     . ASP B  1  241 ? 66.623  36.802 5.309   1.00 21.25  ? 1040 ASP D N     1 
ATOM   7356  C  CA    . ASP B  1  241 ? 65.548  35.839 5.325   1.00 20.35  ? 1040 ASP D CA    1 
ATOM   7357  C  C     . ASP B  1  241 ? 65.173  35.282 3.959   1.00 21.05  ? 1040 ASP D C     1 
ATOM   7358  O  O     . ASP B  1  241 ? 64.291  34.404 3.872   1.00 22.11  ? 1040 ASP D O     1 
ATOM   7359  C  CB    . ASP B  1  241 ? 64.277  36.413 6.003   1.00 21.01  ? 1040 ASP D CB    1 
ATOM   7360  C  CG    . ASP B  1  241 ? 63.718  37.612 5.275   1.00 21.05  ? 1040 ASP D CG    1 
ATOM   7361  O  OD1   . ASP B  1  241 ? 64.154  37.923 4.126   1.00 19.80  ? 1040 ASP D OD1   1 
ATOM   7362  O  OD2   . ASP B  1  241 ? 62.820  38.249 5.842   1.00 22.03  ? 1040 ASP D OD2   1 
ATOM   7363  N  N     . GLY B  1  242 ? 65.818  35.756 2.893   1.00 19.56  ? 1041 GLY D N     1 
ATOM   7364  C  CA    . GLY B  1  242 ? 65.584  35.194 1.581   1.00 19.62  ? 1041 GLY D CA    1 
ATOM   7365  C  C     . GLY B  1  242 ? 64.260  35.574 0.944   1.00 19.63  ? 1041 GLY D C     1 
ATOM   7366  O  O     . GLY B  1  242 ? 63.835  34.890 0.039   1.00 19.73  ? 1041 GLY D O     1 
ATOM   7367  N  N     . LEU B  1  243 ? 63.625  36.672 1.397   1.00 18.60  ? 1042 LEU D N     1 
ATOM   7368  C  CA    . LEU B  1  243 ? 62.285  36.986 0.957   1.00 18.89  ? 1042 LEU D CA    1 
ATOM   7369  C  C     . LEU B  1  243 ? 62.211  38.327 0.266   1.00 18.83  ? 1042 LEU D C     1 
ATOM   7370  O  O     . LEU B  1  243 ? 62.967  39.265 0.587   1.00 18.84  ? 1042 LEU D O     1 
ATOM   7371  C  CB    . LEU B  1  243 ? 61.305  37.002 2.179   1.00 18.55  ? 1042 LEU D CB    1 
ATOM   7372  C  CG    . LEU B  1  243 ? 61.000  35.649 2.832   1.00 19.08  ? 1042 LEU D CG    1 
ATOM   7373  C  CD1   . LEU B  1  243 ? 60.085  35.845 4.003   1.00 19.13  ? 1042 LEU D CD1   1 
ATOM   7374  C  CD2   . LEU B  1  243 ? 60.367  34.721 1.863   1.00 19.73  ? 1042 LEU D CD2   1 
ATOM   7375  N  N     . LYS B  1  244 ? 61.305  38.382 -0.715  1.00 19.47  ? 1043 LYS D N     1 
ATOM   7376  C  CA    . LYS B  1  244 ? 60.846  39.653 -1.307  1.00 19.95  ? 1043 LYS D CA    1 
ATOM   7377  C  C     . LYS B  1  244 ? 59.733  40.208 -0.440  1.00 20.27  ? 1043 LYS D C     1 
ATOM   7378  O  O     . LYS B  1  244 ? 59.173  39.507 0.398   1.00 21.22  ? 1043 LYS D O     1 
ATOM   7379  C  CB    . LYS B  1  244 ? 60.348  39.388 -2.731  1.00 19.98  ? 1043 LYS D CB    1 
ATOM   7380  C  CG    . LYS B  1  244 ? 61.406  38.880 -3.680  1.00 20.79  ? 1043 LYS D CG    1 
ATOM   7381  C  CD    . LYS B  1  244 ? 60.724  38.574 -5.052  1.00 20.43  ? 1043 LYS D CD    1 
ATOM   7382  C  CE    . LYS B  1  244 ? 61.747  37.862 -5.955  1.00 20.92  ? 1043 LYS D CE    1 
ATOM   7383  N  NZ    . LYS B  1  244 ? 61.067  37.514 -7.216  1.00 21.32  ? 1043 LYS D NZ    1 
ATOM   7384  N  N     . PRO B  1  245 ? 59.400  41.510 -0.580  1.00 21.39  ? 1044 PRO D N     1 
ATOM   7385  C  CA    . PRO B  1  245 ? 58.293  42.085 0.177   1.00 20.99  ? 1044 PRO D CA    1 
ATOM   7386  C  C     . PRO B  1  245 ? 56.953  41.333 0.083   1.00 21.56  ? 1044 PRO D C     1 
ATOM   7387  O  O     . PRO B  1  245 ? 56.290  41.167 1.123   1.00 21.28  ? 1044 PRO D O     1 
ATOM   7388  C  CB    . PRO B  1  245 ? 58.175  43.502 -0.362  1.00 21.37  ? 1044 PRO D CB    1 
ATOM   7389  C  CG    . PRO B  1  245 ? 59.560  43.812 -0.759  1.00 21.73  ? 1044 PRO D CG    1 
ATOM   7390  C  CD    . PRO B  1  245 ? 60.172  42.519 -1.328  1.00 21.29  ? 1044 PRO D CD    1 
ATOM   7391  N  N     . VAL B  1  246 ? 56.549  40.876 -1.145  1.00 20.87  ? 1045 VAL D N     1 
ATOM   7392  C  CA    . VAL B  1  246 ? 55.253  40.215 -1.226  1.00 20.59  ? 1045 VAL D CA    1 
ATOM   7393  C  C     . VAL B  1  246 ? 55.253  38.900 -0.412  1.00 20.85  ? 1045 VAL D C     1 
ATOM   7394  O  O     . VAL B  1  246 ? 54.278  38.550 0.268   1.00 20.24  ? 1045 VAL D O     1 
ATOM   7395  C  CB    . VAL B  1  246 ? 54.820  39.996 -2.663  1.00 20.44  ? 1045 VAL D CB    1 
ATOM   7396  C  CG1   . VAL B  1  246 ? 55.762  39.013 -3.411  1.00 20.39  ? 1045 VAL D CG1   1 
ATOM   7397  C  CG2   . VAL B  1  246 ? 53.397  39.483 -2.739  1.00 20.77  ? 1045 VAL D CG2   1 
ATOM   7398  N  N     . HIS B  1  247 ? 56.346  38.174 -0.466  1.00 20.66  ? 1046 HIS D N     1 
ATOM   7399  C  CA    . HIS B  1  247 ? 56.396  36.884 0.234   1.00 21.15  ? 1046 HIS D CA    1 
ATOM   7400  C  C     . HIS B  1  247 ? 56.506  37.090 1.754   1.00 20.32  ? 1046 HIS D C     1 
ATOM   7401  O  O     . HIS B  1  247 ? 55.909  36.324 2.522   1.00 18.76  ? 1046 HIS D O     1 
ATOM   7402  C  CB    . HIS B  1  247 ? 57.638  36.077 -0.246  1.00 22.65  ? 1046 HIS D CB    1 
ATOM   7403  C  CG    . HIS B  1  247 ? 57.609  35.854 -1.721  1.00 26.24  ? 1046 HIS D CG    1 
ATOM   7404  N  ND1   . HIS B  1  247 ? 58.192  36.721 -2.611  1.00 28.88  ? 1046 HIS D ND1   1 
ATOM   7405  C  CD2   . HIS B  1  247 ? 57.096  34.846 -2.464  1.00 28.09  ? 1046 HIS D CD2   1 
ATOM   7406  C  CE1   . HIS B  1  247 ? 58.032  36.262 -3.836  1.00 29.43  ? 1046 HIS D CE1   1 
ATOM   7407  N  NE2   . HIS B  1  247 ? 57.381  35.136 -3.782  1.00 28.14  ? 1046 HIS D NE2   1 
ATOM   7408  N  N     . ARG B  1  248 ? 57.256  38.103 2.187   1.00 19.81  ? 1047 ARG D N     1 
ATOM   7409  C  CA    . ARG B  1  248 ? 57.338  38.376 3.605   1.00 19.74  ? 1047 ARG D CA    1 
ATOM   7410  C  C     . ARG B  1  248 ? 55.981  38.783 4.151   1.00 20.52  ? 1047 ARG D C     1 
ATOM   7411  O  O     . ARG B  1  248 ? 55.601  38.365 5.265   1.00 20.42  ? 1047 ARG D O     1 
ATOM   7412  C  CB    . ARG B  1  248 ? 58.363  39.523 3.857   1.00 19.50  ? 1047 ARG D CB    1 
ATOM   7413  C  CG    . ARG B  1  248 ? 58.681  39.718 5.345   1.00 19.90  ? 1047 ARG D CG    1 
ATOM   7414  C  CD    . ARG B  1  248 ? 59.813  40.663 5.536   1.00 19.99  ? 1047 ARG D CD    1 
ATOM   7415  N  NE    . ARG B  1  248 ? 61.055  40.203 4.869   1.00 21.24  ? 1047 ARG D NE    1 
ATOM   7416  C  CZ    . ARG B  1  248 ? 61.587  40.767 3.812   1.00 20.78  ? 1047 ARG D CZ    1 
ATOM   7417  N  NH1   . ARG B  1  248 ? 61.038  41.863 3.256   1.00 21.49  ? 1047 ARG D NH1   1 
ATOM   7418  N  NH2   . ARG B  1  248 ? 62.713  40.281 3.305   1.00 21.67  ? 1047 ARG D NH2   1 
ATOM   7419  N  N     . ARG B  1  249 ? 55.224  39.612 3.416   1.00 20.16  ? 1048 ARG D N     1 
ATOM   7420  C  CA    . ARG B  1  249 ? 53.926  40.036 3.859   1.00 22.21  ? 1048 ARG D CA    1 
ATOM   7421  C  C     . ARG B  1  249 ? 52.885  38.907 3.830   1.00 21.91  ? 1048 ARG D C     1 
ATOM   7422  O  O     . ARG B  1  249 ? 51.982  38.878 4.678   1.00 21.99  ? 1048 ARG D O     1 
ATOM   7423  C  CB    . ARG B  1  249 ? 53.459  41.221 3.011   1.00 21.73  ? 1048 ARG D CB    1 
ATOM   7424  C  CG    . ARG B  1  249 ? 54.264  42.494 3.310   1.00 22.82  ? 1048 ARG D CG    1 
ATOM   7425  C  CD    . ARG B  1  249 ? 54.183  43.491 2.151   1.00 22.12  ? 1048 ARG D CD    1 
ATOM   7426  N  NE    . ARG B  1  249 ? 54.853  44.730 2.515   1.00 22.24  ? 1048 ARG D NE    1 
ATOM   7427  C  CZ    . ARG B  1  249 ? 55.073  45.744 1.660   1.00 23.45  ? 1048 ARG D CZ    1 
ATOM   7428  N  NH1   . ARG B  1  249 ? 54.676  45.670 0.394   1.00 21.55  ? 1048 ARG D NH1   1 
ATOM   7429  N  NH2   . ARG B  1  249 ? 55.678  46.866 2.090   1.00 21.80  ? 1048 ARG D NH2   1 
ATOM   7430  N  N     . ILE B  1  250 ? 53.005  37.990 2.884   1.00 21.85  ? 1049 ILE D N     1 
ATOM   7431  C  CA    . ILE B  1  250 ? 52.154  36.778 2.903   1.00 20.80  ? 1049 ILE D CA    1 
ATOM   7432  C  C     . ILE B  1  250 ? 52.400  35.988 4.176   1.00 21.07  ? 1049 ILE D C     1 
ATOM   7433  O  O     . ILE B  1  250 ? 51.455  35.624 4.896   1.00 20.76  ? 1049 ILE D O     1 
ATOM   7434  C  CB    . ILE B  1  250 ? 52.419  35.918 1.663   1.00 20.60  ? 1049 ILE D CB    1 
ATOM   7435  C  CG1   . ILE B  1  250 ? 51.756  36.558 0.423   1.00 20.47  ? 1049 ILE D CG1   1 
ATOM   7436  C  CG2   . ILE B  1  250 ? 51.754  34.549 1.887   1.00 20.72  ? 1049 ILE D CG2   1 
ATOM   7437  C  CD1   . ILE B  1  250 ? 52.308  36.086 -0.910  1.00 20.02  ? 1049 ILE D CD1   1 
ATOM   7438  N  N     . LEU B  1  251 ? 53.688  35.669 4.478   1.00 21.03  ? 1050 LEU D N     1 
ATOM   7439  C  CA    . LEU B  1  251 ? 53.967  34.825 5.626   1.00 21.21  ? 1050 LEU D CA    1 
ATOM   7440  C  C     . LEU B  1  251 ? 53.670  35.542 6.916   1.00 21.63  ? 1050 LEU D C     1 
ATOM   7441  O  O     . LEU B  1  251 ? 53.215  34.936 7.892   1.00 22.35  ? 1050 LEU D O     1 
ATOM   7442  C  CB    . LEU B  1  251 ? 55.454  34.375 5.573   1.00 21.40  ? 1050 LEU D CB    1 
ATOM   7443  C  CG    . LEU B  1  251 ? 55.714  33.538 4.283   1.00 21.98  ? 1050 LEU D CG    1 
ATOM   7444  C  CD1   . LEU B  1  251 ? 57.244  33.218 4.293   1.00 22.88  ? 1050 LEU D CD1   1 
ATOM   7445  C  CD2   . LEU B  1  251 ? 54.933  32.346 4.170   1.00 21.95  ? 1050 LEU D CD2   1 
ATOM   7446  N  N     . TYR B  1  252 ? 53.934  36.876 6.959   1.00 22.77  ? 1051 TYR D N     1 
ATOM   7447  C  CA    . TYR B  1  252 ? 53.555  37.655 8.140   1.00 23.51  ? 1051 TYR D CA    1 
ATOM   7448  C  C     . TYR B  1  252 ? 52.069  37.671 8.328   1.00 22.24  ? 1051 TYR D C     1 
ATOM   7449  O  O     . TYR B  1  252 ? 51.571  37.566 9.463   1.00 22.78  ? 1051 TYR D O     1 
ATOM   7450  C  CB    . TYR B  1  252 ? 54.099  39.060 8.014   1.00 23.21  ? 1051 TYR D CB    1 
ATOM   7451  C  CG    . TYR B  1  252 ? 53.773  39.945 9.227   1.00 26.13  ? 1051 TYR D CG    1 
ATOM   7452  C  CD1   . TYR B  1  252 ? 54.296  39.628 10.514  1.00 25.89  ? 1051 TYR D CD1   1 
ATOM   7453  C  CD2   . TYR B  1  252 ? 52.979  41.081 9.081   1.00 26.01  ? 1051 TYR D CD2   1 
ATOM   7454  C  CE1   . TYR B  1  252 ? 54.019  40.409 11.584  1.00 28.99  ? 1051 TYR D CE1   1 
ATOM   7455  C  CE2   . TYR B  1  252 ? 52.684  41.874 10.160  1.00 28.40  ? 1051 TYR D CE2   1 
ATOM   7456  C  CZ    . TYR B  1  252 ? 53.189  41.569 11.425  1.00 29.35  ? 1051 TYR D CZ    1 
ATOM   7457  O  OH    . TYR B  1  252 ? 52.920  42.354 12.490  1.00 30.25  ? 1051 TYR D OH    1 
ATOM   7458  N  N     . GLY B  1  253 ? 51.308  37.846 7.236   1.00 22.44  ? 1052 GLY D N     1 
ATOM   7459  C  CA    . GLY B  1  253 ? 49.850  37.795 7.331   1.00 22.32  ? 1052 GLY D CA    1 
ATOM   7460  C  C     . GLY B  1  253 ? 49.337  36.470 7.843   1.00 22.32  ? 1052 GLY D C     1 
ATOM   7461  O  O     . GLY B  1  253 ? 48.481  36.442 8.739   1.00 20.96  ? 1052 GLY D O     1 
ATOM   7462  N  N     . LEU B  1  254 ? 49.861  35.370 7.296   1.00 21.30  ? 1053 LEU D N     1 
ATOM   7463  C  CA    . LEU B  1  254 ? 49.473  34.035 7.797   1.00 22.57  ? 1053 LEU D CA    1 
ATOM   7464  C  C     . LEU B  1  254 ? 49.730  33.945 9.297   1.00 23.60  ? 1053 LEU D C     1 
ATOM   7465  O  O     . LEU B  1  254 ? 48.943  33.330 10.035  1.00 24.38  ? 1053 LEU D O     1 
ATOM   7466  C  CB    . LEU B  1  254 ? 50.259  32.950 7.090   1.00 21.22  ? 1053 LEU D CB    1 
ATOM   7467  C  CG    . LEU B  1  254 ? 49.838  32.650 5.595   1.00 21.36  ? 1053 LEU D CG    1 
ATOM   7468  C  CD1   . LEU B  1  254 ? 50.929  31.721 4.979   1.00 21.70  ? 1053 LEU D CD1   1 
ATOM   7469  C  CD2   . LEU B  1  254 ? 48.444  32.017 5.583   1.00 20.02  ? 1053 LEU D CD2   1 
ATOM   7470  N  N     . ASN B  1  255 ? 50.842  34.544 9.781   1.00 23.12  ? 1054 ASN D N     1 
ATOM   7471  C  CA    . ASN B  1  255 ? 51.129  34.498 11.200  1.00 24.38  ? 1054 ASN D CA    1 
ATOM   7472  C  C     . ASN B  1  255 ? 50.159  35.347 11.995  1.00 24.27  ? 1054 ASN D C     1 
ATOM   7473  O  O     . ASN B  1  255 ? 49.658  34.935 13.054  1.00 24.13  ? 1054 ASN D O     1 
ATOM   7474  C  CB    . ASN B  1  255 ? 52.564  34.964 11.448  1.00 25.23  ? 1054 ASN D CB    1 
ATOM   7475  C  CG    . ASN B  1  255 ? 53.109  34.454 12.805  1.00 27.95  ? 1054 ASN D CG    1 
ATOM   7476  O  OD1   . ASN B  1  255 ? 53.194  33.279 13.033  1.00 31.34  ? 1054 ASN D OD1   1 
ATOM   7477  N  ND2   . ASN B  1  255 ? 53.514  35.342 13.637  1.00 27.01  ? 1054 ASN D ND2   1 
ATOM   7478  N  N     . GLU B  1  256 ? 49.876  36.554 11.504  1.00 25.86  ? 1055 GLU D N     1 
ATOM   7479  C  CA    . GLU B  1  256 ? 48.953  37.438 12.213  1.00 28.56  ? 1055 GLU D CA    1 
ATOM   7480  C  C     . GLU B  1  256 ? 47.511  36.914 12.167  1.00 28.74  ? 1055 GLU D C     1 
ATOM   7481  O  O     . GLU B  1  256 ? 46.776  37.128 13.088  1.00 27.07  ? 1055 GLU D O     1 
ATOM   7482  C  CB    . GLU B  1  256 ? 49.034  38.840 11.593  1.00 29.25  ? 1055 GLU D CB    1 
ATOM   7483  C  CG    . GLU B  1  256 ? 50.324  39.498 11.821  1.00 33.85  ? 1055 GLU D CG    1 
ATOM   7484  C  CD    . GLU B  1  256 ? 50.590  39.791 13.351  1.00 39.11  ? 1055 GLU D CD    1 
ATOM   7485  O  OE1   . GLU B  1  256 ? 51.736  39.732 13.807  1.00 43.94  ? 1055 GLU D OE1   1 
ATOM   7486  O  OE2   . GLU B  1  256 ? 49.670  40.178 13.970  1.00 42.66  ? 1055 GLU D OE2   1 
ATOM   7487  N  N     . GLN B  1  257 ? 47.148  36.253 11.075  1.00 27.66  ? 1056 GLN D N     1 
ATOM   7488  C  CA    . GLN B  1  257 ? 45.834  35.627 11.003  1.00 27.46  ? 1056 GLN D CA    1 
ATOM   7489  C  C     . GLN B  1  257 ? 45.760  34.291 11.764  1.00 28.52  ? 1056 GLN D C     1 
ATOM   7490  O  O     . GLN B  1  257 ? 44.726  33.664 11.792  1.00 28.23  ? 1056 GLN D O     1 
ATOM   7491  C  CB    . GLN B  1  257 ? 45.478  35.349 9.519   1.00 27.66  ? 1056 GLN D CB    1 
ATOM   7492  C  CG    . GLN B  1  257 ? 45.395  36.641 8.694   1.00 27.82  ? 1056 GLN D CG    1 
ATOM   7493  C  CD    . GLN B  1  257 ? 45.499  36.317 7.196   1.00 27.84  ? 1056 GLN D CD    1 
ATOM   7494  O  OE1   . GLN B  1  257 ? 45.002  35.294 6.702   1.00 27.54  ? 1056 GLN D OE1   1 
ATOM   7495  N  NE2   . GLN B  1  257 ? 46.156  37.200 6.458   1.00 28.63  ? 1056 GLN D NE2   1 
ATOM   7496  N  N     . GLY B  1  258 ? 46.844  33.895 12.399  1.00 30.17  ? 1057 GLY D N     1 
ATOM   7497  C  CA    . GLY B  1  258 ? 46.872  32.660 13.172  1.00 29.15  ? 1057 GLY D CA    1 
ATOM   7498  C  C     . GLY B  1  258 ? 46.772  31.386 12.350  1.00 27.92  ? 1057 GLY D C     1 
ATOM   7499  O  O     . GLY B  1  258 ? 46.200  30.383 12.801  1.00 26.76  ? 1057 GLY D O     1 
ATOM   7500  N  N     . MET B  1  259 ? 47.269  31.420 11.107  1.00 26.50  ? 1058 MET D N     1 
ATOM   7501  C  CA    . MET B  1  259 ? 47.178  30.302 10.210  1.00 26.35  ? 1058 MET D CA    1 
ATOM   7502  C  C     . MET B  1  259 ? 48.311  29.265 10.347  1.00 26.48  ? 1058 MET D C     1 
ATOM   7503  O  O     . MET B  1  259 ? 49.070  28.961 9.405   1.00 26.21  ? 1058 MET D O     1 
ATOM   7504  C  CB    . MET B  1  259 ? 47.142  30.788 8.758   1.00 26.93  ? 1058 MET D CB    1 
ATOM   7505  C  CG    . MET B  1  259 ? 45.924  31.633 8.469   1.00 28.28  ? 1058 MET D CG    1 
ATOM   7506  S  SD    . MET B  1  259 ? 44.389  30.881 8.982   1.00 31.76  ? 1058 MET D SD    1 
ATOM   7507  C  CE    . MET B  1  259 ? 44.494  29.306 7.946   1.00 30.50  ? 1058 MET D CE    1 
ATOM   7508  N  N     . THR B  1  260 ? 48.459  28.750 11.569  1.00 26.26  ? 1059 THR D N     1 
ATOM   7509  C  CA    . THR B  1  260 ? 49.452  27.789 11.894  1.00 27.35  ? 1059 THR D CA    1 
ATOM   7510  C  C     . THR B  1  260 ? 49.056  26.400 11.407  1.00 29.10  ? 1059 THR D C     1 
ATOM   7511  O  O     . THR B  1  260 ? 47.872  26.144 11.125  1.00 28.80  ? 1059 THR D O     1 
ATOM   7512  C  CB    . THR B  1  260 ? 49.732  27.754 13.414  1.00 28.93  ? 1059 THR D CB    1 
ATOM   7513  O  OG1   . THR B  1  260 ? 48.477  27.686 14.134  1.00 28.56  ? 1059 THR D OG1   1 
ATOM   7514  C  CG2   . THR B  1  260 ? 50.421  29.038 13.837  1.00 30.88  ? 1059 THR D CG2   1 
ATOM   7515  N  N     . PRO B  1  261 ? 50.089  25.459 11.313  1.00 29.19  ? 1060 PRO D N     1 
ATOM   7516  C  CA    . PRO B  1  261 ? 49.695  24.173 10.748  1.00 29.65  ? 1060 PRO D CA    1 
ATOM   7517  C  C     . PRO B  1  261 ? 48.626  23.419 11.552  1.00 33.81  ? 1060 PRO D C     1 
ATOM   7518  O  O     . PRO B  1  261 ? 47.854  22.667 10.928  1.00 32.59  ? 1060 PRO D O     1 
ATOM   7519  C  CB    . PRO B  1  261 ? 51.006  23.384 10.780  1.00 31.49  ? 1060 PRO D CB    1 
ATOM   7520  C  CG    . PRO B  1  261 ? 52.077  24.397 10.630  1.00 32.12  ? 1060 PRO D CG    1 
ATOM   7521  C  CD    . PRO B  1  261 ? 51.586  25.490 11.531  1.00 29.32  ? 1060 PRO D CD    1 
ATOM   7522  N  N     . ASP B  1  262 ? 48.579  23.587 12.872  1.00 35.06  ? 1061 ASP D N     1 
ATOM   7523  C  CA    . ASP B  1  262 ? 47.571  22.926 13.691  1.00 42.88  ? 1061 ASP D CA    1 
ATOM   7524  C  C     . ASP B  1  262 ? 46.114  23.330 13.368  1.00 44.58  ? 1061 ASP D C     1 
ATOM   7525  O  O     . ASP B  1  262 ? 45.228  22.522 13.468  1.00 51.58  ? 1061 ASP D O     1 
ATOM   7526  C  CB    . ASP B  1  262 ? 47.908  23.099 15.191  1.00 44.22  ? 1061 ASP D CB    1 
ATOM   7527  C  CG    . ASP B  1  262 ? 48.072  24.561 15.567  1.00 50.78  ? 1061 ASP D CG    1 
ATOM   7528  O  OD1   . ASP B  1  262 ? 48.662  25.313 14.765  1.00 46.22  ? 1061 ASP D OD1   1 
ATOM   7529  O  OD2   . ASP B  1  262 ? 47.608  24.964 16.669  1.00 48.81  ? 1061 ASP D OD2   1 
ATOM   7530  N  N     . LYS B  1  263 ? 45.926  24.574 13.008  1.00 42.93  ? 1062 LYS D N     1 
ATOM   7531  C  CA    . LYS B  1  263 ? 44.576  25.103 12.661  1.00 42.37  ? 1062 LYS D CA    1 
ATOM   7532  C  C     . LYS B  1  263 ? 44.046  24.700 11.307  1.00 34.21  ? 1062 LYS D C     1 
ATOM   7533  O  O     . LYS B  1  263 ? 44.811  24.281 10.426  1.00 31.28  ? 1062 LYS D O     1 
ATOM   7534  C  CB    . LYS B  1  263 ? 44.557  26.647 12.788  1.00 47.49  ? 1062 LYS D CB    1 
ATOM   7535  C  CG    . LYS B  1  263 ? 44.781  27.119 14.245  1.00 51.12  ? 1062 LYS D CG    1 
ATOM   7536  C  CD    . LYS B  1  263 ? 44.619  28.622 14.296  1.00 59.38  ? 1062 LYS D CD    1 
ATOM   7537  C  CE    . LYS B  1  263 ? 44.718  29.148 15.695  1.00 57.23  ? 1062 LYS D CE    1 
ATOM   7538  N  NZ    . LYS B  1  263 ? 44.749  30.650 15.704  1.00 63.92  ? 1062 LYS D NZ    1 
ATOM   7539  N  N     . SER B  1  264 ? 42.740  24.828 11.112  1.00 33.21  ? 1063 SER D N     1 
ATOM   7540  C  CA    . SER B  1  264 ? 42.056  24.511 9.854   1.00 32.44  ? 1063 SER D CA    1 
ATOM   7541  C  C     . SER B  1  264 ? 42.511  25.463 8.698   1.00 31.93  ? 1063 SER D C     1 
ATOM   7542  O  O     . SER B  1  264 ? 42.939  26.602 8.913   1.00 31.19  ? 1063 SER D O     1 
ATOM   7543  C  CB    . SER B  1  264 ? 40.535  24.743 10.064  1.00 35.48  ? 1063 SER D CB    1 
ATOM   7544  O  OG    . SER B  1  264 ? 40.048  23.619 10.829  1.00 40.29  ? 1063 SER D OG    1 
ATOM   7545  N  N     . TYR B  1  265 ? 42.425  24.980 7.479   1.00 28.94  ? 1064 TYR D N     1 
ATOM   7546  C  CA    . TYR B  1  265 ? 42.731  25.773 6.329   1.00 31.02  ? 1064 TYR D CA    1 
ATOM   7547  C  C     . TYR B  1  265 ? 41.781  26.986 6.267   1.00 30.98  ? 1064 TYR D C     1 
ATOM   7548  O  O     . TYR B  1  265 ? 40.727  26.940 6.782   1.00 29.42  ? 1064 TYR D O     1 
ATOM   7549  C  CB    . TYR B  1  265 ? 42.601  24.979 5.028   1.00 31.44  ? 1064 TYR D CB    1 
ATOM   7550  C  CG    . TYR B  1  265 ? 43.666  23.934 4.824   1.00 32.99  ? 1064 TYR D CG    1 
ATOM   7551  C  CD1   . TYR B  1  265 ? 44.872  24.214 4.224   1.00 31.78  ? 1064 TYR D CD1   1 
ATOM   7552  C  CD2   . TYR B  1  265 ? 43.443  22.595 5.205   1.00 35.47  ? 1064 TYR D CD2   1 
ATOM   7553  C  CE1   . TYR B  1  265 ? 45.826  23.298 4.012   1.00 31.91  ? 1064 TYR D CE1   1 
ATOM   7554  C  CE2   . TYR B  1  265 ? 44.389  21.634 5.011   1.00 36.77  ? 1064 TYR D CE2   1 
ATOM   7555  C  CZ    . TYR B  1  265 ? 45.586  21.962 4.400   1.00 35.03  ? 1064 TYR D CZ    1 
ATOM   7556  O  OH    . TYR B  1  265 ? 46.538  21.020 4.195   1.00 38.83  ? 1064 TYR D OH    1 
ATOM   7557  N  N     . LYS B  1  266 ? 42.226  28.055 5.622   1.00 27.96  ? 1065 LYS D N     1 
ATOM   7558  C  CA    . LYS B  1  266 ? 41.438  29.271 5.503   1.00 28.00  ? 1065 LYS D CA    1 
ATOM   7559  C  C     . LYS B  1  266 ? 41.335  29.666 4.019   1.00 26.17  ? 1065 LYS D C     1 
ATOM   7560  O  O     . LYS B  1  266 ? 42.258  29.459 3.248   1.00 24.55  ? 1065 LYS D O     1 
ATOM   7561  C  CB    . LYS B  1  266 ? 42.056  30.384 6.292   1.00 30.45  ? 1065 LYS D CB    1 
ATOM   7562  C  CG    . LYS B  1  266 ? 41.404  31.735 6.169   1.00 33.81  ? 1065 LYS D CG    1 
ATOM   7563  C  CD    . LYS B  1  266 ? 42.215  32.775 6.946   1.00 36.24  ? 1065 LYS D CD    1 
ATOM   7564  C  CE    . LYS B  1  266 ? 41.711  34.154 6.819   1.00 35.51  ? 1065 LYS D CE    1 
ATOM   7565  N  NZ    . LYS B  1  266 ? 42.658  35.063 7.528   1.00 35.64  ? 1065 LYS D NZ    1 
ATOM   7566  N  N     A LYS B  1  267 ? 40.188  30.130 3.504   0.35 25.23  ? 1066 LYS D N     1 
ATOM   7567  N  N     B LYS B  1  267 ? 40.188  30.120 3.500   0.35 25.30  ? 1066 LYS D N     1 
ATOM   7568  N  N     C LYS B  1  267 ? 40.239  30.111 3.490   0.30 25.91  ? 1066 LYS D N     1 
ATOM   7569  C  CA    A LYS B  1  267 ? 40.070  30.485 2.086   0.35 24.47  ? 1066 LYS D CA    1 
ATOM   7570  C  CA    B LYS B  1  267 ? 40.090  30.478 2.082   0.35 24.57  ? 1066 LYS D CA    1 
ATOM   7571  C  CA    C LYS B  1  267 ? 40.169  30.490 2.088   0.30 25.43  ? 1066 LYS D CA    1 
ATOM   7572  C  C     A LYS B  1  267 ? 41.174  31.464 1.644   0.35 23.44  ? 1066 LYS D C     1 
ATOM   7573  C  C     B LYS B  1  267 ? 41.189  31.453 1.641   0.35 23.47  ? 1066 LYS D C     1 
ATOM   7574  C  C     C LYS B  1  267 ? 41.274  31.465 1.650   0.30 24.12  ? 1066 LYS D C     1 
ATOM   7575  O  O     A LYS B  1  267 ? 41.509  32.420 2.351   0.35 23.38  ? 1066 LYS D O     1 
ATOM   7576  O  O     B LYS B  1  267 ? 41.473  32.435 2.308   0.35 23.30  ? 1066 LYS D O     1 
ATOM   7577  O  O     C LYS B  1  267 ? 41.611  32.420 2.350   0.30 24.28  ? 1066 LYS D O     1 
ATOM   7578  C  CB    A LYS B  1  267 ? 38.673  31.052 1.861   0.35 24.23  ? 1066 LYS D CB    1 
ATOM   7579  C  CB    B LYS B  1  267 ? 38.770  31.207 1.840   0.35 24.48  ? 1066 LYS D CB    1 
ATOM   7580  C  CB    C LYS B  1  267 ? 38.848  31.205 1.868   0.30 26.04  ? 1066 LYS D CB    1 
ATOM   7581  C  CG    A LYS B  1  267 ? 37.586  29.974 1.810   0.35 24.27  ? 1066 LYS D CG    1 
ATOM   7582  C  CG    B LYS B  1  267 ? 37.610  30.707 2.669   0.35 24.56  ? 1066 LYS D CG    1 
ATOM   7583  C  CG    C LYS B  1  267 ? 37.649  30.391 2.236   0.30 26.86  ? 1066 LYS D CG    1 
ATOM   7584  C  CD    A LYS B  1  267 ? 37.350  29.287 3.196   0.35 23.96  ? 1066 LYS D CD    1 
ATOM   7585  C  CD    B LYS B  1  267 ? 36.887  29.643 1.822   0.35 24.49  ? 1066 LYS D CD    1 
ATOM   7586  C  CD    C LYS B  1  267 ? 37.570  29.037 1.513   0.30 26.85  ? 1066 LYS D CD    1 
ATOM   7587  C  CE    A LYS B  1  267 ? 37.269  30.272 4.327   0.35 23.30  ? 1066 LYS D CE    1 
ATOM   7588  C  CE    B LYS B  1  267 ? 35.896  28.690 2.506   0.35 23.96  ? 1066 LYS D CE    1 
ATOM   7589  C  CE    C LYS B  1  267 ? 37.206  29.188 0.051   0.30 27.34  ? 1066 LYS D CE    1 
ATOM   7590  N  NZ    A LYS B  1  267 ? 37.776  29.519 5.552   0.35 23.73  ? 1066 LYS D NZ    1 
ATOM   7591  N  NZ    B LYS B  1  267 ? 36.233  27.491 1.623   0.35 23.93  ? 1066 LYS D NZ    1 
ATOM   7592  N  NZ    C LYS B  1  267 ? 36.991  27.866 -0.654  0.30 28.60  ? 1066 LYS D NZ    1 
ATOM   7593  N  N     . SER B  1  268 ? 41.725  31.203 0.477   1.00 23.56  ? 1067 SER D N     1 
ATOM   7594  C  CA    . SER B  1  268 ? 42.837  32.022 -0.012  1.00 23.02  ? 1067 SER D CA    1 
ATOM   7595  C  C     . SER B  1  268 ? 42.410  33.467 -0.257  1.00 22.74  ? 1067 SER D C     1 
ATOM   7596  O  O     . SER B  1  268 ? 43.172  34.396 0.025   1.00 22.19  ? 1067 SER D O     1 
ATOM   7597  C  CB    . SER B  1  268 ? 43.400  31.423 -1.315  1.00 22.59  ? 1067 SER D CB    1 
ATOM   7598  O  OG    . SER B  1  268 ? 43.849  30.094 -1.081  1.00 23.93  ? 1067 SER D OG    1 
ATOM   7599  N  N     . ALA B  1  269 ? 41.165  33.646 -0.732  1.00 23.29  ? 1068 ALA D N     1 
ATOM   7600  C  CA    . ALA B  1  269 ? 40.665  35.009 -0.965  1.00 23.16  ? 1068 ALA D CA    1 
ATOM   7601  C  C     . ALA B  1  269 ? 40.669  35.820 0.317   1.00 23.30  ? 1068 ALA D C     1 
ATOM   7602  O  O     . ALA B  1  269 ? 40.902  37.038 0.275   1.00 24.28  ? 1068 ALA D O     1 
ATOM   7603  C  CB    . ALA B  1  269 ? 39.250  34.924 -1.563  1.00 22.53  ? 1068 ALA D CB    1 
ATOM   7604  N  N     . ARG B  1  270 ? 40.418  35.187 1.476   1.00 23.71  ? 1069 ARG D N     1 
ATOM   7605  C  CA    . ARG B  1  270 ? 40.492  35.912 2.721   1.00 23.71  ? 1069 ARG D CA    1 
ATOM   7606  C  C     . ARG B  1  270 ? 41.925  36.201 3.097   1.00 23.43  ? 1069 ARG D C     1 
ATOM   7607  O  O     . ARG B  1  270 ? 42.243  37.318 3.567   1.00 22.58  ? 1069 ARG D O     1 
ATOM   7608  C  CB    . ARG B  1  270 ? 39.810  35.110 3.833   1.00 23.84  ? 1069 ARG D CB    1 
ATOM   7609  C  CG    . ARG B  1  270 ? 38.281  34.967 3.673   1.00 25.81  ? 1069 ARG D CG    1 
ATOM   7610  C  CD    . ARG B  1  270 ? 37.645  34.364 4.912   1.00 26.09  ? 1069 ARG D CD    1 
ATOM   7611  N  NE    . ARG B  1  270 ? 37.997  35.038 6.148   1.00 29.34  ? 1069 ARG D NE    1 
ATOM   7612  C  CZ    . ARG B  1  270 ? 37.950  34.436 7.343   1.00 31.71  ? 1069 ARG D CZ    1 
ATOM   7613  N  NH1   . ARG B  1  270 ? 37.579  33.179 7.416   1.00 30.19  ? 1069 ARG D NH1   1 
ATOM   7614  N  NH2   . ARG B  1  270 ? 38.265  35.114 8.460   1.00 32.78  ? 1069 ARG D NH2   1 
ATOM   7615  N  N     . ILE B  1  271 ? 42.830  35.210 2.909   1.00 22.41  ? 1070 ILE D N     1 
ATOM   7616  C  CA    . ILE B  1  271 ? 44.240  35.415 3.202   1.00 22.67  ? 1070 ILE D CA    1 
ATOM   7617  C  C     . ILE B  1  271 ? 44.787  36.564 2.331   1.00 23.13  ? 1070 ILE D C     1 
ATOM   7618  O  O     . ILE B  1  271 ? 45.483  37.477 2.843   1.00 22.28  ? 1070 ILE D O     1 
ATOM   7619  C  CB    . ILE B  1  271 ? 45.024  34.129 2.940   1.00 22.68  ? 1070 ILE D CB    1 
ATOM   7620  C  CG1   . ILE B  1  271 ? 44.480  33.007 3.828   1.00 23.49  ? 1070 ILE D CG1   1 
ATOM   7621  C  CG2   . ILE B  1  271 ? 46.553  34.379 3.193   1.00 21.85  ? 1070 ILE D CG2   1 
ATOM   7622  C  CD1   . ILE B  1  271 ? 45.111  31.643 3.539   1.00 24.09  ? 1070 ILE D CD1   1 
ATOM   7623  N  N     . VAL B  1  272 ? 44.455  36.561 1.041   1.00 21.96  ? 1071 VAL D N     1 
ATOM   7624  C  CA    . VAL B  1  272 ? 45.020  37.539 0.156   1.00 22.06  ? 1071 VAL D CA    1 
ATOM   7625  C  C     . VAL B  1  272 ? 44.425  38.911 0.372   1.00 21.22  ? 1071 VAL D C     1 
ATOM   7626  O  O     . VAL B  1  272 ? 45.124  39.924 0.320   1.00 21.78  ? 1071 VAL D O     1 
ATOM   7627  C  CB    . VAL B  1  272 ? 44.772  37.081 -1.337  1.00 21.35  ? 1071 VAL D CB    1 
ATOM   7628  C  CG1   . VAL B  1  272 ? 45.109  38.220 -2.327  1.00 21.16  ? 1071 VAL D CG1   1 
ATOM   7629  C  CG2   . VAL B  1  272 ? 45.681  35.849 -1.617  1.00 21.60  ? 1071 VAL D CG2   1 
ATOM   7630  N  N     . GLY B  1  273 ? 43.104  38.964 0.629   1.00 22.53  ? 1072 GLY D N     1 
ATOM   7631  C  CA    . GLY B  1  273 ? 42.450  40.242 0.872   1.00 23.03  ? 1072 GLY D CA    1 
ATOM   7632  C  C     . GLY B  1  273 ? 43.042  40.950 2.080   1.00 22.08  ? 1072 GLY D C     1 
ATOM   7633  O  O     . GLY B  1  273 ? 43.241  42.176 2.046   1.00 20.77  ? 1072 GLY D O     1 
ATOM   7634  N  N     . ASP B  1  274 ? 43.268  40.207 3.166   1.00 22.57  ? 1073 ASP D N     1 
ATOM   7635  C  CA    . ASP B  1  274 ? 43.875  40.813 4.355   1.00 23.20  ? 1073 ASP D CA    1 
ATOM   7636  C  C     . ASP B  1  274 ? 45.280  41.302 4.060   1.00 22.42  ? 1073 ASP D C     1 
ATOM   7637  O  O     . ASP B  1  274 ? 45.618  42.438 4.457   1.00 22.17  ? 1073 ASP D O     1 
ATOM   7638  C  CB    . ASP B  1  274 ? 43.925  39.786 5.513   1.00 25.60  ? 1073 ASP D CB    1 
ATOM   7639  C  CG    . ASP B  1  274 ? 42.495  39.511 6.051   1.00 30.53  ? 1073 ASP D CG    1 
ATOM   7640  O  OD1   . ASP B  1  274 ? 41.462  40.180 5.608   1.00 33.89  ? 1073 ASP D OD1   1 
ATOM   7641  O  OD2   . ASP B  1  274 ? 42.436  38.550 6.904   1.00 34.49  ? 1073 ASP D OD2   1 
ATOM   7642  N  N     . VAL B  1  275 ? 46.095  40.492 3.388   1.00 22.04  ? 1074 VAL D N     1 
ATOM   7643  C  CA    . VAL B  1  275 ? 47.464  40.901 3.055   1.00 22.17  ? 1074 VAL D CA    1 
ATOM   7644  C  C     . VAL B  1  275 ? 47.430  42.145 2.166   1.00 22.76  ? 1074 VAL D C     1 
ATOM   7645  O  O     . VAL B  1  275 ? 48.194  43.086 2.392   1.00 22.79  ? 1074 VAL D O     1 
ATOM   7646  C  CB    . VAL B  1  275 ? 48.221  39.748 2.356   1.00 21.84  ? 1074 VAL D CB    1 
