data_5O6I
# 
_entry.id   5O6I 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5O6I         
WWPDB D_1200005270 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5O6I 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Molina, R.'     1 ? 
'Marcaida, M.J.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Comput. Aided Mol. Des.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1573-4951 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            31 
_citation.language                  ? 
_citation.page_first                1063 
_citation.page_last                 1072 
_citation.title                     'Structure and dynamics of mesophilic variants from the homing endonuclease I-DmoI.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1007/s10822-017-0087-5 
_citation.pdbx_database_id_PubMed   29177929 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Alba, J.'       1 
primary 'Marcaida, M.J.' 2 
primary 'Prieto, J.'     3 
primary 'Montoya, G.'    4 
primary 'Molina, R.'     5 
primary 
;D'Abramo, M.
;
6 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   119.81 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5O6I 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     107.000 
_cell.length_a_esd                 ? 
_cell.length_b                     70.480 
_cell.length_b_esd                 ? 
_cell.length_c                     107.320 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5O6I 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Homing endonuclease I-DmoI' 23416.266 3   3.1.-.- ? ? ? 
2 polymer     syn 'DNA (25-MER)'               7707.932  3   ?       ? ? ? 
3 polymer     syn 'DNA (25-MER)'               7654.926  3   ?       ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'         54.938    6   ?       ? ? ? 
5 non-polymer syn 'CHLORIDE ION'               35.453    2   ?       ? ? ? 
6 water       nat water                        18.015    283 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MAHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHFAPLMQFLIDELNVKSKIQIVKGDTRYE
LRVSSKKLYYYFTNMLERIRLCNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHG
VYVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
;MAHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHFAPLMQFLIDELNVKSKIQIVKGDTRYE
LRVSSKKLYYYFTNMLERIRLCNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHG
VYVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
A,F,K ? 
2 polydeoxyribonucleotide no no 
;(DG)(DC)(DC)(DT)(DT)(DG)(DC)(DC)(DG)(DG)(DG)(DT)(DA)(DA)(DG)(DT)(DT)(DC)(DC)(DG)
(DG)(DC)(DG)(DC)(DG)
;
GCCTTGCCGGGTAAGTTCCGGCGCG C,G,L ? 
3 polydeoxyribonucleotide no no 
;(DC)(DG)(DC)(DG)(DC)(DC)(DG)(DG)(DA)(DA)(DC)(DT)(DT)(DA)(DC)(DC)(DC)(DG)(DG)(DC)
(DA)(DA)(DG)(DG)(DC)
;
CGCGCCGGAACTTACCCGGCAAGGC D,I,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   ASN n 
1 5   ASN n 
1 6   GLU n 
1 7   ASN n 
1 8   VAL n 
1 9   SER n 
1 10  GLY n 
1 11  ILE n 
1 12  SER n 
1 13  ALA n 
1 14  TYR n 
1 15  LEU n 
1 16  LEU n 
1 17  GLY n 
1 18  LEU n 
1 19  ILE n 
1 20  ILE n 
1 21  GLY n 
1 22  ASP n 
1 23  GLY n 
1 24  GLY n 
1 25  LEU n 
1 26  TYR n 
1 27  LYS n 
1 28  LEU n 
1 29  LYS n 
1 30  TYR n 
1 31  LYS n 
1 32  GLY n 
1 33  ASN n 
1 34  ARG n 
1 35  SER n 
1 36  GLU n 
1 37  TYR n 
1 38  ARG n 
1 39  VAL n 
1 40  VAL n 
1 41  ILE n 
1 42  THR n 
1 43  GLN n 
1 44  LYS n 
1 45  SER n 
1 46  GLU n 
1 47  ASN n 
1 48  LEU n 
1 49  ILE n 
1 50  LYS n 
1 51  GLN n 
1 52  HIS n 
1 53  PHE n 
1 54  ALA n 
1 55  PRO n 
1 56  LEU n 
1 57  MET n 
1 58  GLN n 
1 59  PHE n 
1 60  LEU n 
1 61  ILE n 
1 62  ASP n 
1 63  GLU n 
1 64  LEU n 
1 65  ASN n 
1 66  VAL n 
1 67  LYS n 
1 68  SER n 
1 69  LYS n 
1 70  ILE n 
1 71  GLN n 
1 72  ILE n 
1 73  VAL n 
1 74  LYS n 
1 75  GLY n 
1 76  ASP n 
1 77  THR n 
1 78  ARG n 
1 79  TYR n 
1 80  GLU n 
1 81  LEU n 
1 82  ARG n 
1 83  VAL n 
1 84  SER n 
1 85  SER n 
1 86  LYS n 
1 87  LYS n 
1 88  LEU n 
1 89  TYR n 
1 90  TYR n 
1 91  TYR n 
1 92  PHE n 
1 93  THR n 
1 94  ASN n 
1 95  MET n 
1 96  LEU n 
1 97  GLU n 
1 98  ARG n 
1 99  ILE n 
1 100 ARG n 
1 101 LEU n 
1 102 CYS n 
1 103 ASN n 
1 104 MET n 
1 105 ARG n 
1 106 GLU n 
1 107 GLN n 
1 108 ILE n 
1 109 ALA n 
1 110 PHE n 
1 111 ILE n 
1 112 LYS n 
1 113 GLY n 
1 114 LEU n 
1 115 TYR n 
1 116 VAL n 
1 117 ALA n 
1 118 GLU n 
1 119 GLY n 
1 120 ASP n 
1 121 LYS n 
1 122 THR n 
1 123 LEU n 
1 124 LYS n 
1 125 ARG n 
1 126 LEU n 
1 127 ARG n 
1 128 ILE n 
1 129 TRP n 
1 130 ASN n 
1 131 LYS n 
1 132 ASN n 
1 133 LYS n 
1 134 ALA n 
1 135 LEU n 
1 136 LEU n 
1 137 GLU n 
1 138 ILE n 
1 139 VAL n 
1 140 SER n 
1 141 ARG n 
1 142 TRP n 
1 143 LEU n 
1 144 ASN n 
1 145 ASN n 
1 146 LEU n 
1 147 GLY n 
1 148 VAL n 
1 149 ARG n 
1 150 ASN n 
1 151 THR n 
1 152 ILE n 
1 153 HIS n 
1 154 LEU n 
1 155 ASP n 
1 156 ASP n 
1 157 HIS n 
1 158 ARG n 
1 159 HIS n 
1 160 GLY n 
1 161 VAL n 
1 162 TYR n 
1 163 VAL n 
1 164 LEU n 
1 165 ASN n 
1 166 ILE n 
1 167 SER n 
1 168 LEU n 
1 169 ARG n 
1 170 ASP n 
1 171 ARG n 
1 172 ILE n 
1 173 LYS n 
1 174 PHE n 
1 175 VAL n 
1 176 HIS n 
1 177 THR n 
1 178 ILE n 
1 179 LEU n 
1 180 SER n 
1 181 SER n 
1 182 HIS n 
1 183 LEU n 
1 184 ASN n 
1 185 PRO n 
1 186 LEU n 
1 187 PRO n 
1 188 PRO n 
1 189 GLU n 
1 190 ALA n 
1 191 ALA n 
1 192 ALA n 
1 193 LEU n 
1 194 GLU n 
1 195 HIS n 
1 196 HIS n 
1 197 HIS n 
1 198 HIS n 
1 199 HIS n 
1 200 HIS n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DT  n 
2 6   DG  n 
2 7   DC  n 
2 8   DC  n 
2 9   DG  n 
2 10  DG  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
2 16  DT  n 
2 17  DT  n 
2 18  DC  n 
2 19  DC  n 
2 20  DG  n 
2 21  DG  n 
2 22  DC  n 
2 23  DG  n 
2 24  DC  n 
2 25  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DC  n 
3 6   DC  n 
3 7   DG  n 
3 8   DG  n 
3 9   DA  n 
3 10  DA  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DA  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DG  n 
3 19  DG  n 
3 20  DC  n 
3 21  DA  n 
3 22  DA  n 
3 23  DG  n 
3 24  DG  n 
3 25  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   200 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Desulfurococcus mucosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2275 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 25 'synthetic construct' ? 32630 ? 
3 1 sample 1 25 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DMO1_DESMO P21505 ? 1 
;HNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELR
VSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVY
VLNISLRDRIKFVHTILSSHLNPLPPE
;
2 
2 PDB 5O6I       5O6I   ? 2 ? 1 
3 PDB 5O6I       5O6I   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5O6I A 3 ? 189 ? P21505 2 ? 188 ? 2 188 
2 2 5O6I C 1 ? 25  ? 5O6I   1 ? 25  ? 1 25  
3 3 5O6I D 1 ? 25  ? 5O6I   1 ? 25  ? 1 25  
4 1 5O6I F 3 ? 189 ? P21505 2 ? 188 ? 2 188 
5 2 5O6I G 1 ? 25  ? 5O6I   1 ? 25  ? 1 25  
6 3 5O6I I 1 ? 25  ? 5O6I   1 ? 25  ? 1 25  
7 1 5O6I K 3 ? 189 ? P21505 2 ? 188 ? 2 188 
8 2 5O6I L 1 ? 25  ? 5O6I   1 ? 25  ? 1 25  
9 3 5O6I N 1 ? 25  ? 5O6I   1 ? 25  ? 1 25  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5O6I MET A 1   ? UNP P21505 ?   ?   'initiating methionine' 0   1  
1 5O6I ALA A 2   ? UNP P21505 ?   ?   'expression tag'        1   2  
1 5O6I PHE A 53  ? UNP P21505 ILE 52  conflict                52  3  
1 5O6I THR A 93  ? UNP P21505 ALA 92  conflict                92  4  
1 5O6I CYS A 102 ? UNP P21505 PHE 101 conflict                101 5  
1 5O6I ALA A 190 ? UNP P21505 ?   ?   'expression tag'        189 6  
1 5O6I ALA A 191 ? UNP P21505 ?   ?   'expression tag'        190 7  
1 5O6I ALA A 192 ? UNP P21505 ?   ?   'expression tag'        191 8  
1 5O6I LEU A 193 ? UNP P21505 ?   ?   'expression tag'        192 9  
1 5O6I GLU A 194 ? UNP P21505 ?   ?   'expression tag'        193 10 
1 5O6I HIS A 195 ? UNP P21505 ?   ?   'expression tag'        194 11 
1 5O6I HIS A 196 ? UNP P21505 ?   ?   'expression tag'        195 12 
1 5O6I HIS A 197 ? UNP P21505 ?   ?   'expression tag'        196 13 
1 5O6I HIS A 198 ? UNP P21505 ?   ?   'expression tag'        197 14 
1 5O6I HIS A 199 ? UNP P21505 ?   ?   'expression tag'        198 15 
1 5O6I HIS A 200 ? UNP P21505 ?   ?   'expression tag'        199 16 
4 5O6I MET F 1   ? UNP P21505 ?   ?   'initiating methionine' 0   17 
4 5O6I ALA F 2   ? UNP P21505 ?   ?   'expression tag'        1   18 
4 5O6I PHE F 53  ? UNP P21505 ILE 52  conflict                52  19 
4 5O6I THR F 93  ? UNP P21505 ALA 92  conflict                92  20 
4 5O6I CYS F 102 ? UNP P21505 PHE 101 conflict                101 21 
4 5O6I ALA F 190 ? UNP P21505 ?   ?   'expression tag'        189 22 
4 5O6I ALA F 191 ? UNP P21505 ?   ?   'expression tag'        190 23 
4 5O6I ALA F 192 ? UNP P21505 ?   ?   'expression tag'        191 24 
4 5O6I LEU F 193 ? UNP P21505 ?   ?   'expression tag'        192 25 
4 5O6I GLU F 194 ? UNP P21505 ?   ?   'expression tag'        193 26 
4 5O6I HIS F 195 ? UNP P21505 ?   ?   'expression tag'        194 27 
4 5O6I HIS F 196 ? UNP P21505 ?   ?   'expression tag'        195 28 
4 5O6I HIS F 197 ? UNP P21505 ?   ?   'expression tag'        196 29 
4 5O6I HIS F 198 ? UNP P21505 ?   ?   'expression tag'        197 30 
4 5O6I HIS F 199 ? UNP P21505 ?   ?   'expression tag'        198 31 
4 5O6I HIS F 200 ? UNP P21505 ?   ?   'expression tag'        199 32 
7 5O6I MET K 1   ? UNP P21505 ?   ?   'initiating methionine' 0   33 
7 5O6I ALA K 2   ? UNP P21505 ?   ?   'expression tag'        1   34 
7 5O6I PHE K 53  ? UNP P21505 ILE 52  conflict                52  35 
7 5O6I THR K 93  ? UNP P21505 ALA 92  conflict                92  36 
7 5O6I CYS K 102 ? UNP P21505 PHE 101 conflict                101 37 
7 5O6I ALA K 190 ? UNP P21505 ?   ?   'expression tag'        189 38 
7 5O6I ALA K 191 ? UNP P21505 ?   ?   'expression tag'        190 39 
7 5O6I ALA K 192 ? UNP P21505 ?   ?   'expression tag'        191 40 
7 5O6I LEU K 193 ? UNP P21505 ?   ?   'expression tag'        192 41 
7 5O6I GLU K 194 ? UNP P21505 ?   ?   'expression tag'        193 42 
7 5O6I HIS K 195 ? UNP P21505 ?   ?   'expression tag'        194 43 
7 5O6I HIS K 196 ? UNP P21505 ?   ?   'expression tag'        195 44 
7 5O6I HIS K 197 ? UNP P21505 ?   ?   'expression tag'        196 45 
7 5O6I HIS K 198 ? UNP P21505 ?   ?   'expression tag'        197 46 
7 5O6I HIS K 199 ? UNP P21505 ?   ?   'expression tag'        198 47 
7 5O6I HIS K 200 ? UNP P21505 ?   ?   'expression tag'        199 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                       ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5O6I 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.02 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.25 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '5-6 % PEG4000, 0.07 M NaAc pH = 4.6-5.5 and 30% Glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-06-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5O6I 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.25 
_reflns.d_resolution_low                 56.14 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       64736 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5O6I 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.250 
_refine.ls_d_res_low                             56.137 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     64736 
_refine.ls_number_reflns_R_free                  3282 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.96 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1977 
_refine.ls_R_factor_R_free                       0.2278 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1961 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4UN8 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.42 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.29 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4533 
_refine_hist.pdbx_number_atoms_nucleic_acid   3057 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             283 
_refine_hist.number_atoms_total               7881 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        56.137 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 8146  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.607  ? 11643 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 21.770 ? 4361  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.039  ? 1311  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 942   ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.2500 2.2836  . . 150 2696 99.00 . . . 0.3448 . 0.2886 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2836 2.3193  . . 139 2603 99.00 . . . 0.3274 . 0.2763 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3193 2.3573  . . 156 2704 99.00 . . . 0.3321 . 0.2821 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3573 2.3980  . . 154 2624 99.00 . . . 0.3156 . 0.2714 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3980 2.4416  . . 136 2692 98.00 . . . 0.3439 . 0.2772 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4416 2.4885  . . 132 2666 98.00 . . . 0.2933 . 0.2666 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4885 2.5393  . . 124 2684 99.00 . . . 0.3325 . 0.2558 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5393 2.5945  . . 129 2684 99.00 . . . 0.2658 . 0.2501 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5945 2.6549  . . 146 2672 98.00 . . . 0.3176 . 0.2359 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6549 2.7213  . . 153 2716 99.00 . . . 0.2624 . 0.2433 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7213 2.7949  . . 155 2657 99.00 . . . 0.3052 . 0.2345 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7949 2.8771  . . 127 2700 99.00 . . . 0.2387 . 0.2341 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8771 2.9700  . . 145 2716 99.00 . . . 0.2842 . 0.2288 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9700 3.0761  . . 153 2715 99.00 . . . 0.2680 . 0.2354 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0761 3.1992  . . 141 2702 99.00 . . . 0.2602 . 0.2235 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1992 3.3448  . . 142 2686 99.00 . . . 0.2374 . 0.1888 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3448 3.5212  . . 141 2686 99.00 . . . 0.1997 . 0.1766 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5212 3.7417  . . 138 2707 99.00 . . . 0.2289 . 0.1749 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7417 4.0305  . . 166 2683 98.00 . . . 0.2049 . 0.1759 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0305 4.4360  . . 149 2667 96.00 . . . 0.1561 . 0.1600 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4360 5.0775  . . 131 2535 93.00 . . . 0.1960 . 0.1575 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0775 6.3957  . . 132 2684 96.00 . . . 0.1924 . 0.1670 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3957 56.1542 . . 143 2575 91.00 . . . 0.1679 . 0.1597 . . . . . . . . . . 
# 
_struct.entry_id                     5O6I 
_struct.title                        'Structures and dynamics of mesophilic variants from the homing endonuclease I-DmoI' 
_struct.pdbx_descriptor              'Penicillin-binding protein 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5O6I 
_struct_keywords.text            'Desulfurococcus mobilis, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 4 ? 
N N N 4 ? 
O N N 5 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
U N N 6 ? 
V N N 6 ? 
W N N 6 ? 
X N N 6 ? 
Y N N 6 ? 
Z N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 7   ? ASP A 22  ? ASN A 6   ASP A 21  1 ? 16 
HELX_P HELX_P2  AA2 SER A 45  ? HIS A 52  ? SER A 44  HIS A 51  1 ? 8  
HELX_P HELX_P3  AA3 HIS A 52  ? LEU A 64  ? HIS A 51  LEU A 63  1 ? 13 
HELX_P HELX_P4  AA4 SER A 85  ? ARG A 98  ? SER A 84  ARG A 97  1 ? 14 
HELX_P HELX_P5  AA5 ILE A 99  ? CYS A 102 ? ILE A 98  CYS A 101 5 ? 4  
HELX_P HELX_P6  AA6 ASN A 103 ? GLY A 119 ? ASN A 102 GLY A 118 1 ? 17 
HELX_P HELX_P7  AA7 ASN A 132 ? LEU A 146 ? ASN A 131 LEU A 145 1 ? 15 
HELX_P HELX_P8  AA8 ASP A 170 ? ILE A 178 ? ASP A 169 ILE A 177 1 ? 9  
HELX_P HELX_P9  AA9 PRO A 187 ? HIS A 195 ? PRO A 186 HIS A 194 1 ? 9  
HELX_P HELX_P10 AB1 ASN D 7   ? ASP D 22  ? ASN F 6   ASP F 21  1 ? 16 
HELX_P HELX_P11 AB2 LYS D 31  ? ASN D 33  ? LYS F 30  ASN F 32  5 ? 3  
HELX_P HELX_P12 AB3 SER D 45  ? HIS D 52  ? SER F 44  HIS F 51  1 ? 8  
HELX_P HELX_P13 AB4 HIS D 52  ? ASN D 65  ? HIS F 51  ASN F 64  1 ? 14 
HELX_P HELX_P14 AB5 SER D 85  ? ARG D 98  ? SER F 84  ARG F 97  1 ? 14 
HELX_P HELX_P15 AB6 ILE D 99  ? CYS D 102 ? ILE F 98  CYS F 101 5 ? 4  
HELX_P HELX_P16 AB7 ASN D 103 ? GLY D 119 ? ASN F 102 GLY F 118 1 ? 17 
HELX_P HELX_P17 AB8 ASN D 132 ? LEU D 146 ? ASN F 131 LEU F 145 1 ? 15 
HELX_P HELX_P18 AB9 ASP D 170 ? ILE D 178 ? ASP F 169 ILE F 177 1 ? 9  
HELX_P HELX_P19 AC1 ASN G 7   ? ASP G 22  ? ASN K 6   ASP K 21  1 ? 16 
HELX_P HELX_P20 AC2 SER G 45  ? HIS G 52  ? SER K 44  HIS K 51  1 ? 8  
HELX_P HELX_P21 AC3 HIS G 52  ? ASN G 65  ? HIS K 51  ASN K 64  1 ? 14 
HELX_P HELX_P22 AC4 SER G 85  ? ARG G 98  ? SER K 84  ARG K 97  1 ? 14 
HELX_P HELX_P23 AC5 ILE G 99  ? CYS G 102 ? ILE K 98  CYS K 101 5 ? 4  
HELX_P HELX_P24 AC6 ASN G 103 ? GLY G 119 ? ASN K 102 GLY K 118 1 ? 17 
HELX_P HELX_P25 AC7 ASN G 132 ? LEU G 146 ? ASN K 131 LEU K 145 1 ? 15 
HELX_P HELX_P26 AC8 ASP G 170 ? ILE G 178 ? ASP K 169 ILE K 177 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A GLY 21  O   ? ? ? 1_555 K MN  .  MN ? ? A GLY 20  A MN  202 1_555 ? ? ? ? ? ? ?            2.431 ? 
metalc2   metalc ? ? A ASP 22  OD1 ? ? ? 1_555 J MN  .  MN ? ? A ASP 21  A MN  201 1_555 ? ? ? ? ? ? ?            2.668 ? 
metalc3   metalc ? ? A ASP 22  OD2 ? ? ? 1_555 J MN  .  MN ? ? A ASP 21  A MN  201 1_555 ? ? ? ? ? ? ?            2.527 ? 
metalc4   metalc ? ? A ALA 117 O   ? ? ? 1_555 J MN  .  MN ? ? A ALA 116 A MN  201 1_555 ? ? ? ? ? ? ?            2.476 ? 
metalc5   metalc ? ? A GLU 118 OE2 ? ? ? 1_555 K MN  .  MN ? ? A GLU 117 A MN  202 1_555 ? ? ? ? ? ? ?            2.446 ? 
metalc6   metalc ? ? B DA  14  OP1 ? ? ? 1_555 J MN  .  MN ? ? C DA  14  A MN  201 1_555 ? ? ? ? ? ? ?            2.462 ? 
metalc7   metalc ? ? B DG  15  OP2 ? ? ? 1_555 K MN  .  MN ? ? C DG  15  A MN  202 1_555 ? ? ? ? ? ? ?            2.374 ? 
metalc8   metalc ? ? C DC  15  OP1 ? ? ? 1_555 K MN  .  MN ? ? D DC  15  A MN  202 1_555 ? ? ? ? ? ? ?            2.404 ? 
metalc9   metalc ? ? C DC  16  OP2 ? ? ? 1_555 J MN  .  MN ? ? D DC  16  A MN  201 1_555 ? ? ? ? ? ? ?            2.481 ? 
metalc10  metalc ? ? D GLY 21  O   ? ? ? 1_555 N MN  .  MN ? ? F GLY 20  F MN  202 1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc11  metalc ? ? D ASP 22  OD1 ? ? ? 1_555 M MN  .  MN ? ? F ASP 21  F MN  201 1_555 ? ? ? ? ? ? ?            2.792 ? 
metalc12  metalc ? ? D ASP 22  OD2 ? ? ? 1_555 M MN  .  MN ? ? F ASP 21  F MN  201 1_555 ? ? ? ? ? ? ?            2.554 ? 
metalc13  metalc ? ? D ALA 117 O   ? ? ? 1_555 M MN  .  MN ? ? F ALA 116 F MN  201 1_555 ? ? ? ? ? ? ?            2.444 ? 
metalc14  metalc ? ? D GLU 118 OE2 ? ? ? 1_555 N MN  .  MN ? ? F GLU 117 F MN  202 1_555 ? ? ? ? ? ? ?            2.519 ? 
metalc15  metalc ? ? E DA  14  OP1 ? ? ? 1_555 M MN  .  MN ? ? G DA  14  F MN  201 1_555 ? ? ? ? ? ? ?            2.423 ? 
metalc16  metalc ? ? E DG  15  OP2 ? ? ? 1_555 N MN  .  MN ? ? G DG  15  F MN  202 1_555 ? ? ? ? ? ? ?            2.419 ? 
metalc17  metalc ? ? F DC  15  OP1 ? ? ? 1_555 N MN  .  MN ? ? I DC  15  F MN  202 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc18  metalc ? ? F DC  16  OP2 ? ? ? 1_555 M MN  .  MN ? ? I DC  16  F MN  201 1_555 ? ? ? ? ? ? ?            2.483 ? 
metalc19  metalc ? ? G GLY 21  O   ? ? ? 1_555 Q MN  .  MN ? ? K GLY 20  K MN  202 1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc20  metalc ? ? G ASP 22  OD1 ? ? ? 1_555 P MN  .  MN ? ? K ASP 21  K MN  201 1_555 ? ? ? ? ? ? ?            2.671 ? 
metalc21  metalc ? ? G ASP 22  OD2 ? ? ? 1_555 P MN  .  MN ? ? K ASP 21  K MN  201 1_555 ? ? ? ? ? ? ?            2.583 ? 
metalc22  metalc ? ? G ALA 117 O   ? ? ? 1_555 P MN  .  MN ? ? K ALA 116 K MN  201 1_555 ? ? ? ? ? ? ?            2.449 ? 
metalc23  metalc ? ? G GLU 118 OE2 ? ? ? 1_555 Q MN  .  MN ? ? K GLU 117 K MN  202 1_555 ? ? ? ? ? ? ?            2.497 ? 
metalc24  metalc ? ? H DA  14  OP1 ? ? ? 1_555 P MN  .  MN ? ? L DA  14  K MN  201 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc25  metalc ? ? H DG  15  OP2 ? ? ? 1_555 Q MN  .  MN ? ? L DG  15  K MN  202 1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc26  metalc ? ? I DC  15  OP1 ? ? ? 1_555 Q MN  .  MN ? ? N DC  15  K MN  202 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc27  metalc ? ? I DC  16  OP2 ? ? ? 1_555 P MN  .  MN ? ? N DC  16  K MN  201 1_555 ? ? ? ? ? ? ?            2.431 ? 
metalc28  metalc ? ? J MN  .   MN  ? ? ? 1_555 T HOH .  O  ? ? A MN  201 D HOH 120 1_555 ? ? ? ? ? ? ?            2.429 ? 
metalc29  metalc ? ? J MN  .   MN  ? ? ? 1_555 R HOH .  O  ? ? A MN  201 A HOH 317 1_555 ? ? ? ? ? ? ?            2.629 ? 
metalc30  metalc ? ? K MN  .   MN  ? ? ? 1_555 S HOH .  O  ? ? A MN  202 C HOH 118 1_555 ? ? ? ? ? ? ?            2.558 ? 
metalc31  metalc ? ? K MN  .   MN  ? ? ? 1_555 R HOH .  O  ? ? A MN  202 A HOH 316 1_555 ? ? ? ? ? ? ?            2.632 ? 
metalc32  metalc ? ? M MN  .   MN  ? ? ? 1_555 U HOH .  O  ? ? F MN  201 F HOH 309 1_555 ? ? ? ? ? ? ?            2.622 ? 
metalc33  metalc ? ? N MN  .   MN  ? ? ? 1_555 U HOH .  O  ? ? F MN  202 F HOH 315 1_555 ? ? ? ? ? ? ?            2.593 ? 
metalc34  metalc ? ? P MN  .   MN  ? ? ? 1_555 X HOH .  O  ? ? K MN  201 K HOH 315 1_555 ? ? ? ? ? ? ?            2.258 ? 
metalc35  metalc ? ? P MN  .   MN  ? ? ? 1_555 X HOH .  O  ? ? K MN  201 K HOH 330 1_555 ? ? ? ? ? ? ?            2.680 ? 
metalc36  metalc ? ? Q MN  .   MN  ? ? ? 1_555 X HOH .  O  ? ? K MN  202 K HOH 326 1_555 ? ? ? ? ? ? ?            2.572 ? 
metalc37  metalc ? ? Q MN  .   MN  ? ? ? 1_555 Y HOH .  O  ? ? K MN  202 L HOH 124 1_555 ? ? ? ? ? ? ?            2.721 ? 
hydrog1   hydrog ? ? B DG  1   N1  ? ? ? 1_555 C DC  25 N3 ? ? C DG  1   D DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? B DG  1   N2  ? ? ? 1_555 C DC  25 O2 ? ? C DG  1   D DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? B DG  1   O6  ? ? ? 1_555 C DC  25 N4 ? ? C DG  1   D DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? B DC  2   N3  ? ? ? 1_555 C DG  24 N1 ? ? C DC  2   D DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? B DC  2   N4  ? ? ? 1_555 C DG  24 O6 ? ? C DC  2   D DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? B DC  2   O2  ? ? ? 1_555 C DG  24 N2 ? ? C DC  2   D DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? B DC  3   N3  ? ? ? 1_555 C DG  23 N1 ? ? C DC  3   D DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? B DC  3   N4  ? ? ? 1_555 C DG  23 O6 ? ? C DC  3   D DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? B DC  3   O2  ? ? ? 1_555 C DG  23 N2 ? ? C DC  3   D DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? B DT  4   N3  ? ? ? 1_555 C DA  22 N1 ? ? C DT  4   D DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? B DT  4   O4  ? ? ? 1_555 C DA  22 N6 ? ? C DT  4   D DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? B DT  5   N3  ? ? ? 1_555 C DA  21 N1 ? ? C DT  5   D DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? B DT  5   O4  ? ? ? 1_555 C DA  21 N6 ? ? C DT  5   D DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? B DG  6   N1  ? ? ? 1_555 C DC  20 N3 ? ? C DG  6   D DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? B DG  6   N2  ? ? ? 1_555 C DC  20 O2 ? ? C DG  6   D DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? B DG  6   O6  ? ? ? 1_555 C DC  20 N4 ? ? C DG  6   D DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? B DC  7   N3  ? ? ? 1_555 C DG  19 N1 ? ? C DC  7   D DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? B DC  7   N4  ? ? ? 1_555 C DG  19 O6 ? ? C DC  7   D DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? B DC  7   O2  ? ? ? 1_555 C DG  19 N2 ? ? C DC  7   D DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? B DC  8   N3  ? ? ? 1_555 C DG  18 N1 ? ? C DC  8   D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? B DC  8   N4  ? ? ? 1_555 C DG  18 O6 ? ? C DC  8   D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? B DC  8   O2  ? ? ? 1_555 C DG  18 N2 ? ? C DC  8   D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? B DG  9   N1  ? ? ? 1_555 C DC  17 N3 ? ? C DG  9   D DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? B DG  9   N2  ? ? ? 1_555 C DC  17 O2 ? ? C DG  9   D DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? B DG  9   O6  ? ? ? 1_555 C DC  17 N4 ? ? C DG  9   D DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? B DG  10  N1  ? ? ? 1_555 C DC  16 N3 ? ? C DG  10  D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? B DG  10  N2  ? ? ? 1_555 C DC  16 O2 ? ? C DG  10  D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? B DG  10  O6  ? ? ? 1_555 C DC  16 N4 ? ? C DG  10  D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? B DG  11  N1  ? ? ? 1_555 C DC  15 N3 ? ? C DG  11  D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? B DG  11  N2  ? ? ? 1_555 C DC  15 O2 ? ? C DG  11  D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? B DG  11  O6  ? ? ? 1_555 C DC  15 N4 ? ? C DG  11  D DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? B DT  12  N3  ? ? ? 1_555 C DA  14 N1 ? ? C DT  12  D DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? B DT  12  O4  ? ? ? 1_555 C DA  14 N6 ? ? C DT  12  D DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? B DA  13  N1  ? ? ? 1_555 C DT  13 N3 ? ? C DA  13  D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? B DA  13  N6  ? ? ? 1_555 C DT  13 O4 ? ? C DA  13  D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? B DA  14  N1  ? ? ? 1_555 C DT  12 N3 ? ? C DA  14  D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? B DA  14  N6  ? ? ? 1_555 C DT  12 O4 ? ? C DA  14  D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? B DG  15  N1  ? ? ? 1_555 C DC  11 N3 ? ? C DG  15  D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? B DG  15  N2  ? ? ? 1_555 C DC  11 O2 ? ? C DG  15  D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? B DG  15  O6  ? ? ? 1_555 C DC  11 N4 ? ? C DG  15  D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? B DT  16  N3  ? ? ? 1_555 C DA  10 N1 ? ? C DT  16  D DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? B DT  16  O4  ? ? ? 1_555 C DA  10 N6 ? ? C DT  16  D DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? B DT  17  N3  ? ? ? 1_555 C DA  9  N1 ? ? C DT  17  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? B DT  17  O4  ? ? ? 1_555 C DA  9  N6 ? ? C DT  17  D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? B DC  18  N3  ? ? ? 1_555 C DG  8  N1 ? ? C DC  18  D DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? B DC  18  N4  ? ? ? 1_555 C DG  8  O6 ? ? C DC  18  D DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? B DC  18  O2  ? ? ? 1_555 C DG  8  N2 ? ? C DC  18  D DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? B DC  19  N3  ? ? ? 1_555 C DG  7  N1 ? ? C DC  19  D DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? B DC  19  N4  ? ? ? 1_555 C DG  7  O6 ? ? C DC  19  D DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? B DC  19  O2  ? ? ? 1_555 C DG  7  N2 ? ? C DC  19  D DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? B DG  20  N1  ? ? ? 1_555 C DC  6  N3 ? ? C DG  20  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? B DG  20  N2  ? ? ? 1_555 C DC  6  O2 ? ? C DG  20  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? B DG  20  O6  ? ? ? 1_555 C DC  6  N4 ? ? C DG  20  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? B DG  21  N1  ? ? ? 1_555 C DC  5  N3 ? ? C DG  21  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? B DG  21  N2  ? ? ? 1_555 C DC  5  O2 ? ? C DG  21  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? B DG  21  O6  ? ? ? 1_555 C DC  5  N4 ? ? C DG  21  D DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? B DC  22  N3  ? ? ? 1_555 C DG  4  N1 ? ? C DC  22  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? B DC  22  N4  ? ? ? 1_555 C DG  4  O6 ? ? C DC  22  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? B DC  22  O2  ? ? ? 1_555 C DG  4  N2 ? ? C DC  22  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? B DG  23  N1  ? ? ? 1_555 C DC  3  N3 ? ? C DG  23  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? B DG  23  N2  ? ? ? 1_555 C DC  3  O2 ? ? C DG  23  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? B DG  23  O6  ? ? ? 1_555 C DC  3  N4 ? ? C DG  23  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? B DC  24  N3  ? ? ? 1_555 C DG  2  N1 ? ? C DC  24  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? B DC  24  N4  ? ? ? 1_555 C DG  2  O6 ? ? C DC  24  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? B DC  24  O2  ? ? ? 1_555 C DG  2  N2 ? ? C DC  24  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? B DG  25  N1  ? ? ? 1_555 C DC  1  N3 ? ? C DG  25  D DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? B DG  25  N2  ? ? ? 1_555 C DC  1  O2 ? ? C DG  25  D DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? B DG  25  O6  ? ? ? 1_555 C DC  1  N4 ? ? C DG  25  D DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? E DG  1   N1  ? ? ? 1_555 F DC  25 N3 ? ? G DG  1   I DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? E DG  1   N2  ? ? ? 1_555 F DC  25 O2 ? ? G DG  1   I DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? E DG  1   O6  ? ? ? 1_555 F DC  25 N4 ? ? G DG  1   I DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? E DC  2   N3  ? ? ? 1_555 F DG  24 N1 ? ? G DC  2   I DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? E DC  2   N4  ? ? ? 1_555 F DG  24 O6 ? ? G DC  2   I DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? E DC  2   O2  ? ? ? 1_555 F DG  24 N2 ? ? G DC  2   I DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? E DC  3   N3  ? ? ? 1_555 F DG  23 N1 ? ? G DC  3   I DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? E DC  3   N4  ? ? ? 1_555 F DG  23 O6 ? ? G DC  3   I DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? E DC  3   O2  ? ? ? 1_555 F DG  23 N2 ? ? G DC  3   I DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? E DT  4   N3  ? ? ? 1_555 F DA  22 N1 ? ? G DT  4   I DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? E DT  4   O4  ? ? ? 1_555 F DA  22 N6 ? ? G DT  4   I DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? E DT  5   N3  ? ? ? 1_555 F DA  21 N1 ? ? G DT  5   I DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? E DT  5   O4  ? ? ? 1_555 F DA  21 N6 ? ? G DT  5   I DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? E DG  6   N1  ? ? ? 1_555 F DC  20 N3 ? ? G DG  6   I DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? E DG  6   N2  ? ? ? 1_555 F DC  20 O2 ? ? G DG  6   I DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? E DG  6   O6  ? ? ? 1_555 F DC  20 N4 ? ? G DG  6   I DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? E DC  7   N3  ? ? ? 1_555 F DG  19 N1 ? ? G DC  7   I DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? E DC  7   N4  ? ? ? 1_555 F DG  19 O6 ? ? G DC  7   I DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? E DC  7   O2  ? ? ? 1_555 F DG  19 N2 ? ? G DC  7   I DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? E DC  8   N3  ? ? ? 1_555 F DG  18 N1 ? ? G DC  8   I DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? E DC  8   N4  ? ? ? 1_555 F DG  18 O6 ? ? G DC  8   I DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? E DC  8   O2  ? ? ? 1_555 F DG  18 N2 ? ? G DC  8   I DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? E DG  9   N1  ? ? ? 1_555 F DC  17 N3 ? ? G DG  9   I DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? E DG  9   N2  ? ? ? 1_555 F DC  17 O2 ? ? G DG  9   I DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? E DG  9   O6  ? ? ? 1_555 F DC  17 N4 ? ? G DG  9   I DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? E DG  10  N1  ? ? ? 1_555 F DC  16 N3 ? ? G DG  10  I DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? E DG  10  N2  ? ? ? 1_555 F DC  16 O2 ? ? G DG  10  I DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? E DG  10  O6  ? ? ? 1_555 F DC  16 N4 ? ? G DG  10  I DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? E DG  11  N1  ? ? ? 1_555 F DC  15 N3 ? ? G DG  11  I DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? E DG  11  N2  ? ? ? 1_555 F DC  15 O2 ? ? G DG  11  I DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? E DG  11  O6  ? ? ? 1_555 F DC  15 N4 ? ? G DG  11  I DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? E DT  12  N3  ? ? ? 1_555 F DA  14 N1 ? ? G DT  12  I DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? E DT  12  O4  ? ? ? 1_555 F DA  14 N6 ? ? G DT  12  I DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? E DA  13  N1  ? ? ? 1_555 F DT  13 N3 ? ? G DA  13  I DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? E DA  13  N6  ? ? ? 1_555 F DT  13 O4 ? ? G DA  13  I DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? E DA  14  N1  ? ? ? 1_555 F DT  12 N3 ? ? G DA  14  I DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? E DA  14  N6  ? ? ? 1_555 F DT  12 O4 ? ? G DA  14  I DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? E DG  15  N1  ? ? ? 1_555 F DC  11 N3 ? ? G DG  15  I DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? E DG  15  N2  ? ? ? 1_555 F DC  11 O2 ? ? G DG  15  I DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? E DG  15  O6  ? ? ? 1_555 F DC  11 N4 ? ? G DG  15  I DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? E DT  16  N3  ? ? ? 1_555 F DA  10 N1 ? ? G DT  16  I DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? E DT  16  O4  ? ? ? 1_555 F DA  10 N6 ? ? G DT  16  I DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? E DT  17  N3  ? ? ? 1_555 F DA  9  N1 ? ? G DT  17  I DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? E DT  17  O4  ? ? ? 1_555 F DA  9  N6 ? ? G DT  17  I DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? E DC  18  N3  ? ? ? 1_555 F DG  8  N1 ? ? G DC  18  I DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? E DC  18  N4  ? ? ? 1_555 F DG  8  O6 ? ? G DC  18  I DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? E DC  18  O2  ? ? ? 1_555 F DG  8  N2 ? ? G DC  18  I DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? E DC  19  N3  ? ? ? 1_555 F DG  7  N1 ? ? G DC  19  I DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? E DC  19  N4  ? ? ? 1_555 F DG  7  O6 ? ? G DC  19  I DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? E DC  19  O2  ? ? ? 1_555 F DG  7  N2 ? ? G DC  19  I DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? E DG  20  N1  ? ? ? 1_555 F DC  6  N3 ? ? G DG  20  I DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? E DG  20  N2  ? ? ? 1_555 F DC  6  O2 ? ? G DG  20  I DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? E DG  20  O6  ? ? ? 1_555 F DC  6  N4 ? ? G DG  20  I DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? E DG  21  N1  ? ? ? 1_555 F DC  5  N3 ? ? G DG  21  I DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? E DG  21  N2  ? ? ? 1_555 F DC  5  O2 ? ? G DG  21  I DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? E DG  21  O6  ? ? ? 1_555 F DC  5  N4 ? ? G DG  21  I DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? E DC  22  N3  ? ? ? 1_555 F DG  4  N1 ? ? G DC  22  I DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? E DC  22  N4  ? ? ? 1_555 F DG  4  O6 ? ? G DC  22  I DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? E DC  22  O2  ? ? ? 1_555 F DG  4  N2 ? ? G DC  22  I DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ? ? E DG  23  N1  ? ? ? 1_555 F DC  3  N3 ? ? G DG  23  I DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? E DG  23  N2  ? ? ? 1_555 F DC  3  O2 ? ? G DG  23  I DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? E DG  23  O6  ? ? ? 1_555 F DC  3  N4 ? ? G DG  23  I DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? E DC  24  N3  ? ? ? 1_555 F DG  2  N1 ? ? G DC  24  I DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? E DC  24  N4  ? ? ? 1_555 F DG  2  O6 ? ? G DC  24  I DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? E DC  24  O2  ? ? ? 1_555 F DG  2  N2 ? ? G DC  24  I DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? E DG  25  N1  ? ? ? 1_555 F DC  1  N3 ? ? G DG  25  I DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? E DG  25  N2  ? ? ? 1_555 F DC  1  O2 ? ? G DG  25  I DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? E DG  25  O6  ? ? ? 1_555 F DC  1  N4 ? ? G DG  25  I DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? H DG  1   N1  ? ? ? 1_555 I DC  25 N3 ? ? L DG  1   N DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? H DG  1   N2  ? ? ? 1_555 I DC  25 O2 ? ? L DG  1   N DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? H DG  1   O6  ? ? ? 1_555 I DC  25 N4 ? ? L DG  1   N DC  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? H DC  2   N3  ? ? ? 1_555 I DG  24 N1 ? ? L DC  2   N DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? H DC  2   N4  ? ? ? 1_555 I DG  24 O6 ? ? L DC  2   N DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? H DC  2   O2  ? ? ? 1_555 I DG  24 N2 ? ? L DC  2   N DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? H DC  3   N3  ? ? ? 1_555 I DG  23 N1 ? ? L DC  3   N DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? H DC  3   N4  ? ? ? 1_555 I DG  23 O6 ? ? L DC  3   N DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? H DC  3   O2  ? ? ? 1_555 I DG  23 N2 ? ? L DC  3   N DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? H DT  4   N3  ? ? ? 1_555 I DA  22 N1 ? ? L DT  4   N DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? H DT  4   O4  ? ? ? 1_555 I DA  22 N6 ? ? L DT  4   N DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? H DT  5   N3  ? ? ? 1_555 I DA  21 N1 ? ? L DT  5   N DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? H DT  5   O4  ? ? ? 1_555 I DA  21 N6 ? ? L DT  5   N DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ? ? H DG  6   N1  ? ? ? 1_555 I DC  20 N3 ? ? L DG  6   N DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? H DG  6   N2  ? ? ? 1_555 I DC  20 O2 ? ? L DG  6   N DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? H DG  6   O6  ? ? ? 1_555 I DC  20 N4 ? ? L DG  6   N DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? H DC  7   N3  ? ? ? 1_555 I DG  19 N1 ? ? L DC  7   N DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? H DC  7   N4  ? ? ? 1_555 I DG  19 O6 ? ? L DC  7   N DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? H DC  7   O2  ? ? ? 1_555 I DG  19 N2 ? ? L DC  7   N DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? H DC  8   N3  ? ? ? 1_555 I DG  18 N1 ? ? L DC  8   N DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ? ? H DC  8   N4  ? ? ? 1_555 I DG  18 O6 ? ? L DC  8   N DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ? ? H DC  8   O2  ? ? ? 1_555 I DG  18 N2 ? ? L DC  8   N DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ? ? H DG  9   N1  ? ? ? 1_555 I DC  17 N3 ? ? L DG  9   N DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ? ? H DG  9   N2  ? ? ? 1_555 I DC  17 O2 ? ? L DG  9   N DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ? ? H DG  9   O6  ? ? ? 1_555 I DC  17 N4 ? ? L DG  9   N DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ? ? H DG  10  N1  ? ? ? 1_555 I DC  16 N3 ? ? L DG  10  N DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ? ? H DG  10  N2  ? ? ? 1_555 I DC  16 O2 ? ? L DG  10  N DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ? ? H DG  10  O6  ? ? ? 1_555 I DC  16 N4 ? ? L DG  10  N DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ? ? H DG  11  N1  ? ? ? 1_555 I DC  15 N3 ? ? L DG  11  N DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ? ? H DG  11  N2  ? ? ? 1_555 I DC  15 O2 ? ? L DG  11  N DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ? ? H DG  11  O6  ? ? ? 1_555 I DC  15 N4 ? ? L DG  11  N DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ? ? H DT  12  N3  ? ? ? 1_555 I DA  14 N1 ? ? L DT  12  N DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ? ? H DT  12  O4  ? ? ? 1_555 I DA  14 N6 ? ? L DT  12  N DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ? ? H DA  13  N1  ? ? ? 1_555 I DT  13 N3 ? ? L DA  13  N DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ? ? H DA  13  N6  ? ? ? 1_555 I DT  13 O4 ? ? L DA  13  N DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ? ? H DA  14  N1  ? ? ? 1_555 I DT  12 N3 ? ? L DA  14  N DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ? ? H DA  14  N6  ? ? ? 1_555 I DT  12 O4 ? ? L DA  14  N DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ? ? H DG  15  N1  ? ? ? 1_555 I DC  11 N3 ? ? L DG  15  N DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ? ? H DG  15  N2  ? ? ? 1_555 I DC  11 O2 ? ? L DG  15  N DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ? ? H DG  15  O6  ? ? ? 1_555 I DC  11 N4 ? ? L DG  15  N DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ? ? H DT  16  N3  ? ? ? 1_555 I DA  10 N1 ? ? L DT  16  N DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ? ? H DT  16  O4  ? ? ? 1_555 I DA  10 N6 ? ? L DT  16  N DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ? ? H DT  17  N3  ? ? ? 1_555 I DA  9  N1 ? ? L DT  17  N DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ? ? H DT  17  O4  ? ? ? 1_555 I DA  9  N6 ? ? L DT  17  N DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ? ? H DC  18  N3  ? ? ? 1_555 I DG  8  N1 ? ? L DC  18  N DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ? ? H DC  18  N4  ? ? ? 1_555 I DG  8  O6 ? ? L DC  18  N DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ? ? H DC  18  O2  ? ? ? 1_555 I DG  8  N2 ? ? L DC  18  N DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ? ? H DC  19  N3  ? ? ? 1_555 I DG  7  N1 ? ? L DC  19  N DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ? ? H DC  19  N4  ? ? ? 1_555 I DG  7  O6 ? ? L DC  19  N DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ? ? H DC  19  O2  ? ? ? 1_555 I DG  7  N2 ? ? L DC  19  N DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ? ? H DG  20  N1  ? ? ? 1_555 I DC  6  N3 ? ? L DG  20  N DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ? ? H DG  20  N2  ? ? ? 1_555 I DC  6  O2 ? ? L DG  20  N DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ? ? H DG  20  O6  ? ? ? 1_555 I DC  6  N4 ? ? L DG  20  N DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ? ? H DG  21  N1  ? ? ? 1_555 I DC  5  N3 ? ? L DG  21  N DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ? ? H DG  21  N2  ? ? ? 1_555 I DC  5  O2 ? ? L DG  21  N DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ? ? H DG  21  O6  ? ? ? 1_555 I DC  5  N4 ? ? L DG  21  N DC  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ? ? H DC  22  N3  ? ? ? 1_555 I DG  4  N1 ? ? L DC  22  N DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ? ? H DC  22  N4  ? ? ? 1_555 I DG  4  O6 ? ? L DC  22  N DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ? ? H DC  22  O2  ? ? ? 1_555 I DG  4  N2 ? ? L DC  22  N DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ? ? H DG  23  N1  ? ? ? 1_555 I DC  3  N3 ? ? L DG  23  N DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ? ? H DG  23  N2  ? ? ? 1_555 I DC  3  O2 ? ? L DG  23  N DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ? ? H DG  23  O6  ? ? ? 1_555 I DC  3  N4 ? ? L DG  23  N DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ? ? H DC  24  N3  ? ? ? 1_555 I DG  2  N1 ? ? L DC  24  N DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ? ? H DC  24  N4  ? ? ? 1_555 I DG  2  O6 ? ? L DC  24  N DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ? ? H DC  24  O2  ? ? ? 1_555 I DG  2  N2 ? ? L DC  24  N DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ? ? H DG  25  N1  ? ? ? 1_555 I DC  1  N3 ? ? L DG  25  N DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ? ? H DG  25  N2  ? ? ? 1_555 I DC  1  O2 ? ? L DG  25  N DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ? ? H DG  25  O6  ? ? ? 1_555 I DC  1  N4 ? ? L DG  25  N DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 31 A . ? LYS 30 A GLY 32 A ? GLY 31 A 1 2.37  
2 GLY 32 A . ? GLY 31 A ASN 33 A ? ASN 32 A 1 1.09  
3 LYS 31 G . ? LYS 30 K GLY 32 G ? GLY 31 K 1 -5.50 
4 GLY 32 G . ? GLY 31 K ASN 33 G ? ASN 32 K 1 -6.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 23  ? LYS A 29  ? GLY A 22  LYS A 28  
AA1 2 SER A 35  ? GLN A 43  ? SER A 34  GLN A 42  
AA1 3 TYR A 79  ? SER A 84  ? TYR A 78  SER A 83  
AA1 4 ILE A 70  ? LYS A 74  ? ILE A 69  LYS A 73  
AA2 1 LEU A 126 ? ASN A 130 ? LEU A 125 ASN A 129 
AA2 2 VAL A 161 ? ILE A 166 ? VAL A 160 ILE A 165 
AA2 3 ASN A 150 ? ASP A 156 ? ASN A 149 ASP A 155 
AA3 1 GLY D 23  ? LYS D 29  ? GLY F 22  LYS F 28  
AA3 2 SER D 35  ? GLN D 43  ? SER F 34  GLN F 42  
AA3 3 TYR D 79  ? SER D 84  ? TYR F 78  SER F 83  
AA3 4 ILE D 70  ? LYS D 74  ? ILE F 69  LYS F 73  
AA4 1 LEU D 126 ? ASN D 130 ? LEU F 125 ASN F 129 
AA4 2 VAL D 161 ? ILE D 166 ? VAL F 160 ILE F 165 
AA4 3 ASN D 150 ? ASP D 156 ? ASN F 149 ASP F 155 
AA5 1 GLY G 23  ? LYS G 29  ? GLY K 22  LYS K 28  
AA5 2 SER G 35  ? GLN G 43  ? SER K 34  GLN K 42  
AA5 3 TYR G 79  ? SER G 84  ? TYR K 78  SER K 83  
AA5 4 ILE G 70  ? LYS G 74  ? ILE K 69  LYS K 73  
AA6 1 LEU G 126 ? ASN G 130 ? LEU K 125 ASN K 129 
AA6 2 VAL G 161 ? ILE G 166 ? VAL K 160 ILE K 165 
AA6 3 ASN G 150 ? ASP G 156 ? ASN K 149 ASP K 155 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 28  ? N LEU A 27  O GLU A 36  ? O GLU A 35  
AA1 2 3 N ILE A 41  ? N ILE A 40  O LEU A 81  ? O LEU A 80  
AA1 3 4 O ARG A 82  ? O ARG A 81  N GLN A 71  ? N GLN A 70  
AA2 1 2 N LEU A 126 ? N LEU A 125 O ILE A 166 ? O ILE A 165 
AA2 2 3 O ASN A 165 ? O ASN A 164 N THR A 151 ? N THR A 150 
AA3 1 2 N LEU D 28  ? N LEU F 27  O GLU D 36  ? O GLU F 35  
AA3 2 3 N ILE D 41  ? N ILE F 40  O LEU D 81  ? O LEU F 80  
AA3 3 4 O ARG D 82  ? O ARG F 81  N GLN D 71  ? N GLN F 70  
AA4 1 2 N LEU D 126 ? N LEU F 125 O ILE D 166 ? O ILE F 165 
AA4 2 3 O ASN D 165 ? O ASN F 164 N THR D 151 ? N THR F 150 
AA5 1 2 N LEU G 28  ? N LEU K 27  O GLU G 36  ? O GLU K 35  
AA5 2 3 N ILE G 41  ? N ILE K 40  O LEU G 81  ? O LEU K 80  
AA5 3 4 O ARG G 82  ? O ARG K 81  N GLN G 71  ? N GLN K 70  
AA6 1 2 N LEU G 126 ? N LEU K 125 O ILE G 166 ? O ILE K 165 
AA6 2 3 O ASN G 165 ? O ASN K 164 N THR G 151 ? N THR K 150 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN 201 ? 6 'binding site for residue MN A 201' 
AC2 Software A MN 202 ? 7 'binding site for residue MN A 202' 
AC3 Software F MN 201 ? 6 'binding site for residue MN F 201' 
AC4 Software F MN 202 ? 5 'binding site for residue MN F 202' 
AC5 Software K MN 201 ? 6 'binding site for residue MN K 201' 
AC6 Software K MN 202 ? 6 'binding site for residue MN K 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 22  ? ASP A 21  . ? 1_555 ? 
2  AC1 6 ALA A 117 ? ALA A 116 . ? 1_555 ? 
3  AC1 6 HOH R .   ? HOH A 317 . ? 1_555 ? 
4  AC1 6 DA  B 14  ? DA  C 14  . ? 1_555 ? 
5  AC1 6 DC  C 16  ? DC  D 16  . ? 1_555 ? 
6  AC1 6 HOH T .   ? HOH D 120 . ? 1_555 ? 
7  AC2 7 GLY A 21  ? GLY A 20  . ? 1_555 ? 
8  AC2 7 GLU A 118 ? GLU A 117 . ? 1_555 ? 
9  AC2 7 ASN A 130 ? ASN A 129 . ? 1_555 ? 
10 AC2 7 HOH R .   ? HOH A 316 . ? 1_555 ? 
11 AC2 7 DG  B 15  ? DG  C 15  . ? 1_555 ? 
12 AC2 7 HOH S .   ? HOH C 118 . ? 1_555 ? 
13 AC2 7 DC  C 15  ? DC  D 15  . ? 1_555 ? 
14 AC3 6 ASP D 22  ? ASP F 21  . ? 1_555 ? 
15 AC3 6 ALA D 117 ? ALA F 116 . ? 1_555 ? 
16 AC3 6 HOH U .   ? HOH F 309 . ? 1_555 ? 
17 AC3 6 DA  E 14  ? DA  G 14  . ? 1_555 ? 
18 AC3 6 DC  F 16  ? DC  I 16  . ? 1_555 ? 
19 AC3 6 HOH W .   ? HOH I 116 . ? 1_555 ? 
20 AC4 5 GLY D 21  ? GLY F 20  . ? 1_555 ? 
21 AC4 5 GLU D 118 ? GLU F 117 . ? 1_555 ? 
22 AC4 5 HOH U .   ? HOH F 315 . ? 1_555 ? 
23 AC4 5 DG  E 15  ? DG  G 15  . ? 1_555 ? 
24 AC4 5 DC  F 15  ? DC  I 15  . ? 1_555 ? 
25 AC5 6 ASP G 22  ? ASP K 21  . ? 1_555 ? 
26 AC5 6 ALA G 117 ? ALA K 116 . ? 1_555 ? 
27 AC5 6 HOH X .   ? HOH K 315 . ? 1_555 ? 
28 AC5 6 HOH X .   ? HOH K 330 . ? 1_555 ? 
29 AC5 6 DA  H 14  ? DA  L 14  . ? 1_555 ? 
30 AC5 6 DC  I 16  ? DC  N 16  . ? 1_555 ? 
31 AC6 6 GLY G 21  ? GLY K 20  . ? 1_555 ? 
32 AC6 6 GLU G 118 ? GLU K 117 . ? 1_555 ? 
33 AC6 6 HOH X .   ? HOH K 326 . ? 1_555 ? 
34 AC6 6 DG  H 15  ? DG  L 15  . ? 1_555 ? 
35 AC6 6 HOH Y .   ? HOH L 124 . ? 1_555 ? 
36 AC6 6 DC  I 15  ? DC  N 15  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5O6I 
_atom_sites.fract_transf_matrix[1][1]   0.009346 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005355 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014188 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010739 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 6   ? 76.838  21.918  32.822  1.00 76.96  ? 5   GLU A N     1 
ATOM   2    C  CA    . GLU A 1 6   ? 76.632  21.849  31.382  1.00 74.99  ? 5   GLU A CA    1 
ATOM   3    C  C     . GLU A 1 6   ? 75.162  22.078  31.038  1.00 78.28  ? 5   GLU A C     1 
ATOM   4    O  O     . GLU A 1 6   ? 74.831  22.443  29.908  1.00 82.13  ? 5   GLU A O     1 
ATOM   5    C  CB    . GLU A 1 6   ? 77.114  20.498  30.841  1.00 74.19  ? 5   GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 6   ? 76.846  20.262  29.362  1.00 66.53  ? 5   GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 6   ? 77.446  21.342  28.484  1.00 79.31  ? 5   GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 6   ? 78.675  21.550  28.551  1.00 81.74  ? 5   GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 6   ? 76.687  21.988  27.731  1.00 78.47  ? 5   GLU A OE2   1 
ATOM   10   N  N     . ASN A 1 7   ? 74.290  21.866  32.028  1.00 68.65  ? 6   ASN A N     1 
ATOM   11   C  CA    . ASN A 1 7   ? 72.839  21.964  31.871  1.00 70.71  ? 6   ASN A CA    1 
ATOM   12   C  C     . ASN A 1 7   ? 72.314  20.864  30.952  1.00 65.49  ? 6   ASN A C     1 
ATOM   13   O  O     . ASN A 1 7   ? 71.352  20.171  31.299  1.00 59.18  ? 6   ASN A O     1 
ATOM   14   C  CB    . ASN A 1 7   ? 72.431  23.350  31.353  1.00 73.44  ? 6   ASN A CB    1 
ATOM   15   C  CG    . ASN A 1 7   ? 70.926  23.551  31.338  1.00 80.44  ? 6   ASN A CG    1 
ATOM   16   O  OD1   . ASN A 1 7   ? 70.175  22.771  31.923  1.00 83.92  ? 6   ASN A OD1   1 
ATOM   17   N  ND2   . ASN A 1 7   ? 70.479  24.607  30.667  1.00 82.67  ? 6   ASN A ND2   1 
ATOM   18   N  N     . VAL A 1 8   ? 72.934  20.695  29.781  1.00 61.50  ? 7   VAL A N     1 
ATOM   19   C  CA    . VAL A 1 8   ? 72.598  19.566  28.919  1.00 60.72  ? 7   VAL A CA    1 
ATOM   20   C  C     . VAL A 1 8   ? 72.959  18.251  29.601  1.00 55.30  ? 7   VAL A C     1 
ATOM   21   O  O     . VAL A 1 8   ? 72.191  17.282  29.561  1.00 46.80  ? 7   VAL A O     1 
ATOM   22   C  CB    . VAL A 1 8   ? 73.298  19.712  27.554  1.00 61.41  ? 7   VAL A CB    1 
ATOM   23   C  CG1   . VAL A 1 8   ? 73.287  18.397  26.798  1.00 46.86  ? 7   VAL A CG1   1 
ATOM   24   C  CG2   . VAL A 1 8   ? 72.630  20.802  26.733  1.00 71.75  ? 7   VAL A CG2   1 
ATOM   25   N  N     . SER A 1 9   ? 74.126  18.200  30.248  1.00 52.48  ? 8   SER A N     1 
ATOM   26   C  CA    . SER A 1 9   ? 74.530  16.982  30.944  1.00 54.36  ? 8   SER A CA    1 
ATOM   27   C  C     . SER A 1 9   ? 73.625  16.704  32.138  1.00 43.28  ? 8   SER A C     1 
ATOM   28   O  O     . SER A 1 9   ? 73.346  15.541  32.453  1.00 45.56  ? 8   SER A O     1 
ATOM   29   C  CB    . SER A 1 9   ? 75.986  17.088  31.394  1.00 44.92  ? 8   SER A CB    1 
ATOM   30   O  OG    . SER A 1 9   ? 76.113  17.976  32.491  1.00 63.62  ? 8   SER A OG    1 
ATOM   31   N  N     . GLY A 1 10  ? 73.164  17.755  32.818  1.00 42.66  ? 9   GLY A N     1 
ATOM   32   C  CA    . GLY A 1 10  ? 72.257  17.554  33.936  1.00 36.07  ? 9   GLY A CA    1 
ATOM   33   C  C     . GLY A 1 10  ? 70.901  17.037  33.496  1.00 46.90  ? 9   GLY A C     1 
ATOM   34   O  O     . GLY A 1 10  ? 70.328  16.148  34.131  1.00 40.97  ? 9   GLY A O     1 
ATOM   35   N  N     . ILE A 1 11  ? 70.370  17.584  32.401  1.00 43.07  ? 10  ILE A N     1 
ATOM   36   C  CA    . ILE A 1 11  ? 69.095  17.105  31.879  1.00 49.69  ? 10  ILE A CA    1 
ATOM   37   C  C     . ILE A 1 11  ? 69.254  15.710  31.287  1.00 45.35  ? 10  ILE A C     1 
ATOM   38   O  O     . ILE A 1 11  ? 68.352  14.870  31.392  1.00 41.41  ? 10  ILE A O     1 
ATOM   39   C  CB    . ILE A 1 11  ? 68.535  18.109  30.855  1.00 45.65  ? 10  ILE A CB    1 
ATOM   40   C  CG1   . ILE A 1 11  ? 68.171  19.421  31.554  1.00 51.57  ? 10  ILE A CG1   1 
ATOM   41   C  CG2   . ILE A 1 11  ? 67.324  17.537  30.134  1.00 43.83  ? 10  ILE A CG2   1 
ATOM   42   C  CD1   . ILE A 1 11  ? 67.765  20.529  30.611  1.00 57.93  ? 10  ILE A CD1   1 
ATOM   43   N  N     . SER A 1 12  ? 70.406  15.434  30.670  1.00 39.19  ? 11  SER A N     1 
ATOM   44   C  CA    . SER A 1 12  ? 70.665  14.101  30.136  1.00 39.93  ? 11  SER A CA    1 
ATOM   45   C  C     . SER A 1 12  ? 70.657  13.055  31.244  1.00 38.37  ? 11  SER A C     1 
ATOM   46   O  O     . SER A 1 12  ? 70.049  11.988  31.104  1.00 35.40  ? 11  SER A O     1 
ATOM   47   C  CB    . SER A 1 12  ? 72.002  14.082  29.393  1.00 40.61  ? 11  SER A CB    1 
ATOM   48   O  OG    . SER A 1 12  ? 71.944  14.854  28.207  1.00 47.13  ? 11  SER A OG    1 
ATOM   49   N  N     . ALA A 1 13  ? 71.328  13.349  32.360  1.00 34.35  ? 12  ALA A N     1 
ATOM   50   C  CA    . ALA A 1 13  ? 71.392  12.390  33.459  1.00 36.70  ? 12  ALA A CA    1 
ATOM   51   C  C     . ALA A 1 13  ? 70.030  12.209  34.119  1.00 34.45  ? 12  ALA A C     1 
ATOM   52   O  O     . ALA A 1 13  ? 69.688  11.103  34.553  1.00 32.52  ? 12  ALA A O     1 
ATOM   53   C  CB    . ALA A 1 13  ? 72.432  12.837  34.485  1.00 31.15  ? 12  ALA A CB    1 
ATOM   54   N  N     . TYR A 1 14  ? 69.243  13.284  34.211  1.00 34.31  ? 13  TYR A N     1 
ATOM   55   C  CA    . TYR A 1 14  ? 67.897  13.171  34.764  1.00 34.56  ? 13  TYR A CA    1 
ATOM   56   C  C     . TYR A 1 14  ? 67.026  12.277  33.891  1.00 30.86  ? 13  TYR A C     1 
ATOM   57   O  O     . TYR A 1 14  ? 66.327  11.388  34.391  1.00 30.69  ? 13  TYR A O     1 
ATOM   58   C  CB    . TYR A 1 14  ? 67.272  14.559  34.911  1.00 34.88  ? 13  TYR A CB    1 
ATOM   59   C  CG    . TYR A 1 14  ? 65.877  14.549  35.499  1.00 29.62  ? 13  TYR A CG    1 
ATOM   60   C  CD1   . TYR A 1 14  ? 65.667  14.224  36.833  1.00 31.14  ? 13  TYR A CD1   1 
ATOM   61   C  CD2   . TYR A 1 14  ? 64.771  14.869  34.720  1.00 35.25  ? 13  TYR A CD2   1 
ATOM   62   C  CE1   . TYR A 1 14  ? 64.395  14.216  37.376  1.00 35.71  ? 13  TYR A CE1   1 
ATOM   63   C  CE2   . TYR A 1 14  ? 63.494  14.863  35.254  1.00 33.21  ? 13  TYR A CE2   1 
ATOM   64   C  CZ    . TYR A 1 14  ? 63.313  14.536  36.583  1.00 37.05  ? 13  TYR A CZ    1 
ATOM   65   O  OH    . TYR A 1 14  ? 62.046  14.528  37.121  1.00 41.16  ? 13  TYR A OH    1 
ATOM   66   N  N     . LEU A 1 15  ? 67.064  12.497  32.575  1.00 31.47  ? 14  LEU A N     1 
ATOM   67   C  CA    . LEU A 1 15  ? 66.279  11.673  31.663  1.00 33.60  ? 14  LEU A CA    1 
ATOM   68   C  C     . LEU A 1 15  ? 66.741  10.222  31.690  1.00 32.11  ? 14  LEU A C     1 
ATOM   69   O  O     . LEU A 1 15  ? 65.921  9.302   31.594  1.00 30.56  ? 14  LEU A O     1 
ATOM   70   C  CB    . LEU A 1 15  ? 66.362  12.240  30.246  1.00 29.93  ? 14  LEU A CB    1 
ATOM   71   C  CG    . LEU A 1 15  ? 65.651  13.578  30.034  1.00 35.63  ? 14  LEU A CG    1 
ATOM   72   C  CD1   . LEU A 1 15  ? 65.993  14.164  28.673  1.00 29.23  ? 14  LEU A CD1   1 
ATOM   73   C  CD2   . LEU A 1 15  ? 64.147  13.410  30.188  1.00 34.62  ? 14  LEU A CD2   1 
ATOM   74   N  N     . LEU A 1 16  ? 68.051  9.996   31.826  1.00 32.69  ? 15  LEU A N     1 
ATOM   75   C  CA    . LEU A 1 16  ? 68.558  8.628   31.891  1.00 31.66  ? 15  LEU A CA    1 
ATOM   76   C  C     . LEU A 1 16  ? 67.987  7.888   33.094  1.00 30.81  ? 15  LEU A C     1 
ATOM   77   O  O     . LEU A 1 16  ? 67.638  6.705   32.996  1.00 29.10  ? 15  LEU A O     1 
ATOM   78   C  CB    . LEU A 1 16  ? 70.086  8.631   31.938  1.00 27.93  ? 15  LEU A CB    1 
ATOM   79   C  CG    . LEU A 1 16  ? 70.760  7.264   31.797  1.00 30.85  ? 15  LEU A CG    1 
ATOM   80   C  CD1   . LEU A 1 16  ? 70.415  6.631   30.456  1.00 27.15  ? 15  LEU A CD1   1 
ATOM   81   C  CD2   . LEU A 1 16  ? 72.268  7.382   31.970  1.00 25.05  ? 15  LEU A CD2   1 
ATOM   82   N  N     . GLY A 1 17  ? 67.881  8.568   34.238  1.00 23.45  ? 16  GLY A N     1 
ATOM   83   C  CA    . GLY A 1 17  ? 67.257  7.951   35.397  1.00 27.02  ? 16  GLY A CA    1 
ATOM   84   C  C     . GLY A 1 17  ? 65.808  7.578   35.146  1.00 32.02  ? 16  GLY A C     1 
ATOM   85   O  O     . GLY A 1 17  ? 65.354  6.506   35.552  1.00 32.74  ? 16  GLY A O     1 
ATOM   86   N  N     . LEU A 1 18  ? 65.063  8.459   34.473  1.00 29.20  ? 17  LEU A N     1 
ATOM   87   C  CA    . LEU A 1 18  ? 63.692  8.131   34.094  1.00 29.20  ? 17  LEU A CA    1 
ATOM   88   C  C     . LEU A 1 18  ? 63.661  6.979   33.099  1.00 33.25  ? 17  LEU A C     1 
ATOM   89   O  O     . LEU A 1 18  ? 62.822  6.076   33.207  1.00 31.40  ? 17  LEU A O     1 
ATOM   90   C  CB    . LEU A 1 18  ? 63.000  9.359   33.500  1.00 27.63  ? 17  LEU A CB    1 
ATOM   91   C  CG    . LEU A 1 18  ? 62.893  10.617  34.360  1.00 35.70  ? 17  LEU A CG    1 
ATOM   92   C  CD1   . LEU A 1 18  ? 62.350  11.769  33.530  1.00 34.00  ? 17  LEU A CD1   1 
ATOM   93   C  CD2   . LEU A 1 18  ? 62.010  10.365  35.571  1.00 27.48  ? 17  LEU A CD2   1 
ATOM   94   N  N     . ILE A 1 19  ? 64.568  6.999   32.120  1.00 24.16  ? 18  ILE A N     1 
ATOM   95   C  CA    . ILE A 1 19  ? 64.596  5.960   31.095  1.00 25.92  ? 18  ILE A CA    1 
ATOM   96   C  C     . ILE A 1 19  ? 64.946  4.612   31.709  1.00 29.67  ? 18  ILE A C     1 
ATOM   97   O  O     . ILE A 1 19  ? 64.223  3.626   31.532  1.00 26.58  ? 18  ILE A O     1 
ATOM   98   C  CB    . ILE A 1 19  ? 65.584  6.340   29.978  1.00 28.66  ? 18  ILE A CB    1 
ATOM   99   C  CG1   . ILE A 1 19  ? 65.047  7.522   29.171  1.00 32.92  ? 18  ILE A CG1   1 
ATOM   100  C  CG2   . ILE A 1 19  ? 65.852  5.145   29.076  1.00 23.58  ? 18  ILE A CG2   1 
ATOM   101  C  CD1   . ILE A 1 19  ? 66.126  8.318   28.473  1.00 30.01  ? 18  ILE A CD1   1 
ATOM   102  N  N     . ILE A 1 20  ? 66.066  4.547   32.434  1.00 29.44  ? 19  ILE A N     1 
ATOM   103  C  CA    . ILE A 1 20  ? 66.465  3.296   33.072  1.00 29.74  ? 19  ILE A CA    1 
ATOM   104  C  C     . ILE A 1 20  ? 65.398  2.840   34.057  1.00 29.47  ? 19  ILE A C     1 
ATOM   105  O  O     . ILE A 1 20  ? 65.145  1.639   34.215  1.00 35.42  ? 19  ILE A O     1 
ATOM   106  C  CB    . ILE A 1 20  ? 67.838  3.459   33.752  1.00 28.22  ? 19  ILE A CB    1 
ATOM   107  C  CG1   . ILE A 1 20  ? 68.915  3.751   32.708  1.00 33.58  ? 19  ILE A CG1   1 
ATOM   108  C  CG2   . ILE A 1 20  ? 68.200  2.212   34.536  1.00 33.43  ? 19  ILE A CG2   1 
ATOM   109  C  CD1   . ILE A 1 20  ? 68.945  2.754   31.574  1.00 36.63  ? 19  ILE A CD1   1 
ATOM   110  N  N     . GLY A 1 21  ? 64.740  3.789   34.716  1.00 33.13  ? 20  GLY A N     1 
ATOM   111  C  CA    . GLY A 1 21  ? 63.670  3.463   35.634  1.00 28.34  ? 20  GLY A CA    1 
ATOM   112  C  C     . GLY A 1 21  ? 62.387  3.032   34.951  1.00 36.10  ? 20  GLY A C     1 
ATOM   113  O  O     . GLY A 1 21  ? 62.057  1.845   34.939  1.00 34.22  ? 20  GLY A O     1 
ATOM   114  N  N     . ASP A 1 22  ? 61.659  3.976   34.361  1.00 31.50  ? 21  ASP A N     1 
ATOM   115  C  CA    . ASP A 1 22  ? 60.310  3.714   33.878  1.00 30.92  ? 21  ASP A CA    1 
ATOM   116  C  C     . ASP A 1 22  ? 60.235  3.451   32.380  1.00 27.93  ? 21  ASP A C     1 
ATOM   117  O  O     . ASP A 1 22  ? 59.130  3.390   31.832  1.00 31.39  ? 21  ASP A O     1 
ATOM   118  C  CB    . ASP A 1 22  ? 59.392  4.878   34.240  1.00 29.46  ? 21  ASP A CB    1 
ATOM   119  C  CG    . ASP A 1 22  ? 58.878  4.789   35.655  1.00 31.81  ? 21  ASP A CG    1 
ATOM   120  O  OD1   . ASP A 1 22  ? 58.889  3.674   36.220  1.00 27.46  ? 21  ASP A OD1   1 
ATOM   121  O  OD2   . ASP A 1 22  ? 58.465  5.833   36.199  1.00 34.07  ? 21  ASP A OD2   1 
ATOM   122  N  N     . GLY A 1 23  ? 61.368  3.292   31.706  1.00 26.64  ? 22  GLY A N     1 
ATOM   123  C  CA    . GLY A 1 23  ? 61.341  3.049   30.278  1.00 24.68  ? 22  GLY A CA    1 
ATOM   124  C  C     . GLY A 1 23  ? 62.406  2.076   29.821  1.00 29.66  ? 22  GLY A C     1 
ATOM   125  O  O     . GLY A 1 23  ? 62.561  0.999   30.405  1.00 30.65  ? 22  GLY A O     1 
ATOM   126  N  N     . GLY A 1 24  ? 63.151  2.441   28.787  1.00 26.04  ? 23  GLY A N     1 
ATOM   127  C  CA    . GLY A 1 24  ? 64.227  1.589   28.322  1.00 27.31  ? 23  GLY A CA    1 
ATOM   128  C  C     . GLY A 1 24  ? 64.798  2.089   27.017  1.00 36.42  ? 23  GLY A C     1 
ATOM   129  O  O     . GLY A 1 24  ? 64.300  3.038   26.404  1.00 29.67  ? 23  GLY A O     1 
ATOM   130  N  N     . LEU A 1 25  ? 65.873  1.423   26.604  1.00 30.03  ? 24  LEU A N     1 
ATOM   131  C  CA    . LEU A 1 25  ? 66.543  1.677   25.336  1.00 28.84  ? 24  LEU A CA    1 
ATOM   132  C  C     . LEU A 1 25  ? 66.455  0.403   24.510  1.00 31.98  ? 24  LEU A C     1 
ATOM   133  O  O     . LEU A 1 25  ? 66.891  -0.661  24.962  1.00 31.07  ? 24  LEU A O     1 
ATOM   134  C  CB    . LEU A 1 25  ? 67.998  2.089   25.561  1.00 25.85  ? 24  LEU A CB    1 
ATOM   135  C  CG    . LEU A 1 25  ? 68.178  3.273   26.512  1.00 27.67  ? 24  LEU A CG    1 
ATOM   136  C  CD1   . LEU A 1 25  ? 69.613  3.357   27.009  1.00 36.55  ? 24  LEU A CD1   1 
ATOM   137  C  CD2   . LEU A 1 25  ? 67.766  4.568   25.831  1.00 26.98  ? 24  LEU A CD2   1 
ATOM   138  N  N     . TYR A 1 26  ? 65.890  0.507   23.311  1.00 28.69  ? 25  TYR A N     1 
ATOM   139  C  CA    . TYR A 1 26  ? 65.512  -0.671  22.543  1.00 31.96  ? 25  TYR A CA    1 
ATOM   140  C  C     . TYR A 1 26  ? 66.061  -0.590  21.128  1.00 31.12  ? 25  TYR A C     1 
ATOM   141  O  O     . TYR A 1 26  ? 65.867  0.414   20.435  1.00 30.37  ? 25  TYR A O     1 
ATOM   142  C  CB    . TYR A 1 26  ? 63.989  -0.829  22.522  1.00 27.59  ? 25  TYR A CB    1 
ATOM   143  C  CG    . TYR A 1 26  ? 63.384  -0.832  23.906  1.00 32.59  ? 25  TYR A CG    1 
ATOM   144  C  CD1   . TYR A 1 26  ? 63.685  -1.840  24.811  1.00 29.46  ? 25  TYR A CD1   1 
ATOM   145  C  CD2   . TYR A 1 26  ? 62.523  0.180   24.313  1.00 30.55  ? 25  TYR A CD2   1 
ATOM   146  C  CE1   . TYR A 1 26  ? 63.141  -1.847  26.081  1.00 29.39  ? 25  TYR A CE1   1 
ATOM   147  C  CE2   . TYR A 1 26  ? 61.971  0.181   25.582  1.00 27.75  ? 25  TYR A CE2   1 
ATOM   148  C  CZ    . TYR A 1 26  ? 62.284  -0.836  26.461  1.00 30.67  ? 25  TYR A CZ    1 
ATOM   149  O  OH    . TYR A 1 26  ? 61.742  -0.840  27.724  1.00 32.30  ? 25  TYR A OH    1 
ATOM   150  N  N     . LYS A 1 27  ? 66.741  -1.655  20.710  1.00 35.42  ? 26  LYS A N     1 
ATOM   151  C  CA    . LYS A 1 27  ? 67.261  -1.814  19.356  1.00 35.67  ? 26  LYS A CA    1 
ATOM   152  C  C     . LYS A 1 27  ? 66.428  -2.894  18.676  1.00 34.29  ? 26  LYS A C     1 
ATOM   153  O  O     . LYS A 1 27  ? 66.554  -4.080  19.002  1.00 34.56  ? 26  LYS A O     1 
ATOM   154  C  CB    . LYS A 1 27  ? 68.744  -2.179  19.392  1.00 35.89  ? 26  LYS A CB    1 
ATOM   155  C  CG    . LYS A 1 27  ? 69.355  -2.568  18.055  1.00 39.03  ? 26  LYS A CG    1 
ATOM   156  C  CD    . LYS A 1 27  ? 70.840  -2.868  18.220  1.00 44.58  ? 26  LYS A CD    1 
ATOM   157  C  CE    . LYS A 1 27  ? 71.409  -3.612  17.021  1.00 58.55  ? 26  LYS A CE    1 
ATOM   158  N  NZ    . LYS A 1 27  ? 71.482  -2.756  15.807  1.00 57.37  ? 26  LYS A NZ    1 
ATOM   159  N  N     . LEU A 1 28  ? 65.574  -2.485  17.743  1.00 31.65  ? 27  LEU A N     1 
ATOM   160  C  CA    . LEU A 1 28  ? 64.589  -3.372  17.139  1.00 36.23  ? 27  LEU A CA    1 
ATOM   161  C  C     . LEU A 1 28  ? 65.044  -3.835  15.762  1.00 40.52  ? 27  LEU A C     1 
ATOM   162  O  O     . LEU A 1 28  ? 65.644  -3.070  15.002  1.00 38.58  ? 27  LEU A O     1 
ATOM   163  C  CB    . LEU A 1 28  ? 63.227  -2.681  17.014  1.00 33.27  ? 27  LEU A CB    1 
ATOM   164  C  CG    . LEU A 1 28  ? 62.358  -2.401  18.247  1.00 34.57  ? 27  LEU A CG    1 
ATOM   165  C  CD1   . LEU A 1 28  ? 62.092  -3.678  19.037  1.00 41.89  ? 27  LEU A CD1   1 
ATOM   166  C  CD2   . LEU A 1 28  ? 62.948  -1.314  19.131  1.00 32.38  ? 27  LEU A CD2   1 
ATOM   167  N  N     . LYS A 1 29  ? 64.745  -5.093  15.446  1.00 42.29  ? 28  LYS A N     1 
ATOM   168  C  CA    . LYS A 1 29  ? 64.961  -5.659  14.122  1.00 44.17  ? 28  LYS A CA    1 
ATOM   169  C  C     . LYS A 1 29  ? 63.626  -6.157  13.589  1.00 51.59  ? 28  LYS A C     1 
ATOM   170  O  O     . LYS A 1 29  ? 62.931  -6.923  14.265  1.00 51.12  ? 28  LYS A O     1 
ATOM   171  C  CB    . LYS A 1 29  ? 65.987  -6.796  14.165  1.00 45.91  ? 28  LYS A CB    1 
ATOM   172  C  CG    . LYS A 1 29  ? 67.335  -6.393  14.748  1.00 57.56  ? 28  LYS A CG    1 
ATOM   173  C  CD    . LYS A 1 29  ? 68.283  -7.580  14.836  1.00 69.77  ? 28  LYS A CD    1 
ATOM   174  C  CE    . LYS A 1 29  ? 68.560  -7.965  16.281  1.00 67.49  ? 28  LYS A CE    1 
ATOM   175  N  NZ    . LYS A 1 29  ? 69.240  -6.871  17.031  1.00 72.85  ? 28  LYS A NZ    1 
ATOM   176  N  N     . TYR A 1 30  ? 63.266  -5.718  12.386  1.00 51.45  ? 29  TYR A N     1 
ATOM   177  C  CA    . TYR A 1 30  ? 61.959  -5.982  11.803  1.00 47.30  ? 29  TYR A CA    1 
ATOM   178  C  C     . TYR A 1 30  ? 62.096  -6.779  10.513  1.00 52.79  ? 29  TYR A C     1 
ATOM   179  O  O     . TYR A 1 30  ? 63.195  -6.997  9.997   1.00 53.05  ? 29  TYR A O     1 
ATOM   180  C  CB    . TYR A 1 30  ? 61.212  -4.677  11.495  1.00 43.84  ? 29  TYR A CB    1 
ATOM   181  C  CG    . TYR A 1 30  ? 60.902  -3.803  12.685  1.00 47.34  ? 29  TYR A CG    1 
ATOM   182  C  CD1   . TYR A 1 30  ? 60.802  -4.334  13.962  1.00 46.46  ? 29  TYR A CD1   1 
ATOM   183  C  CD2   . TYR A 1 30  ? 60.701  -2.438  12.525  1.00 43.70  ? 29  TYR A CD2   1 
ATOM   184  C  CE1   . TYR A 1 30  ? 60.515  -3.529  15.048  1.00 41.86  ? 29  TYR A CE1   1 
ATOM   185  C  CE2   . TYR A 1 30  ? 60.413  -1.626  13.602  1.00 42.85  ? 29  TYR A CE2   1 
ATOM   186  C  CZ    . TYR A 1 30  ? 60.321  -2.176  14.862  1.00 40.26  ? 29  TYR A CZ    1 
ATOM   187  O  OH    . TYR A 1 30  ? 60.034  -1.368  15.938  1.00 38.80  ? 29  TYR A OH    1 
ATOM   188  N  N     . LYS A 1 31  ? 60.949  -7.216  9.999   1.00 51.81  ? 30  LYS A N     1 
ATOM   189  C  CA    . LYS A 1 31  ? 60.823  -7.559  8.589   1.00 58.30  ? 30  LYS A CA    1 
ATOM   190  C  C     . LYS A 1 31  ? 60.972  -6.250  7.831   1.00 59.21  ? 30  LYS A C     1 
ATOM   191  O  O     . LYS A 1 31  ? 60.102  -5.395  7.942   1.00 63.30  ? 30  LYS A O     1 
ATOM   192  C  CB    . LYS A 1 31  ? 59.460  -8.184  8.269   1.00 57.84  ? 30  LYS A CB    1 
ATOM   193  C  CG    . LYS A 1 31  ? 59.044  -9.373  9.114   1.00 66.11  ? 30  LYS A CG    1 
ATOM   194  C  CD    . LYS A 1 31  ? 57.678  -9.888  8.663   1.00 69.65  ? 30  LYS A CD    1 
ATOM   195  C  CE    . LYS A 1 31  ? 56.553  -9.037  9.240   1.00 67.12  ? 30  LYS A CE    1 
ATOM   196  N  NZ    . LYS A 1 31  ? 55.269  -9.185  8.494   1.00 73.79  ? 30  LYS A NZ    1 
ATOM   197  N  N     . GLY A 1 32  ? 62.044  -6.067  7.066   1.00 63.36  ? 31  GLY A N     1 
ATOM   198  C  CA    . GLY A 1 32  ? 63.080  -7.058  6.856   1.00 60.34  ? 31  GLY A CA    1 
ATOM   199  C  C     . GLY A 1 32  ? 63.885  -6.661  5.632   1.00 60.83  ? 31  GLY A C     1 
ATOM   200  O  O     . GLY A 1 32  ? 63.392  -6.765  4.509   1.00 77.13  ? 31  GLY A O     1 
ATOM   201  N  N     . ASN A 1 33  ? 65.113  -6.188  5.835   1.00 58.14  ? 32  ASN A N     1 
ATOM   202  C  CA    . ASN A 1 33  ? 65.705  -6.064  7.163   1.00 54.37  ? 32  ASN A CA    1 
ATOM   203  C  C     . ASN A 1 33  ? 65.568  -4.647  7.716   1.00 45.95  ? 32  ASN A C     1 
ATOM   204  O  O     . ASN A 1 33  ? 66.552  -3.914  7.810   1.00 46.09  ? 32  ASN A O     1 
ATOM   205  C  CB    . ASN A 1 33  ? 67.184  -6.456  7.125   1.00 60.34  ? 32  ASN A CB    1 
ATOM   206  C  CG    . ASN A 1 33  ? 67.429  -7.741  6.359   1.00 65.09  ? 32  ASN A CG    1 
ATOM   207  O  OD1   . ASN A 1 33  ? 67.425  -7.753  5.128   1.00 65.08  ? 32  ASN A OD1   1 
ATOM   208  N  ND2   . ASN A 1 33  ? 67.652  -8.830  7.086   1.00 71.17  ? 32  ASN A ND2   1 
ATOM   209  N  N     . ARG A 1 34  ? 64.348  -4.264  8.078   1.00 49.91  ? 33  ARG A N     1 
ATOM   210  C  CA    . ARG A 1 34  ? 64.121  -2.966  8.689   1.00 46.65  ? 33  ARG A CA    1 
ATOM   211  C  C     . ARG A 1 34  ? 64.578  -2.986  10.147  1.00 43.43  ? 33  ARG A C     1 
ATOM   212  O  O     . ARG A 1 34  ? 64.805  -4.043  10.743  1.00 43.16  ? 33  ARG A O     1 
ATOM   213  C  CB    . ARG A 1 34  ? 62.646  -2.578  8.579   1.00 46.85  ? 33  ARG A CB    1 
ATOM   214  C  CG    . ARG A 1 34  ? 62.122  -2.599  7.148   1.00 48.11  ? 33  ARG A CG    1 
ATOM   215  C  CD    . ARG A 1 34  ? 60.628  -2.301  7.064   1.00 47.24  ? 33  ARG A CD    1 
ATOM   216  N  NE    . ARG A 1 34  ? 59.822  -3.215  7.866   1.00 49.55  ? 33  ARG A NE    1 
ATOM   217  C  CZ    . ARG A 1 34  ? 59.050  -2.843  8.882   1.00 48.05  ? 33  ARG A CZ    1 
ATOM   218  N  NH1   . ARG A 1 34  ? 58.969  -1.567  9.227   1.00 45.75  ? 33  ARG A NH1   1 
ATOM   219  N  NH2   . ARG A 1 34  ? 58.354  -3.752  9.551   1.00 57.04  ? 33  ARG A NH2   1 
ATOM   220  N  N     . SER A 1 35  ? 64.725  -1.796  10.725  1.00 37.01  ? 34  SER A N     1 
ATOM   221  C  CA    . SER A 1 35  ? 65.204  -1.679  12.095  1.00 39.84  ? 34  SER A CA    1 
ATOM   222  C  C     . SER A 1 35  ? 64.636  -0.415  12.724  1.00 35.51  ? 34  SER A C     1 
ATOM   223  O  O     . SER A 1 35  ? 64.022  0.419   12.054  1.00 36.62  ? 34  SER A O     1 
ATOM   224  C  CB    . SER A 1 35  ? 66.737  -1.670  12.154  1.00 35.50  ? 34  SER A CB    1 
ATOM   225  O  OG    . SER A 1 35  ? 67.265  -0.507  11.540  1.00 37.12  ? 34  SER A OG    1 
ATOM   226  N  N     . GLU A 1 36  ? 64.851  -0.285  14.032  1.00 33.15  ? 35  GLU A N     1 
ATOM   227  C  CA    . GLU A 1 36  ? 64.418  0.894   14.767  1.00 36.06  ? 35  GLU A CA    1 
ATOM   228  C  C     . GLU A 1 36  ? 65.189  0.970   16.077  1.00 33.17  ? 35  GLU A C     1 
ATOM   229  O  O     . GLU A 1 36  ? 65.559  -0.054  16.657  1.00 31.12  ? 35  GLU A O     1 
ATOM   230  C  CB    . GLU A 1 36  ? 62.908  0.875   15.035  1.00 35.50  ? 35  GLU A CB    1 
ATOM   231  C  CG    . GLU A 1 36  ? 62.365  2.191   15.572  1.00 36.33  ? 35  GLU A CG    1 
ATOM   232  C  CD    . GLU A 1 36  ? 60.859  2.185   15.745  1.00 39.30  ? 35  GLU A CD    1 
ATOM   233  O  OE1   . GLU A 1 36  ? 60.224  1.158   15.427  1.00 38.77  ? 35  GLU A OE1   1 
ATOM   234  O  OE2   . GLU A 1 36  ? 60.311  3.212   16.199  1.00 32.92  ? 35  GLU A OE2   1 
ATOM   235  N  N     . TYR A 1 37  ? 65.427  2.200   16.530  1.00 31.54  ? 36  TYR A N     1 
ATOM   236  C  CA    . TYR A 1 37  ? 66.122  2.473   17.782  1.00 32.61  ? 36  TYR A CA    1 
ATOM   237  C  C     . TYR A 1 37  ? 65.241  3.400   18.604  1.00 32.74  ? 36  TYR A C     1 
ATOM   238  O  O     . TYR A 1 37  ? 64.861  4.475   18.129  1.00 38.70  ? 36  TYR A O     1 
ATOM   239  C  CB    . TYR A 1 37  ? 67.491  3.113   17.530  1.00 31.19  ? 36  TYR A CB    1 
ATOM   240  C  CG    . TYR A 1 37  ? 68.393  2.328   16.600  1.00 34.33  ? 36  TYR A CG    1 
ATOM   241  C  CD1   . TYR A 1 37  ? 68.191  2.342   15.224  1.00 28.84  ? 36  TYR A CD1   1 
ATOM   242  C  CD2   . TYR A 1 37  ? 69.455  1.585   17.097  1.00 30.82  ? 36  TYR A CD2   1 
ATOM   243  C  CE1   . TYR A 1 37  ? 69.013  1.629   14.373  1.00 32.65  ? 36  TYR A CE1   1 
ATOM   244  C  CE2   . TYR A 1 37  ? 70.284  0.871   16.253  1.00 32.70  ? 36  TYR A CE2   1 
ATOM   245  C  CZ    . TYR A 1 37  ? 70.059  0.897   14.893  1.00 37.76  ? 36  TYR A CZ    1 
ATOM   246  O  OH    . TYR A 1 37  ? 70.881  0.187   14.049  1.00 38.48  ? 36  TYR A OH    1 
ATOM   247  N  N     . ARG A 1 38  ? 64.917  2.994   19.829  1.00 26.92  ? 37  ARG A N     1 
ATOM   248  C  CA    . ARG A 1 38  ? 63.906  3.688   20.612  1.00 29.43  ? 37  ARG A CA    1 
ATOM   249  C  C     . ARG A 1 38  ? 64.442  4.113   21.969  1.00 30.25  ? 37  ARG A C     1 
ATOM   250  O  O     . ARG A 1 38  ? 65.149  3.355   22.641  1.00 29.07  ? 37  ARG A O     1 
ATOM   251  C  CB    . ARG A 1 38  ? 62.666  2.814   20.802  1.00 31.25  ? 37  ARG A CB    1 
ATOM   252  C  CG    . ARG A 1 38  ? 61.798  2.735   19.566  1.00 29.94  ? 37  ARG A CG    1 
ATOM   253  C  CD    . ARG A 1 38  ? 60.518  1.978   19.837  1.00 34.59  ? 37  ARG A CD    1 
ATOM   254  N  NE    . ARG A 1 38  ? 59.675  1.930   18.649  1.00 35.94  ? 37  ARG A NE    1 
ATOM   255  C  CZ    . ARG A 1 38  ? 58.517  1.284   18.580  1.00 40.93  ? 37  ARG A CZ    1 
ATOM   256  N  NH1   . ARG A 1 38  ? 58.057  0.624   19.634  1.00 37.93  ? 37  ARG A NH1   1 
ATOM   257  N  NH2   . ARG A 1 38  ? 57.820  1.299   17.455  1.00 39.74  ? 37  ARG A NH2   1 
ATOM   258  N  N     . VAL A 1 39  ? 64.093  5.336   22.357  1.00 30.12  ? 38  VAL A N     1 
ATOM   259  C  CA    . VAL A 1 39  ? 64.296  5.857   23.703  1.00 26.66  ? 38  VAL A CA    1 
ATOM   260  C  C     . VAL A 1 39  ? 62.914  6.070   24.303  1.00 34.79  ? 38  VAL A C     1 
ATOM   261  O  O     . VAL A 1 39  ? 62.106  6.830   23.755  1.00 32.13  ? 38  VAL A O     1 
ATOM   262  C  CB    . VAL A 1 39  ? 65.110  7.159   23.689  1.00 29.73  ? 38  VAL A CB    1 
ATOM   263  C  CG1   . VAL A 1 39  ? 65.264  7.705   25.093  1.00 28.09  ? 38  VAL A CG1   1 
ATOM   264  C  CG2   . VAL A 1 39  ? 66.470  6.924   23.050  1.00 25.84  ? 38  VAL A CG2   1 
ATOM   265  N  N     . VAL A 1 40  ? 62.630  5.394   25.415  1.00 32.03  ? 39  VAL A N     1 
ATOM   266  C  CA    . VAL A 1 40  ? 61.267  5.254   25.912  1.00 30.19  ? 39  VAL A CA    1 
ATOM   267  C  C     . VAL A 1 40  ? 61.199  5.631   27.386  1.00 27.82  ? 39  VAL A C     1 
ATOM   268  O  O     . VAL A 1 40  ? 62.090  5.289   28.170  1.00 25.95  ? 39  VAL A O     1 
ATOM   269  C  CB    . VAL A 1 40  ? 60.743  3.816   25.697  1.00 32.56  ? 39  VAL A CB    1 
ATOM   270  C  CG1   . VAL A 1 40  ? 59.392  3.620   26.373  1.00 32.11  ? 39  VAL A CG1   1 
ATOM   271  C  CG2   . VAL A 1 40  ? 60.645  3.502   24.212  1.00 27.68  ? 39  VAL A CG2   1 
ATOM   272  N  N     . ILE A 1 41  ? 60.141  6.356   27.752  1.00 28.40  ? 40  ILE A N     1 
ATOM   273  C  CA    . ILE A 1 41  ? 59.716  6.534   29.136  1.00 31.52  ? 40  ILE A CA    1 
ATOM   274  C  C     . ILE A 1 41  ? 58.216  6.279   29.190  1.00 30.80  ? 40  ILE A C     1 
ATOM   275  O  O     . ILE A 1 41  ? 57.453  6.899   28.441  1.00 31.01  ? 40  ILE A O     1 
ATOM   276  C  CB    . ILE A 1 41  ? 60.031  7.944   29.673  1.00 27.17  ? 40  ILE A CB    1 
ATOM   277  C  CG1   . ILE A 1 41  ? 61.509  8.288   29.494  1.00 31.14  ? 40  ILE A CG1   1 
ATOM   278  C  CG2   . ILE A 1 41  ? 59.631  8.056   31.139  1.00 31.03  ? 40  ILE A CG2   1 
ATOM   279  C  CD1   . ILE A 1 41  ? 61.808  9.763   29.673  1.00 28.10  ? 40  ILE A CD1   1 
ATOM   280  N  N     . THR A 1 42  ? 57.793  5.369   30.063  1.00 27.23  ? 41  THR A N     1 
ATOM   281  C  CA    . THR A 1 42  ? 56.379  5.087   30.258  1.00 28.87  ? 41  THR A CA    1 
ATOM   282  C  C     . THR A 1 42  ? 55.917  5.640   31.600  1.00 34.77  ? 41  THR A C     1 
ATOM   283  O  O     . THR A 1 42  ? 56.704  5.762   32.544  1.00 30.66  ? 41  THR A O     1 
ATOM   284  C  CB    . THR A 1 42  ? 56.083  3.584   30.192  1.00 28.03  ? 41  THR A CB    1 
ATOM   285  O  OG1   . THR A 1 42  ? 56.702  2.920   31.300  1.00 28.42  ? 41  THR A OG1   1 
ATOM   286  C  CG2   . THR A 1 42  ? 56.602  2.992   28.889  1.00 33.46  ? 41  THR A CG2   1 
ATOM   287  N  N     . GLN A 1 43  ? 54.630  5.971   31.674  1.00 31.59  ? 42  GLN A N     1 
ATOM   288  C  CA    . GLN A 1 43  ? 54.042  6.551   32.874  1.00 34.15  ? 42  GLN A CA    1 
ATOM   289  C  C     . GLN A 1 43  ? 52.528  6.542   32.728  1.00 36.16  ? 42  GLN A C     1 
ATOM   290  O  O     . GLN A 1 43  ? 51.999  6.715   31.626  1.00 32.68  ? 42  GLN A O     1 
ATOM   291  C  CB    . GLN A 1 43  ? 54.544  7.983   33.108  1.00 30.54  ? 42  GLN A CB    1 
ATOM   292  C  CG    . GLN A 1 43  ? 54.410  8.481   34.536  1.00 35.12  ? 42  GLN A CG    1 
ATOM   293  C  CD    . GLN A 1 43  ? 55.555  8.024   35.419  1.00 33.07  ? 42  GLN A CD    1 
ATOM   294  O  OE1   . GLN A 1 43  ? 56.445  7.299   34.974  1.00 39.77  ? 42  GLN A OE1   1 
ATOM   295  N  NE2   . GLN A 1 43  ? 55.542  8.452   36.675  1.00 29.53  ? 42  GLN A NE2   1 
ATOM   296  N  N     . LYS A 1 44  ? 51.839  6.337   33.853  1.00 34.62  ? 43  LYS A N     1 
ATOM   297  C  CA    . LYS A 1 44  ? 50.380  6.365   33.844  1.00 39.87  ? 43  LYS A CA    1 
ATOM   298  C  C     . LYS A 1 44  ? 49.859  7.774   33.578  1.00 36.82  ? 43  LYS A C     1 
ATOM   299  O  O     . LYS A 1 44  ? 48.997  7.977   32.716  1.00 38.59  ? 43  LYS A O     1 
ATOM   300  C  CB    . LYS A 1 44  ? 49.837  5.831   35.170  1.00 42.19  ? 43  LYS A CB    1 
ATOM   301  C  CG    . LYS A 1 44  ? 48.322  5.889   35.293  1.00 40.88  ? 43  LYS A CG    1 
ATOM   302  C  CD    . LYS A 1 44  ? 47.670  4.625   34.761  1.00 49.71  ? 43  LYS A CD    1 
ATOM   303  C  CE    . LYS A 1 44  ? 46.160  4.678   34.931  1.00 57.09  ? 43  LYS A CE    1 
ATOM   304  N  NZ    . LYS A 1 44  ? 45.771  4.913   36.350  1.00 52.89  ? 43  LYS A NZ    1 
ATOM   305  N  N     . SER A 1 45  ? 50.377  8.759   34.307  1.00 35.88  ? 44  SER A N     1 
ATOM   306  C  CA    . SER A 1 45  ? 49.945  10.145  34.153  1.00 41.53  ? 44  SER A CA    1 
ATOM   307  C  C     . SER A 1 45  ? 50.433  10.696  32.816  1.00 48.49  ? 44  SER A C     1 
ATOM   308  O  O     . SER A 1 45  ? 51.640  10.814  32.587  1.00 41.47  ? 44  SER A O     1 
ATOM   309  C  CB    . SER A 1 45  ? 50.472  10.984  35.313  1.00 39.23  ? 44  SER A CB    1 
ATOM   310  O  OG    . SER A 1 45  ? 50.332  12.367  35.045  1.00 49.43  ? 44  SER A OG    1 
ATOM   311  N  N     . GLU A 1 46  ? 49.496  11.036  31.926  1.00 48.63  ? 45  GLU A N     1 
ATOM   312  C  CA    . GLU A 1 46  ? 49.873  11.684  30.674  1.00 46.61  ? 45  GLU A CA    1 
ATOM   313  C  C     . GLU A 1 46  ? 50.223  13.147  30.901  1.00 43.28  ? 45  GLU A C     1 
ATOM   314  O  O     . GLU A 1 46  ? 51.051  13.705  30.168  1.00 45.20  ? 45  GLU A O     1 
ATOM   315  C  CB    . GLU A 1 46  ? 48.753  11.536  29.640  1.00 53.15  ? 45  GLU A CB    1 
ATOM   316  C  CG    . GLU A 1 46  ? 48.739  12.608  28.542  1.00 58.97  ? 45  GLU A CG    1 
ATOM   317  C  CD    . GLU A 1 46  ? 47.547  12.492  27.614  1.00 72.42  ? 45  GLU A CD    1 
ATOM   318  O  OE1   . GLU A 1 46  ? 46.390  12.606  28.087  1.00 70.02  ? 45  GLU A OE1   1 
ATOM   319  O  OE2   . GLU A 1 46  ? 47.756  12.287  26.392  1.00 66.42  ? 45  GLU A OE2   1 
ATOM   320  N  N     . ASN A 1 47  ? 49.614  13.776  31.913  1.00 45.27  ? 46  ASN A N     1 
ATOM   321  C  CA    . ASN A 1 47  ? 50.049  15.104  32.330  1.00 44.96  ? 46  ASN A CA    1 
ATOM   322  C  C     . ASN A 1 47  ? 51.543  15.122  32.623  1.00 45.84  ? 46  ASN A C     1 
ATOM   323  O  O     . ASN A 1 47  ? 52.283  15.958  32.093  1.00 45.85  ? 46  ASN A O     1 
ATOM   324  C  CB    . ASN A 1 47  ? 49.263  15.550  33.560  1.00 47.90  ? 46  ASN A CB    1 
ATOM   325  C  CG    . ASN A 1 47  ? 47.910  16.141  33.213  1.00 66.17  ? 46  ASN A CG    1 
ATOM   326  O  OD1   . ASN A 1 47  ? 47.455  16.066  32.073  1.00 53.23  ? 46  ASN A OD1   1 
ATOM   327  N  ND2   . ASN A 1 47  ? 47.265  16.753  34.202  1.00 67.32  ? 46  ASN A ND2   1 
ATOM   328  N  N     . LEU A 1 48  ? 52.007  14.193  33.463  1.00 40.78  ? 47  LEU A N     1 
ATOM   329  C  CA    . LEU A 1 48  ? 53.418  14.153  33.831  1.00 40.91  ? 47  LEU A CA    1 
ATOM   330  C  C     . LEU A 1 48  ? 54.306  13.935  32.611  1.00 40.07  ? 47  LEU A C     1 
ATOM   331  O  O     . LEU A 1 48  ? 55.402  14.501  32.521  1.00 41.82  ? 47  LEU A O     1 
ATOM   332  C  CB    . LEU A 1 48  ? 53.648  13.058  34.871  1.00 43.91  ? 47  LEU A CB    1 
ATOM   333  C  CG    . LEU A 1 48  ? 54.922  13.179  35.702  1.00 46.89  ? 47  LEU A CG    1 
ATOM   334  C  CD1   . LEU A 1 48  ? 55.035  14.584  36.259  1.00 50.35  ? 47  LEU A CD1   1 
ATOM   335  C  CD2   . LEU A 1 48  ? 54.927  12.152  36.821  1.00 46.87  ? 47  LEU A CD2   1 
ATOM   336  N  N     A ILE A 1 49  ? 53.850  13.119  31.660  0.00 39.32  ? 48  ILE A N     1 
ATOM   337  N  N     B ILE A 1 49  ? 53.846  13.122  31.660  1.00 39.37  ? 48  ILE A N     1 
ATOM   338  C  CA    A ILE A 1 49  ? 54.635  12.880  30.453  0.00 39.66  ? 48  ILE A CA    1 
ATOM   339  C  CA    B ILE A 1 49  ? 54.626  12.871  30.452  1.00 39.11  ? 48  ILE A CA    1 
ATOM   340  C  C     A ILE A 1 49  ? 54.634  14.116  29.563  0.00 41.42  ? 48  ILE A C     1 
ATOM   341  C  C     B ILE A 1 49  ? 54.630  14.103  29.554  1.00 41.64  ? 48  ILE A C     1 
ATOM   342  O  O     A ILE A 1 49  ? 55.687  14.571  29.103  0.00 40.01  ? 48  ILE A O     1 
ATOM   343  O  O     B ILE A 1 49  ? 55.684  14.543  29.082  1.00 40.45  ? 48  ILE A O     1 
ATOM   344  C  CB    A ILE A 1 49  ? 54.109  11.643  29.702  0.00 40.10  ? 48  ILE A CB    1 
ATOM   345  C  CB    B ILE A 1 49  ? 54.087  11.631  29.714  1.00 40.00  ? 48  ILE A CB    1 
ATOM   346  C  CG1   A ILE A 1 49  ? 54.509  10.363  30.436  0.00 41.20  ? 48  ILE A CG1   1 
ATOM   347  C  CG1   B ILE A 1 49  ? 54.678  10.353  30.314  1.00 41.75  ? 48  ILE A CG1   1 
ATOM   348  C  CG2   A ILE A 1 49  ? 54.625  11.625  28.269  0.00 42.55  ? 48  ILE A CG2   1 
ATOM   349  C  CG2   B ILE A 1 49  ? 54.384  11.714  28.221  1.00 43.72  ? 48  ILE A CG2   1 
ATOM   350  C  CD1   A ILE A 1 49  ? 54.204  9.097   29.665  0.00 39.38  ? 48  ILE A CD1   1 
ATOM   351  C  CD1   B ILE A 1 49  ? 54.337  9.096   29.540  1.00 39.77  ? 48  ILE A CD1   1 
ATOM   352  N  N     . LYS A 1 50  ? 53.451  14.684  29.313  1.00 37.39  ? 49  LYS A N     1 
ATOM   353  C  CA    . LYS A 1 50  ? 53.356  15.813  28.393  1.00 40.97  ? 49  LYS A CA    1 
ATOM   354  C  C     . LYS A 1 50  ? 53.946  17.091  28.976  1.00 40.34  ? 49  LYS A C     1 
ATOM   355  O  O     . LYS A 1 50  ? 54.520  17.896  28.234  1.00 39.24  ? 49  LYS A O     1 
ATOM   356  C  CB    . LYS A 1 50  ? 51.898  16.051  27.995  1.00 45.49  ? 49  LYS A CB    1 
ATOM   357  C  CG    . LYS A 1 50  ? 51.334  15.013  27.043  1.00 54.07  ? 49  LYS A CG    1 
ATOM   358  C  CD    . LYS A 1 50  ? 50.057  15.498  26.376  1.00 55.01  ? 49  LYS A CD    1 
ATOM   359  C  CE    . LYS A 1 50  ? 49.680  14.606  25.203  1.00 60.31  ? 49  LYS A CE    1 
ATOM   360  N  NZ    . LYS A 1 50  ? 48.379  14.997  24.595  1.00 66.80  ? 49  LYS A NZ    1 
ATOM   361  N  N     . GLN A 1 51  ? 53.822  17.300  30.286  1.00 37.86  ? 50  GLN A N     1 
ATOM   362  C  CA    . GLN A 1 51  ? 54.158  18.588  30.881  1.00 40.93  ? 50  GLN A CA    1 
ATOM   363  C  C     . GLN A 1 51  ? 55.526  18.627  31.546  1.00 42.78  ? 50  GLN A C     1 
ATOM   364  O  O     . GLN A 1 51  ? 56.120  19.706  31.640  1.00 43.98  ? 50  GLN A O     1 
ATOM   365  C  CB    . GLN A 1 51  ? 53.090  18.990  31.904  1.00 41.49  ? 50  GLN A CB    1 
ATOM   366  C  CG    . GLN A 1 51  ? 51.698  19.129  31.307  1.00 46.35  ? 50  GLN A CG    1 
ATOM   367  C  CD    . GLN A 1 51  ? 50.666  19.575  32.323  1.00 53.31  ? 50  GLN A CD    1 
ATOM   368  O  OE1   . GLN A 1 51  ? 50.958  19.687  33.514  1.00 57.16  ? 50  GLN A OE1   1 
ATOM   369  N  NE2   . GLN A 1 51  ? 49.450  19.833  31.856  1.00 47.11  ? 50  GLN A NE2   1 
ATOM   370  N  N     . HIS A 1 52  ? 56.048  17.494  32.012  1.00 41.37  ? 51  HIS A N     1 
ATOM   371  C  CA    . HIS A 1 52  ? 57.342  17.463  32.684  1.00 39.28  ? 51  HIS A CA    1 
ATOM   372  C  C     . HIS A 1 52  ? 58.405  16.718  31.891  1.00 37.96  ? 51  HIS A C     1 
ATOM   373  O  O     . HIS A 1 52  ? 59.511  17.235  31.704  1.00 41.63  ? 51  HIS A O     1 
ATOM   374  C  CB    . HIS A 1 52  ? 57.201  16.834  34.079  1.00 38.69  ? 51  HIS A CB    1 
ATOM   375  C  CG    . HIS A 1 52  ? 58.471  16.836  34.873  1.00 55.09  ? 51  HIS A CG    1 
ATOM   376  N  ND1   . HIS A 1 52  ? 59.045  17.993  35.355  1.00 66.29  ? 51  HIS A ND1   1 
ATOM   377  C  CD2   . HIS A 1 52  ? 59.277  15.823  35.270  1.00 47.93  ? 51  HIS A CD2   1 
ATOM   378  C  CE1   . HIS A 1 52  ? 60.150  17.693  36.014  1.00 55.79  ? 51  HIS A CE1   1 
ATOM   379  N  NE2   . HIS A 1 52  ? 60.313  16.382  35.977  1.00 47.56  ? 51  HIS A NE2   1 
ATOM   380  N  N     . PHE A 1 53  ? 58.099  15.511  31.412  1.00 33.53  ? 52  PHE A N     1 
ATOM   381  C  CA    . PHE A 1 53  ? 59.108  14.704  30.732  1.00 37.93  ? 52  PHE A CA    1 
ATOM   382  C  C     . PHE A 1 53  ? 59.373  15.211  29.319  1.00 38.07  ? 52  PHE A C     1 
ATOM   383  O  O     . PHE A 1 53  ? 60.527  15.457  28.947  1.00 37.37  ? 52  PHE A O     1 
ATOM   384  C  CB    . PHE A 1 53  ? 58.674  13.235  30.696  1.00 36.19  ? 52  PHE A CB    1 
ATOM   385  C  CG    . PHE A 1 53  ? 58.588  12.583  32.052  1.00 38.35  ? 52  PHE A CG    1 
ATOM   386  C  CD1   . PHE A 1 53  ? 59.104  13.204  33.179  1.00 33.06  ? 52  PHE A CD1   1 
ATOM   387  C  CD2   . PHE A 1 53  ? 57.992  11.341  32.195  1.00 38.26  ? 52  PHE A CD2   1 
ATOM   388  C  CE1   . PHE A 1 53  ? 59.020  12.600  34.421  1.00 33.06  ? 52  PHE A CE1   1 
ATOM   389  C  CE2   . PHE A 1 53  ? 57.906  10.732  33.433  1.00 33.56  ? 52  PHE A CE2   1 
ATOM   390  C  CZ    . PHE A 1 53  ? 58.422  11.362  34.547  1.00 35.27  ? 52  PHE A CZ    1 
ATOM   391  N  N     . ALA A 1 54  ? 58.317  15.374  28.521  1.00 33.19  ? 53  ALA A N     1 
ATOM   392  C  CA    . ALA A 1 54  ? 58.494  15.721  27.113  1.00 36.62  ? 53  ALA A CA    1 
ATOM   393  C  C     . ALA A 1 54  ? 59.196  17.056  26.882  1.00 35.09  ? 53  ALA A C     1 
ATOM   394  O  O     . ALA A 1 54  ? 60.039  17.119  25.969  1.00 35.32  ? 53  ALA A O     1 
ATOM   395  C  CB    . ALA A 1 54  ? 57.135  15.696  26.400  1.00 34.51  ? 53  ALA A CB    1 
ATOM   396  N  N     . PRO A 1 55  ? 58.907  18.141  27.616  1.00 36.68  ? 54  PRO A N     1 
ATOM   397  C  CA    . PRO A 1 55  ? 59.677  19.377  27.388  1.00 36.52  ? 54  PRO A CA    1 
ATOM   398  C  C     . PRO A 1 55  ? 61.168  19.209  27.623  1.00 42.07  ? 54  PRO A C     1 
ATOM   399  O  O     . PRO A 1 55  ? 61.976  19.800  26.897  1.00 42.66  ? 54  PRO A O     1 
ATOM   400  C  CB    . PRO A 1 55  ? 59.050  20.365  28.382  1.00 40.20  ? 54  PRO A CB    1 
ATOM   401  C  CG    . PRO A 1 55  ? 57.668  19.865  28.577  1.00 43.88  ? 54  PRO A CG    1 
ATOM   402  C  CD    . PRO A 1 55  ? 57.784  18.371  28.546  1.00 36.99  ? 54  PRO A CD    1 
ATOM   403  N  N     . LEU A 1 56  ? 61.557  18.414  28.622  1.00 36.71  ? 55  LEU A N     1 
ATOM   404  C  CA    . LEU A 1 56  ? 62.975  18.160  28.850  1.00 35.88  ? 55  LEU A CA    1 
ATOM   405  C  C     . LEU A 1 56  ? 63.582  17.360  27.705  1.00 37.06  ? 55  LEU A C     1 
ATOM   406  O  O     . LEU A 1 56  ? 64.682  17.675  27.235  1.00 34.89  ? 55  LEU A O     1 
ATOM   407  C  CB    . LEU A 1 56  ? 63.171  17.429  30.178  1.00 33.08  ? 55  LEU A CB    1 
ATOM   408  C  CG    . LEU A 1 56  ? 62.736  18.190  31.432  1.00 35.05  ? 55  LEU A CG    1 
ATOM   409  C  CD1   . LEU A 1 56  ? 63.002  17.364  32.679  1.00 36.03  ? 55  LEU A CD1   1 
ATOM   410  C  CD2   . LEU A 1 56  ? 63.442  19.534  31.513  1.00 42.01  ? 55  LEU A CD2   1 
ATOM   411  N  N     . MET A 1 57  ? 62.877  16.325  27.240  1.00 34.97  ? 56  MET A N     1 
ATOM   412  C  CA    . MET A 1 57  ? 63.383  15.527  26.128  1.00 35.61  ? 56  MET A CA    1 
ATOM   413  C  C     . MET A 1 57  ? 63.461  16.351  24.849  1.00 40.44  ? 56  MET A C     1 
ATOM   414  O  O     . MET A 1 57  ? 64.383  16.171  24.045  1.00 33.86  ? 56  MET A O     1 
ATOM   415  C  CB    . MET A 1 57  ? 62.501  14.295  25.923  1.00 30.59  ? 56  MET A CB    1 
ATOM   416  C  CG    . MET A 1 57  ? 62.999  13.344  24.845  1.00 30.83  ? 56  MET A CG    1 
ATOM   417  S  SD    . MET A 1 57  ? 64.557  12.546  25.286  1.00 37.41  ? 56  MET A SD    1 
ATOM   418  C  CE    . MET A 1 57  ? 63.991  11.359  26.502  1.00 30.28  ? 56  MET A CE    1 
ATOM   419  N  N     . GLN A 1 58  ? 62.505  17.262  24.647  1.00 37.92  ? 57  GLN A N     1 
ATOM   420  C  CA    . GLN A 1 58  ? 62.524  18.098  23.450  1.00 42.19  ? 57  GLN A CA    1 
ATOM   421  C  C     . GLN A 1 58  ? 63.723  19.037  23.453  1.00 40.63  ? 57  GLN A C     1 
ATOM   422  O  O     . GLN A 1 58  ? 64.349  19.255  22.409  1.00 37.62  ? 57  GLN A O     1 
ATOM   423  C  CB    . GLN A 1 58  ? 61.223  18.892  23.340  1.00 42.89  ? 57  GLN A CB    1 
ATOM   424  C  CG    . GLN A 1 58  ? 61.079  19.664  22.038  1.00 39.34  ? 57  GLN A CG    1 
ATOM   425  C  CD    . GLN A 1 58  ? 60.810  18.760  20.852  1.00 43.01  ? 57  GLN A CD    1 
ATOM   426  O  OE1   . GLN A 1 58  ? 59.747  18.149  20.753  1.00 47.45  ? 57  GLN A OE1   1 
ATOM   427  N  NE2   . GLN A 1 58  ? 61.775  18.670  19.944  1.00 41.66  ? 57  GLN A NE2   1 
ATOM   428  N  N     . PHE A 1 59  ? 64.054  19.604  24.616  1.00 41.20  ? 58  PHE A N     1 
ATOM   429  C  CA    . PHE A 1 59  ? 65.242  20.445  24.712  1.00 46.27  ? 58  PHE A CA    1 
ATOM   430  C  C     . PHE A 1 59  ? 66.496  19.661  24.351  1.00 49.26  ? 58  PHE A C     1 
ATOM   431  O  O     . PHE A 1 59  ? 67.337  20.143  23.584  1.00 45.77  ? 58  PHE A O     1 
ATOM   432  C  CB    . PHE A 1 59  ? 65.356  21.034  26.118  1.00 45.68  ? 58  PHE A CB    1 
ATOM   433  C  CG    . PHE A 1 59  ? 66.647  21.764  26.369  1.00 50.99  ? 58  PHE A CG    1 
ATOM   434  C  CD1   . PHE A 1 59  ? 66.871  23.017  25.822  1.00 62.08  ? 58  PHE A CD1   1 
ATOM   435  C  CD2   . PHE A 1 59  ? 67.633  21.198  27.160  1.00 53.34  ? 58  PHE A CD2   1 
ATOM   436  C  CE1   . PHE A 1 59  ? 68.057  23.690  26.057  1.00 60.94  ? 58  PHE A CE1   1 
ATOM   437  C  CE2   . PHE A 1 59  ? 68.820  21.865  27.398  1.00 65.33  ? 58  PHE A CE2   1 
ATOM   438  C  CZ    . PHE A 1 59  ? 69.033  23.112  26.847  1.00 64.49  ? 58  PHE A CZ    1 
ATOM   439  N  N     . LEU A 1 60  ? 66.630  18.441  24.878  1.00 45.05  ? 59  LEU A N     1 
ATOM   440  C  CA    . LEU A 1 60  ? 67.794  17.621  24.553  1.00 42.80  ? 59  LEU A CA    1 
ATOM   441  C  C     . LEU A 1 60  ? 67.837  17.289  23.067  1.00 44.40  ? 59  LEU A C     1 
ATOM   442  O  O     . LEU A 1 60  ? 68.910  17.299  22.452  1.00 46.51  ? 59  LEU A O     1 
ATOM   443  C  CB    . LEU A 1 60  ? 67.786  16.342  25.388  1.00 43.24  ? 59  LEU A CB    1 
ATOM   444  C  CG    . LEU A 1 60  ? 68.978  15.413  25.151  1.00 36.08  ? 59  LEU A CG    1 
ATOM   445  C  CD1   . LEU A 1 60  ? 70.283  16.155  25.392  1.00 41.28  ? 59  LEU A CD1   1 
ATOM   446  C  CD2   . LEU A 1 60  ? 68.884  14.190  26.040  1.00 36.34  ? 59  LEU A CD2   1 
ATOM   447  N  N     . ILE A 1 61  ? 66.679  16.990  22.473  1.00 41.34  ? 60  ILE A N     1 
ATOM   448  C  CA    A ILE A 1 61  ? 66.638  16.694  21.044  0.35 42.21  ? 60  ILE A CA    1 
ATOM   449  C  CA    B ILE A 1 61  ? 66.620  16.700  21.043  0.65 42.23  ? 60  ILE A CA    1 
ATOM   450  C  C     . ILE A 1 61  ? 67.103  17.900  20.237  1.00 45.75  ? 60  ILE A C     1 
ATOM   451  O  O     . ILE A 1 61  ? 67.814  17.754  19.234  1.00 44.12  ? 60  ILE A O     1 
ATOM   452  C  CB    A ILE A 1 61  ? 65.226  16.232  20.630  0.35 44.38  ? 60  ILE A CB    1 
ATOM   453  C  CB    B ILE A 1 61  ? 65.188  16.285  20.652  0.65 44.37  ? 60  ILE A CB    1 
ATOM   454  C  CG1   A ILE A 1 61  ? 65.184  14.709  20.483  0.35 45.50  ? 60  ILE A CG1   1 
ATOM   455  C  CG1   B ILE A 1 61  ? 64.877  14.876  21.160  0.65 46.58  ? 60  ILE A CG1   1 
ATOM   456  C  CG2   A ILE A 1 61  ? 64.783  16.893  19.331  0.35 45.41  ? 60  ILE A CG2   1 
ATOM   457  C  CG2   B ILE A 1 61  ? 64.982  16.367  19.156  0.65 44.79  ? 60  ILE A CG2   1 
ATOM   458  C  CD1   A ILE A 1 61  ? 65.878  13.967  21.595  0.35 40.24  ? 60  ILE A CD1   1 
ATOM   459  C  CD1   B ILE A 1 61  ? 63.531  14.351  20.707  0.65 42.63  ? 60  ILE A CD1   1 
ATOM   460  N  N     . ASP A 1 62  ? 66.735  19.107  20.672  1.00 47.65  ? 61  ASP A N     1 
ATOM   461  C  CA    . ASP A 1 62  ? 67.130  20.308  19.942  1.00 55.79  ? 61  ASP A CA    1 
ATOM   462  C  C     . ASP A 1 62  ? 68.623  20.582  20.080  1.00 48.28  ? 61  ASP A C     1 
ATOM   463  O  O     . ASP A 1 62  ? 69.284  20.945  19.100  1.00 55.70  ? 61  ASP A O     1 
ATOM   464  C  CB    . ASP A 1 62  ? 66.314  21.507  20.427  1.00 48.96  ? 61  ASP A CB    1 
ATOM   465  C  CG    . ASP A 1 62  ? 64.823  21.329  20.200  1.00 54.90  ? 61  ASP A CG    1 
ATOM   466  O  OD1   . ASP A 1 62  ? 64.446  20.539  19.309  1.00 52.53  ? 61  ASP A OD1   1 
ATOM   467  O  OD2   . ASP A 1 62  ? 64.028  21.975  20.914  1.00 56.67  ? 61  ASP A OD2   1 
ATOM   468  N  N     . GLU A 1 63  ? 69.175  20.415  21.286  1.00 46.42  ? 62  GLU A N     1 
ATOM   469  C  CA    . GLU A 1 63  ? 70.587  20.723  21.494  1.00 56.19  ? 62  GLU A CA    1 
ATOM   470  C  C     . GLU A 1 63  ? 71.501  19.697  20.837  1.00 51.73  ? 62  GLU A C     1 
ATOM   471  O  O     . GLU A 1 63  ? 72.648  20.019  20.506  1.00 55.51  ? 62  GLU A O     1 
ATOM   472  C  CB    . GLU A 1 63  ? 70.899  20.822  22.986  1.00 57.39  ? 62  GLU A CB    1 
ATOM   473  C  CG    . GLU A 1 63  ? 69.952  21.721  23.767  1.00 69.69  ? 62  GLU A CG    1 
ATOM   474  C  CD    . GLU A 1 63  ? 70.083  23.180  23.394  1.00 83.69  ? 62  GLU A CD    1 
ATOM   475  O  OE1   . GLU A 1 63  ? 71.137  23.787  23.698  1.00 80.37  ? 62  GLU A OE1   1 
ATOM   476  O  OE2   . GLU A 1 63  ? 69.128  23.728  22.791  1.00 79.83  ? 62  GLU A OE2   1 
ATOM   477  N  N     . LEU A 1 64  ? 71.023  18.470  20.640  1.00 52.74  ? 63  LEU A N     1 
ATOM   478  C  CA    . LEU A 1 64  ? 71.789  17.442  19.945  1.00 49.99  ? 63  LEU A CA    1 
ATOM   479  C  C     . LEU A 1 64  ? 71.542  17.434  18.442  1.00 51.89  ? 63  LEU A C     1 
ATOM   480  O  O     . LEU A 1 64  ? 72.178  16.649  17.730  1.00 52.47  ? 63  LEU A O     1 
ATOM   481  C  CB    . LEU A 1 64  ? 71.471  16.057  20.520  1.00 45.95  ? 63  LEU A CB    1 
ATOM   482  C  CG    . LEU A 1 64  ? 71.828  15.798  21.984  1.00 43.33  ? 63  LEU A CG    1 
ATOM   483  C  CD1   . LEU A 1 64  ? 71.413  14.390  22.385  1.00 34.67  ? 63  LEU A CD1   1 
ATOM   484  C  CD2   . LEU A 1 64  ? 73.313  16.015  22.220  1.00 44.23  ? 63  LEU A CD2   1 
ATOM   485  N  N     . ASN A 1 65  ? 70.644  18.290  17.949  1.00 50.24  ? 64  ASN A N     1 
ATOM   486  C  CA    . ASN A 1 65  ? 70.270  18.330  16.534  1.00 51.17  ? 64  ASN A CA    1 
ATOM   487  C  C     . ASN A 1 65  ? 69.749  16.976  16.058  1.00 50.92  ? 64  ASN A C     1 
ATOM   488  O  O     . ASN A 1 65  ? 70.001  16.551  14.928  1.00 55.38  ? 64  ASN A O     1 
ATOM   489  C  CB    . ASN A 1 65  ? 71.427  18.817  15.659  1.00 57.51  ? 64  ASN A CB    1 
ATOM   490  C  CG    . ASN A 1 65  ? 71.656  20.309  15.783  1.00 65.45  ? 64  ASN A CG    1 
ATOM   491  O  OD1   . ASN A 1 65  ? 71.005  21.105  15.106  1.00 74.34  ? 64  ASN A OD1   1 
ATOM   492  N  ND2   . ASN A 1 65  ? 72.581  20.698  16.652  1.00 61.09  ? 64  ASN A ND2   1 
ATOM   493  N  N     . VAL A 1 66  ? 69.020  16.292  16.934  1.00 47.09  ? 65  VAL A N     1 
ATOM   494  C  CA    . VAL A 1 66  ? 68.260  15.113  16.541  1.00 48.93  ? 65  VAL A CA    1 
ATOM   495  C  C     . VAL A 1 66  ? 66.978  15.580  15.867  1.00 44.08  ? 65  VAL A C     1 
ATOM   496  O  O     . VAL A 1 66  ? 66.280  16.461  16.378  1.00 48.10  ? 65  VAL A O     1 
ATOM   497  C  CB    . VAL A 1 66  ? 67.965  14.222  17.759  1.00 46.08  ? 65  VAL A CB    1 
ATOM   498  C  CG1   . VAL A 1 66  ? 67.074  13.048  17.363  1.00 47.40  ? 65  VAL A CG1   1 
ATOM   499  C  CG2   . VAL A 1 66  ? 69.263  13.737  18.382  1.00 42.64  ? 65  VAL A CG2   1 
ATOM   500  N  N     . LYS A 1 67  ? 66.674  15.011  14.706  1.00 49.54  ? 66  LYS A N     1 
ATOM   501  C  CA    . LYS A 1 67  ? 65.508  15.422  13.934  1.00 59.78  ? 66  LYS A CA    1 
ATOM   502  C  C     . LYS A 1 67  ? 64.278  14.575  14.217  1.00 56.80  ? 66  LYS A C     1 
ATOM   503  O  O     . LYS A 1 67  ? 63.178  14.955  13.800  1.00 60.85  ? 66  LYS A O     1 
ATOM   504  C  CB    . LYS A 1 67  ? 65.815  15.373  12.432  1.00 61.68  ? 66  LYS A CB    1 
ATOM   505  C  CG    . LYS A 1 67  ? 66.958  16.274  12.015  1.00 65.22  ? 66  LYS A CG    1 
ATOM   506  C  CD    . LYS A 1 67  ? 66.786  17.690  12.538  1.00 64.93  ? 66  LYS A CD    1 
ATOM   507  C  CE    . LYS A 1 67  ? 68.083  18.468  12.433  1.00 71.85  ? 66  LYS A CE    1 
ATOM   508  N  NZ    . LYS A 1 67  ? 67.926  19.836  12.986  1.00 77.52  ? 66  LYS A NZ    1 
ATOM   509  N  N     . SER A 1 68  ? 64.435  13.450  14.910  1.00 50.77  ? 67  SER A N     1 
ATOM   510  C  CA    . SER A 1 68  ? 63.290  12.640  15.292  1.00 48.97  ? 67  SER A CA    1 
ATOM   511  C  C     . SER A 1 68  ? 62.353  13.440  16.192  1.00 42.65  ? 67  SER A C     1 
ATOM   512  O  O     . SER A 1 68  ? 62.743  14.420  16.833  1.00 46.21  ? 67  SER A O     1 
ATOM   513  C  CB    . SER A 1 68  ? 63.748  11.364  16.000  1.00 39.85  ? 67  SER A CB    1 
ATOM   514  O  OG    . SER A 1 68  ? 64.507  10.541  15.131  1.00 43.10  ? 67  SER A OG    1 
ATOM   515  N  N     . LYS A 1 69  ? 61.097  13.017  16.224  1.00 41.72  ? 68  LYS A N     1 
ATOM   516  C  CA    . LYS A 1 69  ? 60.063  13.708  16.975  1.00 46.20  ? 68  LYS A CA    1 
ATOM   517  C  C     . LYS A 1 69  ? 59.712  12.926  18.233  1.00 43.58  ? 68  LYS A C     1 
ATOM   518  O  O     . LYS A 1 69  ? 59.949  11.719  18.330  1.00 36.29  ? 68  LYS A O     1 
ATOM   519  C  CB    . LYS A 1 69  ? 58.811  13.919  16.114  1.00 44.71  ? 68  LYS A CB    1 
ATOM   520  C  CG    . LYS A 1 69  ? 58.041  12.645  15.810  1.00 53.77  ? 68  LYS A CG    1 
ATOM   521  C  CD    . LYS A 1 69  ? 56.877  12.919  14.870  1.00 62.04  ? 68  LYS A CD    1 
ATOM   522  C  CE    . LYS A 1 69  ? 55.851  13.842  15.509  1.00 62.25  ? 68  LYS A CE    1 
ATOM   523  N  NZ    . LYS A 1 69  ? 55.066  13.157  16.572  1.00 58.75  ? 68  LYS A NZ    1 
ATOM   524  N  N     . ILE A 1 70  ? 59.151  13.634  19.209  1.00 41.28  ? 69  ILE A N     1 
ATOM   525  C  CA    . ILE A 1 70  ? 58.678  13.001  20.435  1.00 35.04  ? 69  ILE A CA    1 
ATOM   526  C  C     . ILE A 1 70  ? 57.281  12.452  20.167  1.00 43.79  ? 69  ILE A C     1 
ATOM   527  O  O     . ILE A 1 70  ? 56.344  13.209  19.908  1.00 46.86  ? 69  ILE A O     1 
ATOM   528  C  CB    . ILE A 1 70  ? 58.674  13.978  21.615  1.00 36.61  ? 69  ILE A CB    1 
ATOM   529  C  CG1   . ILE A 1 70  ? 60.106  14.355  21.996  1.00 37.84  ? 69  ILE A CG1   1 
ATOM   530  C  CG2   . ILE A 1 70  ? 57.944  13.368  22.805  1.00 39.92  ? 69  ILE A CG2   1 
ATOM   531  C  CD1   . ILE A 1 70  ? 60.200  15.248  23.213  1.00 41.05  ? 69  ILE A CD1   1 
ATOM   532  N  N     . GLN A 1 71  ? 57.146  11.131  20.214  1.00 34.20  ? 70  GLN A N     1 
ATOM   533  C  CA    . GLN A 1 71  ? 55.854  10.475  20.094  1.00 39.64  ? 70  GLN A CA    1 
ATOM   534  C  C     . GLN A 1 71  ? 55.299  10.186  21.480  1.00 40.37  ? 70  GLN A C     1 
ATOM   535  O  O     . GLN A 1 71  ? 56.023  9.721   22.366  1.00 34.06  ? 70  GLN A O     1 
ATOM   536  C  CB    . GLN A 1 71  ? 55.958  9.167   19.306  1.00 41.21  ? 70  GLN A CB    1 
ATOM   537  C  CG    . GLN A 1 71  ? 56.679  9.266   17.977  1.00 39.42  ? 70  GLN A CG    1 
ATOM   538  C  CD    . GLN A 1 71  ? 56.697  7.939   17.243  1.00 35.52  ? 70  GLN A CD    1 
ATOM   539  O  OE1   . GLN A 1 71  ? 55.669  7.271   17.121  1.00 49.81  ? 70  GLN A OE1   1 