ATOM   7647  C  CG1   . VAL B  1  275 ? 49.501  40.244 1.704   1.00 21.16  ? 1074 VAL D CG1   1 
ATOM   7648  C  CG2   . VAL B  1  275 ? 48.531  38.650 3.365   1.00 22.21  ? 1074 VAL D CG2   1 
ATOM   7649  N  N     . MET B  1  276 ? 46.553  42.160 1.166   1.00 22.28  ? 1075 MET D N     1 
ATOM   7650  C  CA    . MET B  1  276 ? 46.459  43.283 0.230   1.00 22.51  ? 1075 MET D CA    1 
ATOM   7651  C  C     . MET B  1  276 ? 46.016  44.581 0.953   1.00 23.51  ? 1075 MET D C     1 
ATOM   7652  O  O     . MET B  1  276 ? 46.564  45.657 0.682   1.00 22.54  ? 1075 MET D O     1 
ATOM   7653  C  CB    . MET B  1  276 ? 45.477  42.961 -0.889  1.00 23.15  ? 1075 MET D CB    1 
ATOM   7654  C  CG    . MET B  1  276 ? 45.396  44.020 -1.964  1.00 24.15  ? 1075 MET D CG    1 
ATOM   7655  S  SD    . MET B  1  276 ? 44.384  43.365 -3.355  1.00 25.82  ? 1075 MET D SD    1 
ATOM   7656  C  CE    . MET B  1  276 ? 42.793  42.842 -2.569  1.00 25.90  ? 1075 MET D CE    1 
ATOM   7657  N  N     . GLY B  1  277 ? 45.021  44.498 1.836   1.00 23.17  ? 1076 GLY D N     1 
ATOM   7658  C  CA    . GLY B  1  277 ? 44.550  45.703 2.474   1.00 24.39  ? 1076 GLY D CA    1 
ATOM   7659  C  C     . GLY B  1  277 ? 45.492  46.192 3.599   1.00 24.02  ? 1076 GLY D C     1 
ATOM   7660  O  O     . GLY B  1  277 ? 45.603  47.398 3.831   1.00 25.39  ? 1076 GLY D O     1 
ATOM   7661  N  N     . LYS B  1  278 ? 46.151  45.265 4.266   1.00 23.87  ? 1077 LYS D N     1 
ATOM   7662  C  CA    . LYS B  1  278 ? 46.991  45.613 5.422   1.00 24.25  ? 1077 LYS D CA    1 
ATOM   7663  C  C     . LYS B  1  278 ? 48.428  45.972 5.083   1.00 25.69  ? 1077 LYS D C     1 
ATOM   7664  O  O     . LYS B  1  278 ? 48.993  46.875 5.700   1.00 25.18  ? 1077 LYS D O     1 
ATOM   7665  C  CB    . LYS B  1  278 ? 46.983  44.477 6.444   1.00 24.73  ? 1077 LYS D CB    1 
ATOM   7666  C  CG    . LYS B  1  278 ? 45.593  44.354 7.168   1.00 26.36  ? 1077 LYS D CG    1 
ATOM   7667  C  CD    . LYS B  1  278 ? 45.746  43.298 8.273   1.00 28.14  ? 1077 LYS D CD    1 
ATOM   7668  C  CE    . LYS B  1  278 ? 44.874  43.569 9.443   1.00 31.90  ? 1077 LYS D CE    1 
ATOM   7669  N  NZ    . LYS B  1  278 ? 44.218  42.518 10.202  1.00 32.76  ? 1077 LYS D NZ    1 
ATOM   7670  N  N     . TYR B  1  279 ? 49.045  45.312 4.096   1.00 24.47  ? 1078 TYR D N     1 
ATOM   7671  C  CA    . TYR B  1  279 ? 50.471  45.531 3.829   1.00 23.92  ? 1078 TYR D CA    1 
ATOM   7672  C  C     . TYR B  1  279 ? 50.860  45.665 2.362   1.00 22.06  ? 1078 TYR D C     1 
ATOM   7673  O  O     . TYR B  1  279 ? 51.860  46.286 2.085   1.00 20.67  ? 1078 TYR D O     1 
ATOM   7674  C  CB    . TYR B  1  279 ? 51.314  44.393 4.450   1.00 25.78  ? 1078 TYR D CB    1 
ATOM   7675  C  CG    . TYR B  1  279 ? 50.722  43.776 5.688   1.00 27.66  ? 1078 TYR D CG    1 
ATOM   7676  C  CD1   . TYR B  1  279 ? 50.883  44.414 6.953   1.00 29.57  ? 1078 TYR D CD1   1 
ATOM   7677  C  CD2   . TYR B  1  279 ? 50.060  42.597 5.653   1.00 28.38  ? 1078 TYR D CD2   1 
ATOM   7678  C  CE1   . TYR B  1  279 ? 50.349  43.832 8.090   1.00 29.47  ? 1078 TYR D CE1   1 
ATOM   7679  C  CE2   . TYR B  1  279 ? 49.524  42.017 6.800   1.00 29.19  ? 1078 TYR D CE2   1 
ATOM   7680  C  CZ    . TYR B  1  279 ? 49.679  42.620 7.983   1.00 30.12  ? 1078 TYR D CZ    1 
ATOM   7681  O  OH    . TYR B  1  279 ? 49.152  42.049 9.108   1.00 34.48  ? 1078 TYR D OH    1 
ATOM   7682  N  N     . HIS B  1  280 ? 50.113  45.100 1.419   1.00 21.29  ? 1079 HIS D N     1 
ATOM   7683  C  CA    . HIS B  1  280 ? 50.578  44.973 0.022   1.00 21.25  ? 1079 HIS D CA    1 
ATOM   7684  C  C     . HIS B  1  280 ? 49.557  45.601 -0.923  1.00 21.61  ? 1079 HIS D C     1 
ATOM   7685  O  O     . HIS B  1  280 ? 48.747  44.871 -1.517  1.00 20.91  ? 1079 HIS D O     1 
ATOM   7686  C  CB    . HIS B  1  280 ? 50.864  43.501 -0.323  1.00 20.67  ? 1079 HIS D CB    1 
ATOM   7687  C  CG    . HIS B  1  280 ? 51.877  43.368 -1.424  1.00 20.53  ? 1079 HIS D CG    1 
ATOM   7688  N  ND1   . HIS B  1  280 ? 53.235  43.646 -1.242  1.00 20.73  ? 1079 HIS D ND1   1 
ATOM   7689  C  CD2   . HIS B  1  280 ? 51.737  42.981 -2.717  1.00 20.34  ? 1079 HIS D CD2   1 
ATOM   7690  C  CE1   . HIS B  1  280 ? 53.877  43.407 -2.355  1.00 20.19  ? 1079 HIS D CE1   1 
ATOM   7691  N  NE2   . HIS B  1  280 ? 52.987  43.010 -3.274  1.00 20.98  ? 1079 HIS D NE2   1 
ATOM   7692  N  N     . PRO B  1  281 ? 49.577  46.929 -1.103  1.00 21.99  ? 1080 PRO D N     1 
ATOM   7693  C  CA    . PRO B  1  281 ? 48.542  47.608 -1.903  1.00 23.25  ? 1080 PRO D CA    1 
ATOM   7694  C  C     . PRO B  1  281 ? 48.735  47.417 -3.386  1.00 24.05  ? 1080 PRO D C     1 
ATOM   7695  O  O     . PRO B  1  281 ? 48.895  48.376 -4.166  1.00 25.26  ? 1080 PRO D O     1 
ATOM   7696  C  CB    . PRO B  1  281 ? 48.683  49.100 -1.487  1.00 23.91  ? 1080 PRO D CB    1 
ATOM   7697  C  CG    . PRO B  1  281 ? 50.182  49.213 -1.202  1.00 24.13  ? 1080 PRO D CG    1 
ATOM   7698  C  CD    . PRO B  1  281 ? 50.589  47.867 -0.567  1.00 23.93  ? 1080 PRO D CD    1 
ATOM   7699  N  N     . HIS B  1  282 ? 48.707  46.168 -3.811  1.00 22.49  ? 1081 HIS D N     1 
ATOM   7700  C  CA    . HIS B  1  282 ? 48.885  45.840 -5.217  1.00 22.28  ? 1081 HIS D CA    1 
ATOM   7701  C  C     . HIS B  1  282 ? 47.842  44.807 -5.675  1.00 22.09  ? 1081 HIS D C     1 
ATOM   7702  O  O     . HIS B  1  282 ? 47.105  44.295 -4.869  1.00 21.47  ? 1081 HIS D O     1 
ATOM   7703  C  CB    . HIS B  1  282 ? 50.299  45.289 -5.479  1.00 22.00  ? 1081 HIS D CB    1 
ATOM   7704  C  CG    . HIS B  1  282 ? 51.355  46.198 -5.023  1.00 22.04  ? 1081 HIS D CG    1 
ATOM   7705  N  ND1   . HIS B  1  282 ? 51.666  47.351 -5.684  1.00 22.67  ? 1081 HIS D ND1   1 
ATOM   7706  C  CD2   . HIS B  1  282 ? 52.190  46.139 -3.954  1.00 22.61  ? 1081 HIS D CD2   1 
ATOM   7707  C  CE1   . HIS B  1  282 ? 52.629  48.001 -5.056  1.00 23.97  ? 1081 HIS D CE1   1 
ATOM   7708  N  NE2   . HIS B  1  282 ? 52.962  47.286 -3.969  1.00 24.83  ? 1081 HIS D NE2   1 
ATOM   7709  N  N     . GLY B  1  283 ? 47.875  44.486 -6.944  1.00 22.02  ? 1082 GLY D N     1 
ATOM   7710  C  CA    . GLY B  1  283 ? 46.857  43.612 -7.490  1.00 24.14  ? 1082 GLY D CA    1 
ATOM   7711  C  C     . GLY B  1  283 ? 46.851  42.276 -6.758  1.00 25.53  ? 1082 GLY D C     1 
ATOM   7712  O  O     . GLY B  1  283 ? 47.924  41.776 -6.366  1.00 24.76  ? 1082 GLY D O     1 
ATOM   7713  N  N     . ASP B  1  284 ? 45.676  41.702 -6.525  1.00 25.57  ? 1083 ASP D N     1 
ATOM   7714  C  CA    . ASP B  1  284 ? 45.565  40.491 -5.775  1.00 25.60  ? 1083 ASP D CA    1 
ATOM   7715  C  C     . ASP B  1  284 ? 46.232  39.280 -6.511  1.00 24.46  ? 1083 ASP D C     1 
ATOM   7716  O  O     . ASP B  1  284 ? 46.681  38.332 -5.874  1.00 23.34  ? 1083 ASP D O     1 
ATOM   7717  C  CB    . ASP B  1  284 ? 44.120  40.159 -5.428  1.00 26.31  ? 1083 ASP D CB    1 
ATOM   7718  C  CG    . ASP B  1  284 ? 43.210  40.197 -6.671  1.00 28.34  ? 1083 ASP D CG    1 
ATOM   7719  O  OD1   . ASP B  1  284 ? 43.119  39.211 -7.360  1.00 29.44  ? 1083 ASP D OD1   1 
ATOM   7720  O  OD2   . ASP B  1  284 ? 42.649  41.251 -7.128  1.00 27.98  ? 1083 ASP D OD2   1 
ATOM   7721  N  N     . SER B  1  285 ? 46.304  39.353 -7.847  1.00 24.78  ? 1084 SER D N     1 
ATOM   7722  C  CA    . SER B  1  285 ? 46.913  38.282 -8.591  1.00 24.43  ? 1084 SER D CA    1 
ATOM   7723  C  C     . SER B  1  285 ? 48.393  38.151 -8.270  1.00 23.14  ? 1084 SER D C     1 
ATOM   7724  O  O     . SER B  1  285 ? 48.943  37.036 -8.239  1.00 22.99  ? 1084 SER D O     1 
ATOM   7725  C  CB    . SER B  1  285 ? 46.690  38.468 -10.113 1.00 26.10  ? 1084 SER D CB    1 
ATOM   7726  O  OG    . SER B  1  285 ? 47.545  39.498 -10.600 1.00 31.84  ? 1084 SER D OG    1 
ATOM   7727  N  N     . SER B  1  286 ? 49.087  39.274 -8.076  1.00 22.10  ? 1085 SER D N     1 
ATOM   7728  C  CA    . SER B  1  286 ? 50.488  39.238 -7.689  1.00 22.85  ? 1085 SER D CA    1 
ATOM   7729  C  C     . SER B  1  286 ? 50.629  38.548 -6.323  1.00 22.32  ? 1085 SER D C     1 
ATOM   7730  O  O     . SER B  1  286 ? 51.550  37.697 -6.153  1.00 23.52  ? 1085 SER D O     1 
ATOM   7731  C  CB    . SER B  1  286 ? 51.072  40.642 -7.573  1.00 22.05  ? 1085 SER D CB    1 
ATOM   7732  O  OG    . SER B  1  286 ? 51.391  41.116 -8.918  1.00 23.80  ? 1085 SER D OG    1 
ATOM   7733  N  N     . ILE B  1  287 ? 49.746  38.860 -5.376  1.00 21.34  ? 1086 ILE D N     1 
ATOM   7734  C  CA    . ILE B  1  287 ? 49.827  38.259 -4.076  1.00 21.16  ? 1086 ILE D CA    1 
ATOM   7735  C  C     . ILE B  1  287 ? 49.487  36.766 -4.142  1.00 21.25  ? 1086 ILE D C     1 
ATOM   7736  O  O     . ILE B  1  287 ? 50.225  35.927 -3.639  1.00 20.57  ? 1086 ILE D O     1 
ATOM   7737  C  CB    . ILE B  1  287 ? 48.891  39.013 -3.090  1.00 20.63  ? 1086 ILE D CB    1 
ATOM   7738  C  CG1   . ILE B  1  287 ? 49.317  40.457 -2.946  1.00 20.76  ? 1086 ILE D CG1   1 
ATOM   7739  C  CG2   . ILE B  1  287 ? 48.893  38.315 -1.701  1.00 20.17  ? 1086 ILE D CG2   1 
ATOM   7740  C  CD1   . ILE B  1  287 ? 48.267  41.331 -2.340  1.00 22.26  ? 1086 ILE D CD1   1 
ATOM   7741  N  N     . TYR B  1  288 ? 48.376  36.438 -4.778  1.00 21.63  ? 1087 TYR D N     1 
ATOM   7742  C  CA    . TYR B  1  288 ? 47.913  35.048 -4.812  1.00 21.90  ? 1087 TYR D CA    1 
ATOM   7743  C  C     . TYR B  1  288 ? 48.908  34.143 -5.540  1.00 22.21  ? 1087 TYR D C     1 
ATOM   7744  O  O     . TYR B  1  288 ? 49.261  33.073 -5.055  1.00 20.85  ? 1087 TYR D O     1 
ATOM   7745  C  CB    . TYR B  1  288 ? 46.536  34.970 -5.476  1.00 21.78  ? 1087 TYR D CB    1 
ATOM   7746  C  CG    . TYR B  1  288 ? 45.962  33.580 -5.517  1.00 22.10  ? 1087 TYR D CG    1 
ATOM   7747  C  CD1   . TYR B  1  288 ? 45.823  32.815 -4.345  1.00 21.73  ? 1087 TYR D CD1   1 
ATOM   7748  C  CD2   . TYR B  1  288 ? 45.542  33.009 -6.744  1.00 22.35  ? 1087 TYR D CD2   1 
ATOM   7749  C  CE1   . TYR B  1  288 ? 45.272  31.559 -4.385  1.00 22.79  ? 1087 TYR D CE1   1 
ATOM   7750  C  CE2   . TYR B  1  288 ? 45.013  31.726 -6.754  1.00 23.19  ? 1087 TYR D CE2   1 
ATOM   7751  C  CZ    . TYR B  1  288 ? 44.876  31.026 -5.604  1.00 22.65  ? 1087 TYR D CZ    1 
ATOM   7752  O  OH    . TYR B  1  288 ? 44.330  29.745 -5.636  1.00 24.04  ? 1087 TYR D OH    1 
ATOM   7753  N  N     . GLU B  1  289 ? 49.372  34.561 -6.722  1.00 22.73  ? 1088 GLU D N     1 
ATOM   7754  C  CA    . GLU B  1  289 ? 50.283  33.711 -7.468  1.00 23.81  ? 1088 GLU D CA    1 
ATOM   7755  C  C     . GLU B  1  289 ? 51.600  33.474 -6.742  1.00 22.63  ? 1088 GLU D C     1 
ATOM   7756  O  O     . GLU B  1  289 ? 52.209  32.412 -6.847  1.00 21.72  ? 1088 GLU D O     1 
ATOM   7757  C  CB    . GLU B  1  289 ? 50.577  34.359 -8.843  1.00 27.18  ? 1088 GLU D CB    1 
ATOM   7758  C  CG    . GLU B  1  289 ? 49.353  34.169 -9.805  1.00 32.99  ? 1088 GLU D CG    1 
ATOM   7759  C  CD    . GLU B  1  289 ? 49.576  34.900 -11.126 1.00 36.43  ? 1088 GLU D CD    1 
ATOM   7760  O  OE1   . GLU B  1  289 ? 48.484  35.060 -11.755 1.00 47.09  ? 1088 GLU D OE1   1 
ATOM   7761  O  OE2   . GLU B  1  289 ? 50.821  35.172 -11.401 1.00 44.37  ? 1088 GLU D OE2   1 
ATOM   7762  N  N     . ALA B  1  290 ? 52.054  34.477 -5.976  1.00 21.58  ? 1089 ALA D N     1 
ATOM   7763  C  CA    . ALA B  1  290 ? 53.230  34.287 -5.154  1.00 21.97  ? 1089 ALA D CA    1 
ATOM   7764  C  C     . ALA B  1  290 ? 52.959  33.285 -4.034  1.00 21.95  ? 1089 ALA D C     1 
ATOM   7765  O  O     . ALA B  1  290 ? 53.810  32.430 -3.732  1.00 21.81  ? 1089 ALA D O     1 
ATOM   7766  C  CB    . ALA B  1  290 ? 53.698  35.619 -4.580  1.00 22.06  ? 1089 ALA D CB    1 
ATOM   7767  N  N     . MET B  1  291 ? 51.775  33.342 -3.416  1.00 22.08  ? 1090 MET D N     1 
ATOM   7768  C  CA    . MET B  1  291 ? 51.429  32.384 -2.399  1.00 22.20  ? 1090 MET D CA    1 
ATOM   7769  C  C     . MET B  1  291 ? 51.311  31.001 -3.000  1.00 22.63  ? 1090 MET D C     1 
ATOM   7770  O  O     . MET B  1  291 ? 51.718  29.996 -2.341  1.00 21.77  ? 1090 MET D O     1 
ATOM   7771  C  CB    . MET B  1  291 ? 50.110  32.783 -1.717  1.00 22.69  ? 1090 MET D CB    1 
ATOM   7772  C  CG    . MET B  1  291 ? 49.872  32.004 -0.389  1.00 23.48  ? 1090 MET D CG    1 
ATOM   7773  S  SD    . MET B  1  291 ? 48.168  32.118 0.230   1.00 26.04  ? 1090 MET D SD    1 
ATOM   7774  C  CE    . MET B  1  291 ? 47.218  31.246 -1.010  1.00 24.81  ? 1090 MET D CE    1 
ATOM   7775  N  N     . VAL B  1  292 ? 50.752  30.909 -4.192  1.00 21.42  ? 1091 VAL D N     1 
ATOM   7776  C  CA    . VAL B  1  292 ? 50.625  29.599 -4.871  1.00 22.49  ? 1091 VAL D CA    1 
ATOM   7777  C  C     . VAL B  1  292 ? 52.002  28.955 -5.075  1.00 22.30  ? 1091 VAL D C     1 
ATOM   7778  O  O     . VAL B  1  292 ? 52.159  27.757 -4.817  1.00 22.48  ? 1091 VAL D O     1 
ATOM   7779  C  CB    . VAL B  1  292 ? 49.898  29.776 -6.240  1.00 21.09  ? 1091 VAL D CB    1 
ATOM   7780  C  CG1   . VAL B  1  292 ? 50.042  28.563 -7.089  1.00 21.49  ? 1091 VAL D CG1   1 
ATOM   7781  C  CG2   . VAL B  1  292 ? 48.423  30.068 -5.944  1.00 21.46  ? 1091 VAL D CG2   1 
ATOM   7782  N  N     A ARG B  1  293 ? 52.982  29.730 -5.516  0.50 23.48  ? 1092 ARG D N     1 
ATOM   7783  N  N     B ARG B  1  293 ? 52.987  29.727 -5.502  0.50 22.84  ? 1092 ARG D N     1 
ATOM   7784  C  CA    A ARG B  1  293 ? 54.317  29.192 -5.748  0.50 23.96  ? 1092 ARG D CA    1 
ATOM   7785  C  CA    B ARG B  1  293 ? 54.309  29.169 -5.748  0.50 22.92  ? 1092 ARG D CA    1 
ATOM   7786  C  C     A ARG B  1  293 ? 54.931  28.653 -4.473  0.50 23.37  ? 1092 ARG D C     1 
ATOM   7787  C  C     B ARG B  1  293 ? 54.943  28.653 -4.471  0.50 22.77  ? 1092 ARG D C     1 
ATOM   7788  O  O     A ARG B  1  293 ? 55.623  27.622 -4.507  0.50 24.13  ? 1092 ARG D O     1 
ATOM   7789  O  O     B ARG B  1  293 ? 55.650  27.633 -4.498  0.50 23.56  ? 1092 ARG D O     1 
ATOM   7790  C  CB    A ARG B  1  293 ? 55.239  30.271 -6.357  0.50 25.02  ? 1092 ARG D CB    1 
ATOM   7791  C  CB    B ARG B  1  293 ? 55.232  30.222 -6.409  0.50 22.97  ? 1092 ARG D CB    1 
ATOM   7792  C  CG    A ARG B  1  293 ? 55.461  30.122 -7.871  0.50 26.75  ? 1092 ARG D CG    1 
ATOM   7793  C  CG    B ARG B  1  293 ? 54.730  30.869 -7.712  0.50 23.33  ? 1092 ARG D CG    1 
ATOM   7794  C  CD    A ARG B  1  293 ? 56.364  31.255 -8.353  0.50 27.65  ? 1092 ARG D CD    1 
ATOM   7795  C  CD    B ARG B  1  293 ? 55.727  31.886 -8.292  0.50 22.97  ? 1092 ARG D CD    1 
ATOM   7796  N  NE    A ARG B  1  293 ? 57.605  31.382 -7.624  0.50 28.20  ? 1092 ARG D NE    1 
ATOM   7797  N  NE    B ARG B  1  293 ? 55.040  32.304 -9.490  0.50 23.23  ? 1092 ARG D NE    1 
ATOM   7798  C  CZ    A ARG B  1  293 ? 58.575  30.515 -7.743  0.50 27.97  ? 1092 ARG D CZ    1 
ATOM   7799  C  CZ    B ARG B  1  293 ? 54.414  33.464 -9.570  0.50 22.36  ? 1092 ARG D CZ    1 
ATOM   7800  N  NH1   A ARG B  1  293 ? 58.381  29.537 -8.545  0.50 30.37  ? 1092 ARG D NH1   1 
ATOM   7801  N  NH1   B ARG B  1  293 ? 54.527  34.240 -8.472  0.50 21.46  ? 1092 ARG D NH1   1 
ATOM   7802  N  NH2   A ARG B  1  293 ? 59.676  30.593 -7.079  0.50 27.43  ? 1092 ARG D NH2   1 
ATOM   7803  N  NH2   B ARG B  1  293 ? 53.769  33.790 -10.639 0.50 21.71  ? 1092 ARG D NH2   1 
ATOM   7804  N  N     . MET B  1  294 ? 54.703  29.316 -3.347  1.00 22.87  ? 1093 MET D N     1 
ATOM   7805  C  CA    . MET B  1  294 ? 55.230  28.858 -2.060  1.00 23.35  ? 1093 MET D CA    1 
ATOM   7806  C  C     . MET B  1  294 ? 54.585  27.549 -1.613  1.00 21.81  ? 1093 MET D C     1 
ATOM   7807  O  O     . MET B  1  294 ? 55.102  26.912 -0.686  1.00 21.62  ? 1093 MET D O     1 
ATOM   7808  C  CB    . MET B  1  294 ? 55.060  29.918 -0.984  1.00 25.47  ? 1093 MET D CB    1 
ATOM   7809  C  CG    . MET B  1  294 ? 56.015  31.086 -1.143  1.00 27.04  ? 1093 MET D CG    1 
ATOM   7810  S  SD    . MET B  1  294 ? 55.866  32.285 0.258   1.00 34.31  ? 1093 MET D SD    1 
ATOM   7811  C  CE    . MET B  1  294 ? 54.361  33.113 -0.269  1.00 27.09  ? 1093 MET D CE    1 
ATOM   7812  N  N     . ALA B  1  295 ? 53.458  27.144 -2.224  1.00 21.28  ? 1094 ALA D N     1 
ATOM   7813  C  CA    . ALA B  1  295 ? 52.820  25.886 -1.874  1.00 21.25  ? 1094 ALA D CA    1 
ATOM   7814  C  C     . ALA B  1  295 ? 53.110  24.738 -2.830  1.00 22.22  ? 1094 ALA D C     1 
ATOM   7815  O  O     . ALA B  1  295 ? 52.639  23.604 -2.580  1.00 22.21  ? 1094 ALA D O     1 
ATOM   7816  C  CB    . ALA B  1  295 ? 51.264  26.114 -1.877  1.00 22.46  ? 1094 ALA D CB    1 
ATOM   7817  N  N     . GLN B  1  296 ? 53.875  24.970 -3.909  1.00 22.07  ? 1095 GLN D N     1 
ATOM   7818  C  CA    . GLN B  1  296 ? 54.156  23.927 -4.878  1.00 22.36  ? 1095 GLN D CA    1 
ATOM   7819  C  C     . GLN B  1  296 ? 55.422  23.187 -4.596  1.00 22.51  ? 1095 GLN D C     1 
ATOM   7820  O  O     . GLN B  1  296 ? 56.525  23.884 -4.449  1.00 23.52  ? 1095 GLN D O     1 
ATOM   7821  C  CB    . GLN B  1  296 ? 54.206  24.559 -6.287  1.00 22.08  ? 1095 GLN D CB    1 
ATOM   7822  C  CG    . GLN B  1  296 ? 52.873  25.123 -6.794  1.00 22.69  ? 1095 GLN D CG    1 
ATOM   7823  C  CD    . GLN B  1  296 ? 53.022  25.950 -8.019  1.00 22.54  ? 1095 GLN D CD    1 
ATOM   7824  O  OE1   . GLN B  1  296 ? 54.102  26.466 -8.327  1.00 23.23  ? 1095 GLN D OE1   1 
ATOM   7825  N  NE2   . GLN B  1  296 ? 51.928  26.115 -8.769  1.00 22.94  ? 1095 GLN D NE2   1 
ATOM   7826  N  N     . ASP B  1  297 ? 55.404  21.891 -4.438  1.00 22.84  ? 1096 ASP D N     1 
ATOM   7827  C  CA    . ASP B  1  297 ? 56.645  21.155 -4.083  1.00 24.49  ? 1096 ASP D CA    1 
ATOM   7828  C  C     . ASP B  1  297 ? 57.572  20.906 -5.262  1.00 23.97  ? 1096 ASP D C     1 
ATOM   7829  O  O     . ASP B  1  297 ? 58.636  20.321 -5.102  1.00 23.36  ? 1096 ASP D O     1 
ATOM   7830  C  CB    . ASP B  1  297 ? 56.310  19.828 -3.356  1.00 28.20  ? 1096 ASP D CB    1 
ATOM   7831  C  CG    . ASP B  1  297 ? 55.519  18.855 -4.243  1.00 32.59  ? 1096 ASP D CG    1 
ATOM   7832  O  OD1   . ASP B  1  297 ? 55.268  19.162 -5.423  1.00 32.19  ? 1096 ASP D OD1   1 
ATOM   7833  O  OD2   . ASP B  1  297 ? 55.086  17.813 -3.738  1.00 39.20  ? 1096 ASP D OD2   1 
ATOM   7834  N  N     . PHE B  1  298 ? 57.158  21.351 -6.454  1.00 23.63  ? 1097 PHE D N     1 
ATOM   7835  C  CA    . PHE B  1  298 ? 58.038  21.390 -7.630  1.00 23.54  ? 1097 PHE D CA    1 
ATOM   7836  C  C     . PHE B  1  298 ? 58.682  22.777 -7.811  1.00 23.27  ? 1097 PHE D C     1 
ATOM   7837  O  O     . PHE B  1  298 ? 59.581  22.914 -8.648  1.00 23.39  ? 1097 PHE D O     1 
ATOM   7838  C  CB    . PHE B  1  298 ? 57.323  20.971 -8.871  1.00 24.38  ? 1097 PHE D CB    1 
ATOM   7839  C  CG    . PHE B  1  298 ? 56.015  21.672 -9.094  1.00 25.28  ? 1097 PHE D CG    1 
ATOM   7840  C  CD1   . PHE B  1  298 ? 55.964  22.869 -9.787  1.00 26.20  ? 1097 PHE D CD1   1 
ATOM   7841  C  CD2   . PHE B  1  298 ? 54.822  21.088 -8.618  1.00 24.99  ? 1097 PHE D CD2   1 
ATOM   7842  C  CE1   . PHE B  1  298 ? 54.762  23.514 -10.003 1.00 26.64  ? 1097 PHE D CE1   1 
ATOM   7843  C  CE2   . PHE B  1  298 ? 53.612  21.780 -8.835  1.00 25.23  ? 1097 PHE D CE2   1 
ATOM   7844  C  CZ    . PHE B  1  298 ? 53.604  22.973 -9.539  1.00 24.93  ? 1097 PHE D CZ    1 
ATOM   7845  N  N     . SER B  1  299 ? 58.231  23.788 -7.055  1.00 21.68  ? 1098 SER D N     1 
ATOM   7846  C  CA    . SER B  1  299 ? 58.857  25.099 -7.106  1.00 22.73  ? 1098 SER D CA    1 
ATOM   7847  C  C     . SER B  1  299 ? 59.717  25.415 -5.896  1.00 21.01  ? 1098 SER D C     1 
ATOM   7848  O  O     . SER B  1  299 ? 60.792  25.995 -6.048  1.00 20.91  ? 1098 SER D O     1 
ATOM   7849  C  CB    . SER B  1  299 ? 57.761  26.191 -7.219  1.00 22.07  ? 1098 SER D CB    1 
ATOM   7850  O  OG    . SER B  1  299 ? 56.958  25.941 -8.361  1.00 23.19  ? 1098 SER D OG    1 
ATOM   7851  N  N     . TYR B  1  300 ? 59.286  25.047 -4.714  1.00 21.14  ? 1099 TYR D N     1 
ATOM   7852  C  CA    . TYR B  1  300 ? 60.012  25.360 -3.462  1.00 21.57  ? 1099 TYR D CA    1 
ATOM   7853  C  C     . TYR B  1  300 ? 60.642  24.065 -2.910  1.00 21.99  ? 1099 TYR D C     1 
ATOM   7854  O  O     . TYR B  1  300 ? 59.959  23.081 -2.697  1.00 22.14  ? 1099 TYR D O     1 
ATOM   7855  C  CB    . TYR B  1  300 ? 59.060  25.998 -2.423  1.00 23.04  ? 1099 TYR D CB    1 
ATOM   7856  C  CG    . TYR B  1  300 ? 59.024  27.471 -2.520  1.00 23.12  ? 1099 TYR D CG    1 
ATOM   7857  C  CD1   . TYR B  1  300 ? 58.617  28.075 -3.670  1.00 25.47  ? 1099 TYR D CD1   1 
ATOM   7858  C  CD2   . TYR B  1  300 ? 59.468  28.304 -1.474  1.00 24.10  ? 1099 TYR D CD2   1 
ATOM   7859  C  CE1   . TYR B  1  300 ? 58.628  29.503 -3.832  1.00 26.24  ? 1099 TYR D CE1   1 
ATOM   7860  C  CE2   . TYR B  1  300 ? 59.489  29.691 -1.587  1.00 23.86  ? 1099 TYR D CE2   1 
ATOM   7861  C  CZ    . TYR B  1  300 ? 59.055  30.241 -2.741  1.00 26.11  ? 1099 TYR D CZ    1 
ATOM   7862  O  OH    . TYR B  1  300 ? 58.996  31.610 -2.973  1.00 28.16  ? 1099 TYR D OH    1 
ATOM   7863  N  N     . ARG B  1  301 ? 61.933  24.100 -2.700  1.00 21.65  ? 1100 ARG D N     1 
ATOM   7864  C  CA    . ARG B  1  301 ? 62.644  22.962 -2.123  1.00 21.57  ? 1100 ARG D CA    1 
ATOM   7865  C  C     . ARG B  1  301 ? 62.115  22.661 -0.701  1.00 22.35  ? 1100 ARG D C     1 
ATOM   7866  O  O     . ARG B  1  301 ? 62.096  21.495 -0.293  1.00 23.80  ? 1100 ARG D O     1 
ATOM   7867  C  CB    . ARG B  1  301 ? 64.155  23.273 -2.061  1.00 21.13  ? 1100 ARG D CB    1 
ATOM   7868  C  CG    . ARG B  1  301 ? 65.023  22.132 -1.593  1.00 20.98  ? 1100 ARG D CG    1 
ATOM   7869  C  CD    . ARG B  1  301 ? 64.815  20.881 -2.448  1.00 21.00  ? 1100 ARG D CD    1 
ATOM   7870  N  NE    . ARG B  1  301 ? 65.636  19.776 -1.982  1.00 22.03  ? 1100 ARG D NE    1 
ATOM   7871  C  CZ    . ARG B  1  301 ? 65.313  18.985 -0.961  1.00 21.65  ? 1100 ARG D CZ    1 
ATOM   7872  N  NH1   . ARG B  1  301 ? 64.165  19.168 -0.310  1.00 21.46  ? 1100 ARG D NH1   1 
ATOM   7873  N  NH2   . ARG B  1  301 ? 66.130  18.005 -0.582  1.00 21.80  ? 1100 ARG D NH2   1 
ATOM   7874  N  N     . TYR B  1  302 ? 61.656  23.682 0.014   1.00 21.19  ? 1101 TYR D N     1 
ATOM   7875  C  CA    . TYR B  1  302 ? 61.014  23.520 1.307   1.00 20.94  ? 1101 TYR D CA    1 
ATOM   7876  C  C     . TYR B  1  302 ? 59.779  24.409 1.322   1.00 21.05  ? 1101 TYR D C     1 
ATOM   7877  O  O     . TYR B  1  302 ? 59.846  25.605 1.675   1.00 20.62  ? 1101 TYR D O     1 
ATOM   7878  C  CB    . TYR B  1  302 ? 61.989  23.881 2.461   1.00 20.70  ? 1101 TYR D CB    1 
ATOM   7879  C  CG    . TYR B  1  302 ? 63.217  23.001 2.430   1.00 21.43  ? 1101 TYR D CG    1 
ATOM   7880  C  CD1   . TYR B  1  302 ? 63.175  21.717 2.970   1.00 21.81  ? 1101 TYR D CD1   1 
ATOM   7881  C  CD2   . TYR B  1  302 ? 64.378  23.423 1.780   1.00 21.22  ? 1101 TYR D CD2   1 
ATOM   7882  C  CE1   . TYR B  1  302 ? 64.262  20.871 2.896   1.00 22.53  ? 1101 TYR D CE1   1 
ATOM   7883  C  CE2   . TYR B  1  302 ? 65.476  22.595 1.711   1.00 21.86  ? 1101 TYR D CE2   1 
ATOM   7884  C  CZ    . TYR B  1  302 ? 65.417  21.322 2.255   1.00 21.71  ? 1101 TYR D CZ    1 
ATOM   7885  O  OH    . TYR B  1  302 ? 66.510  20.507 2.165   1.00 23.03  ? 1101 TYR D OH    1 
ATOM   7886  N  N     . PRO B  1  303 ? 58.619  23.866 0.920   1.00 21.85  ? 1102 PRO D N     1 
ATOM   7887  C  CA    . PRO B  1  303 ? 57.426  24.678 0.737   1.00 21.15  ? 1102 PRO D CA    1 
ATOM   7888  C  C     . PRO B  1  303 ? 57.046  25.470 1.983   1.00 22.29  ? 1102 PRO D C     1 
ATOM   7889  O  O     . PRO B  1  303 ? 57.095  24.947 3.104   1.00 20.69  ? 1102 PRO D O     1 
ATOM   7890  C  CB    . PRO B  1  303 ? 56.323  23.688 0.422   1.00 21.83  ? 1102 PRO D CB    1 
ATOM   7891  C  CG    . PRO B  1  303 ? 57.088  22.624 -0.324  1.00 22.29  ? 1102 PRO D CG    1 
ATOM   7892  C  CD    . PRO B  1  303 ? 58.393  22.466 0.527   1.00 21.65  ? 1102 PRO D CD    1 
ATOM   7893  N  N     . LEU B  1  304 ? 56.685  26.769 1.770   1.00 21.22  ? 1103 LEU D N     1 
ATOM   7894  C  CA    . LEU B  1  304 ? 56.369  27.646 2.843   1.00 21.11  ? 1103 LEU D CA    1 
ATOM   7895  C  C     . LEU B  1  304 ? 54.831  27.756 3.085   1.00 21.00  ? 1103 LEU D C     1 
ATOM   7896  O  O     . LEU B  1  304 ? 54.422  28.264 4.130   1.00 21.21  ? 1103 LEU D O     1 
ATOM   7897  C  CB    . LEU B  1  304 ? 56.934  29.020 2.602   1.00 20.86  ? 1103 LEU D CB    1 
ATOM   7898  C  CG    . LEU B  1  304 ? 58.458  29.026 2.338   1.00 20.12  ? 1103 LEU D CG    1 
ATOM   7899  C  CD1   . LEU B  1  304 ? 59.023  30.459 2.087   1.00 19.48  ? 1103 LEU D CD1   1 
ATOM   7900  C  CD2   . LEU B  1  304 ? 59.253  28.358 3.557   1.00 19.86  ? 1103 LEU D CD2   1 
ATOM   7901  N  N     . VAL B  1  305 ? 54.009  27.291 2.138   1.00 21.76  ? 1104 VAL D N     1 
ATOM   7902  C  CA    . VAL B  1  305 ? 52.577  27.396 2.273   1.00 22.17  ? 1104 VAL D CA    1 
ATOM   7903  C  C     . VAL B  1  305 ? 51.973  25.992 2.075   1.00 22.25  ? 1104 VAL D C     1 
ATOM   7904  O  O     . VAL B  1  305 ? 52.469  25.194 1.254   1.00 22.03  ? 1104 VAL D O     1 
ATOM   7905  C  CB    . VAL B  1  305 ? 51.981  28.349 1.197   1.00 21.92  ? 1104 VAL D CB    1 
ATOM   7906  C  CG1   . VAL B  1  305 ? 50.438  28.305 1.178   1.00 20.88  ? 1104 VAL D CG1   1 
ATOM   7907  C  CG2   . VAL B  1  305 ? 52.470  29.781 1.490   1.00 21.92  ? 1104 VAL D CG2   1 
ATOM   7908  N  N     . ASP B  1  306 ? 50.970  25.647 2.859   1.00 22.76  ? 1105 ASP D N     1 
ATOM   7909  C  CA    . ASP B  1  306 ? 50.261  24.398 2.779   1.00 23.05  ? 1105 ASP D CA    1 
ATOM   7910  C  C     . ASP B  1  306 ? 48.883  24.694 2.113   1.00 23.51  ? 1105 ASP D C     1 
ATOM   7911  O  O     . ASP B  1  306 ? 47.999  25.271 2.732   1.00 24.26  ? 1105 ASP D O     1 
ATOM   7912  C  CB    . ASP B  1  306 ? 50.089  23.829 4.227   1.00 23.73  ? 1105 ASP D CB    1 
ATOM   7913  C  CG    . ASP B  1  306 ? 49.268  22.533 4.248   1.00 25.51  ? 1105 ASP D CG    1 
ATOM   7914  O  OD1   . ASP B  1  306 ? 48.908  21.967 3.159   1.00 27.75  ? 1105 ASP D OD1   1 
ATOM   7915  O  OD2   . ASP B  1  306 ? 48.991  22.089 5.356   1.00 26.88  ? 1105 ASP D OD2   1 
ATOM   7916  N  N     . GLY B  1  307 ? 48.756  24.228 0.879   1.00 24.32  ? 1106 GLY D N     1 
ATOM   7917  C  CA    . GLY B  1  307 ? 47.577  24.567 0.075   1.00 24.78  ? 1106 GLY D CA    1 
ATOM   7918  C  C     . GLY B  1  307 ? 46.576  23.403 -0.031  1.00 26.22  ? 1106 GLY D C     1 
ATOM   7919  O  O     . GLY B  1  307 ? 46.964  22.301 -0.143  1.00 26.56  ? 1106 GLY D O     1 
ATOM   7920  N  N     . GLN B  1  308 ? 45.298  23.760 -0.042  1.00 25.64  ? 1107 GLN D N     1 
ATOM   7921  C  CA    . GLN B  1  308 ? 44.215  22.820 -0.331  1.00 27.90  ? 1107 GLN D CA    1 
ATOM   7922  C  C     . GLN B  1  308 ? 43.410  23.257 -1.475  1.00 27.08  ? 1107 GLN D C     1 
ATOM   7923  O  O     . GLN B  1  308 ? 42.975  24.398 -1.539  1.00 25.83  ? 1107 GLN D O     1 
ATOM   7924  C  CB    . GLN B  1  308 ? 43.295  22.728 0.967   1.00 29.25  ? 1107 GLN D CB    1 
ATOM   7925  C  CG    . GLN B  1  308 ? 42.194  21.664 0.782   1.00 35.03  ? 1107 GLN D CG    1 
ATOM   7926  C  CD    . GLN B  1  308 ? 41.549  21.348 2.098   1.00 38.42  ? 1107 GLN D CD    1 
ATOM   7927  O  OE1   . GLN B  1  308 ? 41.665  20.247 2.598   1.00 43.58  ? 1107 GLN D OE1   1 
ATOM   7928  N  NE2   . GLN B  1  308 ? 40.833  22.301 2.637   1.00 41.93  ? 1107 GLN D NE2   1 
ATOM   7929  N  N     . GLY B  1  309 ? 43.235  22.349 -2.427  1.00 26.66  ? 1108 GLY D N     1 
ATOM   7930  C  CA    . GLY B  1  309 ? 42.554  22.613 -3.744  1.00 26.50  ? 1108 GLY D CA    1 
ATOM   7931  C  C     . GLY B  1  309 ? 43.578  22.517 -4.837  1.00 25.18  ? 1108 GLY D C     1 
ATOM   7932  O  O     . GLY B  1  309 ? 44.678  21.985 -4.664  1.00 25.21  ? 1108 GLY D O     1 
ATOM   7933  N  N     . ASN B  1  310 ? 43.192  22.982 -6.003  1.00 25.75  ? 1109 ASN D N     1 
ATOM   7934  C  CA    . ASN B  1  310 ? 44.094  22.867 -7.194  1.00 26.93  ? 1109 ASN D CA    1 
ATOM   7935  C  C     . ASN B  1  310 ? 45.076  24.095 -7.078  1.00 25.91  ? 1109 ASN D C     1 
ATOM   7936  O  O     . ASN B  1  310 ? 44.702  25.262 -7.187  1.00 25.39  ? 1109 ASN D O     1 
ATOM   7937  C  CB    . ASN B  1  310 ? 43.229  23.033 -8.468  1.00 29.37  ? 1109 ASN D CB    1 
ATOM   7938  C  CG    . ASN B  1  310 ? 44.078  23.054 -9.717  1.00 33.14  ? 1109 ASN D CG    1 