ATOM   540  N  NE2   . GLN A 1 71  ? 57.869  7.542   16.764  1.00 35.84  ? 70  GLN A NE2   1 
ATOM   541  N  N     . ILE A 1 72  ? 54.014  10.464  21.663  1.00 32.67  ? 71  ILE A N     1 
ATOM   542  C  CA    . ILE A 1 72  ? 53.308  10.150  22.897  1.00 31.40  ? 71  ILE A CA    1 
ATOM   543  C  C     . ILE A 1 72  ? 52.183  9.192   22.535  1.00 36.47  ? 71  ILE A C     1 
ATOM   544  O  O     . ILE A 1 72  ? 51.177  9.596   21.938  1.00 40.72  ? 71  ILE A O     1 
ATOM   545  C  CB    . ILE A 1 72  ? 52.780  11.406  23.597  1.00 35.99  ? 71  ILE A CB    1 
ATOM   546  C  CG1   . ILE A 1 72  ? 53.960  12.296  23.996  1.00 35.19  ? 71  ILE A CG1   1 
ATOM   547  C  CG2   . ILE A 1 72  ? 51.946  11.028  24.811  1.00 42.04  ? 71  ILE A CG2   1 
ATOM   548  C  CD1   . ILE A 1 72  ? 53.607  13.413  24.932  1.00 51.55  ? 71  ILE A CD1   1 
ATOM   549  N  N     . VAL A 1 73  ? 52.359  7.921   22.885  1.00 30.67  ? 72  VAL A N     1 
ATOM   550  C  CA    . VAL A 1 73  ? 51.453  6.847   22.498  1.00 35.70  ? 72  VAL A CA    1 
ATOM   551  C  C     . VAL A 1 73  ? 50.664  6.417   23.726  1.00 41.80  ? 72  VAL A C     1 
ATOM   552  O  O     . VAL A 1 73  ? 51.241  6.205   24.800  1.00 36.21  ? 72  VAL A O     1 
ATOM   553  C  CB    . VAL A 1 73  ? 52.224  5.660   21.895  1.00 37.50  ? 72  VAL A CB    1 
ATOM   554  C  CG1   . VAL A 1 73  ? 51.262  4.588   21.409  1.00 43.16  ? 72  VAL A CG1   1 
ATOM   555  C  CG2   . VAL A 1 73  ? 53.130  6.133   20.767  1.00 39.44  ? 72  VAL A CG2   1 
ATOM   556  N  N     . LYS A 1 74  ? 49.350  6.291   23.569  1.00 47.24  ? 73  LYS A N     1 
ATOM   557  C  CA    . LYS A 1 74  ? 48.481  5.852   24.652  1.00 52.07  ? 73  LYS A CA    1 
ATOM   558  C  C     . LYS A 1 74  ? 48.369  4.333   24.623  1.00 51.47  ? 73  LYS A C     1 
ATOM   559  O  O     . LYS A 1 74  ? 47.893  3.758   23.638  1.00 57.53  ? 73  LYS A O     1 
ATOM   560  C  CB    . LYS A 1 74  ? 47.098  6.490   24.541  1.00 56.01  ? 73  LYS A CB    1 
ATOM   561  C  CG    . LYS A 1 74  ? 46.105  5.963   25.569  1.00 63.61  ? 73  LYS A CG    1 
ATOM   562  C  CD    . LYS A 1 74  ? 44.911  6.889   25.727  1.00 66.02  ? 73  LYS A CD    1 
ATOM   563  C  CE    . LYS A 1 74  ? 44.085  6.519   26.950  1.00 73.43  ? 73  LYS A CE    1 
ATOM   564  N  NZ    . LYS A 1 74  ? 43.215  5.337   26.703  1.00 74.73  ? 73  LYS A NZ    1 
ATOM   565  N  N     . GLY A 1 75  ? 48.811  3.687   25.702  1.00 45.05  ? 74  GLY A N     1 
ATOM   566  C  CA    . GLY A 1 75  ? 48.671  2.258   25.856  1.00 47.75  ? 74  GLY A CA    1 
ATOM   567  C  C     . GLY A 1 75  ? 47.467  1.896   26.714  1.00 50.03  ? 74  GLY A C     1 
ATOM   568  O  O     . GLY A 1 75  ? 46.735  2.747   27.215  1.00 50.19  ? 74  GLY A O     1 
ATOM   569  N  N     . ASP A 1 76  ? 47.274  0.586   26.877  1.00 51.42  ? 75  ASP A N     1 
ATOM   570  C  CA    . ASP A 1 76  ? 46.142  0.100   27.659  1.00 58.66  ? 75  ASP A CA    1 
ATOM   571  C  C     . ASP A 1 76  ? 46.276  0.481   29.128  1.00 55.23  ? 75  ASP A C     1 
ATOM   572  O  O     . ASP A 1 76  ? 45.279  0.810   29.782  1.00 53.72  ? 75  ASP A O     1 
ATOM   573  C  CB    . ASP A 1 76  ? 46.016  -1.415  27.507  1.00 54.24  ? 75  ASP A CB    1 
ATOM   574  C  CG    . ASP A 1 76  ? 47.301  -2.143  27.850  1.00 57.73  ? 75  ASP A CG    1 
ATOM   575  O  OD1   . ASP A 1 76  ? 48.375  -1.504  27.813  1.00 68.17  ? 75  ASP A OD1   1 
ATOM   576  O  OD2   . ASP A 1 76  ? 47.240  -3.352  28.157  1.00 55.46  ? 75  ASP A OD2   1 
ATOM   577  N  N     . THR A 1 77  ? 47.498  0.453   29.664  1.00 49.22  ? 76  THR A N     1 
ATOM   578  C  CA    . THR A 1 77  ? 47.723  0.678   31.083  1.00 43.45  ? 76  THR A CA    1 
ATOM   579  C  C     . THR A 1 77  ? 48.585  1.892   31.397  1.00 43.45  ? 76  THR A C     1 
ATOM   580  O  O     . THR A 1 77  ? 48.699  2.252   32.575  1.00 42.03  ? 76  THR A O     1 
ATOM   581  C  CB    . THR A 1 77  ? 48.370  -0.560  31.725  1.00 45.87  ? 76  THR A CB    1 
ATOM   582  O  OG1   . THR A 1 77  ? 49.691  -0.739  31.200  1.00 38.20  ? 76  THR A OG1   1 
ATOM   583  C  CG2   . THR A 1 77  ? 47.542  -1.805  31.438  1.00 43.79  ? 76  THR A CG2   1 
ATOM   584  N  N     . ARG A 1 78  ? 49.189  2.531   30.399  1.00 35.56  ? 77  ARG A N     1 
ATOM   585  C  CA    . ARG A 1 78  ? 50.059  3.675   30.643  1.00 33.67  ? 77  ARG A CA    1 
ATOM   586  C  C     . ARG A 1 78  ? 50.319  4.383   29.322  1.00 32.45  ? 77  ARG A C     1 
ATOM   587  O  O     . ARG A 1 78  ? 50.076  3.833   28.245  1.00 36.87  ? 77  ARG A O     1 
ATOM   588  C  CB    . ARG A 1 78  ? 51.387  3.255   31.288  1.00 32.56  ? 77  ARG A CB    1 
ATOM   589  C  CG    . ARG A 1 78  ? 52.462  2.799   30.298  1.00 33.99  ? 77  ARG A CG    1 
ATOM   590  C  CD    . ARG A 1 78  ? 52.098  1.491   29.608  1.00 34.34  ? 77  ARG A CD    1 
ATOM   591  N  NE    . ARG A 1 78  ? 53.048  1.139   28.556  1.00 40.39  ? 77  ARG A NE    1 
ATOM   592  C  CZ    . ARG A 1 78  ? 52.946  1.541   27.293  1.00 38.81  ? 77  ARG A CZ    1 
ATOM   593  N  NH1   . ARG A 1 78  ? 51.935  2.314   26.920  1.00 29.48  ? 77  ARG A NH1   1 
ATOM   594  N  NH2   . ARG A 1 78  ? 53.856  1.172   26.401  1.00 36.39  ? 77  ARG A NH2   1 
ATOM   595  N  N     . TYR A 1 79  ? 50.819  5.608   29.423  1.00 33.46  ? 78  TYR A N     1 
ATOM   596  C  CA    . TYR A 1 79  ? 51.276  6.351   28.261  1.00 31.83  ? 78  TYR A CA    1 
ATOM   597  C  C     . TYR A 1 79  ? 52.765  6.108   28.039  1.00 32.15  ? 78  TYR A C     1 
ATOM   598  O  O     . TYR A 1 79  ? 53.505  5.754   28.959  1.00 31.26  ? 78  TYR A O     1 
ATOM   599  C  CB    . TYR A 1 79  ? 51.004  7.844   28.431  1.00 38.62  ? 78  TYR A CB    1 
ATOM   600  C  CG    . TYR A 1 79  ? 49.550  8.221   28.272  1.00 47.16  ? 78  TYR A CG    1 
ATOM   601  C  CD1   . TYR A 1 79  ? 49.065  8.694   27.059  1.00 50.96  ? 78  TYR A CD1   1 
ATOM   602  C  CD2   . TYR A 1 79  ? 48.660  8.092   29.329  1.00 47.04  ? 78  TYR A CD2   1 
ATOM   603  C  CE1   . TYR A 1 79  ? 47.737  9.040   26.908  1.00 59.73  ? 78  TYR A CE1   1 
ATOM   604  C  CE2   . TYR A 1 79  ? 47.329  8.432   29.187  1.00 58.20  ? 78  TYR A CE2   1 
ATOM   605  C  CZ    . TYR A 1 79  ? 46.873  8.907   27.975  1.00 66.22  ? 78  TYR A CZ    1 
ATOM   606  O  OH    . TYR A 1 79  ? 45.549  9.249   27.830  1.00 72.11  ? 78  TYR A OH    1 
ATOM   607  N  N     . GLU A 1 80  ? 53.198  6.301   26.796  1.00 36.05  ? 79  GLU A N     1 
ATOM   608  C  CA    . GLU A 1 80  ? 54.578  6.042   26.404  1.00 31.73  ? 79  GLU A CA    1 
ATOM   609  C  C     . GLU A 1 80  ? 55.142  7.260   25.692  1.00 35.44  ? 79  GLU A C     1 
ATOM   610  O  O     . GLU A 1 80  ? 54.617  7.672   24.652  1.00 34.38  ? 79  GLU A O     1 
ATOM   611  C  CB    . GLU A 1 80  ? 54.676  4.810   25.500  1.00 33.40  ? 79  GLU A CB    1 
ATOM   612  C  CG    . GLU A 1 80  ? 56.059  4.602   24.900  1.00 41.21  ? 79  GLU A CG    1 
ATOM   613  C  CD    . GLU A 1 80  ? 56.094  3.478   23.884  1.00 44.18  ? 79  GLU A CD    1 
ATOM   614  O  OE1   . GLU A 1 80  ? 55.077  2.766   23.746  1.00 40.61  ? 79  GLU A OE1   1 
ATOM   615  O  OE2   . GLU A 1 80  ? 57.140  3.307   23.221  1.00 36.96  ? 79  GLU A OE2   1 
ATOM   616  N  N     . LEU A 1 81  ? 56.203  7.833   26.252  1.00 29.82  ? 80  LEU A N     1 
ATOM   617  C  CA    . LEU A 1 81  ? 57.013  8.821   25.553  1.00 33.80  ? 80  LEU A CA    1 
ATOM   618  C  C     . LEU A 1 81  ? 58.080  8.071   24.766  1.00 29.92  ? 80  LEU A C     1 
ATOM   619  O  O     . LEU A 1 81  ? 58.859  7.307   25.345  1.00 38.11  ? 80  LEU A O     1 
ATOM   620  C  CB    . LEU A 1 81  ? 57.644  9.806   26.539  1.00 34.12  ? 80  LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 81  ? 58.378  11.044  26.008  1.00 30.78  ? 80  LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 81  ? 58.408  12.112  27.082  1.00 38.86  ? 80  LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 81  ? 59.799  10.727  25.554  1.00 33.65  ? 80  LEU A CD2   1 
ATOM   624  N  N     . ARG A 1 82  ? 58.116  8.284   23.455  1.00 28.98  ? 81  ARG A N     1 
ATOM   625  C  CA    . ARG A 1 82  ? 58.982  7.514   22.574  1.00 34.12  ? 81  ARG A CA    1 
ATOM   626  C  C     . ARG A 1 82  ? 59.700  8.436   21.602  1.00 37.13  ? 81  ARG A C     1 
ATOM   627  O  O     . ARG A 1 82  ? 59.068  9.277   20.955  1.00 35.75  ? 81  ARG A O     1 
ATOM   628  C  CB    . ARG A 1 82  ? 58.179  6.466   21.799  1.00 33.63  ? 81  ARG A CB    1 
ATOM   629  C  CG    . ARG A 1 82  ? 58.987  5.703   20.765  1.00 33.68  ? 81  ARG A CG    1 
ATOM   630  C  CD    . ARG A 1 82  ? 58.071  4.955   19.816  1.00 34.15  ? 81  ARG A CD    1 
ATOM   631  N  NE    . ARG A 1 82  ? 57.094  4.146   20.536  1.00 40.41  ? 81  ARG A NE    1 
ATOM   632  C  CZ    . ARG A 1 82  ? 56.082  3.509   19.957  1.00 37.52  ? 81  ARG A CZ    1 
ATOM   633  N  NH1   . ARG A 1 82  ? 55.912  3.587   18.644  1.00 34.95  ? 81  ARG A NH1   1 
ATOM   634  N  NH2   . ARG A 1 82  ? 55.240  2.795   20.691  1.00 32.32  ? 81  ARG A NH2   1 
ATOM   635  N  N     . VAL A 1 83  ? 61.016  8.271   21.502  1.00 36.17  ? 82  VAL A N     1 
ATOM   636  C  CA    . VAL A 1 83  ? 61.826  8.910   20.472  1.00 35.36  ? 82  VAL A CA    1 
ATOM   637  C  C     . VAL A 1 83  ? 62.468  7.805   19.645  1.00 34.43  ? 82  VAL A C     1 
ATOM   638  O  O     . VAL A 1 83  ? 63.212  6.974   20.182  1.00 32.74  ? 82  VAL A O     1 
ATOM   639  C  CB    . VAL A 1 83  ? 62.896  9.839   21.065  1.00 33.02  ? 82  VAL A CB    1 
ATOM   640  C  CG1   . VAL A 1 83  ? 63.572  10.637  19.957  1.00 33.92  ? 82  VAL A CG1   1 
ATOM   641  C  CG2   . VAL A 1 83  ? 62.287  10.766  22.104  1.00 31.97  ? 82  VAL A CG2   1 
ATOM   642  N  N     . SER A 1 84  ? 62.175  7.788   18.348  1.00 32.45  ? 83  SER A N     1 
ATOM   643  C  CA    . SER A 1 84  ? 62.744  6.807   17.426  1.00 36.19  ? 83  SER A CA    1 
ATOM   644  C  C     . SER A 1 84  ? 63.965  7.449   16.775  1.00 40.03  ? 83  SER A C     1 
ATOM   645  O  O     . SER A 1 84  ? 63.862  8.137   15.759  1.00 39.92  ? 83  SER A O     1 
ATOM   646  C  CB    . SER A 1 84  ? 61.712  6.367   16.394  1.00 34.59  ? 83  SER A CB    1 
ATOM   647  O  OG    . SER A 1 84  ? 62.250  5.391   15.520  1.00 32.68  ? 83  SER A OG    1 
ATOM   648  N  N     . SER A 1 85  ? 65.135  7.217   17.368  1.00 34.84  ? 84  SER A N     1 
ATOM   649  C  CA    . SER A 1 85  ? 66.360  7.873   16.922  1.00 35.52  ? 84  SER A CA    1 
ATOM   650  C  C     . SER A 1 85  ? 67.556  7.000   17.262  1.00 34.99  ? 84  SER A C     1 
ATOM   651  O  O     . SER A 1 85  ? 67.815  6.732   18.440  1.00 32.00  ? 84  SER A O     1 
ATOM   652  C  CB    . SER A 1 85  ? 66.503  9.253   17.569  1.00 31.27  ? 84  SER A CB    1 
ATOM   653  O  OG    . SER A 1 85  ? 67.788  9.798   17.333  1.00 42.48  ? 84  SER A OG    1 
ATOM   654  N  N     . LYS A 1 86  ? 68.284  6.563   16.231  1.00 31.09  ? 85  LYS A N     1 
ATOM   655  C  CA    . LYS A 1 86  ? 69.519  5.816   16.452  1.00 33.37  ? 85  LYS A CA    1 
ATOM   656  C  C     . LYS A 1 86  ? 70.555  6.674   17.165  1.00 33.53  ? 85  LYS A C     1 
ATOM   657  O  O     . LYS A 1 86  ? 71.283  6.190   18.039  1.00 32.43  ? 85  LYS A O     1 
ATOM   658  C  CB    . LYS A 1 86  ? 70.065  5.310   15.117  1.00 39.78  ? 85  LYS A CB    1 
ATOM   659  C  CG    . LYS A 1 86  ? 71.348  4.500   15.215  1.00 39.60  ? 85  LYS A CG    1 
ATOM   660  C  CD    . LYS A 1 86  ? 71.816  4.062   13.833  1.00 35.11  ? 85  LYS A CD    1 
ATOM   661  C  CE    . LYS A 1 86  ? 73.060  3.191   13.910  1.00 44.18  ? 85  LYS A CE    1 
ATOM   662  N  NZ    . LYS A 1 86  ? 73.520  2.761   12.558  1.00 32.50  ? 85  LYS A NZ    1 
ATOM   663  N  N     . LYS A 1 87  ? 70.625  7.958   16.808  1.00 33.08  ? 86  LYS A N     1 
ATOM   664  C  CA    . LYS A 1 87  ? 71.594  8.858   17.424  1.00 35.41  ? 86  LYS A CA    1 
ATOM   665  C  C     . LYS A 1 87  ? 71.299  9.058   18.905  1.00 34.44  ? 86  LYS A C     1 
ATOM   666  O  O     . LYS A 1 87  ? 72.218  9.070   19.733  1.00 31.65  ? 86  LYS A O     1 
ATOM   667  C  CB    . LYS A 1 87  ? 71.592  10.192  16.677  1.00 37.23  ? 86  LYS A CB    1 
ATOM   668  C  CG    . LYS A 1 87  ? 72.546  11.242  17.209  1.00 43.45  ? 86  LYS A CG    1 
ATOM   669  C  CD    . LYS A 1 87  ? 72.826  12.278  16.131  1.00 45.24  ? 86  LYS A CD    1 
ATOM   670  C  CE    . LYS A 1 87  ? 72.750  13.693  16.675  1.00 49.12  ? 86  LYS A CE    1 
ATOM   671  N  NZ    . LYS A 1 87  ? 73.899  14.022  17.559  1.00 53.03  ? 86  LYS A NZ    1 
ATOM   672  N  N     . LEU A 1 88  ? 70.021  9.209   19.261  1.00 29.11  ? 87  LEU A N     1 
ATOM   673  C  CA    . LEU A 1 88  ? 69.666  9.381   20.666  1.00 32.46  ? 87  LEU A CA    1 
ATOM   674  C  C     . LEU A 1 88  ? 69.789  8.075   21.440  1.00 25.99  ? 87  LEU A C     1 
ATOM   675  O  O     . LEU A 1 88  ? 70.139  8.091   22.626  1.00 28.12  ? 87  LEU A O     1 
ATOM   676  C  CB    . LEU A 1 88  ? 68.247  9.932   20.790  1.00 29.94  ? 87  LEU A CB    1 
ATOM   677  C  CG    . LEU A 1 88  ? 67.847  10.349  22.206  1.00 30.55  ? 87  LEU A CG    1 
ATOM   678  C  CD1   . LEU A 1 88  ? 68.585  11.616  22.619  1.00 31.13  ? 87  LEU A CD1   1 
ATOM   679  C  CD2   . LEU A 1 88  ? 66.343  10.527  22.321  1.00 34.16  ? 87  LEU A CD2   1 
ATOM   680  N  N     . TYR A 1 89  ? 69.501  6.944   20.792  1.00 29.65  ? 88  TYR A N     1 
ATOM   681  C  CA    . TYR A 1 89  ? 69.637  5.647   21.447  1.00 28.20  ? 88  TYR A CA    1 
ATOM   682  C  C     . TYR A 1 89  ? 71.069  5.416   21.916  1.00 30.87  ? 88  TYR A C     1 
ATOM   683  O  O     . TYR A 1 89  ? 71.307  5.070   23.079  1.00 34.12  ? 88  TYR A O     1 
ATOM   684  C  CB    . TYR A 1 89  ? 69.186  4.538   20.492  1.00 25.10  ? 88  TYR A CB    1 
ATOM   685  C  CG    . TYR A 1 89  ? 69.561  3.135   20.921  1.00 32.99  ? 88  TYR A CG    1 
ATOM   686  C  CD1   . TYR A 1 89  ? 68.760  2.417   21.802  1.00 28.05  ? 88  TYR A CD1   1 
ATOM   687  C  CD2   . TYR A 1 89  ? 70.706  2.520   20.427  1.00 33.31  ? 88  TYR A CD2   1 
ATOM   688  C  CE1   . TYR A 1 89  ? 69.097  1.132   22.189  1.00 29.67  ? 88  TYR A CE1   1 
ATOM   689  C  CE2   . TYR A 1 89  ? 71.052  1.237   20.809  1.00 32.39  ? 88  TYR A CE2   1 
ATOM   690  C  CZ    . TYR A 1 89  ? 70.245  0.547   21.689  1.00 33.05  ? 88  TYR A CZ    1 
ATOM   691  O  OH    . TYR A 1 89  ? 70.587  -0.730  22.067  1.00 32.68  ? 88  TYR A OH    1 
ATOM   692  N  N     . TYR A 1 90  ? 72.042  5.613   21.023  1.00 27.18  ? 89  TYR A N     1 
ATOM   693  C  CA    . TYR A 1 90  ? 73.435  5.408   21.403  1.00 32.33  ? 89  TYR A CA    1 
ATOM   694  C  C     . TYR A 1 90  ? 73.940  6.513   22.321  1.00 32.72  ? 89  TYR A C     1 
ATOM   695  O  O     . TYR A 1 90  ? 74.860  6.283   23.113  1.00 32.18  ? 89  TYR A O     1 
ATOM   696  C  CB    . TYR A 1 90  ? 74.312  5.301   20.157  1.00 29.71  ? 89  TYR A CB    1 
ATOM   697  C  CG    . TYR A 1 90  ? 74.243  3.942   19.503  1.00 34.73  ? 89  TYR A CG    1 
ATOM   698  C  CD1   . TYR A 1 90  ? 74.691  2.810   20.171  1.00 31.71  ? 89  TYR A CD1   1 
ATOM   699  C  CD2   . TYR A 1 90  ? 73.723  3.788   18.225  1.00 35.48  ? 89  TYR A CD2   1 
ATOM   700  C  CE1   . TYR A 1 90  ? 74.629  1.563   19.583  1.00 33.09  ? 89  TYR A CE1   1 
ATOM   701  C  CE2   . TYR A 1 90  ? 73.656  2.543   17.629  1.00 34.82  ? 89  TYR A CE2   1 
ATOM   702  C  CZ    . TYR A 1 90  ? 74.111  1.435   18.313  1.00 33.80  ? 89  TYR A CZ    1 
ATOM   703  O  OH    . TYR A 1 90  ? 74.048  0.192   17.727  1.00 44.41  ? 89  TYR A OH    1 
ATOM   704  N  N     . TYR A 1 91  ? 73.357  7.710   22.232  1.00 30.62  ? 90  TYR A N     1 
ATOM   705  C  CA    . TYR A 1 91  ? 73.728  8.782   23.149  1.00 29.96  ? 90  TYR A CA    1 
ATOM   706  C  C     . TYR A 1 91  ? 73.455  8.381   24.594  1.00 31.03  ? 90  TYR A C     1 
ATOM   707  O  O     . TYR A 1 91  ? 74.292  8.591   25.480  1.00 32.29  ? 90  TYR A O     1 
ATOM   708  C  CB    . TYR A 1 91  ? 72.975  10.063  22.788  1.00 29.69  ? 90  TYR A CB    1 
ATOM   709  C  CG    . TYR A 1 91  ? 73.181  11.196  23.767  1.00 29.28  ? 90  TYR A CG    1 
ATOM   710  C  CD1   . TYR A 1 91  ? 74.329  11.977  23.727  1.00 32.29  ? 90  TYR A CD1   1 
ATOM   711  C  CD2   . TYR A 1 91  ? 72.223  11.489  24.729  1.00 31.07  ? 90  TYR A CD2   1 
ATOM   712  C  CE1   . TYR A 1 91  ? 74.518  13.015  24.620  1.00 34.72  ? 90  TYR A CE1   1 
ATOM   713  C  CE2   . TYR A 1 91  ? 72.401  12.524  25.623  1.00 29.54  ? 90  TYR A CE2   1 
ATOM   714  C  CZ    . TYR A 1 91  ? 73.551  13.283  25.567  1.00 34.03  ? 90  TYR A CZ    1 
ATOM   715  O  OH    . TYR A 1 91  ? 73.729  14.315  26.459  1.00 34.86  ? 90  TYR A OH    1 
ATOM   716  N  N     . PHE A 1 92  ? 72.285  7.792   24.851  1.00 29.71  ? 91  PHE A N     1 
ATOM   717  C  CA    . PHE A 1 92  ? 71.969  7.334   26.199  1.00 31.32  ? 91  PHE A CA    1 
ATOM   718  C  C     . PHE A 1 92  ? 72.660  6.015   26.522  1.00 29.33  ? 91  PHE A C     1 
ATOM   719  O  O     . PHE A 1 92  ? 73.058  5.787   27.670  1.00 32.67  ? 91  PHE A O     1 
ATOM   720  C  CB    . PHE A 1 92  ? 70.457  7.192   26.370  1.00 27.69  ? 91  PHE A CB    1 
ATOM   721  C  CG    . PHE A 1 92  ? 69.743  8.496   26.576  1.00 27.73  ? 91  PHE A CG    1 
ATOM   722  C  CD1   . PHE A 1 92  ? 70.015  9.281   27.684  1.00 30.60  ? 91  PHE A CD1   1 
ATOM   723  C  CD2   . PHE A 1 92  ? 68.788  8.929   25.672  1.00 28.97  ? 91  PHE A CD2   1 
ATOM   724  C  CE1   . PHE A 1 92  ? 69.356  10.478  27.882  1.00 26.89  ? 91  PHE A CE1   1 
ATOM   725  C  CE2   . PHE A 1 92  ? 68.124  10.125  25.865  1.00 27.41  ? 91  PHE A CE2   1 
ATOM   726  C  CZ    . PHE A 1 92  ? 68.408  10.899  26.973  1.00 29.31  ? 91  PHE A CZ    1 
ATOM   727  N  N     . THR A 1 93  ? 72.800  5.132   25.530  1.00 32.11  ? 92  THR A N     1 
ATOM   728  C  CA    . THR A 1 93  ? 73.453  3.847   25.765  1.00 32.31  ? 92  THR A CA    1 
ATOM   729  C  C     . THR A 1 93  ? 74.902  4.040   26.193  1.00 34.03  ? 92  THR A C     1 
ATOM   730  O  O     . THR A 1 93  ? 75.358  3.441   27.173  1.00 34.18  ? 92  THR A O     1 
ATOM   731  C  CB    . THR A 1 93  ? 73.372  2.976   24.511  1.00 37.02  ? 92  THR A CB    1 
ATOM   732  O  OG1   . THR A 1 93  ? 72.008  2.612   24.265  1.00 41.63  ? 92  THR A OG1   1 
ATOM   733  C  CG2   . THR A 1 93  ? 74.206  1.713   24.681  1.00 40.24  ? 92  THR A CG2   1 
ATOM   734  N  N     . ASN A 1 94  ? 75.644  4.880   25.468  1.00 29.69  ? 93  ASN A N     1 
ATOM   735  C  CA    . ASN A 1 94  ? 77.030  5.144   25.838  1.00 32.87  ? 93  ASN A CA    1 
ATOM   736  C  C     . ASN A 1 94  ? 77.126  5.852   27.182  1.00 36.00  ? 93  ASN A C     1 
ATOM   737  O  O     . ASN A 1 94  ? 78.073  5.612   27.941  1.00 35.85  ? 93  ASN A O     1 
ATOM   738  C  CB    . ASN A 1 94  ? 77.716  5.968   24.749  1.00 31.84  ? 93  ASN A CB    1 
ATOM   739  C  CG    . ASN A 1 94  ? 77.912  5.185   23.468  1.00 33.53  ? 93  ASN A CG    1 
ATOM   740  O  OD1   . ASN A 1 94  ? 78.145  3.976   23.496  1.00 39.49  ? 93  ASN A OD1   1 
ATOM   741  N  ND2   . ASN A 1 94  ? 77.814  5.869   22.334  1.00 33.01  ? 93  ASN A ND2   1 
ATOM   742  N  N     . MET A 1 95  ? 76.162  6.720   27.495  1.00 36.60  ? 94  MET A N     1 
ATOM   743  C  CA    . MET A 1 95  ? 76.133  7.348   28.812  1.00 36.18  ? 94  MET A CA    1 
ATOM   744  C  C     . MET A 1 95  ? 75.939  6.310   29.909  1.00 35.41  ? 94  MET A C     1 
ATOM   745  O  O     . MET A 1 95  ? 76.505  6.436   31.001  1.00 33.29  ? 94  MET A O     1 
ATOM   746  C  CB    . MET A 1 95  ? 75.023  8.397   28.865  1.00 29.95  ? 94  MET A CB    1 
ATOM   747  C  CG    . MET A 1 95  ? 75.031  9.259   30.115  1.00 41.55  ? 94  MET A CG    1 
ATOM   748  S  SD    . MET A 1 95  ? 73.733  10.509  30.076  1.00 51.87  ? 94  MET A SD    1 
ATOM   749  C  CE    . MET A 1 95  ? 73.828  11.018  28.365  1.00 39.20  ? 94  MET A CE    1 
ATOM   750  N  N     . LEU A 1 96  ? 75.150  5.269   29.630  1.00 33.26  ? 95  LEU A N     1 
ATOM   751  C  CA    . LEU A 1 96  ? 74.871  4.257   30.644  1.00 41.09  ? 95  LEU A CA    1 
ATOM   752  C  C     . LEU A 1 96  ? 76.106  3.418   30.952  1.00 34.72  ? 95  LEU A C     1 
ATOM   753  O  O     . LEU A 1 96  ? 76.368  3.099   32.117  1.00 37.72  ? 95  LEU A O     1 
ATOM   754  C  CB    . LEU A 1 96  ? 73.718  3.363   30.191  1.00 35.63  ? 95  LEU A CB    1 
ATOM   755  C  CG    . LEU A 1 96  ? 73.321  2.258   31.172  1.00 41.97  ? 95  LEU A CG    1 
ATOM   756  C  CD1   . LEU A 1 96  ? 72.929  2.849   32.519  1.00 37.53  ? 95  LEU A CD1   1 
ATOM   757  C  CD2   . LEU A 1 96  ? 72.195  1.410   30.604  1.00 34.65  ? 95  LEU A CD2   1 
ATOM   758  N  N     . GLU A 1 97  ? 76.871  3.039   29.925  1.00 30.55  ? 96  GLU A N     1 
ATOM   759  C  CA    . GLU A 1 97  ? 78.094  2.280   30.171  1.00 43.62  ? 96  GLU A CA    1 
ATOM   760  C  C     . GLU A 1 97  ? 79.134  3.129   30.889  1.00 36.63  ? 96  GLU A C     1 
ATOM   761  O  O     . GLU A 1 97  ? 79.980  2.596   31.617  1.00 44.19  ? 96  GLU A O     1 
ATOM   762  C  CB    . GLU A 1 97  ? 78.668  1.750   28.855  1.00 43.88  ? 96  GLU A CB    1 
ATOM   763  C  CG    . GLU A 1 97  ? 77.631  1.372   27.804  1.00 51.80  ? 96  GLU A CG    1 
ATOM   764  C  CD    . GLU A 1 97  ? 76.596  0.381   28.307  1.00 71.09  ? 96  GLU A CD    1 
ATOM   765  O  OE1   . GLU A 1 97  ? 76.955  -0.510  29.107  1.00 74.90  ? 96  GLU A OE1   1 
ATOM   766  O  OE2   . GLU A 1 97  ? 75.419  0.496   27.901  1.00 49.71  ? 96  GLU A OE2   1 
ATOM   767  N  N     . ARG A 1 98  ? 79.075  4.444   30.702  1.00 37.70  ? 97  ARG A N     1 
ATOM   768  C  CA    A ARG A 1 98  ? 80.035  5.346   31.327  0.65 38.96  ? 97  ARG A CA    1 
ATOM   769  C  CA    B ARG A 1 98  ? 79.981  5.432   31.261  0.35 38.99  ? 97  ARG A CA    1 
ATOM   770  C  C     . ARG A 1 98  ? 79.465  6.031   32.566  1.00 41.88  ? 97  ARG A C     1 
ATOM   771  O  O     . ARG A 1 98  ? 79.997  7.053   33.012  1.00 39.66  ? 97  ARG A O     1 
ATOM   772  C  CB    A ARG A 1 98  ? 80.528  6.374   30.309  0.65 40.93  ? 97  ARG A CB    1 
ATOM   773  C  CB    B ARG A 1 98  ? 80.194  6.546   30.224  0.35 40.76  ? 97  ARG A CB    1 
ATOM   774  C  CG    A ARG A 1 98  ? 81.242  5.739   29.122  0.65 37.39  ? 97  ARG A CG    1 
ATOM   775  C  CG    B ARG A 1 98  ? 81.487  7.335   30.317  0.35 42.02  ? 97  ARG A CG    1 
ATOM   776  C  CD    A ARG A 1 98  ? 81.740  6.776   28.129  0.65 38.31  ? 97  ARG A CD    1 
ATOM   777  C  CD    B ARG A 1 98  ? 81.560  8.386   29.205  0.35 43.69  ? 97  ARG A CD    1 
ATOM   778  N  NE    A ARG A 1 98  ? 82.629  7.752   28.751  0.65 44.38  ? 97  ARG A NE    1 
ATOM   779  N  NE    B ARG A 1 98  ? 80.516  9.405   29.320  0.35 39.74  ? 97  ARG A NE    1 
ATOM   780  C  CZ    A ARG A 1 98  ? 83.916  7.539   29.006  0.65 46.03  ? 97  ARG A CZ    1 
ATOM   781  C  CZ    B ARG A 1 98  ? 79.525  9.574   28.448  0.35 42.69  ? 97  ARG A CZ    1 
ATOM   782  N  NH1   A ARG A 1 98  ? 84.476  6.378   28.696  0.65 42.39  ? 97  ARG A NH1   1 
ATOM   783  N  NH1   B ARG A 1 98  ? 79.433  8.794   27.380  0.35 37.68  ? 97  ARG A NH1   1 
ATOM   784  N  NH2   A ARG A 1 98  ? 84.645  8.490   29.573  0.65 46.66  ? 97  ARG A NH2   1 
ATOM   785  N  NH2   B ARG A 1 98  ? 78.626  10.530  28.642  0.35 41.84  ? 97  ARG A NH2   1 
ATOM   786  N  N     . ILE A 1 99  ? 78.427  5.441   33.168  1.00 36.56  ? 98  ILE A N     1 
ATOM   787  C  CA    . ILE A 1 99  ? 77.717  6.075   34.278  1.00 38.93  ? 98  ILE A CA    1 
ATOM   788  C  C     . ILE A 1 99  ? 78.593  6.221   35.520  1.00 42.68  ? 98  ILE A C     1 
ATOM   789  O  O     . ILE A 1 99  ? 78.420  7.171   36.295  1.00 35.57  ? 98  ILE A O     1 
ATOM   790  C  CB    . ILE A 1 99  ? 76.426  5.292   34.590  1.00 34.62  ? 98  ILE A CB    1 
ATOM   791  C  CG1   . ILE A 1 99  ? 75.545  6.072   35.566  1.00 40.17  ? 98  ILE A CG1   1 
ATOM   792  C  CG2   . ILE A 1 99  ? 76.747  3.910   35.150  1.00 40.02  ? 98  ILE A CG2   1 
ATOM   793  C  CD1   . ILE A 1 99  ? 74.322  5.309   36.026  1.00 48.85  ? 98  ILE A CD1   1 
ATOM   794  N  N     . ARG A 1 100 ? 79.540  5.307   35.739  1.00 41.35  ? 99  ARG A N     1 
ATOM   795  C  CA    A ARG A 1 100 ? 80.383  5.368   36.928  0.62 45.90  ? 99  ARG A CA    1 
ATOM   796  C  CA    B ARG A 1 100 ? 80.376  5.373   36.933  0.38 46.00  ? 99  ARG A CA    1 
ATOM   797  C  C     . ARG A 1 100 ? 81.299  6.585   36.948  1.00 43.33  ? 99  ARG A C     1 
ATOM   798  O  O     . ARG A 1 100 ? 81.952  6.828   37.969  1.00 44.42  ? 99  ARG A O     1 
ATOM   799  C  CB    A ARG A 1 100 ? 81.218  4.090   37.041  0.62 45.79  ? 99  ARG A CB    1 
ATOM   800  C  CB    B ARG A 1 100 ? 81.205  4.093   37.070  0.38 45.97  ? 99  ARG A CB    1 
ATOM   801  C  CG    A ARG A 1 100 ? 80.399  2.838   37.314  0.62 48.85  ? 99  ARG A CG    1 
ATOM   802  C  CG    B ARG A 1 100 ? 80.505  2.970   37.827  0.38 48.35  ? 99  ARG A CG    1 
ATOM   803  C  CD    A ARG A 1 100 ? 81.192  1.576   37.014  0.62 49.06  ? 99  ARG A CD    1 
ATOM   804  C  CD    B ARG A 1 100 ? 81.233  1.644   37.653  0.38 48.48  ? 99  ARG A CD    1 
ATOM   805  N  NE    A ARG A 1 100 ? 80.485  0.371   37.440  0.62 47.84  ? 99  ARG A NE    1 
ATOM   806  N  NE    B ARG A 1 100 ? 80.557  0.547   38.343  0.38 49.81  ? 99  ARG A NE    1 
ATOM   807  C  CZ    A ARG A 1 100 ? 79.613  -0.292  36.687  0.62 46.09  ? 99  ARG A CZ    1 
ATOM   808  C  CZ    B ARG A 1 100 ? 81.067  -0.115  39.377  0.38 51.22  ? 99  ARG A CZ    1 
ATOM   809  N  NH1   A ARG A 1 100 ? 79.334  0.133   35.463  0.62 42.97  ? 99  ARG A NH1   1 
ATOM   810  N  NH1   B ARG A 1 100 ? 82.268  0.199   39.842  0.38 50.41  ? 99  ARG A NH1   1 
ATOM   811  N  NH2   A ARG A 1 100 ? 79.018  -1.379  37.159  0.62 47.20  ? 99  ARG A NH2   1 
ATOM   812  N  NH2   B ARG A 1 100 ? 80.378  -1.098  39.942  0.38 50.70  ? 99  ARG A NH2   1 
ATOM   813  N  N     . LEU A 1 101 ? 81.361  7.352   35.860  1.00 46.39  ? 100 LEU A N     1 
ATOM   814  C  CA    . LEU A 1 101 ? 82.238  8.511   35.762  1.00 37.48  ? 100 LEU A CA    1 
ATOM   815  C  C     . LEU A 1 101 ? 81.508  9.837   35.929  1.00 47.81  ? 100 LEU A C     1 
ATOM   816  O  O     . LEU A 1 101 ? 82.133  10.891  35.772  1.00 49.27  ? 100 LEU A O     1 
ATOM   817  C  CB    . LEU A 1 101 ? 82.969  8.501   34.417  1.00 35.39  ? 100 LEU A CB    1 
ATOM   818  C  CG    . LEU A 1 101 ? 83.708  7.212   34.056  1.00 43.72  ? 100 LEU A CG    1 
ATOM   819  C  CD1   . LEU A 1 101 ? 84.369  7.343   32.695  1.00 47.89  ? 100 LEU A CD1   1 
ATOM   820  C  CD2   . LEU A 1 101 ? 84.733  6.864   35.124  1.00 42.36  ? 100 LEU A CD2   1 
ATOM   821  N  N     . CYS A 1 102 ? 80.213  9.814   36.236  1.00 40.97  ? 101 CYS A N     1 
ATOM   822  C  CA    . CYS A 1 102 ? 79.458  11.052  36.385  1.00 48.52  ? 101 CYS A CA    1 
ATOM   823  C  C     . CYS A 1 102 ? 80.040  11.911  37.500  1.00 44.71  ? 101 CYS A C     1 
ATOM   824  O  O     . CYS A 1 102 ? 80.397  11.411  38.570  1.00 43.93  ? 101 CYS A O     1 
ATOM   825  C  CB    . CYS A 1 102 ? 77.988  10.748  36.684  1.00 42.09  ? 101 CYS A CB    1 
ATOM   826  S  SG    . CYS A 1 102 ? 77.060  10.017  35.319  1.00 52.55  ? 101 CYS A SG    1 
ATOM   827  N  N     . ASN A 1 103 ? 80.138  13.215  37.245  1.00 43.07  ? 102 ASN A N     1 
ATOM   828  C  CA    . ASN A 1 103 ? 80.484  14.146  38.307  1.00 49.98  ? 102 ASN A CA    1 
ATOM   829  C  C     . ASN A 1 103 ? 79.302  14.277  39.269  1.00 45.06  ? 102 ASN A C     1 
ATOM   830  O  O     . ASN A 1 103 ? 78.230  13.703  39.058  1.00 45.14  ? 102 ASN A O     1 
ATOM   831  C  CB    . ASN A 1 103 ? 80.905  15.496  37.722  1.00 41.44  ? 102 ASN A CB    1 
ATOM   832  C  CG    . ASN A 1 103 ? 79.832  16.129  36.848  1.00 56.62  ? 102 ASN A CG    1 
ATOM   833  O  OD1   . ASN A 1 103 ? 78.655  16.169  37.209  1.00 55.63  ? 102 ASN A OD1   1 
ATOM   834  N  ND2   . ASN A 1 103 ? 80.241  16.630  35.689  1.00 58.52  ? 102 ASN A ND2   1 
ATOM   835  N  N     . MET A 1 104 ? 79.499  15.048  40.341  1.00 44.43  ? 103 MET A N     1 
ATOM   836  C  CA    . MET A 1 104 ? 78.474  15.136  41.379  1.00 46.84  ? 103 MET A CA    1 
ATOM   837  C  C     . MET A 1 104 ? 77.159  15.670  40.825  1.00 48.83  ? 103 MET A C     1 
ATOM   838  O  O     . MET A 1 104 ? 76.080  15.205  41.213  1.00 45.65  ? 103 MET A O     1 
ATOM   839  C  CB    . MET A 1 104 ? 78.960  16.012  42.533  1.00 46.19  ? 103 MET A CB    1 
ATOM   840  C  CG    . MET A 1 104 ? 77.907  16.233  43.610  1.00 48.77  ? 103 MET A CG    1 
ATOM   841  S  SD    . MET A 1 104 ? 78.431  17.355  44.918  1.00 81.35  ? 103 MET A SD    1 
ATOM   842  C  CE    . MET A 1 104 ? 79.596  16.320  45.801  1.00 61.70  ? 103 MET A CE    1 
ATOM   843  N  N     . ARG A 1 105 ? 77.227  16.638  39.909  1.00 42.42  ? 104 ARG A N     1 
ATOM   844  C  CA    . ARG A 1 105 ? 76.010  17.236  39.370  1.00 49.94  ? 104 ARG A CA    1 
ATOM   845  C  C     . ARG A 1 105 ? 75.192  16.211  38.592  1.00 44.85  ? 104 ARG A C     1 
ATOM   846  O  O     . ARG A 1 105 ? 73.970  16.121  38.755  1.00 42.43  ? 104 ARG A O     1 
ATOM   847  C  CB    . ARG A 1 105 ? 76.365  18.432  38.487  1.00 51.56  ? 104 ARG A CB    1 
ATOM   848  C  CG    . ARG A 1 105 ? 75.196  19.354  38.206  1.00 64.83  ? 104 ARG A CG    1 
ATOM   849  C  CD    . ARG A 1 105 ? 75.591  20.803  38.425  1.00 73.90  ? 104 ARG A CD    1 
ATOM   850  N  NE    . ARG A 1 105 ? 76.361  21.358  37.318  1.00 78.15  ? 104 ARG A NE    1 
ATOM   851  C  CZ    . ARG A 1 105 ? 75.943  22.362  36.556  1.00 81.79  ? 104 ARG A CZ    1 
ATOM   852  N  NH1   . ARG A 1 105 ? 74.762  22.921  36.782  1.00 67.79  ? 104 ARG A NH1   1 
ATOM   853  N  NH2   . ARG A 1 105 ? 76.706  22.811  35.570  1.00 83.39  ? 104 ARG A NH2   1 
ATOM   854  N  N     . GLU A 1 106 ? 75.855  15.425  37.740  1.00 40.44  ? 105 GLU A N     1 
ATOM   855  C  CA    . GLU A 1 106 ? 75.153  14.388  36.992  1.00 40.64  ? 105 GLU A CA    1 
ATOM   856  C  C     . GLU A 1 106 ? 74.661  13.273  37.905  1.00 45.32  ? 105 GLU A C     1 
ATOM   857  O  O     . GLU A 1 106 ? 73.618  12.666  37.633  1.00 46.42  ? 105 GLU A O     1 
ATOM   858  C  CB    . GLU A 1 106 ? 76.064  13.822  35.903  1.00 43.07  ? 105 GLU A CB    1 
ATOM   859  C  CG    . GLU A 1 106 ? 76.727  14.884  35.043  1.00 54.58  ? 105 GLU A CG    1 
ATOM   860  C  CD    . GLU A 1 106 ? 77.871  14.334  34.215  1.00 58.25  ? 105 GLU A CD    1 
ATOM   861  O  OE1   . GLU A 1 106 ? 77.710  14.209  32.983  1.00 66.96  ? 105 GLU A OE1   1 
ATOM   862  O  OE2   . GLU A 1 106 ? 78.931  14.021  34.797  1.00 57.50  ? 105 GLU A OE2   1 
ATOM   863  N  N     . GLN A 1 107 ? 75.393  12.988  38.985  1.00 45.35  ? 106 GLN A N     1 
ATOM   864  C  CA    . GLN A 1 107 ? 74.953  11.972  39.936  1.00 39.88  ? 106 GLN A CA    1 
ATOM   865  C  C     . GLN A 1 107 ? 73.641  12.377  40.596  1.00 47.13  ? 106 GLN A C     1 
ATOM   866  O  O     . GLN A 1 107 ? 72.703  11.576  40.683  1.00 41.83  ? 106 GLN A O     1 
ATOM   867  C  CB    . GLN A 1 107 ? 76.034  11.737  40.991  1.00 42.69  ? 106 GLN A CB    1 
ATOM   868  C  CG    . GLN A 1 107 ? 77.292  11.069  40.464  1.00 43.99  ? 106 GLN A CG    1 
ATOM   869  C  CD    . GLN A 1 107 ? 78.440  11.132  41.453  1.00 44.79  ? 106 GLN A CD    1 
ATOM   870  O  OE1   . GLN A 1 107 ? 78.233  11.332  42.650  1.00 37.34  ? 106 GLN A OE1   1 
ATOM   871  N  NE2   . GLN A 1 107 ? 79.660  10.964  40.956  1.00 44.22  ? 106 GLN A NE2   1 
ATOM   872  N  N     . ILE A 1 108 ? 73.560  13.623  41.068  1.00 44.24  ? 107 ILE A N     1 
ATOM   873  C  CA    . ILE A 1 108 ? 72.340  14.104  41.711  1.00 43.08  ? 107 ILE A CA    1 
ATOM   874  C  C     . ILE A 1 108 ? 71.172  14.063  40.736  1.00 38.01  ? 107 ILE A C     1 
ATOM   875  O  O     . ILE A 1 108 ? 70.061  13.649  41.090  1.00 40.29  ? 107 ILE A O     1 
ATOM   876  C  CB    . ILE A 1 108 ? 72.560  15.520  42.277  1.00 44.28  ? 107 ILE A CB    1 
ATOM   877  C  CG1   . ILE A 1 108 ? 73.508  15.473  43.477  1.00 47.58  ? 107 ILE A CG1   1 
ATOM   878  C  CG2   . ILE A 1 108 ? 71.234  16.160  42.661  1.00 44.15  ? 107 ILE A CG2   1 
ATOM   879  C  CD1   . ILE A 1 108 ? 73.994  16.834  43.925  1.00 49.37  ? 107 ILE A CD1   1 
ATOM   880  N  N     . ALA A 1 109 ? 71.406  14.479  39.489  1.00 37.03  ? 108 ALA A N     1 
ATOM   881  C  CA    . ALA A 1 109 ? 70.337  14.479  38.496  1.00 40.49  ? 108 ALA A CA    1 
ATOM   882  C  C     . ALA A 1 109 ? 69.870  13.063  38.182  1.00 40.29  ? 108 ALA A C     1 
ATOM   883  O  O     . ALA A 1 109 ? 68.668  12.820  38.023  1.00 38.63  ? 108 ALA A O     1 
ATOM   884  C  CB    . ALA A 1 109 ? 70.804  15.186  37.224  1.00 38.24  ? 108 ALA A CB    1 
ATOM   885  N  N     . PHE A 1 110 ? 70.806  12.114  38.088  1.00 38.13  ? 109 PHE A N     1 
ATOM   886  C  CA    . PHE A 1 110 ? 70.424  10.732  37.811  1.00 37.46  ? 109 PHE A CA    1 
ATOM   887  C  C     . PHE A 1 110 ? 69.641  10.132  38.971  1.00 33.96  ? 109 PHE A C     1 
ATOM   888  O  O     . PHE A 1 110 ? 68.655  9.417   38.757  1.00 33.92  ? 109 PHE A O     1 
ATOM   889  C  CB    . PHE A 1 110 ? 71.664  9.890   37.506  1.00 34.28  ? 109 PHE A CB    1 
ATOM   890  C  CG    . PHE A 1 110 ? 71.362  8.438   37.249  1.00 37.11  ? 109 PHE A CG    1 
ATOM   891  C  CD1   . PHE A 1 110 ? 70.970  8.011   35.990  1.00 33.03  ? 109 PHE A CD1   1 
ATOM   892  C  CD2   . PHE A 1 110 ? 71.469  7.502   38.266  1.00 32.62  ? 109 PHE A CD2   1 
ATOM   893  C  CE1   . PHE A 1 110 ? 70.688  6.677   35.751  1.00 31.57  ? 109 PHE A CE1   1 
ATOM   894  C  CE2   . PHE A 1 110 ? 71.188  6.168   38.033  1.00 29.97  ? 109 PHE A CE2   1 
ATOM   895  C  CZ    . PHE A 1 110 ? 70.798  5.755   36.774  1.00 32.26  ? 109 PHE A CZ    1 
ATOM   896  N  N     . ILE A 1 111 ? 70.067  10.405  40.206  1.00 36.38  ? 110 ILE A N     1 
ATOM   897  C  CA    . ILE A 1 111 ? 69.337  9.910   41.369  1.00 39.04  ? 110 ILE A CA    1 
ATOM   898  C  C     . ILE A 1 111 ? 67.953  10.545  41.436  1.00 38.68  ? 110 ILE A C     1 
ATOM   899  O  O     . ILE A 1 111 ? 66.979  9.903   41.848  1.00 36.86  ? 110 ILE A O     1 
ATOM   900  C  CB    . ILE A 1 111 ? 70.148  10.161  42.653  1.00 33.48  ? 110 ILE A CB    1 
ATOM   901  C  CG1   . ILE A 1 111 ? 71.479  9.409   42.593  1.00 38.70  ? 110 ILE A CG1   1 
ATOM   902  C  CG2   . ILE A 1 111 ? 69.363  9.732   43.883  1.00 39.02  ? 110 ILE A CG2   1 
ATOM   903  C  CD1   . ILE A 1 111 ? 72.391  9.686   43.768  1.00 37.72  ? 110 ILE A CD1   1 
ATOM   904  N  N     . LYS A 1 112 ? 67.844  11.812  41.028  1.00 36.14  ? 111 LYS A N     1 
ATOM   905  C  CA    . LYS A 1 112 ? 66.541  12.459  40.911  1.00 35.18  ? 111 LYS A CA    1 
ATOM   906  C  C     . LYS A 1 112 ? 65.625  11.673  39.983  1.00 33.34  ? 111 LYS A C     1 
ATOM   907  O  O     . LYS A 1 112 ? 64.509  11.294  40.357  1.00 36.72  ? 111 LYS A O     1 
ATOM   908  C  CB    . LYS A 1 112 ? 66.711  13.886  40.392  1.00 40.24  ? 111 LYS A CB    1 
ATOM   909  C  CG    . LYS A 1 112 ? 66.673  14.976  41.440  1.00 45.63  ? 111 LYS A CG    1 
ATOM   910  C  CD    . LYS A 1 112 ? 67.179  16.267  40.826  1.00 52.51  ? 111 LYS A CD    1 
ATOM   911  C  CE    . LYS A 1 112 ? 66.870  17.482  41.677  1.00 62.62  ? 111 LYS A CE    1 
ATOM   912  N  NZ    . LYS A 1 112 ? 67.415  18.722  41.059  1.00 57.60  ? 111 LYS A NZ    1 
ATOM   913  N  N     . GLY A 1 113 ? 66.086  11.423  38.755  1.00 31.67  ? 112 GLY A N     1 
ATOM   914  C  CA    . GLY A 1 113 ? 65.252  10.731  37.786  1.00 32.46  ? 112 GLY A CA    1 
ATOM   915  C  C     . GLY A 1 113 ? 64.945  9.302   38.188  1.00 35.49  ? 112 GLY A C     1 
ATOM   916  O  O     . GLY A 1 113 ? 63.833  8.814   37.973  1.00 31.55  ? 112 GLY A O     1 
ATOM   917  N  N     . LEU A 1 114 ? 65.924  8.613   38.779  1.00 29.96  ? 113 LEU A N     1 
ATOM   918  C  CA    . LEU A 1 114 ? 65.696  7.236   39.203  1.00 32.47  ? 113 LEU A CA    1 
ATOM   919  C  C     . LEU A 1 114 ? 64.676  7.167   40.333  1.00 36.95  ? 113 LEU A C     1 
ATOM   920  O  O     . LEU A 1 114 ? 63.885  6.219   40.404  1.00 29.94  ? 113 LEU A O     1 
ATOM   921  C  CB    . LEU A 1 114 ? 67.014  6.589   39.629  1.00 30.94  ? 113 LEU A CB    1 
ATOM   922  C  CG    . LEU A 1 114 ? 66.953  5.078   39.869  1.00 33.38  ? 113 LEU A CG    1 
ATOM   923  C  CD1   . LEU A 1 114 ? 66.608  4.346   38.580  1.00 27.71  ? 113 LEU A CD1   1 
ATOM   924  C  CD2   . LEU A 1 114 ? 68.261  4.564   40.450  1.00 31.70  ? 113 LEU A CD2   1 
ATOM   925  N  N     . TYR A 1 115 ? 64.671  8.163   41.224  1.00 30.43  ? 114 TYR A N     1 
ATOM   926  C  CA    . TYR A 1 115 ? 63.702  8.146   42.316  1.00 31.65  ? 114 TYR A CA    1 
ATOM   927  C  C     . TYR A 1 115 ? 62.305  8.497   41.820  1.00 32.02  ? 114 TYR A C     1 
ATOM   928  O  O     . TYR A 1 115 ? 61.315  7.922   42.287  1.00 31.60  ? 114 TYR A O     1 
ATOM   929  C  CB    . TYR A 1 115 ? 64.127  9.098   43.433  1.00 36.43  ? 114 TYR A CB    1 
ATOM   930  C  CG    . TYR A 1 115 ? 63.427  8.796   44.739  1.00 35.25  ? 114 TYR A CG    1 
ATOM   931  C  CD1   . TYR A 1 115 ? 62.157  9.295   45.004  1.00 33.20  ? 114 TYR A CD1   1 
ATOM   932  C  CD2   . TYR A 1 115 ? 64.026  7.990   45.697  1.00 34.18  ? 114 TYR A CD2   1 
ATOM   933  C  CE1   . TYR A 1 115 ? 61.509  9.008   46.190  1.00 36.50  ? 114 TYR A CE1   1 
ATOM   934  C  CE2   . TYR A 1 115 ? 63.387  7.698   46.887  1.00 36.66  ? 114 TYR A CE2   1 
ATOM   935  C  CZ    . TYR A 1 115 ? 62.129  8.210   47.128  1.00 37.24  ? 114 TYR A CZ    1 
ATOM   936  O  OH    . TYR A 1 115 ? 61.489  7.921   48.311  1.00 41.27  ? 114 TYR A OH    1 
ATOM   937  N  N     . VAL A 1 116 ? 62.199  9.442   40.883  1.00 33.01  ? 115 VAL A N     1 
ATOM   938  C  CA    . VAL A 1 116 ? 60.903  9.729   40.273  1.00 32.61  ? 115 VAL A CA    1 
ATOM   939  C  C     . VAL A 1 116 ? 60.335  8.469   39.634  1.00 35.76  ? 115 VAL A C     1 
ATOM   940  O  O     . VAL A 1 116 ? 59.127  8.207   39.697  1.00 33.33  ? 115 VAL A O     1 
ATOM   941  C  CB    . VAL A 1 116 ? 61.031  10.875  39.252  1.00 36.32  ? 115 VAL A CB    1 
ATOM   942  C  CG1   . VAL A 1 116 ? 59.751  11.019  38.442  1.00 31.56  ? 115 VAL A CG1   1 
ATOM   943  C  CG2   . VAL A 1 116 ? 61.360  12.176  39.960  1.00 34.28  ? 115 VAL A CG2   1 
ATOM   944  N  N     . ALA A 1 117 ? 61.202  7.654   39.034  1.00 28.03  ? 116 ALA A N     1 
ATOM   945  C  CA    . ALA A 1 117 ? 60.753  6.427   38.391  1.00 28.70  ? 116 ALA A CA    1 
ATOM   946  C  C     . ALA A 1 117 ? 60.519  5.311   39.404  1.00 29.34  ? 116 ALA A C     1 
ATOM   947  O  O     . ALA A 1 117 ? 59.440  4.713   39.439  1.00 24.67  ? 116 ALA A O     1 
ATOM   948  C  CB    . ALA A 1 117 ? 61.770  5.991   37.335  1.00 27.95  ? 116 ALA A CB    1 
ATOM   949  N  N     . GLU A 1 118 ? 61.508  5.025   40.248  1.00 32.87  ? 117 GLU A N     1 
ATOM   950  C  CA    . GLU A 1 118 ? 61.498  3.821   41.068  1.00 33.48  ? 117 GLU A CA    1 
ATOM   951  C  C     . GLU A 1 118 ? 61.303  4.082   42.554  1.00 33.20  ? 117 GLU A C     1 
ATOM   952  O  O     . GLU A 1 118 ? 61.351  3.132   43.342  1.00 32.71  ? 117 GLU A O     1 
ATOM   953  C  CB    . GLU A 1 118 ? 62.808  3.053   40.869  1.00 29.61  ? 117 GLU A CB    1 
ATOM   954  C  CG    . GLU A 1 118 ? 63.254  2.958   39.429  1.00 31.46  ? 117 GLU A CG    1 
ATOM   955  C  CD    . GLU A 1 118 ? 62.591  1.817   38.700  1.00 39.01  ? 117 GLU A CD    1 
ATOM   956  O  OE1   . GLU A 1 118 ? 61.398  1.934   38.344  1.00 34.99  ? 117 GLU A OE1   1 
ATOM   957  O  OE2   . GLU A 1 118 ? 63.268  0.787   38.511  1.00 40.97  ? 117 GLU A OE2   1 
ATOM   958  N  N     . GLY A 1 119 ? 61.087  5.326   42.963  1.00 29.83  ? 118 GLY A N     1 
ATOM   959  C  CA    . GLY A 1 119 ? 61.130  5.656   44.369  1.00 39.36  ? 118 GLY A CA    1 
ATOM   960  C  C     . GLY A 1 119 ? 59.783  5.612   45.067  1.00 37.59  ? 118 GLY A C     1 
ATOM   961  O  O     . GLY A 1 119 ? 58.724  5.595   44.443  1.00 33.99  ? 118 GLY A O     1 
ATOM   962  N  N     . ASP A 1 120 ? 59.851  5.584   46.397  1.00 37.64  ? 119 ASP A N     1 
ATOM   963  C  CA    . ASP A 1 120 ? 58.671  5.711   47.246  1.00 36.47  ? 119 ASP A CA    1 
ATOM   964  C  C     . ASP A 1 120 ? 58.204  7.161   47.213  1.00 38.33  ? 119 ASP A C     1 
ATOM   965  O  O     . ASP A 1 120 ? 58.826  8.034   47.827  1.00 41.41  ? 119 ASP A O     1 
ATOM   966  C  CB    . ASP A 1 120 ? 59.006  5.266   48.668  1.00 40.11  ? 119 ASP A CB    1 
ATOM   967  C  CG    . ASP A 1 120 ? 57.778  5.135   49.557  1.00 46.38  ? 119 ASP A CG    1 
ATOM   968  O  OD1   . ASP A 1 120 ? 56.808  5.903   49.383  1.00 46.06  ? 119 ASP A OD1   1 
ATOM   969  O  OD2   . ASP A 1 120 ? 57.787  4.255   50.444  1.00 44.12  ? 119 ASP A OD2   1 
ATOM   970  N  N     . LYS A 1 121 ? 57.111  7.425   46.497  1.00 42.97  ? 120 LYS A N     1 
ATOM   971  C  CA    . LYS A 1 121 ? 56.657  8.794   46.284  1.00 41.99  ? 120 LYS A CA    1 
ATOM   972  C  C     . LYS A 1 121 ? 55.962  9.398   47.497  1.00 49.75  ? 120 LYS A C     1 
ATOM   973  O  O     . LYS A 1 121 ? 55.668  10.598  47.483  1.00 49.66  ? 120 LYS A O     1 
ATOM   974  C  CB    . LYS A 1 121 ? 55.723  8.857   45.073  1.00 42.36  ? 120 LYS A CB    1 
ATOM   975  C  CG    . LYS A 1 121 ? 56.341  9.521   43.849  1.00 44.98  ? 120 LYS A CG    1 
ATOM   976  C  CD    . LYS A 1 121 ? 57.497  8.706   43.290  1.00 45.57  ? 120 LYS A CD    1 
ATOM   977  C  CE    . LYS A 1 121 ? 56.997  7.485   42.535  1.00 47.18  ? 120 LYS A CE    1 
ATOM   978  N  NZ    . LYS A 1 121 ? 58.120  6.663   42.003  1.00 42.38  ? 120 LYS A NZ    1 
ATOM   979  N  N     . THR A 1 122 ? 55.690  8.611   48.541  1.00 45.35  ? 121 THR A N     1 
ATOM   980  C  CA    . THR A 1 122 ? 55.095  9.182   49.745  1.00 46.42  ? 121 THR A CA    1 
ATOM   981  C  C     . THR A 1 122 ? 56.098  10.031  50.512  1.00 52.63  ? 121 THR A C     1 
ATOM   982  O  O     . THR A 1 122 ? 55.706  10.977  51.205  1.00 53.98  ? 121 THR A O     1 
ATOM   983  C  CB    . THR A 1 122 ? 54.557  8.076   50.654  1.00 46.07  ? 121 THR A CB    1 
ATOM   984  O  OG1   . THR A 1 122 ? 55.653  7.335   51.205  1.00 51.83  ? 121 THR A OG1   1 
ATOM   985  C  CG2   . THR A 1 122 ? 53.660  7.133   49.872  1.00 52.87  ? 121 THR A CG2   1 
ATOM   986  N  N     . LEU A 1 123 ? 57.387  9.699   50.404  1.00 54.61  ? 122 LEU A N     1 
ATOM   987  C  CA    . LEU A 1 123 ? 58.474  10.320  51.157  1.00 52.29  ? 122 LEU A CA    1 
ATOM   988  C  C     . LEU A 1 123 ? 58.349  10.051  52.653  1.00 51.86  ? 122 LEU A C     1 
ATOM   989  O  O     . LEU A 1 123 ? 59.174  10.526  53.441  1.00 58.79  ? 122 LEU A O     1 
ATOM   990  C  CB    . LEU A 1 123 ? 58.554  11.827  50.885  1.00 47.85  ? 122 LEU A CB    1 
ATOM   991  C  CG    . LEU A 1 123 ? 58.664  12.261  49.420  1.00 49.95  ? 122 LEU A CG    1 
ATOM   992  C  CD1   . LEU A 1 123 ? 59.048  13.731  49.330  1.00 51.12  ? 122 LEU A CD1   1 
ATOM   993  C  CD2   . LEU A 1 123 ? 59.660  11.394  48.662  1.00 52.78  ? 122 LEU A CD2   1 
ATOM   994  N  N     . LYS A 1 124 ? 57.325  9.293   53.056  1.00 56.01  ? 123 LYS A N     1 
ATOM   995  C  CA    . LYS A 1 124 ? 57.303  8.754   54.411  1.00 57.20  ? 123 LYS A CA    1 
ATOM   996  C  C     . LYS A 1 124 ? 58.483  7.819   54.627  1.00 54.97  ? 123 LYS A C     1 
ATOM   997  O  O     . LYS A 1 124 ? 59.128  7.844   55.682  1.00 59.33  ? 123 LYS A O     1 
ATOM   998  C  CB    . LYS A 1 124 ? 55.985  8.023   54.668  1.00 58.08  ? 123 LYS A CB    1 
ATOM   999  C  CG    . LYS A 1 124 ? 54.741  8.834   54.338  1.00 65.28  ? 123 LYS A CG    1 
ATOM   1000 C  CD    . LYS A 1 124 ? 54.689  10.128  55.133  1.00 73.29  ? 123 LYS A CD    1 
ATOM   1001 C  CE    . LYS A 1 124 ? 54.499  9.859   56.617  1.00 83.84  ? 123 LYS A CE    1 
ATOM   1002 N  NZ    . LYS A 1 124 ? 54.373  11.121  57.395  1.00 83.53  ? 123 LYS A NZ    1 
ATOM   1003 N  N     . ARG A 1 125 ? 58.777  6.988   53.631  1.00 53.81  ? 124 ARG A N     1 
ATOM   1004 C  CA    . ARG A 1 125 ? 59.985  6.184   53.572  1.00 50.87  ? 124 ARG A CA    1 
ATOM   1005 C  C     . ARG A 1 125 ? 60.710  6.508   52.274  1.00 51.35  ? 124 ARG A C     1 
ATOM   1006 O  O     . ARG A 1 125 ? 60.094  6.941   51.295  1.00 45.79  ? 124 ARG A O     1 
ATOM   1007 C  CB    . ARG A 1 125 ? 59.660  4.688   53.648  1.00 50.41  ? 124 ARG A CB    1 
ATOM   1008 C  CG    . ARG A 1 125 ? 58.506  4.367   54.586  1.00 46.78  ? 124 ARG A CG    1 
ATOM   1009 C  CD    . ARG A 1 125 ? 58.049  2.926   54.450  1.00 43.36  ? 124 ARG A CD    1 
ATOM   1010 N  NE    . ARG A 1 125 ? 59.070  1.980   54.887  1.00 42.73  ? 124 ARG A NE    1 
ATOM   1011 C  CZ    . ARG A 1 125 ? 58.841  0.691   55.115  1.00 50.03  ? 124 ARG A CZ    1 
ATOM   1012 N  NH1   . ARG A 1 125 ? 57.622  0.193   54.949  1.00 46.22  ? 124 ARG A NH1   1 
ATOM   1013 N  NH2   . ARG A 1 125 ? 59.828  -0.101  55.511  1.00 46.87  ? 124 ARG A NH2   1 
ATOM   1014 N  N     . LEU A 1 126 ? 62.024  6.311   52.269  1.00 44.55  ? 125 LEU A N     1 
ATOM   1015 C  CA    . LEU A 1 126 ? 62.862  6.659   51.123  1.00 49.22  ? 125 LEU A CA    1 
ATOM   1016 C  C     . LEU A 1 126 ? 63.468  5.374   50.568  1.00 41.98  ? 125 LEU A C     1 
ATOM   1017 O  O     . LEU A 1 126 ? 64.503  4.904   51.053  1.00 43.15  ? 125 LEU A O     1 
ATOM   1018 C  CB    . LEU A 1 126 ? 63.929  7.672   51.525  1.00 47.14  ? 125 LEU A CB    1 
ATOM   1019 C  CG    . LEU A 1 126 ? 63.357  8.986   52.064  1.00 47.43  ? 125 LEU A CG    1 
ATOM   1020 C  CD1   . LEU A 1 126 ? 64.440  9.839   52.704  1.00 44.39  ? 125 LEU A CD1   1 
ATOM   1021 C  CD2   . LEU A 1 126 ? 62.645  9.755   50.959  1.00 41.87  ? 125 LEU A CD2   1 
ATOM   1022 N  N     . ARG A 1 127 ? 62.820  4.813   49.548  1.00 40.55  ? 126 ARG A N     1 
ATOM   1023 C  CA    . ARG A 1 127 ? 63.185  3.519   48.992  1.00 41.07  ? 126 ARG A CA    1 
ATOM   1024 C  C     . ARG A 1 127 ? 63.246  3.601   47.473  1.00 39.70  ? 126 ARG A C     1 
ATOM   1025 O  O     . ARG A 1 127 ? 62.514  4.372   46.848  1.00 31.57  ? 126 ARG A O     1 
ATOM   1026 C  CB    . ARG A 1 127 ? 62.181  2.434   49.412  1.00 35.73  ? 126 ARG A CB    1 
ATOM   1027 C  CG    . ARG A 1 127 ? 62.019  2.278   50.917  1.00 44.49  ? 126 ARG A CG    1 
ATOM   1028 C  CD    . ARG A 1 127 ? 60.935  1.266   51.259  1.00 37.00  ? 126 ARG A CD    1 
ATOM   1029 N  NE    . ARG A 1 127 ? 59.595  1.823   51.104  1.00 38.27  ? 126 ARG A NE    1 
ATOM   1030 C  CZ    . ARG A 1 127 ? 58.474  1.123   51.245  1.00 42.12  ? 126 ARG A CZ    1 
ATOM   1031 N  NH1   . ARG A 1 127 ? 58.529  -0.168  51.541  1.00 39.09  ? 126 ARG A NH1   1 
ATOM   1032 N  NH2   . ARG A 1 127 ? 57.296  1.713   51.087  1.00 41.30  ? 126 ARG A NH2   1 
ATOM   1033 N  N     . ILE A 1 128 ? 64.128  2.793   46.886  1.00 34.93  ? 127 ILE A N     1 
ATOM   1034 C  CA    . ILE A 1 128 ? 64.266  2.674   45.437  1.00 35.15  ? 127 ILE A CA    1 
ATOM   1035 C  C     . ILE A 1 128 ? 64.297  1.191   45.093  1.00 38.37  ? 127 ILE A C     1 
ATOM   1036 O  O     . ILE A 1 128 ? 65.163  0.457   45.585  1.00 35.32  ? 127 ILE A O     1 
ATOM   1037 C  CB    . ILE A 1 128 ? 65.532  3.371   44.910  1.00 39.53  ? 127 ILE A CB    1 
ATOM   1038 C  CG1   . ILE A 1 128 ? 65.535  4.853   45.285  1.00 41.13  ? 127 ILE A CG1   1 
ATOM   1039 C  CG2   . ILE A 1 128 ? 65.643  3.202   43.402  1.00 32.87  ? 127 ILE A CG2   1 
ATOM   1040 C  CD1   . ILE A 1 128 ? 66.773  5.595   44.828  1.00 39.03  ? 127 ILE A CD1   1 
ATOM   1041 N  N     . TRP A 1 129 ? 63.367  0.754   44.247  1.00 31.07  ? 128 TRP A N     1 
ATOM   1042 C  CA    . TRP A 1 129 ? 63.256  -0.646  43.857  1.00 36.14  ? 128 TRP A CA    1 
ATOM   1043 C  C     . TRP A 1 129 ? 63.843  -0.868  42.469  1.00 36.04  ? 128 TRP A C     1 
ATOM   1044 O  O     . TRP A 1 129 ? 63.658  -0.045  41.568  1.00 32.43  ? 128 TRP A O     1 
ATOM   1045 C  CB    . TRP A 1 129 ? 61.796  -1.103  43.867  1.00 32.46  ? 128 TRP A CB    1 
ATOM   1046 C  CG    . TRP A 1 129 ? 61.181  -1.166  45.227  1.00 35.55  ? 128 TRP A CG    1 
ATOM   1047 C  CD1   . TRP A 1 129 ? 61.195  -2.227  46.084  1.00 33.84  ? 128 TRP A CD1   1 
ATOM   1048 C  CD2   . TRP A 1 129 ? 60.450  -0.127  45.887  1.00 32.32  ? 128 TRP A CD2   1 
ATOM   1049 N  NE1   . TRP A 1 129 ? 60.520  -1.912  47.239  1.00 41.19  ? 128 TRP A NE1   1 
ATOM   1050 C  CE2   . TRP A 1 129 ? 60.053  -0.627  47.143  1.00 34.17  ? 128 TRP A CE2   1 
ATOM   1051 C  CE3   . TRP A 1 129 ? 60.093  1.179   45.538  1.00 39.40  ? 128 TRP A CE3   1 
ATOM   1052 C  CZ2   . TRP A 1 129 ? 59.318  0.132   48.050  1.00 35.07  ? 128 TRP A CZ2   1 
ATOM   1053 C  CZ3   . TRP A 1 129 ? 59.365  1.932   46.441  1.00 34.90  ? 128 TRP A CZ3   1 
ATOM   1054 C  CH2   . TRP A 1 129 ? 58.985  1.406   47.682  1.00 36.50  ? 128 TRP A CH2   1 
ATOM   1055 N  N     . ASN A 1 130 ? 64.540  -1.991  42.304  1.00 33.21  ? 129 ASN A N     1 
ATOM   1056 C  CA    . ASN A 1 130 ? 65.063  -2.408  41.008  1.00 33.13  ? 129 ASN A CA    1 
ATOM   1057 C  C     . ASN A 1 130 ? 65.634  -3.812  41.136  1.00 37.26  ? 129 ASN A C     1 
ATOM   1058 O  O     . ASN A 1 130 ? 66.135  -4.196  42.197  1.00 39.86  ? 129 ASN A O     1 
ATOM   1059 C  CB    . ASN A 1 130 ? 66.142  -1.447  40.492  1.00 31.64  ? 129 ASN A CB    1 
ATOM   1060 C  CG    . ASN A 1 130 ? 66.140  -1.332  38.982  1.00 37.56  ? 129 ASN A CG    1 
ATOM   1061 O  OD1   . ASN A 1 130 ? 66.873  -2.041  38.294  1.00 35.59  ? 129 ASN A OD1   1 
ATOM   1062 N  ND2   . ASN A 1 130 ? 65.308  -0.440  38.458  1.00 32.54  ? 129 ASN A ND2   1 
ATOM   1063 N  N     . LYS A 1 131 ? 65.550  -4.574  40.042  1.00 38.48  ? 130 LYS A N     1 
ATOM   1064 C  CA    . LYS A 1 131 ? 66.195  -5.880  39.984  1.00 38.26  ? 130 LYS A CA    1 
ATOM   1065 C  C     . LYS A 1 131 ? 67.684  -5.780  39.683  1.00 42.72  ? 130 LYS A C     1 
ATOM   1066 O  O     . LYS A 1 131 ? 68.420  -6.741  39.931  1.00 41.94  ? 130 LYS A O     1 
ATOM   1067 C  CB    . LYS A 1 131 ? 65.522  -6.765  38.930  1.00 33.72  ? 130 LYS A CB    1 
ATOM   1068 C  CG    . LYS A 1 131 ? 64.100  -7.179  39.271  1.00 42.24  ? 130 LYS A CG    1 
ATOM   1069 C  CD    . LYS A 1 131 ? 63.539  -8.142  38.237  1.00 41.10  ? 130 LYS A CD    1 
ATOM   1070 C  CE    . LYS A 1 131 ? 64.356  -9.422  38.174  1.00 41.35  ? 130 LYS A CE    1 
ATOM   1071 N  NZ    . LYS A 1 131 ? 63.619  -10.516 37.483  1.00 47.02  ? 130 LYS A NZ    1 
ATOM   1072 N  N     . ASN A 1 132 ? 68.140  -4.645  39.158  1.00 35.16  ? 131 ASN A N     1 
ATOM   1073 C  CA    . ASN A 1 132 ? 69.549  -4.436  38.827  1.00 34.06  ? 131 ASN A CA    1 
ATOM   1074 C  C     . ASN A 1 132 ? 70.277  -4.025  40.101  1.00 38.61  ? 131 ASN A C     1 
ATOM   1075 O  O     . ASN A 1 132 ? 70.327  -2.849  40.467  1.00 37.29  ? 131 ASN A O     1 
ATOM   1076 C  CB    . ASN A 1 132 ? 69.687  -3.386  37.730  1.00 33.26  ? 131 ASN A CB    1 
ATOM   1077 C  CG    . ASN A 1 132 ? 71.093  -3.307  37.162  1.00 38.80  ? 131 ASN A CG    1 
ATOM   1078 O  OD1   . ASN A 1 132 ? 72.061  -3.730  37.793  1.00 40.88  ? 131 ASN A OD1   1 
ATOM   1079 N  ND2   . ASN A 1 132 ? 71.209  -2.754  35.960  1.00 37.68  ? 131 ASN A ND2   1 
ATOM   1080 N  N     . LYS A 1 133 ? 70.854  -5.014  40.788  1.00 38.79  ? 132 LYS A N     1 
ATOM   1081 C  CA    . LYS A 1 133 ? 71.549  -4.734  42.040  1.00 39.72  ? 132 LYS A CA    1 
ATOM   1082 C  C     . LYS A 1 133 ? 72.816  -3.920  41.803  1.00 36.58  ? 132 LYS A C     1 
ATOM   1083 O  O     . LYS A 1 133 ? 73.171  -3.063  42.621  1.00 38.84  ? 132 LYS A O     1 
ATOM   1084 C  CB    . LYS A 1 133 ? 71.879  -6.039  42.763  1.00 47.05  ? 132 LYS A CB    1 
ATOM   1085 C  CG    . LYS A 1 133 ? 72.503  -5.842  44.137  1.00 47.38  ? 132 LYS A CG    1 
ATOM   1086 C  CD    . LYS A 1 133 ? 72.837  -7.169  44.795  1.00 53.17  ? 132 LYS A CD    1 
ATOM   1087 C  CE    . LYS A 1 133 ? 73.506  -6.958  46.145  1.00 68.74  ? 132 LYS A CE    1 
ATOM   1088 N  NZ    . LYS A 1 133 ? 73.969  -8.239  46.748  1.00 67.06  ? 132 LYS A NZ    1 
ATOM   1089 N  N     . ALA A 1 134 ? 73.509  -4.174  40.690  1.00 34.74  ? 133 ALA A N     1 
ATOM   1090 C  CA    . ALA A 1 134 ? 74.734  -3.436  40.396  1.00 41.92  ? 133 ALA A CA    1 
ATOM   1091 C  C     . ALA A 1 134 ? 74.457  -1.947  40.234  1.00 38.53  ? 133 ALA A C     1 
ATOM   1092 O  O     . ALA A 1 134 ? 75.252  -1.108  40.673  1.00 39.66  ? 133 ALA A O     1 
ATOM   1093 C  CB    . ALA A 1 134 ? 75.399  -3.999  39.141  1.00 34.04  ? 133 ALA A CB    1 
ATOM   1094 N  N     . LEU A 1 135 ? 73.330  -1.599  39.608  1.00 38.49  ? 134 LEU A N     1 
ATOM   1095 C  CA    . LEU A 1 135 ? 72.965  -0.193  39.474  1.00 38.34  ? 134 LEU A CA    1 
ATOM   1096 C  C     . LEU A 1 135 ? 72.672  0.433   40.832  1.00 38.36  ? 134 LEU A C     1 
ATOM   1097 O  O     . LEU A 1 135 ? 73.041  1.587   41.083  1.00 34.51  ? 134 LEU A O     1 
ATOM   1098 C  CB    . LEU A 1 135 ? 71.759  -0.051  38.547  1.00 38.41  ? 134 LEU A CB    1 
ATOM   1099 C  CG    . LEU A 1 135 ? 71.226  1.371   38.360  1.00 40.82  ? 134 LEU A CG    1 
ATOM   1100 C  CD1   . LEU A 1 135 ? 72.261  2.252   37.675  1.00 41.43  ? 134 LEU A CD1   1 
ATOM   1101 C  CD2   . LEU A 1 135 ? 69.922  1.357   37.583  1.00 42.99  ? 134 LEU A CD2   1 
ATOM   1102 N  N     . LEU A 1 136 ? 72.012  -0.312  41.722  1.00 31.52  ? 135 LEU A N     1 
ATOM   1103 C  CA    . LEU A 1 136 ? 71.732  0.209   43.055  1.00 37.89  ? 135 LEU A CA    1 
ATOM   1104 C  C     . LEU A 1 136 ? 73.004  0.363   43.876  1.00 36.70  ? 135 LEU A C     1 
ATOM   1105 O  O     . LEU A 1 136 ? 73.115  1.299   44.676  1.00 40.21  ? 135 LEU A O     1 
ATOM   1106 C  CB    . LEU A 1 136 ? 70.738  -0.699  43.778  1.00 37.41  ? 135 LEU A CB    1 
ATOM   1107 C  CG    . LEU A 1 136 ? 69.322  -0.708  43.200  1.00 36.71  ? 135 LEU A CG    1 
ATOM   1108 C  CD1   . LEU A 1 136 ? 68.401  -1.572  44.048  1.00 36.63  ? 135 LEU A CD1   1 
ATOM   1109 C  CD2   . LEU A 1 136 ? 68.786  0.711   43.091  1.00 32.24  ? 135 LEU A CD2   1 
ATOM   1110 N  N     . GLU A 1 137 ? 73.972  -0.537  43.695  1.00 38.67  ? 136 GLU A N     1 
ATOM   1111 C  CA    . GLU A 1 137 ? 75.241  -0.402  44.402  1.00 42.29  ? 136 GLU A CA    1 
ATOM   1112 C  C     . GLU A 1 137 ? 76.010  0.827   43.937  1.00 40.32  ? 136 GLU A C     1 
ATOM   1113 O  O     . GLU A 1 137 ? 76.710  1.454   44.739  1.00 38.26  ? 136 GLU A O     1 
ATOM   1114 C  CB    . GLU A 1 137 ? 76.081  -1.667  44.221  1.00 37.36  ? 136 GLU A CB    1 
ATOM   1115 C  CG    . GLU A 1 137 ? 75.647  -2.819  45.111  1.00 51.88  ? 136 GLU A CG    1 
ATOM   1116 C  CD    . GLU A 1 137 ? 76.339  -4.126  44.775  1.00 67.55  ? 136 GLU A CD    1 
ATOM   1117 O  OE1   . GLU A 1 137 ? 76.846  -4.266  43.639  1.00 60.00  ? 136 GLU A OE1   1 
ATOM   1118 O  OE2   . GLU A 1 137 ? 76.376  -5.022  45.648  1.00 73.52  ? 136 GLU A OE2   1 
ATOM   1119 N  N     . ILE A 1 138 ? 75.889  1.189   42.658  1.00 42.86  ? 137 ILE A N     1 
ATOM   1120 C  CA    . ILE A 1 138 ? 76.473  2.440   42.180  1.00 39.86  ? 137 ILE A CA    1 
ATOM   1121 C  C     . ILE A 1 138 ? 75.816  3.625   42.876  1.00 46.27  ? 137 ILE A C     1 
ATOM   1122 O  O     . ILE A 1 138 ? 76.493  4.530   43.379  1.00 41.93  ? 137 ILE A O     1 
ATOM   1123 C  CB    . ILE A 1 138 ? 76.339  2.545   40.649  1.00 42.36  ? 137 ILE A CB    1 
ATOM   1124 C  CG1   . ILE A 1 138 ? 77.104  1.413   39.962  1.00 43.43  ? 137 ILE A CG1   1 
ATOM   1125 C  CG2   . ILE A 1 138 ? 76.829  3.902   40.161  1.00 38.00  ? 137 ILE A CG2   1 
ATOM   1126 C  CD1   . ILE A 1 138 ? 76.849  1.326   38.471  1.00 43.70  ? 137 ILE A CD1   1 
ATOM   1127 N  N     . VAL A 1 139 ? 74.481  3.633   42.917  1.00 38.29  ? 138 VAL A N     1 
ATOM   1128 C  CA    . VAL A 1 139 ? 73.756  4.713   43.581  1.00 43.04  ? 138 VAL A CA    1 
ATOM   1129 C  C     . VAL A 1 139 ? 74.079  4.735   45.069  1.00 38.87  ? 138 VAL A C     1 
ATOM   1130 O  O     . VAL A 1 139 ? 74.164  5.803   45.687  1.00 35.83  ? 138 VAL A O     1 
ATOM   1131 C  CB    . VAL A 1 139 ? 72.243  4.569   43.328  1.00 42.02  ? 138 VAL A CB    1 
ATOM   1132 C  CG1   . VAL A 1 139 ? 71.466  5.645   44.071  1.00 30.88  ? 138 VAL A CG1   1 
ATOM   1133 C  CG2   . VAL A 1 139 ? 71.949  4.625   41.836  1.00 39.23  ? 138 VAL A CG2   1 
ATOM   1134 N  N     . SER A 1 140 ? 74.277  3.556   45.665  1.00 35.45  ? 139 SER A N     1 
ATOM   1135 C  CA    . SER A 1 140 ? 74.573  3.482   47.092  1.00 41.64  ? 139 SER A CA    1 
ATOM   1136 C  C     . SER A 1 140 ? 75.882  4.187   47.428  1.00 42.29  ? 139 SER A C     1 
ATOM   1137 O  O     . SER A 1 140 ? 75.956  4.941   48.405  1.00 38.52  ? 139 SER A O     1 
ATOM   1138 C  CB    . SER A 1 140 ? 74.622  2.023   47.541  1.00 38.54  ? 139 SER A CB    1 
ATOM   1139 O  OG    . SER A 1 140 ? 74.992  1.924   48.904  1.00 40.01  ? 139 SER A OG    1 
ATOM   1140 N  N     . ARG A 1 141 ? 76.926  3.953   46.630  1.00 38.71  ? 140 ARG A N     1 
ATOM   1141 C  CA    . ARG A 1 141 ? 78.206  4.603   46.888  1.00 38.68  ? 140 ARG A CA    1 
ATOM   1142 C  C     . ARG A 1 141 ? 78.137  6.101   46.620  1.00 44.31  ? 140 ARG A C     1 
ATOM   1143 O  O     . ARG A 1 141 ? 78.804  6.883   47.309  1.00 48.26  ? 140 ARG A O     1 
ATOM   1144 C  CB    . ARG A 1 141 ? 79.304  3.947   46.048  1.00 41.47  ? 140 ARG A CB    1 
ATOM   1145 C  CG    . ARG A 1 141 ? 79.331  2.429   46.167  1.00 40.10  ? 140 ARG A CG    1 
ATOM   1146 C  CD    . ARG A 1 141 ? 80.614  1.829   45.616  1.00 42.83  ? 140 ARG A CD    1 
ATOM   1147 N  NE    . ARG A 1 141 ? 80.786  2.094   44.191  1.00 54.88  ? 140 ARG A NE    1 
ATOM   1148 C  CZ    . ARG A 1 141 ? 80.431  1.254   43.224  1.00 66.06  ? 140 ARG A CZ    1 
ATOM   1149 N  NH1   . ARG A 1 141 ? 79.875  0.087   43.523  1.00 60.82  ? 140 ARG A NH1   1 
ATOM   1150 N  NH2   . ARG A 1 141 ? 80.628  1.584   41.955  1.00 65.46  ? 140 ARG A NH2   1 
ATOM   1151 N  N     . TRP A 1 142 ? 77.340  6.519   45.634  1.00 39.80  ? 141 TRP A N     1 
ATOM   1152 C  CA    . TRP A 1 142 ? 77.123  7.944   45.407  1.00 40.08  ? 141 TRP A CA    1 
ATOM   1153 C  C     . TRP A 1 142 ? 76.458  8.592   46.614  1.00 40.14  ? 141 TRP A C     1 
ATOM   1154 O  O     . TRP A 1 142 ? 76.863  9.673   47.057  1.00 39.57  ? 141 TRP A O     1 
ATOM   1155 C  CB    . TRP A 1 142 ? 76.270  8.156   44.156  1.00 39.76  ? 141 TRP A CB    1 
ATOM   1156 C  CG    . TRP A 1 142 ? 76.964  7.848   42.868  1.00 38.04  ? 141 TRP A CG    1 
ATOM   1157 C  CD1   . TRP A 1 142 ? 78.268  7.480   42.704  1.00 43.97  ? 141 TRP A CD1   1 
ATOM   1158 C  CD2   . TRP A 1 142 ? 76.387  7.877   41.558  1.00 42.26  ? 141 TRP A CD2   1 
ATOM   1159 N  NE1   . TRP A 1 142 ? 78.538  7.281   41.371  1.00 50.84  ? 141 TRP A NE1   1 
ATOM   1160 C  CE2   . TRP A 1 142 ? 77.399  7.518   40.647  1.00 40.01  ? 141 TRP A CE2   1 
ATOM   1161 C  CE3   . TRP A 1 142 ? 75.111  8.173   41.067  1.00 41.49  ? 141 TRP A CE3   1 
ATOM   1162 C  CZ2   . TRP A 1 142 ? 77.176  7.447   39.274  1.00 42.00  ? 141 TRP A CZ2   1 
ATOM   1163 C  CZ3   . TRP A 1 142 ? 74.892  8.102   39.704  1.00 39.00  ? 141 TRP A CZ3   1 
ATOM   1164 C  CH2   . TRP A 1 142 ? 75.919  7.742   38.823  1.00 45.63  ? 141 TRP A CH2   1 
ATOM   1165 N  N     . LEU A 1 143 ? 75.427  7.939   47.158  1.00 40.23  ? 142 LEU A N     1 
ATOM   1166 C  CA    . LEU A 1 143 ? 74.717  8.491   48.307  1.00 40.45  ? 142 LEU A CA    1 
ATOM   1167 C  C     . LEU A 1 143 ? 75.619  8.568   49.531  1.00 42.47  ? 142 LEU A C     1 
ATOM   1168 O  O     . LEU A 1 143 ? 75.606  9.568   50.258  1.00 43.68  ? 142 LEU A O     1 
ATOM   1169 C  CB    . LEU A 1 143 ? 73.475  7.651   48.607  1.00 38.02  ? 142 LEU A CB    1 
ATOM   1170 C  CG    . LEU A 1 143 ? 72.336  7.730   47.588  1.00 37.03  ? 142 LEU A CG    1 
ATOM   1171 C  CD1   . LEU A 1 143 ? 71.205  6.790   47.971  1.00 35.33  ? 142 LEU A CD1   1 
ATOM   1172 C  CD2   . LEU A 1 143 ? 71.830  9.155   47.466  1.00 33.89  ? 142 LEU A CD2   1 
ATOM   1173 N  N     . ASN A 1 144 ? 76.406  7.517   49.779  1.00 40.28  ? 143 ASN A N     1 
ATOM   1174 C  CA    . ASN A 1 144 ? 77.332  7.530   50.908  1.00 45.97  ? 143 ASN A CA    1 
ATOM   1175 C  C     . ASN A 1 144 ? 78.322  8.682   50.791  1.00 43.05  ? 143 ASN A C     1 
ATOM   1176 O  O     . ASN A 1 144 ? 78.558  9.414   51.759  1.00 50.98  ? 143 ASN A O     1 
ATOM   1177 C  CB    . ASN A 1 144 ? 78.070  6.193   50.997  1.00 40.46  ? 143 ASN A CB    1 
ATOM   1178 C  CG    . ASN A 1 144 ? 77.361  5.195   51.889  1.00 48.94  ? 143 ASN A CG    1 
ATOM   1179 O  OD1   . ASN A 1 144 ? 76.898  5.538   52.978  1.00 41.43  ? 143 ASN A OD1   1 
ATOM   1180 N  ND2   . ASN A 1 144 ? 77.271  3.952   51.432  1.00 44.06  ? 143 ASN A ND2   1 
ATOM   1181 N  N     . ASN A 1 145 ? 78.908  8.861   49.604  1.00 45.08  ? 144 ASN A N     1 
ATOM   1182 C  CA    . ASN A 1 145 ? 79.826  9.974   49.389  1.00 39.06  ? 144 ASN A CA    1 
ATOM   1183 C  C     . ASN A 1 145 ? 79.136  11.315  49.601  1.00 47.80  ? 144 ASN A C     1 
ATOM   1184 O  O     . ASN A 1 145 ? 79.786  12.294  49.987  1.00 51.47  ? 144 ASN A O     1 
ATOM   1185 C  CB    . ASN A 1 145 ? 80.423  9.896   47.984  1.00 37.72  ? 144 ASN A CB    1 
ATOM   1186 C  CG    . ASN A 1 145 ? 81.376  11.037  47.691  1.00 47.40  ? 144 ASN A CG    1 
ATOM   1187 O  OD1   . ASN A 1 145 ? 82.472  11.103  48.247  1.00 51.65  ? 144 ASN A OD1   1 
ATOM   1188 N  ND2   . ASN A 1 145 ? 80.964  11.940  46.809  1.00 40.67  ? 144 ASN A ND2   1 
ATOM   1189 N  N     . LEU A 1 146 ? 77.829  11.379  49.360  1.00 47.31  ? 145 LEU A N     1 
ATOM   1190 C  CA    . LEU A 1 146 ? 77.052  12.586  49.609  1.00 48.27  ? 145 LEU A CA    1 
ATOM   1191 C  C     . LEU A 1 146 ? 76.596  12.708  51.058  1.00 46.18  ? 145 LEU A C     1 
ATOM   1192 O  O     . LEU A 1 146 ? 75.921  13.687  51.395  1.00 52.41  ? 145 LEU A O     1 
ATOM   1193 C  CB    . LEU A 1 146 ? 75.836  12.625  48.680  1.00 47.64  ? 145 LEU A CB    1 
ATOM   1194 C  CG    . LEU A 1 146 ? 76.123  12.967  47.217  1.00 45.99  ? 145 LEU A CG    1 
ATOM   1195 C  CD1   . LEU A 1 146 ? 74.897  12.722  46.354  1.00 42.47  ? 145 LEU A CD1   1 
ATOM   1196 C  CD2   . LEU A 1 146 ? 76.585  14.410  47.094  1.00 52.01  ? 145 LEU A CD2   1 
ATOM   1197 N  N     . GLY A 1 147 ? 76.943  11.750  51.914  1.00 45.83  ? 146 GLY A N     1 
ATOM   1198 C  CA    . GLY A 1 147 ? 76.549  11.813  53.307  1.00 50.75  ? 146 GLY A CA    1 
ATOM   1199 C  C     . GLY A 1 147 ? 75.173  11.271  53.608  1.00 53.94  ? 146 GLY A C     1 
ATOM   1200 O  O     . GLY A 1 147 ? 74.607  11.600  54.655  1.00 51.68  ? 146 GLY A O     1 
ATOM   1201 N  N     . VAL A 1 148 ? 74.616  10.447  52.727  1.00 48.12  ? 147 VAL A N     1 
ATOM   1202 C  CA    . VAL A 1 148 ? 73.285  9.877   52.899  1.00 46.45  ? 147 VAL A CA    1 
ATOM   1203 C  C     . VAL A 1 148 ? 73.452  8.383   53.141  1.00 50.48  ? 147 VAL A C     1 
ATOM   1204 O  O     . VAL A 1 148 ? 73.794  7.628   52.222  1.00 49.01  ? 147 VAL A O     1 
ATOM   1205 C  CB    . VAL A 1 148 ? 72.388  10.149  51.685  1.00 46.36  ? 147 VAL A CB    1 
ATOM   1206 C  CG1   . VAL A 1 148 ? 70.999  9.589   51.922  1.00 40.66  ? 147 VAL A CG1   1 
ATOM   1207 C  CG2   . VAL A 1 148 ? 72.324  11.642  51.398  1.00 46.06  ? 147 VAL A CG2   1 
ATOM   1208 N  N     . ARG A 1 149 ? 73.211  7.954   54.377  1.00 49.95  ? 148 ARG A N     1 
ATOM   1209 C  CA    . ARG A 1 149 ? 73.351  6.549   54.733  1.00 45.85  ? 148 ARG A CA    1 
ATOM   1210 C  C     . ARG A 1 149 ? 72.211  5.727   54.140  1.00 42.28  ? 148 ARG A C     1 
ATOM   1211 O  O     . ARG A 1 149 ? 71.070  6.187   54.038  1.00 44.53  ? 148 ARG A O     1 
ATOM   1212 C  CB    . ARG A 1 149 ? 73.391  6.393   56.253  1.00 46.93  ? 148 ARG A CB    1 
ATOM   1213 C  CG    . ARG A 1 149 ? 74.689  6.884   56.879  1.00 56.84  ? 148 ARG A CG    1 
ATOM   1214 C  CD    . ARG A 1 149 ? 74.548  7.115   58.376  1.00 57.08  ? 148 ARG A CD    1 
ATOM   1215 N  NE    . ARG A 1 149 ? 73.872  8.375   58.674  1.00 58.20  ? 148 ARG A NE    1 
ATOM   1216 C  CZ    . ARG A 1 149 ? 73.605  8.807   59.902  1.00 64.91  ? 148 ARG A CZ    1 
ATOM   1217 N  NH1   . ARG A 1 149 ? 73.955  8.080   60.954  1.00 60.10  ? 148 ARG A NH1   1 
ATOM   1218 N  NH2   . ARG A 1 149 ? 72.987  9.968   60.080  1.00 58.14  ? 148 ARG A NH2   1 
ATOM   1219 N  N     . ASN A 1 150 ? 72.530  4.494   53.750  1.00 37.23  ? 149 ASN A N     1 
ATOM   1220 C  CA    . ASN A 1 150 ? 71.575  3.666   53.027  1.00 47.83  ? 149 ASN A CA    1 
ATOM   1221 C  C     . ASN A 1 150 ? 71.981  2.202   53.130  1.00 48.41  ? 149 ASN A C     1 
ATOM   1222 O  O     . ASN A 1 150 ? 73.124  1.876   53.461  1.00 42.78  ? 149 ASN A O     1 
ATOM   1223 C  CB    . ASN A 1 150 ? 71.479  4.087   51.558  1.00 44.91  ? 149 ASN A CB    1 
ATOM   1224 C  CG    . ASN A 1 150 ? 72.782  3.881   50.812  1.00 45.58  ? 149 ASN A CG    1 
ATOM   1225 O  OD1   . ASN A 1 150 ? 73.017  2.821   50.233  1.00 51.78  ? 149 ASN A OD1   1 
ATOM   1226 N  ND2   . ASN A 1 150 ? 73.642  4.894   50.830  1.00 42.77  ? 149 ASN A ND2   1 
ATOM   1227 N  N     . THR A 1 151 ? 71.020  1.325   52.835  1.00 40.58  ? 150 THR A N     1 
ATOM   1228 C  CA    . THR A 1 151 ? 71.240  -0.115  52.801  1.00 43.24  ? 150 THR A CA    1 
ATOM   1229 C  C     . THR A 1 151 ? 70.524  -0.701  51.591  1.00 44.14  ? 150 THR A C     1 
ATOM   1230 O  O     . THR A 1 151 ? 69.578  -0.116  51.059  1.00 45.80  ? 150 THR A O     1 
ATOM   1231 C  CB    . THR A 1 151 ? 70.739  -0.813  54.077  1.00 55.49  ? 150 THR A CB    1 
ATOM   1232 O  OG1   . THR A 1 151 ? 69.327  -0.612  54.213  1.00 51.29  ? 150 THR A OG1   1 
ATOM   1233 C  CG2   . THR A 1 151 ? 71.452  -0.278  55.313  1.00 46.05  ? 150 THR A CG2   1 
ATOM   1234 N  N     . ILE A 1 152 ? 70.984  -1.877  51.165  1.00 43.62  ? 151 ILE A N     1 
ATOM   1235 C  CA    . ILE A 1 152 ? 70.394  -2.603  50.046  1.00 43.49  ? 151 ILE A CA    1 
ATOM   1236 C  C     . ILE A 1 152 ? 70.071  -4.018  50.504  1.00 39.93  ? 151 ILE A C     1 
ATOM   1237 O  O     . ILE A 1 152 ? 70.936  -4.708  51.053  1.00 48.35  ? 151 ILE A O     1 
ATOM   1238 C  CB    . ILE A 1 152 ? 71.330  -2.641  48.820  1.00 42.15  ? 151 ILE A CB    1 
ATOM   1239 C  CG1   . ILE A 1 152 ? 71.670  -1.226  48.350  1.00 44.81  ? 151 ILE A CG1   1 
ATOM   1240 C  CG2   . ILE A 1 152 ? 70.696  -3.438  47.687  1.00 37.74  ? 151 ILE A CG2   1 
ATOM   1241 C  CD1   . ILE A 1 152 ? 72.658  -1.191  47.201  1.00 42.17  ? 151 ILE A CD1   1 
ATOM   1242 N  N     . HIS A 1 153 ? 68.830  -4.447  50.282  1.00 39.56  ? 152 HIS A N     1 
ATOM   1243 C  CA    A HIS A 1 153 ? 68.454  -5.818  50.577  0.41 44.47  ? 152 HIS A CA    1 
ATOM   1244 C  CA    B HIS A 1 153 ? 68.378  -5.787  50.633  0.59 44.11  ? 152 HIS A CA    1 
ATOM   1245 C  C     . HIS A 1 153 ? 67.439  -6.292  49.547  1.00 45.80  ? 152 HIS A C     1 
ATOM   1246 O  O     . HIS A 1 153 ? 66.851  -5.502  48.803  1.00 43.96  ? 152 HIS A O     1 
ATOM   1247 C  CB    A HIS A 1 153 ? 67.909  -5.964  52.007  0.41 45.58  ? 152 HIS A CB    1 
ATOM   1248 C  CB    B HIS A 1 153 ? 67.647  -5.817  51.984  0.59 45.30  ? 152 HIS A CB    1 
ATOM   1249 C  CG    A HIS A 1 153 ? 66.432  -5.744  52.128  0.41 47.34  ? 152 HIS A CG    1 
ATOM   1250 C  CG    B HIS A 1 153 ? 68.453  -5.290  53.129  0.59 46.73  ? 152 HIS A CG    1 
ATOM   1251 N  ND1   A HIS A 1 153 ? 65.878  -4.500  52.342  0.41 49.85  ? 152 HIS A ND1   1 
ATOM   1252 N  ND1   B HIS A 1 153 ? 69.133  -6.112  54.001  0.59 45.44  ? 152 HIS A ND1   1 
ATOM   1253 C  CD2   A HIS A 1 153 ? 65.396  -6.615  52.087  0.41 49.58  ? 152 HIS A CD2   1 
ATOM   1254 C  CD2   B HIS A 1 153 ? 68.674  -4.024  53.554  0.59 47.46  ? 152 HIS A CD2   1 
ATOM   1255 C  CE1   A HIS A 1 153 ? 64.564  -4.614  52.420  0.41 46.33  ? 152 HIS A CE1   1 
ATOM   1256 C  CE1   B HIS A 1 153 ? 69.745  -5.375  54.910  0.59 46.24  ? 152 HIS A CE1   1 
ATOM   1257 N  NE2   A HIS A 1 153 ? 64.246  -5.886  52.265  0.41 45.75  ? 152 HIS A NE2   1 
ATOM   1258 N  NE2   B HIS A 1 153 ? 69.483  -4.104  54.662  0.59 46.36  ? 152 HIS A NE2   1 
ATOM   1259 N  N     . LEU A 1 154 ? 67.274  -7.611  49.485  1.00 45.36  ? 153 LEU A N     1 
ATOM   1260 C  CA    . LEU A 1 154 ? 66.319  -8.218  48.563  1.00 47.27  ? 153 LEU A CA    1 
ATOM   1261 C  C     . LEU A 1 154 ? 64.919  -8.037  49.135  1.00 50.93  ? 153 LEU A C     1 
ATOM   1262 O  O     . LEU A 1 154 ? 64.532  -8.728  50.083  1.00 55.46  ? 153 LEU A O     1 
ATOM   1263 C  CB    . LEU A 1 154 ? 66.635  -9.694  48.343  1.00 46.08  ? 153 LEU A CB    1 
ATOM   1264 C  CG    . LEU A 1 154 ? 65.690  -10.401 47.366  1.00 50.84  ? 153 LEU A CG    1 
ATOM   1265 C  CD1   . LEU A 1 154 ? 65.770  -9.764  45.985  1.00 48.78  ? 153 LEU A CD1   1 
ATOM   1266 C  CD2   . LEU A 1 154 ? 65.986  -11.891 47.295  1.00 52.52  ? 153 LEU A CD2   1 
ATOM   1267 N  N     . ASP A 1 155 ? 64.158  -7.108  48.560  1.00 44.46  ? 154 ASP A N     1 
ATOM   1268 C  CA    . ASP A 1 155 ? 62.848  -6.765  49.095  1.00 46.22  ? 154 ASP A CA    1 
ATOM   1269 C  C     . ASP A 1 155 ? 61.737  -7.664  48.571  1.00 50.84  ? 154 ASP A C     1 
ATOM   1270 O  O     . ASP A 1 155 ? 60.772  -7.927  49.298  1.00 53.50  ? 154 ASP A O     1 
ATOM   1271 C  CB    . ASP A 1 155 ? 62.521  -5.304  48.774  1.00 46.24  ? 154 ASP A CB    1 
ATOM   1272 C  CG    . ASP A 1 155 ? 61.236  -4.837  49.423  1.00 48.35  ? 154 ASP A CG    1 
ATOM   1273 O  OD1   . ASP A 1 155 ? 61.270  -4.497  50.624  1.00 56.27  ? 154 ASP A OD1   1 
ATOM   1274 O  OD2   . ASP A 1 155 ? 60.197  -4.801  48.734  1.00 48.68  ? 154 ASP A OD2   1 
ATOM   1275 N  N     . ASP A 1 156 ? 61.845  -8.140  47.334  1.00 48.32  ? 155 ASP A N     1 
ATOM   1276 C  CA    . ASP A 1 156 ? 60.847  -9.022  46.733  1.00 49.68  ? 155 ASP A CA    1 
ATOM   1277 C  C     . ASP A 1 156 ? 61.528  -10.354 46.435  1.00 54.59  ? 155 ASP A C     1 
ATOM   1278 O  O     . ASP A 1 156 ? 62.259  -10.479 45.447  1.00 51.65  ? 155 ASP A O     1 
ATOM   1279 C  CB    . ASP A 1 156 ? 60.249  -8.399  45.472  1.00 41.81  ? 155 ASP A CB    1 
ATOM   1280 C  CG    . ASP A 1 156 ? 59.029  -9.152  44.964  1.00 53.22  ? 155 ASP A CG    1 
ATOM   1281 O  OD1   . ASP A 1 156 ? 58.900  -10.361 45.245  1.00 57.37  ? 155 ASP A OD1   1 
ATOM   1282 O  OD2   . ASP A 1 156 ? 58.192  -8.528  44.278  1.00 51.26  ? 155 ASP A OD2   1 
ATOM   1283 N  N     . HIS A 1 157 ? 61.282  -11.350 47.290  1.00 60.35  ? 156 HIS A N     1 
ATOM   1284 C  CA    . HIS A 1 157 ? 61.855  -12.673 47.077  1.00 60.77  ? 156 HIS A CA    1 
ATOM   1285 C  C     . HIS A 1 157 ? 61.178  -13.418 45.935  1.00 56.60  ? 156 HIS A C     1 
ATOM   1286 O  O     . HIS A 1 157 ? 61.755  -14.375 45.407  1.00 61.52  ? 156 HIS A O     1 
ATOM   1287 C  CB    . HIS A 1 157 ? 61.765  -13.498 48.362  1.00 62.23  ? 156 HIS A CB    1 
ATOM   1288 C  CG    . HIS A 1 157 ? 60.362  -13.805 48.786  1.00 70.74  ? 156 HIS A CG    1 
ATOM   1289 N  ND1   . HIS A 1 157 ? 59.753  -15.013 48.523  1.00 69.12  ? 156 HIS A ND1   1 
ATOM   1290 C  CD2   . HIS A 1 157 ? 59.447  -13.059 49.449  1.00 72.16  ? 156 HIS A CD2   1 
ATOM   1291 C  CE1   . HIS A 1 157 ? 58.524  -14.999 49.009  1.00 70.12  ? 156 HIS A CE1   1 
ATOM   1292 N  NE2   . HIS A 1 157 ? 58.314  -13.824 49.576  1.00 69.82  ? 156 HIS A NE2   1 
ATOM   1293 N  N     . ARG A 1 158 ? 59.972  -13.002 45.542  1.00 50.01  ? 157 ARG A N     1 
ATOM   1294 C  CA    . ARG A 1 158 ? 59.270  -13.676 44.455  1.00 47.39  ? 157 ARG A CA    1 
ATOM   1295 C  C     . ARG A 1 158 ? 59.932  -13.391 43.112  1.00 58.83  ? 157 ARG A C     1 
ATOM   1296 O  O     . ARG A 1 158 ? 60.176  -14.309 42.320  1.00 57.66  ? 157 ARG A O     1 
ATOM   1297 C  CB    . ARG A 1 158 ? 57.805  -13.240 44.427  1.00 49.88  ? 157 ARG A CB    1 
ATOM   1298 C  CG    . ARG A 1 158 ? 57.069  -13.402 45.745  1.00 49.06  ? 157 ARG A CG    1 
ATOM   1299 C  CD    . ARG A 1 158 ? 55.804  -12.556 45.763  1.00 53.17  ? 157 ARG A CD    1 
ATOM   1300 N  NE    . ARG A 1 158 ? 56.109  -11.128 45.723  1.00 51.39  ? 157 ARG A NE    1 
ATOM   1301 C  CZ    . ARG A 1 158 ? 55.191  -10.168 45.665  1.00 52.46  ? 157 ARG A CZ    1 
ATOM   1302 N  NH1   . ARG A 1 158 ? 53.902  -10.479 45.637  1.00 51.89  ? 157 ARG A NH1   1 
ATOM   1303 N  NH2   . ARG A 1 158 ? 55.562  -8.895  45.634  1.00 48.93  ? 157 ARG A NH2   1 
ATOM   1304 N  N     . HIS A 1 159 ? 60.230  -12.120 42.839  1.00 56.81  ? 158 HIS A N     1 
ATOM   1305 C  CA    . HIS A 1 159 ? 60.711  -11.699 41.532  1.00 49.83  ? 158 HIS A CA    1 
ATOM   1306 C  C     . HIS A 1 159 ? 62.184  -11.319 41.510  1.00 46.78  ? 158 HIS A C     1 
ATOM   1307 O  O     . HIS A 1 159 ? 62.733  -11.111 40.423  1.00 53.24  ? 158 HIS A O     1 
ATOM   1308 C  CB    . HIS A 1 159 ? 59.880  -10.510 41.027  1.00 43.81  ? 158 HIS A CB    1 
ATOM   1309 C  CG    . HIS A 1 159 ? 58.417  -10.802 40.909  1.00 44.87  ? 158 HIS A CG    1 
ATOM   1310 N  ND1   . HIS A 1 159 ? 57.497  -10.385 41.848  1.00 52.00  ? 158 HIS A ND1   1 
ATOM   1311 C  CD2   . HIS A 1 159 ? 57.713  -11.469 39.964  1.00 44.65  ? 158 HIS A CD2   1 
ATOM   1312 C  CE1   . HIS A 1 159 ? 56.291  -10.783 41.486  1.00 45.26  ? 158 HIS A CE1   1 
ATOM   1313 N  NE2   . HIS A 1 159 ? 56.394  -11.443 40.347  1.00 47.94  ? 158 HIS A NE2   1 
ATOM   1314 N  N     . GLY A 1 160 ? 62.837  -11.224 42.665  1.00 48.63  ? 159 GLY A N     1 
ATOM   1315 C  CA    . GLY A 1 160 ? 64.229  -10.822 42.696  1.00 41.92  ? 159 GLY A CA    1 
ATOM   1316 C  C     . GLY A 1 160 ? 64.447  -9.328  42.653  1.00 45.41  ? 159 GLY A C     1 
ATOM   1317 O  O     . GLY A 1 160 ? 65.448  -8.869  42.093  1.00 42.27  ? 159 GLY A O     1 
ATOM   1318 N  N     . VAL A 1 161 ? 63.538  -8.552  43.234  1.00 45.54  ? 160 VAL A N     1 
ATOM   1319 C  CA    . VAL A 1 161 ? 63.623  -7.096  43.211  1.00 40.83  ? 160 VAL A CA    1 
ATOM   1320 C  C     . VAL A 1 161 ? 64.309  -6.628  44.487  1.00 44.23  ? 160 VAL A C     1 
ATOM   1321 O  O     . VAL A 1 161 ? 63.812  -6.865  45.593  1.00 43.08  ? 160 VAL A O     1 
ATOM   1322 C  CB    . VAL A 1 161 ? 62.232  -6.461  43.071  1.00 41.05  ? 160 VAL A CB    1 
ATOM   1323 C  CG1   . VAL A 1 161 ? 62.346  -4.945  42.992  1.00 37.84  ? 160 VAL A CG1   1 
ATOM   1324 C  CG2   . VAL A 1 161 ? 61.513  -7.016  41.851  1.00 32.65  ? 160 VAL A CG2   1 
ATOM   1325 N  N     . TYR A 1 162 ? 65.451  -5.966  44.333  1.00 38.60  ? 161 TYR A N     1 
ATOM   1326 C  CA    . TYR A 1 162 ? 66.129  -5.370  45.470  1.00 43.23  ? 161 TYR A CA    1 
ATOM   1327 C  C     . TYR A 1 162 ? 65.543  -3.995  45.770  1.00 40.77  ? 161 TYR A C     1 
ATOM   1328 O  O     . TYR A 1 162 ? 64.858  -3.387  44.943  1.00 37.38  ? 161 TYR A O     1 
ATOM   1329 C  CB    . TYR A 1 162 ? 67.629  -5.251  45.205  1.00 39.98  ? 161 TYR A CB    1 
ATOM   1330 C  CG    . TYR A 1 162 ? 68.323  -6.577  45.005  1.00 52.53  ? 161 TYR A CG    1 
ATOM   1331 C  CD1   . TYR A 1 162 ? 68.409  -7.155  43.745  1.00 48.56  ? 161 TYR A CD1   1 
ATOM   1332 C  CD2   . TYR A 1 162 ? 68.892  -7.253  46.077  1.00 46.03  ? 161 TYR A CD2   1 
ATOM   1333 C  CE1   . TYR A 1 162 ? 69.042  -8.369  43.559  1.00 51.41  ? 161 TYR A CE1   1 
ATOM   1334 C  CE2   . TYR A 1 162 ? 69.527  -8.466  45.900  1.00 47.15  ? 161 TYR A CE2   1 
ATOM   1335 C  CZ    . TYR A 1 162 ? 69.599  -9.020  44.639  1.00 54.29  ? 161 TYR A CZ    1 
ATOM   1336 O  OH    . TYR A 1 162 ? 70.231  -10.228 44.460  1.00 62.30  ? 161 TYR A OH    1 
ATOM   1337 N  N     . VAL A 1 163 ? 65.817  -3.507  46.976  1.00 41.45  ? 162 VAL A N     1 
ATOM   1338 C  CA    . VAL A 1 163 ? 65.436  -2.159  47.369  1.00 37.26  ? 162 VAL A CA    1 
ATOM   1339 C  C     . VAL A 1 163 ? 66.647  -1.475  47.985  1.00 37.42  ? 162 VAL A C     1 
ATOM   1340 O  O     . VAL A 1 163 ? 67.442  -2.106  48.691  1.00 42.41  ? 162 VAL A O     1 
ATOM   1341 C  CB    . VAL A 1 163 ? 64.235  -2.148  48.342  1.00 43.35  ? 162 VAL A CB    1 
ATOM   1342 C  CG1   . VAL A 1 163 ? 64.648  -2.585  49.739  1.00 40.56  ? 162 VAL A CG1   1 
ATOM   1343 C  CG2   . VAL A 1 163 ? 63.593  -0.770  48.378  1.00 36.35  ? 162 VAL A CG2   1 
ATOM   1344 N  N     . LEU A 1 164 ? 66.809  -0.193  47.677  1.00 38.18  ? 163 LEU A N     1 
ATOM   1345 C  CA    . LEU A 1 164 ? 67.785  0.661   48.338  1.00 38.77  ? 163 LEU A CA    1 
ATOM   1346 C  C     . LEU A 1 164 ? 67.012  1.524   49.325  1.00 44.59  ? 163 LEU A C     1 
ATOM   1347 O  O     . LEU A 1 164 ? 66.216  2.378   48.921  1.00 38.81  ? 163 LEU A O     1 
ATOM   1348 C  CB    . LEU A 1 164 ? 68.552  1.511   47.326  1.00 36.71  ? 163 LEU A CB    1 
ATOM   1349 C  CG    . LEU A 1 164 ? 69.787  2.298   47.787  1.00 44.33  ? 163 LEU A CG    1 
ATOM   1350 C  CD1   . LEU A 1 164 ? 70.659  2.640   46.590  1.00 38.84  ? 163 LEU A CD1   1 
ATOM   1351 C  CD2   . LEU A 1 164 ? 69.415  3.573   48.536  1.00 43.81  ? 163 LEU A CD2   1 
ATOM   1352 N  N     . ASN A 1 165 ? 67.229  1.292   50.614  1.00 42.82  ? 164 ASN A N     1 
ATOM   1353 C  CA    . ASN A 1 165 ? 66.540  2.033   51.660  1.00 42.64  ? 164 ASN A CA    1 
ATOM   1354 C  C     . ASN A 1 165 ? 67.444  3.152   52.158  1.00 46.20  ? 164 ASN A C     1 
ATOM   1355 O  O     . ASN A 1 165 ? 68.517  2.890   52.710  1.00 46.06  ? 164 ASN A O     1 
ATOM   1356 C  CB    . ASN A 1 165 ? 66.137  1.119   52.816  1.00 42.68  ? 164 ASN A CB    1 
ATOM   1357 C  CG    . ASN A 1 165 ? 65.188  1.797   53.784  1.00 47.86  ? 164 ASN A CG    1 
ATOM   1358 O  OD1   . ASN A 1 165 ? 63.978  1.839   53.557  1.00 44.74  ? 164 ASN A OD1   1 
ATOM   1359 N  ND2   . ASN A 1 165 ? 65.733  2.343   54.864  1.00 48.15  ? 164 ASN A ND2   1 
ATOM   1360 N  N     . ILE A 1 166 ? 67.013  4.390   51.952  1.00 43.61  ? 165 ILE A N     1 
ATOM   1361 C  CA    . ILE A 1 166 ? 67.712  5.545   52.500  1.00 43.53  ? 165 ILE A CA    1 
ATOM   1362 C  C     . ILE A 1 166 ? 67.285  5.727   53.949  1.00 49.99  ? 165 ILE A C     1 
ATOM   1363 O  O     . ILE A 1 166 ? 66.087  5.791   54.253  1.00 45.31  ? 165 ILE A O     1 
ATOM   1364 C  CB    . ILE A 1 166 ? 67.421  6.801   51.666  1.00 39.77  ? 165 ILE A CB    1 
ATOM   1365 C  CG1   . ILE A 1 166 ? 68.162  6.733   50.329  1.00 41.80  ? 165 ILE A CG1   1 
ATOM   1366 C  CG2   . ILE A 1 166 ? 67.786  8.057   52.440  1.00 41.59  ? 165 ILE A CG2   1 
ATOM   1367 C  CD1   . ILE A 1 166 ? 67.331  7.180   49.149  1.00 38.51  ? 165 ILE A CD1   1 
ATOM   1368 N  N     . SER A 1 167 ? 68.264  5.798   54.849  1.00 46.79  ? 166 SER A N     1 
ATOM   1369 C  CA    . SER A 1 167 ? 67.966  5.919   56.269  1.00 45.27  ? 166 SER A CA    1 
ATOM   1370 C  C     . SER A 1 167 ? 67.220  7.216   56.549  1.00 49.88  ? 166 SER A C     1 
ATOM   1371 O  O     . SER A 1 167 ? 67.601  8.285   56.063  1.00 40.31  ? 166 SER A O     1 
ATOM   1372 C  CB    . SER A 1 167 ? 69.257  5.864   57.085  1.00 47.21  ? 166 SER A CB    1 
ATOM   1373 O  OG    . SER A 1 167 ? 68.988  6.023   58.468  1.00 48.46  ? 166 SER A OG    1 
ATOM   1374 N  N     . LEU A 1 168 ? 66.148  7.117   57.339  1.00 46.11  ? 167 LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 168 ? 65.379  8.301   57.701  1.00 49.81  ? 167 LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 168 ? 66.173  9.259   58.578  1.00 53.36  ? 167 LEU A C     1 
ATOM   1377 O  O     . LEU A 1 168 ? 65.760  10.412  58.744  1.00 53.37  ? 167 LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 168 ? 64.085  7.890   58.404  1.00 58.02  ? 167 LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 168 ? 63.114  7.078   57.545  1.00 62.28  ? 167 LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 168 ? 61.816  6.810   58.292  1.00 57.71  ? 167 LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 168 ? 62.842  7.789   56.227  1.00 52.25  ? 167 LEU A CD2   1 
ATOM   1382 N  N     . ARG A 1 169 ? 67.299  8.809   59.139  1.00 51.33  ? 168 ARG A N     1 
ATOM   1383 C  CA    . ARG A 1 169 ? 68.166  9.703   59.899  1.00 53.33  ? 168 ARG A CA    1 
ATOM   1384 C  C     . ARG A 1 169 ? 68.652  10.868  59.048  1.00 56.17  ? 168 ARG A C     1 
ATOM   1385 O  O     . ARG A 1 169 ? 68.913  11.956  59.576  1.00 60.99  ? 168 ARG A O     1 
ATOM   1386 C  CB    . ARG A 1 169 ? 69.360  8.926   60.456  1.00 53.91  ? 168 ARG A CB    1 
ATOM   1387 C  CG    . ARG A 1 169 ? 68.996  7.825   61.438  1.00 53.29  ? 168 ARG A CG    1 
ATOM   1388 C  CD    . ARG A 1 169 ? 70.229  7.044   61.871  1.00 56.26  ? 168 ARG A CD    1 
ATOM   1389 N  NE    . ARG A 1 169 ? 70.898  6.406   60.740  1.00 63.29  ? 168 ARG A NE    1 
ATOM   1390 C  CZ    . ARG A 1 169 ? 71.843  5.477   60.855  1.00 70.25  ? 168 ARG A CZ    1 
ATOM   1391 N  NH1   . ARG A 1 169 ? 72.237  5.073   62.055  1.00 71.27  ? 168 ARG A NH1   1 
ATOM   1392 N  NH2   . ARG A 1 169 ? 72.395  4.951   59.770  1.00 69.21  ? 168 ARG A NH2   1 
ATOM   1393 N  N     . ASP A 1 170 ? 68.777  10.665  57.737  1.00 51.73  ? 169 ASP A N     1 
ATOM   1394 C  CA    . ASP A 1 170 ? 69.251  11.694  56.820  1.00 55.23  ? 169 ASP A CA    1 
ATOM   1395 C  C     . ASP A 1 170 ? 68.195  12.044  55.776  1.00 50.94  ? 169 ASP A C     1 
ATOM   1396 O  O     . ASP A 1 170 ? 68.527  12.388  54.640  1.00 54.82  ? 169 ASP A O     1 
ATOM   1397 C  CB    . ASP A 1 170 ? 70.547  11.254  56.141  1.00 60.30  ? 169 ASP A CB    1 
ATOM   1398 C  CG    . ASP A 1 170 ? 71.578  10.745  57.128  1.00 58.07  ? 169 ASP A CG    1 
ATOM   1399 O  OD1   . ASP A 1 170 ? 72.276  9.762   56.804  1.00 57.07  ? 169 ASP A OD1   1 
ATOM   1400 O  OD2   . ASP A 1 170 ? 71.689  11.328  58.227  1.00 65.26  ? 169 ASP A OD2   1 
ATOM   1401 N  N     . ARG A 1 171 ? 66.916  11.960  56.152  1.00 53.05  ? 170 ARG A N     1 
ATOM   1402 C  CA    . ARG A 1 171 ? 65.848  12.248  55.199  1.00 50.41  ? 170 ARG A CA    1 
ATOM   1403 C  C     . ARG A 1 171 ? 65.874  13.705  54.754  1.00 55.35  ? 170 ARG A C     1 
ATOM   1404 O  O     . ARG A 1 171 ? 65.543  14.007  53.602  1.00 51.24  ? 170 ARG A O     1 
ATOM   1405 C  CB    . ARG A 1 171 ? 64.489  11.889  55.806  1.00 52.82  ? 170 ARG A CB    1 
ATOM   1406 C  CG    . ARG A 1 171 ? 63.857  12.985  56.654  1.00 61.86  ? 170 ARG A CG    1 
ATOM   1407 C  CD    . ARG A 1 171 ? 62.788  12.436  57.581  1.00 66.90  ? 170 ARG A CD    1 
ATOM   1408 N  NE    . ARG A 1 171 ? 61.701  11.786  56.856  1.00 62.24  ? 170 ARG A NE    1 
ATOM   1409 C  CZ    . ARG A 1 171 ? 60.839  10.940  57.411  1.00 73.67  ? 170 ARG A CZ    1 
ATOM   1410 N  NH1   . ARG A 1 171 ? 60.939  10.641  58.699  1.00 70.28  ? 170 ARG A NH1   1 
ATOM   1411 N  NH2   . ARG A 1 171 ? 59.879  10.393  56.680  1.00 65.48  ? 170 ARG A NH2   1 
ATOM   1412 N  N     . ILE A 1 172 ? 66.276  14.618  55.641  1.00 61.22  ? 171 ILE A N     1 
ATOM   1413 C  CA    . ILE A 1 172 ? 66.354  16.026  55.269  1.00 59.37  ? 171 ILE A CA    1 
ATOM   1414 C  C     . ILE A 1 172 ? 67.511  16.253  54.307  1.00 51.15  ? 171 ILE A C     1 
ATOM   1415 O  O     . ILE A 1 172 ? 67.390  17.004  53.332  1.00 58.23  ? 171 ILE A O     1 
ATOM   1416 C  CB    . ILE A 1 172 ? 66.476  16.902  56.530  1.00 62.55  ? 171 ILE A CB    1 
ATOM   1417 C  CG1   . ILE A 1 172 ? 65.160  16.893  57.311  1.00 58.36  ? 171 ILE A CG1   1 
ATOM   1418 C  CG2   . ILE A 1 172 ? 66.877  18.323  56.164  1.00 52.57  ? 171 ILE A CG2   1 
ATOM   1419 C  CD1   . ILE A 1 172 ? 65.222  17.649  58.619  1.00 59.71  ? 171 ILE A CD1   1 
ATOM   1420 N  N     . LYS A 1 173 ? 68.646  15.597  54.560  1.00 55.54  ? 172 LYS A N     1 
ATOM   1421 C  CA    . LYS A 1 173 ? 69.788  15.697  53.658  1.00 53.98  ? 172 LYS A CA    1 
ATOM   1422 C  C     . LYS A 1 173 ? 69.422  15.217  52.259  1.00 51.00  ? 172 LYS A C     1 
ATOM   1423 O  O     . LYS A 1 173 ? 69.754  15.864  51.259  1.00 51.29  ? 172 LYS A O     1 
ATOM   1424 C  CB    . LYS A 1 173 ? 70.957  14.888  54.220  1.00 54.31  ? 172 LYS A CB    1 
ATOM   1425 C  CG    . LYS A 1 173 ? 72.336  15.410  53.856  1.00 61.12  ? 172 LYS A CG    1 
ATOM   1426 C  CD    . LYS A 1 173 ? 73.384  14.849  54.808  1.00 61.57  ? 172 LYS A CD    1 
ATOM   1427 C  CE    . LYS A 1 173 ? 74.748  15.477  54.578  1.00 68.56  ? 172 LYS A CE    1 
ATOM   1428 N  NZ    . LYS A 1 173 ? 75.320  15.100  53.256  1.00 69.44  ? 172 LYS A NZ    1 
ATOM   1429 N  N     . PHE A 1 174 ? 68.719  14.085  52.172  1.00 49.74  ? 173 PHE A N     1 
ATOM   1430 C  CA    . PHE A 1 174 ? 68.369  13.521  50.873  1.00 49.71  ? 173 PHE A CA    1 
ATOM   1431 C  C     . PHE A 1 174 ? 67.360  14.397  50.139  1.00 46.83  ? 173 PHE A C     1 
ATOM   1432 O  O     . PHE A 1 174 ? 67.534  14.699  48.952  1.00 46.75  ? 173 PHE A O     1 
ATOM   1433 C  CB    . PHE A 1 174 ? 67.822  12.103  51.051  1.00 47.68  ? 173 PHE A CB    1 
ATOM   1434 C  CG    . PHE A 1 174 ? 67.447  11.432  49.761  1.00 47.21  ? 173 PHE A CG    1 
ATOM   1435 C  CD1   . PHE A 1 174 ? 68.424  10.998  48.880  1.00 49.60  ? 173 PHE A CD1   1 
ATOM   1436 C  CD2   . PHE A 1 174 ? 66.117  11.232  49.430  1.00 49.33  ? 173 PHE A CD2   1 
ATOM   1437 C  CE1   . PHE A 1 174 ? 68.081  10.380  47.692  1.00 44.42  ? 173 PHE A CE1   1 
ATOM   1438 C  CE2   . PHE A 1 174 ? 65.767  10.614  48.243  1.00 50.58  ? 173 PHE A CE2   1 
ATOM   1439 C  CZ    . PHE A 1 174 ? 66.751  10.189  47.373  1.00 44.43  ? 173 PHE A CZ    1 
ATOM   1440 N  N     . VAL A 1 175 ? 66.300  14.819  50.829  1.00 50.42  ? 174 VAL A N     1 
ATOM   1441 C  CA    . VAL A 1 175 ? 65.234  15.561  50.162  1.00 47.09  ? 174 VAL A CA    1 
ATOM   1442 C  C     . VAL A 1 175 ? 65.701  16.961  49.778  1.00 53.22  ? 174 VAL A C     1 
ATOM   1443 O  O     . VAL A 1 175 ? 65.385  17.458  48.691  1.00 49.34  ? 174 VAL A O     1 
ATOM   1444 C  CB    . VAL A 1 175 ? 63.977  15.603  51.051  1.00 46.73  ? 174 VAL A CB    1 
ATOM   1445 C  CG1   . VAL A 1 175 ? 62.914  16.497  50.433  1.00 45.68  ? 174 VAL A CG1   1 
ATOM   1446 C  CG2   . VAL A 1 175 ? 63.429  14.199  51.254  1.00 48.44  ? 174 VAL A CG2   1 
ATOM   1447 N  N     . HIS A 1 176 ? 66.470  17.617  50.650  1.00 51.88  ? 175 HIS A N     1 
ATOM   1448 C  CA    . HIS A 1 176 ? 66.833  19.008  50.400  1.00 53.75  ? 175 HIS A CA    1 
ATOM   1449 C  C     . HIS A 1 176 ? 67.998  19.126  49.422  1.00 56.65  ? 175 HIS A C     1 
ATOM   1450 O  O     . HIS A 1 176 ? 67.936  19.906  48.466  1.00 58.04  ? 175 HIS A O     1 
ATOM   1451 C  CB    . HIS A 1 176 ? 67.171  19.713  51.715  1.00 61.69  ? 175 HIS A CB    1 
ATOM   1452 C  CG    . HIS A 1 176 ? 67.398  21.185  51.568  1.00 73.44  ? 175 HIS A CG    1 
ATOM   1453 N  ND1   . HIS A 1 176 ? 68.656  21.747  51.547  1.00 77.02  ? 175 HIS A ND1   1 
ATOM   1454 C  CD2   . HIS A 1 176 ? 66.525  22.212  51.428  1.00 76.92  ? 175 HIS A CD2   1 
ATOM   1455 C  CE1   . HIS A 1 176 ? 68.550  23.056  51.403  1.00 79.42  ? 175 HIS A CE1   1 
ATOM   1456 N  NE2   . HIS A 1 176 ? 67.267  23.364  51.329  1.00 76.89  ? 175 HIS A NE2   1 
ATOM   1457 N  N     . THR A 1 177 ? 69.068  18.363  49.642  1.00 51.15  ? 176 THR A N     1 
ATOM   1458 C  CA    . THR A 1 177 ? 70.289  18.539  48.866  1.00 55.36  ? 176 THR A CA    1 
ATOM   1459 C  C     . THR A 1 177 ? 70.298  17.764  47.556  1.00 55.64  ? 176 THR A C     1 
ATOM   1460 O  O     . THR A 1 177 ? 71.032  18.144  46.636  1.00 55.06  ? 176 THR A O     1 
ATOM   1461 C  CB    . THR A 1 177 ? 71.511  18.129  49.694  1.00 54.07  ? 176 THR A CB    1 
ATOM   1462 O  OG1   . THR A 1 177 ? 71.520  16.706  49.866  1.00 52.85  ? 176 THR A OG1   1 
ATOM   1463 C  CG2   . THR A 1 177 ? 71.477  18.800  51.058  1.00 49.42  ? 176 THR A CG2   1 
ATOM   1464 N  N     . ILE A 1 178 ? 69.514  16.695  47.442  1.00 46.94  ? 177 ILE A N     1 
ATOM   1465 C  CA    . ILE A 1 178 ? 69.478  15.868  46.238  1.00 53.10  ? 177 ILE A CA    1 
ATOM   1466 C  C     . ILE A 1 178 ? 68.185  16.082  45.457  1.00 49.78  ? 177 ILE A C     1 
ATOM   1467 O  O     . ILE A 1 178 ? 68.208  16.569  44.326  1.00 48.62  ? 177 ILE A O     1 
ATOM   1468 C  CB    . ILE A 1 178 ? 69.686  14.375  46.578  1.00 53.41  ? 177 ILE A CB    1 
ATOM   1469 C  CG1   . ILE A 1 178 ? 71.081  14.159  47.166  1.00 58.78  ? 177 ILE A CG1   1 
ATOM   1470 C  CG2   . ILE A 1 178 ? 69.481  13.513  45.340  1.00 49.03  ? 177 ILE A CG2   1 
ATOM   1471 C  CD1   . ILE A 1 178 ? 71.381  12.723  47.503  1.00 62.50  ? 177 ILE A CD1   1 
ATOM   1472 N  N     . LEU A 1 179 ? 67.042  15.728  46.050  1.00 45.50  ? 178 LEU A N     1 
ATOM   1473 C  CA    . LEU A 1 179 ? 65.777  15.821  45.330  1.00 51.08  ? 178 LEU A CA    1 
ATOM   1474 C  C     . LEU A 1 179 ? 65.405  17.263  45.009  1.00 54.48  ? 178 LEU A C     1 
ATOM   1475 O  O     . LEU A 1 179 ? 64.662  17.509  44.055  1.00 49.93  ? 178 LEU A O     1 
ATOM   1476 C  CB    . LEU A 1 179 ? 64.657  15.162  46.139  1.00 41.14  ? 178 LEU A CB    1 
ATOM   1477 C  CG    . LEU A 1 179 ? 64.650  13.636  46.251  1.00 48.05  ? 178 LEU A CG    1 
ATOM   1478 C  CD1   . LEU A 1 179 ? 63.410  13.167  46.998  1.00 41.74  ? 178 LEU A CD1   1 
ATOM   1479 C  CD2   . LEU A 1 179 ? 64.725  12.990  44.876  1.00 34.18  ? 178 LEU A CD2   1 
ATOM   1480 N  N     . SER A 1 180 ? 65.906  18.229  45.779  1.00 49.94  ? 179 SER A N     1 
ATOM   1481 C  CA    . SER A 1 180 ? 65.500  19.621  45.625  1.00 50.98  ? 179 SER A CA    1 
ATOM   1482 C  C     . SER A 1 180 ? 66.616  20.505  45.077  1.00 57.22  ? 179 SER A C     1 
ATOM   1483 O  O     . SER A 1 180 ? 66.565  21.729  45.239  1.00 59.48  ? 179 SER A O     1 
ATOM   1484 C  CB    . SER A 1 180 ? 64.996  20.171  46.960  1.00 46.01  ? 179 SER A CB    1 
ATOM   1485 O  OG    . SER A 1 180 ? 63.861  19.451  47.411  1.00 45.78  ? 179 SER A OG    1 
ATOM   1486 N  N     . SER A 1 181 ? 67.614  19.918  44.424  1.00 54.24  ? 180 SER A N     1 
ATOM   1487 C  CA    . SER A 1 181 ? 68.728  20.704  43.909  1.00 59.45  ? 180 SER A CA    1 
ATOM   1488 C  C     . SER A 1 181 ? 68.308  21.505  42.682  1.00 67.20  ? 180 SER A C     1 
ATOM   1489 O  O     . SER A 1 181 ? 67.612  21.000  41.796  1.00 61.38  ? 180 SER A O     1 
ATOM   1490 C  CB    . SER A 1 181 ? 69.904  19.793  43.561  1.00 58.49  ? 180 SER A CB    1 
ATOM   1491 O  OG    . SER A 1 181 ? 70.956  20.531  42.964  1.00 50.03  ? 180 SER A OG    1 
ATOM   1492 N  N     . HIS A 1 182 ? 68.742  22.764  42.632  1.00 67.85  ? 181 HIS A N     1 
ATOM   1493 C  CA    . HIS A 1 182 ? 68.461  23.649  41.509  1.00 69.08  ? 181 HIS A CA    1 
ATOM   1494 C  C     . HIS A 1 182 ? 69.516  23.578  40.414  1.00 64.32  ? 181 HIS A C     1 
ATOM   1495 O  O     . HIS A 1 182 ? 69.404  24.304  39.420  1.00 61.90  ? 181 HIS A O     1 
ATOM   1496 C  CB    . HIS A 1 182 ? 68.329  25.096  41.993  1.00 67.96  ? 181 HIS A CB    1 
ATOM   1497 C  CG    . HIS A 1 182 ? 66.992  25.417  42.581  1.00 77.26  ? 181 HIS A CG    1 
ATOM   1498 N  ND1   . HIS A 1 182 ? 66.260  26.523  42.204  1.00 77.59  ? 181 HIS A ND1   1 
ATOM   1499 C  CD2   . HIS A 1 182 ? 66.250  24.775  43.513  1.00 72.39  ? 181 HIS A CD2   1 
ATOM   1500 C  CE1   . HIS A 1 182 ? 65.127  26.550  42.882  1.00 82.02  ? 181 HIS A CE1   1 
ATOM   1501 N  NE2   . HIS A 1 182 ? 65.096  25.500  43.683  1.00 77.75  ? 181 HIS A NE2   1 
ATOM   1502 N  N     . LEU A 1 183 ? 70.537  22.736  40.574  1.00 62.79  ? 182 LEU A N     1 
ATOM   1503 C  CA    . LEU A 1 183 ? 71.549  22.558  39.539  1.00 66.22  ? 182 LEU A CA    1 
ATOM   1504 C  C     . LEU A 1 183 ? 71.040  21.751  38.354  1.00 67.32  ? 182 LEU A C     1 
ATOM   1505 O  O     . LEU A 1 183 ? 71.704  21.723  37.312  1.00 63.68  ? 182 LEU A O     1 
ATOM   1506 C  CB    . LEU A 1 183 ? 72.785  21.884  40.134  1.00 67.93  ? 182 LEU A CB    1 
ATOM   1507 C  CG    . LEU A 1 183 ? 73.347  22.494  41.431  1.00 69.33  ? 182 LEU A CG    1 
ATOM   1508 C  CD1   . LEU A 1 183 ? 74.040  21.441  42.278  1.00 67.26  ? 182 LEU A CD1   1 
ATOM   1509 C  CD2   . LEU A 1 183 ? 74.293  23.637  41.123  1.00 62.16  ? 182 LEU A CD2   1 
ATOM   1510 N  N     . ASN A 1 184 ? 69.888  21.109  38.492  1.00 61.89  ? 183 ASN A N     1 
ATOM   1511 C  CA    . ASN A 1 184 ? 69.267  20.339  37.426  1.00 62.44  ? 183 ASN A CA    1 
ATOM   1512 C  C     . ASN A 1 184 ? 67.766  20.376  37.652  1.00 61.91  ? 183 ASN A C     1 
ATOM   1513 O  O     . ASN A 1 184 ? 67.305  20.764  38.733  1.00 55.58  ? 183 ASN A O     1 
ATOM   1514 C  CB    . ASN A 1 184 ? 69.802  18.899  37.396  1.00 57.09  ? 183 ASN A CB    1 
ATOM   1515 C  CG    . ASN A 1 184 ? 70.130  18.370  38.774  1.00 61.20  ? 183 ASN A CG    1 
ATOM   1516 O  OD1   . ASN A 1 184 ? 69.248  18.195  39.609  1.00 63.07  ? 183 ASN A OD1   1 
ATOM   1517 N  ND2   . ASN A 1 184 ? 71.409  18.106  39.017  1.00 62.47  ? 183 ASN A ND2   1 
ATOM   1518 N  N     . PRO A 1 185 ? 66.966  20.009  36.642  1.00 61.15  ? 184 PRO A N     1 
ATOM   1519 C  CA    . PRO A 1 185 ? 65.509  20.172  36.759  1.00 62.94  ? 184 PRO A CA    1 
ATOM   1520 C  C     . PRO A 1 185 ? 64.935  19.522  38.012  1.00 59.47  ? 184 PRO A C     1 
ATOM   1521 O  O     . PRO A 1 185 ? 65.367  18.449  38.439  1.00 53.58  ? 184 PRO A O     1 
ATOM   1522 C  CB    . PRO A 1 185 ? 64.972  19.505  35.485  1.00 57.16  ? 184 PRO A CB    1 
ATOM   1523 C  CG    . PRO A 1 185 ? 66.127  18.729  34.918  1.00 63.68  ? 184 PRO A CG    1 
ATOM   1524 C  CD    . PRO A 1 185 ? 67.332  19.511  35.305  1.00 61.41  ? 184 PRO A CD    1 
ATOM   1525 N  N     . LEU A 1 186 ? 63.949  20.195  38.600  1.00 64.66  ? 185 LEU A N     1 
ATOM   1526 C  CA    . LEU A 1 186 ? 63.340  19.744  39.846  1.00 62.72  ? 185 LEU A CA    1 
ATOM   1527 C  C     . LEU A 1 186 ? 62.306  18.660  39.569  1.00 62.53  ? 185 LEU A C     1 
ATOM   1528 O  O     . LEU A 1 186 ? 61.504  18.798  38.638  1.00 59.33  ? 185 LEU A O     1 
ATOM   1529 C  CB    . LEU A 1 186 ? 62.676  20.911  40.575  1.00 61.36  ? 185 LEU A CB    1 
ATOM   1530 C  CG    . LEU A 1 186 ? 63.567  21.957  41.245  1.00 68.65  ? 185 LEU A CG    1 
ATOM   1531 C  CD1   . LEU A 1 186 ? 62.720  23.088  41.809  1.00 74.54  ? 185 LEU A CD1   1 
ATOM   1532 C  CD2   . LEU A 1 186 ? 64.406  21.322  42.341  1.00 62.56  ? 185 LEU A CD2   1 
ATOM   1533 N  N     . PRO A 1 187 ? 62.290  17.583  40.346  1.00 64.56  ? 186 PRO A N     1 
ATOM   1534 C  CA    . PRO A 1 187 ? 61.210  16.599  40.246  1.00 59.86  ? 186 PRO A CA    1 
ATOM   1535 C  C     . PRO A 1 187 ? 59.879  17.221  40.621  1.00 61.02  ? 186 PRO A C     1 
ATOM   1536 O  O     . PRO A 1 187 ? 59.839  18.279  41.269  1.00 54.65  ? 186 PRO A O     1 
ATOM   1537 C  CB    . PRO A 1 187 ? 61.626  15.506  41.246  1.00 58.94  ? 186 PRO A CB    1 
ATOM   1538 C  CG    . PRO A 1 187 ? 63.056  15.795  41.597  1.00 61.96  ? 186 PRO A CG    1 
ATOM   1539 C  CD    . PRO A 1 187 ? 63.256  17.254  41.402  1.00 62.20  ? 186 PRO A CD    1 
ATOM   1540 N  N     . PRO A 1 188 ? 58.763  16.605  40.219  1.00 64.69  ? 187 PRO A N     1 
ATOM   1541 C  CA    . PRO A 1 188 ? 57.453  17.236  40.463  1.00 68.02  ? 187 PRO A CA    1 
ATOM   1542 C  C     . PRO A 1 188 ? 57.143  17.462  41.932  1.00 67.30  ? 187 PRO A C     1 
ATOM   1543 O  O     . PRO A 1 188 ? 56.668  18.545  42.298  1.00 65.89  ? 187 PRO A O     1 
ATOM   1544 C  CB    . PRO A 1 188 ? 56.469  16.246  39.821  1.00 62.69  ? 187 PRO A CB    1 
ATOM   1545 C  CG    . PRO A 1 188 ? 57.281  15.514  38.807  1.00 63.36  ? 187 PRO A CG    1 
ATOM   1546 C  CD    . PRO A 1 188 ? 58.645  15.386  39.402  1.00 55.25  ? 187 PRO A CD    1 
ATOM   1547 N  N     . GLU A 1 189 ? 57.400  16.474  42.791  1.00 65.28  ? 188 GLU A N     1 
ATOM   1548 C  CA    . GLU A 1 189 ? 57.027  16.607  44.194  1.00 61.69  ? 188 GLU A CA    1 
ATOM   1549 C  C     . GLU A 1 189 ? 57.963  17.536  44.958  1.00 67.24  ? 188 GLU A C     1 
ATOM   1550 O  O     . GLU A 1 189 ? 57.527  18.200  45.905  1.00 67.68  ? 188 GLU A O     1 
ATOM   1551 C  CB    . GLU A 1 189 ? 56.981  15.230  44.857  1.00 63.81  ? 188 GLU A CB    1 
ATOM   1552 C  CG    . GLU A 1 189 ? 55.955  14.297  44.234  1.00 62.76  ? 188 GLU A CG    1 
ATOM   1553 C  CD    . GLU A 1 189 ? 55.739  13.039  45.047  1.00 68.54  ? 188 GLU A CD    1 
ATOM   1554 O  OE1   . GLU A 1 189 ? 56.580  12.744  45.921  1.00 62.16  ? 188 GLU A OE1   1 
ATOM   1555 O  OE2   . GLU A 1 189 ? 54.726  12.346  44.812  1.00 70.19  ? 188 GLU A OE2   1 
ATOM   1556 N  N     . ALA A 1 190 ? 59.239  17.598  44.573  1.00 60.51  ? 189 ALA A N     1 
ATOM   1557 C  CA    . ALA A 1 190 ? 60.138  18.570  45.185  1.00 59.45  ? 189 ALA A CA    1 
ATOM   1558 C  C     . ALA A 1 190 ? 59.810  19.987  44.734  1.00 62.17  ? 189 ALA A C     1 
ATOM   1559 O  O     . ALA A 1 190 ? 59.953  20.934  45.516  1.00 58.63  ? 189 ALA A O     1 
ATOM   1560 C  CB    . ALA A 1 190 ? 61.591  18.228  44.858  1.00 51.32  ? 189 ALA A CB    1 
ATOM   1561 N  N     . ALA A 1 191 ? 59.367  20.151  43.486  1.00 64.52  ? 190 ALA A N     1 
ATOM   1562 C  CA    . ALA A 1 191 ? 59.000  21.476  42.999  1.00 66.14  ? 190 ALA A CA    1 
ATOM   1563 C  C     . ALA A 1 191 ? 57.735  21.984  43.680  1.00 63.83  ? 190 ALA A C     1 
ATOM   1564 O  O     . ALA A 1 191 ? 57.622  23.178  43.980  1.00 62.32  ? 190 ALA A O     1 
ATOM   1565 C  CB    . ALA A 1 191 ? 58.822  21.447  41.482  1.00 57.51  ? 190 ALA A CB    1 
ATOM   1566 N  N     . ALA A 1 192 ? 56.772  21.093  43.930  1.00 65.01  ? 191 ALA A N     1 
ATOM   1567 C  CA    . ALA A 1 192 ? 55.564  21.494  44.643  1.00 70.23  ? 191 ALA A CA    1 
ATOM   1568 C  C     . ALA A 1 192 ? 55.852  21.788  46.110  1.00 70.23  ? 191 ALA A C     1 
ATOM   1569 O  O     . ALA A 1 192 ? 55.224  22.677  46.697  1.00 64.99  ? 191 ALA A O     1 
ATOM   1570 C  CB    . ALA A 1 192 ? 54.492  20.412  44.514  1.00 60.65  ? 191 ALA A CB    1 
ATOM   1571 N  N     . LEU A 1 193 ? 56.790  21.055  46.715  1.00 66.18  ? 192 LEU A N     1 
ATOM   1572 C  CA    . LEU A 1 193 ? 57.175  21.329  48.096  1.00 67.26  ? 192 LEU A CA    1 
ATOM   1573 C  C     . LEU A 1 193 ? 57.803  22.711  48.224  1.00 70.18  ? 192 LEU A C     1 
ATOM   1574 O  O     . LEU A 1 193 ? 57.452  23.487  49.120  1.00 70.45  ? 192 LEU A O     1 
ATOM   1575 C  CB    . LEU A 1 193 ? 58.146  20.258  48.593  1.00 62.69  ? 192 LEU A CB    1 
ATOM   1576 C  CG    . LEU A 1 193 ? 57.580  18.964  49.176  1.00 62.36  ? 192 LEU A CG    1 
ATOM   1577 C  CD1   . LEU A 1 193 ? 58.712  18.075  49.669  1.00 61.88  ? 192 LEU A CD1   1 
ATOM   1578 C  CD2   . LEU A 1 193 ? 56.605  19.263  50.302  1.00 62.78  ? 192 LEU A CD2   1 
ATOM   1579 N  N     . GLU A 1 194 ? 58.741  23.032  47.330  1.00 72.19  ? 193 GLU A N     1 
ATOM   1580 C  CA    . GLU A 1 194 ? 59.463  24.296  47.424  1.00 75.92  ? 193 GLU A CA    1 
ATOM   1581 C  C     . GLU A 1 194 ? 58.530  25.484  47.229  1.00 80.40  ? 193 GLU A C     1 
ATOM   1582 O  O     . GLU A 1 194 ? 58.618  26.480  47.957  1.00 83.84  ? 193 GLU A O     1 
ATOM   1583 C  CB    . GLU A 1 194 ? 60.592  24.324  46.396  1.00 68.86  ? 193 GLU A CB    1 
ATOM   1584 C  CG    . GLU A 1 194 ? 61.443  25.578  46.436  1.00 81.46  ? 193 GLU A CG    1 
ATOM   1585 C  CD    . GLU A 1 194 ? 62.492  25.597  45.344  1.00 87.90  ? 193 GLU A CD    1 
ATOM   1586 O  OE1   . GLU A 1 194 ? 62.197  26.110  44.244  1.00 85.95  ? 193 GLU A OE1   1 
ATOM   1587 O  OE2   . GLU A 1 194 ? 63.609  25.092  45.581  1.00 91.53  ? 193 GLU A OE2   1 
ATOM   1588 N  N     . HIS A 1 195 ? 57.629  25.399  46.253  1.00 73.93  ? 194 HIS A N     1 
ATOM   1589 C  CA    . HIS A 1 195 ? 56.678  26.469  45.989  1.00 79.04  ? 194 HIS A CA    1 
ATOM   1590 C  C     . HIS A 1 195 ? 55.447  26.396  46.882  1.00 81.42  ? 194 HIS A C     1 
ATOM   1591 O  O     . HIS A 1 195 ? 54.537  27.217  46.718  1.00 82.78  ? 194 HIS A O     1 
ATOM   1592 C  CB    . HIS A 1 195 ? 56.240  26.443  44.522  1.00 67.68  ? 194 HIS A CB    1 
ATOM   1593 C  CG    . HIS A 1 195 ? 57.366  26.575  43.542  1.00 78.11  ? 194 HIS A CG    1 
ATOM   1594 N  ND1   . HIS A 1 195 ? 58.527  25.837  43.631  1.00 77.75  ? 194 HIS A ND1   1 
ATOM   1595 C  CD2   . HIS A 1 195 ? 57.502  27.355  42.443  1.00 68.24  ? 194 HIS A CD2   1 
ATOM   1596 C  CE1   . HIS A 1 195 ? 59.331  26.161  42.635  1.00 72.85  ? 194 HIS A CE1   1 
ATOM   1597 N  NE2   . HIS A 1 195 ? 58.733  27.080  41.899  1.00 69.63  ? 194 HIS A NE2   1 
ATOM   1598 N  N     . HIS A 1 196 ? 55.402  25.440  47.808  1.00 82.58  ? 195 HIS A N     1 