ATOM   7939  O  OD1   . ASN B  1  310 ? 45.262  22.780 -9.690  1.00 30.90  ? 1109 ASN D OD1   1 
ATOM   7940  N  ND2   . ASN B  1  310 ? 43.493  23.390 -10.844 1.00 36.43  ? 1109 ASN D ND2   1 
ATOM   7941  N  N     . PHE B  1  311 ? 46.335  23.737 -6.846  1.00 24.24  ? 1110 PHE D N     1 
ATOM   7942  C  CA    . PHE B  1  311 ? 47.405  24.733 -6.709  1.00 24.78  ? 1110 PHE D CA    1 
ATOM   7943  C  C     . PHE B  1  311 ? 48.415  24.665 -7.845  1.00 25.12  ? 1110 PHE D C     1 
ATOM   7944  O  O     . PHE B  1  311 ? 49.572  24.999 -7.667  1.00 25.47  ? 1110 PHE D O     1 
ATOM   7945  C  CB    . PHE B  1  311 ? 48.111  24.506 -5.352  1.00 22.86  ? 1110 PHE D CB    1 
ATOM   7946  C  CG    . PHE B  1  311 ? 47.527  25.399 -4.253  1.00 23.61  ? 1110 PHE D CG    1 
ATOM   7947  C  CD1   . PHE B  1  311 ? 46.351  25.068 -3.670  1.00 23.25  ? 1110 PHE D CD1   1 
ATOM   7948  C  CD2   . PHE B  1  311 ? 48.211  26.588 -3.935  1.00 23.22  ? 1110 PHE D CD2   1 
ATOM   7949  C  CE1   . PHE B  1  311 ? 45.808  25.902 -2.688  1.00 24.38  ? 1110 PHE D CE1   1 
ATOM   7950  C  CE2   . PHE B  1  311 ? 47.660  27.398 -2.935  1.00 25.30  ? 1110 PHE D CE2   1 
ATOM   7951  C  CZ    . PHE B  1  311 ? 46.462  27.081 -2.300  1.00 23.88  ? 1110 PHE D CZ    1 
ATOM   7952  N  N     . GLY B  1  312 ? 47.968  24.212 -9.021  1.00 25.21  ? 1111 GLY D N     1 
ATOM   7953  C  CA    . GLY B  1  312 ? 48.819  24.124 -10.202 1.00 28.39  ? 1111 GLY D CA    1 
ATOM   7954  C  C     . GLY B  1  312 ? 49.505  22.833 -10.377 1.00 29.73  ? 1111 GLY D C     1 
ATOM   7955  O  O     . GLY B  1  312 ? 49.406  21.921 -9.566  1.00 28.37  ? 1111 GLY D O     1 
ATOM   7956  N  N     . SER B  1  313 ? 50.244  22.713 -11.498 1.00 31.29  ? 1112 SER D N     1 
ATOM   7957  C  CA    . SER B  1  313 ? 50.971  21.479 -11.838 1.00 31.00  ? 1112 SER D CA    1 
ATOM   7958  C  C     . SER B  1  313 ? 52.257  21.835 -12.527 1.00 33.08  ? 1112 SER D C     1 
ATOM   7959  O  O     . SER B  1  313 ? 52.507  23.039 -12.854 1.00 28.95  ? 1112 SER D O     1 
ATOM   7960  C  CB    . SER B  1  313 ? 50.153  20.547 -12.732 1.00 32.38  ? 1112 SER D CB    1 
ATOM   7961  O  OG    . SER B  1  313 ? 50.070  21.064 -14.052 1.00 32.41  ? 1112 SER D OG    1 
ATOM   7962  N  N     . MET B  1  314 ? 53.102  20.817 -12.756 1.00 34.37  ? 1113 MET D N     1 
ATOM   7963  C  CA    . MET B  1  314 ? 54.353  20.985 -13.503 1.00 38.51  ? 1113 MET D CA    1 
ATOM   7964  C  C     . MET B  1  314 ? 54.104  21.328 -14.987 1.00 37.85  ? 1113 MET D C     1 
ATOM   7965  O  O     . MET B  1  314 ? 55.042  21.747 -15.651 1.00 39.72  ? 1113 MET D O     1 
ATOM   7966  C  CB    . MET B  1  314 ? 55.139  19.635 -13.439 1.00 43.01  ? 1113 MET D CB    1 
ATOM   7967  C  CG    . MET B  1  314 ? 55.840  19.448 -12.135 1.00 45.35  ? 1113 MET D CG    1 
ATOM   7968  S  SD    . MET B  1  314 ? 56.784  17.935 -11.975 1.00 53.60  ? 1113 MET D SD    1 
ATOM   7969  C  CE    . MET B  1  314 ? 58.425  18.440 -12.506 1.00 43.57  ? 1113 MET D CE    1 
ATOM   7970  N  N     . ASP B  1  315 ? 52.900  21.127 -15.504 1.00 34.77  ? 1114 ASP D N     1 
ATOM   7971  C  CA    . ASP B  1  315 ? 52.612  21.427 -16.881 1.00 35.52  ? 1114 ASP D CA    1 
ATOM   7972  C  C     . ASP B  1  315 ? 52.229  22.885 -17.118 1.00 36.06  ? 1114 ASP D C     1 
ATOM   7973  O  O     . ASP B  1  315 ? 51.703  23.223 -18.171 1.00 37.64  ? 1114 ASP D O     1 
ATOM   7974  C  CB    . ASP B  1  315 ? 51.449  20.532 -17.396 1.00 37.00  ? 1114 ASP D CB    1 
ATOM   7975  C  CG    . ASP B  1  315 ? 51.849  19.075 -17.460 1.00 40.22  ? 1114 ASP D CG    1 
ATOM   7976  O  OD1   . ASP B  1  315 ? 53.056  18.783 -17.534 1.00 39.53  ? 1114 ASP D OD1   1 
ATOM   7977  O  OD2   . ASP B  1  315 ? 50.980  18.236 -17.503 1.00 43.31  ? 1114 ASP D OD2   1 
ATOM   7978  N  N     . GLY B  1  316 ? 52.489  23.731 -16.140 1.00 37.77  ? 1115 GLY D N     1 
ATOM   7979  C  CA    . GLY B  1  316 ? 52.180  25.148 -16.271 1.00 38.10  ? 1115 GLY D CA    1 
ATOM   7980  C  C     . GLY B  1  316 ? 50.734  25.502 -15.989 1.00 39.83  ? 1115 GLY D C     1 
ATOM   7981  O  O     . GLY B  1  316 ? 50.328  26.631 -16.218 1.00 36.46  ? 1115 GLY D O     1 
ATOM   7982  N  N     . ASP B  1  317 ? 49.970  24.533 -15.478 1.00 38.43  ? 1116 ASP D N     1 
ATOM   7983  C  CA    . ASP B  1  317 ? 48.592  24.785 -15.132 1.00 43.96  ? 1116 ASP D CA    1 
ATOM   7984  C  C     . ASP B  1  317 ? 48.611  25.763 -13.927 1.00 40.49  ? 1116 ASP D C     1 
ATOM   7985  O  O     . ASP B  1  317 ? 49.375  25.647 -13.018 1.00 42.92  ? 1116 ASP D O     1 
ATOM   7986  C  CB    . ASP B  1  317 ? 47.920  23.475 -14.674 1.00 47.15  ? 1116 ASP D CB    1 
ATOM   7987  C  CG    . ASP B  1  317 ? 47.601  22.587 -15.778 1.00 56.02  ? 1116 ASP D CG    1 
ATOM   7988  O  OD1   . ASP B  1  317 ? 47.008  23.105 -16.743 1.00 61.44  ? 1116 ASP D OD1   1 
ATOM   7989  O  OD2   . ASP B  1  317 ? 47.942  21.370 -15.725 1.00 60.51  ? 1116 ASP D OD2   1 
ATOM   7990  N  N     . GLY B  1  318 ? 47.706  26.735 -14.004 1.00 39.30  ? 1117 GLY D N     1 
ATOM   7991  C  CA    . GLY B  1  318 ? 47.632  27.685 -12.927 1.00 37.92  ? 1117 GLY D CA    1 
ATOM   7992  C  C     . GLY B  1  318 ? 46.765  27.097 -11.810 1.00 34.99  ? 1117 GLY D C     1 
ATOM   7993  O  O     . GLY B  1  318 ? 46.083  26.088 -11.983 1.00 32.83  ? 1117 GLY D O     1 
ATOM   7994  N  N     . ALA B  1  319 ? 46.841  27.725 -10.638 1.00 34.25  ? 1118 ALA D N     1 
ATOM   7995  C  CA    . ALA B  1  319 ? 46.042  27.277 -9.534  1.00 31.16  ? 1118 ALA D CA    1 
ATOM   7996  C  C     . ALA B  1  319 ? 44.579  27.642 -9.865  1.00 31.65  ? 1118 ALA D C     1 
ATOM   7997  O  O     . ALA B  1  319 ? 44.359  28.515 -10.659 1.00 33.77  ? 1118 ALA D O     1 
ATOM   7998  C  CB    . ALA B  1  319 ? 46.546  27.929 -8.246  1.00 32.12  ? 1118 ALA D CB    1 
ATOM   7999  N  N     . ALA B  1  320 ? 43.641  27.092 -9.119  1.00 30.32  ? 1119 ALA D N     1 
ATOM   8000  C  CA    . ALA B  1  320 ? 42.263  27.479 -9.257  1.00 29.59  ? 1119 ALA D CA    1 
ATOM   8001  C  C     . ALA B  1  320 ? 42.155  28.903 -8.687  1.00 29.85  ? 1119 ALA D C     1 
ATOM   8002  O  O     . ALA B  1  320 ? 42.975  29.333 -7.894  1.00 26.26  ? 1119 ALA D O     1 
ATOM   8003  C  CB    . ALA B  1  320 ? 41.358  26.486 -8.510  1.00 28.92  ? 1119 ALA D CB    1 
ATOM   8004  N  N     . ALA B  1  321 ? 41.062  29.580 -9.026  1.00 27.77  ? 1120 ALA D N     1 
ATOM   8005  C  CA    . ALA B  1  321 ? 40.861  30.956 -8.558  1.00 27.81  ? 1120 ALA D CA    1 
ATOM   8006  C  C     . ALA B  1  321 ? 40.832  30.934 -6.997  1.00 25.80  ? 1120 ALA D C     1 
ATOM   8007  O  O     . ALA B  1  321 ? 40.428  29.934 -6.358  1.00 25.41  ? 1120 ALA D O     1 
ATOM   8008  C  CB    . ALA B  1  321 ? 39.512  31.461 -9.078  1.00 29.09  ? 1120 ALA D CB    1 
ATOM   8009  N  N     . MET B  1  322 ? 41.276  32.020 -6.403  1.00 24.46  ? 1121 MET D N     1 
ATOM   8010  C  CA    . MET B  1  322 ? 41.547  32.050 -4.988  1.00 23.54  ? 1121 MET D CA    1 
ATOM   8011  C  C     . MET B  1  322 ? 40.304  31.927 -4.113  1.00 24.38  ? 1121 MET D C     1 
ATOM   8012  O  O     . MET B  1  322 ? 40.409  31.669 -2.919  1.00 23.84  ? 1121 MET D O     1 
ATOM   8013  C  CB    . MET B  1  322 ? 42.328  33.311 -4.590  1.00 24.21  ? 1121 MET D CB    1 
ATOM   8014  C  CG    . MET B  1  322 ? 41.530  34.640 -4.786  1.00 25.17  ? 1121 MET D CG    1 
ATOM   8015  S  SD    . MET B  1  322 ? 42.610  35.977 -4.179  1.00 28.04  ? 1121 MET D SD    1 
ATOM   8016  C  CE    . MET B  1  322 ? 41.565  37.375 -4.482  1.00 28.92  ? 1121 MET D CE    1 
ATOM   8017  N  N     . ARG B  1  323 ? 39.105  32.040 -4.736  1.00 24.79  ? 1122 ARG D N     1 
ATOM   8018  C  CA    . ARG B  1  323 ? 37.915  31.826 -3.940  1.00 25.93  ? 1122 ARG D CA    1 
ATOM   8019  C  C     . ARG B  1  323 ? 37.645  30.346 -3.778  1.00 26.33  ? 1122 ARG D C     1 
ATOM   8020  O  O     . ARG B  1  323 ? 36.854  29.974 -2.940  1.00 26.47  ? 1122 ARG D O     1 
ATOM   8021  C  CB    . ARG B  1  323 ? 36.690  32.545 -4.506  1.00 25.88  ? 1122 ARG D CB    1 
ATOM   8022  C  CG    . ARG B  1  323 ? 36.163  31.966 -5.821  1.00 28.22  ? 1122 ARG D CG    1 
ATOM   8023  C  CD    . ARG B  1  323 ? 34.954  32.872 -6.294  1.00 30.20  ? 1122 ARG D CD    1 
ATOM   8024  N  NE    . ARG B  1  323 ? 34.421  32.317 -7.561  1.00 34.76  ? 1122 ARG D NE    1 
ATOM   8025  C  CZ    . ARG B  1  323 ? 34.868  32.527 -8.754  1.00 35.32  ? 1122 ARG D CZ    1 
ATOM   8026  N  NH1   . ARG B  1  323 ? 35.994  33.214 -8.991  1.00 37.53  ? 1122 ARG D NH1   1 
ATOM   8027  N  NH2   . ARG B  1  323 ? 34.180  32.048 -9.767  1.00 37.36  ? 1122 ARG D NH2   1 
ATOM   8028  N  N     . PHE B  1  324 ? 38.320  29.516 -4.576  1.00 26.89  ? 1123 PHE D N     1 
ATOM   8029  C  CA    . PHE B  1  324 ? 38.106  28.065 -4.533  1.00 27.81  ? 1123 PHE D CA    1 
ATOM   8030  C  C     . PHE B  1  324 ? 39.189  27.313 -3.754  1.00 27.98  ? 1123 PHE D C     1 
ATOM   8031  O  O     . PHE B  1  324 ? 39.002  26.128 -3.494  1.00 32.47  ? 1123 PHE D O     1 
ATOM   8032  C  CB    . PHE B  1  324 ? 38.039  27.514 -5.956  1.00 28.33  ? 1123 PHE D CB    1 
ATOM   8033  C  CG    . PHE B  1  324 ? 36.883  28.038 -6.759  1.00 29.20  ? 1123 PHE D CG    1 
ATOM   8034  C  CD1   . PHE B  1  324 ? 35.566  27.870 -6.322  1.00 30.04  ? 1123 PHE D CD1   1 
ATOM   8035  C  CD2   . PHE B  1  324 ? 37.130  28.713 -7.978  1.00 30.23  ? 1123 PHE D CD2   1 
ATOM   8036  C  CE1   . PHE B  1  324 ? 34.519  28.346 -7.063  1.00 30.13  ? 1123 PHE D CE1   1 
ATOM   8037  C  CE2   . PHE B  1  324 ? 36.086  29.191 -8.738  1.00 31.48  ? 1123 PHE D CE2   1 
ATOM   8038  C  CZ    . PHE B  1  324 ? 34.792  29.002 -8.286  1.00 30.67  ? 1123 PHE D CZ    1 
ATOM   8039  N  N     . THR B  1  325 ? 40.286  27.948 -3.388  1.00 26.58  ? 1124 THR D N     1 
ATOM   8040  C  CA    . THR B  1  325 ? 41.378  27.266 -2.708  1.00 25.47  ? 1124 THR D CA    1 
ATOM   8041  C  C     . THR B  1  325 ? 41.487  27.754 -1.263  1.00 25.94  ? 1124 THR D C     1 
ATOM   8042  O  O     . THR B  1  325 ? 40.898  28.769 -0.864  1.00 24.51  ? 1124 THR D O     1 
ATOM   8043  C  CB    . THR B  1  325 ? 42.709  27.452 -3.435  1.00 24.29  ? 1124 THR D CB    1 
ATOM   8044  O  OG1   . THR B  1  325 ? 43.103  28.853 -3.377  1.00 22.81  ? 1124 THR D OG1   1 
ATOM   8045  C  CG2   . THR B  1  325 ? 42.577  27.023 -4.884  1.00 23.30  ? 1124 THR D CG2   1 
ATOM   8046  N  N     A GLU B  1  326 ? 42.275  27.009 -0.485  0.50 25.77  ? 1125 GLU D N     1 
ATOM   8047  N  N     B GLU B  1  326 ? 42.256  26.999 -0.478  0.50 26.41  ? 1125 GLU D N     1 
ATOM   8048  C  CA    A GLU B  1  326 ? 42.490  27.303 0.918   0.50 26.01  ? 1125 GLU D CA    1 
ATOM   8049  C  CA    B GLU B  1  326 ? 42.496  27.324 0.914   0.50 27.03  ? 1125 GLU D CA    1 
ATOM   8050  C  C     A GLU B  1  326 ? 43.970  27.073 1.227   0.50 25.20  ? 1125 GLU D C     1 
ATOM   8051  C  C     B GLU B  1  326 ? 43.980  27.107 1.206   0.50 25.78  ? 1125 GLU D C     1 
ATOM   8052  O  O     A GLU B  1  326 ? 44.665  26.363 0.499   0.50 25.01  ? 1125 GLU D O     1 
ATOM   8053  O  O     B GLU B  1  326 ? 44.684  26.437 0.449   0.50 25.42  ? 1125 GLU D O     1 
ATOM   8054  C  CB    A GLU B  1  326 ? 41.577  26.442 1.818   0.50 27.53  ? 1125 GLU D CB    1 
ATOM   8055  C  CB    B GLU B  1  326 ? 41.624  26.486 1.851   0.50 29.74  ? 1125 GLU D CB    1 
ATOM   8056  C  CG    A GLU B  1  326 ? 40.064  26.591 1.480   0.50 29.72  ? 1125 GLU D CG    1 
ATOM   8057  C  CG    B GLU B  1  326 ? 40.128  26.760 1.701   0.50 33.86  ? 1125 GLU D CG    1 
ATOM   8058  C  CD    A GLU B  1  326 ? 39.159  25.634 2.259   0.50 31.38  ? 1125 GLU D CD    1 
ATOM   8059  C  CD    B GLU B  1  326 ? 39.290  25.894 2.640   0.50 36.62  ? 1125 GLU D CD    1 
ATOM   8060  O  OE1   A GLU B  1  326 ? 39.750  24.856 3.090   0.50 36.33  ? 1125 GLU D OE1   1 
ATOM   8061  O  OE1   B GLU B  1  326 ? 39.784  24.826 3.044   0.50 43.15  ? 1125 GLU D OE1   1 
ATOM   8062  O  OE2   A GLU B  1  326 ? 37.945  25.618 2.049   0.50 31.42  ? 1125 GLU D OE2   1 
ATOM   8063  O  OE2   B GLU B  1  326 ? 38.374  26.468 3.199   0.50 37.67  ? 1125 GLU D OE2   1 
ATOM   8064  N  N     . ALA B  1  327 ? 44.450  27.672 2.324   1.00 24.29  ? 1126 ALA D N     1 
ATOM   8065  C  CA    . ALA B  1  327 ? 45.870  27.605 2.624   1.00 24.09  ? 1126 ALA D CA    1 
ATOM   8066  C  C     . ALA B  1  327 ? 46.111  27.857 4.117   1.00 23.45  ? 1126 ALA D C     1 
ATOM   8067  O  O     . ALA B  1  327 ? 45.277  28.403 4.834   1.00 22.71  ? 1126 ALA D O     1 
ATOM   8068  C  CB    . ALA B  1  327 ? 46.686  28.613 1.793   1.00 22.21  ? 1126 ALA D CB    1 
ATOM   8069  N  N     . ARG B  1  328 ? 47.310  27.464 4.580   1.00 22.67  ? 1127 ARG D N     1 
ATOM   8070  C  CA    . ARG B  1  328 ? 47.777  27.696 5.921   1.00 24.17  ? 1127 ARG D CA    1 
ATOM   8071  C  C     . ARG B  1  328 ? 49.339  27.645 5.890   1.00 24.10  ? 1127 ARG D C     1 
ATOM   8072  O  O     . ARG B  1  328 ? 49.916  27.234 4.924   1.00 23.07  ? 1127 ARG D O     1 
ATOM   8073  C  CB    . ARG B  1  328 ? 47.177  26.720 6.907   1.00 23.43  ? 1127 ARG D CB    1 
ATOM   8074  C  CG    . ARG B  1  328 ? 47.706  25.291 6.765   1.00 24.20  ? 1127 ARG D CG    1 
ATOM   8075  C  CD    . ARG B  1  328 ? 46.869  24.352 7.652   1.00 26.79  ? 1127 ARG D CD    1 
ATOM   8076  N  NE    . ARG B  1  328 ? 47.077  22.954 7.257   1.00 29.48  ? 1127 ARG D NE    1 
ATOM   8077  C  CZ    . ARG B  1  328 ? 46.396  21.931 7.740   1.00 30.96  ? 1127 ARG D CZ    1 
ATOM   8078  N  NH1   . ARG B  1  328 ? 45.414  22.083 8.674   1.00 32.03  ? 1127 ARG D NH1   1 
ATOM   8079  N  NH2   . ARG B  1  328 ? 46.653  20.719 7.318   1.00 32.12  ? 1127 ARG D NH2   1 
ATOM   8080  N  N     A MET B  1  329 ? 50.059  27.850 6.919   0.50 24.69  ? 1128 MET D N     1 
ATOM   8081  N  N     B MET B  1  329 ? 50.057  27.851 6.917   0.50 24.81  ? 1128 MET D N     1 
ATOM   8082  C  CA    A MET B  1  329 ? 51.488  27.682 6.920   0.50 25.89  ? 1128 MET D CA    1 
ATOM   8083  C  CA    B MET B  1  329 ? 51.487  27.694 6.916   0.50 26.12  ? 1128 MET D CA    1 
ATOM   8084  C  C     A MET B  1  329 ? 51.883  26.217 6.906   0.50 24.96  ? 1128 MET D C     1 
ATOM   8085  C  C     B MET B  1  329 ? 51.891  26.229 6.928   0.50 25.01  ? 1128 MET D C     1 
ATOM   8086  O  O     A MET B  1  329 ? 51.122  25.378 7.310   0.50 24.92  ? 1128 MET D O     1 
ATOM   8087  O  O     B MET B  1  329 ? 51.134  25.403 7.360   0.50 24.75  ? 1128 MET D O     1 
ATOM   8088  C  CB    A MET B  1  329 ? 52.074  28.272 8.211   0.50 28.23  ? 1128 MET D CB    1 
ATOM   8089  C  CB    B MET B  1  329 ? 52.053  28.325 8.193   0.50 28.87  ? 1128 MET D CB    1 
ATOM   8090  C  CG    A MET B  1  329 ? 51.927  29.760 8.396   0.50 31.42  ? 1128 MET D CG    1 
ATOM   8091  C  CG    B MET B  1  329 ? 51.881  29.830 8.330   0.50 32.26  ? 1128 MET D CG    1 
ATOM   8092  S  SD    A MET B  1  329 ? 52.723  30.155 10.063  0.50 34.47  ? 1128 MET D SD    1 
ATOM   8093  S  SD    B MET B  1  329 ? 52.344  30.341 10.126  0.50 38.79  ? 1128 MET D SD    1 
ATOM   8094  C  CE    A MET B  1  329 ? 51.240  31.011 10.761  0.50 33.37  ? 1128 MET D CE    1 
ATOM   8095  C  CE    B MET B  1  329 ? 53.652  29.184 10.276  0.50 30.95  ? 1128 MET D CE    1 
ATOM   8096  N  N     . THR B  1  330 ? 53.102  25.947 6.440   1.00 24.08  ? 1129 THR D N     1 
ATOM   8097  C  CA    . THR B  1  330 ? 53.724  24.671 6.686   1.00 23.72  ? 1129 THR D CA    1 
ATOM   8098  C  C     . THR B  1  330 ? 54.472  24.749 8.027   1.00 23.22  ? 1129 THR D C     1 
ATOM   8099  O  O     . THR B  1  330 ? 54.675  25.819 8.583   1.00 21.50  ? 1129 THR D O     1 
ATOM   8100  C  CB    . THR B  1  330 ? 54.705  24.325 5.546   1.00 23.13  ? 1129 THR D CB    1 
ATOM   8101  O  OG1   . THR B  1  330 ? 55.752  25.337 5.455   1.00 23.18  ? 1129 THR D OG1   1 
ATOM   8102  C  CG2   . THR B  1  330 ? 53.986  24.178 4.235   1.00 22.94  ? 1129 THR D CG2   1 
ATOM   8103  N  N     . LYS B  1  331 ? 54.861  23.593 8.525   1.00 23.29  ? 1130 LYS D N     1 
ATOM   8104  C  CA    . LYS B  1  331 ? 55.579  23.594 9.797   1.00 24.51  ? 1130 LYS D CA    1 
ATOM   8105  C  C     . LYS B  1  331 ? 56.901  24.326 9.719   1.00 23.42  ? 1130 LYS D C     1 
ATOM   8106  O  O     . LYS B  1  331 ? 57.275  25.016 10.682  1.00 24.06  ? 1130 LYS D O     1 
ATOM   8107  C  CB    . LYS B  1  331 ? 55.801  22.161 10.275  1.00 26.86  ? 1130 LYS D CB    1 
ATOM   8108  C  CG    . LYS B  1  331 ? 54.480  21.472 10.688  1.00 31.36  ? 1130 LYS D CG    1 
ATOM   8109  C  CD    . LYS B  1  331 ? 54.785  20.021 11.104  1.00 37.69  ? 1130 LYS D CD    1 
ATOM   8110  C  CE    . LYS B  1  331 ? 54.701  19.063 9.867   1.00 37.50  ? 1130 LYS D CE    1 
ATOM   8111  N  NZ    . LYS B  1  331 ? 53.344  19.087 9.219   1.00 36.34  ? 1130 LYS D NZ    1 
ATOM   8112  N  N     . ILE B  1  332 ? 57.621  24.215 8.620   1.00 23.06  ? 1131 ILE D N     1 
ATOM   8113  C  CA    . ILE B  1  332 ? 58.940  24.838 8.521   1.00 22.51  ? 1131 ILE D CA    1 
ATOM   8114  C  C     . ILE B  1  332 ? 58.808  26.362 8.473   1.00 21.84  ? 1131 ILE D C     1 
ATOM   8115  O  O     . ILE B  1  332 ? 59.721  27.083 8.867   1.00 20.83  ? 1131 ILE D O     1 
ATOM   8116  C  CB    . ILE B  1  332 ? 59.726  24.255 7.326   1.00 22.23  ? 1131 ILE D CB    1 
ATOM   8117  C  CG1   . ILE B  1  332 ? 61.246  24.580 7.569   1.00 21.48  ? 1131 ILE D CG1   1 
ATOM   8118  C  CG2   . ILE B  1  332 ? 59.283  24.868 5.992   1.00 23.16  ? 1131 ILE D CG2   1 
ATOM   8119  C  CD1   . ILE B  1  332 ? 62.142  23.885 6.489   1.00 21.55  ? 1131 ILE D CD1   1 
ATOM   8120  N  N     . THR B  1  333 ? 57.681  26.871 7.986   1.00 21.21  ? 1132 THR D N     1 
ATOM   8121  C  CA    . THR B  1  333 ? 57.482  28.327 7.993   1.00 21.11  ? 1132 THR D CA    1 
ATOM   8122  C  C     . THR B  1  333 ? 57.357  28.874 9.441   1.00 21.34  ? 1132 THR D C     1 
ATOM   8123  O  O     . THR B  1  333 ? 57.767  30.020 9.670   1.00 20.27  ? 1132 THR D O     1 
ATOM   8124  C  CB    . THR B  1  333 ? 56.162  28.667 7.239   1.00 22.41  ? 1132 THR D CB    1 
ATOM   8125  O  OG1   . THR B  1  333 ? 56.440  28.486 5.831   1.00 21.27  ? 1132 THR D OG1   1 
ATOM   8126  C  CG2   . THR B  1  333 ? 55.713  30.082 7.461   1.00 23.28  ? 1132 THR D CG2   1 
ATOM   8127  N  N     . LEU B  1  334 ? 56.915  28.043 10.373  1.00 20.72  ? 1133 LEU D N     1 
ATOM   8128  C  CA    . LEU B  1  334 ? 56.952  28.435 11.770  1.00 22.64  ? 1133 LEU D CA    1 
ATOM   8129  C  C     . LEU B  1  334 ? 58.391  28.828 12.198  1.00 22.55  ? 1133 LEU D C     1 
ATOM   8130  O  O     . LEU B  1  334 ? 58.547  29.694 13.073  1.00 23.05  ? 1133 LEU D O     1 
ATOM   8131  C  CB    . LEU B  1  334 ? 56.510  27.240 12.677  1.00 24.26  ? 1133 LEU D CB    1 
ATOM   8132  C  CG    . LEU B  1  334 ? 55.005  26.934 12.663  1.00 26.25  ? 1133 LEU D CG    1 
ATOM   8133  C  CD1   . LEU B  1  334 ? 54.847  25.513 13.350  1.00 26.26  ? 1133 LEU D CD1   1 
ATOM   8134  C  CD2   . LEU B  1  334 ? 54.227  27.992 13.480  1.00 29.03  ? 1133 LEU D CD2   1 
ATOM   8135  N  N     . GLU B  1  335 ? 59.398  28.237 11.593  1.00 22.29  ? 1134 GLU D N     1 
ATOM   8136  C  CA    . GLU B  1  335 ? 60.746  28.584 11.935  1.00 22.87  ? 1134 GLU D CA    1 
ATOM   8137  C  C     . GLU B  1  335 ? 61.199  29.913 11.288  1.00 22.47  ? 1134 GLU D C     1 
ATOM   8138  O  O     . GLU B  1  335 ? 62.149  30.519 11.801  1.00 21.96  ? 1134 GLU D O     1 
ATOM   8139  C  CB    . GLU B  1  335 ? 61.728  27.464 11.478  1.00 24.23  ? 1134 GLU D CB    1 
ATOM   8140  C  CG    . GLU B  1  335 ? 61.386  26.099 11.985  1.00 28.24  ? 1134 GLU D CG    1 
ATOM   8141  C  CD    . GLU B  1  335 ? 61.272  26.036 13.555  1.00 31.38  ? 1134 GLU D CD    1 
ATOM   8142  O  OE1   . GLU B  1  335 ? 60.339  25.476 14.101  1.00 32.57  ? 1134 GLU D OE1   1 
ATOM   8143  O  OE2   . GLU B  1  335 ? 62.190  26.581 14.211  1.00 31.41  ? 1134 GLU D OE2   1 
ATOM   8144  N  N     . LEU B  1  336 ? 60.553  30.338 10.219  1.00 21.40  ? 1135 LEU D N     1 
ATOM   8145  C  CA    . LEU B  1  336 ? 60.830  31.676 9.721   1.00 21.53  ? 1135 LEU D CA    1 
ATOM   8146  C  C     . LEU B  1  336 ? 60.260  32.756 10.641  1.00 22.25  ? 1135 LEU D C     1 
ATOM   8147  O  O     . LEU B  1  336 ? 60.856  33.843 10.741  1.00 21.30  ? 1135 LEU D O     1 
ATOM   8148  C  CB    . LEU B  1  336 ? 60.183  31.888 8.297   1.00 21.89  ? 1135 LEU D CB    1 
ATOM   8149  C  CG    . LEU B  1  336 ? 60.852  31.099 7.164   1.00 22.64  ? 1135 LEU D CG    1 
ATOM   8150  C  CD1   . LEU B  1  336 ? 60.088  31.438 5.864   1.00 22.94  ? 1135 LEU D CD1   1 
ATOM   8151  C  CD2   . LEU B  1  336 ? 62.341  31.417 7.071   1.00 23.57  ? 1135 LEU D CD2   1 
ATOM   8152  N  N     . LEU B  1  337 ? 59.142  32.499 11.285  1.00 21.80  ? 1136 LEU D N     1 
ATOM   8153  C  CA    . LEU B  1  337 ? 58.475  33.482 12.106  1.00 24.19  ? 1136 LEU D CA    1 
ATOM   8154  C  C     . LEU B  1  337 ? 58.800  33.344 13.611  1.00 24.82  ? 1136 LEU D C     1 
ATOM   8155  O  O     . LEU B  1  337 ? 58.443  34.238 14.352  1.00 26.00  ? 1136 LEU D O     1 
ATOM   8156  C  CB    . LEU B  1  337 ? 56.937  33.362 11.948  1.00 24.32  ? 1136 LEU D CB    1 
ATOM   8157  C  CG    . LEU B  1  337 ? 56.458  33.669 10.535  1.00 25.27  ? 1136 LEU D CG    1 
ATOM   8158  C  CD1   . LEU B  1  337 ? 55.165  32.905 10.237  1.00 25.85  ? 1136 LEU D CD1   1 
ATOM   8159  C  CD2   . LEU B  1  337 ? 56.253  35.175 10.360  1.00 24.69  ? 1136 LEU D CD2   1 
ATOM   8160  N  N     A ARG B  1  338 ? 59.502  32.287 13.997  0.50 25.82  ? 1137 ARG D N     1 
ATOM   8161  N  N     B ARG B  1  338 ? 59.504  32.287 13.999  0.50 26.34  ? 1137 ARG D N     1 
ATOM   8162  C  CA    A ARG B  1  338 ? 59.790  32.033 15.386  0.50 27.77  ? 1137 ARG D CA    1 
ATOM   8163  C  CA    B ARG B  1  338 ? 59.777  32.036 15.391  0.50 28.71  ? 1137 ARG D CA    1 
ATOM   8164  C  C     A ARG B  1  338 ? 60.571  33.232 15.972  0.50 28.23  ? 1137 ARG D C     1 
ATOM   8165  C  C     B ARG B  1  338 ? 60.566  33.231 15.973  0.50 28.82  ? 1137 ARG D C     1 
ATOM   8166  O  O     A ARG B  1  338 ? 61.492  33.753 15.444  0.50 27.74  ? 1137 ARG D O     1 
ATOM   8167  O  O     B ARG B  1  338 ? 61.486  33.748 15.439  0.50 28.21  ? 1137 ARG D O     1 
ATOM   8168  C  CB    A ARG B  1  338 ? 60.634  30.748 15.494  0.50 28.48  ? 1137 ARG D CB    1 
ATOM   8169  C  CB    B ARG B  1  338 ? 60.597  30.735 15.536  0.50 30.50  ? 1137 ARG D CB    1 
ATOM   8170  C  CG    A ARG B  1  338 ? 60.922  30.245 16.920  0.50 30.74  ? 1137 ARG D CG    1 
ATOM   8171  C  CG    B ARG B  1  338 ? 60.755  30.220 17.001  0.50 34.04  ? 1137 ARG D CG    1 
ATOM   8172  C  CD    A ARG B  1  338 ? 61.711  28.945 16.807  0.50 29.54  ? 1137 ARG D CD    1 
ATOM   8173  C  CD    B ARG B  1  338 ? 61.327  28.782 17.030  0.50 34.35  ? 1137 ARG D CD    1 
ATOM   8174  N  NE    A ARG B  1  338 ? 62.741  28.755 17.788  0.50 29.04  ? 1137 ARG D NE    1 
ATOM   8175  N  NE    B ARG B  1  338 ? 60.387  27.845 16.435  0.50 32.84  ? 1137 ARG D NE    1 
ATOM   8176  C  CZ    A ARG B  1  338 ? 63.652  27.793 17.749  0.50 27.93  ? 1137 ARG D CZ    1 
ATOM   8177  C  CZ    B ARG B  1  338 ? 59.452  27.217 17.116  0.50 33.05  ? 1137 ARG D CZ    1 
ATOM   8178  N  NH1   A ARG B  1  338 ? 63.614  26.882 16.778  0.50 25.88  ? 1137 ARG D NH1   1 
ATOM   8179  N  NH1   B ARG B  1  338 ? 59.351  27.369 18.410  0.50 34.17  ? 1137 ARG D NH1   1 
ATOM   8180  N  NH2   A ARG B  1  338 ? 64.588  27.763 18.661  0.50 26.67  ? 1137 ARG D NH2   1 
ATOM   8181  N  NH2   B ARG B  1  338 ? 58.634  26.395 16.485  0.50 33.44  ? 1137 ARG D NH2   1 
ATOM   8182  N  N     . ASP B  1  339 ? 60.045  33.634 17.079  1.00 28.62  ? 1138 ASP D N     1 
ATOM   8183  C  CA    . ASP B  1  339 ? 60.512  34.693 17.998  1.00 29.94  ? 1138 ASP D CA    1 
ATOM   8184  C  C     . ASP B  1  339 ? 60.246  36.083 17.456  1.00 28.76  ? 1138 ASP D C     1 
ATOM   8185  O  O     . ASP B  1  339 ? 60.841  37.030 17.926  1.00 27.14  ? 1138 ASP D O     1 
ATOM   8186  C  CB    . ASP B  1  339 ? 62.013  34.626 18.324  1.00 32.56  ? 1138 ASP D CB    1 
ATOM   8187  C  CG    . ASP B  1  339 ? 62.457  33.230 18.727  1.00 34.62  ? 1138 ASP D CG    1 
ATOM   8188  O  OD1   . ASP B  1  339 ? 61.917  32.682 19.608  1.00 35.90  ? 1138 ASP D OD1   1 
ATOM   8189  O  OD2   . ASP B  1  339 ? 63.413  32.741 18.139  1.00 41.56  ? 1138 ASP D OD2   1 
ATOM   8190  N  N     . ILE B  1  340 ? 59.355  36.202 16.473  1.00 25.73  ? 1139 ILE D N     1 
ATOM   8191  C  CA    . ILE B  1  340 ? 59.097  37.492 15.867  1.00 24.78  ? 1139 ILE D CA    1 
ATOM   8192  C  C     . ILE B  1  340 ? 58.517  38.482 16.834  1.00 27.16  ? 1139 ILE D C     1 
ATOM   8193  O  O     . ILE B  1  340 ? 58.669  39.705 16.646  1.00 27.56  ? 1139 ILE D O     1 
ATOM   8194  C  CB    . ILE B  1  340 ? 58.207  37.336 14.605  1.00 24.34  ? 1139 ILE D CB    1 
ATOM   8195  C  CG1   . ILE B  1  340 ? 58.231  38.627 13.783  1.00 24.18  ? 1139 ILE D CG1   1 
ATOM   8196  C  CG2   . ILE B  1  340 ? 56.768  36.959 15.039  1.00 23.76  ? 1139 ILE D CG2   1 
ATOM   8197  C  CD1   . ILE B  1  340 ? 57.502  38.453 12.452  1.00 25.05  ? 1139 ILE D CD1   1 
ATOM   8198  N  N     . ASN B  1  341 ? 57.862  38.002 17.885  1.00 28.71  ? 1140 ASN D N     1 
ATOM   8199  C  CA    . ASN B  1  341 ? 57.257  38.840 18.936  1.00 31.09  ? 1140 ASN D CA    1 
ATOM   8200  C  C     . ASN B  1  341 ? 58.118  38.970 20.157  1.00 29.67  ? 1140 ASN D C     1 
ATOM   8201  O  O     . ASN B  1  341 ? 57.616  39.250 21.226  1.00 30.76  ? 1140 ASN D O     1 
ATOM   8202  C  CB    . ASN B  1  341 ? 55.866  38.354 19.263  1.00 35.06  ? 1140 ASN D CB    1 
ATOM   8203  C  CG    . ASN B  1  341 ? 54.885  38.572 18.111  1.00 36.02  ? 1140 ASN D CG    1 
ATOM   8204  O  OD1   . ASN B  1  341 ? 54.837  39.701 17.487  1.00 35.96  ? 1140 ASN D OD1   1 
ATOM   8205  N  ND2   . ASN B  1  341 ? 54.135  37.496 17.784  1.00 38.34  ? 1140 ASN D ND2   1 
ATOM   8206  N  N     . LYS B  1  342 ? 59.418  38.813 19.979  1.00 28.60  ? 1141 LYS D N     1 
ATOM   8207  C  CA    . LYS B  1  342 ? 60.384  38.918 21.067  1.00 29.48  ? 1141 LYS D CA    1 
ATOM   8208  C  C     . LYS B  1  342 ? 61.419  39.978 20.776  1.00 27.88  ? 1141 LYS D C     1 
ATOM   8209  O  O     . LYS B  1  342 ? 62.544  39.887 21.211  1.00 27.99  ? 1141 LYS D O     1 
ATOM   8210  C  CB    . LYS B  1  342 ? 61.017  37.581 21.352  1.00 29.09  ? 1141 LYS D CB    1 
ATOM   8211  C  CG    . LYS B  1  342 ? 60.032  36.595 21.965  1.00 32.99  ? 1141 LYS D CG    1 
ATOM   8212  C  CD    . LYS B  1  342 ? 60.647  35.236 22.181  1.00 33.62  ? 1141 LYS D CD    1 
ATOM   8213  C  CE    . LYS B  1  342 ? 59.503  34.419 22.873  1.00 38.89  ? 1141 LYS D CE    1 
ATOM   8214  N  NZ    . LYS B  1  342 ? 58.344  34.159 21.964  1.00 41.39  ? 1141 LYS D NZ    1 
ATOM   8215  N  N     . ASP B  1  343 ? 60.997  40.986 19.967  1.00 29.23  ? 1142 ASP D N     1 
ATOM   8216  C  CA    . ASP B  1  343 ? 61.851  42.133 19.640  1.00 28.46  ? 1142 ASP D CA    1 
ATOM   8217  C  C     . ASP B  1  343 ? 63.175  41.642 19.069  1.00 25.78  ? 1142 ASP D C     1 
ATOM   8218  O  O     . ASP B  1  343 ? 64.279  42.121 19.386  1.00 25.05  ? 1142 ASP D O     1 
ATOM   8219  C  CB    . ASP B  1  343 ? 62.092  43.009 20.926  1.00 29.38  ? 1142 ASP D CB    1 
ATOM   8220  C  CG    . ASP B  1  343 ? 62.778  44.307 20.561  1.00 31.87  ? 1142 ASP D CG    1 
ATOM   8221  O  OD1   . ASP B  1  343 ? 62.607  44.799 19.472  1.00 30.35  ? 1142 ASP D OD1   1 
ATOM   8222  O  OD2   . ASP B  1  343 ? 63.499  44.858 21.422  1.00 31.78  ? 1142 ASP D OD2   1 
ATOM   8223  N  N     . THR B  1  344 ? 63.050  40.699 18.147  1.00 24.57  ? 1143 THR D N     1 
ATOM   8224  C  CA    . THR B  1  344 ? 64.243  40.162 17.435  1.00 23.99  ? 1143 THR D CA    1 
ATOM   8225  C  C     . THR B  1  344 ? 64.508  40.876 16.154  1.00 23.71  ? 1143 THR D C     1 
ATOM   8226  O  O     . THR B  1  344 ? 65.647  40.897 15.688  1.00 23.76  ? 1143 THR D O     1 
ATOM   8227  C  CB    . THR B  1  344 ? 64.035  38.655 17.134  1.00 25.14  ? 1143 THR D CB    1 
ATOM   8228  O  OG1   . THR B  1  344 ? 62.775  38.506 16.432  1.00 24.18  ? 1143 THR D OG1   1 
ATOM   8229  C  CG2   . THR B  1  344 ? 63.991  37.854 18.421  1.00 24.28  ? 1143 THR D CG2   1 