ATOM   1599 C  CA    . HIS A 1 196 ? 54.269  25.248  48.710  1.00 82.23  ? 195 HIS A CA    1 
ATOM   1600 C  C     . HIS A 1 196 ? 52.973  25.021  47.934  1.00 82.68  ? 195 HIS A C     1 
ATOM   1601 O  O     . HIS A 1 196 ? 52.677  23.903  47.515  1.00 73.35  ? 195 HIS A O     1 
ATOM   1602 C  CB    . HIS A 1 196 ? 54.119  26.445  49.655  1.00 82.86  ? 195 HIS A CB    1 
ATOM   1603 C  CG    . HIS A 1 196 ? 55.418  26.952  50.198  1.00 85.82  ? 195 HIS A CG    1 
ATOM   1604 N  ND1   . HIS A 1 196 ? 56.340  26.132  50.813  1.00 87.74  ? 195 HIS A ND1   1 
ATOM   1605 C  CD2   . HIS A 1 196 ? 55.948  28.198  50.223  1.00 86.66  ? 195 HIS A CD2   1 
ATOM   1606 C  CE1   . HIS A 1 196 ? 57.383  26.850  51.190  1.00 84.34  ? 195 HIS A CE1   1 
ATOM   1607 N  NE2   . HIS A 1 196 ? 57.170  28.107  50.844  1.00 89.65  ? 195 HIS A NE2   1 
ATOM   1608 O  "O5'" . DG  B 2 1   ? 54.046  4.252   76.378  1.00 79.68  ? 1   DG  C "O5'" 1 
ATOM   1609 C  "C5'" . DG  B 2 1   ? 54.362  5.638   76.378  1.00 69.28  ? 1   DG  C "C5'" 1 
ATOM   1610 C  "C4'" . DG  B 2 1   ? 55.078  6.024   75.101  1.00 77.79  ? 1   DG  C "C4'" 1 
ATOM   1611 O  "O4'" . DG  B 2 1   ? 56.356  5.336   75.025  1.00 74.61  ? 1   DG  C "O4'" 1 
ATOM   1612 C  "C3'" . DG  B 2 1   ? 54.329  5.681   73.813  1.00 82.06  ? 1   DG  C "C3'" 1 
ATOM   1613 O  "O3'" . DG  B 2 1   ? 54.417  6.768   72.926  1.00 89.17  ? 1   DG  C "O3'" 1 
ATOM   1614 C  "C2'" . DG  B 2 1   ? 55.081  4.464   73.283  1.00 78.63  ? 1   DG  C "C2'" 1 
ATOM   1615 C  "C1'" . DG  B 2 1   ? 56.494  4.752   73.751  1.00 75.68  ? 1   DG  C "C1'" 1 
ATOM   1616 N  N9    . DG  B 2 1   ? 57.313  3.551   73.870  1.00 66.40  ? 1   DG  C N9    1 
ATOM   1617 C  C8    . DG  B 2 1   ? 56.886  2.289   74.206  1.00 62.85  ? 1   DG  C C8    1 
ATOM   1618 N  N7    . DG  B 2 1   ? 57.843  1.404   74.224  1.00 62.46  ? 1   DG  C N7    1 
ATOM   1619 C  C5    . DG  B 2 1   ? 58.978  2.126   73.874  1.00 53.71  ? 1   DG  C C5    1 
ATOM   1620 C  C6    . DG  B 2 1   ? 60.319  1.700   73.729  1.00 54.77  ? 1   DG  C C6    1 
ATOM   1621 O  O6    . DG  B 2 1   ? 60.783  0.562   73.887  1.00 57.95  ? 1   DG  C O6    1 
ATOM   1622 N  N1    . DG  B 2 1   ? 61.157  2.751   73.362  1.00 52.66  ? 1   DG  C N1    1 
ATOM   1623 C  C2    . DG  B 2 1   ? 60.749  4.050   73.161  1.00 59.04  ? 1   DG  C C2    1 
ATOM   1624 N  N2    . DG  B 2 1   ? 61.702  4.925   72.809  1.00 55.28  ? 1   DG  C N2    1 
ATOM   1625 N  N3    . DG  B 2 1   ? 59.495  4.462   73.294  1.00 57.58  ? 1   DG  C N3    1 
ATOM   1626 C  C4    . DG  B 2 1   ? 58.667  3.449   73.651  1.00 61.76  ? 1   DG  C C4    1 
ATOM   1627 P  P     . DC  B 2 2   ? 53.521  6.825   71.593  1.00 98.60  ? 2   DC  C P     1 
ATOM   1628 O  OP1   . DC  B 2 2   ? 52.590  7.970   71.727  1.00 89.71  ? 2   DC  C OP1   1 
ATOM   1629 O  OP2   . DC  B 2 2   ? 52.994  5.480   71.285  1.00 85.58  ? 2   DC  C OP2   1 
ATOM   1630 O  "O5'" . DC  B 2 2   ? 54.599  7.156   70.468  1.00 85.62  ? 2   DC  C "O5'" 1 
ATOM   1631 C  "C5'" . DC  B 2 2   ? 55.867  7.687   70.847  1.00 83.09  ? 2   DC  C "C5'" 1 
ATOM   1632 C  "C4'" . DC  B 2 2   ? 56.943  7.306   69.850  1.00 74.95  ? 2   DC  C "C4'" 1 
ATOM   1633 O  "O4'" . DC  B 2 2   ? 57.646  6.113   70.305  1.00 68.47  ? 2   DC  C "O4'" 1 
ATOM   1634 C  "C3'" . DC  B 2 2   ? 56.433  6.969   68.451  1.00 68.11  ? 2   DC  C "C3'" 1 
ATOM   1635 O  "O3'" . DC  B 2 2   ? 57.360  7.441   67.492  1.00 70.98  ? 2   DC  C "O3'" 1 
ATOM   1636 C  "C2'" . DC  B 2 2   ? 56.426  5.444   68.475  1.00 67.81  ? 2   DC  C "C2'" 1 
ATOM   1637 C  "C1'" . DC  B 2 2   ? 57.717  5.210   69.231  1.00 66.04  ? 2   DC  C "C1'" 1 
ATOM   1638 N  N1    . DC  B 2 2   ? 57.892  3.828   69.749  1.00 59.00  ? 2   DC  C N1    1 
ATOM   1639 C  C2    . DC  B 2 2   ? 59.182  3.316   69.894  1.00 61.53  ? 2   DC  C C2    1 
ATOM   1640 O  O2    . DC  B 2 2   ? 60.148  4.034   69.607  1.00 62.21  ? 2   DC  C O2    1 
ATOM   1641 N  N3    . DC  B 2 2   ? 59.341  2.053   70.356  1.00 56.48  ? 2   DC  C N3    1 
ATOM   1642 C  C4    . DC  B 2 2   ? 58.275  1.312   70.653  1.00 53.92  ? 2   DC  C C4    1 
ATOM   1643 N  N4    . DC  B 2 2   ? 58.483  0.070   71.105  1.00 61.69  ? 2   DC  C N4    1 
ATOM   1644 C  C5    . DC  B 2 2   ? 56.947  1.811   70.501  1.00 56.96  ? 2   DC  C C5    1 
ATOM   1645 C  C6    . DC  B 2 2   ? 56.803  3.062   70.045  1.00 62.35  ? 2   DC  C C6    1 
ATOM   1646 P  P     . DC  B 2 3   ? 56.962  8.615   66.472  1.00 83.59  ? 3   DC  C P     1 
ATOM   1647 O  OP1   . DC  B 2 3   ? 56.762  9.844   67.269  1.00 72.38  ? 3   DC  C OP1   1 
ATOM   1648 O  OP2   . DC  B 2 3   ? 55.877  8.122   65.594  1.00 78.73  ? 3   DC  C OP2   1 
ATOM   1649 O  "O5'" . DC  B 2 3   ? 58.279  8.793   65.583  1.00 75.73  ? 3   DC  C "O5'" 1 
ATOM   1650 C  "C5'" . DC  B 2 3   ? 59.540  8.974   66.218  1.00 72.45  ? 3   DC  C "C5'" 1 
ATOM   1651 C  "C4'" . DC  B 2 3   ? 60.531  7.904   65.788  1.00 68.84  ? 3   DC  C "C4'" 1 
ATOM   1652 O  "O4'" . DC  B 2 3   ? 60.191  6.637   66.390  1.00 63.89  ? 3   DC  C "O4'" 1 
ATOM   1653 C  "C3'" . DC  B 2 3   ? 60.598  7.643   64.279  1.00 68.37  ? 3   DC  C "C3'" 1 
ATOM   1654 O  "O3'" . DC  B 2 3   ? 61.834  8.118   63.762  1.00 72.03  ? 3   DC  C "O3'" 1 
ATOM   1655 C  "C2'" . DC  B 2 3   ? 60.475  6.113   64.141  1.00 61.67  ? 3   DC  C "C2'" 1 
ATOM   1656 C  "C1'" . DC  B 2 3   ? 60.694  5.621   65.566  1.00 57.10  ? 3   DC  C "C1'" 1 
ATOM   1657 N  N1    . DC  B 2 3   ? 59.976  4.350   65.875  1.00 57.14  ? 3   DC  C N1    1 
ATOM   1658 C  C2    . DC  B 2 3   ? 60.703  3.167   66.052  1.00 56.77  ? 3   DC  C C2    1 
ATOM   1659 O  O2    . DC  B 2 3   ? 61.935  3.196   65.950  1.00 60.48  ? 3   DC  C O2    1 
ATOM   1660 N  N3    . DC  B 2 3   ? 60.035  2.021   66.332  1.00 59.09  ? 3   DC  C N3    1 
ATOM   1661 C  C4    . DC  B 2 3   ? 58.705  2.031   66.433  1.00 59.23  ? 3   DC  C C4    1 
ATOM   1662 N  N4    . DC  B 2 3   ? 58.089  0.877   66.710  1.00 58.26  ? 3   DC  C N4    1 
ATOM   1663 C  C5    . DC  B 2 3   ? 57.947  3.225   66.253  1.00 58.57  ? 3   DC  C C5    1 
ATOM   1664 C  C6    . DC  B 2 3   ? 58.617  4.349   65.977  1.00 60.54  ? 3   DC  C C6    1 
ATOM   1665 P  P     . DT  B 2 4   ? 62.121  8.072   62.182  1.00 75.24  ? 4   DT  C P     1 
ATOM   1666 O  OP1   . DT  B 2 4   ? 63.149  9.094   61.885  1.00 71.68  ? 4   DT  C OP1   1 
ATOM   1667 O  OP2   . DT  B 2 4   ? 60.815  8.117   61.487  1.00 81.17  ? 4   DT  C OP2   1 
ATOM   1668 O  "O5'" . DT  B 2 4   ? 62.784  6.634   61.955  1.00 60.35  ? 4   DT  C "O5'" 1 
ATOM   1669 C  "C5'" . DT  B 2 4   ? 63.993  6.302   62.624  1.00 52.98  ? 4   DT  C "C5'" 1 
ATOM   1670 C  "C4'" . DT  B 2 4   ? 64.393  4.864   62.346  1.00 51.58  ? 4   DT  C "C4'" 1 
ATOM   1671 O  "O4'" . DT  B 2 4   ? 63.431  3.961   62.944  1.00 50.18  ? 4   DT  C "O4'" 1 
ATOM   1672 C  "C3'" . DT  B 2 4   ? 64.475  4.482   60.862  1.00 52.09  ? 4   DT  C "C3'" 1 
ATOM   1673 O  "O3'" . DT  B 2 4   ? 65.755  3.935   60.576  1.00 55.88  ? 4   DT  C "O3'" 1 
ATOM   1674 C  "C2'" . DT  B 2 4   ? 63.366  3.438   60.687  1.00 50.69  ? 4   DT  C "C2'" 1 
ATOM   1675 C  "C1'" . DT  B 2 4   ? 63.264  2.862   62.088  1.00 54.14  ? 4   DT  C "C1'" 1 
ATOM   1676 N  N1    . DT  B 2 4   ? 61.952  2.220   62.382  1.00 50.17  ? 4   DT  C N1    1 
ATOM   1677 C  C2    . DT  B 2 4   ? 61.920  0.887   62.720  1.00 51.90  ? 4   DT  C C2    1 
ATOM   1678 O  O2    . DT  B 2 4   ? 62.918  0.194   62.797  1.00 51.30  ? 4   DT  C O2    1 
ATOM   1679 N  N3    . DT  B 2 4   ? 60.669  0.390   62.970  1.00 54.68  ? 4   DT  C N3    1 
ATOM   1680 C  C4    . DT  B 2 4   ? 59.470  1.077   62.915  1.00 52.69  ? 4   DT  C C4    1 
ATOM   1681 O  O4    . DT  B 2 4   ? 58.394  0.540   63.157  1.00 60.66  ? 4   DT  C O4    1 
ATOM   1682 C  C5    . DT  B 2 4   ? 59.574  2.471   62.552  1.00 54.81  ? 4   DT  C C5    1 
ATOM   1683 C  C7    . DT  B 2 4   ? 58.340  3.319   62.460  1.00 50.45  ? 4   DT  C C7    1 
ATOM   1684 C  C6    . DT  B 2 4   ? 60.796  2.969   62.305  1.00 51.85  ? 4   DT  C C6    1 
ATOM   1685 P  P     . DT  B 2 5   ? 66.238  3.747   59.055  1.00 53.16  ? 5   DT  C P     1 
ATOM   1686 O  OP1   . DT  B 2 5   ? 67.715  3.827   59.054  1.00 47.60  ? 5   DT  C OP1   1 
ATOM   1687 O  OP2   . DT  B 2 5   ? 65.448  4.669   58.209  1.00 54.79  ? 5   DT  C OP2   1 
ATOM   1688 O  "O5'" . DT  B 2 5   ? 65.805  2.248   58.699  1.00 50.30  ? 5   DT  C "O5'" 1 
ATOM   1689 C  "C5'" . DT  B 2 5   ? 66.389  1.162   59.405  1.00 43.07  ? 5   DT  C "C5'" 1 
ATOM   1690 C  "C4'" . DT  B 2 5   ? 65.644  -0.135  59.139  1.00 53.55  ? 5   DT  C "C4'" 1 
ATOM   1691 O  "O4'" . DT  B 2 5   ? 64.295  -0.056  59.673  1.00 48.07  ? 5   DT  C "O4'" 1 
ATOM   1692 C  "C3'" . DT  B 2 5   ? 65.490  -0.519  57.659  1.00 54.87  ? 5   DT  C "C3'" 1 
ATOM   1693 O  "O3'" . DT  B 2 5   ? 65.826  -1.887  57.492  1.00 58.63  ? 5   DT  C "O3'" 1 
ATOM   1694 C  "C2'" . DT  B 2 5   ? 64.001  -0.287  57.396  1.00 52.77  ? 5   DT  C "C2'" 1 
ATOM   1695 C  "C1'" . DT  B 2 5   ? 63.428  -0.661  58.749  1.00 55.90  ? 5   DT  C "C1'" 1 
ATOM   1696 N  N1    . DT  B 2 5   ? 62.036  -0.182  58.986  1.00 50.30  ? 5   DT  C N1    1 
ATOM   1697 C  C2    . DT  B 2 5   ? 61.143  -1.022  59.608  1.00 53.55  ? 5   DT  C C2    1 
ATOM   1698 O  O2    . DT  B 2 5   ? 61.435  -2.143  59.983  1.00 57.34  ? 5   DT  C O2    1 
ATOM   1699 N  N3    . DT  B 2 5   ? 59.890  -0.500  59.781  1.00 50.75  ? 5   DT  C N3    1 
ATOM   1700 C  C4    . DT  B 2 5   ? 59.447  0.751   59.399  1.00 48.76  ? 5   DT  C C4    1 
ATOM   1701 O  O4    . DT  B 2 5   ? 58.297  1.129   59.599  1.00 52.50  ? 5   DT  C O4    1 
ATOM   1702 C  C5    . DT  B 2 5   ? 60.432  1.584   58.748  1.00 48.57  ? 5   DT  C C5    1 
ATOM   1703 C  C7    . DT  B 2 5   ? 60.067  2.964   58.289  1.00 47.89  ? 5   DT  C C7    1 
ATOM   1704 C  C6    . DT  B 2 5   ? 61.666  1.082   58.573  1.00 49.91  ? 5   DT  C C6    1 
ATOM   1705 P  P     . DG  B 2 6   ? 66.712  -2.368  56.241  1.00 65.43  ? 6   DG  C P     1 
ATOM   1706 O  OP1   . DG  B 2 6   ? 68.119  -2.010  56.525  1.00 58.04  ? 6   DG  C OP1   1 
ATOM   1707 O  OP2   . DG  B 2 6   ? 66.059  -1.879  55.006  1.00 62.13  ? 6   DG  C OP2   1 
ATOM   1708 O  "O5'" . DG  B 2 6   ? 66.567  -3.960  56.273  1.00 59.40  ? 6   DG  C "O5'" 1 
ATOM   1709 C  "C5'" . DG  B 2 6   ? 66.849  -4.675  57.471  1.00 50.54  ? 6   DG  C "C5'" 1 
ATOM   1710 C  "C4'" . DG  B 2 6   ? 65.905  -5.854  57.634  1.00 49.31  ? 6   DG  C "C4'" 1 
ATOM   1711 O  "O4'" . DG  B 2 6   ? 64.600  -5.381  58.055  1.00 50.59  ? 6   DG  C "O4'" 1 
ATOM   1712 C  "C3'" . DG  B 2 6   ? 65.680  -6.682  56.371  1.00 55.88  ? 6   DG  C "C3'" 1 
ATOM   1713 O  "O3'" . DG  B 2 6   ? 65.704  -8.068  56.688  1.00 62.94  ? 6   DG  C "O3'" 1 
ATOM   1714 C  "C2'" . DG  B 2 6   ? 64.301  -6.232  55.885  1.00 55.63  ? 6   DG  C "C2'" 1 
ATOM   1715 C  "C1'" . DG  B 2 6   ? 63.600  -5.869  57.187  1.00 53.09  ? 6   DG  C "C1'" 1 
ATOM   1716 N  N9    . DG  B 2 6   ? 62.589  -4.825  57.030  1.00 51.28  ? 6   DG  C N9    1 
ATOM   1717 C  C8    . DG  B 2 6   ? 62.762  -3.590  56.453  1.00 52.27  ? 6   DG  C C8    1 
ATOM   1718 N  N7    . DG  B 2 6   ? 61.683  -2.858  56.455  1.00 45.96  ? 6   DG  C N7    1 
ATOM   1719 C  C5    . DG  B 2 6   ? 60.732  -3.656  57.077  1.00 51.04  ? 6   DG  C C5    1 
ATOM   1720 C  C6    . DG  B 2 6   ? 59.371  -3.395  57.365  1.00 52.86  ? 6   DG  C C6    1 
ATOM   1721 O  O6    . DG  B 2 6   ? 58.717  -2.372  57.118  1.00 52.90  ? 6   DG  C O6    1 
ATOM   1722 N  N1    . DG  B 2 6   ? 58.764  -4.472  58.005  1.00 54.28  ? 6   DG  C N1    1 
ATOM   1723 C  C2    . DG  B 2 6   ? 59.392  -5.651  58.327  1.00 55.47  ? 6   DG  C C2    1 
ATOM   1724 N  N2    . DG  B 2 6   ? 58.640  -6.575  58.944  1.00 59.20  ? 6   DG  C N2    1 
ATOM   1725 N  N3    . DG  B 2 6   ? 60.667  -5.910  58.063  1.00 57.25  ? 6   DG  C N3    1 
ATOM   1726 C  C4    . DG  B 2 6   ? 61.273  -4.871  57.439  1.00 51.63  ? 6   DG  C C4    1 
ATOM   1727 P  P     . DC  B 2 7   ? 65.698  -9.167  55.516  1.00 72.04  ? 7   DC  C P     1 
ATOM   1728 O  OP1   . DC  B 2 7   ? 66.325  -10.396 56.050  1.00 75.09  ? 7   DC  C OP1   1 
ATOM   1729 O  OP2   . DC  B 2 7   ? 66.247  -8.535  54.296  1.00 64.80  ? 7   DC  C OP2   1 
ATOM   1730 O  "O5'" . DC  B 2 7   ? 64.144  -9.451  55.279  1.00 56.38  ? 7   DC  C "O5'" 1 
ATOM   1731 C  "C5'" . DC  B 2 7   ? 63.338  -9.873  56.367  1.00 53.15  ? 7   DC  C "C5'" 1 
ATOM   1732 C  "C4'" . DC  B 2 7   ? 61.874  -9.925  55.974  1.00 63.34  ? 7   DC  C "C4'" 1 
ATOM   1733 O  "O4'" . DC  B 2 7   ? 61.307  -8.601  56.010  1.00 60.41  ? 7   DC  C "O4'" 1 
ATOM   1734 C  "C3'" . DC  B 2 7   ? 61.594  -10.464 54.567  1.00 62.70  ? 7   DC  C "C3'" 1 
ATOM   1735 O  "O3'" . DC  B 2 7   ? 60.959  -11.734 54.659  1.00 72.70  ? 7   DC  C "O3'" 1 
ATOM   1736 C  "C2'" . DC  B 2 7   ? 60.673  -9.407  53.927  1.00 62.53  ? 7   DC  C "C2'" 1 
ATOM   1737 C  "C1'" . DC  B 2 7   ? 60.225  -8.578  55.125  1.00 64.05  ? 7   DC  C "C1'" 1 
ATOM   1738 N  N1    . DC  B 2 7   ? 59.900  -7.155  54.797  1.00 58.23  ? 7   DC  C N1    1 
ATOM   1739 C  C2    . DC  B 2 7   ? 58.648  -6.637  55.144  1.00 55.45  ? 7   DC  C C2    1 
ATOM   1740 O  O2    . DC  B 2 7   ? 57.830  -7.368  55.715  1.00 60.24  ? 7   DC  C O2    1 
ATOM   1741 N  N3    . DC  B 2 7   ? 58.365  -5.344  54.844  1.00 57.55  ? 7   DC  C N3    1 
ATOM   1742 C  C4    . DC  B 2 7   ? 59.274  -4.588  54.228  1.00 53.76  ? 7   DC  C C4    1 
ATOM   1743 N  N4    . DC  B 2 7   ? 58.949  -3.320  53.954  1.00 49.25  ? 7   DC  C N4    1 
ATOM   1744 C  C5    . DC  B 2 7   ? 60.557  -5.098  53.867  1.00 52.51  ? 7   DC  C C5    1 
ATOM   1745 C  C6    . DC  B 2 7   ? 60.825  -6.374  54.168  1.00 57.50  ? 7   DC  C C6    1 
ATOM   1746 P  P     . DC  B 2 8   ? 60.597  -12.567 53.333  1.00 80.95  ? 8   DC  C P     1 
ATOM   1747 O  OP1   . DC  B 2 8   ? 60.676  -14.004 53.680  1.00 82.78  ? 8   DC  C OP1   1 
ATOM   1748 O  OP2   . DC  B 2 8   ? 61.408  -12.037 52.215  1.00 77.10  ? 8   DC  C OP2   1 
ATOM   1749 O  "O5'" . DC  B 2 8   ? 59.068  -12.191 53.061  1.00 75.66  ? 8   DC  C "O5'" 1 
ATOM   1750 C  "C5'" . DC  B 2 8   ? 58.110  -12.342 54.100  1.00 63.66  ? 8   DC  C "C5'" 1 
ATOM   1751 C  "C4'" . DC  B 2 8   ? 56.853  -11.549 53.796  1.00 64.94  ? 8   DC  C "C4'" 1 
ATOM   1752 O  "O4'" . DC  B 2 8   ? 57.158  -10.146 53.799  1.00 67.43  ? 8   DC  C "O4'" 1 
ATOM   1753 C  "C3'" . DC  B 2 8   ? 56.249  -11.807 52.425  1.00 65.26  ? 8   DC  C "C3'" 1 
ATOM   1754 O  "O3'" . DC  B 2 8   ? 55.282  -12.847 52.511  1.00 71.90  ? 8   DC  C "O3'" 1 
ATOM   1755 C  "C2'" . DC  B 2 8   ? 55.599  -10.463 52.050  1.00 60.27  ? 8   DC  C "C2'" 1 
ATOM   1756 C  "C1'" . DC  B 2 8   ? 56.149  -9.475  53.085  1.00 59.14  ? 8   DC  C "C1'" 1 
ATOM   1757 N  N1    . DC  B 2 8   ? 56.730  -8.233  52.488  1.00 58.93  ? 8   DC  C N1    1 
ATOM   1758 C  C2    . DC  B 2 8   ? 55.930  -7.093  52.345  1.00 55.57  ? 8   DC  C C2    1 
ATOM   1759 O  O2    . DC  B 2 8   ? 54.750  -7.134  52.711  1.00 54.56  ? 8   DC  C O2    1 
ATOM   1760 N  N3    . DC  B 2 8   ? 56.474  -5.973  51.806  1.00 56.14  ? 8   DC  C N3    1 
ATOM   1761 C  C4    . DC  B 2 8   ? 57.752  -5.969  51.423  1.00 51.74  ? 8   DC  C C4    1 
ATOM   1762 N  N4    . DC  B 2 8   ? 58.244  -4.842  50.898  1.00 49.55  ? 8   DC  C N4    1 
ATOM   1763 C  C5    . DC  B 2 8   ? 58.582  -7.120  51.563  1.00 54.04  ? 8   DC  C C5    1 
ATOM   1764 C  C6    . DC  B 2 8   ? 58.034  -8.218  52.094  1.00 58.76  ? 8   DC  C C6    1 
ATOM   1765 P  P     . DG  B 2 9   ? 54.741  -13.564 51.178  1.00 66.82  ? 9   DG  C P     1 
ATOM   1766 O  OP1   . DG  B 2 9   ? 54.328  -14.936 51.545  1.00 74.62  ? 9   DG  C OP1   1 
ATOM   1767 O  OP2   . DG  B 2 9   ? 55.747  -13.358 50.114  1.00 72.85  ? 9   DG  C OP2   1 
ATOM   1768 O  "O5'" . DG  B 2 9   ? 53.438  -12.722 50.790  1.00 63.47  ? 9   DG  C "O5'" 1 
ATOM   1769 C  "C5'" . DG  B 2 9   ? 52.307  -12.723 51.654  1.00 60.49  ? 9   DG  C "C5'" 1 
ATOM   1770 C  "C4'" . DG  B 2 9   ? 51.250  -11.741 51.174  1.00 61.92  ? 9   DG  C "C4'" 1 
ATOM   1771 O  "O4'" . DG  B 2 9   ? 51.821  -10.409 51.088  1.00 61.29  ? 9   DG  C "O4'" 1 
ATOM   1772 C  "C3'" . DG  B 2 9   ? 50.665  -12.030 49.794  1.00 61.37  ? 9   DG  C "C3'" 1 
ATOM   1773 O  "O3'" . DG  B 2 9   ? 49.301  -11.629 49.767  1.00 60.53  ? 9   DG  C "O3'" 1 
ATOM   1774 C  "C2'" . DG  B 2 9   ? 51.520  -11.152 48.886  1.00 60.68  ? 9   DG  C "C2'" 1 
ATOM   1775 C  "C1'" . DG  B 2 9   ? 51.708  -9.926  49.764  1.00 58.67  ? 9   DG  C "C1'" 1 
ATOM   1776 N  N9    . DG  B 2 9   ? 52.908  -9.158  49.454  1.00 54.69  ? 9   DG  C N9    1 
ATOM   1777 C  C8    . DG  B 2 9   ? 54.169  -9.648  49.218  1.00 53.26  ? 9   DG  C C8    1 
ATOM   1778 N  N7    . DG  B 2 9   ? 55.052  -8.718  48.978  1.00 53.45  ? 9   DG  C N7    1 
ATOM   1779 C  C5    . DG  B 2 9   ? 54.328  -7.536  49.058  1.00 52.66  ? 9   DG  C C5    1 
ATOM   1780 C  C6    . DG  B 2 9   ? 54.749  -6.196  48.887  1.00 48.80  ? 9   DG  C C6    1 
ATOM   1781 O  O6    . DG  B 2 9   ? 55.883  -5.775  48.622  1.00 51.93  ? 9   DG  C O6    1 
ATOM   1782 N  N1    . DG  B 2 9   ? 53.695  -5.300  49.054  1.00 47.89  ? 9   DG  C N1    1 
ATOM   1783 C  C2    . DG  B 2 9   ? 52.400  -5.656  49.349  1.00 48.76  ? 9   DG  C C2    1 
ATOM   1784 N  N2    . DG  B 2 9   ? 51.520  -4.652  49.474  1.00 49.87  ? 9   DG  C N2    1 
ATOM   1785 N  N3    . DG  B 2 9   ? 51.994  -6.907  49.512  1.00 51.61  ? 9   DG  C N3    1 
ATOM   1786 C  C4    . DG  B 2 9   ? 53.008  -7.791  49.353  1.00 53.79  ? 9   DG  C C4    1 
ATOM   1787 P  P     . DG  B 2 10  ? 48.364  -11.979 48.509  1.00 67.09  ? 10  DG  C P     1 
ATOM   1788 O  OP1   . DG  B 2 10  ? 47.126  -12.587 49.044  1.00 76.74  ? 10  DG  C OP1   1 
ATOM   1789 O  OP2   . DG  B 2 10  ? 49.171  -12.722 47.515  1.00 74.34  ? 10  DG  C OP2   1 
ATOM   1790 O  "O5'" . DG  B 2 10  ? 47.985  -10.544 47.909  1.00 63.89  ? 10  DG  C "O5'" 1 
ATOM   1791 C  "C5'" . DG  B 2 10  ? 47.661  -9.471  48.791  1.00 58.48  ? 10  DG  C "C5'" 1 
ATOM   1792 C  "C4'" . DG  B 2 10  ? 47.114  -8.268  48.033  1.00 62.75  ? 10  DG  C "C4'" 1 
ATOM   1793 O  "O4'" . DG  B 2 10  ? 48.179  -7.319  47.780  1.00 62.76  ? 10  DG  C "O4'" 1 
ATOM   1794 C  "C3'" . DG  B 2 10  ? 46.499  -8.568  46.675  1.00 59.77  ? 10  DG  C "C3'" 1 
ATOM   1795 O  "O3'" . DG  B 2 10  ? 45.458  -7.637  46.405  1.00 60.79  ? 10  DG  C "O3'" 1 
ATOM   1796 C  "C2'" . DG  B 2 10  ? 47.677  -8.381  45.722  1.00 57.56  ? 10  DG  C "C2'" 1 
ATOM   1797 C  "C1'" . DG  B 2 10  ? 48.464  -7.257  46.394  1.00 58.05  ? 10  DG  C "C1'" 1 
ATOM   1798 N  N9    . DG  B 2 10  ? 49.908  -7.380  46.229  1.00 56.07  ? 10  DG  C N9    1 
ATOM   1799 C  C8    . DG  B 2 10  ? 50.649  -8.535  46.280  1.00 52.34  ? 10  DG  C C8    1 
ATOM   1800 N  N7    . DG  B 2 10  ? 51.926  -8.341  46.109  1.00 50.04  ? 10  DG  C N7    1 
ATOM   1801 C  C5    . DG  B 2 10  ? 52.042  -6.967  45.940  1.00 47.89  ? 10  DG  C C5    1 
ATOM   1802 C  C6    . DG  B 2 10  ? 53.189  -6.170  45.717  1.00 47.46  ? 10  DG  C C6    1 
ATOM   1803 O  O6    . DG  B 2 10  ? 54.369  -6.534  45.620  1.00 41.40  ? 10  DG  C O6    1 
ATOM   1804 N  N1    . DG  B 2 10  ? 52.864  -4.820  45.600  1.00 44.77  ? 10  DG  C N1    1 
ATOM   1805 C  C2    . DG  B 2 10  ? 51.592  -4.307  45.689  1.00 47.84  ? 10  DG  C C2    1 
ATOM   1806 N  N2    . DG  B 2 10  ? 51.477  -2.978  45.552  1.00 42.03  ? 10  DG  C N2    1 
ATOM   1807 N  N3    . DG  B 2 10  ? 50.508  -5.043  45.899  1.00 51.61  ? 10  DG  C N3    1 
ATOM   1808 C  C4    . DG  B 2 10  ? 50.808  -6.360  46.014  1.00 47.58  ? 10  DG  C C4    1 
ATOM   1809 P  P     . DG  B 2 11  ? 44.476  -7.859  45.153  1.00 64.57  ? 11  DG  C P     1 
ATOM   1810 O  OP1   . DG  B 2 11  ? 43.185  -7.216  45.485  1.00 65.17  ? 11  DG  C OP1   1 
ATOM   1811 O  OP2   . DG  B 2 11  ? 44.516  -9.294  44.794  1.00 59.96  ? 11  DG  C OP2   1 
ATOM   1812 O  "O5'" . DG  B 2 11  ? 45.168  -7.033  43.970  1.00 67.41  ? 11  DG  C "O5'" 1 
ATOM   1813 C  "C5'" . DG  B 2 11  ? 45.188  -5.610  44.014  1.00 53.51  ? 11  DG  C "C5'" 1 
ATOM   1814 C  "C4'" . DG  B 2 11  ? 45.958  -5.031  42.836  1.00 58.04  ? 11  DG  C "C4'" 1 
ATOM   1815 O  "O4'" . DG  B 2 11  ? 47.382  -5.273  43.006  1.00 53.69  ? 11  DG  C "O4'" 1 
ATOM   1816 C  "C3'" . DG  B 2 11  ? 45.602  -5.614  41.462  1.00 52.80  ? 11  DG  C "C3'" 1 
ATOM   1817 O  "O3'" . DG  B 2 11  ? 45.700  -4.593  40.475  1.00 58.01  ? 11  DG  C "O3'" 1 
ATOM   1818 C  "C2'" . DG  B 2 11  ? 46.713  -6.638  41.264  1.00 50.89  ? 11  DG  C "C2'" 1 
ATOM   1819 C  "C1'" . DG  B 2 11  ? 47.875  -5.836  41.814  1.00 46.33  ? 11  DG  C "C1'" 1 
ATOM   1820 N  N9    . DG  B 2 11  ? 49.074  -6.609  42.108  1.00 46.33  ? 11  DG  C N9    1 
ATOM   1821 C  C8    . DG  B 2 11  ? 49.164  -7.959  42.343  1.00 42.98  ? 11  DG  C C8    1 
ATOM   1822 N  N7    . DG  B 2 11  ? 50.384  -8.363  42.574  1.00 53.52  ? 11  DG  C N7    1 
ATOM   1823 C  C5    . DG  B 2 11  ? 51.148  -7.205  42.484  1.00 47.39  ? 11  DG  C C5    1 
ATOM   1824 C  C6    . DG  B 2 11  ? 52.542  -7.013  42.641  1.00 44.51  ? 11  DG  C C6    1 
ATOM   1825 O  O6    . DG  B 2 11  ? 53.410  -7.859  42.898  1.00 48.00  ? 11  DG  C O6    1 
ATOM   1826 N  N1    . DG  B 2 11  ? 52.902  -5.678  42.466  1.00 47.01  ? 11  DG  C N1    1 
ATOM   1827 C  C2    . DG  B 2 11  ? 52.026  -4.659  42.178  1.00 47.74  ? 11  DG  C C2    1 
ATOM   1828 N  N2    . DG  B 2 11  ? 52.558  -3.435  42.046  1.00 43.77  ? 11  DG  C N2    1 
ATOM   1829 N  N3    . DG  B 2 11  ? 50.720  -4.826  42.030  1.00 41.54  ? 11  DG  C N3    1 
ATOM   1830 C  C4    . DG  B 2 11  ? 50.354  -6.120  42.196  1.00 50.83  ? 11  DG  C C4    1 
ATOM   1831 P  P     . DT  B 2 12  ? 44.470  -3.608  40.162  1.00 62.23  ? 12  DT  C P     1 
ATOM   1832 O  OP1   . DT  B 2 12  ? 43.755  -3.313  41.424  1.00 55.64  ? 12  DT  C OP1   1 
ATOM   1833 O  OP2   . DT  B 2 12  ? 43.728  -4.181  39.018  1.00 61.87  ? 12  DT  C OP2   1 
ATOM   1834 O  "O5'" . DT  B 2 12  ? 45.190  -2.270  39.654  1.00 53.41  ? 12  DT  C "O5'" 1 
ATOM   1835 C  "C5'" . DT  B 2 12  ? 46.016  -1.519  40.548  1.00 50.67  ? 12  DT  C "C5'" 1 
ATOM   1836 C  "C4'" . DT  B 2 12  ? 47.280  -1.014  39.860  1.00 51.66  ? 12  DT  C "C4'" 1 
ATOM   1837 O  "O4'" . DT  B 2 12  ? 48.312  -2.039  39.903  1.00 45.01  ? 12  DT  C "O4'" 1 
ATOM   1838 C  "C3'" . DT  B 2 12  ? 47.137  -0.650  38.380  1.00 46.00  ? 12  DT  C "C3'" 1 
ATOM   1839 O  "O3'" . DT  B 2 12  ? 48.063  0.372   38.065  1.00 50.57  ? 12  DT  C "O3'" 1 
ATOM   1840 C  "C2'" . DT  B 2 12  ? 47.557  -1.947  37.708  1.00 46.58  ? 12  DT  C "C2'" 1 
ATOM   1841 C  "C1'" . DT  B 2 12  ? 48.744  -2.299  38.584  1.00 46.44  ? 12  DT  C "C1'" 1 
ATOM   1842 N  N1    . DT  B 2 12  ? 49.192  -3.688  38.503  1.00 20.00  ? 12  DT  C N1    1 
ATOM   1843 C  C2    . DT  B 2 12  ? 50.539  -3.966  38.687  1.00 20.00  ? 12  DT  C C2    1 
ATOM   1844 O  O2    . DT  B 2 12  ? 51.388  -3.105  38.924  1.00 20.00  ? 12  DT  C O2    1 
ATOM   1845 N  N3    . DT  B 2 12  ? 50.860  -5.298  38.587  1.00 20.00  ? 12  DT  C N3    1 
ATOM   1846 C  C4    . DT  B 2 12  ? 50.018  -6.348  38.325  1.00 20.00  ? 12  DT  C C4    1 
ATOM   1847 O  O4    . DT  B 2 12  ? 50.469  -7.492  38.280  1.00 20.00  ? 12  DT  C O4    1 
ATOM   1848 C  C5    . DT  B 2 12  ? 48.628  -5.989  38.124  1.00 20.00  ? 12  DT  C C5    1 
ATOM   1849 C  C7    . DT  B 2 12  ? 47.636  -7.068  37.832  1.00 20.00  ? 12  DT  C C7    1 
ATOM   1850 C  C6    . DT  B 2 12  ? 48.291  -4.691  38.216  1.00 20.00  ? 12  DT  C C6    1 
ATOM   1851 P  P     . DA  B 2 13  ? 47.612  1.910   37.988  1.00 47.26  ? 13  DA  C P     1 
ATOM   1852 O  OP1   . DA  B 2 13  ? 46.994  2.269   39.283  1.00 41.62  ? 13  DA  C OP1   1 
ATOM   1853 O  OP2   . DA  B 2 13  ? 46.853  2.091   36.731  1.00 49.20  ? 13  DA  C OP2   1 
ATOM   1854 O  "O5'" . DA  B 2 13  ? 49.005  2.693   37.877  1.00 45.33  ? 13  DA  C "O5'" 1 
ATOM   1855 C  "C5'" . DA  B 2 13  ? 49.967  2.585   38.928  1.00 34.91  ? 13  DA  C "C5'" 1 
ATOM   1856 C  "C4'" . DA  B 2 13  ? 51.354  2.272   38.384  1.00 43.33  ? 13  DA  C "C4'" 1 
ATOM   1857 O  "O4'" . DA  B 2 13  ? 51.408  0.892   37.933  1.00 45.65  ? 13  DA  C "O4'" 1 
ATOM   1858 C  "C3'" . DA  B 2 13  ? 51.802  3.118   37.194  1.00 36.26  ? 13  DA  C "C3'" 1 
ATOM   1859 O  "O3'" . DA  B 2 13  ? 53.195  3.378   37.292  1.00 35.36  ? 13  DA  C "O3'" 1 
ATOM   1860 C  "C2'" . DA  B 2 13  ? 51.488  2.216   36.005  1.00 33.78  ? 13  DA  C "C2'" 1 
ATOM   1861 C  "C1'" . DA  B 2 13  ? 51.817  0.849   36.581  1.00 38.26  ? 13  DA  C "C1'" 1 
ATOM   1862 N  N9    . DA  B 2 13  ? 51.114  -0.248  35.926  1.00 38.27  ? 13  DA  C N9    1 
ATOM   1863 C  C8    . DA  B 2 13  ? 49.867  -0.212  35.367  1.00 38.45  ? 13  DA  C C8    1 
ATOM   1864 N  N7    . DA  B 2 13  ? 49.485  -1.357  34.854  1.00 36.83  ? 13  DA  C N7    1 
ATOM   1865 C  C5    . DA  B 2 13  ? 50.555  -2.204  35.096  1.00 38.42  ? 13  DA  C C5    1 
ATOM   1866 C  C6    . DA  B 2 13  ? 50.777  -3.563  34.798  1.00 37.64  ? 13  DA  C C6    1 
ATOM   1867 N  N6    . DA  B 2 13  ? 49.887  -4.331  34.163  1.00 40.20  ? 13  DA  C N6    1 
ATOM   1868 N  N1    . DA  B 2 13  ? 51.954  -4.102  35.179  1.00 37.39  ? 13  DA  C N1    1 
ATOM   1869 C  C2    . DA  B 2 13  ? 52.843  -3.330  35.816  1.00 36.92  ? 13  DA  C C2    1 
ATOM   1870 N  N3    . DA  B 2 13  ? 52.747  -2.043  36.150  1.00 33.33  ? 13  DA  C N3    1 
ATOM   1871 C  C4    . DA  B 2 13  ? 51.567  -1.536  35.758  1.00 36.58  ? 13  DA  C C4    1 
ATOM   1872 P  P     . DA  B 2 14  ? 53.889  4.456   36.326  1.00 31.55  ? 14  DA  C P     1 
ATOM   1873 O  OP1   . DA  B 2 14  ? 55.206  4.772   36.902  1.00 31.48  ? 14  DA  C OP1   1 
ATOM   1874 O  OP2   . DA  B 2 14  ? 52.926  5.550   36.078  1.00 37.91  ? 14  DA  C OP2   1 
ATOM   1875 O  "O5'" . DA  B 2 14  ? 54.106  3.664   34.953  1.00 35.23  ? 14  DA  C "O5'" 1 
ATOM   1876 C  "C5'" . DA  B 2 14  ? 55.406  3.243   34.570  1.00 28.30  ? 14  DA  C "C5'" 1 
ATOM   1877 C  "C4'" . DA  B 2 14  ? 55.739  1.884   35.158  1.00 35.11  ? 14  DA  C "C4'" 1 
ATOM   1878 O  "O4'" . DA  B 2 14  ? 54.615  0.978   34.973  1.00 35.95  ? 14  DA  C "O4'" 1 
ATOM   1879 C  "C3'" . DA  B 2 14  ? 56.929  1.189   34.504  1.00 30.83  ? 14  DA  C "C3'" 1 
ATOM   1880 O  "O3'" . DA  B 2 14  ? 57.622  0.421   35.458  1.00 34.60  ? 14  DA  C "O3'" 1 
ATOM   1881 C  "C2'" . DA  B 2 14  ? 56.256  0.294   33.478  1.00 29.54  ? 14  DA  C "C2'" 1 
ATOM   1882 C  "C1'" . DA  B 2 14  ? 55.060  -0.169  34.280  1.00 32.65  ? 14  DA  C "C1'" 1 
ATOM   1883 N  N9    . DA  B 2 14  ? 53.972  -0.683  33.459  1.00 36.99  ? 14  DA  C N9    1 
ATOM   1884 C  C8    . DA  B 2 14  ? 52.851  -0.013  33.060  1.00 36.40  ? 14  DA  C C8    1 
ATOM   1885 N  N7    . DA  B 2 14  ? 52.040  -0.734  32.323  1.00 36.72  ? 14  DA  C N7    1 
ATOM   1886 C  C5    . DA  B 2 14  ? 52.676  -1.961  32.232  1.00 35.06  ? 14  DA  C C5    1 
ATOM   1887 C  C6    . DA  B 2 14  ? 52.331  -3.163  31.584  1.00 39.38  ? 14  DA  C C6    1 
ATOM   1888 N  N6    . DA  B 2 14  ? 51.208  -3.321  30.877  1.00 34.07  ? 14  DA  C N6    1 
ATOM   1889 N  N1    . DA  B 2 14  ? 53.188  -4.200  31.692  1.00 37.80  ? 14  DA  C N1    1 
ATOM   1890 C  C2    . DA  B 2 14  ? 54.312  -4.038  32.401  1.00 39.08  ? 14  DA  C C2    1 
ATOM   1891 N  N3    . DA  B 2 14  ? 54.742  -2.959  33.052  1.00 35.36  ? 14  DA  C N3    1 
ATOM   1892 C  C4    . DA  B 2 14  ? 53.869  -1.946  32.925  1.00 34.02  ? 14  DA  C C4    1 
ATOM   1893 P  P     . DG  B 2 15  ? 58.929  -0.389  35.006  1.00 27.93  ? 15  DG  C P     1 
ATOM   1894 O  OP1   . DG  B 2 15  ? 58.536  -1.801  34.789  1.00 35.38  ? 15  DG  C OP1   1 
ATOM   1895 O  OP2   . DG  B 2 15  ? 59.941  -0.087  36.031  1.00 34.06  ? 15  DG  C OP2   1 
ATOM   1896 O  "O5'" . DG  B 2 15  ? 59.325  0.314   33.611  1.00 33.65  ? 15  DG  C "O5'" 1 
ATOM   1897 C  "C5'" . DG  B 2 15  ? 60.368  -0.202  32.782  1.00 31.93  ? 15  DG  C "C5'" 1 
ATOM   1898 C  "C4'" . DG  B 2 15  ? 59.961  -1.514  32.128  1.00 34.98  ? 15  DG  C "C4'" 1 
ATOM   1899 O  "O4'" . DG  B 2 15  ? 58.546  -1.507  31.826  1.00 31.09  ? 15  DG  C "O4'" 1 
ATOM   1900 C  "C3'" . DG  B 2 15  ? 60.675  -1.841  30.810  1.00 31.22  ? 15  DG  C "C3'" 1 
ATOM   1901 O  "O3'" . DG  B 2 15  ? 61.399  -3.055  30.952  1.00 41.38  ? 15  DG  C "O3'" 1 
ATOM   1902 C  "C2'" . DG  B 2 15  ? 59.534  -1.979  29.787  1.00 33.20  ? 15  DG  C "C2'" 1 
ATOM   1903 C  "C1'" . DG  B 2 15  ? 58.347  -2.290  30.682  1.00 26.51  ? 15  DG  C "C1'" 1 
ATOM   1904 N  N9    . DG  B 2 15  ? 57.051  -1.953  30.099  1.00 32.38  ? 15  DG  C N9    1 
ATOM   1905 C  C8    . DG  B 2 15  ? 56.468  -0.711  30.030  1.00 36.31  ? 15  DG  C C8    1 
ATOM   1906 N  N7    . DG  B 2 15  ? 55.295  -0.718  29.457  1.00 31.80  ? 15  DG  C N7    1 
ATOM   1907 C  C5    . DG  B 2 15  ? 55.084  -2.052  29.129  1.00 35.63  ? 15  DG  C C5    1 
ATOM   1908 C  C6    . DG  B 2 15  ? 53.983  -2.672  28.489  1.00 38.93  ? 15  DG  C C6    1 
ATOM   1909 O  O6    . DG  B 2 15  ? 52.942  -2.147  28.071  1.00 34.00  ? 15  DG  C O6    1 
ATOM   1910 N  N1    . DG  B 2 15  ? 54.175  -4.044  28.349  1.00 34.49  ? 15  DG  C N1    1 
ATOM   1911 C  C2    . DG  B 2 15  ? 55.288  -4.730  28.774  1.00 39.98  ? 15  DG  C C2    1 
ATOM   1912 N  N2    . DG  B 2 15  ? 55.292  -6.052  28.553  1.00 42.58  ? 15  DG  C N2    1 
ATOM   1913 N  N3    . DG  B 2 15  ? 56.325  -4.160  29.375  1.00 35.19  ? 15  DG  C N3    1 
ATOM   1914 C  C4    . DG  B 2 15  ? 56.155  -2.824  29.518  1.00 25.91  ? 15  DG  C C4    1 
ATOM   1915 P  P     . DT  B 2 16  ? 62.665  -3.363  30.012  1.00 38.00  ? 16  DT  C P     1 
ATOM   1916 O  OP1   . DT  B 2 16  ? 63.563  -4.260  30.773  1.00 41.32  ? 16  DT  C OP1   1 
ATOM   1917 O  OP2   . DT  B 2 16  ? 63.173  -2.077  29.484  1.00 34.90  ? 16  DT  C OP2   1 
ATOM   1918 O  "O5'" . DT  B 2 16  ? 62.039  -4.181  28.791  1.00 39.99  ? 16  DT  C "O5'" 1 
ATOM   1919 C  "C5'" . DT  B 2 16  ? 61.408  -5.425  29.036  1.00 31.81  ? 16  DT  C "C5'" 1 
ATOM   1920 C  "C4'" . DT  B 2 16  ? 60.679  -5.922  27.802  1.00 38.12  ? 16  DT  C "C4'" 1 
ATOM   1921 O  "O4'" . DT  B 2 16  ? 59.442  -5.199  27.632  1.00 35.96  ? 16  DT  C "O4'" 1 
ATOM   1922 C  "C3'" . DT  B 2 16  ? 61.442  -5.774  26.479  1.00 36.29  ? 16  DT  C "C3'" 1 
ATOM   1923 O  "O3'" . DT  B 2 16  ? 61.693  -7.065  25.940  1.00 39.45  ? 16  DT  C "O3'" 1 
ATOM   1924 C  "C2'" . DT  B 2 16  ? 60.492  -4.953  25.583  1.00 35.27  ? 16  DT  C "C2'" 1 
ATOM   1925 C  "C1'" . DT  B 2 16  ? 59.149  -5.171  26.264  1.00 35.01  ? 16  DT  C "C1'" 1 
ATOM   1926 N  N1    . DT  B 2 16  ? 58.137  -4.098  26.016  1.00 37.52  ? 16  DT  C N1    1 
ATOM   1927 C  C2    . DT  B 2 16  ? 56.920  -4.445  25.480  1.00 38.02  ? 16  DT  C C2    1 
ATOM   1928 O  O2    . DT  B 2 16  ? 56.626  -5.588  25.179  1.00 40.54  ? 16  DT  C O2    1 
ATOM   1929 N  N3    . DT  B 2 16  ? 56.053  -3.402  25.302  1.00 36.30  ? 16  DT  C N3    1 
ATOM   1930 C  C4    . DT  B 2 16  ? 56.273  -2.072  25.604  1.00 36.96  ? 16  DT  C C4    1 
ATOM   1931 O  O4    . DT  B 2 16  ? 55.427  -1.205  25.406  1.00 41.83  ? 16  DT  C O4    1 
ATOM   1932 C  C5    . DT  B 2 16  ? 57.568  -1.773  26.168  1.00 34.23  ? 16  DT  C C5    1 
ATOM   1933 C  C7    . DT  B 2 16  ? 57.920  -0.362  26.535  1.00 28.60  ? 16  DT  C C7    1 
ATOM   1934 C  C6    . DT  B 2 16  ? 58.429  -2.790  26.349  1.00 31.67  ? 16  DT  C C6    1 
ATOM   1935 P  P     . DT  B 2 17  ? 62.649  -7.254  24.663  1.00 38.67  ? 17  DT  C P     1 
ATOM   1936 O  OP1   . DT  B 2 17  ? 63.372  -8.532  24.852  1.00 41.82  ? 17  DT  C OP1   1 
ATOM   1937 O  OP2   . DT  B 2 17  ? 63.413  -6.004  24.456  1.00 42.25  ? 17  DT  C OP2   1 
ATOM   1938 O  "O5'" . DT  B 2 17  ? 61.621  -7.430  23.453  1.00 39.82  ? 17  DT  C "O5'" 1 
ATOM   1939 C  "C5'" . DT  B 2 17  ? 60.661  -8.472  23.506  1.00 41.14  ? 17  DT  C "C5'" 1 
ATOM   1940 C  "C4'" . DT  B 2 17  ? 59.620  -8.320  22.412  1.00 45.30  ? 17  DT  C "C4'" 1 
ATOM   1941 O  "O4'" . DT  B 2 17  ? 58.782  -7.161  22.673  1.00 40.26  ? 17  DT  C "O4'" 1 
ATOM   1942 C  "C3'" . DT  B 2 17  ? 60.171  -8.128  20.995  1.00 50.16  ? 17  DT  C "C3'" 1 
ATOM   1943 O  "O3'" . DT  B 2 17  ? 59.389  -8.885  20.100  1.00 48.45  ? 17  DT  C "O3'" 1 
ATOM   1944 C  "C2'" . DT  B 2 17  ? 59.961  -6.636  20.759  1.00 38.95  ? 17  DT  C "C2'" 1 
ATOM   1945 C  "C1'" . DT  B 2 17  ? 58.637  -6.448  21.470  1.00 43.06  ? 17  DT  C "C1'" 1 
ATOM   1946 N  N1    . DT  B 2 17  ? 58.300  -5.036  21.777  1.00 37.12  ? 17  DT  C N1    1 
ATOM   1947 C  C2    . DT  B 2 17  ? 57.001  -4.613  21.620  1.00 40.18  ? 17  DT  C C2    1 
ATOM   1948 O  O2    . DT  B 2 17  ? 56.104  -5.344  21.242  1.00 45.62  ? 17  DT  C O2    1 
ATOM   1949 N  N3    . DT  B 2 17  ? 56.786  -3.298  21.925  1.00 38.25  ? 17  DT  C N3    1 
ATOM   1950 C  C4    . DT  B 2 17  ? 57.721  -2.379  22.361  1.00 36.25  ? 17  DT  C C4    1 
ATOM   1951 O  O4    . DT  B 2 17  ? 57.428  -1.214  22.610  1.00 33.30  ? 17  DT  C O4    1 
ATOM   1952 C  C5    . DT  B 2 17  ? 59.066  -2.888  22.502  1.00 37.44  ? 17  DT  C C5    1 
ATOM   1953 C  C7    . DT  B 2 17  ? 60.167  -1.986  22.967  1.00 26.79  ? 17  DT  C C7    1 
ATOM   1954 C  C6    . DT  B 2 17  ? 59.288  -4.177  22.206  1.00 30.95  ? 17  DT  C C6    1 
ATOM   1955 P  P     . DC  B 2 18  ? 60.074  -9.784  18.962  1.00 57.30  ? 18  DC  C P     1 
ATOM   1956 O  OP1   . DC  B 2 18  ? 60.037  -11.181 19.452  1.00 59.00  ? 18  DC  C OP1   1 
ATOM   1957 O  OP2   . DC  B 2 18  ? 61.365  -9.176  18.575  1.00 53.34  ? 18  DC  C OP2   1 
ATOM   1958 O  "O5'" . DC  B 2 18  ? 59.042  -9.667  17.746  1.00 53.98  ? 18  DC  C "O5'" 1 
ATOM   1959 C  "C5'" . DC  B 2 18  ? 57.818  -10.370 17.813  1.00 51.06  ? 18  DC  C "C5'" 1 
ATOM   1960 C  "C4'" . DC  B 2 18  ? 56.616  -9.445  17.678  1.00 52.63  ? 18  DC  C "C4'" 1 
ATOM   1961 O  "O4'" . DC  B 2 18  ? 56.789  -8.243  18.451  1.00 49.64  ? 18  DC  C "O4'" 1 
ATOM   1962 C  "C3'" . DC  B 2 18  ? 56.330  -8.917  16.291  1.00 54.34  ? 18  DC  C "C3'" 1 
ATOM   1963 O  "O3'" . DC  B 2 18  ? 55.694  -9.915  15.504  1.00 62.67  ? 18  DC  C "O3'" 1 
ATOM   1964 C  "C2'" . DC  B 2 18  ? 55.377  -7.757  16.601  1.00 49.46  ? 18  DC  C "C2'" 1 
ATOM   1965 C  "C1'" . DC  B 2 18  ? 55.792  -7.330  18.021  1.00 48.57  ? 18  DC  C "C1'" 1 
ATOM   1966 N  N1    . DC  B 2 18  ? 56.315  -5.935  18.081  1.00 42.25  ? 18  DC  C N1    1 
ATOM   1967 C  C2    . DC  B 2 18  ? 55.410  -4.866  18.075  1.00 44.18  ? 18  DC  C C2    1 
ATOM   1968 O  O2    . DC  B 2 18  ? 54.196  -5.103  18.035  1.00 41.49  ? 18  DC  C O2    1 
ATOM   1969 N  N3    . DC  B 2 18  ? 55.889  -3.600  18.118  1.00 41.61  ? 18  DC  C N3    1 
ATOM   1970 C  C4    . DC  B 2 18  ? 57.204  -3.385  18.161  1.00 42.29  ? 18  DC  C C4    1 
ATOM   1971 N  N4    . DC  B 2 18  ? 57.627  -2.118  18.203  1.00 42.89  ? 18  DC  C N4    1 
ATOM   1972 C  C5    . DC  B 2 18  ? 58.143  -4.461  18.162  1.00 37.48  ? 18  DC  C C5    1 
ATOM   1973 C  C6    . DC  B 2 18  ? 57.659  -5.708  18.117  1.00 42.40  ? 18  DC  C C6    1 
ATOM   1974 P  P     . DC  B 2 19  ? 55.633  -9.765  13.903  1.00 62.85  ? 19  DC  C P     1 
ATOM   1975 O  OP1   . DC  B 2 19  ? 55.031  -11.004 13.366  1.00 76.80  ? 19  DC  C OP1   1 
ATOM   1976 O  OP2   . DC  B 2 19  ? 56.967  -9.333  13.433  1.00 57.60  ? 19  DC  C OP2   1 
ATOM   1977 O  "O5'" . DC  B 2 19  ? 54.586  -8.578  13.660  1.00 62.63  ? 19  DC  C "O5'" 1 
ATOM   1978 C  "C5'" . DC  B 2 19  ? 53.207  -8.777  13.951  1.00 56.95  ? 19  DC  C "C5'" 1 
ATOM   1979 C  "C4'" . DC  B 2 19  ? 52.396  -7.524  13.661  1.00 63.24  ? 19  DC  C "C4'" 1 
ATOM   1980 O  "O4'" . DC  B 2 19  ? 52.744  -6.483  14.597  1.00 53.52  ? 19  DC  C "O4'" 1 
ATOM   1981 C  "C3'" . DC  B 2 19  ? 52.637  -6.892  12.306  1.00 59.62  ? 19  DC  C "C3'" 1 
ATOM   1982 O  "O3'" . DC  B 2 19  ? 51.871  -7.560  11.312  1.00 71.97  ? 19  DC  C "O3'" 1 
ATOM   1983 C  "C2'" . DC  B 2 19  ? 52.133  -5.468  12.533  1.00 62.81  ? 19  DC  C "C2'" 1 
ATOM   1984 C  "C1'" . DC  B 2 19  ? 52.462  -5.223  14.011  1.00 59.11  ? 19  DC  C "C1'" 1 
ATOM   1985 N  N1    . DC  B 2 19  ? 53.649  -4.344  14.214  1.00 20.00  ? 19  DC  C N1    1 
ATOM   1986 C  C2    . DC  B 2 19  ? 53.489  -2.961  14.264  1.00 20.00  ? 19  DC  C C2    1 
ATOM   1987 O  O2    . DC  B 2 19  ? 52.355  -2.485  14.134  1.00 20.00  ? 19  DC  C O2    1 
ATOM   1988 N  N3    . DC  B 2 19  ? 54.586  -2.185  14.446  1.00 20.00  ? 19  DC  C N3    1 
ATOM   1989 C  C4    . DC  B 2 19  ? 55.800  -2.732  14.584  1.00 20.00  ? 19  DC  C C4    1 
ATOM   1990 N  N4    . DC  B 2 19  ? 56.835  -1.926  14.765  1.00 20.00  ? 19  DC  C N4    1 
ATOM   1991 C  C5    . DC  B 2 19  ? 55.990  -4.148  14.531  1.00 20.00  ? 19  DC  C C5    1 
ATOM   1992 C  C6    . DC  B 2 19  ? 54.877  -4.908  14.350  1.00 20.00  ? 19  DC  C C6    1 
ATOM   1993 P  P     . DG  B 2 20  ? 52.298  -7.470  9.765   1.00 73.27  ? 20  DG  C P     1 
ATOM   1994 O  OP1   . DG  B 2 20  ? 51.389  -8.354  9.002   1.00 79.90  ? 20  DG  C OP1   1 
ATOM   1995 O  OP2   . DG  B 2 20  ? 53.760  -7.664  9.683   1.00 70.34  ? 20  DG  C OP2   1 
ATOM   1996 O  "O5'" . DG  B 2 20  ? 51.989  -5.954  9.365   1.00 65.48  ? 20  DG  C "O5'" 1 
ATOM   1997 C  "C5'" . DG  B 2 20  ? 50.647  -5.522  9.244   1.00 69.58  ? 20  DG  C "C5'" 1 
ATOM   1998 C  "C4'" . DG  B 2 20  ? 50.568  -4.013  9.106   1.00 71.69  ? 20  DG  C "C4'" 1 
ATOM   1999 O  "O4'" . DG  B 2 20  ? 51.089  -3.377  10.297  1.00 68.07  ? 20  DG  C "O4'" 1 
ATOM   2000 C  "C3'" . DG  B 2 20  ? 51.393  -3.412  7.988   1.00 73.79  ? 20  DG  C "C3'" 1 
ATOM   2001 O  "O3'" . DG  B 2 20  ? 50.729  -3.616  6.712   1.00 74.70  ? 20  DG  C "O3'" 1 
ATOM   2002 C  "C2'" . DG  B 2 20  ? 51.435  -1.955  8.432   1.00 73.46  ? 20  DG  C "C2'" 1 
ATOM   2003 C  "C1'" . DG  B 2 20  ? 51.591  -2.094  9.949   1.00 66.79  ? 20  DG  C "C1'" 1 
ATOM   2004 N  N9    . DG  B 2 20  ? 52.976  -1.982  10.407  1.00 61.33  ? 20  DG  C N9    1 
ATOM   2005 C  C8    . DG  B 2 20  ? 53.894  -2.997  10.537  1.00 57.71  ? 20  DG  C C8    1 
ATOM   2006 N  N7    . DG  B 2 20  ? 55.057  -2.593  10.969  1.00 51.68  ? 20  DG  C N7    1 
ATOM   2007 C  C5    . DG  B 2 20  ? 54.902  -1.222  11.136  1.00 48.29  ? 20  DG  C C5    1 
ATOM   2008 C  C6    . DG  B 2 20  ? 55.825  -0.245  11.582  1.00 38.99  ? 20  DG  C C6    1 
ATOM   2009 O  O6    . DG  B 2 20  ? 57.003  -0.405  11.931  1.00 47.58  ? 20  DG  C O6    1 
ATOM   2010 N  N1    . DG  B 2 20  ? 55.260  1.027   11.603  1.00 43.79  ? 20  DG  C N1    1 
ATOM   2011 C  C2    . DG  B 2 20  ? 53.967  1.319   11.237  1.00 46.26  ? 20  DG  C C2    1 
ATOM   2012 N  N2    . DG  B 2 20  ? 53.599  2.604   11.324  1.00 47.40  ? 20  DG  C N2    1 
ATOM   2013 N  N3    . DG  B 2 20  ? 53.093  0.414   10.819  1.00 46.54  ? 20  DG  C N3    1 
ATOM   2014 C  C4    . DG  B 2 20  ? 53.627  -0.831  10.793  1.00 49.10  ? 20  DG  C C4    1 
ATOM   2015 P  P     . DG  B 2 21  ? 50.443  -2.420  5.667   1.00 81.07  ? 21  DG  C P     1 
ATOM   2016 O  OP1   . DG  B 2 21  ? 49.369  -1.559  6.210   1.00 77.29  ? 21  DG  C OP1   1 
ATOM   2017 O  OP2   . DG  B 2 21  ? 50.237  -3.073  4.355   1.00 87.98  ? 21  DG  C OP2   1 
ATOM   2018 O  "O5'" . DG  B 2 21  ? 51.811  -1.588  5.578   1.00 70.49  ? 21  DG  C "O5'" 1 
ATOM   2019 C  "C5'" . DG  B 2 21  ? 51.862  -0.370  4.829   1.00 72.37  ? 21  DG  C "C5'" 1 
ATOM   2020 C  "C4'" . DG  B 2 21  ? 51.923  0.841   5.750   1.00 64.93  ? 21  DG  C "C4'" 1 
ATOM   2021 O  "O4'" . DG  B 2 21  ? 52.539  0.466   7.000   1.00 60.32  ? 21  DG  C "O4'" 1 
ATOM   2022 C  "C3'" . DG  B 2 21  ? 52.759  1.995   5.228   1.00 62.97  ? 21  DG  C "C3'" 1 
ATOM   2023 O  "O3'" . DG  B 2 21  ? 51.953  2.851   4.432   1.00 63.69  ? 21  DG  C "O3'" 1 
ATOM   2024 C  "C2'" . DG  B 2 21  ? 53.213  2.694   6.509   1.00 58.82  ? 21  DG  C "C2'" 1 
ATOM   2025 C  "C1'" . DG  B 2 21  ? 53.290  1.546   7.520   1.00 59.00  ? 21  DG  C "C1'" 1 
ATOM   2026 N  N9    . DG  B 2 21  ? 54.647  1.072   7.787   1.00 54.98  ? 21  DG  C N9    1 
ATOM   2027 C  C8    . DG  B 2 21  ? 55.112  -0.213  7.643   1.00 48.31  ? 21  DG  C C8    1 
ATOM   2028 N  N7    . DG  B 2 21  ? 56.368  -0.352  7.962   1.00 49.20  ? 21  DG  C N7    1 
ATOM   2029 C  C5    . DG  B 2 21  ? 56.764  0.922   8.347   1.00 42.66  ? 21  DG  C C5    1 
ATOM   2030 C  C6    . DG  B 2 21  ? 58.023  1.387   8.797   1.00 43.36  ? 21  DG  C C6    1 
ATOM   2031 O  O6    . DG  B 2 21  ? 59.069  0.741   8.949   1.00 44.26  ? 21  DG  C O6    1 
ATOM   2032 N  N1    . DG  B 2 21  ? 57.998  2.749   9.083   1.00 37.24  ? 21  DG  C N1    1 
ATOM   2033 C  C2    . DG  B 2 21  ? 56.897  3.560   8.951   1.00 42.15  ? 21  DG  C C2    1 
ATOM   2034 N  N2    . DG  B 2 21  ? 57.068  4.850   9.275   1.00 42.36  ? 21  DG  C N2    1 
ATOM   2035 N  N3    . DG  B 2 21  ? 55.709  3.138   8.531   1.00 44.87  ? 21  DG  C N3    1 
ATOM   2036 C  C4    . DG  B 2 21  ? 55.717  1.812   8.247   1.00 43.98  ? 21  DG  C C4    1 
ATOM   2037 P  P     . DC  B 2 22  ? 52.421  3.250   2.949   1.00 63.15  ? 22  DC  C P     1 
ATOM   2038 O  OP1   . DC  B 2 22  ? 51.284  3.909   2.268   1.00 69.10  ? 22  DC  C OP1   1 
ATOM   2039 O  OP2   . DC  B 2 22  ? 53.048  2.051   2.350   1.00 61.10  ? 22  DC  C OP2   1 
ATOM   2040 O  "O5'" . DC  B 2 22  ? 53.580  4.325   3.185   1.00 59.68  ? 22  DC  C "O5'" 1 
ATOM   2041 C  "C5'" . DC  B 2 22  ? 53.352  5.463   4.010   1.00 53.73  ? 22  DC  C "C5'" 1 
ATOM   2042 C  "C4'" . DC  B 2 22  ? 54.675  6.079   4.418   1.00 59.21  ? 22  DC  C "C4'" 1 
ATOM   2043 O  "O4'" . DC  B 2 22  ? 55.373  5.147   5.264   1.00 57.82  ? 22  DC  C "O4'" 1 
ATOM   2044 C  "C3'" . DC  B 2 22  ? 55.611  6.370   3.249   1.00 59.04  ? 22  DC  C "C3'" 1 
ATOM   2045 O  "O3'" . DC  B 2 22  ? 55.634  7.764   2.962   1.00 59.35  ? 22  DC  C "O3'" 1 
ATOM   2046 C  "C2'" . DC  B 2 22  ? 56.988  5.875   3.701   1.00 52.67  ? 22  DC  C "C2'" 1 
ATOM   2047 C  "C1'" . DC  B 2 22  ? 56.759  5.284   5.088   1.00 52.91  ? 22  DC  C "C1'" 1 
ATOM   2048 N  N1    . DC  B 2 22  ? 57.383  3.945   5.248   1.00 47.11  ? 22  DC  C N1    1 
ATOM   2049 C  C2    . DC  B 2 22  ? 58.616  3.826   5.896   1.00 43.63  ? 22  DC  C C2    1 
ATOM   2050 O  O2    . DC  B 2 22  ? 59.166  4.843   6.337   1.00 43.26  ? 22  DC  C O2    1 
ATOM   2051 N  N3    . DC  B 2 22  ? 59.172  2.597   6.026   1.00 43.67  ? 22  DC  C N3    1 
ATOM   2052 C  C4    . DC  B 2 22  ? 58.546  1.525   5.536   1.00 44.23  ? 22  DC  C C4    1 
ATOM   2053 N  N4    . DC  B 2 22  ? 59.132  0.334   5.689   1.00 49.10  ? 22  DC  C N4    1 
ATOM   2054 C  C5    . DC  B 2 22  ? 57.291  1.628   4.868   1.00 46.30  ? 22  DC  C C5    1 
ATOM   2055 C  C6    . DC  B 2 22  ? 56.753  2.845   4.745   1.00 46.68  ? 22  DC  C C6    1 
ATOM   2056 P  P     . DG  B 2 23  ? 56.371  8.294   1.635   1.00 67.73  ? 23  DG  C P     1 
ATOM   2057 O  OP1   . DG  B 2 23  ? 55.634  9.480   1.146   1.00 79.58  ? 23  DG  C OP1   1 
ATOM   2058 O  OP2   . DG  B 2 23  ? 56.565  7.128   0.744   1.00 55.05  ? 23  DG  C OP2   1 
ATOM   2059 O  "O5'" . DG  B 2 23  ? 57.826  8.730   2.140   1.00 60.30  ? 23  DG  C "O5'" 1 
ATOM   2060 C  "C5'" . DG  B 2 23  ? 58.006  9.273   3.445   1.00 63.28  ? 23  DG  C "C5'" 1 
ATOM   2061 C  "C4'" . DG  B 2 23  ? 59.485  9.413   3.772   1.00 60.38  ? 23  DG  C "C4'" 1 
ATOM   2062 O  "O4'" . DG  B 2 23  ? 60.010  8.144   4.245   1.00 55.33  ? 23  DG  C "O4'" 1 
ATOM   2063 C  "C3'" . DG  B 2 23  ? 60.370  9.824   2.599   1.00 61.25  ? 23  DG  C "C3'" 1 
ATOM   2064 O  "O3'" . DG  B 2 23  ? 61.384  10.708  3.049   1.00 61.68  ? 23  DG  C "O3'" 1 
ATOM   2065 C  "C2'" . DG  B 2 23  ? 60.955  8.495   2.126   1.00 50.26  ? 23  DG  C "C2'" 1 
ATOM   2066 C  "C1'" . DG  B 2 23  ? 61.100  7.740   3.439   1.00 52.26  ? 23  DG  C "C1'" 1 
ATOM   2067 N  N9    . DG  B 2 23  ? 61.039  6.289   3.288   1.00 47.56  ? 23  DG  C N9    1 
ATOM   2068 C  C8    . DG  B 2 23  ? 60.035  5.564   2.698   1.00 42.22  ? 23  DG  C C8    1 
ATOM   2069 N  N7    . DG  B 2 23  ? 60.237  4.278   2.718   1.00 44.93  ? 23  DG  C N7    1 
ATOM   2070 C  C5    . DG  B 2 23  ? 61.459  4.137   3.361   1.00 38.03  ? 23  DG  C C5    1 
ATOM   2071 C  C6    . DG  B 2 23  ? 62.196  2.970   3.669   1.00 40.16  ? 23  DG  C C6    1 
ATOM   2072 O  O6    . DG  B 2 23  ? 61.902  1.791   3.425   1.00 45.60  ? 23  DG  C O6    1 
ATOM   2073 N  N1    . DG  B 2 23  ? 63.386  3.271   4.325   1.00 37.18  ? 23  DG  C N1    1 
ATOM   2074 C  C2    . DG  B 2 23  ? 63.810  4.540   4.643   1.00 36.71  ? 23  DG  C C2    1 
ATOM   2075 N  N2    . DG  B 2 23  ? 64.987  4.630   5.279   1.00 38.54  ? 23  DG  C N2    1 
ATOM   2076 N  N3    . DG  B 2 23  ? 63.129  5.643   4.360   1.00 39.47  ? 23  DG  C N3    1 
ATOM   2077 C  C4    . DG  B 2 23  ? 61.967  5.367   3.720   1.00 37.10  ? 23  DG  C C4    1 
ATOM   2078 P  P     . DC  B 2 24  ? 62.224  11.576  1.990   1.00 80.30  ? 24  DC  C P     1 
ATOM   2079 O  OP1   . DC  B 2 24  ? 62.588  12.849  2.651   1.00 67.69  ? 24  DC  C OP1   1 
ATOM   2080 O  OP2   . DC  B 2 24  ? 61.464  11.593  0.719   1.00 58.19  ? 24  DC  C OP2   1 
ATOM   2081 O  "O5'" . DC  B 2 24  ? 63.550  10.713  1.757   1.00 55.83  ? 24  DC  C "O5'" 1 
ATOM   2082 C  "C5'" . DC  B 2 24  ? 64.437  10.471  2.840   1.00 44.22  ? 24  DC  C "C5'" 1 
ATOM   2083 C  "C4'" . DC  B 2 24  ? 65.597  9.596   2.404   1.00 45.21  ? 24  DC  C "C4'" 1 
ATOM   2084 O  "O4'" . DC  B 2 24  ? 65.215  8.197   2.490   1.00 49.23  ? 24  DC  C "O4'" 1 
ATOM   2085 C  "C3'" . DC  B 2 24  ? 66.076  9.823   0.965   1.00 43.82  ? 24  DC  C "C3'" 1 
ATOM   2086 O  "O3'" . DC  B 2 24  ? 67.492  9.929   0.938   1.00 47.12  ? 24  DC  C "O3'" 1 
ATOM   2087 C  "C2'" . DC  B 2 24  ? 65.595  8.570   0.232   1.00 52.01  ? 24  DC  C "C2'" 1 
ATOM   2088 C  "C1'" . DC  B 2 24  ? 65.668  7.533   1.338   1.00 45.28  ? 24  DC  C "C1'" 1 
ATOM   2089 N  N1    . DC  B 2 24  ? 64.804  6.343   1.095   1.00 35.81  ? 24  DC  C N1    1 
ATOM   2090 C  C2    . DC  B 2 24  ? 65.214  5.086   1.553   1.00 39.87  ? 24  DC  C C2    1 
ATOM   2091 O  O2    . DC  B 2 24  ? 66.285  4.987   2.165   1.00 40.74  ? 24  DC  C O2    1 
ATOM   2092 N  N3    . DC  B 2 24  ? 64.420  4.012   1.318   1.00 37.09  ? 24  DC  C N3    1 
ATOM   2093 C  C4    . DC  B 2 24  ? 63.273  4.162   0.654   1.00 38.36  ? 24  DC  C C4    1 
ATOM   2094 N  N4    . DC  B 2 24  ? 62.523  3.074   0.446   1.00 40.79  ? 24  DC  C N4    1 
ATOM   2095 C  C5    . DC  B 2 24  ? 62.842  5.434   0.176   1.00 36.91  ? 24  DC  C C5    1 
ATOM   2096 C  C6    . DC  B 2 24  ? 63.632  6.485   0.414   1.00 36.91  ? 24  DC  C C6    1 
ATOM   2097 P  P     . DG  B 2 25  ? 68.241  10.587  -0.323  1.00 46.06  ? 25  DG  C P     1 
ATOM   2098 O  OP1   . DG  B 2 25  ? 68.706  11.931  0.084   1.00 61.09  ? 25  DG  C OP1   1 
ATOM   2099 O  OP2   . DG  B 2 25  ? 67.376  10.447  -1.515  1.00 45.55  ? 25  DG  C OP2   1 
ATOM   2100 O  "O5'" . DG  B 2 25  ? 69.514  9.645   -0.537  1.00 44.95  ? 25  DG  C "O5'" 1 
ATOM   2101 C  "C5'" . DG  B 2 25  ? 70.385  9.369   0.554   1.00 42.63  ? 25  DG  C "C5'" 1 
ATOM   2102 C  "C4'" . DG  B 2 25  ? 71.178  8.096   0.309   1.00 42.67  ? 25  DG  C "C4'" 1 
ATOM   2103 O  "O4'" . DG  B 2 25  ? 70.305  6.944   0.444   1.00 42.12  ? 25  DG  C "O4'" 1 
ATOM   2104 C  "C3'" . DG  B 2 25  ? 71.819  7.988   -1.073  1.00 40.76  ? 25  DG  C "C3'" 1 
ATOM   2105 O  "O3'" . DG  B 2 25  ? 73.110  7.403   -0.966  1.00 48.07  ? 25  DG  C "O3'" 1 
ATOM   2106 C  "C2'" . DG  B 2 25  ? 70.854  7.085   -1.838  1.00 37.65  ? 25  DG  C "C2'" 1 
ATOM   2107 C  "C1'" . DG  B 2 25  ? 70.336  6.169   -0.737  1.00 39.37  ? 25  DG  C "C1'" 1 
ATOM   2108 N  N9    . DG  B 2 25  ? 68.987  5.669   -0.989  1.00 37.30  ? 25  DG  C N9    1 
ATOM   2109 C  C8    . DG  B 2 25  ? 67.865  6.420   -1.241  1.00 37.06  ? 25  DG  C C8    1 
ATOM   2110 N  N7    . DG  B 2 25  ? 66.791  5.705   -1.427  1.00 36.69  ? 25  DG  C N7    1 
ATOM   2111 C  C5    . DG  B 2 25  ? 67.227  4.394   -1.287  1.00 33.10  ? 25  DG  C C5    1 
ATOM   2112 C  C6    . DG  B 2 25  ? 66.506  3.180   -1.383  1.00 35.58  ? 25  DG  C C6    1 
ATOM   2113 O  O6    . DG  B 2 25  ? 65.300  3.020   -1.618  1.00 39.87  ? 25  DG  C O6    1 
ATOM   2114 N  N1    . DG  B 2 25  ? 67.328  2.075   -1.174  1.00 33.23  ? 25  DG  C N1    1 
ATOM   2115 C  C2    . DG  B 2 25  ? 68.675  2.136   -0.907  1.00 37.27  ? 25  DG  C C2    1 
ATOM   2116 N  N2    . DG  B 2 25  ? 69.300  0.961   -0.737  1.00 37.17  ? 25  DG  C N2    1 
ATOM   2117 N  N3    . DG  B 2 25  ? 69.364  3.268   -0.815  1.00 37.50  ? 25  DG  C N3    1 
ATOM   2118 C  C4    . DG  B 2 25  ? 68.577  4.354   -1.016  1.00 34.84  ? 25  DG  C C4    1 
ATOM   2119 O  "O5'" . DC  C 3 1   ? 65.289  -6.566  -3.277  1.00 71.71  ? 1   DC  D "O5'" 1 
ATOM   2120 C  "C5'" . DC  C 3 1   ? 66.564  -6.329  -3.866  1.00 60.09  ? 1   DC  D "C5'" 1 
ATOM   2121 C  "C4'" . DC  C 3 1   ? 67.547  -5.792  -2.838  1.00 62.21  ? 1   DC  D "C4'" 1 
ATOM   2122 O  "O4'" . DC  C 3 1   ? 67.531  -4.340  -2.857  1.00 57.56  ? 1   DC  D "O4'" 1 
ATOM   2123 C  "C3'" . DC  C 3 1   ? 67.267  -6.201  -1.394  1.00 57.74  ? 1   DC  D "C3'" 1 
ATOM   2124 O  "O3'" . DC  C 3 1   ? 68.495  -6.445  -0.717  1.00 63.25  ? 1   DC  D "O3'" 1 
ATOM   2125 C  "C2'" . DC  C 3 1   ? 66.544  -4.981  -0.827  1.00 54.09  ? 1   DC  D "C2'" 1 
ATOM   2126 C  "C1'" . DC  C 3 1   ? 67.229  -3.844  -1.570  1.00 53.41  ? 1   DC  D "C1'" 1 
ATOM   2127 N  N1    . DC  C 3 1   ? 66.372  -2.637  -1.726  1.00 47.26  ? 1   DC  D N1    1 
ATOM   2128 C  C2    . DC  C 3 1   ? 66.889  -1.374  -1.416  1.00 41.94  ? 1   DC  D C2    1 
ATOM   2129 O  O2    . DC  C 3 1   ? 68.056  -1.282  -1.016  1.00 44.76  ? 1   DC  D O2    1 
ATOM   2130 N  N3    . DC  C 3 1   ? 66.095  -0.286  -1.567  1.00 39.46  ? 1   DC  D N3    1 
ATOM   2131 C  C4    . DC  C 3 1   ? 64.841  -0.428  -2.002  1.00 39.42  ? 1   DC  D C4    1 
ATOM   2132 N  N4    . DC  C 3 1   ? 64.097  0.674   -2.134  1.00 40.04  ? 1   DC  D N4    1 
ATOM   2133 C  C5    . DC  C 3 1   ? 64.297  -1.707  -2.323  1.00 35.65  ? 1   DC  D C5    1 
ATOM   2134 C  C6    . DC  C 3 1   ? 65.089  -2.773  -2.171  1.00 45.15  ? 1   DC  D C6    1 
ATOM   2135 P  P     . DG  C 3 2   ? 68.504  -6.967  0.803   1.00 75.51  ? 2   DG  D P     1 
ATOM   2136 O  OP1   . DG  C 3 2   ? 69.544  -8.014  0.903   1.00 69.40  ? 2   DG  D OP1   1 
ATOM   2137 O  OP2   . DG  C 3 2   ? 67.114  -7.274  1.209   1.00 69.62  ? 2   DG  D OP2   1 
ATOM   2138 O  "O5'" . DG  C 3 2   ? 68.987  -5.692  1.636   1.00 66.92  ? 2   DG  D "O5'" 1 
ATOM   2139 C  "C5'" . DG  C 3 2   ? 70.242  -5.093  1.343   1.00 54.03  ? 2   DG  D "C5'" 1 
ATOM   2140 C  "C4'" . DG  C 3 2   ? 70.482  -3.880  2.222   1.00 55.81  ? 2   DG  D "C4'" 1 
ATOM   2141 O  "O4'" . DG  C 3 2   ? 69.605  -2.799  1.813   1.00 54.17  ? 2   DG  D "O4'" 1 
ATOM   2142 C  "C3'" . DG  C 3 2   ? 70.224  -4.099  3.712   1.00 54.54  ? 2   DG  D "C3'" 1 
ATOM   2143 O  "O3'" . DG  C 3 2   ? 71.234  -3.451  4.470   1.00 59.86  ? 2   DG  D "O3'" 1 
ATOM   2144 C  "C2'" . DG  C 3 2   ? 68.855  -3.455  3.928   1.00 51.08  ? 2   DG  D "C2'" 1 
ATOM   2145 C  "C1'" . DG  C 3 2   ? 68.901  -2.308  2.931   1.00 48.89  ? 2   DG  D "C1'" 1 
ATOM   2146 N  N9    . DG  C 3 2   ? 67.585  -1.865  2.483   1.00 39.01  ? 2   DG  D N9    1 
ATOM   2147 C  C8    . DG  C 3 2   ? 66.518  -2.657  2.132   1.00 41.18  ? 2   DG  D C8    1 
ATOM   2148 N  N7    . DG  C 3 2   ? 65.467  -1.978  1.762   1.00 41.92  ? 2   DG  D N7    1 
ATOM   2149 C  C5    . DG  C 3 2   ? 65.864  -0.651  1.869   1.00 39.94  ? 2   DG  D C5    1 
ATOM   2150 C  C6    . DG  C 3 2   ? 65.148  0.540   1.601   1.00 43.35  ? 2   DG  D C6    1 
ATOM   2151 O  O6    . DG  C 3 2   ? 63.981  0.661   1.202   1.00 41.42  ? 2   DG  D O6    1 
ATOM   2152 N  N1    . DG  C 3 2   ? 65.924  1.672   1.840   1.00 38.70  ? 2   DG  D N1    1 
ATOM   2153 C  C2    . DG  C 3 2   ? 67.226  1.654   2.283   1.00 41.19  ? 2   DG  D C2    1 
ATOM   2154 N  N2    . DG  C 3 2   ? 67.812  2.848   2.457   1.00 38.27  ? 2   DG  D N2    1 
ATOM   2155 N  N3    . DG  C 3 2   ? 67.907  0.545   2.538   1.00 39.81  ? 2   DG  D N3    1 
ATOM   2156 C  C4    . DG  C 3 2   ? 67.166  -0.566  2.309   1.00 39.09  ? 2   DG  D C4    1 
ATOM   2157 P  P     . DC  C 3 3   ? 71.411  -3.774  6.033   1.00 60.57  ? 3   DC  D P     1 
ATOM   2158 O  OP1   . DC  C 3 3   ? 72.865  -3.796  6.308   1.00 57.53  ? 3   DC  D OP1   1 
ATOM   2159 O  OP2   . DC  C 3 3   ? 70.580  -4.953  6.361   1.00 61.08  ? 3   DC  D OP2   1 
ATOM   2160 O  "O5'" . DC  C 3 3   ? 70.783  -2.492  6.752   1.00 53.75  ? 3   DC  D "O5'" 1 
ATOM   2161 C  "C5'" . DC  C 3 3   ? 71.373  -1.220  6.538   1.00 51.12  ? 3   DC  D "C5'" 1 
ATOM   2162 C  "C4'" . DC  C 3 3   ? 70.396  -0.095  6.830   1.00 51.23  ? 3   DC  D "C4'" 1 
ATOM   2163 O  "O4'" . DC  C 3 3   ? 69.232  -0.208  5.990   1.00 52.64  ? 3   DC  D "O4'" 1 
ATOM   2164 C  "C3'" . DC  C 3 3   ? 69.865  -0.034  8.266   1.00 44.94  ? 3   DC  D "C3'" 1 
ATOM   2165 O  "O3'" . DC  C 3 3   ? 70.453  1.074   8.931   1.00 49.11  ? 3   DC  D "O3'" 1 
ATOM   2166 C  "C2'" . DC  C 3 3   ? 68.339  0.141   8.102   1.00 46.87  ? 3   DC  D "C2'" 1 
ATOM   2167 C  "C1'" . DC  C 3 3   ? 68.202  0.493   6.624   1.00 42.69  ? 3   DC  D "C1'" 1 
ATOM   2168 N  N1    . DC  C 3 3   ? 66.895  0.101   6.011   1.00 38.73  ? 3   DC  D N1    1 
ATOM   2169 C  C2    . DC  C 3 3   ? 65.979  1.095   5.650   1.00 41.75  ? 3   DC  D C2    1 
ATOM   2170 O  O2    . DC  C 3 3   ? 66.266  2.281   5.851   1.00 46.92  ? 3   DC  D O2    1 
ATOM   2171 N  N3    . DC  C 3 3   ? 64.800  0.730   5.089   1.00 41.25  ? 3   DC  D N3    1 
ATOM   2172 C  C4    . DC  C 3 3   ? 64.527  -0.560  4.888   1.00 41.17  ? 3   DC  D C4    1 
ATOM   2173 N  N4    . DC  C 3 3   ? 63.350  -0.870  4.332   1.00 40.33  ? 3   DC  D N4    1 
ATOM   2174 C  C5    . DC  C 3 3   ? 65.448  -1.588  5.247   1.00 42.21  ? 3   DC  D C5    1 
ATOM   2175 C  C6    . DC  C 3 3   ? 66.610  -1.216  5.799   1.00 45.02  ? 3   DC  D C6    1 
ATOM   2176 P  P     . DG  C 3 4   ? 70.368  1.220   10.528  1.00 42.40  ? 4   DG  D P     1 
ATOM   2177 O  OP1   . DG  C 3 4   ? 71.696  1.684   10.989  1.00 48.01  ? 4   DG  D OP1   1 
ATOM   2178 O  OP2   . DG  C 3 4   ? 69.788  -0.020  11.089  1.00 45.57  ? 4   DG  D OP2   1 
ATOM   2179 O  "O5'" . DG  C 3 4   ? 69.323  2.410   10.732  1.00 40.56  ? 4   DG  D "O5'" 1 
ATOM   2180 C  "C5'" . DG  C 3 4   ? 69.560  3.660   10.101  1.00 38.07  ? 4   DG  D "C5'" 1 
ATOM   2181 C  "C4'" . DG  C 3 4   ? 68.284  4.474   9.996   1.00 37.31  ? 4   DG  D "C4'" 1 
ATOM   2182 O  "O4'" . DG  C 3 4   ? 67.322  3.784   9.153   1.00 36.82  ? 4   DG  D "O4'" 1 
ATOM   2183 C  "C3'" . DG  C 3 4   ? 67.562  4.743   11.323  1.00 38.10  ? 4   DG  D "C3'" 1 
ATOM   2184 O  "O3'" . DG  C 3 4   ? 67.156  6.103   11.368  1.00 37.98  ? 4   DG  D "O3'" 1 
ATOM   2185 C  "C2'" . DG  C 3 4   ? 66.353  3.812   11.247  1.00 36.73  ? 4   DG  D "C2'" 1 
ATOM   2186 C  "C1'" . DG  C 3 4   ? 66.062  3.888   9.764   1.00 38.37  ? 4   DG  D "C1'" 1 
ATOM   2187 N  N9    . DG  C 3 4   ? 65.189  2.835   9.260   1.00 37.09  ? 4   DG  D N9    1 
ATOM   2188 C  C8    . DG  C 3 4   ? 65.376  1.476   9.347   1.00 33.81  ? 4   DG  D C8    1 
ATOM   2189 N  N7    . DG  C 3 4   ? 64.415  0.786   8.795   1.00 32.92  ? 4   DG  D N7    1 
ATOM   2190 C  C5    . DG  C 3 4   ? 63.539  1.752   8.312   1.00 34.95  ? 4   DG  D C5    1 
ATOM   2191 C  C6    . DG  C 3 4   ? 62.314  1.611   7.618   1.00 36.73  ? 4   DG  D C6    1 
ATOM   2192 O  O6    . DG  C 3 4   ? 61.740  0.572   7.280   1.00 37.65  ? 4   DG  D O6    1 
ATOM   2193 N  N1    . DG  C 3 4   ? 61.747  2.846   7.314   1.00 36.43  ? 4   DG  D N1    1 
ATOM   2194 C  C2    . DG  C 3 4   ? 62.295  4.063   7.639   1.00 38.34  ? 4   DG  D C2    1 
ATOM   2195 N  N2    . DG  C 3 4   ? 61.604  5.148   7.262   1.00 32.91  ? 4   DG  D N2    1 
ATOM   2196 N  N3    . DG  C 3 4   ? 63.441  4.208   8.288   1.00 37.05  ? 4   DG  D N3    1 
ATOM   2197 C  C4    . DG  C 3 4   ? 64.004  3.014   8.591   1.00 31.32  ? 4   DG  D C4    1 
ATOM   2198 P  P     . DC  C 3 5   ? 66.773  6.795   12.764  1.00 38.31  ? 5   DC  D P     1 
ATOM   2199 O  OP1   . DC  C 3 5   ? 67.575  8.034   12.854  1.00 38.54  ? 5   DC  D OP1   1 
ATOM   2200 O  OP2   . DC  C 3 5   ? 66.877  5.772   13.827  1.00 35.76  ? 5   DC  D OP2   1 
ATOM   2201 O  "O5'" . DC  C 3 5   ? 65.228  7.196   12.590  1.00 44.16  ? 5   DC  D "O5'" 1 
ATOM   2202 C  "C5'" . DC  C 3 5   ? 64.882  8.495   12.107  1.00 43.64  ? 5   DC  D "C5'" 1 
ATOM   2203 C  "C4'" . DC  C 3 5   ? 63.455  8.536   11.575  1.00 37.70  ? 5   DC  D "C4'" 1 
ATOM   2204 O  "O4'" . DC  C 3 5   ? 63.121  7.270   10.943  1.00 36.09  ? 5   DC  D "O4'" 1 
ATOM   2205 C  "C3'" . DC  C 3 5   ? 62.362  8.784   12.624  1.00 38.77  ? 5   DC  D "C3'" 1 
ATOM   2206 O  "O3'" . DC  C 3 5   ? 61.415  9.719   12.111  1.00 51.20  ? 5   DC  D "O3'" 1 
ATOM   2207 C  "C2'" . DC  C 3 5   ? 61.737  7.401   12.796  1.00 42.70  ? 5   DC  D "C2'" 1 
ATOM   2208 C  "C1'" . DC  C 3 5   ? 61.844  6.872   11.379  1.00 31.04  ? 5   DC  D "C1'" 1 
ATOM   2209 N  N1    . DC  C 3 5   ? 61.737  5.390   11.271  1.00 34.30  ? 5   DC  D N1    1 
ATOM   2210 C  C2    . DC  C 3 5   ? 60.630  4.823   10.629  1.00 39.95  ? 5   DC  D C2    1 
ATOM   2211 O  O2    . DC  C 3 5   ? 59.756  5.565   10.167  1.00 41.56  ? 5   DC  D O2    1 
ATOM   2212 N  N3    . DC  C 3 5   ? 60.547  3.473   10.534  1.00 34.99  ? 5   DC  D N3    1 
ATOM   2213 C  C4    . DC  C 3 5   ? 61.510  2.708   11.047  1.00 34.73  ? 5   DC  D C4    1 
ATOM   2214 N  N4    . DC  C 3 5   ? 61.384  1.382   10.930  1.00 36.61  ? 5   DC  D N4    1 
ATOM   2215 C  C5    . DC  C 3 5   ? 62.646  3.267   11.704  1.00 30.95  ? 5   DC  D C5    1 
ATOM   2216 C  C6    . DC  C 3 5   ? 62.718  4.599   11.791  1.00 33.52  ? 5   DC  D C6    1 
ATOM   2217 P  P     . DC  C 3 6   ? 60.613  10.705  13.095  1.00 46.85  ? 6   DC  D P     1 
ATOM   2218 O  OP1   . DC  C 3 6   ? 60.834  12.087  12.613  1.00 58.82  ? 6   DC  D OP1   1 
ATOM   2219 O  OP2   . DC  C 3 6   ? 60.953  10.344  14.489  1.00 48.32  ? 6   DC  D OP2   1 
ATOM   2220 O  "O5'" . DC  C 3 6   ? 59.078  10.346  12.831  1.00 46.09  ? 6   DC  D "O5'" 1 
ATOM   2221 C  "C5'" . DC  C 3 6   ? 58.596  9.046   13.130  1.00 49.98  ? 6   DC  D "C5'" 1 
ATOM   2222 C  "C4'" . DC  C 3 6   ? 57.249  8.807   12.478  1.00 40.67  ? 6   DC  D "C4'" 1 
ATOM   2223 O  "O4'" . DC  C 3 6   ? 57.254  7.508   11.834  1.00 40.50  ? 6   DC  D "O4'" 1 
ATOM   2224 C  "C3'" . DC  C 3 6   ? 56.066  8.791   13.437  1.00 48.61  ? 6   DC  D "C3'" 1 
ATOM   2225 O  "O3'" . DC  C 3 6   ? 54.903  9.290   12.789  1.00 60.17  ? 6   DC  D "O3'" 1 
ATOM   2226 C  "C2'" . DC  C 3 6   ? 55.931  7.311   13.774  1.00 43.52  ? 6   DC  D "C2'" 1 
ATOM   2227 C  "C1'" . DC  C 3 6   ? 56.310  6.656   12.451  1.00 42.80  ? 6   DC  D "C1'" 1 
ATOM   2228 N  N1    . DC  C 3 6   ? 56.928  5.310   12.611  1.00 36.80  ? 6   DC  D N1    1 
ATOM   2229 C  C2    . DC  C 3 6   ? 56.222  4.173   12.205  1.00 44.25  ? 6   DC  D C2    1 
ATOM   2230 O  O2    . DC  C 3 6   ? 55.094  4.308   11.717  1.00 40.71  ? 6   DC  D O2    1 
ATOM   2231 N  N3    . DC  C 3 6   ? 56.798  2.954   12.356  1.00 38.01  ? 6   DC  D N3    1 
ATOM   2232 C  C4    . DC  C 3 6   ? 58.018  2.853   12.886  1.00 38.92  ? 6   DC  D C4    1 
ATOM   2233 N  N4    . DC  C 3 6   ? 58.544  1.631   13.016  1.00 38.94  ? 6   DC  D N4    1 
ATOM   2234 C  C5    . DC  C 3 6   ? 58.752  4.001   13.307  1.00 37.47  ? 6   DC  D C5    1 
ATOM   2235 C  C6    . DC  C 3 6   ? 58.174  5.197   13.152  1.00 38.96  ? 6   DC  D C6    1 
ATOM   2236 P  P     . DG  C 3 7   ? 53.778  10.061  13.637  1.00 60.01  ? 7   DG  D P     1 
ATOM   2237 O  OP1   . DG  C 3 7   ? 52.950  10.827  12.680  1.00 61.27  ? 7   DG  D OP1   1 
ATOM   2238 O  OP2   . DG  C 3 7   ? 54.450  10.761  14.753  1.00 61.67  ? 7   DG  D OP2   1 
ATOM   2239 O  "O5'" . DG  C 3 7   ? 52.874  8.885   14.235  1.00 56.18  ? 7   DG  D "O5'" 1 
ATOM   2240 C  "C5'" . DG  C 3 7   ? 51.875  8.288   13.426  1.00 51.90  ? 7   DG  D "C5'" 1 
ATOM   2241 C  "C4'" . DG  C 3 7   ? 51.325  7.027   14.070  1.00 54.62  ? 7   DG  D "C4'" 1 
ATOM   2242 O  "O4'" . DG  C 3 7   ? 52.272  5.950   13.929  1.00 44.84  ? 7   DG  D "O4'" 1 
ATOM   2243 C  "C3'" . DG  C 3 7   ? 51.016  7.127   15.570  1.00 52.41  ? 7   DG  D "C3'" 1 
ATOM   2244 O  "O3'" . DG  C 3 7   ? 49.602  7.030   15.766  1.00 48.58  ? 7   DG  D "O3'" 1 
ATOM   2245 C  "C2'" . DG  C 3 7   ? 51.778  5.940   16.197  1.00 44.23  ? 7   DG  D "C2'" 1 
ATOM   2246 C  "C1'" . DG  C 3 7   ? 52.070  5.060   14.990  1.00 48.64  ? 7   DG  D "C1'" 1 
ATOM   2247 N  N9    . DG  C 3 7   ? 53.256  4.231   15.123  1.00 20.00  ? 7   DG  D N9    1 
ATOM   2248 C  C8    . DG  C 3 7   ? 54.518  4.622   15.506  1.00 20.00  ? 7   DG  D C8    1 
ATOM   2249 N  N7    . DG  C 3 7   ? 55.389  3.645   15.522  1.00 20.00  ? 7   DG  D N7    1 
ATOM   2250 C  C5    . DG  C 3 7   ? 54.669  2.524   15.125  1.00 20.00  ? 7   DG  D C5    1 
ATOM   2251 C  C6    . DG  C 3 7   ? 55.061  1.175   14.952  1.00 20.00  ? 7   DG  D C6    1 
ATOM   2252 O  O6    . DG  C 3 7   ? 56.181  0.674   15.122  1.00 20.00  ? 7   DG  D O6    1 
ATOM   2253 N  N1    . DG  C 3 7   ? 53.996  0.375   14.536  1.00 20.00  ? 7   DG  D N1    1 
ATOM   2254 C  C2    . DG  C 3 7   ? 52.711  0.819   14.314  1.00 20.00  ? 7   DG  D C2    1 
ATOM   2255 N  N2    . DG  C 3 7   ? 51.811  -0.097  13.915  1.00 20.00  ? 7   DG  D N2    1 
ATOM   2256 N  N3    . DG  C 3 7   ? 52.333  2.080   14.473  1.00 20.00  ? 7   DG  D N3    1 
ATOM   2257 C  C4    . DG  C 3 7   ? 53.354  2.875   14.877  1.00 20.00  ? 7   DG  D C4    1 
ATOM   2258 P  P     . DG  C 3 8   ? 48.971  6.764   17.222  1.00 52.81  ? 8   DG  D P     1 
ATOM   2259 O  OP1   . DG  C 3 8   ? 47.593  7.299   17.187  1.00 55.26  ? 8   DG  D OP1   1 
ATOM   2260 O  OP2   . DG  C 3 8   ? 49.905  7.244   18.264  1.00 59.12  ? 8   DG  D OP2   1 
ATOM   2261 O  "O5'" . DG  C 3 8   ? 48.883  5.170   17.304  1.00 50.89  ? 8   DG  D "O5'" 1 
ATOM   2262 C  "C5'" . DG  C 3 8   ? 48.338  4.440   16.210  1.00 45.44  ? 8   DG  D "C5'" 1 
ATOM   2263 C  "C4'" . DG  C 3 8   ? 48.305  2.954   16.512  1.00 45.53  ? 8   DG  D "C4'" 1 
ATOM   2264 O  "O4'" . DG  C 3 8   ? 49.644  2.411   16.442  1.00 47.03  ? 8   DG  D "O4'" 1 
ATOM   2265 C  "C3'" . DG  C 3 8   ? 47.761  2.590   17.896  1.00 47.00  ? 8   DG  D "C3'" 1 
ATOM   2266 O  "O3'" . DG  C 3 8   ? 46.649  1.719   17.762  1.00 49.82  ? 8   DG  D "O3'" 1 
ATOM   2267 C  "C2'" . DG  C 3 8   ? 48.941  1.907   18.604  1.00 40.08  ? 8   DG  D "C2'" 1 
ATOM   2268 C  "C1'" . DG  C 3 8   ? 49.796  1.435   17.439  1.00 45.23  ? 8   DG  D "C1'" 1 
ATOM   2269 N  N9    . DG  C 3 8   ? 51.217  1.331   17.762  1.00 43.96  ? 8   DG  D N9    1 
ATOM   2270 C  C8    . DG  C 3 8   ? 52.066  2.359   18.093  1.00 37.05  ? 8   DG  D C8    1 
ATOM   2271 N  N7    . DG  C 3 8   ? 53.287  1.968   18.329  1.00 39.84  ? 8   DG  D N7    1 
ATOM   2272 C  C5    . DG  C 3 8   ? 53.248  0.593   18.141  1.00 38.23  ? 8   DG  D C5    1 
ATOM   2273 C  C6    . DG  C 3 8   ? 54.276  -0.373  18.256  1.00 37.91  ? 8   DG  D C6    1 
ATOM   2274 O  O6    . DG  C 3 8   ? 55.466  -0.196  18.557  1.00 36.93  ? 8   DG  D O6    1 
ATOM   2275 N  N1    . DG  C 3 8   ? 53.811  -1.656  17.980  1.00 37.51  ? 8   DG  D N1    1 
ATOM   2276 C  C2    . DG  C 3 8   ? 52.516  -1.966  17.635  1.00 40.67  ? 8   DG  D C2    1 
ATOM   2277 N  N2    . DG  C 3 8   ? 52.256  -3.261  17.406  1.00 35.87  ? 8   DG  D N2    1 
ATOM   2278 N  N3    . DG  C 3 8   ? 51.543  -1.070  17.524  1.00 40.07  ? 8   DG  D N3    1 
ATOM   2279 C  C4    . DG  C 3 8   ? 51.980  0.184   17.790  1.00 38.51  ? 8   DG  D C4    1 
ATOM   2280 P  P     . DA  C 3 9   ? 45.671  1.456   19.008  1.00 49.09  ? 9   DA  D P     1 
ATOM   2281 O  OP1   . DA  C 3 9   ? 44.334  1.124   18.467  1.00 65.25  ? 9   DA  D OP1   1 
ATOM   2282 O  OP2   . DA  C 3 9   ? 45.825  2.583   19.954  1.00 51.65  ? 9   DA  D OP2   1 
ATOM   2283 O  "O5'" . DA  C 3 9   ? 46.285  0.153   19.693  1.00 44.19  ? 9   DA  D "O5'" 1 
ATOM   2284 C  "C5'" . DA  C 3 9   ? 46.680  -0.935  18.879  1.00 40.30  ? 9   DA  D "C5'" 1 
ATOM   2285 C  "C4'" . DA  C 3 9   ? 47.390  -1.999  19.693  1.00 53.21  ? 9   DA  D "C4'" 1 
ATOM   2286 O  "O4'" . DA  C 3 9   ? 48.800  -1.669  19.832  1.00 49.78  ? 9   DA  D "O4'" 1 
ATOM   2287 C  "C3'" . DA  C 3 9   ? 46.870  -2.199  21.123  1.00 49.47  ? 9   DA  D "C3'" 1 
ATOM   2288 O  "O3'" . DA  C 3 9   ? 46.873  -3.578  21.413  1.00 58.96  ? 9   DA  D "O3'" 1 
ATOM   2289 C  "C2'" . DA  C 3 9   ? 47.928  -1.480  21.955  1.00 49.55  ? 9   DA  D "C2'" 1 
ATOM   2290 C  "C1'" . DA  C 3 9   ? 49.158  -1.890  21.172  1.00 50.93  ? 9   DA  D "C1'" 1 
ATOM   2291 N  N9    . DA  C 3 9   ? 50.376  -1.151  21.487  1.00 46.75  ? 9   DA  D N9    1 
ATOM   2292 C  C8    . DA  C 3 9   ? 50.483  0.151   21.890  1.00 43.95  ? 9   DA  D C8    1 
ATOM   2293 N  N7    . DA  C 3 9   ? 51.720  0.535   22.106  1.00 44.80  ? 9   DA  D N7    1 
ATOM   2294 C  C5    . DA  C 3 9   ? 52.473  -0.595  21.826  1.00 43.01  ? 9   DA  D C5    1 
ATOM   2295 C  C6    . DA  C 3 9   ? 53.859  -0.848  21.862  1.00 37.29  ? 9   DA  D C6    1 
ATOM   2296 N  N6    . DA  C 3 9   ? 54.766  0.069   22.212  1.00 38.95  ? 9   DA  D N6    1 
ATOM   2297 N  N1    . DA  C 3 9   ? 54.278  -2.086  21.523  1.00 38.43  ? 9   DA  D N1    1 
ATOM   2298 C  C2    . DA  C 3 9   ? 53.367  -3.002  21.174  1.00 40.56  ? 9   DA  D C2    1 
ATOM   2299 N  N3    . DA  C 3 9   ? 52.043  -2.881  21.103  1.00 36.93  ? 9   DA  D N3    1 
ATOM   2300 C  C4    . DA  C 3 9   ? 51.659  -1.641  21.445  1.00 39.32  ? 9   DA  D C4    1 
ATOM   2301 P  P     . DA  C 3 10  ? 45.505  -4.364  21.700  1.00 61.37  ? 10  DA  D P     1 
ATOM   2302 O  OP1   . DA  C 3 10  ? 44.575  -4.127  20.563  1.00 62.34  ? 10  DA  D OP1   1 
ATOM   2303 O  OP2   . DA  C 3 10  ? 45.075  -3.943  23.050  1.00 45.99  ? 10  DA  D OP2   1 
ATOM   2304 O  "O5'" . DA  C 3 10  ? 45.977  -5.898  21.797  1.00 54.32  ? 10  DA  D "O5'" 1 
ATOM   2305 C  "C5'" . DA  C 3 10  ? 46.612  -6.514  20.698  1.00 45.54  ? 10  DA  D "C5'" 1 
ATOM   2306 C  "C4'" . DA  C 3 10  ? 47.793  -7.360  21.150  1.00 51.93  ? 10  DA  D "C4'" 1 
ATOM   2307 O  "O4'" . DA  C 3 10  ? 48.911  -6.491  21.446  1.00 51.21  ? 10  DA  D "O4'" 1 
ATOM   2308 C  "C3'" . DA  C 3 10  ? 47.565  -8.231  22.384  1.00 53.32  ? 10  DA  D "C3'" 1 
ATOM   2309 O  "O3'" . DA  C 3 10  ? 47.972  -9.584  22.092  1.00 60.08  ? 10  DA  D "O3'" 1 
ATOM   2310 C  "C2'" . DA  C 3 10  ? 48.449  -7.597  23.464  1.00 55.57  ? 10  DA  D "C2'" 1 
ATOM   2311 C  "C1'" . DA  C 3 10  ? 49.514  -6.864  22.659  1.00 51.03  ? 10  DA  D "C1'" 1 
ATOM   2312 N  N9    . DA  C 3 10  ? 49.967  -5.648  23.308  1.00 51.13  ? 10  DA  D N9    1 
ATOM   2313 C  C8    . DA  C 3 10  ? 49.194  -4.582  23.662  1.00 49.21  ? 10  DA  D C8    1 
ATOM   2314 N  N7    . DA  C 3 10  ? 49.864  -3.613  24.238  1.00 47.60  ? 10  DA  D N7    1 
ATOM   2315 C  C5    . DA  C 3 10  ? 51.166  -4.076  24.261  1.00 45.70  ? 10  DA  D C5    1 
ATOM   2316 C  C6    . DA  C 3 10  ? 52.356  -3.508  24.744  1.00 42.00  ? 10  DA  D C6    1 
ATOM   2317 N  N6    . DA  C 3 10  ? 52.408  -2.301  25.316  1.00 39.26  ? 10  DA  D N6    1 
ATOM   2318 N  N1    . DA  C 3 10  ? 53.489  -4.226  24.617  1.00 37.35  ? 10  DA  D N1    1 
ATOM   2319 C  C2    . DA  C 3 10  ? 53.425  -5.434  24.043  1.00 43.54  ? 10  DA  D C2    1 
ATOM   2320 N  N3    . DA  C 3 10  ? 52.363  -6.077  23.548  1.00 45.21  ? 10  DA  D N3    1 
ATOM   2321 C  C4    . DA  C 3 10  ? 51.251  -5.332  23.692  1.00 42.42  ? 10  DA  D C4    1 
ATOM   2322 P  P     . DC  C 3 11  ? 47.613  -10.786 23.100  1.00 63.48  ? 11  DC  D P     1 
ATOM   2323 O  OP1   . DC  C 3 11  ? 47.563  -12.083 22.382  1.00 60.67  ? 11  DC  D OP1   1 
ATOM   2324 O  OP2   . DC  C 3 11  ? 46.419  -10.369 23.855  1.00 58.42  ? 11  DC  D OP2   1 
ATOM   2325 O  "O5'" . DC  C 3 11  ? 48.830  -10.781 24.137  1.00 57.96  ? 11  DC  D "O5'" 1 
ATOM   2326 C  "C5'" . DC  C 3 11  ? 50.184  -10.683 23.671  1.00 58.98  ? 11  DC  D "C5'" 1 
ATOM   2327 C  "C4'" . DC  C 3 11  ? 51.156  -10.625 24.844  1.00 68.81  ? 11  DC  D "C4'" 1 
ATOM   2328 O  "O4'" . DC  C 3 11  ? 51.453  -9.242  25.186  1.00 59.81  ? 11  DC  D "O4'" 1 
ATOM   2329 C  "C3'" . DC  C 3 11  ? 50.654  -11.280 26.135  1.00 65.47  ? 11  DC  D "C3'" 1 
ATOM   2330 O  "O3'" . DC  C 3 11  ? 51.683  -12.066 26.706  1.00 69.97  ? 11  DC  D "O3'" 1 
ATOM   2331 C  "C2'" . DC  C 3 11  ? 50.314  -10.083 27.020  1.00 59.43  ? 11  DC  D "C2'" 1 
ATOM   2332 C  "C1'" . DC  C 3 11  ? 51.380  -9.097  26.585  1.00 59.09  ? 11  DC  D "C1'" 1 
ATOM   2333 N  N1    . DC  C 3 11  ? 51.064  -7.674  26.910  1.00 49.83  ? 11  DC  D N1    1 
ATOM   2334 C  C2    . DC  C 3 11  ? 52.104  -6.785  27.203  1.00 46.18  ? 11  DC  D C2    1 
ATOM   2335 O  O2    . DC  C 3 11  ? 53.271  -7.196  27.186  1.00 46.18  ? 11  DC  D O2    1 
ATOM   2336 N  N3    . DC  C 3 11  ? 51.803  -5.495  27.493  1.00 44.20  ? 11  DC  D N3    1 
ATOM   2337 C  C4    . DC  C 3 11  ? 50.532  -5.091  27.500  1.00 45.55  ? 11  DC  D C4    1 
ATOM   2338 N  N4    . DC  C 3 11  ? 50.284  -3.810  27.792  1.00 47.15  ? 11  DC  D N4    1 
ATOM   2339 C  C5    . DC  C 3 11  ? 49.458  -5.983  27.207  1.00 41.46  ? 11  DC  D C5    1 
ATOM   2340 C  C6    . DC  C 3 11  ? 49.767  -7.253  26.922  1.00 47.67  ? 11  DC  D C6    1 
ATOM   2341 P  P     . DT  C 3 12  ? 51.315  -13.325 27.633  1.00 78.55  ? 12  DT  D P     1 
ATOM   2342 O  OP1   . DT  C 3 12  ? 51.894  -14.519 26.979  1.00 75.28  ? 12  DT  D OP1   1 
ATOM   2343 O  OP2   . DT  C 3 12  ? 49.866  -13.271 27.934  1.00 61.55  ? 12  DT  D OP2   1 
ATOM   2344 O  "O5'" . DT  C 3 12  ? 52.120  -13.051 28.986  1.00 73.13  ? 12  DT  D "O5'" 1 
ATOM   2345 C  "C5'" . DT  C 3 12  ? 53.522  -13.269 29.020  1.00 65.61  ? 12  DT  D "C5'" 1 
ATOM   2346 C  "C4'" . DT  C 3 12  ? 54.208  -12.293 29.959  1.00 60.51  ? 12  DT  D "C4'" 1 
ATOM   2347 O  "O4'" . DT  C 3 12  ? 53.634  -10.979 29.809  1.00 57.73  ? 12  DT  D "O4'" 1 
ATOM   2348 C  "C3'" . DT  C 3 12  ? 54.102  -12.634 31.451  1.00 46.82  ? 12  DT  D "C3'" 1 
ATOM   2349 O  "O3'" . DT  C 3 12  ? 55.393  -12.964 31.951  1.00 48.01  ? 12  DT  D "O3'" 1 
ATOM   2350 C  "C2'" . DT  C 3 12  ? 53.544  -11.352 32.101  1.00 49.51  ? 12  DT  D "C2'" 1 
ATOM   2351 C  "C1'" . DT  C 3 12  ? 53.782  -10.302 31.025  1.00 48.83  ? 12  DT  D "C1'" 1 
ATOM   2352 N  N1    . DT  C 3 12  ? 52.815  -9.166  31.056  1.00 50.36  ? 12  DT  D N1    1 
ATOM   2353 C  C2    . DT  C 3 12  ? 53.250  -7.924  31.457  1.00 44.43  ? 12  DT  D C2    1 
ATOM   2354 O  O2    . DT  C 3 12  ? 54.397  -7.697  31.800  1.00 49.19  ? 12  DT  D O2    1 
ATOM   2355 N  N3    . DT  C 3 12  ? 52.290  -6.949  31.444  1.00 42.01  ? 12  DT  D N3    1 
ATOM   2356 C  C4    . DT  C 3 12  ? 50.965  -7.086  31.077  1.00 40.23  ? 12  DT  D C4    1 
ATOM   2357 O  O4    . DT  C 3 12  ? 50.177  -6.146  31.100  1.00 41.79  ? 12  DT  D O4    1 
ATOM   2358 C  C5    . DT  C 3 12  ? 50.573  -8.413  30.665  1.00 48.19  ? 12  DT  D C5    1 
ATOM   2359 C  C7    . DT  C 3 12  ? 49.158  -8.684  30.244  1.00 39.64  ? 12  DT  D C7    1 
ATOM   2360 C  C6    . DT  C 3 12  ? 51.506  -9.378  30.672  1.00 43.63  ? 12  DT  D C6    1 
ATOM   2361 P  P     . DT  C 3 13  ? 55.605  -13.342 33.498  1.00 64.06  ? 13  DT  D P     1 
ATOM   2362 O  OP1   . DT  C 3 13  ? 56.789  -14.228 33.572  1.00 49.79  ? 13  DT  D OP1   1 
ATOM   2363 O  OP2   . DT  C 3 13  ? 54.309  -13.794 34.052  1.00 57.22  ? 13  DT  D OP2   1 
ATOM   2364 O  "O5'" . DT  C 3 13  ? 55.985  -11.947 34.178  1.00 61.38  ? 13  DT  D "O5'" 1 
ATOM   2365 C  "C5'" . DT  C 3 13  ? 57.107  -11.215 33.701  1.00 50.09  ? 13  DT  D "C5'" 1 
ATOM   2366 C  "C4'" . DT  C 3 13  ? 57.353  -9.975  34.542  1.00 48.30  ? 13  DT  D "C4'" 1 
ATOM   2367 O  "O4'" . DT  C 3 13  ? 56.277  -9.021  34.342  1.00 43.54  ? 13  DT  D "O4'" 1 
ATOM   2368 C  "C3'" . DT  C 3 13  ? 57.426  -10.211 36.052  1.00 46.07  ? 13  DT  D "C3'" 1 
ATOM   2369 O  "O3'" . DT  C 3 13  ? 58.370  -9.313  36.628  1.00 48.79  ? 13  DT  D "O3'" 1 
ATOM   2370 C  "C2'" . DT  C 3 13  ? 56.008  -9.857  36.495  1.00 44.83  ? 13  DT  D "C2'" 1 
ATOM   2371 C  "C1'" . DT  C 3 13  ? 55.746  -8.661  35.596  1.00 39.90  ? 13  DT  D "C1'" 1 
ATOM   2372 N  N1    . DT  C 3 13  ? 54.311  -8.315  35.419  1.00 45.47  ? 13  DT  D N1    1 
ATOM   2373 C  C2    . DT  C 3 13  ? 53.931  -6.997  35.503  1.00 41.70  ? 13  DT  D C2    1 
ATOM   2374 O  O2    . DT  C 3 13  ? 54.714  -6.092  35.730  1.00 39.08  ? 13  DT  D O2    1 
ATOM   2375 N  N3    . DT  C 3 13  ? 52.595  -6.772  35.316  1.00 44.15  ? 13  DT  D N3    1 
ATOM   2376 C  C4    . DT  C 3 13  ? 51.619  -7.715  35.055  1.00 45.55  ? 13  DT  D C4    1 
ATOM   2377 O  O4    . DT  C 3 13  ? 50.440  -7.412  34.902  1.00 46.65  ? 13  DT  D O4    1 
ATOM   2378 C  C5    . DT  C 3 13  ? 52.084  -9.080  34.973  1.00 48.10  ? 13  DT  D C5    1 
ATOM   2379 C  C7    . DT  C 3 13  ? 51.115  -10.190 34.694  1.00 52.56  ? 13  DT  D C7    1 
ATOM   2380 C  C6    . DT  C 3 13  ? 53.394  -9.312  35.155  1.00 46.77  ? 13  DT  D C6    1 
ATOM   2381 P  P     . DA  C 3 14  ? 59.951  -9.608  36.581  1.00 49.16  ? 14  DA  D P     1 
ATOM   2382 O  OP1   . DA  C 3 14  ? 60.312  -10.187 35.268  1.00 47.70  ? 14  DA  D OP1   1 
ATOM   2383 O  OP2   . DA  C 3 14  ? 60.306  -10.331 37.819  1.00 50.79  ? 14  DA  D OP2   1 
ATOM   2384 O  "O5'" . DA  C 3 14  ? 60.601  -8.150  36.687  1.00 51.33  ? 14  DA  D "O5'" 1 
ATOM   2385 C  "C5'" . DA  C 3 14  ? 60.391  -7.196  35.648  1.00 35.74  ? 14  DA  D "C5'" 1 
ATOM   2386 C  "C4'" . DA  C 3 14  ? 60.118  -5.806  36.213  1.00 44.27  ? 14  DA  D "C4'" 1 
ATOM   2387 O  "O4'" . DA  C 3 14  ? 58.729  -5.700  36.613  1.00 38.35  ? 14  DA  D "O4'" 1 
ATOM   2388 C  "C3'" . DA  C 3 14  ? 60.930  -5.417  37.443  1.00 41.78  ? 14  DA  D "C3'" 1 
ATOM   2389 O  "O3'" . DA  C 3 14  ? 61.159  -4.014  37.431  1.00 34.71  ? 14  DA  D "O3'" 1 
ATOM   2390 C  "C2'" . DA  C 3 14  ? 60.006  -5.818  38.589  1.00 35.57  ? 14  DA  D "C2'" 1 
ATOM   2391 C  "C1'" . DA  C 3 14  ? 58.640  -5.476  38.007  1.00 36.79  ? 14  DA  D "C1'" 1 
ATOM   2392 N  N9    . DA  C 3 14  ? 57.555  -6.302  38.521  1.00 42.80  ? 14  DA  D N9    1 
ATOM   2393 C  C8    . DA  C 3 14  ? 57.631  -7.603  38.934  1.00 43.71  ? 14  DA  D C8    1 
ATOM   2394 N  N7    . DA  C 3 14  ? 56.483  -8.099  39.331  1.00 44.74  ? 14  DA  D N7    1 
ATOM   2395 C  C5    . DA  C 3 14  ? 55.593  -7.053  39.160  1.00 42.81  ? 14  DA  D C5    1 
ATOM   2396 C  C6    . DA  C 3 14  ? 54.212  -6.934  39.398  1.00 44.16  ? 14  DA  D C6    1 
ATOM   2397 N  N6    . DA  C 3 14  ? 53.461  -7.928  39.881  1.00 48.98  ? 14  DA  D N6    1 
ATOM   2398 N  N1    . DA  C 3 14  ? 53.631  -5.750  39.121  1.00 44.57  ? 14  DA  D N1    1 
ATOM   2399 C  C2    . DA  C 3 14  ? 54.384  -4.757  38.635  1.00 43.71  ? 14  DA  D C2    1 
ATOM   2400 N  N3    . DA  C 3 14  ? 55.688  -4.750  38.371  1.00 36.47  ? 14  DA  D N3    1 
ATOM   2401 C  C4    . DA  C 3 14  ? 56.238  -5.939  38.658  1.00 41.60  ? 14  DA  D C4    1 
ATOM   2402 P  P     . DC  C 3 15  ? 62.349  -3.376  38.300  1.00 39.97  ? 15  DC  D P     1 
ATOM   2403 O  OP1   . DC  C 3 15  ? 62.587  -2.018  37.793  1.00 37.88  ? 15  DC  D OP1   1 
ATOM   2404 O  OP2   . DC  C 3 15  ? 63.477  -4.329  38.311  1.00 39.90  ? 15  DC  D OP2   1 
ATOM   2405 O  "O5'" . DC  C 3 15  ? 61.740  -3.265  39.777  1.00 39.78  ? 15  DC  D "O5'" 1 
ATOM   2406 C  "C5'" . DC  C 3 15  ? 61.282  -2.004  40.276  1.00 35.22  ? 15  DC  D "C5'" 1 
ATOM   2407 C  "C4'" . DC  C 3 15  ? 59.930  -1.642  39.686  1.00 35.21  ? 15  DC  D "C4'" 1 
ATOM   2408 O  "O4'" . DC  C 3 15  ? 59.050  -2.797  39.742  1.00 40.61  ? 15  DC  D "O4'" 1 
ATOM   2409 C  "C3'" . DC  C 3 15  ? 59.186  -0.519  40.409  1.00 39.60  ? 15  DC  D "C3'" 1 
ATOM   2410 O  "O3'" . DC  C 3 15  ? 58.445  0.249   39.460  1.00 37.03  ? 15  DC  D "O3'" 1 
ATOM   2411 C  "C2'" . DC  C 3 15  ? 58.271  -1.291  41.355  1.00 35.18  ? 15  DC  D "C2'" 1 
ATOM   2412 C  "C1'" . DC  C 3 15  ? 57.894  -2.481  40.491  1.00 37.86  ? 15  DC  D "C1'" 1 
ATOM   2413 N  N1    . DC  C 3 15  ? 57.495  -3.683  41.275  1.00 36.32  ? 15  DC  D N1    1 
ATOM   2414 C  C2    . DC  C 3 15  ? 56.144  -3.906  41.562  1.00 36.80  ? 15  DC  D C2    1 
ATOM   2415 O  O2    . DC  C 3 15  ? 55.300  -3.096  41.160  1.00 36.05  ? 15  DC  D O2    1 
ATOM   2416 N  N3    . DC  C 3 15  ? 55.798  -5.006  42.274  1.00 38.06  ? 15  DC  D N3    1 
ATOM   2417 C  C4    . DC  C 3 15  ? 56.739  -5.855  42.690  1.00 38.59  ? 15  DC  D C4    1 
ATOM   2418 N  N4    . DC  C 3 15  ? 56.350  -6.926  43.389  1.00 43.71  ? 15  DC  D N4    1 
ATOM   2419 C  C5    . DC  C 3 15  ? 58.120  -5.645  42.408  1.00 39.22  ? 15  DC  D C5    1 
ATOM   2420 C  C6    . DC  C 3 15  ? 58.449  -4.557  41.704  1.00 43.27  ? 15  DC  D C6    1 
ATOM   2421 P  P     . DC  C 3 16  ? 57.382  1.372   39.913  1.00 35.77  ? 16  DC  D P     1 
ATOM   2422 O  OP1   . DC  C 3 16  ? 56.135  0.691   40.326  1.00 39.23  ? 16  DC  D OP1   1 
ATOM   2423 O  OP2   . DC  C 3 16  ? 57.291  2.272   38.746  1.00 27.73  ? 16  DC  D OP2   1 
ATOM   2424 O  "O5'" . DC  C 3 16  ? 58.111  2.209   41.090  1.00 36.37  ? 16  DC  D "O5'" 1 
ATOM   2425 C  "C5'" . DC  C 3 16  ? 57.864  1.948   42.495  1.00 35.47  ? 16  DC  D "C5'" 1 
ATOM   2426 C  "C4'" . DC  C 3 16  ? 56.407  2.171   42.860  1.00 38.60  ? 16  DC  D "C4'" 1 
ATOM   2427 O  "O4'" . DC  C 3 16  ? 55.755  0.884   43.008  1.00 41.01  ? 16  DC  D "O4'" 1 
ATOM   2428 C  "C3'" . DC  C 3 16  ? 56.156  2.900   44.170  1.00 36.19  ? 16  DC  D "C3'" 1 
ATOM   2429 O  "O3'" . DC  C 3 16  ? 54.909  3.581   44.094  1.00 42.08  ? 16  DC  D "O3'" 1 
ATOM   2430 C  "C2'" . DC  C 3 16  ? 56.106  1.751   45.172  1.00 34.94  ? 16  DC  D "C2'" 1 
ATOM   2431 C  "C1'" . DC  C 3 16  ? 55.405  0.667   44.360  1.00 39.99  ? 16  DC  D "C1'" 1 
ATOM   2432 N  N1    . DC  C 3 16  ? 55.806  -0.725  44.732  1.00 34.92  ? 16  DC  D N1    1 
ATOM   2433 C  C2    . DC  C 3 16  ? 54.829  -1.722  44.832  1.00 36.93  ? 16  DC  D C2    1 
ATOM   2434 O  O2    . DC  C 3 16  ? 53.648  -1.431  44.613  1.00 42.20  ? 16  DC  D O2    1 
ATOM   2435 N  N3    . DC  C 3 16  ? 55.206  -2.981  45.166  1.00 38.19  ? 16  DC  D N3    1 
ATOM   2436 C  C4    . DC  C 3 16  ? 56.491  -3.255  45.394  1.00 40.69  ? 16  DC  D C4    1 
ATOM   2437 N  N4    . DC  C 3 16  ? 56.814  -4.511  45.721  1.00 42.38  ? 16  DC  D N4    1 
ATOM   2438 C  C5    . DC  C 3 16  ? 57.502  -2.253  45.297  1.00 35.45  ? 16  DC  D C5    1 
ATOM   2439 C  C6    . DC  C 3 16  ? 57.119  -1.015  44.965  1.00 35.64  ? 16  DC  D C6    1 
ATOM   2440 P  P     . DC  C 3 17  ? 54.477  4.636   45.226  1.00 42.30  ? 17  DC  D P     1 
ATOM   2441 O  OP1   . DC  C 3 17  ? 53.680  5.686   44.554  1.00 37.25  ? 17  DC  D OP1   1 
ATOM   2442 O  OP2   . DC  C 3 17  ? 55.681  5.008   46.001  1.00 48.44  ? 17  DC  D OP2   1 
ATOM   2443 O  "O5'" . DC  C 3 17  ? 53.503  3.796   46.176  1.00 41.60  ? 17  DC  D "O5'" 1 
ATOM   2444 C  "C5'" . DC  C 3 17  ? 52.244  3.362   45.678  1.00 41.17  ? 17  DC  D "C5'" 1 
ATOM   2445 C  "C4'" . DC  C 3 17  ? 51.605  2.347   46.609  1.00 49.42  ? 17  DC  D "C4'" 1 
ATOM   2446 O  "O4'" . DC  C 3 17  ? 52.407  1.150   46.660  1.00 43.47  ? 17  DC  D "O4'" 1 
ATOM   2447 C  "C3'" . DC  C 3 17  ? 51.432  2.805   48.062  1.00 45.55  ? 17  DC  D "C3'" 1 
ATOM   2448 O  "O3'" . DC  C 3 17  ? 50.046  2.899   48.365  1.00 55.33  ? 17  DC  D "O3'" 1 
ATOM   2449 C  "C2'" . DC  C 3 17  ? 52.129  1.711   48.896  1.00 42.26  ? 17  DC  D "C2'" 1 
ATOM   2450 C  "C1'" . DC  C 3 17  ? 52.218  0.553   47.912  1.00 49.46  ? 17  DC  D "C1'" 1 
ATOM   2451 N  N1    . DC  C 3 17  ? 53.357  -0.382  48.163  1.00 47.55  ? 17  DC  D N1    1 
ATOM   2452 C  C2    . DC  C 3 17  ? 53.097  -1.732  48.427  1.00 46.67  ? 17  DC  D C2    1 
ATOM   2453 O  O2    . DC  C 3 17  ? 51.925  -2.125  48.461  1.00 50.34  ? 17  DC  D O2    1 
ATOM   2454 N  N3    . DC  C 3 17  ? 54.140  -2.571  48.643  1.00 47.38  ? 17  DC  D N3    1 
ATOM   2455 C  C4    . DC  C 3 17  ? 55.391  -2.109  48.596  1.00 43.56  ? 17  DC  D C4    1 
ATOM   2456 N  N4    . DC  C 3 17  ? 56.387  -2.974  48.816  1.00 41.91  ? 17  DC  D N4    1 
ATOM   2457 C  C5    . DC  C 3 17  ? 55.675  -0.738  48.325  1.00 36.73  ? 17  DC  D C5    1 
ATOM   2458 C  C6    . DC  C 3 17  ? 54.639  0.081   48.114  1.00 38.02  ? 17  DC  D C6    1 
ATOM   2459 P  P     . DG  C 3 18  ? 49.534  3.800   49.593  1.00 56.73  ? 18  DG  D P     1 
ATOM   2460 O  OP1   . DG  C 3 18  ? 48.136  4.186   49.296  1.00 57.21  ? 18  DG  D OP1   1 
ATOM   2461 O  OP2   . DG  C 3 18  ? 50.544  4.848   49.858  1.00 56.66  ? 18  DG  D OP2   1 
ATOM   2462 O  "O5'" . DG  C 3 18  ? 49.529  2.780   50.822  1.00 52.14  ? 18  DG  D "O5'" 1 
ATOM   2463 C  "C5'" . DG  C 3 18  ? 48.796  1.572   50.714  1.00 49.37  ? 18  DG  D "C5'" 1 
ATOM   2464 C  "C4'" . DG  C 3 18  ? 49.261  0.548   51.733  1.00 52.87  ? 18  DG  D "C4'" 1 
ATOM   2465 O  "O4'" . DG  C 3 18  ? 50.554  0.005   51.357  1.00 49.11  ? 18  DG  D "O4'" 1 
ATOM   2466 C  "C3'" . DG  C 3 18  ? 49.424  1.064   53.173  1.00 62.11  ? 18  DG  D "C3'" 1 
ATOM   2467 O  "O3'" . DG  C 3 18  ? 48.710  0.210   54.048  1.00 69.73  ? 18  DG  D "O3'" 1 
ATOM   2468 C  "C2'" . DG  C 3 18  ? 50.934  0.956   53.413  1.00 49.37  ? 18  DG  D "C2'" 1 
ATOM   2469 C  "C1'" . DG  C 3 18  ? 51.256  -0.239  52.543  1.00 51.52  ? 18  DG  D "C1'" 1 
ATOM   2470 N  N9    . DG  C 3 18  ? 52.676  -0.423  52.257  1.00 48.32  ? 18  DG  D N9    1 
ATOM   2471 C  C8    . DG  C 3 18  ? 53.617  0.551   52.022  1.00 47.48  ? 18  DG  D C8    1 
ATOM   2472 N  N7    . DG  C 3 18  ? 54.814  0.072   51.809  1.00 46.67  ? 18  DG  D N7    1 
ATOM   2473 C  C5    . DG  C 3 18  ? 54.653  -1.305  51.914  1.00 46.46  ? 18  DG  D C5    1 
ATOM   2474 C  C6    . DG  C 3 18  ? 55.600  -2.350  51.783  1.00 43.83  ? 18  DG  D C6    1 
ATOM   2475 O  O6    . DG  C 3 18  ? 56.810  -2.263  51.534  1.00 49.95  ? 18  DG  D O6    1 
ATOM   2476 N  N1    . DG  C 3 18  ? 55.015  -3.602  51.963  1.00 49.21  ? 18  DG  D N1    1 
ATOM   2477 C  C2    . DG  C 3 18  ? 53.685  -3.815  52.241  1.00 47.52  ? 18  DG  D C2    1 
ATOM   2478 N  N2    . DG  C 3 18  ? 53.305  -5.093  52.385  1.00 49.46  ? 18  DG  D N2    1 
ATOM   2479 N  N3    . DG  C 3 18  ? 52.791  -2.847  52.369  1.00 43.96  ? 18  DG  D N3    1 
ATOM   2480 C  C4    . DG  C 3 18  ? 53.344  -1.622  52.193  1.00 49.87  ? 18  DG  D C4    1 
ATOM   2481 P  P     . DG  C 3 19  ? 48.256  0.708   55.506  1.00 66.82  ? 19  DG  D P     1 
ATOM   2482 O  OP1   . DG  C 3 19  ? 46.852  1.163   55.393  1.00 68.76  ? 19  DG  D OP1   1 
ATOM   2483 O  OP2   . DG  C 3 19  ? 49.287  1.624   56.041  1.00 53.59  ? 19  DG  D OP2   1 
ATOM   2484 O  "O5'" . DG  C 3 19  ? 48.292  -0.634  56.374  1.00 68.62  ? 19  DG  D "O5'" 1 
ATOM   2485 C  "C5'" . DG  C 3 19  ? 47.752  -1.836  55.836  1.00 65.35  ? 19  DG  D "C5'" 1 
ATOM   2486 C  "C4'" . DG  C 3 19  ? 48.515  -3.048  56.341  1.00 69.37  ? 19  DG  D "C4'" 1 
ATOM   2487 O  "O4'" . DG  C 3 19  ? 49.801  -3.128  55.676  1.00 62.53  ? 19  DG  D "O4'" 1 
ATOM   2488 C  "C3'" . DG  C 3 19  ? 48.799  -3.050  57.844  1.00 72.83  ? 19  DG  D "C3'" 1 
ATOM   2489 O  "O3'" . DG  C 3 19  ? 48.353  -4.269  58.418  1.00 84.42  ? 19  DG  D "O3'" 1 
ATOM   2490 C  "C2'" . DG  C 3 19  ? 50.321  -2.897  57.940  1.00 63.32  ? 19  DG  D "C2'" 1 
ATOM   2491 C  "C1'" . DG  C 3 19  ? 50.793  -3.469  56.612  1.00 68.43  ? 19  DG  D "C1'" 1 
ATOM   2492 N  N9    . DG  C 3 19  ? 52.063  -2.907  56.158  1.00 56.44  ? 19  DG  D N9    1 
ATOM   2493 C  C8    . DG  C 3 19  ? 52.313  -1.598  55.824  1.00 55.47  ? 19  DG  D C8    1 
ATOM   2494 N  N7    . DG  C 3 19  ? 53.542  -1.382  55.449  1.00 55.06  ? 19  DG  D N7    1 
ATOM   2495 C  C5    . DG  C 3 19  ? 54.150  -2.628  55.538  1.00 56.12  ? 19  DG  D C5    1 
ATOM   2496 C  C6    . DG  C 3 19  ? 55.482  -3.013  55.257  1.00 51.85  ? 19  DG  D C6    1 
ATOM   2497 O  O6    . DG  C 3 19  ? 56.419  -2.305  54.861  1.00 54.12  ? 19  DG  D O6    1 
ATOM   2498 N  N1    . DG  C 3 19  ? 55.683  -4.373  55.479  1.00 54.07  ? 19  DG  D N1    1 
ATOM   2499 C  C2    . DG  C 3 19  ? 54.718  -5.249  55.917  1.00 56.24  ? 19  DG  D C2    1 
ATOM   2500 N  N2    . DG  C 3 19  ? 55.102  -6.525  56.072  1.00 58.31  ? 19  DG  D N2    1 
ATOM   2501 N  N3    . DG  C 3 19  ? 53.465  -4.901  56.184  1.00 49.86  ? 19  DG  D N3    1 
ATOM   2502 C  C4    . DG  C 3 19  ? 53.253  -3.579  55.972  1.00 51.90  ? 19  DG  D C4    1 
ATOM   2503 P  P     . DC  C 3 20  ? 48.334  -4.455  60.014  1.00 73.32  ? 20  DC  D P     1 
ATOM   2504 O  OP1   . DC  C 3 20  ? 47.161  -5.291  60.351  1.00 86.82  ? 20  DC  D OP1   1 
ATOM   2505 O  OP2   . DC  C 3 20  ? 48.488  -3.119  60.632  1.00 57.41  ? 20  DC  D OP2   1 
ATOM   2506 O  "O5'" . DC  C 3 20  ? 49.662  -5.292  60.308  1.00 63.58  ? 20  DC  D "O5'" 1 
ATOM   2507 C  "C5'" . DC  C 3 20  ? 49.940  -6.459  59.546  1.00 67.78  ? 20  DC  D "C5'" 1 
ATOM   2508 C  "C4'" . DC  C 3 20  ? 51.263  -7.071  59.961  1.00 69.73  ? 20  DC  D "C4'" 1 
ATOM   2509 O  "O4'" . DC  C 3 20  ? 52.351  -6.405  59.269  1.00 66.17  ? 20  DC  D "O4'" 1 
ATOM   2510 C  "C3'" . DC  C 3 20  ? 51.578  -6.973  61.454  1.00 69.91  ? 20  DC  D "C3'" 1 
ATOM   2511 O  "O3'" . DC  C 3 20  ? 52.074  -8.215  61.918  1.00 79.23  ? 20  DC  D "O3'" 1 
ATOM   2512 C  "C2'" . DC  C 3 20  ? 52.645  -5.880  61.520  1.00 71.10  ? 20  DC  D "C2'" 1 
ATOM   2513 C  "C1'" . DC  C 3 20  ? 53.360  -6.077  60.194  1.00 66.64  ? 20  DC  D "C1'" 1 
ATOM   2514 N  N1    . DC  C 3 20  ? 54.068  -4.859  59.706  1.00 60.66  ? 20  DC  D N1    1 
ATOM   2515 C  C2    . DC  C 3 20  ? 55.427  -4.932  59.383  1.00 59.98  ? 20  DC  D C2    1 
ATOM   2516 O  O2    . DC  C 3 20  ? 56.020  -6.010  59.510  1.00 61.90  ? 20  DC  D O2    1 
ATOM   2517 N  N3    . DC  C 3 20  ? 56.056  -3.816  58.937  1.00 60.99  ? 20  DC  D N3    1 
ATOM   2518 C  C4    . DC  C 3 20  ? 55.380  -2.672  58.814  1.00 59.44  ? 20  DC  D C4    1 
ATOM   2519 N  N4    . DC  C 3 20  ? 56.043  -1.599  58.371  1.00 55.47  ? 20  DC  D N4    1 
ATOM   2520 C  C5    . DC  C 3 20  ? 53.995  -2.579  59.138  1.00 59.74  ? 20  DC  D C5    1 
ATOM   2521 C  C6    . DC  C 3 20  ? 53.385  -3.686  59.576  1.00 63.65  ? 20  DC  D C6    1 
ATOM   2522 P  P     . DA  C 3 21  ? 51.839  -8.667  63.441  1.00 83.57  ? 21  DA  D P     1 
ATOM   2523 O  OP1   . DA  C 3 21  ? 51.277  -10.037 63.410  1.00 78.47  ? 21  DA  D OP1   1 
ATOM   2524 O  OP2   . DA  C 3 21  ? 51.108  -7.584  64.136  1.00 71.50  ? 21  DA  D OP2   1 
ATOM   2525 O  "O5'" . DA  C 3 21  ? 53.317  -8.722  64.043  1.00 71.42  ? 21  DA  D "O5'" 1 
ATOM   2526 C  "C5'" . DA  C 3 21  ? 54.345  -9.373  63.314  1.00 72.73  ? 21  DA  D "C5'" 1 
ATOM   2527 C  "C4'" . DA  C 3 21  ? 55.700  -8.752  63.605  1.00 77.45  ? 21  DA  D "C4'" 1 
ATOM   2528 O  "O4'" . DA  C 3 21  ? 55.828  -7.476  62.918  1.00 76.02  ? 21  DA  D "O4'" 1 
ATOM   2529 C  "C3'" . DA  C 3 21  ? 55.989  -8.455  65.084  1.00 73.59  ? 21  DA  D "C3'" 1 
ATOM   2530 O  "O3'" . DA  C 3 21  ? 57.333  -8.783  65.361  1.00 81.88  ? 21  DA  D "O3'" 1 
ATOM   2531 C  "C2'" . DA  C 3 21  ? 55.789  -6.945  65.156  1.00 72.35  ? 21  DA  D "C2'" 1 
ATOM   2532 C  "C1'" . DA  C 3 21  ? 56.395  -6.563  63.824  1.00 71.50  ? 21  DA  D "C1'" 1 
ATOM   2533 N  N9    . DA  C 3 21  ? 56.121  -5.198  63.392  1.00 67.34  ? 21  DA  D N9    1 
ATOM   2534 C  C8    . DA  C 3 21  ? 54.988  -4.464  63.611  1.00 63.37  ? 21  DA  D C8    1 
ATOM   2535 N  N7    . DA  C 3 21  ? 55.039  -3.253  63.104  1.00 57.28  ? 21  DA  D N7    1 
ATOM   2536 C  C5    . DA  C 3 21  ? 56.294  -3.191  62.517  1.00 64.05  ? 21  DA  D C5    1 
ATOM   2537 C  C6    . DA  C 3 21  ? 56.967  -2.173  61.810  1.00 61.21  ? 21  DA  D C6    1 
ATOM   2538 N  N6    . DA  C 3 21  ? 56.436  -0.971  61.567  1.00 58.91  ? 21  DA  D N6    1 
ATOM   2539 N  N1    . DA  C 3 21  ? 58.211  -2.441  61.360  1.00 60.16  ? 21  DA  D N1    1 
ATOM   2540 C  C2    . DA  C 3 21  ? 58.740  -3.645  61.604  1.00 61.76  ? 21  DA  D C2    1 
ATOM   2541 N  N3    . DA  C 3 21  ? 58.207  -4.676  62.255  1.00 69.49  ? 21  DA  D N3    1 
ATOM   2542 C  C4    . DA  C 3 21  ? 56.972  -4.380  62.689  1.00 66.40  ? 21  DA  D C4    1 
ATOM   2543 P  P     . DA  C 3 22  ? 57.712  -9.763  66.574  1.00 91.15  ? 22  DA  D P     1 
ATOM   2544 O  OP1   . DA  C 3 22  ? 57.125  -11.089 66.278  1.00 90.53  ? 22  DA  D OP1   1 
ATOM   2545 O  OP2   . DA  C 3 22  ? 57.380  -9.071  67.840  1.00 81.48  ? 22  DA  D OP2   1 
ATOM   2546 O  "O5'" . DA  C 3 22  ? 59.304  -9.870  66.469  1.00 82.58  ? 22  DA  D "O5'" 1 
ATOM   2547 C  "C5'" . DA  C 3 22  ? 59.907  -10.223 65.228  1.00 82.10  ? 22  DA  D "C5'" 1 
ATOM   2548 C  "C4'" . DA  C 3 22  ? 61.232  -9.502  65.035  1.00 81.32  ? 22  DA  D "C4'" 1 
ATOM   2549 O  "O4'" . DA  C 3 22  ? 60.995  -8.163  64.530  1.00 87.57  ? 22  DA  D "O4'" 1 
ATOM   2550 C  "C3'" . DA  C 3 22  ? 62.075  -9.341  66.294  1.00 84.81  ? 22  DA  D "C3'" 1 
ATOM   2551 O  "O3'" . DA  C 3 22  ? 63.447  -9.508  65.975  1.00 91.01  ? 22  DA  D "O3'" 1 
ATOM   2552 C  "C2'" . DA  C 3 22  ? 61.766  -7.913  66.743  1.00 82.54  ? 22  DA  D "C2'" 1 
ATOM   2553 C  "C1'" . DA  C 3 22  ? 61.533  -7.201  65.414  1.00 80.38  ? 22  DA  D "C1'" 1 
ATOM   2554 N  N9    . DA  C 3 22  ? 60.584  -6.094  65.505  1.00 75.13  ? 22  DA  D N9    1 
ATOM   2555 C  C8    . DA  C 3 22  ? 59.335  -6.126  66.058  1.00 73.49  ? 22  DA  D C8    1 
ATOM   2556 N  N7    . DA  C 3 22  ? 58.696  -4.982  65.991  1.00 71.11  ? 22  DA  D N7    1 
ATOM   2557 C  C5    . DA  C 3 22  ? 59.587  -4.141  65.345  1.00 70.07  ? 22  DA  D C5    1 
ATOM   2558 C  C6    . DA  C 3 22  ? 59.509  -2.785  64.968  1.00 65.97  ? 22  DA  D C6    1 
ATOM   2559 N  N6    . DA  C 3 22  ? 58.442  -2.016  65.203  1.00 62.71  ? 22  DA  D N6    1 
ATOM   2560 N  N1    . DA  C 3 22  ? 60.575  -2.250  64.337  1.00 62.86  ? 22  DA  D N1    1 
ATOM   2561 C  C2    . DA  C 3 22  ? 61.643  -3.024  64.104  1.00 68.06  ? 22  DA  D C2    1 
ATOM   2562 N  N3    . DA  C 3 22  ? 61.832  -4.307  64.410  1.00 71.60  ? 22  DA  D N3    1 
ATOM   2563 C  C4    . DA  C 3 22  ? 60.756  -4.811  65.035  1.00 71.32  ? 22  DA  D C4    1 
ATOM   2564 P  P     . DG  C 3 23  ? 64.527  -9.753  67.138  1.00 105.10 ? 23  DG  D P     1 
ATOM   2565 O  OP1   . DG  C 3 23  ? 65.532  -10.705 66.612  1.00 88.51  ? 23  DG  D OP1   1 
ATOM   2566 O  OP2   . DG  C 3 23  ? 63.795  -10.069 68.385  1.00 97.76  ? 23  DG  D OP2   1 
ATOM   2567 O  "O5'" . DG  C 3 23  ? 65.219  -8.324  67.308  1.00 88.65  ? 23  DG  D "O5'" 1 
ATOM   2568 C  "C5'" . DG  C 3 23  ? 65.804  -7.701  66.178  1.00 81.17  ? 23  DG  D "C5'" 1 
ATOM   2569 C  "C4'" . DG  C 3 23  ? 65.990  -6.212  66.400  1.00 78.99  ? 23  DG  D "C4'" 1 
ATOM   2570 O  "O4'" . DG  C 3 23  ? 64.713  -5.540  66.414  1.00 87.28  ? 23  DG  D "O4'" 1 
ATOM   2571 C  "C3'" . DG  C 3 23  ? 66.684  -5.819  67.710  1.00 79.81  ? 23  DG  D "C3'" 1 
ATOM   2572 O  "O3'" . DG  C 3 23  ? 67.949  -5.247  67.410  1.00 86.98  ? 23  DG  D "O3'" 1 
ATOM   2573 C  "C2'" . DG  C 3 23  ? 65.726  -4.793  68.353  1.00 78.15  ? 23  DG  D "C2'" 1 
ATOM   2574 C  "C1'" . DG  C 3 23  ? 64.872  -4.373  67.167  1.00 77.56  ? 23  DG  D "C1'" 1 
ATOM   2575 N  N9    . DG  C 3 23  ? 63.555  -3.847  67.520  1.00 72.81  ? 23  DG  D N9    1 
ATOM   2576 C  C8    . DG  C 3 23  ? 62.514  -4.526  68.107  1.00 73.24  ? 23  DG  D C8    1 
ATOM   2577 N  N7    . DG  C 3 23  ? 61.452  -3.788  68.293  1.00 70.21  ? 23  DG  D N7    1 
ATOM   2578 C  C5    . DG  C 3 23  ? 61.812  -2.542  67.793  1.00 69.07  ? 23  DG  D C5    1 
ATOM   2579 C  C6    . DG  C 3 23  ? 61.070  -1.336  67.721  1.00 67.26  ? 23  DG  D C6    1 
ATOM   2580 O  O6    . DG  C 3 23  ? 59.909  -1.124  68.099  1.00 68.08  ? 23  DG  D O6    1 
ATOM   2581 N  N1    . DG  C 3 23  ? 61.812  -0.309  67.141  1.00 65.81  ? 23  DG  D N1    1 
ATOM   2582 C  C2    . DG  C 3 23  ? 63.104  -0.431  66.688  1.00 68.92  ? 23  DG  D C2    1 
ATOM   2583 N  N2    . DG  C 3 23  ? 63.655  0.672   66.159  1.00 63.37  ? 23  DG  D N2    1 
ATOM   2584 N  N3    . DG  C 3 23  ? 63.809  -1.553  66.750  1.00 70.80  ? 23  DG  D N3    1 
ATOM   2585 C  C4    . DG  C 3 23  ? 63.102  -2.563  67.312  1.00 72.36  ? 23  DG  D C4    1 
ATOM   2586 P  P     . DG  C 3 24  ? 68.965  -4.827  68.580  1.00 89.81  ? 24  DG  D P     1 
ATOM   2587 O  OP1   . DG  C 3 24  ? 70.336  -5.075  68.080  1.00 87.62  ? 24  DG  D OP1   1 
ATOM   2588 O  OP2   . DG  C 3 24  ? 68.516  -5.459  69.840  1.00 87.93  ? 24  DG  D OP2   1 
ATOM   2589 O  "O5'" . DG  C 3 24  ? 68.745  -3.251  68.713  1.00 80.30  ? 24  DG  D "O5'" 1 
ATOM   2590 C  "C5'" . DG  C 3 24  ? 68.375  -2.490  67.567  1.00 83.65  ? 24  DG  D "C5'" 1 
ATOM   2591 C  "C4'" . DG  C 3 24  ? 68.332  -1.011  67.898  1.00 86.90  ? 24  DG  D "C4'" 1 
ATOM   2592 O  "O4'" . DG  C 3 24  ? 66.958  -0.593  68.099  1.00 86.43  ? 24  DG  D "O4'" 1 
ATOM   2593 C  "C3'" . DG  C 3 24  ? 69.085  -0.621  69.161  1.00 85.42  ? 24  DG  D "C3'" 1 
ATOM   2594 O  "O3'" . DG  C 3 24  ? 69.696  0.643   68.987  1.00 88.11  ? 24  DG  D "O3'" 1 
ATOM   2595 C  "C2'" . DG  C 3 24  ? 67.987  -0.579  70.221  1.00 82.91  ? 24  DG  D "C2'" 1 
ATOM   2596 C  "C1'" . DG  C 3 24  ? 66.776  -0.117  69.417  1.00 79.00  ? 24  DG  D "C1'" 1 
ATOM   2597 N  N9    . DG  C 3 24  ? 65.512  -0.648  69.919  1.00 70.28  ? 24  DG  D N9    1 
ATOM   2598 C  C8    . DG  C 3 24  ? 65.282  -1.913  70.402  1.00 71.91  ? 24  DG  D C8    1 
ATOM   2599 N  N7    . DG  C 3 24  ? 64.049  -2.110  70.778  1.00 69.31  ? 24  DG  D N7    1 
ATOM   2600 C  C5    . DG  C 3 24  ? 63.419  -0.898  70.526  1.00 66.32  ? 24  DG  D C5    1 
ATOM   2601 C  C6    . DG  C 3 24  ? 62.075  -0.510  70.733  1.00 66.29  ? 24  DG  D C6    1 
ATOM   2602 O  O6    . DG  C 3 24  ? 61.143  -1.185  71.195  1.00 68.19  ? 24  DG  D O6    1 
ATOM   2603 N  N1    . DG  C 3 24  ? 61.853  0.809   70.343  1.00 62.53  ? 24  DG  D N1    1 
ATOM   2604 C  C2    . DG  C 3 24  ? 62.810  1.645   69.820  1.00 62.53  ? 24  DG  D C2    1 
ATOM   2605 N  N2    . DG  C 3 24  ? 62.408  2.884   69.502  1.00 58.98  ? 24  DG  D N2    1 
ATOM   2606 N  N3    . DG  C 3 24  ? 64.075  1.294   69.621  1.00 62.78  ? 24  DG  D N3    1 
ATOM   2607 C  C4    . DG  C 3 24  ? 64.306  0.013   69.996  1.00 64.38  ? 24  DG  D C4    1 
ATOM   2608 P  P     . DC  C 3 25  ? 70.948  1.064   69.899  1.00 94.85  ? 25  DC  D P     1 
ATOM   2609 O  OP1   . DC  C 3 25  ? 72.065  1.420   68.995  1.00 92.26  ? 25  DC  D OP1   1 
ATOM   2610 O  OP2   . DC  C 3 25  ? 71.136  0.009   70.920  1.00 81.89  ? 25  DC  D OP2   1 
ATOM   2611 O  "O5'" . DC  C 3 25  ? 70.438  2.383   70.641  1.00 84.97  ? 25  DC  D "O5'" 1 
ATOM   2612 C  "C5'" . DC  C 3 25  ? 69.798  3.409   69.893  1.00 77.54  ? 25  DC  D "C5'" 1 
ATOM   2613 C  "C4'" . DC  C 3 25  ? 68.772  4.134   70.742  1.00 81.44  ? 25  DC  D "C4'" 1 
ATOM   2614 O  "O4'" . DC  C 3 25  ? 67.608  3.300   70.917  1.00 77.06  ? 25  DC  D "O4'" 1 
ATOM   2615 C  "C3'" . DC  C 3 25  ? 69.244  4.497   72.153  1.00 80.05  ? 25  DC  D "C3'" 1 
ATOM   2616 O  "O3'" . DC  C 3 25  ? 69.380  5.908   72.275  1.00 77.17  ? 25  DC  D "O3'" 1 
ATOM   2617 C  "C2'" . DC  C 3 25  ? 68.148  3.949   73.085  1.00 69.06  ? 25  DC  D "C2'" 1 
ATOM   2618 C  "C1'" . DC  C 3 25  ? 67.002  3.644   72.132  1.00 71.34  ? 25  DC  D "C1'" 1 
ATOM   2619 N  N1    . DC  C 3 25  ? 66.146  2.508   72.577  1.00 68.56  ? 25  DC  D N1    1 
ATOM   2620 C  C2    . DC  C 3 25  ? 64.761  2.679   72.669  1.00 63.08  ? 25  DC  D C2    1 
ATOM   2621 O  O2    . DC  C 3 25  ? 64.267  3.774   72.371  1.00 61.57  ? 25  DC  D O2    1 
ATOM   2622 N  N3    . DC  C 3 25  ? 63.996  1.636   73.079  1.00 54.63  ? 25  DC  D N3    1 
ATOM   2623 C  C4    . DC  C 3 25  ? 64.567  0.471   73.390  1.00 60.21  ? 25  DC  D C4    1 
ATOM   2624 N  N4    . DC  C 3 25  ? 63.773  -0.527  73.789  1.00 69.32  ? 25  DC  D N4    1 
ATOM   2625 C  C5    . DC  C 3 25  ? 65.978  0.279   73.306  1.00 58.92  ? 25  DC  D C5    1 
ATOM   2626 C  C6    . DC  C 3 25  ? 66.721  1.314   72.901  1.00 64.24  ? 25  DC  D C6    1 
ATOM   2627 N  N     . GLU D 1 6   ? 53.072  -14.392 7.302   1.00 79.27  ? 5   GLU F N     1 
ATOM   2628 C  CA    . GLU D 1 6   ? 51.705  -14.453 6.799   1.00 82.89  ? 5   GLU F CA    1 
ATOM   2629 C  C     . GLU D 1 6   ? 50.717  -14.153 7.928   1.00 77.47  ? 5   GLU F C     1 
ATOM   2630 O  O     . GLU D 1 6   ? 49.556  -13.823 7.680   1.00 80.68  ? 5   GLU F O     1 
ATOM   2631 C  CB    . GLU D 1 6   ? 51.432  -15.825 6.168   1.00 81.62  ? 5   GLU F CB    1 
ATOM   2632 C  CG    . GLU D 1 6   ? 50.021  -16.026 5.633   1.00 81.03  ? 5   GLU F CG    1 
ATOM   2633 C  CD    . GLU D 1 6   ? 49.579  -14.912 4.702   1.00 87.84  ? 5   GLU F CD    1 
ATOM   2634 O  OE1   . GLU D 1 6   ? 50.229  -14.714 3.655   1.00 89.81  ? 5   GLU F OE1   1 
ATOM   2635 O  OE2   . GLU D 1 6   ? 48.576  -14.237 5.016   1.00 83.94  ? 5   GLU F OE2   1 
ATOM   2636 N  N     . ASN D 1 7   ? 51.195  -14.271 9.170   1.00 69.15  ? 6   ASN F N     1 
ATOM   2637 C  CA    . ASN D 1 7   ? 50.438  -13.917 10.369  1.00 71.53  ? 6   ASN F CA    1 
ATOM   2638 C  C     . ASN D 1 7   ? 49.235  -14.831 10.585  1.00 72.93  ? 6   ASN F C     1 
ATOM   2639 O  O     . ASN D 1 7   ? 49.017  -15.316 11.700  1.00 67.24  ? 6   ASN F O     1 
ATOM   2640 C  CB    . ASN D 1 7   ? 49.997  -12.451 10.316  1.00 80.96  ? 6   ASN F CB    1 
ATOM   2641 C  CG    . ASN D 1 7   ? 49.137  -12.059 11.499  1.00 83.70  ? 6   ASN F CG    1 
ATOM   2642 O  OD1   . ASN D 1 7   ? 47.909  -12.121 11.436  1.00 77.28  ? 6   ASN F OD1   1 
ATOM   2643 N  ND2   . ASN D 1 7   ? 49.779  -11.659 12.591  1.00 85.01  ? 6   ASN F ND2   1 
ATOM   2644 N  N     . VAL D 1 8   ? 48.434  -15.063 9.540   1.00 72.25  ? 7   VAL F N     1 
ATOM   2645 C  CA    . VAL D 1 8   ? 47.412  -16.096 9.636   1.00 57.77  ? 7   VAL F CA    1 
ATOM   2646 C  C     . VAL D 1 8   ? 48.050  -17.478 9.636   1.00 57.10  ? 7   VAL F C     1 
ATOM   2647 O  O     . VAL D 1 8   ? 47.447  -18.439 10.127  1.00 49.25  ? 7   VAL F O     1 
ATOM   2648 C  CB    . VAL D 1 8   ? 46.375  -15.960 8.503   1.00 62.68  ? 7   VAL F CB    1 
ATOM   2649 C  CG1   . VAL D 1 8   ? 46.897  -16.561 7.209   1.00 65.22  ? 7   VAL F CG1   1 
ATOM   2650 C  CG2   . VAL D 1 8   ? 45.059  -16.607 8.904   1.00 56.16  ? 7   VAL F CG2   1 
ATOM   2651 N  N     . SER D 1 9   ? 49.271  -17.599 9.106   1.00 57.32  ? 8   SER F N     1 
ATOM   2652 C  CA    . SER D 1 9   ? 50.001  -18.857 9.202   1.00 54.54  ? 8   SER F CA    1 
ATOM   2653 C  C     . SER D 1 9   ? 50.526  -19.078 10.614  1.00 51.32  ? 8   SER F C     1 
ATOM   2654 O  O     . SER D 1 9   ? 50.550  -20.213 11.104  1.00 47.62  ? 8   SER F O     1 
ATOM   2655 C  CB    . SER D 1 9   ? 51.149  -18.875 8.194   1.00 63.14  ? 8   SER F CB    1 
ATOM   2656 O  OG    . SER D 1 9   ? 52.257  -18.133 8.675   1.00 65.76  ? 8   SER F OG    1 
ATOM   2657 N  N     . GLY D 1 10  ? 50.950  -18.004 11.284  1.00 50.06  ? 9   GLY F N     1 
ATOM   2658 C  CA    . GLY D 1 10  ? 51.423  -18.137 12.651  1.00 48.96  ? 9   GLY F CA    1 
ATOM   2659 C  C     . GLY D 1 10  ? 50.314  -18.498 13.619  1.00 51.88  ? 9   GLY F C     1 