ATOM   8230  N  N     . ILE B  1  345 ? 63.450  41.498 15.549  1.00 23.85  ? 1144 ILE D N     1 
ATOM   8231  C  CA    . ILE B  1  345 ? 63.603  42.203 14.277  1.00 23.14  ? 1144 ILE D CA    1 
ATOM   8232  C  C     . ILE B  1  345 ? 62.895  43.521 14.381  1.00 23.92  ? 1144 ILE D C     1 
ATOM   8233  O  O     . ILE B  1  345 ? 62.031  43.707 15.239  1.00 24.50  ? 1144 ILE D O     1 
ATOM   8234  C  CB    . ILE B  1  345 ? 63.055  41.353 13.077  1.00 22.78  ? 1144 ILE D CB    1 
ATOM   8235  C  CG1   . ILE B  1  345 ? 61.651  40.890 13.335  1.00 23.17  ? 1144 ILE D CG1   1 
ATOM   8236  C  CG2   . ILE B  1  345 ? 63.927  40.110 12.864  1.00 22.69  ? 1144 ILE D CG2   1 
ATOM   8237  C  CD1   . ILE B  1  345 ? 60.550  41.814 12.756  1.00 23.31  ? 1144 ILE D CD1   1 
ATOM   8238  N  N     . ASP B  1  346 ? 63.251  44.452 13.510  1.00 24.26  ? 1145 ASP D N     1 
ATOM   8239  C  CA    . ASP B  1  346 ? 62.642  45.801 13.526  1.00 26.32  ? 1145 ASP D CA    1 
ATOM   8240  C  C     . ASP B  1  346 ? 61.365  45.830 12.738  1.00 25.38  ? 1145 ASP D C     1 
ATOM   8241  O  O     . ASP B  1  346 ? 61.332  45.394 11.564  1.00 24.33  ? 1145 ASP D O     1 
ATOM   8242  C  CB    . ASP B  1  346 ? 63.636  46.821 12.968  1.00 27.22  ? 1145 ASP D CB    1 
ATOM   8243  C  CG    . ASP B  1  346 ? 64.878  46.995 13.869  1.00 29.64  ? 1145 ASP D CG    1 
ATOM   8244  O  OD1   . ASP B  1  346 ? 64.824  46.648 15.053  1.00 30.11  ? 1145 ASP D OD1   1 
ATOM   8245  O  OD2   . ASP B  1  346 ? 65.887  47.439 13.302  1.00 32.07  ? 1145 ASP D OD2   1 
ATOM   8246  N  N     . PHE B  1  347 ? 60.306  46.348 13.337  1.00 26.37  ? 1146 PHE D N     1 
ATOM   8247  C  CA    . PHE B  1  347 ? 59.040  46.568 12.635  1.00 26.18  ? 1146 PHE D CA    1 
ATOM   8248  C  C     . PHE B  1  347 ? 59.060  48.015 12.060  1.00 26.98  ? 1146 PHE D C     1 
ATOM   8249  O  O     . PHE B  1  347 ? 59.735  48.932 12.595  1.00 26.94  ? 1146 PHE D O     1 
ATOM   8250  C  CB    . PHE B  1  347 ? 57.868  46.435 13.565  1.00 27.38  ? 1146 PHE D CB    1 
ATOM   8251  C  CG    . PHE B  1  347 ? 57.502  45.010 13.838  1.00 28.65  ? 1146 PHE D CG    1 
ATOM   8252  C  CD1   . PHE B  1  347 ? 58.120  44.286 14.830  1.00 29.77  ? 1146 PHE D CD1   1 
ATOM   8253  C  CD2   . PHE B  1  347 ? 56.482  44.408 13.066  1.00 28.15  ? 1146 PHE D CD2   1 
ATOM   8254  C  CE1   . PHE B  1  347 ? 57.783  42.961 15.070  1.00 30.35  ? 1146 PHE D CE1   1 
ATOM   8255  C  CE2   . PHE B  1  347 ? 56.162  43.077 13.312  1.00 30.68  ? 1146 PHE D CE2   1 
ATOM   8256  C  CZ    . PHE B  1  347 ? 56.825  42.364 14.311  1.00 30.60  ? 1146 PHE D CZ    1 
ATOM   8257  N  N     . ILE B  1  348 ? 58.302  48.188 11.005  1.00 25.69  ? 1147 ILE D N     1 
ATOM   8258  C  CA    . ILE B  1  348 ? 58.218  49.478 10.326  1.00 27.18  ? 1147 ILE D CA    1 
ATOM   8259  C  C     . ILE B  1  348 ? 56.737  49.780 10.119  1.00 28.21  ? 1147 ILE D C     1 
ATOM   8260  O  O     . ILE B  1  348 ? 55.888  48.888 10.225  1.00 26.00  ? 1147 ILE D O     1 
ATOM   8261  C  CB    . ILE B  1  348 ? 58.948  49.536 8.959   1.00 25.74  ? 1147 ILE D CB    1 
ATOM   8262  C  CG1   . ILE B  1  348 ? 58.393  48.494 8.012   1.00 25.96  ? 1147 ILE D CG1   1 
ATOM   8263  C  CG2   . ILE B  1  348 ? 60.475  49.473 9.197   1.00 26.97  ? 1147 ILE D CG2   1 
ATOM   8264  C  CD1   . ILE B  1  348 ? 59.083  48.516 6.632   1.00 28.26  ? 1147 ILE D CD1   1 
ATOM   8265  N  N     . ASP B  1  349 ? 56.432  51.053 9.821   1.00 28.93  ? 1148 ASP D N     1 
ATOM   8266  C  CA    . ASP B  1  349 ? 55.063  51.375 9.481   1.00 30.87  ? 1148 ASP D CA    1 
ATOM   8267  C  C     . ASP B  1  349 ? 54.706  50.840 8.108   1.00 29.46  ? 1148 ASP D C     1 
ATOM   8268  O  O     . ASP B  1  349 ? 55.563  50.773 7.213   1.00 26.84  ? 1148 ASP D O     1 
ATOM   8269  C  CB    . ASP B  1  349 ? 54.850  52.910 9.487   1.00 33.65  ? 1148 ASP D CB    1 
ATOM   8270  C  CG    . ASP B  1  349 ? 54.896  53.518 10.866  1.00 38.20  ? 1148 ASP D CG    1 
ATOM   8271  O  OD1   . ASP B  1  349 ? 54.712  52.749 11.838  1.00 35.95  ? 1148 ASP D OD1   1 
ATOM   8272  O  OD2   . ASP B  1  349 ? 55.014  54.770 10.814  1.00 42.68  ? 1148 ASP D OD2   1 
ATOM   8273  N  N     . ASN B  1  350 ? 53.449  50.425 7.949   1.00 26.92  ? 1149 ASN D N     1 
ATOM   8274  C  CA    . ASN B  1  350 ? 53.014  49.857 6.666   1.00 26.71  ? 1149 ASN D CA    1 
ATOM   8275  C  C     . ASN B  1  350 ? 52.814  51.072 5.679   1.00 27.83  ? 1149 ASN D C     1 
ATOM   8276  O  O     . ASN B  1  350 ? 53.203  52.207 5.945   1.00 27.50  ? 1149 ASN D O     1 
ATOM   8277  C  CB    . ASN B  1  350 ? 51.747  49.057 6.842   1.00 25.24  ? 1149 ASN D CB    1 
ATOM   8278  C  CG    . ASN B  1  350 ? 50.499  49.946 7.049   1.00 28.02  ? 1149 ASN D CG    1 
ATOM   8279  O  OD1   . ASN B  1  350 ? 50.573  50.977 7.707   1.00 26.56  ? 1149 ASN D OD1   1 
ATOM   8280  N  ND2   . ASN B  1  350 ? 49.386  49.523 6.473   1.00 25.89  ? 1149 ASN D ND2   1 
ATOM   8281  N  N     . TYR B  1  351 ? 52.187  50.784 4.538   1.00 26.96  ? 1150 TYR D N     1 
ATOM   8282  C  CA    . TYR B  1  351 ? 52.122  51.768 3.514   1.00 30.89  ? 1150 TYR D CA    1 
ATOM   8283  C  C     . TYR B  1  351 ? 51.258  53.008 3.862   1.00 33.52  ? 1150 TYR D C     1 
ATOM   8284  O  O     . TYR B  1  351 ? 51.522  54.105 3.390   1.00 33.70  ? 1150 TYR D O     1 
ATOM   8285  C  CB    . TYR B  1  351 ? 51.600  51.167 2.182   1.00 28.85  ? 1150 TYR D CB    1 
ATOM   8286  C  CG    . TYR B  1  351 ? 50.140  50.728 2.219   1.00 29.91  ? 1150 TYR D CG    1 
ATOM   8287  C  CD1   . TYR B  1  351 ? 49.780  49.466 2.681   1.00 28.51  ? 1150 TYR D CD1   1 
ATOM   8288  C  CD2   . TYR B  1  351 ? 49.124  51.590 1.742   1.00 29.85  ? 1150 TYR D CD2   1 
ATOM   8289  C  CE1   . TYR B  1  351 ? 48.477  49.061 2.691   1.00 27.47  ? 1150 TYR D CE1   1 
ATOM   8290  C  CE2   . TYR B  1  351 ? 47.809  51.210 1.759   1.00 31.23  ? 1150 TYR D CE2   1 
ATOM   8291  C  CZ    . TYR B  1  351 ? 47.489  49.936 2.230   1.00 30.55  ? 1150 TYR D CZ    1 
ATOM   8292  O  OH    . TYR B  1  351 ? 46.154  49.528 2.244   1.00 29.25  ? 1150 TYR D OH    1 
ATOM   8293  N  N     . ASP B  1  352 ? 50.248  52.818 4.722   1.00 34.88  ? 1151 ASP D N     1 
ATOM   8294  C  CA    . ASP B  1  352 ? 49.349  53.900 5.061   1.00 36.27  ? 1151 ASP D CA    1 
ATOM   8295  C  C     . ASP B  1  352 ? 49.441  54.335 6.516   1.00 38.37  ? 1151 ASP D C     1 
ATOM   8296  O  O     . ASP B  1  352 ? 48.623  55.184 6.957   1.00 33.92  ? 1151 ASP D O     1 
ATOM   8297  C  CB    . ASP B  1  352 ? 47.891  53.541 4.718   1.00 39.09  ? 1151 ASP D CB    1 
ATOM   8298  C  CG    . ASP B  1  352 ? 47.381  52.329 5.504   1.00 34.86  ? 1151 ASP D CG    1 
ATOM   8299  O  OD1   . ASP B  1  352 ? 48.074  51.842 6.407   1.00 34.78  ? 1151 ASP D OD1   1 
ATOM   8300  O  OD2   . ASP B  1  352 ? 46.258  51.867 5.211   1.00 37.46  ? 1151 ASP D OD2   1 
ATOM   8301  N  N     . GLY B  1  353 ? 50.371  53.764 7.283   1.00 34.34  ? 1152 GLY D N     1 
ATOM   8302  C  CA    . GLY B  1  353 ? 50.533  54.140 8.678   1.00 35.63  ? 1152 GLY D CA    1 
ATOM   8303  C  C     . GLY B  1  353 ? 49.516  53.572 9.621   1.00 37.20  ? 1152 GLY D C     1 
ATOM   8304  O  O     . GLY B  1  353 ? 49.547  53.912 10.823  1.00 40.55  ? 1152 GLY D O     1 
ATOM   8305  N  N     . ASN B  1  354 ? 48.615  52.719 9.149   1.00 35.83  ? 1153 ASN D N     1 
ATOM   8306  C  CA    . ASN B  1  354 ? 47.607  52.079 10.012  1.00 35.24  ? 1153 ASN D CA    1 
ATOM   8307  C  C     . ASN B  1  354 ? 48.083  50.760 10.596  1.00 31.94  ? 1153 ASN D C     1 
ATOM   8308  O  O     . ASN B  1  354 ? 47.462  50.278 11.532  1.00 29.97  ? 1153 ASN D O     1 
ATOM   8309  C  CB    . ASN B  1  354 ? 46.308  51.858 9.250   1.00 38.89  ? 1153 ASN D CB    1 
ATOM   8310  C  CG    . ASN B  1  354 ? 45.651  53.149 8.832   1.00 45.71  ? 1153 ASN D CG    1 
ATOM   8311  O  OD1   . ASN B  1  354 ? 45.611  54.106 9.605   1.00 48.97  ? 1153 ASN D OD1   1 
ATOM   8312  N  ND2   . ASN B  1  354 ? 45.139  53.189 7.593   1.00 43.68  ? 1153 ASN D ND2   1 
ATOM   8313  N  N     . GLU B  1  355 ? 49.146  50.181 10.053  1.00 28.66  ? 1154 GLU D N     1 
ATOM   8314  C  CA    . GLU B  1  355 ? 49.612  48.884 10.515  1.00 29.05  ? 1154 GLU D CA    1 
ATOM   8315  C  C     . GLU B  1  355 ? 51.111  48.890 10.677  1.00 28.34  ? 1154 GLU D C     1 
ATOM   8316  O  O     . GLU B  1  355 ? 51.809  49.787 10.202  1.00 28.30  ? 1154 GLU D O     1 
ATOM   8317  C  CB    . GLU B  1  355 ? 49.204  47.738 9.509   1.00 29.35  ? 1154 GLU D CB    1 
ATOM   8318  C  CG    . GLU B  1  355 ? 47.742  47.775 9.018   1.00 28.62  ? 1154 GLU D CG    1 
ATOM   8319  C  CD    . GLU B  1  355 ? 46.796  47.252 10.053  1.00 31.32  ? 1154 GLU D CD    1 
ATOM   8320  O  OE1   . GLU B  1  355 ? 47.242  46.835 11.166  1.00 30.24  ? 1154 GLU D OE1   1 
ATOM   8321  O  OE2   . GLU B  1  355 ? 45.536  47.272 9.828   1.00 32.18  ? 1154 GLU D OE2   1 
ATOM   8322  N  N     . ARG B  1  356 ? 51.614  47.864 11.358  1.00 28.71  ? 1155 ARG D N     1 
ATOM   8323  C  CA    . ARG B  1  356 ? 53.063  47.639 11.453  1.00 26.77  ? 1155 ARG D CA    1 
ATOM   8324  C  C     . ARG B  1  356 ? 53.384  46.326 10.765  1.00 25.96  ? 1155 ARG D C     1 
ATOM   8325  O  O     . ARG B  1  356 ? 52.593  45.401 10.776  1.00 25.23  ? 1155 ARG D O     1 
ATOM   8326  C  CB    . ARG B  1  356 ? 53.482  47.520 12.939  1.00 28.49  ? 1155 ARG D CB    1 
ATOM   8327  C  CG    . ARG B  1  356 ? 53.092  48.764 13.768  1.00 34.88  ? 1155 ARG D CG    1 
ATOM   8328  C  CD    . ARG B  1  356 ? 54.109  49.892 13.594  1.00 38.20  ? 1155 ARG D CD    1 
ATOM   8329  N  NE    . ARG B  1  356 ? 55.334  49.573 14.309  1.00 36.70  ? 1155 ARG D NE    1 
ATOM   8330  C  CZ    . ARG B  1  356 ? 56.459  50.297 14.208  1.00 39.83  ? 1155 ARG D CZ    1 
ATOM   8331  N  NH1   . ARG B  1  356 ? 56.515  51.367 13.401  1.00 38.81  ? 1155 ARG D NH1   1 
ATOM   8332  N  NH2   . ARG B  1  356 ? 57.535  49.950 14.902  1.00 38.90  ? 1155 ARG D NH2   1 
ATOM   8333  N  N     . GLU B  1  357 ? 54.557  46.274 10.123  1.00 24.69  ? 1156 GLU D N     1 
ATOM   8334  C  CA    . GLU B  1  357 ? 54.997  45.085 9.432   1.00 24.39  ? 1156 GLU D CA    1 
ATOM   8335  C  C     . GLU B  1  357 ? 56.475  44.848 9.669   1.00 23.36  ? 1156 GLU D C     1 
ATOM   8336  O  O     . GLU B  1  357 ? 57.213  45.797 9.964   1.00 23.55  ? 1156 GLU D O     1 
ATOM   8337  C  CB    . GLU B  1  357 ? 54.719  45.190 7.914   1.00 23.94  ? 1156 GLU D CB    1 
ATOM   8338  C  CG    . GLU B  1  357 ? 55.440  46.372 7.236   1.00 23.10  ? 1156 GLU D CG    1 
ATOM   8339  C  CD    . GLU B  1  357 ? 55.438  46.305 5.742   1.00 25.14  ? 1156 GLU D CD    1 
ATOM   8340  O  OE1   . GLU B  1  357 ? 55.361  47.360 5.113   1.00 26.12  ? 1156 GLU D OE1   1 
ATOM   8341  O  OE2   . GLU B  1  357 ? 55.259  45.208 5.194   1.00 25.16  ? 1156 GLU D OE2   1 
ATOM   8342  N  N     . PRO B  1  358 ? 56.929  43.608 9.574   1.00 23.47  ? 1157 PRO D N     1 
ATOM   8343  C  CA    . PRO B  1  358 ? 58.367  43.351 9.814   1.00 23.15  ? 1157 PRO D CA    1 
ATOM   8344  C  C     . PRO B  1  358 ? 59.229  43.768 8.664   1.00 22.82  ? 1157 PRO D C     1 
ATOM   8345  O  O     . PRO B  1  358 ? 58.874  43.608 7.492   1.00 21.98  ? 1157 PRO D O     1 
ATOM   8346  C  CB    . PRO B  1  358 ? 58.402  41.799 10.009  1.00 22.83  ? 1157 PRO D CB    1 
ATOM   8347  C  CG    . PRO B  1  358 ? 57.226  41.331 9.202   1.00 22.24  ? 1157 PRO D CG    1 
ATOM   8348  C  CD    . PRO B  1  358 ? 56.174  42.369 9.384   1.00 23.15  ? 1157 PRO D CD    1 
ATOM   8349  N  N     . SER B  1  359 ? 60.378  44.356 8.997   1.00 23.31  ? 1158 SER D N     1 
ATOM   8350  C  CA    . SER B  1  359 ? 61.381  44.654 7.948   1.00 23.33  ? 1158 SER D CA    1 
ATOM   8351  C  C     . SER B  1  359 ? 62.067  43.367 7.484   1.00 23.13  ? 1158 SER D C     1 
ATOM   8352  O  O     . SER B  1  359 ? 62.580  43.330 6.369   1.00 23.05  ? 1158 SER D O     1 
ATOM   8353  C  CB    . SER B  1  359 ? 62.410  45.643 8.482   1.00 23.58  ? 1158 SER D CB    1 
ATOM   8354  O  OG    . SER B  1  359 ? 63.113  45.058 9.616   1.00 24.45  ? 1158 SER D OG    1 
ATOM   8355  N  N     . VAL B  1  360 ? 62.072  42.330 8.313   1.00 22.40  ? 1159 VAL D N     1 
ATOM   8356  C  CA    . VAL B  1  360 ? 62.763  41.076 8.030   1.00 21.68  ? 1159 VAL D CA    1 
ATOM   8357  C  C     . VAL B  1  360 ? 62.232  40.024 8.984   1.00 21.81  ? 1159 VAL D C     1 
ATOM   8358  O  O     . VAL B  1  360 ? 61.873  40.342 10.119  1.00 20.94  ? 1159 VAL D O     1 
ATOM   8359  C  CB    . VAL B  1  360 ? 64.276  41.273 8.109   1.00 22.62  ? 1159 VAL D CB    1 
ATOM   8360  C  CG1   . VAL B  1  360 ? 64.729  41.567 9.570   1.00 23.38  ? 1159 VAL D CG1   1 
ATOM   8361  C  CG2   . VAL B  1  360 ? 65.042  40.003 7.601   1.00 22.91  ? 1159 VAL D CG2   1 
ATOM   8362  N  N     . LEU B  1  361 ? 62.175  38.775 8.556   1.00 21.00  ? 1160 LEU D N     1 
ATOM   8363  C  CA    . LEU B  1  361 ? 61.745  37.738 9.498   1.00 21.36  ? 1160 LEU D CA    1 
ATOM   8364  C  C     . LEU B  1  361 ? 62.953  37.162 10.221  1.00 22.13  ? 1160 LEU D C     1 
ATOM   8365  O  O     . LEU B  1  361 ? 64.098  37.220 9.719   1.00 21.50  ? 1160 LEU D O     1 
ATOM   8366  C  CB    . LEU B  1  361 ? 61.037  36.596 8.737   1.00 20.61  ? 1160 LEU D CB    1 
ATOM   8367  C  CG    . LEU B  1  361 ? 59.773  37.044 7.931   1.00 20.29  ? 1160 LEU D CG    1 
ATOM   8368  C  CD1   . LEU B  1  361 ? 58.979  35.813 7.467   1.00 20.40  ? 1160 LEU D CD1   1 
ATOM   8369  C  CD2   . LEU B  1  361 ? 58.891  37.983 8.731   1.00 20.44  ? 1160 LEU D CD2   1 
ATOM   8370  N  N     . PRO B  1  362 ? 62.741  36.599 11.414  1.00 21.96  ? 1161 PRO D N     1 
ATOM   8371  C  CA    . PRO B  1  362 ? 63.873  36.013 12.176  1.00 23.09  ? 1161 PRO D CA    1 
ATOM   8372  C  C     . PRO B  1  362 ? 64.566  34.903 11.395  1.00 23.53  ? 1161 PRO D C     1 
ATOM   8373  O  O     . PRO B  1  362 ? 65.793  34.744 11.541  1.00 23.66  ? 1161 PRO D O     1 
ATOM   8374  C  CB    . PRO B  1  362 ? 63.231  35.512 13.435  1.00 22.81  ? 1161 PRO D CB    1 
ATOM   8375  C  CG    . PRO B  1  362 ? 62.002  36.392 13.625  1.00 22.62  ? 1161 PRO D CG    1 
ATOM   8376  C  CD    . PRO B  1  362 ? 61.502  36.697 12.201  1.00 21.93  ? 1161 PRO D CD    1 
ATOM   8377  N  N     . ALA B  1  363 ? 63.845  34.126 10.638  1.00 22.44  ? 1162 ALA D N     1 
ATOM   8378  C  CA    . ALA B  1  363 ? 64.418  33.171 9.659   1.00 22.66  ? 1162 ALA D CA    1 
ATOM   8379  C  C     . ALA B  1  363 ? 65.400  32.244 10.293  1.00 23.20  ? 1162 ALA D C     1 
ATOM   8380  O  O     . ALA B  1  363 ? 66.610  32.320 10.056  1.00 25.31  ? 1162 ALA D O     1 
ATOM   8381  C  CB    . ALA B  1  363 ? 65.073  33.943 8.464   1.00 22.48  ? 1162 ALA D CB    1 
ATOM   8382  N  N     . ARG B  1  364 ? 64.875  31.376 11.134  1.00 23.80  ? 1163 ARG D N     1 
ATOM   8383  C  CA    . ARG B  1  364 ? 65.758  30.469 11.917  1.00 23.90  ? 1163 ARG D CA    1 
ATOM   8384  C  C     . ARG B  1  364 ? 66.322  29.336 11.068  1.00 24.70  ? 1163 ARG D C     1 
ATOM   8385  O  O     . ARG B  1  364 ? 67.004  28.497 11.629  1.00 25.16  ? 1163 ARG D O     1 
ATOM   8386  C  CB    . ARG B  1  364 ? 64.998  29.963 13.127  1.00 23.74  ? 1163 ARG D CB    1 
ATOM   8387  C  CG    . ARG B  1  364 ? 64.328  31.034 13.985  1.00 23.46  ? 1163 ARG D CG    1 
ATOM   8388  C  CD    . ARG B  1  364 ? 65.348  32.178 14.416  1.00 24.60  ? 1163 ARG D CD    1 
ATOM   8389  N  NE    . ARG B  1  364 ? 66.606  31.675 14.893  1.00 23.75  ? 1163 ARG D NE    1 
ATOM   8390  C  CZ    . ARG B  1  364 ? 66.752  31.051 16.087  1.00 26.30  ? 1163 ARG D CZ    1 
ATOM   8391  N  NH1   . ARG B  1  364 ? 65.739  30.958 16.939  1.00 25.64  ? 1163 ARG D NH1   1 
ATOM   8392  N  NH2   . ARG B  1  364 ? 67.932  30.487 16.417  1.00 24.77  ? 1163 ARG D NH2   1 
ATOM   8393  N  N     . PHE B  1  365 ? 66.078  29.269 9.759   1.00 24.25  ? 1164 PHE D N     1 
ATOM   8394  C  CA    . PHE B  1  365 ? 66.879  28.426 8.878   1.00 23.75  ? 1164 PHE D CA    1 
ATOM   8395  C  C     . PHE B  1  365 ? 67.257  29.271 7.660   1.00 23.66  ? 1164 PHE D C     1 
ATOM   8396  O  O     . PHE B  1  365 ? 66.567  30.246 7.339   1.00 23.84  ? 1164 PHE D O     1 
ATOM   8397  C  CB    . PHE B  1  365 ? 66.131  27.140 8.452   1.00 22.17  ? 1164 PHE D CB    1 
ATOM   8398  C  CG    . PHE B  1  365 ? 64.946  27.399 7.526   1.00 23.24  ? 1164 PHE D CG    1 
ATOM   8399  C  CD1   . PHE B  1  365 ? 63.707  27.623 8.010   1.00 22.29  ? 1164 PHE D CD1   1 
ATOM   8400  C  CD2   . PHE B  1  365 ? 65.175  27.324 6.142   1.00 21.88  ? 1164 PHE D CD2   1 
ATOM   8401  C  CE1   . PHE B  1  365 ? 62.657  27.850 7.142   1.00 23.17  ? 1164 PHE D CE1   1 
ATOM   8402  C  CE2   . PHE B  1  365 ? 64.095  27.552 5.275   1.00 22.37  ? 1164 PHE D CE2   1 
ATOM   8403  C  CZ    . PHE B  1  365 ? 62.823  27.805 5.761   1.00 21.84  ? 1164 PHE D CZ    1 
ATOM   8404  N  N     . PRO B  1  366 ? 68.357  28.955 6.974   1.00 23.40  ? 1165 PRO D N     1 
ATOM   8405  C  CA    . PRO B  1  366 ? 68.857  29.817 5.878   1.00 23.14  ? 1165 PRO D CA    1 
ATOM   8406  C  C     . PRO B  1  366 ? 68.033  29.729 4.632   1.00 23.83  ? 1165 PRO D C     1 
ATOM   8407  O  O     . PRO B  1  366 ? 68.371  28.964 3.728   1.00 22.31  ? 1165 PRO D O     1 
ATOM   8408  C  CB    . PRO B  1  366 ? 70.279  29.307 5.617   1.00 21.96  ? 1165 PRO D CB    1 
ATOM   8409  C  CG    . PRO B  1  366 ? 70.277  27.897 6.080   1.00 23.01  ? 1165 PRO D CG    1 
ATOM   8410  C  CD    . PRO B  1  366 ? 69.303  27.813 7.263   1.00 23.32  ? 1165 PRO D CD    1 
ATOM   8411  N  N     . ASN B  1  367 ? 66.964  30.591 4.549   1.00 22.97  ? 1166 ASN D N     1 
ATOM   8412  C  CA    . ASN B  1  367 ? 65.948  30.386 3.525   1.00 22.75  ? 1166 ASN D CA    1 
ATOM   8413  C  C     . ASN B  1  367 ? 66.370  30.885 2.157   1.00 21.08  ? 1166 ASN D C     1 
ATOM   8414  O  O     . ASN B  1  367 ? 65.932  30.299 1.149   1.00 22.02  ? 1166 ASN D O     1 
ATOM   8415  C  CB    . ASN B  1  367 ? 64.694  31.136 3.989   1.00 22.83  ? 1166 ASN D CB    1 
ATOM   8416  C  CG    . ASN B  1  367 ? 63.541  30.989 3.010   1.00 23.47  ? 1166 ASN D CG    1 
ATOM   8417  O  OD1   . ASN B  1  367 ? 63.250  29.863 2.554   1.00 23.21  ? 1166 ASN D OD1   1 
ATOM   8418  N  ND2   . ASN B  1  367 ? 62.949  32.109 2.645   1.00 21.55  ? 1166 ASN D ND2   1 
ATOM   8419  N  N     . LEU B  1  368 ? 67.147  31.929 2.050   1.00 19.98  ? 1167 LEU D N     1 
ATOM   8420  C  CA    . LEU B  1  368 ? 67.661  32.428 0.761   1.00 20.75  ? 1167 LEU D CA    1 
ATOM   8421  C  C     . LEU B  1  368 ? 68.257  31.301 -0.067  1.00 20.82  ? 1167 LEU D C     1 
ATOM   8422  O  O     . LEU B  1  368 ? 67.882  31.062 -1.227  1.00 21.06  ? 1167 LEU D O     1 
ATOM   8423  C  CB    . LEU B  1  368 ? 68.645  33.542 0.935   1.00 20.10  ? 1167 LEU D CB    1 
ATOM   8424  C  CG    . LEU B  1  368 ? 69.173  34.147 -0.418  1.00 20.53  ? 1167 LEU D CG    1 
ATOM   8425  C  CD1   . LEU B  1  368 ? 68.173  35.107 -1.046  1.00 21.25  ? 1167 LEU D CD1   1 
ATOM   8426  C  CD2   . LEU B  1  368 ? 70.557  34.843 -0.176  1.00 21.15  ? 1167 LEU D CD2   1 
ATOM   8427  N  N     . LEU B  1  369 ? 69.213  30.593 0.502   1.00 19.86  ? 1168 LEU D N     1 
ATOM   8428  C  CA    . LEU B  1  369 ? 69.891  29.502 -0.217  1.00 19.78  ? 1168 LEU D CA    1 
ATOM   8429  C  C     . LEU B  1  369 ? 69.026  28.226 -0.261  1.00 19.71  ? 1168 LEU D C     1 
ATOM   8430  O  O     . LEU B  1  369 ? 69.106  27.479 -1.233  1.00 21.87  ? 1168 LEU D O     1 
ATOM   8431  C  CB    . LEU B  1  369 ? 71.226  29.184 0.443   1.00 19.13  ? 1168 LEU D CB    1 
ATOM   8432  C  CG    . LEU B  1  369 ? 72.231  30.362 0.279   1.00 19.62  ? 1168 LEU D CG    1 
ATOM   8433  C  CD1   . LEU B  1  369 ? 73.490  30.100 1.133   1.00 20.05  ? 1168 LEU D CD1   1 
ATOM   8434  C  CD2   . LEU B  1  369 ? 72.620  30.486 -1.231  1.00 19.58  ? 1168 LEU D CD2   1 
ATOM   8435  N  N     . ALA B  1  370 ? 68.194  28.005 0.766   1.00 20.50  ? 1169 ALA D N     1 
ATOM   8436  C  CA    . ALA B  1  370 ? 67.413  26.778 0.836   1.00 20.24  ? 1169 ALA D CA    1 
ATOM   8437  C  C     . ALA B  1  370 ? 66.374  26.726 -0.312  1.00 20.32  ? 1169 ALA D C     1 
ATOM   8438  O  O     . ALA B  1  370 ? 66.254  25.710 -1.021  1.00 20.67  ? 1169 ALA D O     1 
ATOM   8439  C  CB    . ALA B  1  370 ? 66.714  26.655 2.180   1.00 19.51  ? 1169 ALA D CB    1 
ATOM   8440  N  N     . ASN B  1  371 ? 65.607  27.817 -0.486  1.00 21.06  ? 1170 ASN D N     1 
ATOM   8441  C  CA    . ASN B  1  371 ? 64.577  27.835 -1.492  1.00 21.63  ? 1170 ASN D CA    1 
ATOM   8442  C  C     . ASN B  1  371 ? 64.951  28.601 -2.758  1.00 22.83  ? 1170 ASN D C     1 
ATOM   8443  O  O     . ASN B  1  371 ? 64.247  28.528 -3.749  1.00 22.23  ? 1170 ASN D O     1 
ATOM   8444  C  CB    . ASN B  1  371 ? 63.292  28.435 -0.910  1.00 21.11  ? 1170 ASN D CB    1 
ATOM   8445  C  CG    . ASN B  1  371 ? 62.484  27.383 -0.172  1.00 21.04  ? 1170 ASN D CG    1 
ATOM   8446  O  OD1   . ASN B  1  371 ? 62.275  26.277 -0.671  1.00 21.31  ? 1170 ASN D OD1   1 
ATOM   8447  N  ND2   . ASN B  1  371 ? 62.045  27.737 1.048   1.00 19.63  ? 1170 ASN D ND2   1 
ATOM   8448  N  N     . GLY B  1  372 ? 66.050  29.338 -2.673  1.00 23.33  ? 1171 GLY D N     1 
ATOM   8449  C  CA    . GLY B  1  372 ? 66.506  30.074 -3.837  1.00 23.47  ? 1171 GLY D CA    1 
ATOM   8450  C  C     . GLY B  1  372 ? 65.695  31.311 -4.105  1.00 22.60  ? 1171 GLY D C     1 
ATOM   8451  O  O     . GLY B  1  372 ? 64.844  31.637 -3.354  1.00 21.49  ? 1171 GLY D O     1 
ATOM   8452  N  N     . ALA B  1  373 ? 65.957  31.934 -5.229  1.00 24.23  ? 1172 ALA D N     1 
ATOM   8453  C  CA    . ALA B  1  373 ? 65.225  33.105 -5.642  1.00 25.31  ? 1172 ALA D CA    1 
ATOM   8454  C  C     . ALA B  1  373 ? 65.425  33.371 -7.097  1.00 25.84  ? 1172 ALA D C     1 
ATOM   8455  O  O     . ALA B  1  373 ? 66.476  33.126 -7.653  1.00 28.13  ? 1172 ALA D O     1 
ATOM   8456  C  CB    . ALA B  1  373 ? 65.667  34.336 -4.856  1.00 24.05  ? 1172 ALA D CB    1 
ATOM   8457  N  N     . SER B  1  374 ? 64.352  33.945 -7.683  1.00 25.51  ? 1173 SER D N     1 
ATOM   8458  C  CA    . SER B  1  374 ? 64.513  34.374 -9.066  1.00 28.57  ? 1173 SER D CA    1 
ATOM   8459  C  C     . SER B  1  374 ? 63.791  35.683 -9.188  1.00 29.39  ? 1173 SER D C     1 
ATOM   8460  O  O     . SER B  1  374 ? 62.624  35.799 -8.782  1.00 30.25  ? 1173 SER D O     1 
ATOM   8461  C  CB    . SER B  1  374 ? 64.048  33.268 -10.038 1.00 28.06  ? 1173 SER D CB    1 
ATOM   8462  O  OG    . SER B  1  374 ? 63.038  33.630 -10.861 1.00 34.81  ? 1173 SER D OG    1 
ATOM   8463  N  N     . GLY B  1  375 ? 64.463  36.682 -9.716  1.00 25.52  ? 1174 GLY D N     1 
ATOM   8464  C  CA    . GLY B  1  375 ? 63.849  37.969 -9.845  1.00 26.02  ? 1174 GLY D CA    1 
ATOM   8465  C  C     . GLY B  1  375 ? 64.415  38.922 -10.887 1.00 26.91  ? 1174 GLY D C     1 
ATOM   8466  O  O     . GLY B  1  375 ? 65.613  39.038 -11.008 1.00 29.16  ? 1174 GLY D O     1 
ATOM   8467  N  N     . ILE B  1  376 ? 63.553  39.612 -11.614 1.00 24.34  ? 1175 ILE D N     1 
ATOM   8468  C  CA    . ILE B  1  376 ? 63.982  40.530 -12.612 1.00 22.71  ? 1175 ILE D CA    1 
ATOM   8469  C  C     . ILE B  1  376 ? 63.623  41.946 -12.080 1.00 22.28  ? 1175 ILE D C     1 
ATOM   8470  O  O     . ILE B  1  376 ? 62.497  42.278 -11.878 1.00 21.81  ? 1175 ILE D O     1 
ATOM   8471  C  CB    . ILE B  1  376 ? 63.235  40.277 -13.911 1.00 22.55  ? 1175 ILE D CB    1 
ATOM   8472  C  CG1   . ILE B  1  376 ? 63.533  38.895 -14.414 1.00 21.56  ? 1175 ILE D CG1   1 
ATOM   8473  C  CG2   . ILE B  1  376 ? 63.634  41.356 -14.981 1.00 22.82  ? 1175 ILE D CG2   1 
ATOM   8474  C  CD1   . ILE B  1  376 ? 62.472  38.385 -15.415 1.00 20.92  ? 1175 ILE D CD1   1 
ATOM   8475  N  N     . ALA B  1  377 ? 64.659  42.738 -11.864 1.00 21.52  ? 1176 ALA D N     1 
ATOM   8476  C  CA    . ALA B  1  377 ? 64.509  44.033 -11.296 1.00 22.32  ? 1176 ALA D CA    1 
ATOM   8477  C  C     . ALA B  1  377 ? 64.743  45.108 -12.375 1.00 22.94  ? 1176 ALA D C     1 
ATOM   8478  O  O     . ALA B  1  377 ? 64.276  44.941 -13.500 1.00 22.10  ? 1176 ALA D O     1 
ATOM   8479  C  CB    . ALA B  1  377 ? 65.491  44.193 -10.175 1.00 21.67  ? 1176 ALA D CB    1 
ATOM   8480  N  N     . VAL B  1  378 ? 65.430  46.195 -11.989 1.00 24.45  ? 1177 VAL D N     1 
ATOM   8481  C  CA    . VAL B  1  378 ? 65.839  47.144 -13.038 1.00 25.55  ? 1177 VAL D CA    1 
ATOM   8482  C  C     . VAL B  1  378 ? 67.338  47.360 -12.817 1.00 25.39  ? 1177 VAL D C     1 
ATOM   8483  O  O     . VAL B  1  378 ? 67.863  47.429 -11.695 1.00 27.05  ? 1177 VAL D O     1 
ATOM   8484  C  CB    . VAL B  1  378 ? 65.130  48.526 -12.845 1.00 26.25  ? 1177 VAL D CB    1 
ATOM   8485  C  CG1   . VAL B  1  378 ? 65.511  49.457 -13.959 1.00 25.66  ? 1177 VAL D CG1   1 
ATOM   8486  C  CG2   . VAL B  1  378 ? 63.575  48.328 -12.813 1.00 25.76  ? 1177 VAL D CG2   1 
ATOM   8487  N  N     . GLY B  1  379 ? 68.081  47.427 -13.950 1.00 27.07  ? 1178 GLY D N     1 
ATOM   8488  C  CA    . GLY B  1  379 ? 69.533  47.483 -13.863 1.00 26.59  ? 1178 GLY D CA    1 
ATOM   8489  C  C     . GLY B  1  379 ? 70.242  46.182 -13.468 1.00 26.91  ? 1178 GLY D C     1 
ATOM   8490  O  O     . GLY B  1  379 ? 71.455  46.140 -13.523 1.00 26.34  ? 1178 GLY D O     1 
ATOM   8491  N  N     . MET B  1  380 ? 69.464  45.160 -13.086 1.00 25.79  ? 1179 MET D N     1 
ATOM   8492  C  CA    . MET B  1  380 ? 70.076  43.925 -12.601 1.00 25.40  ? 1179 MET D CA    1 
ATOM   8493  C  C     . MET B  1  380 ? 68.942  42.900 -12.423 1.00 25.85  ? 1179 MET D C     1 
ATOM   8494  O  O     . MET B  1  380 ? 67.754  43.218 -12.563 1.00 23.94  ? 1179 MET D O     1 
ATOM   8495  C  CB    . MET B  1  380 ? 70.726  44.157 -11.199 1.00 25.70  ? 1179 MET D CB    1 
ATOM   8496  C  CG    . MET B  1  380 ? 69.764  44.752 -10.165 1.00 24.96  ? 1179 MET D CG    1 
ATOM   8497  S  SD    . MET B  1  380 ? 70.628  45.244 -8.701  1.00 27.27  ? 1179 MET D SD    1 
ATOM   8498  C  CE    . MET B  1  380 ? 71.795  46.521 -9.287  1.00 26.02  ? 1179 MET D CE    1 
ATOM   8499  N  N     . ALA B  1  381 ? 69.354  41.650 -12.223 1.00 24.63  ? 1180 ALA D N     1 
ATOM   8500  C  CA    . ALA B  1  381 ? 68.430  40.574 -11.955 1.00 25.26  ? 1180 ALA D CA    1 
ATOM   8501  C  C     . ALA B  1  381 ? 69.138  39.626 -10.977 1.00 24.84  ? 1180 ALA D C     1 
ATOM   8502  O  O     . ALA B  1  381 ? 70.359  39.741 -10.745 1.00 27.51  ? 1180 ALA D O     1 
ATOM   8503  C  CB    . ALA B  1  381 ? 67.981  39.846 -13.213 1.00 23.86  ? 1180 ALA D CB    1 
ATOM   8504  N  N     . THR B  1  382 ? 68.381  38.667 -10.444 1.00 23.65  ? 1181 THR D N     1 
ATOM   8505  C  CA    . THR B  1  382 ? 68.983  37.664 -9.586  1.00 24.04  ? 1181 THR D CA    1 
ATOM   8506  C  C     . THR B  1  382 ? 68.478  36.283 -9.962  1.00 23.54  ? 1181 THR D C     1 
ATOM   8507  O  O     . THR B  1  382 ? 67.372  36.131 -10.472 1.00 22.94  ? 1181 THR D O     1 
ATOM   8508  C  CB    . THR B  1  382 ? 68.658  37.966 -8.097  1.00 23.51  ? 1181 THR D CB    1 
ATOM   8509  O  OG1   . THR B  1  382 ? 69.438  37.108 -7.253  1.00 23.25  ? 1181 THR D OG1   1 
ATOM   8510  C  CG2   . THR B  1  382 ? 67.175  37.711 -7.781  1.00 22.88  ? 1181 THR D CG2   1 
ATOM   8511  N  N     . ASN B  1  383 ? 69.315  35.279 -9.678  1.00 22.97  ? 1182 ASN D N     1 
ATOM   8512  C  CA    . ASN B  1  383 ? 68.955  33.896 -10.007 1.00 23.04  ? 1182 ASN D CA    1 
ATOM   8513  C  C     . ASN B  1  383 ? 69.778  33.006 -9.068  1.00 21.75  ? 1182 ASN D C     1 
ATOM   8514  O  O     . ASN B  1  383 ? 70.940  32.714 -9.348  1.00 22.61  ? 1182 ASN D O     1 
ATOM   8515  C  CB    . ASN B  1  383 ? 69.224  33.597 -11.508 1.00 22.88  ? 1182 ASN D CB    1 
ATOM   8516  C  CG    . ASN B  1  383 ? 68.409  32.405 -11.995 1.00 24.74  ? 1182 ASN D CG    1 
ATOM   8517  O  OD1   . ASN B  1  383 ? 67.352  32.106 -11.473 1.00 24.47  ? 1182 ASN D OD1   1 
ATOM   8518  N  ND2   . ASN B  1  383 ? 68.886  31.712 -13.022 1.00 23.37  ? 1182 ASN D ND2   1 
ATOM   8519  N  N     . ILE B  1  384 ? 69.172  32.616 -7.966  1.00 22.34  ? 1183 ILE D N     1 
ATOM   8520  C  CA    . ILE B  1  384 ? 69.861  31.844 -6.925  1.00 22.38  ? 1183 ILE D CA    1 
ATOM   8521  C  C     . ILE B  1  384 ? 69.151  30.472 -6.846  1.00 23.44  ? 1183 ILE D C     1 