ATOM   2660 O  O     . GLY D 1 10  ? 50.499  -19.338 14.504  1.00 43.20  ? 9   GLY F O     1 
ATOM   2661 N  N     . ILE D 1 11  ? 49.146  -17.871 13.468  1.00 48.16  ? 10  ILE F N     1 
ATOM   2662 C  CA    . ILE D 1 11  ? 48.012  -18.210 14.321  1.00 42.80  ? 10  ILE F CA    1 
ATOM   2663 C  C     . ILE D 1 11  ? 47.510  -19.613 14.002  1.00 38.91  ? 10  ILE F C     1 
ATOM   2664 O  O     . ILE D 1 11  ? 47.080  -20.351 14.897  1.00 41.45  ? 10  ILE F O     1 
ATOM   2665 C  CB    . ILE D 1 11  ? 46.902  -17.151 14.176  1.00 50.38  ? 10  ILE F CB    1 
ATOM   2666 C  CG1   . ILE D 1 11  ? 47.392  -15.799 14.698  1.00 52.62  ? 10  ILE F CG1   1 
ATOM   2667 C  CG2   . ILE D 1 11  ? 45.643  -17.578 14.916  1.00 43.68  ? 10  ILE F CG2   1 
ATOM   2668 C  CD1   . ILE D 1 11  ? 46.333  -14.717 14.693  1.00 53.22  ? 10  ILE F CD1   1 
ATOM   2669 N  N     . SER D 1 12  ? 47.569  -20.009 12.728  1.00 42.08  ? 11  SER F N     1 
ATOM   2670 C  CA    . SER D 1 12  ? 47.187  -21.367 12.354  1.00 43.47  ? 11  SER F CA    1 
ATOM   2671 C  C     . SER D 1 12  ? 48.101  -22.392 13.014  1.00 41.24  ? 11  SER F C     1 
ATOM   2672 O  O     . SER D 1 12  ? 47.635  -23.398 13.560  1.00 33.79  ? 11  SER F O     1 
ATOM   2673 C  CB    . SER D 1 12  ? 47.217  -21.523 10.833  1.00 40.48  ? 11  SER F CB    1 
ATOM   2674 O  OG    . SER D 1 12  ? 46.196  -20.759 10.217  1.00 45.60  ? 11  SER F OG    1 
ATOM   2675 N  N     . ALA D 1 13  ? 49.414  -22.148 12.972  1.00 39.21  ? 12  ALA F N     1 
ATOM   2676 C  CA    . ALA D 1 13  ? 50.359  -23.074 13.586  1.00 34.74  ? 12  ALA F CA    1 
ATOM   2677 C  C     . ALA D 1 13  ? 50.169  -23.138 15.095  1.00 36.83  ? 12  ALA F C     1 
ATOM   2678 O  O     . ALA D 1 13  ? 50.266  -24.214 15.695  1.00 35.85  ? 12  ALA F O     1 
ATOM   2679 C  CB    . ALA D 1 13  ? 51.791  -22.668 13.242  1.00 33.12  ? 12  ALA F CB    1 
ATOM   2680 N  N     . TYR D 1 14  ? 49.897  -21.993 15.724  1.00 38.13  ? 13  TYR F N     1 
ATOM   2681 C  CA    . TYR D 1 14  ? 49.669  -21.974 17.165  1.00 34.90  ? 13  TYR F CA    1 
ATOM   2682 C  C     . TYR D 1 14  ? 48.428  -22.777 17.531  1.00 32.28  ? 13  TYR F C     1 
ATOM   2683 O  O     . TYR D 1 14  ? 48.456  -23.600 18.453  1.00 32.57  ? 13  TYR F O     1 
ATOM   2684 C  CB    . TYR D 1 14  ? 49.544  -20.531 17.656  1.00 36.30  ? 13  TYR F CB    1 
ATOM   2685 C  CG    . TYR D 1 14  ? 49.243  -20.413 19.131  1.00 34.79  ? 13  TYR F CG    1 
ATOM   2686 C  CD1   . TYR D 1 14  ? 50.222  -20.671 20.081  1.00 37.06  ? 13  TYR F CD1   1 
ATOM   2687 C  CD2   . TYR D 1 14  ? 47.980  -20.041 19.575  1.00 34.68  ? 13  TYR F CD2   1 
ATOM   2688 C  CE1   . TYR D 1 14  ? 49.952  -20.563 21.432  1.00 35.67  ? 13  TYR F CE1   1 
ATOM   2689 C  CE2   . TYR D 1 14  ? 47.701  -19.931 20.924  1.00 37.24  ? 13  TYR F CE2   1 
ATOM   2690 C  CZ    . TYR D 1 14  ? 48.691  -20.194 21.848  1.00 42.75  ? 13  TYR F CZ    1 
ATOM   2691 O  OH    . TYR D 1 14  ? 48.422  -20.087 23.193  1.00 43.26  ? 13  TYR F OH    1 
ATOM   2692 N  N     . LEU D 1 15  ? 47.325  -22.548 16.814  1.00 36.94  ? 14  LEU F N     1 
ATOM   2693 C  CA    . LEU D 1 15  ? 46.104  -23.304 17.074  1.00 35.61  ? 14  LEU F CA    1 
ATOM   2694 C  C     . LEU D 1 15  ? 46.313  -24.791 16.824  1.00 34.19  ? 14  LEU F C     1 
ATOM   2695 O  O     . LEU D 1 15  ? 45.806  -25.631 17.576  1.00 28.57  ? 14  LEU F O     1 
ATOM   2696 C  CB    . LEU D 1 15  ? 44.962  -22.770 16.209  1.00 27.23  ? 14  LEU F CB    1 
ATOM   2697 C  CG    . LEU D 1 15  ? 44.391  -21.407 16.604  1.00 36.27  ? 14  LEU F CG    1 
ATOM   2698 C  CD1   . LEU D 1 15  ? 43.447  -20.890 15.529  1.00 39.50  ? 14  LEU F CD1   1 
ATOM   2699 C  CD2   . LEU D 1 15  ? 43.681  -21.498 17.945  1.00 32.99  ? 14  LEU F CD2   1 
ATOM   2700 N  N     . LEU D 1 16  ? 47.065  -25.135 15.774  1.00 31.55  ? 15  LEU F N     1 
ATOM   2701 C  CA    . LEU D 1 16  ? 47.344  -26.540 15.492  1.00 32.75  ? 15  LEU F CA    1 
ATOM   2702 C  C     . LEU D 1 16  ? 48.092  -27.195 16.646  1.00 34.65  ? 15  LEU F C     1 
ATOM   2703 O  O     . LEU D 1 16  ? 47.859  -28.368 16.961  1.00 32.37  ? 15  LEU F O     1 
ATOM   2704 C  CB    . LEU D 1 16  ? 48.141  -26.665 14.193  1.00 31.39  ? 15  LEU F CB    1 
ATOM   2705 C  CG    . LEU D 1 16  ? 48.370  -28.085 13.671  1.00 35.13  ? 15  LEU F CG    1 
ATOM   2706 C  CD1   . LEU D 1 16  ? 47.044  -28.766 13.362  1.00 29.27  ? 15  LEU F CD1   1 
ATOM   2707 C  CD2   . LEU D 1 16  ? 49.268  -28.065 12.443  1.00 32.77  ? 15  LEU F CD2   1 
ATOM   2708 N  N     . GLY D 1 17  ? 48.995  -26.451 17.290  1.00 32.49  ? 16  GLY F N     1 
ATOM   2709 C  CA    . GLY D 1 17  ? 49.674  -26.983 18.460  1.00 33.96  ? 16  GLY F CA    1 
ATOM   2710 C  C     . GLY D 1 17  ? 48.720  -27.275 19.602  1.00 33.36  ? 16  GLY F C     1 
ATOM   2711 O  O     . GLY D 1 17  ? 48.855  -28.287 20.293  1.00 36.30  ? 16  GLY F O     1 
ATOM   2712 N  N     . LEU D 1 18  ? 47.739  -26.394 19.813  1.00 32.65  ? 17  LEU F N     1 
ATOM   2713 C  CA    . LEU D 1 18  ? 46.732  -26.639 20.841  1.00 33.12  ? 17  LEU F CA    1 
ATOM   2714 C  C     . LEU D 1 18  ? 45.818  -27.793 20.452  1.00 32.61  ? 17  LEU F C     1 
ATOM   2715 O  O     . LEU D 1 18  ? 45.464  -28.624 21.297  1.00 31.93  ? 17  LEU F O     1 
ATOM   2716 C  CB    . LEU D 1 18  ? 45.910  -25.374 21.087  1.00 30.40  ? 17  LEU F CB    1 
ATOM   2717 C  CG    . LEU D 1 18  ? 46.640  -24.121 21.568  1.00 32.23  ? 17  LEU F CG    1 
ATOM   2718 C  CD1   . LEU D 1 18  ? 45.663  -22.962 21.673  1.00 34.34  ? 17  LEU F CD1   1 
ATOM   2719 C  CD2   . LEU D 1 18  ? 47.318  -24.372 22.903  1.00 30.91  ? 17  LEU F CD2   1 
ATOM   2720 N  N     . ILE D 1 19  ? 45.423  -27.855 19.178  1.00 30.05  ? 18  ILE F N     1 
ATOM   2721 C  CA    . ILE D 1 19  ? 44.533  -28.918 18.714  1.00 29.82  ? 18  ILE F CA    1 
ATOM   2722 C  C     . ILE D 1 19  ? 45.199  -30.278 18.885  1.00 33.91  ? 18  ILE F C     1 
ATOM   2723 O  O     . ILE D 1 19  ? 44.650  -31.184 19.520  1.00 30.18  ? 18  ILE F O     1 
ATOM   2724 C  CB    . ILE D 1 19  ? 44.123  -28.678 17.251  1.00 32.58  ? 18  ILE F CB    1 
ATOM   2725 C  CG1   . ILE D 1 19  ? 43.264  -27.418 17.133  1.00 30.30  ? 18  ILE F CG1   1 
ATOM   2726 C  CG2   . ILE D 1 19  ? 43.383  -29.887 16.701  1.00 30.44  ? 18  ILE F CG2   1 
ATOM   2727 C  CD1   . ILE D 1 19  ? 43.211  -26.849 15.734  1.00 29.83  ? 18  ILE F CD1   1 
ATOM   2728 N  N     . ILE D 1 20  ? 46.394  -30.441 18.316  1.00 29.22  ? 19  ILE F N     1 
ATOM   2729 C  CA    . ILE D 1 20  ? 47.109  -31.708 18.449  1.00 39.03  ? 19  ILE F CA    1 
ATOM   2730 C  C     . ILE D 1 20  ? 47.372  -32.017 19.916  1.00 34.78  ? 19  ILE F C     1 
ATOM   2731 O  O     . ILE D 1 20  ? 47.291  -33.173 20.349  1.00 36.67  ? 19  ILE F O     1 
ATOM   2732 C  CB    . ILE D 1 20  ? 48.412  -31.669 17.629  1.00 40.32  ? 19  ILE F CB    1 
ATOM   2733 C  CG1   . ILE D 1 20  ? 48.103  -31.637 16.129  1.00 41.55  ? 19  ILE F CG1   1 
ATOM   2734 C  CG2   . ILE D 1 20  ? 49.287  -32.858 17.956  1.00 39.06  ? 19  ILE F CG2   1 
ATOM   2735 C  CD1   . ILE D 1 20  ? 47.332  -32.837 15.648  1.00 51.34  ? 19  ILE F CD1   1 
ATOM   2736 N  N     . GLY D 1 21  ? 47.660  -30.987 20.707  1.00 33.17  ? 20  GLY F N     1 
ATOM   2737 C  CA    . GLY D 1 21  ? 47.897  -31.162 22.124  1.00 31.15  ? 20  GLY F CA    1 
ATOM   2738 C  C     . GLY D 1 21  ? 46.657  -31.498 22.929  1.00 38.70  ? 20  GLY F C     1 
ATOM   2739 O  O     . GLY D 1 21  ? 46.517  -32.623 23.409  1.00 36.62  ? 20  GLY F O     1 
ATOM   2740 N  N     . ASP D 1 22  ? 45.742  -30.544 23.088  1.00 31.10  ? 21  ASP F N     1 
ATOM   2741 C  CA    . ASP D 1 22  ? 44.623  -30.708 24.009  1.00 32.97  ? 21  ASP F CA    1 
ATOM   2742 C  C     . ASP D 1 22  ? 43.295  -30.979 23.313  1.00 33.89  ? 21  ASP F C     1 
ATOM   2743 O  O     . ASP D 1 22  ? 42.253  -30.976 23.976  1.00 34.20  ? 21  ASP F O     1 
ATOM   2744 C  CB    . ASP D 1 22  ? 44.496  -29.475 24.903  1.00 36.14  ? 21  ASP F CB    1 
ATOM   2745 C  CG    . ASP D 1 22  ? 45.535  -29.448 26.000  1.00 33.49  ? 21  ASP F CG    1 
ATOM   2746 O  OD1   . ASP D 1 22  ? 46.066  -30.525 26.345  1.00 39.43  ? 21  ASP F OD1   1 
ATOM   2747 O  OD2   . ASP D 1 22  ? 45.819  -28.349 26.516  1.00 39.23  ? 21  ASP F OD2   1 
ATOM   2748 N  N     . GLY D 1 23  ? 43.300  -31.219 22.006  1.00 29.39  ? 22  GLY F N     1 
ATOM   2749 C  CA    . GLY D 1 23  ? 42.060  -31.494 21.307  1.00 34.26  ? 22  GLY F CA    1 
ATOM   2750 C  C     . GLY D 1 23  ? 42.187  -32.601 20.282  1.00 34.48  ? 22  GLY F C     1 
ATOM   2751 O  O     . GLY D 1 23  ? 42.774  -33.650 20.564  1.00 33.73  ? 22  GLY F O     1 
ATOM   2752 N  N     . GLY D 1 24  ? 41.651  -32.379 19.089  1.00 38.17  ? 23  GLY F N     1 
ATOM   2753 C  CA    . GLY D 1 24  ? 41.762  -33.371 18.037  1.00 33.73  ? 23  GLY F CA    1 
ATOM   2754 C  C     . GLY D 1 24  ? 41.012  -32.930 16.800  1.00 33.97  ? 23  GLY F C     1 
ATOM   2755 O  O     . GLY D 1 24  ? 40.301  -31.919 16.796  1.00 31.48  ? 23  GLY F O     1 
ATOM   2756 N  N     . LEU D 1 25  ? 41.193  -33.712 15.739  1.00 31.01  ? 24  LEU F N     1 
ATOM   2757 C  CA    . LEU D 1 25  ? 40.499  -33.528 14.472  1.00 29.14  ? 24  LEU F CA    1 
ATOM   2758 C  C     . LEU D 1 25  ? 39.706  -34.796 14.197  1.00 33.74  ? 24  LEU F C     1 
ATOM   2759 O  O     . LEU D 1 25  ? 40.286  -35.882 14.098  1.00 32.77  ? 24  LEU F O     1 
ATOM   2760 C  CB    . LEU D 1 25  ? 41.489  -33.240 13.342  1.00 30.49  ? 24  LEU F CB    1 
ATOM   2761 C  CG    . LEU D 1 25  ? 42.394  -32.027 13.566  1.00 32.69  ? 24  LEU F CG    1 
ATOM   2762 C  CD1   . LEU D 1 25  ? 43.572  -32.039 12.604  1.00 29.55  ? 24  LEU F CD1   1 
ATOM   2763 C  CD2   . LEU D 1 25  ? 41.600  -30.737 13.430  1.00 34.08  ? 24  LEU F CD2   1 
ATOM   2764 N  N     . TYR D 1 26  ? 38.386  -34.662 14.081  1.00 30.78  ? 25  TYR F N     1 
ATOM   2765 C  CA    . TYR D 1 26  ? 37.497  -35.814 14.086  1.00 34.08  ? 25  TYR F CA    1 
ATOM   2766 C  C     . TYR D 1 26  ? 36.594  -35.803 12.863  1.00 34.71  ? 25  TYR F C     1 
ATOM   2767 O  O     . TYR D 1 26  ? 35.928  -34.801 12.581  1.00 38.65  ? 25  TYR F O     1 
ATOM   2768 C  CB    . TYR D 1 26  ? 36.661  -35.841 15.368  1.00 30.01  ? 25  TYR F CB    1 
ATOM   2769 C  CG    . TYR D 1 26  ? 37.508  -35.785 16.617  1.00 39.99  ? 25  TYR F CG    1 
ATOM   2770 C  CD1   . TYR D 1 26  ? 38.360  -36.831 16.946  1.00 37.39  ? 25  TYR F CD1   1 
ATOM   2771 C  CD2   . TYR D 1 26  ? 37.471  -34.679 17.457  1.00 34.12  ? 25  TYR F CD2   1 
ATOM   2772 C  CE1   . TYR D 1 26  ? 39.142  -36.784 18.082  1.00 33.41  ? 25  TYR F CE1   1 
ATOM   2773 C  CE2   . TYR D 1 26  ? 38.249  -34.624 18.597  1.00 34.22  ? 25  TYR F CE2   1 
ATOM   2774 C  CZ    . TYR D 1 26  ? 39.083  -35.679 18.903  1.00 38.80  ? 25  TYR F CZ    1 
ATOM   2775 O  OH    . TYR D 1 26  ? 39.862  -35.631 20.034  1.00 36.77  ? 25  TYR F OH    1 
ATOM   2776 N  N     . LYS D 1 27  ? 36.575  -36.925 12.148  1.00 34.15  ? 26  LYS F N     1 
ATOM   2777 C  CA    . LYS D 1 27  ? 35.703  -37.149 11.001  1.00 41.17  ? 26  LYS F CA    1 
ATOM   2778 C  C     . LYS D 1 27  ? 34.675  -38.198 11.411  1.00 43.55  ? 26  LYS F C     1 
ATOM   2779 O  O     . LYS D 1 27  ? 34.998  -39.387 11.503  1.00 46.52  ? 26  LYS F O     1 
ATOM   2780 C  CB    . LYS D 1 27  ? 36.519  -37.596 9.789   1.00 41.07  ? 26  LYS F CB    1 
ATOM   2781 C  CG    . LYS D 1 27  ? 35.718  -37.921 8.538   1.00 47.64  ? 26  LYS F CG    1 
ATOM   2782 C  CD    . LYS D 1 27  ? 36.653  -38.065 7.341   1.00 50.41  ? 26  LYS F CD    1 
ATOM   2783 C  CE    . LYS D 1 27  ? 36.228  -39.194 6.415   1.00 56.31  ? 26  LYS F CE    1 
ATOM   2784 N  NZ    . LYS D 1 27  ? 35.083  -38.814 5.544   1.00 60.56  ? 26  LYS F NZ    1 
ATOM   2785 N  N     . LEU D 1 28  ? 33.447  -37.755 11.671  1.00 41.89  ? 27  LEU F N     1 
ATOM   2786 C  CA    . LEU D 1 28  ? 32.404  -38.604 12.229  1.00 42.29  ? 27  LEU F CA    1 
ATOM   2787 C  C     . LEU D 1 28  ? 31.489  -39.134 11.133  1.00 50.14  ? 27  LEU F C     1 
ATOM   2788 O  O     . LEU D 1 28  ? 31.183  -38.428 10.168  1.00 44.59  ? 27  LEU F O     1 
ATOM   2789 C  CB    . LEU D 1 28  ? 31.558  -37.846 13.257  1.00 47.49  ? 27  LEU F CB    1 
ATOM   2790 C  CG    . LEU D 1 28  ? 32.112  -37.464 14.634  1.00 43.41  ? 27  LEU F CG    1 
ATOM   2791 C  CD1   . LEU D 1 28  ? 32.638  -38.688 15.374  1.00 46.80  ? 27  LEU F CD1   1 
ATOM   2792 C  CD2   . LEU D 1 28  ? 33.170  -36.371 14.547  1.00 44.94  ? 27  LEU F CD2   1 
ATOM   2793 N  N     . LYS D 1 29  ? 31.048  -40.378 11.300  1.00 47.87  ? 28  LYS F N     1 
ATOM   2794 C  CA    . LYS D 1 29  ? 30.005  -40.975 10.477  1.00 47.12  ? 28  LYS F CA    1 
ATOM   2795 C  C     . LYS D 1 29  ? 28.791  -41.253 11.351  1.00 54.76  ? 28  LYS F C     1 
ATOM   2796 O  O     . LYS D 1 29  ? 28.910  -41.896 12.399  1.00 58.57  ? 28  LYS F O     1 
ATOM   2797 C  CB    . LYS D 1 29  ? 30.489  -42.267 9.811   1.00 47.06  ? 28  LYS F CB    1 
ATOM   2798 C  CG    . LYS D 1 29  ? 31.362  -42.057 8.578   1.00 54.72  ? 28  LYS F CG    1 
ATOM   2799 C  CD    . LYS D 1 29  ? 31.117  -40.697 7.944   1.00 57.11  ? 28  LYS F CD    1 
ATOM   2800 C  CE    . LYS D 1 29  ? 32.291  -40.266 7.084   1.00 60.87  ? 28  LYS F CE    1 
ATOM   2801 N  NZ    . LYS D 1 29  ? 31.999  -39.008 6.343   1.00 62.99  ? 28  LYS F NZ    1 
ATOM   2802 N  N     . TYR D 1 30  ? 27.635  -40.756 10.929  1.00 51.02  ? 29  TYR F N     1 
ATOM   2803 C  CA    . TYR D 1 30  ? 26.385  -40.938 11.651  1.00 49.18  ? 29  TYR F CA    1 
ATOM   2804 C  C     . TYR D 1 30  ? 25.434  -41.805 10.836  1.00 55.43  ? 29  TYR F C     1 
ATOM   2805 O  O     . TYR D 1 30  ? 25.676  -42.109 9.665   1.00 45.49  ? 29  TYR F O     1 
ATOM   2806 C  CB    . TYR D 1 30  ? 25.739  -39.585 11.971  1.00 49.52  ? 29  TYR F CB    1 
ATOM   2807 C  CG    . TYR D 1 30  ? 26.564  -38.702 12.881  1.00 51.76  ? 29  TYR F CG    1 
ATOM   2808 C  CD1   . TYR D 1 30  ? 27.381  -39.251 13.862  1.00 50.55  ? 29  TYR F CD1   1 
ATOM   2809 C  CD2   . TYR D 1 30  ? 26.527  -37.319 12.759  1.00 46.55  ? 29  TYR F CD2   1 
ATOM   2810 C  CE1   . TYR D 1 30  ? 28.137  -38.446 14.696  1.00 49.06  ? 29  TYR F CE1   1 
ATOM   2811 C  CE2   . TYR D 1 30  ? 27.279  -36.506 13.588  1.00 44.32  ? 29  TYR F CE2   1 
ATOM   2812 C  CZ    . TYR D 1 30  ? 28.082  -37.075 14.554  1.00 50.01  ? 29  TYR F CZ    1 
ATOM   2813 O  OH    . TYR D 1 30  ? 28.833  -36.272 15.382  1.00 49.47  ? 29  TYR F OH    1 
ATOM   2814 N  N     . LYS D 1 31  ? 24.338  -42.204 11.476  1.00 57.36  ? 30  LYS F N     1 
ATOM   2815 C  CA    . LYS D 1 31  ? 23.338  -43.021 10.805  1.00 57.53  ? 30  LYS F CA    1 
ATOM   2816 C  C     . LYS D 1 31  ? 22.651  -42.228 9.698   1.00 58.47  ? 30  LYS F C     1 
ATOM   2817 O  O     . LYS D 1 31  ? 22.469  -41.011 9.792   1.00 59.86  ? 30  LYS F O     1 
ATOM   2818 C  CB    . LYS D 1 31  ? 22.299  -43.529 11.807  1.00 59.64  ? 30  LYS F CB    1 
ATOM   2819 C  CG    . LYS D 1 31  ? 21.567  -42.427 12.557  1.00 70.79  ? 30  LYS F CG    1 
ATOM   2820 C  CD    . LYS D 1 31  ? 20.081  -42.722 12.683  1.00 80.42  ? 30  LYS F CD    1 
ATOM   2821 C  CE    . LYS D 1 31  ? 19.386  -41.685 13.553  1.00 79.37  ? 30  LYS F CE    1 
ATOM   2822 N  NZ    . LYS D 1 31  ? 19.232  -40.379 12.853  1.00 79.27  ? 30  LYS F NZ    1 
ATOM   2823 N  N     . GLY D 1 32  ? 22.277  -42.932 8.636   1.00 56.02  ? 31  GLY F N     1 
ATOM   2824 C  CA    . GLY D 1 32  ? 21.583  -42.303 7.525   1.00 52.85  ? 31  GLY F CA    1 
ATOM   2825 C  C     . GLY D 1 32  ? 22.462  -41.444 6.641   1.00 57.17  ? 31  GLY F C     1 
ATOM   2826 O  O     . GLY D 1 32  ? 22.013  -40.393 6.163   1.00 51.00  ? 31  GLY F O     1 
ATOM   2827 N  N     . ASN D 1 33  ? 23.707  -41.863 6.417   1.00 51.84  ? 32  ASN F N     1 
ATOM   2828 C  CA    . ASN D 1 33  ? 24.683  -41.180 5.571   1.00 48.89  ? 32  ASN F CA    1 
ATOM   2829 C  C     . ASN D 1 33  ? 25.059  -39.796 6.086   1.00 48.82  ? 32  ASN F C     1 
ATOM   2830 O  O     . ASN D 1 33  ? 25.707  -39.028 5.365   1.00 45.98  ? 32  ASN F O     1 
ATOM   2831 C  CB    . ASN D 1 33  ? 24.198  -41.077 4.118   1.00 57.14  ? 32  ASN F CB    1 
ATOM   2832 C  CG    . ASN D 1 33  ? 24.057  -42.431 3.453   1.00 63.36  ? 32  ASN F CG    1 
ATOM   2833 O  OD1   . ASN D 1 33  ? 22.964  -42.824 3.046   1.00 60.91  ? 32  ASN F OD1   1 
ATOM   2834 N  ND2   . ASN D 1 33  ? 25.166  -43.151 3.338   1.00 67.41  ? 32  ASN F ND2   1 
ATOM   2835 N  N     . ARG D 1 34  ? 24.676  -39.454 7.313   1.00 44.18  ? 33  ARG F N     1 
ATOM   2836 C  CA    . ARG D 1 34  ? 25.068  -38.179 7.889   1.00 44.92  ? 33  ARG F CA    1 
ATOM   2837 C  C     . ARG D 1 34  ? 26.532  -38.224 8.320   1.00 47.29  ? 33  ARG F C     1 
ATOM   2838 O  O     . ARG D 1 34  ? 27.116  -39.292 8.526   1.00 46.74  ? 33  ARG F O     1 
ATOM   2839 C  CB    . ARG D 1 34  ? 24.165  -37.824 9.072   1.00 40.63  ? 33  ARG F CB    1 
ATOM   2840 C  CG    . ARG D 1 34  ? 22.696  -37.692 8.691   1.00 47.00  ? 33  ARG F CG    1 
ATOM   2841 C  CD    . ARG D 1 34  ? 21.796  -37.489 9.902   1.00 39.91  ? 33  ARG F CD    1 
ATOM   2842 N  NE    . ARG D 1 34  ? 21.955  -38.542 10.899  1.00 54.08  ? 33  ARG F NE    1 
ATOM   2843 C  CZ    . ARG D 1 34  ? 22.404  -38.338 12.134  1.00 56.42  ? 33  ARG F CZ    1 
ATOM   2844 N  NH1   . ARG D 1 34  ? 22.733  -37.116 12.529  1.00 49.34  ? 33  ARG F NH1   1 
ATOM   2845 N  NH2   . ARG D 1 34  ? 22.518  -39.355 12.976  1.00 57.97  ? 33  ARG F NH2   1 
ATOM   2846 N  N     . SER D 1 35  ? 27.128  -37.041 8.448   1.00 42.45  ? 34  SER F N     1 
ATOM   2847 C  CA    . SER D 1 35  ? 28.545  -36.934 8.760   1.00 42.47  ? 34  SER F CA    1 
ATOM   2848 C  C     . SER D 1 35  ? 28.788  -35.664 9.561   1.00 43.69  ? 34  SER F C     1 
ATOM   2849 O  O     . SER D 1 35  ? 27.913  -34.803 9.684   1.00 36.09  ? 34  SER F O     1 
ATOM   2850 C  CB    . SER D 1 35  ? 29.397  -36.937 7.486   1.00 38.72  ? 34  SER F CB    1 
ATOM   2851 O  OG    . SER D 1 35  ? 29.136  -35.785 6.701   1.00 44.59  ? 34  SER F OG    1 
ATOM   2852 N  N     . GLU D 1 36  ? 29.997  -35.557 10.108  1.00 38.22  ? 35  GLU F N     1 
ATOM   2853 C  CA    . GLU D 1 36  ? 30.411  -34.346 10.799  1.00 39.40  ? 35  GLU F CA    1 
ATOM   2854 C  C     . GLU D 1 36  ? 31.931  -34.285 10.832  1.00 40.70  ? 35  GLU F C     1 
ATOM   2855 O  O     . GLU D 1 36  ? 32.608  -35.314 10.903  1.00 38.02  ? 35  GLU F O     1 
ATOM   2856 C  CB    . GLU D 1 36  ? 29.845  -34.271 12.222  1.00 39.79  ? 35  GLU F CB    1 
ATOM   2857 C  CG    . GLU D 1 36  ? 29.821  -32.856 12.778  1.00 39.71  ? 35  GLU F CG    1 
ATOM   2858 C  CD    . GLU D 1 36  ? 29.377  -32.789 14.224  1.00 37.02  ? 35  GLU F CD    1 
ATOM   2859 O  OE1   . GLU D 1 36  ? 28.841  -33.795 14.735  1.00 39.94  ? 35  GLU F OE1   1 
ATOM   2860 O  OE2   . GLU D 1 36  ? 29.564  -31.725 14.851  1.00 35.32  ? 35  GLU F OE2   1 
ATOM   2861 N  N     . TYR D 1 37  ? 32.453  -33.062 10.777  1.00 32.16  ? 36  TYR F N     1 
ATOM   2862 C  CA    . TYR D 1 37  ? 33.886  -32.799 10.796  1.00 31.14  ? 36  TYR F CA    1 
ATOM   2863 C  C     . TYR D 1 37  ? 34.154  -31.778 11.889  1.00 33.62  ? 36  TYR F C     1 
ATOM   2864 O  O     . TYR D 1 37  ? 33.610  -30.670 11.848  1.00 38.45  ? 36  TYR F O     1 
ATOM   2865 C  CB    . TYR D 1 37  ? 34.371  -32.278 9.439   1.00 33.12  ? 36  TYR F CB    1 
ATOM   2866 C  CG    . TYR D 1 37  ? 34.006  -33.156 8.258   1.00 34.54  ? 36  TYR F CG    1 
ATOM   2867 C  CD1   . TYR D 1 37  ? 32.728  -33.123 7.709   1.00 35.43  ? 36  TYR F CD1   1 
ATOM   2868 C  CD2   . TYR D 1 37  ? 34.943  -34.003 7.681   1.00 35.53  ? 36  TYR F CD2   1 
ATOM   2869 C  CE1   . TYR D 1 37  ? 32.392  -33.918 6.629   1.00 32.28  ? 36  TYR F CE1   1 
ATOM   2870 C  CE2   . TYR D 1 37  ? 34.616  -34.801 6.599   1.00 36.64  ? 36  TYR F CE2   1 
ATOM   2871 C  CZ    . TYR D 1 37  ? 33.339  -34.754 6.078   1.00 46.37  ? 36  TYR F CZ    1 
ATOM   2872 O  OH    . TYR D 1 37  ? 33.008  -35.545 5.002   1.00 40.92  ? 36  TYR F OH    1 
ATOM   2873 N  N     . ARG D 1 38  ? 34.987  -32.142 12.862  1.00 31.74  ? 37  ARG F N     1 
ATOM   2874 C  CA    . ARG D 1 38  ? 35.159  -31.345 14.068  1.00 30.66  ? 37  ARG F CA    1 
ATOM   2875 C  C     . ARG D 1 38  ? 36.610  -30.932 14.266  1.00 29.64  ? 37  ARG F C     1 
ATOM   2876 O  O     . ARG D 1 38  ? 37.533  -31.726 14.054  1.00 29.19  ? 37  ARG F O     1 
ATOM   2877 C  CB    . ARG D 1 38  ? 34.672  -32.111 15.301  1.00 36.50  ? 37  ARG F CB    1 
ATOM   2878 C  CG    . ARG D 1 38  ? 33.167  -32.273 15.363  1.00 36.74  ? 37  ARG F CG    1 
ATOM   2879 C  CD    . ARG D 1 38  ? 32.724  -32.791 16.717  1.00 38.45  ? 37  ARG F CD    1 
ATOM   2880 N  NE    . ARG D 1 38  ? 31.276  -32.966 16.782  1.00 40.13  ? 37  ARG F NE    1 
ATOM   2881 C  CZ    . ARG D 1 38  ? 30.633  -33.492 17.818  1.00 42.85  ? 37  ARG F CZ    1 
ATOM   2882 N  NH1   . ARG D 1 38  ? 31.308  -33.897 18.886  1.00 41.87  ? 37  ARG F NH1   1 
ATOM   2883 N  NH2   . ARG D 1 38  ? 29.313  -33.613 17.788  1.00 41.82  ? 37  ARG F NH2   1 
ATOM   2884 N  N     . VAL D 1 39  ? 36.793  -29.682 14.680  1.00 30.93  ? 38  VAL F N     1 
ATOM   2885 C  CA    . VAL D 1 39  ? 38.072  -29.153 15.140  1.00 31.39  ? 38  VAL F CA    1 
ATOM   2886 C  C     . VAL D 1 39  ? 37.893  -28.790 16.608  1.00 38.17  ? 38  VAL F C     1 
ATOM   2887 O  O     . VAL D 1 39  ? 37.054  -27.943 16.942  1.00 35.53  ? 38  VAL F O     1 
ATOM   2888 C  CB    . VAL D 1 39  ? 38.516  -27.935 14.317  1.00 28.48  ? 38  VAL F CB    1 
ATOM   2889 C  CG1   . VAL D 1 39  ? 39.801  -27.358 14.875  1.00 28.72  ? 38  VAL F CG1   1 
ATOM   2890 C  CG2   . VAL D 1 39  ? 38.685  -28.318 12.853  1.00 27.17  ? 38  VAL F CG2   1 
ATOM   2891 N  N     . VAL D 1 40  ? 38.666  -29.430 17.483  1.00 31.00  ? 39  VAL F N     1 
ATOM   2892 C  CA    . VAL D 1 40  ? 38.394  -29.416 18.915  1.00 30.37  ? 39  VAL F CA    1 
ATOM   2893 C  C     . VAL D 1 40  ? 39.635  -28.986 19.686  1.00 34.57  ? 39  VAL F C     1 
ATOM   2894 O  O     . VAL D 1 40  ? 40.755  -29.399 19.367  1.00 31.98  ? 39  VAL F O     1 
ATOM   2895 C  CB    . VAL D 1 40  ? 37.908  -30.800 19.400  1.00 34.06  ? 39  VAL F CB    1 
ATOM   2896 C  CG1   . VAL D 1 40  ? 37.821  -30.847 20.920  1.00 31.26  ? 39  VAL F CG1   1 
ATOM   2897 C  CG2   . VAL D 1 40  ? 36.560  -31.135 18.778  1.00 30.96  ? 39  VAL F CG2   1 
ATOM   2898 N  N     . ILE D 1 41  ? 39.427  -28.139 20.695  1.00 35.77  ? 40  ILE F N     1 
ATOM   2899 C  CA    . ILE D 1 41  ? 40.400  -27.871 21.748  1.00 33.91  ? 40  ILE F CA    1 
ATOM   2900 C  C     . ILE D 1 41  ? 39.669  -27.964 23.080  1.00 38.89  ? 40  ILE F C     1 
ATOM   2901 O  O     . ILE D 1 41  ? 38.634  -27.315 23.268  1.00 37.89  ? 40  ILE F O     1 
ATOM   2902 C  CB    . ILE D 1 41  ? 41.060  -26.486 21.605  1.00 30.87  ? 40  ILE F CB    1 
ATOM   2903 C  CG1   . ILE D 1 41  ? 41.773  -26.351 20.260  1.00 29.67  ? 40  ILE F CG1   1 
ATOM   2904 C  CG2   . ILE D 1 41  ? 42.031  -26.239 22.751  1.00 32.83  ? 40  ILE F CG2   1 
ATOM   2905 C  CD1   . ILE D 1 41  ? 42.236  -24.940 19.965  1.00 33.36  ? 40  ILE F CD1   1 
ATOM   2906 N  N     . THR D 1 42  ? 40.196  -28.768 23.998  1.00 37.47  ? 41  THR F N     1 
ATOM   2907 C  CA    . THR D 1 42  ? 39.633  -28.892 25.335  1.00 38.67  ? 41  THR F CA    1 
ATOM   2908 C  C     . THR D 1 42  ? 40.576  -28.268 26.358  1.00 39.41  ? 41  THR F C     1 
ATOM   2909 O  O     . THR D 1 42  ? 41.796  -28.263 26.177  1.00 38.02  ? 41  THR F O     1 
ATOM   2910 C  CB    . THR D 1 42  ? 39.369  -30.357 25.700  1.00 37.04  ? 41  THR F CB    1 
ATOM   2911 O  OG1   . THR D 1 42  ? 40.614  -31.051 25.851  1.00 41.01  ? 41  THR F OG1   1 
ATOM   2912 C  CG2   . THR D 1 42  ? 38.541  -31.036 24.620  1.00 34.44  ? 41  THR F CG2   1 
ATOM   2913 N  N     . GLN D 1 43  ? 39.999  -27.732 27.431  1.00 39.50  ? 42  GLN F N     1 
ATOM   2914 C  CA    . GLN D 1 43  ? 40.785  -27.101 28.482  1.00 43.31  ? 42  GLN F CA    1 
ATOM   2915 C  C     . GLN D 1 43  ? 39.914  -26.927 29.717  1.00 46.86  ? 42  GLN F C     1 
ATOM   2916 O  O     . GLN D 1 43  ? 38.699  -26.733 29.613  1.00 46.83  ? 42  GLN F O     1 
ATOM   2917 C  CB    . GLN D 1 43  ? 41.339  -25.747 28.024  1.00 42.75  ? 42  GLN F CB    1 
ATOM   2918 C  CG    . GLN D 1 43  ? 42.555  -25.269 28.782  1.00 47.12  ? 42  GLN F CG    1 
ATOM   2919 C  CD    . GLN D 1 43  ? 43.826  -25.950 28.318  1.00 41.20  ? 42  GLN F CD    1 
ATOM   2920 O  OE1   . GLN D 1 43  ? 43.878  -26.491 27.218  1.00 43.27  ? 42  GLN F OE1   1 
ATOM   2921 N  NE2   . GLN D 1 43  ? 44.854  -25.932 29.158  1.00 37.47  ? 42  GLN F NE2   1 
ATOM   2922 N  N     . LYS D 1 44  ? 40.554  -27.004 30.885  1.00 49.59  ? 43  LYS F N     1 
ATOM   2923 C  CA    . LYS D 1 44  ? 39.834  -26.820 32.140  1.00 50.23  ? 43  LYS F CA    1 
ATOM   2924 C  C     . LYS D 1 44  ? 39.483  -25.356 32.366  1.00 54.45  ? 43  LYS F C     1 
ATOM   2925 O  O     . LYS D 1 44  ? 38.362  -25.037 32.780  1.00 58.00  ? 43  LYS F O     1 
ATOM   2926 C  CB    . LYS D 1 44  ? 40.670  -27.352 33.305  1.00 53.41  ? 43  LYS F CB    1 
ATOM   2927 C  CG    . LYS D 1 44  ? 39.952  -27.351 34.642  1.00 54.02  ? 43  LYS F CG    1 
ATOM   2928 C  CD    . LYS D 1 44  ? 38.844  -28.387 34.661  1.00 66.93  ? 43  LYS F CD    1 
ATOM   2929 C  CE    . LYS D 1 44  ? 38.185  -28.477 36.027  1.00 69.93  ? 43  LYS F CE    1 
ATOM   2930 N  NZ    . LYS D 1 44  ? 37.147  -29.544 36.063  1.00 71.18  ? 43  LYS F NZ    1 
ATOM   2931 N  N     . SER D 1 45  ? 40.423  -24.454 32.094  1.00 49.24  ? 44  SER F N     1 
ATOM   2932 C  CA    . SER D 1 45  ? 40.238  -23.036 32.386  1.00 52.40  ? 44  SER F CA    1 
ATOM   2933 C  C     . SER D 1 45  ? 39.200  -22.440 31.442  1.00 62.06  ? 44  SER F C     1 
ATOM   2934 O  O     . SER D 1 45  ? 39.429  -22.345 30.232  1.00 55.82  ? 44  SER F O     1 
ATOM   2935 C  CB    . SER D 1 45  ? 41.569  -22.299 32.272  1.00 51.45  ? 44  SER F CB    1 
ATOM   2936 O  OG    . SER D 1 45  ? 41.382  -20.895 32.329  1.00 58.80  ? 44  SER F OG    1 
ATOM   2937 N  N     . GLU D 1 46  ? 38.057  -22.037 32.000  1.00 65.09  ? 45  GLU F N     1 
ATOM   2938 C  CA    . GLU D 1 46  ? 37.025  -21.374 31.208  1.00 64.61  ? 45  GLU F CA    1 
ATOM   2939 C  C     . GLU D 1 46  ? 37.549  -20.083 30.593  1.00 57.55  ? 45  GLU F C     1 
ATOM   2940 O  O     . GLU D 1 46  ? 37.323  -19.807 29.409  1.00 51.70  ? 45  GLU F O     1 
ATOM   2941 C  CB    . GLU D 1 46  ? 35.801  -21.095 32.080  1.00 72.88  ? 45  GLU F CB    1 
ATOM   2942 C  CG    . GLU D 1 46  ? 34.969  -19.908 31.624  1.00 70.86  ? 45  GLU F CG    1 
ATOM   2943 C  CD    . GLU D 1 46  ? 33.748  -19.681 32.491  1.00 77.40  ? 45  GLU F CD    1 
ATOM   2944 O  OE1   . GLU D 1 46  ? 32.838  -20.537 32.475  1.00 75.54  ? 45  GLU F OE1   1 
ATOM   2945 O  OE2   . GLU D 1 46  ? 33.699  -18.648 33.191  1.00 73.01  ? 45  GLU F OE2   1 
ATOM   2946 N  N     . ASN D 1 47  ? 38.253  -19.276 31.391  1.00 61.00  ? 46  ASN F N     1 
ATOM   2947 C  CA    . ASN D 1 47  ? 38.762  -18.001 30.896  1.00 62.80  ? 46  ASN F CA    1 
ATOM   2948 C  C     . ASN D 1 47  ? 39.776  -18.205 29.777  1.00 63.07  ? 46  ASN F C     1 
ATOM   2949 O  O     . ASN D 1 47  ? 39.833  -17.414 28.829  1.00 63.64  ? 46  ASN F O     1 
ATOM   2950 C  CB    . ASN D 1 47  ? 39.379  -17.208 32.048  1.00 66.76  ? 46  ASN F CB    1 
ATOM   2951 C  CG    . ASN D 1 47  ? 40.264  -16.076 31.568  1.00 70.38  ? 46  ASN F CG    1 
ATOM   2952 O  OD1   . ASN D 1 47  ? 39.779  -15.010 31.190  1.00 81.09  ? 46  ASN F OD1   1 
ATOM   2953 N  ND2   . ASN D 1 47  ? 41.573  -16.301 31.584  1.00 66.01  ? 46  ASN F ND2   1 
ATOM   2954 N  N     . LEU D 1 48  ? 40.583  -19.264 29.867  1.00 56.55  ? 47  LEU F N     1 
ATOM   2955 C  CA    . LEU D 1 48  ? 41.581  -19.518 28.833  1.00 57.76  ? 47  LEU F CA    1 
ATOM   2956 C  C     . LEU D 1 48  ? 40.926  -19.920 27.517  1.00 55.77  ? 47  LEU F C     1 
ATOM   2957 O  O     . LEU D 1 48  ? 41.382  -19.515 26.441  1.00 55.00  ? 47  LEU F O     1 
ATOM   2958 C  CB    . LEU D 1 48  ? 42.551  -20.602 29.303  1.00 56.91  ? 47  LEU F CB    1 
ATOM   2959 C  CG    . LEU D 1 48  ? 43.889  -20.737 28.576  1.00 57.92  ? 47  LEU F CG    1 
ATOM   2960 C  CD1   . LEU D 1 48  ? 44.608  -19.399 28.521  1.00 57.82  ? 47  LEU F CD1   1 
ATOM   2961 C  CD2   . LEU D 1 48  ? 44.754  -21.787 29.256  1.00 59.16  ? 47  LEU F CD2   1 
ATOM   2962 N  N     A ILE D 1 49  ? 39.876  -20.742 27.578  0.42 51.06  ? 48  ILE F N     1 
ATOM   2963 N  N     B ILE D 1 49  ? 39.829  -20.676 27.586  0.58 51.02  ? 48  ILE F N     1 
ATOM   2964 C  CA    A ILE D 1 49  ? 39.184  -21.161 26.361  0.42 50.68  ? 48  ILE F CA    1 
ATOM   2965 C  CA    B ILE D 1 49  ? 39.196  -21.200 26.382  0.58 50.67  ? 48  ILE F CA    1 
ATOM   2966 C  C     A ILE D 1 49  ? 38.494  -19.972 25.709  0.42 52.52  ? 48  ILE F C     1 
ATOM   2967 C  C     B ILE D 1 49  ? 38.197  -20.232 25.752  0.58 52.38  ? 48  ILE F C     1 
ATOM   2968 O  O     A ILE D 1 49  ? 38.665  -19.703 24.513  0.42 50.92  ? 48  ILE F O     1 
ATOM   2969 O  O     B ILE D 1 49  ? 37.865  -20.389 24.568  0.58 51.95  ? 48  ILE F O     1 
ATOM   2970 C  CB    A ILE D 1 49  ? 38.178  -22.285 26.674  0.42 49.72  ? 48  ILE F CB    1 
ATOM   2971 C  CB    B ILE D 1 49  ? 38.519  -22.549 26.690  0.58 48.79  ? 48  ILE F CB    1 
ATOM   2972 C  CG1   A ILE D 1 49  ? 38.871  -23.645 26.706  0.42 47.54  ? 48  ILE F CG1   1 
ATOM   2973 C  CG1   B ILE D 1 49  ? 38.385  -23.392 25.420  0.58 48.46  ? 48  ILE F CG1   1 
ATOM   2974 C  CG2   A ILE D 1 49  ? 37.045  -22.298 25.654  0.42 51.72  ? 48  ILE F CG2   1 
ATOM   2975 C  CG2   B ILE D 1 49  ? 37.159  -22.338 27.341  0.58 53.92  ? 48  ILE F CG2   1 
ATOM   2976 C  CD1   A ILE D 1 49  ? 39.316  -24.133 25.345  0.42 46.43  ? 48  ILE F CD1   1 
ATOM   2977 C  CD1   B ILE D 1 49  ? 37.892  -24.800 25.674  0.58 43.60  ? 48  ILE F CD1   1 
ATOM   2978 N  N     . LYS D 1 50  ? 37.715  -19.232 26.495  1.00 52.83  ? 49  LYS F N     1 
ATOM   2979 C  CA    . LYS D 1 50  ? 36.792  -18.248 25.942  1.00 54.93  ? 49  LYS F CA    1 
ATOM   2980 C  C     . LYS D 1 50  ? 37.435  -16.899 25.658  1.00 55.18  ? 49  LYS F C     1 
ATOM   2981 O  O     . LYS D 1 50  ? 36.967  -16.181 24.769  1.00 56.83  ? 49  LYS F O     1 
ATOM   2982 C  CB    . LYS D 1 50  ? 35.604  -18.052 26.890  1.00 55.86  ? 49  LYS F CB    1 
ATOM   2983 C  CG    . LYS D 1 50  ? 34.882  -19.339 27.248  1.00 59.32  ? 49  LYS F CG    1 
ATOM   2984 C  CD    . LYS D 1 50  ? 33.861  -19.108 28.348  1.00 62.95  ? 49  LYS F CD    1 
ATOM   2985 C  CE    . LYS D 1 50  ? 32.508  -19.697 27.992  1.00 66.09  ? 49  LYS F CE    1 
ATOM   2986 N  NZ    . LYS D 1 50  ? 31.568  -19.633 29.145  1.00 65.98  ? 49  LYS F NZ    1 
ATOM   2987 N  N     . GLN D 1 51  ? 38.489  -16.528 26.384  1.00 54.80  ? 50  GLN F N     1 
ATOM   2988 C  CA    . GLN D 1 51  ? 39.085  -15.208 26.236  1.00 56.00  ? 50  GLN F CA    1 
ATOM   2989 C  C     . GLN D 1 51  ? 40.408  -15.210 25.485  1.00 65.89  ? 50  GLN F C     1 
ATOM   2990 O  O     . GLN D 1 51  ? 40.927  -14.130 25.183  1.00 64.07  ? 50  GLN F O     1 
ATOM   2991 C  CB    . GLN D 1 51  ? 39.289  -14.559 27.614  1.00 62.01  ? 50  GLN F CB    1 
ATOM   2992 C  CG    . GLN D 1 51  ? 38.017  -14.448 28.442  1.00 71.73  ? 50  GLN F CG    1 
ATOM   2993 C  CD    . GLN D 1 51  ? 36.878  -13.788 27.688  1.00 75.67  ? 50  GLN F CD    1 
ATOM   2994 O  OE1   . GLN D 1 51  ? 37.076  -12.805 26.973  1.00 79.24  ? 50  GLN F OE1   1 
ATOM   2995 N  NE2   . GLN D 1 51  ? 35.675  -14.329 27.843  1.00 67.23  ? 50  GLN F NE2   1 
ATOM   2996 N  N     . HIS D 1 52  ? 40.967  -16.378 25.171  1.00 61.61  ? 51  HIS F N     1 
ATOM   2997 C  CA    . HIS D 1 52  ? 42.241  -16.428 24.465  1.00 57.91  ? 51  HIS F CA    1 
ATOM   2998 C  C     . HIS D 1 52  ? 42.187  -17.371 23.269  1.00 52.29  ? 51  HIS F C     1 
ATOM   2999 O  O     . HIS D 1 52  ? 42.604  -17.005 22.166  1.00 51.94  ? 51  HIS F O     1 
ATOM   3000 C  CB    . HIS D 1 52  ? 43.365  -16.843 25.417  1.00 58.32  ? 51  HIS F CB    1 
ATOM   3001 C  CG    . HIS D 1 52  ? 43.736  -15.785 26.409  1.00 65.28  ? 51  HIS F CG    1 
ATOM   3002 N  ND1   . HIS D 1 52  ? 43.274  -15.787 27.708  1.00 70.19  ? 51  HIS F ND1   1 
ATOM   3003 C  CD2   . HIS D 1 52  ? 44.520  -14.688 26.290  1.00 62.68  ? 51  HIS F CD2   1 
ATOM   3004 C  CE1   . HIS D 1 52  ? 43.761  -14.738 28.347  1.00 72.41  ? 51  HIS F CE1   1 
ATOM   3005 N  NE2   . HIS D 1 52  ? 44.520  -14.055 27.509  1.00 78.46  ? 51  HIS F NE2   1 
ATOM   3006 N  N     . PHE D 1 53  ? 41.675  -18.586 23.474  1.00 49.52  ? 52  PHE F N     1 
ATOM   3007 C  CA    . PHE D 1 53  ? 41.646  -19.562 22.388  1.00 50.14  ? 52  PHE F CA    1 
ATOM   3008 C  C     . PHE D 1 53  ? 40.565  -19.219 21.369  1.00 42.91  ? 52  PHE F C     1 
ATOM   3009 O  O     . PHE D 1 53  ? 40.822  -19.199 20.160  1.00 46.61  ? 52  PHE F O     1 
ATOM   3010 C  CB    . PHE D 1 53  ? 41.431  -20.971 22.945  1.00 44.48  ? 52  PHE F CB    1 
ATOM   3011 C  CG    . PHE D 1 53  ? 42.567  -21.476 23.796  1.00 46.63  ? 52  PHE F CG    1 
ATOM   3012 C  CD1   . PHE D 1 53  ? 43.775  -20.798 23.851  1.00 41.81  ? 52  PHE F CD1   1 
ATOM   3013 C  CD2   . PHE D 1 53  ? 42.426  -22.639 24.534  1.00 44.50  ? 52  PHE F CD2   1 
ATOM   3014 C  CE1   . PHE D 1 53  ? 44.815  -21.265 24.635  1.00 40.79  ? 52  PHE F CE1   1 
ATOM   3015 C  CE2   . PHE D 1 53  ? 43.462  -23.113 25.317  1.00 49.05  ? 52  PHE F CE2   1 
ATOM   3016 C  CZ    . PHE D 1 53  ? 44.658  -22.425 25.368  1.00 42.23  ? 52  PHE F CZ    1 
ATOM   3017 N  N     . ALA D 1 54  ? 39.349  -18.946 21.843  1.00 52.30  ? 53  ALA F N     1 
ATOM   3018 C  CA    . ALA D 1 54  ? 38.240  -18.658 20.933  1.00 42.85  ? 53  ALA F CA    1 
ATOM   3019 C  C     . ALA D 1 54  ? 38.465  -17.413 20.082  1.00 44.16  ? 53  ALA F C     1 
ATOM   3020 O  O     . ALA D 1 54  ? 38.183  -17.467 18.872  1.00 45.95  ? 53  ALA F O     1 
ATOM   3021 C  CB    . ALA D 1 54  ? 36.934  -18.562 21.730  1.00 46.89  ? 53  ALA F CB    1 
ATOM   3022 N  N     . PRO D 1 55  ? 38.941  -16.278 20.615  1.00 47.59  ? 54  PRO F N     1 
ATOM   3023 C  CA    . PRO D 1 55  ? 39.181  -15.122 19.733  1.00 42.17  ? 54  PRO F CA    1 
ATOM   3024 C  C     . PRO D 1 55  ? 40.198  -15.395 18.640  1.00 46.55  ? 54  PRO F C     1 
ATOM   3025 O  O     . PRO D 1 55  ? 40.068  -14.850 17.536  1.00 49.58  ? 54  PRO F O     1 
ATOM   3026 C  CB    . PRO D 1 55  ? 39.670  -14.036 20.702  1.00 46.93  ? 54  PRO F CB    1 
ATOM   3027 C  CG    . PRO D 1 55  ? 39.111  -14.429 22.018  1.00 53.94  ? 54  PRO F CG    1 
ATOM   3028 C  CD    . PRO D 1 55  ? 39.156  -15.924 22.031  1.00 54.09  ? 54  PRO F CD    1 
ATOM   3029 N  N     . LEU D 1 56  ? 41.213  -16.219 18.912  1.00 48.56  ? 55  LEU F N     1 
ATOM   3030 C  CA    . LEU D 1 56  ? 42.160  -16.585 17.864  1.00 40.55  ? 55  LEU F CA    1 
ATOM   3031 C  C     . LEU D 1 56  ? 41.504  -17.478 16.819  1.00 37.93  ? 55  LEU F C     1 
ATOM   3032 O  O     . LEU D 1 56  ? 41.725  -17.300 15.615  1.00 39.58  ? 55  LEU F O     1 
ATOM   3033 C  CB    . LEU D 1 56  ? 43.379  -17.276 18.473  1.00 43.88  ? 55  LEU F CB    1 
ATOM   3034 C  CG    . LEU D 1 56  ? 44.327  -16.391 19.284  1.00 51.04  ? 55  LEU F CG    1 
ATOM   3035 C  CD1   . LEU D 1 56  ? 45.441  -17.224 19.899  1.00 40.38  ? 55  LEU F CD1   1 
ATOM   3036 C  CD2   . LEU D 1 56  ? 44.900  -15.286 18.412  1.00 48.56  ? 55  LEU F CD2   1 
ATOM   3037 N  N     . MET D 1 57  ? 40.696  -18.445 17.260  1.00 39.42  ? 56  MET F N     1 
ATOM   3038 C  CA    . MET D 1 57  ? 39.982  -19.294 16.313  1.00 41.96  ? 56  MET F CA    1 
ATOM   3039 C  C     . MET D 1 57  ? 38.957  -18.491 15.522  1.00 44.73  ? 56  MET F C     1 
ATOM   3040 O  O     . MET D 1 57  ? 38.791  -18.706 14.315  1.00 45.53  ? 56  MET F O     1 
ATOM   3041 C  CB    . MET D 1 57  ? 39.308  -20.453 17.048  1.00 39.93  ? 56  MET F CB    1 
ATOM   3042 C  CG    . MET D 1 57  ? 38.568  -21.427 16.141  1.00 39.99  ? 56  MET F CG    1 
ATOM   3043 S  SD    . MET D 1 57  ? 39.670  -22.418 15.112  1.00 44.79  ? 56  MET F SD    1 
ATOM   3044 C  CE    . MET D 1 57  ? 40.369  -23.529 16.331  1.00 32.96  ? 56  MET F CE    1 
ATOM   3045 N  N     . GLN D 1 58  ? 38.268  -17.555 16.181  1.00 42.62  ? 57  GLN F N     1 
ATOM   3046 C  CA    . GLN D 1 58  ? 37.293  -16.724 15.481  1.00 46.33  ? 57  GLN F CA    1 
ATOM   3047 C  C     . GLN D 1 58  ? 37.958  -15.895 14.392  1.00 43.18  ? 57  GLN F C     1 
ATOM   3048 O  O     . GLN D 1 58  ? 37.397  -15.721 13.304  1.00 51.14  ? 57  GLN F O     1 
ATOM   3049 C  CB    . GLN D 1 58  ? 36.566  -15.814 16.471  1.00 50.76  ? 57  GLN F CB    1 
ATOM   3050 C  CG    . GLN D 1 58  ? 35.477  -14.969 15.833  1.00 46.48  ? 57  GLN F CG    1 
ATOM   3051 C  CD    . GLN D 1 58  ? 34.380  -15.814 15.219  1.00 43.84  ? 57  GLN F CD    1 
ATOM   3052 O  OE1   . GLN D 1 58  ? 34.191  -15.818 14.005  1.00 47.57  ? 57  GLN F OE1   1 
ATOM   3053 N  NE2   . GLN D 1 58  ? 33.652  -16.538 16.060  1.00 40.19  ? 57  GLN F NE2   1 
ATOM   3054 N  N     . PHE D 1 59  ? 39.155  -15.374 14.667  1.00 43.32  ? 58  PHE F N     1 
ATOM   3055 C  CA    . PHE D 1 59  ? 39.875  -14.609 13.656  1.00 45.67  ? 58  PHE F CA    1 
ATOM   3056 C  C     . PHE D 1 59  ? 40.230  -15.480 12.458  1.00 48.15  ? 58  PHE F C     1 
ATOM   3057 O  O     . PHE D 1 59  ? 40.117  -15.043 11.307  1.00 51.86  ? 58  PHE F O     1 
ATOM   3058 C  CB    . PHE D 1 59  ? 41.133  -13.991 14.264  1.00 51.57  ? 58  PHE F CB    1 
ATOM   3059 C  CG    . PHE D 1 59  ? 42.018  -13.310 13.261  1.00 58.46  ? 58  PHE F CG    1 
ATOM   3060 C  CD1   . PHE D 1 59  ? 41.687  -12.061 12.763  1.00 63.43  ? 58  PHE F CD1   1 
ATOM   3061 C  CD2   . PHE D 1 59  ? 43.179  -13.919 12.816  1.00 52.00  ? 58  PHE F CD2   1 
ATOM   3062 C  CE1   . PHE D 1 59  ? 42.499  -11.432 11.838  1.00 62.30  ? 58  PHE F CE1   1 
ATOM   3063 C  CE2   . PHE D 1 59  ? 43.994  -13.296 11.891  1.00 59.74  ? 58  PHE F CE2   1 
ATOM   3064 C  CZ    . PHE D 1 59  ? 43.654  -12.051 11.402  1.00 55.22  ? 58  PHE F CZ    1 
ATOM   3065 N  N     . LEU D 1 60  ? 40.659  -16.718 12.710  1.00 47.89  ? 59  LEU F N     1 
ATOM   3066 C  CA    . LEU D 1 60  ? 40.982  -17.628 11.616  1.00 41.87  ? 59  LEU F CA    1 
ATOM   3067 C  C     . LEU D 1 60  ? 39.732  -18.024 10.840  1.00 41.72  ? 59  LEU F C     1 
ATOM   3068 O  O     . LEU D 1 60  ? 39.773  -18.154 9.611   1.00 47.54  ? 59  LEU F O     1 
ATOM   3069 C  CB    . LEU D 1 60  ? 41.693  -18.866 12.159  1.00 45.83  ? 59  LEU F CB    1 
ATOM   3070 C  CG    . LEU D 1 60  ? 42.058  -19.941 11.135  1.00 47.48  ? 59  LEU F CG    1 
ATOM   3071 C  CD1   . LEU D 1 60  ? 43.098  -19.420 10.159  1.00 39.52  ? 59  LEU F CD1   1 
ATOM   3072 C  CD2   . LEU D 1 60  ? 42.556  -21.191 11.834  1.00 44.77  ? 59  LEU F CD2   1 
ATOM   3073 N  N     . ILE D 1 61  ? 38.614  -18.224 11.543  1.00 43.04  ? 60  ILE F N     1 
ATOM   3074 C  CA    A ILE D 1 61  ? 37.362  -18.584 10.881  0.09 48.73  ? 60  ILE F CA    1 
ATOM   3075 C  CA    B ILE D 1 61  ? 37.371  -18.591 10.871  0.91 48.81  ? 60  ILE F CA    1 
ATOM   3076 C  C     . ILE D 1 61  ? 36.945  -17.491 9.904   1.00 51.31  ? 60  ILE F C     1 
ATOM   3077 O  O     . ILE D 1 61  ? 36.606  -17.759 8.745   1.00 45.62  ? 60  ILE F O     1 
ATOM   3078 C  CB    A ILE D 1 61  ? 36.263  -18.852 11.926  0.09 46.44  ? 60  ILE F CB    1 
ATOM   3079 C  CB    B ILE D 1 61  ? 36.271  -18.898 11.904  0.91 46.47  ? 60  ILE F CB    1 
ATOM   3080 C  CG1   A ILE D 1 61  ? 36.539  -20.152 12.683  0.09 45.09  ? 60  ILE F CG1   1 
ATOM   3081 C  CG1   B ILE D 1 61  ? 36.441  -20.316 12.453  0.91 44.80  ? 60  ILE F CG1   1 
ATOM   3082 C  CG2   A ILE D 1 61  ? 34.894  -18.896 11.270  0.09 47.81  ? 60  ILE F CG2   1 
ATOM   3083 C  CG2   B ILE D 1 61  ? 34.891  -18.720 11.295  0.91 47.88  ? 60  ILE F CG2   1 
ATOM   3084 C  CD1   A ILE D 1 61  ? 36.456  -21.385 11.823  0.09 43.49  ? 60  ILE F CD1   1 
ATOM   3085 C  CD1   B ILE D 1 61  ? 35.352  -20.731 13.417  0.91 44.84  ? 60  ILE F CD1   1 
ATOM   3086 N  N     . ASP D 1 62  ? 36.969  -16.238 10.362  1.00 53.01  ? 61  ASP F N     1 
ATOM   3087 C  CA    . ASP D 1 62  ? 36.541  -15.128 9.516   1.00 54.70  ? 61  ASP F CA    1 
ATOM   3088 C  C     . ASP D 1 62  ? 37.485  -14.924 8.337   1.00 53.31  ? 61  ASP F C     1 
ATOM   3089 O  O     . ASP D 1 62  ? 37.040  -14.603 7.229   1.00 55.59  ? 61  ASP F O     1 
ATOM   3090 C  CB    . ASP D 1 62  ? 36.436  -13.852 10.348  1.00 46.56  ? 61  ASP F CB    1 
ATOM   3091 C  CG    . ASP D 1 62  ? 35.524  -14.018 11.542  1.00 50.91  ? 61  ASP F CG    1 
ATOM   3092 O  OD1   . ASP D 1 62  ? 35.674  -13.258 12.522  1.00 64.46  ? 61  ASP F OD1   1 
ATOM   3093 O  OD2   . ASP D 1 62  ? 34.655  -14.913 11.496  1.00 59.59  ? 61  ASP F OD2   1 
ATOM   3094 N  N     . GLU D 1 63  ? 38.789  -15.105 8.553   1.00 51.02  ? 62  GLU F N     1 
ATOM   3095 C  CA    . GLU D 1 63  ? 39.754  -14.912 7.478   1.00 53.88  ? 62  GLU F CA    1 
ATOM   3096 C  C     . GLU D 1 63  ? 39.748  -16.052 6.469   1.00 55.11  ? 62  GLU F C     1 
ATOM   3097 O  O     . GLU D 1 63  ? 40.244  -15.873 5.351   1.00 62.57  ? 62  GLU F O     1 
ATOM   3098 C  CB    . GLU D 1 63  ? 41.159  -14.736 8.057   1.00 59.03  ? 62  GLU F CB    1 
ATOM   3099 C  CG    . GLU D 1 63  ? 41.692  -13.316 7.946   1.00 66.46  ? 62  GLU F CG    1 
ATOM   3100 C  CD    . GLU D 1 63  ? 41.971  -12.911 6.510   1.00 84.49  ? 62  GLU F CD    1 
ATOM   3101 O  OE1   . GLU D 1 63  ? 42.338  -13.792 5.704   1.00 87.04  ? 62  GLU F OE1   1 
ATOM   3102 O  OE2   . GLU D 1 63  ? 41.820  -11.715 6.186   1.00 93.92  ? 62  GLU F OE2   1 
ATOM   3103 N  N     . LEU D 1 64  ? 39.208  -17.212 6.834   1.00 53.86  ? 63  LEU F N     1 
ATOM   3104 C  CA    . LEU D 1 64  ? 39.015  -18.315 5.903   1.00 53.33  ? 63  LEU F CA    1 
ATOM   3105 C  C     . LEU D 1 64  ? 37.601  -18.364 5.346   1.00 53.19  ? 63  LEU F C     1 
ATOM   3106 O  O     . LEU D 1 64  ? 37.313  -19.210 4.493   1.00 51.35  ? 63  LEU F O     1 
ATOM   3107 C  CB    . LEU D 1 64  ? 39.347  -19.648 6.583   1.00 55.46  ? 63  LEU F CB    1 
ATOM   3108 C  CG    . LEU D 1 64  ? 40.745  -20.235 6.371   1.00 55.13  ? 63  LEU F CG    1 
ATOM   3109 C  CD1   . LEU D 1 64  ? 41.827  -19.189 6.595   1.00 48.70  ? 63  LEU F CD1   1 
ATOM   3110 C  CD2   . LEU D 1 64  ? 40.959  -21.433 7.286   1.00 48.10  ? 63  LEU F CD2   1 
ATOM   3111 N  N     . ASN D 1 65  ? 36.720  -17.472 5.806   1.00 56.39  ? 64  ASN F N     1 
ATOM   3112 C  CA    . ASN D 1 65  ? 35.308  -17.464 5.422   1.00 56.80  ? 64  ASN F CA    1 
ATOM   3113 C  C     . ASN D 1 65  ? 34.644  -18.810 5.700   1.00 54.46  ? 64  ASN F C     1 
ATOM   3114 O  O     . ASN D 1 65  ? 33.868  -19.322 4.891   1.00 56.49  ? 64  ASN F O     1 
ATOM   3115 C  CB    . ASN D 1 65  ? 35.126  -17.053 3.959   1.00 64.53  ? 64  ASN F CB    1 
ATOM   3116 C  CG    . ASN D 1 65  ? 34.665  -15.615 3.815   1.00 75.93  ? 64  ASN F CG    1 
ATOM   3117 O  OD1   . ASN D 1 65  ? 33.468  -15.329 3.847   1.00 74.79  ? 64  ASN F OD1   1 
ATOM   3118 N  ND2   . ASN D 1 65  ? 35.616  -14.700 3.666   1.00 72.36  ? 64  ASN F ND2   1 
ATOM   3119 N  N     . VAL D 1 66  ? 34.954  -19.390 6.854   1.00 48.76  ? 65  VAL F N     1 
ATOM   3120 C  CA    . VAL D 1 66  ? 34.230  -20.558 7.340   1.00 50.05  ? 65  VAL F CA    1 
ATOM   3121 C  C     . VAL D 1 66  ? 32.927  -20.086 7.971   1.00 52.50  ? 65  VAL F C     1 
ATOM   3122 O  O     . VAL D 1 66  ? 32.916  -19.141 8.769   1.00 54.53  ? 65  VAL F O     1 
ATOM   3123 C  CB    . VAL D 1 66  ? 35.086  -21.353 8.339   1.00 48.35  ? 65  VAL F CB    1 
ATOM   3124 C  CG1   . VAL D 1 66  ? 34.238  -22.371 9.082   1.00 42.01  ? 65  VAL F CG1   1 
ATOM   3125 C  CG2   . VAL D 1 66  ? 36.240  -22.042 7.620   1.00 45.92  ? 65  VAL F CG2   1 
ATOM   3126 N  N     . LYS D 1 67  ? 31.821  -20.728 7.601   1.00 53.00  ? 66  LYS F N     1 
ATOM   3127 C  CA    . LYS D 1 67  ? 30.503  -20.329 8.076   1.00 60.62  ? 66  LYS F CA    1 
ATOM   3128 C  C     . LYS D 1 67  ? 30.169  -20.874 9.459   1.00 60.67  ? 66  LYS F C     1 
ATOM   3129 O  O     . LYS D 1 67  ? 29.175  -20.447 10.057  1.00 62.01  ? 66  LYS F O     1 
ATOM   3130 C  CB    . LYS D 1 67  ? 29.431  -20.784 7.078   1.00 73.46  ? 66  LYS F CB    1 
ATOM   3131 C  CG    . LYS D 1 67  ? 29.614  -20.210 5.692   1.00 70.69  ? 66  LYS F CG    1 
ATOM   3132 C  CD    . LYS D 1 67  ? 29.598  -18.696 5.742   1.00 70.16  ? 66  LYS F CD    1 
ATOM   3133 C  CE    . LYS D 1 67  ? 30.695  -18.083 4.885   1.00 71.06  ? 66  LYS F CE    1 
ATOM   3134 N  NZ    . LYS D 1 67  ? 30.987  -16.665 5.257   1.00 70.81  ? 66  LYS F NZ    1 
ATOM   3135 N  N     . SER D 1 68  ? 30.974  -21.788 9.986   1.00 56.47  ? 67  SER F N     1 
ATOM   3136 C  CA    . SER D 1 68  ? 30.588  -22.510 11.186  1.00 44.49  ? 67  SER F CA    1 
ATOM   3137 C  C     . SER D 1 68  ? 30.735  -21.640 12.431  1.00 45.87  ? 67  SER F C     1 
ATOM   3138 O  O     . SER D 1 68  ? 31.374  -20.584 12.427  1.00 43.47  ? 67  SER F O     1 
ATOM   3139 C  CB    . SER D 1 68  ? 31.416  -23.787 11.330  1.00 40.76  ? 67  SER F CB    1 
ATOM   3140 O  OG    . SER D 1 68  ? 31.204  -24.644 10.220  1.00 39.88  ? 67  SER F OG    1 
ATOM   3141 N  N     . LYS D 1 69  ? 30.114  -22.109 13.506  1.00 42.19  ? 68  LYS F N     1 
ATOM   3142 C  CA    . LYS D 1 69  ? 30.095  -21.434 14.792  1.00 44.01  ? 68  LYS F CA    1 
ATOM   3143 C  C     . LYS D 1 69  ? 31.189  -21.994 15.693  1.00 44.00  ? 68  LYS F C     1 
ATOM   3144 O  O     . LYS D 1 69  ? 31.626  -23.135 15.531  1.00 37.90  ? 68  LYS F O     1 
ATOM   3145 C  CB    . LYS D 1 69  ? 28.717  -21.613 15.437  1.00 45.52  ? 68  LYS F CB    1 
ATOM   3146 C  CG    . LYS D 1 69  ? 28.570  -21.160 16.879  1.00 59.44  ? 68  LYS F CG    1 
ATOM   3147 C  CD    . LYS D 1 69  ? 27.152  -20.679 17.124  1.00 62.47  ? 68  LYS F CD    1 
ATOM   3148 C  CE    . LYS D 1 69  ? 26.134  -21.680 16.598  1.00 62.08  ? 68  LYS F CE    1 
ATOM   3149 N  NZ    . LYS D 1 69  ? 24.960  -21.802 17.496  1.00 68.35  ? 68  LYS F NZ    1 
ATOM   3150 N  N     . ILE D 1 70  ? 31.650  -21.171 16.631  1.00 40.83  ? 69  ILE F N     1 
ATOM   3151 C  CA    . ILE D 1 70  ? 32.540  -21.630 17.690  1.00 43.86  ? 69  ILE F CA    1 
ATOM   3152 C  C     . ILE D 1 70  ? 31.652  -22.056 18.856  1.00 46.57  ? 69  ILE F C     1 
ATOM   3153 O  O     . ILE D 1 70  ? 31.092  -21.221 19.568  1.00 50.22  ? 69  ILE F O     1 
ATOM   3154 C  CB    . ILE D 1 70  ? 33.548  -20.559 18.103  1.00 48.44  ? 69  ILE F CB    1 
ATOM   3155 C  CG1   . ILE D 1 70  ? 34.491  -20.242 16.943  1.00 46.32  ? 69  ILE F CG1   1 
ATOM   3156 C  CG2   . ILE D 1 70  ? 34.344  -21.023 19.315  1.00 49.94  ? 69  ILE F CG2   1 
ATOM   3157 C  CD1   . ILE D 1 70  ? 35.650  -19.352 17.327  1.00 45.83  ? 69  ILE F CD1   1 
ATOM   3158 N  N     . GLN D 1 71  ? 31.514  -23.364 19.040  1.00 44.83  ? 70  GLN F N     1 
ATOM   3159 C  CA    . GLN D 1 71  ? 30.734  -23.912 20.139  1.00 42.59  ? 70  GLN F CA    1 
ATOM   3160 C  C     . GLN D 1 71  ? 31.622  -24.073 21.365  1.00 46.42  ? 70  GLN F C     1 
ATOM   3161 O  O     . GLN D 1 71  ? 32.713  -24.646 21.279  1.00 44.32  ? 70  GLN F O     1 
ATOM   3162 C  CB    . GLN D 1 71  ? 30.124  -25.262 19.760  1.00 38.08  ? 70  GLN F CB    1 
ATOM   3163 C  CG    . GLN D 1 71  ? 29.223  -25.236 18.540  1.00 37.06  ? 70  GLN F CG    1 
ATOM   3164 C  CD    . GLN D 1 71  ? 28.788  -26.627 18.123  1.00 39.32  ? 70  GLN F CD    1 
ATOM   3165 O  OE1   . GLN D 1 71  ? 28.252  -27.389 18.928  1.00 46.26  ? 70  GLN F OE1   1 
ATOM   3166 N  NE2   . GLN D 1 71  ? 29.024  -26.968 16.861  1.00 41.07  ? 70  GLN F NE2   1 
ATOM   3167 N  N     . ILE D 1 72  ? 31.156  -23.562 22.498  1.00 46.71  ? 71  ILE F N     1 
ATOM   3168 C  CA    . ILE D 1 72  ? 31.787  -23.793 23.790  1.00 44.25  ? 71  ILE F CA    1 
ATOM   3169 C  C     . ILE D 1 72  ? 30.866  -24.718 24.570  1.00 50.34  ? 71  ILE F C     1 
ATOM   3170 O  O     . ILE D 1 72  ? 29.803  -24.296 25.044  1.00 58.65  ? 71  ILE F O     1 
ATOM   3171 C  CB    . ILE D 1 72  ? 32.045  -22.487 24.552  1.00 46.19  ? 71  ILE F CB    1 
ATOM   3172 C  CG1   . ILE D 1 72  ? 32.766  -21.474 23.659  1.00 42.93  ? 71  ILE F CG1   1 
ATOM   3173 C  CG2   . ILE D 1 72  ? 32.858  -22.764 25.808  1.00 45.59  ? 71  ILE F CG2   1 
ATOM   3174 C  CD1   . ILE D 1 72  ? 34.126  -21.935 23.185  1.00 49.97  ? 71  ILE F CD1   1 
ATOM   3175 N  N     . VAL D 1 73  ? 31.260  -25.981 24.694  1.00 45.40  ? 72  VAL F N     1 
ATOM   3176 C  CA    . VAL D 1 73  ? 30.473  -26.994 25.386  1.00 50.74  ? 72  VAL F CA    1 
ATOM   3177 C  C     . VAL D 1 73  ? 31.142  -27.276 26.723  1.00 56.57  ? 72  VAL F C     1 
ATOM   3178 O  O     . VAL D 1 73  ? 32.297  -27.717 26.768  1.00 50.54  ? 72  VAL F O     1 
ATOM   3179 C  CB    . VAL D 1 73  ? 30.340  -28.278 24.552  1.00 48.01  ? 72  VAL F CB    1 
ATOM   3180 C  CG1   . VAL D 1 73  ? 29.344  -29.228 25.199  1.00 46.21  ? 72  VAL F CG1   1 
ATOM   3181 C  CG2   . VAL D 1 73  ? 29.923  -27.943 23.129  1.00 51.97  ? 72  VAL F CG2   1 
ATOM   3182 N  N     . LYS D 1 74  ? 30.418  -27.019 27.811  1.00 56.41  ? 73  LYS F N     1 
ATOM   3183 C  CA    . LYS D 1 74  ? 30.930  -27.240 29.159  1.00 57.92  ? 73  LYS F CA    1 
ATOM   3184 C  C     . LYS D 1 74  ? 30.678  -28.694 29.544  1.00 60.09  ? 73  LYS F C     1 
ATOM   3185 O  O     . LYS D 1 74  ? 29.526  -29.115 29.693  1.00 63.50  ? 73  LYS F O     1 
ATOM   3186 C  CB    . LYS D 1 74  ? 30.271  -26.283 30.149  1.00 67.19  ? 73  LYS F CB    1 
ATOM   3187 C  CG    . LYS D 1 74  ? 30.699  -26.488 31.593  1.00 64.68  ? 73  LYS F CG    1 
ATOM   3188 C  CD    . LYS D 1 74  ? 30.221  -25.343 32.473  1.00 74.86  ? 73  LYS F CD    1 
ATOM   3189 C  CE    . LYS D 1 74  ? 30.590  -25.571 33.930  1.00 74.68  ? 73  LYS F CE    1 
ATOM   3190 N  NZ    . LYS D 1 74  ? 29.820  -26.698 34.524  1.00 72.83  ? 73  LYS F NZ    1 
ATOM   3191 N  N     . GLY D 1 75  ? 31.757  -29.461 29.702  1.00 50.20  ? 74  GLY F N     1 
ATOM   3192 C  CA    . GLY D 1 75  ? 31.665  -30.860 30.047  1.00 49.75  ? 74  GLY F CA    1 
ATOM   3193 C  C     . GLY D 1 75  ? 31.879  -31.112 31.533  1.00 56.67  ? 74  GLY F C     1 
ATOM   3194 O  O     . GLY D 1 75  ? 32.035  -30.200 32.342  1.00 62.30  ? 74  GLY F O     1 
ATOM   3195 N  N     . ASP D 1 76  ? 31.886  -32.400 31.879  1.00 54.30  ? 75  ASP F N     1 
ATOM   3196 C  CA    . ASP D 1 76  ? 32.049  -32.798 33.273  1.00 66.70  ? 75  ASP F CA    1 
ATOM   3197 C  C     . ASP D 1 76  ? 33.417  -32.392 33.809  1.00 62.81  ? 75  ASP F C     1 
ATOM   3198 O  O     . ASP D 1 76  ? 33.527  -31.825 34.902  1.00 65.73  ? 75  ASP F O     1 
ATOM   3199 C  CB    . ASP D 1 76  ? 31.841  -34.307 33.411  1.00 70.39  ? 75  ASP F CB    1 
ATOM   3200 C  CG    . ASP D 1 76  ? 32.551  -35.095 32.323  1.00 74.45  ? 75  ASP F CG    1 
ATOM   3201 O  OD1   . ASP D 1 76  ? 33.407  -34.513 31.623  1.00 74.87  ? 75  ASP F OD1   1 
ATOM   3202 O  OD2   . ASP D 1 76  ? 32.254  -36.299 32.168  1.00 69.27  ? 75  ASP F OD2   1 
ATOM   3203 N  N     . THR D 1 77  ? 34.475  -32.668 33.046  1.00 62.60  ? 76  THR F N     1 
ATOM   3204 C  CA    . THR D 1 77  ? 35.836  -32.451 33.509  1.00 52.89  ? 76  THR F CA    1 
ATOM   3205 C  C     . THR D 1 77  ? 36.560  -31.315 32.800  1.00 53.92  ? 76  THR F C     1 
ATOM   3206 O  O     . THR D 1 77  ? 37.655  -30.944 33.236  1.00 54.62  ? 76  THR F O     1 
ATOM   3207 C  CB    . THR D 1 77  ? 36.662  -33.738 33.354  1.00 52.05  ? 76  THR F CB    1 
ATOM   3208 O  OG1   . THR D 1 77  ? 36.682  -34.132 31.976  1.00 54.32  ? 76  THR F OG1   1 
ATOM   3209 C  CG2   . THR D 1 77  ? 36.062  -34.860 34.187  1.00 49.56  ? 76  THR F CG2   1 
ATOM   3210 N  N     . ARG D 1 78  ? 35.992  -30.752 31.736  1.00 51.83  ? 77  ARG F N     1 
ATOM   3211 C  CA    . ARG D 1 78  ? 36.690  -29.723 30.973  1.00 48.80  ? 77  ARG F CA    1 
ATOM   3212 C  C     . ARG D 1 78  ? 35.719  -29.068 30.002  1.00 47.15  ? 77  ARG F C     1 
ATOM   3213 O  O     . ARG D 1 78  ? 34.690  -29.645 29.639  1.00 46.92  ? 77  ARG F O     1 
ATOM   3214 C  CB    . ARG D 1 78  ? 37.892  -30.299 30.208  1.00 48.36  ? 77  ARG F CB    1 
ATOM   3215 C  CG    . ARG D 1 78  ? 37.551  -30.984 28.882  1.00 46.73  ? 77  ARG F CG    1 
ATOM   3216 C  CD    . ARG D 1 78  ? 36.699  -32.234 29.070  1.00 44.38  ? 77  ARG F CD    1 
ATOM   3217 N  NE    . ARG D 1 78  ? 36.327  -32.846 27.798  1.00 51.99  ? 77  ARG F NE    1 
ATOM   3218 C  CZ    . ARG D 1 78  ? 35.317  -32.436 27.036  1.00 49.19  ? 77  ARG F CZ    1 
ATOM   3219 N  NH1   . ARG D 1 78  ? 34.573  -31.405 27.413  1.00 40.65  ? 77  ARG F NH1   1 
ATOM   3220 N  NH2   . ARG D 1 78  ? 35.052  -33.057 25.894  1.00 44.97  ? 77  ARG F NH2   1 
ATOM   3221 N  N     . TYR D 1 79  ? 36.066  -27.852 29.588  1.00 42.63  ? 78  TYR F N     1 
ATOM   3222 C  CA    . TYR D 1 79  ? 35.358  -27.178 28.512  1.00 44.72  ? 78  TYR F CA    1 
ATOM   3223 C  C     . TYR D 1 79  ? 35.873  -27.665 27.164  1.00 49.79  ? 78  TYR F C     1 
ATOM   3224 O  O     . TYR D 1 79  ? 37.023  -28.092 27.034  1.00 47.37  ? 78  TYR F O     1 
ATOM   3225 C  CB    . TYR D 1 79  ? 35.535  -25.662 28.611  1.00 48.46  ? 78  TYR F CB    1 
ATOM   3226 C  CG    . TYR D 1 79  ? 34.835  -25.024 29.788  1.00 64.34  ? 78  TYR F CG    1 
ATOM   3227 C  CD1   . TYR D 1 79  ? 35.435  -24.983 31.039  1.00 66.28  ? 78  TYR F CD1   1 
ATOM   3228 C  CD2   . TYR D 1 79  ? 33.580  -24.445 29.643  1.00 64.88  ? 78  TYR F CD2   1 
ATOM   3229 C  CE1   . TYR D 1 79  ? 34.800  -24.398 32.117  1.00 69.59  ? 78  TYR F CE1   1 
ATOM   3230 C  CE2   . TYR D 1 79  ? 32.939  -23.854 30.714  1.00 68.54  ? 78  TYR F CE2   1 
ATOM   3231 C  CZ    . TYR D 1 79  ? 33.553  -23.833 31.948  1.00 72.35  ? 78  TYR F CZ    1 
ATOM   3232 O  OH    . TYR D 1 79  ? 32.918  -23.245 33.019  1.00 81.53  ? 78  TYR F OH    1 
ATOM   3233 N  N     . GLU D 1 80  ? 35.011  -27.591 26.153  1.00 47.33  ? 79  GLU F N     1 
ATOM   3234 C  CA    . GLU D 1 80  ? 35.358  -28.015 24.803  1.00 41.44  ? 79  GLU F CA    1 
ATOM   3235 C  C     . GLU D 1 80  ? 35.098  -26.873 23.832  1.00 45.31  ? 79  GLU F C     1 
ATOM   3236 O  O     . GLU D 1 80  ? 33.948  -26.461 23.646  1.00 41.26  ? 79  GLU F O     1 
ATOM   3237 C  CB    . GLU D 1 80  ? 34.563  -29.254 24.385  1.00 42.10  ? 79  GLU F CB    1 
ATOM   3238 C  CG    . GLU D 1 80  ? 34.797  -29.662 22.936  1.00 44.70  ? 79  GLU F CG    1 
ATOM   3239 C  CD    . GLU D 1 80  ? 33.949  -30.844 22.507  1.00 51.03  ? 79  GLU F CD    1 
ATOM   3240 O  OE1   . GLU D 1 80  ? 33.183  -31.366 23.344  1.00 47.02  ? 79  GLU F OE1   1 
ATOM   3241 O  OE2   . GLU D 1 80  ? 34.048  -31.250 21.328  1.00 43.15  ? 79  GLU F OE2   1 
ATOM   3242 N  N     . LEU D 1 81  ? 36.165  -26.360 23.227  1.00 36.75  ? 80  LEU F N     1 
ATOM   3243 C  CA    . LEU D 1 81  ? 36.031  -25.498 22.062  1.00 34.41  ? 80  LEU F CA    1 
ATOM   3244 C  C     . LEU D 1 81  ? 35.887  -26.379 20.830  1.00 38.97  ? 80  LEU F C     1 
ATOM   3245 O  O     . LEU D 1 81  ? 36.714  -27.264 20.595  1.00 37.17  ? 80  LEU F O     1 
ATOM   3246 C  CB    . LEU D 1 81  ? 37.243  -24.574 21.925  1.00 38.18  ? 80  LEU F CB    1 
ATOM   3247 C  CG    . LEU D 1 81  ? 37.211  -23.414 20.918  1.00 41.51  ? 80  LEU F CG    1 
ATOM   3248 C  CD1   . LEU D 1 81  ? 38.268  -22.388 21.286  1.00 43.52  ? 80  LEU F CD1   1 
ATOM   3249 C  CD2   . LEU D 1 81  ? 37.420  -23.869 19.477  1.00 42.31  ? 80  LEU F CD2   1 
ATOM   3250 N  N     . ARG D 1 82  ? 34.842  -26.144 20.043  1.00 35.48  ? 81  ARG F N     1 
ATOM   3251 C  CA    . ARG D 1 82  ? 34.578  -27.001 18.894  1.00 30.91  ? 81  ARG F CA    1 
ATOM   3252 C  C     . ARG D 1 82  ? 34.056  -26.183 17.725  1.00 39.89  ? 81  ARG F C     1 
ATOM   3253 O  O     . ARG D 1 82  ? 33.135  -25.376 17.880  1.00 34.72  ? 81  ARG F O     1 
ATOM   3254 C  CB    . ARG D 1 82  ? 33.572  -28.109 19.237  1.00 36.39  ? 81  ARG F CB    1 
ATOM   3255 C  CG    . ARG D 1 82  ? 33.124  -28.928 18.031  1.00 37.06  ? 81  ARG F CG    1 
ATOM   3256 C  CD    . ARG D 1 82  ? 31.792  -29.628 18.313  1.00 34.56  ? 81  ARG F CD    1 
ATOM   3257 N  NE    . ARG D 1 82  ? 31.909  -30.454 19.511  1.00 37.52  ? 81  ARG F NE    1 
ATOM   3258 C  CZ    . ARG D 1 82  ? 30.864  -30.955 20.162  1.00 46.08  ? 81  ARG F CZ    1 
ATOM   3259 N  NH1   . ARG D 1 82  ? 29.625  -30.704 19.740  1.00 46.21  ? 81  ARG F NH1   1 
ATOM   3260 N  NH2   . ARG D 1 82  ? 31.065  -31.700 21.232  1.00 41.36  ? 81  ARG F NH2   1 
ATOM   3261 N  N     . VAL D 1 83  ? 34.645  -26.408 16.555  1.00 34.81  ? 82  VAL F N     1 
ATOM   3262 C  CA    . VAL D 1 83  ? 34.137  -25.891 15.293  1.00 35.37  ? 82  VAL F CA    1 
ATOM   3263 C  C     . VAL D 1 83  ? 33.734  -27.084 14.440  1.00 35.40  ? 82  VAL F C     1 
ATOM   3264 O  O     . VAL D 1 83  ? 34.571  -27.940 14.125  1.00 34.18  ? 82  VAL F O     1 
ATOM   3265 C  CB    . VAL D 1 83  ? 35.175  -25.022 14.571  1.00 35.37  ? 82  VAL F CB    1 
ATOM   3266 C  CG1   . VAL D 1 83  ? 34.542  -24.339 13.375  1.00 36.90  ? 82  VAL F CG1   1 
ATOM   3267 C  CG2   . VAL D 1 83  ? 35.769  -24.005 15.534  1.00 34.95  ? 82  VAL F CG2   1 
ATOM   3268 N  N     . SER D 1 84  ? 32.454  -27.156 14.090  1.00 35.94  ? 83  SER F N     1 
ATOM   3269 C  CA    . SER D 1 84  ? 31.944  -28.200 13.205  1.00 36.46  ? 83  SER F CA    1 
ATOM   3270 C  C     . SER D 1 84  ? 32.039  -27.674 11.779  1.00 38.85  ? 83  SER F C     1 
ATOM   3271 O  O     . SER D 1 84  ? 31.155  -26.954 11.312  1.00 37.19  ? 83  SER F O     1 
ATOM   3272 C  CB    . SER D 1 84  ? 30.513  -28.572 13.580  1.00 36.33  ? 83  SER F CB    1 
ATOM   3273 O  OG    . SER D 1 84  ? 30.066  -29.691 12.839  1.00 38.98  ? 83  SER F OG    1 
ATOM   3274 N  N     . SER D 1 85  ? 33.121  -28.023 11.085  1.00 33.45  ? 84  SER F N     1 
ATOM   3275 C  CA    . SER D 1 85  ? 33.376  -27.467 9.758   1.00 32.58  ? 84  SER F CA    1 
ATOM   3276 C  C     . SER D 1 85  ? 34.240  -28.432 8.964   1.00 39.39  ? 84  SER F C     1 
ATOM   3277 O  O     . SER D 1 85  ? 35.352  -28.760 9.389   1.00 35.83  ? 84  SER F O     1 
ATOM   3278 C  CB    . SER D 1 85  ? 34.054  -26.102 9.867   1.00 29.40  ? 84  SER F CB    1 
ATOM   3279 O  OG    . SER D 1 85  ? 34.539  -25.673 8.606   1.00 42.82  ? 84  SER F OG    1 
ATOM   3280 N  N     . LYS D 1 86  ? 33.734  -28.874 7.810   1.00 35.82  ? 85  LYS F N     1 
ATOM   3281 C  CA    . LYS D 1 86  ? 34.524  -29.725 6.926   1.00 34.55  ? 85  LYS F CA    1 
ATOM   3282 C  C     . LYS D 1 86  ? 35.704  -28.961 6.338   1.00 38.84  ? 85  LYS F C     1 
ATOM   3283 O  O     . LYS D 1 86  ? 36.799  -29.516 6.187   1.00 34.32  ? 85  LYS F O     1 
ATOM   3284 C  CB    . LYS D 1 86  ? 33.632  -30.283 5.818   1.00 34.29  ? 85  LYS F CB    1 
ATOM   3285 C  CG    . LYS D 1 86  ? 34.357  -31.074 4.745   1.00 35.41  ? 85  LYS F CG    1 
ATOM   3286 C  CD    . LYS D 1 86  ? 33.360  -31.685 3.772   1.00 38.08  ? 85  LYS F CD    1 
ATOM   3287 C  CE    . LYS D 1 86  ? 34.049  -32.261 2.548   1.00 38.56  ? 85  LYS F CE    1 
ATOM   3288 N  NZ    . LYS D 1 86  ? 33.065  -32.845 1.594   1.00 40.84  ? 85  LYS F NZ    1 
ATOM   3289 N  N     . LYS D 1 87  ? 35.498  -27.684 6.008   1.00 37.08  ? 86  LYS F N     1 
ATOM   3290 C  CA    . LYS D 1 87  ? 36.573  -26.872 5.448   1.00 33.89  ? 86  LYS F CA    1 
ATOM   3291 C  C     . LYS D 1 87  ? 37.691  -26.659 6.461   1.00 35.46  ? 86  LYS F C     1 
ATOM   3292 O  O     . LYS D 1 87  ? 38.875  -26.771 6.120   1.00 36.19  ? 86  LYS F O     1 
ATOM   3293 C  CB    . LYS D 1 87  ? 36.010  -25.532 4.974   1.00 40.45  ? 86  LYS F CB    1 
ATOM   3294 C  CG    . LYS D 1 87  ? 37.041  -24.565 4.424   1.00 43.47  ? 86  LYS F CG    1 
ATOM   3295 C  CD    . LYS D 1 87  ? 36.372  -23.277 3.969   1.00 49.19  ? 86  LYS F CD    1 
ATOM   3296 C  CE    . LYS D 1 87  ? 37.381  -22.291 3.408   1.00 51.36  ? 86  LYS F CE    1 
ATOM   3297 N  NZ    . LYS D 1 87  ? 37.218  -22.113 1.939   1.00 61.02  ? 86  LYS F NZ    1 
ATOM   3298 N  N     . LEU D 1 88  ? 37.337  -26.355 7.712   1.00 31.56  ? 87  LEU F N     1 
ATOM   3299 C  CA    . LEU D 1 88  ? 38.357  -26.158 8.736   1.00 34.69  ? 87  LEU F CA    1 
ATOM   3300 C  C     . LEU D 1 88  ? 39.016  -27.472 9.130   1.00 33.03  ? 87  LEU F C     1 
ATOM   3301 O  O     . LEU D 1 88  ? 40.208  -27.490 9.460   1.00 33.21  ? 87  LEU F O     1 
ATOM   3302 C  CB    . LEU D 1 88  ? 37.750  -25.483 9.965   1.00 32.92  ? 87  LEU F CB    1 
ATOM   3303 C  CG    . LEU D 1 88  ? 38.766  -24.999 11.002  1.00 33.94  ? 87  LEU F CG    1 
ATOM   3304 C  CD1   . LEU D 1 88  ? 39.620  -23.878 10.426  1.00 31.25  ? 87  LEU F CD1   1 
ATOM   3305 C  CD2   . LEU D 1 88  ? 38.078  -24.559 12.284  1.00 34.43  ? 87  LEU F CD2   1 
ATOM   3306 N  N     . TYR D 1 89  ? 38.261  -28.574 9.111   1.00 30.89  ? 88  TYR F N     1 
ATOM   3307 C  CA    . TYR D 1 89  ? 38.838  -29.879 9.422   1.00 30.34  ? 88  TYR F CA    1 
ATOM   3308 C  C     . TYR D 1 89  ? 39.979  -30.211 8.470   1.00 33.32  ? 88  TYR F C     1 
ATOM   3309 O  O     . TYR D 1 89  ? 41.075  -30.589 8.902   1.00 29.08  ? 88  TYR F O     1 
ATOM   3310 C  CB    . TYR D 1 89  ? 37.752  -30.956 9.367   1.00 27.46  ? 88  TYR F CB    1 
ATOM   3311 C  CG    . TYR D 1 89  ? 38.282  -32.375 9.368   1.00 32.11  ? 88  TYR F CG    1 
ATOM   3312 C  CD1   . TYR D 1 89  ? 38.466  -33.070 8.177   1.00 32.09  ? 88  TYR F CD1   1 
ATOM   3313 C  CD2   . TYR D 1 89  ? 38.599  -33.020 10.557  1.00 32.91  ? 88  TYR F CD2   1 
ATOM   3314 C  CE1   . TYR D 1 89  ? 38.951  -34.364 8.171   1.00 33.92  ? 88  TYR F CE1   1 
ATOM   3315 C  CE2   . TYR D 1 89  ? 39.085  -34.316 10.561  1.00 29.37  ? 88  TYR F CE2   1 
ATOM   3316 C  CZ    . TYR D 1 89  ? 39.258  -34.982 9.365   1.00 37.12  ? 88  TYR F CZ    1 
ATOM   3317 O  OH    . TYR D 1 89  ? 39.740  -36.271 9.360   1.00 32.29  ? 88  TYR F OH    1 
ATOM   3318 N  N     . TYR D 1 90  ? 39.742  -30.069 7.165   1.00 29.46  ? 89  TYR F N     1 
ATOM   3319 C  CA    . TYR D 1 90  ? 40.776  -30.377 6.185   1.00 34.17  ? 89  TYR F CA    1 
ATOM   3320 C  C     . TYR D 1 90  ? 41.853  -29.303 6.128   1.00 36.15  ? 89  TYR F C     1 
ATOM   3321 O  O     . TYR D 1 90  ? 42.987  -29.595 5.732   1.00 35.15  ? 89  TYR F O     1 
ATOM   3322 C  CB    . TYR D 1 90  ? 40.151  -30.579 4.805   1.00 28.17  ? 89  TYR F CB    1 
ATOM   3323 C  CG    . TYR D 1 90  ? 39.518  -31.940 4.642   1.00 35.09  ? 89  TYR F CG    1 
ATOM   3324 C  CD1   . TYR D 1 90  ? 40.297  -33.089 4.632   1.00 31.25  ? 89  TYR F CD1   1 
ATOM   3325 C  CD2   . TYR D 1 90  ? 38.143  -32.078 4.509   1.00 36.48  ? 89  TYR F CD2   1 
ATOM   3326 C  CE1   . TYR D 1 90  ? 39.726  -34.338 4.488   1.00 33.99  ? 89  TYR F CE1   1 
ATOM   3327 C  CE2   . TYR D 1 90  ? 37.562  -33.324 4.365   1.00 33.72  ? 89  TYR F CE2   1 
ATOM   3328 C  CZ    . TYR D 1 90  ? 38.359  -34.450 4.355   1.00 34.44  ? 89  TYR F CZ    1 
ATOM   3329 O  OH    . TYR D 1 90  ? 37.786  -35.693 4.212   1.00 39.94  ? 89  TYR F OH    1 
ATOM   3330 N  N     . TYR D 1 91  ? 41.525  -28.067 6.511   1.00 31.72  ? 90  TYR F N     1 
ATOM   3331 C  CA    . TYR D 1 91  ? 42.548  -27.030 6.596   1.00 31.09  ? 90  TYR F CA    1 
ATOM   3332 C  C     . TYR D 1 91  ? 43.628  -27.412 7.600   1.00 38.13  ? 90  TYR F C     1 
ATOM   3333 O  O     . TYR D 1 91  ? 44.824  -27.259 7.327   1.00 34.71  ? 90  TYR F O     1 
ATOM   3334 C  CB    . TYR D 1 91  ? 41.911  -25.692 6.972   1.00 34.14  ? 90  TYR F CB    1 
ATOM   3335 C  CG    . TYR D 1 91  ? 42.904  -24.574 7.201   1.00 35.35  ? 90  TYR F CG    1 
ATOM   3336 C  CD1   . TYR D 1 91  ? 43.448  -23.871 6.133   1.00 35.55  ? 90  TYR F CD1   1 
ATOM   3337 C  CD2   . TYR D 1 91  ? 43.295  -24.219 8.486   1.00 30.02  ? 90  TYR F CD2   1 
ATOM   3338 C  CE1   . TYR D 1 91  ? 44.356  -22.848 6.339   1.00 32.30  ? 90  TYR F CE1   1 
ATOM   3339 C  CE2   . TYR D 1 91  ? 44.200  -23.198 8.702   1.00 29.24  ? 90  TYR F CE2   1 
ATOM   3340 C  CZ    . TYR D 1 91  ? 44.727  -22.515 7.625   1.00 39.51  ? 90  TYR F CZ    1 
ATOM   3341 O  OH    . TYR D 1 91  ? 45.629  -21.497 7.836   1.00 41.72  ? 90  TYR F OH    1 
ATOM   3342 N  N     . PHE D 1 92  ? 43.224  -27.923 8.764   1.00 33.11  ? 91  PHE F N     1 
ATOM   3343 C  CA    . PHE D 1 92  ? 44.194  -28.330 9.773   1.00 36.08  ? 91  PHE F CA    1 
ATOM   3344 C  C     . PHE D 1 92  ? 44.766  -29.712 9.481   1.00 35.88  ? 91  PHE F C     1 
ATOM   3345 O  O     . PHE D 1 92  ? 45.943  -29.967 9.757   1.00 29.30  ? 91  PHE F O     1 
ATOM   3346 C  CB    . PHE D 1 92  ? 43.553  -28.302 11.160  1.00 30.36  ? 91  PHE F CB    1 
ATOM   3347 C  CG    . PHE D 1 92  ? 43.483  -26.931 11.767  1.00 30.89  ? 91  PHE F CG    1 
ATOM   3348 C  CD1   . PHE D 1 92  ? 44.641  -26.262 12.127  1.00 27.14  ? 91  PHE F CD1   1 
ATOM   3349 C  CD2   . PHE D 1 92  ? 42.262  -26.314 11.984  1.00 31.14  ? 91  PHE F CD2   1 
ATOM   3350 C  CE1   . PHE D 1 92  ? 44.583  -25.001 12.689  1.00 32.08  ? 91  PHE F CE1   1 
ATOM   3351 C  CE2   . PHE D 1 92  ? 42.198  -25.054 12.548  1.00 29.96  ? 91  PHE F CE2   1 
ATOM   3352 C  CZ    . PHE D 1 92  ? 43.361  -24.397 12.901  1.00 30.38  ? 91  PHE F CZ    1 
ATOM   3353 N  N     . THR D 1 93  ? 43.950  -30.614 8.929   1.00 34.38  ? 92  THR F N     1 
ATOM   3354 C  CA    . THR D 1 93  ? 44.433  -31.956 8.613   1.00 36.26  ? 92  THR F CA    1 
ATOM   3355 C  C     . THR D 1 93  ? 45.530  -31.906 7.556   1.00 42.17  ? 92  THR F C     1 
ATOM   3356 O  O     . THR D 1 93  ? 46.588  -32.527 7.712   1.00 44.64  ? 92  THR F O     1 
ATOM   3357 C  CB    . THR D 1 93  ? 43.272  -32.838 8.148   1.00 36.72  ? 92  THR F CB    1 
ATOM   3358 O  OG1   . THR D 1 93  ? 42.468  -33.206 9.276   1.00 45.11  ? 92  THR F OG1   1 
ATOM   3359 C  CG2   . THR D 1 93  ? 43.791  -34.098 7.471   1.00 47.04  ? 92  THR F CG2   1 
ATOM   3360 N  N     . ASN D 1 94  ? 45.295  -31.165 6.469   1.00 39.48  ? 93  ASN F N     1 
ATOM   3361 C  CA    . ASN D 1 94  ? 46.325  -31.015 5.447   1.00 43.90  ? 93  ASN F CA    1 
ATOM   3362 C  C     . ASN D 1 94  ? 47.540  -30.275 5.985   1.00 37.73  ? 93  ASN F C     1 
ATOM   3363 O  O     . ASN D 1 94  ? 48.671  -30.557 5.572   1.00 46.10  ? 93  ASN F O     1 
ATOM   3364 C  CB    . ASN D 1 94  ? 45.757  -30.289 4.227   1.00 34.56  ? 93  ASN F CB    1 
ATOM   3365 C  CG    . ASN D 1 94  ? 44.788  -31.147 3.439   1.00 40.89  ? 93  ASN F CG    1 
ATOM   3366 O  OD1   . ASN D 1 94  ? 44.997  -32.349 3.277   1.00 42.09  ? 93  ASN F OD1   1 
ATOM   3367 N  ND2   . ASN D 1 94  ? 43.717  -30.533 2.950   1.00 40.99  ? 93  ASN F ND2   1 
ATOM   3368 N  N     . MET D 1 95  ? 47.332  -29.331 6.905   1.00 38.36  ? 94  MET F N     1 
ATOM   3369 C  CA    . MET D 1 95  ? 48.458  -28.625 7.507   1.00 36.22  ? 94  MET F CA    1 
ATOM   3370 C  C     . MET D 1 95  ? 49.298  -29.563 8.366   1.00 42.93  ? 94  MET F C     1 
ATOM   3371 O  O     . MET D 1 95  ? 50.528  -29.447 8.401   1.00 42.52  ? 94  MET F O     1 
ATOM   3372 C  CB    . MET D 1 95  ? 47.952  -27.445 8.333   1.00 36.05  ? 94  MET F CB    1 
ATOM   3373 C  CG    . MET D 1 95  ? 49.050  -26.584 8.926   1.00 35.23  ? 94  MET F CG    1 
ATOM   3374 S  SD    . MET D 1 95  ? 48.397  -25.168 9.828   1.00 49.73  ? 94  MET F SD    1 
ATOM   3375 C  CE    . MET D 1 95  ? 49.914  -24.307 10.225  1.00 48.49  ? 94  MET F CE    1 
ATOM   3376 N  N     . LEU D 1 96  ? 48.649  -30.499 9.062   1.00 40.34  ? 95  LEU F N     1 
ATOM   3377 C  CA    . LEU D 1 96  ? 49.383  -31.463 9.877   1.00 40.36  ? 95  LEU F CA    1 
ATOM   3378 C  C     . LEU D 1 96  ? 50.246  -32.369 9.007   1.00 42.46  ? 95  LEU F C     1 
ATOM   3379 O  O     . LEU D 1 96  ? 51.384  -32.690 9.367   1.00 42.97  ? 95  LEU F O     1 
ATOM   3380 C  CB    . LEU D 1 96  ? 48.403  -32.292 10.710  1.00 41.02  ? 95  LEU F CB    1 
ATOM   3381 C  CG    . LEU D 1 96  ? 48.806  -32.879 12.070  1.00 47.29  ? 95  LEU F CG    1 
ATOM   3382 C  CD1   . LEU D 1 96  ? 48.299  -34.311 12.199  1.00 40.42  ? 95  LEU F CD1   1 
ATOM   3383 C  CD2   . LEU D 1 96  ? 50.305  -32.805 12.342  1.00 36.76  ? 95  LEU F CD2   1 
ATOM   3384 N  N     . GLU D 1 97  ? 49.725  -32.787 7.851   1.00 40.69  ? 96  GLU F N     1 
ATOM   3385 C  CA    . GLU D 1 97  ? 50.477  -33.690 6.986   1.00 43.54  ? 96  GLU F CA    1 
ATOM   3386 C  C     . GLU D 1 97  ? 51.718  -33.019 6.407   1.00 44.55  ? 96  GLU F C     1 
ATOM   3387 O  O     . GLU D 1 97  ? 52.688  -33.705 6.067   1.00 49.70  ? 96  GLU F O     1 
ATOM   3388 C  CB    . GLU D 1 97  ? 49.577  -34.207 5.864   1.00 47.62  ? 96  GLU F CB    1 
ATOM   3389 C  CG    . GLU D 1 97  ? 48.342  -34.945 6.357   1.00 56.92  ? 96  GLU F CG    1 
ATOM   3390 C  CD    . GLU D 1 97  ? 47.461  -35.430 5.223   1.00 72.31  ? 96  GLU F CD    1 
ATOM   3391 O  OE1   . GLU D 1 97  ? 46.338  -35.903 5.500   1.00 62.78  ? 96  GLU F OE1   1 
ATOM   3392 O  OE2   . GLU D 1 97  ? 47.890  -35.337 4.053   1.00 78.83  ? 96  GLU F OE2   1 
ATOM   3393 N  N     . ARG D 1 98  ? 51.712  -31.690 6.298   1.00 46.48  ? 97  ARG F N     1 
ATOM   3394 C  CA    A ARG D 1 98  ? 52.844  -30.954 5.745   0.58 43.95  ? 97  ARG F CA    1 
ATOM   3395 C  CA    B ARG D 1 98  ? 52.819  -30.923 5.743   0.42 42.77  ? 97  ARG F CA    1 
ATOM   3396 C  C     . ARG D 1 98  ? 53.625  -30.202 6.818   1.00 43.18  ? 97  ARG F C     1 
ATOM   3397 O  O     . ARG D 1 98  ? 54.350  -29.251 6.505   1.00 44.94  ? 97  ARG F O     1 
ATOM   3398 C  CB    A ARG D 1 98  ? 52.361  -29.992 4.658   0.58 44.72  ? 97  ARG F CB    1 
ATOM   3399 C  CB    B ARG D 1 98  ? 52.292  -29.911 4.722   0.42 44.70  ? 97  ARG F CB    1 
ATOM   3400 C  CG    A ARG D 1 98  ? 51.274  -30.576 3.768   0.58 44.22  ? 97  ARG F CG    1 
ATOM   3401 C  CG    B ARG D 1 98  ? 51.544  -28.737 5.351   0.42 45.54  ? 97  ARG F CG    1 
ATOM   3402 C  CD    A ARG D 1 98  ? 51.040  -29.743 2.520   0.58 44.99  ? 97  ARG F CD    1 
ATOM   3403 C  CD    B ARG D 1 98  ? 51.106  -27.708 4.321   0.42 47.24  ? 97  ARG F CD    1 
ATOM   3404 N  NE    A ARG D 1 98  ? 51.550  -30.417 1.331   0.58 47.57  ? 97  ARG F NE    1 
ATOM   3405 N  NE    B ARG D 1 98  ? 52.200  -27.290 3.448   0.42 53.13  ? 97  ARG F NE    1 
ATOM   3406 C  CZ    A ARG D 1 98  ? 52.604  -30.010 0.633   0.58 50.29  ? 97  ARG F CZ    1 
ATOM   3407 C  CZ    B ARG D 1 98  ? 53.126  -26.393 3.774   0.42 52.41  ? 97  ARG F CZ    1 
ATOM   3408 N  NH1   A ARG D 1 98  ? 53.260  -28.916 0.992   0.58 51.46  ? 97  ARG F NH1   1 
ATOM   3409 N  NH1   B ARG D 1 98  ? 53.103  -25.808 4.964   0.42 51.96  ? 97  ARG F NH1   1 
ATOM   3410 N  NH2   A ARG D 1 98  ? 52.994  -30.693 -0.433  0.58 50.95  ? 97  ARG F NH2   1 
ATOM   3411 N  NH2   B ARG D 1 98  ? 54.079  -26.081 2.906   0.42 45.80  ? 97  ARG F NH2   1 
ATOM   3412 N  N     . ILE D 1 99  ? 53.517  -30.632 8.079   1.00 41.05  ? 98  ILE F N     1 
ATOM   3413 C  CA    . ILE D 1 99  ? 54.107  -29.883 9.186   1.00 46.16  ? 98  ILE F CA    1 
ATOM   3414 C  C     . ILE D 1 99  ? 55.629  -29.829 9.082   1.00 44.58  ? 98  ILE F C     1 
ATOM   3415 O  O     . ILE D 1 99  ? 56.252  -28.861 9.535   1.00 43.64  ? 98  ILE F O     1 
ATOM   3416 C  CB    . ILE D 1 99  ? 53.648  -30.473 10.536  1.00 47.52  ? 98  ILE F CB    1 
ATOM   3417 C  CG1   . ILE D 1 99  ? 54.146  -29.598 11.694  1.00 43.70  ? 98  ILE F CG1   1 
ATOM   3418 C  CG2   . ILE D 1 99  ? 54.158  -31.896 10.700  1.00 39.92  ? 98  ILE F CG2   1 
ATOM   3419 C  CD1   . ILE D 1 99  ? 53.376  -29.775 12.977  1.00 48.18  ? 98  ILE F CD1   1 
ATOM   3420 N  N     . ARG D 1 100 ? 56.252  -30.847 8.481   1.00 43.75  ? 99  ARG F N     1 
ATOM   3421 C  CA    A ARG D 1 100 ? 57.702  -30.817 8.313   0.46 48.37  ? 99  ARG F CA    1 
ATOM   3422 C  CA    B ARG D 1 100 ? 57.702  -30.825 8.303   0.54 48.38  ? 99  ARG F CA    1 
ATOM   3423 C  C     . ARG D 1 100 ? 58.152  -29.678 7.410   1.00 51.11  ? 99  ARG F C     1 
ATOM   3424 O  O     . ARG D 1 100 ? 59.304  -29.241 7.513   1.00 50.02  ? 99  ARG F O     1 
ATOM   3425 C  CB    A ARG D 1 100 ? 58.197  -32.151 7.757   0.46 46.52  ? 99  ARG F CB    1 
ATOM   3426 C  CB    B ARG D 1 100 ? 58.188  -32.152 7.718   0.54 46.52  ? 99  ARG F CB    1 
ATOM   3427 C  CG    A ARG D 1 100 ? 58.026  -33.313 8.717   0.46 46.57  ? 99  ARG F CG    1 
ATOM   3428 C  CG    B ARG D 1 100 ? 58.075  -33.341 8.659   0.54 46.57  ? 99  ARG F CG    1 
ATOM   3429 C  CD    A ARG D 1 100 ? 57.921  -34.631 7.974   0.46 49.38  ? 99  ARG F CD    1 
ATOM   3430 C  CD    B ARG D 1 100 ? 58.493  -34.629 7.962   0.54 48.05  ? 99  ARG F CD    1 
ATOM   3431 N  NE    A ARG D 1 100 ? 56.967  -35.526 8.619   0.46 51.30  ? 99  ARG F NE    1 
ATOM   3432 N  NE    B ARG D 1 100 ? 58.278  -35.806 8.799   0.54 46.86  ? 99  ARG F NE    1 
ATOM   3433 C  CZ    A ARG D 1 100 ? 55.653  -35.472 8.429   0.46 49.28  ? 99  ARG F CZ    1 
ATOM   3434 C  CZ    B ARG D 1 100 ? 59.219  -36.378 9.543   0.54 47.74  ? 99  ARG F CZ    1 
ATOM   3435 N  NH1   A ARG D 1 100 ? 55.138  -34.564 7.610   0.46 44.12  ? 99  ARG F NH1   1 
ATOM   3436 N  NH1   B ARG D 1 100 ? 60.451  -35.886 9.556   0.54 49.40  ? 99  ARG F NH1   1 
ATOM   3437 N  NH2   A ARG D 1 100 ? 54.853  -36.322 9.057   0.46 51.26  ? 99  ARG F NH2   1 
ATOM   3438 N  NH2   B ARG D 1 100 ? 58.929  -37.446 10.274  0.54 49.10  ? 99  ARG F NH2   1 
ATOM   3439 N  N     . LEU D 1 101 ? 57.276  -29.182 6.540   1.00 48.96  ? 100 LEU F N     1 
ATOM   3440 C  CA    . LEU D 1 101 ? 57.593  -28.094 5.628   1.00 49.40  ? 100 LEU F CA    1 
ATOM   3441 C  C     . LEU D 1 101 ? 57.326  -26.720 6.230   1.00 49.24  ? 100 LEU F C     1 
ATOM   3442 O  O     . LEU D 1 101 ? 57.324  -25.727 5.496   1.00 52.65  ? 100 LEU F O     1 
ATOM   3443 C  CB    . LEU D 1 101 ? 56.799  -28.258 4.331   1.00 47.06  ? 100 LEU F CB    1 
ATOM   3444 C  CG    . LEU D 1 101 ? 57.061  -29.559 3.569   1.00 50.53  ? 100 LEU F CG    1 
ATOM   3445 C  CD1   . LEU D 1 101 ? 56.115  -29.698 2.389   1.00 49.93  ? 100 LEU F CD1   1 
ATOM   3446 C  CD2   . LEU D 1 101 ? 58.508  -29.618 3.106   1.00 45.70  ? 100 LEU F CD2   1 
ATOM   3447 N  N     . CYS D 1 102 ? 57.106  -26.640 7.540   1.00 52.80  ? 101 CYS F N     1 
ATOM   3448 C  CA    . CYS D 1 102 ? 56.801  -25.364 8.172   1.00 50.20  ? 101 CYS F CA    1 
ATOM   3449 C  C     . CYS D 1 102 ? 58.029  -24.463 8.202   1.00 60.33  ? 101 CYS F C     1 
ATOM   3450 O  O     . CYS D 1 102 ? 59.147  -24.915 8.467   1.00 60.55  ? 101 CYS F O     1 
ATOM   3451 C  CB    . CYS D 1 102 ? 56.283  -25.582 9.594   1.00 50.39  ? 101 CYS F CB    1 
ATOM   3452 S  SG    . CYS D 1 102 ? 54.572  -26.156 9.697   1.00 71.95  ? 101 CYS F SG    1 
ATOM   3453 N  N     . ASN D 1 103 ? 57.814  -23.179 7.929   1.00 57.84  ? 102 ASN F N     1 
ATOM   3454 C  CA    . ASN D 1 103 ? 58.877  -22.193 8.043   1.00 53.73  ? 102 ASN F CA    1 
ATOM   3455 C  C     . ASN D 1 103 ? 59.137  -21.878 9.517   1.00 56.62  ? 102 ASN F C     1 
ATOM   3456 O  O     . ASN D 1 103 ? 58.457  -22.376 10.418  1.00 56.04  ? 102 ASN F O     1 
ATOM   3457 C  CB    . ASN D 1 103 ? 58.519  -20.937 7.249   1.00 48.51  ? 102 ASN F CB    1 
ATOM   3458 C  CG    . ASN D 1 103 ? 57.136  -20.406 7.584   1.00 61.62  ? 102 ASN F CG    1 
ATOM   3459 O  OD1   . ASN D 1 103 ? 56.706  -20.435 8.736   1.00 61.20  ? 102 ASN F OD1   1 
ATOM   3460 N  ND2   . ASN D 1 103 ? 56.429  -19.921 6.569   1.00 65.69  ? 102 ASN F ND2   1 
ATOM   3461 N  N     . MET D 1 104 ? 60.141  -21.031 9.764   1.00 53.59  ? 103 MET F N     1 
ATOM   3462 C  CA    . MET D 1 104 ? 60.513  -20.704 11.139  1.00 53.29  ? 103 MET F CA    1 
ATOM   3463 C  C     . MET D 1 104 ? 59.365  -20.033 11.880  1.00 51.55  ? 103 MET F C     1 
ATOM   3464 O  O     . MET D 1 104 ? 59.195  -20.234 13.090  1.00 50.20  ? 103 MET F O     1 
ATOM   3465 C  CB    . MET D 1 104 ? 61.751  -19.809 11.149  1.00 52.61  ? 103 MET F CB    1 
ATOM   3466 C  CG    . MET D 1 104 ? 62.195  -19.404 12.541  1.00 54.77  ? 103 MET F CG    1 
ATOM   3467 S  SD    . MET D 1 104 ? 63.954  -19.041 12.622  1.00 94.57  ? 103 MET F SD    1 
ATOM   3468 C  CE    . MET D 1 104 ? 64.626  -20.682 12.376  1.00 63.94  ? 103 MET F CE    1 
ATOM   3469 N  N     . ARG D 1 105 ? 58.575  -19.224 11.169  1.00 51.00  ? 104 ARG F N     1 
ATOM   3470 C  CA    . ARG D 1 105 ? 57.369  -18.626 11.729  1.00 54.20  ? 104 ARG F CA    1 
ATOM   3471 C  C     . ARG D 1 105 ? 56.469  -19.682 12.355  1.00 49.15  ? 104 ARG F C     1 
ATOM   3472 O  O     . ARG D 1 105 ? 56.162  -19.632 13.551  1.00 45.01  ? 104 ARG F O     1 
ATOM   3473 C  CB    . ARG D 1 105 ? 56.614  -17.870 10.634  1.00 55.99  ? 104 ARG F CB    1 
ATOM   3474 C  CG    . ARG D 1 105 ? 55.485  -17.007 11.138  1.00 76.57  ? 104 ARG F CG    1 
ATOM   3475 C  CD    . ARG D 1 105 ? 55.386  -15.716 10.361  1.00 79.11  ? 104 ARG F CD    1 
ATOM   3476 N  NE    . ARG D 1 105 ? 55.936  -14.600 11.128  1.00 87.73  ? 104 ARG F NE    1 
ATOM   3477 C  CZ    . ARG D 1 105 ? 55.313  -14.007 12.143  1.00 85.16  ? 104 ARG F CZ    1 
ATOM   3478 N  NH1   . ARG D 1 105 ? 54.113  -14.418 12.529  1.00 79.79  ? 104 ARG F NH1   1 
ATOM   3479 N  NH2   . ARG D 1 105 ? 55.901  -13.005 12.774  1.00 82.54  ? 104 ARG F NH2   1 
ATOM   3480 N  N     . GLU D 1 106 ? 56.042  -20.654 11.545  1.00 48.83  ? 105 GLU F N     1 
ATOM   3481 C  CA    . GLU D 1 106 ? 55.089  -21.655 12.006  1.00 46.78  ? 105 GLU F CA    1 
ATOM   3482 C  C     . GLU D 1 106 ? 55.713  -22.618 13.009  1.00 44.04  ? 105 GLU F C     1 
ATOM   3483 O  O     . GLU D 1 106 ? 55.015  -23.124 13.896  1.00 43.29  ? 105 GLU F O     1 
ATOM   3484 C  CB    . GLU D 1 106 ? 54.528  -22.404 10.801  1.00 44.21  ? 105 GLU F CB    1 
ATOM   3485 C  CG    . GLU D 1 106 ? 53.840  -21.482 9.799   1.00 57.26  ? 105 GLU F CG    1 
ATOM   3486 C  CD    . GLU D 1 106 ? 53.748  -22.078 8.408   1.00 63.56  ? 105 GLU F CD    1 
ATOM   3487 O  OE1   . GLU D 1 106 ? 54.745  -22.669 7.947   1.00 63.34  ? 105 GLU F OE1   1 
ATOM   3488 O  OE2   . GLU D 1 106 ? 52.680  -21.949 7.774   1.00 69.06  ? 105 GLU F OE2   1 
ATOM   3489 N  N     . GLN D 1 107 ? 57.018  -22.879 12.893  1.00 44.43  ? 106 GLN F N     1 
ATOM   3490 C  CA    . GLN D 1 107 ? 57.687  -23.759 13.846  1.00 46.26  ? 106 GLN F CA    1 
ATOM   3491 C  C     . GLN D 1 107 ? 57.587  -23.210 15.263  1.00 41.58  ? 106 GLN F C     1 
ATOM   3492 O  O     . GLN D 1 107 ? 57.197  -23.924 16.192  1.00 46.39  ? 106 GLN F O     1 
ATOM   3493 C  CB    . GLN D 1 107 ? 59.150  -23.952 13.447  1.00 41.78  ? 106 GLN F CB    1 
ATOM   3494 C  CG    . GLN D 1 107 ? 59.356  -24.779 12.191  1.00 45.28  ? 106 GLN F CG    1 
ATOM   3495 C  CD    . GLN D 1 107 ? 60.793  -24.752 11.710  1.00 52.64  ? 106 GLN F CD    1 
ATOM   3496 O  OE1   . GLN D 1 107 ? 61.708  -24.439 12.472  1.00 47.86  ? 106 GLN F OE1   1 
ATOM   3497 N  NE2   . GLN D 1 107 ? 60.998  -25.074 10.439  1.00 54.85  ? 106 GLN F NE2   1 
ATOM   3498 N  N     . ILE D 1 108 ? 57.929  -21.932 15.443  1.00 37.43  ? 107 ILE F N     1 
ATOM   3499 C  CA    . ILE D 1 108 ? 57.886  -21.329 16.773  1.00 39.90  ? 107 ILE F CA    1 
ATOM   3500 C  C     . ILE D 1 108 ? 56.458  -21.302 17.302  1.00 40.52  ? 107 ILE F C     1 
ATOM   3501 O  O     . ILE D 1 108 ? 56.210  -21.593 18.479  1.00 38.94  ? 107 ILE F O     1 
ATOM   3502 C  CB    . ILE D 1 108 ? 58.506  -19.920 16.737  1.00 41.63  ? 107 ILE F CB    1 
ATOM   3503 C  CG1   . ILE D 1 108 ? 60.006  -20.005 16.447  1.00 52.32  ? 107 ILE F CG1   1 
ATOM   3504 C  CG2   . ILE D 1 108 ? 58.251  -19.184 18.044  1.00 39.00  ? 107 ILE F CG2   1 
ATOM   3505 C  CD1   . ILE D 1 108 ? 60.694  -18.658 16.391  1.00 56.82  ? 107 ILE F CD1   1 
ATOM   3506 N  N     . ALA D 1 109 ? 55.495  -20.964 16.441  1.00 38.50  ? 108 ALA F N     1 
ATOM   3507 C  CA    . ALA D 1 109 ? 54.105  -20.889 16.880  1.00 41.06  ? 108 ALA F CA    1 
ATOM   3508 C  C     . ALA D 1 109 ? 53.555  -22.267 17.227  1.00 33.90  ? 108 ALA F C     1 
ATOM   3509 O  O     . ALA D 1 109 ? 52.806  -22.413 18.200  1.00 34.74  ? 108 ALA F O     1 
ATOM   3510 C  CB    . ALA D 1 109 ? 53.252  -20.224 15.803  1.00 40.47  ? 108 ALA F CB    1 
ATOM   3511 N  N     . PHE D 1 110 ? 53.912  -23.290 16.445  1.00 36.86  ? 109 PHE F N     1 
ATOM   3512 C  CA    . PHE D 1 110 ? 53.434  -24.639 16.738  1.00 35.16  ? 109 PHE F CA    1 
ATOM   3513 C  C     . PHE D 1 110 ? 54.007  -25.156 18.052  1.00 38.83  ? 109 PHE F C     1 
ATOM   3514 O  O     . PHE D 1 110 ? 53.288  -25.773 18.847  1.00 37.80  ? 109 PHE F O     1 
ATOM   3515 C  CB    . PHE D 1 110 ? 53.784  -25.589 15.592  1.00 41.08  ? 109 PHE F CB    1 
ATOM   3516 C  CG    . PHE D 1 110 ? 53.378  -27.014 15.846  1.00 37.65  ? 109 PHE F CG    1 
ATOM   3517 C  CD1   . PHE D 1 110 ? 52.063  -27.414 15.675  1.00 34.48  ? 109 PHE F CD1   1 
ATOM   3518 C  CD2   . PHE D 1 110 ? 54.309  -27.950 16.267  1.00 39.08  ? 109 PHE F CD2   1 
ATOM   3519 C  CE1   . PHE D 1 110 ? 51.684  -28.722 15.915  1.00 39.73  ? 109 PHE F CE1   1 
ATOM   3520 C  CE2   . PHE D 1 110 ? 53.937  -29.260 16.508  1.00 43.03  ? 109 PHE F CE2   1 
ATOM   3521 C  CZ    . PHE D 1 110 ? 52.622  -29.646 16.334  1.00 38.95  ? 109 PHE F CZ    1 
ATOM   3522 N  N     . ILE D 1 111 ? 55.298  -24.918 18.296  1.00 37.27  ? 110 ILE F N     1 
ATOM   3523 C  CA    . ILE D 1 111 ? 55.909  -25.352 19.548  1.00 30.48  ? 110 ILE F CA    1 
ATOM   3524 C  C     . ILE D 1 111 ? 55.295  -24.609 20.727  1.00 33.89  ? 110 ILE F C     1 
ATOM   3525 O  O     . ILE D 1 111 ? 55.092  -25.184 21.804  1.00 35.35  ? 110 ILE F O     1 
ATOM   3526 C  CB    . ILE D 1 111 ? 57.437  -25.164 19.489  1.00 36.59  ? 110 ILE F CB    1 
ATOM   3527 C  CG1   . ILE D 1 111 ? 58.035  -26.008 18.363  1.00 36.14  ? 110 ILE F CG1   1 
ATOM   3528 C  CG2   . ILE D 1 111 ? 58.077  -25.537 20.818  1.00 35.95  ? 110 ILE F CG2   1 
ATOM   3529 C  CD1   . ILE D 1 111 ? 59.525  -25.816 18.184  1.00 44.36  ? 110 ILE F CD1   1 
ATOM   3530 N  N     . LYS D 1 112 ? 54.983  -23.324 20.544  1.00 38.25  ? 111 LYS F N     1 
ATOM   3531 C  CA    . LYS D 1 112 ? 54.351  -22.554 21.612  1.00 37.00  ? 111 LYS F CA    1 
ATOM   3532 C  C     . LYS D 1 112 ? 52.995  -23.142 21.979  1.00 37.89  ? 111 LYS F C     1 
ATOM   3533 O  O     . LYS D 1 112 ? 52.707  -23.382 23.157  1.00 38.75  ? 111 LYS F O     1 
ATOM   3534 C  CB    . LYS D 1 112 ? 54.209  -21.092 21.191  1.00 42.80  ? 111 LYS F CB    1 
ATOM   3535 C  CG    . LYS D 1 112 ? 53.614  -20.193 22.262  1.00 49.00  ? 111 LYS F CG    1 
ATOM   3536 C  CD    . LYS D 1 112 ? 53.832  -18.725 21.933  1.00 63.55  ? 111 LYS F CD    1 
ATOM   3537 C  CE    . LYS D 1 112 ? 53.190  -17.822 22.974  1.00 74.17  ? 111 LYS F CE    1 
ATOM   3538 N  NZ    . LYS D 1 112 ? 52.987  -18.520 24.275  1.00 67.89  ? 111 LYS F NZ    1 
ATOM   3539 N  N     . GLY D 1 113 ? 52.147  -23.385 20.977  1.00 34.33  ? 112 GLY F N     1 
ATOM   3540 C  CA    . GLY D 1 113 ? 50.852  -23.988 21.249  1.00 34.76  ? 112 GLY F CA    1 
ATOM   3541 C  C     . GLY D 1 113 ? 50.968  -25.393 21.808  1.00 34.34  ? 112 GLY F C     1 
ATOM   3542 O  O     . GLY D 1 113 ? 50.220  -25.776 22.710  1.00 31.67  ? 112 GLY F O     1 
ATOM   3543 N  N     . LEU D 1 114 ? 51.911  -26.179 21.281  1.00 35.88  ? 113 LEU F N     1 
ATOM   3544 C  CA    . LEU D 1 114 ? 52.121  -27.525 21.805  1.00 33.37  ? 113 LEU F CA    1 
ATOM   3545 C  C     . LEU D 1 114 ? 52.557  -27.484 23.264  1.00 35.12  ? 113 LEU F C     1 
ATOM   3546 O  O     . LEU D 1 114 ? 52.147  -28.333 24.065  1.00 31.85  ? 113 LEU F O     1 
ATOM   3547 C  CB    . LEU D 1 114 ? 53.154  -28.267 20.958  1.00 36.76  ? 113 LEU F CB    1 
ATOM   3548 C  CG    . LEU D 1 114 ? 53.319  -29.758 21.262  1.00 35.39  ? 113 LEU F CG    1 
ATOM   3549 C  CD1   . LEU D 1 114 ? 52.041  -30.519 20.937  1.00 35.81  ? 113 LEU F CD1   1 
ATOM   3550 C  CD2   . LEU D 1 114 ? 54.505  -30.339 20.504  1.00 37.51  ? 113 LEU F CD2   1 
ATOM   3551 N  N     . TYR D 1 115 ? 53.382  -26.499 23.633  1.00 31.14  ? 114 TYR F N     1 
ATOM   3552 C  CA    . TYR D 1 115 ? 53.812  -26.399 25.024  1.00 30.38  ? 114 TYR F CA    1 
ATOM   3553 C  C     . TYR D 1 115 ? 52.684  -25.898 25.917  1.00 30.05  ? 114 TYR F C     1 
ATOM   3554 O  O     . TYR D 1 115 ? 52.525  -26.376 27.046  1.00 33.85  ? 114 TYR F O     1 
ATOM   3555 C  CB    . TYR D 1 115 ? 55.036  -25.492 25.153  1.00 33.31  ? 114 TYR F CB    1 
ATOM   3556 C  CG    . TYR D 1 115 ? 55.768  -25.703 26.460  1.00 33.88  ? 114 TYR F CG    1 
ATOM   3557 C  CD1   . TYR D 1 115 ? 56.890  -26.517 26.524  1.00 29.69  ? 114 TYR F CD1   1 
ATOM   3558 C  CD2   . TYR D 1 115 ? 55.319  -25.113 27.636  1.00 35.75  ? 114 TYR F CD2   1 
ATOM   3559 C  CE1   . TYR D 1 115 ? 57.554  -26.727 27.718  1.00 32.70  ? 114 TYR F CE1   1 
ATOM   3560 C  CE2   . TYR D 1 115 ? 55.976  -25.318 28.835  1.00 35.55  ? 114 TYR F CE2   1 
ATOM   3561 C  CZ    . TYR D 1 115 ? 57.093  -26.125 28.870  1.00 34.14  ? 114 TYR F CZ    1 
ATOM   3562 O  OH    . TYR D 1 115 ? 57.751  -26.332 30.060  1.00 36.75  ? 114 TYR F OH    1 
ATOM   3563 N  N     . VAL D 1 116 ? 51.902  -24.926 25.444  1.00 30.71  ? 115 VAL F N     1 
ATOM   3564 C  CA    . VAL D 1 116 ? 50.725  -24.504 26.199  1.00 30.78  ? 115 VAL F CA    1 
ATOM   3565 C  C     . VAL D 1 116 ? 49.821  -25.699 26.466  1.00 38.93  ? 115 VAL F C     1 
ATOM   3566 O  O     . VAL D 1 116 ? 49.256  -25.843 27.558  1.00 31.09  ? 115 VAL F O     1 
ATOM   3567 C  CB    . VAL D 1 116 ? 49.980  -23.380 25.454  1.00 38.36  ? 115 VAL F CB    1 
ATOM   3568 C  CG1   . VAL D 1 116 ? 48.642  -23.090 26.121  1.00 30.47  ? 115 VAL F CG1   1 
ATOM   3569 C  CG2   . VAL D 1 116 ? 50.831  -22.121 25.407  1.00 30.43  ? 115 VAL F CG2   1 
ATOM   3570 N  N     . ALA D 1 117 ? 49.701  -26.595 25.486  1.00 33.61  ? 116 ALA F N     1 
ATOM   3571 C  CA    . ALA D 1 117 ? 48.866  -27.779 25.646  1.00 33.19  ? 116 ALA F CA    1 
ATOM   3572 C  C     . ALA D 1 117 ? 49.555  -28.843 26.496  1.00 35.53  ? 116 ALA F C     1 
ATOM   3573 O  O     . ALA D 1 117 ? 49.026  -29.267 27.526  1.00 31.46  ? 116 ALA F O     1 
ATOM   3574 C  CB    . ALA D 1 117 ? 48.495  -28.344 24.272  1.00 26.54  ? 116 ALA F CB    1 
ATOM   3575 N  N     . GLU D 1 118 ? 50.742  -29.283 26.087  1.00 34.37  ? 117 GLU F N     1 
ATOM   3576 C  CA    . GLU D 1 118 ? 51.362  -30.467 26.668  1.00 33.53  ? 117 GLU F CA    1 
ATOM   3577 C  C     . GLU D 1 118 ? 52.537  -30.165 27.588  1.00 31.39  ? 117 GLU F C     1 
ATOM   3578 O  O     . GLU D 1 118 ? 53.160  -31.104 28.094  1.00 28.17  ? 117 GLU F O     1 
ATOM   3579 C  CB    . GLU D 1 118 ? 51.830  -31.406 25.553  1.00 32.45  ? 117 GLU F CB    1 
ATOM   3580 C  CG    . GLU D 1 118 ? 50.820  -31.609 24.443  1.00 34.80  ? 117 GLU F CG    1 
ATOM   3581 C  CD    . GLU D 1 118 ? 49.817  -32.693 24.765  1.00 34.66  ? 117 GLU F CD    1 
ATOM   3582 O  OE1   . GLU D 1 118 ? 49.033  -32.525 25.722  1.00 39.11  ? 117 GLU F OE1   1 
ATOM   3583 O  OE2   . GLU D 1 118 ? 49.830  -33.725 24.066  1.00 38.69  ? 117 GLU F OE2   1 
ATOM   3584 N  N     . GLY D 1 119 ? 52.854  -28.896 27.830  1.00 29.95  ? 118 GLY F N     1 
ATOM   3585 C  CA    . GLY D 1 119 ? 54.095  -28.558 28.492  1.00 35.20  ? 118 GLY F CA    1 
ATOM   3586 C  C     . GLY D 1 119 ? 53.999  -28.471 30.005  1.00 35.78  ? 118 GLY F C     1 
ATOM   3587 O  O     . GLY D 1 119 ? 52.920  -28.421 30.594  1.00 33.47  ? 118 GLY F O     1 
ATOM   3588 N  N     . ASP D 1 120 ? 55.174  -28.465 30.630  1.00 35.56  ? 119 ASP F N     1 
ATOM   3589 C  CA    . ASP D 1 120 ? 55.322  -28.215 32.062  1.00 38.47  ? 119 ASP F CA    1 
ATOM   3590 C  C     . ASP D 1 120 ? 55.160  -26.716 32.276  1.00 42.32  ? 119 ASP F C     1 
ATOM   3591 O  O     . ASP D 1 120 ? 56.089  -25.939 32.042  1.00 40.94  ? 119 ASP F O     1 
ATOM   3592 C  CB    . ASP D 1 120 ? 56.681  -28.715 32.544  1.00 42.20  ? 119 ASP F CB    1 
ATOM   3593 C  CG    . ASP D 1 120 ? 56.828  -28.684 34.058  1.00 40.86  ? 119 ASP F CG    1 
ATOM   3594 O  OD1   . ASP D 1 120 ? 56.204  -27.829 34.720  1.00 45.21  ? 119 ASP F OD1   1 
ATOM   3595 O  OD2   . ASP D 1 120 ? 57.588  -29.523 34.588  1.00 40.42  ? 119 ASP F OD2   1 
ATOM   3596 N  N     . LYS D 1 121 ? 53.972  -26.297 32.717  1.00 40.71  ? 120 LYS F N     1 
ATOM   3597 C  CA    . LYS D 1 121 ? 53.677  -24.873 32.816  1.00 48.04  ? 120 LYS F CA    1 
ATOM   3598 C  C     . LYS D 1 121 ? 54.347  -24.201 34.008  1.00 43.70  ? 120 LYS F C     1 
ATOM   3599 O  O     . LYS D 1 121 ? 54.353  -22.967 34.074  1.00 49.23  ? 120 LYS F O     1 
ATOM   3600 C  CB    . LYS D 1 121 ? 52.163  -24.642 32.884  1.00 41.69  ? 120 LYS F CB    1 
ATOM   3601 C  CG    . LYS D 1 121 ? 51.514  -25.075 34.186  1.00 53.62  ? 120 LYS F CG    1 
ATOM   3602 C  CD    . LYS D 1 121 ? 50.090  -24.541 34.295  1.00 59.04  ? 120 LYS F CD    1 
ATOM   3603 C  CE    . LYS D 1 121 ? 49.123  -25.325 33.419  1.00 60.83  ? 120 LYS F CE    1 
ATOM   3604 N  NZ    . LYS D 1 121 ? 48.807  -26.663 33.992  1.00 55.88  ? 120 LYS F NZ    1 
ATOM   3605 N  N     . THR D 1 122 ? 54.910  -24.967 34.945  1.00 40.33  ? 121 THR F N     1 
ATOM   3606 C  CA    . THR D 1 122 ? 55.605  -24.360 36.075  1.00 43.29  ? 121 THR F CA    1 
ATOM   3607 C  C     . THR D 1 122 ? 56.925  -23.720 35.667  1.00 51.25  ? 121 THR F C     1 
ATOM   3608 O  O     . THR D 1 122 ? 57.408  -22.825 36.370  1.00 43.65  ? 121 THR F O     1 
ATOM   3609 C  CB    . THR D 1 122 ? 55.865  -25.398 37.167  1.00 46.24  ? 121 THR F CB    1 
ATOM   3610 O  OG1   . THR D 1 122 ? 57.020  -26.173 36.824  1.00 52.09  ? 121 THR F OG1   1 
ATOM   3611 C  CG2   . THR D 1 122 ? 54.668  -26.323 37.325  1.00 46.84  ? 121 THR F CG2   1 
ATOM   3612 N  N     . LEU D 1 123 ? 57.520  -24.167 34.560  1.00 48.43  ? 122 LEU F N     1 
ATOM   3613 C  CA    . LEU D 1 123 ? 58.800  -23.718 34.019  1.00 49.92  ? 122 LEU F CA    1 
ATOM   3614 C  C     . LEU D 1 123 ? 59.978  -24.049 34.929  1.00 44.47  ? 122 LEU F C     1 
ATOM   3615 O  O     . LEU D 1 123 ? 61.121  -23.744 34.563  1.00 46.81  ? 122 LEU F O     1 
ATOM   3616 C  CB    . LEU D 1 123 ? 58.811  -22.213 33.707  1.00 44.93  ? 122 LEU F CB    1 
ATOM   3617 C  CG    . LEU D 1 123 ? 57.765  -21.734 32.699  1.00 52.55  ? 122 LEU F CG    1 
ATOM   3618 C  CD1   . LEU D 1 123 ? 58.059  -20.310 32.256  1.00 48.20  ? 122 LEU F CD1   1 
ATOM   3619 C  CD2   . LEU D 1 123 ? 57.692  -22.670 31.498  1.00 51.64  ? 122 LEU F CD2   1 
ATOM   3620 N  N     . LYS D 1 124 ? 59.747  -24.651 36.101  1.00 43.30  ? 123 LYS F N     1 
ATOM   3621 C  CA    . LYS D 1 124 ? 60.851  -25.215 36.870  1.00 50.84  ? 123 LYS F CA    1 
ATOM   3622 C  C     . LYS D 1 124 ? 61.642  -26.193 36.016  1.00 50.97  ? 123 LYS F C     1 
ATOM   3623 O  O     . LYS D 1 124 ? 62.876  -26.238 36.077  1.00 48.50  ? 123 LYS F O     1 
ATOM   3624 C  CB    . LYS D 1 124 ? 60.322  -25.917 38.122  1.00 46.98  ? 123 LYS F CB    1 
ATOM   3625 C  CG    . LYS D 1 124 ? 59.555  -25.026 39.085  1.00 55.00  ? 123 LYS F CG    1 
ATOM   3626 C  CD    . LYS D 1 124 ? 59.084  -25.823 40.294  1.00 62.12  ? 123 LYS F CD    1 
ATOM   3627 C  CE    . LYS D 1 124 ? 58.209  -24.988 41.216  1.00 68.10  ? 123 LYS F CE    1 
ATOM   3628 N  NZ    . LYS D 1 124 ? 57.745  -25.772 42.395  1.00 73.47  ? 123 LYS F NZ    1 
ATOM   3629 N  N     . ARG D 1 125 ? 60.937  -26.985 35.215  1.00 51.49  ? 124 ARG F N     1 
ATOM   3630 C  CA    . ARG D 1 125 ? 61.523  -27.815 34.179  1.00 43.18  ? 124 ARG F CA    1 
ATOM   3631 C  C     . ARG D 1 125 ? 60.764  -27.555 32.887  1.00 37.89  ? 124 ARG F C     1 
ATOM   3632 O  O     . ARG D 1 125 ? 59.624  -27.085 32.898  1.00 44.24  ? 124 ARG F O     1 
ATOM   3633 C  CB    . ARG D 1 125 ? 61.473  -29.301 34.558  1.00 43.63  ? 124 ARG F CB    1 
ATOM   3634 C  CG    . ARG D 1 125 ? 62.002  -29.576 35.956  1.00 45.38  ? 124 ARG F CG    1 
ATOM   3635 C  CD    . ARG D 1 125 ? 61.535  -30.916 36.493  1.00 48.14  ? 124 ARG F CD    1 
ATOM   3636 N  NE    . ARG D 1 125 ? 62.287  -32.031 35.929  1.00 42.46  ? 124 ARG F NE    1 
ATOM   3637 C  CZ    . ARG D 1 125 ? 62.272  -33.263 36.425  1.00 50.33  ? 124 ARG F CZ    1 
ATOM   3638 N  NH1   . ARG D 1 125 ? 61.542  -33.537 37.498  1.00 42.49  ? 124 ARG F NH1   1 
ATOM   3639 N  NH2   . ARG D 1 125 ? 62.987  -34.221 35.851  1.00 50.37  ? 124 ARG F NH2   1 
ATOM   3640 N  N     . LEU D 1 126 ? 61.412  -27.847 31.768  1.00 35.81  ? 125 LEU F N     1 
ATOM   3641 C  CA    . LEU D 1 126 ? 60.845  -27.597 30.446  1.00 36.34  ? 125 LEU F CA    1 
ATOM   3642 C  C     . LEU D 1 126 ? 60.624  -28.948 29.772  1.00 36.44  ? 125 LEU F C     1 
ATOM   3643 O  O     . LEU D 1 126 ? 61.550  -29.525 29.195  1.00 39.60  ? 125 LEU F O     1 
ATOM   3644 C  CB    . LEU D 1 126 ? 61.759  -26.685 29.635  1.00 35.91  ? 125 LEU F CB    1 
ATOM   3645 C  CG    . LEU D 1 126 ? 62.103  -25.372 30.345  1.00 39.37  ? 125 LEU F CG    1 
ATOM   3646 C  CD1   . LEU D 1 126 ? 63.139  -24.573 29.566  1.00 34.72  ? 125 LEU F CD1   1 
ATOM   3647 C  CD2   . LEU D 1 126 ? 60.847  -24.543 30.582  1.00 37.94  ? 125 LEU F CD2   1 
ATOM   3648 N  N     . ARG D 1 127 ? 59.392  -29.448 29.852  1.00 37.43  ? 126 ARG F N     1 
ATOM   3649 C  CA    . ARG D 1 127 ? 59.052  -30.789 29.401  1.00 37.18  ? 126 ARG F CA    1 
ATOM   3650 C  C     . ARG D 1 127 ? 57.787  -30.756 28.557  1.00 38.19  ? 126 ARG F C     1 
ATOM   3651 O  O     . ARG D 1 127 ? 56.859  -29.995 28.844  1.00 33.39  ? 126 ARG F O     1 
ATOM   3652 C  CB    . ARG D 1 127 ? 58.850  -31.733 30.594  1.00 33.37  ? 126 ARG F CB    1 
ATOM   3653 C  CG    . ARG D 1 127 ? 60.089  -31.923 31.456  1.00 34.77  ? 126 ARG F CG    1 
ATOM   3654 C  CD    . ARG D 1 127 ? 59.812  -32.849 32.633  1.00 27.54  ? 126 ARG F CD    1 
ATOM   3655 N  NE    . ARG D 1 127 ? 58.949  -32.227 33.634  1.00 31.39  ? 126 ARG F NE    1 
ATOM   3656 C  CZ    . ARG D 1 127 ? 58.567  -32.819 34.762  1.00 35.43  ? 126 ARG F CZ    1 
ATOM   3657 N  NH1   . ARG D 1 127 ? 58.968  -34.053 35.035  1.00 34.59  ? 126 ARG F NH1   1 
ATOM   3658 N  NH2   . ARG D 1 127 ? 57.781  -32.178 35.617  1.00 32.90  ? 126 ARG F NH2   1 
ATOM   3659 N  N     . ILE D 1 128 ? 57.756  -31.590 27.518  1.00 33.86  ? 127 ILE F N     1 
ATOM   3660 C  CA    . ILE D 1 128 ? 56.584  -31.770 26.668  1.00 30.25  ? 127 ILE F CA    1 
ATOM   3661 C  C     . ILE D 1 128 ? 56.276  -33.259 26.602  1.00 33.78  ? 127 ILE F C     1 
ATOM   3662 O  O     . ILE D 1 128 ? 57.143  -34.059 26.234  1.00 32.43  ? 127 ILE F O     1 
ATOM   3663 C  CB    . ILE D 1 128 ? 56.802  -31.205 25.251  1.00 30.17  ? 127 ILE F CB    1 
ATOM   3664 C  CG1   . ILE D 1 128 ? 57.276  -29.753 25.315  1.00 36.17  ? 127 ILE F CG1   1 
ATOM   3665 C  CG2   . ILE D 1 128 ? 55.524  -31.311 24.433  1.00 31.31  ? 127 ILE F CG2   1 
ATOM   3666 C  CD1   . ILE D 1 128 ? 57.680  -29.183 23.973  1.00 33.48  ? 127 ILE F CD1   1 
ATOM   3667 N  N     . TRP D 1 129 ? 55.046  -33.630 26.951  1.00 25.48  ? 128 TRP F N     1 
ATOM   3668 C  CA    . TRP D 1 129 ? 54.627  -35.024 27.004  1.00 32.78  ? 128 TRP F CA    1 
ATOM   3669 C  C     . TRP D 1 129 ? 53.714  -35.349 25.830  1.00 34.02  ? 128 TRP F C     1 
ATOM   3670 O  O     . TRP D 1 129 ? 52.827  -34.560 25.486  1.00 32.96  ? 128 TRP F O     1 
ATOM   3671 C  CB    . TRP D 1 129 ? 53.899  -35.329 28.317  1.00 30.34  ? 128 TRP F CB    1 
ATOM   3672 C  CG    . TRP D 1 129 ? 54.793  -35.345 29.518  1.00 32.60  ? 128 TRP F CG    1 
ATOM   3673 C  CD1   . TRP D 1 129 ? 55.577  -36.378 29.940  1.00 34.20  ? 128 TRP F CD1   1 
ATOM   3674 C  CD2   . TRP D 1 129 ? 54.988  -34.282 30.460  1.00 32.44  ? 128 TRP F CD2   1 
ATOM   3675 N  NE1   . TRP D 1 129 ? 56.252  -36.024 31.083  1.00 34.29  ? 128 TRP F NE1   1 
ATOM   3676 C  CE2   . TRP D 1 129 ? 55.907  -34.743 31.423  1.00 39.87  ? 128 TRP F CE2   1 
ATOM   3677 C  CE3   . TRP D 1 129 ? 54.475  -32.987 30.581  1.00 36.73  ? 128 TRP F CE3   1 
ATOM   3678 C  CZ2   . TRP D 1 129 ? 56.327  -33.953 32.493  1.00 29.81  ? 128 TRP F CZ2   1 
ATOM   3679 C  CZ3   . TRP D 1 129 ? 54.893  -32.204 31.645  1.00 33.12  ? 128 TRP F CZ3   1 
ATOM   3680 C  CH2   . TRP D 1 129 ? 55.810  -32.690 32.586  1.00 31.18  ? 128 TRP F CH2   1 
ATOM   3681 N  N     . ASN D 1 130 ? 53.927  -36.519 25.227  1.00 28.01  ? 129 ASN F N     1 
ATOM   3682 C  CA    . ASN D 1 130 ? 53.068  -36.999 24.150  1.00 33.08  ? 129 ASN F CA    1 
ATOM   3683 C  C     . ASN D 1 130 ? 53.426  -38.441 23.821  1.00 35.24  ? 129 ASN F C     1 
ATOM   3684 O  O     . ASN D 1 130 ? 54.580  -38.856 23.966  1.00 34.60  ? 129 ASN F O     1 
ATOM   3685 C  CB    . ASN D 1 130 ? 53.195  -36.129 22.894  1.00 31.37  ? 129 ASN F CB    1 
ATOM   3686 C  CG    . ASN D 1 130 ? 51.921  -36.101 22.080  1.00 33.54  ? 129 ASN F CG    1 
ATOM   3687 O  OD1   . ASN D 1 130 ? 51.737  -36.901 21.165  1.00 36.77  ? 129 ASN F OD1   1 
ATOM   3688 N  ND2   . ASN D 1 130 ? 51.026  -35.179 22.417  1.00 31.78  ? 129 ASN F ND2   1 
ATOM   3689 N  N     . LYS D 1 131 ? 52.420  -39.196 23.369  1.00 36.48  ? 130 LYS F N     1 
ATOM   3690 C  CA    . LYS D 1 131 ? 52.641  -40.556 22.890  1.00 33.54  ? 130 LYS F CA    1 
ATOM   3691 C  C     . LYS D 1 131 ? 53.176  -40.595 21.465  1.00 34.09  ? 130 LYS F C     1 
ATOM   3692 O  O     . LYS D 1 131 ? 53.735  -41.619 21.055  1.00 42.13  ? 130 LYS F O     1 
ATOM   3693 C  CB    . LYS D 1 131 ? 51.343  -41.365 22.959  1.00 36.00  ? 130 LYS F CB    1 
ATOM   3694 C  CG    . LYS D 1 131 ? 50.943  -41.812 24.357  1.00 39.97  ? 130 LYS F CG    1 
ATOM   3695 C  CD    . LYS D 1 131 ? 49.605  -42.540 24.341  1.00 42.18  ? 130 LYS F CD    1 
ATOM   3696 C  CE    . LYS D 1 131 ? 49.680  -43.834 23.546  1.00 41.78  ? 130 LYS F CE    1 
ATOM   3697 N  NZ    . LYS D 1 131 ? 50.078  -44.987 24.398  1.00 52.16  ? 130 LYS F NZ    1 
ATOM   3698 N  N     . ASN D 1 132 ? 53.014  -39.515 20.704  1.00 34.56  ? 131 ASN F N     1 
ATOM   3699 C  CA    . ASN D 1 132 ? 53.459  -39.461 19.311  1.00 35.83  ? 131 ASN F CA    1 
ATOM   3700 C  C     . ASN D 1 132 ? 54.942  -39.114 19.300  1.00 39.86  ? 131 ASN F C     1 
ATOM   3701 O  O     . ASN D 1 132 ? 55.333  -37.946 19.301  1.00 36.56  ? 131 ASN F O     1 
ATOM   3702 C  CB    . ASN D 1 132 ? 52.635  -38.446 18.526  1.00 37.51  ? 131 ASN F CB    1 
ATOM   3703 C  CG    . ASN D 1 132 ? 52.860  -38.536 17.025  1.00 39.75  ? 131 ASN F CG    1 
ATOM   3704 O  OD1   . ASN D 1 132 ? 53.902  -39.000 16.562  1.00 42.14  ? 131 ASN F OD1   1 
ATOM   3705 N  ND2   . ASN D 1 132 ? 51.876  -38.084 16.257  1.00 34.32  ? 131 ASN F ND2   1 
ATOM   3706 N  N     . LYS D 1 133 ? 55.783  -40.152 19.286  1.00 39.74  ? 132 LYS F N     1 
ATOM   3707 C  CA    . LYS D 1 133 ? 57.227  -39.934 19.291  1.00 42.88  ? 132 LYS F CA    1 
ATOM   3708 C  C     . LYS D 1 133 ? 57.691  -39.253 18.009  1.00 42.12  ? 132 LYS F C     1 
ATOM   3709 O  O     . LYS D 1 133 ? 58.612  -38.428 18.038  1.00 41.71  ? 132 LYS F O     1 
ATOM   3710 C  CB    . LYS D 1 133 ? 57.960  -41.261 19.486  1.00 48.04  ? 132 LYS F CB    1 
ATOM   3711 C  CG    . LYS D 1 133 ? 59.465  -41.112 19.657  1.00 48.99  ? 132 LYS F CG    1 
ATOM   3712 C  CD    . LYS D 1 133 ? 60.168  -42.459 19.643  1.00 56.13  ? 132 LYS F CD    1 
ATOM   3713 C  CE    . LYS D 1 133 ? 61.667  -42.294 19.844  1.00 61.21  ? 132 LYS F CE    1 
ATOM   3714 N  NZ    . LYS D 1 133 ? 62.416  -43.539 19.519  1.00 58.23  ? 132 LYS F NZ    1 
ATOM   3715 N  N     . ALA D 1 134 ? 57.069  -39.587 16.876  1.00 38.98  ? 133 ALA F N     1 
ATOM   3716 C  CA    . ALA D 1 134 ? 57.443  -38.957 15.614  1.00 43.80  ? 133 ALA F CA    1 
ATOM   3717 C  C     . ALA D 1 134 ? 57.206  -37.453 15.658  1.00 38.37  ? 133 ALA F C     1 
ATOM   3718 O  O     . ALA D 1 134 ? 58.011  -36.673 15.134  1.00 39.50  ? 133 ALA F O     1 
ATOM   3719 C  CB    . ALA D 1 134 ? 56.668  -39.590 14.459  1.00 37.32  ? 133 ALA F CB    1 
ATOM   3720 N  N     . LEU D 1 135 ? 56.107  -37.026 16.284  1.00 39.19  ? 134 LEU F N     1 