ATOM   8522  O  O     . ILE B  1  384 ? 67.929  30.396 -6.704  1.00 23.79  ? 1183 ILE D O     1 
ATOM   8523  C  CB    . ILE B  1  384 ? 69.707  32.538 -5.531  1.00 22.65  ? 1183 ILE D CB    1 
ATOM   8524  C  CG1   . ILE B  1  384 ? 70.445  33.897 -5.607  1.00 23.52  ? 1183 ILE D CG1   1 
ATOM   8525  C  CG2   . ILE B  1  384 ? 70.363  31.677 -4.437  1.00 21.47  ? 1183 ILE D CG2   1 
ATOM   8526  C  CD1   . ILE B  1  384 ? 70.172  34.776 -4.437  1.00 24.52  ? 1183 ILE D CD1   1 
ATOM   8527  N  N     . PRO B  1  385 ? 69.876  29.370 -6.972  1.00 24.43  ? 1184 PRO D N     1 
ATOM   8528  C  CA    . PRO B  1  385 ? 69.216  28.063 -6.991  1.00 23.25  ? 1184 PRO D CA    1 
ATOM   8529  C  C     . PRO B  1  385 ? 68.979  27.562 -5.558  1.00 24.01  ? 1184 PRO D C     1 
ATOM   8530  O  O     . PRO B  1  385 ? 69.595  28.031 -4.601  1.00 23.99  ? 1184 PRO D O     1 
ATOM   8531  C  CB    . PRO B  1  385 ? 70.298  27.161 -7.668  1.00 24.15  ? 1184 PRO D CB    1 
ATOM   8532  C  CG    . PRO B  1  385 ? 71.616  27.826 -7.269  1.00 22.94  ? 1184 PRO D CG    1 
ATOM   8533  C  CD    . PRO B  1  385 ? 71.341  29.308 -7.213  1.00 22.39  ? 1184 PRO D CD    1 
ATOM   8534  N  N     . PRO B  1  386 ? 68.035  26.618 -5.402  1.00 22.39  ? 1185 PRO D N     1 
ATOM   8535  C  CA    . PRO B  1  386 ? 67.766  26.072 -4.089  1.00 22.29  ? 1185 PRO D CA    1 
ATOM   8536  C  C     . PRO B  1  386 ? 68.867  25.066 -3.677  1.00 21.60  ? 1185 PRO D C     1 
ATOM   8537  O  O     . PRO B  1  386 ? 69.666  24.605 -4.485  1.00 21.40  ? 1185 PRO D O     1 
ATOM   8538  C  CB    . PRO B  1  386 ? 66.401  25.363 -4.282  1.00 20.56  ? 1185 PRO D CB    1 
ATOM   8539  C  CG    . PRO B  1  386 ? 66.408  24.990 -5.741  1.00 21.52  ? 1185 PRO D CG    1 
ATOM   8540  C  CD    . PRO B  1  386 ? 67.143  26.063 -6.433  1.00 23.22  ? 1185 PRO D CD    1 
ATOM   8541  N  N     . HIS B  1  387 ? 68.869  24.757 -2.376  1.00 22.84  ? 1186 HIS D N     1 
ATOM   8542  C  CA    . HIS B  1  387 ? 69.925  23.958 -1.805  1.00 22.55  ? 1186 HIS D CA    1 
ATOM   8543  C  C     . HIS B  1  387 ? 69.371  23.014 -0.763  1.00 22.50  ? 1186 HIS D C     1 
ATOM   8544  O  O     . HIS B  1  387 ? 68.232  23.171 -0.293  1.00 23.10  ? 1186 HIS D O     1 
ATOM   8545  C  CB    . HIS B  1  387 ? 71.037  24.868 -1.137  1.00 22.49  ? 1186 HIS D CB    1 
ATOM   8546  C  CG    . HIS B  1  387 ? 71.829  25.644 -2.118  1.00 23.28  ? 1186 HIS D CG    1 
ATOM   8547  N  ND1   . HIS B  1  387 ? 71.371  26.780 -2.744  1.00 23.97  ? 1186 HIS D ND1   1 
ATOM   8548  C  CD2   . HIS B  1  387 ? 73.079  25.403 -2.619  1.00 23.66  ? 1186 HIS D CD2   1 
ATOM   8549  C  CE1   . HIS B  1  387 ? 72.299  27.249 -3.581  1.00 23.65  ? 1186 HIS D CE1   1 
ATOM   8550  N  NE2   . HIS B  1  387 ? 73.332  26.443 -3.534  1.00 26.44  ? 1186 HIS D NE2   1 
ATOM   8551  N  N     . ASN B  1  388 ? 70.211  22.034 -0.383  1.00 22.18  ? 1187 ASN D N     1 
ATOM   8552  C  CA    . ASN B  1  388 ? 69.787  21.083 0.640   1.00 21.47  ? 1187 ASN D CA    1 
ATOM   8553  C  C     . ASN B  1  388 ? 69.975  21.699 2.032   1.00 21.27  ? 1187 ASN D C     1 
ATOM   8554  O  O     . ASN B  1  388 ? 71.053  22.249 2.335   1.00 22.25  ? 1187 ASN D O     1 
ATOM   8555  C  CB    . ASN B  1  388 ? 70.653  19.823 0.490   1.00 21.24  ? 1187 ASN D CB    1 
ATOM   8556  C  CG    . ASN B  1  388 ? 70.186  18.726 1.458   1.00 21.79  ? 1187 ASN D CG    1 
ATOM   8557  O  OD1   . ASN B  1  388 ? 70.715  18.612 2.557   1.00 22.18  ? 1187 ASN D OD1   1 
ATOM   8558  N  ND2   . ASN B  1  388 ? 69.212  17.916 1.025   1.00 22.45  ? 1187 ASN D ND2   1 
ATOM   8559  N  N     . LEU B  1  389 ? 68.938  21.594 2.854   1.00 21.71  ? 1188 LEU D N     1 
ATOM   8560  C  CA    . LEU B  1  389 ? 68.963  22.266 4.149   1.00 21.99  ? 1188 LEU D CA    1 
ATOM   8561  C  C     . LEU B  1  389 ? 69.965  21.641 5.105   1.00 21.98  ? 1188 LEU D C     1 
ATOM   8562  O  O     . LEU B  1  389 ? 70.630  22.331 5.875   1.00 22.66  ? 1188 LEU D O     1 
ATOM   8563  C  CB    . LEU B  1  389 ? 67.538  22.197 4.790   1.00 21.89  ? 1188 LEU D CB    1 
ATOM   8564  C  CG    . LEU B  1  389 ? 67.439  22.985 6.105   1.00 22.29  ? 1188 LEU D CG    1 
ATOM   8565  C  CD1   . LEU B  1  389 ? 67.672  24.450 6.015   1.00 24.73  ? 1188 LEU D CD1   1 
ATOM   8566  C  CD2   . LEU B  1  389 ? 66.036  22.653 6.704   1.00 22.63  ? 1188 LEU D CD2   1 
ATOM   8567  N  N     . THR B  1  390 ? 70.082  20.314 5.078   1.00 22.71  ? 1189 THR D N     1 
ATOM   8568  C  CA    . THR B  1  390 ? 71.118  19.658 5.890   1.00 22.36  ? 1189 THR D CA    1 
ATOM   8569  C  C     . THR B  1  390 ? 72.487  20.146 5.500   1.00 22.81  ? 1189 THR D C     1 
ATOM   8570  O  O     . THR B  1  390 ? 73.297  20.492 6.390   1.00 22.68  ? 1189 THR D O     1 
ATOM   8571  C  CB    . THR B  1  390 ? 71.024  18.129 5.691   1.00 23.11  ? 1189 THR D CB    1 
ATOM   8572  O  OG1   . THR B  1  390 ? 69.718  17.694 5.990   1.00 23.63  ? 1189 THR D OG1   1 
ATOM   8573  C  CG2   . THR B  1  390 ? 71.959  17.415 6.597   1.00 23.53  ? 1189 THR D CG2   1 
ATOM   8574  N  N     . GLU B  1  391 ? 72.776  20.204 4.210   1.00 21.73  ? 1190 GLU D N     1 
ATOM   8575  C  CA    . GLU B  1  391 ? 74.100  20.650 3.759   1.00 21.55  ? 1190 GLU D CA    1 
ATOM   8576  C  C     . GLU B  1  391 ? 74.314  22.117 4.151   1.00 20.86  ? 1190 GLU D C     1 
ATOM   8577  O  O     . GLU B  1  391 ? 75.407  22.472 4.610   1.00 19.60  ? 1190 GLU D O     1 
ATOM   8578  C  CB    . GLU B  1  391 ? 74.215  20.487 2.234   1.00 21.89  ? 1190 GLU D CB    1 
ATOM   8579  C  CG    . GLU B  1  391 ? 74.026  19.048 1.813   1.00 23.57  ? 1190 GLU D CG    1 
ATOM   8580  C  CD    . GLU B  1  391 ? 74.314  18.889 0.315   1.00 25.52  ? 1190 GLU D CD    1 
ATOM   8581  O  OE1   . GLU B  1  391 ? 74.667  19.878 -0.344  1.00 26.09  ? 1190 GLU D OE1   1 
ATOM   8582  O  OE2   . GLU B  1  391 ? 74.180  17.764 -0.179  1.00 27.44  ? 1190 GLU D OE2   1 
ATOM   8583  N  N     . LEU B  1  392 ? 73.308  22.968 3.952   1.00 20.16  ? 1191 LEU D N     1 
ATOM   8584  C  CA    . LEU B  1  392 ? 73.481  24.379 4.259   1.00 21.03  ? 1191 LEU D CA    1 
ATOM   8585  C  C     . LEU B  1  392 ? 73.803  24.604 5.734   1.00 21.21  ? 1191 LEU D C     1 
ATOM   8586  O  O     . LEU B  1  392 ? 74.679  25.381 6.081   1.00 22.39  ? 1191 LEU D O     1 
ATOM   8587  C  CB    . LEU B  1  392 ? 72.159  25.158 3.928   1.00 20.89  ? 1191 LEU D CB    1 
ATOM   8588  C  CG    . LEU B  1  392 ? 71.902  25.327 2.434   1.00 21.97  ? 1191 LEU D CG    1 
ATOM   8589  C  CD1   . LEU B  1  392 ? 70.574  26.092 2.308   1.00 21.17  ? 1191 LEU D CD1   1 
ATOM   8590  C  CD2   . LEU B  1  392 ? 73.018  26.091 1.769   1.00 22.08  ? 1191 LEU D CD2   1 
ATOM   8591  N  N     . ILE B  1  393 ? 73.079  23.941 6.621   1.00 22.07  ? 1192 ILE D N     1 
ATOM   8592  C  CA    . ILE B  1  393 ? 73.278  24.170 8.050   1.00 21.48  ? 1192 ILE D CA    1 
ATOM   8593  C  C     . ILE B  1  393 ? 74.634  23.667 8.504   1.00 21.35  ? 1192 ILE D C     1 
ATOM   8594  O  O     . ILE B  1  393 ? 75.326  24.301 9.305   1.00 21.56  ? 1192 ILE D O     1 
ATOM   8595  C  CB    . ILE B  1  393 ? 72.105  23.562 8.842   1.00 22.96  ? 1192 ILE D CB    1 
ATOM   8596  C  CG1   . ILE B  1  393 ? 70.845  24.435 8.622   1.00 23.08  ? 1192 ILE D CG1   1 
ATOM   8597  C  CG2   . ILE B  1  393 ? 72.457  23.457 10.328  1.00 22.49  ? 1192 ILE D CG2   1 
ATOM   8598  C  CD1   . ILE B  1  393 ? 69.647  23.941 9.388   1.00 23.76  ? 1192 ILE D CD1   1 
ATOM   8599  N  N     . ASN B  1  394 ? 75.062  22.517 7.986   1.00 21.14  ? 1193 ASN D N     1 
ATOM   8600  C  CA    . ASN B  1  394 ? 76.430  22.045 8.262   1.00 22.18  ? 1193 ASN D CA    1 
ATOM   8601  C  C     . ASN B  1  394 ? 77.451  23.074 7.805   1.00 22.04  ? 1193 ASN D C     1 
ATOM   8602  O  O     . ASN B  1  394 ? 78.471  23.282 8.455   1.00 23.14  ? 1193 ASN D O     1 
ATOM   8603  C  CB    . ASN B  1  394 ? 76.658  20.706 7.595   1.00 22.66  ? 1193 ASN D CB    1 
ATOM   8604  C  CG    . ASN B  1  394 ? 75.945  19.574 8.366   1.00 24.06  ? 1193 ASN D CG    1 
ATOM   8605  O  OD1   . ASN B  1  394 ? 75.699  19.672 9.550   1.00 24.27  ? 1193 ASN D OD1   1 
ATOM   8606  N  ND2   . ASN B  1  394 ? 75.584  18.481 7.742   1.00 24.84  ? 1193 ASN D ND2   1 
ATOM   8607  N  N     . GLY B  1  395 ? 77.175  23.757 6.677   1.00 22.77  ? 1194 GLY D N     1 
ATOM   8608  C  CA    . GLY B  1  395 ? 78.057  24.792 6.188   1.00 23.01  ? 1194 GLY D CA    1 
ATOM   8609  C  C     . GLY B  1  395 ? 78.100  25.985 7.144   1.00 22.98  ? 1194 GLY D C     1 
ATOM   8610  O  O     . GLY B  1  395 ? 79.177  26.511 7.446   1.00 24.24  ? 1194 GLY D O     1 
ATOM   8611  N  N     . VAL B  1  396 ? 76.923  26.413 7.634   1.00 23.78  ? 1195 VAL D N     1 
ATOM   8612  C  CA    . VAL B  1  396 ? 76.881  27.506 8.573   1.00 23.91  ? 1195 VAL D CA    1 
ATOM   8613  C  C     . VAL B  1  396 ? 77.587  27.103 9.897   1.00 23.98  ? 1195 VAL D C     1 
ATOM   8614  O  O     . VAL B  1  396 ? 78.292  27.923 10.512  1.00 22.90  ? 1195 VAL D O     1 
ATOM   8615  C  CB    . VAL B  1  396 ? 75.415  27.917 8.869   1.00 23.85  ? 1195 VAL D CB    1 
ATOM   8616  C  CG1   . VAL B  1  396 ? 75.408  29.101 9.876   1.00 23.77  ? 1195 VAL D CG1   1 
ATOM   8617  C  CG2   . VAL B  1  396 ? 74.769  28.400 7.572   1.00 24.82  ? 1195 VAL D CG2   1 
ATOM   8618  N  N     . LEU B  1  397 ? 77.414  25.859 10.297  1.00 23.85  ? 1196 LEU D N     1 
ATOM   8619  C  CA    . LEU B  1  397 ? 78.104  25.381 11.493  1.00 23.94  ? 1196 LEU D CA    1 
ATOM   8620  C  C     . LEU B  1  397 ? 79.610  25.361 11.285  1.00 25.50  ? 1196 LEU D C     1 
ATOM   8621  O  O     . LEU B  1  397 ? 80.371  25.766 12.194  1.00 26.51  ? 1196 LEU D O     1 
ATOM   8622  C  CB    . LEU B  1  397 ? 77.622  23.948 11.863  1.00 23.79  ? 1196 LEU D CB    1 
ATOM   8623  C  CG    . LEU B  1  397 ? 76.143  23.912 12.356  1.00 23.51  ? 1196 LEU D CG    1 
ATOM   8624  C  CD1   . LEU B  1  397 ? 75.793  22.401 12.548  1.00 25.19  ? 1196 LEU D CD1   1 
ATOM   8625  C  CD2   . LEU B  1  397 ? 75.993  24.656 13.663  1.00 24.32  ? 1196 LEU D CD2   1 
ATOM   8626  N  N     . SER B  1  398 ? 80.073  24.908 10.128  1.00 24.14  ? 1197 SER D N     1 
ATOM   8627  C  CA    . SER B  1  398 ? 81.495  24.946 9.812   1.00 24.95  ? 1197 SER D CA    1 
ATOM   8628  C  C     . SER B  1  398 ? 82.012  26.400 9.805   1.00 25.20  ? 1197 SER D C     1 
ATOM   8629  O  O     . SER B  1  398 ? 83.098  26.666 10.348  1.00 25.96  ? 1197 SER D O     1 
ATOM   8630  C  CB    . SER B  1  398 ? 81.785  24.301 8.472   1.00 24.70  ? 1197 SER D CB    1 
ATOM   8631  O  OG    . SER B  1  398 ? 81.473  22.923 8.505   1.00 25.59  ? 1197 SER D OG    1 
ATOM   8632  N  N     . LEU B  1  399 ? 81.234  27.315 9.227   1.00 23.58  ? 1198 LEU D N     1 
ATOM   8633  C  CA    . LEU B  1  399 ? 81.653  28.695 9.203   1.00 23.71  ? 1198 LEU D CA    1 
ATOM   8634  C  C     . LEU B  1  399 ? 81.683  29.313 10.642  1.00 24.14  ? 1198 LEU D C     1 
ATOM   8635  O  O     . LEU B  1  399 ? 82.576  30.096 10.954  1.00 24.97  ? 1198 LEU D O     1 
ATOM   8636  C  CB    . LEU B  1  399 ? 80.657  29.523 8.332   1.00 23.49  ? 1198 LEU D CB    1 
ATOM   8637  C  CG    . LEU B  1  399 ? 80.810  31.061 8.487   1.00 23.19  ? 1198 LEU D CG    1 
ATOM   8638  C  CD1   . LEU B  1  399 ? 82.060  31.590 7.878   1.00 24.14  ? 1198 LEU D CD1   1 
ATOM   8639  C  CD2   . LEU B  1  399 ? 79.578  31.686 7.795   1.00 22.44  ? 1198 LEU D CD2   1 
ATOM   8640  N  N     . SER B  1  400 ? 80.735  28.929 11.493  1.00 23.55  ? 1199 SER D N     1 
ATOM   8641  C  CA    . SER B  1  400 ? 80.703  29.487 12.821  1.00 25.51  ? 1199 SER D CA    1 
ATOM   8642  C  C     . SER B  1  400 ? 81.933  29.103 13.652  1.00 25.89  ? 1199 SER D C     1 
ATOM   8643  O  O     . SER B  1  400 ? 82.293  29.816 14.583  1.00 26.06  ? 1199 SER D O     1 
ATOM   8644  C  CB    . SER B  1  400 ? 79.433  28.999 13.571  1.00 25.16  ? 1199 SER D CB    1 
ATOM   8645  O  OG    . SER B  1  400 ? 79.515  27.602 13.874  1.00 29.06  ? 1199 SER D OG    1 
ATOM   8646  N  N     . LYS B  1  401 ? 82.587  27.990 13.281  1.00 26.11  ? 1200 LYS D N     1 
ATOM   8647  C  CA    . LYS B  1  401 ? 83.784  27.526 13.959  1.00 29.46  ? 1200 LYS D CA    1 
ATOM   8648  C  C     . LYS B  1  401 ? 85.066  27.971 13.278  1.00 30.19  ? 1200 LYS D C     1 
ATOM   8649  O  O     . LYS B  1  401 ? 86.166  27.711 13.793  1.00 32.27  ? 1200 LYS D O     1 
ATOM   8650  C  CB    . LYS B  1  401 ? 83.776  26.006 14.053  1.00 31.46  ? 1200 LYS D CB    1 
ATOM   8651  C  CG    . LYS B  1  401 ? 82.517  25.439 14.749  1.00 33.70  ? 1200 LYS D CG    1 
ATOM   8652  C  CD    . LYS B  1  401 ? 82.415  23.920 14.458  1.00 37.12  ? 1200 LYS D CD    1 
ATOM   8653  C  CE    . LYS B  1  401 ? 81.046  23.455 14.978  1.00 42.36  ? 1200 LYS D CE    1 
ATOM   8654  N  NZ    . LYS B  1  401 ? 80.730  22.008 14.809  1.00 40.89  ? 1200 LYS D NZ    1 
ATOM   8655  N  N     . ASN B  1  402 ? 84.974  28.621 12.110  1.00 29.31  ? 1201 ASN D N     1 
ATOM   8656  C  CA    . ASN B  1  402 ? 86.160  29.037 11.357  1.00 27.66  ? 1201 ASN D CA    1 
ATOM   8657  C  C     . ASN B  1  402 ? 85.780  30.200 10.470  1.00 27.11  ? 1201 ASN D C     1 
ATOM   8658  O  O     . ASN B  1  402 ? 85.331  30.009 9.312   1.00 28.38  ? 1201 ASN D O     1 
ATOM   8659  C  CB    . ASN B  1  402 ? 86.708  27.881 10.527  1.00 27.84  ? 1201 ASN D CB    1 
ATOM   8660  C  CG    . ASN B  1  402 ? 87.948  28.306 9.714   1.00 28.51  ? 1201 ASN D CG    1 
ATOM   8661  O  OD1   . ASN B  1  402 ? 88.524  29.343 9.922   1.00 27.87  ? 1201 ASN D OD1   1 
ATOM   8662  N  ND2   . ASN B  1  402 ? 88.338  27.486 8.770   1.00 28.36  ? 1201 ASN D ND2   1 
ATOM   8663  N  N     . PRO B  1  403 ? 85.931  31.427 10.968  1.00 26.83  ? 1202 PRO D N     1 
ATOM   8664  C  CA    . PRO B  1  403 ? 85.619  32.605 10.156  1.00 27.45  ? 1202 PRO D CA    1 
ATOM   8665  C  C     . PRO B  1  403 ? 86.435  32.687 8.850   1.00 26.74  ? 1202 PRO D C     1 
ATOM   8666  O  O     . PRO B  1  403 ? 85.972  33.320 7.908   1.00 26.05  ? 1202 PRO D O     1 
ATOM   8667  C  CB    . PRO B  1  403 ? 85.891  33.777 11.077  1.00 29.11  ? 1202 PRO D CB    1 
ATOM   8668  C  CG    . PRO B  1  403 ? 85.900  33.190 12.455  1.00 30.99  ? 1202 PRO D CG    1 
ATOM   8669  C  CD    . PRO B  1  403 ? 86.354  31.785 12.319  1.00 29.65  ? 1202 PRO D CD    1 
ATOM   8670  N  N     . ASP B  1  404 ? 87.642  32.081 8.801   1.00 27.75  ? 1203 ASP D N     1 
ATOM   8671  C  CA    . ASP B  1  404 ? 88.470  32.148 7.627   1.00 26.59  ? 1203 ASP D CA    1 
ATOM   8672  C  C     . ASP B  1  404 ? 88.308  30.938 6.692   1.00 26.04  ? 1203 ASP D C     1 
ATOM   8673  O  O     . ASP B  1  404 ? 89.167  30.721 5.808   1.00 27.33  ? 1203 ASP D O     1 
ATOM   8674  C  CB    . ASP B  1  404 ? 89.954  32.213 8.053   1.00 28.68  ? 1203 ASP D CB    1 
ATOM   8675  C  CG    . ASP B  1  404 ? 90.283  33.527 8.738   1.00 32.21  ? 1203 ASP D CG    1 
ATOM   8676  O  OD1   . ASP B  1  404 ? 89.656  34.600 8.441   1.00 36.57  ? 1203 ASP D OD1   1 
ATOM   8677  O  OD2   . ASP B  1  404 ? 91.230  33.447 9.538   1.00 35.49  ? 1203 ASP D OD2   1 
ATOM   8678  N  N     . ILE B  1  405 ? 87.233  30.177 6.860   1.00 24.87  ? 1204 ILE D N     1 
ATOM   8679  C  CA    . ILE B  1  405 ? 86.992  29.045 6.004   1.00 25.54  ? 1204 ILE D CA    1 
ATOM   8680  C  C     . ILE B  1  405 ? 86.848  29.522 4.547   1.00 25.94  ? 1204 ILE D C     1 
ATOM   8681  O  O     . ILE B  1  405 ? 86.381  30.631 4.278   1.00 24.97  ? 1204 ILE D O     1 
ATOM   8682  C  CB    . ILE B  1  405 ? 85.762  28.246 6.452   1.00 25.88  ? 1204 ILE D CB    1 
ATOM   8683  C  CG1   . ILE B  1  405 ? 85.713  26.905 5.721   1.00 25.41  ? 1204 ILE D CG1   1 
ATOM   8684  C  CG2   . ILE B  1  405 ? 84.454  29.156 6.177   1.00 24.43  ? 1204 ILE D CG2   1 
ATOM   8685  C  CD1   . ILE B  1  405 ? 84.550  26.062 6.282   1.00 26.52  ? 1204 ILE D CD1   1 
ATOM   8686  N  N     . SER B  1  406 ? 87.304  28.684 3.617   1.00 25.92  ? 1205 SER D N     1 
ATOM   8687  C  CA    . SER B  1  406 ? 87.275  29.063 2.207   1.00 25.11  ? 1205 SER D CA    1 
ATOM   8688  C  C     . SER B  1  406 ? 86.019  28.436 1.515   1.00 25.04  ? 1205 SER D C     1 
ATOM   8689  O  O     . SER B  1  406 ? 85.339  27.586 2.032   1.00 24.51  ? 1205 SER D O     1 
ATOM   8690  C  CB    . SER B  1  406 ? 88.476  28.466 1.466   1.00 26.65  ? 1205 SER D CB    1 
ATOM   8691  O  OG    . SER B  1  406 ? 88.368  27.013 1.299   1.00 24.61  ? 1205 SER D OG    1 
ATOM   8692  N  N     . ILE B  1  407 ? 85.749  28.934 0.323   1.00 25.27  ? 1206 ILE D N     1 
ATOM   8693  C  CA    . ILE B  1  407 ? 84.607  28.443 -0.375  1.00 25.63  ? 1206 ILE D CA    1 
ATOM   8694  C  C     . ILE B  1  407 ? 84.829  26.981 -0.736  1.00 26.74  ? 1206 ILE D C     1 
ATOM   8695  O  O     . ILE B  1  407 ? 83.888  26.202 -0.651  1.00 25.17  ? 1206 ILE D O     1 
ATOM   8696  C  CB    . ILE B  1  407 ? 84.309  29.331 -1.609  1.00 26.70  ? 1206 ILE D CB    1 
ATOM   8697  C  CG1   . ILE B  1  407 ? 83.682  30.649 -1.108  1.00 27.43  ? 1206 ILE D CG1   1 
ATOM   8698  C  CG2   . ILE B  1  407 ? 83.318  28.584 -2.558  1.00 25.33  ? 1206 ILE D CG2   1 
ATOM   8699  C  CD1   . ILE B  1  407 ? 83.806  31.750 -2.055  1.00 31.14  ? 1206 ILE D CD1   1 
ATOM   8700  N  N     . ALA B  1  408 ? 86.043  26.598 -1.091  1.00 26.18  ? 1207 ALA D N     1 
ATOM   8701  C  CA    . ALA B  1  408 ? 86.295  25.202 -1.431  1.00 26.09  ? 1207 ALA D CA    1 
ATOM   8702  C  C     . ALA B  1  408 ? 86.027  24.305 -0.219  1.00 26.70  ? 1207 ALA D C     1 
ATOM   8703  O  O     . ALA B  1  408 ? 85.475  23.198 -0.369  1.00 27.10  ? 1207 ALA D O     1 
ATOM   8704  C  CB    . ALA B  1  408 ? 87.720  24.980 -1.920  1.00 25.55  ? 1207 ALA D CB    1 
ATOM   8705  N  N     . GLU B  1  409 ? 86.429  24.737 0.973   1.00 25.32  ? 1208 GLU D N     1 
ATOM   8706  C  CA    . GLU B  1  409 ? 86.164  23.948 2.165   1.00 26.05  ? 1208 GLU D CA    1 
ATOM   8707  C  C     . GLU B  1  409 ? 84.647  23.917 2.487   1.00 24.58  ? 1208 GLU D C     1 
ATOM   8708  O  O     . GLU B  1  409 ? 84.137  22.888 2.909   1.00 25.31  ? 1208 GLU D O     1 
ATOM   8709  C  CB    . GLU B  1  409 ? 86.947  24.509 3.373   1.00 26.86  ? 1208 GLU D CB    1 
ATOM   8710  C  CG    . GLU B  1  409 ? 88.438  24.282 3.251   1.00 35.32  ? 1208 GLU D CG    1 
ATOM   8711  C  CD    . GLU B  1  409 ? 89.238  25.051 4.326   1.00 36.85  ? 1208 GLU D CD    1 
ATOM   8712  O  OE1   . GLU B  1  409 ? 89.076  26.348 4.537   1.00 33.73  ? 1208 GLU D OE1   1 
ATOM   8713  O  OE2   . GLU B  1  409 ? 90.261  24.481 4.660   1.00 45.47  ? 1208 GLU D OE2   1 
ATOM   8714  N  N     . LEU B  1  410 ? 83.952  25.037 2.270   1.00 23.51  ? 1209 LEU D N     1 
ATOM   8715  C  CA    . LEU B  1  410 ? 82.520  25.042 2.466   1.00 24.33  ? 1209 LEU D CA    1 
ATOM   8716  C  C     . LEU B  1  410 ? 81.797  24.104 1.506   1.00 23.52  ? 1209 LEU D C     1 
ATOM   8717  O  O     . LEU B  1  410 ? 80.695  23.625 1.822   1.00 22.90  ? 1209 LEU D O     1 
ATOM   8718  C  CB    . LEU B  1  410 ? 81.957  26.477 2.314   1.00 23.33  ? 1209 LEU D CB    1 
ATOM   8719  C  CG    . LEU B  1  410 ? 82.102  27.417 3.485   1.00 23.46  ? 1209 LEU D CG    1 
ATOM   8720  C  CD1   . LEU B  1  410 ? 81.878  28.840 3.021   1.00 22.71  ? 1209 LEU D CD1   1 
ATOM   8721  C  CD2   . LEU B  1  410 ? 81.106  27.049 4.602   1.00 24.96  ? 1209 LEU D CD2   1 
ATOM   8722  N  N     . MET B  1  411 ? 82.383  23.833 0.343   1.00 23.10  ? 1210 MET D N     1 
ATOM   8723  C  CA    . MET B  1  411 ? 81.808  22.882 -0.585  1.00 25.48  ? 1210 MET D CA    1 
ATOM   8724  C  C     . MET B  1  411 ? 81.959  21.425 -0.124  1.00 27.42  ? 1210 MET D C     1 
ATOM   8725  O  O     . MET B  1  411 ? 81.377  20.524 -0.731  1.00 29.62  ? 1210 MET D O     1 
ATOM   8726  C  CB    . MET B  1  411 ? 82.417  23.090 -1.984  1.00 25.57  ? 1210 MET D CB    1 
ATOM   8727  C  CG    . MET B  1  411 ? 81.873  24.310 -2.675  1.00 24.42  ? 1210 MET D CG    1 
ATOM   8728  S  SD    . MET B  1  411 ? 82.613  24.608 -4.319  1.00 28.12  ? 1210 MET D SD    1 
ATOM   8729  C  CE    . MET B  1  411 ? 81.991  23.219 -5.274  1.00 25.99  ? 1210 MET D CE    1 
ATOM   8730  N  N     A GLU B  1  412 ? 82.715  21.186 0.935   0.50 26.40  ? 1211 GLU D N     1 
ATOM   8731  N  N     B GLU B  1  412 ? 82.720  21.179 0.927   0.50 26.84  ? 1211 GLU D N     1 
ATOM   8732  C  CA    A GLU B  1  412 ? 82.723  19.869 1.560   0.50 26.88  ? 1211 GLU D CA    1 
ATOM   8733  C  CA    B GLU B  1  412 ? 82.693  19.853 1.532   0.50 27.66  ? 1211 GLU D CA    1 
ATOM   8734  C  C     A GLU B  1  412 ? 81.433  19.598 2.341   0.50 26.86  ? 1211 GLU D C     1 
ATOM   8735  C  C     B GLU B  1  412 ? 81.356  19.596 2.229   0.50 27.77  ? 1211 GLU D C     1 
ATOM   8736  O  O     A GLU B  1  412 ? 81.108  18.447 2.577   0.50 27.45  ? 1211 GLU D O     1 
ATOM   8737  O  O     B GLU B  1  412 ? 80.910  18.460 2.298   0.50 29.63  ? 1211 GLU D O     1 
ATOM   8738  C  CB    A GLU B  1  412 ? 83.947  19.782 2.524   0.50 27.45  ? 1211 GLU D CB    1 
ATOM   8739  C  CB    B GLU B  1  412 ? 83.858  19.781 2.575   0.50 28.70  ? 1211 GLU D CB    1 
ATOM   8740  C  CG    A GLU B  1  412 ? 85.261  19.673 1.771   0.50 29.58  ? 1211 GLU D CG    1 
ATOM   8741  C  CG    B GLU B  1  412 ? 85.226  19.962 1.962   0.50 31.05  ? 1211 GLU D CG    1 
ATOM   8742  C  CD    A GLU B  1  412 ? 86.458  19.817 2.669   0.50 30.08  ? 1211 GLU D CD    1 
ATOM   8743  C  CD    B GLU B  1  412 ? 85.500  18.823 0.905   0.50 32.44  ? 1211 GLU D CD    1 
ATOM   8744  O  OE1   A GLU B  1  412 ? 87.530  20.349 2.266   0.50 31.66  ? 1211 GLU D OE1   1 
ATOM   8745  O  OE1   B GLU B  1  412 ? 85.051  17.655 0.995   0.50 32.53  ? 1211 GLU D OE1   1 
ATOM   8746  O  OE2   A GLU B  1  412 ? 86.319  19.294 3.762   0.50 32.72  ? 1211 GLU D OE2   1 
ATOM   8747  O  OE2   B GLU B  1  412 ? 86.215  19.024 -0.066  0.50 35.97  ? 1211 GLU D OE2   1 
ATOM   8748  N  N     . ASP B  1  413 ? 80.712  20.655 2.729   1.00 25.89  ? 1212 ASP D N     1 
ATOM   8749  C  CA    . ASP B  1  413 ? 79.376  20.538 3.285   1.00 25.37  ? 1212 ASP D CA    1 
ATOM   8750  C  C     . ASP B  1  413 ? 78.304  20.718 2.231   1.00 24.92  ? 1212 ASP D C     1 
ATOM   8751  O  O     . ASP B  1  413 ? 77.357  19.924 2.157   1.00 24.79  ? 1212 ASP D O     1 
ATOM   8752  C  CB    . ASP B  1  413 ? 79.164  21.608 4.391   1.00 25.53  ? 1212 ASP D CB    1 
ATOM   8753  C  CG    . ASP B  1  413 ? 80.042  21.373 5.596   1.00 26.72  ? 1212 ASP D CG    1 
ATOM   8754  O  OD1   . ASP B  1  413 ? 80.066  20.206 6.091   1.00 24.78  ? 1212 ASP D OD1   1 
ATOM   8755  O  OD2   . ASP B  1  413 ? 80.701  22.376 6.028   1.00 26.40  ? 1212 ASP D OD2   1 
ATOM   8756  N  N     . ILE B  1  414 ? 78.456  21.753 1.387   1.00 24.30  ? 1213 ILE D N     1 
ATOM   8757  C  CA    . ILE B  1  414 ? 77.450  22.148 0.415   1.00 24.44  ? 1213 ILE D CA    1 
ATOM   8758  C  C     . ILE B  1  414 ? 77.948  21.669 -0.962  1.00 25.34  ? 1213 ILE D C     1 
ATOM   8759  O  O     . ILE B  1  414 ? 78.749  22.330 -1.606  1.00 27.33  ? 1213 ILE D O     1 
ATOM   8760  C  CB    . ILE B  1  414 ? 77.208  23.658 0.455   1.00 24.51  ? 1213 ILE D CB    1 
ATOM   8761  C  CG1   . ILE B  1  414 ? 76.834  24.080 1.849   1.00 25.32  ? 1213 ILE D CG1   1 
ATOM   8762  C  CG2   . ILE B  1  414 ? 76.111  24.057 -0.533  1.00 23.87  ? 1213 ILE D CG2   1 
ATOM   8763  C  CD1   . ILE B  1  414 ? 76.854  25.619 2.066   1.00 25.33  ? 1213 ILE D CD1   1 
ATOM   8764  N  N     . GLU B  1  415 ? 77.476  20.533 -1.399  1.00 27.30  ? 1214 GLU D N     1 
ATOM   8765  C  CA    . GLU B  1  415 ? 77.947  19.950 -2.662  1.00 29.91  ? 1214 GLU D CA    1 
ATOM   8766  C  C     . GLU B  1  415 ? 77.558  20.789 -3.848  1.00 28.03  ? 1214 GLU D C     1 
ATOM   8767  O  O     . GLU B  1  415 ? 78.275  20.832 -4.877  1.00 26.64  ? 1214 GLU D O     1 
ATOM   8768  C  CB    . GLU B  1  415 ? 77.388  18.529 -2.844  1.00 33.43  ? 1214 GLU D CB    1 
ATOM   8769  C  CG    . GLU B  1  415 ? 77.747  17.541 -1.733  1.00 42.35  ? 1214 GLU D CG    1 
ATOM   8770  C  CD    . GLU B  1  415 ? 77.179  16.178 -2.008  1.00 49.86  ? 1214 GLU D CD    1 
ATOM   8771  O  OE1   . GLU B  1  415 ? 76.983  15.841 -3.268  1.00 56.50  ? 1214 GLU D OE1   1 
ATOM   8772  O  OE2   . GLU B  1  415 ? 76.842  15.399 -1.100  1.00 52.12  ? 1214 GLU D OE2   1 
ATOM   8773  N  N     . GLY B  1  416 ? 76.436  21.518 -3.752  1.00 26.24  ? 1215 GLY D N     1 
ATOM   8774  C  CA    . GLY B  1  416 ? 75.908  22.239 -4.879  1.00 25.19  ? 1215 GLY D CA    1 
ATOM   8775  C  C     . GLY B  1  416 ? 74.415  22.431 -4.662  1.00 24.23  ? 1215 GLY D C     1 
ATOM   8776  O  O     . GLY B  1  416 ? 73.876  22.099 -3.611  1.00 23.52  ? 1215 GLY D O     1 
ATOM   8777  N  N     . PRO B  1  417 ? 73.718  22.962 -5.697  1.00 24.89  ? 1216 PRO D N     1 
ATOM   8778  C  CA    . PRO B  1  417 ? 72.292  23.095 -5.600  1.00 24.43  ? 1216 PRO D CA    1 
ATOM   8779  C  C     . PRO B  1  417 ? 71.585  21.770 -5.389  1.00 24.90  ? 1216 PRO D C     1 
ATOM   8780  O  O     . PRO B  1  417 ? 72.105  20.697 -5.759  1.00 27.69  ? 1216 PRO D O     1 
ATOM   8781  C  CB    . PRO B  1  417 ? 71.909  23.731 -6.971  1.00 24.58  ? 1216 PRO D CB    1 
ATOM   8782  C  CG    . PRO B  1  417 ? 73.121  24.362 -7.427  1.00 25.80  ? 1216 PRO D CG    1 
ATOM   8783  C  CD    . PRO B  1  417 ? 74.262  23.477 -6.953  1.00 24.78  ? 1216 PRO D CD    1 
ATOM   8784  N  N     . ASP B  1  418 ? 70.397  21.845 -4.810  1.00 25.13  ? 1217 ASP D N     1 
ATOM   8785  C  CA    . ASP B  1  418 ? 69.533  20.670 -4.640  1.00 24.31  ? 1217 ASP D CA    1 
ATOM   8786  C  C     . ASP B  1  418 ? 68.144  21.103 -5.054  1.00 23.57  ? 1217 ASP D C     1 
ATOM   8787  O  O     . ASP B  1  418 ? 67.444  21.799 -4.293  1.00 23.54  ? 1217 ASP D O     1 
ATOM   8788  C  CB    . ASP B  1  418 ? 69.585  20.191 -3.168  1.00 24.89  ? 1217 ASP D CB    1 
ATOM   8789  C  CG    . ASP B  1  418 ? 68.941  18.823 -2.985  1.00 26.32  ? 1217 ASP D CG    1 
ATOM   8790  O  OD1   . ASP B  1  418 ? 68.883  18.045 -3.962  1.00 27.93  ? 1217 ASP D OD1   1 
ATOM   8791  O  OD2   . ASP B  1  418 ? 68.503  18.513 -1.859  1.00 24.12  ? 1217 ASP D OD2   1 
ATOM   8792  N  N     . PHE B  1  419 ? 67.749  20.710 -6.259  1.00 22.64  ? 1218 PHE D N     1 
ATOM   8793  C  CA    . PHE B  1  419 ? 66.481  21.167 -6.859  1.00 23.93  ? 1218 PHE D CA    1 
ATOM   8794  C  C     . PHE B  1  419 ? 65.321  20.303 -6.301  1.00 24.22  ? 1218 PHE D C     1 
ATOM   8795  O  O     . PHE B  1  419 ? 65.466  19.075 -6.134  1.00 23.15  ? 1218 PHE D O     1 
ATOM   8796  C  CB    . PHE B  1  419 ? 66.522  21.085 -8.345  1.00 23.74  ? 1218 PHE D CB    1 
ATOM   8797  C  CG    . PHE B  1  419 ? 67.601  21.913 -8.948  1.00 25.65  ? 1218 PHE D CG    1 
ATOM   8798  C  CD1   . PHE B  1  419 ? 67.583  23.313 -8.859  1.00 27.02  ? 1218 PHE D CD1   1 
ATOM   8799  C  CD2   . PHE B  1  419 ? 68.637  21.294 -9.636  1.00 25.69  ? 1218 PHE D CD2   1 
ATOM   8800  C  CE1   . PHE B  1  419 ? 68.585  24.082 -9.425  1.00 26.94  ? 1218 PHE D CE1   1 
ATOM   8801  C  CE2   . PHE B  1  419 ? 69.689  22.118 -10.159 1.00 26.13  ? 1218 PHE D CE2   1 
ATOM   8802  C  CZ    . PHE B  1  419 ? 69.674  23.569 -10.102 1.00 25.31  ? 1218 PHE D CZ    1 
ATOM   8803  N  N     . PRO B  1  420 ? 64.163  20.925 -6.061  1.00 23.16  ? 1219 PRO D N     1 
ATOM   8804  C  CA    . PRO B  1  420 ? 63.009  20.129 -5.650  1.00 24.51  ? 1219 PRO D CA    1 
ATOM   8805  C  C     . PRO B  1  420 ? 62.628  19.061 -6.670  1.00 26.30  ? 1219 PRO D C     1 
ATOM   8806  O  O     . PRO B  1  420 ? 62.051  18.043 -6.306  1.00 25.73  ? 1219 PRO D O     1 
ATOM   8807  C  CB    . PRO B  1  420 ? 61.885  21.170 -5.526  1.00 23.44  ? 1219 PRO D CB    1 
ATOM   8808  C  CG    . PRO B  1  420 ? 62.322  22.305 -6.322  1.00 24.13  ? 1219 PRO D CG    1 
ATOM   8809  C  CD    . PRO B  1  420 ? 63.850  22.335 -6.174  1.00 23.69  ? 1219 PRO D CD    1 
ATOM   8810  N  N     . THR B  1  421 ? 62.962  19.285 -7.929  1.00 25.68  ? 1220 THR D N     1 
ATOM   8811  C  CA    . THR B  1  421 ? 62.656  18.340 -9.002  1.00 27.68  ? 1220 THR D CA    1 
ATOM   8812  C  C     . THR B  1  421 ? 63.768  17.319 -9.208  1.00 27.53  ? 1220 THR D C     1 
ATOM   8813  O  O     . THR B  1  421 ? 63.690  16.536 -10.180 1.00 28.57  ? 1220 THR D O     1 
ATOM   8814  C  CB    . THR B  1  421 ? 62.495  19.155 -10.329 1.00 27.90  ? 1220 THR D CB    1 
ATOM   8815  O  OG1   . THR B  1  421 ? 63.498  20.169 -10.406 1.00 28.13  ? 1220 THR D OG1   1 
ATOM   8816  C  CG2   . THR B  1  421 ? 61.189  19.880 -10.385 1.00 30.56  ? 1220 THR D CG2   1 
ATOM   8817  N  N     . ALA B  1  422 ? 64.750  17.260 -8.302  1.00 27.15  ? 1221 ALA D N     1 
ATOM   8818  C  CA    . ALA B  1  422 ? 65.826  16.263 -8.334  1.00 25.90  ? 1221 ALA D CA    1 
ATOM   8819  C  C     . ALA B  1  422 ? 66.642  16.440 -9.592  1.00 26.58  ? 1221 ALA D C     1 
ATOM   8820  O  O     . ALA B  1  422 ? 67.212  17.535 -9.766  1.00 26.47  ? 1221 ALA D O     1 
ATOM   8821  C  CB    . ALA B  1  422 ? 65.193  14.859 -8.115  1.00 26.47  ? 1221 ALA D CB    1 
ATOM   8822  N  N     . GLY B  1  423 ? 66.759  15.431 -10.465 1.00 27.52  ? 1222 GLY D N     1 
ATOM   8823  C  CA    . GLY B  1  423 ? 67.557  15.496 -11.676 1.00 29.15  ? 1222 GLY D CA    1 
ATOM   8824  C  C     . GLY B  1  423 ? 69.042  15.423 -11.430 1.00 30.82  ? 1222 GLY D C     1 
ATOM   8825  O  O     . GLY B  1  423 ? 69.509  15.034 -10.366 1.00 32.83  ? 1222 GLY D O     1 
ATOM   8826  N  N     . LEU B  1  424 ? 69.796  15.795 -12.470 1.00 31.02  ? 1223 LEU D N     1 
ATOM   8827  C  CA    . LEU B  1  424 ? 71.255  15.627 -12.500 1.00 31.08  ? 1223 LEU D CA    1 
ATOM   8828  C  C     . LEU B  1  424 ? 71.872  16.999 -12.757 1.00 29.78  ? 1223 LEU D C     1 
ATOM   8829  O  O     . LEU B  1  424 ? 71.297  17.863 -13.437 1.00 29.45  ? 1223 LEU D O     1 
ATOM   8830  C  CB    . LEU B  1  424 ? 71.674  14.650 -13.631 1.00 32.15  ? 1223 LEU D CB    1 
ATOM   8831  C  CG    . LEU B  1  424 ? 71.671  13.146 -13.402 1.00 34.69  ? 1223 LEU D CG    1 
ATOM   8832  C  CD1   . LEU B  1  424 ? 70.359  12.589 -12.892 1.00 35.25  ? 1223 LEU D CD1   1 
ATOM   8833  C  CD2   . LEU B  1  424 ? 72.049  12.455 -14.754 1.00 34.14  ? 1223 LEU D CD2   1 
ATOM   8834  N  N     . ILE B  1  425 ? 73.072  17.189 -12.202 1.00 29.89  ? 1224 ILE D N     1 
ATOM   8835  C  CA    . ILE B  1  425 ? 73.944  18.325 -12.533 1.00 29.04  ? 1224 ILE D CA    1 
ATOM   8836  C  C     . ILE B  1  425 ? 75.212  17.761 -13.121 1.00 31.22  ? 1224 ILE D C     1 
ATOM   8837  O  O     . ILE B  1  425 ? 75.807  16.845 -12.538 1.00 31.83  ? 1224 ILE D O     1 
ATOM   8838  C  CB    . ILE B  1  425 ? 74.249  19.172 -11.305 1.00 27.60  ? 1224 ILE D CB    1 
ATOM   8839  C  CG1   . ILE B  1  425 ? 72.963  19.948 -10.858 1.00 26.96  ? 1224 ILE D CG1   1 
ATOM   8840  C  CG2   . ILE B  1  425 ? 75.355  20.170 -11.585 1.00 30.00  ? 1224 ILE D CG2   1 
ATOM   8841  C  CD1   . ILE B  1  425 ? 73.214  20.822 -9.646  1.00 25.12  ? 1224 ILE D CD1   1 
ATOM   8842  N  N     . LEU B  1  426 ? 75.633  18.299 -14.266 1.00 32.21  ? 1225 LEU D N     1 
ATOM   8843  C  CA    . LEU B  1  426 ? 76.821  17.798 -14.999 1.00 33.50  ? 1225 LEU D CA    1 
ATOM   8844  C  C     . LEU B  1  426 ? 78.083  18.548 -14.537 1.00 33.08  ? 1225 LEU D C     1 
ATOM   8845  O  O     . LEU B  1  426 ? 78.314  19.659 -14.926 1.00 35.50  ? 1225 LEU D O     1 
ATOM   8846  C  CB    . LEU B  1  426 ? 76.586  17.984 -16.495 1.00 34.58  ? 1225 LEU D CB    1 
ATOM   8847  C  CG    . LEU B  1  426 ? 75.338  17.312 -17.069 1.00 34.80  ? 1225 LEU D CG    1 
ATOM   8848  C  CD1   . LEU B  1  426 ? 75.234  17.588 -18.575 1.00 37.07  ? 1225 LEU D CD1   1 
ATOM   8849  C  CD2   . LEU B  1  426 ? 75.335  15.775 -16.786 1.00 35.62  ? 1225 LEU D CD2   1 
ATOM   8850  N  N     . GLY B  1  427 ? 78.841  17.930 -13.680 1.00 34.10  ? 1226 GLY D N     1 
ATOM   8851  C  CA    . GLY B  1  427 ? 80.119  18.426 -13.205 1.00 34.67  ? 1226 GLY D CA    1 
ATOM   8852  C  C     . GLY B  1  427 ? 80.034  19.422 -12.116 1.00 33.57  ? 1226 GLY D C     1 
ATOM   8853  O  O     . GLY B  1  427 ? 78.942  19.880 -11.728 1.00 32.89  ? 1226 GLY D O     1 
ATOM   8854  N  N     . LYS B  1  428 ? 81.173  19.796 -11.564 1.00 33.38  ? 1227 LYS D N     1 
ATOM   8855  C  CA    . LYS B  1  428 ? 81.275  20.796 -10.493 1.00 35.40  ? 1227 LYS D CA    1 
ATOM   8856  C  C     . LYS B  1  428 ? 81.821  22.131 -10.984 1.00 32.86  ? 1227 LYS D C     1 
ATOM   8857  O  O     . LYS B  1  428 ? 81.933  23.040 -10.164 1.00 29.63  ? 1227 LYS D O     1 
ATOM   8858  C  CB    . LYS B  1  428 ? 82.177  20.274 -9.384  1.00 38.93  ? 1227 LYS D CB    1 
ATOM   8859  C  CG    . LYS B  1  428 ? 81.528  19.295 -8.440  1.00 50.03  ? 1227 LYS D CG    1 
ATOM   8860  C  CD    . LYS B  1  428 ? 81.719  19.724 -6.999  1.00 57.22  ? 1227 LYS D CD    1 
ATOM   8861  C  CE    . LYS B  1  428 ? 80.901  18.882 -6.026  1.00 63.12  ? 1227 LYS D CE    1 
ATOM   8862  N  NZ    . LYS B  1  428 ? 81.082  19.432 -4.616  1.00 60.56  ? 1227 LYS D NZ    1 
ATOM   8863  N  N     . SER B  1  429 ? 82.182  22.274 -12.267 1.00 31.67  ? 1228 SER D N     1 
ATOM   8864  C  CA    . SER B  1  429 ? 82.890  23.452 -12.674 1.00 31.25  ? 1228 SER D CA    1 
ATOM   8865  C  C     . SER B  1  429 ? 82.026  24.706 -12.668 1.00 30.38  ? 1228 SER D C     1 
ATOM   8866  O  O     . SER B  1  429 ? 82.491  25.813 -12.377 1.00 28.78  ? 1228 SER D O     1 
ATOM   8867  C  CB    . SER B  1  429 ? 83.573  23.261 -14.039 1.00 33.35  ? 1228 SER D CB    1 
ATOM   8868  O  OG    . SER B  1  429 ? 82.555  23.473 -15.065 1.00 36.39  ? 1228 SER D OG    1 
ATOM   8869  N  N     . GLY B  1  430 ? 80.759  24.565 -13.021 1.00 30.58  ? 1229 GLY D N     1 
ATOM   8870  C  CA    . GLY B  1  430 ? 79.859  25.732 -12.973 1.00 29.00  ? 1229 GLY D CA    1 
ATOM   8871  C  C     . GLY B  1  430 ? 79.415  26.000 -11.542 1.00 26.16  ? 1229 GLY D C     1 
ATOM   8872  O  O     . GLY B  1  430 ? 79.289  27.168 -11.174 1.00 25.88  ? 1229 GLY D O     1 
ATOM   8873  N  N     . ILE B  1  431 ? 79.207  24.975 -10.744 1.00 25.52  ? 1230 ILE D N     1 
ATOM   8874  C  CA    . ILE B  1  431 ? 78.892  25.155 -9.338  1.00 24.39  ? 1230 ILE D CA    1 
ATOM   8875  C  C     . ILE B  1  431 ? 80.022  25.935 -8.644  1.00 24.38  ? 1230 ILE D C     1 
ATOM   8876  O  O     . ILE B  1  431 ? 79.777  26.874 -7.889  1.00 23.59  ? 1230 ILE D O     1 
ATOM   8877  C  CB    . ILE B  1  431 ? 78.718  23.765 -8.636  1.00 24.48  ? 1230 ILE D CB    1 
ATOM   8878  C  CG1   . ILE B  1  431 ? 77.492  23.072 -9.197  1.00 24.93  ? 1230 ILE D CG1   1 
ATOM   8879  C  CG2   . ILE B  1  431 ? 78.575  23.940 -7.144  1.00 23.28  ? 1230 ILE D CG2   1 
ATOM   8880  C  CD1   . ILE B  1  431 ? 77.387  21.606 -8.753  1.00 25.61  ? 1230 ILE D CD1   1 
ATOM   8881  N  N     . ARG B  1  432 ? 81.267  25.539 -8.886  1.00 25.25  ? 1231 ARG D N     1 
ATOM   8882  C  CA    . ARG B  1  432 ? 82.388  26.137 -8.180  1.00 26.28  ? 1231 ARG D CA    1 
ATOM   8883  C  C     . ARG B  1  432 ? 82.594  27.626 -8.574  1.00 26.61  ? 1231 ARG D C     1 
ATOM   8884  O  O     . ARG B  1  432 ? 82.844  28.461 -7.698  1.00 27.59  ? 1231 ARG D O     1 
ATOM   8885  C  CB    . ARG B  1  432 ? 83.653  25.336 -8.484  1.00 27.51  ? 1231 ARG D CB    1 
ATOM   8886  C  CG    . ARG B  1  432 ? 84.855  25.780 -7.629  1.00 27.56  ? 1231 ARG D CG    1 
ATOM   8887  C  CD    . ARG B  1  432 ? 85.851  24.634 -7.592  1.00 30.36  ? 1231 ARG D CD    1 
ATOM   8888  N  NE    . ARG B  1  432 ? 86.966  24.963 -6.709  1.00 31.95  ? 1231 ARG D NE    1 
ATOM   8889  C  CZ    . ARG B  1  432 ? 87.975  24.119 -6.479  1.00 34.09  ? 1231 ARG D CZ    1 
ATOM   8890  N  NH1   . ARG B  1  432 ? 87.883  22.943 -7.130  1.00 35.46  ? 1231 ARG D NH1   1 
ATOM   8891  N  NH2   . ARG B  1  432 ? 89.021  24.549 -5.771  1.00 30.82  ? 1231 ARG D NH2   1 
ATOM   8892  N  N     A ARG B  1  433 ? 82.453  27.924 -9.872  0.50 28.03  ? 1232 ARG D N     1 
ATOM   8893  N  N     B ARG B  1  433 ? 82.434  27.938 -9.866  0.50 28.05  ? 1232 ARG D N     1 
ATOM   8894  C  CA    A ARG B  1  433 ? 82.516  29.311 -10.312 0.50 28.59  ? 1232 ARG D CA    1 
ATOM   8895  C  CA    B ARG B  1  433 ? 82.535  29.332 -10.283 0.50 28.55  ? 1232 ARG D CA    1 
ATOM   8896  C  C     A ARG B  1  433 ? 81.410  30.167 -9.650  0.50 28.08  ? 1232 ARG D C     1 
ATOM   8897  C  C     B ARG B  1  433 ? 81.398  30.196 -9.687  0.50 28.15  ? 1232 ARG D C     1 
ATOM   8898  O  O     A ARG B  1  433 ? 81.663  31.271 -9.149  0.50 27.70  ? 1232 ARG D O     1 
ATOM   8899  O  O     B ARG B  1  433 ? 81.622  31.337 -9.263  0.50 28.02  ? 1232 ARG D O     1 
ATOM   8900  C  CB    A ARG B  1  433 ? 82.390  29.389 -11.846 0.50 31.30  ? 1232 ARG D CB    1 
ATOM   8901  C  CB    B ARG B  1  433 ? 82.538  29.432 -11.813 0.50 31.20  ? 1232 ARG D CB    1 
ATOM   8902  C  CG    A ARG B  1  433 ? 83.628  28.936 -12.650 0.50 34.19  ? 1232 ARG D CG    1 
ATOM   8903  C  CG    B ARG B  1  433 ? 83.971  28.971 -12.272 0.50 33.04  ? 1232 ARG D CG    1 
ATOM   8904  C  CD    A ARG B  1  433 ? 83.463  29.138 -14.190 0.50 34.93  ? 1232 ARG D CD    1 
ATOM   8905  C  CD    B ARG B  1  433 ? 84.022  28.977 -13.801 0.50 35.23  ? 1232 ARG D CD    1 
ATOM   8906  N  NE    A ARG B  1  433 ? 82.657  30.325 -14.415 0.50 35.41  ? 1232 ARG D NE    1 
ATOM   8907  N  NE    B ARG B  1  433 ? 85.288  28.672 -14.415 0.50 35.35  ? 1232 ARG D NE    1 
ATOM   8908  C  CZ    A ARG B  1  433 ? 82.722  31.193 -15.426 0.50 37.53  ? 1232 ARG D CZ    1 
ATOM   8909  C  CZ    B ARG B  1  433 ? 86.006  29.643 -14.958 0.50 38.35  ? 1232 ARG D CZ    1 
ATOM   8910  N  NH1   A ARG B  1  433 ? 81.880  32.223 -15.370 0.50 35.89  ? 1232 ARG D NH1   1 
ATOM   8911  N  NH1   B ARG B  1  433 ? 85.570  30.894 -14.859 0.50 37.75  ? 1232 ARG D NH1   1 
ATOM   8912  N  NH2   A ARG B  1  433 ? 83.592  31.066 -16.470 0.50 37.69  ? 1232 ARG D NH2   1 
ATOM   8913  N  NH2   B ARG B  1  433 ? 87.119  29.373 -15.641 0.50 39.93  ? 1232 ARG D NH2   1 
ATOM   8914  N  N     . ALA B  1  434 ? 80.194  29.661 -9.675  1.00 27.60  ? 1233 ALA D N     1 
ATOM   8915  C  CA    . ALA B  1  434 ? 79.086  30.372 -9.050  1.00 26.19  ? 1233 ALA D CA    1 
ATOM   8916  C  C     . ALA B  1  434 ? 79.335  30.613 -7.560  1.00 25.37  ? 1233 ALA D C     1 
ATOM   8917  O  O     . ALA B  1  434 ? 79.092  31.717 -7.055  1.00 26.98  ? 1233 ALA D O     1 
ATOM   8918  C  CB    . ALA B  1  434 ? 77.775  29.601 -9.236  1.00 24.66  ? 1233 ALA D CB    1 
ATOM   8919  N  N     . TYR B  1  435 ? 79.840  29.610 -6.853  1.00 24.74  ? 1234 TYR D N     1 
ATOM   8920  C  CA    . TYR B  1  435 ? 80.068  29.777 -5.427  1.00 26.56  ? 1234 TYR D CA    1 
ATOM   8921  C  C     . TYR B  1  435 ? 81.227  30.712 -5.135  1.00 26.82  ? 1234 TYR D C     1 
ATOM   8922  O  O     . TYR B  1  435 ? 81.205  31.432 -4.132  1.00 25.84  ? 1234 TYR D O     1 
ATOM   8923  C  CB    . TYR B  1  435 ? 80.321  28.400 -4.751  1.00 24.70  ? 1234 TYR D CB    1 
ATOM   8924  C  CG    . TYR B  1  435 ? 79.091  27.558 -4.620  1.00 24.23  ? 1234 TYR D CG    1 
ATOM   8925  C  CD1   . TYR B  1  435 ? 77.822  28.092 -4.894  1.00 24.70  ? 1234 TYR D CD1   1 
ATOM   8926  C  CD2   . TYR B  1  435 ? 79.184  26.246 -4.212  1.00 24.30  ? 1234 TYR D CD2   1 
ATOM   8927  C  CE1   . TYR B  1  435 ? 76.665  27.338 -4.764  1.00 23.15  ? 1234 TYR D CE1   1 
ATOM   8928  C  CE2   . TYR B  1  435 ? 78.034  25.450 -4.052  1.00 24.37  ? 1234 TYR D CE2   1 
ATOM   8929  C  CZ    . TYR B  1  435 ? 76.783  26.018 -4.334  1.00 24.09  ? 1234 TYR D CZ    1 
ATOM   8930  O  OH    . TYR B  1  435 ? 75.662  25.248 -4.188  1.00 24.34  ? 1234 TYR D OH    1 
ATOM   8931  N  N     . GLU B  1  436 ? 82.259  30.703 -5.984  1.00 29.87  ? 1235 GLU D N     1 
ATOM   8932  C  CA    . GLU B  1  436 ? 83.398  31.589 -5.732  1.00 29.98  ? 1235 GLU D CA    1 
ATOM   8933  C  C     . GLU B  1  436 ? 83.108  33.033 -6.083  1.00 29.50  ? 1235 GLU D C     1 
ATOM   8934  O  O     . GLU B  1  436 ? 83.613  33.916 -5.425  1.00 30.30  ? 1235 GLU D O     1 
ATOM   8935  C  CB    . GLU B  1  436 ? 84.615  31.103 -6.534  1.00 31.86  ? 1235 GLU D CB    1 
ATOM   8936  C  CG    . GLU B  1  436 ? 85.327  29.922 -5.927  1.00 35.97  ? 1235 GLU D CG    1 
ATOM   8937  C  CD    . GLU B  1  436 ? 86.283  30.301 -4.826  1.00 36.47  ? 1235 GLU D CD    1 
ATOM   8938  O  OE1   . GLU B  1  436 ? 86.561  31.470 -4.618  1.00 40.28  ? 1235 GLU D OE1   1 
ATOM   8939  O  OE2   . GLU B  1  436 ? 86.784  29.400 -4.127  1.00 38.83  ? 1235 GLU D OE2   1 
ATOM   8940  N  N     . THR B  1  437 ? 82.284  33.279 -7.110  1.00 30.43  ? 1236 THR D N     1 
ATOM   8941  C  CA    . THR B  1  437 ? 82.112  34.612 -7.662  1.00 30.98  ? 1236 THR D CA    1 
ATOM   8942  C  C     . THR B  1  437 ? 80.675  35.123 -7.583  1.00 31.35  ? 1236 THR D C     1 
ATOM   8943  O  O     . THR B  1  437 ? 80.485  36.353 -7.788  1.00 32.41  ? 1236 THR D O     1 
ATOM   8944  C  CB    . THR B  1  437 ? 82.522  34.650 -9.127  1.00 31.79  ? 1236 THR D CB    1 
ATOM   8945  O  OG1   . THR B  1  437 ? 81.683  33.768 -9.895  1.00 30.00  ? 1236 THR D OG1   1 
ATOM   8946  C  CG2   . THR B  1  437 ? 83.996  34.204 -9.280  1.00 34.37  ? 1236 THR D CG2   1 
ATOM   8947  N  N     . GLY B  1  438 ? 79.695  34.246 -7.361  1.00 29.04  ? 1237 GLY D N     1 
ATOM   8948  C  CA    . GLY B  1  438 ? 78.306  34.647 -7.480  1.00 28.00  ? 1237 GLY D CA    1 
ATOM   8949  C  C     . GLY B  1  438 ? 77.700  34.410 -8.858  1.00 27.00  ? 1237 GLY D C     1 
ATOM   8950  O  O     . GLY B  1  438 ? 76.475  34.502 -8.992  1.00 25.86  ? 1237 GLY D O     1 
ATOM   8951  N  N     . ARG B  1  439 ? 78.496  34.094 -9.855  1.00 27.58  ? 1238 ARG D N     1 
ATOM   8952  C  CA    . ARG B  1  439 ? 78.024  33.890 -11.218 1.00 31.48  ? 1238 ARG D CA    1 
ATOM   8953  C  C     . ARG B  1  439 ? 78.663  32.631 -11.820 1.00 31.89  ? 1238 ARG D C     1 
ATOM   8954  O  O     . ARG B  1  439 ? 79.847  32.347 -11.601 1.00 31.39  ? 1238 ARG D O     1 
ATOM   8955  C  CB    . ARG B  1  439 ? 78.381  35.083 -12.121 1.00 33.46  ? 1238 ARG D CB    1 
ATOM   8956  C  CG    . ARG B  1  439 ? 77.578  36.336 -11.776 1.00 36.32  ? 1238 ARG D CG    1 
ATOM   8957  C  CD    . ARG B  1  439 ? 78.001  37.507 -12.641 1.00 36.73  ? 1238 ARG D CD    1 
ATOM   8958  N  NE    . ARG B  1  439 ? 78.026  37.226 -14.047 1.00 40.28  ? 1238 ARG D NE    1 
ATOM   8959  C  CZ    . ARG B  1  439 ? 76.963  37.076 -14.829 1.00 42.67  ? 1238 ARG D CZ    1 
ATOM   8960  N  NH1   . ARG B  1  439 ? 75.704  37.238 -14.333 1.00 39.07  ? 1238 ARG D NH1   1 
ATOM   8961  N  NH2   . ARG B  1  439 ? 77.192  36.781 -16.144 1.00 39.85  ? 1238 ARG D NH2   1 
ATOM   8962  N  N     . GLY B  1  440 ? 77.863  31.877 -12.566 1.00 34.00  ? 1239 GLY D N     1 
ATOM   8963  C  CA    . GLY B  1  440 ? 78.280  30.631 -13.125 1.00 34.66  ? 1239 GLY D CA    1 
ATOM   8964  C  C     . GLY B  1  440 ? 77.149  29.865 -13.783 1.00 35.04  ? 1239 GLY D C     1 
ATOM   8965  O  O     . GLY B  1  440 ? 75.997  30.000 -13.401 1.00 31.19  ? 1239 GLY D O     1 
ATOM   8966  N  N     . SER B  1  441 ? 77.481  29.090 -14.846 1.00 34.23  ? 1240 SER D N     1 
ATOM   8967  C  CA    . SER B  1  441 ? 76.462  28.341 -15.534 1.00 32.35  ? 1240 SER D CA    1 
ATOM   8968  C  C     . SER B  1  441 ? 76.465  26.910 -15.095 1.00 30.82  ? 1240 SER D C     1 
ATOM   8969  O  O     . SER B  1  441 ? 77.490  26.275 -15.061 1.00 33.48  ? 1240 SER D O     1 
ATOM   8970  C  CB    . SER B  1  441 ? 76.709  28.451 -17.040 1.00 34.56  ? 1240 SER D CB    1 
ATOM   8971  O  OG    . SER B  1  441 ? 75.819  27.625 -17.778 1.00 39.01  ? 1240 SER D OG    1 
ATOM   8972  N  N     . ILE B  1  442 ? 75.275  26.417 -14.754 1.00 28.85  ? 1241 ILE D N     1 
ATOM   8973  C  CA    . ILE B  1  442 ? 75.137  25.047 -14.231 1.00 28.28  ? 1241 ILE D CA    1 
ATOM   8974  C  C     . ILE B  1  442 ? 74.201  24.275 -15.234 1.00 29.19  ? 1241 ILE D C     1 
ATOM   8975  O  O     . ILE B  1  442 ? 73.086  24.696 -15.518 1.00 28.21  ? 1241 ILE D O     1 
ATOM   8976  C  CB    . ILE B  1  442 ? 74.531  25.052 -12.851 1.00 27.75  ? 1241 ILE D CB    1 
ATOM   8977  C  CG1   . ILE B  1  442 ? 75.541  25.604 -11.862 1.00 28.07  ? 1241 ILE D CG1   1 
ATOM   8978  C  CG2   . ILE B  1  442 ? 74.096  23.653 -12.444 1.00 29.42  ? 1241 ILE D CG2   1 
ATOM   8979  C  CD1   . ILE B  1  442 ? 74.934  25.748 -10.399 1.00 26.43  ? 1241 ILE D CD1   1 
ATOM   8980  N  N     . GLN B  1  443 ? 74.682  23.144 -15.704 1.00 29.59  ? 1242 GLN D N     1 
ATOM   8981  C  CA    . GLN B  1  443 ? 73.936  22.313 -16.613 1.00 31.69  ? 1242 GLN D CA    1 
ATOM   8982  C  C     . GLN B  1  443 ? 73.087  21.307 -15.852 1.00 30.73  ? 1242 GLN D C     1 
ATOM   8983  O  O     . GLN B  1  443 ? 73.585  20.532 -15.057 1.00 30.39  ? 1242 GLN D O     1 
ATOM   8984  C  CB    . GLN B  1  443 ? 74.847  21.558 -17.584 1.00 33.31  ? 1242 GLN D CB    1 
ATOM   8985  C  CG    . GLN B  1  443 ? 75.628  22.462 -18.529 1.00 37.32  ? 1242 GLN D CG    1 
ATOM   8986  C  CD    . GLN B  1  443 ? 74.750  23.199 -19.496 1.00 42.57  ? 1242 GLN D CD    1 
ATOM   8987  O  OE1   . GLN B  1  443 ? 73.861  22.612 -20.114 1.00 43.24  ? 1242 GLN D OE1   1 
ATOM   8988  N  NE2   . GLN B  1  443 ? 74.967  24.482 -19.644 1.00 45.08  ? 1242 GLN D NE2   1 
ATOM   8989  N  N     . MET B  1  444 ? 71.772  21.350 -16.077 1.00 30.94  ? 1243 MET D N     1 
ATOM   8990  C  CA    . MET B  1  444 ? 70.859  20.465 -15.458 1.00 29.75  ? 1243 MET D CA    1 
ATOM   8991  C  C     . MET B  1  444 ? 70.391  19.441 -16.485 1.00 32.29  ? 1243 MET D C     1 
ATOM   8992  O  O     . MET B  1  444 ? 69.962  19.812 -17.570 1.00 35.10  ? 1243 MET D O     1 
ATOM   8993  C  CB    . MET B  1  444 ? 69.632  21.237 -14.966 1.00 30.16  ? 1243 MET D CB    1 
ATOM   8994  C  CG    . MET B  1  444 ? 69.914  22.334 -13.962 1.00 31.02  ? 1243 MET D CG    1 
ATOM   8995  S  SD    . MET B  1  444 ? 68.435  23.154 -13.380 1.00 32.92  ? 1243 MET D SD    1 
ATOM   8996  C  CE    . MET B  1  444 ? 67.804  23.878 -14.876 1.00 30.37  ? 1243 MET D CE    1 
ATOM   8997  N  N     . ARG B  1  445 ? 70.471  18.166 -16.143 1.00 30.86  ? 1244 ARG D N     1 
ATOM   8998  C  CA    . ARG B  1  445 ? 70.017  17.121 -17.053 1.00 31.91  ? 1244 ARG D CA    1 
ATOM   8999  C  C     . ARG B  1  445 ? 68.956  16.277 -16.423 1.00 31.18  ? 1244 ARG D C     1 
ATOM   9000  O  O     . ARG B  1  445 ? 69.031  15.956 -15.228 1.00 30.14  ? 1244 ARG D O     1 
ATOM   9001  C  CB    . ARG B  1  445 ? 71.222  16.219 -17.499 1.00 32.24  ? 1244 ARG D CB    1 
ATOM   9002  C  CG    . ARG B  1  445 ? 70.779  15.122 -18.492 1.00 34.10  ? 1244 ARG D CG    1 
ATOM   9003  C  CD    . ARG B  1  445 ? 71.972  14.340 -18.977 1.00 34.46  ? 1244 ARG D CD    1 
ATOM   9004  N  NE    . ARG B  1  445 ? 72.744  15.092 -19.944 1.00 35.36  ? 1244 ARG D NE    1 
ATOM   9005  C  CZ    . ARG B  1  445 ? 73.946  14.671 -20.413 1.00 37.40  ? 1244 ARG D CZ    1 
ATOM   9006  N  NH1   . ARG B  1  445 ? 74.492  13.540 -19.986 1.00 35.46  ? 1244 ARG D NH1   1 
ATOM   9007  N  NH2   . ARG B  1  445 ? 74.587  15.415 -21.312 1.00 35.68  ? 1244 ARG D NH2   1 
ATOM   9008  N  N     . SER B  1  446 ? 67.953  15.909 -17.218 1.00 31.51  ? 1245 SER D N     1 
ATOM   9009  C  CA    . SER B  1  446 ? 66.912  14.987 -16.789 1.00 31.07  ? 1245 SER D CA    1 
ATOM   9010  C  C     . SER B  1  446 ? 67.531  13.636 -16.436 1.00 31.76  ? 1245 SER D C     1 
ATOM   9011  O  O     . SER B  1  446 ? 68.590  13.246 -16.939 1.00 31.43  ? 1245 SER D O     1 
ATOM   9012  C  CB    . SER B  1  446 ? 65.879  14.808 -17.888 1.00 35.03  ? 1245 SER D CB    1 
ATOM   9013  O  OG    . SER B  1  446 ? 65.215  16.021 -18.174 1.00 32.40  ? 1245 SER D OG    1 
ATOM   9014  N  N     . ARG B  1  447 ? 66.842  12.903 -15.547 1.00 32.95  ? 1246 ARG D N     1 
ATOM   9015  C  CA    . ARG B  1  447 ? 67.165  11.511 -15.310 1.00 33.03  ? 1246 ARG D CA    1 
ATOM   9016  C  C     . ARG B  1  447 ? 66.404  10.680 -16.345 1.00 33.92  ? 1246 ARG D C     1 
ATOM   9017  O  O     . ARG B  1  447 ? 65.176  10.666 -16.368 1.00 35.02  ? 1246 ARG D O     1 
ATOM   9018  C  CB    . ARG B  1  447 ? 66.799  11.082 -13.897 1.00 34.04  ? 1246 ARG D CB    1 
ATOM   9019  C  CG    . ARG B  1  447 ? 67.299  9.644  -13.563 1.00 36.96  ? 1246 ARG D CG    1 
ATOM   9020  C  CD    . ARG B  1  447 ? 67.162  9.359  -12.049 1.00 37.69  ? 1246 ARG D CD    1 
ATOM   9021  N  NE    . ARG B  1  447 ? 68.065  10.155 -11.227 1.00 38.03  ? 1246 ARG D NE    1 
ATOM   9022  C  CZ    . ARG B  1  447 ? 69.328  9.814  -10.967 1.00 38.32  ? 1246 ARG D CZ    1 
ATOM   9023  N  NH1   . ARG B  1  447 ? 69.825  8.674  -11.438 1.00 39.58  ? 1246 ARG D NH1   1 
ATOM   9024  N  NH2   . ARG B  1  447 ? 70.110  10.569 -10.213 1.00 34.87  ? 1246 ARG D NH2   1 
ATOM   9025  N  N     . ALA B  1  448 ? 67.130  10.002 -17.224 1.00 35.79  ? 1247 ALA D N     1 
ATOM   9026  C  CA    . ALA B  1  448 ? 66.570  9.188  -18.272 1.00 36.83  ? 1247 ALA D CA    1 
ATOM   9027  C  C     . ALA B  1  448 ? 67.308  7.857  -18.320 1.00 39.41  ? 1247 ALA D C     1 
ATOM   9028  O  O     . ALA B  1  448 ? 68.516  7.807  -18.172 1.00 39.52  ? 1247 ALA D O     1 
ATOM   9029  C  CB    . ALA B  1  448 ? 66.652  9.888  -19.634 1.00 37.09  ? 1247 ALA D CB    1 
ATOM   9030  N  N     . VAL B  1  449 ? 66.547  6.755  -18.512 1.00 41.25  ? 1248 VAL D N     1 
ATOM   9031  C  CA    . VAL B  1  449 ? 67.109  5.446  -18.721 1.00 43.85  ? 1248 VAL D CA    1 
ATOM   9032  C  C     . VAL B  1  449 ? 66.585  4.827  -19.995 1.00 43.88  ? 1248 VAL D C     1 
ATOM   9033  O  O     . VAL B  1  449 ? 65.491  5.142  -20.457 1.00 44.37  ? 1248 VAL D O     1 
ATOM   9034  C  CB    . VAL B  1  449 ? 66.792  4.531  -17.522 1.00 43.16  ? 1248 VAL D CB    1 
ATOM   9035  C  CG1   . VAL B  1  449 ? 67.594  5.018  -16.280 1.00 41.28  ? 1248 VAL D CG1   1 
ATOM   9036  C  CG2   . VAL B  1  449 ? 65.310  4.396  -17.339 1.00 45.88  ? 1248 VAL D CG2   1 
ATOM   9037  N  N     . ILE B  1  450 ? 67.377  3.946  -20.578 1.00 47.30  ? 1249 ILE D N     1 
ATOM   9038  C  CA    . ILE B  1  450 ? 67.016  3.231  -21.778 1.00 50.31  ? 1249 ILE D CA    1 
ATOM   9039  C  C     . ILE B  1  450 ? 66.608  1.807  -21.348 1.00 53.13  ? 1249 ILE D C     1 
ATOM   9040  O  O     . ILE B  1  450 ? 67.377  1.109  -20.729 1.00 56.11  ? 1249 ILE D O     1 
ATOM   9041  C  CB    . ILE B  1  450 ? 68.194  3.208  -22.741 1.00 50.81  ? 1249 ILE D CB    1 
ATOM   9042  C  CG1   . ILE B  1  450 ? 68.399  4.597  -23.304 1.00 50.60  ? 1249 ILE D CG1   1 
ATOM   9043  C  CG2   . ILE B  1  450 ? 67.930  2.225  -23.892 1.00 51.02  ? 1249 ILE D CG2   1 
ATOM   9044  C  CD1   . ILE B  1  450 ? 69.752  4.826  -23.956 1.00 50.76  ? 1249 ILE D CD1   1 
ATOM   9045  N  N     . GLU B  1  451 ? 65.407  1.411  -21.712 1.00 57.10  ? 1250 GLU D N     1 
ATOM   9046  C  CA    . GLU B  1  451 ? 64.943  0.081  -21.372 1.00 61.12  ? 1250 GLU D CA    1 
ATOM   9047  C  C     . GLU B  1  451 ? 64.644  -0.787 -22.573 1.00 66.68  ? 1250 GLU D C     1 
ATOM   9048  O  O     . GLU B  1  451 ? 64.520  -0.304 -23.694 1.00 66.48  ? 1250 GLU D O     1 
ATOM   9049  C  CB    . GLU B  1  451 ? 63.634  0.172  -20.601 1.00 58.71  ? 1250 GLU D CB    1 
ATOM   9050  C  CG    . GLU B  1  451 ? 63.771  0.596  -19.140 1.00 58.66  ? 1250 GLU D CG    1 
ATOM   9051  C  CD    . GLU B  1  451 ? 62.425  0.937  -18.537 1.00 55.59  ? 1250 GLU D CD    1 
ATOM   9052  O  OE1   . GLU B  1  451 ? 62.441  1.329  -17.364 1.00 54.20  ? 1250 GLU D OE1   1 
ATOM   9053  O  OE2   . GLU B  1  451 ? 61.397  0.748  -19.226 1.00 55.34  ? 1250 GLU D OE2   1 
ATOM   9054  N  N     A GLU B  1  452 ? 64.502  -2.076 -22.310 0.70 71.40  ? 1251 GLU D N     1 
ATOM   9055  N  N     B GLU B  1  452 ? 64.623  -2.077 -22.303 0.30 66.01  ? 1251 GLU D N     1 
ATOM   9056  C  CA    A GLU B  1  452 ? 64.160  -3.050 -23.326 0.70 74.40  ? 1251 GLU D CA    1 
ATOM   9057  C  CA    B GLU B  1  452 ? 64.271  -3.063 -23.306 0.30 66.17  ? 1251 GLU D CA    1 
ATOM   9058  C  C     A GLU B  1  452 ? 62.680  -3.305 -23.206 0.70 75.38  ? 1251 GLU D C     1 
ATOM   9059  C  C     B GLU B  1  452 ? 62.765  -3.240 -23.395 0.30 65.24  ? 1251 GLU D C     1 
ATOM   9060  O  O     A GLU B  1  452 ? 62.212  -3.632 -22.132 0.70 70.49  ? 1251 GLU D O     1 
ATOM   9061  O  O     B GLU B  1  452 ? 62.075  -3.333 -22.375 0.30 62.34  ? 1251 GLU D O     1 
ATOM   9062  C  CB    A GLU B  1  452 ? 64.925  -4.346 -23.071 0.70 75.29  ? 1251 GLU D CB    1 
ATOM   9063  C  CB    B GLU B  1  452 ? 64.933  -4.405 -23.002 0.30 67.48  ? 1251 GLU D CB    1 
ATOM   9064  C  CG    A GLU B  1  452 ? 65.970  -4.665 -24.125 0.70 77.34  ? 1251 GLU D CG    1 
ATOM   9065  C  CG    B GLU B  1  452 ? 66.437  -4.331 -22.807 0.30 68.15  ? 1251 GLU D CG    1 
ATOM   9066  C  CD    A GLU B  1  452 ? 67.133  -3.689 -24.102 0.70 78.87  ? 1251 GLU D CD    1 
ATOM   9067  C  CD    B GLU B  1  452 ? 67.153  -3.620 -23.947 0.30 69.23  ? 1251 GLU D CD    1 
ATOM   9068  O  OE1   A GLU B  1  452 ? 67.294  -2.947 -23.094 0.70 77.40  ? 1251 GLU D OE1   1 
ATOM   9069  O  OE1   B GLU B  1  452 ? 66.889  -3.952 -25.128 0.30 70.49  ? 1251 GLU D OE1   1 
ATOM   9070  O  OE2   A GLU B  1  452 ? 67.884  -3.659 -25.093 0.70 78.86  ? 1251 GLU D OE2   1 
ATOM   9071  O  OE2   B GLU B  1  452 ? 67.993  -2.734 -23.657 0.30 68.32  ? 1251 GLU D OE2   1 
ATOM   9072  N  N     A ARG B  1  453 ? 61.943  -3.154 -24.300 0.70 78.35  ? 1252 ARG D N     1 
ATOM   9073  N  N     B ARG B  1  453 ? 62.266  -3.280 -24.622 0.30 64.77  ? 1252 ARG D N     1 
ATOM   9074  C  CA    A ARG B  1  453 ? 60.502  -3.395 -24.238 0.70 81.22  ? 1252 ARG D CA    1 
ATOM   9075  C  CA    B ARG B  1  453 ? 60.852  -3.494 -24.875 0.30 64.89  ? 1252 ARG D CA    1 
ATOM   9076  C  C     A ARG B  1  453 ? 60.024  -4.536 -25.118 0.70 82.93  ? 1252 ARG D C     1 
ATOM   9077  C  C     B ARG B  1  453 ? 60.594  -4.941 -25.317 0.30 66.84  ? 1252 ARG D C     1 
ATOM   9078  O  O     A ARG B  1  453 ? 58.842  -4.562 -25.476 0.70 84.52  ? 1252 ARG D O     1 
ATOM   9079  O  O     B ARG B  1  453 ? 60.770  -5.853 -24.516 0.30 66.70  ? 1252 ARG D O     1 
ATOM   9080  C  CB    A ARG B  1  453 ? 59.728  -2.102 -24.522 0.70 79.52  ? 1252 ARG D CB    1 
ATOM   9081  C  CB    B ARG B  1  453 ? 60.347  -2.481 -25.905 0.30 64.06  ? 1252 ARG D CB    1 
ATOM   9082  C  CG    A ARG B  1  453 ? 60.178  -1.365 -25.769 0.70 78.20  ? 1252 ARG D CG    1 
ATOM   9083  C  CG    B ARG B  1  453 ? 59.574  -1.315 -25.311 0.30 61.58  ? 1252 ARG D CG    1 
ATOM   9084  C  CD    A ARG B  1  453 ? 59.008  -0.707 -26.477 0.70 78.03  ? 1252 ARG D CD    1 
ATOM   9085  C  CD    B ARG B  1  453 ? 58.590  -0.749 -26.319 0.30 61.51  ? 1252 ARG D CD    1 
ATOM   9086  N  NE    A ARG B  1  453 ? 59.449  -0.026 -27.685 0.70 76.31  ? 1252 ARG D NE    1 
ATOM   9087  N  NE    B ARG B  1  453 ? 59.268  -0.133 -27.464 0.30 60.87  ? 1252 ARG D NE    1 
ATOM   9088  C  CZ    A ARG B  1  453 ? 58.692  0.149  -28.765 0.70 75.17  ? 1252 ARG D CZ    1 
ATOM   9089  C  CZ    B ARG B  1  453 ? 58.690  0.099  -28.643 0.30 60.76  ? 1252 ARG D CZ    1 
ATOM   9090  N  NH1   A ARG B  1  453 ? 57.445  -0.308 -28.777 0.70 71.54  ? 1252 ARG D NH1   1 
ATOM   9091  N  NH1   B ARG B  1  453 ? 57.423  -0.245 -28.831 0.30 59.91  ? 1252 ARG D NH1   1 
ATOM   9092  N  NH2   A ARG B  1  453 ? 59.181  0.782  -29.825 0.70 73.06  ? 1252 ARG D NH2   1 
ATOM   9093  N  NH2   B ARG B  1  453 ? 59.372  0.673  -29.625 0.30 60.21  ? 1252 ARG D NH2   1 
ATOM   9094  N  N     A GLY B  1  454 ? 60.925  -5.474 -25.418 0.70 81.99  ? 1253 GLY D N     1 
ATOM   9095  N  N     B GLY B  1  454 ? 60.189  -5.175 -26.570 0.30 67.78  ? 1253 GLY D N     1 
ATOM   9096  C  CA    A GLY B  1  454 ? 60.641  -6.615 -26.264 0.70 79.82  ? 1253 GLY D CA    1 
ATOM   9097  C  CA    B GLY B  1  454 ? 59.746  -6.581 -26.929 0.30 69.53  ? 1253 GLY D CA    1 
ATOM   9098  C  C     A GLY B  1  454 ? 60.263  -6.233 -27.683 0.70 79.85  ? 1253 GLY D C     1 
ATOM   9099  C  C     B GLY B  1  454 ? 60.710  -6.806 -28.043 0.30 70.83  ? 1253 GLY D C     1 
ATOM   9100  O  O     A GLY B  1  454 ? 59.542  -5.258 -27.891 0.70 74.46  ? 1253 GLY D O     1 
ATOM   9101  O  O     B GLY B  1  454 ? 61.849  -7.144 -27.734 0.30 70.85  ? 1253 GLY D O     1 
ATOM   9102  N  N     A GLY B  1  455 ? 60.727  -6.975 -28.677 0.70 83.09  ? 1254 GLY D N     1 
ATOM   9103  N  N     B GLY B  1  455 ? 60.257  -6.954 -29.287 0.30 71.27  ? 1254 GLY D N     1 
ATOM   9104  C  CA    A GLY B  1  455 ? 61.607  -8.125 -28.466 0.70 82.60  ? 1254 GLY D CA    1 