ATOM   3721 C  CA    . LEU D 1 135 ? 55.842  -35.598 16.423  1.00 39.35  ? 134 LEU F CA    1 
ATOM   3722 C  C     . LEU D 1 135 ? 56.879  -34.926 17.315  1.00 33.48  ? 134 LEU F C     1 
ATOM   3723 O  O     . LEU D 1 135 ? 57.369  -33.838 16.993  1.00 34.46  ? 134 LEU F O     1 
ATOM   3724 C  CB    . LEU D 1 135 ? 54.437  -35.377 16.978  1.00 37.99  ? 134 LEU F CB    1 
ATOM   3725 C  CG    . LEU D 1 135 ? 54.070  -33.921 17.265  1.00 40.72  ? 134 LEU F CG    1 
ATOM   3726 C  CD1   . LEU D 1 135 ? 54.110  -33.092 15.991  1.00 37.30  ? 134 LEU F CD1   1 
ATOM   3727 C  CD2   . LEU D 1 135 ? 52.708  -33.837 17.926  1.00 39.61  ? 134 LEU F CD2   1 
ATOM   3728 N  N     . LEU D 1 136 ? 57.220  -35.556 18.442  1.00 30.14  ? 135 LEU F N     1 
ATOM   3729 C  CA    . LEU D 1 136 ? 58.237  -34.990 19.322  1.00 37.63  ? 135 LEU F CA    1 
ATOM   3730 C  C     . LEU D 1 136 ? 59.595  -34.946 18.633  1.00 33.58  ? 135 LEU F C     1 
ATOM   3731 O  O     . LEU D 1 136 ? 60.368  -34.000 18.828  1.00 34.42  ? 135 LEU F O     1 
ATOM   3732 C  CB    . LEU D 1 136 ? 58.318  -35.794 20.620  1.00 30.32  ? 135 LEU F CB    1 
ATOM   3733 C  CG    . LEU D 1 136 ? 57.118  -35.685 21.563  1.00 36.87  ? 135 LEU F CG    1 
ATOM   3734 C  CD1   . LEU D 1 136 ? 57.339  -36.523 22.812  1.00 30.37  ? 135 LEU F CD1   1 
ATOM   3735 C  CD2   . LEU D 1 136 ? 56.855  -34.232 21.929  1.00 29.23  ? 135 LEU F CD2   1 
ATOM   3736 N  N     . GLU D 1 137 ? 59.901  -35.961 17.821  1.00 33.71  ? 136 GLU F N     1 
ATOM   3737 C  CA    . GLU D 1 137 ? 61.166  -35.970 17.095  1.00 37.21  ? 136 GLU F CA    1 
ATOM   3738 C  C     . GLU D 1 137 ? 61.246  -34.827 16.092  1.00 38.74  ? 136 GLU F C     1 
ATOM   3739 O  O     . GLU D 1 137 ? 62.329  -34.272 15.875  1.00 39.99  ? 136 GLU F O     1 
ATOM   3740 C  CB    . GLU D 1 137 ? 61.359  -37.316 16.395  1.00 36.23  ? 136 GLU F CB    1 
ATOM   3741 C  CG    . GLU D 1 137 ? 61.998  -38.377 17.277  1.00 51.31  ? 136 GLU F CG    1 
ATOM   3742 C  CD    . GLU D 1 137 ? 61.860  -39.775 16.708  1.00 66.76  ? 136 GLU F CD    1 
ATOM   3743 O  OE1   . GLU D 1 137 ? 60.979  -39.985 15.847  1.00 59.43  ? 136 GLU F OE1   1 
ATOM   3744 O  OE2   . GLU D 1 137 ? 62.636  -40.663 17.120  1.00 73.07  ? 136 GLU F OE2   1 
ATOM   3745 N  N     . ILE D 1 138 ? 60.119  -34.459 15.479  1.00 35.88  ? 137 ILE F N     1 
ATOM   3746 C  CA    . ILE D 1 138 ? 60.098  -33.294 14.598  1.00 32.44  ? 137 ILE F CA    1 
ATOM   3747 C  C     . ILE D 1 138 ? 60.383  -32.028 15.396  1.00 36.43  ? 137 ILE F C     1 
ATOM   3748 O  O     . ILE D 1 138 ? 61.200  -31.189 14.997  1.00 37.85  ? 137 ILE F O     1 
ATOM   3749 C  CB    . ILE D 1 138 ? 58.751  -33.201 13.859  1.00 39.95  ? 137 ILE F CB    1 
ATOM   3750 C  CG1   . ILE D 1 138 ? 58.573  -34.389 12.912  1.00 40.26  ? 137 ILE F CG1   1 
ATOM   3751 C  CG2   . ILE D 1 138 ? 58.651  -31.887 13.098  1.00 34.88  ? 137 ILE F CG2   1 
ATOM   3752 C  CD1   . ILE D 1 138 ? 57.214  -34.439 12.247  1.00 45.88  ? 137 ILE F CD1   1 
ATOM   3753 N  N     . VAL D 1 139 ? 59.714  -31.878 16.542  1.00 32.67  ? 138 VAL F N     1 
ATOM   3754 C  CA    . VAL D 1 139 ? 59.936  -30.712 17.394  1.00 33.75  ? 138 VAL F CA    1 
ATOM   3755 C  C     . VAL D 1 139 ? 61.381  -30.671 17.877  1.00 34.56  ? 138 VAL F C     1 
ATOM   3756 O  O     . VAL D 1 139 ? 61.988  -29.598 17.978  1.00 32.59  ? 138 VAL F O     1 
ATOM   3757 C  CB    . VAL D 1 139 ? 58.943  -30.719 18.572  1.00 31.04  ? 138 VAL F CB    1 
ATOM   3758 C  CG1   . VAL D 1 139 ? 59.249  -29.588 19.544  1.00 28.75  ? 138 VAL F CG1   1 
ATOM   3759 C  CG2   . VAL D 1 139 ? 57.512  -30.619 18.060  1.00 31.34  ? 138 VAL F CG2   1 
ATOM   3760 N  N     . SER D 1 140 ? 61.957  -31.841 18.169  1.00 29.95  ? 139 SER F N     1 
ATOM   3761 C  CA    . SER D 1 140 ? 63.334  -31.893 18.649  1.00 39.33  ? 139 SER F CA    1 
ATOM   3762 C  C     . SER D 1 140 ? 64.307  -31.333 17.618  1.00 35.33  ? 139 SER F C     1 
ATOM   3763 O  O     . SER D 1 140 ? 65.263  -30.633 17.971  1.00 35.88  ? 139 SER F O     1 
ATOM   3764 C  CB    . SER D 1 140 ? 63.708  -33.332 19.007  1.00 36.14  ? 139 SER F CB    1 
ATOM   3765 O  OG    . SER D 1 140 ? 65.074  -33.424 19.374  1.00 40.85  ? 139 SER F OG    1 
ATOM   3766 N  N     . ARG D 1 141 ? 64.078  -31.629 16.337  1.00 38.50  ? 140 ARG F N     1 
ATOM   3767 C  CA    . ARG D 1 141 ? 64.983  -31.148 15.299  1.00 39.92  ? 140 ARG F CA    1 
ATOM   3768 C  C     . ARG D 1 141 ? 64.836  -29.647 15.087  1.00 41.92  ? 140 ARG F C     1 
ATOM   3769 O  O     . ARG D 1 141 ? 65.835  -28.943 14.897  1.00 43.77  ? 140 ARG F O     1 
ATOM   3770 C  CB    . ARG D 1 141 ? 64.736  -31.911 13.999  1.00 39.74  ? 140 ARG F CB    1 
ATOM   3771 C  CG    . ARG D 1 141 ? 64.930  -33.409 14.144  1.00 44.78  ? 140 ARG F CG    1 
ATOM   3772 C  CD    . ARG D 1 141 ? 64.848  -34.126 12.812  1.00 51.84  ? 140 ARG F CD    1 
ATOM   3773 N  NE    . ARG D 1 141 ? 65.553  -35.404 12.857  1.00 71.57  ? 140 ARG F NE    1 
ATOM   3774 C  CZ    . ARG D 1 141 ? 66.831  -35.561 12.530  1.00 69.74  ? 140 ARG F CZ    1 
ATOM   3775 N  NH1   . ARG D 1 141 ? 67.547  -34.520 12.128  1.00 58.19  ? 140 ARG F NH1   1 
ATOM   3776 N  NH2   . ARG D 1 141 ? 67.395  -36.759 12.603  1.00 63.25  ? 140 ARG F NH2   1 
ATOM   3777 N  N     . TRP D 1 142 ? 63.601  -29.140 15.115  1.00 34.44  ? 141 TRP F N     1 
ATOM   3778 C  CA    . TRP D 1 142 ? 63.397  -27.696 15.057  1.00 36.29  ? 141 TRP F CA    1 
ATOM   3779 C  C     . TRP D 1 142 ? 64.070  -27.004 16.233  1.00 36.53  ? 141 TRP F C     1 
ATOM   3780 O  O     . TRP D 1 142 ? 64.704  -25.955 16.067  1.00 39.90  ? 141 TRP F O     1 
ATOM   3781 C  CB    . TRP D 1 142 ? 61.904  -27.372 15.041  1.00 36.57  ? 141 TRP F CB    1 
ATOM   3782 C  CG    . TRP D 1 142 ? 61.183  -27.835 13.819  1.00 39.98  ? 141 TRP F CG    1 
ATOM   3783 C  CD1   . TRP D 1 142 ? 61.736  -28.301 12.662  1.00 46.54  ? 141 TRP F CD1   1 
ATOM   3784 C  CD2   . TRP D 1 142 ? 59.765  -27.874 13.632  1.00 47.39  ? 141 TRP F CD2   1 
ATOM   3785 N  NE1   . TRP D 1 142 ? 60.747  -28.628 11.764  1.00 45.68  ? 141 TRP F NE1   1 
ATOM   3786 C  CE2   . TRP D 1 142 ? 59.528  -28.375 12.337  1.00 47.55  ? 141 TRP F CE2   1 
ATOM   3787 C  CE3   . TRP D 1 142 ? 58.672  -27.533 14.434  1.00 42.12  ? 141 TRP F CE3   1 
ATOM   3788 C  CZ2   . TRP D 1 142 ? 58.244  -28.544 11.827  1.00 44.37  ? 141 TRP F CZ2   1 
ATOM   3789 C  CZ3   . TRP D 1 142 ? 57.398  -27.702 13.926  1.00 39.47  ? 141 TRP F CZ3   1 
ATOM   3790 C  CH2   . TRP D 1 142 ? 57.195  -28.202 12.635  1.00 38.09  ? 141 TRP F CH2   1 
ATOM   3791 N  N     . LEU D 1 143 ? 63.936  -27.575 17.433  1.00 39.48  ? 142 LEU F N     1 
ATOM   3792 C  CA    . LEU D 1 143 ? 64.598  -27.006 18.601  1.00 38.73  ? 142 LEU F CA    1 
ATOM   3793 C  C     . LEU D 1 143 ? 66.113  -27.030 18.437  1.00 41.68  ? 142 LEU F C     1 
ATOM   3794 O  O     . LEU D 1 143 ? 66.796  -26.057 18.775  1.00 43.66  ? 142 LEU F O     1 
ATOM   3795 C  CB    . LEU D 1 143 ? 64.178  -27.763 19.862  1.00 35.40  ? 142 LEU F CB    1 
ATOM   3796 C  CG    . LEU D 1 143 ? 62.737  -27.554 20.340  1.00 43.81  ? 142 LEU F CG    1 
ATOM   3797 C  CD1   . LEU D 1 143 ? 62.475  -28.318 21.630  1.00 38.84  ? 142 LEU F CD1   1 
ATOM   3798 C  CD2   . LEU D 1 143 ? 62.436  -26.076 20.521  1.00 34.22  ? 142 LEU F CD2   1 
ATOM   3799 N  N     . ASN D 1 144 ? 66.656  -28.129 17.909  1.00 40.08  ? 143 ASN F N     1 
ATOM   3800 C  CA    . ASN D 1 144 ? 68.093  -28.193 17.665  1.00 47.29  ? 143 ASN F CA    1 
ATOM   3801 C  C     . ASN D 1 144 ? 68.532  -27.122 16.674  1.00 46.86  ? 143 ASN F C     1 
ATOM   3802 O  O     . ASN D 1 144 ? 69.588  -26.503 16.847  1.00 47.68  ? 143 ASN F O     1 
ATOM   3803 C  CB    . ASN D 1 144 ? 68.482  -29.584 17.163  1.00 48.21  ? 143 ASN F CB    1 
ATOM   3804 C  CG    . ASN D 1 144 ? 68.747  -30.557 18.295  1.00 47.83  ? 143 ASN F CG    1 
ATOM   3805 O  OD1   . ASN D 1 144 ? 69.401  -30.216 19.280  1.00 45.53  ? 143 ASN F OD1   1 
ATOM   3806 N  ND2   . ASN D 1 144 ? 68.239  -31.777 18.159  1.00 47.38  ? 143 ASN F ND2   1 
ATOM   3807 N  N     . ASN D 1 145 ? 67.729  -26.883 15.634  1.00 49.69  ? 144 ASN F N     1 
ATOM   3808 C  CA    . ASN D 1 145 ? 68.060  -25.837 14.673  1.00 48.04  ? 144 ASN F CA    1 
ATOM   3809 C  C     . ASN D 1 145 ? 68.010  -24.454 15.309  1.00 52.42  ? 144 ASN F C     1 
ATOM   3810 O  O     . ASN D 1 145 ? 68.713  -23.541 14.862  1.00 55.72  ? 144 ASN F O     1 
ATOM   3811 C  CB    . ASN D 1 145 ? 67.115  -25.904 13.474  1.00 51.95  ? 144 ASN F CB    1 
ATOM   3812 C  CG    . ASN D 1 145 ? 67.365  -24.793 12.475  1.00 63.53  ? 144 ASN F CG    1 
ATOM   3813 O  OD1   . ASN D 1 145 ? 68.424  -24.732 11.853  1.00 61.60  ? 144 ASN F OD1   1 
ATOM   3814 N  ND2   . ASN D 1 145 ? 66.388  -23.908 12.313  1.00 53.69  ? 144 ASN F ND2   1 
ATOM   3815 N  N     . LEU D 1 146 ? 67.195  -24.281 16.345  1.00 46.58  ? 145 LEU F N     1 
ATOM   3816 C  CA    . LEU D 1 146 ? 67.083  -23.011 17.047  1.00 44.90  ? 145 LEU F CA    1 
ATOM   3817 C  C     . LEU D 1 146 ? 68.087  -22.870 18.183  1.00 52.01  ? 145 LEU F C     1 
ATOM   3818 O  O     . LEU D 1 146 ? 68.104  -21.829 18.848  1.00 52.25  ? 145 LEU F O     1 
ATOM   3819 C  CB    . LEU D 1 146 ? 65.661  -22.835 17.586  1.00 51.16  ? 145 LEU F CB    1 
ATOM   3820 C  CG    . LEU D 1 146 ? 64.589  -22.617 16.517  1.00 56.35  ? 145 LEU F CG    1 
ATOM   3821 C  CD1   . LEU D 1 146 ? 63.200  -22.875 17.077  1.00 47.75  ? 145 LEU F CD1   1 
ATOM   3822 C  CD2   . LEU D 1 146 ? 64.690  -21.207 15.962  1.00 53.63  ? 145 LEU F CD2   1 
ATOM   3823 N  N     . GLY D 1 147 ? 68.917  -23.880 18.422  1.00 48.32  ? 146 GLY F N     1 
ATOM   3824 C  CA    . GLY D 1 147 ? 69.932  -23.794 19.451  1.00 47.76  ? 146 GLY F CA    1 
ATOM   3825 C  C     . GLY D 1 147 ? 69.489  -24.182 20.841  1.00 48.88  ? 146 GLY F C     1 
ATOM   3826 O  O     . GLY D 1 147 ? 70.193  -23.865 21.807  1.00 46.22  ? 146 GLY F O     1 
ATOM   3827 N  N     . VAL D 1 148 ? 68.352  -24.855 20.982  1.00 43.10  ? 147 VAL F N     1 
ATOM   3828 C  CA    . VAL D 1 148 ? 67.867  -25.327 22.274  1.00 43.18  ? 147 VAL F CA    1 
ATOM   3829 C  C     . VAL D 1 148 ? 68.022  -26.841 22.297  1.00 42.48  ? 147 VAL F C     1 
ATOM   3830 O  O     . VAL D 1 148 ? 67.298  -27.564 21.601  1.00 39.27  ? 147 VAL F O     1 
ATOM   3831 C  CB    . VAL D 1 148 ? 66.414  -24.907 22.536  1.00 39.27  ? 147 VAL F CB    1 
ATOM   3832 C  CG1   . VAL D 1 148 ? 66.364  -23.488 23.066  1.00 44.35  ? 147 VAL F CG1   1 
ATOM   3833 C  CG2   . VAL D 1 148 ? 65.589  -25.009 21.268  1.00 49.96  ? 147 VAL F CG2   1 
ATOM   3834 N  N     . ARG D 1 149 ? 68.961  -27.326 23.102  1.00 39.30  ? 148 ARG F N     1 
ATOM   3835 C  CA    . ARG D 1 149 ? 69.226  -28.754 23.168  1.00 36.18  ? 148 ARG F CA    1 
ATOM   3836 C  C     . ARG D 1 149 ? 68.183  -29.459 24.023  1.00 38.86  ? 148 ARG F C     1 
ATOM   3837 O  O     . ARG D 1 149 ? 67.583  -28.874 24.929  1.00 33.48  ? 148 ARG F O     1 
ATOM   3838 C  CB    . ARG D 1 149 ? 70.634  -29.005 23.703  1.00 41.40  ? 148 ARG F CB    1 
ATOM   3839 C  CG    . ARG D 1 149 ? 71.651  -28.346 22.804  1.00 48.36  ? 148 ARG F CG    1 
ATOM   3840 C  CD    . ARG D 1 149 ? 73.037  -28.128 23.396  1.00 57.75  ? 148 ARG F CD    1 
ATOM   3841 N  NE    . ARG D 1 149 ? 73.084  -26.789 23.987  1.00 60.68  ? 148 ARG F NE    1 
ATOM   3842 C  CZ    . ARG D 1 149 ? 74.012  -26.359 24.836  1.00 63.00  ? 148 ARG F CZ    1 
ATOM   3843 N  NH1   . ARG D 1 149 ? 75.040  -27.131 25.160  1.00 69.79  ? 148 ARG F NH1   1 
ATOM   3844 N  NH2   . ARG D 1 149 ? 73.938  -25.127 25.318  1.00 54.12  ? 148 ARG F NH2   1 
ATOM   3845 N  N     . ASN D 1 150 ? 67.987  -30.739 23.729  1.00 30.11  ? 149 ASN F N     1 
ATOM   3846 C  CA    . ASN D 1 150 ? 66.852  -31.470 24.260  1.00 36.77  ? 149 ASN F CA    1 
ATOM   3847 C  C     . ASN D 1 150 ? 67.091  -32.956 24.063  1.00 37.69  ? 149 ASN F C     1 
ATOM   3848 O  O     . ASN D 1 150 ? 67.902  -33.371 23.231  1.00 38.94  ? 149 ASN F O     1 
ATOM   3849 C  CB    . ASN D 1 150 ? 65.554  -31.040 23.573  1.00 33.15  ? 149 ASN F CB    1 
ATOM   3850 C  CG    . ASN D 1 150 ? 65.552  -31.367 22.094  1.00 34.72  ? 149 ASN F CG    1 
ATOM   3851 O  OD1   . ASN D 1 150 ? 65.055  -32.413 21.683  1.00 36.57  ? 149 ASN F OD1   1 
ATOM   3852 N  ND2   . ASN D 1 150 ? 66.118  -30.477 21.286  1.00 35.70  ? 149 ASN F ND2   1 
ATOM   3853 N  N     . THR D 1 151 ? 66.370  -33.751 24.846  1.00 36.22  ? 150 THR F N     1 
ATOM   3854 C  CA    . THR D 1 151 ? 66.380  -35.197 24.724  1.00 41.33  ? 150 THR F CA    1 
ATOM   3855 C  C     . THR D 1 151 ? 64.949  -35.713 24.751  1.00 37.32  ? 150 THR F C     1 
ATOM   3856 O  O     . THR D 1 151 ? 64.040  -35.064 25.276  1.00 38.56  ? 150 THR F O     1 
ATOM   3857 C  CB    . THR D 1 151 ? 67.191  -35.866 25.845  1.00 42.58  ? 150 THR F CB    1 
ATOM   3858 O  OG1   . THR D 1 151 ? 66.612  -35.540 27.115  1.00 46.95  ? 150 THR F OG1   1 
ATOM   3859 C  CG2   . THR D 1 151 ? 68.644  -35.412 25.812  1.00 36.52  ? 150 THR F CG2   1 
ATOM   3860 N  N     . ILE D 1 152 ? 64.763  -36.895 24.174  1.00 34.76  ? 151 ILE F N     1 
ATOM   3861 C  CA    . ILE D 1 152 ? 63.487  -37.597 24.193  1.00 36.00  ? 151 ILE F CA    1 
ATOM   3862 C  C     . ILE D 1 152 ? 63.705  -38.963 24.827  1.00 38.61  ? 151 ILE F C     1 
ATOM   3863 O  O     . ILE D 1 152 ? 64.563  -39.731 24.375  1.00 40.20  ? 151 ILE F O     1 
ATOM   3864 C  CB    . ILE D 1 152 ? 62.891  -37.748 22.781  1.00 35.00  ? 151 ILE F CB    1 
ATOM   3865 C  CG1   . ILE D 1 152 ? 62.525  -36.383 22.197  1.00 36.11  ? 151 ILE F CG1   1 
ATOM   3866 C  CG2   . ILE D 1 152 ? 61.676  -38.663 22.812  1.00 36.51  ? 151 ILE F CG2   1 
ATOM   3867 C  CD1   . ILE D 1 152 ? 62.065  -36.448 20.755  1.00 34.65  ? 151 ILE F CD1   1 
ATOM   3868 N  N     . HIS D 1 153 ? 62.940  -39.261 25.874  1.00 31.36  ? 152 HIS F N     1 
ATOM   3869 C  CA    A HIS D 1 153 ? 62.950  -40.602 26.431  0.48 39.97  ? 152 HIS F CA    1 
ATOM   3870 C  CA    B HIS D 1 153 ? 62.965  -40.547 26.560  0.52 40.04  ? 152 HIS F CA    1 
ATOM   3871 C  C     . HIS D 1 153 ? 61.533  -40.989 26.821  1.00 37.91  ? 152 HIS F C     1 
ATOM   3872 O  O     . HIS D 1 153 ? 60.611  -40.171 26.834  1.00 39.56  ? 152 HIS F O     1 
ATOM   3873 C  CB    A HIS D 1 153 ? 63.923  -40.722 27.615  0.48 39.17  ? 152 HIS F CB    1 
ATOM   3874 C  CB    B HIS D 1 153 ? 63.711  -40.479 27.902  0.52 39.06  ? 152 HIS F CB    1 
ATOM   3875 C  CG    A HIS D 1 153 ? 63.424  -40.110 28.886  0.48 37.28  ? 152 HIS F CG    1 
ATOM   3876 C  CG    B HIS D 1 153 ? 65.128  -40.010 27.797  0.52 39.87  ? 152 HIS F CG    1 
ATOM   3877 N  ND1   A HIS D 1 153 ? 62.716  -40.825 29.828  0.48 42.37  ? 152 HIS F ND1   1 
ATOM   3878 N  ND1   B HIS D 1 153 ? 66.198  -40.878 27.756  0.52 40.10  ? 152 HIS F ND1   1 
ATOM   3879 C  CD2   A HIS D 1 153 ? 63.551  -38.857 29.382  0.48 37.89  ? 152 HIS F CD2   1 
ATOM   3880 C  CD2   B HIS D 1 153 ? 65.653  -38.763 27.748  0.52 39.79  ? 152 HIS F CD2   1 
ATOM   3881 C  CE1   A HIS D 1 153 ? 62.419  -40.036 30.845  0.48 42.31  ? 152 HIS F CE1   1 
ATOM   3882 C  CE1   B HIS D 1 153 ? 67.320  -40.186 27.674  0.52 39.11  ? 152 HIS F CE1   1 
ATOM   3883 N  NE2   A HIS D 1 153 ? 62.914  -38.836 30.599  0.48 41.76  ? 152 HIS F NE2   1 
ATOM   3884 N  NE2   B HIS D 1 153 ? 67.017  -38.900 27.668  0.52 38.15  ? 152 HIS F NE2   1 
ATOM   3885 N  N     . LEU D 1 154 ? 61.355  -42.279 27.081  1.00 41.06  ? 153 LEU F N     1 
ATOM   3886 C  CA    . LEU D 1 154 ? 60.046  -42.810 27.442  1.00 37.91  ? 153 LEU F CA    1 
ATOM   3887 C  C     . LEU D 1 154 ? 59.789  -42.488 28.909  1.00 42.37  ? 153 LEU F C     1 
ATOM   3888 O  O     . LEU D 1 154 ? 60.389  -43.095 29.802  1.00 48.90  ? 153 LEU F O     1 
ATOM   3889 C  CB    . LEU D 1 154 ? 59.984  -44.311 27.175  1.00 42.70  ? 153 LEU F CB    1 
ATOM   3890 C  CG    . LEU D 1 154 ? 58.717  -45.036 27.651  1.00 50.06  ? 153 LEU F CG    1 
ATOM   3891 C  CD1   . LEU D 1 154 ? 57.496  -44.452 26.978  1.00 47.73  ? 153 LEU F CD1   1 
ATOM   3892 C  CD2   . LEU D 1 154 ? 58.820  -46.521 27.372  1.00 46.55  ? 153 LEU F CD2   1 
ATOM   3893 N  N     . ASP D 1 155 ? 58.904  -41.522 29.157  1.00 38.89  ? 154 ASP F N     1 
ATOM   3894 C  CA    . ASP D 1 155 ? 58.687  -41.043 30.517  1.00 37.73  ? 154 ASP F CA    1 
ATOM   3895 C  C     . ASP D 1 155 ? 57.700  -41.919 31.274  1.00 46.89  ? 154 ASP F C     1 
ATOM   3896 O  O     . ASP D 1 155 ? 57.906  -42.209 32.458  1.00 49.11  ? 154 ASP F O     1 
ATOM   3897 C  CB    . ASP D 1 155 ? 58.194  -39.597 30.489  1.00 35.54  ? 154 ASP F CB    1 
ATOM   3898 C  CG    . ASP D 1 155 ? 58.326  -38.911 31.835  1.00 44.44  ? 154 ASP F CG    1 
ATOM   3899 O  OD1   . ASP D 1 155 ? 59.380  -39.077 32.485  1.00 40.74  ? 154 ASP F OD1   1 
ATOM   3900 O  OD2   . ASP D 1 155 ? 57.380  -38.205 32.241  1.00 40.21  ? 154 ASP F OD2   1 
ATOM   3901 N  N     . ASP D 1 156 ? 56.625  -42.343 30.618  1.00 41.42  ? 155 ASP F N     1 
ATOM   3902 C  CA    . ASP D 1 156 ? 55.571  -43.133 31.247  1.00 39.51  ? 155 ASP F CA    1 
ATOM   3903 C  C     . ASP D 1 156 ? 55.582  -44.521 30.613  1.00 49.49  ? 155 ASP F C     1 
ATOM   3904 O  O     . ASP D 1 156 ? 55.013  -44.726 29.537  1.00 43.08  ? 155 ASP F O     1 
ATOM   3905 C  CB    . ASP D 1 156 ? 54.215  -42.451 31.088  1.00 38.24  ? 155 ASP F CB    1 
ATOM   3906 C  CG    . ASP D 1 156 ? 53.157  -43.027 32.012  1.00 46.50  ? 155 ASP F CG    1 
ATOM   3907 O  OD1   . ASP D 1 156 ? 53.292  -44.197 32.426  1.00 57.18  ? 155 ASP F OD1   1 
ATOM   3908 O  OD2   . ASP D 1 156 ? 52.187  -42.306 32.326  1.00 43.61  ? 155 ASP F OD2   1 
ATOM   3909 N  N     . HIS D 1 157 ? 56.235  -45.472 31.286  1.00 48.62  ? 156 HIS F N     1 
ATOM   3910 C  CA    . HIS D 1 157 ? 56.220  -46.856 30.826  1.00 43.12  ? 156 HIS F CA    1 
ATOM   3911 C  C     . HIS D 1 157 ? 54.816  -47.447 30.835  1.00 42.80  ? 156 HIS F C     1 
ATOM   3912 O  O     . HIS D 1 157 ? 54.547  -48.391 30.084  1.00 44.65  ? 156 HIS F O     1 
ATOM   3913 C  CB    . HIS D 1 157 ? 57.142  -47.716 31.695  1.00 44.85  ? 156 HIS F CB    1 
ATOM   3914 C  CG    . HIS D 1 157 ? 58.601  -47.473 31.465  1.00 53.51  ? 156 HIS F CG    1 
ATOM   3915 N  ND1   . HIS D 1 157 ? 59.072  -46.443 30.679  1.00 53.61  ? 156 HIS F ND1   1 
ATOM   3916 C  CD2   . HIS D 1 157 ? 59.695  -48.132 31.916  1.00 54.74  ? 156 HIS F CD2   1 
ATOM   3917 C  CE1   . HIS D 1 157 ? 60.393  -46.477 30.657  1.00 46.57  ? 156 HIS F CE1   1 
ATOM   3918 N  NE2   . HIS D 1 157 ? 60.796  -47.492 31.400  1.00 55.42  ? 156 HIS F NE2   1 
ATOM   3919 N  N     . ARG D 1 158 ? 53.917  -46.911 31.664  1.00 41.32  ? 157 ARG F N     1 
ATOM   3920 C  CA    . ARG D 1 158 ? 52.581  -47.487 31.786  1.00 43.05  ? 157 ARG F CA    1 
ATOM   3921 C  C     . ARG D 1 158 ? 51.725  -47.186 30.562  1.00 56.29  ? 157 ARG F C     1 
ATOM   3922 O  O     . ARG D 1 158 ? 50.915  -48.022 30.145  1.00 53.06  ? 157 ARG F O     1 
ATOM   3923 C  CB    . ARG D 1 158 ? 51.900  -46.963 33.050  1.00 43.69  ? 157 ARG F CB    1 
ATOM   3924 C  CG    . ARG D 1 158 ? 52.766  -47.015 34.296  1.00 39.52  ? 157 ARG F CG    1 
ATOM   3925 C  CD    . ARG D 1 158 ? 52.199  -46.126 35.393  1.00 50.41  ? 157 ARG F CD    1 
ATOM   3926 N  NE    . ARG D 1 158 ? 52.287  -44.710 35.046  1.00 45.29  ? 157 ARG F NE    1 
ATOM   3927 C  CZ    . ARG D 1 158 ? 51.759  -43.728 35.769  1.00 48.96  ? 157 ARG F CZ    1 
ATOM   3928 N  NH1   . ARG D 1 158 ? 51.096  -44.003 36.884  1.00 45.50  ? 157 ARG F NH1   1 
ATOM   3929 N  NH2   . ARG D 1 158 ? 51.892  -42.468 35.375  1.00 46.42  ? 157 ARG F NH2   1 
ATOM   3930 N  N     . HIS D 1 159 ? 51.882  -45.998 29.975  1.00 50.84  ? 158 HIS F N     1 
ATOM   3931 C  CA    . HIS D 1 159 ? 51.038  -45.564 28.868  1.00 45.77  ? 158 HIS F CA    1 
ATOM   3932 C  C     . HIS D 1 159 ? 51.828  -45.261 27.601  1.00 48.57  ? 158 HIS F C     1 
ATOM   3933 O  O     . HIS D 1 159 ? 51.242  -44.787 26.620  1.00 47.05  ? 158 HIS F O     1 
ATOM   3934 C  CB    . HIS D 1 159 ? 50.222  -44.333 29.275  1.00 38.66  ? 158 HIS F CB    1 
ATOM   3935 C  CG    . HIS D 1 159 ? 49.399  -44.535 30.508  1.00 49.34  ? 158 HIS F CG    1 
ATOM   3936 N  ND1   . HIS D 1 159 ? 48.186  -45.191 30.495  1.00 47.74  ? 158 HIS F ND1   1 
ATOM   3937 C  CD2   . HIS D 1 159 ? 49.611  -44.164 31.793  1.00 48.19  ? 158 HIS F CD2   1 
ATOM   3938 C  CE1   . HIS D 1 159 ? 47.688  -45.217 31.719  1.00 52.22  ? 158 HIS F CE1   1 
ATOM   3939 N  NE2   . HIS D 1 159 ? 48.533  -44.600 32.525  1.00 52.03  ? 158 HIS F NE2   1 
ATOM   3940 N  N     . GLY D 1 160 ? 53.133  -45.518 27.590  1.00 42.77  ? 159 GLY F N     1 
ATOM   3941 C  CA    . GLY D 1 160 ? 53.932  -45.236 26.410  1.00 35.91  ? 159 GLY F CA    1 
ATOM   3942 C  C     . GLY D 1 160 ? 54.021  -43.767 26.064  1.00 43.08  ? 159 GLY F C     1 
ATOM   3943 O  O     . GLY D 1 160 ? 54.087  -43.417 24.881  1.00 39.90  ? 159 GLY F O     1 
ATOM   3944 N  N     . VAL D 1 161 ? 54.023  -42.895 27.067  1.00 43.65  ? 160 VAL F N     1 
ATOM   3945 C  CA    . VAL D 1 161 ? 54.089  -41.455 26.849  1.00 36.83  ? 160 VAL F CA    1 
ATOM   3946 C  C     . VAL D 1 161 ? 55.549  -41.023 26.880  1.00 37.49  ? 160 VAL F C     1 
ATOM   3947 O  O     . VAL D 1 161 ? 56.242  -41.213 27.885  1.00 38.28  ? 160 VAL F O     1 
ATOM   3948 C  CB    . VAL D 1 161 ? 53.270  -40.693 27.902  1.00 40.75  ? 160 VAL F CB    1 
ATOM   3949 C  CG1   . VAL D 1 161 ? 53.413  -39.191 27.699  1.00 35.30  ? 160 VAL F CG1   1 
ATOM   3950 C  CG2   . VAL D 1 161 ? 51.810  -41.109 27.841  1.00 35.88  ? 160 VAL F CG2   1 
ATOM   3951 N  N     . TYR D 1 162 ? 56.016  -40.445 25.779  1.00 37.71  ? 161 TYR F N     1 
ATOM   3952 C  CA    . TYR D 1 162 ? 57.356  -39.890 25.735  1.00 34.94  ? 161 TYR F CA    1 
ATOM   3953 C  C     . TYR D 1 162 ? 57.366  -38.482 26.318  1.00 34.94  ? 161 TYR F C     1 
ATOM   3954 O  O     . TYR D 1 162 ? 56.336  -37.809 26.407  1.00 36.09  ? 161 TYR F O     1 
ATOM   3955 C  CB    . TYR D 1 162 ? 57.885  -39.858 24.301  1.00 31.37  ? 161 TYR F CB    1 
ATOM   3956 C  CG    . TYR D 1 162 ? 58.097  -41.222 23.689  1.00 45.32  ? 161 TYR F CG    1 
ATOM   3957 C  CD1   . TYR D 1 162 ? 57.045  -41.913 23.101  1.00 45.81  ? 161 TYR F CD1   1 
ATOM   3958 C  CD2   . TYR D 1 162 ? 59.351  -41.818 23.695  1.00 43.87  ? 161 TYR F CD2   1 
ATOM   3959 C  CE1   . TYR D 1 162 ? 57.236  -43.160 22.540  1.00 47.63  ? 161 TYR F CE1   1 
ATOM   3960 C  CE2   . TYR D 1 162 ? 59.552  -43.065 23.136  1.00 50.23  ? 161 TYR F CE2   1 
ATOM   3961 C  CZ    . TYR D 1 162 ? 58.491  -43.731 22.559  1.00 53.70  ? 161 TYR F CZ    1 
ATOM   3962 O  OH    . TYR D 1 162 ? 58.685  -44.973 22.001  1.00 62.12  ? 161 TYR F OH    1 
ATOM   3963 N  N     . VAL D 1 163 ? 58.552  -38.039 26.722  1.00 37.71  ? 162 VAL F N     1 
ATOM   3964 C  CA    . VAL D 1 163 ? 58.766  -36.668 27.162  1.00 32.57  ? 162 VAL F CA    1 
ATOM   3965 C  C     . VAL D 1 163 ? 59.898  -36.075 26.337  1.00 33.23  ? 162 VAL F C     1 
ATOM   3966 O  O     . VAL D 1 163 ? 60.917  -36.735 26.100  1.00 36.65  ? 162 VAL F O     1 
ATOM   3967 C  CB    . VAL D 1 163 ? 59.069  -36.579 28.671  1.00 35.63  ? 162 VAL F CB    1 
ATOM   3968 C  CG1   . VAL D 1 163 ? 60.393  -37.255 29.017  1.00 36.24  ? 162 VAL F CG1   1 
ATOM   3969 C  CG2   . VAL D 1 163 ? 59.070  -35.127 29.127  1.00 34.54  ? 162 VAL F CG2   1 
ATOM   3970 N  N     . LEU D 1 164 ? 59.698  -34.850 25.864  1.00 36.46  ? 163 LEU F N     1 
ATOM   3971 C  CA    . LEU D 1 164 ? 60.766  -34.051 25.280  1.00 34.89  ? 163 LEU F CA    1 
ATOM   3972 C  C     . LEU D 1 164 ? 61.251  -33.111 26.375  1.00 33.42  ? 163 LEU F C     1 
ATOM   3973 O  O     . LEU D 1 164 ? 60.537  -32.182 26.766  1.00 31.34  ? 163 LEU F O     1 
ATOM   3974 C  CB    . LEU D 1 164 ? 60.278  -33.285 24.050  1.00 33.94  ? 163 LEU F CB    1 
ATOM   3975 C  CG    . LEU D 1 164 ? 61.313  -32.658 23.106  1.00 32.99  ? 163 LEU F CG    1 
ATOM   3976 C  CD1   . LEU D 1 164 ? 60.672  -32.339 21.765  1.00 35.13  ? 163 LEU F CD1   1 
ATOM   3977 C  CD2   . LEU D 1 164 ? 61.946  -31.401 23.690  1.00 37.72  ? 163 LEU F CD2   1 
ATOM   3978 N  N     . ASN D 1 165 ? 62.450  -33.367 26.886  1.00 33.08  ? 164 ASN F N     1 
ATOM   3979 C  CA    . ASN D 1 165 ? 63.032  -32.556 27.945  1.00 35.74  ? 164 ASN F CA    1 
ATOM   3980 C  C     . ASN D 1 165 ? 63.946  -31.511 27.321  1.00 32.91  ? 164 ASN F C     1 
ATOM   3981 O  O     . ASN D 1 165 ? 64.951  -31.857 26.694  1.00 38.74  ? 164 ASN F O     1 
ATOM   3982 C  CB    . ASN D 1 165 ? 63.807  -33.419 28.939  1.00 34.04  ? 164 ASN F CB    1 
ATOM   3983 C  CG    . ASN D 1 165 ? 64.228  -32.646 30.172  1.00 36.04  ? 164 ASN F CG    1 
ATOM   3984 O  OD1   . ASN D 1 165 ? 63.433  -32.435 31.088  1.00 43.82  ? 164 ASN F OD1   1 
ATOM   3985 N  ND2   . ASN D 1 165 ? 65.482  -32.209 30.198  1.00 41.61  ? 164 ASN F ND2   1 
ATOM   3986 N  N     . ILE D 1 166 ? 63.591  -30.242 27.485  1.00 34.48  ? 165 ILE F N     1 
ATOM   3987 C  CA    . ILE D 1 166 ? 64.445  -29.150 27.038  1.00 37.46  ? 165 ILE F CA    1 
ATOM   3988 C  C     . ILE D 1 166 ? 65.505  -28.897 28.100  1.00 35.66  ? 165 ILE F C     1 
ATOM   3989 O  O     . ILE D 1 166 ? 65.185  -28.706 29.280  1.00 37.25  ? 165 ILE F O     1 
ATOM   3990 C  CB    . ILE D 1 166 ? 63.617  -27.885 26.761  1.00 33.91  ? 165 ILE F CB    1 
ATOM   3991 C  CG1   . ILE D 1 166 ? 62.739  -28.082 25.524  1.00 36.16  ? 165 ILE F CG1   1 
ATOM   3992 C  CG2   . ILE D 1 166 ? 64.525  -26.676 26.591  1.00 32.76  ? 165 ILE F CG2   1 
ATOM   3993 C  CD1   . ILE D 1 166 ? 61.266  -28.223 25.838  1.00 36.90  ? 165 ILE F CD1   1 
ATOM   3994 N  N     . SER D 1 167 ? 66.770  -28.910 27.687  1.00 36.95  ? 166 SER F N     1 
ATOM   3995 C  CA    . SER D 1 167 ? 67.864  -28.702 28.625  1.00 40.30  ? 166 SER F CA    1 
ATOM   3996 C  C     . SER D 1 167 ? 67.743  -27.333 29.283  1.00 43.16  ? 166 SER F C     1 
ATOM   3997 O  O     . SER D 1 167 ? 67.649  -26.308 28.600  1.00 45.35  ? 166 SER F O     1 
ATOM   3998 C  CB    . SER D 1 167 ? 69.205  -28.835 27.902  1.00 41.03  ? 166 SER F CB    1 
ATOM   3999 O  OG    . SER D 1 167 ? 70.292  -28.690 28.799  1.00 47.18  ? 166 SER F OG    1 
ATOM   4000 N  N     . LEU D 1 168 ? 67.725  -27.324 30.619  1.00 37.33  ? 167 LEU F N     1 
ATOM   4001 C  CA    . LEU D 1 168 ? 67.637  -26.080 31.379  1.00 45.59  ? 167 LEU F CA    1 
ATOM   4002 C  C     . LEU D 1 168 ? 68.823  -25.165 31.143  1.00 48.65  ? 167 LEU F C     1 
ATOM   4003 O  O     . LEU D 1 168 ? 68.767  -23.990 31.528  1.00 52.78  ? 167 LEU F O     1 
ATOM   4004 C  CB    . LEU D 1 168 ? 67.527  -26.377 32.872  1.00 35.52  ? 167 LEU F CB    1 
ATOM   4005 C  CG    . LEU D 1 168 ? 66.220  -27.052 33.272  1.00 39.05  ? 167 LEU F CG    1 
ATOM   4006 C  CD1   . LEU D 1 168 ? 66.173  -27.276 34.772  1.00 42.28  ? 167 LEU F CD1   1 
ATOM   4007 C  CD2   . LEU D 1 168 ? 65.041  -26.217 32.801  1.00 37.84  ? 167 LEU F CD2   1 
ATOM   4008 N  N     . ARG D 1 169 ? 69.896  -25.684 30.549  1.00 39.85  ? 168 ARG F N     1 
ATOM   4009 C  CA    . ARG D 1 169 ? 71.043  -24.866 30.203  1.00 48.94  ? 168 ARG F CA    1 
ATOM   4010 C  C     . ARG D 1 169 ? 70.723  -23.927 29.041  1.00 51.75  ? 168 ARG F C     1 
ATOM   4011 O  O     . ARG D 1 169 ? 71.398  -22.908 28.879  1.00 49.56  ? 168 ARG F O     1 
ATOM   4012 C  CB    . ARG D 1 169 ? 72.225  -25.797 29.899  1.00 46.88  ? 168 ARG F CB    1 
ATOM   4013 C  CG    . ARG D 1 169 ? 72.448  -25.993 28.426  1.00 61.87  ? 168 ARG F CG    1 
ATOM   4014 C  CD    . ARG D 1 169 ? 73.482  -27.058 28.065  1.00 72.53  ? 168 ARG F CD    1 
ATOM   4015 N  NE    . ARG D 1 169 ? 72.848  -28.334 27.710  1.00 71.42  ? 168 ARG F NE    1 
ATOM   4016 C  CZ    . ARG D 1 169 ? 73.540  -29.442 27.487  1.00 68.19  ? 168 ARG F CZ    1 
ATOM   4017 N  NH1   . ARG D 1 169 ? 74.853  -29.416 27.635  1.00 69.04  ? 168 ARG F NH1   1 
ATOM   4018 N  NH2   . ARG D 1 169 ? 72.935  -30.560 27.144  1.00 65.32  ? 168 ARG F NH2   1 
ATOM   4019 N  N     . ASP D 1 170 ? 69.684  -24.226 28.252  1.00 48.84  ? 169 ASP F N     1 
ATOM   4020 C  CA    . ASP D 1 170 ? 69.166  -23.323 27.226  1.00 47.33  ? 169 ASP F CA    1 
ATOM   4021 C  C     . ASP D 1 170 ? 67.809  -22.742 27.620  1.00 44.52  ? 169 ASP F C     1 
ATOM   4022 O  O     . ASP D 1 170 ? 66.982  -22.430 26.759  1.00 47.95  ? 169 ASP F O     1 
ATOM   4023 C  CB    . ASP D 1 170 ? 69.066  -24.040 25.880  1.00 48.20  ? 169 ASP F CB    1 
ATOM   4024 C  CG    . ASP D 1 170 ? 70.415  -24.512 25.372  1.00 55.65  ? 169 ASP F CG    1 
ATOM   4025 O  OD1   . ASP D 1 170 ? 71.425  -23.820 25.626  1.00 50.93  ? 169 ASP F OD1   1 
ATOM   4026 O  OD2   . ASP D 1 170 ? 70.466  -25.581 24.729  1.00 50.00  ? 169 ASP F OD2   1 
ATOM   4027 N  N     . ARG D 1 171 ? 67.578  -22.594 28.928  1.00 48.65  ? 170 ARG F N     1 
ATOM   4028 C  CA    . ARG D 1 171 ? 66.276  -22.165 29.429  1.00 45.62  ? 170 ARG F CA    1 
ATOM   4029 C  C     . ARG D 1 171 ? 65.893  -20.793 28.888  1.00 51.83  ? 170 ARG F C     1 
ATOM   4030 O  O     . ARG D 1 171 ? 64.762  -20.587 28.433  1.00 47.08  ? 170 ARG F O     1 
ATOM   4031 C  CB    . ARG D 1 171 ? 66.291  -22.152 30.958  1.00 43.34  ? 170 ARG F CB    1 
ATOM   4032 C  CG    . ARG D 1 171 ? 65.282  -21.206 31.578  1.00 50.66  ? 170 ARG F CG    1 
ATOM   4033 C  CD    . ARG D 1 171 ? 65.571  -20.970 33.051  1.00 46.35  ? 170 ARG F CD    1 
ATOM   4034 N  NE    . ARG D 1 171 ? 65.438  -22.187 33.844  1.00 42.01  ? 170 ARG F NE    1 
ATOM   4035 C  CZ    . ARG D 1 171 ? 64.278  -22.677 34.268  1.00 49.51  ? 170 ARG F CZ    1 
ATOM   4036 N  NH1   . ARG D 1 171 ? 63.144  -22.056 33.971  1.00 54.89  ? 170 ARG F NH1   1 
ATOM   4037 N  NH2   . ARG D 1 171 ? 64.249  -23.790 34.989  1.00 43.83  ? 170 ARG F NH2   1 
ATOM   4038 N  N     . ILE D 1 172 ? 66.826  -19.839 28.940  1.00 50.18  ? 171 ILE F N     1 
ATOM   4039 C  CA    . ILE D 1 172 ? 66.543  -18.492 28.451  1.00 46.97  ? 171 ILE F CA    1 
ATOM   4040 C  C     . ILE D 1 172 ? 66.204  -18.524 26.968  1.00 46.59  ? 171 ILE F C     1 
ATOM   4041 O  O     . ILE D 1 172 ? 65.250  -17.877 26.518  1.00 49.81  ? 171 ILE F O     1 
ATOM   4042 C  CB    . ILE D 1 172 ? 67.736  -17.561 28.736  1.00 50.24  ? 171 ILE F CB    1 
ATOM   4043 C  CG1   . ILE D 1 172 ? 67.955  -17.414 30.243  1.00 49.91  ? 171 ILE F CG1   1 
ATOM   4044 C  CG2   . ILE D 1 172 ? 67.517  -16.201 28.091  1.00 47.47  ? 171 ILE F CG2   1 
ATOM   4045 C  CD1   . ILE D 1 172 ? 69.269  -16.756 30.602  1.00 55.46  ? 171 ILE F CD1   1 
ATOM   4046 N  N     . LYS D 1 173 ? 66.971  -19.288 26.187  1.00 43.56  ? 172 LYS F N     1 
ATOM   4047 C  CA    . LYS D 1 173 ? 66.751  -19.335 24.747  1.00 45.64  ? 172 LYS F CA    1 
ATOM   4048 C  C     . LYS D 1 173 ? 65.378  -19.905 24.410  1.00 53.07  ? 172 LYS F C     1 
ATOM   4049 O  O     . LYS D 1 173 ? 64.723  -19.442 23.472  1.00 50.20  ? 172 LYS F O     1 
ATOM   4050 C  CB    . LYS D 1 173 ? 67.856  -20.153 24.078  1.00 49.52  ? 172 LYS F CB    1 
ATOM   4051 C  CG    . LYS D 1 173 ? 67.711  -20.301 22.571  1.00 53.52  ? 172 LYS F CG    1 
ATOM   4052 C  CD    . LYS D 1 173 ? 67.783  -18.958 21.863  1.00 65.52  ? 172 LYS F CD    1 
ATOM   4053 C  CE    . LYS D 1 173 ? 68.295  -19.117 20.440  1.00 66.10  ? 172 LYS F CE    1 
ATOM   4054 N  NZ    . LYS D 1 173 ? 67.516  -18.309 19.461  1.00 58.80  ? 172 LYS F NZ    1 
ATOM   4055 N  N     . PHE D 1 174 ? 64.917  -20.902 25.168  1.00 44.59  ? 173 PHE F N     1 
ATOM   4056 C  CA    . PHE D 1 174 ? 63.630  -21.515 24.854  1.00 42.65  ? 173 PHE F CA    1 
ATOM   4057 C  C     . PHE D 1 174 ? 62.464  -20.625 25.268  1.00 43.69  ? 173 PHE F C     1 
ATOM   4058 O  O     . PHE D 1 174 ? 61.535  -20.404 24.483  1.00 42.03  ? 173 PHE F O     1 
ATOM   4059 C  CB    . PHE D 1 174 ? 63.512  -22.884 25.525  1.00 40.63  ? 173 PHE F CB    1 
ATOM   4060 C  CG    . PHE D 1 174 ? 62.157  -23.514 25.370  1.00 38.38  ? 173 PHE F CG    1 
ATOM   4061 C  CD1   . PHE D 1 174 ? 61.767  -24.056 24.157  1.00 33.08  ? 173 PHE F CD1   1 
ATOM   4062 C  CD2   . PHE D 1 174 ? 61.270  -23.555 26.433  1.00 34.16  ? 173 PHE F CD2   1 
ATOM   4063 C  CE1   . PHE D 1 174 ? 60.519  -24.632 24.007  1.00 39.53  ? 173 PHE F CE1   1 
ATOM   4064 C  CE2   . PHE D 1 174 ? 60.020  -24.129 26.291  1.00 39.96  ? 173 PHE F CE2   1 
ATOM   4065 C  CZ    . PHE D 1 174 ? 59.644  -24.669 25.076  1.00 40.16  ? 173 PHE F CZ    1 
ATOM   4066 N  N     . VAL D 1 175 ? 62.490  -20.115 26.500  1.00 44.24  ? 174 VAL F N     1 
ATOM   4067 C  CA    . VAL D 1 175 ? 61.368  -19.325 27.000  1.00 48.35  ? 174 VAL F CA    1 
ATOM   4068 C  C     . VAL D 1 175 ? 61.233  -18.027 26.214  1.00 58.53  ? 174 VAL F C     1 
ATOM   4069 O  O     . VAL D 1 175 ? 60.136  -17.659 25.776  1.00 57.59  ? 174 VAL F O     1 
ATOM   4070 C  CB    . VAL D 1 175 ? 61.530  -19.058 28.508  1.00 53.67  ? 174 VAL F CB    1 
ATOM   4071 C  CG1   . VAL D 1 175 ? 60.452  -18.100 28.996  1.00 55.29  ? 174 VAL F CG1   1 
ATOM   4072 C  CG2   . VAL D 1 175 ? 61.479  -20.364 29.286  1.00 45.03  ? 174 VAL F CG2   1 
ATOM   4073 N  N     . HIS D 1 176 ? 62.347  -17.322 26.006  1.00 48.56  ? 175 HIS F N     1 
ATOM   4074 C  CA    . HIS D 1 176 ? 62.275  -16.003 25.385  1.00 52.23  ? 175 HIS F CA    1 
ATOM   4075 C  C     . HIS D 1 176 ? 61.958  -16.098 23.897  1.00 51.55  ? 175 HIS F C     1 
ATOM   4076 O  O     . HIS D 1 176 ? 61.209  -15.270 23.365  1.00 58.93  ? 175 HIS F O     1 
ATOM   4077 C  CB    . HIS D 1 176 ? 63.583  -15.245 25.608  1.00 56.42  ? 175 HIS F CB    1 
ATOM   4078 C  CG    . HIS D 1 176 ? 63.461  -13.764 25.424  1.00 66.29  ? 175 HIS F CG    1 
ATOM   4079 N  ND1   . HIS D 1 176 ? 63.910  -13.113 24.295  1.00 70.29  ? 175 HIS F ND1   1 
ATOM   4080 C  CD2   . HIS D 1 176 ? 62.936  -12.807 26.226  1.00 61.08  ? 175 HIS F CD2   1 
ATOM   4081 C  CE1   . HIS D 1 176 ? 63.669  -11.819 24.410  1.00 66.15  ? 175 HIS F CE1   1 
ATOM   4082 N  NE2   . HIS D 1 176 ? 63.079  -11.607 25.572  1.00 64.09  ? 175 HIS F NE2   1 
ATOM   4083 N  N     . THR D 1 177 ? 62.509  -17.098 23.206  1.00 49.68  ? 176 THR F N     1 
ATOM   4084 C  CA    . THR D 1 177 ? 62.328  -17.174 21.760  1.00 46.71  ? 176 THR F CA    1 
ATOM   4085 C  C     . THR D 1 177 ? 60.970  -17.755 21.382  1.00 53.44  ? 176 THR F C     1 
ATOM   4086 O  O     . THR D 1 177 ? 60.351  -17.303 20.412  1.00 64.47  ? 176 THR F O     1 
ATOM   4087 C  CB    . THR D 1 177 ? 63.447  -18.005 21.127  1.00 54.27  ? 176 THR F CB    1 
ATOM   4088 O  OG1   . THR D 1 177 ? 64.718  -17.429 21.451  1.00 59.84  ? 176 THR F OG1   1 
ATOM   4089 C  CG2   . THR D 1 177 ? 63.293  -18.061 19.613  1.00 57.98  ? 176 THR F CG2   1 
ATOM   4090 N  N     . ILE D 1 178 ? 60.485  -18.746 22.128  1.00 52.68  ? 177 ILE F N     1 
ATOM   4091 C  CA    . ILE D 1 178 ? 59.298  -19.508 21.746  1.00 53.79  ? 177 ILE F CA    1 
ATOM   4092 C  C     . ILE D 1 178 ? 58.121  -19.232 22.682  1.00 54.79  ? 177 ILE F C     1 
ATOM   4093 O  O     . ILE D 1 178 ? 57.041  -18.847 22.233  1.00 62.38  ? 177 ILE F O     1 
ATOM   4094 C  CB    . ILE D 1 178 ? 59.610  -21.018 21.661  1.00 54.19  ? 177 ILE F CB    1 
ATOM   4095 C  CG1   . ILE D 1 178 ? 60.718  -21.260 20.635  1.00 50.06  ? 177 ILE F CG1   1 
ATOM   4096 C  CG2   . ILE D 1 178 ? 58.358  -21.801 21.298  1.00 54.58  ? 177 ILE F CG2   1 
ATOM   4097 C  CD1   . ILE D 1 178 ? 60.918  -22.710 20.277  1.00 49.35  ? 177 ILE F CD1   1 
ATOM   4098 N  N     . LEU D 1 179 ? 58.308  -19.432 23.988  1.00 49.76  ? 178 LEU F N     1 
ATOM   4099 C  CA    . LEU D 1 179 ? 57.200  -19.236 24.920  1.00 59.10  ? 178 LEU F CA    1 
ATOM   4100 C  C     . LEU D 1 179 ? 56.867  -17.757 25.083  1.00 66.44  ? 178 LEU F C     1 
ATOM   4101 O  O     . LEU D 1 179 ? 55.745  -17.325 24.794  1.00 71.60  ? 178 LEU F O     1 
ATOM   4102 C  CB    . LEU D 1 179 ? 57.518  -19.874 26.274  1.00 54.32  ? 178 LEU F CB    1 
ATOM   4103 C  CG    . LEU D 1 179 ? 57.368  -21.394 26.358  1.00 55.21  ? 178 LEU F CG    1 
ATOM   4104 C  CD1   . LEU D 1 179 ? 57.622  -21.881 27.777  1.00 54.01  ? 178 LEU F CD1   1 
ATOM   4105 C  CD2   . LEU D 1 179 ? 55.987  -21.819 25.879  1.00 52.80  ? 178 LEU F CD2   1 
ATOM   4106 N  N     . SER D 1 180 ? 57.827  -16.963 25.551  1.00 65.69  ? 179 SER F N     1 
ATOM   4107 C  CA    . SER D 1 180 ? 57.606  -15.534 25.775  1.00 68.94  ? 179 SER F CA    1 
ATOM   4108 C  C     . SER D 1 180 ? 57.790  -14.697 24.514  1.00 64.35  ? 179 SER F C     1 
ATOM   4109 O  O     . SER D 1 180 ? 58.379  -13.615 24.567  1.00 62.71  ? 179 SER F O     1 
ATOM   4110 C  CB    . SER D 1 180 ? 58.534  -15.048 26.886  1.00 55.72  ? 179 SER F CB    1 
ATOM   4111 O  OG    . SER D 1 180 ? 57.932  -15.198 28.161  1.00 73.41  ? 179 SER F OG    1 
ATOM   4112 N  N     . SER D 1 181 ? 57.293  -15.167 23.373  1.00 68.52  ? 180 SER F N     1 
ATOM   4113 C  CA    . SER D 1 181 ? 57.446  -14.467 22.106  1.00 75.47  ? 180 SER F CA    1 
ATOM   4114 C  C     . SER D 1 181 ? 56.161  -13.733 21.744  1.00 77.57  ? 180 SER F C     1 
ATOM   4115 O  O     . SER D 1 181 ? 55.062  -14.281 21.871  1.00 76.18  ? 180 SER F O     1 
ATOM   4116 C  CB    . SER D 1 181 ? 57.823  -15.439 20.985  1.00 69.27  ? 180 SER F CB    1 
ATOM   4117 O  OG    . SER D 1 181 ? 56.675  -16.082 20.458  1.00 74.94  ? 180 SER F OG    1 
ATOM   4118 N  N     . HIS D 1 182 ? 56.311  -12.487 21.289  1.00 76.08  ? 181 HIS F N     1 
ATOM   4119 C  CA    . HIS D 1 182 ? 55.196  -11.662 20.844  1.00 82.17  ? 181 HIS F CA    1 
ATOM   4120 C  C     . HIS D 1 182 ? 54.864  -11.868 19.369  1.00 76.95  ? 181 HIS F C     1 
ATOM   4121 O  O     . HIS D 1 182 ? 54.091  -11.085 18.805  1.00 80.73  ? 181 HIS F O     1 
ATOM   4122 C  CB    . HIS D 1 182 ? 55.499  -10.179 21.082  1.00 76.14  ? 181 HIS F CB    1 
ATOM   4123 C  CG    . HIS D 1 182 ? 55.714  -9.816  22.519  1.00 80.98  ? 181 HIS F CG    1 
ATOM   4124 N  ND1   . HIS D 1 182 ? 56.918  -10.006 23.163  1.00 73.31  ? 181 HIS F ND1   1 
ATOM   4125 C  CD2   . HIS D 1 182 ? 54.886  -9.251  23.429  1.00 77.61  ? 181 HIS F CD2   1 
ATOM   4126 C  CE1   . HIS D 1 182 ? 56.820  -9.582  24.410  1.00 66.92  ? 181 HIS F CE1   1 
ATOM   4127 N  NE2   . HIS D 1 182 ? 55.596  -9.122  24.598  1.00 69.24  ? 181 HIS F NE2   1 
ATOM   4128 N  N     . LEU D 1 183 ? 55.424  -12.900 18.736  1.00 78.34  ? 182 LEU F N     1 
ATOM   4129 C  CA    . LEU D 1 183 ? 55.407  -13.069 17.276  1.00 76.96  ? 182 LEU F CA    1 
ATOM   4130 C  C     . LEU D 1 183 ? 53.996  -13.153 16.663  1.00 82.10  ? 182 LEU F C     1 
ATOM   4131 O  O     . LEU D 1 183 ? 53.931  -13.494 15.474  1.00 86.99  ? 182 LEU F O     1 
ATOM   4132 C  CB    . LEU D 1 183 ? 56.213  -14.310 16.891  1.00 74.88  ? 182 LEU F CB    1 
ATOM   4133 C  CG    . LEU D 1 183 ? 57.670  -14.045 16.510  1.00 71.76  ? 182 LEU F CG    1 
ATOM   4134 C  CD1   . LEU D 1 183 ? 58.379  -15.327 16.096  1.00 63.43  ? 182 LEU F CD1   1 
ATOM   4135 C  CD2   . LEU D 1 183 ? 57.771  -12.996 15.412  1.00 72.96  ? 182 LEU F CD2   1 
ATOM   4136 N  N     . ASN D 1 184 ? 52.898  -12.876 17.361  1.00 86.57  ? 183 ASN F N     1 
ATOM   4137 C  CA    . ASN D 1 184 ? 51.578  -12.841 16.736  1.00 87.09  ? 183 ASN F CA    1 
ATOM   4138 C  C     . ASN D 1 184 ? 50.834  -11.563 17.108  1.00 81.58  ? 183 ASN F C     1 
ATOM   4139 O  O     . ASN D 1 184 ? 50.352  -11.419 18.231  1.00 78.71  ? 183 ASN F O     1 
ATOM   4140 C  CB    . ASN D 1 184 ? 50.750  -14.062 17.140  1.00 84.61  ? 183 ASN F CB    1 
ATOM   4141 C  CG    . ASN D 1 184 ? 51.266  -15.348 16.527  1.00 84.80  ? 183 ASN F CG    1 
ATOM   4142 O  OD1   . ASN D 1 184 ? 51.788  -15.355 15.412  1.00 81.58  ? 183 ASN F OD1   1 
ATOM   4143 N  ND2   . ASN D 1 184 ? 51.124  -16.449 17.257  1.00 70.94  ? 183 ASN F ND2   1 
ATOM   4144 O  "O5'" . DG  E 2 1   ? 78.287  -27.741 50.544  1.00 56.45  ? 1   DG  G "O5'" 1 
ATOM   4145 C  "C5'" . DG  E 2 1   ? 78.743  -26.424 50.264  1.00 45.99  ? 1   DG  G "C5'" 1 
ATOM   4146 C  "C4'" . DG  E 2 1   ? 78.167  -25.918 48.952  1.00 50.80  ? 1   DG  G "C4'" 1 
ATOM   4147 O  "O4'" . DG  E 2 1   ? 78.608  -26.771 47.865  1.00 51.43  ? 1   DG  G "O4'" 1 
ATOM   4148 C  "C3'" . DG  E 2 1   ? 76.639  -25.882 48.884  1.00 48.25  ? 1   DG  G "C3'" 1 
ATOM   4149 O  "O3'" . DG  E 2 1   ? 76.212  -24.635 48.347  1.00 57.07  ? 1   DG  G "O3'" 1 
ATOM   4150 C  "C2'" . DG  E 2 1   ? 76.285  -27.053 47.964  1.00 46.82  ? 1   DG  G "C2'" 1 
ATOM   4151 C  "C1'" . DG  E 2 1   ? 77.509  -27.138 47.063  1.00 47.25  ? 1   DG  G "C1'" 1 
ATOM   4152 N  N9    . DG  E 2 1   ? 77.760  -28.480 46.543  1.00 45.95  ? 1   DG  G N9    1 
ATOM   4153 C  C8    . DG  E 2 1   ? 77.650  -29.666 47.228  1.00 41.51  ? 1   DG  G C8    1 
ATOM   4154 N  N7    . DG  E 2 1   ? 77.949  -30.713 46.510  1.00 41.46  ? 1   DG  G N7    1 
ATOM   4155 C  C5    . DG  E 2 1   ? 78.285  -30.189 45.268  1.00 38.84  ? 1   DG  G C5    1 
ATOM   4156 C  C6    . DG  E 2 1   ? 78.696  -30.845 44.083  1.00 36.82  ? 1   DG  G C6    1 
ATOM   4157 O  O6    . DG  E 2 1   ? 78.849  -32.059 43.892  1.00 41.07  ? 1   DG  G O6    1 
ATOM   4158 N  N1    . DG  E 2 1   ? 78.938  -29.941 43.051  1.00 38.21  ? 1   DG  G N1    1 
ATOM   4159 C  C2    . DG  E 2 1   ? 78.801  -28.577 43.152  1.00 43.18  ? 1   DG  G C2    1 
ATOM   4160 N  N2    . DG  E 2 1   ? 79.080  -27.869 42.048  1.00 36.15  ? 1   DG  G N2    1 
ATOM   4161 N  N3    . DG  E 2 1   ? 78.416  -27.950 44.257  1.00 40.39  ? 1   DG  G N3    1 
ATOM   4162 C  C4    . DG  E 2 1   ? 78.176  -28.816 45.272  1.00 43.78  ? 1   DG  G C4    1 
ATOM   4163 P  P     . DC  E 2 2   ? 74.649  -24.280 48.249  1.00 56.16  ? 2   DC  G P     1 
ATOM   4164 O  OP1   . DC  E 2 2   ? 74.513  -22.815 48.410  1.00 54.54  ? 2   DC  G OP1   1 
ATOM   4165 O  OP2   . DC  E 2 2   ? 73.908  -25.190 49.149  1.00 57.13  ? 2   DC  G OP2   1 
ATOM   4166 O  "O5'" . DC  E 2 2   ? 74.270  -24.670 46.749  1.00 57.14  ? 2   DC  G "O5'" 1 
ATOM   4167 C  "C5'" . DC  E 2 2   ? 75.050  -24.171 45.674  1.00 41.44  ? 2   DC  G "C5'" 1 
ATOM   4168 C  "C4'" . DC  E 2 2   ? 74.673  -24.856 44.380  1.00 53.38  ? 2   DC  G "C4'" 1 
ATOM   4169 O  "O4'" . DC  E 2 2   ? 75.263  -26.167 44.323  1.00 49.48  ? 2   DC  G "O4'" 1 
ATOM   4170 C  "C3'" . DC  E 2 2   ? 73.175  -25.068 44.193  1.00 51.97  ? 2   DC  G "C3'" 1 
ATOM   4171 O  "O3'" . DC  E 2 2   ? 72.693  -24.126 43.256  1.00 62.52  ? 2   DC  G "O3'" 1 
ATOM   4172 C  "C2'" . DC  E 2 2   ? 73.045  -26.514 43.682  1.00 45.46  ? 2   DC  G "C2'" 1 
ATOM   4173 C  "C1'" . DC  E 2 2   ? 74.488  -26.949 43.457  1.00 48.33  ? 2   DC  G "C1'" 1 
ATOM   4174 N  N1    . DC  E 2 2   ? 74.724  -28.384 43.767  1.00 39.59  ? 2   DC  G N1    1 
ATOM   4175 C  C2    . DC  E 2 2   ? 75.282  -29.218 42.793  1.00 43.92  ? 2   DC  G C2    1 
ATOM   4176 O  O2    . DC  E 2 2   ? 75.578  -28.741 41.690  1.00 47.65  ? 2   DC  G O2    1 
ATOM   4177 N  N3    . DC  E 2 2   ? 75.486  -30.525 43.087  1.00 40.42  ? 2   DC  G N3    1 
ATOM   4178 C  C4    . DC  E 2 2   ? 75.152  -30.999 44.289  1.00 46.06  ? 2   DC  G C4    1 
ATOM   4179 N  N4    . DC  E 2 2   ? 75.372  -32.295 44.532  1.00 43.45  ? 2   DC  G N4    1 
ATOM   4180 C  C5    . DC  E 2 2   ? 74.578  -30.165 45.294  1.00 38.74  ? 2   DC  G C5    1 
ATOM   4181 C  C6    . DC  E 2 2   ? 74.382  -28.877 44.992  1.00 43.53  ? 2   DC  G C6    1 
ATOM   4182 P  P     . DC  E 2 3   ? 71.158  -24.147 42.771  1.00 58.24  ? 3   DC  G P     1 
ATOM   4183 O  OP1   . DC  E 2 3   ? 70.745  -22.753 42.512  1.00 54.51  ? 3   DC  G OP1   1 
ATOM   4184 O  OP2   . DC  E 2 3   ? 70.362  -24.999 43.678  1.00 55.11  ? 3   DC  G OP2   1 
ATOM   4185 O  "O5'" . DC  E 2 3   ? 71.251  -24.912 41.376  1.00 54.83  ? 3   DC  G "O5'" 1 
ATOM   4186 C  "C5'" . DC  E 2 3   ? 72.336  -24.624 40.499  1.00 44.38  ? 3   DC  G "C5'" 1 
ATOM   4187 C  "C4'" . DC  E 2 3   ? 72.384  -25.594 39.334  1.00 48.88  ? 3   DC  G "C4'" 1 
ATOM   4188 O  "O4'" . DC  E 2 3   ? 72.891  -26.869 39.790  1.00 42.18  ? 3   DC  G "O4'" 1 
ATOM   4189 C  "C3'" . DC  E 2 3   ? 71.039  -25.868 38.664  1.00 40.34  ? 3   DC  G "C3'" 1 
ATOM   4190 O  "O3'" . DC  E 2 3   ? 71.159  -25.693 37.265  1.00 53.35  ? 3   DC  G "O3'" 1 
ATOM   4191 C  "C2'" . DC  E 2 3   ? 70.718  -27.321 39.037  1.00 40.09  ? 3   DC  G "C2'" 1 
ATOM   4192 C  "C1'" . DC  E 2 3   ? 72.099  -27.916 39.286  1.00 42.30  ? 3   DC  G "C1'" 1 
ATOM   4193 N  N1    . DC  E 2 3   ? 72.096  -29.009 40.300  1.00 39.91  ? 3   DC  G N1    1 
ATOM   4194 C  C2    . DC  E 2 3   ? 72.670  -30.246 39.992  1.00 40.18  ? 3   DC  G C2    1 
ATOM   4195 O  O2    . DC  E 2 3   ? 73.170  -30.415 38.875  1.00 46.40  ? 3   DC  G O2    1 
ATOM   4196 N  N3    . DC  E 2 3   ? 72.665  -31.226 40.929  1.00 42.37  ? 3   DC  G N3    1 
ATOM   4197 C  C4    . DC  E 2 3   ? 72.116  -31.004 42.124  1.00 45.91  ? 3   DC  G C4    1 
ATOM   4198 N  N4    . DC  E 2 3   ? 72.134  -32.001 43.016  1.00 46.19  ? 3   DC  G N4    1 
ATOM   4199 C  C5    . DC  E 2 3   ? 71.525  -29.751 42.459  1.00 44.11  ? 3   DC  G C5    1 
ATOM   4200 C  C6    . DC  E 2 3   ? 71.536  -28.791 41.527  1.00 43.21  ? 3   DC  G C6    1 
ATOM   4201 P  P     . DT  E 2 4   ? 69.872  -25.831 36.314  1.00 44.76  ? 4   DT  G P     1 
ATOM   4202 O  OP1   . DT  E 2 4   ? 70.027  -24.868 35.200  1.00 44.10  ? 4   DT  G OP1   1 
ATOM   4203 O  OP2   . DT  E 2 4   ? 68.664  -25.776 37.163  1.00 41.52  ? 4   DT  G OP2   1 
ATOM   4204 O  "O5'" . DT  E 2 4   ? 70.009  -27.304 35.718  1.00 47.64  ? 4   DT  G "O5'" 1 
ATOM   4205 C  "C5'" . DT  E 2 4   ? 71.262  -27.727 35.211  1.00 38.51  ? 4   DT  G "C5'" 1 
ATOM   4206 C  "C4'" . DT  E 2 4   ? 71.232  -29.198 34.853  1.00 46.20  ? 4   DT  G "C4'" 1 
ATOM   4207 O  "O4'" . DT  E 2 4   ? 71.298  -30.002 36.058  1.00 42.27  ? 4   DT  G "O4'" 1 
ATOM   4208 C  "C3'" . DT  E 2 4   ? 69.981  -29.658 34.098  1.00 44.69  ? 4   DT  G "C3'" 1 
ATOM   4209 O  "O3'" . DT  E 2 4   ? 70.369  -30.392 32.949  1.00 45.99  ? 4   DT  G "O3'" 1 
ATOM   4210 C  "C2'" . DT  E 2 4   ? 69.252  -30.542 35.115  1.00 40.65  ? 4   DT  G "C2'" 1 
ATOM   4211 C  "C1'" . DT  E 2 4   ? 70.418  -31.085 35.921  1.00 41.81  ? 4   DT  G "C1'" 1 
ATOM   4212 N  N1    . DT  E 2 4   ? 70.049  -31.576 37.279  1.00 41.73  ? 4   DT  G N1    1 
ATOM   4213 C  C2    . DT  E 2 4   ? 70.338  -32.876 37.618  1.00 42.14  ? 4   DT  G C2    1 
ATOM   4214 O  O2    . DT  E 2 4   ? 70.883  -33.658 36.859  1.00 44.71  ? 4   DT  G O2    1 
ATOM   4215 N  N3    . DT  E 2 4   ? 69.967  -33.234 38.886  1.00 41.34  ? 4   DT  G N3    1 
ATOM   4216 C  C4    . DT  E 2 4   ? 69.348  -32.437 39.831  1.00 39.28  ? 4   DT  G C4    1 
ATOM   4217 O  O4    . DT  E 2 4   ? 69.052  -32.853 40.947  1.00 46.07  ? 4   DT  G O4    1 
ATOM   4218 C  C5    . DT  E 2 4   ? 69.072  -31.083 39.412  1.00 40.08  ? 4   DT  G C5    1 
ATOM   4219 C  C7    . DT  E 2 4   ? 68.402  -30.126 40.352  1.00 42.94  ? 4   DT  G C7    1 
ATOM   4220 C  C6    . DT  E 2 4   ? 69.434  -30.720 38.171  1.00 39.83  ? 4   DT  G C6    1 
ATOM   4221 P  P     . DT  E 2 5   ? 69.317  -30.673 31.770  1.00 43.74  ? 5   DT  G P     1 
ATOM   4222 O  OP1   . DT  E 2 5   ? 70.075  -30.657 30.500  1.00 40.54  ? 5   DT  G OP1   1 
ATOM   4223 O  OP2   . DT  E 2 5   ? 68.163  -29.763 31.955  1.00 40.00  ? 5   DT  G OP2   1 
ATOM   4224 O  "O5'" . DT  E 2 5   ? 68.820  -32.163 32.061  1.00 44.57  ? 5   DT  G "O5'" 1 
ATOM   4225 C  "C5'" . DT  E 2 5   ? 69.773  -33.205 32.195  1.00 36.33  ? 5   DT  G "C5'" 1 
ATOM   4226 C  "C4'" . DT  E 2 5   ? 69.136  -34.461 32.764  1.00 41.35  ? 5   DT  G "C4'" 1 
ATOM   4227 O  "O4'" . DT  E 2 5   ? 68.930  -34.314 34.194  1.00 38.52  ? 5   DT  G "O4'" 1 
ATOM   4228 C  "C3'" . DT  E 2 5   ? 67.768  -34.835 32.175  1.00 43.92  ? 5   DT  G "C3'" 1 
ATOM   4229 O  "O3'" . DT  E 2 5   ? 67.772  -36.208 31.826  1.00 48.78  ? 5   DT  G "O3'" 1 
ATOM   4230 C  "C2'" . DT  E 2 5   ? 66.803  -34.563 33.332  1.00 43.30  ? 5   DT  G "C2'" 1 
ATOM   4231 C  "C1'" . DT  E 2 5   ? 67.692  -34.891 34.516  1.00 43.55  ? 5   DT  G "C1'" 1 
ATOM   4232 N  N1    . DT  E 2 5   ? 67.216  -34.338 35.816  1.00 40.84  ? 5   DT  G N1    1 
ATOM   4233 C  C2    . DT  E 2 5   ? 67.273  -35.132 36.937  1.00 44.23  ? 5   DT  G C2    1 
ATOM   4234 O  O2    . DT  E 2 5   ? 67.698  -36.274 36.925  1.00 47.29  ? 5   DT  G O2    1 
ATOM   4235 N  N3    . DT  E 2 5   ? 66.815  -34.540 38.083  1.00 38.79  ? 5   DT  G N3    1 
ATOM   4236 C  C4    . DT  E 2 5   ? 66.313  -33.260 38.219  1.00 42.96  ? 5   DT  G C4    1 
ATOM   4237 O  O4    . DT  E 2 5   ? 65.924  -32.818 39.295  1.00 44.18  ? 5   DT  G O4    1 
ATOM   4238 C  C5    . DT  E 2 5   ? 66.278  -32.479 37.004  1.00 41.41  ? 5   DT  G C5    1 
ATOM   4239 C  C7    . DT  E 2 5   ? 65.754  -31.074 37.027  1.00 40.63  ? 5   DT  G C7    1 
ATOM   4240 C  C6    . DT  E 2 5   ? 66.726  -33.050 35.873  1.00 42.95  ? 5   DT  G C6    1 
ATOM   4241 P  P     . DG  E 2 6   ? 66.793  -36.774 30.686  1.00 48.32  ? 6   DG  G P     1 
ATOM   4242 O  OP1   . DG  E 2 6   ? 67.496  -36.641 29.391  1.00 53.63  ? 6   DG  G OP1   1 
ATOM   4243 O  OP2   . DG  E 2 6   ? 65.459  -36.161 30.867  1.00 47.28  ? 6   DG  G OP2   1 
ATOM   4244 O  "O5'" . DG  E 2 6   ? 66.677  -38.326 31.045  1.00 50.07  ? 6   DG  G "O5'" 1 
ATOM   4245 C  "C5'" . DG  E 2 6   ? 67.855  -39.069 31.346  1.00 46.00  ? 6   DG  G "C5'" 1 
ATOM   4246 C  "C4'" . DG  E 2 6   ? 67.580  -40.113 32.413  1.00 45.07  ? 6   DG  G "C4'" 1 
ATOM   4247 O  "O4'" . DG  E 2 6   ? 67.361  -39.460 33.692  1.00 41.73  ? 6   DG  G "O4'" 1 
ATOM   4248 C  "C3'" . DG  E 2 6   ? 66.353  -40.986 32.157  1.00 47.48  ? 6   DG  G "C3'" 1 
ATOM   4249 O  "O3'" . DG  E 2 6   ? 66.660  -42.345 32.429  1.00 42.76  ? 6   DG  G "O3'" 1 
ATOM   4250 C  "C2'" . DG  E 2 6   ? 65.306  -40.434 33.125  1.00 44.23  ? 6   DG  G "C2'" 1 
ATOM   4251 C  "C1'" . DG  E 2 6   ? 66.165  -39.925 34.274  1.00 45.45  ? 6   DG  G "C1'" 1 
ATOM   4252 N  N9    . DG  E 2 6   ? 65.551  -38.818 35.003  1.00 45.94  ? 6   DG  G N9    1 
ATOM   4253 C  C8    . DG  E 2 6   ? 65.112  -37.627 34.476  1.00 47.85  ? 6   DG  G C8    1 
ATOM   4254 N  N7    . DG  E 2 6   ? 64.603  -36.821 35.364  1.00 42.27  ? 6   DG  G N7    1 
ATOM   4255 C  C5    . DG  E 2 6   ? 64.712  -37.518 36.560  1.00 42.55  ? 6   DG  G C5    1 
ATOM   4256 C  C6    . DG  E 2 6   ? 64.325  -37.146 37.869  1.00 43.68  ? 6   DG  G C6    1 
ATOM   4257 O  O6    . DG  E 2 6   ? 63.794  -36.090 38.241  1.00 47.03  ? 6   DG  G O6    1 
ATOM   4258 N  N1    . DG  E 2 6   ? 64.612  -38.146 38.795  1.00 43.06  ? 6   DG  G N1    1 
ATOM   4259 C  C2    . DG  E 2 6   ? 65.199  -39.353 38.493  1.00 44.73  ? 6   DG  G C2    1 
ATOM   4260 N  N2    . DG  E 2 6   ? 65.397  -40.190 39.522  1.00 48.37  ? 6   DG  G N2    1 
ATOM   4261 N  N3    . DG  E 2 6   ? 65.566  -39.715 37.270  1.00 45.84  ? 6   DG  G N3    1 
ATOM   4262 C  C4    . DG  E 2 6   ? 65.293  -38.751 36.356  1.00 46.30  ? 6   DG  G C4    1 
ATOM   4263 P  P     . DC  E 2 7   ? 65.584  -43.496 32.116  1.00 55.20  ? 7   DC  G P     1 
ATOM   4264 O  OP1   . DC  E 2 7   ? 66.333  -44.762 31.946  1.00 56.94  ? 7   DC  G OP1   1 
ATOM   4265 O  OP2   . DC  E 2 7   ? 64.701  -43.014 31.030  1.00 49.50  ? 7   DC  G OP2   1 
ATOM   4266 O  "O5'" . DC  E 2 7   ? 64.723  -43.582 33.462  1.00 45.16  ? 7   DC  G "O5'" 1 
ATOM   4267 C  "C5'" . DC  E 2 7   ? 65.389  -43.753 34.704  1.00 54.51  ? 7   DC  G "C5'" 1 
ATOM   4268 C  "C4'" . DC  E 2 7   ? 64.434  -43.598 35.876  1.00 54.66  ? 7   DC  G "C4'" 1 
ATOM   4269 O  "O4'" . DC  E 2 7   ? 64.137  -42.201 36.104  1.00 49.74  ? 7   DC  G "O4'" 1 
ATOM   4270 C  "C3'" . DC  E 2 7   ? 63.075  -44.299 35.727  1.00 48.28  ? 7   DC  G "C3'" 1 
ATOM   4271 O  "O3'" . DC  E 2 7   ? 62.932  -45.270 36.754  1.00 60.54  ? 7   DC  G "O3'" 1 
ATOM   4272 C  "C2'" . DC  E 2 7   ? 62.051  -43.160 35.885  1.00 47.41  ? 7   DC  G "C2'" 1 
ATOM   4273 C  "C1'" . DC  E 2 7   ? 62.857  -42.138 36.666  1.00 50.70  ? 7   DC  G "C1'" 1 
ATOM   4274 N  N1    . DC  E 2 7   ? 62.345  -40.737 36.572  1.00 49.70  ? 7   DC  G N1    1 
ATOM   4275 C  C2    . DC  E 2 7   ? 61.849  -40.112 37.722  1.00 46.69  ? 7   DC  G C2    1 
ATOM   4276 O  O2    . DC  E 2 7   ? 61.843  -40.735 38.791  1.00 48.15  ? 7   DC  G O2    1 
ATOM   4277 N  N3    . DC  E 2 7   ? 61.388  -38.840 37.632  1.00 43.05  ? 7   DC  G N3    1 
ATOM   4278 C  C4    . DC  E 2 7   ? 61.413  -38.202 36.463  1.00 43.09  ? 7   DC  G C4    1 
ATOM   4279 N  N4    . DC  E 2 7   ? 60.947  -36.949 36.426  1.00 40.11  ? 7   DC  G N4    1 
ATOM   4280 C  C5    . DC  E 2 7   ? 61.914  -38.822 35.278  1.00 43.70  ? 7   DC  G C5    1 
ATOM   4281 C  C6    . DC  E 2 7   ? 62.366  -40.078 35.378  1.00 46.58  ? 7   DC  G C6    1 
ATOM   4282 P  P     . DC  E 2 8   ? 62.011  -46.567 36.533  1.00 68.63  ? 8   DC  G P     1 
ATOM   4283 O  OP1   . DC  E 2 8   ? 62.662  -47.690 37.244  1.00 56.89  ? 8   DC  G OP1   1 
ATOM   4284 O  OP2   . DC  E 2 8   ? 61.722  -46.681 35.086  1.00 67.81  ? 8   DC  G OP2   1 
ATOM   4285 O  "O5'" . DC  E 2 8   ? 60.648  -46.197 37.283  1.00 54.07  ? 8   DC  G "O5'" 1 
ATOM   4286 C  "C5'" . DC  E 2 8   ? 60.668  -45.872 38.666  1.00 49.15  ? 8   DC  G "C5'" 1 
ATOM   4287 C  "C4'" . DC  E 2 8   ? 59.363  -45.221 39.091  1.00 53.44  ? 8   DC  G "C4'" 1 
ATOM   4288 O  "O4'" . DC  E 2 8   ? 59.395  -43.801 38.785  1.00 51.00  ? 8   DC  G "O4'" 1 
ATOM   4289 C  "C3'" . DC  E 2 8   ? 58.103  -45.775 38.409  1.00 55.15  ? 8   DC  G "C3'" 1 
ATOM   4290 O  "O3'" . DC  E 2 8   ? 57.128  -46.106 39.390  1.00 61.87  ? 8   DC  G "O3'" 1 
ATOM   4291 C  "C2'" . DC  E 2 8   ? 57.634  -44.615 37.528  1.00 55.55  ? 8   DC  G "C2'" 1 
ATOM   4292 C  "C1'" . DC  E 2 8   ? 58.125  -43.422 38.324  1.00 52.61  ? 8   DC  G "C1'" 1 
ATOM   4293 N  N1    . DC  E 2 8   ? 58.245  -42.173 37.519  1.00 45.96  ? 8   DC  G N1    1 
ATOM   4294 C  C2    . DC  E 2 8   ? 57.928  -40.942 38.103  1.00 48.26  ? 8   DC  G C2    1 
ATOM   4295 O  O2    . DC  E 2 8   ? 57.567  -40.911 39.286  1.00 50.05  ? 8   DC  G O2    1 
ATOM   4296 N  N3    . DC  E 2 8   ? 58.033  -39.815 37.356  1.00 42.69  ? 8   DC  G N3    1 
ATOM   4297 C  C4    . DC  E 2 8   ? 58.426  -39.891 36.084  1.00 41.91  ? 8   DC  G C4    1 
ATOM   4298 N  N4    . DC  E 2 8   ? 58.513  -38.753 35.387  1.00 36.81  ? 8   DC  G N4    1 
ATOM   4299 C  C5    . DC  E 2 8   ? 58.747  -41.137 35.470  1.00 41.98  ? 8   DC  G C5    1 
ATOM   4300 C  C6    . DC  E 2 8   ? 58.640  -42.242 36.216  1.00 44.19  ? 8   DC  G C6    1 
ATOM   4301 P  P     . DG  E 2 9   ? 55.939  -47.133 39.046  1.00 59.83  ? 9   DG  G P     1 
ATOM   4302 O  OP1   . DG  E 2 9   ? 56.401  -48.493 39.395  1.00 54.56  ? 9   DG  G OP1   1 
ATOM   4303 O  OP2   . DG  E 2 9   ? 55.461  -46.856 37.674  1.00 64.97  ? 9   DG  G OP2   1 
ATOM   4304 O  "O5'" . DG  E 2 9   ? 54.770  -46.702 40.047  1.00 54.81  ? 9   DG  G "O5'" 1 
ATOM   4305 C  "C5'" . DG  E 2 9   ? 55.067  -46.426 41.406  1.00 52.67  ? 9   DG  G "C5'" 1 
ATOM   4306 C  "C4'" . DG  E 2 9   ? 54.248  -45.250 41.911  1.00 53.83  ? 9   DG  G "C4'" 1 
ATOM   4307 O  "O4'" . DG  E 2 9   ? 54.661  -44.036 41.228  1.00 55.34  ? 9   DG  G "O4'" 1 
ATOM   4308 C  "C3'" . DG  E 2 9   ? 52.738  -45.364 41.703  1.00 60.39  ? 9   DG  G "C3'" 1 
ATOM   4309 O  "O3'" . DG  E 2 9   ? 52.060  -44.874 42.852  1.00 70.28  ? 9   DG  G "O3'" 1 
ATOM   4310 C  "C2'" . DG  E 2 9   ? 52.489  -44.479 40.483  1.00 57.74  ? 9   DG  G "C2'" 1 
ATOM   4311 C  "C1'" . DG  E 2 9   ? 53.533  -43.391 40.680  1.00 60.02  ? 9   DG  G "C1'" 1 
ATOM   4312 N  N9    . DG  E 2 9   ? 53.935  -42.738 39.438  1.00 50.94  ? 9   DG  G N9    1 
ATOM   4313 C  C8    . DG  E 2 9   ? 54.421  -43.344 38.305  1.00 49.80  ? 9   DG  G C8    1 
ATOM   4314 N  N7    . DG  E 2 9   ? 54.701  -42.506 37.347  1.00 44.74  ? 9   DG  G N7    1 
ATOM   4315 C  C5    . DG  E 2 9   ? 54.383  -41.263 37.877  1.00 42.55  ? 9   DG  G C5    1 
ATOM   4316 C  C6    . DG  E 2 9   ? 54.477  -39.975 37.300  1.00 42.03  ? 9   DG  G C6    1 
ATOM   4317 O  O6    . DG  E 2 9   ? 54.875  -39.670 36.166  1.00 40.76  ? 9   DG  G O6    1 
ATOM   4318 N  N1    . DG  E 2 9   ? 54.050  -38.983 38.180  1.00 41.12  ? 9   DG  G N1    1 
ATOM   4319 C  C2    . DG  E 2 9   ? 53.591  -39.209 39.457  1.00 44.62  ? 9   DG  G C2    1 
ATOM   4320 N  N2    . DG  E 2 9   ? 53.223  -38.126 40.157  1.00 41.93  ? 9   DG  G N2    1 
ATOM   4321 N  N3    . DG  E 2 9   ? 53.498  -40.412 40.010  1.00 44.46  ? 9   DG  G N3    1 
ATOM   4322 C  C4    . DG  E 2 9   ? 53.910  -41.388 39.165  1.00 46.02  ? 9   DG  G C4    1 
ATOM   4323 P  P     . DG  E 2 10  ? 50.460  -44.972 42.963  1.00 70.41  ? 10  DG  G P     1 
ATOM   4324 O  OP1   . DG  E 2 10  ? 50.144  -45.398 44.343  1.00 84.83  ? 10  DG  G OP1   1 
ATOM   4325 O  OP2   . DG  E 2 10  ? 49.959  -45.766 41.819  1.00 50.46  ? 10  DG  G OP2   1 
ATOM   4326 O  "O5'" . DG  E 2 10  ? 49.972  -43.460 42.778  1.00 59.85  ? 10  DG  G "O5'" 1 
ATOM   4327 C  "C5'" . DG  E 2 10  ? 50.404  -42.461 43.697  1.00 59.31  ? 10  DG  G "C5'" 1 
ATOM   4328 C  "C4'" . DG  E 2 10  ? 49.591  -41.182 43.552  1.00 66.52  ? 10  DG  G "C4'" 1 
ATOM   4329 O  "O4'" . DG  E 2 10  ? 50.069  -40.419 42.416  1.00 61.69  ? 10  DG  G "O4'" 1 
ATOM   4330 C  "C3'" . DG  E 2 10  ? 48.097  -41.372 43.327  1.00 60.36  ? 10  DG  G "C3'" 1 
ATOM   4331 O  "O3'" . DG  E 2 10  ? 47.386  -40.305 43.939  1.00 65.60  ? 10  DG  G "O3'" 1 
ATOM   4332 C  "C2'" . DG  E 2 10  ? 47.976  -41.326 41.805  1.00 61.37  ? 10  DG  G "C2'" 1 
ATOM   4333 C  "C1'" . DG  E 2 10  ? 49.055  -40.312 41.436  1.00 58.52  ? 10  DG  G "C1'" 1 
ATOM   4334 N  N9    . DG  E 2 10  ? 49.668  -40.555 40.135  1.00 54.82  ? 10  DG  G N9    1 
ATOM   4335 C  C8    . DG  E 2 10  ? 50.119  -41.756 39.644  1.00 60.19  ? 10  DG  G C8    1 
ATOM   4336 N  N7    . DG  E 2 10  ? 50.637  -41.668 38.451  1.00 52.30  ? 10  DG  G N7    1 
ATOM   4337 C  C5    . DG  E 2 10  ? 50.530  -40.320 38.133  1.00 51.11  ? 10  DG  G C5    1 
ATOM   4338 C  C6    . DG  E 2 10  ? 50.926  -39.624 36.967  1.00 43.71  ? 10  DG  G C6    1 
ATOM   4339 O  O6    . DG  E 2 10  ? 51.467  -40.079 35.949  1.00 44.77  ? 10  DG  G O6    1 
ATOM   4340 N  N1    . DG  E 2 10  ? 50.633  -38.265 37.053  1.00 37.81  ? 10  DG  G N1    1 
ATOM   4341 C  C2    . DG  E 2 10  ? 50.036  -37.656 38.132  1.00 47.16  ? 10  DG  G C2    1 
ATOM   4342 N  N2    . DG  E 2 10  ? 49.835  -36.334 38.034  1.00 38.42  ? 10  DG  G N2    1 
ATOM   4343 N  N3    . DG  E 2 10  ? 49.661  -38.297 39.232  1.00 49.74  ? 10  DG  G N3    1 
ATOM   4344 C  C4    . DG  E 2 10  ? 49.939  -39.621 39.162  1.00 47.72  ? 10  DG  G C4    1 
ATOM   4345 P  P     . DG  E 2 11  ? 45.827  -40.462 44.288  1.00 74.72  ? 11  DG  G P     1 
ATOM   4346 O  OP1   . DG  E 2 11  ? 45.600  -39.817 45.601  1.00 68.61  ? 11  DG  G OP1   1 
ATOM   4347 O  OP2   . DG  E 2 11  ? 45.463  -41.883 44.090  1.00 60.05  ? 11  DG  G OP2   1 
ATOM   4348 O  "O5'" . DG  E 2 11  ? 45.095  -39.598 43.158  1.00 74.65  ? 11  DG  G "O5'" 1 
ATOM   4349 C  "C5'" . DG  E 2 11  ? 45.355  -38.202 43.056  1.00 69.57  ? 11  DG  G "C5'" 1 
ATOM   4350 C  "C4'" . DG  E 2 11  ? 44.892  -37.652 41.717  1.00 63.05  ? 11  DG  G "C4'" 1 
ATOM   4351 O  "O4'" . DG  E 2 11  ? 45.793  -38.090 40.662  1.00 57.22  ? 11  DG  G "O4'" 1 
ATOM   4352 C  "C3'" . DG  E 2 11  ? 43.490  -38.090 41.271  1.00 62.59  ? 11  DG  G "C3'" 1 
ATOM   4353 O  "O3'" . DG  E 2 11  ? 42.842  -37.006 40.628  1.00 67.21  ? 11  DG  G "O3'" 1 
ATOM   4354 C  "C2'" . DG  E 2 11  ? 43.803  -39.189 40.263  1.00 54.63  ? 11  DG  G "C2'" 1 
ATOM   4355 C  "C1'" . DG  E 2 11  ? 45.011  -38.568 39.595  1.00 60.77  ? 11  DG  G "C1'" 1 
ATOM   4356 N  N9    . DG  E 2 11  ? 45.800  -39.488 38.786  1.00 53.81  ? 11  DG  G N9    1 
ATOM   4357 C  C8    . DG  E 2 11  ? 45.994  -40.831 38.995  1.00 48.48  ? 11  DG  G C8    1 
ATOM   4358 N  N7    . DG  E 2 11  ? 46.752  -41.391 38.091  1.00 53.82  ? 11  DG  G N7    1 
ATOM   4359 C  C5    . DG  E 2 11  ? 47.076  -40.350 37.228  1.00 48.29  ? 11  DG  G C5    1 
ATOM   4360 C  C6    . DG  E 2 11  ? 47.874  -40.346 36.059  1.00 43.94  ? 11  DG  G C6    1 
ATOM   4361 O  O6    . DG  E 2 11  ? 48.470  -41.296 35.533  1.00 45.51  ? 11  DG  G O6    1 
ATOM   4362 N  N1    . DG  E 2 11  ? 47.942  -39.079 35.485  1.00 46.42  ? 11  DG  G N1    1 
ATOM   4363 C  C2    . DG  E 2 11  ? 47.321  -37.958 35.981  1.00 44.16  ? 11  DG  G C2    1 
ATOM   4364 N  N2    . DG  E 2 11  ? 47.504  -36.822 35.292  1.00 40.26  ? 11  DG  G N2    1 
ATOM   4365 N  N3    . DG  E 2 11  ? 46.573  -37.948 37.075  1.00 45.44  ? 11  DG  G N3    1 
ATOM   4366 C  C4    . DG  E 2 11  ? 46.496  -39.175 37.644  1.00 51.46  ? 11  DG  G C4    1 
ATOM   4367 P  P     . DT  E 2 12  ? 41.859  -36.030 41.437  1.00 71.85  ? 12  DT  G P     1 
ATOM   4368 O  OP1   . DT  E 2 12  ? 42.528  -35.648 42.702  1.00 75.56  ? 12  DT  G OP1   1 
ATOM   4369 O  OP2   . DT  E 2 12  ? 40.525  -36.670 41.473  1.00 71.26  ? 12  DT  G OP2   1 
ATOM   4370 O  "O5'" . DT  E 2 12  ? 41.758  -34.743 40.490  1.00 64.67  ? 12  DT  G "O5'" 1 
ATOM   4371 C  "C5'" . DT  E 2 12  ? 42.949  -34.084 40.060  1.00 65.08  ? 12  DT  G "C5'" 1 
ATOM   4372 C  "C4'" . DT  E 2 12  ? 42.912  -33.780 38.568  1.00 57.22  ? 12  DT  G "C4'" 1 
ATOM   4373 O  "O4'" . DT  E 2 12  ? 43.462  -34.898 37.815  1.00 53.88  ? 12  DT  G "O4'" 1 
ATOM   4374 C  "C3'" . DT  E 2 12  ? 41.519  -33.536 37.972  1.00 53.71  ? 12  DT  G "C3'" 1 
ATOM   4375 O  "O3'" . DT  E 2 12  ? 41.615  -32.599 36.904  1.00 54.69  ? 12  DT  G "O3'" 1 
ATOM   4376 C  "C2'" . DT  E 2 12  ? 41.189  -34.910 37.412  1.00 51.76  ? 12  DT  G "C2'" 1 
ATOM   4377 C  "C1'" . DT  E 2 12  ? 42.540  -35.236 36.807  1.00 54.76  ? 12  DT  G "C1'" 1 
ATOM   4378 N  N1    . DT  E 2 12  ? 42.723  -36.652 36.426  1.00 50.51  ? 12  DT  G N1    1 
ATOM   4379 C  C2    . DT  E 2 12  ? 43.639  -36.962 35.450  1.00 48.17  ? 12  DT  G C2    1 
ATOM   4380 O  O2    . DT  E 2 12  ? 44.322  -36.125 34.886  1.00 49.75  ? 12  DT  G O2    1 
ATOM   4381 N  N3    . DT  E 2 12  ? 43.734  -38.294 35.158  1.00 42.64  ? 12  DT  G N3    1 
ATOM   4382 C  C4    . DT  E 2 12  ? 43.015  -39.326 35.731  1.00 49.03  ? 12  DT  G C4    1 
ATOM   4383 O  O4    . DT  E 2 12  ? 43.173  -40.496 35.401  1.00 52.77  ? 12  DT  G O4    1 
ATOM   4384 C  C5    . DT  E 2 12  ? 42.066  -38.930 36.746  1.00 55.02  ? 12  DT  G C5    1 
ATOM   4385 C  C7    . DT  E 2 12  ? 41.227  -39.961 37.439  1.00 56.52  ? 12  DT  G C7    1 
ATOM   4386 C  C6    . DT  E 2 12  ? 41.965  -37.626 37.039  1.00 51.20  ? 12  DT  G C6    1 
ATOM   4387 P  P     . DA  E 2 13  ? 41.731  -31.020 37.172  1.00 63.68  ? 13  DA  G P     1 
ATOM   4388 O  OP1   . DA  E 2 13  ? 42.739  -30.773 38.228  1.00 65.28  ? 13  DA  G OP1   1 
ATOM   4389 O  OP2   . DA  E 2 13  ? 40.359  -30.495 37.328  1.00 62.38  ? 13  DA  G OP2   1 
ATOM   4390 O  "O5'" . DA  E 2 13  ? 42.324  -30.458 35.795  1.00 59.49  ? 13  DA  G "O5'" 1 
ATOM   4391 C  "C5'" . DA  E 2 13  ? 43.714  -30.611 35.505  1.00 50.50  ? 13  DA  G "C5'" 1 
ATOM   4392 C  "C4'" . DA  E 2 13  ? 43.933  -31.116 34.087  1.00 47.68  ? 13  DA  G "C4'" 1 
ATOM   4393 O  "O4'" . DA  E 2 13  ? 43.517  -32.504 33.989  1.00 51.27  ? 13  DA  G "O4'" 1 
ATOM   4394 C  "C3'" . DA  E 2 13  ? 43.161  -30.370 33.001  1.00 47.82  ? 13  DA  G "C3'" 1 
ATOM   4395 O  "O3'" . DA  E 2 13  ? 43.958  -30.269 31.830  1.00 41.97  ? 13  DA  G "O3'" 1 
ATOM   4396 C  "C2'" . DA  E 2 13  ? 41.951  -31.269 32.772  1.00 44.20  ? 13  DA  G "C2'" 1 
ATOM   4397 C  "C1'" . DA  E 2 13  ? 42.576  -32.642 32.946  1.00 41.73  ? 13  DA  G "C1'" 1 
ATOM   4398 N  N9    . DA  E 2 13  ? 41.620  -33.678 33.320  1.00 45.37  ? 13  DA  G N9    1 
ATOM   4399 C  C8    . DA  E 2 13  ? 40.529  -33.540 34.133  1.00 45.18  ? 13  DA  G C8    1 
ATOM   4400 N  N7    . DA  E 2 13  ? 39.849  -34.649 34.298  1.00 41.56  ? 13  DA  G N7    1 
ATOM   4401 C  C5    . DA  E 2 13  ? 40.544  -35.579 33.542  1.00 42.22  ? 13  DA  G C5    1 
ATOM   4402 C  C6    . DA  E 2 13  ? 40.336  -36.951 33.299  1.00 42.96  ? 13  DA  G C6    1 
ATOM   4403 N  N6    . DA  E 2 13  ? 39.319  -37.646 33.819  1.00 53.67  ? 13  DA  G N6    1 
ATOM   4404 N  N1    . DA  E 2 13  ? 41.217  -37.584 32.495  1.00 40.43  ? 13  DA  G N1    1 
ATOM   4405 C  C2    . DA  E 2 13  ? 42.234  -36.886 31.977  1.00 37.52  ? 13  DA  G C2    1 
ATOM   4406 N  N3    . DA  E 2 13  ? 42.530  -35.597 32.131  1.00 36.38  ? 13  DA  G N3    1 
ATOM   4407 C  C4    . DA  E 2 13  ? 41.638  -34.996 32.933  1.00 38.90  ? 13  DA  G C4    1 
ATOM   4408 P  P     . DA  E 2 14  ? 43.549  -29.249 30.659  1.00 42.85  ? 14  DA  G P     1 
ATOM   4409 O  OP1   . DA  E 2 14  ? 44.709  -29.113 29.767  1.00 34.11  ? 14  DA  G OP1   1 
ATOM   4410 O  OP2   . DA  E 2 14  ? 42.975  -28.038 31.281  1.00 49.05  ? 14  DA  G OP2   1 
ATOM   4411 O  "O5'" . DA  E 2 14  ? 42.390  -30.013 29.862  1.00 45.96  ? 14  DA  G "O5'" 1 
ATOM   4412 C  "C5'" . DA  E 2 14  ? 42.657  -30.581 28.583  1.00 34.88  ? 14  DA  G "C5'" 1 
ATOM   4413 C  "C4'" . DA  E 2 14  ? 43.336  -31.933 28.714  1.00 37.88  ? 14  DA  G "C4'" 1 
ATOM   4414 O  "O4'" . DA  E 2 14  ? 42.622  -32.747 29.685  1.00 40.12  ? 14  DA  G "O4'" 1 
ATOM   4415 C  "C3'" . DA  E 2 14  ? 43.356  -32.762 27.434  1.00 34.44  ? 14  DA  G "C3'" 1 
ATOM   4416 O  "O3'" . DA  E 2 14  ? 44.497  -33.595 27.424  1.00 39.42  ? 14  DA  G "O3'" 1 
ATOM   4417 C  "C2'" . DA  E 2 14  ? 42.089  -33.587 27.578  1.00 37.55  ? 14  DA  G "C2'" 1 
ATOM   4418 C  "C1'" . DA  E 2 14  ? 42.165  -33.926 29.052  1.00 39.12  ? 14  DA  G "C1'" 1 
ATOM   4419 N  N9    . DA  E 2 14  ? 40.885  -34.311 29.632  1.00 42.14  ? 14  DA  G N9    1 
ATOM   4420 C  C8    . DA  E 2 14  ? 40.004  -33.507 30.296  1.00 40.32  ? 14  DA  G C8    1 
ATOM   4421 N  N7    . DA  E 2 14  ? 38.929  -34.133 30.712  1.00 41.35  ? 14  DA  G N7    1 
ATOM   4422 C  C5    . DA  E 2 14  ? 39.120  -35.438 30.290  1.00 38.95  ? 14  DA  G C5    1 
ATOM   4423 C  C6    . DA  E 2 14  ? 38.337  -36.602 30.420  1.00 41.20  ? 14  DA  G C6    1 
ATOM   4424 N  N6    . DA  E 2 14  ? 37.154  -36.626 31.041  1.00 47.34  ? 14  DA  G N6    1 
ATOM   4425 N  N1    . DA  E 2 14  ? 38.819  -37.743 29.884  1.00 40.33  ? 14  DA  G N1    1 
ATOM   4426 C  C2    . DA  E 2 14  ? 40.004  -37.714 29.263  1.00 43.55  ? 14  DA  G C2    1 
ATOM   4427 N  N3    . DA  E 2 14  ? 40.828  -36.683 29.078  1.00 40.44  ? 14  DA  G N3    1 
ATOM   4428 C  C4    . DA  E 2 14  ? 40.320  -35.565 29.621  1.00 38.66  ? 14  DA  G C4    1 
ATOM   4429 P  P     . DG  E 2 15  ? 44.802  -34.517 26.146  1.00 36.44  ? 15  DG  G P     1 
ATOM   4430 O  OP1   . DG  E 2 15  ? 44.431  -35.911 26.484  1.00 43.34  ? 15  DG  G OP1   1 
ATOM   4431 O  OP2   . DG  E 2 15  ? 46.199  -34.210 25.788  1.00 37.41  ? 15  DG  G OP2   1 
ATOM   4432 O  "O5'" . DG  E 2 15  ? 43.828  -33.923 25.012  1.00 38.20  ? 15  DG  G "O5'" 1 
ATOM   4433 C  "C5'" . DG  E 2 15  ? 43.686  -34.570 23.746  1.00 32.43  ? 15  DG  G "C5'" 1 
ATOM   4434 C  "C4'" . DG  E 2 15  ? 42.857  -35.839 23.866  1.00 33.50  ? 15  DG  G "C4'" 1 
ATOM   4435 O  "O4'" . DG  E 2 15  ? 41.870  -35.698 24.914  1.00 35.39  ? 15  DG  G "O4'" 1 
ATOM   4436 C  "C3'" . DG  E 2 15  ? 42.077  -36.241 22.604  1.00 38.14  ? 15  DG  G "C3'" 1 
ATOM   4437 O  "O3'" . DG  E 2 15  ? 42.508  -37.520 22.166  1.00 37.00  ? 15  DG  G "O3'" 1 
ATOM   4438 C  "C2'" . DG  E 2 15  ? 40.611  -36.270 23.065  1.00 36.02  ? 15  DG  G "C2'" 1 
ATOM   4439 C  "C1'" . DG  E 2 15  ? 40.764  -36.481 24.559  1.00 31.79  ? 15  DG  G "C1'" 1 
ATOM   4440 N  N9    . DG  E 2 15  ? 39.605  -36.065 25.347  1.00 35.34  ? 15  DG  G N9    1 
ATOM   4441 C  C8    . DG  E 2 15  ? 39.273  -34.788 25.731  1.00 35.57  ? 15  DG  G C8    1 
ATOM   4442 N  N7    . DG  E 2 15  ? 38.176  -34.727 26.436  1.00 31.95  ? 15  DG  G N7    1 
ATOM   4443 C  C5    . DG  E 2 15  ? 37.756  -36.049 26.527  1.00 33.57  ? 15  DG  G C5    1 
ATOM   4444 C  C6    . DG  E 2 15  ? 36.624  -36.605 27.173  1.00 38.73  ? 15  DG  G C6    1 
ATOM   4445 O  O6    . DG  E 2 15  ? 35.741  -36.020 27.814  1.00 38.19  ? 15  DG  G O6    1 
ATOM   4446 N  N1    . DG  E 2 15  ? 36.572  -37.989 27.020  1.00 36.79  ? 15  DG  G N1    1 
ATOM   4447 C  C2    . DG  E 2 15  ? 37.495  -38.740 26.332  1.00 46.69  ? 15  DG  G C2    1 
ATOM   4448 N  N2    . DG  E 2 15  ? 37.277  -40.062 26.294  1.00 43.08  ? 15  DG  G N2    1 
ATOM   4449 N  N3    . DG  E 2 15  ? 38.560  -38.231 25.724  1.00 43.58  ? 15  DG  G N3    1 
ATOM   4450 C  C4    . DG  E 2 15  ? 38.625  -36.884 25.862  1.00 34.60  ? 15  DG  G C4    1 
ATOM   4451 P  P     . DT  E 2 16  ? 42.268  -37.986 20.648  1.00 39.25  ? 16  DT  G P     1 
ATOM   4452 O  OP1   . DT  E 2 16  ? 43.346  -38.943 20.315  1.00 46.72  ? 16  DT  G OP1   1 
ATOM   4453 O  OP2   . DT  E 2 16  ? 42.070  -36.778 19.815  1.00 40.79  ? 16  DT  G OP2   1 
ATOM   4454 O  "O5'" . DT  E 2 16  ? 40.881  -38.778 20.705  1.00 41.33  ? 16  DT  G "O5'" 1 
ATOM   4455 C  "C5'" . DT  E 2 16  ? 40.800  -40.000 21.424  1.00 42.41  ? 16  DT  G "C5'" 1 
ATOM   4456 C  "C4'" . DT  E 2 16  ? 39.390  -40.561 21.387  1.00 44.43  ? 16  DT  G "C4'" 1 
ATOM   4457 O  "O4'" . DT  E 2 16  ? 38.547  -39.832 22.303  1.00 39.45  ? 16  DT  G "O4'" 1 
ATOM   4458 C  "C3'" . DT  E 2 16  ? 38.696  -40.500 20.021  1.00 44.77  ? 16  DT  G "C3'" 1 
ATOM   4459 O  "O3'" . DT  E 2 16  ? 38.370  -41.817 19.597  1.00 51.56  ? 16  DT  G "O3'" 1 
ATOM   4460 C  "C2'" . DT  E 2 16  ? 37.438  -39.648 20.270  1.00 41.18  ? 16  DT  G "C2'" 1 
ATOM   4461 C  "C1'" . DT  E 2 16  ? 37.251  -39.779 21.773  1.00 42.82  ? 16  DT  G "C1'" 1 
ATOM   4462 N  N1    . DT  E 2 16  ? 36.539  -38.630 22.402  1.00 39.60  ? 16  DT  G N1    1 
ATOM   4463 C  C2    . DT  E 2 16  ? 35.422  -38.871 23.167  1.00 43.29  ? 16  DT  G C2    1 
ATOM   4464 O  O2    . DT  E 2 16  ? 34.968  -39.985 23.352  1.00 50.36  ? 16  DT  G O2    1 
ATOM   4465 N  N3    . DT  E 2 16  ? 34.848  -37.752 23.710  1.00 40.56  ? 16  DT  G N3    1 
ATOM   4466 C  C4    . DT  E 2 16  ? 35.273  -36.443 23.570  1.00 37.38  ? 16  DT  G C4    1 
ATOM   4467 O  O4    . DT  E 2 16  ? 34.689  -35.503 24.099  1.00 41.83  ? 16  DT  G O4    1 
ATOM   4468 C  C5    . DT  E 2 16  ? 36.452  -36.261 22.758  1.00 37.25  ? 16  DT  G C5    1 
ATOM   4469 C  C7    . DT  E 2 16  ? 37.007  -34.885 22.534  1.00 34.19  ? 16  DT  G C7    1 
ATOM   4470 C  C6    . DT  E 2 16  ? 37.023  -37.351 22.221  1.00 41.67  ? 16  DT  G C6    1 
ATOM   4471 P  P     . DT  E 2 17  ? 37.758  -42.081 18.136  1.00 50.33  ? 17  DT  G P     1 
ATOM   4472 O  OP1   . DT  E 2 17  ? 38.290  -43.380 17.667  1.00 47.73  ? 17  DT  G OP1   1 
ATOM   4473 O  OP2   . DT  E 2 17  ? 37.964  -40.868 17.314  1.00 54.35  ? 17  DT  G OP2   1 
ATOM   4474 O  "O5'" . DT  E 2 17  ? 36.194  -42.242 18.413  1.00 45.04  ? 17  DT  G "O5'" 1 
ATOM   4475 C  "C5'" . DT  E 2 17  ? 35.750  -43.176 19.385  1.00 42.41  ? 17  DT  G "C5'" 1 
ATOM   4476 C  "C4'" . DT  E 2 17  ? 34.273  -43.000 19.681  1.00 46.92  ? 17  DT  G "C4'" 1 
ATOM   4477 O  "O4'" . DT  E 2 17  ? 34.059  -41.779 20.439  1.00 49.22  ? 17  DT  G "O4'" 1 
ATOM   4478 C  "C3'" . DT  E 2 17  ? 33.363  -42.897 18.452  1.00 51.26  ? 17  DT  G "C3'" 1 
ATOM   4479 O  "O3'" . DT  E 2 17  ? 32.193  -43.654 18.683  1.00 64.98  ? 17  DT  G "O3'" 1 
ATOM   4480 C  "C2'" . DT  E 2 17  ? 33.044  -41.405 18.397  1.00 47.38  ? 17  DT  G "C2'" 1 
ATOM   4481 C  "C1'" . DT  E 2 17  ? 32.965  -41.098 19.879  1.00 49.02  ? 17  DT  G "C1'" 1 
ATOM   4482 N  N1    . DT  E 2 17  ? 33.068  -39.652 20.212  1.00 45.32  ? 17  DT  G N1    1 
ATOM   4483 C  C2    . DT  E 2 17  ? 32.253  -39.135 21.191  1.00 46.10  ? 17  DT  G C2    1 
ATOM   4484 O  O2    . DT  E 2 17  ? 31.447  -39.805 21.809  1.00 52.19  ? 17  DT  G O2    1 
ATOM   4485 N  N3    . DT  E 2 17  ? 32.419  -37.798 21.427  1.00 49.50  ? 17  DT  G N3    1 
ATOM   4486 C  C4    . DT  E 2 17  ? 33.298  -36.941 20.793  1.00 40.29  ? 17  DT  G C4    1 
ATOM   4487 O  O4    . DT  E 2 17  ? 33.373  -35.750 21.077  1.00 41.10  ? 17  DT  G O4    1 
ATOM   4488 C  C5    . DT  E 2 17  ? 34.123  -37.547 19.773  1.00 39.09  ? 17  DT  G C5    1 
ATOM   4489 C  C7    . DT  E 2 17  ? 35.115  -36.718 19.016  1.00 39.69  ? 17  DT  G C7    1 
ATOM   4490 C  C6    . DT  E 2 17  ? 33.969  -38.859 19.534  1.00 38.84  ? 17  DT  G C6    1 
ATOM   4491 P  P     . DC  E 2 18  ? 31.413  -44.359 17.470  1.00 70.76  ? 18  DC  G P     1 
ATOM   4492 O  OP1   . DC  E 2 18  ? 31.959  -45.728 17.338  1.00 56.97  ? 18  DC  G OP1   1 
ATOM   4493 O  OP2   . DC  E 2 18  ? 31.429  -43.445 16.306  1.00 64.25  ? 18  DC  G OP2   1 
ATOM   4494 O  "O5'" . DC  E 2 18  ? 29.911  -44.445 18.010  1.00 58.75  ? 18  DC  G "O5'" 1 
ATOM   4495 C  "C5'" . DC  E 2 18  ? 29.663  -44.982 19.302  1.00 57.30  ? 18  DC  G "C5'" 1 
ATOM   4496 C  "C4'" . DC  E 2 18  ? 28.811  -44.041 20.141  1.00 61.86  ? 18  DC  G "C4'" 1 
ATOM   4497 O  "O4'" . DC  E 2 18  ? 29.510  -42.803 20.376  1.00 59.55  ? 18  DC  G "O4'" 1 
ATOM   4498 C  "C3'" . DC  E 2 18  ? 27.514  -43.591 19.507  1.00 58.39  ? 18  DC  G "C3'" 1 
ATOM   4499 O  "O3'" . DC  E 2 18  ? 26.522  -44.599 19.641  1.00 73.55  ? 18  DC  G "O3'" 1 
ATOM   4500 C  "C2'" . DC  E 2 18  ? 27.173  -42.357 20.347  1.00 60.11  ? 18  DC  G "C2'" 1 
ATOM   4501 C  "C1'" . DC  E 2 18  ? 28.554  -41.831 20.768  1.00 57.64  ? 18  DC  G "C1'" 1 
ATOM   4502 N  N1    . DC  E 2 18  ? 28.894  -40.514 20.152  1.00 51.95  ? 18  DC  G N1    1 
ATOM   4503 C  C2    . DC  E 2 18  ? 28.503  -39.335 20.796  1.00 54.50  ? 18  DC  G C2    1 
ATOM   4504 O  O2    . DC  E 2 18  ? 27.893  -39.408 21.870  1.00 58.49  ? 18  DC  G O2    1 
ATOM   4505 N  N3    . DC  E 2 18  ? 28.808  -38.143 20.227  1.00 55.10  ? 18  DC  G N3    1 
ATOM   4506 C  C4    . DC  E 2 18  ? 29.467  -38.106 19.069  1.00 49.99  ? 18  DC  G C4    1 
ATOM   4507 N  N4    . DC  E 2 18  ? 29.745  -36.906 18.547  1.00 45.85  ? 18  DC  G N4    1 
ATOM   4508 C  C5    . DC  E 2 18  ? 29.869  -39.297 18.394  1.00 46.70  ? 18  DC  G C5    1 
ATOM   4509 C  C6    . DC  E 2 18  ? 29.562  -40.468 18.964  1.00 49.56  ? 18  DC  G C6    1 
ATOM   4510 P  P     . DC  E 2 19  ? 25.222  -44.581 18.695  1.00 68.35  ? 19  DC  G P     1 
ATOM   4511 O  OP1   . DC  E 2 19  ? 24.468  -45.826 18.961  1.00 77.56  ? 19  DC  G OP1   1 
ATOM   4512 O  OP2   . DC  E 2 19  ? 25.670  -44.275 17.319  1.00 62.63  ? 19  DC  G OP2   1 
ATOM   4513 O  "O5'" . DC  E 2 19  ? 24.367  -43.336 19.229  1.00 63.77  ? 19  DC  G "O5'" 1 
ATOM   4514 C  "C5'" . DC  E 2 19  ? 23.758  -43.395 20.515  1.00 62.65  ? 19  DC  G "C5'" 1 
ATOM   4515 C  "C4'" . DC  E 2 19  ? 23.176  -42.048 20.919  1.00 65.80  ? 19  DC  G "C4'" 1 
ATOM   4516 O  "O4'" . DC  E 2 19  ? 24.208  -41.044 20.923  1.00 64.04  ? 19  DC  G "O4'" 1 
ATOM   4517 C  "C3'" . DC  E 2 19  ? 22.128  -41.481 19.983  1.00 70.56  ? 19  DC  G "C3'" 1 
ATOM   4518 O  "O3'" . DC  E 2 19  ? 20.854  -42.055 20.265  1.00 83.92  ? 19  DC  G "O3'" 1 
ATOM   4519 C  "C2'" . DC  E 2 19  ? 22.157  -39.990 20.335  1.00 65.53  ? 19  DC  G "C2'" 1 
ATOM   4520 C  "C1'" . DC  E 2 19  ? 23.592  -39.772 20.837  1.00 64.93  ? 19  DC  G "C1'" 1 
ATOM   4521 N  N1    . DC  E 2 19  ? 24.401  -38.893 19.946  1.00 53.26  ? 19  DC  G N1    1 
ATOM   4522 C  C2    . DC  E 2 19  ? 24.342  -37.505 20.112  1.00 54.80  ? 19  DC  G C2    1 
ATOM   4523 O  O2    . DC  E 2 19  ? 23.623  -37.033 21.002  1.00 53.96  ? 19  DC  G O2    1 
ATOM   4524 N  N3    . DC  E 2 19  ? 25.079  -36.715 19.292  1.00 51.70  ? 19  DC  G N3    1 
ATOM   4525 C  C4    . DC  E 2 19  ? 25.842  -37.263 18.346  1.00 52.73  ? 19  DC  G C4    1 
ATOM   4526 N  N4    . DC  E 2 19  ? 26.552  -36.443 17.562  1.00 44.04  ? 19  DC  G N4    1 
ATOM   4527 C  C5    . DC  E 2 19  ? 25.912  -38.675 18.160  1.00 50.91  ? 19  DC  G C5    1 
ATOM   4528 C  C6    . DC  E 2 19  ? 25.180  -39.445 18.973  1.00 56.59  ? 19  DC  G C6    1 
ATOM   4529 P  P     . DG  E 2 20  ? 19.649  -41.918 19.210  1.00 83.56  ? 20  DG  G P     1 
ATOM   4530 O  OP1   . DG  E 2 20  ? 18.518  -42.728 19.712  1.00 91.38  ? 20  DG  G OP1   1 
ATOM   4531 O  OP2   . DG  E 2 20  ? 20.197  -42.171 17.859  1.00 72.73  ? 20  DG  G OP2   1 
ATOM   4532 O  "O5'" . DG  E 2 20  ? 19.239  -40.373 19.278  1.00 72.23  ? 20  DG  G "O5'" 1 
ATOM   4533 C  "C5'" . DG  E 2 20  ? 18.609  -39.845 20.441  1.00 65.87  ? 20  DG  G "C5'" 1 
ATOM   4534 C  "C4'" . DG  E 2 20  ? 18.159  -38.417 20.194  1.00 69.55  ? 20  DG  G "C4'" 1 
ATOM   4535 O  "O4'" . DG  E 2 20  ? 19.324  -37.584 19.953  1.00 68.93  ? 20  DG  G "O4'" 1 
ATOM   4536 C  "C3'" . DG  E 2 20  ? 17.243  -38.243 18.982  1.00 75.46  ? 20  DG  G "C3'" 1 
ATOM   4537 O  "O3'" . DG  E 2 20  ? 16.158  -37.378 19.288  1.00 74.34  ? 20  DG  G "O3'" 1 
ATOM   4538 C  "C2'" . DG  E 2 20  ? 18.156  -37.644 17.916  1.00 73.04  ? 20  DG  G "C2'" 1 
ATOM   4539 C  "C1'" . DG  E 2 20  ? 19.172  -36.873 18.744  1.00 68.40  ? 20  DG  G "C1'" 1 
ATOM   4540 N  N9    . DG  E 2 20  ? 20.474  -36.786 18.088  1.00 62.00  ? 20  DG  G N9    1 
ATOM   4541 C  C8    . DG  E 2 20  ? 21.190  -37.824 17.544  1.00 61.98  ? 20  DG  G C8    1 
ATOM   4542 N  N7    . DG  E 2 20  ? 22.318  -37.452 17.007  1.00 60.48  ? 20  DG  G N7    1 
ATOM   4543 C  C5    . DG  E 2 20  ? 22.350  -36.078 17.201  1.00 50.23  ? 20  DG  G C5    1 
ATOM   4544 C  C6    . DG  E 2 20  ? 23.332  -35.131 16.830  1.00 46.02  ? 20  DG  G C6    1 
ATOM   4545 O  O6    . DG  E 2 20  ? 24.401  -35.329 16.236  1.00 50.71  ? 20  DG  G O6    1 
ATOM   4546 N  N1    . DG  E 2 20  ? 22.977  -33.841 17.217  1.00 45.96  ? 20  DG  G N1    1 
ATOM   4547 C  C2    . DG  E 2 20  ? 21.817  -33.510 17.878  1.00 46.21  ? 20  DG  G C2    1 
ATOM   4548 N  N2    . DG  E 2 20  ? 21.648  -32.212 18.167  1.00 41.20  ? 20  DG  G N2    1 
ATOM   4549 N  N3    . DG  E 2 20  ? 20.888  -34.389 18.232  1.00 49.68  ? 20  DG  G N3    1 
ATOM   4550 C  C4    . DG  E 2 20  ? 21.221  -35.650 17.864  1.00 49.41  ? 20  DG  G C4    1 
ATOM   4551 P  P     . DG  E 2 21  ? 15.036  -37.085 18.174  1.00 84.94  ? 21  DG  G P     1 
ATOM   4552 O  OP1   . DG  E 2 21  ? 13.774  -36.772 18.880  1.00 86.55  ? 21  DG  G OP1   1 
ATOM   4553 O  OP2   . DG  E 2 21  ? 15.073  -38.194 17.195  1.00 74.60  ? 21  DG  G OP2   1 
ATOM   4554 O  "O5'" . DG  E 2 21  ? 15.559  -35.760 17.444  1.00 70.55  ? 21  DG  G "O5'" 1 
ATOM   4555 C  "C5'" . DG  E 2 21  ? 15.567  -34.530 18.153  1.00 69.96  ? 21  DG  G "C5'" 1 
ATOM   4556 C  "C4'" . DG  E 2 21  ? 16.424  -33.486 17.455  1.00 71.76  ? 21  DG  G "C4'" 1 
ATOM   4557 O  "O4'" . DG  E 2 21  ? 17.724  -34.021 17.158  1.00 70.83  ? 21  DG  G "O4'" 1 
ATOM   4558 C  "C3'" . DG  E 2 21  ? 15.915  -33.010 16.104  1.00 64.54  ? 21  DG  G "C3'" 1 
ATOM   4559 O  "O3'" . DG  E 2 21  ? 15.011  -31.923 16.268  1.00 74.05  ? 21  DG  G "O3'" 1 
ATOM   4560 C  "C2'" . DG  E 2 21  ? 17.198  -32.558 15.388  1.00 62.17  ? 21  DG  G "C2'" 1 
ATOM   4561 C  "C1'" . DG  E 2 21  ? 18.326  -33.131 16.251  1.00 65.01  ? 21  DG  G "C1'" 1 
ATOM   4562 N  N9    . DG  E 2 21  ? 19.343  -33.820 15.466  1.00 57.91  ? 21  DG  G N9    1 
ATOM   4563 C  C8    . DG  E 2 21  ? 19.453  -35.169 15.230  1.00 55.95  ? 21  DG  G C8    1 
ATOM   4564 N  N7    . DG  E 2 21  ? 20.468  -35.479 14.468  1.00 52.01  ? 21  DG  G N7    1 
ATOM   4565 C  C5    . DG  E 2 21  ? 21.057  -34.254 14.173  1.00 46.95  ? 21  DG  G C5    1 
ATOM   4566 C  C6    . DG  E 2 21  ? 22.194  -33.951 13.385  1.00 43.44  ? 21  DG  G C6    1 
ATOM   4567 O  O6    . DG  E 2 21  ? 22.932  -34.733 12.771  1.00 48.17  ? 21  DG  G O6    1 
ATOM   4568 N  N1    . DG  E 2 21  ? 22.446  -32.581 13.348  1.00 38.82  ? 21  DG  G N1    1 
ATOM   4569 C  C2    . DG  E 2 21  ? 21.694  -31.626 13.991  1.00 42.14  ? 21  DG  G C2    1 
ATOM   4570 N  N2    . DG  E 2 21  ? 22.090  -30.354 13.839  1.00 40.99  ? 21  DG  G N2    1 
ATOM   4571 N  N3    . DG  E 2 21  ? 20.629  -31.897 14.730  1.00 44.86  ? 21  DG  G N3    1 
ATOM   4572 C  C4    . DG  E 2 21  ? 20.371  -33.227 14.776  1.00 47.33  ? 21  DG  G C4    1 
ATOM   4573 P  P     . DC  E 2 22  ? 14.177  -31.369 15.009  1.00 74.69  ? 22  DC  G P     1 
ATOM   4574 O  OP1   . DC  E 2 22  ? 13.121  -30.471 15.525  1.00 69.90  ? 22  DC  G OP1   1 
ATOM   4575 O  OP2   . DC  E 2 22  ? 13.819  -32.532 14.168  1.00 68.20  ? 22  DC  G OP2   1 
ATOM   4576 O  "O5'" . DC  E 2 22  ? 15.234  -30.493 14.185  1.00 65.03  ? 22  DC  G "O5'" 1 
ATOM   4577 C  "C5'" . DC  E 2 22  ? 15.875  -29.380 14.795  1.00 62.05  ? 22  DC  G "C5'" 1 
ATOM   4578 C  "C4'" . DC  E 2 22  ? 16.834  -28.718 13.823  1.00 63.20  ? 22  DC  G "C4'" 1 
ATOM   4579 O  "O4'" . DC  E 2 22  ? 17.919  -29.630 13.504  1.00 55.16  ? 22  DC  G "O4'" 1 
ATOM   4580 C  "C3'" . DC  E 2 22  ? 16.211  -28.306 12.487  1.00 59.34  ? 22  DC  G "C3'" 1 
ATOM   4581 O  "O3'" . DC  E 2 22  ? 16.582  -26.972 12.171  1.00 58.61  ? 22  DC  G "O3'" 1 
ATOM   4582 C  "C2'" . DC  E 2 22  ? 16.794  -29.311 11.490  1.00 54.70  ? 22  DC  G "C2'" 1 
ATOM   4583 C  "C1'" . DC  E 2 22  ? 18.141  -29.621 12.114  1.00 57.40  ? 22  DC  G "C1'" 1 
ATOM   4584 N  N1    . DC  E 2 22  ? 18.689  -30.949 11.709  1.00 51.26  ? 22  DC  G N1    1 
ATOM   4585 C  C2    . DC  E 2 22  ? 19.881  -31.013 10.981  1.00 41.11  ? 22  DC  G C2    1 
ATOM   4586 O  O2    . DC  E 2 22  ? 20.466  -29.964 10.688  1.00 47.25  ? 22  DC  G O2    1 
ATOM   4587 N  N3    . DC  E 2 22  ? 20.364  -32.228 10.619  1.00 38.89  ? 22  DC  G N3    1 
ATOM   4588 C  C4    . DC  E 2 22  ? 19.702  -33.337 10.955  1.00 43.81  ? 22  DC  G C4    1 
ATOM   4589 N  N4    . DC  E 2 22  ? 20.217  -34.511 10.576  1.00 41.76  ? 22  DC  G N4    1 
ATOM   4590 C  C5    . DC  E 2 22  ? 18.484  -33.290 11.694  1.00 49.07  ? 22  DC  G C5    1 
ATOM   4591 C  C6    . DC  E 2 22  ? 18.018  -32.087 12.045  1.00 50.27  ? 22  DC  G C6    1 
ATOM   4592 P  P     . DG  E 2 23  ? 16.091  -26.290 10.802  1.00 74.78  ? 23  DG  G P     1 
ATOM   4593 O  OP1   . DG  E 2 23  ? 15.851  -24.859 11.088  1.00 65.20  ? 23  DG  G OP1   1 
ATOM   4594 O  OP2   . DG  E 2 23  ? 15.003  -27.112 10.224  1.00 60.53  ? 23  DG  G OP2   1 
ATOM   4595 O  "O5'" . DG  E 2 23  ? 17.367  -26.409 9.848   1.00 67.46  ? 23  DG  G "O5'" 1 
ATOM   4596 C  "C5'" . DG  E 2 23  ? 18.646  -26.009 10.330  1.00 58.59  ? 23  DG  G "C5'" 1 
ATOM   4597 C  "C4'" . DG  E 2 23  ? 19.610  -25.743 9.185   1.00 61.13  ? 23  DG  G "C4'" 1 
ATOM   4598 O  "O4'" . DG  E 2 23  ? 20.273  -26.973 8.803   1.00 51.19  ? 23  DG  G "O4'" 1 
ATOM   4599 C  "C3'" . DG  E 2 23  ? 18.982  -25.196 7.912   1.00 54.77  ? 23  DG  G "C3'" 1 
ATOM   4600 O  "O3'" . DG  E 2 23  ? 19.902  -24.334 7.262   1.00 56.73  ? 23  DG  G "O3'" 1 
ATOM   4601 C  "C2'" . DG  E 2 23  ? 18.717  -26.459 7.093   1.00 45.33  ? 23  DG  G "C2'" 1 
ATOM   4602 C  "C1'" . DG  E 2 23  ? 19.882  -27.360 7.500   1.00 52.90  ? 23  DG  G "C1'" 1 
ATOM   4603 N  N9    . DG  E 2 23  ? 19.540  -28.778 7.540   1.00 46.30  ? 23  DG  G N9    1 
ATOM   4604 C  C8    . DG  E 2 23  ? 18.475  -29.354 8.191   1.00 41.65  ? 23  DG  G C8    1 
ATOM   4605 N  N7    . DG  E 2 23  ? 18.429  -30.651 8.064   1.00 37.47  ? 23  DG  G N7    1 
ATOM   4606 C  C5    . DG  E 2 23  ? 19.538  -30.956 7.285   1.00 39.30  ? 23  DG  G C5    1 
ATOM   4607 C  C6    . DG  E 2 23  ? 20.008  -32.206 6.818   1.00 36.96  ? 23  DG  G C6    1 
ATOM   4608 O  O6    . DG  E 2 23  ? 19.521  -33.329 7.008   1.00 44.23  ? 23  DG  G O6    1 
ATOM   4609 N  N1    . DG  E 2 23  ? 21.167  -32.069 6.058   1.00 36.80  ? 23  DG  G N1    1 
ATOM   4610 C  C2    . DG  E 2 23  ? 21.792  -30.876 5.785   1.00 36.84  ? 23  DG  G C2    1 
ATOM   4611 N  N2    . DG  E 2 23  ? 22.901  -30.945 5.034   1.00 36.03  ? 23  DG  G N2    1 
ATOM   4612 N  N3    . DG  E 2 23  ? 21.362  -29.698 6.216   1.00 39.58  ? 23  DG  G N3    1 
ATOM   4613 C  C4    . DG  E 2 23  ? 20.233  -29.813 6.957   1.00 42.89  ? 23  DG  G C4    1 
ATOM   4614 P  P     . DC  E 2 24  ? 19.403  -23.332 6.111   1.00 65.92  ? 24  DC  G P     1 
ATOM   4615 O  OP1   . DC  E 2 24  ? 20.285  -22.144 6.144   1.00 57.52  ? 24  DC  G OP1   1 
ATOM   4616 O  OP2   . DC  E 2 24  ? 17.938  -23.170 6.252   1.00 64.78  ? 24  DC  G OP2   1 
ATOM   4617 O  "O5'" . DC  E 2 24  ? 19.681  -24.142 4.762   1.00 65.24  ? 24  DC  G "O5'" 1 
ATOM   4618 C  "C5'" . DC  E 2 24  ? 20.990  -24.623 4.485   1.00 49.12  ? 24  DC  G "C5'" 1 
ATOM   4619 C  "C4'" . DC  E 2 24  ? 20.991  -25.510 3.255   1.00 47.28  ? 24  DC  G "C4'" 1 
ATOM   4620 O  "O4'" . DC  E 2 24  ? 20.761  -26.891 3.641   1.00 46.59  ? 24  DC  G "O4'" 1 
ATOM   4621 C  "C3'" . DC  E 2 24  ? 19.918  -25.175 2.209   1.00 48.60  ? 24  DC  G "C3'" 1 
ATOM   4622 O  "O3'" . DC  E 2 24  ? 20.509  -25.105 0.920   1.00 48.15  ? 24  DC  G "O3'" 1 
ATOM   4623 C  "C2'" . DC  E 2 24  ? 18.946  -26.352 2.313   1.00 46.54  ? 24  DC  G "C2'" 1 
ATOM   4624 C  "C1'" . DC  E 2 24  ? 19.890  -27.471 2.706   1.00 43.42  ? 24  DC  G "C1'" 1 
ATOM   4625 N  N1    . DC  E 2 24  ? 19.211  -28.642 3.328   1.00 37.61  ? 24  DC  G N1    1 
ATOM   4626 C  C2    . DC  E 2 24  ? 19.701  -29.930 3.087   1.00 39.01  ? 24  DC  G C2    1 
ATOM   4627 O  O2    . DC  E 2 24  ? 20.699  -30.070 2.369   1.00 40.14  ? 24  DC  G O2    1 
ATOM   4628 N  N3    . DC  E 2 24  ? 19.070  -30.989 3.651   1.00 33.68  ? 24  DC  G N3    1 
ATOM   4629 C  C4    . DC  E 2 24  ? 17.996  -30.795 4.418   1.00 36.78  ? 24  DC  G C4    1 
ATOM   4630 N  N4    . DC  E 2 24  ? 17.408  -31.870 4.954   1.00 39.30  ? 24  DC  G N4    1 
ATOM   4631 C  C5    . DC  E 2 24  ? 17.479  -29.490 4.673   1.00 38.63  ? 24  DC  G C5    1 
ATOM   4632 C  C6    . DC  E 2 24  ? 18.109  -28.453 4.110   1.00 36.16  ? 24  DC  G C6    1 
ATOM   4633 P  P     . DG  E 2 25  ? 19.784  -24.300 -0.267  1.00 45.67  ? 25  DG  G P     1 
ATOM   4634 O  OP1   . DG  E 2 25  ? 20.479  -23.003 -0.415  1.00 55.78  ? 25  DG  G OP1   1 
ATOM   4635 O  OP2   . DG  E 2 25  ? 18.324  -24.325 -0.028  1.00 47.30  ? 25  DG  G OP2   1 
ATOM   4636 O  "O5'" . DG  E 2 25  ? 20.079  -25.191 -1.561  1.00 47.57  ? 25  DG  G "O5'" 1 
ATOM   4637 C  "C5'" . DG  E 2 25  ? 21.422  -25.436 -1.965  1.00 44.00  ? 25  DG  G "C5'" 1 
ATOM   4638 C  "C4'" . DG  E 2 25  ? 21.501  -26.649 -2.879  1.00 44.21  ? 25  DG  G "C4'" 1 
ATOM   4639 O  "O4'" . DG  E 2 25  ? 21.205  -27.849 -2.119  1.00 39.09  ? 25  DG  G "O4'" 1 
ATOM   4640 C  "C3'" . DG  E 2 25  ? 20.528  -26.640 -4.055  1.00 40.46  ? 25  DG  G "C3'" 1 
ATOM   4641 O  "O3'" . DG  E 2 25  ? 21.146  -27.206 -5.204  1.00 44.32  ? 25  DG  G "O3'" 1 
ATOM   4642 C  "C2'" . DG  E 2 25  ? 19.373  -27.504 -3.557  1.00 32.64  ? 25  DG  G "C2'" 1 
ATOM   4643 C  "C1'" . DG  E 2 25  ? 20.090  -28.517 -2.673  1.00 38.22  ? 25  DG  G "C1'" 1 
ATOM   4644 N  N9    . DG  E 2 25  ? 19.264  -29.013 -1.576  1.00 39.02  ? 25  DG  G N9    1 
ATOM   4645 C  C8    . DG  E 2 25  ? 18.540  -28.261 -0.683  1.00 34.95  ? 25  DG  G C8    1 
ATOM   4646 N  N7    . DG  E 2 25  ? 17.894  -28.975 0.195   1.00 36.75  ? 25  DG  G N7    1 
ATOM   4647 C  C5    . DG  E 2 25  ? 18.210  -30.286 -0.134  1.00 31.70  ? 25  DG  G C5    1 
ATOM   4648 C  C6    . DG  E 2 25  ? 17.802  -31.500 0.468   1.00 34.05  ? 25  DG  G C6    1 
ATOM   4649 O  O6    . DG  E 2 25  ? 17.054  -31.660 1.443   1.00 36.27  ? 25  DG  G O6    1 
ATOM   4650 N  N1    . DG  E 2 25  ? 18.352  -32.605 -0.177  1.00 37.11  ? 25  DG  G N1    1 
ATOM   4651 C  C2    . DG  E 2 25  ? 19.191  -32.544 -1.265  1.00 37.76  ? 25  DG  G C2    1 
ATOM   4652 N  N2    . DG  E 2 25  ? 19.622  -33.718 -1.750  1.00 41.41  ? 25  DG  G N2    1 
ATOM   4653 N  N3    . DG  E 2 25  ? 19.581  -31.413 -1.838  1.00 34.74  ? 25  DG  G N3    1 
ATOM   4654 C  C4    . DG  E 2 25  ? 19.054  -30.327 -1.222  1.00 35.90  ? 25  DG  G C4    1 
ATOM   4655 O  "O5'" . DC  F 3 1   ? 14.246  -40.007 -0.973  1.00 67.61  ? 1   DC  I "O5'" 1 
ATOM   4656 C  "C5'" . DC  F 3 1   ? 15.297  -40.830 -0.481  1.00 49.49  ? 1   DC  I "C5'" 1 
ATOM   4657 C  "C4'" . DC  F 3 1   ? 16.600  -40.520 -1.193  1.00 55.90  ? 1   DC  I "C4'" 1 
ATOM   4658 O  "O4'" . DC  F 3 1   ? 16.744  -39.083 -1.329  1.00 51.72  ? 1   DC  I "O4'" 1 
ATOM   4659 C  "C3'" . DC  F 3 1   ? 17.854  -40.983 -0.468  1.00 54.51  ? 1   DC  I "C3'" 1 
ATOM   4660 O  "O3'" . DC  F 3 1   ? 18.892  -41.228 -1.409  1.00 59.06  ? 1   DC  I "O3'" 1 
ATOM   4661 C  "C2'" . DC  F 3 1   ? 18.171  -39.784 0.416   1.00 54.59  ? 1   DC  I "C2'" 1 
ATOM   4662 C  "C1'" . DC  F 3 1   ? 17.799  -38.623 -0.503  1.00 55.94  ? 1   DC  I "C1'" 1 
ATOM   4663 N  N1    . DC  F 3 1   ? 17.330  -37.409 0.224   1.00 46.49  ? 1   DC  I N1    1 
ATOM   4664 C  C2    . DC  F 3 1   ? 17.930  -36.172 -0.036  1.00 40.26  ? 1   DC  I C2    1 
ATOM   4665 O  O2    . DC  F 3 1   ? 18.845  -36.109 -0.866  1.00 43.93  ? 1   DC  I O2    1 
ATOM   4666 N  N3    . DC  F 3 1   ? 17.489  -35.076 0.630   1.00 40.24  ? 1   DC  I N3    1 
ATOM   4667 C  C4    . DC  F 3 1   ? 16.498  -35.187 1.517   1.00 43.37  ? 1   DC  I C4    1 
ATOM   4668 N  N4    . DC  F 3 1   ? 16.098  -34.078 2.149   1.00 39.30  ? 1   DC  I N4    1 
ATOM   4669 C  C5    . DC  F 3 1   ? 15.874  -36.438 1.795   1.00 46.56  ? 1   DC  I C5    1 
ATOM   4670 C  C6    . DC  F 3 1   ? 16.317  -37.512 1.132   1.00 51.10  ? 1   DC  I C6    1 
ATOM   4671 P  P     . DG  F 3 2   ? 20.198  -42.061 -0.981  1.00 67.61  ? 2   DG  I P     1 
ATOM   4672 O  OP1   . DG  F 3 2   ? 20.614  -42.864 -2.152  1.00 62.54  ? 2   DG  I OP1   1 
ATOM   4673 O  OP2   . DG  F 3 2   ? 19.910  -42.732 0.306   1.00 53.87  ? 2   DG  I OP2   1 
ATOM   4674 O  "O5'" . DG  F 3 2   ? 21.302  -40.932 -0.719  1.00 59.63  ? 2   DG  I "O5'" 1 
ATOM   4675 C  "C5'" . DG  F 3 2   ? 21.701  -40.075 -1.783  1.00 52.36  ? 2   DG  I "C5'" 1 
ATOM   4676 C  "C4'" . DG  F 3 2   ? 22.547  -38.922 -1.271  1.00 57.40  ? 2   DG  I "C4'" 1 
ATOM   4677 O  "O4'" . DG  F 3 2   ? 21.703  -37.942 -0.612  1.00 59.32  ? 2   DG  I "O4'" 1 
ATOM   4678 C  "C3'" . DG  F 3 2   ? 23.630  -39.306 -0.254  1.00 55.10  ? 2   DG  I "C3'" 1 
ATOM   4679 O  "O3'" . DG  F 3 2   ? 24.867  -38.710 -0.625  1.00 60.73  ? 2   DG  I "O3'" 1 
ATOM   4680 C  "C2'" . DG  F 3 2   ? 23.101  -38.729 1.061   1.00 46.26  ? 2   DG  I "C2'" 1 
ATOM   4681 C  "C1'" . DG  F 3 2   ? 22.342  -37.514 0.564   1.00 47.14  ? 2   DG  I "C1'" 1 
ATOM   4682 N  N9    . DG  F 3 2   ? 21.331  -37.024 1.497   1.00 43.22  ? 2   DG  I N9    1 
ATOM   4683 C  C8    . DG  F 3 2   ? 20.469  -37.776 2.257   1.00 44.53  ? 2   DG  I C8    1 
ATOM   4684 N  N7    . DG  F 3 2   ? 19.671  -37.059 3.000   1.00 46.47  ? 2   DG  I N7    1 
ATOM   4685 C  C5    . DG  F 3 2   ? 20.027  -35.747 2.712   1.00 43.42  ? 2   DG  I C5    1 
ATOM   4686 C  C6    . DG  F 3 2   ? 19.508  -34.530 3.215   1.00 41.68  ? 2   DG  I C6    1 
ATOM   4687 O  O6    . DG  F 3 2   ? 18.601  -34.365 4.042   1.00 40.94  ? 2   DG  I O6    1 
ATOM   4688 N  N1    . DG  F 3 2   ? 20.152  -33.426 2.660   1.00 35.63  ? 2   DG  I N1    1 
ATOM   4689 C  C2    . DG  F 3 2   ? 21.168  -33.492 1.736   1.00 38.91  ? 2   DG  I C2    1 
ATOM   4690 N  N2    . DG  F 3 2   ? 21.666  -32.320 1.315   1.00 40.30  ? 2   DG  I N2    1 
ATOM   4691 N  N3    . DG  F 3 2   ? 21.663  -34.626 1.258   1.00 43.05  ? 2   DG  I N3    1 
ATOM   4692 C  C4    . DG  F 3 2   ? 21.047  -35.709 1.788   1.00 39.80  ? 2   DG  I C4    1 
ATOM   4693 P  P     . DC  F 3 3   ? 26.254  -39.293 -0.059  1.00 61.71  ? 3   DC  I P     1 
ATOM   4694 O  OP1   . DC  F 3 3   ? 27.351  -38.591 -0.762  1.00 55.06  ? 3   DC  I OP1   1 
ATOM   4695 O  OP2   . DC  F 3 3   ? 26.175  -40.770 -0.101  1.00 63.02  ? 3   DC  I OP2   1 
ATOM   4696 O  "O5'" . DC  F 3 3   ? 26.258  -38.851 1.477   1.00 56.82  ? 3   DC  I "O5'" 1 
ATOM   4697 C  "C5'" . DC  F 3 3   ? 27.337  -38.087 1.995   1.00 56.71  ? 3   DC  I "C5'" 1 
ATOM   4698 C  "C4'" . DC  F 3 3   ? 26.954  -36.622 2.113   1.00 56.50  ? 3   DC  I "C4'" 1 
ATOM   4699 O  "O4'" . DC  F 3 3   ? 25.562  -36.516 2.460   1.00 51.82  ? 3   DC  I "O4'" 1 
ATOM   4700 C  "C3'" . DC  F 3 3   ? 27.709  -35.851 3.195   1.00 44.03  ? 3   DC  I "C3'" 1 
ATOM   4701 O  "O3'" . DC  F 3 3   ? 28.703  -35.027 2.601   1.00 44.42  ? 3   DC  I "O3'" 1 
ATOM   4702 C  "C2'" . DC  F 3 3   ? 26.632  -35.015 3.912   1.00 42.62  ? 3   DC  I "C2'" 1 
ATOM   4703 C  "C1'" . DC  F 3 3   ? 25.358  -35.294 3.116   1.00 43.80  ? 3   DC  I "C1'" 1 
ATOM   4704 N  N1    . DC  F 3 3   ? 24.139  -35.416 3.968   1.00 42.54  ? 3   DC  I N1    1 
ATOM   4705 C  C2    . DC  F 3 3   ? 23.493  -34.263 4.426   1.00 38.22  ? 3   DC  I C2    1 
ATOM   4706 O  O2    . DC  F 3 3   ? 23.946  -33.154 4.117   1.00 43.30  ? 3   DC  I O2    1 
ATOM   4707 N  N3    . DC  F 3 3   ? 22.386  -34.393 5.199   1.00 33.37  ? 3   DC  I N3    1 
ATOM   4708 C  C4    . DC  F 3 3   ? 21.929  -35.608 5.511   1.00 38.53  ? 3   DC  I C4    1 
ATOM   4709 N  N4    . DC  F 3 3   ? 20.834  -35.687 6.275   1.00 40.65  ? 3   DC  I N4    1 
ATOM   4710 C  C5    . DC  F 3 3   ? 22.573  -36.794 5.053   1.00 41.94  ? 3   DC  I C5    1 
ATOM   4711 C  C6    . DC  F 3 3   ? 23.664  -36.653 4.293   1.00 43.48  ? 3   DC  I C6    1 
ATOM   4712 P  P     . DG  F 3 4   ? 29.984  -34.569 3.455   1.00 42.93  ? 4   DG  I P     1 
ATOM   4713 O  OP1   . DG  F 3 4   ? 31.003  -34.078 2.500   1.00 39.31  ? 4   DG  I OP1   1 
ATOM   4714 O  OP2   . DG  F 3 4   ? 30.316  -35.665 4.392   1.00 42.03  ? 4   DG  I OP2   1 
ATOM   4715 O  "O5'" . DG  F 3 4   ? 29.449  -33.328 4.310   1.00 43.10  ? 4   DG  I "O5'" 1 
ATOM   4716 C  "C5'" . DG  F 3 4   ? 29.025  -32.149 3.642   1.00 38.38  ? 4   DG  I "C5'" 1 
ATOM   4717 C  "C4'" . DG  F 3 4   ? 28.362  -31.181 4.604   1.00 39.20  ? 4   DG  I "C4'" 1 
ATOM   4718 O  "O4'" . DG  F 3 4   ? 27.123  -31.746 5.100   1.00 42.77  ? 4   DG  I "O4'" 1 
ATOM   4719 C  "C3'" . DG  F 3 4   ? 29.189  -30.807 5.841   1.00 39.23  ? 4   DG  I "C3'" 1 
ATOM   4720 O  "O3'" . DG  F 3 4   ? 29.235  -29.390 5.959   1.00 40.01  ? 4   DG  I "O3'" 1 
ATOM   4721 C  "C2'" . DG  F 3 4   ? 28.420  -31.452 7.000   1.00 38.09  ? 4   DG  I "C2'" 1 
ATOM   4722 C  "C1'" . DG  F 3 4   ? 27.000  -31.439 6.464   1.00 35.20  ? 4   DG  I "C1'" 1 
ATOM   4723 N  N9    . DG  F 3 4   ? 26.120  -32.426 7.083   1.00 38.59  ? 4   DG  I N9    1 
ATOM   4724 C  C8    . DG  F 3 4   ? 26.260  -33.793 7.062   1.00 36.58  ? 4   DG  I C8    1 
ATOM   4725 N  N7    . DG  F 3 4   ? 25.308  -34.422 7.692   1.00 37.76  ? 4   DG  I N7    1 
ATOM   4726 C  C5    . DG  F 3 4   ? 24.480  -33.408 8.158   1.00 38.76  ? 4   DG  I C5    1 
ATOM   4727 C  C6    . DG  F 3 4   ? 23.285  -33.480 8.912   1.00 39.89  ? 4   DG  I C6    1 
ATOM   4728 O  O6    . DG  F 3 4   ? 22.702  -34.487 9.331   1.00 42.13  ? 4   DG  I O6    1 
ATOM   4729 N  N1    . DG  F 3 4   ? 22.763  -32.215 9.173   1.00 36.76  ? 4   DG  I N1    1 
ATOM   4730 C  C2    . DG  F 3 4   ? 23.326  -31.032 8.757   1.00 38.12  ? 4   DG  I C2    1 
ATOM   4731 N  N2    . DG  F 3 4   ? 22.678  -29.911 9.104   1.00 40.88  ? 4   DG  I N2    1 
ATOM   4732 N  N3    . DG  F 3 4   ? 24.445  -30.951 8.050   1.00 41.85  ? 4   DG  I N3    1 
ATOM   4733 C  C4    . DG  F 3 4   ? 24.966  -32.174 7.788   1.00 34.85  ? 4   DG  I C4    1 
ATOM   4734 P  P     . DC  F 3 5   ? 29.970  -28.682 7.199   1.00 41.31  ? 5   DC  I P     1 
ATOM   4735 O  OP1   . DC  F 3 5   ? 30.579  -27.437 6.683   1.00 36.53  ? 5   DC  I OP1   1 
ATOM   4736 O  OP2   . DC  F 3 5   ? 30.823  -29.676 7.890   1.00 38.86  ? 5   DC  I OP2   1 
ATOM   4737 O  "O5'" . DC  F 3 5   ? 28.767  -28.282 8.172   1.00 40.58  ? 5   DC  I "O5'" 1 
ATOM   4738 C  "C5'" . DC  F 3 5   ? 28.956  -27.268 9.144   1.00 39.66  ? 5   DC  I "C5'" 1 
ATOM   4739 C  "C4'" . DC  F 3 5   ? 27.634  -26.839 9.753   1.00 40.90  ? 5   DC  I "C4'" 1 
ATOM   4740 O  "O4'" . DC  F 3 5   ? 26.689  -27.940 9.691   1.00 34.56  ? 5   DC  I "O4'" 1 
ATOM   4741 C  "C3'" . DC  F 3 5   ? 27.716  -26.428 11.222  1.00 39.73  ? 5   DC  I "C3'" 1 
ATOM   4742 O  "O3'" . DC  F 3 5   ? 26.882  -25.307 11.470  1.00 41.88  ? 5   DC  I "O3'" 1 
ATOM   4743 C  "C2'" . DC  F 3 5   ? 27.225  -27.668 11.961  1.00 36.45  ? 5   DC  I "C2'" 1 
ATOM   4744 C  "C1'" . DC  F 3 5   ? 26.205  -28.235 10.984  1.00 35.19  ? 5   DC  I "C1'" 1 
ATOM   4745 N  N1    . DC  F 3 5   ? 26.043  -29.709 11.098  1.00 36.39  ? 5   DC  I N1    1 
ATOM   4746 C  C2    . DC  F 3 5   ? 24.943  -30.234 11.785  1.00 37.48  ? 5   DC  I C2    1 
ATOM   4747 O  O2    . DC  F 3 5   ? 24.119  -29.459 12.286  1.00 39.91  ? 5   DC  I O2    1 
ATOM   4748 N  N3    . DC  F 3 5   ? 24.814  -31.580 11.884  1.00 37.59  ? 5   DC  I N3    1 
ATOM   4749 C  C4    . DC  F 3 5   ? 25.727  -32.381 11.332  1.00 39.24  ? 5   DC  I C4    1 
ATOM   4750 N  N4    . DC  F 3 5   ? 25.557  -33.701 11.454  1.00 33.72  ? 5   DC  I N4    1 
ATOM   4751 C  C5    . DC  F 3 5   ? 26.855  -31.864 10.629  1.00 37.15  ? 5   DC  I C5    1 
ATOM   4752 C  C6    . DC  F 3 5   ? 26.972  -30.536 10.539  1.00 40.37  ? 5   DC  I C6    1 
ATOM   4753 P  P     . DC  F 3 6   ? 27.134  -24.395 12.769  1.00 44.41  ? 6   DC  I P     1 
ATOM   4754 O  OP1   . DC  F 3 6   ? 26.502  -23.082 12.511  1.00 51.75  ? 6   DC  I OP1   1 
ATOM   4755 O  OP2   . DC  F 3 6   ? 28.576  -24.460 13.093  1.00 46.45  ? 6   DC  I OP2   1 
ATOM   4756 O  "O5'" . DC  F 3 6   ? 26.319  -25.141 13.930  1.00 45.27  ? 6   DC  I "O5'" 1 
ATOM   4757 C  "C5'" . DC  F 3 6   ? 24.906  -25.009 13.983  1.00 50.09  ? 6   DC  I "C5'" 1 
ATOM   4758 C  "C4'" . DC  F 3 6   ? 24.289  -25.869 15.079  1.00 49.05  ? 6   DC  I "C4'" 1 
ATOM   4759 O  "O4'" . DC  F 3 6   ? 24.390  -27.273 14.752  1.00 46.66  ? 6   DC  I "O4'" 1 
ATOM   4760 C  "C3'" . DC  F 3 6   ? 24.896  -25.723 16.486  1.00 49.72  ? 6   DC  I "C3'" 1 
ATOM   4761 O  "O3'" . DC  F 3 6   ? 23.908  -25.208 17.371  1.00 63.25  ? 6   DC  I "O3'" 1 
ATOM   4762 C  "C2'" . DC  F 3 6   ? 25.288  -27.162 16.866  1.00 47.37  ? 6   DC  I "C2'" 1 
ATOM   4763 C  "C1'" . DC  F 3 6   ? 24.365  -27.964 15.967  1.00 44.42  ? 6   DC  I "C1'" 1 
ATOM   4764 N  N1    . DC  F 3 6   ? 24.774  -29.382 15.749  1.00 41.06  ? 6   DC  I N1    1 
ATOM   4765 C  C2    . DC  F 3 6   ? 24.020  -30.405 16.334  1.00 43.40  ? 6   DC  I C2    1 
ATOM   4766 O  O2    . DC  F 3 6   ? 23.035  -30.109 17.020  1.00 46.63  ? 6   DC  I O2    1 
ATOM   4767 N  N3    . DC  F 3 6   ? 24.388  -31.693 16.130  1.00 41.75  ? 6   DC  I N3    1 
ATOM   4768 C  C4    . DC  F 3 6   ? 25.456  -31.970 15.382  1.00 38.01  ? 6   DC  I C4    1 
ATOM   4769 N  N4    . DC  F 3 6   ? 25.782  -33.256 15.212  1.00 40.39  ? 6   DC  I N4    1 
ATOM   4770 C  C5    . DC  F 3 6   ? 26.239  -30.942 14.778  1.00 41.00  ? 6   DC  I C5    1 
ATOM   4771 C  C6    . DC  F 3 6   ? 25.865  -29.673 14.984  1.00 40.96  ? 6   DC  I C6    1 
ATOM   4772 P  P     . DG  F 3 7   ? 24.333  -24.480 18.738  1.00 65.54  ? 7   DG  I P     1 
ATOM   4773 O  OP1   . DG  F 3 7   ? 23.333  -23.423 19.006  1.00 58.35  ? 7   DG  I OP1   1 
ATOM   4774 O  OP2   . DG  F 3 7   ? 25.768  -24.133 18.645  1.00 59.03  ? 7   DG  I OP2   1 
ATOM   4775 O  "O5'" . DG  F 3 7   ? 24.188  -25.616 19.843  1.00 58.28  ? 7   DG  I "O5'" 1 
ATOM   4776 C  "C5'" . DG  F 3 7   ? 22.921  -26.177 20.121  1.00 56.51  ? 7   DG  I "C5'" 1 
ATOM   4777 C  "C4'" . DG  F 3 7   ? 23.071  -27.329 21.087  1.00 64.13  ? 7   DG  I "C4'" 1 
ATOM   4778 O  "O4'" . DG  F 3 7   ? 23.421  -28.522 20.356  1.00 52.02  ? 7   DG  I "O4'" 1 
ATOM   4779 C  "C3'" . DG  F 3 7   ? 24.170  -27.132 22.138  1.00 64.57  ? 7   DG  I "C3'" 1 
ATOM   4780 O  "O3'" . DG  F 3 7   ? 23.590  -27.102 23.441  1.00 74.69  ? 7   DG  I "O3'" 1 
ATOM   4781 C  "C2'" . DG  F 3 7   ? 25.116  -28.330 21.941  1.00 54.29  ? 7   DG  I "C2'" 1 