ATOM   9105  C  CA    B GLY B  1  455 ? 61.113  -7.584 -30.263 0.30 71.47  ? 1254 GLY D CA    1 
ATOM   9106  C  C     A GLY B  1  455 ? 62.999  -7.619 -28.669 0.70 81.01  ? 1254 GLY D C     1 
ATOM   9107  C  C     B GLY B  1  455 ? 62.409  -6.806 -30.485 0.30 71.16  ? 1254 GLY D C     1 
ATOM   9108  O  O     A GLY B  1  455 ? 63.911  -7.978 -27.935 0.70 78.09  ? 1254 GLY D O     1 
ATOM   9109  O  O     B GLY B  1  455 ? 62.745  -6.314 -31.582 0.30 69.75  ? 1254 GLY D O     1 
ATOM   9110  N  N     A GLY B  1  456 ? 63.153  -6.752 -29.675 0.70 82.35  ? 1255 GLY D N     1 
ATOM   9111  N  N     B GLY B  1  456 ? 63.200  -6.790 -29.418 0.30 72.93  ? 1255 GLY D N     1 
ATOM   9112  C  CA    A GLY B  1  456 ? 64.414  -6.105 -29.949 0.70 79.81  ? 1255 GLY D CA    1 
ATOM   9113  C  CA    B GLY B  1  456 ? 64.498  -6.142 -29.412 0.30 73.92  ? 1255 GLY D CA    1 
ATOM   9114  C  C     A GLY B  1  456 ? 64.272  -4.600 -29.732 0.70 78.27  ? 1255 GLY D C     1 
ATOM   9115  C  C     B GLY B  1  456 ? 64.315  -4.638 -29.495 0.30 74.26  ? 1255 GLY D C     1 
ATOM   9116  O  O     A GLY B  1  456 ? 65.208  -3.839 -29.961 0.70 74.97  ? 1255 GLY D O     1 
ATOM   9117  O  O     B GLY B  1  456 ? 65.278  -3.929 -29.823 0.30 72.91  ? 1255 GLY D O     1 
ATOM   9118  N  N     . ARG B  1  457 ? 63.072  -4.190 -29.339 1.00 74.90  ? 1256 ARG D N     1 
ATOM   9119  C  CA    . ARG B  1  457 ? 62.731  -2.782 -29.182 1.00 76.25  ? 1256 ARG D CA    1 
ATOM   9120  C  C     . ARG B  1  457 ? 63.239  -2.205 -27.874 1.00 74.09  ? 1256 ARG D C     1 
ATOM   9121  O  O     . ARG B  1  457 ? 63.389  -2.904 -26.878 1.00 76.65  ? 1256 ARG D O     1 
ATOM   9122  C  CB    . ARG B  1  457 ? 61.212  -2.588 -29.271 1.00 76.44  ? 1256 ARG D CB    1 
ATOM   9123  C  CG    . ARG B  1  457 ? 60.574  -3.121 -30.546 1.00 79.36  ? 1256 ARG D CG    1 
ATOM   9124  C  CD    . ARG B  1  457 ? 60.425  -2.048 -31.600 1.00 84.53  ? 1256 ARG D CD    1 
ATOM   9125  N  NE    . ARG B  1  457 ? 59.279  -2.253 -32.481 1.00 89.45  ? 1256 ARG D NE    1 
ATOM   9126  C  CZ    . ARG B  1  457 ? 58.959  -1.447 -33.499 1.00 87.75  ? 1256 ARG D CZ    1 
ATOM   9127  N  NH1   . ARG B  1  457 ? 57.883  -1.689 -34.232 1.00 89.66  ? 1256 ARG D NH1   1 
ATOM   9128  N  NH2   . ARG B  1  457 ? 59.700  -0.393 -33.781 1.00 83.63  ? 1256 ARG D NH2   1 
ATOM   9129  N  N     . GLN B  1  458 ? 63.490  -0.909 -27.910 1.00 70.04  ? 1257 GLN D N     1 
ATOM   9130  C  CA    . GLN B  1  458 ? 63.974  -0.146 -26.754 1.00 65.08  ? 1257 GLN D CA    1 
ATOM   9131  C  C     . GLN B  1  458 ? 63.144  1.095  -26.558 1.00 59.76  ? 1257 GLN D C     1 
ATOM   9132  O  O     . GLN B  1  458 ? 62.380  1.485  -27.444 1.00 57.83  ? 1257 GLN D O     1 
ATOM   9133  C  CB    . GLN B  1  458 ? 65.433  0.245  -26.957 1.00 65.15  ? 1257 GLN D CB    1 
ATOM   9134  C  CG    . GLN B  1  458 ? 66.443  -0.763 -26.417 1.00 65.43  ? 1257 GLN D CG    1 
ATOM   9135  C  CD    . GLN B  1  458 ? 67.879  -0.325 -26.635 1.00 62.21  ? 1257 GLN D CD    1 
ATOM   9136  O  OE1   . GLN B  1  458 ? 68.207  0.358  -27.594 1.00 64.73  ? 1257 GLN D OE1   1 
ATOM   9137  N  NE2   . GLN B  1  458 ? 68.749  -0.728 -25.744 1.00 62.63  ? 1257 GLN D NE2   1 
ATOM   9138  N  N     . ARG B  1  459 ? 63.296  1.728  -25.401 1.00 58.71  ? 1258 ARG D N     1 
ATOM   9139  C  CA    . ARG B  1  459 ? 62.588  2.977  -25.094 1.00 54.32  ? 1258 ARG D CA    1 
ATOM   9140  C  C     . ARG B  1  459 ? 63.310  3.817  -24.061 1.00 49.50  ? 1258 ARG D C     1 
ATOM   9141  O  O     . ARG B  1  459 ? 64.127  3.309  -23.291 1.00 47.89  ? 1258 ARG D O     1 
ATOM   9142  C  CB    . ARG B  1  459 ? 61.163  2.692  -24.633 1.00 53.08  ? 1258 ARG D CB    1 
ATOM   9143  C  CG    . ARG B  1  459 ? 61.068  1.972  -23.302 1.00 52.51  ? 1258 ARG D CG    1 
ATOM   9144  C  CD    . ARG B  1  459 ? 59.629  1.912  -22.863 1.00 54.60  ? 1258 ARG D CD    1 
ATOM   9145  N  NE    . ARG B  1  459 ? 59.506  1.485  -21.493 1.00 55.40  ? 1258 ARG D NE    1 
ATOM   9146  C  CZ    . ARG B  1  459 ? 58.572  0.662  -21.049 1.00 59.43  ? 1258 ARG D CZ    1 
ATOM   9147  N  NH1   . ARG B  1  459 ? 57.681  0.159  -21.887 1.00 56.91  ? 1258 ARG D NH1   1 
ATOM   9148  N  NH2   . ARG B  1  459 ? 58.544  0.323  -19.767 1.00 63.64  ? 1258 ARG D NH2   1 
ATOM   9149  N  N     . ILE B  1  460 ? 63.008  5.118  -24.056 1.00 46.91  ? 1259 ILE D N     1 
ATOM   9150  C  CA    . ILE B  1  460 ? 63.624  6.060  -23.114 1.00 43.25  ? 1259 ILE D CA    1 
ATOM   9151  C  C     . ILE B  1  460 ? 62.563  6.452  -22.089 1.00 43.05  ? 1259 ILE D C     1 
ATOM   9152  O  O     . ILE B  1  460 ? 61.474  6.917  -22.462 1.00 44.72  ? 1259 ILE D O     1 
ATOM   9153  C  CB    . ILE B  1  460 ? 64.173  7.286  -23.839 1.00 42.14  ? 1259 ILE D CB    1 
ATOM   9154  C  CG1   . ILE B  1  460 ? 65.265  6.879  -24.825 1.00 40.88  ? 1259 ILE D CG1   1 
ATOM   9155  C  CG2   . ILE B  1  460 ? 64.699  8.315  -22.829 1.00 40.95  ? 1259 ILE D CG2   1 
ATOM   9156  C  CD1   . ILE B  1  460 ? 65.555  7.955  -25.873 1.00 42.26  ? 1259 ILE D CD1   1 
ATOM   9157  N  N     . VAL B  1  461 ? 62.888  6.291  -20.811 1.00 40.79  ? 1260 VAL D N     1 
ATOM   9158  C  CA    . VAL B  1  461 ? 61.971  6.616  -19.729 1.00 40.21  ? 1260 VAL D CA    1 
ATOM   9159  C  C     . VAL B  1  461 ? 62.581  7.743  -18.900 1.00 39.25  ? 1260 VAL D C     1 
ATOM   9160  O  O     . VAL B  1  461 ? 63.634  7.565  -18.277 1.00 40.72  ? 1260 VAL D O     1 
ATOM   9161  C  CB    . VAL B  1  461 ? 61.683  5.398  -18.849 1.00 39.72  ? 1260 VAL D CB    1 
ATOM   9162  C  CG1   . VAL B  1  461 ? 60.671  5.772  -17.759 1.00 37.24  ? 1260 VAL D CG1   1 
ATOM   9163  C  CG2   . VAL B  1  461 ? 61.122  4.266  -19.705 1.00 40.10  ? 1260 VAL D CG2   1 
ATOM   9164  N  N     . VAL B  1  462 ? 61.916  8.895  -18.888 1.00 37.37  ? 1261 VAL D N     1 
ATOM   9165  C  CA    . VAL B  1  462 ? 62.362  10.054 -18.127 1.00 35.44  ? 1261 VAL D CA    1 
ATOM   9166  C  C     . VAL B  1  462 ? 61.548  10.153 -16.846 1.00 32.21  ? 1261 VAL D C     1 
ATOM   9167  O  O     . VAL B  1  462 ? 60.307  10.224 -16.885 1.00 33.20  ? 1261 VAL D O     1 
ATOM   9168  C  CB    . VAL B  1  462 ? 62.213  11.346 -18.960 1.00 35.82  ? 1261 VAL D CB    1 
ATOM   9169  C  CG1   . VAL B  1  462 ? 62.699  12.555 -18.151 1.00 35.19  ? 1261 VAL D CG1   1 
ATOM   9170  C  CG2   . VAL B  1  462 ? 62.986  11.204 -20.295 1.00 36.74  ? 1261 VAL D CG2   1 
ATOM   9171  N  N     . THR B  1  463 ? 62.236  10.137 -15.710 1.00 31.24  ? 1262 THR D N     1 
ATOM   9172  C  CA    . THR B  1  463 ? 61.580  10.158 -14.407 1.00 32.35  ? 1262 THR D CA    1 
ATOM   9173  C  C     . THR B  1  463 ? 61.846  11.433 -13.619 1.00 31.26  ? 1262 THR D C     1 
ATOM   9174  O  O     . THR B  1  463 ? 61.194  11.647 -12.593 1.00 31.74  ? 1262 THR D O     1 
ATOM   9175  C  CB    . THR B  1  463 ? 62.014  8.958  -13.569 1.00 31.98  ? 1262 THR D CB    1 
ATOM   9176  O  OG1   . THR B  1  463 ? 63.456  8.900  -13.541 1.00 34.91  ? 1262 THR D OG1   1 
ATOM   9177  C  CG2   . THR B  1  463 ? 61.486  7.668  -14.200 1.00 32.30  ? 1262 THR D CG2   1 
ATOM   9178  N  N     . GLU B  1  464 ? 62.784  12.267 -14.059 1.00 32.59  ? 1263 GLU D N     1 
ATOM   9179  C  CA    . GLU B  1  464 ? 63.048  13.542 -13.398 1.00 31.78  ? 1263 GLU D CA    1 
ATOM   9180  C  C     . GLU B  1  464 ? 63.428  14.520 -14.534 1.00 30.98  ? 1263 GLU D C     1 
ATOM   9181  O  O     . GLU B  1  464 ? 64.107  14.156 -15.481 1.00 33.07  ? 1263 GLU D O     1 
ATOM   9182  C  CB    . GLU B  1  464 ? 64.229  13.412 -12.419 1.00 32.64  ? 1263 GLU D CB    1 
ATOM   9183  C  CG    . GLU B  1  464 ? 63.964  12.523 -11.229 1.00 33.26  ? 1263 GLU D CG    1 
ATOM   9184  C  CD    . GLU B  1  464 ? 65.263  12.123 -10.477 1.00 36.16  ? 1263 GLU D CD    1 
ATOM   9185  O  OE1   . GLU B  1  464 ? 65.210  11.189 -9.642  1.00 36.66  ? 1263 GLU D OE1   1 
ATOM   9186  O  OE2   . GLU B  1  464 ? 66.338  12.729 -10.660 1.00 30.19  ? 1263 GLU D OE2   1 
ATOM   9187  N  N     . ILE B  1  465 ? 63.001  15.765 -14.355 1.00 31.26  ? 1264 ILE D N     1 
ATOM   9188  C  CA    . ILE B  1  465 ? 63.228  16.784 -15.406 1.00 30.33  ? 1264 ILE D CA    1 
ATOM   9189  C  C     . ILE B  1  465 ? 63.892  17.986 -14.732 1.00 30.87  ? 1264 ILE D C     1 
ATOM   9190  O  O     . ILE B  1  465 ? 63.857  18.081 -13.502 1.00 33.33  ? 1264 ILE D O     1 
ATOM   9191  C  CB    . ILE B  1  465 ? 61.933  17.206 -16.155 1.00 31.50  ? 1264 ILE D CB    1 
ATOM   9192  C  CG1   . ILE B  1  465 ? 60.922  17.837 -15.189 1.00 36.52  ? 1264 ILE D CG1   1 
ATOM   9193  C  CG2   . ILE B  1  465 ? 61.330  16.003 -16.852 1.00 36.68  ? 1264 ILE D CG2   1 
ATOM   9194  C  CD1   . ILE B  1  465 ? 59.723  18.425 -15.957 1.00 33.76  ? 1264 ILE D CD1   1 
ATOM   9195  N  N     . PRO B  1  466 ? 64.503  18.918 -15.482 1.00 30.38  ? 1265 PRO D N     1 
ATOM   9196  C  CA    . PRO B  1  466 ? 65.222  20.011 -14.844 1.00 30.05  ? 1265 PRO D CA    1 
ATOM   9197  C  C     . PRO B  1  466 ? 64.300  20.999 -14.136 1.00 30.93  ? 1265 PRO D C     1 
ATOM   9198  O  O     . PRO B  1  466 ? 63.099  21.098 -14.404 1.00 29.82  ? 1265 PRO D O     1 
ATOM   9199  C  CB    . PRO B  1  466 ? 65.967  20.682 -15.984 1.00 30.52  ? 1265 PRO D CB    1 
ATOM   9200  C  CG    . PRO B  1  466 ? 66.029  19.631 -17.075 1.00 29.48  ? 1265 PRO D CG    1 
ATOM   9201  C  CD    . PRO B  1  466 ? 64.716  18.866 -16.955 1.00 28.33  ? 1265 PRO D CD    1 
ATOM   9202  N  N     . PHE B  1  467 ? 64.901  21.751 -13.210 1.00 30.29  ? 1266 PHE D N     1 
ATOM   9203  C  CA    . PHE B  1  467 ? 64.187  22.746 -12.410 1.00 28.08  ? 1266 PHE D CA    1 
ATOM   9204  C  C     . PHE B  1  467 ? 63.599  23.836 -13.308 1.00 27.13  ? 1266 PHE D C     1 
ATOM   9205  O  O     . PHE B  1  467 ? 64.232  24.306 -14.233 1.00 26.75  ? 1266 PHE D O     1 
ATOM   9206  C  CB    . PHE B  1  467 ? 65.164  23.362 -11.410 1.00 24.90  ? 1266 PHE D CB    1 
ATOM   9207  C  CG    . PHE B  1  467 ? 64.532  24.314 -10.414 1.00 25.66  ? 1266 PHE D CG    1 
ATOM   9208  C  CD1   . PHE B  1  467 ? 63.416  23.947 -9.673  1.00 24.82  ? 1266 PHE D CD1   1 
ATOM   9209  C  CD2   . PHE B  1  467 ? 65.074  25.576 -10.231 1.00 24.91  ? 1266 PHE D CD2   1 
ATOM   9210  C  CE1   . PHE B  1  467 ? 62.860  24.830 -8.755  1.00 24.75  ? 1266 PHE D CE1   1 
ATOM   9211  C  CE2   . PHE B  1  467 ? 64.550  26.456 -9.315  1.00 25.43  ? 1266 PHE D CE2   1 
ATOM   9212  C  CZ    . PHE B  1  467 ? 63.421  26.125 -8.555  1.00 25.09  ? 1266 PHE D CZ    1 
ATOM   9213  N  N     . GLN B  1  468 ? 62.364  24.206 -13.010 1.00 28.59  ? 1267 GLN D N     1 
ATOM   9214  C  CA    . GLN B  1  468 ? 61.683  25.263 -13.791 1.00 30.61  ? 1267 GLN D CA    1 
ATOM   9215  C  C     . GLN B  1  468 ? 61.338  24.927 -15.215 1.00 32.26  ? 1267 GLN D C     1 
ATOM   9216  O  O     . GLN B  1  468 ? 61.095  25.791 -15.993 1.00 34.15  ? 1267 GLN D O     1 
ATOM   9217  C  CB    . GLN B  1  468 ? 62.337  26.630 -13.697 1.00 31.48  ? 1267 GLN D CB    1 
ATOM   9218  C  CG    . GLN B  1  468 ? 62.457  27.119 -12.218 1.00 34.43  ? 1267 GLN D CG    1 
ATOM   9219  C  CD    . GLN B  1  468 ? 63.262  28.383 -12.078 1.00 35.48  ? 1267 GLN D CD    1 
ATOM   9220  O  OE1   . GLN B  1  468 ? 64.375  28.463 -12.453 1.00 37.78  ? 1267 GLN D OE1   1 
ATOM   9221  N  NE2   . GLN B  1  468 ? 62.665  29.393 -11.505 1.00 42.09  ? 1267 GLN D NE2   1 
ATOM   9222  N  N     . VAL B  1  469 ? 61.293  23.634 -15.539 1.00 30.01  ? 1268 VAL D N     1 
ATOM   9223  C  CA    . VAL B  1  469 ? 60.978  23.196 -16.918 1.00 30.72  ? 1268 VAL D CA    1 
ATOM   9224  C  C     . VAL B  1  469 ? 59.497  22.726 -16.921 1.00 29.89  ? 1268 VAL D C     1 
ATOM   9225  O  O     . VAL B  1  469 ? 59.081  21.926 -16.111 1.00 30.86  ? 1268 VAL D O     1 
ATOM   9226  C  CB    . VAL B  1  469 ? 61.887  22.096 -17.366 1.00 29.55  ? 1268 VAL D CB    1 
ATOM   9227  C  CG1   . VAL B  1  469 ? 61.370  21.369 -18.607 1.00 33.29  ? 1268 VAL D CG1   1 
ATOM   9228  C  CG2   . VAL B  1  469 ? 63.282  22.681 -17.641 1.00 31.76  ? 1268 VAL D CG2   1 
ATOM   9229  N  N     . ASN B  1  470 ? 58.730  23.268 -17.855 1.00 30.51  ? 1269 ASN D N     1 
ATOM   9230  C  CA    . ASN B  1  470 ? 57.360  22.913 -18.065 1.00 32.97  ? 1269 ASN D CA    1 
ATOM   9231  C  C     . ASN B  1  470 ? 57.357  21.540 -18.780 1.00 34.44  ? 1269 ASN D C     1 
ATOM   9232  O  O     . ASN B  1  470 ? 57.843  21.409 -19.905 1.00 33.83  ? 1269 ASN D O     1 
ATOM   9233  C  CB    . ASN B  1  470 ? 56.664  23.961 -18.936 1.00 33.62  ? 1269 ASN D CB    1 
ATOM   9234  C  CG    . ASN B  1  470 ? 55.185  23.679 -19.132 1.00 33.48  ? 1269 ASN D CG    1 
ATOM   9235  O  OD1   . ASN B  1  470 ? 54.779  22.552 -19.354 1.00 32.68  ? 1269 ASN D OD1   1 
ATOM   9236  N  ND2   . ASN B  1  470 ? 54.387  24.733 -19.026 1.00 33.63  ? 1269 ASN D ND2   1 
ATOM   9237  N  N     . LYS B  1  471 ? 56.825  20.534 -18.097 1.00 35.32  ? 1270 LYS D N     1 
ATOM   9238  C  CA    . LYS B  1  471 ? 56.841  19.173 -18.629 1.00 35.84  ? 1270 LYS D CA    1 
ATOM   9239  C  C     . LYS B  1  471 ? 56.044  19.077 -19.922 1.00 37.89  ? 1270 LYS D C     1 
ATOM   9240  O  O     . LYS B  1  471 ? 56.518  18.491 -20.911 1.00 35.54  ? 1270 LYS D O     1 
ATOM   9241  C  CB    . LYS B  1  471 ? 56.285  18.201 -17.574 1.00 36.53  ? 1270 LYS D CB    1 
ATOM   9242  C  CG    . LYS B  1  471 ? 56.131  16.762 -18.075 1.00 38.82  ? 1270 LYS D CG    1 
ATOM   9243  C  CD    . LYS B  1  471 ? 55.998  15.783 -16.920 1.00 40.25  ? 1270 LYS D CD    1 
ATOM   9244  C  CE    . LYS B  1  471 ? 54.863  16.165 -15.963 1.00 38.17  ? 1270 LYS D CE    1 
ATOM   9245  N  NZ    . LYS B  1  471 ? 53.535  16.141 -16.649 1.00 36.57  ? 1270 LYS D NZ    1 
ATOM   9246  N  N     . ALA B  1  472 ? 54.844  19.647 -19.937 1.00 38.95  ? 1271 ALA D N     1 
ATOM   9247  C  CA    . ALA B  1  472 ? 54.012  19.592 -21.140 1.00 39.75  ? 1271 ALA D CA    1 
ATOM   9248  C  C     . ALA B  1  472 ? 54.689  20.325 -22.295 1.00 40.09  ? 1271 ALA D C     1 
ATOM   9249  O  O     . ALA B  1  472 ? 54.706  19.840 -23.425 1.00 35.61  ? 1271 ALA D O     1 
ATOM   9250  C  CB    . ALA B  1  472 ? 52.623  20.158 -20.855 1.00 39.47  ? 1271 ALA D CB    1 
ATOM   9251  N  N     . ARG B  1  473 ? 55.255  21.493 -22.002 1.00 39.57  ? 1272 ARG D N     1 
ATOM   9252  C  CA    . ARG B  1  473 ? 55.935  22.262 -23.017 1.00 40.22  ? 1272 ARG D CA    1 
ATOM   9253  C  C     . ARG B  1  473 ? 57.129  21.472 -23.569 1.00 40.14  ? 1272 ARG D C     1 
ATOM   9254  O  O     . ARG B  1  473 ? 57.391  21.484 -24.758 1.00 38.05  ? 1272 ARG D O     1 
ATOM   9255  C  CB    . ARG B  1  473 ? 56.342  23.635 -22.475 1.00 41.65  ? 1272 ARG D CB    1 
ATOM   9256  C  CG    . ARG B  1  473 ? 57.560  24.255 -23.121 1.00 50.99  ? 1272 ARG D CG    1 
ATOM   9257  C  CD    . ARG B  1  473 ? 57.514  25.774 -23.189 1.00 55.98  ? 1272 ARG D CD    1 
ATOM   9258  N  NE    . ARG B  1  473 ? 56.795  26.351 -22.053 1.00 65.59  ? 1272 ARG D NE    1 
ATOM   9259  C  CZ    . ARG B  1  473 ? 57.334  26.747 -20.906 1.00 61.72  ? 1272 ARG D CZ    1 
ATOM   9260  N  NH1   . ARG B  1  473 ? 56.583  27.286 -19.981 1.00 59.02  ? 1272 ARG D NH1   1 
ATOM   9261  N  NH2   . ARG B  1  473 ? 58.616  26.607 -20.689 1.00 62.04  ? 1272 ARG D NH2   1 
ATOM   9262  N  N     . MET B  1  474 ? 57.846  20.776 -22.683 1.00 40.06  ? 1273 MET D N     1 
ATOM   9263  C  CA    . MET B  1  474 ? 58.980  19.956 -23.109 1.00 39.47  ? 1273 MET D CA    1 
ATOM   9264  C  C     . MET B  1  474 ? 58.518  18.812 -24.017 1.00 37.82  ? 1273 MET D C     1 
ATOM   9265  O  O     . MET B  1  474 ? 59.149  18.531 -25.045 1.00 42.16  ? 1273 MET D O     1 
ATOM   9266  C  CB    . MET B  1  474 ? 59.730  19.423 -21.916 1.00 38.00  ? 1273 MET D CB    1 
ATOM   9267  C  CG    . MET B  1  474 ? 60.980  18.618 -22.296 1.00 41.46  ? 1273 MET D CG    1 
ATOM   9268  S  SD    . MET B  1  474 ? 61.678  17.737 -20.826 1.00 44.66  ? 1273 MET D SD    1 
ATOM   9269  C  CE    . MET B  1  474 ? 60.422  16.429 -20.598 1.00 47.25  ? 1273 MET D CE    1 
ATOM   9270  N  N     . ILE B  1  475 ? 57.432  18.149 -23.641 1.00 37.40  ? 1274 ILE D N     1 
ATOM   9271  C  CA    . ILE B  1  475 ? 56.897  17.059 -24.446 1.00 42.29  ? 1274 ILE D CA    1 
ATOM   9272  C  C     . ILE B  1  475 ? 56.424  17.590 -25.820 1.00 41.44  ? 1274 ILE D C     1 
ATOM   9273  O  O     . ILE B  1  475 ? 56.619  16.937 -26.850 1.00 46.91  ? 1274 ILE D O     1 
ATOM   9274  C  CB    . ILE B  1  475 ? 55.763  16.345 -23.708 1.00 41.16  ? 1274 ILE D CB    1 
ATOM   9275  C  CG1   . ILE B  1  475 ? 56.326  15.611 -22.501 1.00 39.32  ? 1274 ILE D CG1   1 
ATOM   9276  C  CG2   . ILE B  1  475 ? 55.021  15.392 -24.646 1.00 41.56  ? 1274 ILE D CG2   1 
ATOM   9277  C  CD1   . ILE B  1  475 ? 55.317  15.099 -21.527 1.00 36.59  ? 1274 ILE D CD1   1 
ATOM   9278  N  N     . GLU B  1  476 ? 55.830  18.770 -25.826 1.00 43.17  ? 1275 GLU D N     1 
ATOM   9279  C  CA    . GLU B  1  476 ? 55.362  19.336 -27.061 1.00 43.61  ? 1275 GLU D CA    1 
ATOM   9280  C  C     . GLU B  1  476 ? 56.546  19.664 -27.978 1.00 43.89  ? 1275 GLU D C     1 
ATOM   9281  O  O     . GLU B  1  476 ? 56.435  19.608 -29.187 1.00 42.45  ? 1275 GLU D O     1 
ATOM   9282  C  CB    . GLU B  1  476 ? 54.541  20.619 -26.792 1.00 47.77  ? 1275 GLU D CB    1 
ATOM   9283  N  N     . LYS B  1  477 ? 57.672  19.994 -27.386 1.00 42.22  ? 1276 LYS D N     1 
ATOM   9284  C  CA    . LYS B  1  477 ? 58.846  20.309 -28.156 1.00 41.84  ? 1276 LYS D CA    1 
ATOM   9285  C  C     . LYS B  1  477 ? 59.375  19.072 -28.840 1.00 43.68  ? 1276 LYS D C     1 
ATOM   9286  O  O     . LYS B  1  477 ? 59.793  19.122 -29.996 1.00 46.42  ? 1276 LYS D O     1 
ATOM   9287  C  CB    . LYS B  1  477 ? 59.925  20.920 -27.255 1.00 41.28  ? 1276 LYS D CB    1 
ATOM   9288  C  CG    . LYS B  1  477 ? 61.087  21.523 -27.983 1.00 45.40  ? 1276 LYS D CG    1 
ATOM   9289  N  N     . ILE B  1  478 ? 59.348  17.943 -28.125 1.00 42.32  ? 1277 ILE D N     1 
ATOM   9290  C  CA    . ILE B  1  478 ? 59.811  16.701 -28.678 1.00 42.62  ? 1277 ILE D CA    1 
ATOM   9291  C  C     . ILE B  1  478 ? 58.902  16.341 -29.845 1.00 46.58  ? 1277 ILE D C     1 
ATOM   9292  O  O     . ILE B  1  478 ? 59.379  16.048 -30.930 1.00 48.01  ? 1277 ILE D O     1 
ATOM   9293  C  CB    . ILE B  1  478 ? 59.788  15.591 -27.626 1.00 43.20  ? 1277 ILE D CB    1 
ATOM   9294  C  CG1   . ILE B  1  478 ? 60.819  15.892 -26.540 1.00 40.14  ? 1277 ILE D CG1   1 
ATOM   9295  C  CG2   . ILE B  1  478 ? 60.076  14.229 -28.313 1.00 44.83  ? 1277 ILE D CG2   1 
ATOM   9296  C  CD1   . ILE B  1  478 ? 60.676  15.060 -25.288 1.00 42.29  ? 1277 ILE D CD1   1 
ATOM   9297  N  N     . ALA B  1  479 ? 57.599  16.373 -29.611 1.00 48.09  ? 1278 ALA D N     1 
ATOM   9298  C  CA    . ALA B  1  479 ? 56.643  16.042 -30.650 1.00 52.04  ? 1278 ALA D CA    1 
ATOM   9299  C  C     . ALA B  1  479 ? 56.842  16.935 -31.859 1.00 54.62  ? 1278 ALA D C     1 
ATOM   9300  O  O     . ALA B  1  479 ? 56.621  16.526 -32.993 1.00 58.83  ? 1278 ALA D O     1 
ATOM   9301  C  CB    . ALA B  1  479 ? 55.227  16.143 -30.123 1.00 52.75  ? 1278 ALA D CB    1 
ATOM   9302  N  N     . GLU B  1  480 ? 57.244  18.171 -31.603 1.00 53.49  ? 1279 GLU D N     1 
ATOM   9303  C  CA    . GLU B  1  480 ? 57.471  19.133 -32.665 1.00 58.35  ? 1279 GLU D CA    1 
ATOM   9304  C  C     . GLU B  1  480 ? 58.649  18.656 -33.506 1.00 58.87  ? 1279 GLU D C     1 
ATOM   9305  O  O     . GLU B  1  480 ? 58.632  18.789 -34.745 1.00 57.32  ? 1279 GLU D O     1 
ATOM   9306  C  CB    . GLU B  1  480 ? 57.701  20.514 -32.091 1.00 60.34  ? 1279 GLU D CB    1 
ATOM   9307  C  CG    . GLU B  1  480 ? 58.511  21.449 -32.968 1.00 65.56  ? 1279 GLU D CG    1 
ATOM   9308  C  CD    . GLU B  1  480 ? 59.170  22.617 -32.220 1.00 70.96  ? 1279 GLU D CD    1 
ATOM   9309  O  OE1   . GLU B  1  480 ? 58.634  23.130 -31.201 1.00 68.05  ? 1279 GLU D OE1   1 
ATOM   9310  O  OE2   . GLU B  1  480 ? 60.302  22.966 -32.627 1.00 79.63  ? 1279 GLU D OE2   1 
ATOM   9311  N  N     . LEU B  1  481 ? 59.666  18.110 -32.862 1.00 53.24  ? 1280 LEU D N     1 
ATOM   9312  C  CA    . LEU B  1  481 ? 60.832  17.640 -33.574 1.00 56.45  ? 1280 LEU D CA    1 
ATOM   9313  C  C     . LEU B  1  481 ? 60.503  16.398 -34.385 1.00 60.10  ? 1280 LEU D C     1 
ATOM   9314  O  O     . LEU B  1  481 ? 60.895  16.289 -35.546 1.00 60.26  ? 1280 LEU D O     1 
ATOM   9315  C  CB    . LEU B  1  481 ? 61.973  17.338 -32.603 1.00 56.09  ? 1280 LEU D CB    1 
ATOM   9316  C  CG    . LEU B  1  481 ? 62.560  18.583 -31.932 1.00 59.95  ? 1280 LEU D CG    1 
ATOM   9317  C  CD1   . LEU B  1  481 ? 63.748  18.209 -31.066 1.00 57.77  ? 1280 LEU D CD1   1 
ATOM   9318  C  CD2   . LEU B  1  481 ? 62.882  19.673 -32.966 1.00 57.20  ? 1280 LEU D CD2   1 
ATOM   9319  N  N     . VAL B  1  482 ? 59.743  15.489 -33.798 1.00 56.73  ? 1281 VAL D N     1 
ATOM   9320  C  CA    . VAL B  1  482 ? 59.352  14.268 -34.491 1.00 58.93  ? 1281 VAL D CA    1 
ATOM   9321  C  C     . VAL B  1  482 ? 58.556  14.648 -35.722 1.00 64.03  ? 1281 VAL D C     1 
ATOM   9322  O  O     . VAL B  1  482 ? 58.932  14.270 -36.849 1.00 66.66  ? 1281 VAL D O     1 
ATOM   9323  C  CB    . VAL B  1  482 ? 58.538  13.349 -33.576 1.00 53.47  ? 1281 VAL D CB    1 
ATOM   9324  C  CG1   . VAL B  1  482 ? 57.997  12.161 -34.373 1.00 56.86  ? 1281 VAL D CG1   1 
ATOM   9325  C  CG2   . VAL B  1  482 ? 59.401  12.853 -32.439 1.00 54.95  ? 1281 VAL D CG2   1 
ATOM   9326  N  N     A ARG B  1  483 ? 57.568  15.670 -35.448 0.50 63.09  ? 1282 ARG D N     1 
ATOM   9327  N  N     B ARG B  1  483 ? 57.579  15.460 -35.490 0.50 64.58  ? 1282 ARG D N     1 
ATOM   9328  C  CA    A ARG B  1  483 ? 56.916  16.091 -36.692 0.50 62.92  ? 1282 ARG D CA    1 
ATOM   9329  C  CA    B ARG B  1  483 ? 56.558  15.741 -36.478 0.50 64.74  ? 1282 ARG D CA    1 
ATOM   9330  C  C     A ARG B  1  483 ? 57.818  16.715 -37.727 0.50 64.37  ? 1282 ARG D C     1 
ATOM   9331  C  C     B ARG B  1  483 ? 57.272  16.315 -37.687 0.50 66.28  ? 1282 ARG D C     1 
ATOM   9332  O  O     A ARG B  1  483 ? 57.640  16.736 -38.909 0.50 64.86  ? 1282 ARG D O     1 
ATOM   9333  O  O     B ARG B  1  483 ? 56.816  16.177 -38.833 0.50 64.02  ? 1282 ARG D O     1 
ATOM   9334  C  CB    A ARG B  1  483 ? 55.746  17.049 -36.408 0.50 62.45  ? 1282 ARG D CB    1 
ATOM   9335  C  CB    B ARG B  1  483 ? 55.535  16.755 -35.930 0.50 67.10  ? 1282 ARG D CB    1 
ATOM   9336  C  CG    A ARG B  1  483 ? 54.596  16.418 -35.744 0.50 59.68  ? 1282 ARG D CG    1 
ATOM   9337  C  CG    B ARG B  1  483 ? 54.508  17.108 -36.959 0.50 69.05  ? 1282 ARG D CG    1 
ATOM   9338  C  CD    A ARG B  1  483 ? 53.359  17.327 -35.663 0.50 58.89  ? 1282 ARG D CD    1 
ATOM   9339  C  CD    B ARG B  1  483 ? 53.421  18.065 -36.431 0.50 69.29  ? 1282 ARG D CD    1 
ATOM   9340  N  NE    A ARG B  1  483 ? 53.525  18.578 -34.910 0.50 56.41  ? 1282 ARG D NE    1 
ATOM   9341  N  NE    B ARG B  1  483 ? 53.827  19.017 -35.383 0.50 69.54  ? 1282 ARG D NE    1 
ATOM   9342  C  CZ    A ARG B  1  483 ? 53.366  18.681 -33.590 0.50 51.34  ? 1282 ARG D CZ    1 
ATOM   9343  C  CZ    B ARG B  1  483 ? 53.966  20.327 -35.565 0.50 68.19  ? 1282 ARG D CZ    1 
ATOM   9344  N  NH1   A ARG B  1  483 ? 52.985  17.639 -32.897 0.50 49.21  ? 1282 ARG D NH1   1 
ATOM   9345  N  NH1   B ARG B  1  483 ? 53.806  20.841 -36.772 0.50 73.12  ? 1282 ARG D NH1   1 
ATOM   9346  N  NH2   A ARG B  1  483 ? 53.505  19.854 -32.997 0.50 49.40  ? 1282 ARG D NH2   1 
ATOM   9347  N  NH2   B ARG B  1  483 ? 54.326  21.116 -34.577 0.50 67.96  ? 1282 ARG D NH2   1 
ATOM   9348  N  N     . ASP B  1  484 ? 58.354  17.170 -37.384 1.00 62.46  ? 1283 ASP D N     1 
ATOM   9349  C  CA    . ASP B  1  484 ? 59.025  17.928 -38.368 1.00 66.73  ? 1283 ASP D CA    1 
ATOM   9350  C  C     . ASP B  1  484 ? 60.259  17.175 -38.881 1.00 67.69  ? 1283 ASP D C     1 
ATOM   9351  O  O     . ASP B  1  484 ? 61.094  17.753 -39.570 1.00 68.55  ? 1283 ASP D O     1 
ATOM   9352  C  CB    . ASP B  1  484 ? 59.398  19.253 -37.789 1.00 66.99  ? 1283 ASP D CB    1 
ATOM   9353  C  CG    . ASP B  1  484 ? 58.221  20.188 -37.685 1.00 68.09  ? 1283 ASP D CG    1 
ATOM   9354  O  OD1   . ASP B  1  484 ? 57.154  19.850 -38.200 1.00 67.76  ? 1283 ASP D OD1   1 
ATOM   9355  O  OD2   . ASP B  1  484 ? 58.388  21.316 -37.078 1.00 67.16  ? 1283 ASP D OD2   1 
ATOM   9356  N  N     . LYS B  1  485 ? 60.384  15.916 -38.496 1.00 68.43  ? 1284 LYS D N     1 
ATOM   9357  C  CA    . LYS B  1  485 ? 61.471  15.046 -38.929 1.00 68.01  ? 1284 LYS D CA    1 
ATOM   9358  C  C     . LYS B  1  485 ? 62.862  15.485 -38.484 1.00 68.29  ? 1284 LYS D C     1 
ATOM   9359  O  O     . LYS B  1  485 ? 63.860  15.071 -39.054 1.00 69.47  ? 1284 LYS D O     1 
ATOM   9360  C  CB    . LYS B  1  485 ? 61.484  14.818 -40.455 1.00 66.75  ? 1284 LYS D CB    1 
ATOM   9361  C  CG    . LYS B  1  485 ? 60.399  13.893 -40.951 1.00 67.72  ? 1284 LYS D CG    1 
ATOM   9362  N  N     . LYS B  1  486 ? 62.925  16.350 -37.481 1.00 63.05  ? 1285 LYS D N     1 
ATOM   9363  C  CA    . LYS B  1  486 ? 64.204  16.781 -36.958 1.00 59.71  ? 1285 LYS D CA    1 
ATOM   9364  C  C     . LYS B  1  486 ? 64.881  15.671 -36.131 1.00 60.66  ? 1285 LYS D C     1 
ATOM   9365  O  O     . LYS B  1  486 ? 66.073  15.677 -35.976 1.00 62.03  ? 1285 LYS D O     1 
ATOM   9366  C  CB    . LYS B  1  486 ? 64.081  18.085 -36.195 1.00 59.90  ? 1285 LYS D CB    1 
ATOM   9367  C  CG    . LYS B  1  486 ? 63.953  19.265 -37.214 1.00 56.83  ? 1285 LYS D CG    1 
ATOM   9368  N  N     . ILE B  1  487 ? 64.088  14.755 -35.592 1.00 59.41  ? 1286 ILE D N     1 
ATOM   9369  C  CA    . ILE B  1  487 ? 64.613  13.623 -34.868 1.00 60.56  ? 1286 ILE D CA    1 
ATOM   9370  C  C     . ILE B  1  487 ? 64.058  12.399 -35.555 1.00 61.60  ? 1286 ILE D C     1 
ATOM   9371  O  O     . ILE B  1  487 ? 62.831  12.253 -35.669 1.00 59.78  ? 1286 ILE D O     1 
ATOM   9372  C  CB    . ILE B  1  487 ? 64.154  13.635 -33.363 1.00 60.30  ? 1286 ILE D CB    1 
ATOM   9373  C  CG1   . ILE B  1  487 ? 64.879  14.718 -32.605 1.00 59.64  ? 1286 ILE D CG1   1 
ATOM   9374  C  CG2   . ILE B  1  487 ? 64.387  12.286 -32.708 1.00 60.23  ? 1286 ILE D CG2   1 
ATOM   9375  C  CD1   . ILE B  1  487 ? 66.334  14.420 -32.438 1.00 66.39  ? 1286 ILE D CD1   1 
ATOM   9376  N  N     . ASP B  1  488 ? 64.942  11.543 -36.020 1.00 64.17  ? 1287 ASP D N     1 
ATOM   9377  C  CA    . ASP B  1  488 ? 64.519  10.351 -36.796 1.00 69.75  ? 1287 ASP D CA    1 
ATOM   9378  C  C     . ASP B  1  488 ? 63.859  9.109  -36.164 1.00 70.69  ? 1287 ASP D C     1 
ATOM   9379  O  O     . ASP B  1  488 ? 62.937  8.560  -36.767 1.00 77.35  ? 1287 ASP D O     1 
ATOM   9380  C  CB    . ASP B  1  488 ? 65.596  9.935  -37.810 1.00 68.91  ? 1287 ASP D CB    1 
ATOM   9381  N  N     . GLY B  1  489 ? 64.314  8.681  -34.985 1.00 63.49  ? 1288 GLY D N     1 
ATOM   9382  C  CA    . GLY B  1  489 ? 63.846  7.426  -34.433 1.00 62.54  ? 1288 GLY D CA    1 
ATOM   9383  C  C     . GLY B  1  489 ? 62.717  7.212  -33.444 1.00 61.11  ? 1288 GLY D C     1 
ATOM   9384  O  O     . GLY B  1  489 ? 62.674  6.171  -32.816 1.00 60.57  ? 1288 GLY D O     1 
ATOM   9385  N  N     . ILE B  1  490 ? 61.832  8.172  -33.271 1.00 56.32  ? 1289 ILE D N     1 
ATOM   9386  C  CA    . ILE B  1  490 ? 60.786  8.021  -32.284 1.00 58.63  ? 1289 ILE D CA    1 
ATOM   9387  C  C     . ILE B  1  490 ? 59.470  7.481  -32.797 1.00 57.29  ? 1289 ILE D C     1 
ATOM   9388  O  O     . ILE B  1  490 ? 58.908  8.025  -33.719 1.00 55.00  ? 1289 ILE D O     1 
ATOM   9389  C  CB    . ILE B  1  490 ? 60.499  9.376  -31.595 1.00 55.72  ? 1289 ILE D CB    1 
ATOM   9390  C  CG1   . ILE B  1  490 ? 61.769  9.988  -31.051 1.00 58.03  ? 1289 ILE D CG1   1 
ATOM   9391  C  CG2   . ILE B  1  490 ? 59.463  9.200  -30.511 1.00 59.58  ? 1289 ILE D CG2   1 
ATOM   9392  C  CD1   . ILE B  1  490 ? 62.416  9.182  -29.969 1.00 61.28  ? 1289 ILE D CD1   1 
ATOM   9393  N  N     . THR B  1  491 ? 58.971  6.423  -32.171 1.00 57.36  ? 1290 THR D N     1 
ATOM   9394  C  CA    . THR B  1  491 ? 57.680  5.870  -32.571 1.00 57.54  ? 1290 THR D CA    1 
ATOM   9395  C  C     . THR B  1  491 ? 56.515  6.416  -31.723 1.00 59.40  ? 1290 THR D C     1 
ATOM   9396  O  O     . THR B  1  491 ? 55.458  6.724  -32.247 1.00 55.95  ? 1290 THR D O     1 