ATOM   4782 C  "C1'" . DG  F 3 7   ? 24.260  -29.309 21.154  1.00 51.89  ? 7   DG  I "C1'" 1 
ATOM   4783 N  N9    . DG  F 3 7   ? 25.027  -30.194 20.282  1.00 43.32  ? 7   DG  I N9    1 
ATOM   4784 C  C8    . DG  F 3 7   ? 26.020  -29.841 19.399  1.00 40.90  ? 7   DG  I C8    1 
ATOM   4785 N  N7    . DG  F 3 7   ? 26.520  -30.856 18.748  1.00 39.25  ? 7   DG  I N7    1 
ATOM   4786 C  C5    . DG  F 3 7   ? 25.811  -31.950 19.229  1.00 38.08  ? 7   DG  I C5    1 
ATOM   4787 C  C6    . DG  F 3 7   ? 25.911  -33.322 18.897  1.00 39.29  ? 7   DG  I C6    1 
ATOM   4788 O  O6    . DG  F 3 7   ? 26.672  -33.863 18.082  1.00 40.17  ? 7   DG  I O6    1 
ATOM   4789 N  N1    . DG  F 3 7   ? 25.004  -34.094 19.620  1.00 42.77  ? 7   DG  I N1    1 
ATOM   4790 C  C2    . DG  F 3 7   ? 24.116  -33.602 20.547  1.00 47.22  ? 7   DG  I C2    1 
ATOM   4791 N  N2    . DG  F 3 7   ? 23.320  -34.501 21.144  1.00 43.56  ? 7   DG  I N2    1 
ATOM   4792 N  N3    . DG  F 3 7   ? 24.013  -32.321 20.866  1.00 45.11  ? 7   DG  I N3    1 
ATOM   4793 C  C4    . DG  F 3 7   ? 24.888  -31.556 20.172  1.00 43.86  ? 7   DG  I C4    1 
ATOM   4794 P  P     . DG  F 3 8   ? 24.512  -27.146 24.757  1.00 71.17  ? 8   DG  I P     1 
ATOM   4795 O  OP1   . DG  F 3 8   ? 23.743  -26.502 25.844  1.00 71.94  ? 8   DG  I OP1   1 
ATOM   4796 O  OP2   . DG  F 3 8   ? 25.860  -26.634 24.422  1.00 78.29  ? 8   DG  I OP2   1 
ATOM   4797 O  "O5'" . DG  F 3 8   ? 24.613  -28.707 25.077  1.00 60.65  ? 8   DG  I "O5'" 1 
ATOM   4798 C  "C5'" . DG  F 3 8   ? 23.436  -29.499 25.031  1.00 59.37  ? 8   DG  I "C5'" 1 
ATOM   4799 C  "C4'" . DG  F 3 8   ? 23.758  -30.971 25.197  1.00 62.76  ? 8   DG  I "C4'" 1 
ATOM   4800 O  "O4'" . DG  F 3 8   ? 24.444  -31.460 24.031  1.00 54.97  ? 8   DG  I "O4'" 1 
ATOM   4801 C  "C3'" . DG  F 3 8   ? 24.665  -31.306 26.382  1.00 64.64  ? 8   DG  I "C3'" 1 
ATOM   4802 O  "O3'" . DG  F 3 8   ? 23.900  -31.937 27.401  1.00 70.27  ? 8   DG  I "O3'" 1 
ATOM   4803 C  "C2'" . DG  F 3 8   ? 25.735  -32.253 25.797  1.00 58.87  ? 8   DG  I "C2'" 1 
ATOM   4804 C  "C1'" . DG  F 3 8   ? 25.181  -32.585 24.414  1.00 53.58  ? 8   DG  I "C1'" 1 
ATOM   4805 N  N9    . DG  F 3 8   ? 26.209  -32.836 23.407  1.00 52.40  ? 8   DG  I N9    1 
ATOM   4806 C  C8    . DG  F 3 8   ? 26.975  -31.901 22.753  1.00 44.34  ? 8   DG  I C8    1 
ATOM   4807 N  N7    . DG  F 3 8   ? 27.811  -32.421 21.897  1.00 42.24  ? 8   DG  I N7    1 
ATOM   4808 C  C5    . DG  F 3 8   ? 27.584  -33.789 21.987  1.00 45.00  ? 8   DG  I C5    1 
ATOM   4809 C  C6    . DG  F 3 8   ? 28.196  -34.863 21.297  1.00 45.81  ? 8   DG  I C6    1 
ATOM   4810 O  O6    . DG  F 3 8   ? 29.089  -34.816 20.441  1.00 48.57  ? 8   DG  I O6    1 
ATOM   4811 N  N1    . DG  F 3 8   ? 27.671  -36.092 21.687  1.00 50.48  ? 8   DG  I N1    1 
ATOM   4812 C  C2    . DG  F 3 8   ? 26.681  -36.262 22.625  1.00 49.58  ? 8   DG  I C2    1 
ATOM   4813 N  N2    . DG  F 3 8   ? 26.304  -37.526 22.869  1.00 48.95  ? 8   DG  I N2    1 
ATOM   4814 N  N3    . DG  F 3 8   ? 26.099  -35.265 23.279  1.00 44.15  ? 8   DG  I N3    1 
ATOM   4815 C  C4    . DG  F 3 8   ? 26.600  -34.060 22.911  1.00 47.07  ? 8   DG  I C4    1 
ATOM   4816 P  P     . DA  F 3 9   ? 24.488  -32.087 28.888  1.00 65.03  ? 9   DA  I P     1 
ATOM   4817 O  OP1   . DA  F 3 9   ? 23.335  -32.249 29.803  1.00 74.96  ? 9   DA  I OP1   1 
ATOM   4818 O  OP2   . DA  F 3 9   ? 25.456  -30.990 29.113  1.00 58.30  ? 9   DA  I OP2   1 
ATOM   4819 O  "O5'" . DA  F 3 9   ? 25.293  -33.466 28.832  1.00 58.58  ? 9   DA  I "O5'" 1 
ATOM   4820 C  "C5'" . DA  F 3 9   ? 24.665  -34.619 28.292  1.00 59.82  ? 9   DA  I "C5'" 1 
ATOM   4821 C  "C4'" . DA  F 3 9   ? 25.669  -35.734 28.064  1.00 67.84  ? 9   DA  I "C4'" 1 
ATOM   4822 O  "O4'" . DA  F 3 9   ? 26.488  -35.447 26.897  1.00 62.02  ? 9   DA  I "O4'" 1 
ATOM   4823 C  "C3'" . DA  F 3 9   ? 26.654  -35.980 29.217  1.00 72.26  ? 9   DA  I "C3'" 1 
ATOM   4824 O  "O3'" . DA  F 3 9   ? 26.729  -37.367 29.475  1.00 84.57  ? 9   DA  I "O3'" 1 
ATOM   4825 C  "C2'" . DA  F 3 9   ? 27.976  -35.465 28.651  1.00 65.07  ? 9   DA  I "C2'" 1 
ATOM   4826 C  "C1'" . DA  F 3 9   ? 27.799  -35.845 27.197  1.00 64.91  ? 9   DA  I "C1'" 1 
ATOM   4827 N  N9    . DA  F 3 9   ? 28.736  -35.197 26.284  1.00 55.84  ? 9   DA  I N9    1 
ATOM   4828 C  C8    . DA  F 3 9   ? 29.124  -33.886 26.281  1.00 53.20  ? 9   DA  I C8    1 
ATOM   4829 N  N7    . DA  F 3 9   ? 29.993  -33.596 25.340  1.00 57.09  ? 9   DA  I N7    1 
ATOM   4830 C  C5    . DA  F 3 9   ? 30.188  -34.801 24.684  1.00 50.80  ? 9   DA  I C5    1 
ATOM   4831 C  C6    . DA  F 3 9   ? 30.995  -35.169 23.587  1.00 49.53  ? 9   DA  I C6    1 
ATOM   4832 N  N6    . DA  F 3 9   ? 31.787  -34.311 22.935  1.00 49.72  ? 9   DA  I N6    1 
ATOM   4833 N  N1    . DA  F 3 9   ? 30.955  -36.457 23.185  1.00 50.69  ? 9   DA  I N1    1 
ATOM   4834 C  C2    . DA  F 3 9   ? 30.161  -37.313 23.839  1.00 52.55  ? 9   DA  I C2    1 
ATOM   4835 N  N3    . DA  F 3 9   ? 29.362  -37.085 24.879  1.00 53.28  ? 9   DA  I N3    1 
ATOM   4836 C  C4    . DA  F 3 9   ? 29.423  -35.797 25.255  1.00 53.21  ? 9   DA  I C4    1 
ATOM   4837 P  P     . DA  F 3 10  ? 26.511  -37.942 30.957  1.00 81.60  ? 10  DA  I P     1 
ATOM   4838 O  OP1   . DA  F 3 10  ? 25.146  -37.569 31.393  1.00 75.53  ? 10  DA  I OP1   1 
ATOM   4839 O  OP2   . DA  F 3 10  ? 27.681  -37.544 31.771  1.00 70.78  ? 10  DA  I OP2   1 
ATOM   4840 O  "O5'" . DA  F 3 10  ? 26.578  -39.524 30.747  1.00 70.67  ? 10  DA  I "O5'" 1 
ATOM   4841 C  "C5'" . DA  F 3 10  ? 26.027  -40.104 29.569  1.00 66.24  ? 10  DA  I "C5'" 1 
ATOM   4842 C  "C4'" . DA  F 3 10  ? 26.997  -41.093 28.944  1.00 68.39  ? 10  DA  I "C4'" 1 
ATOM   4843 O  "O4'" . DA  F 3 10  ? 27.931  -40.391 28.082  1.00 75.67  ? 10  DA  I "O4'" 1 
ATOM   4844 C  "C3'" . DA  F 3 10  ? 27.848  -41.881 29.936  1.00 75.96  ? 10  DA  I "C3'" 1 
ATOM   4845 O  "O3'" . DA  F 3 10  ? 28.004  -43.215 29.477  1.00 73.97  ? 10  DA  I "O3'" 1 
ATOM   4846 C  "C2'" . DA  F 3 10  ? 29.175  -41.123 29.932  1.00 72.60  ? 10  DA  I "C2'" 1 
ATOM   4847 C  "C1'" . DA  F 3 10  ? 29.258  -40.661 28.484  1.00 68.17  ? 10  DA  I "C1'" 1 
ATOM   4848 N  N9    . DA  F 3 10  ? 30.044  -39.444 28.300  1.00 63.46  ? 10  DA  I N9    1 
ATOM   4849 C  C8    . DA  F 3 10  ? 29.945  -38.283 29.015  1.00 58.30  ? 10  DA  I C8    1 
ATOM   4850 N  N7    . DA  F 3 10  ? 30.775  -37.346 28.620  1.00 55.92  ? 10  DA  I N7    1 
ATOM   4851 C  C5    . DA  F 3 10  ? 31.462  -37.931 27.569  1.00 58.47  ? 10  DA  I C5    1 
ATOM   4852 C  C6    . DA  F 3 10  ? 32.483  -37.457 26.721  1.00 52.09  ? 10  DA  I C6    1 
ATOM   4853 N  N6    . DA  F 3 10  ? 33.005  -36.229 26.811  1.00 49.77  ? 10  DA  I N6    1 
ATOM   4854 N  N1    . DA  F 3 10  ? 32.949  -38.297 25.774  1.00 47.02  ? 10  DA  I N1    1 
ATOM   4855 C  C2    . DA  F 3 10  ? 32.425  -39.526 25.687  1.00 55.41  ? 10  DA  I C2    1 
ATOM   4856 N  N3    . DA  F 3 10  ? 31.465  -40.082 26.425  1.00 55.77  ? 10  DA  I N3    1 
ATOM   4857 C  C4    . DA  F 3 10  ? 31.022  -39.224 27.357  1.00 58.02  ? 10  DA  I C4    1 
ATOM   4858 P  P     . DC  F 3 11  ? 28.448  -44.375 30.495  1.00 82.50  ? 11  DC  I P     1 
ATOM   4859 O  OP1   . DC  F 3 11  ? 27.749  -45.617 30.095  1.00 75.38  ? 11  DC  I OP1   1 
ATOM   4860 O  OP2   . DC  F 3 11  ? 28.294  -43.847 31.869  1.00 75.23  ? 11  DC  I OP2   1 
ATOM   4861 O  "O5'" . DC  F 3 11  ? 30.009  -44.550 30.205  1.00 85.54  ? 11  DC  I "O5'" 1 
ATOM   4862 C  "C5'" . DC  F 3 11  ? 30.452  -44.794 28.879  1.00 75.12  ? 11  DC  I "C5'" 1 
ATOM   4863 C  "C4'" . DC  F 3 11  ? 31.929  -44.481 28.733  1.00 78.27  ? 11  DC  I "C4'" 1 
ATOM   4864 O  "O4'" . DC  F 3 11  ? 32.117  -43.066 28.577  1.00 77.15  ? 11  DC  I "O4'" 1 
ATOM   4865 C  "C3'" . DC  F 3 11  ? 32.796  -44.865 29.929  1.00 75.24  ? 11  DC  I "C3'" 1 
ATOM   4866 O  "O3'" . DC  F 3 11  ? 33.417  -46.124 29.682  1.00 77.08  ? 11  DC  I "O3'" 1 
ATOM   4867 C  "C2'" . DC  F 3 11  ? 33.829  -43.722 30.036  1.00 70.93  ? 11  DC  I "C2'" 1 
ATOM   4868 C  "C1'" . DC  F 3 11  ? 33.453  -42.782 28.887  1.00 66.89  ? 11  DC  I "C1'" 1 
ATOM   4869 N  N1    . DC  F 3 11  ? 33.571  -41.330 29.227  1.00 64.25  ? 11  DC  I N1    1 
ATOM   4870 C  C2    . DC  F 3 11  ? 34.428  -40.514 28.480  1.00 58.19  ? 11  DC  I C2    1 
ATOM   4871 O  O2    . DC  F 3 11  ? 35.075  -41.010 27.550  1.00 58.91  ? 11  DC  I O2    1 
ATOM   4872 N  N3    . DC  F 3 11  ? 34.525  -39.199 28.796  1.00 52.35  ? 11  DC  I N3    1 
ATOM   4873 C  C4    . DC  F 3 11  ? 33.811  -38.701 29.806  1.00 58.39  ? 11  DC  I C4    1 
ATOM   4874 N  N4    . DC  F 3 11  ? 33.940  -37.398 30.081  1.00 56.00  ? 11  DC  I N4    1 
ATOM   4875 C  C5    . DC  F 3 11  ? 32.932  -39.516 30.580  1.00 58.69  ? 11  DC  I C5    1 
ATOM   4876 C  C6    . DC  F 3 11  ? 32.844  -40.812 30.258  1.00 57.08  ? 11  DC  I C6    1 
ATOM   4877 P  P     . DT  F 3 12  ? 34.498  -46.725 30.708  1.00 83.64  ? 12  DT  I P     1 
ATOM   4878 O  OP1   . DT  F 3 12  ? 34.442  -48.199 30.583  1.00 78.59  ? 12  DT  I OP1   1 
ATOM   4879 O  OP2   . DT  F 3 12  ? 34.300  -46.097 32.033  1.00 73.41  ? 12  DT  I OP2   1 
ATOM   4880 O  "O5'" . DT  F 3 12  ? 35.895  -46.227 30.113  1.00 73.22  ? 12  DT  I "O5'" 1 
ATOM   4881 C  "C5'" . DT  F 3 12  ? 36.191  -46.447 28.740  1.00 67.69  ? 12  DT  I "C5'" 1 
ATOM   4882 C  "C4'" . DT  F 3 12  ? 37.495  -45.778 28.353  1.00 61.92  ? 12  DT  I "C4'" 1 
ATOM   4883 O  "O4'" . DT  F 3 12  ? 37.358  -44.339 28.473  1.00 67.92  ? 12  DT  I "O4'" 1 
ATOM   4884 C  "C3'" . DT  F 3 12  ? 38.701  -46.173 29.206  1.00 63.97  ? 12  DT  I "C3'" 1 
ATOM   4885 O  "O3'" . DT  F 3 12  ? 39.807  -46.470 28.365  1.00 66.75  ? 12  DT  I "O3'" 1 
ATOM   4886 C  "C2'" . DT  F 3 12  ? 38.957  -44.936 30.071  1.00 63.51  ? 12  DT  I "C2'" 1 
ATOM   4887 C  "C1'" . DT  F 3 12  ? 38.459  -43.813 29.176  1.00 65.06  ? 12  DT  I "C1'" 1 
ATOM   4888 N  N1    . DT  F 3 12  ? 38.000  -42.609 29.929  1.00 60.30  ? 12  DT  I N1    1 
ATOM   4889 C  C2    . DT  F 3 12  ? 38.510  -41.374 29.603  1.00 55.06  ? 12  DT  I C2    1 
ATOM   4890 O  O2    . DT  F 3 12  ? 39.332  -41.203 28.721  1.00 51.35  ? 12  DT  I O2    1 
ATOM   4891 N  N3    . DT  F 3 12  ? 38.019  -40.337 30.351  1.00 53.71  ? 12  DT  I N3    1 
ATOM   4892 C  C4    . DT  F 3 12  ? 37.089  -40.409 31.372  1.00 54.60  ? 12  DT  I C4    1 
ATOM   4893 O  O4    . DT  F 3 12  ? 36.711  -39.417 31.987  1.00 56.68  ? 12  DT  I O4    1 
ATOM   4894 C  C5    . DT  F 3 12  ? 36.594  -41.733 31.663  1.00 59.20  ? 12  DT  I C5    1 
ATOM   4895 C  C7    . DT  F 3 12  ? 35.582  -41.937 32.751  1.00 54.42  ? 12  DT  I C7    1 
ATOM   4896 C  C6    . DT  F 3 12  ? 37.068  -42.757 30.936  1.00 60.39  ? 12  DT  I C6    1 
ATOM   4897 P  P     . DT  F 3 13  ? 41.159  -47.083 28.980  1.00 66.09  ? 13  DT  I P     1 
ATOM   4898 O  OP1   . DT  F 3 13  ? 41.648  -48.110 28.034  1.00 61.44  ? 13  DT  I OP1   1 
ATOM   4899 O  OP2   . DT  F 3 13  ? 40.905  -47.448 30.392  1.00 71.23  ? 13  DT  I OP2   1 
ATOM   4900 O  "O5'" . DT  F 3 13  ? 42.172  -45.847 28.954  1.00 60.38  ? 13  DT  I "O5'" 1 
ATOM   4901 C  "C5'" . DT  F 3 13  ? 42.363  -45.126 27.743  1.00 60.37  ? 13  DT  I "C5'" 1 
ATOM   4902 C  "C4'" . DT  F 3 13  ? 43.177  -43.866 27.977  1.00 51.01  ? 13  DT  I "C4'" 1 
ATOM   4903 O  "O4'" . DT  F 3 13  ? 42.406  -42.913 28.756  1.00 45.54  ? 13  DT  I "O4'" 1 
ATOM   4904 C  "C3'" . DT  F 3 13  ? 44.492  -44.070 28.737  1.00 48.79  ? 13  DT  I "C3'" 1 
ATOM   4905 O  "O3'" . DT  F 3 13  ? 45.507  -43.271 28.148  1.00 45.26  ? 13  DT  I "O3'" 1 
ATOM   4906 C  "C2'" . DT  F 3 13  ? 44.146  -43.564 30.137  1.00 43.07  ? 13  DT  I "C2'" 1 
ATOM   4907 C  "C1'" . DT  F 3 13  ? 43.223  -42.413 29.785  1.00 47.70  ? 13  DT  I "C1'" 1 
ATOM   4908 N  N1    . DT  F 3 13  ? 42.357  -41.947 30.905  1.00 47.56  ? 13  DT  I N1    1 
ATOM   4909 C  C2    . DT  F 3 13  ? 42.355  -40.612 31.234  1.00 45.02  ? 13  DT  I C2    1 
ATOM   4910 O  O2    . DT  F 3 13  ? 43.033  -39.781 30.656  1.00 45.46  ? 13  DT  I O2    1 
ATOM   4911 N  N3    . DT  F 3 13  ? 41.527  -40.278 32.271  1.00 48.26  ? 13  DT  I N3    1 
ATOM   4912 C  C4    . DT  F 3 13  ? 40.715  -41.128 32.998  1.00 50.65  ? 13  DT  I C4    1 
ATOM   4913 O  O4    . DT  F 3 13  ? 40.005  -40.730 33.915  1.00 59.34  ? 13  DT  I O4    1 
ATOM   4914 C  C5    . DT  F 3 13  ? 40.762  -42.516 32.602  1.00 54.99  ? 13  DT  I C5    1 
ATOM   4915 C  C7    . DT  F 3 13  ? 39.923  -43.532 33.319  1.00 57.38  ? 13  DT  I C7    1 
ATOM   4916 C  C6    . DT  F 3 13  ? 41.571  -42.855 31.585  1.00 52.46  ? 13  DT  I C6    1 
ATOM   4917 P  P     . DA  F 3 14  ? 46.351  -43.793 26.882  1.00 49.65  ? 14  DA  I P     1 
ATOM   4918 O  OP1   . DA  F 3 14  ? 45.435  -44.451 25.925  1.00 55.10  ? 14  DA  I OP1   1 
ATOM   4919 O  OP2   . DA  F 3 14  ? 47.521  -44.536 27.398  1.00 46.25  ? 14  DA  I OP2   1 
ATOM   4920 O  "O5'" . DA  F 3 14  ? 46.880  -42.440 26.214  1.00 46.12  ? 14  DA  I "O5'" 1 
ATOM   4921 C  "C5'" . DA  F 3 14  ? 45.948  -41.488 25.706  1.00 39.34  ? 14  DA  I "C5'" 1 
ATOM   4922 C  "C4'" . DA  F 3 14  ? 46.292  -40.074 26.155  1.00 41.63  ? 14  DA  I "C4'" 1 
ATOM   4923 O  "O4'" . DA  F 3 14  ? 45.885  -39.879 27.534  1.00 41.12  ? 14  DA  I "O4'" 1 
ATOM   4924 C  "C3'" . DA  F 3 14  ? 47.771  -39.709 26.105  1.00 39.48  ? 14  DA  I "C3'" 1 
ATOM   4925 O  "O3'" . DA  F 3 14  ? 47.907  -38.337 25.772  1.00 36.22  ? 14  DA  I "O3'" 1 
ATOM   4926 C  "C2'" . DA  F 3 14  ? 48.232  -39.984 27.534  1.00 36.61  ? 14  DA  I "C2'" 1 
ATOM   4927 C  "C1'" . DA  F 3 14  ? 47.010  -39.550 28.328  1.00 40.98  ? 14  DA  I "C1'" 1 
ATOM   4928 N  N9    . DA  F 3 14  ? 46.864  -40.230 29.610  1.00 44.93  ? 14  DA  I N9    1 
ATOM   4929 C  C8    . DA  F 3 14  ? 47.189  -41.526 29.899  1.00 45.23  ? 14  DA  I C8    1 
ATOM   4930 N  N7    . DA  F 3 14  ? 46.928  -41.873 31.137  1.00 45.21  ? 14  DA  I N7    1 
ATOM   4931 C  C5    . DA  F 3 14  ? 46.388  -40.727 31.696  1.00 37.05  ? 14  DA  I C5    1 
ATOM   4932 C  C6    . DA  F 3 14  ? 45.905  -40.439 32.986  1.00 40.00  ? 14  DA  I C6    1 
ATOM   4933 N  N6    . DA  F 3 14  ? 45.892  -41.329 33.981  1.00 52.15  ? 14  DA  I N6    1 
ATOM   4934 N  N1    . DA  F 3 14  ? 45.434  -39.195 33.214  1.00 43.67  ? 14  DA  I N1    1 
ATOM   4935 C  C2    . DA  F 3 14  ? 45.449  -38.307 32.214  1.00 41.93  ? 14  DA  I C2    1 
ATOM   4936 N  N3    . DA  F 3 14  ? 45.876  -38.462 30.962  1.00 41.63  ? 14  DA  I N3    1 
ATOM   4937 C  C4    . DA  F 3 14  ? 46.338  -39.707 30.768  1.00 41.55  ? 14  DA  I C4    1 
ATOM   4938 P  P     . DC  F 3 15  ? 49.290  -37.788 25.175  1.00 36.01  ? 15  DC  I P     1 
ATOM   4939 O  OP1   . DC  F 3 15  ? 49.040  -36.463 24.598  1.00 32.51  ? 15  DC  I OP1   1 
ATOM   4940 O  OP2   . DC  F 3 15  ? 49.869  -38.844 24.319  1.00 41.75  ? 15  DC  I OP2   1 
ATOM   4941 O  "O5'" . DC  F 3 15  ? 50.220  -37.598 26.465  1.00 41.18  ? 15  DC  I "O5'" 1 
ATOM   4942 C  "C5'" . DC  F 3 15  ? 50.441  -36.293 27.005  1.00 33.30  ? 15  DC  I "C5'" 1 
ATOM   4943 C  "C4'" . DC  F 3 15  ? 49.279  -35.856 27.881  1.00 33.84  ? 15  DC  I "C4'" 1 
ATOM   4944 O  "O4'" . DC  F 3 15  ? 48.913  -36.936 28.782  1.00 41.62  ? 15  DC  I "O4'" 1 
ATOM   4945 C  "C3'" . DC  F 3 15  ? 49.569  -34.657 28.782  1.00 36.78  ? 15  DC  I "C3'" 1 
ATOM   4946 O  "O3'" . DC  F 3 15  ? 48.386  -33.887 28.954  1.00 38.91  ? 15  DC  I "O3'" 1 
ATOM   4947 C  "C2'" . DC  F 3 15  ? 49.982  -35.327 30.085  1.00 36.77  ? 15  DC  I "C2'" 1 
ATOM   4948 C  "C1'" . DC  F 3 15  ? 48.997  -36.479 30.117  1.00 38.90  ? 15  DC  I "C1'" 1 
ATOM   4949 N  N1    . DC  F 3 15  ? 49.417  -37.612 30.983  1.00 39.58  ? 15  DC  I N1    1 
ATOM   4950 C  C2    . DC  F 3 15  ? 48.981  -37.667 32.312  1.00 37.15  ? 15  DC  I C2    1 
ATOM   4951 O  O2    . DC  F 3 15  ? 48.257  -36.763 32.748  1.00 35.92  ? 15  DC  I O2    1 
ATOM   4952 N  N3    . DC  F 3 15  ? 49.367  -38.712 33.085  1.00 38.03  ? 15  DC  I N3    1 
ATOM   4953 C  C4    . DC  F 3 15  ? 50.148  -39.665 32.577  1.00 38.87  ? 15  DC  I C4    1 
ATOM   4954 N  N4    . DC  F 3 15  ? 50.503  -40.675 33.376  1.00 40.33  ? 15  DC  I N4    1 
ATOM   4955 C  C5    . DC  F 3 15  ? 50.601  -39.627 31.225  1.00 39.44  ? 15  DC  I C5    1 
ATOM   4956 C  C6    . DC  F 3 15  ? 50.213  -38.593 30.472  1.00 41.02  ? 15  DC  I C6    1 
ATOM   4957 P  P     . DC  F 3 16  ? 48.417  -32.553 29.849  1.00 37.21  ? 16  DC  I P     1 
ATOM   4958 O  OP1   . DC  F 3 16  ? 47.855  -32.900 31.175  1.00 35.63  ? 16  DC  I OP1   1 
ATOM   4959 O  OP2   . DC  F 3 16  ? 47.761  -31.504 29.047  1.00 36.38  ? 16  DC  I OP2   1 
ATOM   4960 O  "O5'" . DC  F 3 16  ? 49.985  -32.201 29.946  1.00 36.12  ? 16  DC  I "O5'" 1 
ATOM   4961 C  "C5'" . DC  F 3 16  ? 50.448  -31.094 30.724  1.00 31.62  ? 16  DC  I "C5'" 1 
ATOM   4962 C  "C4'" . DC  F 3 16  ? 50.279  -31.363 32.209  1.00 39.98  ? 16  DC  I "C4'" 1 
ATOM   4963 O  "O4'" . DC  F 3 16  ? 50.372  -32.782 32.467  1.00 31.10  ? 16  DC  I "O4'" 1 
ATOM   4964 C  "C3'" . DC  F 3 16  ? 51.308  -30.694 33.131  1.00 37.13  ? 16  DC  I "C3'" 1 
ATOM   4965 O  "O3'" . DC  F 3 16  ? 50.628  -29.858 34.056  1.00 40.90  ? 16  DC  I "O3'" 1 
ATOM   4966 C  "C2'" . DC  F 3 16  ? 51.999  -31.876 33.836  1.00 38.16  ? 16  DC  I "C2'" 1 
ATOM   4967 C  "C1'" . DC  F 3 16  ? 50.936  -32.957 33.735  1.00 35.99  ? 16  DC  I "C1'" 1 
ATOM   4968 N  N1    . DC  F 3 16  ? 51.456  -34.353 33.832  1.00 35.92  ? 16  DC  I N1    1 
ATOM   4969 C  C2    . DC  F 3 16  ? 51.032  -35.175 34.883  1.00 38.67  ? 16  DC  I C2    1 
ATOM   4970 O  O2    . DC  F 3 16  ? 50.244  -34.722 35.723  1.00 40.68  ? 16  DC  I O2    1 
ATOM   4971 N  N3    . DC  F 3 16  ? 51.502  -36.444 34.954  1.00 34.66  ? 16  DC  I N3    1 
ATOM   4972 C  C4    . DC  F 3 16  ? 52.350  -36.895 34.030  1.00 33.17  ? 16  DC  I C4    1 
ATOM   4973 N  N4    . DC  F 3 16  ? 52.786  -38.154 34.142  1.00 31.83  ? 16  DC  I N4    1 
ATOM   4974 C  C5    . DC  F 3 16  ? 52.789  -36.075 32.949  1.00 33.57  ? 16  DC  I C5    1 
ATOM   4975 C  C6    . DC  F 3 16  ? 52.319  -34.824 32.888  1.00 39.00  ? 16  DC  I C6    1 
ATOM   4976 P  P     . DC  F 3 17  ? 51.440  -28.861 35.018  1.00 43.21  ? 17  DC  I P     1 
ATOM   4977 O  OP1   . DC  F 3 17  ? 50.500  -27.782 35.393  1.00 46.59  ? 17  DC  I OP1   1 
ATOM   4978 O  OP2   . DC  F 3 17  ? 52.734  -28.531 34.379  1.00 46.30  ? 17  DC  I OP2   1 
ATOM   4979 O  "O5'" . DC  F 3 17  ? 51.723  -29.740 36.320  1.00 46.68  ? 17  DC  I "O5'" 1 
ATOM   4980 C  "C5'" . DC  F 3 17  ? 50.629  -30.226 37.083  1.00 44.20  ? 17  DC  I "C5'" 1 
ATOM   4981 C  "C4'" . DC  F 3 17  ? 51.099  -31.155 38.186  1.00 45.66  ? 17  DC  I "C4'" 1 
ATOM   4982 O  "O4'" . DC  F 3 17  ? 51.535  -32.411 37.621  1.00 41.39  ? 17  DC  I "O4'" 1 
ATOM   4983 C  "C3'" . DC  F 3 17  ? 52.270  -30.634 39.029  1.00 47.19  ? 17  DC  I "C3'" 1 
ATOM   4984 O  "O3'" . DC  F 3 17  ? 51.869  -30.546 40.390  1.00 60.75  ? 17  DC  I "O3'" 1 
ATOM   4985 C  "C2'" . DC  F 3 17  ? 53.375  -31.686 38.828  1.00 42.84  ? 17  DC  I "C2'" 1 
ATOM   4986 C  "C1'" . DC  F 3 17  ? 52.573  -32.910 38.418  1.00 45.66  ? 17  DC  I "C1'" 1 
ATOM   4987 N  N1    . DC  F 3 17  ? 53.342  -33.912 37.624  1.00 42.57  ? 17  DC  I N1    1 
ATOM   4988 C  C2    . DC  F 3 17  ? 53.407  -35.238 38.065  1.00 42.73  ? 17  DC  I C2    1 
ATOM   4989 O  O2    . DC  F 3 17  ? 52.830  -35.552 39.113  1.00 49.05  ? 17  DC  I O2    1 
ATOM   4990 N  N3    . DC  F 3 17  ? 54.102  -36.141 37.332  1.00 40.56  ? 17  DC  I N3    1 
ATOM   4991 C  C4    . DC  F 3 17  ? 54.709  -35.762 36.206  1.00 40.64  ? 17  DC  I C4    1 
ATOM   4992 N  N4    . DC  F 3 17  ? 55.384  -36.688 35.517  1.00 37.41  ? 17  DC  I N4    1 
ATOM   4993 C  C5    . DC  F 3 17  ? 54.654  -34.415 35.739  1.00 35.44  ? 17  DC  I C5    1 
ATOM   4994 C  C6    . DC  F 3 17  ? 53.964  -33.533 36.470  1.00 40.52  ? 17  DC  I C6    1 
ATOM   4995 P  P     . DG  F 3 18  ? 52.642  -29.578 41.412  1.00 59.93  ? 18  DG  I P     1 
ATOM   4996 O  OP1   . DG  F 3 18  ? 51.672  -29.196 42.463  1.00 63.28  ? 18  DG  I OP1   1 
ATOM   4997 O  OP2   . DG  F 3 18  ? 53.331  -28.526 40.633  1.00 48.51  ? 18  DG  I OP2   1 
ATOM   4998 O  "O5'" . DG  F 3 18  ? 53.746  -30.530 42.065  1.00 53.65  ? 18  DG  I "O5'" 1 
ATOM   4999 C  "C5'" . DG  F 3 18  ? 53.335  -31.704 42.746  1.00 48.04  ? 18  DG  I "C5'" 1 
ATOM   5000 C  "C4'" . DG  F 3 18  ? 54.505  -32.640 42.988  1.00 58.33  ? 18  DG  I "C4'" 1 
ATOM   5001 O  "O4'" . DG  F 3 18  ? 54.824  -33.375 41.776  1.00 55.44  ? 18  DG  I "O4'" 1 
ATOM   5002 C  "C3'" . DG  F 3 18  ? 55.815  -31.970 43.430  1.00 61.02  ? 18  DG  I "C3'" 1 
ATOM   5003 O  "O3'" . DG  F 3 18  ? 56.332  -32.666 44.546  1.00 71.15  ? 18  DG  I "O3'" 1 
ATOM   5004 C  "C2'" . DG  F 3 18  ? 56.722  -32.151 42.212  1.00 54.31  ? 18  DG  I "C2'" 1 
ATOM   5005 C  "C1'" . DG  F 3 18  ? 56.219  -33.489 41.712  1.00 56.39  ? 18  DG  I "C1'" 1 
ATOM   5006 N  N9    . DG  F 3 18  ? 56.626  -33.826 40.353  1.00 46.78  ? 18  DG  I N9    1 
ATOM   5007 C  C8    . DG  F 3 18  ? 56.858  -32.963 39.309  1.00 45.44  ? 18  DG  I C8    1 
ATOM   5008 N  N7    . DG  F 3 18  ? 57.223  -33.566 38.210  1.00 44.90  ? 18  DG  I N7    1 
ATOM   5009 C  C5    . DG  F 3 18  ? 57.236  -34.914 38.550  1.00 42.35  ? 18  DG  I C5    1 
ATOM   5010 C  C6    . DG  F 3 18  ? 57.554  -36.052 37.770  1.00 42.67  ? 18  DG  I C6    1 
ATOM   5011 O  O6    . DG  F 3 18  ? 57.898  -36.096 36.580  1.00 41.06  ? 18  DG  I O6    1 
ATOM   5012 N  N1    . DG  F 3 18  ? 57.440  -37.230 38.505  1.00 46.91  ? 18  DG  I N1    1 
ATOM   5013 C  C2    . DG  F 3 18  ? 57.067  -37.299 39.826  1.00 45.62  ? 18  DG  I C2    1 
ATOM   5014 N  N2    . DG  F 3 18  ? 57.014  -38.526 40.365  1.00 42.93  ? 18  DG  I N2    1 
ATOM   5015 N  N3    . DG  F 3 18  ? 56.768  -36.242 40.567  1.00 44.88  ? 18  DG  I N3    1 
ATOM   5016 C  C4    . DG  F 3 18  ? 56.874  -35.087 39.866  1.00 44.07  ? 18  DG  I C4    1 
ATOM   5017 P  P     . DG  F 3 19  ? 57.091  -31.887 45.727  1.00 61.02  ? 19  DG  I P     1 
ATOM   5018 O  OP1   . DG  F 3 19  ? 56.058  -31.267 46.587  1.00 67.49  ? 19  DG  I OP1   1 
ATOM   5019 O  OP2   . DG  F 3 19  ? 58.147  -31.046 45.119  1.00 63.33  ? 19  DG  I OP2   1 
ATOM   5020 O  "O5'" . DG  F 3 19  ? 57.803  -33.066 46.538  1.00 65.24  ? 19  DG  I "O5'" 1 
ATOM   5021 C  "C5'" . DG  F 3 19  ? 57.074  -34.249 46.848  1.00 60.41  ? 19  DG  I "C5'" 1 
ATOM   5022 C  "C4'" . DG  F 3 19  ? 57.913  -35.488 46.588  1.00 67.66  ? 19  DG  I "C4'" 1 
ATOM   5023 O  "O4'" . DG  F 3 19  ? 57.974  -35.750 45.162  1.00 59.76  ? 19  DG  I "O4'" 1 
ATOM   5024 C  "C3'" . DG  F 3 19  ? 59.361  -35.402 47.076  1.00 68.59  ? 19  DG  I "C3'" 1 
ATOM   5025 O  "O3'" . DG  F 3 19  ? 59.670  -36.533 47.879  1.00 77.58  ? 19  DG  I "O3'" 1 
ATOM   5026 C  "C2'" . DG  F 3 19  ? 60.189  -35.377 45.787  1.00 63.01  ? 19  DG  I "C2'" 1 
ATOM   5027 C  "C1'" . DG  F 3 19  ? 59.286  -36.112 44.810  1.00 60.97  ? 19  DG  I "C1'" 1 
ATOM   5028 N  N9    . DG  F 3 19  ? 59.510  -35.732 43.416  1.00 59.05  ? 19  DG  I N9    1 
ATOM   5029 C  C8    . DG  F 3 19  ? 59.378  -34.476 42.874  1.00 56.20  ? 19  DG  I C8    1 
ATOM   5030 N  N7    . DG  F 3 19  ? 59.641  -34.429 41.598  1.00 53.48  ? 19  DG  I N7    1 
ATOM   5031 C  C5    . DG  F 3 19  ? 59.970  -35.738 41.270  1.00 48.45  ? 19  DG  I C5    1 
ATOM   5032 C  C6    . DG  F 3 19  ? 60.347  -36.297 40.025  1.00 46.62  ? 19  DG  I C6    1 
ATOM   5033 O  O6    . DG  F 3 19  ? 60.468  -35.725 38.932  1.00 47.82  ? 19  DG  I O6    1 
ATOM   5034 N  N1    . DG  F 3 19  ? 60.595  -37.663 40.128  1.00 47.00  ? 19  DG  I N1    1 
ATOM   5035 C  C2    . DG  F 3 19  ? 60.491  -38.396 41.286  1.00 51.14  ? 19  DG  I C2    1 
ATOM   5036 N  N2    . DG  F 3 19  ? 60.771  -39.704 41.187  1.00 47.67  ? 19  DG  I N2    1 
ATOM   5037 N  N3    . DG  F 3 19  ? 60.139  -37.885 42.461  1.00 44.82  ? 19  DG  I N3    1 
ATOM   5038 C  C4    . DG  F 3 19  ? 59.893  -36.554 42.378  1.00 51.85  ? 19  DG  I C4    1 
ATOM   5039 P  P     . DC  F 3 20  ? 61.060  -36.602 48.683  1.00 78.46  ? 20  DC  I P     1 
ATOM   5040 O  OP1   . DC  F 3 20  ? 60.785  -37.230 49.994  1.00 78.04  ? 20  DC  I OP1   1 
ATOM   5041 O  OP2   . DC  F 3 20  ? 61.690  -35.264 48.626  1.00 71.65  ? 20  DC  I OP2   1 
ATOM   5042 O  "O5'" . DC  F 3 20  ? 61.948  -37.608 47.815  1.00 64.37  ? 20  DC  I "O5'" 1 
ATOM   5043 C  "C5'" . DC  F 3 20  ? 61.488  -38.933 47.583  1.00 63.61  ? 20  DC  I "C5'" 1 
ATOM   5044 C  "C4'" . DC  F 3 20  ? 62.445  -39.687 46.679  1.00 65.86  ? 20  DC  I "C4'" 1 
ATOM   5045 O  "O4'" . DC  F 3 20  ? 62.337  -39.180 45.325  1.00 63.28  ? 20  DC  I "O4'" 1 
ATOM   5046 C  "C3'" . DC  F 3 20  ? 63.921  -39.578 47.069  1.00 68.44  ? 20  DC  I "C3'" 1 
ATOM   5047 O  "O3'" . DC  F 3 20  ? 64.516  -40.867 47.081  1.00 68.60  ? 20  DC  I "O3'" 1 
ATOM   5048 C  "C2'" . DC  F 3 20  ? 64.522  -38.684 45.982  1.00 63.12  ? 20  DC  I "C2'" 1 
ATOM   5049 C  "C1'" . DC  F 3 20  ? 63.624  -38.981 44.792  1.00 58.11  ? 20  DC  I "C1'" 1 
ATOM   5050 N  N1    . DC  F 3 20  ? 63.554  -37.863 43.808  1.00 52.91  ? 20  DC  I N1    1 
ATOM   5051 C  C2    . DC  F 3 20  ? 64.014  -38.058 42.501  1.00 52.21  ? 20  DC  I C2    1 
ATOM   5052 O  O2    . DC  F 3 20  ? 64.474  -39.161 42.181  1.00 54.07  ? 20  DC  I O2    1 
ATOM   5053 N  N3    . DC  F 3 20  ? 63.942  -37.028 41.619  1.00 51.90  ? 20  DC  I N3    1 
ATOM   5054 C  C4    . DC  F 3 20  ? 63.439  -35.854 42.003  1.00 52.44  ? 20  DC  I C4    1 
ATOM   5055 N  N4    . DC  F 3 20  ? 63.388  -34.869 41.100  1.00 44.52  ? 20  DC  I N4    1 
ATOM   5056 C  C5    . DC  F 3 20  ? 62.967  -35.637 43.331  1.00 54.75  ? 20  DC  I C5    1 
ATOM   5057 C  C6    . DC  F 3 20  ? 63.042  -36.658 44.190  1.00 55.60  ? 20  DC  I C6    1 
ATOM   5058 P  P     . DA  F 3 21  ? 65.850  -41.134 47.935  1.00 77.40  ? 21  DA  I P     1 
ATOM   5059 O  OP1   . DA  F 3 21  ? 65.689  -42.435 48.621  1.00 64.35  ? 21  DA  I OP1   1 
ATOM   5060 O  OP2   . DA  F 3 21  ? 66.141  -39.914 48.720  1.00 63.32  ? 21  DA  I OP2   1 
ATOM   5061 O  "O5'" . DA  F 3 21  ? 66.986  -41.286 46.823  1.00 67.03  ? 21  DA  I "O5'" 1 
ATOM   5062 C  "C5'" . DA  F 3 21  ? 66.868  -42.296 45.835  1.00 71.80  ? 21  DA  I "C5'" 1 
ATOM   5063 C  "C4'" . DA  F 3 21  ? 67.730  -41.978 44.629  1.00 69.68  ? 21  DA  I "C4'" 1 
ATOM   5064 O  "O4'" . DA  F 3 21  ? 67.223  -40.794 43.957  1.00 66.97  ? 21  DA  I "O4'" 1 
ATOM   5065 C  "C3'" . DA  F 3 21  ? 69.204  -41.691 44.938  1.00 62.06  ? 21  DA  I "C3'" 1 
ATOM   5066 O  "O3'" . DA  F 3 21  ? 70.019  -42.377 44.007  1.00 64.84  ? 21  DA  I "O3'" 1 
ATOM   5067 C  "C2'" . DA  F 3 21  ? 69.307  -40.176 44.753  1.00 59.90  ? 21  DA  I "C2'" 1 
ATOM   5068 C  "C1'" . DA  F 3 21  ? 68.311  -39.967 43.630  1.00 55.32  ? 21  DA  I "C1'" 1 
ATOM   5069 N  N9    . DA  F 3 21  ? 67.840  -38.592 43.488  1.00 53.51  ? 21  DA  I N9    1 
ATOM   5070 C  C8    . DA  F 3 21  ? 67.470  -37.734 44.486  1.00 49.52  ? 21  DA  I C8    1 
ATOM   5071 N  N7    . DA  F 3 21  ? 67.087  -36.554 44.054  1.00 48.77  ? 21  DA  I N7    1 
ATOM   5072 C  C5    . DA  F 3 21  ? 67.216  -36.647 42.677  1.00 47.93  ? 21  DA  I C5    1 
ATOM   5073 C  C6    . DA  F 3 21  ? 66.967  -35.731 41.633  1.00 47.13  ? 21  DA  I C6    1 
ATOM   5074 N  N6    . DA  F 3 21  ? 66.518  -34.488 41.835  1.00 42.60  ? 21  DA  I N6    1 
ATOM   5075 N  N1    . DA  F 3 21  ? 67.200  -36.144 40.370  1.00 44.79  ? 21  DA  I N1    1 
ATOM   5076 C  C2    . DA  F 3 21  ? 67.650  -37.389 40.171  1.00 42.24  ? 21  DA  I C2    1 
ATOM   5077 N  N3    . DA  F 3 21  ? 67.919  -38.336 41.067  1.00 48.95  ? 21  DA  I N3    1 
ATOM   5078 C  C4    . DA  F 3 21  ? 67.678  -37.896 42.313  1.00 56.09  ? 21  DA  I C4    1 
ATOM   5079 P  P     . DA  F 3 22  ? 71.486  -42.885 44.417  1.00 67.33  ? 22  DA  I P     1 
ATOM   5080 O  OP1   . DA  F 3 22  ? 71.344  -44.206 45.067  1.00 72.81  ? 22  DA  I OP1   1 
ATOM   5081 O  OP2   . DA  F 3 22  ? 72.170  -41.780 45.126  1.00 70.19  ? 22  DA  I OP2   1 
ATOM   5082 O  "O5'" . DA  F 3 22  ? 72.211  -43.084 43.007  1.00 72.34  ? 22  DA  I "O5'" 1 
ATOM   5083 C  "C5'" . DA  F 3 22  ? 71.504  -43.691 41.934  1.00 67.06  ? 22  DA  I "C5'" 1 
ATOM   5084 C  "C4'" . DA  F 3 22  ? 71.869  -43.044 40.611  1.00 60.87  ? 22  DA  I "C4'" 1 
ATOM   5085 O  "O4'" . DA  F 3 22  ? 71.256  -41.732 40.521  1.00 58.03  ? 22  DA  I "O4'" 1 
ATOM   5086 C  "C3'" . DA  F 3 22  ? 73.363  -42.841 40.386  1.00 60.14  ? 22  DA  I "C3'" 1 
ATOM   5087 O  "O3'" . DA  F 3 22  ? 73.695  -43.183 39.051  1.00 55.30  ? 22  DA  I "O3'" 1 
ATOM   5088 C  "C2'" . DA  F 3 22  ? 73.571  -41.351 40.666  1.00 62.64  ? 22  DA  I "C2'" 1 
ATOM   5089 C  "C1'" . DA  F 3 22  ? 72.234  -40.752 40.248  1.00 55.64  ? 22  DA  I "C1'" 1 
ATOM   5090 N  N9    . DA  F 3 22  ? 71.879  -39.542 40.988  1.00 51.61  ? 22  DA  I N9    1 
ATOM   5091 C  C8    . DA  F 3 22  ? 71.834  -39.393 42.346  1.00 53.69  ? 22  DA  I C8    1 
ATOM   5092 N  N7    . DA  F 3 22  ? 71.471  -38.194 42.736  1.00 51.18  ? 22  DA  I N7    1 
ATOM   5093 C  C5    . DA  F 3 22  ? 71.258  -37.509 41.552  1.00 47.26  ? 22  DA  I C5    1 
ATOM   5094 C  C6    . DA  F 3 22  ? 70.853  -36.187 41.280  1.00 47.49  ? 22  DA  I C6    1 
ATOM   5095 N  N6    . DA  F 3 22  ? 70.585  -35.288 42.233  1.00 44.93  ? 22  DA  I N6    1 
ATOM   5096 N  N1    . DA  F 3 22  ? 70.738  -35.822 39.986  1.00 46.44  ? 22  DA  I N1    1 
ATOM   5097 C  C2    . DA  F 3 22  ? 71.009  -36.724 39.034  1.00 45.85  ? 22  DA  I C2    1 
ATOM   5098 N  N3    . DA  F 3 22  ? 71.395  -37.993 39.167  1.00 47.72  ? 22  DA  I N3    1 
ATOM   5099 C  C4    . DA  F 3 22  ? 71.503  -38.325 40.463  1.00 49.96  ? 22  DA  I C4    1 
ATOM   5100 P  P     . DG  F 3 23  ? 75.232  -43.328 38.611  1.00 73.66  ? 23  DG  I P     1 
ATOM   5101 O  OP1   . DG  F 3 23  ? 75.296  -44.344 37.537  1.00 63.27  ? 23  DG  I OP1   1 
ATOM   5102 O  OP2   . DG  F 3 23  ? 76.043  -43.497 39.838  1.00 68.58  ? 23  DG  I OP2   1 
ATOM   5103 O  "O5'" . DG  F 3 23  ? 75.572  -41.900 37.986  1.00 72.67  ? 23  DG  I "O5'" 1 
ATOM   5104 C  "C5'" . DG  F 3 23  ? 74.653  -41.295 37.091  1.00 65.29  ? 23  DG  I "C5'" 1 
ATOM   5105 C  "C4'" . DG  F 3 23  ? 75.078  -39.881 36.752  1.00 65.94  ? 23  DG  I "C4'" 1 
ATOM   5106 O  "O4'" . DG  F 3 23  ? 74.466  -38.943 37.675  1.00 67.84  ? 23  DG  I "O4'" 1 
ATOM   5107 C  "C3'" . DG  F 3 23  ? 76.586  -39.621 36.819  1.00 63.94  ? 23  DG  I "C3'" 1 
ATOM   5108 O  "O3'" . DG  F 3 23  ? 76.981  -38.889 35.674  1.00 76.25  ? 23  DG  I "O3'" 1 
ATOM   5109 C  "C2'" . DG  F 3 23  ? 76.737  -38.788 38.093  1.00 58.62  ? 23  DG  I "C2'" 1 
ATOM   5110 C  "C1'" . DG  F 3 23  ? 75.438  -38.008 38.070  1.00 62.39  ? 23  DG  I "C1'" 1 
ATOM   5111 N  N9    . DG  F 3 23  ? 75.055  -37.442 39.359  1.00 52.42  ? 23  DG  I N9    1 
ATOM   5112 C  C8    . DG  F 3 23  ? 75.093  -38.060 40.586  1.00 49.57  ? 23  DG  I C8    1 
ATOM   5113 N  N7    . DG  F 3 23  ? 74.683  -37.297 41.563  1.00 51.21  ? 23  DG  I N7    1 
ATOM   5114 C  C5    . DG  F 3 23  ? 74.350  -36.099 40.941  1.00 47.44  ? 23  DG  I C5    1 
ATOM   5115 C  C6    . DG  F 3 23  ? 73.845  -34.895 41.489  1.00 48.14  ? 23  DG  I C6    1 
ATOM   5116 O  O6    . DG  F 3 23  ? 73.583  -34.639 42.672  1.00 49.01  ? 23  DG  I O6    1 
ATOM   5117 N  N1    . DG  F 3 23  ? 73.645  -33.927 40.506  1.00 41.44  ? 23  DG  I N1    1 
ATOM   5118 C  C2    . DG  F 3 23  ? 73.901  -34.101 39.167  1.00 45.69  ? 23  DG  I C2    1 
ATOM   5119 N  N2    . DG  F 3 23  ? 73.646  -33.053 38.371  1.00 46.79  ? 23  DG  I N2    1 
ATOM   5120 N  N3    . DG  F 3 23  ? 74.373  -35.223 38.643  1.00 44.96  ? 23  DG  I N3    1 
ATOM   5121 C  C4    . DG  F 3 23  ? 74.573  -36.175 39.586  1.00 49.99  ? 23  DG  I C4    1 
ATOM   5122 P  P     . DG  F 3 24  ? 78.523  -38.813 35.234  1.00 81.53  ? 24  DG  I P     1 
ATOM   5123 O  OP1   . DG  F 3 24  ? 78.662  -39.580 33.977  1.00 76.81  ? 24  DG  I OP1   1 
ATOM   5124 O  OP2   . DG  F 3 24  ? 79.369  -39.152 36.401  1.00 76.64  ? 24  DG  I OP2   1 
ATOM   5125 O  "O5'" . DG  F 3 24  ? 78.732  -37.263 34.915  1.00 75.99  ? 24  DG  I "O5'" 1 
ATOM   5126 C  "C5'" . DG  F 3 24  ? 77.665  -36.513 34.347  1.00 68.84  ? 24  DG  I "C5'" 1 
ATOM   5127 C  "C4'" . DG  F 3 24  ? 77.893  -35.027 34.538  1.00 65.65  ? 24  DG  I "C4'" 1 
ATOM   5128 O  "O4'" . DG  F 3 24  ? 77.301  -34.597 35.791  1.00 73.15  ? 24  DG  I "O4'" 1 
ATOM   5129 C  "C3'" . DG  F 3 24  ? 79.360  -34.608 34.584  1.00 67.77  ? 24  DG  I "C3'" 1 
ATOM   5130 O  "O3'" . DG  F 3 24  ? 79.550  -33.447 33.799  1.00 76.46  ? 24  DG  I "O3'" 1 
ATOM   5131 C  "C2'" . DG  F 3 24  ? 79.614  -34.341 36.070  1.00 60.90  ? 24  DG  I "C2'" 1 
ATOM   5132 C  "C1'" . DG  F 3 24  ? 78.246  -33.878 36.551  1.00 64.18  ? 24  DG  I "C1'" 1 
ATOM   5133 N  N9    . DG  F 3 24  ? 78.000  -34.159 37.964  1.00 54.44  ? 24  DG  I N9    1 
ATOM   5134 C  C8    . DG  F 3 24  ? 78.216  -35.348 38.618  1.00 53.92  ? 24  DG  I C8    1 
ATOM   5135 N  N7    . DG  F 3 24  ? 77.898  -35.311 39.882  1.00 52.89  ? 24  DG  I N7    1 
ATOM   5136 C  C5    . DG  F 3 24  ? 77.437  -34.016 40.080  1.00 46.17  ? 24  DG  I C5    1 
ATOM   5137 C  C6    . DG  F 3 24  ? 76.953  -33.390 41.254  1.00 44.51  ? 24  DG  I C6    1 
ATOM   5138 O  O6    . DG  F 3 24  ? 76.831  -33.874 42.388  1.00 44.99  ? 24  DG  I O6    1 
ATOM   5139 N  N1    . DG  F 3 24  ? 76.588  -32.067 41.020  1.00 45.52  ? 24  DG  I N1    1 
ATOM   5140 C  C2    . DG  F 3 24  ? 76.680  -31.429 39.806  1.00 46.32  ? 24  DG  I C2    1 
ATOM   5141 N  N2    . DG  F 3 24  ? 76.280  -30.149 39.776  1.00 46.91  ? 24  DG  I N2    1 
ATOM   5142 N  N3    . DG  F 3 24  ? 77.133  -32.003 38.697  1.00 45.07  ? 24  DG  I N3    1 
ATOM   5143 C  C4    . DG  F 3 24  ? 77.492  -33.293 38.908  1.00 48.88  ? 24  DG  I C4    1 
ATOM   5144 P  P     . DC  F 3 25  ? 80.999  -33.105 33.198  1.00 87.39  ? 25  DC  I P     1 
ATOM   5145 O  OP1   . DC  F 3 25  ? 80.869  -33.004 31.727  1.00 71.17  ? 25  DC  I OP1   1 
ATOM   5146 O  OP2   . DC  F 3 25  ? 81.969  -34.057 33.784  1.00 73.35  ? 25  DC  I OP2   1 
ATOM   5147 O  "O5'" . DC  F 3 25  ? 81.312  -31.659 33.798  1.00 80.90  ? 25  DC  I "O5'" 1 
ATOM   5148 C  "C5'" . DC  F 3 25  ? 80.247  -30.743 34.015  1.00 67.67  ? 25  DC  I "C5'" 1 
ATOM   5149 C  "C4'" . DC  F 3 25  ? 80.588  -29.781 35.137  1.00 66.27  ? 25  DC  I "C4'" 1 
ATOM   5150 O  "O4'" . DC  F 3 25  ? 80.075  -30.288 36.393  1.00 59.30  ? 25  DC  I "O4'" 1 
ATOM   5151 C  "C3'" . DC  F 3 25  ? 82.089  -29.546 35.350  1.00 60.93  ? 25  DC  I "C3'" 1 
ATOM   5152 O  "O3'" . DC  F 3 25  ? 82.383  -28.159 35.245  1.00 64.35  ? 25  DC  I "O3'" 1 
ATOM   5153 C  "C2'" . DC  F 3 25  ? 82.354  -30.075 36.765  1.00 60.51  ? 25  DC  I "C2'" 1 
ATOM   5154 C  "C1'" . DC  F 3 25  ? 80.983  -29.954 37.408  1.00 56.58  ? 25  DC  I "C1'" 1 
ATOM   5155 N  N1    . DC  F 3 25  ? 80.776  -30.876 38.563  1.00 50.32  ? 25  DC  I N1    1 
ATOM   5156 C  C2    . DC  F 3 25  ? 80.168  -30.396 39.728  1.00 43.41  ? 25  DC  I C2    1 
ATOM   5157 O  O2    . DC  F 3 25  ? 79.808  -29.214 39.777  1.00 42.64  ? 25  DC  I O2    1 
ATOM   5158 N  N3    . DC  F 3 25  ? 79.988  -31.243 40.771  1.00 50.19  ? 25  DC  I N3    1 
ATOM   5159 C  C4    . DC  F 3 25  ? 80.391  -32.511 40.679  1.00 46.78  ? 25  DC  I C4    1 
ATOM   5160 N  N4    . DC  F 3 25  ? 80.192  -33.308 41.734  1.00 49.58  ? 25  DC  I N4    1 
ATOM   5161 C  C5    . DC  F 3 25  ? 81.014  -33.018 39.501  1.00 48.31  ? 25  DC  I C5    1 
ATOM   5162 C  C6    . DC  F 3 25  ? 81.187  -32.173 38.478  1.00 47.64  ? 25  DC  I C6    1 
ATOM   5163 N  N     . GLU G 1 6   ? -6.433  20.612  -10.290 1.00 81.42  ? 5   GLU K N     1 
ATOM   5164 C  CA    . GLU G 1 6   ? -7.594  20.541  -9.410  1.00 76.80  ? 5   GLU K CA    1 
ATOM   5165 C  C     . GLU G 1 6   ? -7.232  21.093  -8.036  1.00 84.70  ? 5   GLU K C     1 
ATOM   5166 O  O     . GLU G 1 6   ? -8.105  21.448  -7.235  1.00 82.31  ? 5   GLU K O     1 
ATOM   5167 C  CB    . GLU G 1 6   ? -8.098  19.099  -9.300  1.00 72.53  ? 5   GLU K CB    1 
ATOM   5168 C  CG    . GLU G 1 6   ? -9.314  18.943  -8.414  1.00 72.30  ? 5   GLU K CG    1 
ATOM   5169 C  CD    . GLU G 1 6   ? -10.414 19.908  -8.788  1.00 85.64  ? 5   GLU K CD    1 
ATOM   5170 O  OE1   . GLU G 1 6   ? -10.968 19.782  -9.900  1.00 80.50  ? 5   GLU K OE1   1 
ATOM   5171 O  OE2   . GLU G 1 6   ? -10.710 20.807  -7.973  1.00 74.92  ? 5   GLU K OE2   1 
ATOM   5172 N  N     . ASN G 1 7   ? -5.924  21.175  -7.788  1.00 77.80  ? 6   ASN K N     1 
ATOM   5173 C  CA    . ASN G 1 7   ? -5.314  21.461  -6.490  1.00 79.64  ? 6   ASN K CA    1 
ATOM   5174 C  C     . ASN G 1 7   ? -5.779  20.473  -5.423  1.00 72.42  ? 6   ASN K C     1 
ATOM   5175 O  O     . ASN G 1 7   ? -4.956  19.957  -4.661  1.00 62.01  ? 6   ASN K O     1 
ATOM   5176 C  CB    . ASN G 1 7   ? -5.575  22.897  -6.027  1.00 75.40  ? 6   ASN K CB    1 
ATOM   5177 C  CG    . ASN G 1 7   ? -4.613  23.319  -4.899  1.00 80.37  ? 6   ASN K CG    1 
ATOM   5178 O  OD1   . ASN G 1 7   ? -3.410  23.045  -4.970  1.00 88.22  ? 6   ASN K OD1   1 
ATOM   5179 N  ND2   . ASN G 1 7   ? -5.126  24.012  -3.891  1.00 74.11  ? 6   ASN K ND2   1 
ATOM   5180 N  N     . VAL G 1 8   ? -7.086  20.193  -5.370  1.00 68.17  ? 7   VAL K N     1 
ATOM   5181 C  CA    . VAL G 1 8   ? -7.631  19.261  -4.378  1.00 62.08  ? 7   VAL K CA    1 
ATOM   5182 C  C     . VAL G 1 8   ? -7.088  17.857  -4.603  1.00 58.23  ? 7   VAL K C     1 
ATOM   5183 O  O     . VAL G 1 8   ? -6.582  17.209  -3.675  1.00 50.21  ? 7   VAL K O     1 
ATOM   5184 C  CB    . VAL G 1 8   ? -9.171  19.289  -4.424  1.00 63.73  ? 7   VAL K CB    1 
ATOM   5185 C  CG1   . VAL G 1 8   ? -9.776  18.408  -3.340  1.00 56.39  ? 7   VAL K CG1   1 
ATOM   5186 C  CG2   . VAL G 1 8   ? -9.670  20.722  -4.298  1.00 68.05  ? 7   VAL K CG2   1 
ATOM   5187 N  N     . SER G 1 9   ? -7.168  17.359  -5.840  1.00 56.20  ? 8   SER K N     1 
ATOM   5188 C  CA    . SER G 1 9   ? -6.675  16.019  -6.138  1.00 60.78  ? 8   SER K CA    1 
ATOM   5189 C  C     . SER G 1 9   ? -5.154  15.939  -6.109  1.00 53.23  ? 8   SER K C     1 
ATOM   5190 O  O     . SER G 1 9   ? -4.607  14.851  -5.902  1.00 47.01  ? 8   SER K O     1 
ATOM   5191 C  CB    . SER G 1 9   ? -7.196  15.550  -7.499  1.00 60.56  ? 8   SER K CB    1 
ATOM   5192 O  OG    . SER G 1 9   ? -6.530  16.219  -8.554  1.00 66.48  ? 8   SER K OG    1 
ATOM   5193 N  N     . GLY G 1 10  ? -4.459  17.059  -6.316  1.00 53.58  ? 9   GLY K N     1 
ATOM   5194 C  CA    . GLY G 1 10  ? -3.015  17.053  -6.153  1.00 43.47  ? 9   GLY K CA    1 
ATOM   5195 C  C     . GLY G 1 10  ? -2.609  16.843  -4.708  1.00 47.26  ? 9   GLY K C     1 
ATOM   5196 O  O     . GLY G 1 10  ? -1.762  15.999  -4.404  1.00 44.63  ? 9   GLY K O     1 
ATOM   5197 N  N     . ILE G 1 11  ? -3.216  17.606  -3.795  1.00 44.58  ? 10  ILE K N     1 
ATOM   5198 C  CA    . ILE G 1 11  ? -2.959  17.407  -2.373  1.00 39.71  ? 10  ILE K CA    1 
ATOM   5199 C  C     . ILE G 1 11  ? -3.447  16.035  -1.930  1.00 36.90  ? 10  ILE K C     1 
ATOM   5200 O  O     . ILE G 1 11  ? -2.833  15.398  -1.066  1.00 38.58  ? 10  ILE K O     1 
ATOM   5201 C  CB    . ILE G 1 11  ? -3.610  18.537  -1.550  1.00 47.01  ? 10  ILE K CB    1 
ATOM   5202 C  CG1   . ILE G 1 11  ? -3.068  19.898  -1.990  1.00 52.65  ? 10  ILE K CG1   1 
ATOM   5203 C  CG2   . ILE G 1 11  ? -3.367  18.331  -0.061  1.00 45.26  ? 10  ILE K CG2   1 
ATOM   5204 C  CD1   . ILE G 1 11  ? -3.653  21.065  -1.225  1.00 54.89  ? 10  ILE K CD1   1 
ATOM   5205 N  N     . SER G 1 12  ? -4.543  15.551  -2.521  1.00 36.01  ? 11  SER K N     1 
ATOM   5206 C  CA    . SER G 1 12  ? -5.048  14.225  -2.177  1.00 38.25  ? 11  SER K CA    1 
ATOM   5207 C  C     . SER G 1 12  ? -4.038  13.141  -2.533  1.00 37.15  ? 11  SER K C     1 
ATOM   5208 O  O     . SER G 1 12  ? -3.835  12.195  -1.762  1.00 34.24  ? 11  SER K O     1 
ATOM   5209 C  CB    . SER G 1 12  ? -6.378  13.968  -2.886  1.00 36.04  ? 11  SER K CB    1 
ATOM   5210 O  OG    . SER G 1 12  ? -7.360  14.911  -2.492  1.00 52.41  ? 11  SER K OG    1 
ATOM   5211 N  N     . ALA G 1 13  ? -3.395  13.261  -3.697  1.00 37.26  ? 12  ALA K N     1 
ATOM   5212 C  CA    . ALA G 1 13  ? -2.403  12.270  -4.101  1.00 38.76  ? 12  ALA K CA    1 
ATOM   5213 C  C     . ALA G 1 13  ? -1.177  12.316  -3.198  1.00 34.58  ? 12  ALA K C     1 
ATOM   5214 O  O     . ALA G 1 13  ? -0.652  11.269  -2.801  1.00 36.36  ? 12  ALA K O     1 
ATOM   5215 C  CB    . ALA G 1 13  ? -2.007  12.489  -5.560  1.00 34.63  ? 12  ALA K CB    1 
ATOM   5216 N  N     . TYR G 1 14  ? -0.707  13.521  -2.864  1.00 31.99  ? 13  TYR K N     1 
ATOM   5217 C  CA    . TYR G 1 14  ? 0.435   13.653  -1.965  1.00 32.14  ? 13  TYR K CA    1 
ATOM   5218 C  C     . TYR G 1 14  ? 0.131   13.056  -0.597  1.00 32.50  ? 13  TYR K C     1 
ATOM   5219 O  O     . TYR G 1 14  ? 0.962   12.340  -0.025  1.00 30.18  ? 13  TYR K O     1 
ATOM   5220 C  CB    . TYR G 1 14  ? 0.827   15.126  -1.839  1.00 33.18  ? 13  TYR K CB    1 
ATOM   5221 C  CG    . TYR G 1 14  ? 1.915   15.403  -0.827  1.00 30.33  ? 13  TYR K CG    1 
ATOM   5222 C  CD1   . TYR G 1 14  ? 3.252   15.206  -1.145  1.00 34.26  ? 13  TYR K CD1   1 
ATOM   5223 C  CD2   . TYR G 1 14  ? 1.607   15.873  0.444   1.00 35.86  ? 13  TYR K CD2   1 
ATOM   5224 C  CE1   . TYR G 1 14  ? 4.252   15.462  -0.224  1.00 34.71  ? 13  TYR K CE1   1 
ATOM   5225 C  CE2   . TYR G 1 14  ? 2.599   16.132  1.371   1.00 30.10  ? 13  TYR K CE2   1 
ATOM   5226 C  CZ    . TYR G 1 14  ? 3.920   15.925  1.032   1.00 35.46  ? 13  TYR K CZ    1 
ATOM   5227 O  OH    . TYR G 1 14  ? 4.912   16.180  1.950   1.00 37.87  ? 13  TYR K OH    1 
ATOM   5228 N  N     . LEU G 1 15  ? -1.059  13.333  -0.060  1.00 32.47  ? 14  LEU K N     1 
ATOM   5229 C  CA    . LEU G 1 15  ? -1.441  12.762  1.228   1.00 32.41  ? 14  LEU K CA    1 
ATOM   5230 C  C     . LEU G 1 15  ? -1.540  11.244  1.149   1.00 28.35  ? 14  LEU K C     1 
ATOM   5231 O  O     . LEU G 1 15  ? -1.157  10.540  2.091   1.00 30.80  ? 14  LEU K O     1 
ATOM   5232 C  CB    . LEU G 1 15  ? -2.764  13.364  1.698   1.00 30.68  ? 14  LEU K CB    1 
ATOM   5233 C  CG    . LEU G 1 15  ? -2.705  14.798  2.227   1.00 35.89  ? 14  LEU K CG    1 
ATOM   5234 C  CD1   . LEU G 1 15  ? -4.100  15.316  2.535   1.00 32.62  ? 14  LEU K CD1   1 
ATOM   5235 C  CD2   . LEU G 1 15  ? -1.820  14.873  3.463   1.00 35.17  ? 14  LEU K CD2   1 
ATOM   5236 N  N     . LEU G 1 16  ? -2.050  10.719  0.033   1.00 30.13  ? 15  LEU K N     1 
ATOM   5237 C  CA    . LEU G 1 16  ? -2.151  9.271   -0.120  1.00 33.14  ? 15  LEU K CA    1 
ATOM   5238 C  C     . LEU G 1 16  ? -0.771  8.623   -0.140  1.00 31.09  ? 15  LEU K C     1 
ATOM   5239 O  O     . LEU G 1 16  ? -0.589  7.519   0.385   1.00 27.29  ? 15  LEU K O     1 
ATOM   5240 C  CB    . LEU G 1 16  ? -2.928  8.929   -1.392  1.00 26.24  ? 15  LEU K CB    1 
ATOM   5241 C  CG    . LEU G 1 16  ? -3.197  7.444   -1.643  1.00 36.46  ? 15  LEU K CG    1 
ATOM   5242 C  CD1   . LEU G 1 16  ? -4.012  6.844   -0.505  1.00 32.51  ? 15  LEU K CD1   1 
ATOM   5243 C  CD2   . LEU G 1 16  ? -3.901  7.241   -2.976  1.00 30.23  ? 15  LEU K CD2   1 
ATOM   5244 N  N     . GLY G 1 17  ? 0.214   9.298   -0.738  1.00 30.50  ? 16  GLY K N     1 
ATOM   5245 C  CA    . GLY G 1 17  ? 1.574   8.785   -0.698  1.00 28.69  ? 16  GLY K CA    1 
ATOM   5246 C  C     . GLY G 1 17  ? 2.120   8.702   0.714   1.00 29.47  ? 16  GLY K C     1 
ATOM   5247 O  O     . GLY G 1 17  ? 2.825   7.752   1.064   1.00 27.61  ? 16  GLY K O     1 
ATOM   5248 N  N     . LEU G 1 18  ? 1.800   9.696   1.547   1.00 27.44  ? 17  LEU K N     1 
ATOM   5249 C  CA    . LEU G 1 18  ? 2.193   9.646   2.951   1.00 32.97  ? 17  LEU K CA    1 
ATOM   5250 C  C     . LEU G 1 18  ? 1.458   8.531   3.682   1.00 31.44  ? 17  LEU K C     1 
ATOM   5251 O  O     . LEU G 1 18  ? 2.065   7.765   4.441   1.00 30.53  ? 17  LEU K O     1 
ATOM   5252 C  CB    . LEU G 1 18  ? 1.916   10.991  3.624   1.00 29.91  ? 17  LEU K CB    1 
ATOM   5253 C  CG    . LEU G 1 18  ? 2.604   12.236  3.066   1.00 36.66  ? 17  LEU K CG    1 
ATOM   5254 C  CD1   . LEU G 1 18  ? 2.155   13.465  3.837   1.00 37.20  ? 17  LEU K CD1   1 
ATOM   5255 C  CD2   . LEU G 1 18  ? 4.116   12.088  3.125   1.00 34.31  ? 17  LEU K CD2   1 
ATOM   5256 N  N     . ILE G 1 19  ? 0.144   8.431   3.465   1.00 26.11  ? 18  ILE K N     1 
ATOM   5257 C  CA    . ILE G 1 19  ? -0.661  7.416   4.139   1.00 27.34  ? 18  ILE K CA    1 
ATOM   5258 C  C     . ILE G 1 19  ? -0.182  6.020   3.760   1.00 28.17  ? 18  ILE K C     1 
ATOM   5259 O  O     . ILE G 1 19  ? 0.080   5.180   4.625   1.00 31.91  ? 18  ILE K O     1 
ATOM   5260 C  CB    . ILE G 1 19  ? -2.150  7.604   3.804   1.00 28.06  ? 18  ILE K CB    1 
ATOM   5261 C  CG1   . ILE G 1 19  ? -2.660  8.933   4.360   1.00 29.90  ? 18  ILE K CG1   1 
ATOM   5262 C  CG2   . ILE G 1 19  ? -2.967  6.442   4.349   1.00 30.60  ? 18  ILE K CG2   1 
ATOM   5263 C  CD1   . ILE G 1 19  ? -3.853  9.484   3.614   1.00 28.40  ? 18  ILE K CD1   1 
ATOM   5264 N  N     . ILE G 1 20  ? -0.072  5.754   2.458   1.00 30.29  ? 19  ILE K N     1 
ATOM   5265 C  CA    . ILE G 1 20  ? 0.417   4.454   2.006   1.00 33.21  ? 19  ILE K CA    1 
ATOM   5266 C  C     . ILE G 1 20  ? 1.804   4.184   2.574   1.00 33.58  ? 19  ILE K C     1 
ATOM   5267 O  O     . ILE G 1 20  ? 2.109   3.065   3.003   1.00 33.80  ? 19  ILE K O     1 
ATOM   5268 C  CB    . ILE G 1 20  ? 0.409   4.390   0.466   1.00 35.47  ? 19  ILE K CB    1 
ATOM   5269 C  CG1   . ILE G 1 20  ? -1.026  4.369   -0.079  1.00 50.66  ? 19  ILE K CG1   1 
ATOM   5270 C  CG2   . ILE G 1 20  ? 1.185   3.188   -0.025  1.00 41.64  ? 19  ILE K CG2   1 
ATOM   5271 C  CD1   . ILE G 1 20  ? -1.968  3.478   0.691   1.00 50.17  ? 19  ILE K CD1   1 
ATOM   5272 N  N     . GLY G 1 21  ? 2.652   5.206   2.615   1.00 34.04  ? 20  GLY K N     1 
ATOM   5273 C  CA    . GLY G 1 21  ? 3.991   5.055   3.138   1.00 31.40  ? 20  GLY K CA    1 
ATOM   5274 C  C     . GLY G 1 21  ? 4.071   4.943   4.647   1.00 30.39  ? 20  GLY K C     1 
ATOM   5275 O  O     . GLY G 1 21  ? 4.393   3.878   5.177   1.00 32.37  ? 20  GLY K O     1 
ATOM   5276 N  N     . ASP G 1 22  ? 3.780   6.027   5.361   1.00 28.76  ? 21  ASP K N     1 
ATOM   5277 C  CA    . ASP G 1 22  ? 4.032   6.087   6.794   1.00 28.29  ? 21  ASP K CA    1 
ATOM   5278 C  C     . ASP G 1 22  ? 2.783   5.891   7.642   1.00 28.64  ? 21  ASP K C     1 
ATOM   5279 O  O     . ASP G 1 22  ? 2.814   6.182   8.841   1.00 36.34  ? 21  ASP K O     1 
ATOM   5280 C  CB    . ASP G 1 22  ? 4.697   7.415   7.149   1.00 29.63  ? 21  ASP K CB    1 
ATOM   5281 C  CG    . ASP G 1 22  ? 6.183   7.401   6.889   1.00 32.95  ? 21  ASP K CG    1 
ATOM   5282 O  OD1   . ASP G 1 22  ? 6.750   6.294   6.778   1.00 29.34  ? 21  ASP K OD1   1 
ATOM   5283 O  OD2   . ASP G 1 22  ? 6.781   8.493   6.796   1.00 38.85  ? 21  ASP K OD2   1 
ATOM   5284 N  N     . GLY G 1 23  ? 1.694   5.400   7.061   1.00 31.88  ? 22  GLY K N     1 
ATOM   5285 C  CA    . GLY G 1 23  ? 0.485   5.185   7.832   1.00 32.95  ? 22  GLY K CA    1 
ATOM   5286 C  C     . GLY G 1 23  ? -0.365  4.055   7.295   1.00 36.46  ? 22  GLY K C     1 
ATOM   5287 O  O     . GLY G 1 23  ? 0.139   2.954   7.054   1.00 33.02  ? 22  GLY K O     1 
ATOM   5288 N  N     . GLY G 1 24  ? -1.650  4.314   7.093   1.00 30.07  ? 23  GLY K N     1 
ATOM   5289 C  CA    . GLY G 1 24  ? -2.521  3.301   6.538   1.00 27.10  ? 23  GLY K CA    1 
ATOM   5290 C  C     . GLY G 1 24  ? -3.973  3.713   6.627   1.00 32.94  ? 23  GLY K C     1 
ATOM   5291 O  O     . GLY G 1 24  ? -4.323  4.762   7.180   1.00 26.80  ? 23  GLY K O     1 
ATOM   5292 N  N     . LEU G 1 25  ? -4.816  2.855   6.059   1.00 33.61  ? 24  LEU K N     1 
ATOM   5293 C  CA    . LEU G 1 25  ? -6.263  3.022   6.061   1.00 28.44  ? 24  LEU K CA    1 
ATOM   5294 C  C     . LEU G 1 25  ? -6.865  1.804   6.745   1.00 31.26  ? 24  LEU K C     1 
ATOM   5295 O  O     . LEU G 1 25  ? -6.704  0.678   6.263   1.00 34.32  ? 24  LEU K O     1 
ATOM   5296 C  CB    . LEU G 1 25  ? -6.794  3.175   4.635   1.00 31.85  ? 24  LEU K CB    1 
ATOM   5297 C  CG    . LEU G 1 25  ? -6.119  4.287   3.830   1.00 34.88  ? 24  LEU K CG    1 
ATOM   5298 C  CD1   . LEU G 1 25  ? -6.438  4.164   2.348   1.00 34.50  ? 24  LEU K CD1   1 
ATOM   5299 C  CD2   . LEU G 1 25  ? -6.540  5.649   4.361   1.00 31.19  ? 24  LEU K CD2   1 
ATOM   5300 N  N     . TYR G 1 26  ? -7.550  2.026   7.864   1.00 27.91  ? 25  TYR K N     1 
ATOM   5301 C  CA    . TYR G 1 26  ? -7.942  0.948   8.762   1.00 33.49  ? 25  TYR K CA    1 
ATOM   5302 C  C     . TYR G 1 26  ? -9.451  0.946   8.958   1.00 35.77  ? 25  TYR K C     1 
ATOM   5303 O  O     . TYR G 1 26  ? -10.033 1.962   9.354   1.00 36.15  ? 25  TYR K O     1 
ATOM   5304 C  CB    . TYR G 1 26  ? -7.223  1.082   10.105  1.00 31.32  ? 25  TYR K CB    1 
ATOM   5305 C  CG    . TYR G 1 26  ? -5.721  1.120   9.960   1.00 33.29  ? 25  TYR K CG    1 
ATOM   5306 C  CD1   . TYR G 1 26  ? -5.015  -0.013  9.580   1.00 31.26  ? 25  TYR K CD1   1 
ATOM   5307 C  CD2   . TYR G 1 26  ? -5.011  2.291   10.190  1.00 30.53  ? 25  TYR K CD2   1 
ATOM   5308 C  CE1   . TYR G 1 26  ? -3.642  0.016   9.440   1.00 34.23  ? 25  TYR K CE1   1 
ATOM   5309 C  CE2   . TYR G 1 26  ? -3.637  2.329   10.055  1.00 36.08  ? 25  TYR K CE2   1 
ATOM   5310 C  CZ    . TYR G 1 26  ? -2.959  1.189   9.679   1.00 33.71  ? 25  TYR K CZ    1 
ATOM   5311 O  OH    . TYR G 1 26  ? -1.593  1.221   9.539   1.00 38.47  ? 25  TYR K OH    1 
ATOM   5312 N  N     . LYS G 1 27  ? -10.072 -0.199  8.688   1.00 32.66  ? 26  LYS K N     1 
ATOM   5313 C  CA    . LYS G 1 27  ? -11.491 -0.428  8.947   1.00 38.00  ? 26  LYS K CA    1 
ATOM   5314 C  C     . LYS G 1 27  ? -11.577 -1.335  10.171  1.00 36.83  ? 26  LYS K C     1 
ATOM   5315 O  O     . LYS G 1 27  ? -11.394 -2.551  10.070  1.00 36.91  ? 26  LYS K O     1 
ATOM   5316 C  CB    . LYS G 1 27  ? -12.167 -1.042  7.726   1.00 38.39  ? 26  LYS K CB    1 
ATOM   5317 C  CG    . LYS G 1 27  ? -13.683 -1.141  7.803   1.00 46.03  ? 26  LYS K CG    1 
ATOM   5318 C  CD    . LYS G 1 27  ? -14.260 -1.469  6.431   1.00 51.10  ? 26  LYS K CD    1 
ATOM   5319 C  CE    . LYS G 1 27  ? -15.062 -2.761  6.441   1.00 59.54  ? 26  LYS K CE    1 
ATOM   5320 N  NZ    . LYS G 1 27  ? -16.452 -2.555  6.930   1.00 58.04  ? 26  LYS K NZ    1 
ATOM   5321 N  N     . LEU G 1 28  ? -11.842 -0.739  11.330  1.00 32.27  ? 27  LEU K N     1 
ATOM   5322 C  CA    . LEU G 1 28  ? -11.832 -1.463  12.594  1.00 40.57  ? 27  LEU K CA    1 
ATOM   5323 C  C     . LEU G 1 28  ? -13.211 -2.025  12.908  1.00 45.30  ? 27  LEU K C     1 
ATOM   5324 O  O     . LEU G 1 28  ? -14.234 -1.395  12.623  1.00 42.57  ? 27  LEU K O     1 
ATOM   5325 C  CB    . LEU G 1 28  ? -11.382 -0.557  13.745  1.00 36.97  ? 27  LEU K CB    1 
ATOM   5326 C  CG    . LEU G 1 28  ? -9.941  -0.040  13.840  1.00 45.51  ? 27  LEU K CG    1 
ATOM   5327 C  CD1   . LEU G 1 28  ? -8.933  -1.176  13.707  1.00 37.51  ? 27  LEU K CD1   1 
ATOM   5328 C  CD2   . LEU G 1 28  ? -9.661  1.072   12.838  1.00 38.89  ? 27  LEU K CD2   1 
ATOM   5329 N  N     . LYS G 1 29  ? -13.228 -3.214  13.505  1.00 41.33  ? 28  LYS K N     1 
ATOM   5330 C  CA    . LYS G 1 29  ? -14.439 -3.817  14.047  1.00 47.00  ? 28  LYS K CA    1 
ATOM   5331 C  C     . LYS G 1 29  ? -14.229 -4.047  15.536  1.00 52.12  ? 28  LYS K C     1 
ATOM   5332 O  O     . LYS G 1 29  ? -13.337 -4.805  15.930  1.00 46.37  ? 28  LYS K O     1 
ATOM   5333 C  CB    . LYS G 1 29  ? -14.777 -5.131  13.338  1.00 49.27  ? 28  LYS K CB    1 
ATOM   5334 C  CG    . LYS G 1 29  ? -14.994 -4.988  11.843  1.00 56.79  ? 28  LYS K CG    1 
ATOM   5335 C  CD    . LYS G 1 29  ? -16.010 -3.899  11.546  1.00 62.69  ? 28  LYS K CD    1 
ATOM   5336 C  CE    . LYS G 1 29  ? -15.950 -3.470  10.092  1.00 54.68  ? 28  LYS K CE    1 
ATOM   5337 N  NZ    . LYS G 1 29  ? -16.762 -2.246  9.851   1.00 49.94  ? 28  LYS K NZ    1 
ATOM   5338 N  N     . TYR G 1 30  ? -15.038 -3.386  16.356  1.00 48.47  ? 29  TYR K N     1 
ATOM   5339 C  CA    . TYR G 1 30  ? -14.965 -3.505  17.803  1.00 49.83  ? 29  TYR K CA    1 
ATOM   5340 C  C     . TYR G 1 30  ? -16.138 -4.326  18.322  1.00 55.18  ? 29  TYR K C     1 
ATOM   5341 O  O     . TYR G 1 30  ? -17.059 -4.687  17.584  1.00 59.79  ? 29  TYR K O     1 
ATOM   5342 C  CB    . TYR G 1 30  ? -14.964 -2.125  18.472  1.00 48.63  ? 29  TYR K CB    1 
ATOM   5343 C  CG    . TYR G 1 30  ? -13.832 -1.215  18.055  1.00 44.66  ? 29  TYR K CG    1 
ATOM   5344 C  CD1   . TYR G 1 30  ? -12.567 -1.721  17.785  1.00 46.54  ? 29  TYR K CD1   1 
ATOM   5345 C  CD2   . TYR G 1 30  ? -14.029 0.155   17.938  1.00 41.37  ? 29  TYR K CD2   1 
ATOM   5346 C  CE1   . TYR G 1 30  ? -11.530 -0.886  17.408  1.00 42.31  ? 29  TYR K CE1   1 
ATOM   5347 C  CE2   . TYR G 1 30  ? -13.001 0.996   17.562  1.00 43.72  ? 29  TYR K CE2   1 
ATOM   5348 C  CZ    . TYR G 1 30  ? -11.754 0.471   17.298  1.00 45.11  ? 29  TYR K CZ    1 
ATOM   5349 O  OH    . TYR G 1 30  ? -10.729 1.308   16.923  1.00 41.46  ? 29  TYR K OH    1 
ATOM   5350 N  N     . LYS G 1 31  ? -16.090 -4.615  19.617  1.00 56.45  ? 30  LYS K N     1 
ATOM   5351 C  CA    . LYS G 1 31  ? -17.219 -5.225  20.302  1.00 65.55  ? 30  LYS K CA    1 
ATOM   5352 C  C     . LYS G 1 31  ? -18.060 -4.122  20.956  1.00 63.11  ? 30  LYS K C     1 
ATOM   5353 O  O     . LYS G 1 31  ? -17.554 -3.332  21.754  1.00 73.70  ? 30  LYS K O     1 
ATOM   5354 C  CB    . LYS G 1 31  ? -16.734 -6.258  21.334  1.00 62.49  ? 30  LYS K CB    1 
ATOM   5355 C  CG    . LYS G 1 31  ? -15.969 -5.683  22.526  1.00 66.56  ? 30  LYS K CG    1 
ATOM   5356 C  CD    . LYS G 1 31  ? -15.196 -6.747  23.285  1.00 68.49  ? 30  LYS K CD    1 
ATOM   5357 C  CE    . LYS G 1 31  ? -15.226 -6.470  24.780  1.00 80.18  ? 30  LYS K CE    1 
ATOM   5358 N  NZ    . LYS G 1 31  ? -16.617 -6.235  25.266  1.00 82.55  ? 30  LYS K NZ    1 
ATOM   5359 N  N     . GLY G 1 32  ? -19.330 -4.019  20.576  1.00 62.66  ? 31  GLY K N     1 
ATOM   5360 C  CA    . GLY G 1 32  ? -19.915 -4.809  19.508  1.00 54.90  ? 31  GLY K CA    1 
ATOM   5361 C  C     . GLY G 1 32  ? -21.336 -4.345  19.239  1.00 54.45  ? 31  GLY K C     1 
ATOM   5362 O  O     . GLY G 1 32  ? -22.072 -4.043  20.178  1.00 72.66  ? 31  GLY K O     1 
ATOM   5363 N  N     . ASN G 1 33  ? -21.718 -4.245  17.969  1.00 57.59  ? 32  ASN K N     1 
ATOM   5364 C  CA    . ASN G 1 33  ? -20.796 -4.424  16.855  1.00 48.89  ? 32  ASN K CA    1 
ATOM   5365 C  C     . ASN G 1 33  ? -20.283 -3.058  16.423  1.00 45.72  ? 32  ASN K C     1 
ATOM   5366 O  O     . ASN G 1 33  ? -20.609 -2.576  15.338  1.00 43.21  ? 32  ASN K O     1 
ATOM   5367 C  CB    . ASN G 1 33  ? -21.476 -5.132  15.681  1.00 58.88  ? 32  ASN K CB    1 
ATOM   5368 C  CG    . ASN G 1 33  ? -22.354 -6.284  16.123  1.00 63.91  ? 32  ASN K CG    1 
ATOM   5369 O  OD1   . ASN G 1 33  ? -23.116 -6.168  17.082  1.00 66.39  ? 32  ASN K OD1   1 
ATOM   5370 N  ND2   . ASN G 1 33  ? -22.254 -7.407  15.421  1.00 72.70  ? 32  ASN K ND2   1 
ATOM   5371 N  N     . ARG G 1 34  ? -19.490 -2.433  17.288  1.00 47.26  ? 33  ARG K N     1 
ATOM   5372 C  CA    . ARG G 1 34  ? -18.975 -1.103  17.014  1.00 45.33  ? 33  ARG K CA    1 
ATOM   5373 C  C     . ARG G 1 34  ? -17.933 -1.159  15.898  1.00 46.65  ? 33  ARG K C     1 
ATOM   5374 O  O     . ARG G 1 34  ? -17.437 -2.225  15.520  1.00 42.32  ? 33  ARG K O     1 
ATOM   5375 C  CB    . ARG G 1 34  ? -18.393 -0.492  18.288  1.00 42.26  ? 33  ARG K CB    1 
ATOM   5376 C  CG    . ARG G 1 34  ? -19.426 -0.342  19.397  1.00 46.29  ? 33  ARG K CG    1 
ATOM   5377 C  CD    . ARG G 1 34  ? -18.827 0.171   20.698  1.00 44.99  ? 33  ARG K CD    1 
ATOM   5378 N  NE    . ARG G 1 34  ? -17.698 -0.630  21.159  1.00 52.32  ? 33  ARG K NE    1 
ATOM   5379 C  CZ    . ARG G 1 34  ? -16.473 -0.152  21.350  1.00 51.84  ? 33  ARG K CZ    1 
ATOM   5380 N  NH1   . ARG G 1 34  ? -16.217 1.130   21.125  1.00 50.84  ? 33  ARG K NH1   1 
ATOM   5381 N  NH2   . ARG G 1 34  ? -15.505 -0.953  21.773  1.00 60.85  ? 33  ARG K NH2   1 
ATOM   5382 N  N     . SER G 1 35  ? -17.609 0.013   15.358  1.00 41.97  ? 34  SER K N     1 
ATOM   5383 C  CA    . SER G 1 35  ? -16.710 0.096   14.218  1.00 34.65  ? 34  SER K CA    1 
ATOM   5384 C  C     . SER G 1 35  ? -15.986 1.433   14.242  1.00 34.94  ? 34  SER K C     1 
ATOM   5385 O  O     . SER G 1 35  ? -16.340 2.346   14.992  1.00 36.72  ? 34  SER K O     1 
ATOM   5386 C  CB    . SER G 1 35  ? -17.468 -0.080  12.898  1.00 35.81  ? 34  SER K CB    1 
ATOM   5387 O  OG    . SER G 1 35  ? -18.359 1.002   12.678  1.00 36.65  ? 34  SER K OG    1 
ATOM   5388 N  N     . GLU G 1 36  ? -14.957 1.534   13.404  1.00 38.01  ? 35  GLU K N     1 
ATOM   5389 C  CA    . GLU G 1 36  ? -14.233 2.782   13.221  1.00 35.08  ? 35  GLU K CA    1 
ATOM   5390 C  C     . GLU G 1 36  ? -13.509 2.732   11.884  1.00 36.27  ? 35  GLU K C     1 
ATOM   5391 O  O     . GLU G 1 36  ? -13.120 1.660   11.413  1.00 34.43  ? 35  GLU K O     1 
ATOM   5392 C  CB    . GLU G 1 36  ? -13.238 3.040   14.359  1.00 36.85  ? 35  GLU K CB    1 
ATOM   5393 C  CG    . GLU G 1 36  ? -12.941 4.514   14.581  1.00 42.18  ? 35  GLU K CG    1 
ATOM   5394 C  CD    . GLU G 1 36  ? -11.845 4.751   15.602  1.00 40.89  ? 35  GLU K CD    1 
ATOM   5395 O  OE1   . GLU G 1 36  ? -11.185 5.809   15.528  1.00 36.10  ? 35  GLU K OE1   1 
ATOM   5396 O  OE2   . GLU G 1 36  ? -11.642 3.882   16.475  1.00 42.57  ? 35  GLU K OE2   1 
ATOM   5397 N  N     . TYR G 1 37  ? -13.342 3.905   11.279  1.00 35.41  ? 36  TYR K N     1 
ATOM   5398 C  CA    . TYR G 1 37  ? -12.646 4.051   10.007  1.00 32.75  ? 36  TYR K CA    1 
ATOM   5399 C  C     . TYR G 1 37  ? -11.578 5.118   10.186  1.00 34.64  ? 36  TYR K C     1 
ATOM   5400 O  O     . TYR G 1 37  ? -11.900 6.270   10.494  1.00 37.48  ? 36  TYR K O     1 
ATOM   5401 C  CB    . TYR G 1 37  ? -13.613 4.436   8.883   1.00 31.56  ? 36  TYR K CB    1 
ATOM   5402 C  CG    . TYR G 1 37  ? -14.804 3.511   8.730   1.00 34.97  ? 36  TYR K CG    1 
ATOM   5403 C  CD1   . TYR G 1 37  ? -15.903 3.613   9.576   1.00 33.50  ? 36  TYR K CD1   1 
ATOM   5404 C  CD2   . TYR G 1 37  ? -14.836 2.548   7.731   1.00 35.05  ? 36  TYR K CD2   1 
ATOM   5405 C  CE1   . TYR G 1 37  ? -16.993 2.774   9.438   1.00 36.55  ? 36  TYR K CE1   1 
ATOM   5406 C  CE2   . TYR G 1 37  ? -15.923 1.705   7.584   1.00 34.44  ? 36  TYR K CE2   1 
ATOM   5407 C  CZ    . TYR G 1 37  ? -16.998 1.823   8.440   1.00 39.88  ? 36  TYR K CZ    1 
ATOM   5408 O  OH    . TYR G 1 37  ? -18.082 0.987   8.298   1.00 41.10  ? 36  TYR K OH    1 
ATOM   5409 N  N     . ARG G 1 38  ? -10.317 4.742   9.996   1.00 35.77  ? 37  ARG K N     1 
ATOM   5410 C  CA    . ARG G 1 38  ? -9.196  5.608   10.330  1.00 34.46  ? 37  ARG K CA    1 
ATOM   5411 C  C     . ARG G 1 38  ? -8.331  5.892   9.111   1.00 33.81  ? 37  ARG K C     1 
ATOM   5412 O  O     . ARG G 1 38  ? -8.043  4.996   8.311   1.00 30.34  ? 37  ARG K O     1 
ATOM   5413 C  CB    . ARG G 1 38  ? -8.337  4.989   11.436  1.00 32.10  ? 37  ARG K CB    1 
ATOM   5414 C  CG    . ARG G 1 38  ? -8.952  5.096   12.819  1.00 35.77  ? 37  ARG K CG    1 
ATOM   5415 C  CD    . ARG G 1 38  ? -8.018  4.551   13.884  1.00 39.42  ? 37  ARG K CD    1 
ATOM   5416 N  NE    . ARG G 1 38  ? -8.654  4.527   15.197  1.00 42.17  ? 37  ARG K NE    1 
ATOM   5417 C  CZ    . ARG G 1 38  ? -8.060  4.106   16.309  1.00 43.32  ? 37  ARG K CZ    1 
ATOM   5418 N  NH1   . ARG G 1 38  ? -6.807  3.671   16.270  1.00 38.59  ? 37  ARG K NH1   1 
ATOM   5419 N  NH2   . ARG G 1 38  ? -8.717  4.122   17.460  1.00 41.55  ? 37  ARG K NH2   1 
ATOM   5420 N  N     . VAL G 1 39  ? -7.926  7.153   8.982   1.00 36.21  ? 38  VAL K N     1 
ATOM   5421 C  CA    . VAL G 1 39  ? -6.909  7.588   8.033   1.00 31.19  ? 38  VAL K CA    1 
ATOM   5422 C  C     . VAL G 1 39  ? -5.710  8.040   8.854   1.00 36.47  ? 38  VAL K C     1 
ATOM   5423 O  O     . VAL G 1 39  ? -5.826  8.960   9.673   1.00 34.03  ? 38  VAL K O     1 
ATOM   5424 C  CB    . VAL G 1 39  ? -7.424  8.715   7.126   1.00 33.23  ? 38  VAL K CB    1 
ATOM   5425 C  CG1   . VAL G 1 39  ? -6.369  9.100   6.108   1.00 29.12  ? 38  VAL K CG1   1 
ATOM   5426 C  CG2   . VAL G 1 39  ? -8.715  8.294   6.436   1.00 31.65  ? 38  VAL K CG2   1 
ATOM   5427 N  N     . VAL G 1 40  ? -4.564  7.393   8.648   1.00 30.04  ? 39  VAL K N     1 
ATOM   5428 C  CA    . VAL G 1 40  ? -3.437  7.499   9.567   1.00 29.66  ? 39  VAL K CA    1 
ATOM   5429 C  C     . VAL G 1 40  ? -2.168  7.869   8.811   1.00 34.57  ? 39  VAL K C     1 
ATOM   5430 O  O     . VAL G 1 40  ? -1.884  7.320   7.740   1.00 26.99  ? 39  VAL K O     1 
ATOM   5431 C  CB    . VAL G 1 40  ? -3.231  6.183   10.350  1.00 31.65  ? 39  VAL K CB    1 
ATOM   5432 C  CG1   . VAL G 1 40  ? -1.951  6.235   11.171  1.00 27.26  ? 39  VAL K CG1   1 
ATOM   5433 C  CG2   . VAL G 1 40  ? -4.429  5.905   11.246  1.00 32.19  ? 39  VAL K CG2   1 
ATOM   5434 N  N     . ILE G 1 41  ? -1.414  8.815   9.371   1.00 32.84  ? 40  ILE K N     1 
ATOM   5435 C  CA    . ILE G 1 41  ? -0.016  9.050   9.028   1.00 31.59  ? 40  ILE K CA    1 
ATOM   5436 C  C     . ILE G 1 41  ? 0.767   9.117   10.330  1.00 32.46  ? 40  ILE K C     1 
ATOM   5437 O  O     . ILE G 1 41  ? 0.413   9.888   11.229  1.00 34.46  ? 40  ILE K O     1 
ATOM   5438 C  CB    . ILE G 1 41  ? 0.188   10.349  8.223   1.00 31.59  ? 40  ILE K CB    1 
ATOM   5439 C  CG1   . ILE G 1 41  ? -0.703  10.378  6.983   1.00 28.94  ? 40  ILE K CG1   1 
ATOM   5440 C  CG2   . ILE G 1 41  ? 1.651   10.506  7.831   1.00 33.10  ? 40  ILE K CG2   1 
ATOM   5441 C  CD1   . ILE G 1 41  ? -0.713  11.720  6.278   1.00 29.14  ? 40  ILE K CD1   1 
ATOM   5442 N  N     . THR G 1 42  ? 1.819   8.310   10.440  1.00 30.15  ? 41  THR K N     1 
ATOM   5443 C  CA    . THR G 1 42  ? 2.695   8.340   11.601  1.00 36.53  ? 41  THR K CA    1 
ATOM   5444 C  C     . THR G 1 42  ? 4.066   8.874   11.206  1.00 38.76  ? 41  THR K C     1 
ATOM   5445 O  O     . THR G 1 42  ? 4.535   8.664   10.084  1.00 34.86  ? 41  THR K O     1 
ATOM   5446 C  CB    . THR G 1 42  ? 2.844   6.954   12.238  1.00 34.01  ? 41  THR K CB    1 
ATOM   5447 O  OG1   . THR G 1 42  ? 3.566   6.088   11.353  1.00 33.93  ? 41  THR K OG1   1 
ATOM   5448 C  CG2   . THR G 1 42  ? 1.478   6.354   12.539  1.00 31.45  ? 41  THR K CG2   1 
ATOM   5449 N  N     . GLN G 1 43  ? 4.706   9.567   12.145  1.00 33.54  ? 42  GLN K N     1 
ATOM   5450 C  CA    . GLN G 1 43  ? 5.991   10.201  11.890  1.00 37.53  ? 42  GLN K CA    1 
ATOM   5451 C  C     . GLN G 1 43  ? 6.616   10.583  13.223  1.00 41.26  ? 42  GLN K C     1 
ATOM   5452 O  O     . GLN G 1 43  ? 5.909   10.914  14.180  1.00 37.49  ? 42  GLN K O     1 
ATOM   5453 C  CB    . GLN G 1 43  ? 5.835   11.440  10.998  1.00 36.24  ? 42  GLN K CB    1 
ATOM   5454 C  CG    . GLN G 1 43  ? 7.123   11.928  10.353  1.00 39.68  ? 42  GLN K CG    1 
ATOM   5455 C  CD    . GLN G 1 43  ? 7.401   11.257  9.019   1.00 38.17  ? 42  GLN K CD    1 
ATOM   5456 O  OE1   . GLN G 1 43  ? 8.357   11.606  8.326   1.00 36.22  ? 42  GLN K OE1   1 
ATOM   5457 N  NE2   . GLN G 1 43  ? 6.563   10.294  8.651   1.00 36.04  ? 42  GLN K NE2   1 
ATOM   5458 N  N     . LYS G 1 44  ? 7.949   10.531  13.274  1.00 42.16  ? 43  LYS K N     1 
ATOM   5459 C  CA    . LYS G 1 44  ? 8.655   10.888  14.500  1.00 36.96  ? 43  LYS K CA    1 
ATOM   5460 C  C     . LYS G 1 44  ? 8.663   12.396  14.710  1.00 40.70  ? 43  LYS K C     1 
ATOM   5461 O  O     . LYS G 1 44  ? 8.393   12.882  15.815  1.00 45.60  ? 43  LYS K O     1 
ATOM   5462 C  CB    . LYS G 1 44  ? 10.085  10.348  14.461  1.00 43.84  ? 43  LYS K CB    1 
ATOM   5463 C  CG    . LYS G 1 44  ? 10.919  10.728  15.674  1.00 51.49  ? 43  LYS K CG    1 
ATOM   5464 C  CD    . LYS G 1 44  ? 11.130  9.536   16.590  1.00 52.42  ? 43  LYS K CD    1 
ATOM   5465 C  CE    . LYS G 1 44  ? 11.637  9.966   17.958  1.00 62.08  ? 43  LYS K CE    1 
ATOM   5466 N  NZ    . LYS G 1 44  ? 10.530  10.456  18.827  1.00 68.55  ? 43  LYS K NZ    1 
ATOM   5467 N  N     . SER G 1 45  ? 8.969   13.152  13.659  1.00 42.41  ? 44  SER K N     1 
ATOM   5468 C  CA    . SER G 1 45  ? 9.091   14.599  13.772  1.00 44.36  ? 44  SER K CA    1 
ATOM   5469 C  C     . SER G 1 45  ? 7.753   15.227  14.142  1.00 48.70  ? 44  SER K C     1 
ATOM   5470 O  O     . SER G 1 45  ? 6.785   15.143  13.380  1.00 46.92  ? 44  SER K O     1 
ATOM   5471 C  CB    . SER G 1 45  ? 9.611   15.181  12.458  1.00 40.02  ? 44  SER K CB    1 
ATOM   5472 O  OG    . SER G 1 45  ? 9.507   16.594  12.446  1.00 51.87  ? 44  SER K OG    1 
ATOM   5473 N  N     . GLU G 1 46  ? 7.704   15.854  15.320  1.00 50.16  ? 45  GLU K N     1 
ATOM   5474 C  CA    . GLU G 1 46  ? 6.496   16.558  15.738  1.00 47.09  ? 45  GLU K CA    1 
ATOM   5475 C  C     . GLU G 1 46  ? 6.199   17.738  14.822  1.00 49.02  ? 45  GLU K C     1 
ATOM   5476 O  O     . GLU G 1 46  ? 5.041   17.972  14.455  1.00 47.26  ? 45  GLU K O     1 
ATOM   5477 C  CB    . GLU G 1 46  ? 6.641   17.034  17.183  1.00 56.99  ? 45  GLU K CB    1 
ATOM   5478 C  CG    . GLU G 1 46  ? 5.410   17.739  17.728  1.00 60.24  ? 45  GLU K CG    1 
ATOM   5479 C  CD    . GLU G 1 46  ? 5.657   18.390  19.074  1.00 71.58  ? 45  GLU K CD    1 
ATOM   5480 O  OE1   . GLU G 1 46  ? 6.677   18.063  19.715  1.00 70.45  ? 45  GLU K OE1   1 
ATOM   5481 O  OE2   . GLU G 1 46  ? 4.831   19.230  19.490  1.00 81.15  ? 45  GLU K OE2   1 
ATOM   5482 N  N     . ASN G 1 47  ? 7.233   18.496  14.448  1.00 48.06  ? 46  ASN K N     1 
ATOM   5483 C  CA    . ASN G 1 47  ? 7.035   19.660  13.590  1.00 50.33  ? 46  ASN K CA    1 
ATOM   5484 C  C     . ASN G 1 47  ? 6.513   19.252  12.217  1.00 48.19  ? 46  ASN K C     1 
ATOM   5485 O  O     . ASN G 1 47  ? 5.674   19.946  11.631  1.00 49.03  ? 46  ASN K O     1 
ATOM   5486 C  CB    . ASN G 1 47  ? 8.348   20.439  13.470  1.00 50.30  ? 46  ASN K CB    1 
ATOM   5487 C  CG    . ASN G 1 47  ? 8.353   21.411  12.303  1.00 59.47  ? 46  ASN K CG    1 
ATOM   5488 O  OD1   . ASN G 1 47  ? 7.984   22.575  12.451  1.00 63.97  ? 46  ASN K OD1   1 
ATOM   5489 N  ND2   . ASN G 1 47  ? 8.797   20.943  11.140  1.00 59.44  ? 46  ASN K ND2   1 
ATOM   5490 N  N     . LEU G 1 48  ? 7.001   18.130  11.686  1.00 42.98  ? 47  LEU K N     1 
ATOM   5491 C  CA    . LEU G 1 48  ? 6.536   17.664  10.384  1.00 45.60  ? 47  LEU K CA    1 
ATOM   5492 C  C     . LEU G 1 48  ? 5.061   17.285  10.430  1.00 42.40  ? 47  LEU K C     1 
ATOM   5493 O  O     . LEU G 1 48  ? 4.302   17.596  9.505   1.00 43.84  ? 47  LEU K O     1 
ATOM   5494 C  CB    . LEU G 1 48  ? 7.381   16.475  9.929   1.00 46.97  ? 47  LEU K CB    1 
ATOM   5495 C  CG    . LEU G 1 48  ? 7.677   16.298  8.439   1.00 52.17  ? 47  LEU K CG    1 
ATOM   5496 C  CD1   . LEU G 1 48  ? 8.064   17.622  7.801   1.00 52.93  ? 47  LEU K CD1   1 
ATOM   5497 C  CD2   . LEU G 1 48  ? 8.779   15.266  8.249   1.00 42.37  ? 47  LEU K CD2   1 
ATOM   5498 N  N     A ILE G 1 49  ? 4.642   16.591  11.490  0.54 42.19  ? 48  ILE K N     1 
ATOM   5499 N  N     B ILE G 1 49  ? 4.629   16.648  11.520  0.46 42.22  ? 48  ILE K N     1 
ATOM   5500 C  CA    A ILE G 1 49  ? 3.246   16.176  11.613  0.54 42.88  ? 48  ILE K CA    1 
ATOM   5501 C  CA    B ILE G 1 49  ? 3.261   16.150  11.597  0.46 42.80  ? 48  ILE K CA    1 
ATOM   5502 C  C     A ILE G 1 49  ? 2.343   17.394  11.761  0.54 43.27  ? 48  ILE K C     1 
ATOM   5503 C  C     B ILE G 1 49  ? 2.264   17.228  12.012  0.46 43.36  ? 48  ILE K C     1 
ATOM   5504 O  O     A ILE G 1 49  ? 1.327   17.528  11.068  0.54 41.27  ? 48  ILE K O     1 
ATOM   5505 O  O     B ILE G 1 49  ? 1.066   17.085  11.736  0.46 42.67  ? 48  ILE K O     1 
ATOM   5506 C  CB    A ILE G 1 49  ? 3.079   15.209  12.800  0.54 40.90  ? 48  ILE K CB    1 
ATOM   5507 C  CB    B ILE G 1 49  ? 3.195   14.943  12.551  0.46 40.86  ? 48  ILE K CB    1 
ATOM   5508 C  CG1   A ILE G 1 49  ? 3.479   13.787  12.404  0.54 39.30  ? 48  ILE K CG1   1 
ATOM   5509 C  CG1   B ILE G 1 49  ? 2.221   13.890  12.018  0.46 39.12  ? 48  ILE K CG1   1 
ATOM   5510 C  CG2   A ILE G 1 49  ? 1.649   15.240  13.328  0.54 43.63  ? 48  ILE K CG2   1 
ATOM   5511 C  CG2   B ILE G 1 49  ? 2.804   15.375  13.959  0.46 40.56  ? 48  ILE K CG2   1 
ATOM   5512 C  CD1   A ILE G 1 49  ? 2.475   13.098  11.505  0.54 36.83  ? 48  ILE K CD1   1 
ATOM   5513 C  CD1   B ILE G 1 49  ? 2.349   12.544  12.697  0.46 36.96  ? 48  ILE K CD1   1 
ATOM   5514 N  N     . LYS G 1 50  ? 2.713   18.307  12.656  1.00 45.13  ? 49  LYS K N     1 
ATOM   5515 C  CA    . LYS G 1 50  ? 1.816   19.387  13.054  1.00 46.30  ? 49  LYS K CA    1 
ATOM   5516 C  C     . LYS G 1 50  ? 1.860   20.579  12.109  1.00 47.30  ? 49  LYS K C     1 
ATOM   5517 O  O     . LYS G 1 50  ? 0.822   21.195  11.848  1.00 45.37  ? 49  LYS K O     1 
ATOM   5518 C  CB    . LYS G 1 50  ? 2.147   19.847  14.476  1.00 47.78  ? 49  LYS K CB    1 
ATOM   5519 C  CG    . LYS G 1 50  ? 1.760   18.858  15.561  1.00 49.42  ? 49  LYS K CG    1 
ATOM   5520 C  CD    . LYS G 1 50  ? 2.018   19.437  16.942  1.00 56.87  ? 49  LYS K CD    1 
ATOM   5521 C  CE    . LYS G 1 50  ? 1.818   18.396  18.030  1.00 62.26  ? 49  LYS K CE    1 
ATOM   5522 N  NZ    . LYS G 1 50  ? 2.281   18.890  19.356  1.00 67.83  ? 49  LYS K NZ    1 
ATOM   5523 N  N     . GLN G 1 51  ? 3.036   20.930  11.591  1.00 44.52  ? 50  GLN K N     1 
ATOM   5524 C  CA    . GLN G 1 51  ? 3.182   22.141  10.796  1.00 51.51  ? 50  GLN K CA    1 
ATOM   5525 C  C     . GLN G 1 51  ? 3.130   21.894  9.295   1.00 47.04  ? 50  GLN K C     1 
ATOM   5526 O  O     . GLN G 1 51  ? 3.050   22.862  8.531   1.00 49.76  ? 50  GLN K O     1 
ATOM   5527 C  CB    . GLN G 1 51  ? 4.498   22.851  11.146  1.00 51.38  ? 50  GLN K CB    1 
ATOM   5528 C  CG    . GLN G 1 51  ? 4.798   22.920  12.638  1.00 57.93  ? 50  GLN K CG    1 
ATOM   5529 C  CD    . GLN G 1 51  ? 3.732   23.656  13.428  1.00 67.68  ? 50  GLN K CD    1 
ATOM   5530 O  OE1   . GLN G 1 51  ? 3.037   24.526  12.902  1.00 73.71  ? 50  GLN K OE1   1 
ATOM   5531 N  NE2   . GLN G 1 51  ? 3.600   23.309  14.704  1.00 70.73  ? 50  GLN K NE2   1 
ATOM   5532 N  N     . HIS G 1 52  ? 3.169   20.638  8.851   1.00 47.64  ? 51  HIS K N     1 
ATOM   5533 C  CA    . HIS G 1 52  ? 3.184   20.357  7.421   1.00 45.47  ? 51  HIS K CA    1 
ATOM   5534 C  C     . HIS G 1 52  ? 2.086   19.379  7.022   1.00 46.95  ? 51  HIS K C     1 
ATOM   5535 O  O     . HIS G 1 52  ? 1.313   19.655  6.099   1.00 47.04  ? 51  HIS K O     1 
ATOM   5536 C  CB    . HIS G 1 52  ? 4.555   19.821  7.001   1.00 45.20  ? 51  HIS K CB    1 
ATOM   5537 C  CG    . HIS G 1 52  ? 5.664   20.813  7.164   1.00 56.50  ? 51  HIS K CG    1 
ATOM   5538 N  ND1   . HIS G 1 52  ? 6.507   20.817  8.254   1.00 61.63  ? 51  HIS K ND1   1 
ATOM   5539 C  CD2   . HIS G 1 52  ? 6.064   21.840  6.377   1.00 59.34  ? 51  HIS K CD2   1 
ATOM   5540 C  CE1   . HIS G 1 52  ? 7.381   21.800  8.130   1.00 64.94  ? 51  HIS K CE1   1 
ATOM   5541 N  NE2   . HIS G 1 52  ? 7.134   22.436  6.999   1.00 66.74  ? 51  HIS K NE2   1 
ATOM   5542 N  N     . PHE G 1 53  ? 2.002   18.236  7.707   1.00 40.51  ? 52  PHE K N     1 
ATOM   5543 C  CA    . PHE G 1 53  ? 1.014   17.228  7.334   1.00 40.48  ? 52  PHE K CA    1 
ATOM   5544 C  C     . PHE G 1 53  ? -0.388  17.644  7.765   1.00 40.90  ? 52  PHE K C     1 
ATOM   5545 O  O     . PHE G 1 53  ? -1.337  17.575  6.975   1.00 39.54  ? 52  PHE K O     1 
ATOM   5546 C  CB    . PHE G 1 53  ? 1.378   15.871  7.944   1.00 34.85  ? 52  PHE K CB    1 
ATOM   5547 C  CG    . PHE G 1 53  ? 2.645   15.268  7.397   1.00 41.55  ? 52  PHE K CG    1 
ATOM   5548 C  CD1   . PHE G 1 53  ? 3.301   15.836  6.315   1.00 36.58  ? 52  PHE K CD1   1 
ATOM   5549 C  CD2   . PHE G 1 53  ? 3.174   14.120  7.964   1.00 37.48  ? 52  PHE K CD2   1 
ATOM   5550 C  CE1   . PHE G 1 53  ? 4.464   15.276  5.819   1.00 35.36  ? 52  PHE K CE1   1 
ATOM   5551 C  CE2   . PHE G 1 53  ? 4.334   13.554  7.470   1.00 38.41  ? 52  PHE K CE2   1 
ATOM   5552 C  CZ    . PHE G 1 53  ? 4.979   14.132  6.396   1.00 36.34  ? 52  PHE K CZ    1 
ATOM   5553 N  N     . ALA G 1 54  ? -0.535  18.076  9.018   1.00 38.51  ? 53  ALA K N     1 
ATOM   5554 C  CA    . ALA G 1 54  ? -1.859  18.415  9.541   1.00 43.85  ? 53  ALA K CA    1 
ATOM   5555 C  C     . ALA G 1 54  ? -2.531  19.558  8.790   1.00 42.13  ? 53  ALA K C     1 
ATOM   5556 O  O     . ALA G 1 54  ? -3.735  19.442  8.494   1.00 39.71  ? 53  ALA K O     1 
ATOM   5557 C  CB    . ALA G 1 54  ? -1.758  18.714  11.041  1.00 42.51  ? 53  ALA K CB    1 
ATOM   5558 N  N     . PRO G 1 55  ? -1.860  20.672  8.464   1.00 39.21  ? 54  PRO K N     1 
ATOM   5559 C  CA    . PRO G 1 55  ? -2.559  21.724  7.704   1.00 37.68  ? 54  PRO K CA    1 
ATOM   5560 C  C     . PRO G 1 55  ? -3.040  21.263  6.340   1.00 43.12  ? 54  PRO K C     1 
ATOM   5561 O  O     . PRO G 1 55  ? -4.106  21.697  5.886   1.00 40.09  ? 54  PRO K O     1 
ATOM   5562 C  CB    . PRO G 1 55  ? -1.505  22.835  7.594   1.00 40.06  ? 54  PRO K CB    1 
ATOM   5563 C  CG    . PRO G 1 55  ? -0.596  22.605  8.743   1.00 41.81  ? 54  PRO K CG    1 
ATOM   5564 C  CD    . PRO G 1 55  ? -0.516  21.117  8.879   1.00 38.26  ? 54  PRO K CD    1 
ATOM   5565 N  N     . LEU G 1 56  ? -2.283  20.391  5.669   1.00 43.26  ? 55  LEU K N     1 
ATOM   5566 C  CA    . LEU G 1 56  ? -2.739  19.851  4.393   1.00 39.38  ? 55  LEU K CA    1 
ATOM   5567 C  C     . LEU G 1 56  ? -3.962  18.962  4.577   1.00 37.16  ? 55  LEU K C     1 
ATOM   5568 O  O     . LEU G 1 56  ? -4.915  19.038  3.792   1.00 33.17  ? 55  LEU K O     1 
ATOM   5569 C  CB    . LEU G 1 56  ? -1.611  19.077  3.712   1.00 38.85  ? 55  LEU K CB    1 
ATOM   5570 C  CG    . LEU G 1 56  ? -0.518  19.903  3.034   1.00 52.21  ? 55  LEU K CG    1 
ATOM   5571 C  CD1   . LEU G 1 56  ? 0.595   18.999  2.529   1.00 44.02  ? 55  LEU K CD1   1 
ATOM   5572 C  CD2   . LEU G 1 56  ? -1.101  20.727  1.896   1.00 49.54  ? 55  LEU K CD2   1 
ATOM   5573 N  N     . MET G 1 57  ? -3.950  18.109  5.604   1.00 35.28  ? 56  MET K N     1 
ATOM   5574 C  CA    . MET G 1 57  ? -5.116  17.276  5.881   1.00 37.79  ? 56  MET K CA    1 
ATOM   5575 C  C     . MET G 1 57  ? -6.312  18.127  6.289   1.00 38.29  ? 56  MET K C     1 
ATOM   5576 O  O     . MET G 1 57  ? -7.452  17.818  5.924   1.00 33.58  ? 56  MET K O     1 
ATOM   5577 C  CB    . MET G 1 57  ? -4.786  16.254  6.970   1.00 36.14  ? 56  MET K CB    1 
ATOM   5578 C  CG    . MET G 1 57  ? -5.896  15.247  7.245   1.00 34.52  ? 56  MET K CG    1 
ATOM   5579 S  SD    . MET G 1 57  ? -6.145  14.072  5.899   1.00 38.77  ? 56  MET K SD    1 
ATOM   5580 C  CE    . MET G 1 57  ? -4.685  13.047  6.071   1.00 32.09  ? 56  MET K CE    1 
ATOM   5581 N  N     . GLN G 1 58  ? -6.069  19.208  7.035   1.00 38.36  ? 57  GLN K N     1 
ATOM   5582 C  CA    . GLN G 1 58  ? -7.163  20.080  7.454   1.00 37.80  ? 57  GLN K CA    1 
ATOM   5583 C  C     . GLN G 1 58  ? -7.816  20.761  6.258   1.00 44.28  ? 57  GLN K C     1 
ATOM   5584 O  O     . GLN G 1 58  ? -9.038  20.948  6.236   1.00 38.65  ? 57  GLN K O     1 
ATOM   5585 C  CB    . GLN G 1 58  ? -6.657  21.119  8.453   1.00 41.88  ? 57  GLN K CB    1 
ATOM   5586 C  CG    . GLN G 1 58  ? -7.761  21.964  9.072   1.00 37.43  ? 57  GLN K CG    1 
ATOM   5587 C  CD    . GLN G 1 58  ? -8.757  21.132  9.856   1.00 44.70  ? 57  GLN K CD    1 
ATOM   5588 O  OE1   . GLN G 1 58  ? -8.424  20.558  10.892  1.00 38.84  ? 57  GLN K OE1   1 
ATOM   5589 N  NE2   . GLN G 1 58  ? -9.988  21.058  9.361   1.00 43.25  ? 57  GLN K NE2   1 
ATOM   5590 N  N     . PHE G 1 59  ? -7.019  21.142  5.256   1.00 34.79  ? 58  PHE K N     1 
ATOM   5591 C  CA    . PHE G 1 59  ? -7.595  21.706  4.040   1.00 37.02  ? 58  PHE K CA    1 
ATOM   5592 C  C     . PHE G 1 59  ? -8.483  20.692  3.334   1.00 38.39  ? 58  PHE K C     1 
ATOM   5593 O  O     . PHE G 1 59  ? -9.561  21.038  2.836   1.00 36.04  ? 58  PHE K O     1 
ATOM   5594 C  CB    . PHE G 1 59  ? -6.490  22.187  3.100   1.00 32.07  ? 58  PHE K CB    1 
ATOM   5595 C  CG    . PHE G 1 59  ? -6.975  22.495  1.712   1.00 33.05  ? 58  PHE K CG    1 
ATOM   5596 C  CD1   . PHE G 1 59  ? -7.759  23.610  1.468   1.00 36.94  ? 58  PHE K CD1   1 
ATOM   5597 C  CD2   . PHE G 1 59  ? -6.653  21.665  0.651   1.00 37.20  ? 58  PHE K CD2   1 
ATOM   5598 C  CE1   . PHE G 1 59  ? -8.209  23.895  0.192   1.00 38.16  ? 58  PHE K CE1   1 
ATOM   5599 C  CE2   . PHE G 1 59  ? -7.100  21.944  -0.628  1.00 44.84  ? 58  PHE K CE2   1 
ATOM   5600 C  CZ    . PHE G 1 59  ? -7.878  23.060  -0.857  1.00 40.30  ? 58  PHE K CZ    1 
ATOM   5601 N  N     . LEU G 1 60  ? -8.044  19.433  3.277   1.00 38.02  ? 59  LEU K N     1 
ATOM   5602 C  CA    . LEU G 1 60  ? -8.853  18.400  2.641   1.00 40.19  ? 59  LEU K CA    1 
ATOM   5603 C  C     . LEU G 1 60  ? -10.132 18.143  3.426   1.00 37.84  ? 59  LEU K C     1 
ATOM   5604 O  O     . LEU G 1 60  ? -11.194 17.914  2.836   1.00 41.95  ? 59  LEU K O     1 
ATOM   5605 C  CB    . LEU G 1 60  ? -8.042  17.114  2.494   1.00 34.26  ? 59  LEU K CB    1 
ATOM   5606 C  CG    . LEU G 1 60  ? -8.711  16.002  1.689   1.00 42.18  ? 59  LEU K CG    1 
ATOM   5607 C  CD1   . LEU G 1 60  ? -9.028  16.480  0.281   1.00 46.52  ? 59  LEU K CD1   1 
ATOM   5608 C  CD2   . LEU G 1 60  ? -7.826  14.774  1.653   1.00 42.34  ? 59  LEU K CD2   1 
ATOM   5609 N  N     . ILE G 1 61  ? -10.050 18.174  4.758   1.00 38.31  ? 60  ILE K N     1 
ATOM   5610 C  CA    A ILE G 1 61  ? -11.243 18.005  5.584   0.29 38.38  ? 60  ILE K CA    1 
ATOM   5611 C  CA    B ILE G 1 61  ? -11.244 18.003  5.580   0.71 37.07  ? 60  ILE K CA    1 
ATOM   5612 C  C     . ILE G 1 61  ? -12.235 19.129  5.312   1.00 40.48  ? 60  ILE K C     1 
ATOM   5613 O  O     . ILE G 1 61  ? -13.436 18.895  5.132   1.00 38.36  ? 60  ILE K O     1 
ATOM   5614 C  CB    A ILE G 1 61  ? -10.861 17.935  7.074   0.29 36.81  ? 60  ILE K CB    1 
ATOM   5615 C  CB    B ILE G 1 61  ? -10.866 17.922  7.070   0.71 36.75  ? 60  ILE K CB    1 
ATOM   5616 C  CG1   A ILE G 1 61  ? -10.025 16.686  7.354   0.29 36.89  ? 60  ILE K CG1   1 
ATOM   5617 C  CG1   B ILE G 1 61  ? -10.137 16.609  7.361   0.71 36.85  ? 60  ILE K CG1   1 
ATOM   5618 C  CG2   A ILE G 1 61  ? -12.104 17.951  7.947   0.29 40.06  ? 60  ILE K CG2   1 
ATOM   5619 C  CG2   B ILE G 1 61  ? -12.100 18.058  7.948   0.71 40.05  ? 60  ILE K CG2   1 
ATOM   5620 C  CD1   A ILE G 1 61  ? -10.686 15.403  6.915   0.29 35.29  ? 60  ILE K CD1   1 
ATOM   5621 C  CD1   B ILE G 1 61  ? -9.852  16.383  8.828   0.71 37.18  ? 60  ILE K CD1   1 
ATOM   5622 N  N     . ASP G 1 62  ? -11.742 20.371  5.276   1.00 40.83  ? 61  ASP K N     1 
ATOM   5623 C  CA    . ASP G 1 62  ? -12.608 21.502  4.958   1.00 40.96  ? 61  ASP K CA    1 
ATOM   5624 C  C     . ASP G 1 62  ? -13.215 21.350  3.570   1.00 42.62  ? 61  ASP K C     1 
ATOM   5625 O  O     . ASP G 1 62  ? -14.394 21.659  3.361   1.00 38.45  ? 61  ASP K O     1 
ATOM   5626 C  CB    . ASP G 1 62  ? -11.823 22.812  5.050   1.00 41.29  ? 61  ASP K CB    1 
ATOM   5627 C  CG    . ASP G 1 62  ? -11.256 23.064  6.434   1.00 41.87  ? 61  ASP K CG    1 
ATOM   5628 O  OD1   . ASP G 1 62  ? -11.680 22.381  7.390   1.00 44.92  ? 61  ASP K OD1   1 
ATOM   5629 O  OD2   . ASP G 1 62  ? -10.385 23.950  6.565   1.00 40.52  ? 61  ASP K OD2   1 
ATOM   5630 N  N     . GLU G 1 63  ? -12.426 20.856  2.613   1.00 39.85  ? 62  GLU K N     1 
ATOM   5631 C  CA    . GLU G 1 63  ? -12.887 20.764  1.232   1.00 43.18  ? 62  GLU K CA    1 
ATOM   5632 C  C     . GLU G 1 63  ? -13.973 19.707  1.067   1.00 43.48  ? 62  GLU K C     1 
ATOM   5633 O  O     . GLU G 1 63  ? -14.909 19.892  0.280   1.00 46.43  ? 62  GLU K O     1 
ATOM   5634 C  CB    . GLU G 1 63  ? -11.707 20.465  0.308   1.00 46.87  ? 62  GLU K CB    1 
ATOM   5635 C  CG    . GLU G 1 63  ? -11.249 21.659  -0.499  1.00 43.61  ? 62  GLU K CG    1 
ATOM   5636 C  CD    . GLU G 1 63  ? -12.324 22.150  -1.444  1.00 49.91  ? 62  GLU K CD    1 
ATOM   5637 O  OE1   . GLU G 1 63  ? -13.027 21.301  -2.032  1.00 49.18  ? 62  GLU K OE1   1 
ATOM   5638 O  OE2   . GLU G 1 63  ? -12.473 23.379  -1.591  1.00 58.03  ? 62  GLU K OE2   1 
ATOM   5639 N  N     . LEU G 1 64  ? -13.865 18.594  1.785   1.00 41.20  ? 63  LEU K N     1 
ATOM   5640 C  CA    . LEU G 1 64  ? -14.821 17.503  1.657   1.00 38.28  ? 63  LEU K CA    1 
ATOM   5641 C  C     . LEU G 1 64  ? -15.968 17.597  2.653   1.00 37.55  ? 63  LEU K C     1 
ATOM   5642 O  O     . LEU G 1 64  ? -16.796 16.681  2.704   1.00 42.02  ? 63  LEU K O     1 
ATOM   5643 C  CB    . LEU G 1 64  ? -14.107 16.158  1.821   1.00 40.33  ? 63  LEU K CB    1 
ATOM   5644 C  CG    . LEU G 1 64  ? -12.966 15.884  0.839   1.00 48.78  ? 63  LEU K CG    1 
ATOM   5645 C  CD1   . LEU G 1 64  ? -12.359 14.513  1.091   1.00 39.63  ? 63  LEU K CD1   1 
ATOM   5646 C  CD2   . LEU G 1 64  ? -13.452 16.005  -0.597  1.00 46.88  ? 63  LEU K CD2   1 
ATOM   5647 N  N     . ASN G 1 65  ? -16.037 18.674  3.437   1.00 39.54  ? 64  ASN K N     1 
ATOM   5648 C  CA    . ASN G 1 65  ? -17.052 18.844  4.478   1.00 44.95  ? 64  ASN K CA    1 
ATOM   5649 C  C     . ASN G 1 65  ? -17.051 17.682  5.468   1.00 44.49  ? 64  ASN K C     1 
ATOM   5650 O  O     . ASN G 1 65  ? -18.087 17.348  6.050   1.00 46.67  ? 64  ASN K O     1 
ATOM   5651 C  CB    . ASN G 1 65  ? -18.448 19.036  3.876   1.00 44.11  ? 64  ASN K CB    1 
ATOM   5652 C  CG    . ASN G 1 65  ? -18.695 20.461  3.425   1.00 47.26  ? 64  ASN K CG    1 
ATOM   5653 O  OD1   . ASN G 1 65  ? -18.406 21.412  4.150   1.00 51.51  ? 64  ASN K OD1   1 
ATOM   5654 N  ND2   . ASN G 1 65  ? -19.230 20.615  2.220   1.00 49.55  ? 64  ASN K ND2   1 
ATOM   5655 N  N     . VAL G 1 66  ? -15.889 17.057  5.662   1.00 40.56  ? 65  VAL K N     1 
ATOM   5656 C  CA    . VAL G 1 66  ? -15.754 16.020  6.676   1.00 38.57  ? 65  VAL K CA    1 
ATOM   5657 C  C     . VAL G 1 66  ? -15.885 16.650  8.055   1.00 39.08  ? 65  VAL K C     1 
ATOM   5658 O  O     . VAL G 1 66  ? -15.303 17.707  8.335   1.00 41.35  ? 65  VAL K O     1 
ATOM   5659 C  CB    . VAL G 1 66  ? -14.411 15.287  6.515   1.00 40.30  ? 65  VAL K CB    1 
ATOM   5660 C  CG1   . VAL G 1 66  ? -14.160 14.354  7.692   1.00 39.83  ? 65  VAL K CG1   1 
ATOM   5661 C  CG2   . VAL G 1 66  ? -14.380 14.517  5.203   1.00 35.74  ? 65  VAL K CG2   1 
ATOM   5662 N  N     . LYS G 1 67  ? -16.665 16.012  8.924   1.00 45.93  ? 66  LYS K N     1 
ATOM   5663 C  CA    . LYS G 1 67  ? -16.933 16.562  10.246  1.00 52.79  ? 66  LYS K CA    1 
ATOM   5664 C  C     . LYS G 1 67  ? -15.990 16.041  11.320  1.00 54.42  ? 66  LYS K C     1 
ATOM   5665 O  O     . LYS G 1 67  ? -15.976 16.591  12.427  1.00 53.64  ? 66  LYS K O     1 
ATOM   5666 C  CB    . LYS G 1 67  ? -18.382 16.274  10.652  1.00 56.96  ? 66  LYS K CB    1 
ATOM   5667 C  CG    . LYS G 1 67  ? -19.408 17.050  9.844   1.00 61.65  ? 66  LYS K CG    1 
ATOM   5668 C  CD    . LYS G 1 67  ? -18.975 18.496  9.649   1.00 64.21  ? 66  LYS K CD    1 
ATOM   5669 C  CE    . LYS G 1 67  ? -20.048 19.305  8.940   1.00 77.60  ? 66  LYS K CE    1 
ATOM   5670 N  NZ    . LYS G 1 67  ? -20.617 18.575  7.774   1.00 72.68  ? 66  LYS K NZ    1 
ATOM   5671 N  N     . SER G 1 68  ? -15.208 15.006  11.028  1.00 44.71  ? 67  SER K N     1 
ATOM   5672 C  CA    . SER G 1 68  ? -14.249 14.504  11.997  1.00 39.57  ? 67  SER K CA    1 
ATOM   5673 C  C     . SER G 1 68  ? -13.145 15.529  12.239  1.00 42.62  ? 67  SER K C     1 
ATOM   5674 O  O     . SER G 1 68  ? -12.901 16.429  11.429  1.00 48.61  ? 67  SER K O     1 
ATOM   5675 C  CB    . SER G 1 68  ? -13.641 13.186  11.519  1.00 41.81  ? 67  SER K CB    1 
ATOM   5676 O  OG    . SER G 1 68  ? -14.630 12.179  11.405  1.00 40.36  ? 67  SER K OG    1 
ATOM   5677 N  N     . LYS G 1 69  ? -12.475 15.385  13.375  1.00 40.86  ? 68  LYS K N     1 
ATOM   5678 C  CA    . LYS G 1 69  ? -11.355 16.240  13.734  1.00 44.29  ? 68  LYS K CA    1 
ATOM   5679 C  C     . LYS G 1 69  ? -10.039 15.517  13.476  1.00 43.99  ? 68  LYS K C     1 
ATOM   5680 O  O     . LYS G 1 69  ? -9.984  14.289  13.372  1.00 36.95  ? 68  LYS K O     1 
ATOM   5681 C  CB    . LYS G 1 69  ? -11.440 16.663  15.204  1.00 42.24  ? 68  LYS K CB    1 
ATOM   5682 C  CG    . LYS G 1 69  ? -11.226 15.524  16.191  1.00 55.54  ? 68  LYS K CG    1 
ATOM   5683 C  CD    . LYS G 1 69  ? -11.447 15.980  17.626  1.00 55.39  ? 68  LYS K CD    1 
ATOM   5684 C  CE    . LYS G 1 69  ? -10.370 16.957  18.072  1.00 57.00  ? 68  LYS K CE    1 
ATOM   5685 N  NZ    . LYS G 1 69  ? -9.022  16.324  18.113  1.00 63.26  ? 68  LYS K NZ    1 
ATOM   5686 N  N     . ILE G 1 70  ? -8.972  16.301  13.365  1.00 41.35  ? 69  ILE K N     1 
ATOM   5687 C  CA    . ILE G 1 70  ? -7.630  15.744  13.247  1.00 37.44  ? 69  ILE K CA    1 
ATOM   5688 C  C     . ILE G 1 70  ? -7.111  15.439  14.645  1.00 42.63  ? 69  ILE K C     1 
ATOM   5689 O  O     . ILE G 1 70  ? -6.954  16.343  15.472  1.00 42.96  ? 69  ILE K O     1 
ATOM   5690 C  CB    . ILE G 1 70  ? -6.688  16.703  12.506  1.00 38.55  ? 69  ILE K CB    1 
ATOM   5691 C  CG1   . ILE G 1 70  ? -7.040  16.759  11.020  1.00 39.34  ? 69  ILE K CG1   1 
ATOM   5692 C  CG2   . ILE G 1 70  ? -5.239  16.274  12.692  1.00 38.52  ? 69  ILE K CG2   1 
ATOM   5693 C  CD1   . ILE G 1 70  ? -6.151  17.684  10.216  1.00 40.47  ? 69  ILE K CD1   1 
ATOM   5694 N  N     . GLN G 1 71  ? -6.858  14.164  14.916  1.00 38.78  ? 70  GLN K N     1 
ATOM   5695 C  CA    . GLN G 1 71  ? -6.249  13.742  16.167  1.00 38.37  ? 70  GLN K CA    1 
ATOM   5696 C  C     . GLN G 1 71  ? -4.746  13.596  15.978  1.00 38.29  ? 70  GLN K C     1 
ATOM   5697 O  O     . GLN G 1 71  ? -4.285  13.099  14.946  1.00 41.86  ? 70  GLN K O     1 
ATOM   5698 C  CB    . GLN G 1 71  ? -6.833  12.415  16.654  1.00 39.48  ? 70  GLN K CB    1 
ATOM   5699 C  CG    . GLN G 1 71  ? -8.336  12.413  16.853  1.00 34.39  ? 70  GLN K CG    1 
ATOM   5700 C  CD    . GLN G 1 71  ? -8.837  11.090  17.395  1.00 38.23  ? 70  GLN K CD    1 
ATOM   5701 O  OE1   . GLN G 1 71  ? -8.427  10.652  18.470  1.00 46.79  ? 70  GLN K OE1   1 
ATOM   5702 N  NE2   . GLN G 1 71  ? -9.721  10.440  16.647  1.00 34.26  ? 70  GLN K NE2   1 
ATOM   5703 N  N     . ILE G 1 72  ? -3.989  14.039  16.974  1.00 40.59  ? 71  ILE K N     1 
ATOM   5704 C  CA    . ILE G 1 72  ? -2.546  13.846  17.019  1.00 36.89  ? 71  ILE K CA    1 
ATOM   5705 C  C     . ILE G 1 72  ? -2.239  13.130  18.325  1.00 42.16  ? 71  ILE K C     1 
ATOM   5706 O  O     . ILE G 1 72  ? -2.364  13.715  19.408  1.00 50.55  ? 71  ILE K O     1 
ATOM   5707 C  CB    . ILE G 1 72  ? -1.776  15.167  16.908  1.00 40.00  ? 71  ILE K CB    1 
ATOM   5708 C  CG1   . ILE G 1 72  ? -1.972  15.773  15.516  1.00 39.01  ? 71  ILE K CG1   1 
ATOM   5709 C  CG2   . ILE G 1 72  ? -0.296  14.946  17.185  1.00 38.54  ? 71  ILE K CG2   1 
ATOM   5710 C  CD1   . ILE G 1 72  ? -1.547  17.217  15.409  1.00 48.89  ? 71  ILE K CD1   1 
ATOM   5711 N  N     . VAL G 1 73  ? -1.854  11.861  18.226  1.00 38.07  ? 72  VAL K N     1 
ATOM   5712 C  CA    . VAL G 1 73  ? -1.605  11.010  19.383  1.00 42.29  ? 72  VAL K CA    1 
ATOM   5713 C  C     . VAL G 1 73  ? -0.107  10.773  19.493  1.00 44.22  ? 72  VAL K C     1 
ATOM   5714 O  O     . VAL G 1 73  ? 0.536   10.349  18.524  1.00 39.36  ? 72  VAL K O     1 
ATOM   5715 C  CB    . VAL G 1 73  ? -2.368  9.678   19.275  1.00 39.06  ? 72  VAL K CB    1 
ATOM   5716 C  CG1   . VAL G 1 73  ? -2.182  8.855   20.540  1.00 43.10  ? 72  VAL K CG1   1 
ATOM   5717 C  CG2   . VAL G 1 73  ? -3.843  9.934   19.004  1.00 41.38  ? 72  VAL K CG2   1 
ATOM   5718 N  N     . LYS G 1 74  ? 0.447   11.048  20.671  1.00 48.05  ? 73  LYS K N     1 
ATOM   5719 C  CA    . LYS G 1 74  ? 1.870   10.859  20.928  1.00 47.64  ? 73  LYS K CA    1 
ATOM   5720 C  C     . LYS G 1 74  ? 2.093   9.430   21.408  1.00 44.31  ? 73  LYS K C     1 
ATOM   5721 O  O     . LYS G 1 74  ? 1.719   9.078   22.531  1.00 54.06  ? 73  LYS K O     1 
ATOM   5722 C  CB    . LYS G 1 74  ? 2.371   11.869  21.957  1.00 52.08  ? 73  LYS K CB    1 
ATOM   5723 C  CG    . LYS G 1 74  ? 3.858   11.764  22.259  1.00 50.30  ? 73  LYS K CG    1 
ATOM   5724 C  CD    . LYS G 1 74  ? 4.391   13.065  22.834  1.00 59.91  ? 73  LYS K CD    1 
ATOM   5725 C  CE    . LYS G 1 74  ? 5.799   12.898  23.381  1.00 64.51  ? 73  LYS K CE    1 
ATOM   5726 N  NZ    . LYS G 1 74  ? 6.242   14.105  24.132  1.00 68.19  ? 73  LYS K NZ    1 
ATOM   5727 N  N     . GLY G 1 75  ? 2.696   8.604   20.553  1.00 42.25  ? 74  GLY K N     1 
ATOM   5728 C  CA    . GLY G 1 75  ? 3.051   7.253   20.924  1.00 41.74  ? 74  GLY K CA    1 
ATOM   5729 C  C     . GLY G 1 75  ? 4.440   7.179   21.533  1.00 47.34  ? 74  GLY K C     1 
ATOM   5730 O  O     . GLY G 1 75  ? 5.135   8.179   21.706  1.00 49.32  ? 74  GLY K O     1 
ATOM   5731 N  N     . ASP G 1 76  ? 4.842   5.951   21.863  1.00 50.61  ? 75  ASP K N     1 
ATOM   5732 C  CA    . ASP G 1 76  ? 6.164   5.740   22.443  1.00 59.82  ? 75  ASP K CA    1 
ATOM   5733 C  C     . ASP G 1 76  ? 7.268   6.129   21.468  1.00 55.12  ? 75  ASP K C     1 
ATOM   5734 O  O     . ASP G 1 76  ? 8.250   6.774   21.854  1.00 58.25  ? 75  ASP K O     1 
ATOM   5735 C  CB    . ASP G 1 76  ? 6.319   4.280   22.869  1.00 64.04  ? 75  ASP K CB    1 
ATOM   5736 C  CG    . ASP G 1 76  ? 5.921   3.307   21.773  1.00 65.54  ? 75  ASP K CG    1 
ATOM   5737 O  OD1   . ASP G 1 76  ? 5.937   2.084   22.025  1.00 63.25  ? 75  ASP K OD1   1 
ATOM   5738 O  OD2   . ASP G 1 76  ? 5.584   3.765   20.660  1.00 61.03  ? 75  ASP K OD2   1 
ATOM   5739 N  N     . THR G 1 77  ? 7.118   5.759   20.196  1.00 54.06  ? 76  THR K N     1 
ATOM   5740 C  CA    . THR G 1 77  ? 8.184   5.905   19.217  1.00 40.82  ? 76  THR K CA    1 
ATOM   5741 C  C     . THR G 1 77  ? 7.880   6.901   18.106  1.00 43.18  ? 76  THR K C     1 
ATOM   5742 O  O     . THR G 1 77  ? 8.781   7.204   17.316  1.00 46.21  ? 76  THR K O     1 
ATOM   5743 C  CB    . THR G 1 77  ? 8.508   4.541   18.587  1.00 45.59  ? 76  THR K CB    1 
ATOM   5744 O  OG1   . THR G 1 77  ? 7.376   4.077   17.839  1.00 46.27  ? 76  THR K OG1   1 
ATOM   5745 C  CG2   . THR G 1 77  ? 8.845   3.523   19.666  1.00 43.88  ? 76  THR K CG2   1 
ATOM   5746 N  N     . ARG G 1 78  ? 6.657   7.419   18.018  1.00 41.76  ? 77  ARG K N     1 
ATOM   5747 C  CA    . ARG G 1 78  ? 6.303   8.311   16.920  1.00 42.36  ? 77  ARG K CA    1 
ATOM   5748 C  C     . ARG G 1 78  ? 4.974   8.986   17.225  1.00 41.12  ? 77  ARG K C     1 
ATOM   5749 O  O     . ARG G 1 78  ? 4.200   8.524   18.068  1.00 34.85  ? 77  ARG K O     1 
ATOM   5750 C  CB    . ARG G 1 78  ? 6.219   7.560   15.583  1.00 34.20  ? 77  ARG K CB    1 
ATOM   5751 C  CG    . ARG G 1 78  ? 4.901   6.825   15.337  1.00 38.16  ? 77  ARG K CG    1 
ATOM   5752 C  CD    . ARG G 1 78  ? 4.684   5.671   16.307  1.00 35.86  ? 77  ARG K CD    1 
ATOM   5753 N  NE    . ARG G 1 78  ? 3.391   5.024   16.110  1.00 41.39  ? 77  ARG K NE    1 
ATOM   5754 C  CZ    . ARG G 1 78  ? 2.244   5.479   16.605  1.00 39.53  ? 77  ARG K CZ    1 
ATOM   5755 N  NH1   . ARG G 1 78  ? 2.224   6.591   17.327  1.00 36.72  ? 77  ARG K NH1   1 
ATOM   5756 N  NH2   . ARG G 1 78  ? 1.114   4.823   16.376  1.00 39.08  ? 77  ARG K NH2   1 
ATOM   5757 N  N     . TYR G 1 79  ? 4.726   10.088  16.523  1.00 39.69  ? 78  TYR K N     1 
ATOM   5758 C  CA    . TYR G 1 79  ? 3.436   10.761  16.546  1.00 40.81  ? 78  TYR K CA    1 
ATOM   5759 C  C     . TYR G 1 79  ? 2.518   10.156  15.493  1.00 40.35  ? 78  TYR K C     1 
ATOM   5760 O  O     . TYR G 1 79  ? 2.968   9.706   14.437  1.00 35.81  ? 78  TYR K O     1 
ATOM   5761 C  CB    . TYR G 1 79  ? 3.595   12.260  16.286  1.00 39.60  ? 78  TYR K CB    1 
ATOM   5762 C  CG    . TYR G 1 79  ? 4.170   13.040  17.444  1.00 49.81  ? 78  TYR K CG    1 
ATOM   5763 C  CD1   . TYR G 1 79  ? 3.345   13.568  18.428  1.00 48.30  ? 78  TYR K CD1   1 
ATOM   5764 C  CD2   . TYR G 1 79  ? 5.538   13.254  17.551  1.00 50.37  ? 78  TYR K CD2   1 
ATOM   5765 C  CE1   . TYR G 1 79  ? 3.865   14.286  19.487  1.00 56.53  ? 78  TYR K CE1   1 
ATOM   5766 C  CE2   . TYR G 1 79  ? 6.068   13.968  18.608  1.00 58.18  ? 78  TYR K CE2   1 
ATOM   5767 C  CZ    . TYR G 1 79  ? 5.227   14.484  19.572  1.00 64.84  ? 78  TYR K CZ    1 
ATOM   5768 O  OH    . TYR G 1 79  ? 5.750   15.197  20.626  1.00 70.05  ? 78  TYR K OH    1 
ATOM   5769 N  N     . GLU G 1 80  ? 1.220   10.156  15.785  1.00 38.74  ? 79  GLU K N     1 
ATOM   5770 C  CA    . GLU G 1 80  ? 0.214   9.615   14.879  1.00 35.04  ? 79  GLU K CA    1 
ATOM   5771 C  C     . GLU G 1 80  ? -0.797  10.700  14.540  1.00 36.56  ? 79  GLU K C     1 
ATOM   5772 O  O     . GLU G 1 80  ? -1.477  11.219  15.431  1.00 37.83  ? 79  GLU K O     1 
ATOM   5773 C  CB    . GLU G 1 80  ? -0.497  8.407   15.492  1.00 35.73  ? 79  GLU K CB    1 
ATOM   5774 C  CG    . GLU G 1 80  ? -1.644  7.884   14.639  1.00 38.24  ? 79  GLU K CG    1 
ATOM   5775 C  CD    . GLU G 1 80  ? -2.468  6.823   15.342  1.00 44.22  ? 79  GLU K CD    1 
ATOM   5776 O  OE1   . GLU G 1 80  ? -2.079  6.402   16.451  1.00 45.76  ? 79  GLU K OE1   1 
ATOM   5777 O  OE2   . GLU G 1 80  ? -3.508  6.413   14.785  1.00 39.94  ? 79  GLU K OE2   1 
ATOM   5778 N  N     . LEU G 1 81  ? -0.890  11.039  13.257  1.00 35.49  ? 80  LEU K N     1 
ATOM   5779 C  CA    . LEU G 1 81  ? -1.979  11.862  12.748  1.00 33.89  ? 80  LEU K CA    1 
ATOM   5780 C  C     . LEU G 1 81  ? -3.119  10.930  12.357  1.00 34.32  ? 80  LEU K C     1 
ATOM   5781 O  O     . LEU G 1 81  ? -2.945  10.058  11.499  1.00 31.72  ? 80  LEU K O     1 
ATOM   5782 C  CB    . LEU G 1 81  ? -1.517  12.702  11.555  1.00 35.84  ? 80  LEU K CB    1 
ATOM   5783 C  CG    . LEU G 1 81  ? -2.433  13.791  10.979  1.00 39.66  ? 80  LEU K CG    1 
ATOM   5784 C  CD1   . LEU G 1 81  ? -1.608  14.775  10.169  1.00 42.89  ? 80  LEU K CD1   1 
ATOM   5785 C  CD2   . LEU G 1 81  ? -3.553  13.226  10.111  1.00 42.81  ? 80  LEU K CD2   1 
ATOM   5786 N  N     . ARG G 1 82  ? -4.278  11.110  12.983  1.00 34.74  ? 81  ARG K N     1 
ATOM   5787 C  CA    . ARG G 1 82  ? -5.404  10.206  12.793  1.00 36.16  ? 81  ARG K CA    1 
ATOM   5788 C  C     . ARG G 1 82  ? -6.677  10.998  12.547  1.00 39.24  ? 81  ARG K C     1 
ATOM   5789 O  O     . ARG G 1 82  ? -6.976  11.949  13.277  1.00 38.65  ? 81  ARG K O     1 
ATOM   5790 C  CB    . ARG G 1 82  ? -5.588  9.294   14.009  1.00 35.63  ? 81  ARG K CB    1 
ATOM   5791 C  CG    . ARG G 1 82  ? -6.818  8.410   13.934  1.00 35.12  ? 81  ARG K CG    1 
ATOM   5792 C  CD    . ARG G 1 82  ? -7.149  7.836   15.296  1.00 36.80  ? 81  ARG K CD    1 
ATOM   5793 N  NE    . ARG G 1 82  ? -5.998  7.170   15.896  1.00 43.05  ? 81  ARG K NE    1 
ATOM   5794 C  CZ    . ARG G 1 82  ? -5.932  6.801   17.171  1.00 42.58  ? 81  ARG K CZ    1 
ATOM   5795 N  NH1   . ARG G 1 82  ? -6.953  7.038   17.983  1.00 39.88  ? 81  ARG K NH1   1 
ATOM   5796 N  NH2   . ARG G 1 82  ? -4.845  6.200   17.634  1.00 37.77  ? 81  ARG K NH2   1 
ATOM   5797 N  N     . VAL G 1 83  ? -7.424  10.600  11.521  1.00 36.02  ? 82  VAL K N     1 
ATOM   5798 C  CA    . VAL G 1 83  ? -8.759  11.120  11.255  1.00 36.15  ? 82  VAL K CA    1 
ATOM   5799 C  C     . VAL G 1 83  ? -9.719  9.941   11.280  1.00 34.59  ? 82  VAL K C     1 
ATOM   5800 O  O     . VAL G 1 83  ? -9.631  9.044   10.432  1.00 30.63  ? 82  VAL K O     1 
ATOM   5801 C  CB    . VAL G 1 83  ? -8.837  11.862  9.912   1.00 34.93  ? 82  VAL K CB    1 
ATOM   5802 C  CG1   . VAL G 1 83  ? -10.251 12.374  9.675   1.00 37.09  ? 82  VAL K CG1   1 
ATOM   5803 C  CG2   . VAL G 1 83  ? -7.837  13.007  9.878   1.00 29.68  ? 82  VAL K CG2   1 
ATOM   5804 N  N     . SER G 1 84  ? -10.622 9.934   12.257  1.00 27.69  ? 83  SER K N     1 
ATOM   5805 C  CA    . SER G 1 84  ? -11.629 8.882   12.385  1.00 35.49  ? 83  SER K CA    1 
ATOM   5806 C  C     . SER G 1 84  ? -12.851 9.304   11.579  1.00 29.22  ? 83  SER K C     1 
ATOM   5807 O  O     . SER G 1 84  ? -13.698 10.057  12.064  1.00 34.72  ? 83  SER K O     1 
ATOM   5808 C  CB    . SER G 1 84  ? -11.974 8.643   13.850  1.00 30.50  ? 83  SER K CB    1 
ATOM   5809 O  OG    . SER G 1 84  ? -12.947 7.623   13.983  1.00 34.83  ? 83  SER K OG    1 
ATOM   5810 N  N     . SER G 1 85  ? -12.947 8.818   10.344  1.00 34.15  ? 84  SER K N     1 
ATOM   5811 C  CA    . SER G 1 85  ? -13.999 9.271   9.437   1.00 33.46  ? 84  SER K CA    1 
ATOM   5812 C  C     . SER G 1 85  ? -14.262 8.200   8.392   1.00 35.59  ? 84  SER K C     1 
ATOM   5813 O  O     . SER G 1 85  ? -13.377 7.893   7.586   1.00 31.63  ? 84  SER K O     1 
ATOM   5814 C  CB    . SER G 1 85  ? -13.601 10.588  8.768   1.00 28.22  ? 84  SER K CB    1 
ATOM   5815 O  OG    . SER G 1 85  ? -14.421 10.858  7.645   1.00 36.53  ? 84  SER K OG    1 
ATOM   5816 N  N     . LYS G 1 86  ? -15.475 7.642   8.399   1.00 34.29  ? 85  LYS K N     1 
ATOM   5817 C  CA    . LYS G 1 86  ? -15.870 6.713   7.345   1.00 36.20  ? 85  LYS K CA    1 
ATOM   5818 C  C     . LYS G 1 86  ? -15.813 7.380   5.977   1.00 33.81  ? 85  LYS K C     1 
ATOM   5819 O  O     . LYS G 1 86  ? -15.439 6.748   4.982   1.00 30.14  ? 85  LYS K O     1 
ATOM   5820 C  CB    . LYS G 1 86  ? -17.274 6.174   7.621   1.00 34.37  ? 85  LYS K CB    1 
ATOM   5821 C  CG    . LYS G 1 86  ? -17.777 5.170   6.598   1.00 32.46  ? 85  LYS K CG    1 
ATOM   5822 C  CD    . LYS G 1 86  ? -19.190 4.710   6.927   1.00 34.59  ? 85  LYS K CD    1 
ATOM   5823 C  CE    . LYS G 1 86  ? -19.655 3.619   5.975   1.00 40.35  ? 85  LYS K CE    1 
ATOM   5824 N  NZ    . LYS G 1 86  ? -21.047 3.173   6.268   1.00 33.84  ? 85  LYS K NZ    1 
ATOM   5825 N  N     . LYS G 1 87  ? -16.172 8.664   5.913   1.00 33.82  ? 86  LYS K N     1 
ATOM   5826 C  CA    . LYS G 1 87  ? -16.173 9.382   4.643   1.00 30.47  ? 86  LYS K CA    1 
ATOM   5827 C  C     . LYS G 1 87  ? -14.758 9.543   4.098   1.00 28.82  ? 86  LYS K C     1 
ATOM   5828 O  O     . LYS G 1 87  ? -14.495 9.239   2.928   1.00 30.88  ? 86  LYS K O     1 
ATOM   5829 C  CB    . LYS G 1 87  ? -16.845 10.743  4.822   1.00 30.97  ? 86  LYS K CB    1 
ATOM   5830 C  CG    . LYS G 1 87  ? -17.025 11.538  3.541   1.00 36.32  ? 86  LYS K CG    1 
ATOM   5831 C  CD    . LYS G 1 87  ? -17.827 12.803  3.809   1.00 36.85  ? 86  LYS K CD    1 
ATOM   5832 C  CE    . LYS G 1 87  ? -18.007 13.631  2.550   1.00 42.88  ? 86  LYS K CE    1 
ATOM   5833 N  NZ    . LYS G 1 87  ? -18.777 14.877  2.822   1.00 52.98  ? 86  LYS K NZ    1 
ATOM   5834 N  N     . LEU G 1 88  ? -13.832 10.022  4.932   1.00 31.67  ? 87  LEU K N     1 
ATOM   5835 C  CA    . LEU G 1 88  ? -12.458 10.198  4.471   1.00 31.94  ? 87  LEU K CA    1 
ATOM   5836 C  C     . LEU G 1 88  ? -11.785 8.862   4.190   1.00 26.08  ? 87  LEU K C     1 
ATOM   5837 O  O     . LEU G 1 88  ? -10.933 8.775   3.298   1.00 29.17  ? 87  LEU K O     1 
ATOM   5838 C  CB    . LEU G 1 88  ? -11.648 10.988  5.498   1.00 29.99  ? 87  LEU K CB    1 
ATOM   5839 C  CG    . LEU G 1 88  ? -10.318 11.521  4.962   1.00 30.74  ? 87  LEU K CG    1 
ATOM   5840 C  CD1   . LEU G 1 88  ? -10.567 12.550  3.868   1.00 27.02  ? 87  LEU K CD1   1 
ATOM   5841 C  CD2   . LEU G 1 88  ? -9.459  12.102  6.075   1.00 26.17  ? 87  LEU K CD2   1 
ATOM   5842 N  N     . TYR G 1 89  ? -12.152 7.815   4.934   1.00 28.44  ? 88  TYR K N     1 
ATOM   5843 C  CA    . TYR G 1 89  ? -11.573 6.496   4.701   1.00 30.17  ? 88  TYR K CA    1 
ATOM   5844 C  C     . TYR G 1 89  ? -11.866 6.009   3.287   1.00 31.26  ? 88  TYR K C     1 
ATOM   5845 O  O     . TYR G 1 89  ? -10.954 5.610   2.554   1.00 35.94  ? 88  TYR K O     1 
ATOM   5846 C  CB    . TYR G 1 89  ? -12.103 5.502   5.738   1.00 26.86  ? 88  TYR K CB    1 
ATOM   5847 C  CG    . TYR G 1 89  ? -11.805 4.052   5.418   1.00 34.14  ? 88  TYR K CG    1 
ATOM   5848 C  CD1   . TYR G 1 89  ? -10.614 3.463   5.822   1.00 33.09  ? 88  TYR K CD1   1 
ATOM   5849 C  CD2   . TYR G 1 89  ? -12.720 3.270   4.721   1.00 35.09  ? 88  TYR K CD2   1 
ATOM   5850 C  CE1   . TYR G 1 89  ? -10.338 2.138   5.532   1.00 33.04  ? 88  TYR K CE1   1 
ATOM   5851 C  CE2   . TYR G 1 89  ? -12.452 1.948   4.425   1.00 36.70  ? 88  TYR K CE2   1 
ATOM   5852 C  CZ    . TYR G 1 89  ? -11.261 1.387   4.834   1.00 35.06  ? 88  TYR K CZ    1 
ATOM   5853 O  OH    . TYR G 1 89  ? -10.993 0.069   4.543   1.00 31.51  ? 88  TYR K OH    1 
ATOM   5854 N  N     . TYR G 1 90  ? -13.139 6.036   2.885   1.00 31.48  ? 89  TYR K N     1 
ATOM   5855 C  CA    . TYR G 1 90  ? -13.498 5.552   1.556   1.00 32.19  ? 89  TYR K CA    1 
ATOM   5856 C  C     . TYR G 1 90  ? -13.012 6.490   0.462   1.00 29.33  ? 89  TYR K C     1 
ATOM   5857 O  O     . TYR G 1 90  ? -12.762 6.046   -0.664  1.00 33.20  ? 89  TYR K O     1 
ATOM   5858 C  CB    . TYR G 1 90  ? -15.009 5.351   1.458   1.00 30.85  ? 89  TYR K CB    1 
ATOM   5859 C  CG    . TYR G 1 90  ? -15.467 4.036   2.040   1.00 35.99  ? 89  TYR K CG    1 
ATOM   5860 C  CD1   . TYR G 1 90  ? -15.174 2.837   1.404   1.00 29.50  ? 89  TYR K CD1   1 
ATOM   5861 C  CD2   . TYR G 1 90  ? -16.180 3.990   3.231   1.00 33.27  ? 89  TYR K CD2   1 
ATOM   5862 C  CE1   . TYR G 1 90  ? -15.583 1.630   1.932   1.00 31.41  ? 89  TYR K CE1   1 
ATOM   5863 C  CE2   . TYR G 1 90  ? -16.593 2.786   3.768   1.00 31.43  ? 89  TYR K CE2   1 
ATOM   5864 C  CZ    . TYR G 1 90  ? -16.292 1.610   3.114   1.00 36.84  ? 89  TYR K CZ    1 
ATOM   5865 O  OH    . TYR G 1 90  ? -16.700 0.407   3.642   1.00 42.27  ? 89  TYR K OH    1 
ATOM   5866 N  N     . TYR G 1 91  ? -12.876 7.782   0.767   1.00 28.28  ? 90  TYR K N     1 
ATOM   5867 C  CA    . TYR G 1 91  ? -12.301 8.715   -0.196  1.00 29.88  ? 90  TYR K CA    1 
ATOM   5868 C  C     . TYR G 1 91  ? -10.903 8.272   -0.613  1.00 36.38  ? 90  TYR K C     1 
ATOM   5869 O  O     . TYR G 1 91  ? -10.592 8.198   -1.807  1.00 37.72  ? 90  TYR K O     1 
ATOM   5870 C  CB    . TYR G 1 91  ? -12.272 10.123  0.400   1.00 29.79  ? 90  TYR K CB    1 
ATOM   5871 C  CG    . TYR G 1 91  ? -11.611 11.158  -0.480  1.00 33.42  ? 90  TYR K CG    1 
ATOM   5872 C  CD1   . TYR G 1 91  ? -12.304 11.756  -1.526  1.00 34.02  ? 90  TYR K CD1   1 
ATOM   5873 C  CD2   . TYR G 1 91  ? -10.295 11.547  -0.259  1.00 35.08  ? 90  TYR K CD2   1 
ATOM   5874 C  CE1   . TYR G 1 91  ? -11.702 12.706  -2.331  1.00 39.34  ? 90  TYR K CE1   1 
ATOM   5875 C  CE2   . TYR G 1 91  ? -9.686  12.495  -1.058  1.00 35.90  ? 90  TYR K CE2   1 
ATOM   5876 C  CZ    . TYR G 1 91  ? -10.393 13.072  -2.092  1.00 39.84  ? 90  TYR K CZ    1 
ATOM   5877 O  OH    . TYR G 1 91  ? -9.789  14.017  -2.888  1.00 40.62  ? 90  TYR K OH    1 
ATOM   5878 N  N     . PHE G 1 92  ? -10.049 7.957   0.365   1.00 29.63  ? 91  PHE K N     1 
ATOM   5879 C  CA    . PHE G 1 92  ? -8.698  7.503   0.046   1.00 34.89  ? 91  PHE K CA    1 
ATOM   5880 C  C     . PHE G 1 92  ? -8.699  6.066   -0.460  1.00 34.17  ? 91  PHE K C     1 
ATOM   5881 O  O     . PHE G 1 92  ? -7.926  5.722   -1.362  1.00 34.61  ? 91  PHE K O     1 
ATOM   5882 C  CB    . PHE G 1 92  ? -7.793  7.634   1.270   1.00 30.33  ? 91  PHE K CB    1 
ATOM   5883 C  CG    . PHE G 1 92  ? -7.345  9.038   1.546   1.00 29.90  ? 91  PHE K CG    1 
ATOM   5884 C  CD1   . PHE G 1 92  ? -6.581  9.728   0.620   1.00 32.23  ? 91  PHE K CD1   1 
ATOM   5885 C  CD2   . PHE G 1 92  ? -7.677  9.664   2.736   1.00 28.33  ? 91  PHE K CD2   1 
ATOM   5886 C  CE1   . PHE G 1 92  ? -6.163  11.020  0.871   1.00 32.21  ? 91  PHE K CE1   1 
ATOM   5887 C  CE2   . PHE G 1 92  ? -7.260  10.956  2.994   1.00 26.47  ? 91  PHE K CE2   1 
ATOM   5888 C  CZ    . PHE G 1 92  ? -6.501  11.633  2.060   1.00 28.67  ? 91  PHE K CZ    1 
ATOM   5889 N  N     . THR G 1 93  ? -9.549  5.212   0.115   1.00 34.27  ? 92  THR K N     1 
ATOM   5890 C  CA    . THR G 1 93  ? -9.588  3.812   -0.297  1.00 35.43  ? 92  THR K CA    1 
ATOM   5891 C  C     . THR G 1 93  ? -9.999  3.681   -1.759  1.00 39.87  ? 92  THR K C     1 
ATOM   5892 O  O     . THR G 1 93  ? -9.357  2.963   -2.534  1.00 39.27  ? 92  THR K O     1 
ATOM   5893 C  CB    . THR G 1 93  ? -10.538 3.024   0.608   1.00 39.44  ? 92  THR K CB    1 
ATOM   5894 O  OG1   . THR G 1 93  ? -9.912  2.797   1.877   1.00 48.09  ? 92  THR K OG1   1 
ATOM   5895 C  CG2   . THR G 1 93  ? -10.891 1.684   -0.020  1.00 43.57  ? 92  THR K CG2   1 
ATOM   5896 N  N     . ASN G 1 94  ? -11.070 4.376   -2.155  1.00 34.88  ? 93  ASN K N     1 
ATOM   5897 C  CA    . ASN G 1 94  ? -11.477 4.362   -3.557  1.00 39.28  ? 93  ASN K CA    1 
ATOM   5898 C  C     . ASN G 1 94  ? -10.413 4.995   -4.443  1.00 35.74  ? 93  ASN K C     1 
ATOM   5899 O  O     . ASN G 1 94  ? -10.208 4.566   -5.585  1.00 34.37  ? 93  ASN K O     1 
ATOM   5900 C  CB    . ASN G 1 94  ? -12.815 5.081   -3.726  1.00 31.06  ? 93  ASN K CB    1 
ATOM   5901 C  CG    . ASN G 1 94  ? -13.971 4.306   -3.124  1.00 35.79  ? 93  ASN K CG    1 
ATOM   5902 O  OD1   . ASN G 1 94  ? -13.977 3.076   -3.130  1.00 43.50  ? 93  ASN K OD1   1 
ATOM   5903 N  ND2   . ASN G 1 94  ? -14.956 5.025   -2.596  1.00 31.11  ? 93  ASN K ND2   1 
ATOM   5904 N  N     . MET G 1 95  ? -9.723  6.017   -3.934  1.00 38.39  ? 94  MET K N     1 
ATOM   5905 C  CA    . MET G 1 95  ? -8.631  6.621   -4.689  1.00 36.55  ? 94  MET K CA    1 
ATOM   5906 C  C     . MET G 1 95  ? -7.475  5.646   -4.873  1.00 41.74  ? 94  MET K C     1 
ATOM   5907 O  O     . MET G 1 95  ? -6.803  5.670   -5.911  1.00 37.25  ? 94  MET K O     1 
ATOM   5908 C  CB    . MET G 1 95  ? -8.154  7.892   -3.988  1.00 40.86  ? 94  MET K CB    1 
ATOM   5909 C  CG    . MET G 1 95  ? -7.133  8.698   -4.768  1.00 41.12  ? 94  MET K CG    1 
ATOM   5910 S  SD    . MET G 1 95  ? -6.709  10.238  -3.935  1.00 47.09  ? 94  MET K SD    1 
ATOM   5911 C  CE    . MET G 1 95  ? -5.671  11.013  -5.170  1.00 52.29  ? 94  MET K CE    1 
ATOM   5912 N  N     . LEU G 1 96  ? -7.235  4.777   -3.888  1.00 38.69  ? 95  LEU K N     1 
ATOM   5913 C  CA    . LEU G 1 96  ? -6.159  3.799   -4.009  1.00 41.04  ? 95  LEU K CA    1 
ATOM   5914 C  C     . LEU G 1 96  ? -6.482  2.746   -5.063  1.00 44.99  ? 95  LEU K C     1 
ATOM   5915 O  O     . LEU G 1 96  ? -5.607  2.357   -5.845  1.00 46.05  ? 95  LEU K O     1 
ATOM   5916 C  CB    . LEU G 1 96  ? -5.894  3.141   -2.654  1.00 34.15  ? 95  LEU K CB    1 
ATOM   5917 C  CG    . LEU G 1 96  ? -4.843  2.026   -2.614  1.00 37.68  ? 95  LEU K CG    1 
ATOM   5918 C  CD1   . LEU G 1 96  ? -3.552  2.453   -3.303  1.00 38.92  ? 95  LEU K CD1   1 
ATOM   5919 C  CD2   . LEU G 1 96  ? -4.573  1.593   -1.182  1.00 33.20  ? 95  LEU K CD2   1 
ATOM   5920 N  N     . GLU G 1 97  ? -7.730  2.269   -5.098  1.00 41.69  ? 96  GLU K N     1 
ATOM   5921 C  CA    . GLU G 1 97  ? -8.103  1.256   -6.081  1.00 40.42  ? 96  GLU K CA    1 
ATOM   5922 C  C     . GLU G 1 97  ? -7.969  1.777   -7.505  1.00 40.55  ? 96  GLU K C     1 
ATOM   5923 O  O     . GLU G 1 97  ? -7.677  1.005   -8.425  1.00 40.56  ? 96  GLU K O     1 
ATOM   5924 C  CB    . GLU G 1 97  ? -9.534  0.778   -5.835  1.00 43.46  ? 96  GLU K CB    1 
ATOM   5925 C  CG    . GLU G 1 97  ? -9.805  0.292   -4.424  1.00 52.78  ? 96  GLU K CG    1 
ATOM   5926 C  CD    . GLU G 1 97  ? -11.204 -0.270  -4.270  1.00 80.66  ? 96  GLU K CD    1 
ATOM   5927 O  OE1   . GLU G 1 97  ? -11.660 -0.430  -3.117  1.00 73.79  ? 96  GLU K OE1   1 
ATOM   5928 O  OE2   . GLU G 1 97  ? -11.848 -0.553  -5.303  1.00 83.22  ? 96  GLU K OE2   1 
ATOM   5929 N  N     . ARG G 1 98  ? -8.176  3.078   -7.707  1.00 35.56  ? 97  ARG K N     1 
ATOM   5930 C  CA    . ARG G 1 98  ? -8.109  3.697   -9.024  1.00 40.46  ? 97  ARG K CA    1 
ATOM   5931 C  C     . ARG G 1 98  ? -6.799  4.446   -9.242  1.00 42.00  ? 97  ARG K C     1 
ATOM   5932 O  O     . ARG G 1 98  ? -6.748  5.391   -10.037 1.00 39.35  ? 97  ARG K O     1 
ATOM   5933 C  CB    . ARG G 1 98  ? -9.302  4.633   -9.215  1.00 45.30  ? 97  ARG K CB    1 
ATOM   5934 C  CG    . ARG G 1 98  ? -10.644 3.952   -8.995  1.00 46.11  ? 97  ARG K CG    1 
ATOM   5935 C  CD    . ARG G 1 98  ? -11.794 4.945   -9.026  1.00 51.60  ? 97  ARG K CD    1 
ATOM   5936 N  NE    . ARG G 1 98  ? -11.809 5.728   -10.257 1.00 59.96  ? 97  ARG K NE    1 
ATOM   5937 C  CZ    . ARG G 1 98  ? -12.285 5.288   -11.417 1.00 59.72  ? 97  ARG K CZ    1 
ATOM   5938 N  NH1   . ARG G 1 98  ? -12.787 4.064   -11.511 1.00 56.99  ? 97  ARG K NH1   1 
ATOM   5939 N  NH2   . ARG G 1 98  ? -12.258 6.073   -12.485 1.00 60.56  ? 97  ARG K NH2   1 
ATOM   5940 N  N     . ILE G 1 99  ? -5.730  4.030   -8.557  1.00 39.99  ? 98  ILE K N     1 
ATOM   5941 C  CA    . ILE G 1 99  ? -4.476  4.776   -8.607  1.00 38.84  ? 98  ILE K CA    1 
ATOM   5942 C  C     . ILE G 1 99  ? -3.823  4.667   -9.980  1.00 41.51  ? 98  ILE K C     1 
ATOM   5943 O  O     . ILE G 1 99  ? -3.115  5.586   -10.411 1.00 42.53  ? 98  ILE K O     1 
ATOM   5944 C  CB    . ILE G 1 99  ? -3.529  4.299   -7.488  1.00 38.39  ? 98  ILE K CB    1 
ATOM   5945 C  CG1   . ILE G 1 99  ? -2.317  5.224   -7.380  1.00 39.80  ? 98  ILE K CG1   1 
ATOM   5946 C  CG2   . ILE G 1 99  ? -3.081  2.864   -7.728  1.00 38.51  ? 98  ILE K CG2   1 
ATOM   5947 C  CD1   . ILE G 1 99  ? -1.420  4.908   -6.211  1.00 47.11  ? 98  ILE K CD1   1 
ATOM   5948 N  N     . ARG G 1 100 ? -4.050  3.565   -10.697 1.00 40.21  ? 99  ARG K N     1 
ATOM   5949 C  CA    . ARG G 1 100 ? -3.449  3.404   -12.015 1.00 48.48  ? 99  ARG K CA    1 
ATOM   5950 C  C     . ARG G 1 100 ? -4.018  4.372   -13.045 1.00 49.60  ? 99  ARG K C     1 
ATOM   5951 O  O     . ARG G 1 100 ? -3.447  4.495   -14.134 1.00 52.25  ? 99  ARG K O     1 
ATOM   5952 C  CB    . ARG G 1 100 ? -3.622  1.961   -12.496 1.00 51.39  ? 99  ARG K CB    1 
ATOM   5953 C  CG    . ARG G 1 100 ? -2.855  0.938   -11.665 1.00 54.03  ? 99  ARG K CG    1 
ATOM   5954 C  CD    . ARG G 1 100 ? -3.082  -0.484  -12.161 1.00 53.16  ? 99  ARG K CD    1 
ATOM   5955 N  NE    . ARG G 1 100 ? -2.311  -1.461  -11.394 1.00 63.94  ? 99  ARG K NE    1 
ATOM   5956 C  CZ    . ARG G 1 100 ? -2.790  -2.159  -10.369 1.00 71.08  ? 99  ARG K CZ    1 
ATOM   5957 N  NH1   . ARG G 1 100 ? -2.012  -3.024  -9.733  1.00 60.99  ? 99  ARG K NH1   1 
ATOM   5958 N  NH2   . ARG G 1 100 ? -4.047  -1.994  -9.978  1.00 66.94  ? 99  ARG K NH2   1 
ATOM   5959 N  N     . LEU G 1 101 ? -5.114  5.062   -12.728 1.00 48.37  ? 100 LEU K N     1 
ATOM   5960 C  CA    . LEU G 1 101 ? -5.720  6.041   -13.621 1.00 43.95  ? 100 LEU K CA    1 
ATOM   5961 C  C     . LEU G 1 101 ? -5.284  7.468   -13.315 1.00 47.91  ? 100 LEU K C     1 
ATOM   5962 O  O     . LEU G 1 101 ? -5.877  8.412   -13.848 1.00 48.59  ? 100 LEU K O     1 
ATOM   5963 C  CB    . LEU G 1 101 ? -7.246  5.948   -13.552 1.00 42.53  ? 100 LEU K CB    1 
ATOM   5964 C  CG    . LEU G 1 101 ? -7.897  4.575   -13.730 1.00 53.60  ? 100 LEU K CG    1 
ATOM   5965 C  CD1   . LEU G 1 101 ? -9.407  4.691   -13.597 1.00 48.80  ? 100 LEU K CD1   1 
ATOM   5966 C  CD2   . LEU G 1 101 ? -7.521  3.963   -15.068 1.00 50.22  ? 100 LEU K CD2   1 
ATOM   5967 N  N     . CYS G 1 102 ? -4.274  7.650   -12.467 1.00 48.80  ? 101 CYS K N     1 
ATOM   5968 C  CA    . CYS G 1 102 ? -3.837  8.992   -12.103 1.00 50.90  ? 101 CYS K CA    1 
ATOM   5969 C  C     . CYS G 1 102 ? -3.283  9.730   -13.314 1.00 50.28  ? 101 CYS K C     1 
ATOM   5970 O  O     . CYS G 1 102 ? -2.610  9.144   -14.167 1.00 49.25  ? 101 CYS K O     1 
ATOM   5971 C  CB    . CYS G 1 102 ? -2.773  8.926   -11.005 1.00 48.91  ? 101 CYS K CB    1 
ATOM   5972 S  SG    . CYS G 1 102 ? -3.398  8.533   -9.356  1.00 69.35  ? 101 CYS K SG    1 
ATOM   5973 N  N     . ASN G 1 103 ? -3.575  11.027  -13.391 1.00 48.77  ? 102 ASN K N     1 
ATOM   5974 C  CA    . ASN G 1 103 ? -2.944  11.862  -14.398 1.00 46.20  ? 102 ASN K CA    1 
ATOM   5975 C  C     . ASN G 1 103 ? -1.539  12.248  -13.940 1.00 51.98  ? 102 ASN K C     1 
ATOM   5976 O  O     . ASN G 1 103 ? -1.123  11.956  -12.815 1.00 53.28  ? 102 ASN K O     1 
ATOM   5977 C  CB    . ASN G 1 103 ? -3.802  13.097  -14.696 1.00 49.55  ? 102 ASN K CB    1 
ATOM   5978 C  CG    . ASN G 1 103 ? -4.048  13.963  -13.472 1.00 56.24  ? 102 ASN K CG    1 
ATOM   5979 O  OD1   . ASN G 1 103 ? -3.122  14.325  -12.749 1.00 58.00  ? 102 ASN K OD1   1 
ATOM   5980 N  ND2   . ASN G 1 103 ? -5.312  14.300  -13.237 1.00 60.55  ? 102 ASN K ND2   1 
ATOM   5981 N  N     . MET G 1 104 ? -0.804  12.914  -14.836 1.00 46.59  ? 103 MET K N     1 
ATOM   5982 C  CA    . MET G 1 104 ? 0.617   13.161  -14.599 1.00 48.52  ? 103 MET K CA    1 
ATOM   5983 C  C     . MET G 1 104 ? 0.842   13.920  -13.306 1.00 50.04  ? 103 MET K C     1 
ATOM   5984 O  O     . MET G 1 104 ? 1.817   13.673  -12.584 1.00 44.76  ? 103 MET K O     1 
ATOM   5985 C  CB    . MET G 1 104 ? 1.221   13.937  -15.768 1.00 49.54  ? 103 MET K CB    1 
ATOM   5986 C  CG    . MET G 1 104 ? 2.632   14.442  -15.495 1.00 54.44  ? 103 MET K CG    1 
ATOM   5987 S  SD    . MET G 1 104 ? 3.477   15.055  -16.963 1.00 82.40  ? 103 MET K SD    1 
ATOM   5988 C  CE    . MET G 1 104 ? 4.894   15.866  -16.225 1.00 57.40  ? 103 MET K CE    1 
ATOM   5989 N  N     . ARG G 1 105 ? -0.052  14.843  -12.991 1.00 51.42  ? 104 ARG K N     1 
ATOM   5990 C  CA    . ARG G 1 105 ? 0.225   15.742  -11.889 1.00 58.64  ? 104 ARG K CA    1 
ATOM   5991 C  C     . ARG G 1 105 ? -0.082  15.068  -10.549 1.00 56.13  ? 104 ARG K C     1 
ATOM   5992 O  O     . ARG G 1 105 ? 0.639   15.277  -9.562  1.00 52.49  ? 104 ARG K O     1 
ATOM   5993 C  CB    . ARG G 1 105 ? -0.551  17.036  -12.116 1.00 61.71  ? 104 ARG K CB    1 
ATOM   5994 C  CG    . ARG G 1 105 ? -0.840  17.746  -10.865 1.00 68.65  ? 104 ARG K CG    1 
ATOM   5995 C  CD    . ARG G 1 105 ? -1.845  18.823  -11.029 1.00 88.39  ? 104 ARG K CD    1 
ATOM   5996 N  NE    . ARG G 1 105 ? -2.648  18.645  -9.832  1.00 92.47  ? 104 ARG K NE    1 
ATOM   5997 C  CZ    . ARG G 1 105 ? -3.369  19.583  -9.255  1.00 99.14  ? 104 ARG K CZ    1 
ATOM   5998 N  NH1   . ARG G 1 105 ? -3.387  20.818  -9.748  1.00 102.45 ? 104 ARG K NH1   1 
ATOM   5999 N  NH2   . ARG G 1 105 ? -4.050  19.246  -8.186  1.00 94.60  ? 104 ARG K NH2   1 
ATOM   6000 N  N     . GLU G 1 106 ? -1.102  14.199  -10.508 1.00 46.65  ? 105 GLU K N     1 
ATOM   6001 C  CA    . GLU G 1 106 ? -1.318  13.385  -9.315  1.00 47.85  ? 105 GLU K CA    1 
ATOM   6002 C  C     . GLU G 1 106 ? -0.267  12.290  -9.176  1.00 44.07  ? 105 GLU K C     1 
ATOM   6003 O  O     . GLU G 1 106 ? 0.068   11.900  -8.052  1.00 40.10  ? 105 GLU K O     1 
ATOM   6004 C  CB    . GLU G 1 106 ? -2.715  12.766  -9.328  1.00 44.79  ? 105 GLU K CB    1 
ATOM   6005 C  CG    . GLU G 1 106 ? -3.820  13.708  -9.769  1.00 51.08  ? 105 GLU K CG    1 
ATOM   6006 C  CD    . GLU G 1 106 ? -5.111  12.977  -10.074 1.00 65.45  ? 105 GLU K CD    1 
ATOM   6007 O  OE1   . GLU G 1 106 ? -6.021  12.998  -9.220  1.00 73.61  ? 105 GLU K OE1   1 
ATOM   6008 O  OE2   . GLU G 1 106 ? -5.211  12.369  -11.160 1.00 63.73  ? 105 GLU K OE2   1 
ATOM   6009 N  N     . GLN G 1 107 ? 0.259   11.784  -10.295 1.00 43.75  ? 106 GLN K N     1 
ATOM   6010 C  CA    . GLN G 1 107 ? 1.369   10.838  -10.228 1.00 44.25  ? 106 GLN K CA    1 
ATOM   6011 C  C     . GLN G 1 107 ? 2.571   11.465  -9.535  1.00 36.95  ? 106 GLN K C     1 
ATOM   6012 O  O     . GLN G 1 107 ? 3.171   10.862  -8.638  1.00 34.39  ? 106 GLN K O     1 
ATOM   6013 C  CB    . GLN G 1 107 ? 1.751   10.366  -11.632 1.00 44.55  ? 106 GLN K CB    1 
ATOM   6014 C  CG    . GLN G 1 107 ? 0.714   9.496   -12.319 1.00 47.94  ? 106 GLN K CG    1 
ATOM   6015 C  CD    . GLN G 1 107 ? 1.044   9.252   -13.780 1.00 47.43  ? 106 GLN K CD    1 
ATOM   6016 O  OE1   . GLN G 1 107 ? 2.160   9.515   -14.227 1.00 47.79  ? 106 GLN K OE1   1 
ATOM   6017 N  NE2   . GLN G 1 107 ? 0.071   8.750   -14.531 1.00 56.03  ? 106 GLN K NE2   1 
ATOM   6018 N  N     . ILE G 1 108 ? 2.930   12.685  -9.938  1.00 40.75  ? 107 ILE K N     1 
ATOM   6019 C  CA    . ILE G 1 108 ? 4.076   13.366  -9.345  1.00 38.39  ? 107 ILE K CA    1 
ATOM   6020 C  C     . ILE G 1 108 ? 3.833   13.631  -7.865  1.00 40.97  ? 107 ILE K C     1 
ATOM   6021 O  O     . ILE G 1 108 ? 4.724   13.436  -7.029  1.00 43.86  ? 107 ILE K O     1 
ATOM   6022 C  CB    . ILE G 1 108 ? 4.375   14.666  -10.116 1.00 44.28  ? 107 ILE K CB    1 
ATOM   6023 C  CG1   . ILE G 1 108 ? 4.970   14.341  -11.489 1.00 46.87  ? 107 ILE K CG1   1 
ATOM   6024 C  CG2   . ILE G 1 108 ? 5.308   15.568  -9.321  1.00 47.17  ? 107 ILE K CG2   1 
ATOM   6025 C  CD1   . ILE G 1 108 ? 5.007   15.521  -12.435 1.00 44.04  ? 107 ILE K CD1   1 
ATOM   6026 N  N     . ALA G 1 109 ? 2.620   14.069  -7.517  1.00 39.17  ? 108 ALA K N     1 
ATOM   6027 C  CA    . ALA G 1 109 ? 2.303   14.329  -6.117  1.00 38.84  ? 108 ALA K CA    1 
ATOM   6028 C  C     . ALA G 1 109 ? 2.347   13.048  -5.293  1.00 34.68  ? 108 ALA K C     1 
ATOM   6029 O  O     . ALA G 1 109 ? 2.816   13.054  -4.149  1.00 38.48  ? 108 ALA K O     1 
ATOM   6030 C  CB    . ALA G 1 109 ? 0.932   14.996  -6.006  1.00 33.06  ? 108 ALA K CB    1 
ATOM   6031 N  N     . PHE G 1 110 ? 1.868   11.937  -5.860  1.00 35.69  ? 109 PHE K N     1 
ATOM   6032 C  CA    . PHE G 1 110 ? 1.880   10.674  -5.128  1.00 34.95  ? 109 PHE K CA    1 
ATOM   6033 C  C     . PHE G 1 110 ? 3.302   10.170  -4.914  1.00 31.28  ? 109 PHE K C     1 
ATOM   6034 O  O     . PHE G 1 110 ? 3.648   9.726   -3.813  1.00 34.58  ? 109 PHE K O     1 
ATOM   6035 C  CB    . PHE G 1 110 ? 1.048   9.624   -5.866  1.00 35.42  ? 109 PHE K CB    1 
ATOM   6036 C  CG    . PHE G 1 110 ? 1.117   8.256   -5.247  1.00 36.64  ? 109 PHE K CG    1 
ATOM   6037 C  CD1   . PHE G 1 110 ? 0.304   7.924   -4.175  1.00 33.96  ? 109 PHE K CD1   1 
ATOM   6038 C  CD2   . PHE G 1 110 ? 1.996   7.300   -5.736  1.00 31.55  ? 109 PHE K CD2   1 
ATOM   6039 C  CE1   . PHE G 1 110 ? 0.367   6.668   -3.600  1.00 31.54  ? 109 PHE K CE1   1 
ATOM   6040 C  CE2   . PHE G 1 110 ? 2.064   6.042   -5.165  1.00 32.78  ? 109 PHE K CE2   1 
ATOM   6041 C  CZ    . PHE G 1 110 ? 1.248   5.726   -4.095  1.00 32.56  ? 109 PHE K CZ    1 
ATOM   6042 N  N     . ILE G 1 111 ? 4.136   10.217  -5.956  1.00 29.30  ? 110 ILE K N     1 
ATOM   6043 C  CA    . ILE G 1 111 ? 5.526   9.789   -5.815  1.00 35.16  ? 110 ILE K CA    1 
ATOM   6044 C  C     . ILE G 1 111 ? 6.254   10.678  -4.816  1.00 27.77  ? 110 ILE K C     1 
ATOM   6045 O  O     . ILE G 1 111 ? 7.053   10.199  -4.001  1.00 29.52  ? 110 ILE K O     1 
ATOM   6046 C  CB    . ILE G 1 111 ? 6.228   9.784   -7.186  1.00 30.81  ? 110 ILE K CB    1 
ATOM   6047 C  CG1   . ILE G 1 111 ? 5.517   8.831   -8.148  1.00 32.11  ? 110 ILE K CG1   1 
ATOM   6048 C  CG2   . ILE G 1 111 ? 7.688   9.387   -7.036  1.00 33.79  ? 110 ILE K CG2   1 
ATOM   6049 C  CD1   . ILE G 1 111 ? 6.008   8.928   -9.574  1.00 38.67  ? 110 ILE K CD1   1 
ATOM   6050 N  N     . LYS G 1 112 ? 5.985   11.984  -4.860  1.00 31.16  ? 111 LYS K N     1 
ATOM   6051 C  CA    . LYS G 1 112 ? 6.578   12.906  -3.896  1.00 34.65  ? 111 LYS K CA    1 
ATOM   6052 C  C     . LYS G 1 112 ? 6.194   12.528  -2.471  1.00 32.85  ? 111 LYS K C     1 
ATOM   6053 O  O     . LYS G 1 112 ? 7.047   12.481  -1.577  1.00 37.56  ? 111 LYS K O     1 
ATOM   6054 C  CB    . LYS G 1 112 ? 6.144   14.336  -4.218  1.00 38.92  ? 111 LYS K CB    1 
ATOM   6055 C  CG    . LYS G 1 112 ? 6.654   15.392  -3.255  1.00 39.04  ? 111 LYS K CG    1 
ATOM   6056 C  CD    . LYS G 1 112 ? 6.308   16.783  -3.764  1.00 50.67  ? 111 LYS K CD    1 
ATOM   6057 C  CE    . LYS G 1 112 ? 6.440   17.832  -2.673  1.00 68.01  ? 111 LYS K CE    1 
ATOM   6058 N  NZ    . LYS G 1 112 ? 5.197   18.644  -2.541  1.00 71.65  ? 111 LYS K NZ    1 
ATOM   6059 N  N     . GLY G 1 113 ? 4.911   12.246  -2.243  1.00 35.89  ? 112 GLY K N     1 
ATOM   6060 C  CA    . GLY G 1 113 ? 4.484   11.821  -0.920  1.00 28.67  ? 112 GLY K CA    1 
ATOM   6061 C  C     . GLY G 1 113 ? 5.051   10.470  -0.529  1.00 33.21  ? 112 GLY K C     1 
ATOM   6062 O  O     . GLY G 1 113 ? 5.436   10.260  0.625   1.00 33.05  ? 112 GLY K O     1 
ATOM   6063 N  N     . LEU G 1 114 ? 5.114   9.537   -1.481  1.00 32.45  ? 113 LEU K N     1 
ATOM   6064 C  CA    . LEU G 1 114 ? 5.672   8.221   -1.184  1.00 31.59  ? 113 LEU K CA    1 
ATOM   6065 C  C     . LEU G 1 114 ? 7.158   8.312   -0.860  1.00 33.65  ? 113 LEU K C     1 
ATOM   6066 O  O     . LEU G 1 114 ? 7.658   7.568   -0.008  1.00 32.77  ? 113 LEU K O     1 
ATOM   6067 C  CB    . LEU G 1 114 ? 5.436   7.270   -2.357  1.00 32.25  ? 113 LEU K CB    1 
ATOM   6068 C  CG    . LEU G 1 114 ? 5.787   5.802   -2.096  1.00 37.46  ? 113 LEU K CG    1 
ATOM   6069 C  CD1   . LEU G 1 114 ? 4.921   5.237   -0.980  1.00 32.04  ? 113 LEU K CD1   1 
ATOM   6070 C  CD2   . LEU G 1 114 ? 5.646   4.972   -3.364  1.00 38.15  ? 113 LEU K CD2   1 
ATOM   6071 N  N     . TYR G 1 115 ? 7.880   9.220   -1.521  1.00 35.10  ? 114 TYR K N     1 
ATOM   6072 C  CA    . TYR G 1 115 ? 9.306   9.353   -1.242  1.00 32.49  ? 114 TYR K CA    1 
ATOM   6073 C  C     . TYR G 1 115 ? 9.546   10.017  0.108   1.00 31.64  ? 114 TYR K C     1 
ATOM   6074 O  O     . TYR G 1 115 ? 10.468  9.636   0.836   1.00 36.53  ? 114 TYR K O     1 
ATOM   6075 C  CB    . TYR G 1 115 ? 10.004  10.135  -2.353  1.00 32.81  ? 114 TYR K CB    1 
ATOM   6076 C  CG    . TYR G 1 115 ? 11.501  9.930   -2.354  1.00 28.69  ? 114 TYR K CG    1 
ATOM   6077 C  CD1   . TYR G 1 115 ? 12.324  10.659  -1.505  1.00 30.96  ? 114 TYR K CD1   1 
ATOM   6078 C  CD2   . TYR G 1 115 ? 12.091  8.992   -3.191  1.00 32.10  ? 114 TYR K CD2   1 
ATOM   6079 C  CE1   . TYR G 1 115 ? 13.692  10.465  -1.496  1.00 36.31  ? 114 TYR K CE1   1 
ATOM   6080 C  CE2   . TYR G 1 115 ? 13.458  8.792   -3.190  1.00 34.19  ? 114 TYR K CE2   1 
ATOM   6081 C  CZ    . TYR G 1 115 ? 14.254  9.531   -2.341  1.00 37.01  ? 114 TYR K CZ    1 
ATOM   6082 O  OH    . TYR G 1 115 ? 15.615  9.335   -2.335  1.00 40.30  ? 114 TYR K OH    1 
ATOM   6083 N  N     . VAL G 1 116 ? 8.735   11.019  0.457   1.00 29.37  ? 115 VAL K N     1 
ATOM   6084 C  CA    . VAL G 1 116 ? 8.832   11.617  1.787   1.00 33.17  ? 115 VAL K CA    1 
ATOM   6085 C  C     . VAL G 1 116 ? 8.679   10.546  2.859   1.00 32.19  ? 115 VAL K C     1 
ATOM   6086 O  O     . VAL G 1 116 ? 9.343   10.583  3.903   1.00 37.17  ? 115 VAL K O     1 
ATOM   6087 C  CB    . VAL G 1 116 ? 7.785   12.737  1.947   1.00 37.02  ? 115 VAL K CB    1 
ATOM   6088 C  CG1   . VAL G 1 116 ? 7.682   13.178  3.400   1.00 29.17  ? 115 VAL K CG1   1 
ATOM   6089 C  CG2   . VAL G 1 116 ? 8.136   13.921  1.061   1.00 33.78  ? 115 VAL K CG2   1 
ATOM   6090 N  N     . ALA G 1 117 ? 7.826   9.554   2.601   1.00 31.73  ? 116 ALA K N     1 
ATOM   6091 C  CA    . ALA G 1 117 ? 7.574   8.506   3.582   1.00 30.72  ? 116 ALA K CA    1 
ATOM   6092 C  C     . ALA G 1 117 ? 8.602   7.381   3.491   1.00 29.23  ? 116 ALA K C     1 
ATOM   6093 O  O     . ALA G 1 117 ? 9.166   6.965   4.506   1.00 29.56  ? 116 ALA K O     1 
ATOM   6094 C  CB    . ALA G 1 117 ? 6.159   7.953   3.402   1.00 26.83  ? 116 ALA K CB    1 
ATOM   6095 N  N     . GLU G 1 118 ? 8.855   6.869   2.290   1.00 32.06  ? 117 GLU K N     1 
ATOM   6096 C  CA    . GLU G 1 118 ? 9.650   5.660   2.125   1.00 32.45  ? 117 GLU K CA    1 
ATOM   6097 C  C     . GLU G 1 118 ? 11.005  5.915   1.490   1.00 35.89  ? 117 GLU K C     1 
ATOM   6098 O  O     . GLU G 1 118 ? 11.745  4.961   1.231   1.00 33.66  ? 117 GLU K O     1 
ATOM   6099 C  CB    . GLU G 1 118 ? 8.882   4.646   1.272   1.00 34.88  ? 117 GLU K CB    1 
ATOM   6100 C  CG    . GLU G 1 118 ? 7.419   4.544   1.620   1.00 36.19  ? 117 GLU K CG    1 
ATOM   6101 C  CD    . GLU G 1 118 ? 7.157   3.533   2.710   1.00 38.70  ? 117 GLU K CD    1 
ATOM   6102 O  OE1   . GLU G 1 118 ? 7.633   3.736   3.848   1.00 37.20  ? 117 GLU K OE1   1 
ATOM   6103 O  OE2   . GLU G 1 118 ? 6.486   2.525   2.416   1.00 45.28  ? 117 GLU K OE2   1 
ATOM   6104 N  N     . GLY G 1 119 ? 11.345  7.157   1.230   1.00 31.33  ? 118 GLY K N     1 
ATOM   6105 C  CA    . GLY G 1 119 ? 12.482  7.446   0.393   1.00 33.04  ? 118 GLY K CA    1 
ATOM   6106 C  C     . GLY G 1 119 ? 13.776  7.600   1.151   1.00 35.99  ? 118 GLY K C     1 
ATOM   6107 O  O     . GLY G 1 119 ? 13.813  7.880   2.349   1.00 32.66  ? 118 GLY K O     1 
ATOM   6108 N  N     . ASP G 1 120 ? 14.868  7.397   0.424   1.00 38.22  ? 119 ASP K N     1 
ATOM   6109 C  CA    . ASP G 1 120 ? 16.186  7.669   0.971   1.00 37.34  ? 119 ASP K CA    1 
ATOM   6110 C  C     . ASP G 1 120 ? 16.347  9.170   1.134   1.00 36.81  ? 119 ASP K C     1 
ATOM   6111 O  O     . ASP G 1 120 ? 16.675  9.869   0.169   1.00 39.71  ? 119 ASP K O     1 
ATOM   6112 C  CB    . ASP G 1 120 ? 17.271  7.139   0.043   1.00 36.08  ? 119 ASP K CB    1 
ATOM   6113 C  CG    . ASP G 1 120 ? 18.627  7.059   0.706   1.00 47.35  ? 119 ASP K CG    1 
ATOM   6114 O  OD1   . ASP G 1 120 ? 18.942  7.890   1.579   1.00 48.09  ? 119 ASP K OD1   1 
ATOM   6115 O  OD2   . ASP G 1 120 ? 19.394  6.165   0.311   1.00 46.35  ? 119 ASP K OD2   1 
ATOM   6116 N  N     . LYS G 1 121 ? 16.111  9.676   2.342   1.00 40.19  ? 120 LYS K N     1 
ATOM   6117 C  CA    . LYS G 1 121 ? 16.175  11.115  2.550   1.00 44.92  ? 120 LYS K CA    1 
ATOM   6118 C  C     . LYS G 1 121 ? 17.599  11.664  2.480   1.00 55.28  ? 120 LYS K C     1 
ATOM   6119 O  O     . LYS G 1 121 ? 17.768  12.885  2.392   1.00 56.99  ? 120 LYS K O     1 
ATOM   6120 C  CB    . LYS G 1 121 ? 15.540  11.479  3.894   1.00 43.65  ? 120 LYS K CB    1 
ATOM   6121 C  CG    . LYS G 1 121 ? 14.146  12.116  3.806   1.00 58.13  ? 120 LYS K CG    1 
ATOM   6122 C  CD    . LYS G 1 121 ? 13.071  11.072  3.515   1.00 55.16  ? 120 LYS K CD    1 
ATOM   6123 C  CE    . LYS G 1 121 ? 12.791  10.200  4.738   1.00 53.53  ? 120 LYS K CE    1 
ATOM   6124 N  NZ    . LYS G 1 121 ? 11.923  9.030   4.403   1.00 49.49  ? 120 LYS K NZ    1 
ATOM   6125 N  N     . THR G 1 122 ? 18.632  10.817  2.503   1.00 51.79  ? 121 THR K N     1 
ATOM   6126 C  CA    . THR G 1 122 ? 19.983  11.368  2.445   1.00 54.70  ? 121 THR K CA    1 
ATOM   6127 C  C     . THR G 1 122 ? 20.245  12.001  1.081   1.00 55.73  ? 121 THR K C     1 
ATOM   6128 O  O     . THR G 1 122 ? 21.009  12.968  0.966   1.00 57.74  ? 121 THR K O     1 
ATOM   6129 C  CB    . THR G 1 122 ? 21.014  10.284  2.759   1.00 52.70  ? 121 THR K CB    1 
ATOM   6130 O  OG1   . THR G 1 122 ? 22.195  10.899  3.284   1.00 76.36  ? 121 THR K OG1   1 
ATOM   6131 C  CG2   . THR G 1 122 ? 21.397  9.492   1.515   1.00 53.59  ? 121 THR K CG2   1 
ATOM   6132 N  N     . LEU G 1 123 ? 19.588  11.484  0.045   1.00 58.37  ? 122 LEU K N     1 
ATOM   6133 C  CA    . LEU G 1 123 ? 19.677  11.899  -1.348  1.00 57.89  ? 122 LEU K CA    1 
ATOM   6134 C  C     . LEU G 1 123 ? 21.040  11.636  -1.973  1.00 55.86  ? 122 LEU K C     1 
ATOM   6135 O  O     . LEU G 1 123 ? 21.220  11.940  -3.158  1.00 53.94  ? 122 LEU K O     1 
ATOM   6136 C  CB    . LEU G 1 123 ? 19.311  13.377  -1.545  1.00 55.09  ? 122 LEU K CB    1 
ATOM   6137 C  CG    . LEU G 1 123 ? 17.861  13.735  -1.202  1.00 56.90  ? 122 LEU K CG    1 
ATOM   6138 C  CD1   . LEU G 1 123 ? 17.496  15.134  -1.687  1.00 52.15  ? 122 LEU K CD1   1 
ATOM   6139 C  CD2   . LEU G 1 123 ? 16.885  12.697  -1.752  1.00 54.21  ? 122 LEU K CD2   1 
ATOM   6140 N  N     . LYS G 1 124 ? 22.011  11.093  -1.232  1.00 54.33  ? 123 LYS K N     1 
ATOM   6141 C  CA    . LYS G 1 124 ? 23.186  10.543  -1.903  1.00 55.99  ? 123 LYS K CA    1 
ATOM   6142 C  C     . LYS G 1 124 ? 22.788  9.415   -2.842  1.00 52.05  ? 123 LYS K C     1 
ATOM   6143 O  O     . LYS G 1 124 ? 23.450  9.183   -3.858  1.00 53.64  ? 123 LYS K O     1 
ATOM   6144 C  CB    . LYS G 1 124 ? 24.226  10.019  -0.904  1.00 52.30  ? 123 LYS K CB    1 
ATOM   6145 C  CG    . LYS G 1 124 ? 24.347  10.717  0.424   1.00 67.02  ? 123 LYS K CG    1 
ATOM   6146 C  CD    . LYS G 1 124 ? 25.761  11.198  0.661   1.00 81.91  ? 123 LYS K CD    1 
ATOM   6147 C  CE    . LYS G 1 124 ? 26.031  11.336  2.148   1.00 77.21  ? 123 LYS K CE    1 
ATOM   6148 N  NZ    . LYS G 1 124 ? 25.250  12.445  2.770   1.00 75.66  ? 123 LYS K NZ    1 
ATOM   6149 N  N     . ARG G 1 125 ? 21.719  8.700   -2.503  1.00 50.90  ? 124 ARG K N     1 
ATOM   6150 C  CA    . ARG G 1 125 ? 21.117  7.680   -3.343  1.00 49.39  ? 124 ARG K CA    1 
ATOM   6151 C  C     . ARG G 1 125 ? 19.609  7.881   -3.313  1.00 42.03  ? 124 ARG K C     1 
ATOM   6152 O  O     . ARG G 1 125 ? 19.053  8.382   -2.331  1.00 41.15  ? 124 ARG K O     1 
ATOM   6153 C  CB    . ARG G 1 125 ? 21.482  6.255   -2.869  1.00 42.21  ? 124 ARG K CB    1 
ATOM   6154 C  CG    . ARG G 1 125 ? 22.830  6.163   -2.172  1.00 56.40  ? 124 ARG K CG    1 
ATOM   6155 C  CD    . ARG G 1 125 ? 23.060  4.787   -1.557  1.00 40.94  ? 124 ARG K CD    1 
ATOM   6156 N  NE    . ARG G 1 125 ? 22.916  3.761   -2.586  1.00 44.83  ? 124 ARG K NE    1 
ATOM   6157 C  CZ    . ARG G 1 125 ? 23.314  2.502   -2.437  1.00 46.66  ? 124 ARG K CZ    1 
ATOM   6158 N  NH1   . ARG G 1 125 ? 23.898  2.115   -1.307  1.00 43.13  ? 124 ARG K NH1   1 
ATOM   6159 N  NH2   . ARG G 1 125 ? 23.135  1.638   -3.421  1.00 44.16  ? 124 ARG K NH2   1 
ATOM   6160 N  N     . LEU G 1 126 ? 18.950  7.485   -4.391  1.00 37.52  ? 125 LEU K N     1 
ATOM   6161 C  CA    . LEU G 1 126 ? 17.519  7.711   -4.567  1.00 37.55  ? 125 LEU K CA    1 
ATOM   6162 C  C     . LEU G 1 126 ? 16.832  6.349   -4.554  1.00 38.94  ? 125 LEU K C     1 
ATOM   6163 O  O     . LEU G 1 126 ? 16.822  5.637   -5.562  1.00 40.26  ? 125 LEU K O     1 
ATOM   6164 C  CB    . LEU G 1 126 ? 17.263  8.478   -5.858  1.00 39.45  ? 125 LEU K CB    1 
ATOM   6165 C  CG    . LEU G 1 126 ? 17.988  9.825   -5.940  1.00 37.10  ? 125 LEU K CG    1 
ATOM   6166 C  CD1   . LEU G 1 126 ? 17.852  10.439  -7.324  1.00 41.84  ? 125 LEU K CD1   1 
ATOM   6167 C  CD2   . LEU G 1 126 ? 17.474  10.783  -4.874  1.00 40.97  ? 125 LEU K CD2   1 
ATOM   6168 N  N     . ARG G 1 127 ? 16.262  5.989   -3.404  1.00 35.95  ? 126 ARG K N     1 
ATOM   6169 C  CA    . ARG G 1 127 ? 15.688  4.668   -3.201  1.00 36.56  ? 126 ARG K CA    1 
ATOM   6170 C  C     . ARG G 1 127 ? 14.340  4.787   -2.505  1.00 40.66  ? 126 ARG K C     1 
ATOM   6171 O  O     . ARG G 1 127 ? 14.115  5.695   -1.700  1.00 34.15  ? 126 ARG K O     1 
ATOM   6172 C  CB    . ARG G 1 127 ? 16.622  3.773   -2.374  1.00 33.22  ? 126 ARG K CB    1 
ATOM   6173 C  CG    . ARG G 1 127 ? 17.981  3.534   -3.012  1.00 38.19  ? 126 ARG K CG    1 
ATOM   6174 C  CD    . ARG G 1 127 ? 18.893  2.723   -2.105  1.00 34.98  ? 126 ARG K CD    1 
ATOM   6175 N  NE    . ARG G 1 127 ? 19.286  3.467   -0.912  1.00 33.98  ? 126 ARG K NE    1 
ATOM   6176 C  CZ    . ARG G 1 127 ? 20.092  2.992   0.032   1.00 36.31  ? 126 ARG K CZ    1 
ATOM   6177 N  NH1   . ARG G 1 127 ? 20.597  1.771   -0.077  1.00 31.39  ? 126 ARG K NH1   1 
ATOM   6178 N  NH2   . ARG G 1 127 ? 20.396  3.739   1.084   1.00 33.73  ? 126 ARG K NH2   1 
ATOM   6179 N  N     . ILE G 1 128 ? 13.445  3.854   -2.825  1.00 33.76  ? 127 ILE K N     1 
ATOM   6180 C  CA    . ILE G 1 128 ? 12.128  3.753   -2.202  1.00 33.14  ? 127 ILE K CA    1 
ATOM   6181 C  C     . ILE G 1 128 ? 11.932  2.306   -1.770  1.00 32.91  ? 127 ILE K C     1 
ATOM   6182 O  O     . ILE G 1 128 ? 12.030  1.392   -2.596  1.00 33.70  ? 127 ILE K O     1 
ATOM   6183 C  CB    . ILE G 1 128 ? 10.999  4.187   -3.152  1.00 35.43  ? 127 ILE K CB    1 
ATOM   6184 C  CG1   . ILE G 1 128 ? 11.239  5.608   -3.668  1.00 34.96  ? 127 ILE K CG1   1 
ATOM   6185 C  CG2   . ILE G 1 128 ? 9.648   4.092   -2.456  1.00 32.49  ? 127 ILE K CG2   1 
ATOM   6186 C  CD1   . ILE G 1 128 ? 10.209  6.072   -4.679  1.00 36.38  ? 127 ILE K CD1   1 
ATOM   6187 N  N     . TRP G 1 129 ? 11.654  2.098   -0.485  1.00 26.57  ? 128 TRP K N     1 
ATOM   6188 C  CA    . TRP G 1 129 ? 11.473  0.768   0.079   1.00 34.38  ? 128 TRP K CA    1 
ATOM   6189 C  C     . TRP G 1 129 ? 9.997   0.493   0.335   1.00 32.85  ? 128 TRP K C     1 
ATOM   6190 O  O     . TRP G 1 129 ? 9.263   1.377   0.791   1.00 30.00  ? 128 TRP K O     1 
ATOM   6191 C  CB    . TRP G 1 129 ? 12.246  0.613   1.392   1.00 30.01  ? 128 TRP K CB    1 
ATOM   6192 C  CG    . TRP G 1 129 ? 13.733  0.594   1.239   1.00 37.65  ? 128 TRP K CG    1 
ATOM   6193 C  CD1   . TRP G 1 129 ? 14.518  -0.493  0.985   1.00 38.21  ? 128 TRP K CD1   1 
ATOM   6194 C  CD2   . TRP G 1 129 ? 14.622  1.712   1.350   1.00 35.27  ? 128 TRP K CD2   1 
ATOM   6195 N  NE1   . TRP G 1 129 ? 15.838  -0.120  0.922   1.00 39.05  ? 128 TRP K NE1   1 
ATOM   6196 C  CE2   . TRP G 1 129 ? 15.929  1.229   1.144   1.00 35.87  ? 128 TRP K CE2   1 
ATOM   6197 C  CE3   . TRP G 1 129 ? 14.438  3.076   1.600   1.00 37.44  ? 128 TRP K CE3   1 
ATOM   6198 C  CZ2   . TRP G 1 129 ? 17.046  2.060   1.180   1.00 31.42  ? 128 TRP K CZ2   1 
ATOM   6199 C  CZ3   . TRP G 1 129 ? 15.549  3.899   1.636   1.00 37.54  ? 128 TRP K CZ3   1 
ATOM   6200 C  CH2   . TRP G 1 129 ? 16.836  3.388   1.427   1.00 34.04  ? 128 TRP K CH2   1 
ATOM   6201 N  N     . ASN G 1 130 ? 9.573   -0.740  0.057   1.00 30.80  ? 129 ASN K N     1 
ATOM   6202 C  CA    . ASN G 1 130 ? 8.222   -1.191  0.369   1.00 33.13  ? 129 ASN K CA    1 
ATOM   6203 C  C     . ASN G 1 130 ? 8.121   -2.685  0.100   1.00 37.10  ? 129 ASN K C     1 
ATOM   6204 O  O     . ASN G 1 130 ? 8.782   -3.211  -0.801  1.00 33.65  ? 129 ASN K O     1 
ATOM   6205 C  CB    . ASN G 1 130 ? 7.166   -0.438  -0.450  1.00 34.42  ? 129 ASN K CB    1 
ATOM   6206 C  CG    . ASN G 1 130 ? 5.835   -0.351  0.265   1.00 36.20  ? 129 ASN K CG    1 
ATOM   6207 O  OD1   . ASN G 1 130 ? 4.975   -1.215  0.107   1.00 32.37  ? 129 ASN K OD1   1 
ATOM   6208 N  ND2   . ASN G 1 130 ? 5.662   0.694   1.065   1.00 33.85  ? 129 ASN K ND2   1 
ATOM   6209 N  N     . LYS G 1 131 ? 7.283   -3.361  0.892   1.00 39.40  ? 130 LYS K N     1 
ATOM   6210 C  CA    . LYS G 1 131 ? 6.988   -4.770  0.655   1.00 36.57  ? 130 LYS K CA    1 
ATOM   6211 C  C     . LYS G 1 131 ? 5.999   -4.978  -0.483  1.00 31.14  ? 130 LYS K C     1 
ATOM   6212 O  O     . LYS G 1 131 ? 5.962   -6.069  -1.063  1.00 36.05  ? 130 LYS K O     1 
ATOM   6213 C  CB    . LYS G 1 131 ? 6.439   -5.427  1.925   1.00 31.51  ? 130 LYS K CB    1 
ATOM   6214 C  CG    . LYS G 1 131 ? 7.473   -5.656  3.016   1.00 38.84  ? 130 LYS K CG    1 
ATOM   6215 C  CD    . LYS G 1 131 ? 6.865   -6.367  4.216   1.00 41.86  ? 130 LYS K CD    1 
ATOM   6216 C  CE    . LYS G 1 131 ? 6.391   -7.764  3.852   1.00 47.38  ? 130 LYS K CE    1 
ATOM   6217 N  NZ    . LYS G 1 131 ? 6.716   -8.751  4.918   1.00 54.01  ? 130 LYS K NZ    1 
ATOM   6218 N  N     . ASN G 1 132 ? 5.199   -3.965  -0.813  1.00 24.35  ? 131 ASN K N     1 
ATOM   6219 C  CA    . ASN G 1 132 ? 4.200   -4.063  -1.876  1.00 31.71  ? 131 ASN K CA    1 
ATOM   6220 C  C     . ASN G 1 132 ? 4.912   -3.889  -3.212  1.00 33.20  ? 131 ASN K C     1 
ATOM   6221 O  O     . ASN G 1 132 ? 5.119   -2.774  -3.693  1.00 36.25  ? 131 ASN K O     1 
ATOM   6222 C  CB    . ASN G 1 132 ? 3.105   -3.020  -1.679  1.00 27.48  ? 131 ASN K CB    1 
ATOM   6223 C  CG    . ASN G 1 132 ? 1.925   -3.217  -2.618  1.00 33.52  ? 131 ASN K CG    1 
ATOM   6224 O  OD1   . ASN G 1 132 ? 2.040   -3.854  -3.665  1.00 33.29  ? 131 ASN K OD1   1 
ATOM   6225 N  ND2   . ASN G 1 132 ? 0.779   -2.663  -2.241  1.00 33.37  ? 131 ASN K ND2   1 
ATOM   6226 N  N     . LYS G 1 133 ? 5.287   -5.016  -3.823  1.00 35.01  ? 132 LYS K N     1 
ATOM   6227 C  CA    . LYS G 1 133 ? 5.994   -4.967  -5.099  1.00 35.28  ? 132 LYS K CA    1 
ATOM   6228 C  C     . LYS G 1 133 ? 5.122   -4.365  -6.194  1.00 39.69  ? 132 LYS K C     1 
ATOM   6229 O  O     . LYS G 1 133 ? 5.613   -3.612  -7.044  1.00 35.54  ? 132 LYS K O     1 
ATOM   6230 C  CB    . LYS G 1 133 ? 6.459   -6.368  -5.495  1.00 38.39  ? 132 LYS K CB    1 
ATOM   6231 C  CG    . LYS G 1 133 ? 7.337   -6.401  -6.736  1.00 32.17  ? 132 LYS K CG    1 
ATOM   6232 C  CD    . LYS G 1 133 ? 7.545   -7.824  -7.230  1.00 41.14  ? 132 LYS K CD    1 
ATOM   6233 C  CE    . LYS G 1 133 ? 8.576   -7.876  -8.346  1.00 51.33  ? 132 LYS K CE    1 
ATOM   6234 N  NZ    . LYS G 1 133 ? 8.725   -9.249  -8.905  1.00 55.03  ? 132 LYS K NZ    1 
ATOM   6235 N  N     . ALA G 1 134 ? 3.824   -4.684  -6.190  1.00 35.63  ? 133 ALA K N     1 
ATOM   6236 C  CA    . ALA G 1 134 ? 2.930   -4.169  -7.222  1.00 38.47  ? 133 ALA K CA    1 
ATOM   6237 C  C     . ALA G 1 134 ? 2.834   -2.650  -7.181  1.00 35.93  ? 133 ALA K C     1 
ATOM   6238 O  O     . ALA G 1 134 ? 2.669   -2.011  -8.226  1.00 37.83  ? 133 ALA K O     1 
ATOM   6239 C  CB    . ALA G 1 134 ? 1.542   -4.793  -7.075  1.00 31.40  ? 133 ALA K CB    1 
ATOM   6240 N  N     . LEU G 1 135 ? 2.934   -2.055  -5.991  1.00 34.28  ? 134 LEU K N     1 
ATOM   6241 C  CA    . LEU G 1 135 ? 2.912   -0.599  -5.891  1.00 37.14  ? 134 LEU K CA    1 
ATOM   6242 C  C     . LEU G 1 135 ? 4.168   0.012   -6.501  1.00 39.26  ? 134 LEU K C     1 
ATOM   6243 O  O     . LEU G 1 135 ? 4.094   0.996   -7.246  1.00 29.61  ? 134 LEU K O     1 
ATOM   6244 C  CB    . LEU G 1 135 ? 2.767   -0.174  -4.431  1.00 34.43  ? 134 LEU K CB    1 
ATOM   6245 C  CG    . LEU G 1 135 ? 2.945   1.326   -4.190  1.00 43.06  ? 134 LEU K CG    1 
ATOM   6246 C  CD1   . LEU G 1 135 ? 1.857   2.122   -4.900  1.00 35.90  ? 134 LEU K CD1   1 
ATOM   6247 C  CD2   . LEU G 1 135 ? 2.972   1.635   -2.704  1.00 39.45  ? 134 LEU K CD2   1 
ATOM   6248 N  N     . LEU G 1 136 ? 5.336   -0.557  -6.189  1.00 35.13  ? 135 LEU K N     1 
ATOM   6249 C  CA    . LEU G 1 136 ? 6.581   -0.036  -6.740  1.00 35.73  ? 135 LEU K CA    1 
ATOM   6250 C  C     . LEU G 1 136 ? 6.632   -0.194  -8.253  1.00 36.83  ? 135 LEU K C     1 
ATOM   6251 O  O     . LEU G 1 136 ? 7.231   0.638   -8.944  1.00 35.28  ? 135 LEU K O     1 
ATOM   6252 C  CB    . LEU G 1 136 ? 7.777   -0.733  -6.089  1.00 29.51  ? 135 LEU K CB    1 
ATOM   6253 C  CG    . LEU G 1 136 ? 7.970   -0.484  -4.591  1.00 39.34  ? 135 LEU K CG    1 
ATOM   6254 C  CD1   . LEU G 1 136 ? 9.160   -1.270  -4.061  1.00 31.12  ? 135 LEU K CD1   1 
ATOM   6255 C  CD2   . LEU G 1 136 ? 8.138   1.003   -4.309  1.00 28.29  ? 135 LEU K CD2   1 
ATOM   6256 N  N     . GLU G 1 137 ? 6.011   -1.248  -8.787  1.00 34.22  ? 136 GLU K N     1 
ATOM   6257 C  CA    . GLU G 1 137 ? 5.979   -1.426  -10.235 1.00 34.53  ? 136 GLU K CA    1 
ATOM   6258 C  C     . GLU G 1 137 ? 5.096   -0.384  -10.908 1.00 41.01  ? 136 GLU K C     1 
ATOM   6259 O  O     . GLU G 1 137 ? 5.377   0.025   -12.040 1.00 40.67  ? 136 GLU K O     1 
ATOM   6260 C  CB    . GLU G 1 137 ? 5.508   -2.838  -10.581 1.00 40.37  ? 136 GLU K CB    1 
ATOM   6261 C  CG    . GLU G 1 137 ? 6.611   -3.882  -10.509 1.00 48.18  ? 136 GLU K CG    1 
ATOM   6262 C  CD    . GLU G 1 137 ? 6.087   -5.297  -10.637 1.00 61.81  ? 136 GLU K CD    1 
ATOM   6263 O  OE1   . GLU G 1 137 ? 6.902   -6.241  -10.568 1.00 66.42  ? 136 GLU K OE1   1 
ATOM   6264 O  OE2   . GLU G 1 137 ? 4.861   -5.468  -10.802 1.00 62.93  ? 136 GLU K OE2   1 
ATOM   6265 N  N     . ILE G 1 138 ? 4.029   0.054   -10.235 1.00 37.84  ? 137 ILE K N     1 
ATOM   6266 C  CA    . ILE G 1 138 ? 3.237   1.168   -10.748 1.00 34.26  ? 137 ILE K CA    1 
ATOM   6267 C  C     . ILE G 1 138 ? 4.074   2.440   -10.771 1.00 37.78  ? 137 ILE K C     1 
ATOM   6268 O  O     . ILE G 1 138 ? 4.052   3.201   -11.747 1.00 38.65  ? 137 ILE K O     1 
ATOM   6269 C  CB    . ILE G 1 138 ? 1.958   1.349   -9.909  1.00 42.80  ? 137 ILE K CB    1 
ATOM   6270 C  CG1   . ILE G 1 138 ? 1.031   0.143   -10.073 1.00 47.85  ? 137 ILE K CG1   1 
ATOM   6271 C  CG2   . ILE G 1 138 ? 1.240   2.634   -10.296 1.00 38.62  ? 137 ILE K CG2   1 
ATOM   6272 C  CD1   . ILE G 1 138 ? -0.208  0.207   -9.206  1.00 48.02  ? 137 ILE K CD1   1 
ATOM   6273 N  N     . VAL G 1 139 ? 4.830   2.687   -9.699  1.00 35.82  ? 138 VAL K N     1 
ATOM   6274 C  CA    . VAL G 1 139 ? 5.685   3.867   -9.641  1.00 34.71  ? 138 VAL K CA    1 
ATOM   6275 C  C     . VAL G 1 139 ? 6.803   3.769   -10.673 1.00 34.66  ? 138 VAL K C     1 
ATOM   6276 O  O     . VAL G 1 139 ? 7.178   4.768   -11.299 1.00 32.38  ? 138 VAL K O     1 
ATOM   6277 C  CB    . VAL G 1 139 ? 6.240   4.048   -8.216  1.00 35.17  ? 138 VAL K CB    1 
ATOM   6278 C  CG1   . VAL G 1 139 ? 7.237   5.198   -8.166  1.00 31.86  ? 138 VAL K CG1   1 
ATOM   6279 C  CG2   . VAL G 1 139 ? 5.103   4.276   -7.229  1.00 34.38  ? 138 VAL K CG2   1 
ATOM   6280 N  N     . SER G 1 140 ? 7.344   2.565   -10.872 1.00 33.88  ? 139 SER K N     1 
ATOM   6281 C  CA    . SER G 1 140 ? 8.428   2.386   -11.834 1.00 36.88  ? 139 SER K CA    1 
ATOM   6282 C  C     . SER G 1 140 ? 7.990   2.771   -13.241 1.00 37.51  ? 139 SER K C     1 
ATOM   6283 O  O     . SER G 1 140 ? 8.745   3.415   -13.980 1.00 39.23  ? 139 SER K O     1 
ATOM   6284 C  CB    . SER G 1 140 ? 8.918   0.939   -11.804 1.00 35.03  ? 139 SER K CB    1 
ATOM   6285 O  OG    . SER G 1 140 ? 9.965   0.740   -12.737 1.00 39.73  ? 139 SER K OG    1 
ATOM   6286 N  N     . ARG G 1 141 ? 6.773   2.388   -13.630 1.00 33.47  ? 140 ARG K N     1 
ATOM   6287 C  CA    . ARG G 1 141 ? 6.278   2.745   -14.955 1.00 42.56  ? 140 ARG K CA    1 
ATOM   6288 C  C     . ARG G 1 141 ? 6.048   4.247   -15.073 1.00 41.80  ? 140 ARG K C     1 
ATOM   6289 O  O     . ARG G 1 141 ? 6.328   4.843   -16.119 1.00 44.99  ? 140 ARG K O     1 
ATOM   6290 C  CB    . ARG G 1 141 ? 4.997   1.970   -15.262 1.00 48.78  ? 140 ARG K CB    1 
ATOM   6291 C  CG    . ARG G 1 141 ? 5.183   0.459   -15.275 1.00 48.31  ? 140 ARG K CG    1 
ATOM   6292 C  CD    . ARG G 1 141 ? 3.963   -0.254  -15.840 1.00 51.79  ? 140 ARG K CD    1 
ATOM   6293 N  NE    . ARG G 1 141 ? 2.854   -0.297  -14.891 1.00 60.17  ? 140 ARG K NE    1 
ATOM   6294 C  CZ    . ARG G 1 141 ? 2.621   -1.308  -14.059 1.00 58.35  ? 140 ARG K CZ    1 
ATOM   6295 N  NH1   . ARG G 1 141 ? 3.421   -2.365  -14.055 1.00 52.18  ? 140 ARG K NH1   1 
ATOM   6296 N  NH2   . ARG G 1 141 ? 1.586   -1.262  -13.230 1.00 56.30  ? 140 ARG K NH2   1 
ATOM   6297 N  N     . TRP G 1 142 ? 5.539   4.875   -14.009 1.00 40.38  ? 141 TRP K N     1 
ATOM   6298 C  CA    . TRP G 1 142 ? 5.373   6.325   -14.018 1.00 39.23  ? 141 TRP K CA    1 
ATOM   6299 C  C     . TRP G 1 142 ? 6.716   7.031   -14.146 1.00 44.80  ? 141 TRP K C     1 
ATOM   6300 O  O     . TRP G 1 142 ? 6.847   8.004   -14.900 1.00 44.35  ? 141 TRP K O     1 
ATOM   6301 C  CB    . TRP G 1 142 ? 4.654   6.782   -12.748 1.00 33.48  ? 141 TRP K CB    1 
ATOM   6302 C  CG    . TRP G 1 142 ? 3.214   6.379   -12.675 1.00 43.91  ? 141 TRP K CG    1 
ATOM   6303 C  CD1   . TRP G 1 142 ? 2.461   5.832   -13.672 1.00 45.86  ? 141 TRP K CD1   1 
ATOM   6304 C  CD2   . TRP G 1 142 ? 2.351   6.492   -11.537 1.00 40.00  ? 141 TRP K CD2   1 
ATOM   6305 N  NE1   . TRP G 1 142 ? 1.182   5.598   -13.226 1.00 42.09  ? 141 TRP K NE1   1 
ATOM   6306 C  CE2   . TRP G 1 142 ? 1.089   5.995   -11.918 1.00 41.43  ? 141 TRP K CE2   1 
ATOM   6307 C  CE3   . TRP G 1 142 ? 2.523   6.966   -10.233 1.00 38.83  ? 141 TRP K CE3   1 
ATOM   6308 C  CZ2   . TRP G 1 142 ? 0.006   5.958   -11.042 1.00 43.86  ? 141 TRP K CZ2   1 
ATOM   6309 C  CZ3   . TRP G 1 142 ? 1.447   6.928   -9.365  1.00 42.57  ? 141 TRP K CZ3   1 
ATOM   6310 C  CH2   . TRP G 1 142 ? 0.204   6.428   -9.773  1.00 41.30  ? 141 TRP K CH2   1 
ATOM   6311 N  N     . LEU G 1 143 ? 7.728   6.554   -13.416 1.00 35.96  ? 142 LEU K N     1 
ATOM   6312 C  CA    . LEU G 1 143 ? 9.048   7.173   -13.479 1.00 37.27  ? 142 LEU K CA    1 
ATOM   6313 C  C     . LEU G 1 143 ? 9.665   7.024   -14.864 1.00 42.75  ? 142 LEU K C     1 
ATOM   6314 O  O     . LEU G 1 143 ? 10.270  7.968   -15.386 1.00 41.03  ? 142 LEU K O     1 
ATOM   6315 C  CB    . LEU G 1 143 ? 9.962   6.561   -12.417 1.00 35.04  ? 142 LEU K CB    1 
ATOM   6316 C  CG    . LEU G 1 143 ? 9.655   6.944   -10.970 1.00 35.90  ? 142 LEU K CG    1 
ATOM   6317 C  CD1   . LEU G 1 143 ? 10.546  6.182   -10.008 1.00 34.47  ? 142 LEU K CD1   1 
ATOM   6318 C  CD2   . LEU G 1 143 ? 9.834   8.433   -10.785 1.00 28.64  ? 142 LEU K CD2   1 
ATOM   6319 N  N     . ASN G 1 144 ? 9.527   5.843   -15.472 1.00 38.05  ? 143 ASN K N     1 
ATOM   6320 C  CA    . ASN G 1 144 ? 10.058  5.638   -16.815 1.00 45.43  ? 143 ASN K CA    1 
ATOM   6321 C  C     . ASN G 1 144 ? 9.370   6.549   -17.821 1.00 46.40  ? 143 ASN K C     1 
ATOM   6322 O  O     . ASN G 1 144 ? 10.016  7.089   -18.728 1.00 49.34  ? 143 ASN K O     1 
ATOM   6323 C  CB    . ASN G 1 144 ? 9.902   4.173   -17.224 1.00 45.24  ? 143 ASN K CB    1 
ATOM   6324 C  CG    . ASN G 1 144 ? 11.091  3.328   -16.821 1.00 45.22  ? 143 ASN K CG    1 
ATOM   6325 O  OD1   . ASN G 1 144 ? 12.233  3.786   -16.857 1.00 50.49  ? 143 ASN K OD1   1 
ATOM   6326 N  ND2   . ASN G 1 144 ? 10.831  2.085   -16.432 1.00 44.42  ? 143 ASN K ND2   1 
ATOM   6327 N  N     . ASN G 1 145 ? 8.056   6.734   -17.675 1.00 50.82  ? 144 ASN K N     1 
ATOM   6328 C  CA    . ASN G 1 145 ? 7.333   7.648   -18.551 1.00 48.27  ? 144 ASN K CA    1 
ATOM   6329 C  C     . ASN G 1 145 ? 7.800   9.085   -18.364 1.00 48.30  ? 144 ASN K C     1 
ATOM   6330 O  O     . ASN G 1 145 ? 7.780   9.875   -19.314 1.00 48.72  ? 144 ASN K O     1 
ATOM   6331 C  CB    . ASN G 1 145 ? 5.830   7.530   -18.294 1.00 52.43  ? 144 ASN K CB    1 
ATOM   6332 C  CG    . ASN G 1 145 ? 5.045   8.690   -18.870 1.00 68.15  ? 144 ASN K CG    1 
ATOM   6333 O  OD1   . ASN G 1 145 ? 5.044   8.913   -20.079 1.00 76.20  ? 144 ASN K OD1   1 
ATOM   6334 N  ND2   . ASN G 1 145 ? 4.366   9.434   -18.003 1.00 64.24  ? 144 ASN K ND2   1 
ATOM   6335 N  N     . LEU G 1 146 ? 8.232   9.437   -17.155 1.00 47.09  ? 145 LEU K N     1 
ATOM   6336 C  CA    . LEU G 1 146 ? 8.771   10.757  -16.864 1.00 48.95  ? 145 LEU K CA    1 
ATOM   6337 C  C     . LEU G 1 146 ? 10.258  10.866  -17.176 1.00 49.77  ? 145 LEU K C     1 
ATOM   6338 O  O     . LEU G 1 146 ? 10.886  11.861  -16.800 1.00 51.80  ? 145 LEU K O     1 
ATOM   6339 C  CB    . LEU G 1 146 ? 8.519   11.116  -15.397 1.00 44.49  ? 145 LEU K CB    1 
ATOM   6340 C  CG    . LEU G 1 146 ? 7.056   11.308  -14.997 1.00 52.14  ? 145 LEU K CG    1 
ATOM   6341 C  CD1   . LEU G 1 146 ? 6.919   11.430  -13.488 1.00 49.74  ? 145 LEU K CD1   1 
ATOM   6342 C  CD2   . LEU G 1 146 ? 6.473   12.530  -15.689 1.00 52.34  ? 145 LEU K CD2   1 
ATOM   6343 N  N     . GLY G 1 147 ? 10.833  9.871   -17.846 1.00 50.93  ? 146 GLY K N     1 
ATOM   6344 C  CA    . GLY G 1 147 ? 12.242  9.916   -18.190 1.00 42.81  ? 146 GLY K CA    1 
ATOM   6345 C  C     . GLY G 1 147 ? 13.181  9.699   -17.026 1.00 51.73  ? 146 GLY K C     1 
ATOM   6346 O  O     . GLY G 1 147 ? 14.281  10.259  -17.014 1.00 59.32  ? 146 GLY K O     1 
ATOM   6347 N  N     . VAL G 1 148 ? 12.777  8.899   -16.043 1.00 49.54  ? 147 VAL K N     1 
ATOM   6348 C  CA    . VAL G 1 148 ? 13.583  8.620   -14.860 1.00 40.18  ? 147 VAL K CA    1 
ATOM   6349 C  C     . VAL G 1 148 ? 13.807  7.116   -14.803 1.00 45.08  ? 147 VAL K C     1 
ATOM   6350 O  O     . VAL G 1 148 ? 12.884  6.354   -14.485 1.00 45.09  ? 147 VAL K O     1 
ATOM   6351 C  CB    . VAL G 1 148 ? 12.916  9.130   -13.576 1.00 45.39  ? 147 VAL K CB    1 
ATOM   6352 C  CG1   . VAL G 1 148 ? 13.786  8.822   -12.372 1.00 42.19  ? 147 VAL K CG1   1 
ATOM   6353 C  CG2   . VAL G 1 148 ? 12.649  10.626  -13.674 1.00 48.06  ? 147 VAL K CG2   1 
ATOM   6354 N  N     . ARG G 1 149 ? 15.028  6.687   -15.111 1.00 41.46  ? 148 ARG K N     1 
ATOM   6355 C  CA    . ARG G 1 149 ? 15.350  5.267   -15.123 1.00 40.68  ? 148 ARG K CA    1 
ATOM   6356 C  C     . ARG G 1 149 ? 15.450  4.723   -13.702 1.00 37.77  ? 148 ARG K C     1 
ATOM   6357 O  O     . ARG G 1 149 ? 15.870  5.417   -12.773 1.00 35.19  ? 148 ARG K O     1 
ATOM   6358 C  CB    . ARG G 1 149 ? 16.655  5.028   -15.880 1.00 42.38  ? 148 ARG K CB    1 
ATOM   6359 C  CG    . ARG G 1 149 ? 16.504  5.148   -17.386 1.00 51.61  ? 148 ARG K CG    1 
ATOM   6360 C  CD    . ARG G 1 149 ? 17.834  5.375   -18.083 1.00 55.90  ? 148 ARG K CD    1 
ATOM   6361 N  NE    . ARG G 1 149 ? 18.331  6.732   -17.879 1.00 60.84  ? 148 ARG K NE    1 
ATOM   6362 C  CZ    . ARG G 1 149 ? 19.478  7.190   -18.372 1.00 60.27  ? 148 ARG K CZ    1 
ATOM   6363 N  NH1   . ARG G 1 149 ? 20.250  6.397   -19.102 1.00 58.02  ? 148 ARG K NH1   1 
ATOM   6364 N  NH2   . ARG G 1 149 ? 19.851  8.440   -18.137 1.00 51.43  ? 148 ARG K NH2   1 
ATOM   6365 N  N     . ASN G 1 150 ? 15.063  3.459   -13.543 1.00 37.86  ? 149 ASN K N     1 
ATOM   6366 C  CA    . ASN G 1 150 ? 14.962  2.861   -12.220 1.00 35.07  ? 149 ASN K CA    1 
ATOM   6367 C  C     . ASN G 1 150 ? 14.961  1.345   -12.347 1.00 36.17  ? 149 ASN K C     1 
ATOM   6368 O  O     . ASN G 1 150 ? 14.728  0.793   -13.425 1.00 39.92  ? 149 ASN K O     1 
ATOM   6369 C  CB    . ASN G 1 150 ? 13.698  3.333   -11.497 1.00 34.33  ? 149 ASN K CB    1 
ATOM   6370 C  CG    . ASN G 1 150 ? 12.433  2.918   -12.219 1.00 38.11  ? 149 ASN K CG    1 
ATOM   6371 O  OD1   . ASN G 1 150 ? 11.927  1.815   -12.019 1.00 37.07  ? 149 ASN K OD1   1 
ATOM   6372 N  ND2   . ASN G 1 150 ? 11.922  3.796   -13.075 1.00 32.77  ? 149 ASN K ND2   1 
ATOM   6373 N  N     . THR G 1 151 ? 15.223  0.680   -11.222 1.00 34.74  ? 150 THR K N     1 
ATOM   6374 C  CA    . THR G 1 151 ? 15.168  -0.772  -11.134 1.00 37.67  ? 150 THR K CA    1 
ATOM   6375 C  C     . THR G 1 151 ? 14.482  -1.169  -9.834  1.00 34.06  ? 150 THR K C     1 
ATOM   6376 O  O     . THR G 1 151 ? 14.368  -0.373  -8.899  1.00 34.89  ? 150 THR K O     1 
ATOM   6377 C  CB    . THR G 1 151 ? 16.564  -1.412  -11.195 1.00 40.62  ? 150 THR K CB    1 
ATOM   6378 O  OG1   . THR G 1 151 ? 17.388  -0.867  -10.157 1.00 44.01  ? 150 THR K OG1   1 
ATOM   6379 C  CG2   . THR G 1 151 ? 17.218  -1.165  -12.549 1.00 40.28  ? 150 THR K CG2   1 
ATOM   6380 N  N     . ILE G 1 152 ? 14.028  -2.420  -9.783  1.00 34.93  ? 151 ILE K N     1 
ATOM   6381 C  CA    . ILE G 1 152 ? 13.364  -2.976  -8.610  1.00 37.18  ? 151 ILE K CA    1 
ATOM   6382 C  C     . ILE G 1 152 ? 13.972  -4.338  -8.308  1.00 38.17  ? 151 ILE K C     1 
ATOM   6383 O  O     . ILE G 1 152 ? 14.027  -5.206  -9.186  1.00 39.86  ? 151 ILE K O     1 
ATOM   6384 C  CB    . ILE G 1 152 ? 11.841  -3.102  -8.814  1.00 41.48  ? 151 ILE K CB    1 
ATOM   6385 C  CG1   . ILE G 1 152 ? 11.183  -1.721  -8.859  1.00 34.16  ? 151 ILE K CG1   1 
ATOM   6386 C  CG2   . ILE G 1 152 ? 11.219  -3.954  -7.715  1.00 34.55  ? 151 ILE K CG2   1 
ATOM   6387 C  CD1   . ILE G 1 152 ? 9.698   -1.763  -9.157  1.00 33.35  ? 151 ILE K CD1   1 
ATOM   6388 N  N     . HIS G 1 153 ? 14.431  -4.522  -7.071  1.00 34.78  ? 152 HIS K N     1 
ATOM   6389 C  CA    A HIS G 1 153 ? 14.875  -5.834  -6.637  0.55 41.78  ? 152 HIS K CA    1 
ATOM   6390 C  CA    B HIS G 1 153 ? 15.010  -5.769  -6.587  0.45 41.83  ? 152 HIS K CA    1 
ATOM   6391 C  C     . HIS G 1 153 ? 14.507  -6.030  -5.175  1.00 39.54  ? 152 HIS K C     1 
ATOM   6392 O  O     . HIS G 1 153 ? 14.032  -5.117  -4.493  1.00 38.92  ? 152 HIS K O     1 
ATOM   6393 C  CB    A HIS G 1 153 ? 16.380  -6.035  -6.868  0.55 37.71  ? 152 HIS K CB    1 
ATOM   6394 C  CB    B HIS G 1 153 ? 16.547  -5.730  -6.550  0.45 37.41  ? 152 HIS K CB    1 
ATOM   6395 C  CG    A HIS G 1 153 ? 17.248  -5.070  -6.123  0.55 36.38  ? 152 HIS K CG    1 
ATOM   6396 C  CG    B HIS G 1 153 ? 17.194  -5.543  -7.886  0.45 41.62  ? 152 HIS K CG    1 
ATOM   6397 N  ND1   A HIS G 1 153 ? 17.839  -5.381  -4.917  0.55 45.00  ? 152 HIS K ND1   1 
ATOM   6398 N  ND1   B HIS G 1 153 ? 17.215  -4.331  -8.541  0.45 43.13  ? 152 HIS K ND1   1 
ATOM   6399 C  CD2   A HIS G 1 153 ? 17.637  -3.808  -6.419  0.55 37.97  ? 152 HIS K CD2   1 
ATOM   6400 C  CD2   B HIS G 1 153 ? 17.871  -6.409  -8.676  0.45 43.01  ? 152 HIS K CD2   1 
ATOM   6401 C  CE1   A HIS G 1 153 ? 18.550  -4.349  -4.499  0.55 40.98  ? 152 HIS K CE1   1 
ATOM   6402 C  CE1   B HIS G 1 153 ? 17.864  -4.462  -9.684  0.45 37.60  ? 152 HIS K CE1   1 
ATOM   6403 N  NE2   A HIS G 1 153 ? 18.445  -3.382  -5.392  0.55 42.65  ? 152 HIS K NE2   1 
ATOM   6404 N  NE2   B HIS G 1 153 ? 18.272  -5.714  -9.790  0.45 41.81  ? 152 HIS K NE2   1 
ATOM   6405 N  N     . LEU G 1 154 ? 14.674  -7.267  -4.715  1.00 38.14  ? 153 LEU K N     1 
ATOM   6406 C  CA    . LEU G 1 154 ? 14.390  -7.609  -3.326  1.00 37.02  ? 153 LEU K CA    1 
ATOM   6407 C  C     . LEU G 1 154 ? 15.597  -7.211  -2.486  1.00 40.05  ? 153 LEU K C     1 
ATOM   6408 O  O     . LEU G 1 154 ? 16.655  -7.844  -2.566  1.00 41.52  ? 153 LEU K O     1 
ATOM   6409 C  CB    . LEU G 1 154 ? 14.084  -9.096  -3.181  1.00 40.96  ? 153 LEU K CB    1 
ATOM   6410 C  CG    . LEU G 1 154 ? 13.631  -9.514  -1.780  1.00 44.42  ? 153 LEU K CG    1 
ATOM   6411 C  CD1   . LEU G 1 154 ? 12.146  -9.242  -1.589  1.00 45.77  ? 153 LEU K CD1   1 
ATOM   6412 C  CD2   . LEU G 1 154 ? 13.953  -10.972 -1.512  1.00 46.57  ? 153 LEU K CD2   1 
ATOM   6413 N  N     . ASP G 1 155 ? 15.443  -6.159  -1.684  1.00 40.77  ? 154 ASP K N     1 
ATOM   6414 C  CA    . ASP G 1 155 ? 16.559  -5.603  -0.930  1.00 39.10  ? 154 ASP K CA    1 
ATOM   6415 C  C     . ASP G 1 155 ? 16.772  -6.305  0.405   1.00 42.66  ? 154 ASP K C     1 
ATOM   6416 O  O     . ASP G 1 155 ? 17.916  -6.564  0.792   1.00 40.53  ? 154 ASP K O     1 
ATOM   6417 C  CB    . ASP G 1 155 ? 16.336  -4.107  -0.697  1.00 37.19  ? 154 ASP K CB    1 
ATOM   6418 C  CG    . ASP G 1 155 ? 17.620  -3.367  -0.381  1.00 40.31  ? 154 ASP K CG    1 
ATOM   6419 O  OD1   . ASP G 1 155 ? 18.653  -3.666  -1.015  1.00 43.49  ? 154 ASP K OD1   1 
ATOM   6420 O  OD2   . ASP G 1 155 ? 17.595  -2.482  0.500   1.00 45.92  ? 154 ASP K OD2   1 
ATOM   6421 N  N     . ASP G 1 156 ? 15.693  -6.619  1.116   1.00 42.30  ? 155 ASP K N     1 
ATOM   6422 C  CA    . ASP G 1 156 ? 15.764  -7.188  2.460   1.00 40.48  ? 155 ASP K CA    1 
ATOM   6423 C  C     . ASP G 1 156 ? 15.144  -8.582  2.422   1.00 47.29  ? 155 ASP K C     1 
ATOM   6424 O  O     . ASP G 1 156 ? 13.917  -8.724  2.441   1.00 41.95  ? 155 ASP K O     1 
ATOM   6425 C  CB    . ASP G 1 156 ? 15.051  -6.286  3.466   1.00 37.84  ? 155 ASP K CB    1 
ATOM   6426 C  CG    . ASP G 1 156 ? 15.325  -6.679  4.906   1.00 41.84  ? 155 ASP K CG    1 
ATOM   6427 O  OD1   . ASP G 1 156 ? 15.863  -7.781  5.140   1.00 45.20  ? 155 ASP K OD1   1 
ATOM   6428 O  OD2   . ASP G 1 156 ? 14.998  -5.882  5.810   1.00 42.25  ? 155 ASP K OD2   1 
ATOM   6429 N  N     . HIS G 1 157 ? 15.994  -9.610  2.377   1.00 41.58  ? 156 HIS K N     1 
ATOM   6430 C  CA    . HIS G 1 157 ? 15.508  -10.984 2.430   1.00 43.80  ? 156 HIS K CA    1 
ATOM   6431 C  C     . HIS G 1 157 ? 14.982  -11.368 3.806   1.00 46.43  ? 156 HIS K C     1 
ATOM   6432 O  O     . HIS G 1 157 ? 14.300  -12.391 3.925   1.00 47.99  ? 156 HIS K O     1 
ATOM   6433 C  CB    . HIS G 1 157 ? 16.616  -11.952 2.009   1.00 37.35  ? 156 HIS K CB    1 
ATOM   6434 C  CG    . HIS G 1 157 ? 16.871  -11.975 0.534   1.00 41.44  ? 156 HIS K CG    1 
ATOM   6435 N  ND1   . HIS G 1 157 ? 17.467  -10.929 -0.136  1.00 44.94  ? 156 HIS K ND1   1 
ATOM   6436 C  CD2   . HIS G 1 157 ? 16.608  -12.919 -0.401  1.00 40.70  ? 156 HIS K CD2   1 
ATOM   6437 C  CE1   . HIS G 1 157 ? 17.560  -11.226 -1.420  1.00 43.29  ? 156 HIS K CE1   1 
ATOM   6438 N  NE2   . HIS G 1 157 ? 17.046  -12.428 -1.608  1.00 45.14  ? 156 HIS K NE2   1 
ATOM   6439 N  N     . ARG G 1 158 ? 15.276  -10.580 4.843   1.00 42.48  ? 157 ARG K N     1 
ATOM   6440 C  CA    . ARG G 1 158 ? 14.761  -10.890 6.172   1.00 42.54  ? 157 ARG K CA    1 
ATOM   6441 C  C     . ARG G 1 158 ? 13.277  -10.566 6.291   1.00 46.34  ? 157 ARG K C     1 
ATOM   6442 O  O     . ARG G 1 158 ? 12.574  -11.183 7.100   1.00 45.94  ? 157 ARG K O     1 
ATOM   6443 C  CB    . ARG G 1 158 ? 15.546  -10.124 7.237   1.00 40.95  ? 157 ARG K CB    1 
ATOM   6444 C  CG    . ARG G 1 158 ? 17.038  -10.413 7.257   1.00 45.61  ? 157 ARG K CG    1 
ATOM   6445 C  CD    . ARG G 1 158 ? 17.776  -9.367  8.077   1.00 39.51  ? 157 ARG K CD    1 
ATOM   6446 N  NE    . ARG G 1 158 ? 17.610  -8.030  7.514   1.00 42.28  ? 157 ARG K NE    1 
ATOM   6447 C  CZ    . ARG G 1 158 ? 18.077  -6.917  8.071   1.00 46.14  ? 157 ARG K CZ    1 
ATOM   6448 N  NH1   . ARG G 1 158 ? 18.742  -6.973  9.217   1.00 40.90  ? 157 ARG K NH1   1 
ATOM   6449 N  NH2   . ARG G 1 158 ? 17.875  -5.746  7.482   1.00 38.65  ? 157 ARG K NH2   1 
ATOM   6450 N  N     . HIS G 1 159 ? 12.781  -9.611  5.499   1.00 41.70  ? 158 HIS K N     1 
ATOM   6451 C  CA    . HIS G 1 159 ? 11.411  -9.137  5.640   1.00 43.94  ? 158 HIS K CA    1 
ATOM   6452 C  C     . HIS G 1 159 ? 10.666  -9.032  4.314   1.00 43.02  ? 158 HIS K C     1 
ATOM   6453 O  O     . HIS G 1 159 ? 9.524   -8.559  4.300   1.00 44.27  ? 158 HIS K O     1 
ATOM   6454 C  CB    . HIS G 1 159 ? 11.390  -7.776  6.346   1.00 43.28  ? 158 HIS K CB    1 
ATOM   6455 C  CG    . HIS G 1 159 ? 11.995  -7.796  7.715   1.00 47.12  ? 158 HIS K CG    1 
ATOM   6456 N  ND1   . HIS G 1 159 ? 13.289  -7.392  7.962   1.00 49.07  ? 158 HIS K ND1   1 
ATOM   6457 C  CD2   . HIS G 1 159 ? 11.483  -8.173  8.910   1.00 40.66  ? 158 HIS K CD2   1 
ATOM   6458 C  CE1   . HIS G 1 159 ? 13.548  -7.518  9.252   1.00 43.24  ? 158 HIS K CE1   1 
ATOM   6459 N  NE2   . HIS G 1 159 ? 12.468  -7.990  9.849   1.00 43.96  ? 158 HIS K NE2   1 
ATOM   6460 N  N     . GLY G 1 160 ? 11.271  -9.454  3.206   1.00 42.97  ? 159 GLY K N     1 
ATOM   6461 C  CA    . GLY G 1 160 ? 10.610  -9.344  1.919   1.00 38.75  ? 159 GLY K CA    1 
ATOM   6462 C  C     . GLY G 1 160 ? 10.373  -7.923  1.463   1.00 37.51  ? 159 GLY K C     1 
ATOM   6463 O  O     . GLY G 1 160 ? 9.345   -7.643  0.839   1.00 38.78  ? 159 GLY K O     1 
ATOM   6464 N  N     . VAL G 1 161 ? 11.297  -7.016  1.761   1.00 38.20  ? 160 VAL K N     1 
ATOM   6465 C  CA    . VAL G 1 161 ? 11.164  -5.606  1.416   1.00 39.50  ? 160 VAL K CA    1 
ATOM   6466 C  C     . VAL G 1 161 ? 11.881  -5.363  0.095   1.00 35.04  ? 160 VAL K C     1 
ATOM   6467 O  O     . VAL G 1 161 ? 13.098  -5.563  -0.007  1.00 37.57  ? 160 VAL K O     1 
ATOM   6468 C  CB    . VAL G 1 161 ? 11.729  -4.701  2.523   1.00 39.37  ? 160 VAL K CB    1 
ATOM   6469 C  CG1   . VAL G 1 161 ? 11.722  -3.248  2.075   1.00 33.40  ? 160 VAL K CG1   1 
ATOM   6470 C  CG2   . VAL G 1 161 ? 10.932  -4.873  3.807   1.00 36.89  ? 160 VAL K CG2   1 
ATOM   6471 N  N     . TYR G 1 162 ? 11.130  -4.938  -0.915  1.00 32.66  ? 161 TYR K N     1 
ATOM   6472 C  CA    . TYR G 1 162 ? 11.717  -4.553  -2.187  1.00 34.77  ? 161 TYR K CA    1 
ATOM   6473 C  C     . TYR G 1 162 ? 12.205  -3.109  -2.129  1.00 37.10  ? 161 TYR K C     1 
ATOM   6474 O  O     . TYR G 1 162 ? 11.816  -2.327  -1.255  1.00 31.84  ? 161 TYR K O     1 
ATOM   6475 C  CB    . TYR G 1 162 ? 10.705  -4.709  -3.324  1.00 29.48  ? 161 TYR K CB    1 
ATOM   6476 C  CG    . TYR G 1 162 ? 10.296  -6.137  -3.609  1.00 38.72  ? 161 TYR K CG    1 
ATOM   6477 C  CD1   . TYR G 1 162 ? 9.356   -6.783  -2.816  1.00 31.90  ? 161 TYR K CD1   1 
ATOM   6478 C  CD2   . TYR G 1 162 ? 10.844  -6.836  -4.678  1.00 36.18  ? 161 TYR K CD2   1 
ATOM   6479 C  CE1   . TYR G 1 162 ? 8.978   -8.087  -3.075  1.00 35.69  ? 161 TYR K CE1   1 
ATOM   6480 C  CE2   . TYR G 1 162 ? 10.472  -8.140  -4.945  1.00 35.08  ? 161 TYR K CE2   1 
ATOM   6481 C  CZ    . TYR G 1 162 ? 9.538   -8.760  -4.141  1.00 41.34  ? 161 TYR K CZ    1 
ATOM   6482 O  OH    . TYR G 1 162 ? 9.165   -10.058 -4.403  1.00 44.19  ? 161 TYR K OH    1 
ATOM   6483 N  N     . VAL G 1 163 ? 13.067  -2.756  -3.078  1.00 36.36  ? 162 VAL K N     1 
ATOM   6484 C  CA    . VAL G 1 163 ? 13.561  -1.392  -3.210  1.00 37.07  ? 162 VAL K CA    1 
ATOM   6485 C  C     . VAL G 1 163 ? 13.423  -0.965  -4.665  1.00 34.87  ? 162 VAL K C     1 
ATOM   6486 O  O     . VAL G 1 163 ? 13.719  -1.743  -5.580  1.00 35.60  ? 162 VAL K O     1 
ATOM   6487 C  CB    . VAL G 1 163 ? 15.022  -1.250  -2.729  1.00 40.54  ? 162 VAL K CB    1 
ATOM   6488 C  CG1   . VAL G 1 163 ? 15.975  -2.071  -3.591  1.00 32.65  ? 162 VAL K CG1   1 
ATOM   6489 C  CG2   . VAL G 1 163 ? 15.438  0.215   -2.710  1.00 36.29  ? 162 VAL K CG2   1 
ATOM   6490 N  N     . LEU G 1 164 ? 12.936  0.253   -4.875  1.00 30.54  ? 163 LEU K N     1 
ATOM   6491 C  CA    . LEU G 1 164 ? 12.975  0.903   -6.178  1.00 30.17  ? 163 LEU K CA    1 
ATOM   6492 C  C     . LEU G 1 164 ? 14.170  1.846   -6.160  1.00 36.31  ? 163 LEU K C     1 
ATOM   6493 O  O     . LEU G 1 164 ? 14.184  2.825   -5.407  1.00 34.50  ? 163 LEU K O     1 
ATOM   6494 C  CB    . LEU G 1 164 ? 11.673  1.649   -6.468  1.00 29.71  ? 163 LEU K CB    1 
ATOM   6495 C  CG    . LEU G 1 164 ? 11.449  2.198   -7.883  1.00 37.16  ? 163 LEU K CG    1 
ATOM   6496 C  CD1   . LEU G 1 164 ? 9.964   2.368   -8.156  1.00 33.10  ? 163 LEU K CD1   1 
ATOM   6497 C  CD2   . LEU G 1 164 ? 12.170  3.522   -8.105  1.00 40.04  ? 163 LEU K CD2   1 
ATOM   6498 N  N     . ASN G 1 165 ? 15.176  1.545   -6.972  1.00 34.04  ? 164 ASN K N     1 
ATOM   6499 C  CA    . ASN G 1 165 ? 16.397  2.339   -7.028  1.00 35.01  ? 164 ASN K CA    1 
ATOM   6500 C  C     . ASN G 1 165 ? 16.324  3.258   -8.240  1.00 35.02  ? 164 ASN K C     1 
ATOM   6501 O  O     . ASN G 1 165 ? 16.336  2.792   -9.383  1.00 38.55  ? 164 ASN K O     1 
ATOM   6502 C  CB    . ASN G 1 165 ? 17.633  1.445   -7.091  1.00 30.95  ? 164 ASN K CB    1 
ATOM   6503 C  CG    . ASN G 1 165 ? 18.921  2.229   -6.940  1.00 39.44  ? 164 ASN K CG    1 
ATOM   6504 O  OD1   . ASN G 1 165 ? 19.313  2.591   -5.831  1.00 44.38  ? 164 ASN K OD1   1 
ATOM   6505 N  ND2   . ASN G 1 165 ? 19.584  2.502   -8.057  1.00 34.39  ? 164 ASN K ND2   1 
ATOM   6506 N  N     . ILE G 1 166 ? 16.240  4.558   -7.987  1.00 33.99  ? 165 ILE K N     1 
ATOM   6507 C  CA    . ILE G 1 166 ? 16.251  5.548   -9.056  1.00 37.05  ? 165 ILE K CA    1 
ATOM   6508 C  C     . ILE G 1 166 ? 17.688  5.761   -9.508  1.00 43.70  ? 165 ILE K C     1 
ATOM   6509 O  O     . ILE G 1 166 ? 18.571  6.059   -8.694  1.00 48.63  ? 165 ILE K O     1 
ATOM   6510 C  CB    . ILE G 1 166 ? 15.612  6.862   -8.583  1.00 41.42  ? 165 ILE K CB    1 
ATOM   6511 C  CG1   . ILE G 1 166 ? 14.112  6.665   -8.356  1.00 42.18  ? 165 ILE K CG1   1 
ATOM   6512 C  CG2   . ILE G 1 166 ? 15.880  7.978   -9.581  1.00 42.35  ? 165 ILE K CG2   1 
ATOM   6513 C  CD1   . ILE G 1 166 ? 13.589  7.359   -7.123  1.00 38.27  ? 165 ILE K CD1   1 
ATOM   6514 N  N     . SER G 1 167 ? 17.928  5.595   -10.807 1.00 40.86  ? 166 SER K N     1 
ATOM   6515 C  CA    . SER G 1 167 ? 19.277  5.725   -11.342 1.00 45.77  ? 166 SER K CA    1 
ATOM   6516 C  C     . SER G 1 167 ? 19.803  7.138   -11.130 1.00 47.18  ? 166 SER K C     1 
ATOM   6517 O  O     . SER G 1 167 ? 19.127  8.121   -11.448 1.00 44.70  ? 166 SER K O     1 
ATOM   6518 C  CB    . SER G 1 167 ? 19.290  5.372   -12.830 1.00 48.88  ? 166 SER K CB    1 
ATOM   6519 O  OG    . SER G 1 167 ? 20.601  5.453   -13.360 1.00 56.24  ? 166 SER K OG    1 
ATOM   6520 N  N     . LEU G 1 168 ? 21.019  7.236   -10.588 1.00 43.43  ? 167 LEU K N     1 
ATOM   6521 C  CA    . LEU G 1 168 ? 21.637  8.534   -10.350 1.00 46.68  ? 167 LEU K CA    1 
ATOM   6522 C  C     . LEU G 1 168 ? 21.962  9.277   -11.639 1.00 47.19  ? 167 LEU K C     1 
ATOM   6523 O  O     . LEU G 1 168 ? 22.257  10.476  -11.582 1.00 53.53  ? 167 LEU K O     1 
ATOM   6524 C  CB    . LEU G 1 168 ? 22.903  8.365   -9.510  1.00 45.67  ? 167 LEU K CB    1 
ATOM   6525 C  CG    . LEU G 1 168 ? 22.675  7.823   -8.097  1.00 48.88  ? 167 LEU K CG    1 
ATOM   6526 C  CD1   . LEU G 1 168 ? 23.987  7.718   -7.336  1.00 41.70  ? 167 LEU K CD1   1 
ATOM   6527 C  CD2   . LEU G 1 168 ? 21.677  8.693   -7.344  1.00 45.38  ? 167 LEU K CD2   1 
ATOM   6528 N  N     . ARG G 1 169 ? 21.919  8.601   -12.791 1.00 45.86  ? 168 ARG K N     1 
ATOM   6529 C  CA    . ARG G 1 169 ? 22.043  9.300   -14.065 1.00 49.62  ? 168 ARG K CA    1 
ATOM   6530 C  C     . ARG G 1 169 ? 20.915  10.305  -14.255 1.00 56.63  ? 168 ARG K C     1 
ATOM   6531 O  O     . ARG G 1 169 ? 21.096  11.323  -14.934 1.00 49.19  ? 168 ARG K O     1 
ATOM   6532 C  CB    . ARG G 1 169 ? 22.051  8.294   -15.216 1.00 51.65  ? 168 ARG K CB    1 
ATOM   6533 C  CG    . ARG G 1 169 ? 23.218  7.322   -15.193 1.00 52.95  ? 168 ARG K CG    1 
ATOM   6534 C  CD    . ARG G 1 169 ? 23.031  6.228   -16.232 1.00 61.23  ? 168 ARG K CD    1 
ATOM   6535 N  NE    . ARG G 1 169 ? 21.733  5.572   -16.097 1.00 65.56  ? 168 ARG K NE    1 
ATOM   6536 C  CZ    . ARG G 1 169 ? 21.433  4.391   -16.627 1.00 65.69  ? 168 ARG K CZ    1 
ATOM   6537 N  NH1   . ARG G 1 169 ? 22.339  3.729   -17.334 1.00 67.88  ? 168 ARG K NH1   1 
ATOM   6538 N  NH2   . ARG G 1 169 ? 20.227  3.869   -16.451 1.00 63.81  ? 168 ARG K NH2   1 
ATOM   6539 N  N     . ASP G 1 170 ? 19.751  10.038  -13.666 1.00 49.07  ? 169 ASP K N     1 
ATOM   6540 C  CA    . ASP G 1 170 ? 18.598  10.926  -13.734 1.00 45.96  ? 169 ASP K CA    1 
ATOM   6541 C  C     . ASP G 1 170 ? 18.331  11.605  -12.393 1.00 49.95  ? 169 ASP K C     1 
ATOM   6542 O  O     . ASP G 1 170 ? 17.178  11.858  -12.038 1.00 50.57  ? 169 ASP K O     1 
ATOM   6543 C  CB    . ASP G 1 170 ? 17.364  10.154  -14.198 1.00 56.42  ? 169 ASP K CB    1 
ATOM   6544 C  CG    . ASP G 1 170 ? 17.576  9.470   -15.536 1.00 57.92  ? 169 ASP K CG    1 
ATOM   6545 O  OD1   . ASP G 1 170 ? 18.196  10.085  -16.428 1.00 60.39  ? 169 ASP K OD1   1 
ATOM   6546 O  OD2   . ASP G 1 170 ? 17.127  8.315   -15.692 1.00 52.04  ? 169 ASP K OD2   1 
ATOM   6547 N  N     . ARG G 1 171 ? 19.393  11.902  -11.639 1.00 45.35  ? 170 ARG K N     1 
ATOM   6548 C  CA    . ARG G 1 171 ? 19.226  12.490  -10.313 1.00 45.71  ? 170 ARG K CA    1 
ATOM   6549 C  C     . ARG G 1 171 ? 18.591  13.873  -10.396 1.00 55.56  ? 170 ARG K C     1 
ATOM   6550 O  O     . ARG G 1 171 ? 17.606  14.157  -9.705  1.00 50.65  ? 170 ARG K O     1 
ATOM   6551 C  CB    . ARG G 1 171 ? 20.572  12.567  -9.591  1.00 48.68  ? 170 ARG K CB    1 
ATOM   6552 C  CG    . ARG G 1 171 ? 20.600  13.615  -8.485  1.00 49.90  ? 170 ARG K CG    1 
ATOM   6553 C  CD    . ARG G 1 171 ? 21.991  13.814  -7.906  1.00 51.31  ? 170 ARG K CD    1 
ATOM   6554 N  NE    . ARG G 1 171 ? 22.191  13.060  -6.672  1.00 55.92  ? 170 ARG K NE    1 
ATOM   6555 C  CZ    . ARG G 1 171 ? 23.062  12.066  -6.534  1.00 59.14  ? 170 ARG K CZ    1 
ATOM   6556 N  NH1   . ARG G 1 171 ? 23.825  11.704  -7.556  1.00 69.15  ? 170 ARG K NH1   1 
ATOM   6557 N  NH2   . ARG G 1 171 ? 23.175  11.439  -5.372  1.00 56.32  ? 170 ARG K NH2   1 
ATOM   6558 N  N     . ILE G 1 172 ? 19.146  14.752  -11.235 1.00 48.62  ? 171 ILE K N     1 
ATOM   6559 C  CA    . ILE G 1 172 ? 18.637  16.119  -11.296 1.00 53.82  ? 171 ILE K CA    1 
ATOM   6560 C  C     . ILE G 1 172 ? 17.223  16.141  -11.859 1.00 50.81  ? 171 ILE K C     1 
ATOM   6561 O  O     . ILE G 1 172 ? 16.402  16.977  -11.459 1.00 51.56  ? 171 ILE K O     1 
ATOM   6562 C  CB    . ILE G 1 172 ? 19.589  17.023  -12.106 1.00 58.08  ? 171 ILE K CB    1 
ATOM   6563 C  CG1   . ILE G 1 172 ? 19.656  16.592  -13.575 1.00 68.47  ? 171 ILE K CG1   1 
ATOM   6564 C  CG2   . ILE G 1 172 ? 20.979  17.017  -11.489 1.00 48.34  ? 171 ILE K CG2   1 
ATOM   6565 C  CD1   . ILE G 1 172 ? 18.816  17.443  -14.513 1.00 62.13  ? 171 ILE K CD1   1 
ATOM   6566 N  N     . LYS G 1 173 ? 16.906  15.229  -12.780 1.00 48.35  ? 172 LYS K N     1 
ATOM   6567 C  CA    . LYS G 1 173 ? 15.554  15.181  -13.323 1.00 49.14  ? 172 LYS K CA    1 
ATOM   6568 C  C     . LYS G 1 173 ? 14.554  14.739  -12.264 1.00 53.12  ? 172 LYS K C     1 
ATOM   6569 O  O     . LYS G 1 173 ? 13.467  15.313  -12.153 1.00 50.73  ? 172 LYS K O     1 
ATOM   6570 C  CB    . LYS G 1 173 ? 15.503  14.254  -14.537 1.00 55.19  ? 172 LYS K CB    1 
ATOM   6571 C  CG    . LYS G 1 173 ? 14.107  14.076  -15.106 1.00 56.49  ? 172 LYS K CG    1 
ATOM   6572 C  CD    . LYS G 1 173 ? 14.137  13.938  -16.617 1.00 62.34  ? 172 LYS K CD    1 
ATOM   6573 C  CE    . LYS G 1 173 ? 12.803  14.342  -17.220 1.00 58.78  ? 172 LYS K CE    1 
ATOM   6574 N  NZ    . LYS G 1 173 ? 12.280  15.590  -16.597 1.00 54.67  ? 172 LYS K NZ    1 
ATOM   6575 N  N     . PHE G 1 174 ? 14.910  13.730  -11.466 1.00 49.29  ? 173 PHE K N     1 
ATOM   6576 C  CA    . PHE G 1 174 ? 13.996  13.248  -10.435 1.00 51.23  ? 173 PHE K CA    1 
ATOM   6577 C  C     . PHE G 1 174 ? 13.818  14.277  -9.325  1.00 54.17  ? 173 PHE K C     1 
ATOM   6578 O  O     . PHE G 1 174 ? 12.689  14.569  -8.913  1.00 51.08  ? 173 PHE K O     1 
ATOM   6579 C  CB    . PHE G 1 174 ? 14.500  11.924  -9.860  1.00 44.05  ? 173 PHE K CB    1 
ATOM   6580 C  CG    . PHE G 1 174 ? 13.685  11.423  -8.702  1.00 46.38  ? 173 PHE K CG    1 
ATOM   6581 C  CD1   . PHE G 1 174 ? 12.496  10.748  -8.917  1.00 44.25  ? 173 PHE K CD1   1 
ATOM   6582 C  CD2   . PHE G 1 174 ? 14.103  11.637  -7.398  1.00 38.71  ? 173 PHE K CD2   1 
ATOM   6583 C  CE1   . PHE G 1 174 ? 11.740  10.290  -7.855  1.00 42.84  ? 173 PHE K CE1   1 
ATOM   6584 C  CE2   . PHE G 1 174 ? 13.351  11.183  -6.331  1.00 39.17  ? 173 PHE K CE2   1 
ATOM   6585 C  CZ    . PHE G 1 174 ? 12.168  10.509  -6.560  1.00 37.24  ? 173 PHE K CZ    1 
ATOM   6586 N  N     . VAL G 1 175 ? 14.925  14.832  -8.825  1.00 46.14  ? 174 VAL K N     1 
ATOM   6587 C  CA    . VAL G 1 175 ? 14.863  15.744  -7.684  1.00 52.54  ? 174 VAL K CA    1 
ATOM   6588 C  C     . VAL G 1 175 ? 14.039  16.983  -8.020  1.00 57.88  ? 174 VAL K C     1 
ATOM   6589 O  O     . VAL G 1 175 ? 13.281  17.486  -7.180  1.00 67.86  ? 174 VAL K O     1 
ATOM   6590 C  CB    . VAL G 1 175 ? 16.286  16.114  -7.223  1.00 49.70  ? 174 VAL K CB    1 
ATOM   6591 C  CG1   . VAL G 1 175 ? 16.249  17.268  -6.236  1.00 53.81  ? 174 VAL K CG1   1 
ATOM   6592 C  CG2   . VAL G 1 175 ? 16.978  14.908  -6.604  1.00 50.41  ? 174 VAL K CG2   1 
ATOM   6593 N  N     . HIS G 1 176 ? 14.158  17.485  -9.253  1.00 55.19  ? 175 HIS K N     1 
ATOM   6594 C  CA    . HIS G 1 176 ? 13.506  18.731  -9.630  1.00 61.03  ? 175 HIS K CA    1 
ATOM   6595 C  C     . HIS G 1 176 ? 12.098  18.532  -10.181 1.00 67.70  ? 175 HIS K C     1 
ATOM   6596 O  O     . HIS G 1 176 ? 11.233  19.391  -9.971  1.00 68.44  ? 175 HIS K O     1 
ATOM   6597 C  CB    . HIS G 1 176 ? 14.375  19.476  -10.644 1.00 66.85  ? 175 HIS K CB    1 
ATOM   6598 C  CG    . HIS G 1 176 ? 13.603  20.355  -11.582 1.00 82.43  ? 175 HIS K CG    1 
ATOM   6599 N  ND1   . HIS G 1 176 ? 13.064  19.891  -12.766 1.00 86.70  ? 175 HIS K ND1   1 
ATOM   6600 C  CD2   . HIS G 1 176 ? 13.287  21.673  -11.514 1.00 83.47  ? 175 HIS K CD2   1 
ATOM   6601 C  CE1   . HIS G 1 176 ? 12.443  20.881  -13.386 1.00 86.09  ? 175 HIS K CE1   1 
ATOM   6602 N  NE2   . HIS G 1 176 ? 12.563  21.971  -12.648 1.00 93.05  ? 175 HIS K NE2   1 
ATOM   6603 N  N     . THR G 1 177 ? 11.844  17.426  -10.885 1.00 60.61  ? 176 THR K N     1 
ATOM   6604 C  CA    . THR G 1 177 ? 10.505  17.194  -11.417 1.00 63.92  ? 176 THR K CA    1 
ATOM   6605 C  C     . THR G 1 177 ? 9.542   16.755  -10.321 1.00 61.78  ? 176 THR K C     1 
ATOM   6606 O  O     . THR G 1 177 ? 8.373   17.160  -10.314 1.00 61.35  ? 176 THR K O     1 
ATOM   6607 C  CB    . THR G 1 177 ? 10.555  16.150  -12.534 1.00 63.10  ? 176 THR K CB    1 
ATOM   6608 O  OG1   . THR G 1 177 ? 11.319  16.659  -13.635 1.00 67.93  ? 176 THR K OG1   1 
ATOM   6609 C  CG2   . THR G 1 177 ? 9.153   15.797  -13.014 1.00 56.47  ? 176 THR K CG2   1 
ATOM   6610 N  N     . ILE G 1 178 ? 10.013  15.943  -9.379  1.00 53.51  ? 177 ILE K N     1 
ATOM   6611 C  CA    . ILE G 1 178 ? 9.152   15.258  -8.424  1.00 53.35  ? 177 ILE K CA    1 
ATOM   6612 C  C     . ILE G 1 178 ? 9.368   15.764  -7.001  1.00 55.66  ? 177 ILE K C     1 
ATOM   6613 O  O     . ILE G 1 178 ? 8.414   16.138  -6.317  1.00 56.37  ? 177 ILE K O     1 
ATOM   6614 C  CB    . ILE G 1 178 ? 9.349   13.729  -8.508  1.00 51.41  ? 177 ILE K CB    1 
ATOM   6615 C  CG1   . ILE G 1 178 ? 8.692   13.195  -9.781  1.00 50.70  ? 177 ILE K CG1   1 
ATOM   6616 C  CG2   . ILE G 1 178 ? 8.785   13.042  -7.275  1.00 53.04  ? 177 ILE K CG2   1 
ATOM   6617 C  CD1   . ILE G 1 178 ? 9.001   11.759  -10.065 1.00 57.06  ? 177 ILE K CD1   1 
ATOM   6618 N  N     . LEU G 1 179 ? 10.618  15.777  -6.533  1.00 55.93  ? 178 LEU K N     1 
ATOM   6619 C  CA    . LEU G 1 179 ? 10.870  16.135  -5.140  1.00 58.59  ? 178 LEU K CA    1 
ATOM   6620 C  C     . LEU G 1 179 ? 10.622  17.619  -4.894  1.00 65.95  ? 178 LEU K C     1 
ATOM   6621 O  O     . LEU G 1 179 ? 9.884   17.990  -3.973  1.00 71.44  ? 178 LEU K O     1 
ATOM   6622 C  CB    . LEU G 1 179 ? 12.293  15.746  -4.740  1.00 50.20  ? 178 LEU K CB    1 
ATOM   6623 C  CG    . LEU G 1 179 ? 12.516  14.253  -4.491  1.00 53.44  ? 178 LEU K CG    1 
ATOM   6624 C  CD1   . LEU G 1 179 ? 13.821  14.018  -3.747  1.00 45.47  ? 178 LEU K CD1   1 
ATOM   6625 C  CD2   . LEU G 1 179 ? 11.343  13.655  -3.728  1.00 47.12  ? 178 LEU K CD2   1 
ATOM   6626 N  N     . SER G 1 180 ? 11.226  18.486  -5.706  1.00 65.34  ? 179 SER K N     1 
ATOM   6627 C  CA    . SER G 1 180 ? 11.032  19.923  -5.561  1.00 71.27  ? 179 SER K CA    1 
ATOM   6628 C  C     . SER G 1 180 ? 9.787   20.427  -6.281  1.00 82.04  ? 179 SER K C     1 
ATOM   6629 O  O     . SER G 1 180 ? 9.667   21.637  -6.513  1.00 94.34  ? 179 SER K O     1 
ATOM   6630 C  CB    . SER G 1 180 ? 12.265  20.681  -6.060  1.00 74.04  ? 179 SER K CB    1 
ATOM   6631 O  OG    . SER G 1 180 ? 12.300  20.724  -7.474  1.00 76.62  ? 179 SER K OG    1 
ATOM   6632 N  N     . SER G 1 181 ? 8.867   19.537  -6.643  1.00 79.28  ? 180 SER K N     1 
ATOM   6633 C  CA    . SER G 1 181 ? 7.622   19.962  -7.260  1.00 90.39  ? 180 SER K CA    1 
ATOM   6634 C  C     . SER G 1 181 ? 6.752   20.696  -6.244  1.00 101.10 ? 180 SER K C     1 
ATOM   6635 O  O     . SER G 1 181 ? 6.875   20.516  -5.029  1.00 93.49  ? 180 SER K O     1 
ATOM   6636 C  CB    . SER G 1 181 ? 6.867   18.763  -7.833  1.00 82.13  ? 180 SER K CB    1 
ATOM   6637 O  OG    . SER G 1 181 ? 6.292   17.980  -6.802  1.00 75.32  ? 180 SER K OG    1 
ATOM   6638 N  N     . HIS G 1 182 ? 5.860   21.539  -6.760  1.00 111.35 ? 181 HIS K N     1 
ATOM   6639 C  CA    . HIS G 1 182 ? 5.002   22.374  -5.927  1.00 116.77 ? 181 HIS K CA    1 
ATOM   6640 C  C     . HIS G 1 182 ? 3.554   21.901  -6.004  1.00 121.06 ? 181 HIS K C     1 
ATOM   6641 O  O     . HIS G 1 182 ? 3.015   21.408  -5.010  1.00 122.56 ? 181 HIS K O     1 
ATOM   6642 C  CB    . HIS G 1 182 ? 5.142   23.839  -6.344  1.00 121.62 ? 181 HIS K CB    1 
ATOM   6643 C  CG    . HIS G 1 182 ? 6.562   24.265  -6.563  1.00 121.51 ? 181 HIS K CG    1 
ATOM   6644 N  ND1   . HIS G 1 182 ? 7.175   24.205  -7.796  1.00 115.89 ? 181 HIS K ND1   1 
ATOM   6645 C  CD2   . HIS G 1 182 ? 7.493   24.741  -5.703  1.00 115.16 ? 181 HIS K CD2   1 
ATOM   6646 C  CE1   . HIS G 1 182 ? 8.420   24.633  -7.688  1.00 112.65 ? 181 HIS K CE1   1 
ATOM   6647 N  NE2   . HIS G 1 182 ? 8.638   24.965  -6.428  1.00 113.91 ? 181 HIS K NE2   1 
ATOM   6648 N  N     . LEU G 1 183 ? 2.905   22.046  -7.161  1.00 124.65 ? 182 LEU K N     1 
ATOM   6649 C  CA    . LEU G 1 183 ? 1.564   21.520  -7.419  1.00 126.53 ? 182 LEU K CA    1 
ATOM   6650 C  C     . LEU G 1 183 ? 0.516   22.060  -6.449  1.00 130.20 ? 182 LEU K C     1 
ATOM   6651 O  O     . LEU G 1 183 ? -0.553  21.461  -6.293  1.00 120.00 ? 182 LEU K O     1 
ATOM   6652 C  CB    . LEU G 1 183 ? 1.558   19.986  -7.394  1.00 123.94 ? 182 LEU K CB    1 
ATOM   6653 C  CG    . LEU G 1 183 ? 2.561   19.279  -8.309  1.00 114.87 ? 182 LEU K CG    1 
ATOM   6654 C  CD1   . LEU G 1 183 ? 2.489   17.771  -8.119  1.00 80.42  ? 182 LEU K CD1   1 
ATOM   6655 C  CD2   . LEU G 1 183 ? 2.321   19.652  -9.765  1.00 103.69 ? 182 LEU K CD2   1 
ATOM   6656 N  N     . ASN G 1 184 ? 0.794   23.182  -5.792  1.00 131.45 ? 183 ASN K N     1 
ATOM   6657 C  CA    . ASN G 1 184 ? -0.167  23.784  -4.873  1.00 128.31 ? 183 ASN K CA    1 
ATOM   6658 C  C     . ASN G 1 184 ? 0.077   25.283  -4.734  1.00 127.91 ? 183 ASN K C     1 
ATOM   6659 O  O     . ASN G 1 184 ? -0.631  26.094  -5.332  1.00 121.13 ? 183 ASN K O     1 
ATOM   6660 C  CB    . ASN G 1 184 ? -0.102  23.111  -3.498  1.00 124.46 ? 183 ASN K CB    1 
ATOM   6661 C  CG    . ASN G 1 184 ? 1.163   23.458  -2.736  1.00 125.48 ? 183 ASN K CG    1 
ATOM   6662 O  OD1   . ASN G 1 184 ? 1.122   24.183  -1.742  1.00 120.03 ? 183 ASN K OD1   1 
ATOM   6663 N  ND2   . ASN G 1 184 ? 2.294   22.935  -3.195  1.00 125.85 ? 183 ASN K ND2   1 
ATOM   6664 O  "O5'" . DG  H 2 1   ? 43.287  6.788   -8.863  1.00 65.35  ? 1   DG  L "O5'" 1 
ATOM   6665 C  "C5'" . DG  H 2 1   ? 43.489  8.118   -9.327  1.00 58.25  ? 1   DG  L "C5'" 1 
ATOM   6666 C  "C4'" . DG  H 2 1   ? 42.162  8.804   -9.610  1.00 65.64  ? 1   DG  L "C4'" 1 
ATOM   6667 O  "O4'" . DG  H 2 1   ? 41.456  8.089   -10.656 1.00 67.67  ? 1   DG  L "O4'" 1 
ATOM   6668 C  "C3'" . DG  H 2 1   ? 41.204  8.880   -8.426  1.00 62.47  ? 1   DG  L "C3'" 1 
ATOM   6669 O  "O3'" . DG  H 2 1   ? 40.503  10.117  -8.452  1.00 64.35  ? 1   DG  L "O3'" 1 
ATOM   6670 C  "C2'" . DG  H 2 1   ? 40.270  7.693   -8.657  1.00 55.56  ? 1   DG  L "C2'" 1 
ATOM   6671 C  "C1'" . DG  H 2 1   ? 40.210  7.622   -10.179 1.00 61.39  ? 1   DG  L "C1'" 1 
ATOM   6672 N  N9    . DG  H 2 1   ? 40.007  6.269   -10.693 1.00 60.38  ? 1   DG  L N9    1 
ATOM   6673 C  C8    . DG  H 2 1   ? 40.656  5.125   -10.293 1.00 56.64  ? 1   DG  L C8    1 
ATOM   6674 N  N7    . DG  H 2 1   ? 40.273  4.057   -10.937 1.00 55.09  ? 1   DG  L N7    1 
ATOM   6675 C  C5    . DG  H 2 1   ? 39.311  4.522   -11.826 1.00 49.73  ? 1   DG  L C5    1 
ATOM   6676 C  C6    . DG  H 2 1   ? 38.541  3.822   -12.786 1.00 49.94  ? 1   DG  L C6    1 
ATOM   6677 O  O6    . DG  H 2 1   ? 38.558  2.612   -13.051 1.00 48.44  ? 1   DG  L O6    1 
ATOM   6678 N  N1    . DG  H 2 1   ? 37.682  4.672   -13.477 1.00 48.33  ? 1   DG  L N1    1 
ATOM   6679 C  C2    . DG  H 2 1   ? 37.580  6.026   -13.267 1.00 51.03  ? 1   DG  L C2    1 
ATOM   6680 N  N2    . DG  H 2 1   ? 36.694  6.680   -14.032 1.00 51.14  ? 1   DG  L N2    1 
ATOM   6681 N  N3    . DG  H 2 1   ? 38.294  6.695   -12.371 1.00 48.30  ? 1   DG  L N3    1 
ATOM   6682 C  C4    . DG  H 2 1   ? 39.137  5.882   -11.689 1.00 51.97  ? 1   DG  L C4    1 
ATOM   6683 P  P     . DC  H 2 2   ? 39.608  10.574  -7.198  1.00 69.21  ? 2   DC  L P     1 
ATOM   6684 O  OP1   . DC  H 2 2   ? 39.694  12.049  -7.104  1.00 62.69  ? 2   DC  L OP1   1 
ATOM   6685 O  OP2   . DC  H 2 2   ? 39.979  9.735   -6.037  1.00 53.26  ? 2   DC  L OP2   1 
ATOM   6686 O  "O5'" . DC  H 2 2   ? 38.125  10.181  -7.637  1.00 58.54  ? 2   DC  L "O5'" 1 
ATOM   6687 C  "C5'" . DC  H 2 2   ? 37.623  10.646  -8.875  1.00 59.43  ? 2   DC  L "C5'" 1 
ATOM   6688 C  "C4'" . DC  H 2 2   ? 36.430  9.826   -9.325  1.00 60.80  ? 2   DC  L "C4'" 1 
ATOM   6689 O  "O4'" . DC  H 2 2   ? 36.844  8.491   -9.667  1.00 60.05  ? 2   DC  L "O4'" 1 
ATOM   6690 C  "C3'" . DC  H 2 2   ? 35.328  9.659   -8.279  1.00 57.64  ? 2   DC  L "C3'" 1 
ATOM   6691 O  "O3'" . DC  H 2 2   ? 34.229  10.490  -8.621  1.00 55.51  ? 2   DC  L "O3'" 1 
ATOM   6692 C  "C2'" . DC  H 2 2   ? 34.960  8.161   -8.343  1.00 56.85  ? 2   DC  L "C2'" 1 
ATOM   6693 C  "C1'" . DC  H 2 2   ? 35.717  7.669   -9.573  1.00 57.00  ? 2   DC  L "C1'" 1 
ATOM   6694 N  N1    . DC  H 2 2   ? 36.160  6.243   -9.487  1.00 50.16  ? 2   DC  L N1    1 
ATOM   6695 C  C2    . DC  H 2 2   ? 35.661  5.308   -10.401 1.00 55.49  ? 2   DC  L C2    1 
ATOM   6696 O  O2    . DC  H 2 2   ? 34.859  5.680   -11.268 1.00 53.26  ? 2   DC  L O2    1 
ATOM   6697 N  N3    . DC  H 2 2   ? 36.070  4.018   -10.313 1.00 52.52  ? 2   DC  L N3    1 
ATOM   6698 C  C4    . DC  H 2 2   ? 36.935  3.655   -9.364  1.00 52.98  ? 2   DC  L C4    1 
ATOM   6699 N  N4    . DC  H 2 2   ? 37.310  2.372   -9.316  1.00 52.23  ? 2   DC  L N4    1 
ATOM   6700 C  C5    . DC  H 2 2   ? 37.455  4.593   -8.422  1.00 48.60  ? 2   DC  L C5    1 
ATOM   6701 C  C6    . DC  H 2 2   ? 37.044  5.863   -8.520  1.00 54.95  ? 2   DC  L C6    1 
ATOM   6702 P  P     . DC  H 2 3   ? 33.019  10.725  -7.590  1.00 74.18  ? 3   DC  L P     1 
ATOM   6703 O  OP1   . DC  H 2 3   ? 32.787  12.185  -7.510  1.00 72.70  ? 3   DC  L OP1   1 
ATOM   6704 O  OP2   . DC  H 2 3   ? 33.286  9.956   -6.354  1.00 61.22  ? 3   DC  L OP2   1 
ATOM   6705 O  "O5'" . DC  H 2 3   ? 31.776  10.058  -8.335  1.00 59.40  ? 3   DC  L "O5'" 1 
ATOM   6706 C  "C5'" . DC  H 2 3   ? 31.610  10.256  -9.732  1.00 46.06  ? 3   DC  L "C5'" 1 
ATOM   6707 C  "C4'" . DC  H 2 3   ? 30.773  9.148   -10.337 1.00 50.96  ? 3   DC  L "C4'" 1 
ATOM   6708 O  "O4'" . DC  H 2 3   ? 31.533  7.915   -10.351 1.00 48.05  ? 3   DC  L "O4'" 1 
ATOM   6709 C  "C3'" . DC  H 2 3   ? 29.471  8.849   -9.591  1.00 49.34  ? 3   DC  L "C3'" 1 
ATOM   6710 O  "O3'" . DC  H 2 3   ? 28.376  8.924   -10.489 1.00 54.35  ? 3   DC  L "O3'" 1 
ATOM   6711 C  "C2'" . DC  H 2 3   ? 29.666  7.429   -9.043  1.00 47.02  ? 3   DC  L "C2'" 1 
ATOM   6712 C  "C1'" . DC  H 2 3   ? 30.689  6.847   -10.006 1.00 55.14  ? 3   DC  L "C1'" 1 
ATOM   6713 N  N1    . DC  H 2 3   ? 31.525  5.766   -9.408  1.00 47.82  ? 3   DC  L N1    1 
ATOM   6714 C  C2    . DC  H 2 3   ? 31.515  4.486   -9.974  1.00 46.71  ? 3   DC  L C2    1 
ATOM   6715 O  O2    . DC  H 2 3   ? 30.806  4.270   -10.964 1.00 53.65  ? 3   DC  L O2    1 
ATOM   6716 N  N3    . DC  H 2 3   ? 32.284  3.516   -9.417  1.00 50.00  ? 3   DC  L N3    1 
ATOM   6717 C  C4    . DC  H 2 3   ? 33.035  3.790   -8.349  1.00 50.80  ? 3   DC  L C4    1 
ATOM   6718 N  N4    . DC  H 2 3   ? 33.777  2.803   -7.836  1.00 45.42  ? 3   DC  L N4    1 
ATOM   6719 C  C5    . DC  H 2 3   ? 33.059  5.088   -7.761  1.00 47.56  ? 3   DC  L C5    1 
ATOM   6720 C  C6    . DC  H 2 3   ? 32.295  6.034   -8.317  1.00 47.88  ? 3   DC  L C6    1 
ATOM   6721 P  P     . DT  H 2 4   ? 26.870  8.841   -9.940  1.00 54.74  ? 4   DT  L P     1 
ATOM   6722 O  OP1   . DT  H 2 4   ? 26.016  9.605   -10.875 1.00 52.22  ? 4   DT  L OP1   1 
ATOM   6723 O  OP2   . DT  H 2 4   ? 26.886  9.194   -8.503  1.00 53.88  ? 4   DT  L OP2   1 
ATOM   6724 O  "O5'" . DT  H 2 4   ? 26.513  7.289   -10.070 1.00 50.75  ? 4   DT  L "O5'" 1 
ATOM   6725 C  "C5'" . DT  H 2 4   ? 26.656  6.642   -11.326 1.00 44.76  ? 4   DT  L "C5'" 1 
ATOM   6726 C  "C4'" . DT  H 2 4   ? 26.484  5.142   -11.188 1.00 48.55  ? 4   DT  L "C4'" 1 
ATOM   6727 O  "O4'" . DT  H 2 4   ? 27.608  4.583   -10.476 1.00 47.45  ? 4   DT  L "O4'" 1 
ATOM   6728 C  "C3'" . DT  H 2 4   ? 25.233  4.700   -10.420 1.00 46.00  ? 4   DT  L "C3'" 1 
ATOM   6729 O  "O3'" . DT  H 2 4   ? 24.360  3.989   -11.288 1.00 52.16  ? 4   DT  L "O3'" 1 
ATOM   6730 C  "C2'" . DT  H 2 4   ? 25.770  3.801   -9.293  1.00 43.76  ? 4   DT  L "C2'" 1 
ATOM   6731 C  "C1'" . DT  H 2 4   ? 27.165  3.448   -9.787  1.00 45.45  ? 4   DT  L "C1'" 1 
ATOM   6732 N  N1    . DT  H 2 4   ? 28.134  3.145   -8.693  1.00 45.45  ? 4   DT  L N1    1 
ATOM   6733 C  C2    . DT  H 2 4   ? 28.603  1.860   -8.550  1.00 48.35  ? 4   DT  L C2    1 
ATOM   6734 O  O2    . DT  H 2 4   ? 28.265  0.941   -9.276  1.00 54.07  ? 4   DT  L O2    1 
ATOM   6735 N  N3    . DT  H 2 4   ? 29.488  1.684   -7.520  1.00 46.11  ? 4   DT  L N3    1 
ATOM   6736 C  C4    . DT  H 2 4   ? 29.942  2.645   -6.636  1.00 46.56  ? 4   DT  L C4    1 
ATOM   6737 O  O4    . DT  H 2 4   ? 30.740  2.388   -5.741  1.00 50.46  ? 4   DT  L O4    1 
ATOM   6738 C  C5    . DT  H 2 4   ? 29.412  3.972   -6.841  1.00 48.08  ? 4   DT  L C5    1 
ATOM   6739 C  C7    . DT  H 2 4   ? 29.831  5.098   -5.943  1.00 49.97  ? 4   DT  L C7    1 
ATOM   6740 C  C6    . DT  H 2 4   ? 28.543  4.156   -7.849  1.00 46.87  ? 4   DT  L C6    1 
ATOM   6741 P  P     . DT  H 2 5   ? 22.816  3.780   -10.895 1.00 44.68  ? 5   DT  L P     1 
ATOM   6742 O  OP1   . DT  H 2 5   ? 22.068  3.571   -12.155 1.00 45.41  ? 5   DT  L OP1   1 
ATOM   6743 O  OP2   . DT  H 2 5   ? 22.422  4.876   -9.983  1.00 45.56  ? 5   DT  L OP2   1 
ATOM   6744 O  "O5'" . DT  H 2 5   ? 22.820  2.415   -10.062 1.00 36.74  ? 5   DT  L "O5'" 1 
ATOM   6745 C  "C5'" . DT  H 2 5   ? 23.231  1.211   -10.690 1.00 43.88  ? 5   DT  L "C5'" 1 
ATOM   6746 C  "C4'" . DT  H 2 5   ? 23.457  0.104   -9.673  1.00 43.84  ? 5   DT  L "C4'" 1 
ATOM   6747 O  "O4'" . DT  H 2 5   ? 24.619  0.406   -8.855  1.00 44.67  ? 5   DT  L "O4'" 1 
ATOM   6748 C  "C3'" . DT  H 2 5   ? 22.302  -0.141  -8.690  1.00 45.98  ? 5   DT  L "C3'" 1 
ATOM   6749 O  "O3'" . DT  H 2 5   ? 22.068  -1.535  -8.587  1.00 47.48  ? 5   DT  L "O3'" 1 
ATOM   6750 C  "C2'" . DT  H 2 5   ? 22.849  0.417   -7.376  1.00 45.78  ? 5   DT  L "C2'" 1 
ATOM   6751 C  "C1'" . DT  H 2 5   ? 24.315  0.063   -7.528  1.00 43.89  ? 5   DT  L "C1'" 1 
ATOM   6752 N  N1    . DT  H 2 5   ? 25.230  0.794   -6.605  1.00 45.50  ? 5   DT  L N1    1 
ATOM   6753 C  C2    . DT  H 2 5   ? 26.280  0.112   -6.035  1.00 48.03  ? 5   DT  L C2    1 
ATOM   6754 O  O2    . DT  H 2 5   ? 26.505  -1.065  -6.250  1.00 46.37  ? 5   DT  L O2    1 
ATOM   6755 N  N3    . DT  H 2 5   ? 27.065  0.861   -5.201  1.00 39.44  ? 5   DT  L N3    1 
ATOM   6756 C  C4    . DT  H 2 5   ? 26.908  2.197   -4.883  1.00 42.99  ? 5   DT  L C4    1 
ATOM   6757 O  O4    . DT  H 2 5   ? 27.669  2.783   -4.120  1.00 47.43  ? 5   DT  L O4    1 
ATOM   6758 C  C5    . DT  H 2 5   ? 25.786  2.854   -5.512  1.00 45.56  ? 5   DT  L C5    1 
ATOM   6759 C  C7    . DT  H 2 5   ? 25.515  4.304   -5.243  1.00 46.23  ? 5   DT  L C7    1 
ATOM   6760 C  C6    . DT  H 2 5   ? 25.008  2.128   -6.332  1.00 38.86  ? 5   DT  L C6    1 
ATOM   6761 P  P     . DG  H 2 6   ? 20.590  -2.106  -8.322  1.00 51.39  ? 6   DG  L P     1 
ATOM   6762 O  OP1   . DG  H 2 6   ? 19.871  -2.096  -9.614  1.00 45.49  ? 6   DG  L OP1   1 
ATOM   6763 O  OP2   . DG  H 2 6   ? 20.020  -1.392  -7.158  1.00 40.42  ? 6   DG  L OP2   1 
ATOM   6764 O  "O5'" . DG  H 2 6   ? 20.852  -3.623  -7.885  1.00 48.17  ? 6   DG  L "O5'" 1 
ATOM   6765 C  "C5'" . DG  H 2 6   ? 21.689  -4.457  -8.683  1.00 44.21  ? 6   DG  L "C5'" 1 
ATOM   6766 C  "C4'" . DG  H 2 6   ? 22.518  -5.387  -7.813  1.00 43.59  ? 6   DG  L "C4'" 1 
ATOM   6767 O  "O4'" . DG  H 2 6   ? 23.542  -4.624  -7.122  1.00 45.13  ? 6   DG  L "O4'" 1 
ATOM   6768 C  "C3'" . DG  H 2 6   ? 21.735  -6.133  -6.735  1.00 50.17  ? 6   DG  L "C3'" 1 
ATOM   6769 O  "O3'" . DG  H 2 6   ? 22.175  -7.482  -6.654  1.00 47.71  ? 6   DG  L "O3'" 1 
ATOM   6770 C  "C2'" . DG  H 2 6   ? 22.054  -5.356  -5.458  1.00 48.68  ? 6   DG  L "C2'" 1 
ATOM   6771 C  "C1'" . DG  H 2 6   ? 23.465  -4.852  -5.732  1.00 40.20  ? 6   DG  L "C1'" 1 
ATOM   6772 N  N9    . DG  H 2 6   ? 23.768  -3.598  -5.047  1.00 46.54  ? 6   DG  L N9    1 
ATOM   6773 C  C8    . DG  H 2 6   ? 23.069  -2.419  -5.142  1.00 49.05  ? 6   DG  L C8    1 
ATOM   6774 N  N7    . DG  H 2 6   ? 23.568  -1.459  -4.416  1.00 45.12  ? 6   DG  L N7    1 
ATOM   6775 C  C5    . DG  H 2 6   ? 24.670  -2.035  -3.800  1.00 42.82  ? 6   DG  L C5    1 
ATOM   6776 C  C6    . DG  H 2 6   ? 25.604  -1.475  -2.895  1.00 44.31  ? 6   DG  L C6    1 
ATOM   6777 O  O6    . DG  H 2 6   ? 25.641  -0.321  -2.447  1.00 40.84  ? 6   DG  L O6    1 
ATOM   6778 N  N1    . DG  H 2 6   ? 26.568  -2.403  -2.510  1.00 46.79  ? 6   DG  L N1    1 
ATOM   6779 C  C2    . DG  H 2 6   ? 26.623  -3.707  -2.944  1.00 49.55  ? 6   DG  L C2    1 
ATOM   6780 N  N2    . DG  H 2 6   ? 27.629  -4.451  -2.461  1.00 49.84  ? 6   DG  L N2    1 
ATOM   6781 N  N3    . DG  H 2 6   ? 25.755  -4.244  -3.792  1.00 47.82  ? 6   DG  L N3    1 
ATOM   6782 C  C4    . DG  H 2 6   ? 24.808  -3.353  -4.177  1.00 42.20  ? 6   DG  L C4    1 
ATOM   6783 P  P     . DC  H 2 7   ? 21.408  -8.524  -5.702  1.00 53.98  ? 7   DC  L P     1 
ATOM   6784 O  OP1   . DC  H 2 7   ? 21.615  -9.878  -6.262  1.00 57.65  ? 7   DC  L OP1   1 
ATOM   6785 O  OP2   . DC  H 2 7   ? 20.032  -8.017  -5.497  1.00 57.18  ? 7   DC  L OP2   1 
ATOM   6786 O  "O5'" . DC  H 2 7   ? 22.190  -8.417  -4.310  1.00 42.55  ? 7   DC  L "O5'" 1 
ATOM   6787 C  "C5'" . DC  H 2 7   ? 23.572  -8.746  -4.253  1.00 47.63  ? 7   DC  L "C5'" 1 
ATOM   6788 C  "C4'" . DC  H 2 7   ? 24.170  -8.389  -2.902  1.00 53.18  ? 7   DC  L "C4'" 1 
ATOM   6789 O  "O4'" . DC  H 2 7   ? 24.231  -6.956  -2.753  1.00 50.04  ? 7   DC  L "O4'" 1 
ATOM   6790 C  "C3'" . DC  H 2 7   ? 23.396  -8.906  -1.682  1.00 52.69  ? 7   DC  L "C3'" 1 
ATOM   6791 O  "O3'" . DC  H 2 7   ? 24.169  -9.891  -1.007  1.00 53.08  ? 7   DC  L "O3'" 1 
ATOM   6792 C  "C2'" . DC  H 2 7   ? 23.179  -7.657  -0.806  1.00 49.84  ? 7   DC  L "C2'" 1 
ATOM   6793 C  "C1'" . DC  H 2 7   ? 24.181  -6.668  -1.384  1.00 48.66  ? 7   DC  L "C1'" 1 
ATOM   6794 N  N1    . DC  H 2 7   ? 23.791  -5.237  -1.207  1.00 48.83  ? 7   DC  L N1    1 
ATOM   6795 C  C2    . DC  H 2 7   ? 24.543  -4.417  -0.359  1.00 42.98  ? 7   DC  L C2    1 
ATOM   6796 O  O2    . DC  H 2 7   ? 25.519  -4.895  0.232   1.00 48.99  ? 7   DC  L O2    1 
ATOM   6797 N  N3    . DC  H 2 7   ? 24.180  -3.120  -0.208  1.00 43.82  ? 7   DC  L N3    1 
ATOM   6798 C  C4    . DC  H 2 7   ? 23.122  -2.642  -0.863  1.00 45.69  ? 7   DC  L C4    1 
ATOM   6799 N  N4    . DC  H 2 7   ? 22.803  -1.356  -0.681  1.00 40.02  ? 7   DC  L N4    1 
ATOM   6800 C  C5    . DC  H 2 7   ? 22.343  -3.462  -1.732  1.00 46.07  ? 7   DC  L C5    1 
ATOM   6801 C  C6    . DC  H 2 7   ? 22.710  -4.740  -1.874  1.00 45.23  ? 7   DC  L C6    1 
ATOM   6802 P  P     . DC  H 2 8   ? 23.470  -10.904 0.027   1.00 53.44  ? 8   DC  L P     1 
ATOM   6803 O  OP1   . DC  H 2 8   ? 24.357  -12.081 0.162   1.00 55.65  ? 8   DC  L OP1   1 
ATOM   6804 O  OP2   . DC  H 2 8   ? 22.064  -11.086 -0.396  1.00 51.00  ? 8   DC  L OP2   1 
ATOM   6805 O  "O5'" . DC  H 2 8   ? 23.474  -10.101 1.409   1.00 50.07  ? 8   DC  L "O5'" 1 
ATOM   6806 C  "C5'" . DC  H 2 8   ? 24.709  -9.699  1.985   1.00 50.63  ? 8   DC  L "C5'" 1 
ATOM   6807 C  "C4'" . DC  H 2 8   ? 24.487  -8.873  3.240   1.00 47.68  ? 8   DC  L "C4'" 1 
ATOM   6808 O  "O4'" . DC  H 2 8   ? 24.185  -7.497  2.883   1.00 48.85  ? 8   DC  L "O4'" 1 
ATOM   6809 C  "C3'" . DC  H 2 8   ? 23.332  -9.337  4.138   1.00 51.21  ? 8   DC  L "C3'" 1 
ATOM   6810 O  "O3'" . DC  H 2 8   ? 23.735  -9.262  5.494   1.00 54.31  ? 8   DC  L "O3'" 1 
ATOM   6811 C  "C2'" . DC  H 2 8   ? 22.242  -8.311  3.836   1.00 50.01  ? 8   DC  L "C2'" 1 
ATOM   6812 C  "C1'" . DC  H 2 8   ? 23.092  -7.069  3.656   1.00 56.89  ? 8   DC  L "C1'" 1 
ATOM   6813 N  N1    . DC  H 2 8   ? 22.405  -5.947  2.958   1.00 52.49  ? 8   DC  L N1    1 
ATOM   6814 C  C2    . DC  H 2 8   ? 22.736  -4.630  3.291   1.00 50.00  ? 8   DC  L C2    1 
ATOM   6815 O  O2    . DC  H 2 8   ? 23.598  -4.426  4.154   1.00 47.18  ? 8   DC  L O2    1 
ATOM   6816 N  N3    . DC  H 2 8   ? 22.105  -3.614  2.654   1.00 45.40  ? 8   DC  L N3    1 
ATOM   6817 C  C4    . DC  H 2 8   ? 21.181  -3.876  1.729   1.00 42.71  ? 8   DC  L C4    1 
ATOM   6818 N  N4    . DC  H 2 8   ? 20.586  -2.840  1.130   1.00 39.44  ? 8   DC  L N4    1 
ATOM   6819 C  C5    . DC  H 2 8   ? 20.828  -5.214  1.378   1.00 46.75  ? 8   DC  L C5    1 
ATOM   6820 C  C6    . DC  H 2 8   ? 21.458  -6.209  2.012   1.00 48.52  ? 8   DC  L C6    1 
ATOM   6821 P  P     . DG  H 2 9   ? 23.283  -10.387 6.548   1.00 64.46  ? 9   DG  L P     1 
ATOM   6822 O  OP1   . DG  H 2 9   ? 24.177  -11.552 6.363   1.00 74.90  ? 9   DG  L OP1   1 
ATOM   6823 O  OP2   . DG  H 2 9   ? 21.817  -10.556 6.439   1.00 62.44  ? 9   DG  L OP2   1 
ATOM   6824 O  "O5'" . DG  H 2 9   ? 23.596  -9.717  7.966   1.00 58.71  ? 9   DG  L "O5'" 1 
ATOM   6825 C  "C5'" . DG  H 2 9   ? 24.904  -9.231  8.247   1.00 59.41  ? 9   DG  L "C5'" 1 
ATOM   6826 C  "C4'" . DG  H 2 9   ? 24.847  -7.929  9.029   1.00 53.40  ? 9   DG  L "C4'" 1 
ATOM   6827 O  "O4'" . DG  H 2 9   ? 24.379  -6.857  8.166   1.00 52.14  ? 9   DG  L "O4'" 1 
ATOM   6828 C  "C3'" . DG  H 2 9   ? 23.913  -7.932  10.240  1.00 52.42  ? 9   DG  L "C3'" 1 
ATOM   6829 O  "O3'" . DG  H 2 9   ? 24.509  -7.197  11.300  1.00 55.47  ? 9   DG  L "O3'" 1 
ATOM   6830 C  "C2'" . DG  H 2 9   ? 22.666  -7.231  9.707   1.00 53.64  ? 9   DG  L "C2'" 1 
ATOM   6831 C  "C1'" . DG  H 2 9   ? 23.289  -6.204  8.777   1.00 52.71  ? 9   DG  L "C1'" 1 
ATOM   6832 N  N9    . DG  H 2 9   ? 22.387  -5.733  7.731   1.00 53.16  ? 9   DG  L N9    1 
ATOM   6833 C  C8    . DG  H 2 9   ? 21.672  -6.502  6.844   1.00 47.67  ? 9   DG  L C8    1 
ATOM   6834 N  N7    . DG  H 2 9   ? 20.950  -5.801  6.014   1.00 48.17  ? 9   DG  L N7    1 
ATOM   6835 C  C5    . DG  H 2 9   ? 21.204  -4.482  6.372   1.00 49.31  ? 9   DG  L C5    1 
ATOM   6836 C  C6    . DG  H 2 9   ? 20.703  -3.276  5.826   1.00 45.29  ? 9   DG  L C6    1 
ATOM   6837 O  O6    . DG  H 2 9   ? 19.909  -3.130  4.887   1.00 42.33  ? 9   DG  L O6    1 
ATOM   6838 N  N1    . DG  H 2 9   ? 21.217  -2.161  6.484   1.00 42.90  ? 9   DG  L N1    1 
ATOM   6839 C  C2    . DG  H 2 9   ? 22.102  -2.207  7.536   1.00 44.82  ? 9   DG  L C2    1 
ATOM   6840 N  N2    . DG  H 2 9   ? 22.485  -1.026  8.042   1.00 43.77  ? 9   DG  L N2    1 
ATOM   6841 N  N3    . DG  H 2 9   ? 22.577  -3.330  8.056   1.00 42.19  ? 9   DG  L N3    1 
ATOM   6842 C  C4    . DG  H 2 9   ? 22.087  -4.425  7.426   1.00 48.30  ? 9   DG  L C4    1 
ATOM   6843 P  P     . DG  H 2 10  ? 23.904  -7.263  12.787  1.00 58.76  ? 10  DG  L P     1 
ATOM   6844 O  OP1   . DG  H 2 10  ? 25.008  -7.660  13.688  1.00 66.99  ? 10  DG  L OP1   1 
ATOM   6845 O  OP2   . DG  H 2 10  ? 22.661  -8.066  12.754  1.00 61.60  ? 10  DG  L OP2   1 
ATOM   6846 O  "O5'" . DG  H 2 10  ? 23.509  -5.744  13.101  1.00 52.41  ? 10  DG  L "O5'" 1 
ATOM   6847 C  "C5'" . DG  H 2 10  ? 24.456  -4.705  12.864  1.00 53.48  ? 10  DG  L "C5'" 1 
ATOM   6848 C  "C4'" . DG  H 2 10  ? 23.918  -3.352  13.306  1.00 52.79  ? 10  DG  L "C4'" 1 
ATOM   6849 O  "O4'" . DG  H 2 10  ? 23.139  -2.756  12.237  1.00 49.79  ? 10  DG  L "O4'" 1 
ATOM   6850 C  "C3'" . DG  H 2 10  ? 23.011  -3.373  14.529  1.00 54.03  ? 10  DG  L "C3'" 1 
ATOM   6851 O  "O3'" . DG  H 2 10  ? 23.232  -2.205  15.308  1.00 48.58  ? 10  DG  L "O3'" 1 
ATOM   6852 C  "C2'" . DG  H 2 10  ? 21.610  -3.388  13.920  1.00 52.97  ? 10  DG  L "C2'" 1 
ATOM   6853 C  "C1'" . DG  H 2 10  ? 21.802  -2.560  12.653  1.00 48.92  ? 10  DG  L "C1'" 1 
ATOM   6854 N  N9    . DG  H 2 10  ? 20.930  -2.963  11.554  1.00 52.15  ? 10  DG  L N9    1 
ATOM   6855 C  C8    . DG  H 2 10  ? 20.720  -4.241  11.096  1.00 52.18  ? 10  DG  L C8    1 
ATOM   6856 N  N7    . DG  H 2 10  ? 19.896  -4.303  10.088  1.00 48.77  ? 10  DG  L N7    1 
ATOM   6857 C  C5    . DG  H 2 10  ? 19.540  -2.981  9.857   1.00 45.61  ? 10  DG  L C5    1 
ATOM   6858 C  C6    . DG  H 2 10  ? 18.672  -2.428  8.886   1.00 44.44  ? 10  DG  L C6    1 
ATOM   6859 O  O6    . DG  H 2 10  ? 18.023  -3.018  8.011   1.00 44.44  ? 10  DG  L O6    1 
ATOM   6860 N  N1    . DG  H 2 10  ? 18.589  -1.042  8.999   1.00 42.43  ? 10  DG  L N1    1 
ATOM   6861 C  C2    . DG  H 2 10  ? 19.262  -0.287  9.930   1.00 43.66  ? 10  DG  L C2    1 
ATOM   6862 N  N2    . DG  H 2 10  ? 19.056  1.037   9.882   1.00 35.15  ? 10  DG  L N2    1 
ATOM   6863 N  N3    . DG  H 2 10  ? 20.080  -0.793  10.845  1.00 50.21  ? 10  DG  L N3    1 
ATOM   6864 C  C4    . DG  H 2 10  ? 20.171  -2.142  10.749  1.00 48.37  ? 10  DG  L C4    1 
ATOM   6865 P  P     . DG  H 2 11  ? 22.662  -2.108  16.806  1.00 54.52  ? 11  DG  L P     1 
ATOM   6866 O  OP1   . DG  H 2 11  ? 23.548  -1.192  17.557  1.00 57.11  ? 11  DG  L OP1   1 
ATOM   6867 O  OP2   . DG  H 2 11  ? 22.437  -3.486  17.297  1.00 49.28  ? 11  DG  L OP2   1 
ATOM   6868 O  "O5'" . DG  H 2 11  ? 21.234  -1.410  16.625  1.00 57.30  ? 11  DG  L "O5'" 1 
ATOM   6869 C  "C5'" . DG  H 2 11  ? 21.155  -0.092  16.095  1.00 51.49  ? 11  DG  L "C5'" 1 
ATOM   6870 C  "C4'" . DG  H 2 11  ? 19.712  0.319   15.852  1.00 54.77  ? 11  DG  L "C4'" 1 
ATOM   6871 O  "O4'" . DG  H 2 11  ? 19.208  -0.320  14.647  1.00 48.26  ? 11  DG  L "O4'" 1 
ATOM   6872 C  "C3'" . DG  H 2 11  ? 18.722  -0.055  16.965  1.00 52.82  ? 11  DG  L "C3'" 1 
ATOM   6873 O  "O3'" . DG  H 2 11  ? 17.784  0.995   17.130  1.00 59.43  ? 11  DG  L "O3'" 1 
ATOM   6874 C  "C2'" . DG  H 2 11  ? 18.037  -1.287  16.383  1.00 48.38  ? 11  DG  L "C2'" 1 
ATOM   6875 C  "C1'" . DG  H 2 11  ? 17.938  -0.847  14.938  1.00 54.19  ? 11  DG  L "C1'" 1 
ATOM   6876 N  N9    . DG  H 2 11  ? 17.624  -1.912  13.994  1.00 48.59  ? 11  DG  L N9    1 
ATOM   6877 C  C8    . DG  H 2 11  ? 17.882  -3.255  14.129  1.00 49.03  ? 11  DG  L C8    1 
ATOM   6878 N  N7    . DG  H 2 11  ? 17.474  -3.965  13.112  1.00 49.46  ? 11  DG  L N7    1 
ATOM   6879 C  C5    . DG  H 2 11  ? 16.909  -3.031  12.251  1.00 47.97  ? 11  DG  L C5    1 
ATOM   6880 C  C6    . DG  H 2 11  ? 16.301  -3.206  10.985  1.00 45.37  ? 11  DG  L C6    1 
ATOM   6881 O  O6    . DG  H 2 11  ? 16.134  -4.257  10.351  1.00 44.17  ? 11  DG  L O6    1 
ATOM   6882 N  N1    . DG  H 2 11  ? 15.859  -1.995  10.453  1.00 42.87  ? 11  DG  L N1    1 
ATOM   6883 C  C2    . DG  H 2 11  ? 15.991  -0.772  11.068  1.00 42.58  ? 11  DG  L C2    1 
ATOM   6884 N  N2    . DG  H 2 11  ? 15.505  0.286   10.402  1.00 39.70  ? 11  DG  L N2    1 
ATOM   6885 N  N3    . DG  H 2 11  ? 16.559  -0.596  12.253  1.00 44.73  ? 11  DG  L N3    1 
ATOM   6886 C  C4    . DG  H 2 11  ? 16.993  -1.765  12.782  1.00 48.20  ? 11  DG  L C4    1 
ATOM   6887 P  P     . DT  H 2 12  ? 17.999  2.132   18.243  1.00 59.07  ? 12  DT  L P     1 
ATOM   6888 O  OP1   . DT  H 2 12  ? 19.427  2.520   18.240  1.00 60.44  ? 12  DT  L OP1   1 
ATOM   6889 O  OP2   . DT  H 2 12  ? 17.368  1.652   19.493  1.00 56.12  ? 12  DT  L OP2   1 
ATOM   6890 O  "O5'" . DT  H 2 12  ? 17.128  3.356   17.692  1.00 51.03  ? 12  DT  L "O5'" 1 
ATOM   6891 C  "C5'" . DT  H 2 12  ? 17.406  3.905   16.405  1.00 53.64  ? 12  DT  L "C5'" 1 
ATOM   6892 C  "C4'" . DT  H 2 12  ? 16.132  4.098   15.593  1.00 54.10  ? 12  DT  L "C4'" 1 
ATOM   6893 O  "O4'" . DT  H 2 12  ? 15.742  2.842   14.967  1.00 44.44  ? 12  DT  L "O4'" 1 
ATOM   6894 C  "C3'" . DT  H 2 12  ? 14.901  4.555   16.383  1.00 48.09  ? 12  DT  L "C3'" 1 
ATOM   6895 O  "O3'" . DT  H 2 12  ? 14.095  5.359   15.550  1.00 55.62  ? 12  DT  L "O3'" 1 
ATOM   6896 C  "C2'" . DT  H 2 12  ? 14.201  3.231   16.648  1.00 42.90  ? 12  DT  L "C2'" 1 
ATOM   6897 C  "C1'" . DT  H 2 12  ? 14.393  2.590   15.289  1.00 47.78  ? 12  DT  L "C1'" 1 
ATOM   6898 N  N1    . DT  H 2 12  ? 14.142  1.128   15.254  1.00 48.43  ? 12  DT  L N1    1 
ATOM   6899 C  C2    . DT  H 2 12  ? 13.663  0.565   14.095  1.00 45.39  ? 12  DT  L C2    1 
ATOM   6900 O  O2    . DT  H 2 12  ? 13.439  1.207   13.085  1.00 46.33  ? 12  DT  L O2    1 
ATOM   6901 N  N3    . DT  H 2 12  ? 13.459  -0.785  14.157  1.00 42.31  ? 12  DT  L N3    1 
ATOM   6902 C  C4    . DT  H 2 12  ? 13.677  -1.613  15.241  1.00 50.53  ? 12  DT  L C4    1 