ATOM   9397  C  CB    . THR B  1  491 ? 57.676  4.342  -32.545 1.00 59.10  ? 1290 THR D CB    1 
ATOM   9398  O  OG1   . THR B  1  491 ? 58.290  3.885  -31.341 1.00 60.53  ? 1290 THR D OG1   1 
ATOM   9399  C  CG2   . THR B  1  491 ? 58.461  3.813  -33.721 1.00 60.41  ? 1290 THR D CG2   1 
ATOM   9400  N  N     . ASP B  1  492 ? 56.717  6.537  -30.415 1.00 54.68  ? 1291 ASP D N     1 
ATOM   9401  C  CA    . ASP B  1  492 ? 55.655  7.042  -29.565 1.00 55.19  ? 1291 ASP D CA    1 
ATOM   9402  C  C     . ASP B  1  492 ? 56.219  7.955  -28.480 1.00 50.81  ? 1291 ASP D C     1 
ATOM   9403  O  O     . ASP B  1  492 ? 57.389  7.851  -28.111 1.00 46.20  ? 1291 ASP D O     1 
ATOM   9404  C  CB    . ASP B  1  492 ? 54.840  5.889  -28.919 1.00 58.13  ? 1291 ASP D CB    1 
ATOM   9405  C  CG    . ASP B  1  492 ? 53.480  6.340  -28.431 1.00 62.91  ? 1291 ASP D CG    1 
ATOM   9406  O  OD1   . ASP B  1  492 ? 53.049  7.454  -28.822 1.00 63.97  ? 1291 ASP D OD1   1 
ATOM   9407  O  OD2   . ASP B  1  492 ? 52.838  5.594  -27.685 1.00 64.73  ? 1291 ASP D OD2   1 
ATOM   9408  N  N     . LEU B  1  493 ? 55.362  8.811  -27.962 1.00 50.48  ? 1292 LEU D N     1 
ATOM   9409  C  CA    . LEU B  1  493 ? 55.712  9.811  -26.954 1.00 47.75  ? 1292 LEU D CA    1 
ATOM   9410  C  C     . LEU B  1  493 ? 54.543  9.955  -26.004 1.00 47.03  ? 1292 LEU D C     1 
ATOM   9411  O  O     . LEU B  1  493 ? 53.493  10.459 -26.395 1.00 45.41  ? 1292 LEU D O     1 
ATOM   9412  C  CB    . LEU B  1  493 ? 56.035  11.149 -27.620 1.00 49.06  ? 1292 LEU D CB    1 
ATOM   9413  C  CG    . LEU B  1  493 ? 56.272  12.362 -26.721 1.00 49.83  ? 1292 LEU D CG    1 
ATOM   9414  C  CD1   . LEU B  1  493 ? 57.491  12.182 -25.806 1.00 48.92  ? 1292 LEU D CD1   1 
ATOM   9415  C  CD2   . LEU B  1  493 ? 56.369  13.626 -27.590 1.00 53.17  ? 1292 LEU D CD2   1 
ATOM   9416  N  N     . ARG B  1  494 ? 54.712  9.497  -24.762 1.00 43.05  ? 1293 ARG D N     1 
ATOM   9417  C  CA    . ARG B  1  494 ? 53.619  9.463  -23.796 1.00 44.74  ? 1293 ARG D CA    1 
ATOM   9418  C  C     . ARG B  1  494 ? 54.060  9.999  -22.453 1.00 43.77  ? 1293 ARG D C     1 
ATOM   9419  O  O     . ARG B  1  494 ? 55.159  9.701  -21.989 1.00 43.01  ? 1293 ARG D O     1 
ATOM   9420  C  CB    . ARG B  1  494 ? 53.100  8.027  -23.623 1.00 46.78  ? 1293 ARG D CB    1 
ATOM   9421  C  CG    . ARG B  1  494 ? 52.728  7.328  -24.907 1.00 49.10  ? 1293 ARG D CG    1 
ATOM   9422  C  CD    . ARG B  1  494 ? 52.152  5.962  -24.618 1.00 52.20  ? 1293 ARG D CD    1 
ATOM   9423  N  NE    . ARG B  1  494 ? 53.003  5.152  -23.762 1.00 49.93  ? 1293 ARG D NE    1 
ATOM   9424  C  CZ    . ARG B  1  494 ? 53.983  4.360  -24.181 1.00 50.81  ? 1293 ARG D CZ    1 
ATOM   9425  N  NH1   . ARG B  1  494 ? 54.244  4.254  -25.466 1.00 52.25  ? 1293 ARG D NH1   1 
ATOM   9426  N  NH2   . ARG B  1  494 ? 54.693  3.661  -23.303 1.00 51.88  ? 1293 ARG D NH2   1 
ATOM   9427  N  N     . ASP B  1  495 ? 53.172  10.768 -21.823 1.00 44.16  ? 1294 ASP D N     1 
ATOM   9428  C  CA    . ASP B  1  495 ? 53.353  11.279 -20.462 1.00 45.07  ? 1294 ASP D CA    1 
ATOM   9429  C  C     . ASP B  1  495 ? 52.547  10.395 -19.518 1.00 47.23  ? 1294 ASP D C     1 
ATOM   9430  O  O     . ASP B  1  495 ? 51.341  10.560 -19.399 1.00 46.52  ? 1294 ASP D O     1 
ATOM   9431  C  CB    . ASP B  1  495 ? 52.934  12.747 -20.407 1.00 45.02  ? 1294 ASP D CB    1 
ATOM   9432  C  CG    . ASP B  1  495 ? 53.311  13.417 -19.074 1.00 43.67  ? 1294 ASP D CG    1 
ATOM   9433  O  OD1   . ASP B  1  495 ? 53.767  12.699 -18.145 1.00 47.74  ? 1294 ASP D OD1   1 
ATOM   9434  O  OD2   . ASP B  1  495 ? 53.198  14.657 -18.968 1.00 43.28  ? 1294 ASP D OD2   1 
ATOM   9435  N  N     . GLU B  1  496 ? 53.223  9.490  -18.838 1.00 46.78  ? 1295 GLU D N     1 
ATOM   9436  C  CA    . GLU B  1  496 ? 52.568  8.589  -17.875 1.00 46.17  ? 1295 GLU D CA    1 
ATOM   9437  C  C     . GLU B  1  496 ? 52.766  9.041  -16.443 1.00 45.00  ? 1295 GLU D C     1 
ATOM   9438  O  O     . GLU B  1  496 ? 52.733  8.221  -15.533 1.00 41.66  ? 1295 GLU D O     1 
ATOM   9439  C  CB    . GLU B  1  496 ? 53.079  7.150  -18.048 1.00 48.42  ? 1295 GLU D CB    1 
ATOM   9440  C  CG    . GLU B  1  496 ? 52.795  6.558  -19.429 1.00 53.76  ? 1295 GLU D CG    1 
ATOM   9441  C  CD    . GLU B  1  496 ? 53.348  5.181  -19.627 1.00 56.53  ? 1295 GLU D CD    1 
ATOM   9442  O  OE1   . GLU B  1  496 ? 53.920  4.609  -18.674 1.00 61.25  ? 1295 GLU D OE1   1 
ATOM   9443  O  OE2   . GLU B  1  496 ? 53.214  4.639  -20.735 1.00 61.07  ? 1295 GLU D OE2   1 
ATOM   9444  N  N     . THR B  1  497 ? 52.979  10.339 -16.252 1.00 42.74  ? 1296 THR D N     1 
ATOM   9445  C  CA    . THR B  1  497 ? 53.193  10.854 -14.919 1.00 41.19  ? 1296 THR D CA    1 
ATOM   9446  C  C     . THR B  1  497 ? 51.951  10.589 -14.116 1.00 45.85  ? 1296 THR D C     1 
ATOM   9447  O  O     . THR B  1  497 ? 50.821  10.750 -14.598 1.00 43.08  ? 1296 THR D O     1 
ATOM   9448  C  CB    . THR B  1  497 ? 53.457  12.360 -14.974 1.00 38.60  ? 1296 THR D CB    1 
ATOM   9449  O  OG1   . THR B  1  497 ? 54.696  12.597 -15.647 1.00 34.78  ? 1296 THR D OG1   1 
ATOM   9450  C  CG2   . THR B  1  497 ? 53.518  12.933 -13.584 1.00 37.82  ? 1296 THR D CG2   1 
ATOM   9451  N  N     . SER B  1  498 ? 52.147  10.212 -12.860 1.00 48.99  ? 1297 SER D N     1 
ATOM   9452  C  CA    . SER B  1  498 ? 51.038  9.962  -11.959 1.00 50.16  ? 1297 SER D CA    1 
ATOM   9453  C  C     . SER B  1  498 ? 51.478  10.319 -10.566 1.00 54.18  ? 1297 SER D C     1 
ATOM   9454  O  O     . SER B  1  498 ? 52.661  10.472 -10.289 1.00 51.08  ? 1297 SER D O     1 
ATOM   9455  C  CB    . SER B  1  498 ? 50.659  8.466  -12.017 1.00 55.02  ? 1297 SER D CB    1 
ATOM   9456  O  OG    . SER B  1  498 ? 51.594  7.639  -11.354 1.00 56.39  ? 1297 SER D OG    1 
ATOM   9457  N  N     . LEU B  1  499 ? 50.502  10.472 -9.666  1.00 57.09  ? 1298 LEU D N     1 
ATOM   9458  C  CA    . LEU B  1  499 ? 50.847  10.821 -8.306  1.00 62.64  ? 1298 LEU D CA    1 
ATOM   9459  C  C     . LEU B  1  499 ? 51.679  9.687  -7.708  1.00 66.36  ? 1298 LEU D C     1 
ATOM   9460  O  O     . LEU B  1  499 ? 52.665  9.944  -7.028  1.00 67.83  ? 1298 LEU D O     1 
ATOM   9461  C  CB    . LEU B  1  499 ? 49.585  11.022 -7.493  1.00 66.60  ? 1298 LEU D CB    1 
ATOM   9462  C  CG    . LEU B  1  499 ? 49.591  12.091 -6.395  1.00 68.75  ? 1298 LEU D CG    1 
ATOM   9463  C  CD1   . LEU B  1  499 ? 48.449  11.789 -5.401  1.00 69.77  ? 1298 LEU D CD1   1 
ATOM   9464  C  CD2   . LEU B  1  499 ? 50.888  12.464 -5.655  1.00 65.66  ? 1298 LEU D CD2   1 
ATOM   9465  N  N     . ARG B  1  500 ? 51.273  8.452  -7.961  1.00 66.38  ? 1299 ARG D N     1 
ATOM   9466  C  CA    . ARG B  1  500 ? 51.999  7.283  -7.457  1.00 67.07  ? 1299 ARG D CA    1 
ATOM   9467  C  C     . ARG B  1  500 ? 53.352  7.089  -8.092  1.00 65.82  ? 1299 ARG D C     1 
ATOM   9468  O  O     . ARG B  1  500 ? 54.338  6.856  -7.422  1.00 69.44  ? 1299 ARG D O     1 
ATOM   9469  C  CB    . ARG B  1  500 ? 51.188  6.008  -7.715  1.00 65.98  ? 1299 ARG D CB    1 
ATOM   9470  N  N     . THR B  1  501 ? 53.371  7.156  -9.410  1.00 68.21  ? 1300 THR D N     1 
ATOM   9471  C  CA    . THR B  1  501 ? 54.588  6.994  -10.189 1.00 68.26  ? 1300 THR D CA    1 
ATOM   9472  C  C     . THR B  1  501 ? 55.571  8.149  -10.060 1.00 66.33  ? 1300 THR D C     1 
ATOM   9473  O  O     . THR B  1  501 ? 56.766  7.959  -9.959  1.00 70.65  ? 1300 THR D O     1 
ATOM   9474  C  CB    . THR B  1  501 ? 54.245  6.796  -11.677 1.00 70.79  ? 1300 THR D CB    1 
ATOM   9475  O  OG1   . THR B  1  501 ? 53.451  5.625  -11.838 1.00 78.79  ? 1300 THR D OG1   1 
ATOM   9476  C  CG2   . THR B  1  501 ? 55.482  6.645  -12.498 1.00 75.07  ? 1300 THR D CG2   1 
ATOM   9477  N  N     . GLY B  1  502 ? 55.049  9.368  -10.076 1.00 58.66  ? 1301 GLY D N     1 
ATOM   9478  C  CA    . GLY B  1  502 ? 55.914  10.530 -10.103 1.00 49.12  ? 1301 GLY D CA    1 
ATOM   9479  C  C     . GLY B  1  502 ? 56.053  10.789 -11.581 1.00 41.58  ? 1301 GLY D C     1 
ATOM   9480  O  O     . GLY B  1  502 ? 55.388  10.155 -12.365 1.00 40.58  ? 1301 GLY D O     1 
ATOM   9481  N  N     . VAL B  1  503 ? 56.920  11.703 -11.969 1.00 40.49  ? 1302 VAL D N     1 
ATOM   9482  C  CA    . VAL B  1  503 ? 57.135  12.022 -13.375 1.00 39.46  ? 1302 VAL D CA    1 
ATOM   9483  C  C     . VAL B  1  503 ? 57.586  10.769 -14.140 1.00 38.86  ? 1302 VAL D C     1 
ATOM   9484  O  O     . VAL B  1  503 ? 58.457  10.046 -13.698 1.00 37.47  ? 1302 VAL D O     1 
ATOM   9485  C  CB    . VAL B  1  503 ? 58.201  13.096 -13.539 1.00 39.91  ? 1302 VAL D CB    1 
ATOM   9486  C  CG1   . VAL B  1  503 ? 58.573  13.294 -15.009 1.00 36.88  ? 1302 VAL D CG1   1 
ATOM   9487  C  CG2   . VAL B  1  503 ? 57.629  14.445 -13.066 1.00 42.46  ? 1302 VAL D CG2   1 
ATOM   9488  N  N     . ARG B  1  504 ? 56.964  10.536 -15.278 1.00 37.95  ? 1303 ARG D N     1 
ATOM   9489  C  CA    . ARG B  1  504 ? 57.300  9.408  -16.124 1.00 40.17  ? 1303 ARG D CA    1 
ATOM   9490  C  C     . ARG B  1  504 ? 56.936  9.690  -17.581 1.00 39.66  ? 1303 ARG D C     1 
ATOM   9491  O  O     . ARG B  1  504 ? 55.798  9.540  -17.974 1.00 42.36  ? 1303 ARG D O     1 
ATOM   9492  C  CB    . ARG B  1  504 ? 56.546  8.154  -15.686 1.00 42.32  ? 1303 ARG D CB    1 
ATOM   9493  C  CG    . ARG B  1  504 ? 56.764  6.974  -16.619 1.00 44.21  ? 1303 ARG D CG    1 
ATOM   9494  C  CD    . ARG B  1  504 ? 56.081  5.707  -16.113 1.00 48.12  ? 1303 ARG D CD    1 
ATOM   9495  N  NE    . ARG B  1  504 ? 56.168  4.646  -17.109 1.00 50.38  ? 1303 ARG D NE    1 
ATOM   9496  C  CZ    . ARG B  1  504 ? 57.167  3.780  -17.179 1.00 53.12  ? 1303 ARG D CZ    1 
ATOM   9497  N  NH1   . ARG B  1  504 ? 58.178  3.826  -16.288 1.00 52.34  ? 1303 ARG D NH1   1 
ATOM   9498  N  NH2   . ARG B  1  504 ? 57.175  2.860  -18.131 1.00 55.42  ? 1303 ARG D NH2   1 
ATOM   9499  N  N     . VAL B  1  505 ? 57.926  10.099 -18.369 1.00 41.84  ? 1304 VAL D N     1 
ATOM   9500  C  CA    . VAL B  1  505 ? 57.709  10.390 -19.775 1.00 41.61  ? 1304 VAL D CA    1 
ATOM   9501  C  C     . VAL B  1  505 ? 58.380  9.270  -20.581 1.00 44.83  ? 1304 VAL D C     1 
ATOM   9502  O  O     . VAL B  1  505 ? 59.582  9.019  -20.434 1.00 41.81  ? 1304 VAL D O     1 
ATOM   9503  C  CB    . VAL B  1  505 ? 58.299  11.764 -20.166 1.00 40.99  ? 1304 VAL D CB    1 
ATOM   9504  C  CG1   . VAL B  1  505 ? 58.154  12.008 -21.665 1.00 39.14  ? 1304 VAL D CG1   1 
ATOM   9505  C  CG2   . VAL B  1  505 ? 57.623  12.857 -19.386 1.00 38.41  ? 1304 VAL D CG2   1 
ATOM   9506  N  N     . VAL B  1  506 ? 57.597  8.617  -21.427 1.00 48.60  ? 1305 VAL D N     1 
ATOM   9507  C  CA    . VAL B  1  506 ? 58.044  7.441  -22.165 1.00 49.93  ? 1305 VAL D CA    1 
ATOM   9508  C  C     . VAL B  1  506 ? 58.226  7.811  -23.626 1.00 49.23  ? 1305 VAL D C     1 
ATOM   9509  O  O     . VAL B  1  506 ? 57.340  8.421  -24.238 1.00 51.64  ? 1305 VAL D O     1 
ATOM   9510  C  CB    . VAL B  1  506 ? 57.049  6.272  -22.028 1.00 54.01  ? 1305 VAL D CB    1 
ATOM   9511  C  CG1   . VAL B  1  506 ? 57.625  5.030  -22.685 1.00 57.00  ? 1305 VAL D CG1   1 
ATOM   9512  C  CG2   . VAL B  1  506 ? 56.763  6.007  -20.544 1.00 55.15  ? 1305 VAL D CG2   1 
ATOM   9513  N  N     . ILE B  1  507 ? 59.385  7.457  -24.182 1.00 46.37  ? 1306 ILE D N     1 
ATOM   9514  C  CA    . ILE B  1  507 ? 59.748  7.773  -25.558 1.00 48.79  ? 1306 ILE D CA    1 
ATOM   9515  C  C     . ILE B  1  507 ? 60.097  6.464  -26.251 1.00 48.70  ? 1306 ILE D C     1 
ATOM   9516  O  O     . ILE B  1  507 ? 61.171  5.893  -26.010 1.00 48.04  ? 1306 ILE D O     1 
ATOM   9517  C  CB    . ILE B  1  507 ? 60.921  8.749  -25.613 1.00 46.06  ? 1306 ILE D CB    1 
ATOM   9518  C  CG1   . ILE B  1  507 ? 60.653  9.947  -24.684 1.00 41.38  ? 1306 ILE D CG1   1 
ATOM   9519  C  CG2   . ILE B  1  507 ? 61.138  9.218  -27.056 1.00 47.53  ? 1306 ILE D CG2   1 
ATOM   9520  C  CD1   . ILE B  1  507 ? 61.893  10.742 -24.370 1.00 44.40  ? 1306 ILE D CD1   1 
ATOM   9521  N  N     . ASP B  1  508 ? 59.177  5.959  -27.061 1.00 53.98  ? 1307 ASP D N     1 
ATOM   9522  C  CA    . ASP B  1  508 ? 59.405  4.690  -27.739 1.00 54.89  ? 1307 ASP D CA    1 
ATOM   9523  C  C     . ASP B  1  508 ? 60.317  4.868  -28.938 1.00 52.95  ? 1307 ASP D C     1 
ATOM   9524  O  O     . ASP B  1  508 ? 60.171  5.810  -29.694 1.00 56.60  ? 1307 ASP D O     1 
ATOM   9525  C  CB    . ASP B  1  508 ? 58.083  4.050  -28.134 1.00 57.68  ? 1307 ASP D CB    1 
ATOM   9526  C  CG    . ASP B  1  508 ? 57.459  3.264  -26.983 1.00 59.88  ? 1307 ASP D CG    1 
ATOM   9527  O  OD1   . ASP B  1  508 ? 58.196  2.847  -26.091 1.00 59.03  ? 1307 ASP D OD1   1 
ATOM   9528  O  OD2   . ASP B  1  508 ? 56.228  3.078  -26.975 1.00 59.13  ? 1307 ASP D OD2   1 
ATOM   9529  N  N     . VAL B  1  509 ? 61.257  3.953  -29.098 1.00 52.84  ? 1308 VAL D N     1 
ATOM   9530  C  CA    . VAL B  1  509 ? 62.205  4.012  -30.211 1.00 55.92  ? 1308 VAL D CA    1 
ATOM   9531  C  C     . VAL B  1  509 ? 61.996  2.926  -31.264 1.00 57.70  ? 1308 VAL D C     1 
ATOM   9532  O  O     . VAL B  1  509 ? 61.640  1.799  -30.957 1.00 56.40  ? 1308 VAL D O     1 
ATOM   9533  C  CB    . VAL B  1  509 ? 63.652  3.954  -29.692 1.00 53.77  ? 1308 VAL D CB    1 
ATOM   9534  C  CG1   . VAL B  1  509 ? 64.628  4.237  -30.808 1.00 52.20  ? 1308 VAL D CG1   1 
ATOM   9535  C  CG2   . VAL B  1  509 ? 63.840  4.954  -28.557 1.00 52.64  ? 1308 VAL D CG2   1 
ATOM   9536  N  N     . ARG B  1  510 ? 62.219  3.291  -32.516 1.00 62.24  ? 1309 ARG D N     1 
ATOM   9537  C  CA    . ARG B  1  510 ? 62.076  2.386  -33.651 1.00 64.15  ? 1309 ARG D CA    1 
ATOM   9538  C  C     . ARG B  1  510 ? 63.115  1.300  -33.547 1.00 63.57  ? 1309 ARG D C     1 
ATOM   9539  O  O     . ARG B  1  510 ? 64.254  1.557  -33.191 1.00 61.12  ? 1309 ARG D O     1 
ATOM   9540  C  CB    . ARG B  1  510 ? 62.257  3.143  -34.945 1.00 68.34  ? 1309 ARG D CB    1 
ATOM   9541  C  CG    . ARG B  1  510 ? 61.350  2.723  -36.085 1.00 74.69  ? 1309 ARG D CG    1 
ATOM   9542  C  CD    . ARG B  1  510 ? 61.735  3.396  -37.398 1.00 79.27  ? 1309 ARG D CD    1 
ATOM   9543  N  NE    . ARG B  1  510 ? 63.172  3.655  -37.481 1.00 84.38  ? 1309 ARG D NE    1 
ATOM   9544  C  CZ    . ARG B  1  510 ? 63.726  4.818  -37.828 1.00 85.21  ? 1309 ARG D CZ    1 
ATOM   9545  N  NH1   . ARG B  1  510 ? 62.977  5.860  -38.163 1.00 86.19  ? 1309 ARG D NH1   1 
ATOM   9546  N  NH2   . ARG B  1  510 ? 65.037  4.928  -37.840 1.00 88.16  ? 1309 ARG D NH2   1 
ATOM   9547  N  N     . LYS B  1  511 ? 62.717  0.065  -33.860 1.00 65.55  ? 1310 LYS D N     1 
ATOM   9548  C  CA    . LYS B  1  511 ? 63.628  -1.063 -33.781 1.00 65.02  ? 1310 LYS D CA    1 
ATOM   9549  C  C     . LYS B  1  511 ? 64.914  -0.792 -34.520 1.00 68.83  ? 1310 LYS D C     1 
ATOM   9550  O  O     . LYS B  1  511 ? 64.909  -0.211 -35.618 1.00 73.86  ? 1310 LYS D O     1 
ATOM   9551  C  CB    . LYS B  1  511 ? 62.963  -2.310 -34.371 1.00 66.07  ? 1310 LYS D CB    1 
ATOM   9552  C  CG    . LYS B  1  511 ? 63.559  -3.625 -33.866 1.00 61.50  ? 1310 LYS D CG    1 
ATOM   9553  N  N     . ASP B  1  512 ? 66.022  -1.205 -33.922 1.00 70.68  ? 1311 ASP D N     1 
ATOM   9554  C  CA    . ASP B  1  512 ? 67.343  -1.015 -34.526 1.00 77.20  ? 1311 ASP D CA    1 
ATOM   9555  C  C     . ASP B  1  512 ? 67.870  0.423  -34.514 1.00 75.33  ? 1311 ASP D C     1 
ATOM   9556  O  O     . ASP B  1  512 ? 69.043  0.645  -34.750 1.00 75.16  ? 1311 ASP D O     1 
ATOM   9557  C  CB    . ASP B  1  512 ? 67.417  -1.571 -35.946 1.00 83.20  ? 1311 ASP D CB    1 
ATOM   9558  C  CG    . ASP B  1  512 ? 67.058  -3.055 -36.004 1.00 87.15  ? 1311 ASP D CG    1 
ATOM   9559  O  OD1   . ASP B  1  512 ? 67.696  -3.844 -35.232 1.00 84.71  ? 1311 ASP D OD1   1 
ATOM   9560  O  OD2   . ASP B  1  512 ? 66.163  -3.455 -36.783 1.00 90.01  ? 1311 ASP D OD2   1 
ATOM   9561  N  N     . ALA B  1  513 ? 67.006  1.381  -34.200 1.00 74.05  ? 1312 ALA D N     1 
ATOM   9562  C  CA    . ALA B  1  513 ? 67.440  2.764  -34.083 1.00 69.68  ? 1312 ALA D CA    1 
ATOM   9563  C  C     . ALA B  1  513 ? 68.270  2.867  -32.807 1.00 66.23  ? 1312 ALA D C     1 
ATOM   9564  O  O     . ALA B  1  513 ? 67.996  2.160  -31.836 1.00 63.46  ? 1312 ALA D O     1 
ATOM   9565  C  CB    . ALA B  1  513 ? 66.253  3.695  -34.029 1.00 69.69  ? 1312 ALA D CB    1 
ATOM   9566  N  N     . ASN B  1  514 ? 69.296  3.712  -32.800 1.00 63.26  ? 1313 ASN D N     1 
ATOM   9567  C  CA    . ASN B  1  514 ? 70.103  3.830  -31.599 1.00 63.98  ? 1313 ASN D CA    1 
ATOM   9568  C  C     . ASN B  1  514 ? 69.429  4.758  -30.585 1.00 62.48  ? 1313 ASN D C     1 
ATOM   9569  O  O     . ASN B  1  514 ? 69.236  5.942  -30.870 1.00 58.19  ? 1313 ASN D O     1 
ATOM   9570  C  CB    . ASN B  1  514 ? 71.513  4.330  -31.945 1.00 65.38  ? 1313 ASN D CB    1 
ATOM   9571  C  CG    . ASN B  1  514 ? 72.513  4.080  -30.827 1.00 66.40  ? 1313 ASN D CG    1 
ATOM   9572  O  OD1   . ASN B  1  514 ? 72.188  4.186  -29.646 1.00 66.99  ? 1313 ASN D OD1   1 
ATOM   9573  N  ND2   . ASN B  1  514 ? 73.726  3.736  -31.193 1.00 71.64  ? 1313 ASN D ND2   1 
ATOM   9574  N  N     . ALA B  1  515 ? 69.090  4.229  -29.422 1.00 60.63  ? 1314 ALA D N     1 
ATOM   9575  C  CA    . ALA B  1  515 ? 68.415  5.014  -28.402 1.00 57.79  ? 1314 ALA D CA    1 
ATOM   9576  C  C     . ALA B  1  515 ? 69.379  5.968  -27.688 1.00 56.64  ? 1314 ALA D C     1 
ATOM   9577  O  O     . ALA B  1  515 ? 68.957  7.029  -27.212 1.00 55.58  ? 1314 ALA D O     1 
ATOM   9578  C  CB    . ALA B  1  515 ? 67.704  4.136  -27.386 1.00 52.96  ? 1314 ALA D CB    1 
ATOM   9579  N  N     . SER B  1  516 ? 70.653  5.593  -27.593 1.00 58.52  ? 1315 SER D N     1 
ATOM   9580  C  CA    . SER B  1  516 ? 71.643  6.480  -27.012 1.00 59.17  ? 1315 SER D CA    1 
ATOM   9581  C  C     . SER B  1  516 ? 71.829  7.735  -27.866 1.00 58.94  ? 1315 SER D C     1 
ATOM   9582  O  O     . SER B  1  516 ? 72.025  8.834  -27.333 1.00 55.47  ? 1315 SER D O     1 
ATOM   9583  C  CB    . SER B  1  516 ? 72.981  5.768  -26.859 1.00 62.05  ? 1315 SER D CB    1 
ATOM   9584  O  OG    . SER B  1  516 ? 72.811  4.610  -26.043 1.00 74.73  ? 1315 SER D OG    1 
ATOM   9585  N  N     . VAL B  1  517 ? 71.772  7.573  -29.181 1.00 56.92  ? 1316 VAL D N     1 
ATOM   9586  C  CA    . VAL B  1  517 ? 71.943  8.708  -30.083 1.00 53.18  ? 1316 VAL D CA    1 
ATOM   9587  C  C     . VAL B  1  517 ? 70.741  9.645  -29.991 1.00 50.95  ? 1316 VAL D C     1 
ATOM   9588  O  O     . VAL B  1  517 ? 70.889  10.871 -29.990 1.00 51.81  ? 1316 VAL D O     1 
ATOM   9589  C  CB    . VAL B  1  517 ? 72.155  8.211  -31.532 1.00 55.48  ? 1316 VAL D CB    1 
ATOM   9590  C  CG1   . VAL B  1  517 ? 72.139  9.380  -32.489 1.00 53.86  ? 1316 VAL D CG1   1 
ATOM   9591  C  CG2   . VAL B  1  517 ? 73.483  7.478  -31.624 1.00 55.71  ? 1316 VAL D CG2   1 
ATOM   9592  N  N     . ILE B  1  518 ? 69.540  9.095  -29.919 1.00 45.68  ? 1317 ILE D N     1 
ATOM   9593  C  CA    . ILE B  1  518 ? 68.348  9.930  -29.838 1.00 45.66  ? 1317 ILE D CA    1 
ATOM   9594  C  C     . ILE B  1  518 ? 68.301  10.683 -28.508 1.00 42.26  ? 1317 ILE D C     1 
ATOM   9595  O  O     . ILE B  1  518 ? 68.007  11.879 -28.476 1.00 43.68  ? 1317 ILE D O     1 
ATOM   9596  C  CB    . ILE B  1  518 ? 67.069  9.085  -30.034 1.00 43.08  ? 1317 ILE D CB    1 
ATOM   9597  C  CG1   . ILE B  1  518 ? 67.086  8.465  -31.456 1.00 44.22  ? 1317 ILE D CG1   1 
ATOM   9598  C  CG2   . ILE B  1  518 ? 65.847  9.940  -29.849 1.00 44.43  ? 1317 ILE D CG2   1 
ATOM   9599  C  CD1   . ILE B  1  518 ? 66.078  7.324  -31.548 1.00 45.42  ? 1317 ILE D CD1   1 
ATOM   9600  N  N     . LEU B  1  519 ? 68.642  9.996  -27.408 1.00 42.65  ? 1318 LEU D N     1 
ATOM   9601  C  CA    . LEU B  1  519 ? 68.605  10.634 -26.096 1.00 43.10  ? 1318 LEU D CA    1 
ATOM   9602  C  C     . LEU B  1  519 ? 69.597  11.787 -26.020 1.00 44.26  ? 1318 LEU D C     1 
ATOM   9603  O  O     . LEU B  1  519 ? 69.266  12.869 -25.526 1.00 41.37  ? 1318 LEU D O     1 
ATOM   9604  C  CB    . LEU B  1  519 ? 68.882  9.599  -25.010 1.00 43.53  ? 1318 LEU D CB    1 
ATOM   9605  C  CG    . LEU B  1  519 ? 68.834  10.073 -23.556 1.00 43.09  ? 1318 LEU D CG    1 
ATOM   9606  C  CD1   . LEU B  1  519 ? 67.461  10.687 -23.239 1.00 41.74  ? 1318 LEU D CD1   1 
ATOM   9607  C  CD2   . LEU B  1  519 ? 69.135  8.935  -22.602 1.00 44.98  ? 1318 LEU D CD2   1 
ATOM   9608  N  N     . ASN B  1  520 ? 70.820  11.574 -26.519 1.00 48.97  ? 1319 ASN D N     1 
ATOM   9609  C  CA    . ASN B  1  520 ? 71.821  12.642 -26.521 1.00 48.33  ? 1319 ASN D CA    1 
ATOM   9610  C  C     . ASN B  1  520 ? 71.362  13.832 -27.365 1.00 47.72  ? 1319 ASN D C     1 
ATOM   9611  O  O     . ASN B  1  520 ? 71.600  14.979 -26.998 1.00 46.88  ? 1319 ASN D O     1 
ATOM   9612  C  CB    . ASN B  1  520 ? 73.158  12.116 -27.030 1.00 58.49  ? 1319 ASN D CB    1 
ATOM   9613  C  CG    . ASN B  1  520 ? 73.873  11.259 -26.010 1.00 63.94  ? 1319 ASN D CG    1 
ATOM   9614  O  OD1   . ASN B  1  520 ? 73.275  10.842 -25.017 1.00 68.48  ? 1319 ASN D OD1   1 
ATOM   9615  N  ND2   . ASN B  1  520 ? 75.156  11.004 -26.242 1.00 69.12  ? 1319 ASN D ND2   1 
ATOM   9616  N  N     . ASN B  1  521 ? 70.699  13.560 -28.491 1.00 45.06  ? 1320 ASN D N     1 
ATOM   9617  C  CA    . ASN B  1  521 ? 70.160  14.645 -29.297 1.00 45.74  ? 1320 ASN D CA    1 
ATOM   9618  C  C     . ASN B  1  521 ? 69.014  15.354 -28.574 1.00 44.83  ? 1320 ASN D C     1 
ATOM   9619  O  O     . ASN B  1  521 ? 68.882  16.571 -28.684 1.00 45.72  ? 1320 ASN D O     1 
ATOM   9620  C  CB    . ASN B  1  521 ? 69.675  14.118 -30.655 1.00 49.70  ? 1320 ASN D CB    1 
ATOM   9621  C  CG    . ASN B  1  521 ? 70.790  13.843 -31.620 1.00 54.95  ? 1320 ASN D CG    1 
ATOM   9622  O  OD1   . ASN B  1  521 ? 71.753  14.598 -31.705 1.00 58.22  ? 1320 ASN D OD1   1 
ATOM   9623  N  ND2   . ASN B  1  521 ? 70.663  12.749 -32.361 1.00 53.16  ? 1320 ASN D ND2   1 
ATOM   9624  N  N     . LEU B  1  522 ? 68.211  14.608 -27.825 1.00 42.45  ? 1321 LEU D N     1 
ATOM   9625  C  CA    . LEU B  1  522 ? 67.123  15.220 -27.068 1.00 42.80  ? 1321 LEU D CA    1 
ATOM   9626  C  C     . LEU B  1  522 ? 67.670  16.175 -25.992 1.00 41.65  ? 1321 LEU D C     1 
ATOM   9627  O  O     . LEU B  1  522 ? 67.078  17.229 -25.741 1.00 40.01  ? 1321 LEU D O     1 
ATOM   9628  C  CB    . LEU B  1  522 ? 66.251  14.138 -26.417 1.00 43.31  ? 1321 LEU D CB    1 
ATOM   9629  C  CG    . LEU B  1  522 ? 65.290  13.415 -27.371 1.00 45.19  ? 1321 LEU D CG    1 
ATOM   9630  C  CD1   . LEU B  1  522 ? 64.731  12.153 -26.650 1.00 42.48  ? 1321 LEU D CD1   1 
ATOM   9631  C  CD2   . LEU B  1  522 ? 64.163  14.339 -27.927 1.00 46.42  ? 1321 LEU D CD2   1 
ATOM   9632  N  N     . TYR B  1  523 ? 68.789  15.816 -25.367 1.00 38.77  ? 1322 TYR D N     1 
ATOM   9633  C  CA    . TYR B  1  523 ? 69.439  16.752 -24.457 1.00 38.65  ? 1322 TYR D CA    1 
ATOM   9634  C  C     . TYR B  1  523 ? 69.815  18.055 -25.157 1.00 40.86  ? 1322 TYR D C     1 
ATOM   9635  O  O     . TYR B  1  523 ? 69.604  19.138 -24.606 1.00 42.27  ? 1322 TYR D O     1 
ATOM   9636  C  CB    . TYR B  1  523 ? 70.706  16.105 -23.852 1.00 39.87  ? 1322 TYR D CB    1 
ATOM   9637  C  CG    . TYR B  1  523 ? 70.451  14.908 -22.973 1.00 40.08  ? 1322 TYR D CG    1 
ATOM   9638  C  CD1   . TYR B  1  523 ? 69.373  14.865 -22.087 1.00 40.44  ? 1322 TYR D CD1   1 
ATOM   9639  C  CD2   . TYR B  1  523 ? 71.295  13.807 -23.025 1.00 43.55  ? 1322 TYR D CD2   1 
ATOM   9640  C  CE1   . TYR B  1  523 ? 69.155  13.759 -21.276 1.00 40.44  ? 1322 TYR D CE1   1 
ATOM   9641  C  CE2   . TYR B  1  523 ? 71.084  12.692 -22.219 1.00 40.78  ? 1322 TYR D CE2   1 
ATOM   9642  C  CZ    . TYR B  1  523 ? 70.021  12.678 -21.356 1.00 41.86  ? 1322 TYR D CZ    1 
ATOM   9643  O  OH    . TYR B  1  523 ? 69.820  11.570 -20.555 1.00 44.65  ? 1322 TYR D OH    1 
ATOM   9644  N  N     . LYS B  1  524 ? 70.344  17.954 -26.388 1.00 40.30  ? 1323 LYS D N     1 
ATOM   9645  C  CA    . LYS B  1  524 ? 70.871  19.113 -27.099 1.00 39.48  ? 1323 LYS D CA    1 
ATOM   9646  C  C     . LYS B  1  524 ? 69.785  19.938 -27.755 1.00 39.85  ? 1323 LYS D C     1 
ATOM   9647  O  O     . LYS B  1  524 ? 70.000  21.142 -27.996 1.00 43.94  ? 1323 LYS D O     1 
ATOM   9648  C  CB    . LYS B  1  524 ? 71.910  18.680 -28.141 1.00 40.90  ? 1323 LYS D CB    1 
ATOM   9649  N  N     . GLN B  1  525 ? 68.637  19.357 -28.056 1.00 38.87  ? 1324 GLN D N     1 
ATOM   9650  C  CA    . GLN B  1  525 ? 67.584  20.044 -28.813 1.00 41.03  ? 1324 GLN D CA    1 
ATOM   9651  C  C     . GLN B  1  525 ? 66.331  20.385 -28.038 1.00 39.39  ? 1324 GLN D C     1 
ATOM   9652  O  O     . GLN B  1  525 ? 65.497  21.093 -28.567 1.00 39.43  ? 1324 GLN D O     1 
ATOM   9653  C  CB    . GLN B  1  525 ? 67.213  19.210 -30.050 1.00 43.10  ? 1324 GLN D CB    1 
ATOM   9654  C  CG    . GLN B  1  525 ? 68.394  18.834 -30.942 1.00 49.10  ? 1324 GLN D CG    1 
ATOM   9655  C  CD    . GLN B  1  525 ? 67.968  18.138 -32.208 1.00 54.32  ? 1324 GLN D CD    1 
ATOM   9656  O  OE1   . GLN B  1  525 ? 67.074  18.610 -32.935 1.00 59.14  ? 1324 GLN D OE1   1 
ATOM   9657  N  NE2   . GLN B  1  525 ? 68.599  17.001 -32.488 1.00 55.39  ? 1324 GLN D NE2   1 
ATOM   9658  N  N     . THR B  1  526 ? 66.172  19.866 -26.819 1.00 38.22  ? 1325 THR D N     1 
ATOM   9659  C  CA    . THR B  1  526 ? 64.958  20.056 -26.019 1.00 35.80  ? 1325 THR D CA    1 
ATOM   9660  C  C     . THR B  1  526 ? 65.366  20.511 -24.627 1.00 37.13  ? 1325 THR D C     1 
ATOM   9661  O  O     . THR B  1  526 ? 66.536  20.422 -24.238 1.00 37.05  ? 1325 THR D O     1 
ATOM   9662  C  CB    . THR B  1  526 ? 64.120  18.780 -25.932 1.00 35.82  ? 1325 THR D CB    1 
ATOM   9663  O  OG1   . THR B  1  526 ? 64.663  17.909 -24.934 1.00 40.56  ? 1325 THR D OG1   1 
ATOM   9664  C  CG2   . THR B  1  526 ? 64.108  18.025 -27.259 1.00 38.39  ? 1325 THR D CG2   1 
ATOM   9665  N  N     . PRO B  1  527 ? 64.401  20.850 -23.792 1.00 36.86  ? 1326 PRO D N     1 
ATOM   9666  C  CA    . PRO B  1  527 ? 64.673  21.274 -22.426 1.00 36.41  ? 1326 PRO D CA    1 
ATOM   9667  C  C     . PRO B  1  527 ? 65.023  20.068 -21.532 1.00 35.29  ? 1326 PRO D C     1 
ATOM   9668  O  O     . PRO B  1  527 ? 65.149  20.217 -20.330 1.00 34.69  ? 1326 PRO D O     1 
ATOM   9669  C  CB    . PRO B  1  527 ? 63.368  21.916 -21.995 1.00 35.64  ? 1326 PRO D CB    1 
ATOM   9670  C  CG    . PRO B  1  527 ? 62.906  22.565 -23.258 1.00 38.87  ? 1326 PRO D CG    1 
ATOM   9671  C  CD    . PRO B  1  527 ? 63.258  21.572 -24.360 1.00 36.02  ? 1326 PRO D CD    1 
ATOM   9672  N  N     . LEU B  1  528 ? 65.167  18.902 -22.140 1.00 32.76  ? 1327 LEU D N     1 
ATOM   9673  C  CA    . LEU B  1  528 ? 65.501  17.695 -21.420 1.00 33.71  ? 1327 LEU D CA    1 
ATOM   9674  C  C     . LEU B  1  528 ? 66.853  17.929 -20.703 1.00 32.11  ? 1327 LEU D C     1 
ATOM   9675  O  O     . LEU B  1  528 ? 67.078  17.397 -19.653 1.00 31.30  ? 1327 LEU D O     1 
ATOM   9676  C  CB    . LEU B  1  528 ? 65.565  16.492 -22.393 1.00 36.19  ? 1327 LEU D CB    1 
ATOM   9677  C  CG    . LEU B  1  528 ? 65.323  15.161 -21.689 1.00 39.84  ? 1327 LEU D CG    1 
ATOM   9678  C  CD1   . LEU B  1  528 ? 63.952  15.028 -21.191 1.00 40.13  ? 1327 LEU D CD1   1 
ATOM   9679  C  CD2   . LEU B  1  528 ? 65.676  14.004 -22.622 1.00 43.51  ? 1327 LEU D CD2   1 
ATOM   9680  N  N     . GLN B  1  529 ? 67.676  18.781 -21.296 1.00 34.83  ? 1328 GLN D N     1 
ATOM   9681  C  CA    . GLN B  1  529 ? 68.894  19.220 -20.645 1.00 34.92  ? 1328 GLN D CA    1 
ATOM   9682  C  C     . GLN B  1  529 ? 68.765  20.722 -20.725 1.00 35.63  ? 1328 GLN D C     1 
ATOM   9683  O  O     . GLN B  1  529 ? 68.510  21.256 -21.792 1.00 33.24  ? 1328 GLN D O     1 
ATOM   9684  C  CB    . GLN B  1  529 ? 70.162  18.781 -21.321 1.00 37.15  ? 1328 GLN D CB    1 
ATOM   9685  C  CG    . GLN B  1  529 ? 71.386  19.350 -20.612 1.00 37.84  ? 1328 GLN D CG    1 
ATOM   9686  C  CD    . GLN B  1  529 ? 72.682  18.707 -21.092 1.00 38.94  ? 1328 GLN D CD    1 
ATOM   9687  O  OE1   . GLN B  1  529 ? 72.711  17.522 -21.395 1.00 38.15  ? 1328 GLN D OE1   1 
ATOM   9688  N  NE2   . GLN B  1  529 ? 73.748  19.463 -21.054 1.00 38.06