ATOM   6903 O  O4    . DT  H 2 12  ? 13.462  -2.820  15.198  1.00 56.17  ? 12  DT  L O4    1 
ATOM   6904 C  C5    . DT  H 2 12  ? 14.176  -0.958  16.429  1.00 53.19  ? 12  DT  L C5    1 
ATOM   6905 C  C7    . DT  H 2 12  ? 14.450  -1.754  17.670  1.00 48.49  ? 12  DT  L C7    1 
ATOM   6906 C  C6    . DT  H 2 12  ? 14.380  0.367   16.379  1.00 46.94  ? 12  DT  L C6    1 
ATOM   6907 P  P     . DA  H 2 13  ? 14.052  6.953   15.717  1.00 56.93  ? 13  DA  L P     1 
ATOM   6908 O  OP1   . DA  H 2 13  ? 15.424  7.469   15.516  1.00 52.17  ? 13  DA  L OP1   1 
ATOM   6909 O  OP2   . DA  H 2 13  ? 13.326  7.253   16.970  1.00 50.29  ? 13  DA  L OP2   1 
ATOM   6910 O  "O5'" . DA  H 2 13  ? 13.152  7.419   14.478  1.00 55.03  ? 13  DA  L "O5'" 1 
ATOM   6911 C  "C5'" . DA  H 2 13  ? 13.577  7.123   13.146  1.00 38.02  ? 13  DA  L "C5'" 1 
ATOM   6912 C  "C4'" . DA  H 2 13  ? 12.484  6.415   12.357  1.00 44.42  ? 13  DA  L "C4'" 1 
ATOM   6913 O  "O4'" . DA  H 2 13  ? 12.287  5.072   12.876  1.00 41.68  ? 13  DA  L "O4'" 1 
ATOM   6914 C  "C3'" . DA  H 2 13  ? 11.111  7.087   12.391  1.00 38.42  ? 13  DA  L "C3'" 1 
ATOM   6915 O  "O3'" . DA  H 2 13  ? 10.514  7.009   11.112  1.00 37.38  ? 13  DA  L "O3'" 1 
ATOM   6916 C  "C2'" . DA  H 2 13  ? 10.345  6.248   13.410  1.00 39.84  ? 13  DA  L "C2'" 1 
ATOM   6917 C  "C1'" . DA  H 2 13  ? 10.914  4.868   13.134  1.00 41.69  ? 13  DA  L "C1'" 1 
ATOM   6918 N  N9    . DA  H 2 13  ? 10.788  3.947   14.257  1.00 43.10  ? 13  DA  L N9    1 
ATOM   6919 C  C8    . DA  H 2 13  ? 10.996  4.226   15.579  1.00 41.60  ? 13  DA  L C8    1 
ATOM   6920 N  N7    . DA  H 2 13  ? 10.815  3.196   16.371  1.00 39.67  ? 13  DA  L N7    1 
ATOM   6921 C  C5    . DA  H 2 13  ? 10.469  2.170   15.508  1.00 42.12  ? 13  DA  L C5    1 
ATOM   6922 C  C6    . DA  H 2 13  ? 10.149  0.815   15.723  1.00 41.08  ? 13  DA  L C6    1 
ATOM   6923 N  N6    . DA  H 2 13  ? 10.128  0.248   16.934  1.00 43.11  ? 13  DA  L N6    1 
ATOM   6924 N  N1    . DA  H 2 13  ? 9.849   0.064   14.644  1.00 37.34  ? 13  DA  L N1    1 
ATOM   6925 C  C2    . DA  H 2 13  ? 9.872   0.635   13.433  1.00 36.33  ? 13  DA  L C2    1 
ATOM   6926 N  N3    . DA  H 2 13  ? 10.155  1.895   13.107  1.00 37.13  ? 13  DA  L N3    1 
ATOM   6927 C  C4    . DA  H 2 13  ? 10.448  2.616   14.201  1.00 36.46  ? 13  DA  L C4    1 
ATOM   6928 P  P     . DA  H 2 14  ? 9.309   7.995   10.725  1.00 35.90  ? 14  DA  L P     1 
ATOM   6929 O  OP1   . DA  H 2 14  ? 9.141   7.928   9.267   1.00 36.04  ? 14  DA  L OP1   1 
ATOM   6930 O  OP2   . DA  H 2 14  ? 9.566   9.304   11.364  1.00 37.96  ? 14  DA  L OP2   1 
ATOM   6931 O  "O5'" . DA  H 2 14  ? 8.030   7.331   11.419  1.00 37.04  ? 14  DA  L "O5'" 1 
ATOM   6932 C  "C5'" . DA  H 2 14  ? 7.067   6.642   10.633  1.00 30.65  ? 14  DA  L "C5'" 1 
ATOM   6933 C  "C4'" . DA  H 2 14  ? 7.546   5.247   10.270  1.00 33.98  ? 14  DA  L "C4'" 1 
ATOM   6934 O  "O4'" . DA  H 2 14  ? 8.066   4.582   11.455  1.00 36.81  ? 14  DA  L "O4'" 1 
ATOM   6935 C  "C3'" . DA  H 2 14  ? 6.454   4.324   9.740   1.00 39.00  ? 14  DA  L "C3'" 1 
ATOM   6936 O  "O3'" . DA  H 2 14  ? 7.004   3.399   8.836   1.00 38.26  ? 14  DA  L "O3'" 1 
ATOM   6937 C  "C2'" . DA  H 2 14  ? 5.991   3.624   11.006  1.00 36.49  ? 14  DA  L "C2'" 1 
ATOM   6938 C  "C1'" . DA  H 2 14  ? 7.328   3.397   11.680  1.00 31.90  ? 14  DA  L "C1'" 1 
ATOM   6939 N  N9    . DA  H 2 14  ? 7.223   3.170   13.113  1.00 33.68  ? 14  DA  L N9    1 
ATOM   6940 C  C8    . DA  H 2 14  ? 7.423   4.082   14.110  1.00 36.83  ? 14  DA  L C8    1 
ATOM   6941 N  N7    . DA  H 2 14  ? 7.257   3.591   15.314  1.00 35.72  ? 14  DA  L N7    1 
ATOM   6942 C  C5    . DA  H 2 14  ? 6.922   2.266   15.090  1.00 37.87  ? 14  DA  L C5    1 
ATOM   6943 C  C6    . DA  H 2 14  ? 6.618   1.203   15.962  1.00 42.70  ? 14  DA  L C6    1 
ATOM   6944 N  N6    . DA  H 2 14  ? 6.605   1.326   17.293  1.00 40.62  ? 14  DA  L N6    1 
ATOM   6945 N  N1    . DA  H 2 14  ? 6.326   0.006   15.411  1.00 41.65  ? 14  DA  L N1    1 
ATOM   6946 C  C2    . DA  H 2 14  ? 6.339   -0.112  14.079  1.00 38.47  ? 14  DA  L C2    1 
ATOM   6947 N  N3    . DA  H 2 14  ? 6.609   0.813   13.159  1.00 38.89  ? 14  DA  L N3    1 
ATOM   6948 C  C4    . DA  H 2 14  ? 6.893   1.991   13.738  1.00 31.80  ? 14  DA  L C4    1 
ATOM   6949 P  P     . DG  H 2 15  ? 6.050   2.307   8.153   1.00 30.73  ? 15  DG  L P     1 
ATOM   6950 O  OP1   . DG  H 2 15  ? 6.189   1.035   8.902   1.00 29.57  ? 15  DG  L OP1   1 
ATOM   6951 O  OP2   . DG  H 2 15  ? 6.421   2.336   6.731   1.00 31.79  ? 15  DG  L OP2   1 
ATOM   6952 O  "O5'" . DG  H 2 15  ? 4.579   2.940   8.338   1.00 40.80  ? 15  DG  L "O5'" 1 
ATOM   6953 C  "C5'" . DG  H 2 15  ? 3.401   2.223   7.958   1.00 33.24  ? 15  DG  L "C5'" 1 
ATOM   6954 C  "C4'" . DG  H 2 15  ? 3.147   1.041   8.882   1.00 34.38  ? 15  DG  L "C4'" 1 
ATOM   6955 O  "O4'" . DG  H 2 15  ? 3.579   1.354   10.227  1.00 32.91  ? 15  DG  L "O4'" 1 
ATOM   6956 C  "C3'" . DG  H 2 15  ? 1.682   0.597   9.000   1.00 31.00  ? 15  DG  L "C3'" 1 
ATOM   6957 O  "O3'" . DG  H 2 15  ? 1.556   -0.746  8.558   1.00 31.93  ? 15  DG  L "O3'" 1 
ATOM   6958 C  "C2'" . DG  H 2 15  ? 1.369   0.729   10.500  1.00 32.07  ? 15  DG  L "C2'" 1 
ATOM   6959 C  "C1'" . DG  H 2 15  ? 2.755   0.649   11.114  1.00 33.91  ? 15  DG  L "C1'" 1 
ATOM   6960 N  N9    . DG  H 2 15  ? 2.859   1.252   12.441  1.00 37.83  ? 15  DG  L N9    1 
ATOM   6961 C  C8    . DG  H 2 15  ? 3.003   2.586   12.739  1.00 35.69  ? 15  DG  L C8    1 
ATOM   6962 N  N7    . DG  H 2 15  ? 3.080   2.826   14.019  1.00 36.56  ? 15  DG  L N7    1 
ATOM   6963 C  C5    . DG  H 2 15  ? 2.985   1.572   14.608  1.00 36.32  ? 15  DG  L C5    1 
ATOM   6964 C  C6    . DG  H 2 15  ? 3.008   1.200   15.975  1.00 41.80  ? 15  DG  L C6    1 
ATOM   6965 O  O6    . DG  H 2 15  ? 3.120   1.932   16.968  1.00 37.09  ? 15  DG  L O6    1 
ATOM   6966 N  N1    . DG  H 2 15  ? 2.882   -0.177  16.137  1.00 40.89  ? 15  DG  L N1    1 
ATOM   6967 C  C2    . DG  H 2 15  ? 2.752   -1.081  15.109  1.00 46.37  ? 15  DG  L C2    1 
ATOM   6968 N  N2    . DG  H 2 15  ? 2.642   -2.370  15.462  1.00 45.61  ? 15  DG  L N2    1 
ATOM   6969 N  N3    . DG  H 2 15  ? 2.729   -0.746  13.825  1.00 41.89  ? 15  DG  L N3    1 
ATOM   6970 C  C4    . DG  H 2 15  ? 2.850   0.592   13.651  1.00 37.48  ? 15  DG  L C4    1 
ATOM   6971 P  P     . DT  H 2 16  ? 0.148   -1.295  8.014   1.00 38.68  ? 16  DT  L P     1 
ATOM   6972 O  OP1   . DT  H 2 16  ? 0.448   -2.342  7.012   1.00 39.54  ? 16  DT  L OP1   1 
ATOM   6973 O  OP2   . DT  H 2 16  ? -0.693  -0.134  7.645   1.00 33.33  ? 16  DT  L OP2   1 
ATOM   6974 O  "O5'" . DT  H 2 16  ? -0.510  -1.989  9.293   1.00 38.90  ? 16  DT  L "O5'" 1 
ATOM   6975 C  "C5'" . DT  H 2 16  ? 0.114   -3.120  9.877   1.00 35.36  ? 16  DT  L "C5'" 1 
ATOM   6976 C  "C4'" . DT  H 2 16  ? -0.604  -3.543  11.144  1.00 33.34  ? 16  DT  L "C4'" 1 
ATOM   6977 O  "O4'" . DT  H 2 16  ? -0.219  -2.684  12.238  1.00 36.72  ? 16  DT  L "O4'" 1 
ATOM   6978 C  "C3'" . DT  H 2 16  ? -2.136  -3.494  11.077  1.00 35.94  ? 16  DT  L "C3'" 1 
ATOM   6979 O  "O3'" . DT  H 2 16  ? -2.659  -4.786  11.349  1.00 48.15  ? 16  DT  L "O3'" 1 
ATOM   6980 C  "C2'" . DT  H 2 16  ? -2.528  -2.477  12.163  1.00 39.44  ? 16  DT  L "C2'" 1 
ATOM   6981 C  "C1'" . DT  H 2 16  ? -1.322  -2.522  13.087  1.00 40.74  ? 16  DT  L "C1'" 1 
ATOM   6982 N  N1    . DT  H 2 16  ? -1.115  -1.282  13.889  1.00 42.55  ? 16  DT  L N1    1 
ATOM   6983 C  C2    . DT  H 2 16  ? -0.952  -1.386  15.251  1.00 43.34  ? 16  DT  L C2    1 
ATOM   6984 O  O2    . DT  H 2 16  ? -0.979  -2.447  15.847  1.00 53.64  ? 16  DT  L O2    1 
ATOM   6985 N  N3    . DT  H 2 16  ? -0.757  -0.196  15.898  1.00 37.77  ? 16  DT  L N3    1 
ATOM   6986 C  C4    . DT  H 2 16  ? -0.705  1.064   15.331  1.00 40.91  ? 16  DT  L C4    1 
ATOM   6987 O  O4    . DT  H 2 16  ? -0.524  2.077   16.000  1.00 44.91  ? 16  DT  L O4    1 
ATOM   6988 C  C5    . DT  H 2 16  ? -0.880  1.104   13.897  1.00 42.73  ? 16  DT  L C5    1 
ATOM   6989 C  C7    . DT  H 2 16  ? -0.844  2.416   13.170  1.00 35.18  ? 16  DT  L C7    1 
ATOM   6990 C  C6    . DT  H 2 16  ? -1.071  -0.058  13.252  1.00 35.86  ? 16  DT  L C6    1 
ATOM   6991 P  P     . DT  H 2 17  ? -4.231  -5.084  11.215  1.00 45.15  ? 17  DT  L P     1 
ATOM   6992 O  OP1   . DT  H 2 17  ? -4.369  -6.447  10.656  1.00 46.50  ? 17  DT  L OP1   1 
ATOM   6993 O  OP2   . DT  H 2 17  ? -4.871  -3.943  10.523  1.00 45.81  ? 17  DT  L OP2   1 
ATOM   6994 O  "O5'" . DT  H 2 17  ? -4.734  -5.097  12.730  1.00 48.65  ? 17  DT  L "O5'" 1 
ATOM   6995 C  "C5'" . DT  H 2 17  ? -4.024  -5.860  13.695  1.00 46.59  ? 17  DT  L "C5'" 1 
ATOM   6996 C  "C4'" . DT  H 2 17  ? -4.501  -5.553  15.104  1.00 43.00  ? 17  DT  L "C4'" 1 
ATOM   6997 O  "O4'" . DT  H 2 17  ? -3.995  -4.259  15.533  1.00 47.18  ? 17  DT  L "O4'" 1 
ATOM   6998 C  "C3'" . DT  H 2 17  ? -6.019  -5.483  15.290  1.00 44.90  ? 17  DT  L "C3'" 1 
ATOM   6999 O  "O3'" . DT  H 2 17  ? -6.341  -6.009  16.557  1.00 54.17  ? 17  DT  L "O3'" 1 
ATOM   7000 C  "C2'" . DT  H 2 17  ? -6.274  -3.981  15.262  1.00 40.71  ? 17  DT  L "C2'" 1 
ATOM   7001 C  "C1'" . DT  H 2 17  ? -5.071  -3.518  16.059  1.00 43.70  ? 17  DT  L "C1'" 1 
ATOM   7002 N  N1    . DT  H 2 17  ? -4.770  -2.070  15.942  1.00 42.78  ? 17  DT  L N1    1 
ATOM   7003 C  C2    . DT  H 2 17  ? -4.371  -1.384  17.064  1.00 42.80  ? 17  DT  L C2    1 
ATOM   7004 O  O2    . DT  H 2 17  ? -4.249  -1.907  18.157  1.00 45.05  ? 17  DT  L O2    1 
ATOM   7005 N  N3    . DT  H 2 17  ? -4.113  -0.056  16.862  1.00 43.42  ? 17  DT  L N3    1 
ATOM   7006 C  C4    . DT  H 2 17  ? -4.215  0.642   15.675  1.00 39.07  ? 17  DT  L C4    1 
ATOM   7007 O  O4    . DT  H 2 17  ? -3.961  1.839   15.595  1.00 39.10  ? 17  DT  L O4    1 
ATOM   7008 C  C5    . DT  H 2 17  ? -4.641  -0.137  14.536  1.00 39.64  ? 17  DT  L C5    1 
ATOM   7009 C  C7    . DT  H 2 17  ? -4.787  0.512   13.194  1.00 37.35  ? 17  DT  L C7    1 
ATOM   7010 C  C6    . DT  H 2 17  ? -4.896  -1.441  14.722  1.00 38.93  ? 17  DT  L C6    1 
ATOM   7011 P  P     . DC  H 2 18  ? -7.567  -7.026  16.746  1.00 61.93  ? 18  DC  L P     1 
ATOM   7012 O  OP1   . DC  H 2 18  ? -7.000  -8.391  16.669  1.00 52.08  ? 18  DC  L OP1   1 
ATOM   7013 O  OP2   . DC  H 2 18  ? -8.662  -6.633  15.831  1.00 52.03  ? 18  DC  L OP2   1 
ATOM   7014 O  "O5'" . DC  H 2 18  ? -8.028  -6.754  18.253  1.00 52.94  ? 18  DC  L "O5'" 1 
ATOM   7015 C  "C5'" . DC  H 2 18  ? -7.223  -7.225  19.319  1.00 49.33  ? 18  DC  L "C5'" 1 
ATOM   7016 C  "C4'" . DC  H 2 18  ? -6.891  -6.123  20.316  1.00 59.58  ? 18  DC  L "C4'" 1 
ATOM   7017 O  "O4'" . DC  H 2 18  ? -6.304  -4.983  19.654  1.00 54.34  ? 18  DC  L "O4'" 1 
ATOM   7018 C  "C3'" . DC  H 2 18  ? -8.063  -5.515  21.047  1.00 59.95  ? 18  DC  L "C3'" 1 
ATOM   7019 O  "O3'" . DC  H 2 18  ? -8.520  -6.386  22.066  1.00 66.39  ? 18  DC  L "O3'" 1 
ATOM   7020 C  "C2'" . DC  H 2 18  ? -7.418  -4.258  21.629  1.00 57.67  ? 18  DC  L "C2'" 1 
ATOM   7021 C  "C1'" . DC  H 2 18  ? -6.393  -3.879  20.548  1.00 53.14  ? 18  DC  L "C1'" 1 
ATOM   7022 N  N1    . DC  H 2 18  ? -6.769  -2.647  19.798  1.00 49.49  ? 18  DC  L N1    1 
ATOM   7023 C  C2    . DC  H 2 18  ? -6.444  -1.395  20.333  1.00 51.05  ? 18  DC  L C2    1 
ATOM   7024 O  O2    . DC  H 2 18  ? -5.834  -1.339  21.409  1.00 55.48  ? 18  DC  L O2    1 
ATOM   7025 N  N3    . DC  H 2 18  ? -6.799  -0.277  19.654  1.00 49.72  ? 18  DC  L N3    1 
ATOM   7026 C  C4    . DC  H 2 18  ? -7.455  -0.378  18.499  1.00 45.02  ? 18  DC  L C4    1 
ATOM   7027 N  N4    . DC  H 2 18  ? -7.783  0.753   17.866  1.00 41.91  ? 18  DC  L N4    1 
ATOM   7028 C  C5    . DC  H 2 18  ? -7.804  -1.645  17.940  1.00 40.80  ? 18  DC  L C5    1 
ATOM   7029 C  C6    . DC  H 2 18  ? -7.448  -2.742  18.619  1.00 44.67  ? 18  DC  L C6    1 
ATOM   7030 P  P     . DC  H 2 19  ? -10.016 -6.237  22.631  1.00 66.24  ? 19  DC  L P     1 
ATOM   7031 O  OP1   . DC  H 2 19  ? -10.318 -7.440  23.437  1.00 74.18  ? 19  DC  L OP1   1 
ATOM   7032 O  OP2   . DC  H 2 19  ? -10.886 -5.878  21.489  1.00 69.14  ? 19  DC  L OP2   1 
ATOM   7033 O  "O5'" . DC  H 2 19  ? -9.939  -4.962  23.595  1.00 56.30  ? 19  DC  L "O5'" 1 
ATOM   7034 C  "C5'" . DC  H 2 19  ? -9.045  -4.961  24.701  1.00 53.75  ? 19  DC  L "C5'" 1 
ATOM   7035 C  "C4'" . DC  H 2 19  ? -8.957  -3.579  25.325  1.00 59.76  ? 19  DC  L "C4'" 1 
ATOM   7036 O  "O4'" . DC  H 2 19  ? -8.403  -2.650  24.373  1.00 58.28  ? 19  DC  L "O4'" 1 
ATOM   7037 C  "C3'" . DC  H 2 19  ? -10.287 -2.966  25.715  1.00 66.28  ? 19  DC  L "C3'" 1 
ATOM   7038 O  "O3'" . DC  H 2 19  ? -10.667 -3.420  27.011  1.00 73.85  ? 19  DC  L "O3'" 1 
ATOM   7039 C  "C2'" . DC  H 2 19  ? -9.973  -1.467  25.718  1.00 65.65  ? 19  DC  L "C2'" 1 
ATOM   7040 C  "C1'" . DC  H 2 19  ? -8.832  -1.341  24.699  1.00 61.53  ? 19  DC  L "C1'" 1 
ATOM   7041 N  N1    . DC  H 2 19  ? -9.226  -0.636  23.445  1.00 50.10  ? 19  DC  L N1    1 
ATOM   7042 C  C2    . DC  H 2 19  ? -9.141  0.759   23.380  1.00 52.29  ? 19  DC  L C2    1 
ATOM   7043 O  O2    . DC  H 2 19  ? -8.739  1.385   24.369  1.00 52.42  ? 19  DC  L O2    1 
ATOM   7044 N  N3    . DC  H 2 19  ? -9.501  1.386   22.233  1.00 52.34  ? 19  DC  L N3    1 
ATOM   7045 C  C4    . DC  H 2 19  ? -9.928  0.675   21.189  1.00 49.20  ? 19  DC  L C4    1 
ATOM   7046 N  N4    . DC  H 2 19  ? -10.272 1.337   20.080  1.00 46.26  ? 19  DC  L N4    1 
ATOM   7047 C  C5    . DC  H 2 19  ? -10.022 -0.748  21.236  1.00 46.45  ? 19  DC  L C5    1 
ATOM   7048 C  C6    . DC  H 2 19  ? -9.664  -1.356  22.372  1.00 48.98  ? 19  DC  L C6    1 
ATOM   7049 P  P     . DG  H 2 20  ? -12.203 -3.353  27.479  1.00 78.66  ? 20  DG  L P     1 
ATOM   7050 O  OP1   . DG  H 2 20  ? -12.306 -4.055  28.777  1.00 81.85  ? 20  DG  L OP1   1 
ATOM   7051 O  OP2   . DG  H 2 20  ? -13.048 -3.780  26.341  1.00 72.70  ? 20  DG  L OP2   1 
ATOM   7052 O  "O5'" . DG  H 2 20  ? -12.467 -1.795  27.718  1.00 64.06  ? 20  DG  L "O5'" 1 
ATOM   7053 C  "C5'" . DG  H 2 20  ? -11.754 -1.093  28.731  1.00 66.41  ? 20  DG  L "C5'" 1 
ATOM   7054 C  "C4'" . DG  H 2 20  ? -12.187 0.359   28.767  1.00 67.57  ? 20  DG  L "C4'" 1 
ATOM   7055 O  "O4'" . DG  H 2 20  ? -11.799 1.003   27.524  1.00 69.47  ? 20  DG  L "O4'" 1 
ATOM   7056 C  "C3'" . DG  H 2 20  ? -13.697 0.560   28.910  1.00 68.98  ? 20  DG  L "C3'" 1 
ATOM   7057 O  "O3'" . DG  H 2 20  ? -13.988 1.503   29.931  1.00 70.76  ? 20  DG  L "O3'" 1 
ATOM   7058 C  "C2'" . DG  H 2 20  ? -14.141 1.061   27.537  1.00 73.03  ? 20  DG  L "C2'" 1 
ATOM   7059 C  "C1'" . DG  H 2 20  ? -12.886 1.728   27.000  1.00 67.55  ? 20  DG  L "C1'" 1 
ATOM   7060 N  N9    . DG  H 2 20  ? -12.819 1.684   25.543  1.00 67.96  ? 20  DG  L N9    1 
ATOM   7061 C  C8    . DG  H 2 20  ? -12.936 0.569   24.749  1.00 63.68  ? 20  DG  L C8    1 
ATOM   7062 N  N7    . DG  H 2 20  ? -12.856 0.827   23.475  1.00 53.89  ? 20  DG  L N7    1 
ATOM   7063 C  C5    . DG  H 2 20  ? -12.681 2.203   23.417  1.00 51.88  ? 20  DG  L C5    1 
ATOM   7064 C  C6    . DG  H 2 20  ? -12.532 3.053   22.297  1.00 42.57  ? 20  DG  L C6    1 
ATOM   7065 O  O6    . DG  H 2 20  ? -12.526 2.745   21.097  1.00 52.88  ? 20  DG  L O6    1 
ATOM   7066 N  N1    . DG  H 2 20  ? -12.380 4.383   22.677  1.00 42.96  ? 20  DG  L N1    1 
ATOM   7067 C  C2    . DG  H 2 20  ? -12.372 4.834   23.977  1.00 48.23  ? 20  DG  L C2    1 
ATOM   7068 N  N2    . DG  H 2 20  ? -12.212 6.155   24.146  1.00 43.91  ? 20  DG  L N2    1 
ATOM   7069 N  N3    . DG  H 2 20  ? -12.511 4.047   25.036  1.00 52.78  ? 20  DG  L N3    1 
ATOM   7070 C  C4    . DG  H 2 20  ? -12.660 2.748   24.682  1.00 54.25  ? 20  DG  L C4    1 
ATOM   7071 P  P     . DG  H 2 21  ? -15.518 1.867   30.265  1.00 78.23  ? 21  DG  L P     1 
ATOM   7072 O  OP1   . DG  H 2 21  ? -15.581 2.308   31.676  1.00 71.35  ? 21  DG  L OP1   1 
ATOM   7073 O  OP2   . DG  H 2 21  ? -16.358 0.734   29.813  1.00 70.38  ? 21  DG  L OP2   1 
ATOM   7074 O  "O5'" . DG  H 2 21  ? -15.829 3.121   29.321  1.00 59.55  ? 21  DG  L "O5'" 1 
ATOM   7075 C  "C5'" . DG  H 2 21  ? -15.127 4.339   29.522  1.00 62.67  ? 21  DG  L "C5'" 1 
ATOM   7076 C  "C4'" . DG  H 2 21  ? -15.404 5.330   28.404  1.00 63.00  ? 21  DG  L "C4'" 1 
ATOM   7077 O  "O4'" . DG  H 2 21  ? -15.023 4.766   27.138  1.00 60.98  ? 21  DG  L "O4'" 1 
ATOM   7078 C  "C3'" . DG  H 2 21  ? -16.865 5.712   28.213  1.00 59.65  ? 21  DG  L "C3'" 1 
ATOM   7079 O  "O3'" . DG  H 2 21  ? -17.188 6.853   29.004  1.00 62.55  ? 21  DG  L "O3'" 1 
ATOM   7080 C  "C2'" . DG  H 2 21  ? -16.959 6.032   26.712  1.00 63.01  ? 21  DG  L "C2'" 1 
ATOM   7081 C  "C1'" . DG  H 2 21  ? -15.621 5.555   26.143  1.00 60.34  ? 21  DG  L "C1'" 1 
ATOM   7082 N  N9    . DG  H 2 21  ? -15.774 4.778   24.920  1.00 51.96  ? 21  DG  L N9    1 
ATOM   7083 C  C8    . DG  H 2 21  ? -15.890 3.414   24.805  1.00 51.31  ? 21  DG  L C8    1 
ATOM   7084 N  N7    . DG  H 2 21  ? -16.035 3.011   23.572  1.00 54.05  ? 21  DG  L N7    1 
ATOM   7085 C  C5    . DG  H 2 21  ? -16.026 4.184   22.827  1.00 46.61  ? 21  DG  L C5    1 
ATOM   7086 C  C6    . DG  H 2 21  ? -16.145 4.382   21.430  1.00 41.33  ? 21  DG  L C6    1 
ATOM   7087 O  O6    . DG  H 2 21  ? -16.288 3.528   20.544  1.00 45.85  ? 21  DG  L O6    1 
ATOM   7088 N  N1    . DG  H 2 21  ? -16.084 5.733   21.093  1.00 38.14  ? 21  DG  L N1    1 
ATOM   7089 C  C2    . DG  H 2 21  ? -15.927 6.761   21.992  1.00 40.82  ? 21  DG  L C2    1 
ATOM   7090 N  N2    . DG  H 2 21  ? -15.891 8.000   21.480  1.00 42.68  ? 21  DG  L N2    1 
ATOM   7091 N  N3    . DG  H 2 21  ? -15.814 6.588   23.301  1.00 47.63  ? 21  DG  L N3    1 
ATOM   7092 C  C4    . DG  H 2 21  ? -15.872 5.279   23.644  1.00 45.32  ? 21  DG  L C4    1 
ATOM   7093 P  P     . DC  H 2 22  ? -18.723 7.287   29.211  1.00 65.11  ? 22  DC  L P     1 
ATOM   7094 O  OP1   . DC  H 2 22  ? -18.766 8.329   30.259  1.00 64.22  ? 22  DC  L OP1   1 
ATOM   7095 O  OP2   . DC  H 2 22  ? -19.521 6.050   29.362  1.00 61.21  ? 22  DC  L OP2   1 
ATOM   7096 O  "O5'" . DC  H 2 22  ? -19.142 7.944   27.815  1.00 59.09  ? 22  DC  L "O5'" 1 
ATOM   7097 C  "C5'" . DC  H 2 22  ? -18.449 9.082   27.312  1.00 56.74  ? 22  DC  L "C5'" 1 
ATOM   7098 C  "C4'" . DC  H 2 22  ? -18.949 9.418   25.922  1.00 62.86  ? 22  DC  L "C4'" 1 
ATOM   7099 O  "O4'" . DC  H 2 22  ? -18.560 8.368   25.008  1.00 55.70  ? 22  DC  L "O4'" 1 
ATOM   7100 C  "C3'" . DC  H 2 22  ? -20.471 9.527   25.819  1.00 59.21  ? 22  DC  L "C3'" 1 
ATOM   7101 O  "O3'" . DC  H 2 22  ? -20.856 10.865  25.552  1.00 64.62  ? 22  DC  L "O3'" 1 
ATOM   7102 C  "C2'" . DC  H 2 22  ? -20.865 8.584   24.673  1.00 57.79  ? 22  DC  L "C2'" 1 
ATOM   7103 C  "C1'" . DC  H 2 22  ? -19.539 8.242   24.011  1.00 55.43  ? 22  DC  L "C1'" 1 
ATOM   7104 N  N1    . DC  H 2 22  ? -19.505 6.850   23.486  1.00 47.93  ? 22  DC  L N1    1 
ATOM   7105 C  C2    . DC  H 2 22  ? -19.441 6.628   22.107  1.00 44.53  ? 22  DC  L C2    1 
ATOM   7106 O  O2    . DC  H 2 22  ? -19.394 7.598   21.341  1.00 48.59  ? 22  DC  L O2    1 
ATOM   7107 N  N3    . DC  H 2 22  ? -19.423 5.352   21.649  1.00 46.97  ? 22  DC  L N3    1 
ATOM   7108 C  C4    . DC  H 2 22  ? -19.474 4.333   22.508  1.00 42.68  ? 22  DC  L C4    1 
ATOM   7109 N  N4    . DC  H 2 22  ? -19.454 3.093   22.011  1.00 42.00  ? 22  DC  L N4    1 
ATOM   7110 C  C5    . DC  H 2 22  ? -19.548 4.540   23.916  1.00 45.33  ? 22  DC  L C5    1 
ATOM   7111 C  C6    . DC  H 2 22  ? -19.566 5.802   24.356  1.00 49.29  ? 22  DC  L C6    1 
ATOM   7112 P  P     . DG  H 2 23  ? -22.413 11.237  25.404  1.00 79.29  ? 23  DG  L P     1 
ATOM   7113 O  OP1   . DG  H 2 23  ? -22.583 12.636  25.853  1.00 82.51  ? 23  DG  L OP1   1 
ATOM   7114 O  OP2   . DG  H 2 23  ? -23.204 10.161  26.044  1.00 60.29  ? 23  DG  L OP2   1 
ATOM   7115 O  "O5'" . DG  H 2 23  ? -22.670 11.160  23.829  1.00 65.47  ? 23  DG  L "O5'" 1 
ATOM   7116 C  "C5'" . DG  H 2 23  ? -21.768 11.795  22.932  1.00 55.53  ? 23  DG  L "C5'" 1 
ATOM   7117 C  "C4'" . DG  H 2 23  ? -22.258 11.680  21.500  1.00 59.07  ? 23  DG  L "C4'" 1 
ATOM   7118 O  "O4'" . DG  H 2 23  ? -21.948 10.361  20.981  1.00 56.92  ? 23  DG  L "O4'" 1 
ATOM   7119 C  "C3'" . DG  H 2 23  ? -23.760 11.869  21.318  1.00 56.33  ? 23  DG  L "C3'" 1 
ATOM   7120 O  "O3'" . DG  H 2 23  ? -24.015 12.601  20.131  1.00 61.82  ? 23  DG  L "O3'" 1 
ATOM   7121 C  "C2'" . DG  H 2 23  ? -24.287 10.438  21.225  1.00 47.45  ? 23  DG  L "C2'" 1 
ATOM   7122 C  "C1'" . DG  H 2 23  ? -23.128 9.713   20.554  1.00 51.03  ? 23  DG  L "C1'" 1 
ATOM   7123 N  N9    . DG  H 2 23  ? -23.031 8.305   20.929  1.00 42.56  ? 23  DG  L N9    1 
ATOM   7124 C  C8    . DG  H 2 23  ? -22.956 7.795   22.201  1.00 44.34  ? 23  DG  L C8    1 
ATOM   7125 N  N7    . DG  H 2 23  ? -22.870 6.495   22.237  1.00 42.69  ? 23  DG  L N7    1 
ATOM   7126 C  C5    . DG  H 2 23  ? -22.887 6.117   20.902  1.00 35.85  ? 23  DG  L C5    1 
ATOM   7127 C  C6    . DG  H 2 23  ? -22.824 4.829   20.319  1.00 39.93  ? 23  DG  L C6    1 
ATOM   7128 O  O6    . DG  H 2 23  ? -22.736 3.732   20.888  1.00 43.62  ? 23  DG  L O6    1 
ATOM   7129 N  N1    . DG  H 2 23  ? -22.873 4.890   18.929  1.00 41.27  ? 23  DG  L N1    1 
ATOM   7130 C  C2    . DG  H 2 23  ? -22.971 6.049   18.196  1.00 37.10  ? 23  DG  L C2    1 
ATOM   7131 N  N2    . DG  H 2 23  ? -23.005 5.906   16.863  1.00 38.98  ? 23  DG  L N2    1 
ATOM   7132 N  N3    . DG  H 2 23  ? -23.032 7.262   18.729  1.00 36.06  ? 23  DG  L N3    1 
ATOM   7133 C  C4    . DG  H 2 23  ? -22.986 7.220   20.083  1.00 37.85  ? 23  DG  L C4    1 
ATOM   7134 P  P     . DC  H 2 24  ? -25.406 13.383  19.951  1.00 70.57  ? 24  DC  L P     1 
ATOM   7135 O  OP1   . DC  H 2 24  ? -25.122 14.668  19.277  1.00 61.19  ? 24  DC  L OP1   1 
ATOM   7136 O  OP2   . DC  H 2 24  ? -26.103 13.371  21.257  1.00 58.85  ? 24  DC  L OP2   1 
ATOM   7137 O  "O5'" . DC  H 2 24  ? -26.237 12.448  18.959  1.00 64.57  ? 24  DC  L "O5'" 1 
ATOM   7138 C  "C5'" . DC  H 2 24  ? -25.633 11.960  17.768  1.00 48.90  ? 24  DC  L "C5'" 1 
ATOM   7139 C  "C4'" . DC  H 2 24  ? -26.499 10.886  17.140  1.00 45.52  ? 24  DC  L "C4'" 1 
ATOM   7140 O  "O4'" . DC  H 2 24  ? -26.039 9.575   17.564  1.00 42.17  ? 24  DC  L "O4'" 1 
ATOM   7141 C  "C3'" . DC  H 2 24  ? -27.984 10.963  17.516  1.00 46.82  ? 24  DC  L "C3'" 1 
ATOM   7142 O  "O3'" . DC  H 2 24  ? -28.790 10.914  16.350  1.00 49.06  ? 24  DC  L "O3'" 1 
ATOM   7143 C  "C2'" . DC  H 2 24  ? -28.199 9.733   18.398  1.00 49.71  ? 24  DC  L "C2'" 1 
ATOM   7144 C  "C1'" . DC  H 2 24  ? -27.158 8.775   17.852  1.00 45.19  ? 24  DC  L "C1'" 1 
ATOM   7145 N  N1    . DC  H 2 24  ? -26.768 7.724   18.828  1.00 38.00  ? 24  DC  L N1    1 
ATOM   7146 C  C2    . DC  H 2 24  ? -26.503 6.426   18.381  1.00 35.56  ? 24  DC  L C2    1 
ATOM   7147 O  O2    . DC  H 2 24  ? -26.579 6.178   17.172  1.00 38.41  ? 24  DC  L O2    1 
ATOM   7148 N  N3    . DC  H 2 24  ? -26.162 5.476   19.288  1.00 36.81  ? 24  DC  L N3    1 
ATOM   7149 C  C4    . DC  H 2 24  ? -26.093 5.786   20.585  1.00 40.70  ? 24  DC  L C4    1 
ATOM   7150 N  N4    . DC  H 2 24  ? -25.753 4.817   21.442  1.00 34.96  ? 24  DC  L N4    1 
ATOM   7151 C  C5    . DC  H 2 24  ? -26.367 7.102   21.059  1.00 41.98  ? 24  DC  L C5    1 
ATOM   7152 C  C6    . DC  H 2 24  ? -26.702 8.028   20.156  1.00 40.51  ? 24  DC  L C6    1 
ATOM   7153 P  P     . DG  H 2 25  ? -30.332 11.364  16.412  1.00 46.52  ? 25  DG  L P     1 
ATOM   7154 O  OP1   . DG  H 2 25  ? -30.453 12.641  15.676  1.00 52.46  ? 25  DG  L OP1   1 
ATOM   7155 O  OP2   . DG  H 2 25  ? -30.796 11.293  17.816  1.00 41.18  ? 25  DG  L OP2   1 
ATOM   7156 O  "O5'" . DG  H 2 25  ? -31.091 10.223  15.590  1.00 47.47  ? 25  DG  L "O5'" 1 
ATOM   7157 C  "C5'" . DG  H 2 25  ? -30.787 10.013  14.216  1.00 41.07  ? 25  DG  L "C5'" 1 
ATOM   7158 C  "C4'" . DG  H 2 25  ? -31.272 8.648   13.753  1.00 37.40  ? 25  DG  L "C4'" 1 
ATOM   7159 O  "O4'" . DG  H 2 25  ? -30.520 7.611   14.435  1.00 41.68  ? 25  DG  L "O4'" 1 
ATOM   7160 C  "C3'" . DG  H 2 25  ? -32.745 8.353   14.028  1.00 40.19  ? 25  DG  L "C3'" 1 
ATOM   7161 O  "O3'" . DG  H 2 25  ? -33.301 7.605   12.953  1.00 45.12  ? 25  DG  L "O3'" 1 
ATOM   7162 C  "C2'" . DG  H 2 25  ? -32.698 7.532   15.313  1.00 42.64  ? 25  DG  L "C2'" 1 
ATOM   7163 C  "C1'" . DG  H 2 25  ? -31.399 6.758   15.137  1.00 35.82  ? 25  DG  L "C1'" 1 
ATOM   7164 N  N9    . DG  H 2 25  ? -30.768 6.393   16.401  1.00 37.35  ? 25  DG  L N9    1 
ATOM   7165 C  C8    . DG  H 2 25  ? -30.434 7.238   17.431  1.00 36.66  ? 25  DG  L C8    1 
ATOM   7166 N  N7    . DG  H 2 25  ? -29.878 6.632   18.442  1.00 34.31  ? 25  DG  L N7    1 
ATOM   7167 C  C5    . DG  H 2 25  ? -29.838 5.297   18.057  1.00 37.14  ? 25  DG  L C5    1 
ATOM   7168 C  C6    . DG  H 2 25  ? -29.344 4.166   18.747  1.00 33.99  ? 25  DG  L C6    1 
ATOM   7169 O  O6    . DG  H 2 25  ? -28.827 4.119   19.871  1.00 40.55  ? 25  DG  L O6    1 
ATOM   7170 N  N1    . DG  H 2 25  ? -29.496 3.000   18.000  1.00 35.67  ? 25  DG  L N1    1 
ATOM   7171 C  C2    . DG  H 2 25  ? -30.055 2.937   16.746  1.00 39.68  ? 25  DG  L C2    1 
ATOM   7172 N  N2    . DG  H 2 25  ? -30.116 1.721   16.182  1.00 40.75  ? 25  DG  L N2    1 
ATOM   7173 N  N3    . DG  H 2 25  ? -30.523 3.991   16.088  1.00 36.78  ? 25  DG  L N3    1 
ATOM   7174 C  C4    . DG  H 2 25  ? -30.382 5.134   16.803  1.00 37.54  ? 25  DG  L C4    1 
ATOM   7175 O  "O5'" . DC  I 3 1   ? -29.831 -4.827  21.797  1.00 59.82  ? 1   DC  N "O5'" 1 
ATOM   7176 C  "C5'" . DC  I 3 1   ? -30.814 -5.418  20.952  1.00 51.37  ? 1   DC  N "C5'" 1 
ATOM   7177 C  "C4'" . DC  I 3 1   ? -30.561 -5.071  19.493  1.00 55.11  ? 1   DC  N "C4'" 1 
ATOM   7178 O  "O4'" . DC  I 3 1   ? -30.745 -3.647  19.290  1.00 57.54  ? 1   DC  N "O4'" 1 
ATOM   7179 C  "C3'" . DC  I 3 1   ? -29.163 -5.395  18.979  1.00 55.11  ? 1   DC  N "C3'" 1 
ATOM   7180 O  "O3'" . DC  I 3 1   ? -29.234 -5.823  17.624  1.00 57.31  ? 1   DC  N "O3'" 1 
ATOM   7181 C  "C2'" . DC  I 3 1   ? -28.427 -4.063  19.113  1.00 49.10  ? 1   DC  N "C2'" 1 
ATOM   7182 C  "C1'" . DC  I 3 1   ? -29.540 -3.053  18.849  1.00 50.59  ? 1   DC  N "C1'" 1 
ATOM   7183 N  N1    . DC  I 3 1   ? -29.362 -1.769  19.585  1.00 43.73  ? 1   DC  N N1    1 
ATOM   7184 C  C2    . DC  I 3 1   ? -29.373 -0.558  18.884  1.00 43.16  ? 1   DC  N C2    1 
ATOM   7185 O  O2    . DC  I 3 1   ? -29.529 -0.572  17.656  1.00 40.82  ? 1   DC  N O2    1 
ATOM   7186 N  N3    . DC  I 3 1   ? -29.215 0.600   19.573  1.00 39.32  ? 1   DC  N N3    1 
ATOM   7187 C  C4    . DC  I 3 1   ? -29.052 0.573   20.897  1.00 43.45  ? 1   DC  N C4    1 
ATOM   7188 N  N4    . DC  I 3 1   ? -28.899 1.740   21.533  1.00 38.52  ? 1   DC  N N4    1 
ATOM   7189 C  C5    . DC  I 3 1   ? -29.039 -0.651  21.628  1.00 42.04  ? 1   DC  N C5    1 
ATOM   7190 C  C6    . DC  I 3 1   ? -29.197 -1.785  20.939  1.00 44.82  ? 1   DC  N C6    1 
ATOM   7191 P  P     . DG  I 3 2   ? -27.921 -6.362  16.872  1.00 72.36  ? 2   DG  N P     1 
ATOM   7192 O  OP1   . DG  I 3 2   ? -28.359 -7.375  15.886  1.00 57.82  ? 2   DG  N OP1   1 
ATOM   7193 O  OP2   . DG  I 3 2   ? -26.913 -6.716  17.896  1.00 53.48  ? 2   DG  N OP2   1 
ATOM   7194 O  "O5'" . DG  I 3 2   ? -27.387 -5.082  16.082  1.00 59.60  ? 2   DG  N "O5'" 1 
ATOM   7195 C  "C5'" . DG  I 3 2   ? -28.239 -4.418  15.160  1.00 52.57  ? 2   DG  N "C5'" 1 
ATOM   7196 C  "C4'" . DG  I 3 2   ? -27.524 -3.249  14.513  1.00 54.47  ? 2   DG  N "C4'" 1 
ATOM   7197 O  "O4'" . DG  I 3 2   ? -27.544 -2.109  15.408  1.00 50.74  ? 2   DG  N "O4'" 1 
ATOM   7198 C  "C3'" . DG  I 3 2   ? -26.056 -3.504  14.164  1.00 49.21  ? 2   DG  N "C3'" 1 
ATOM   7199 O  "O3'" . DG  I 3 2   ? -25.813 -3.126  12.818  1.00 56.23  ? 2   DG  N "O3'" 1 
ATOM   7200 C  "C2'" . DG  I 3 2   ? -25.282 -2.629  15.155  1.00 46.43  ? 2   DG  N "C2'" 1 
ATOM   7201 C  "C1'" . DG  I 3 2   ? -26.273 -1.511  15.438  1.00 48.48  ? 2   DG  N "C1'" 1 
ATOM   7202 N  N9    . DG  I 3 2   ? -26.096 -0.889  16.747  1.00 39.07  ? 2   DG  N N9    1 
ATOM   7203 C  C8    . DG  I 3 2   ? -25.825 -1.524  17.936  1.00 41.90  ? 2   DG  N C8    1 
ATOM   7204 N  N7    . DG  I 3 2   ? -25.726 -0.709  18.950  1.00 41.48  ? 2   DG  N N7    1 
ATOM   7205 C  C5    . DG  I 3 2   ? -25.951 0.547   18.400  1.00 37.05  ? 2   DG  N C5    1 
ATOM   7206 C  C6    . DG  I 3 2   ? -25.970 1.821   19.015  1.00 39.76  ? 2   DG  N C6    1 
ATOM   7207 O  O6    . DG  I 3 2   ? -25.786 2.101   20.208  1.00 41.07  ? 2   DG  N O6    1 
ATOM   7208 N  N1    . DG  I 3 2   ? -26.235 2.833   18.095  1.00 38.25  ? 2   DG  N N1    1 
ATOM   7209 C  C2    . DG  I 3 2   ? -26.454 2.637   16.752  1.00 40.61  ? 2   DG  N C2    1 
ATOM   7210 N  N2    . DG  I 3 2   ? -26.694 3.737   16.022  1.00 37.58  ? 2   DG  N N2    1 
ATOM   7211 N  N3    . DG  I 3 2   ? -26.439 1.449   16.163  1.00 40.26  ? 2   DG  N N3    1 
ATOM   7212 C  C4    . DG  I 3 2   ? -26.182 0.453   17.045  1.00 39.57  ? 2   DG  N C4    1 
ATOM   7213 P  P     . DC  I 3 3   ? -24.376 -3.371  12.144  1.00 56.67  ? 3   DC  N P     1 
ATOM   7214 O  OP1   . DC  I 3 3   ? -24.620 -3.724  10.727  1.00 53.67  ? 3   DC  N OP1   1 
ATOM   7215 O  OP2   . DC  I 3 3   ? -23.593 -4.286  13.005  1.00 55.30  ? 3   DC  N OP2   1 
ATOM   7216 O  "O5'" . DC  I 3 3   ? -23.697 -1.927  12.195  1.00 59.14  ? 3   DC  N "O5'" 1 
ATOM   7217 C  "C5'" . DC  I 3 3   ? -24.400 -0.816  11.666  1.00 51.72  ? 3   DC  N "C5'" 1 
ATOM   7218 C  "C4'" . DC  I 3 3   ? -23.844 0.494   12.190  1.00 49.10  ? 3   DC  N "C4'" 1 
ATOM   7219 O  "O4'" . DC  I 3 3   ? -24.013 0.579   13.619  1.00 50.32  ? 3   DC  N "O4'" 1 
ATOM   7220 C  "C3'" . DC  I 3 3   ? -22.350 0.730   11.934  1.00 47.33  ? 3   DC  N "C3'" 1 
ATOM   7221 O  "O3'" . DC  I 3 3   ? -22.203 1.775   10.988  1.00 49.77  ? 3   DC  N "O3'" 1 
ATOM   7222 C  "C2'" . DC  I 3 3   ? -21.786 1.128   13.314  1.00 41.14  ? 3   DC  N "C2'" 1 
ATOM   7223 C  "C1'" . DC  I 3 3   ? -23.049 1.474   14.091  1.00 45.36  ? 3   DC  N "C1'" 1 
ATOM   7224 N  N1    . DC  I 3 3   ? -22.926 1.326   15.571  1.00 38.93  ? 3   DC  N N1    1 
ATOM   7225 C  C2    . DC  I 3 3   ? -22.934 2.469   16.377  1.00 38.98  ? 3   DC  N C2    1 
ATOM   7226 O  O2    . DC  I 3 3   ? -23.037 3.580   15.842  1.00 41.37  ? 3   DC  N O2    1 
ATOM   7227 N  N3    . DC  I 3 3   ? -22.827 2.328   17.721  1.00 42.12  ? 3   DC  N N3    1 
ATOM   7228 C  C4    . DC  I 3 3   ? -22.718 1.113   18.258  1.00 39.83  ? 3   DC  N C4    1 
ATOM   7229 N  N4    . DC  I 3 3   ? -22.615 1.025   19.588  1.00 37.94  ? 3   DC  N N4    1 
ATOM   7230 C  C5    . DC  I 3 3   ? -22.710 -0.067  17.454  1.00 38.17  ? 3   DC  N C5    1 
ATOM   7231 C  C6    . DC  I 3 3   ? -22.817 0.085   16.128  1.00 40.87  ? 3   DC  N C6    1 
ATOM   7232 P  P     . DG  I 3 4   ? -20.812 2.001   10.220  1.00 42.91  ? 4   DG  N P     1 
ATOM   7233 O  OP1   . DG  I 3 4   ? -21.137 2.197   8.790   1.00 44.85  ? 4   DG  N OP1   1 
ATOM   7234 O  OP2   . DG  I 3 4   ? -19.868 0.934   10.622  1.00 40.54  ? 4   DG  N OP2   1 
ATOM   7235 O  "O5'" . DG  I 3 4   ? -20.290 3.390   10.811  1.00 40.78  ? 4   DG  N "O5'" 1 
ATOM   7236 C  "C5'" . DG  I 3 4   ? -21.136 4.527   10.765  1.00 36.43  ? 4   DG  N "C5'" 1 
ATOM   7237 C  "C4'" . DG  I 3 4   ? -20.680 5.589   11.747  1.00 38.16  ? 4   DG  N "C4'" 1 
ATOM   7238 O  "O4'" . DG  I 3 4   ? -20.853 5.114   13.107  1.00 32.60  ? 4   DG  N "O4'" 1 
ATOM   7239 C  "C3'" . DG  I 3 4   ? -19.210 6.007   11.626  1.00 41.49  ? 4   DG  N "C3'" 1 
ATOM   7240 O  "O3'" . DG  I 3 4   ? -19.126 7.421   11.627  1.00 43.49  ? 4   DG  N "O3'" 1 
ATOM   7241 C  "C2'" . DG  I 3 4   ? -18.569 5.410   12.881  1.00 41.37  ? 4   DG  N "C2'" 1 
ATOM   7242 C  "C1'" . DG  I 3 4   ? -19.727 5.493   13.855  1.00 43.73  ? 4   DG  N "C1'" 1 
ATOM   7243 N  N9    . DG  I 3 4   ? -19.606 4.607   15.009  1.00 39.69  ? 4   DG  N N9    1 
ATOM   7244 C  C8    . DG  I 3 4   ? -19.481 3.239   14.999  1.00 35.36  ? 4   DG  N C8    1 
ATOM   7245 N  N7    . DG  I 3 4   ? -19.399 2.718   16.193  1.00 37.58  ? 4   DG  N N7    1 
ATOM   7246 C  C5    . DG  I 3 4   ? -19.477 3.812   17.047  1.00 35.34  ? 4   DG  N C5    1 
ATOM   7247 C  C6    . DG  I 3 4   ? -19.442 3.872   18.460  1.00 40.57  ? 4   DG  N C6    1 
ATOM   7248 O  O6    . DG  I 3 4   ? -19.332 2.939   19.265  1.00 43.73  ? 4   DG  N O6    1 
ATOM   7249 N  N1    . DG  I 3 4   ? -19.552 5.180   18.925  1.00 36.80  ? 4   DG  N N1    1 
ATOM   7250 C  C2    . DG  I 3 4   ? -19.677 6.289   18.125  1.00 36.13  ? 4   DG  N C2    1 
ATOM   7251 N  N2    . DG  I 3 4   ? -19.771 7.469   18.755  1.00 42.77  ? 4   DG  N N2    1 
ATOM   7252 N  N3    . DG  I 3 4   ? -19.711 6.247   16.800  1.00 38.51  ? 4   DG  N N3    1 
ATOM   7253 C  C4    . DG  I 3 4   ? -19.606 4.980   16.333  1.00 32.98  ? 4   DG  N C4    1 
ATOM   7254 P  P     . DC  I 3 5   ? -17.744 8.159   11.279  1.00 43.99  ? 5   DC  N P     1 
ATOM   7255 O  OP1   . DC  I 3 5   ? -18.076 9.301   10.400  1.00 37.16  ? 5   DC  N OP1   1 
ATOM   7256 O  OP2   . DC  I 3 5   ? -16.775 7.137   10.825  1.00 41.43  ? 5   DC  N OP2   1 
ATOM   7257 O  "O5'" . DC  I 3 5   ? -17.245 8.720   12.693  1.00 43.23  ? 5   DC  N "O5'" 1 
ATOM   7258 C  "C5'" . DC  I 3 5   ? -16.986 10.109  12.854  1.00 39.45  ? 5   DC  N "C5'" 1 
ATOM   7259 C  "C4'" . DC  I 3 5   ? -16.924 10.487  14.324  1.00 35.02  ? 5   DC  N "C4'" 1 
ATOM   7260 O  "O4'" . DC  I 3 5   ? -17.310 9.349   15.141  1.00 40.85  ? 5   DC  N "O4'" 1 
ATOM   7261 C  "C3'" . DC  I 3 5   ? -15.542 10.921  14.824  1.00 40.11  ? 5   DC  N "C3'" 1 
ATOM   7262 O  "O3'" . DC  I 3 5   ? -15.659 12.094  15.613  1.00 40.79  ? 5   DC  N "O3'" 1 
ATOM   7263 C  "C2'" . DC  I 3 5   ? -15.077 9.730   15.660  1.00 38.04  ? 5   DC  N "C2'" 1 
ATOM   7264 C  "C1'" . DC  I 3 5   ? -16.397 9.218   16.204  1.00 35.76  ? 5   DC  N "C1'" 1 
ATOM   7265 N  N1    . DC  I 3 5   ? -16.356 7.790   16.628  1.00 36.75  ? 5   DC  N N1    1 
ATOM   7266 C  C2    . DC  I 3 5   ? -16.343 7.474   17.991  1.00 37.49  ? 5   DC  N C2    1 
ATOM   7267 O  O2    . DC  I 3 5   ? -16.367 8.390   18.823  1.00 40.23  ? 5   DC  N O2    1 
ATOM   7268 N  N3    . DC  I 3 5   ? -16.302 6.171   18.363  1.00 35.67  ? 5   DC  N N3    1 
ATOM   7269 C  C4    . DC  I 3 5   ? -16.277 5.213   17.436  1.00 35.38  ? 5   DC  N C4    1 
ATOM   7270 N  N4    . DC  I 3 5   ? -16.238 3.942   17.851  1.00 33.88  ? 5   DC  N N4    1 
ATOM   7271 C  C5    . DC  I 3 5   ? -16.288 5.515   16.041  1.00 38.48  ? 5   DC  N C5    1 
ATOM   7272 C  C6    . DC  I 3 5   ? -16.328 6.804   15.686  1.00 38.87  ? 5   DC  N C6    1 
ATOM   7273 P  P     . DC  I 3 6   ? -14.376 13.027  15.869  1.00 44.40  ? 6   DC  N P     1 
ATOM   7274 O  OP1   . DC  I 3 6   ? -14.878 14.398  16.110  1.00 44.55  ? 6   DC  N OP1   1 
ATOM   7275 O  OP2   . DC  I 3 6   ? -13.410 12.781  14.776  1.00 48.58  ? 6   DC  N OP2   1 
ATOM   7276 O  "O5'" . DC  I 3 6   ? -13.752 12.465  17.233  1.00 48.61  ? 6   DC  N "O5'" 1 
ATOM   7277 C  "C5'" . DC  I 3 6   ? -14.296 12.889  18.475  1.00 51.44  ? 6   DC  N "C5'" 1 
ATOM   7278 C  "C4'" . DC  I 3 6   ? -13.720 12.106  19.647  1.00 50.88  ? 6   DC  N "C4'" 1 
ATOM   7279 O  "O4'" . DC  I 3 6   ? -13.925 10.692  19.465  1.00 46.64  ? 6   DC  N "O4'" 1 
ATOM   7280 C  "C3'" . DC  I 3 6   ? -12.215 12.275  19.898  1.00 48.84  ? 6   DC  N "C3'" 1 
ATOM   7281 O  "O3'" . DC  I 3 6   ? -12.018 13.029  21.088  1.00 53.94  ? 6   DC  N "O3'" 1 
ATOM   7282 C  "C2'" . DC  I 3 6   ? -11.693 10.829  20.051  1.00 43.76  ? 6   DC  N "C2'" 1 
ATOM   7283 C  "C1'" . DC  I 3 6   ? -12.981 10.047  20.270  1.00 43.76  ? 6   DC  N "C1'" 1 
ATOM   7284 N  N1    . DC  I 3 6   ? -12.910 8.602   19.892  1.00 43.50  ? 6   DC  N N1    1 
ATOM   7285 C  C2    . DC  I 3 6   ? -12.692 7.643   20.888  1.00 38.61  ? 6   DC  N C2    1 
ATOM   7286 O  O2    . DC  I 3 6   ? -12.551 8.013   22.059  1.00 42.76  ? 6   DC  N O2    1 
ATOM   7287 N  N3    . DC  I 3 6   ? -12.638 6.334   20.539  1.00 41.62  ? 6   DC  N N3    1 
ATOM   7288 C  C4    . DC  I 3 6   ? -12.796 5.975   19.265  1.00 38.39  ? 6   DC  N C4    1 
ATOM   7289 N  N4    . DC  I 3 6   ? -12.734 4.672   18.972  1.00 35.05  ? 6   DC  N N4    1 
ATOM   7290 C  C5    . DC  I 3 6   ? -13.022 6.937   18.236  1.00 36.32  ? 6   DC  N C5    1 
ATOM   7291 C  C6    . DC  I 3 6   ? -13.074 8.227   18.591  1.00 38.31  ? 6   DC  N C6    1 
ATOM   7292 P  P     . DG  I 3 7   ? -10.649 13.832  21.334  1.00 55.59  ? 7   DG  N P     1 
ATOM   7293 O  OP1   . DG  I 3 7   ? -10.945 14.929  22.281  1.00 60.01  ? 7   DG  N OP1   1 
ATOM   7294 O  OP2   . DG  I 3 7   ? -10.048 14.140  20.017  1.00 58.85  ? 7   DG  N OP2   1 
ATOM   7295 O  "O5'" . DG  I 3 7   ? -9.711  12.768  22.068  1.00 48.67  ? 7   DG  N "O5'" 1 
ATOM   7296 C  "C5'" . DG  I 3 7   ? -10.085 12.260  23.339  1.00 51.77  ? 7   DG  N "C5'" 1 
ATOM   7297 C  "C4'" . DG  I 3 7   ? -9.125  11.175  23.791  1.00 53.83  ? 7   DG  N "C4'" 1 
ATOM   7298 O  "O4'" . DG  I 3 7   ? -9.549  9.897   23.268  1.00 50.46  ? 7   DG  N "O4'" 1 
ATOM   7299 C  "C3'" . DG  I 3 7   ? -7.670  11.362  23.343  1.00 53.71  ? 7   DG  N "C3'" 1 
ATOM   7300 O  "O3'" . DG  I 3 7   ? -6.832  11.493  24.494  1.00 71.29  ? 7   DG  N "O3'" 1 
ATOM   7301 C  "C2'" . DG  I 3 7   ? -7.354  10.093  22.531  1.00 48.32  ? 7   DG  N "C2'" 1 
ATOM   7302 C  "C1'" . DG  I 3 7   ? -8.412  9.117   23.021  1.00 43.80  ? 7   DG  N "C1'" 1 
ATOM   7303 N  N9    . DG  I 3 7   ? -8.764  8.087   22.047  1.00 40.25  ? 7   DG  N N9    1 
ATOM   7304 C  C8    . DG  I 3 7   ? -9.018  8.264   20.708  1.00 38.98  ? 7   DG  N C8    1 
ATOM   7305 N  N7    . DG  I 3 7   ? -9.316  7.156   20.085  1.00 39.25  ? 7   DG  N N7    1 
ATOM   7306 C  C5    . DG  I 3 7   ? -9.261  6.184   21.076  1.00 42.16  ? 7   DG  N C5    1 
ATOM   7307 C  C6    . DG  I 3 7   ? -9.492  4.790   21.000  1.00 42.35  ? 7   DG  N C6    1 
ATOM   7308 O  O6    . DG  I 3 7   ? -9.801  4.116   20.008  1.00 41.26  ? 7   DG  N O6    1 
ATOM   7309 N  N1    . DG  I 3 7   ? -9.332  4.174   22.238  1.00 48.91  ? 7   DG  N N1    1 
ATOM   7310 C  C2    . DG  I 3 7   ? -8.992  4.822   23.402  1.00 46.28  ? 7   DG  N C2    1 
ATOM   7311 N  N2    . DG  I 3 7   ? -8.885  4.058   24.499  1.00 48.01  ? 7   DG  N N2    1 
ATOM   7312 N  N3    . DG  I 3 7   ? -8.774  6.127   23.487  1.00 42.87  ? 7   DG  N N3    1 
ATOM   7313 C  C4    . DG  I 3 7   ? -8.925  6.742   22.289  1.00 42.90  ? 7   DG  N C4    1 
ATOM   7314 P  P     . DG  I 3 8   ? -5.230  11.421  24.374  1.00 70.71  ? 8   DG  N P     1 
ATOM   7315 O  OP1   . DG  I 3 8   ? -4.685  12.174  25.525  1.00 66.35  ? 8   DG  N OP1   1 
ATOM   7316 O  OP2   . DG  I 3 8   ? -4.819  11.803  23.004  1.00 59.01  ? 8   DG  N OP2   1 
ATOM   7317 O  "O5'" . DG  I 3 8   ? -4.910  9.871   24.594  1.00 59.84  ? 8   DG  N "O5'" 1 
ATOM   7318 C  "C5'" . DG  I 3 8   ? -5.554  9.169   25.650  1.00 57.64  ? 8   DG  N "C5'" 1 
ATOM   7319 C  "C4'" . DG  I 3 8   ? -5.117  7.718   25.687  1.00 55.70  ? 8   DG  N "C4'" 1 
ATOM   7320 O  "O4'" . DG  I 3 8   ? -5.755  6.986   24.618  1.00 57.38  ? 8   DG  N "O4'" 1 
ATOM   7321 C  "C3'" . DG  I 3 8   ? -3.611  7.490   25.525  1.00 56.12  ? 8   DG  N "C3'" 1 
ATOM   7322 O  "O3'" . DG  I 3 8   ? -3.095  6.891   26.704  1.00 60.74  ? 8   DG  N "O3'" 1 
ATOM   7323 C  "C2'" . DG  I 3 8   ? -3.491  6.558   24.306  1.00 49.79  ? 8   DG  N "C2'" 1 
ATOM   7324 C  "C1'" . DG  I 3 8   ? -4.891  5.968   24.198  1.00 51.41  ? 8   DG  N "C1'" 1 
ATOM   7325 N  N9    . DG  I 3 8   ? -5.265  5.581   22.840  1.00 47.65  ? 8   DG  N N9    1 
ATOM   7326 C  C8    . DG  I 3 8   ? -5.410  6.410   21.753  1.00 45.45  ? 8   DG  N C8    1 
ATOM   7327 N  N7    . DG  I 3 8   ? -5.760  5.784   20.664  1.00 41.15  ? 8   DG  N N7    1 
ATOM   7328 C  C5    . DG  I 3 8   ? -5.858  4.454   21.053  1.00 43.70  ? 8   DG  N C5    1 
ATOM   7329 C  C6    . DG  I 3 8   ? -6.203  3.306   20.299  1.00 46.19  ? 8   DG  N C6    1 
ATOM   7330 O  O6    . DG  I 3 8   ? -6.500  3.237   19.098  1.00 42.78  ? 8   DG  N O6    1 
ATOM   7331 N  N1    . DG  I 3 8   ? -6.182  2.152   21.079  1.00 48.67  ? 8   DG  N N1    1 
ATOM   7332 C  C2    . DG  I 3 8   ? -5.868  2.112   22.417  1.00 49.45  ? 8   DG  N C2    1 
ATOM   7333 N  N2    . DG  I 3 8   ? -5.902  0.904   22.999  1.00 42.58  ? 8   DG  N N2    1 
ATOM   7334 N  N3    . DG  I 3 8   ? -5.543  3.180   23.135  1.00 47.93  ? 8   DG  N N3    1 
ATOM   7335 C  C4    . DG  I 3 8   ? -5.558  4.313   22.390  1.00 45.38  ? 8   DG  N C4    1 
ATOM   7336 P  P     . DA  I 3 9   ? -1.511  6.827   26.963  1.00 59.47  ? 9   DA  N P     1 
ATOM   7337 O  OP1   . DA  I 3 9   ? -1.314  6.849   28.431  1.00 73.23  ? 9   DA  N OP1   1 
ATOM   7338 O  OP2   . DA  I 3 9   ? -0.862  7.853   26.116  1.00 53.04  ? 9   DA  N OP2   1 
ATOM   7339 O  "O5'" . DA  I 3 9   ? -1.110  5.384   26.411  1.00 51.71  ? 9   DA  N "O5'" 1 
ATOM   7340 C  "C5'" . DA  I 3 9   ? -1.930  4.272   26.736  1.00 58.90  ? 9   DA  N "C5'" 1 
ATOM   7341 C  "C4'" . DA  I 3 9   ? -1.617  3.079   25.856  1.00 58.15  ? 9   DA  N "C4'" 1 
ATOM   7342 O  "O4'" . DA  I 3 9   ? -2.208  3.250   24.539  1.00 64.83  ? 9   DA  N "O4'" 1 
ATOM   7343 C  "C3'" . DA  I 3 9   ? -0.125  2.811   25.617  1.00 62.70  ? 9   DA  N "C3'" 1 
ATOM   7344 O  "O3'" . DA  I 3 9   ? 0.147   1.455   25.883  1.00 73.14  ? 9   DA  N "O3'" 1 
ATOM   7345 C  "C2'" . DA  I 3 9   ? 0.048   3.118   24.127  1.00 60.04  ? 9   DA  N "C2'" 1 
ATOM   7346 C  "C1'" . DA  I 3 9   ? -1.314  2.706   23.609  1.00 63.37  ? 9   DA  N "C1'" 1 
ATOM   7347 N  N9    . DA  I 3 9   ? -1.628  3.196   22.268  1.00 53.03  ? 9   DA  N N9    1 
ATOM   7348 C  C8    . DA  I 3 9   ? -1.419  4.453   21.772  1.00 47.43  ? 9   DA  N C8    1 
ATOM   7349 N  N7    . DA  I 3 9   ? -1.797  4.597   20.521  1.00 50.72  ? 9   DA  N N7    1 
ATOM   7350 C  C5    . DA  I 3 9   ? -2.284  3.346   20.174  1.00 51.01  ? 9   DA  N C5    1 
ATOM   7351 C  C6    . DA  I 3 9   ? -2.837  2.836   18.980  1.00 45.66  ? 9   DA  N C6    1 
ATOM   7352 N  N6    . DA  I 3 9   ? -2.995  3.565   17.870  1.00 42.92  ? 9   DA  N N6    1 
ATOM   7353 N  N1    . DA  I 3 9   ? -3.223  1.542   18.972  1.00 43.00  ? 9   DA  N N1    1 
ATOM   7354 C  C2    . DA  I 3 9   ? -3.064  0.815   20.083  1.00 48.41  ? 9   DA  N C2    1 
ATOM   7355 N  N3    . DA  I 3 9   ? -2.560  1.182   21.260  1.00 49.18  ? 9   DA  N N3    1 
ATOM   7356 C  C4    . DA  I 3 9   ? -2.185  2.471   21.238  1.00 48.99  ? 9   DA  N C4    1 
ATOM   7357 P  P     . DA  I 3 10  ? 1.390   1.026   26.802  1.00 73.46  ? 10  DA  N P     1 
ATOM   7358 O  OP1   . DA  I 3 10  ? 1.130   1.504   28.180  1.00 70.04  ? 10  DA  N OP1   1 
ATOM   7359 O  OP2   . DA  I 3 10  ? 2.635   1.422   26.106  1.00 68.34  ? 10  DA  N OP2   1 
ATOM   7360 O  "O5'" . DA  I 3 10  ? 1.304   -0.567  26.782  1.00 70.61  ? 10  DA  N "O5'" 1 
ATOM   7361 C  "C5'" . DA  I 3 10  ? 0.028   -1.196  26.718  1.00 64.60  ? 10  DA  N "C5'" 1 
ATOM   7362 C  "C4'" . DA  I 3 10  ? 0.025   -2.313  25.691  1.00 66.10  ? 10  DA  N "C4'" 1 
ATOM   7363 O  "O4'" . DA  I 3 10  ? -0.319  -1.782  24.384  1.00 61.54  ? 10  DA  N "O4'" 1 
ATOM   7364 C  "C3'" . DA  I 3 10  ? 1.357   -3.035  25.528  1.00 64.62  ? 10  DA  N "C3'" 1 
ATOM   7365 O  "O3'" . DA  I 3 10  ? 1.137   -4.429  25.416  1.00 61.01  ? 10  DA  N "O3'" 1 
ATOM   7366 C  "C2'" . DA  I 3 10  ? 1.935   -2.441  24.242  1.00 69.09  ? 10  DA  N "C2'" 1 
ATOM   7367 C  "C1'" . DA  I 3 10  ? 0.681   -2.109  23.442  1.00 63.40  ? 10  DA  N "C1'" 1 
ATOM   7368 N  N9    . DA  I 3 10  ? 0.847   -0.964  22.550  1.00 62.55  ? 10  DA  N N9    1 
ATOM   7369 C  C8    . DA  I 3 10  ? 1.394   0.248   22.865  1.00 59.47  ? 10  DA  N C8    1 
ATOM   7370 N  N7    . DA  I 3 10  ? 1.405   1.100   21.868  1.00 58.28  ? 10  DA  N N7    1 
ATOM   7371 C  C5    . DA  I 3 10  ? 0.821   0.401   20.826  1.00 55.51  ? 10  DA  N C5    1 
ATOM   7372 C  C6    . DA  I 3 10  ? 0.539   0.751   19.491  1.00 52.53  ? 10  DA  N C6    1 
ATOM   7373 N  N6    . DA  I 3 10  ? 0.824   1.947   18.967  1.00 45.83  ? 10  DA  N N6    1 
ATOM   7374 N  N1    . DA  I 3 10  ? -0.051  -0.181  18.713  1.00 50.68  ? 10  DA  N N1    1 
ATOM   7375 C  C2    . DA  I 3 10  ? -0.336  -1.377  19.242  1.00 56.98  ? 10  DA  N C2    1 
ATOM   7376 N  N3    . DA  I 3 10  ? -0.119  -1.820  20.480  1.00 54.28  ? 10  DA  N N3    1 
ATOM   7377 C  C4    . DA  I 3 10  ? 0.468   -0.873  21.229  1.00 56.73  ? 10  DA  N C4    1 
ATOM   7378 P  P     . DC  I 3 11  ? 2.341   -5.459  25.674  1.00 74.27  ? 11  DC  N P     1 
ATOM   7379 O  OP1   . DC  I 3 11  ? 1.786   -6.628  26.393  1.00 68.18  ? 11  DC  N OP1   1 
ATOM   7380 O  OP2   . DC  I 3 11  ? 3.472   -4.701  26.254  1.00 74.67  ? 11  DC  N OP2   1 
ATOM   7381 O  "O5'" . DC  I 3 11  ? 2.761   -5.911  24.202  1.00 66.62  ? 11  DC  N "O5'" 1 
ATOM   7382 C  "C5'" . DC  I 3 11  ? 1.756   -6.190  23.241  1.00 68.33  ? 11  DC  N "C5'" 1 
ATOM   7383 C  "C4'" . DC  I 3 11  ? 2.326   -6.118  21.840  1.00 66.98  ? 11  DC  N "C4'" 1 
ATOM   7384 O  "O4'" . DC  I 3 11  ? 2.239   -4.771  21.348  1.00 65.15  ? 11  DC  N "O4'" 1 
ATOM   7385 C  "C3'" . DC  I 3 11  ? 3.802   -6.496  21.734  1.00 66.36  ? 11  DC  N "C3'" 1 
ATOM   7386 O  "O3'" . DC  I 3 11  ? 3.919   -7.818  21.218  1.00 67.46  ? 11  DC  N "O3'" 1 
ATOM   7387 C  "C2'" . DC  I 3 11  ? 4.405   -5.442  20.780  1.00 63.05  ? 11  DC  N "C2'" 1 
ATOM   7388 C  "C1'" . DC  I 3 11  ? 3.197   -4.619  20.340  1.00 63.11  ? 11  DC  N "C1'" 1 
ATOM   7389 N  N1    . DC  I 3 11  ? 3.487   -3.165  20.176  1.00 61.33  ? 11  DC  N N1    1 
ATOM   7390 C  C2    . DC  I 3 11  ? 3.187   -2.534  18.964  1.00 55.40  ? 11  DC  N C2    1 
ATOM   7391 O  O2    . DC  I 3 11  ? 2.687   -3.198  18.047  1.00 57.57  ? 11  DC  N O2    1 
ATOM   7392 N  N3    . DC  I 3 11  ? 3.454   -1.212  18.828  1.00 48.21  ? 11  DC  N N3    1 
ATOM   7393 C  C4    . DC  I 3 11  ? 3.994   -0.532  19.839  1.00 53.36  ? 11  DC  N C4    1 
ATOM   7394 N  N4    . DC  I 3 11  ? 4.240   0.769   19.657  1.00 47.08  ? 11  DC  N N4    1 
ATOM   7395 C  C5    . DC  I 3 11  ? 4.307   -1.157  21.083  1.00 56.74  ? 11  DC  N C5    1 
ATOM   7396 C  C6    . DC  I 3 11  ? 4.039   -2.462  21.206  1.00 56.78  ? 11  DC  N C6    1 
ATOM   7397 P  P     . DT  I 3 12  ? 5.350   -8.416  20.794  1.00 76.36  ? 12  DT  N P     1 
ATOM   7398 O  OP1   . DT  I 3 12  ? 5.265   -9.885  20.942  1.00 75.01  ? 12  DT  N OP1   1 
ATOM   7399 O  OP2   . DT  I 3 12  ? 6.414   -7.673  21.505  1.00 67.88  ? 12  DT  N OP2   1 
ATOM   7400 O  "O5'" . DT  I 3 12  ? 5.444   -8.076  19.235  1.00 76.46  ? 12  DT  N "O5'" 1 
ATOM   7401 C  "C5'" . DT  I 3 12  ? 4.331   -8.344  18.392  1.00 66.11  ? 12  DT  N "C5'" 1 
ATOM   7402 C  "C4'" . DT  I 3 12  ? 4.623   -7.941  16.958  1.00 60.62  ? 12  DT  N "C4'" 1 
ATOM   7403 O  "O4'" . DT  I 3 12  ? 4.629   -6.494  16.848  1.00 57.19  ? 12  DT  N "O4'" 1 
ATOM   7404 C  "C3'" . DT  I 3 12  ? 5.964   -8.422  16.411  1.00 60.52  ? 12  DT  N "C3'" 1 
ATOM   7405 O  "O3'" . DT  I 3 12  ? 5.799   -8.863  15.074  1.00 60.93  ? 12  DT  N "O3'" 1 
ATOM   7406 C  "C2'" . DT  I 3 12  ? 6.845   -7.175  16.494  1.00 56.51  ? 12  DT  N "C2'" 1 
ATOM   7407 C  "C1'" . DT  I 3 12  ? 5.836   -6.060  16.262  1.00 55.62  ? 12  DT  N "C1'" 1 
ATOM   7408 N  N1    . DT  I 3 12  ? 6.220   -4.768  16.899  1.00 59.10  ? 12  DT  N N1    1 
ATOM   7409 C  C2    . DT  I 3 12  ? 6.065   -3.597  16.194  1.00 55.85  ? 12  DT  N C2    1 
ATOM   7410 O  O2    . DT  I 3 12  ? 5.629   -3.554  15.057  1.00 59.12  ? 12  DT  N O2    1 
ATOM   7411 N  N3    . DT  I 3 12  ? 6.442   -2.468  16.870  1.00 53.68  ? 12  DT  N N3    1 
ATOM   7412 C  C4    . DT  I 3 12  ? 6.948   -2.393  18.155  1.00 52.28  ? 12  DT  N C4    1 
ATOM   7413 O  O4    . DT  I 3 12  ? 7.258   -1.326  18.676  1.00 51.04  ? 12  DT  N O4    1 
ATOM   7414 C  C5    . DT  I 3 12  ? 7.084   -3.657  18.840  1.00 62.06  ? 12  DT  N C5    1 
ATOM   7415 C  C7    . DT  I 3 12  ? 7.622   -3.703  20.240  1.00 51.55  ? 12  DT  N C7    1 
ATOM   7416 C  C6    . DT  I 3 12  ? 6.717   -4.770  18.186  1.00 59.88  ? 12  DT  N C6    1 
ATOM   7417 P  P     . DT  I 3 13  ? 6.968   -9.673  14.328  1.00 58.49  ? 13  DT  N P     1 
ATOM   7418 O  OP1   . DT  I 3 13  ? 6.349   -10.868 13.711  1.00 62.35  ? 13  DT  N OP1   1 
ATOM   7419 O  OP2   . DT  I 3 13  ? 8.100   -9.838  15.267  1.00 58.09  ? 13  DT  N OP2   1 
ATOM   7420 O  "O5'" . DT  I 3 13  ? 7.419   -8.673  13.167  1.00 61.29  ? 13  DT  N "O5'" 1 
ATOM   7421 C  "C5'" . DT  I 3 13  ? 6.426   -7.994  12.411  1.00 50.47  ? 13  DT  N "C5'" 1 
ATOM   7422 C  "C4'" . DT  I 3 13  ? 7.010   -6.795  11.687  1.00 52.23  ? 13  DT  N "C4'" 1 
ATOM   7423 O  "O4'" . DT  I 3 13  ? 7.309   -5.734  12.633  1.00 54.40  ? 13  DT  N "O4'" 1 
ATOM   7424 C  "C3'" . DT  I 3 13  ? 8.313   -7.060  10.923  1.00 51.15  ? 13  DT  N "C3'" 1 
ATOM   7425 O  "O3'" . DT  I 3 13  ? 8.267   -6.398  9.664   1.00 51.71  ? 13  DT  N "O3'" 1 
ATOM   7426 C  "C2'" . DT  I 3 13  ? 9.363   -6.419  11.832  1.00 51.71  ? 13  DT  N "C2'" 1 
ATOM   7427 C  "C1'" . DT  I 3 13  ? 8.578   -5.218  12.324  1.00 52.02  ? 13  DT  N "C1'" 1 
ATOM   7428 N  N1    . DT  I 3 13  ? 9.140   -4.552  13.533  1.00 54.73  ? 13  DT  N N1    1 
ATOM   7429 C  C2    . DT  I 3 13  ? 9.359   -3.194  13.501  1.00 49.03  ? 13  DT  N C2    1 
ATOM   7430 O  O2    . DT  I 3 13  ? 9.124   -2.505  12.525  1.00 45.39  ? 13  DT  N O2    1 
ATOM   7431 N  N3    . DT  I 3 13  ? 9.869   -2.668  14.656  1.00 48.64  ? 13  DT  N N3    1 
ATOM   7432 C  C4    . DT  I 3 13  ? 10.174  -3.347  15.819  1.00 51.48  ? 13  DT  N C4    1 
ATOM   7433 O  O4    . DT  I 3 13  ? 10.630  -2.781  16.808  1.00 56.44  ? 13  DT  N O4    1 
ATOM   7434 C  C5    . DT  I 3 13  ? 9.919   -4.769  15.790  1.00 53.44  ? 13  DT  N C5    1 
ATOM   7435 C  C7    . DT  I 3 13  ? 10.211  -5.612  16.995  1.00 51.71  ? 13  DT  N C7    1 
ATOM   7436 C  C6    . DT  I 3 13  ? 9.418   -5.297  14.661  1.00 56.27  ? 13  DT  N C6    1 
ATOM   7437 P  P     . DA  I 3 14  ? 7.463   -7.019  8.416   1.00 45.22  ? 14  DA  N P     1 
ATOM   7438 O  OP1   . DA  I 3 14  ? 6.145   -7.516  8.866   1.00 51.89  ? 14  DA  N OP1   1 
ATOM   7439 O  OP2   . DA  I 3 14  ? 8.381   -7.936  7.707   1.00 49.80  ? 14  DA  N OP2   1 
ATOM   7440 O  "O5'" . DA  I 3 14  ? 7.209   -5.748  7.478   1.00 44.37  ? 14  DA  N "O5'" 1 
ATOM   7441 C  "C5'" . DA  I 3 14  ? 6.272   -4.748  7.877   1.00 40.47  ? 14  DA  N "C5'" 1 
ATOM   7442 C  "C4'" . DA  I 3 14  ? 6.799   -3.345  7.602   1.00 41.52  ? 14  DA  N "C4'" 1 
ATOM   7443 O  "O4'" . DA  I 3 14  ? 7.787   -2.983  8.601   1.00 41.27  ? 14  DA  N "O4'" 1 
ATOM   7444 C  "C3'" . DA  I 3 14  ? 7.480   -3.145  6.253   1.00 42.13  ? 14  DA  N "C3'" 1 
ATOM   7445 O  "O3'" . DA  I 3 14  ? 7.224   -1.826  5.787   1.00 35.80  ? 14  DA  N "O3'" 1 
ATOM   7446 C  "C2'" . DA  I 3 14  ? 8.956   -3.339  6.594   1.00 38.47  ? 14  DA  N "C2'" 1 
ATOM   7447 C  "C1'" . DA  I 3 14  ? 9.026   -2.707  7.978   1.00 42.00  ? 14  DA  N "C1'" 1 
ATOM   7448 N  N9    . DA  I 3 14  ? 10.082  -3.248  8.825   1.00 44.08  ? 14  DA  N N9    1 
ATOM   7449 C  C8    . DA  I 3 14  ? 10.496  -4.548  8.899   1.00 46.02  ? 14  DA  N C8    1 
ATOM   7450 N  N7    . DA  I 3 14  ? 11.459  -4.748  9.769   1.00 46.21  ? 14  DA  N N7    1 
ATOM   7451 C  C5    . DA  I 3 14  ? 11.686  -3.492  10.306  1.00 41.87  ? 14  DA  N C5    1 
ATOM   7452 C  C6    . DA  I 3 14  ? 12.584  -3.026  11.285  1.00 43.57  ? 14  DA  N C6    1 
ATOM   7453 N  N6    . DA  I 3 14  ? 13.455  -3.816  11.919  1.00 49.50  ? 14  DA  N N6    1 
ATOM   7454 N  N1    . DA  I 3 14  ? 12.552  -1.711  11.589  1.00 40.81  ? 14  DA  N N1    1 
ATOM   7455 C  C2    . DA  I 3 14  ? 11.678  -0.924  10.952  1.00 39.18  ? 14  DA  N C2    1 
ATOM   7456 N  N3    . DA  I 3 14  ? 10.787  -1.246  10.017  1.00 40.10  ? 14  DA  N N3    1 
ATOM   7457 C  C4    . DA  I 3 14  ? 10.843  -2.557  9.737   1.00 37.58  ? 14  DA  N C4    1 
ATOM   7458 P  P     . DC  I 3 15  ? 7.333   -1.480  4.224   1.00 36.10  ? 15  DC  N P     1 
ATOM   7459 O  OP1   . DC  I 3 15  ? 6.615   -0.221  3.996   1.00 31.19  ? 15  DC  N OP1   1 
ATOM   7460 O  OP2   . DC  I 3 15  ? 6.926   -2.667  3.448   1.00 38.28  ? 15  DC  N OP2   1 
ATOM   7461 O  "O5'" . DC  I 3 15  ? 8.894   -1.222  3.992   1.00 37.37  ? 15  DC  N "O5'" 1 
ATOM   7462 C  "C5'" . DC  I 3 15  ? 9.400   0.109   3.943   1.00 32.31  ? 15  DC  N "C5'" 1 
ATOM   7463 C  "C4'" . DC  I 3 15  ? 9.656   0.653   5.338   1.00 31.54  ? 15  DC  N "C4'" 1 
ATOM   7464 O  "O4'" . DC  I 3 15  ? 10.304  -0.363  6.153   1.00 39.39  ? 15  DC  N "O4'" 1 
ATOM   7465 C  "C3'" . DC  I 3 15  ? 10.582  1.869   5.388   1.00 37.55  ? 15  DC  N "C3'" 1 
ATOM   7466 O  "O3'" . DC  I 3 15  ? 10.156  2.760   6.400   1.00 38.16  ? 15  DC  N "O3'" 1 
ATOM   7467 C  "C2'" . DC  I 3 15  ? 11.925  1.246   5.742   1.00 37.50  ? 15  DC  N "C2'" 1 
ATOM   7468 C  "C1'" . DC  I 3 15  ? 11.475  0.183   6.721   1.00 34.82  ? 15  DC  N "C1'" 1 
ATOM   7469 N  N1    . DC  I 3 15  ? 12.467  -0.903  6.923   1.00 35.03  ? 15  DC  N N1    1 
ATOM   7470 C  C2    . DC  I 3 15  ? 13.465  -0.755  7.894   1.00 36.77  ? 15  DC  N C2    1 
ATOM   7471 O  O2    . DC  I 3 15  ? 13.505  0.283   8.568   1.00 37.18  ? 15  DC  N O2    1 
ATOM   7472 N  N3    . DC  I 3 15  ? 14.361  -1.755  8.069   1.00 39.79  ? 15  DC  N N3    1 
ATOM   7473 C  C4    . DC  I 3 15  ? 14.285  -2.858  7.324   1.00 41.14  ? 15  DC  N C4    1 
ATOM   7474 N  N4    . DC  I 3 15  ? 15.191  -3.817  7.533   1.00 46.68  ? 15  DC  N N4    1 
ATOM   7475 C  C5    . DC  I 3 15  ? 13.276  -3.026  6.330   1.00 40.83  ? 15  DC  N C5    1 
ATOM   7476 C  C6    . DC  I 3 15  ? 12.397  -2.033  6.166   1.00 37.97  ? 15  DC  N C6    1 
ATOM   7477 P  P     . DC  I 3 16  ? 10.980  4.111   6.662   1.00 35.92  ? 16  DC  N P     1 
ATOM   7478 O  OP1   . DC  I 3 16  ? 11.904  3.855   7.793   1.00 40.33  ? 16  DC  N OP1   1 
ATOM   7479 O  OP2   . DC  I 3 16  ? 9.976   5.181   6.791   1.00 30.60  ? 16  DC  N OP2   1 
ATOM   7480 O  "O5'" . DC  I 3 16  ? 11.777  4.330   5.282   1.00 38.55  ? 16  DC  N "O5'" 1 
ATOM   7481 C  "C5'" . DC  I 3 16  ? 12.680  5.424   5.112   1.00 34.65  ? 16  DC  N "C5'" 1 
ATOM   7482 C  "C4'" . DC  I 3 16  ? 13.920  5.246   5.972   1.00 39.21  ? 16  DC  N "C4'" 1 
ATOM   7483 O  "O4'" . DC  I 3 16  ? 14.190  3.839   6.169   1.00 32.92  ? 16  DC  N "O4'" 1 
ATOM   7484 C  "C3'" . DC  I 3 16  ? 15.212  5.852   5.406   1.00 37.54  ? 16  DC  N "C3'" 1 
ATOM   7485 O  "O3'" . DC  I 3 16  ? 15.715  6.817   6.317   1.00 42.13  ? 16  DC  N "O3'" 1 
ATOM   7486 C  "C2'" . DC  I 3 16  ? 16.161  4.647   5.272   1.00 36.83  ? 16  DC  N "C2'" 1 
ATOM   7487 C  "C1'" . DC  I 3 16  ? 15.575  3.681   6.288   1.00 37.77  ? 16  DC  N "C1'" 1 
ATOM   7488 N  N1    . DC  I 3 16  ? 15.918  2.246   6.048   1.00 36.99  ? 16  DC  N N1    1 
ATOM   7489 C  C2    . DC  I 3 16  ? 16.652  1.544   7.011   1.00 35.55  ? 16  DC  N C2    1 
ATOM   7490 O  O2    . DC  I 3 16  ? 17.010  2.129   8.039   1.00 42.87  ? 16  DC  N O2    1 
ATOM   7491 N  N3    . DC  I 3 16  ? 16.952  0.242   6.788   1.00 38.05  ? 16  DC  N N3    1 
ATOM   7492 C  C4    . DC  I 3 16  ? 16.547  -0.354  5.666   1.00 37.47  ? 16  DC  N C4    1 
ATOM   7493 N  N4    . DC  I 3 16  ? 16.867  -1.641  5.492   1.00 32.86  ? 16  DC  N N4    1 
ATOM   7494 C  C5    . DC  I 3 16  ? 15.796  0.343   4.673   1.00 32.11  ? 16  DC  N C5    1 
ATOM   7495 C  C6    . DC  I 3 16  ? 15.506  1.629   4.904   1.00 33.56  ? 16  DC  N C6    1 
ATOM   7496 P  P     . DC  I 3 17  ? 16.935  7.776   5.904   1.00 39.01  ? 17  DC  N P     1 
ATOM   7497 O  OP1   . DC  I 3 17  ? 16.812  9.009   6.712   1.00 42.96  ? 17  DC  N OP1   1 
ATOM   7498 O  OP2   . DC  I 3 17  ? 16.976  7.865   4.427   1.00 39.98  ? 17  DC  N OP2   1 
ATOM   7499 O  "O5'" . DC  I 3 17  ? 18.227  6.974   6.394   1.00 37.86  ? 17  DC  N "O5'" 1 
ATOM   7500 C  "C5'" . DC  I 3 17  ? 18.333  6.579   7.754   1.00 36.15  ? 17  DC  N "C5'" 1 
ATOM   7501 C  "C4'" . DC  I 3 17  ? 19.595  5.769   7.989   1.00 41.50  ? 17  DC  N "C4'" 1 
ATOM   7502 O  "O4'" . DC  I 3 17  ? 19.382  4.399   7.584   1.00 41.60  ? 17  DC  N "O4'" 1 
ATOM   7503 C  "C3'" . DC  I 3 17  ? 20.833  6.257   7.230   1.00 40.70  ? 17  DC  N "C3'" 1 
ATOM   7504 O  "O3'" . DC  I 3 17  ? 21.854  6.597   8.158   1.00 49.59  ? 17  DC  N "O3'" 1 
ATOM   7505 C  "C2'" . DC  I 3 17  ? 21.234  5.063   6.346   1.00 36.65  ? 17  DC  N "C2'" 1 
ATOM   7506 C  "C1'" . DC  I 3 17  ? 20.581  3.892   7.064   1.00 40.84  ? 17  DC  N "C1'" 1 
ATOM   7507 N  N1    . DC  I 3 17  ? 20.251  2.739   6.175   1.00 40.01  ? 17  DC  N N1    1 
ATOM   7508 C  C2    . DC  I 3 17  ? 20.728  1.462   6.492   1.00 44.79  ? 17  DC  N C2    1 
ATOM   7509 O  O2    . DC  I 3 17  ? 21.427  1.313   7.502   1.00 43.21  ? 17  DC  N O2    1 
ATOM   7510 N  N3    . DC  I 3 17  ? 20.412  0.423   5.679   1.00 43.30  ? 17  DC  N N3    1 
ATOM   7511 C  C4    . DC  I 3 17  ? 19.653  0.625   4.600   1.00 39.45  ? 17  DC  N C4    1 
ATOM   7512 N  N4    . DC  I 3 17  ? 19.368  -0.430  3.829   1.00 32.75  ? 17  DC  N N4    1 
ATOM   7513 C  C5    . DC  I 3 17  ? 19.156  1.918   4.263   1.00 38.95  ? 17  DC  N C5    1 
ATOM   7514 C  C6    . DC  I 3 17  ? 19.474  2.935   5.072   1.00 39.81  ? 17  DC  N C6    1 
ATOM   7515 P  P     . DG  I 3 18  ? 23.116  7.482   7.702   1.00 52.01  ? 18  DG  N P     1 
ATOM   7516 O  OP1   . DG  I 3 18  ? 23.616  8.177   8.909   1.00 47.46  ? 18  DG  N OP1   1 
ATOM   7517 O  OP2   . DG  I 3 18  ? 22.737  8.265   6.505   1.00 45.87  ? 18  DG  N OP2   1 
ATOM   7518 O  "O5'" . DG  I 3 18  ? 24.195  6.391   7.262   1.00 43.96  ? 18  DG  N "O5'" 1 
ATOM   7519 C  "C5'" . DG  I 3 18  ? 24.536  5.347   8.160   1.00 38.07  ? 18  DG  N "C5'" 1 
ATOM   7520 C  "C4'" . DG  I 3 18  ? 25.391  4.297   7.478   1.00 46.40  ? 18  DG  N "C4'" 1 
ATOM   7521 O  "O4'" . DG  I 3 18  ? 24.550  3.370   6.739   1.00 41.29  ? 18  DG  N "O4'" 1 
ATOM   7522 C  "C3'" . DG  I 3 18  ? 26.410  4.838   6.466   1.00 47.53  ? 18  DG  N "C3'" 1 
ATOM   7523 O  "O3'" . DG  I 3 18  ? 27.646  4.177   6.655   1.00 62.41  ? 18  DG  N "O3'" 1 
ATOM   7524 C  "C2'" . DG  I 3 18  ? 25.789  4.456   5.123   1.00 39.33  ? 18  DG  N "C2'" 1 
ATOM   7525 C  "C1'" . DG  I 3 18  ? 25.159  3.131   5.497   1.00 42.73  ? 18  DG  N "C1'" 1 
ATOM   7526 N  N9    . DG  I 3 18  ? 24.162  2.645   4.551   1.00 41.17  ? 18  DG  N N9    1 
ATOM   7527 C  C8    . DG  I 3 18  ? 23.356  3.393   3.728   1.00 42.72  ? 18  DG  N C8    1 
ATOM   7528 N  N7    . DG  I 3 18  ? 22.565  2.671   2.981   1.00 43.78  ? 18  DG  N N7    1 
ATOM   7529 C  C5    . DG  I 3 18  ? 22.870  1.361   3.332   1.00 42.12  ? 18  DG  N C5    1 
ATOM   7530 C  C6    . DG  I 3 18  ? 22.337  0.139   2.856   1.00 37.88  ? 18  DG  N C6    1 
ATOM   7531 O  O6    . DG  I 3 18  ? 21.456  -0.033  2.002   1.00 40.19  ? 18  DG  N O6    1 
ATOM   7532 N  N1    . DG  I 3 18  ? 22.927  -0.959  3.479   1.00 37.92  ? 18  DG  N N1    1 
ATOM   7533 C  C2    . DG  I 3 18  ? 23.910  -0.885  4.438   1.00 44.99  ? 18  DG  N C2    1 
ATOM   7534 N  N2    . DG  I 3 18  ? 24.359  -2.052  4.923   1.00 37.77  ? 18  DG  N N2    1 
ATOM   7535 N  N3    . DG  I 3 18  ? 24.418  0.253   4.890   1.00 41.99  ? 18  DG  N N3    1 
ATOM   7536 C  C4    . DG  I 3 18  ? 23.853  1.330   4.294   1.00 40.67  ? 18  DG  N C4    1 
ATOM   7537 P  P     . DG  I 3 19  ? 29.033  4.927   6.355   1.00 56.49  ? 19  DG  N P     1 
ATOM   7538 O  OP1   . DG  I 3 19  ? 29.330  5.793   7.518   1.00 53.49  ? 19  DG  N OP1   1 
ATOM   7539 O  OP2   . DG  I 3 19  ? 28.953  5.511   4.997   1.00 50.83  ? 19  DG  N OP2   1 
ATOM   7540 O  "O5'" . DG  I 3 19  ? 30.093  3.733   6.312   1.00 54.20  ? 19  DG  N "O5'" 1 
ATOM   7541 C  "C5'" . DG  I 3 19  ? 30.028  2.697   7.285   1.00 48.70  ? 19  DG  N "C5'" 1 
ATOM   7542 C  "C4'" . DG  I 3 19  ? 30.247  1.339   6.641   1.00 60.38  ? 19  DG  N "C4'" 1 
ATOM   7543 O  "O4'" . DG  I 3 19  ? 29.042  0.930   5.941   1.00 54.34  ? 19  DG  N "O4'" 1 
ATOM   7544 C  "C3'" . DG  I 3 19  ? 31.382  1.287   5.616   1.00 59.12  ? 19  DG  N "C3'" 1 
ATOM   7545 O  "O3'" . DG  I 3 19  ? 32.200  0.151   5.858   1.00 63.31  ? 19  DG  N "O3'" 1 
ATOM   7546 C  "C2'" . DG  I 3 19  ? 30.655  1.187   4.274   1.00 53.42  ? 19  DG  N "C2'" 1 
ATOM   7547 C  "C1'" . DG  I 3 19  ? 29.382  0.451   4.662   1.00 51.75  ? 19  DG  N "C1'" 1 
ATOM   7548 N  N9    . DG  I 3 19  ? 28.264  0.711   3.759   1.00 48.92  ? 19  DG  N N9    1 
ATOM   7549 C  C8    . DG  I 3 19  ? 27.732  1.935   3.433   1.00 44.09  ? 19  DG  N C8    1 
ATOM   7550 N  N7    . DG  I 3 19  ? 26.733  1.862   2.598   1.00 43.30  ? 19  DG  N N7    1 
ATOM   7551 C  C5    . DG  I 3 19  ? 26.592  0.503   2.353   1.00 44.71  ? 19  DG  N C5    1 
ATOM   7552 C  C6    . DG  I 3 19  ? 25.671  -0.184  1.525   1.00 45.95  ? 19  DG  N C6    1 
ATOM   7553 O  O6    . DG  I 3 19  ? 24.768  0.292   0.821   1.00 44.21  ? 19  DG  N O6    1 
ATOM   7554 N  N1    . DG  I 3 19  ? 25.873  -1.561  1.563   1.00 46.82  ? 19  DG  N N1    1 
ATOM   7555 C  C2    . DG  I 3 19  ? 26.841  -2.194  2.307   1.00 50.62  ? 19  DG  N C2    1 
ATOM   7556 N  N2    . DG  I 3 19  ? 26.881  -3.531  2.214   1.00 50.04  ? 19  DG  N N2    1 
ATOM   7557 N  N3    . DG  I 3 19  ? 27.710  -1.563  3.086   1.00 50.40  ? 19  DG  N N3    1 
ATOM   7558 C  C4    . DG  I 3 19  ? 27.527  -0.220  3.060   1.00 48.67  ? 19  DG  N C4    1 
ATOM   7559 P  P     . DC  I 3 20  ? 33.605  -0.011  5.096   1.00 69.39  ? 20  DC  N P     1 
ATOM   7560 O  OP1   . DC  I 3 20  ? 34.577  -0.557  6.069   1.00 67.79  ? 20  DC  N OP1   1 
ATOM   7561 O  OP2   . DC  I 3 20  ? 33.896  1.261   4.397   1.00 57.97  ? 20  DC  N OP2   1 
ATOM   7562 O  "O5'" . DC  I 3 20  ? 33.307  -1.123  3.989   1.00 57.18  ? 20  DC  N "O5'" 1 
ATOM   7563 C  "C5'" . DC  I 3 20  ? 32.738  -2.365  4.376   1.00 55.22  ? 20  DC  N "C5'" 1 
ATOM   7564 C  "C4'" . DC  I 3 20  ? 32.453  -3.231  3.165   1.00 63.41  ? 20  DC  N "C4'" 1 
ATOM   7565 O  "O4'" . DC  I 3 20  ? 31.228  -2.789  2.520   1.00 55.84  ? 20  DC  N "O4'" 1 
ATOM   7566 C  "C3'" . DC  I 3 20  ? 33.536  -3.211  2.083   1.00 59.08  ? 20  DC  N "C3'" 1 
ATOM   7567 O  "O3'" . DC  I 3 20  ? 33.760  -4.529  1.617   1.00 70.53  ? 20  DC  N "O3'" 1 
ATOM   7568 C  "C2'" . DC  I 3 20  ? 32.920  -2.332  0.994   1.00 60.84  ? 20  DC  N "C2'" 1 
ATOM   7569 C  "C1'" . DC  I 3 20  ? 31.451  -2.690  1.134   1.00 60.23  ? 20  DC  N "C1'" 1 
ATOM   7570 N  N1    . DC  I 3 20  ? 30.520  -1.671  0.571   1.00 55.14  ? 20  DC  N N1    1 
ATOM   7571 C  C2    . DC  I 3 20  ? 29.535  -2.067  -0.340  1.00 53.90  ? 20  DC  N C2    1 
ATOM   7572 O  O2    . DC  I 3 20  ? 29.457  -3.259  -0.663  1.00 54.32  ? 20  DC  N O2    1 
ATOM   7573 N  N3    . DC  I 3 20  ? 28.693  -1.132  -0.844  1.00 48.44  ? 20  DC  N N3    1 
ATOM   7574 C  C4    . DC  I 3 20  ? 28.810  0.143   -0.470  1.00 55.40  ? 20  DC  N C4    1 
ATOM   7575 N  N4    . DC  I 3 20  ? 27.956  1.029   -0.995  1.00 45.22  ? 20  DC  N N4    1 
ATOM   7576 C  C5    . DC  I 3 20  ? 29.808  0.566   0.457   1.00 52.91  ? 20  DC  N C5    1 
ATOM   7577 C  C6    . DC  I 3 20  ? 30.633  -0.365  0.948   1.00 51.95  ? 20  DC  N C6    1 
ATOM   7578 P  P     . DA  I 3 21  ? 35.203  -4.966  1.065   1.00 69.68  ? 21  DA  N P     1 
ATOM   7579 O  OP1   . DA  I 3 21  ? 35.706  -6.042  1.949   1.00 70.66  ? 21  DA  N OP1   1 
ATOM   7580 O  OP2   . DA  I 3 21  ? 36.009  -3.742  0.862   1.00 65.57  ? 21  DA  N OP2   1 
ATOM   7581 O  "O5'" . DA  I 3 21  ? 34.878  -5.579  -0.374  1.00 68.81  ? 21  DA  N "O5'" 1 
ATOM   7582 C  "C5'" . DA  I 3 21  ? 33.701  -6.350  -0.558  1.00 69.21  ? 21  DA  N "C5'" 1 
ATOM   7583 C  "C4'" . DA  I 3 21  ? 33.154  -6.176  -1.962  1.00 64.25  ? 21  DA  N "C4'" 1 
ATOM   7584 O  "O4'" . DA  I 3 21  ? 32.334  -4.977  -2.038  1.00 69.85  ? 21  DA  N "O4'" 1 
ATOM   7585 C  "C3'" . DA  I 3 21  ? 34.212  -6.026  -3.058  1.00 71.15  ? 21  DA  N "C3'" 1 
ATOM   7586 O  "O3'" . DA  I 3 21  ? 33.820  -6.784  -4.190  1.00 79.85  ? 21  DA  N "O3'" 1 
ATOM   7587 C  "C2'" . DA  I 3 21  ? 34.169  -4.532  -3.365  1.00 68.14  ? 21  DA  N "C2'" 1 
ATOM   7588 C  "C1'" . DA  I 3 21  ? 32.686  -4.281  -3.209  1.00 62.82  ? 21  DA  N "C1'" 1 
ATOM   7589 N  N9    . DA  I 3 21  ? 32.326  -2.875  -3.062  1.00 62.82  ? 21  DA  N N9    1 
ATOM   7590 C  C8    . DA  I 3 21  ? 33.025  -1.902  -2.404  1.00 58.20  ? 21  DA  N C8    1 
ATOM   7591 N  N7    . DA  I 3 21  ? 32.451  -0.721  -2.444  1.00 56.19  ? 21  DA  N N7    1 
ATOM   7592 C  C5    . DA  I 3 21  ? 31.298  -0.937  -3.182  1.00 53.72  ? 21  DA  N C5    1 
ATOM   7593 C  C6    . DA  I 3 21  ? 30.252  -0.082  -3.585  1.00 50.76  ? 21  DA  N C6    1 
ATOM   7594 N  N6    . DA  I 3 21  ? 30.206  1.219   -3.282  1.00 46.55  ? 21  DA  N N6    1 
ATOM   7595 N  N1    . DA  I 3 21  ? 29.251  -0.619  -4.315  1.00 48.12  ? 21  DA  N N1    1 
ATOM   7596 C  C2    . DA  I 3 21  ? 29.301  -1.922  -4.616  1.00 51.17  ? 21  DA  N C2    1 
ATOM   7597 N  N3    . DA  I 3 21  ? 30.228  -2.821  -4.295  1.00 55.87  ? 21  DA  N N3    1 
ATOM   7598 C  C4    . DA  I 3 21  ? 31.208  -2.258  -3.571  1.00 57.60  ? 21  DA  N C4    1 
ATOM   7599 P  P     . DA  I 3 22  ? 34.879  -7.713  -4.957  1.00 84.08  ? 22  DA  N P     1 
ATOM   7600 O  OP1   . DA  I 3 22  ? 35.060  -8.953  -4.172  1.00 76.07  ? 22  DA  N OP1   1 
ATOM   7601 O  OP2   . DA  I 3 22  ? 36.032  -6.869  -5.321  1.00 76.20  ? 22  DA  N OP2   1 
ATOM   7602 O  "O5'" . DA  I 3 22  ? 34.127  -8.136  -6.289  1.00 77.76  ? 22  DA  N "O5'" 1 
ATOM   7603 C  "C5'" . DA  I 3 22  ? 32.790  -8.652  -6.231  1.00 77.03  ? 22  DA  N "C5'" 1 
ATOM   7604 C  "C4'" . DA  I 3 22  ? 31.945  -7.964  -7.281  1.00 81.41  ? 22  DA  N "C4'" 1 
ATOM   7605 O  "O4'" . DA  I 3 22  ? 31.664  -6.607  -6.838  1.00 76.57  ? 22  DA  N "O4'" 1 
ATOM   7606 C  "C3'" . DA  I 3 22  ? 32.636  -7.823  -8.651  1.00 79.88  ? 22  DA  N "C3'" 1 
ATOM   7607 O  "O3'" . DA  I 3 22  ? 31.734  -8.092  -9.749  1.00 80.96  ? 22  DA  N "O3'" 1 
ATOM   7608 C  "C2'" . DA  I 3 22  ? 33.115  -6.388  -8.645  1.00 75.72  ? 22  DA  N "C2'" 1 
ATOM   7609 C  "C1'" . DA  I 3 22  ? 32.012  -5.707  -7.861  1.00 69.62  ? 22  DA  N "C1'" 1 
ATOM   7610 N  N9    . DA  I 3 22  ? 32.431  -4.369  -7.347  1.00 73.19  ? 22  DA  N N9    1 
ATOM   7611 C  C8    . DA  I 3 22  ? 33.576  -4.071  -6.651  1.00 68.54  ? 22  DA  N C8    1 
ATOM   7612 N  N7    . DA  I 3 22  ? 33.719  -2.795  -6.377  1.00 66.58  ? 22  DA  N N7    1 
ATOM   7613 C  C5    . DA  I 3 22  ? 32.603  -2.197  -6.941  1.00 65.52  ? 22  DA  N C5    1 
ATOM   7614 C  C6    . DA  I 3 22  ? 32.166  -0.849  -6.998  1.00 57.80  ? 22  DA  N C6    1 
ATOM   7615 N  N6    . DA  I 3 22  ? 32.834  0.170   -6.456  1.00 59.57  ? 22  DA  N N6    1 
ATOM   7616 N  N1    . DA  I 3 22  ? 31.006  -0.595  -7.638  1.00 53.99  ? 22  DA  N N1    1 
ATOM   7617 C  C2    . DA  I 3 22  ? 30.336  -1.622  -8.182  1.00 57.99  ? 22  DA  N C2    1 
ATOM   7618 N  N3    . DA  I 3 22  ? 30.644  -2.920  -8.194  1.00 60.08  ? 22  DA  N N3    1 
ATOM   7619 C  C4    . DA  I 3 22  ? 31.798  -3.146  -7.548  1.00 66.81  ? 22  DA  N C4    1 
ATOM   7620 P  P     . DG  I 3 23  ? 32.296  -8.355  -11.245 1.00 87.31  ? 23  DG  N P     1 
ATOM   7621 O  OP1   . DG  I 3 23  ? 31.573  -9.509  -11.820 1.00 78.91  ? 23  DG  N OP1   1 
ATOM   7622 O  OP2   . DG  I 3 23  ? 33.774  -8.415  -11.198 1.00 79.59  ? 23  DG  N OP2   1 
ATOM   7623 O  "O5'" . DG  I 3 23  ? 31.910  -7.027  -12.076 1.00 82.79  ? 23  DG  N "O5'" 1 
ATOM   7624 C  "C5'" . DG  I 3 23  ? 30.668  -6.339  -11.848 1.00 69.26  ? 23  DG  N "C5'" 1 
ATOM   7625 C  "C4'" . DG  I 3 23  ? 30.465  -5.201  -12.843 1.00 71.23  ? 23  DG  N "C4'" 1 
ATOM   7626 O  "O4'" . DG  I 3 23  ? 30.858  -3.944  -12.242 1.00 71.79  ? 23  DG  N "O4'" 1 
ATOM   7627 C  "C3'" . DG  I 3 23  ? 31.247  -5.303  -14.144 1.00 76.26  ? 23  DG  N "C3'" 1 
ATOM   7628 O  "O3'" . DG  I 3 23  ? 30.431  -4.829  -15.178 1.00 78.41  ? 23  DG  N "O3'" 1 
ATOM   7629 C  "C2'" . DG  I 3 23  ? 32.443  -4.369  -13.901 1.00 72.63  ? 23  DG  N "C2'" 1 
ATOM   7630 C  "C1'" . DG  I 3 23  ? 31.776  -3.272  -13.077 1.00 75.00  ? 23  DG  N "C1'" 1 
ATOM   7631 N  N9    . DG  I 3 23  ? 32.673  -2.533  -12.199 1.00 63.52  ? 23  DG  N N9    1 
ATOM   7632 C  C8    . DG  I 3 23  ? 33.875  -2.968  -11.694 1.00 64.32  ? 23  DG  N C8    1 
ATOM   7633 N  N7    . DG  I 3 23  ? 34.438  -2.111  -10.883 1.00 67.51  ? 23  DG  N N7    1 
ATOM   7634 C  C5    . DG  I 3 23  ? 33.544  -1.041  -10.830 1.00 60.73  ? 23  DG  N C5    1 
ATOM   7635 C  C6    . DG  I 3 23  ? 33.632  0.185   -10.121 1.00 53.54  ? 23  DG  N C6    1 
ATOM   7636 O  O6    . DG  I 3 23  ? 34.547  0.576   -9.379  1.00 62.62  ? 23  DG  N O6    1 
ATOM   7637 N  N1    . DG  I 3 23  ? 32.524  1.004   -10.343 1.00 54.86  ? 23  DG  N N1    1 
ATOM   7638 C  C2    . DG  I 3 23  ? 31.455  0.686   -11.144 1.00 58.32  ? 23  DG  N C2    1 
ATOM   7639 N  N2    . DG  I 3 23  ? 30.476  1.615   -11.224 1.00 52.56  ? 23  DG  N N2    1 
ATOM   7640 N  N3    . DG  I 3 23  ? 31.352  -0.468  -11.822 1.00 53.51  ? 23  DG  N N3    1 
ATOM   7641 C  C4    . DG  I 3 23  ? 32.440  -1.285  -11.616 1.00 61.01  ? 23  DG  N C4    1 
ATOM   7642 P  P     . DG  I 3 24  ? 30.867  -5.020  -16.704 1.00 81.84  ? 24  DG  N P     1 
ATOM   7643 O  OP1   . DG  I 3 24  ? 29.782  -5.778  -17.365 1.00 82.48  ? 24  DG  N OP1   1 
ATOM   7644 O  OP2   . DG  I 3 24  ? 32.249  -5.548  -16.705 1.00 80.32  ? 24  DG  N OP2   1 
ATOM   7645 O  "O5'" . DG  I 3 24  ? 30.900  -3.524  -17.261 1.00 76.39  ? 24  DG  N "O5'" 1 
ATOM   7646 C  "C5'" . DG  I 3 24  ? 29.837  -2.638  -16.953 1.00 74.07  ? 24  DG  N "C5'" 1 
ATOM   7647 C  "C4'" . DG  I 3 24  ? 30.305  -1.198  -17.019 1.00 75.58  ? 24  DG  N "C4'" 1 
ATOM   7648 O  "O4'" . DG  I 3 24  ? 31.053  -0.866  -15.820 1.00 76.63  ? 24  DG  N "O4'" 1 
ATOM   7649 C  "C3'" . DG  I 3 24  ? 31.226  -0.871  -18.201 1.00 81.81  ? 24  DG  N "C3'" 1 
ATOM   7650 O  "O3'" . DG  I 3 24  ? 30.736  0.269   -18.885 1.00 89.25  ? 24  DG  N "O3'" 1 
ATOM   7651 C  "C2'" . DG  I 3 24  ? 32.580  -0.593  -17.541 1.00 68.09  ? 24  DG  N "C2'" 1 
ATOM   7652 C  "C1'" . DG  I 3 24  ? 32.152  -0.072  -16.183 1.00 69.70  ? 24  DG  N "C1'" 1 
ATOM   7653 N  N9    . DG  I 3 24  ? 33.184  -0.190  -15.157 1.00 64.46  ? 24  DG  N N9    1 
ATOM   7654 C  C8    . DG  I 3 24  ? 33.900  -1.315  -14.828 1.00 63.97  ? 24  DG  N C8    1 
ATOM   7655 N  N7    . DG  I 3 24  ? 34.762  -1.118  -13.869 1.00 60.96  ? 24  DG  N N7    1 
ATOM   7656 C  C5    . DG  I 3 24  ? 34.610  0.223   -13.543 1.00 55.96  ? 24  DG  N C5    1 
ATOM   7657 C  C6    . DG  I 3 24  ? 35.280  1.008   -12.575 1.00 52.07  ? 24  DG  N C6    1 
ATOM   7658 O  O6    . DG  I 3 24  ? 36.164  0.657   -11.780 1.00 51.04  ? 24  DG  N O6    1 
ATOM   7659 N  N1    . DG  I 3 24  ? 34.820  2.322   -12.568 1.00 52.74  ? 24  DG  N N1    1 
ATOM   7660 C  C2    . DG  I 3 24  ? 33.842  2.816   -13.399 1.00 58.46  ? 24  DG  N C2    1 
ATOM   7661 N  N2    . DG  I 3 24  ? 33.535  4.113   -13.250 1.00 50.44  ? 24  DG  N N2    1 
ATOM   7662 N  N3    . DG  I 3 24  ? 33.209  2.092   -14.313 1.00 59.71  ? 24  DG  N N3    1 
ATOM   7663 C  C4    . DG  I 3 24  ? 33.642  0.808   -14.327 1.00 59.46  ? 24  DG  N C4    1 
ATOM   7664 P  P     . DC  I 3 25  ? 31.234  0.605   -20.376 1.00 97.28  ? 25  DC  N P     1 
ATOM   7665 O  OP1   . DC  I 3 25  ? 30.056  0.504   -21.266 1.00 84.32  ? 25  DC  N OP1   1 
ATOM   7666 O  OP2   . DC  I 3 25  ? 32.440  -0.205  -20.661 1.00 84.56  ? 25  DC  N OP2   1 
ATOM   7667 O  "O5'" . DC  I 3 25  ? 31.680  2.136   -20.283 1.00 81.89  ? 25  DC  N "O5'" 1 
ATOM   7668 C  "C5'" . DC  I 3 25  ? 30.808  3.091   -19.691 1.00 72.02  ? 25  DC  N "C5'" 1 
ATOM   7669 C  "C4'" . DC  I 3 25  ? 31.580  4.305   -19.209 1.00 64.53  ? 25  DC  N "C4'" 1 
ATOM   7670 O  "O4'" . DC  I 3 25  ? 32.387  3.946   -18.056 1.00 53.92  ? 25  DC  N "O4'" 1 
ATOM   7671 C  "C3'" . DC  I 3 25  ? 32.544  4.909   -20.235 1.00 63.12  ? 25  DC  N "C3'" 1 
ATOM   7672 O  "O3'" . DC  I 3 25  ? 32.398  6.323   -20.266 1.00 68.62  ? 25  DC  N "O3'" 1 
ATOM   7673 C  "C2'" . DC  I 3 25  ? 33.922  4.499   -19.714 1.00 60.77  ? 25  DC  N "C2'" 1 
ATOM   7674 C  "C1'" . DC  I 3 25  ? 33.679  4.479   -18.215 1.00 58.74  ? 25  DC  N "C1'" 1 
ATOM   7675 N  N1    . DC  I 3 25  ? 34.643  3.627   -17.462 1.00 53.56  ? 25  DC  N N1    1 
ATOM   7676 C  C2    . DC  I 3 25  ? 35.333  4.165   -16.370 1.00 49.98  ? 25  DC  N C2    1 
ATOM   7677 O  O2    . DC  I 3 25  ? 35.127  5.341   -16.047 1.00 50.15  ? 25  DC  N O2    1 
ATOM   7678 N  N3    . DC  I 3 25  ? 36.208  3.380   -15.694 1.00 44.33  ? 25  DC  N N3    1 
ATOM   7679 C  C4    . DC  I 3 25  ? 36.401  2.116   -16.073 1.00 50.92  ? 25  DC  N C4    1 
ATOM   7680 N  N4    . DC  I 3 25  ? 37.274  1.381   -15.376 1.00 47.72  ? 25  DC  N N4    1 
ATOM   7681 C  C5    . DC  I 3 25  ? 35.709  1.550   -17.184 1.00 55.51  ? 25  DC  N C5    1 
ATOM   7682 C  C6    . DC  I 3 25  ? 34.849  2.334   -17.844 1.00 53.04  ? 25  DC  N C6    1 
HETATM 7683 MN MN    . MN  J 4 .   ? 57.332  4.678   38.140  1.00 40.66  ? 201 MN  A MN    1 
HETATM 7684 MN MN    . MN  K 4 .   ? 62.280  -0.056  36.438  1.00 40.76  ? 202 MN  A MN    1 
HETATM 7685 CL CL    . CL  L 5 .   ? 45.806  5.374   31.547  0.00 47.40  ? 203 CL  A CL    1 
HETATM 7686 MN MN    . MN  M 4 .   ? 46.870  -29.216 28.676  1.00 44.14  ? 201 MN  F MN    1 
HETATM 7687 MN MN    . MN  N 4 .   ? 47.550  -34.777 23.863  1.00 42.15  ? 202 MN  F MN    1 
HETATM 7688 CL CL    . CL  O 5 .   ? 35.486  -43.023 23.781  0.00 48.70  ? 101 CL  G CL    1 
HETATM 7689 MN MN    . MN  P 4 .   ? 9.148   7.464   6.904   1.00 41.77  ? 201 MN  K MN    1 
HETATM 7690 MN MN    . MN  Q 4 .   ? 5.521   1.802   4.602   1.00 38.72  ? 202 MN  K MN    1 
HETATM 7691 O  O     . HOH R 6 .   ? 60.129  10.100  17.420  1.00 37.22  ? 301 HOH A O     1 
HETATM 7692 O  O     . HOH R 6 .   ? 64.248  23.276  22.416  1.00 59.33  ? 302 HOH A O     1 
HETATM 7693 O  O     . HOH R 6 .   ? 74.770  23.286  27.857  1.00 72.11  ? 303 HOH A O     1 
HETATM 7694 O  O     . HOH R 6 .   ? 59.276  1.855   37.504  1.00 24.47  ? 304 HOH A O     1 
HETATM 7695 O  O     . HOH R 6 .   ? 80.364  2.811   34.041  1.00 44.56  ? 305 HOH A O     1 
HETATM 7696 O  O     . HOH R 6 .   ? 68.577  -6.195  19.307  1.00 61.07  ? 306 HOH A O     1 
HETATM 7697 O  O     . HOH R 6 .   ? 60.728  12.271  54.638  1.00 63.13  ? 307 HOH A O     1 
HETATM 7698 O  O     . HOH R 6 .   ? 69.555  -2.154  23.813  1.00 41.84  ? 308 HOH A O     1 
HETATM 7699 O  O     . HOH R 6 .   ? 63.692  5.042   54.388  1.00 43.59  ? 309 HOH A O     1 
HETATM 7700 O  O     . HOH R 6 .   ? 58.629  1.386   22.427  1.00 33.63  ? 310 HOH A O     1 
HETATM 7701 O  O     . HOH R 6 .   ? 58.771  16.508  19.038  1.00 51.42  ? 311 HOH A O     1 
HETATM 7702 O  O     . HOH R 6 .   ? 52.557  2.409   24.129  1.00 40.98  ? 312 HOH A O     1 
HETATM 7703 O  O     . HOH R 6 .   ? 67.114  13.763  59.158  1.00 57.92  ? 313 HOH A O     1 
HETATM 7704 O  O     . HOH R 6 .   ? 78.602  11.511  45.208  1.00 38.18  ? 314 HOH A O     1 
HETATM 7705 O  O     . HOH R 6 .   ? 83.672  -0.645  37.829  1.00 57.99  ? 315 HOH A O     1 
HETATM 7706 O  O     . HOH R 6 .   ? 64.727  -0.527  35.592  1.00 34.73  ? 316 HOH A O     1 
HETATM 7707 O  O     . HOH R 6 .   ? 56.961  7.250   38.536  1.00 32.45  ? 317 HOH A O     1 
HETATM 7708 O  O     . HOH R 6 .   ? 78.085  -1.806  41.033  1.00 47.54  ? 318 HOH A O     1 
HETATM 7709 O  O     . HOH R 6 .   ? 81.179  6.081   40.378  1.00 48.43  ? 319 HOH A O     1 
HETATM 7710 O  O     . HOH R 6 .   ? 78.720  18.565  34.631  1.00 61.43  ? 320 HOH A O     1 
HETATM 7711 O  O     . HOH R 6 .   ? 61.978  17.286  17.621  1.00 52.00  ? 321 HOH A O     1 
HETATM 7712 O  O     . HOH R 6 .   ? 64.609  -13.079 37.344  1.00 56.21  ? 322 HOH A O     1 
HETATM 7713 O  O     . HOH R 6 .   ? 68.571  1.554   55.733  1.00 55.97  ? 323 HOH A O     1 
HETATM 7714 O  O     . HOH R 6 .   ? 53.975  9.408   38.732  1.00 48.29  ? 324 HOH A O     1 
HETATM 7715 O  O     . HOH R 6 .   ? 74.934  9.404   19.386  1.00 32.04  ? 325 HOH A O     1 
HETATM 7716 O  O     . HOH R 6 .   ? 71.507  14.119  58.154  1.00 61.17  ? 326 HOH A O     1 
HETATM 7717 O  O     . HOH R 6 .   ? 75.640  16.218  17.826  1.00 65.30  ? 327 HOH A O     1 
HETATM 7718 O  O     . HOH R 6 .   ? 76.863  9.713   25.185  1.00 33.10  ? 328 HOH A O     1 
HETATM 7719 O  O     . HOH R 6 .   ? 75.751  1.462   52.414  1.00 50.10  ? 329 HOH A O     1 
HETATM 7720 O  O     . HOH R 6 .   ? 73.909  -0.573  14.962  1.00 46.53  ? 330 HOH A O     1 
HETATM 7721 O  O     . HOH R 6 .   ? 67.107  -3.659  22.735  1.00 42.24  ? 331 HOH A O     1 
HETATM 7722 O  O     . HOH R 6 .   ? 82.233  15.782  40.834  1.00 53.22  ? 332 HOH A O     1 
HETATM 7723 O  O     . HOH R 6 .   ? 75.611  0.872   13.167  1.00 53.05  ? 333 HOH A O     1 
HETATM 7724 O  O     . HOH R 6 .   ? 76.880  0.420   33.216  1.00 57.38  ? 334 HOH A O     1 
HETATM 7725 O  O     . HOH R 6 .   ? 55.429  3.462   48.494  1.00 48.25  ? 335 HOH A O     1 
HETATM 7726 O  O     . HOH R 6 .   ? 63.868  -6.729  17.764  1.00 48.74  ? 336 HOH A O     1 
HETATM 7727 O  O     . HOH R 6 .   ? 51.833  8.244   36.893  1.00 50.53  ? 337 HOH A O     1 
HETATM 7728 O  O     . HOH R 6 .   ? 68.920  15.039  57.527  1.00 63.90  ? 338 HOH A O     1 
HETATM 7729 O  O     . HOH R 6 .   ? 68.966  -2.040  34.032  1.00 43.34  ? 339 HOH A O     1 
HETATM 7730 O  O     . HOH R 6 .   ? 71.008  20.783  34.268  1.00 66.40  ? 340 HOH A O     1 
HETATM 7731 O  O     . HOH R 6 .   ? 62.810  -0.979  53.391  1.00 50.21  ? 341 HOH A O     1 
HETATM 7732 O  O     . HOH R 6 .   ? 57.593  18.623  22.872  1.00 51.29  ? 342 HOH A O     1 
HETATM 7733 O  O     . HOH R 6 .   ? 71.198  -0.011  25.658  1.00 55.23  ? 343 HOH A O     1 
HETATM 7734 O  O     . HOH R 6 .   ? 68.304  11.238  14.629  1.00 51.80  ? 344 HOH A O     1 
HETATM 7735 O  O     . HOH R 6 .   ? 67.906  21.845  16.461  1.00 61.88  ? 345 HOH A O     1 
HETATM 7736 O  O     . HOH R 6 .   ? 71.038  -8.486  39.716  1.00 49.06  ? 346 HOH A O     1 
HETATM 7737 O  O     . HOH R 6 .   ? 52.530  12.423  19.637  1.00 48.64  ? 347 HOH A O     1 
HETATM 7738 O  O     . HOH R 6 .   ? 66.778  -0.839  28.658  1.00 43.56  ? 348 HOH A O     1 
HETATM 7739 O  O     . HOH R 6 .   ? 64.194  -5.933  20.277  1.00 49.68  ? 349 HOH A O     1 
HETATM 7740 O  O     . HOH R 6 .   ? 77.575  12.672  26.265  1.00 45.32  ? 350 HOH A O     1 
HETATM 7741 O  O     . HOH R 6 .   ? 78.114  9.584   22.563  1.00 46.79  ? 351 HOH A O     1 
HETATM 7742 O  O     . HOH R 6 .   ? 54.211  7.101   39.924  1.00 46.05  ? 352 HOH A O     1 
HETATM 7743 O  O     . HOH R 6 .   ? 59.839  -3.951  4.173   1.00 52.66  ? 353 HOH A O     1 
HETATM 7744 O  O     . HOH R 6 .   ? 63.320  24.148  24.029  1.00 70.48  ? 354 HOH A O     1 
HETATM 7745 O  O     . HOH R 6 .   ? 75.167  2.008   57.101  1.00 66.62  ? 355 HOH A O     1 
HETATM 7746 O  O     . HOH R 6 .   ? 83.435  2.857   34.331  1.00 52.03  ? 356 HOH A O     1 
HETATM 7747 O  O     . HOH S 6 .   ? 59.574  -1.272  74.093  1.00 60.27  ? 101 HOH C O     1 
HETATM 7748 O  O     . HOH S 6 .   ? 57.429  -3.484  33.688  1.00 33.66  ? 102 HOH C O     1 
HETATM 7749 O  O     . HOH S 6 .   ? 52.789  3.807   78.418  1.00 59.86  ? 103 HOH C O     1 
HETATM 7750 O  O     . HOH S 6 .   ? 57.759  -7.388  47.756  1.00 51.64  ? 104 HOH C O     1 
HETATM 7751 O  O     . HOH S 6 .   ? 63.357  3.813   56.658  1.00 46.32  ? 105 HOH C O     1 
HETATM 7752 O  O     . HOH S 6 .   ? 56.816  -2.737  36.749  1.00 38.14  ? 106 HOH C O     1 
HETATM 7753 O  O     . HOH S 6 .   ? 64.931  7.129   -2.938  1.00 34.60  ? 107 HOH C O     1 
HETATM 7754 O  O     . HOH S 6 .   ? 49.910  -10.070 39.229  1.00 55.80  ? 108 HOH C O     1 
HETATM 7755 O  O     . HOH S 6 .   ? 60.079  0.537   1.641   1.00 48.53  ? 109 HOH C O     1 
HETATM 7756 O  O     . HOH S 6 .   ? 66.615  8.779   -3.706  1.00 40.71  ? 110 HOH C O     1 
HETATM 7757 O  O     . HOH S 6 .   ? 49.106  -2.609  43.128  1.00 50.72  ? 111 HOH C O     1 
HETATM 7758 O  O     . HOH S 6 .   ? 71.520  3.321   1.255   1.00 46.38  ? 112 HOH C O     1 
HETATM 7759 O  O     . HOH S 6 .   ? 61.983  -4.582  33.465  1.00 48.09  ? 113 HOH C O     1 
HETATM 7760 O  O     . HOH S 6 .   ? 48.151  -3.281  46.566  1.00 51.48  ? 114 HOH C O     1 
HETATM 7761 O  O     . HOH S 6 .   ? 50.876  -1.044  41.217  1.00 52.46  ? 115 HOH C O     1 
HETATM 7762 O  O     . HOH S 6 .   ? 46.716  -4.065  34.347  1.00 53.42  ? 116 HOH C O     1 
HETATM 7763 O  O     . HOH S 6 .   ? 57.745  -7.992  27.912  1.00 52.68  ? 117 HOH C O     1 
HETATM 7764 O  O     . HOH S 6 .   ? 62.364  -1.535  34.352  1.00 45.54  ? 118 HOH C O     1 
HETATM 7765 O  O     . HOH S 6 .   ? 45.769  -1.317  34.702  1.00 50.20  ? 119 HOH C O     1 
HETATM 7766 O  O     . HOH T 6 .   ? 59.980  -12.481 38.163  1.00 57.60  ? 101 HOH D O     1 
HETATM 7767 O  O     . HOH T 6 .   ? 57.021  -5.065  35.337  1.00 34.90  ? 102 HOH D O     1 
HETATM 7768 O  O     . HOH T 6 .   ? 51.004  9.182   18.532  1.00 54.21  ? 103 HOH D O     1 
HETATM 7769 O  O     . HOH T 6 .   ? 69.174  8.998   14.270  1.00 35.58  ? 104 HOH D O     1 
HETATM 7770 O  O     . HOH T 6 .   ? 51.764  -0.013  43.842  1.00 47.57  ? 105 HOH D O     1 
HETATM 7771 O  O     . HOH T 6 .   ? 68.086  -2.750  -4.706  1.00 47.32  ? 106 HOH D O     1 
HETATM 7772 O  O     . HOH T 6 .   ? 62.351  -3.229  3.848   1.00 53.94  ? 107 HOH D O     1 
HETATM 7773 O  O     . HOH T 6 .   ? 64.734  4.524   14.736  1.00 32.41  ? 108 HOH D O     1 
HETATM 7774 O  O     . HOH T 6 .   ? 57.765  4.583   16.525  1.00 30.67  ? 109 HOH D O     1 
HETATM 7775 O  O     . HOH T 6 .   ? 64.046  -5.241  35.766  1.00 49.63  ? 110 HOH D O     1 
HETATM 7776 O  O     . HOH T 6 .   ? 54.386  2.839   40.200  1.00 44.71  ? 111 HOH D O     1 
HETATM 7777 O  O     . HOH T 6 .   ? 50.054  -4.447  19.893  1.00 51.49  ? 112 HOH D O     1 
HETATM 7778 O  O     . HOH T 6 .   ? 61.880  -0.877  0.155   1.00 48.64  ? 113 HOH D O     1 
HETATM 7779 O  O     . HOH T 6 .   ? 54.719  -0.910  38.366  1.00 39.47  ? 114 HOH D O     1 
HETATM 7780 O  O     . HOH T 6 .   ? 70.739  0.850   3.252   1.00 49.02  ? 115 HOH D O     1 
HETATM 7781 O  O     . HOH T 6 .   ? 47.456  -5.576  30.150  1.00 49.84  ? 116 HOH D O     1 
HETATM 7782 O  O     . HOH T 6 .   ? 48.268  6.915   20.757  1.00 47.01  ? 117 HOH D O     1 
HETATM 7783 O  O     . HOH T 6 .   ? 53.574  7.491   42.045  1.00 56.71  ? 118 HOH D O     1 
HETATM 7784 O  O     . HOH T 6 .   ? 52.395  4.759   41.890  1.00 58.42  ? 119 HOH D O     1 
HETATM 7785 O  O     . HOH T 6 .   ? 56.059  4.821   40.204  1.00 31.37  ? 120 HOH D O     1 
HETATM 7786 O  O     . HOH T 6 .   ? 44.738  -4.998  17.477  1.00 69.62  ? 121 HOH D O     1 
HETATM 7787 O  O     . HOH T 6 .   ? 43.831  -7.317  16.802  1.00 65.21  ? 122 HOH D O     1 
HETATM 7788 O  O     . HOH T 6 .   ? 42.439  -4.944  16.088  1.00 57.43  ? 123 HOH D O     1 
HETATM 7789 O  O     . HOH T 6 .   ? 40.552  -7.277  16.194  1.00 66.83  ? 124 HOH D O     1 
HETATM 7790 O  O     . HOH U 6 .   ? 30.641  -24.642 15.189  1.00 44.03  ? 301 HOH F O     1 
HETATM 7791 O  O     . HOH U 6 .   ? 47.899  -12.884 6.811   1.00 69.21  ? 302 HOH F O     1 
HETATM 7792 O  O     . HOH U 6 .   ? 47.046  -32.343 26.884  1.00 23.02  ? 303 HOH F O     1 
HETATM 7793 O  O     . HOH U 6 .   ? 58.693  -11.759 23.433  1.00 68.88  ? 304 HOH F O     1 
HETATM 7794 O  O     . HOH U 6 .   ? 34.225  -22.971 34.772  1.00 68.33  ? 305 HOH F O     1 
HETATM 7795 O  O     . HOH U 6 .   ? 33.730  -15.902 18.323  1.00 57.14  ? 306 HOH F O     1 
HETATM 7796 O  O     . HOH U 6 .   ? 57.259  -13.795 30.005  1.00 57.85  ? 307 HOH F O     1 
HETATM 7797 O  O     . HOH U 6 .   ? 53.629  -44.482 22.720  1.00 45.03  ? 308 HOH F O     1 
HETATM 7798 O  O     . HOH U 6 .   ? 47.303  -26.637 28.869  1.00 35.33  ? 309 HOH F O     1 
HETATM 7799 O  O     . HOH U 6 .   ? 50.420  -16.356 19.683  1.00 55.37  ? 310 HOH F O     1 
HETATM 7800 O  O     . HOH U 6 .   ? 59.723  -37.587 12.675  1.00 47.17  ? 311 HOH F O     1 
HETATM 7801 O  O     . HOH U 6 .   ? 31.481  -17.924 15.947  1.00 54.59  ? 312 HOH F O     1 
HETATM 7802 O  O     . HOH U 6 .   ? 47.950  -43.985 34.996  1.00 48.00  ? 313 HOH F O     1 
HETATM 7803 O  O     . HOH U 6 .   ? 58.669  -11.831 26.459  1.00 60.35  ? 314 HOH F O     1 
HETATM 7804 O  O     . HOH U 6 .   ? 48.453  -35.234 21.476  1.00 38.06  ? 315 HOH F O     1 
HETATM 7805 O  O     . HOH U 6 .   ? 52.732  -35.492 10.392  1.00 63.24  ? 316 HOH F O     1 
HETATM 7806 O  O     . HOH U 6 .   ? 42.977  -9.659  4.986   1.00 66.27  ? 317 HOH F O     1 
HETATM 7807 O  O     . HOH U 6 .   ? 63.889  -29.366 31.521  1.00 34.69  ? 318 HOH F O     1 
HETATM 7808 O  O     . HOH U 6 .   ? 67.731  -33.404 28.346  1.00 51.20  ? 319 HOH F O     1 
HETATM 7809 O  O     . HOH U 6 .   ? 45.979  -26.408 5.029   1.00 37.62  ? 320 HOH F O     1 
HETATM 7810 O  O     . HOH U 6 .   ? 28.647  -30.268 16.965  1.00 41.91  ? 321 HOH F O     1 
HETATM 7811 O  O     . HOH U 6 .   ? 47.620  -11.422 18.054  1.00 70.26  ? 322 HOH F O     1 
HETATM 7812 O  O     . HOH U 6 .   ? 33.956  -33.443 19.690  1.00 39.72  ? 323 HOH F O     1 
HETATM 7813 O  O     . HOH U 6 .   ? 24.674  -44.118 7.726   1.00 55.19  ? 324 HOH F O     1 
HETATM 7814 O  O     . HOH U 6 .   ? 70.124  -31.527 21.635  1.00 37.24  ? 325 HOH F O     1 
HETATM 7815 O  O     . HOH U 6 .   ? 55.772  -10.200 27.173  1.00 57.30  ? 326 HOH F O     1 
HETATM 7816 O  O     . HOH U 6 .   ? 32.129  -42.057 13.268  1.00 48.28  ? 327 HOH F O     1 
HETATM 7817 O  O     . HOH U 6 .   ? 69.729  -19.847 26.968  1.00 50.92  ? 328 HOH F O     1 
HETATM 7818 O  O     . HOH U 6 .   ? 55.903  -16.531 29.885  1.00 61.12  ? 329 HOH F O     1 
HETATM 7819 O  O     . HOH U 6 .   ? 57.705  -12.256 28.651  1.00 53.08  ? 330 HOH F O     1 
HETATM 7820 O  O     . HOH U 6 .   ? 68.360  -33.938 20.299  1.00 46.08  ? 331 HOH F O     1 
HETATM 7821 O  O     . HOH U 6 .   ? 38.763  -19.832 34.335  1.00 59.56  ? 332 HOH F O     1 
HETATM 7822 O  O     . HOH U 6 .   ? 66.536  -36.098 19.829  1.00 62.52  ? 333 HOH F O     1 
HETATM 7823 O  O     . HOH U 6 .   ? 19.600  -38.602 6.863   1.00 49.26  ? 334 HOH F O     1 
HETATM 7824 O  O     . HOH U 6 .   ? 27.441  -26.173 27.637  1.00 47.80  ? 335 HOH F O     1 
HETATM 7825 O  O     . HOH U 6 .   ? 38.543  -39.214 12.981  1.00 44.89  ? 336 HOH F O     1 
HETATM 7826 O  O     . HOH U 6 .   ? 54.956  -42.570 17.440  1.00 50.34  ? 337 HOH F O     1 
HETATM 7827 O  O     . HOH U 6 .   ? 28.195  -22.485 22.778  1.00 53.94  ? 338 HOH F O     1 
HETATM 7828 O  O     . HOH U 6 .   ? 63.828  -44.089 26.284  1.00 44.07  ? 339 HOH F O     1 
HETATM 7829 O  O     . HOH U 6 .   ? 43.572  -35.785 16.056  1.00 39.27  ? 340 HOH F O     1 
HETATM 7830 O  O     . HOH U 6 .   ? 60.563  -36.217 33.301  1.00 42.60  ? 341 HOH F O     1 
HETATM 7831 O  O     . HOH U 6 .   ? 59.545  -14.170 30.734  1.00 49.06  ? 342 HOH F O     1 
HETATM 7832 O  O     . HOH U 6 .   ? 37.825  -22.668 35.145  1.00 62.18  ? 343 HOH F O     1 
HETATM 7833 O  O     . HOH U 6 .   ? 28.735  -20.924 21.825  1.00 71.00  ? 344 HOH F O     1 
HETATM 7834 O  O     . HOH U 6 .   ? 48.443  -37.176 20.792  1.00 38.43  ? 345 HOH F O     1 
HETATM 7835 O  O     . HOH U 6 .   ? 41.308  -37.654 6.701   1.00 59.13  ? 346 HOH F O     1 
HETATM 7836 O  O     . HOH U 6 .   ? 62.612  -18.543 33.061  1.00 51.27  ? 347 HOH F O     1 
HETATM 7837 O  O     . HOH U 6 .   ? 62.880  -17.499 34.644  1.00 56.41  ? 348 HOH F O     1 
HETATM 7838 O  O     . HOH U 6 .   ? 63.170  -17.281 31.409  1.00 62.49  ? 349 HOH F O     1 
HETATM 7839 O  O     . HOH U 6 .   ? 45.526  -10.814 17.896  1.00 70.14  ? 350 HOH F O     1 
HETATM 7840 O  O     . HOH U 6 .   ? 45.365  -9.102  15.115  1.00 67.58  ? 351 HOH F O     1 
HETATM 7841 O  O     . HOH V 6 .   ? 43.124  -28.677 38.205  1.00 68.84  ? 201 HOH G O     1 
HETATM 7842 O  O     . HOH V 6 .   ? 42.806  -37.624 27.051  1.00 40.34  ? 202 HOH G O     1 
HETATM 7843 O  O     . HOH V 6 .   ? 67.364  -26.967 38.909  1.00 53.62  ? 203 HOH G O     1 
HETATM 7844 O  O     . HOH V 6 .   ? 68.982  -22.661 34.248  1.00 48.29  ? 204 HOH G O     1 
HETATM 7845 O  O     . HOH V 6 .   ? 65.954  -30.567 33.143  1.00 41.19  ? 205 HOH G O     1 
HETATM 7846 O  O     . HOH V 6 .   ? 21.612  -21.748 -2.506  1.00 51.02  ? 206 HOH G O     1 
HETATM 7847 O  O     . HOH V 6 .   ? 15.816  -27.688 1.344   1.00 39.02  ? 207 HOH G O     1 
HETATM 7848 O  O     . HOH V 6 .   ? 16.036  -25.749 -0.575  1.00 39.43  ? 208 HOH G O     1 
HETATM 7849 O  O     . HOH V 6 .   ? 70.158  -32.519 28.312  1.00 48.60  ? 209 HOH G O     1 
HETATM 7850 O  O     . HOH V 6 .   ? 74.569  -29.618 36.437  1.00 48.73  ? 210 HOH G O     1 
HETATM 7851 O  O     . HOH V 6 .   ? 67.818  -41.759 37.261  1.00 52.18  ? 211 HOH G O     1 
HETATM 7852 O  O     . HOH V 6 .   ? 62.798  -35.291 32.075  1.00 43.83  ? 212 HOH G O     1 
HETATM 7853 O  O     . HOH V 6 .   ? 14.550  -28.533 7.429   1.00 60.77  ? 213 HOH G O     1 
HETATM 7854 O  O     . HOH V 6 .   ? 14.805  -31.277 6.665   1.00 47.39  ? 214 HOH G O     1 
HETATM 7855 O  O     . HOH V 6 .   ? 32.293  -42.346 23.525  1.00 67.71  ? 215 HOH G O     1 
HETATM 7856 O  O     . HOH V 6 .   ? 32.000  -44.730 22.024  1.00 59.34  ? 216 HOH G O     1 
HETATM 7857 O  O     . HOH V 6 .   ? 16.282  -21.658 2.396   1.00 57.07  ? 217 HOH G O     1 
HETATM 7858 O  O     . HOH V 6 .   ? 14.707  -19.745 4.172   1.00 59.77  ? 218 HOH G O     1 
HETATM 7859 O  O     . HOH W 6 .   ? 13.193  -39.195 0.484   1.00 65.76  ? 101 HOH I O     1 
HETATM 7860 O  O     . HOH W 6 .   ? 44.193  -39.049 28.225  1.00 38.03  ? 102 HOH I O     1 
HETATM 7861 O  O     . HOH W 6 .   ? 83.130  -34.338 35.645  1.00 66.39  ? 103 HOH I O     1 
HETATM 7862 O  O     . HOH W 6 .   ? 46.974  -30.995 32.335  1.00 40.34  ? 104 HOH I O     1 
HETATM 7863 O  O     . HOH W 6 .   ? 32.706  -26.581 5.817   1.00 36.97  ? 105 HOH I O     1 
HETATM 7864 O  O     . HOH W 6 .   ? 68.508  -40.707 40.808  1.00 60.50  ? 106 HOH I O     1 
HETATM 7865 O  O     . HOH W 6 .   ? 30.624  -30.814 10.071  1.00 28.86  ? 107 HOH I O     1 
HETATM 7866 O  O     . HOH W 6 .   ? 17.991  -38.401 4.396   1.00 46.91  ? 108 HOH I O     1 
HETATM 7867 O  O     . HOH W 6 .   ? 40.336  -47.450 25.912  1.00 72.10  ? 109 HOH I O     1 
HETATM 7868 O  O     . HOH W 6 .   ? 45.446  -36.384 29.175  1.00 41.75  ? 110 HOH I O     1 
HETATM 7869 O  O     . HOH W 6 .   ? 55.854  -37.018 43.215  1.00 53.42  ? 111 HOH I O     1 
HETATM 7870 O  O     . HOH W 6 .   ? 54.750  -30.227 35.782  1.00 46.94  ? 112 HOH I O     1 
HETATM 7871 O  O     . HOH W 6 .   ? 22.052  -27.292 11.823  1.00 49.18  ? 113 HOH I O     1 
HETATM 7872 O  O     . HOH W 6 .   ? 25.505  -31.219 2.374   1.00 42.43  ? 114 HOH I O     1 
HETATM 7873 O  O     . HOH W 6 .   ? 25.317  -28.454 6.279   1.00 49.67  ? 115 HOH I O     1 
HETATM 7874 O  O     . HOH W 6 .   ? 47.830  -29.117 31.306  1.00 40.43  ? 116 HOH I O     1 
HETATM 7875 O  O     . HOH X 6 .   ? 5.053   10.103  -21.552 1.00 66.52  ? 301 HOH K O     1 
HETATM 7876 O  O     . HOH X 6 .   ? 7.585   4.486   6.202   1.00 23.82  ? 302 HOH K O     1 
HETATM 7877 O  O     . HOH X 6 .   ? -9.463  19.250  12.507  1.00 49.88  ? 303 HOH K O     1 
HETATM 7878 O  O     . HOH X 6 .   ? -22.499 -1.784  20.855  1.00 46.31  ? 304 HOH K O     1 
HETATM 7879 O  O     . HOH X 6 .   ? 17.979  12.393  -17.051 1.00 56.98  ? 305 HOH K O     1 
HETATM 7880 O  O     . HOH X 6 .   ? -11.403 17.388  -9.975  1.00 70.02  ? 306 HOH K O     1 
HETATM 7881 O  O     . HOH X 6 .   ? -18.608 -0.132  5.073   1.00 48.15  ? 307 HOH K O     1 
HETATM 7882 O  O     . HOH X 6 .   ? -4.740  4.212   14.322  1.00 30.31  ? 308 HOH K O     1 
HETATM 7883 O  O     . HOH X 6 .   ? 6.838   -8.335  -0.161  1.00 40.11  ? 309 HOH K O     1 
HETATM 7884 O  O     . HOH X 6 .   ? -4.857  24.158  6.475   1.00 34.89  ? 310 HOH K O     1 
HETATM 7885 O  O     . HOH X 6 .   ? -21.241 0.982   4.746   1.00 53.12  ? 311 HOH K O     1 
HETATM 7886 O  O     . HOH X 6 .   ? 16.521  -2.926  2.913   1.00 53.35  ? 312 HOH K O     1 
HETATM 7887 O  O     . HOH X 6 .   ? 19.900  5.656   -6.384  1.00 32.65  ? 313 HOH K O     1 
HETATM 7888 O  O     . HOH X 6 .   ? -9.796  7.526   17.130  1.00 33.61  ? 314 HOH K O     1 
HETATM 7889 O  O     . HOH X 6 .   ? 9.464   9.657   6.469   1.00 28.69  ? 315 HOH K O     1 
HETATM 7890 O  O     . HOH X 6 .   ? 18.660  -9.292  2.894   1.00 44.45  ? 316 HOH K O     1 
HETATM 7891 O  O     . HOH X 6 .   ? -16.486 22.852  5.512   1.00 52.42  ? 317 HOH K O     1 
HETATM 7892 O  O     . HOH X 6 .   ? 20.828  13.828  -13.251 1.00 53.40  ? 318 HOH K O     1 
HETATM 7893 O  O     . HOH X 6 .   ? -15.418 -2.035  3.052   1.00 51.79  ? 319 HOH K O     1 
HETATM 7894 O  O     . HOH X 6 .   ? -12.171 8.995   -4.013  1.00 41.31  ? 320 HOH K O     1 
HETATM 7895 O  O     . HOH X 6 .   ? 11.002  12.625  8.260   1.00 50.34  ? 321 HOH K O     1 
HETATM 7896 O  O     . HOH X 6 .   ? -5.759  1.200   -10.554 1.00 48.32  ? 322 HOH K O     1 
HETATM 7897 O  O     . HOH X 6 .   ? -6.073  21.507  12.246  1.00 48.79  ? 323 HOH K O     1 
HETATM 7898 O  O     . HOH X 6 .   ? 14.286  1.894   -16.144 1.00 42.95  ? 324 HOH K O     1 
HETATM 7899 O  O     . HOH X 6 .   ? -1.287  11.612  22.925  1.00 51.67  ? 325 HOH K O     1 
HETATM 7900 O  O     . HOH X 6 .   ? 3.614   0.603   3.361   1.00 38.08  ? 326 HOH K O     1 
HETATM 7901 O  O     . HOH X 6 .   ? -4.864  24.869  -1.117  1.00 51.90  ? 327 HOH K O     1 
HETATM 7902 O  O     . HOH X 6 .   ? 15.510  -9.273  -6.676  1.00 47.13  ? 328 HOH K O     1 
HETATM 7903 O  O     . HOH X 6 .   ? 2.634   -7.016  -4.757  1.00 44.53  ? 329 HOH K O     1 
HETATM 7904 O  O     . HOH X 6 .   ? 11.806  7.736   7.117   1.00 33.49  ? 330 HOH K O     1 
HETATM 7905 O  O     . HOH X 6 .   ? 1.568   -3.249  -10.745 1.00 54.63  ? 331 HOH K O     1 
HETATM 7906 O  O     . HOH X 6 .   ? 8.779   15.339  20.370  1.00 59.89  ? 332 HOH K O     1 
HETATM 7907 O  O     . HOH X 6 .   ? 4.793   -8.154  -2.961  1.00 40.44  ? 333 HOH K O     1 
HETATM 7908 O  O     . HOH X 6 .   ? 12.563  -0.273  -15.315 1.00 48.27  ? 334 HOH K O     1 
HETATM 7909 O  O     . HOH X 6 .   ? 24.048  3.522   -14.784 1.00 61.31  ? 335 HOH K O     1 
HETATM 7910 O  O     . HOH X 6 .   ? 7.263   17.906  0.894   1.00 58.81  ? 336 HOH K O     1 
HETATM 7911 O  O     . HOH X 6 .   ? 6.099   -10.209 -4.851  1.00 41.48  ? 337 HOH K O     1 
HETATM 7912 O  O     . HOH X 6 .   ? 9.808   14.193  18.273  1.00 55.86  ? 338 HOH K O     1 
HETATM 7913 O  O     . HOH X 6 .   ? 11.015  -11.100 -10.026 1.00 61.93  ? 339 HOH K O     1 
HETATM 7914 O  O     . HOH X 6 .   ? 10.385  15.920  16.982  1.00 55.01  ? 340 HOH K O     1 
HETATM 7915 O  O     . HOH X 6 .   ? -8.208  -2.562  7.638   1.00 44.21  ? 341 HOH K O     1 
HETATM 7916 O  O     . HOH X 6 .   ? 10.250  18.374  15.492  1.00 51.51  ? 342 HOH K O     1 
HETATM 7917 O  O     . HOH X 6 .   ? -12.094 19.605  11.583  1.00 56.80  ? 343 HOH K O     1 
HETATM 7918 O  O     . HOH X 6 .   ? -12.749 2.596   -6.441  1.00 55.85  ? 344 HOH K O     1 
HETATM 7919 O  O     . HOH X 6 .   ? -17.477 12.861  8.053   1.00 48.73  ? 345 HOH K O     1 
HETATM 7920 O  O     . HOH X 6 .   ? -15.346 8.642   -3.944  1.00 47.78  ? 346 HOH K O     1 
HETATM 7921 O  O     . HOH X 6 .   ? 16.141  -15.897 3.699   1.00 62.83  ? 347 HOH K O     1 
HETATM 7922 O  O     . HOH X 6 .   ? 14.335  -16.108 5.783   1.00 62.19  ? 348 HOH K O     1 
HETATM 7923 O  O     . HOH X 6 .   ? -11.380 11.053  -5.883  1.00 51.45  ? 349 HOH K O     1 
HETATM 7924 O  O     . HOH Y 6 .   ? 13.378  2.964   11.663  1.00 48.78  ? 101 HOH L O     1 
HETATM 7925 O  O     . HOH Y 6 .   ? 27.376  7.848   -6.735  1.00 50.16  ? 102 HOH L O     1 
HETATM 7926 O  O     . HOH Y 6 .   ? -11.945 -7.477  20.049  1.00 61.51  ? 103 HOH L O     1 
HETATM 7927 O  O     . HOH Y 6 .   ? 21.087  -2.240  -11.822 1.00 51.93  ? 104 HOH L O     1 
HETATM 7928 O  O     . HOH Y 6 .   ? 10.369  11.744  11.271  1.00 42.80  ? 105 HOH L O     1 
HETATM 7929 O  O     . HOH Y 6 .   ? -6.439  -2.492  11.972  1.00 39.62  ? 106 HOH L O     1 
HETATM 7930 O  O     . HOH Y 6 .   ? -30.016 3.761   13.530  1.00 46.48  ? 107 HOH L O     1 
HETATM 7931 O  O     . HOH Y 6 .   ? -25.922 5.656   23.951  1.00 48.19  ? 108 HOH L O     1 
HETATM 7932 O  O     . HOH Y 6 .   ? -20.135 13.463  25.257  1.00 62.87  ? 109 HOH L O     1 
HETATM 7933 O  O     . HOH Y 6 .   ? 5.922   -0.803  10.807  1.00 34.35  ? 110 HOH L O     1 
HETATM 7934 O  O     . HOH Y 6 .   ? 27.777  4.767   -2.279  1.00 49.41  ? 111 HOH L O     1 
HETATM 7935 O  O     . HOH Y 6 .   ? 17.925  -4.384  3.505   1.00 39.88  ? 112 HOH L O     1 
HETATM 7936 O  O     . HOH Y 6 .   ? -30.279 8.050   20.838  1.00 37.65  ? 113 HOH L O     1 
HETATM 7937 O  O     . HOH Y 6 .   ? 22.291  4.143   -7.220  1.00 43.25  ? 114 HOH L O     1 
HETATM 7938 O  O     . HOH Y 6 .   ? 20.212  -9.180  0.680   1.00 50.01  ? 115 HOH L O     1 
HETATM 7939 O  O     . HOH Y 6 .   ? -23.112 5.336   24.917  1.00 50.29  ? 116 HOH L O     1 
HETATM 7940 O  O     . HOH Y 6 .   ? 19.774  -0.325  -4.397  1.00 46.36  ? 117 HOH L O     1 
HETATM 7941 O  O     . HOH Y 6 .   ? -30.543 13.123  20.206  1.00 56.06  ? 118 HOH L O     1 
HETATM 7942 O  O     . HOH Y 6 .   ? 19.721  -11.399 4.427   1.00 50.69  ? 119 HOH L O     1 
HETATM 7943 O  O     . HOH Y 6 .   ? 19.913  -0.844  -1.541  1.00 37.22  ? 120 HOH L O     1 
HETATM 7944 O  O     . HOH Y 6 .   ? -7.158  2.100   26.946  1.00 58.62  ? 121 HOH L O     1 
HETATM 7945 O  O     . HOH Y 6 .   ? 25.499  -2.755  9.072   1.00 48.61  ? 122 HOH L O     1 
HETATM 7946 O  O     . HOH Y 6 .   ? 41.092  14.334  -5.435  1.00 62.51  ? 123 HOH L O     1 
HETATM 7947 O  O     . HOH Y 6 .   ? 4.068   0.100   6.150   1.00 43.69  ? 124 HOH L O     1 
HETATM 7948 O  O     . HOH Y 6 .   ? 25.343  0.881   9.657   1.00 61.01  ? 125 HOH L O     1 
HETATM 7949 O  O     . HOH Y 6 .   ? 29.340  9.069   -5.146  1.00 46.13  ? 126 HOH L O     1 
HETATM 7950 O  O     . HOH Y 6 .   ? 32.913  5.412   -3.788  1.00 50.84  ? 127 HOH L O     1 
HETATM 7951 O  O     . HOH Z 6 .   ? 7.390   -1.893  11.011  1.00 41.73  ? 101 HOH N O     1 
HETATM 7952 O  O     . HOH Z 6 .   ? -25.142 -5.207  18.656  1.00 59.55  ? 102 HOH N O     1 
HETATM 7953 O  O     . HOH Z 6 .   ? 8.321   -0.370  20.688  1.00 60.30  ? 103 HOH N O     1 
HETATM 7954 O  O     . HOH Z 6 .   ? 28.276  0.369   -19.273 1.00 77.03  ? 104 HOH N O     1 
HETATM 7955 O  O     . HOH Z 6 .   ? -6.375  11.819  27.379  1.00 64.46  ? 105 HOH N O     1 
HETATM 7956 O  O     . HOH Z 6 .   ? -32.676 -1.974  19.256  1.00 42.50  ? 106 HOH N O     1 
HETATM 7957 O  O     . HOH Z 6 .   ? -14.840 6.188   12.259  1.00 33.65  ? 107 HOH N O     1 
HETATM 7958 O  O     . HOH Z 6 .   ? -11.009 11.923  14.304  1.00 41.52  ? 108 HOH N O     1 
HETATM 7959 O  O     . HOH Z 6 .   ? 27.908  7.260   3.388   1.00 55.89  ? 109 HOH N O     1 
HETATM 7960 O  O     . HOH Z 6 .   ? -17.867 9.863   7.873   1.00 40.01  ? 110 HOH N O     1 
HETATM 7961 O  O     . HOH Z 6 .   ? -25.509 -1.296  21.520  1.00 50.40  ? 111 HOH N O     1 
HETATM 7962 O  O     . HOH Z 6 .   ? 12.293  6.318   8.886   1.00 40.16  ? 112 HOH N O     1 
HETATM 7963 O  O     . HOH Z 6 .   ? -30.744 -1.797  15.488  1.00 48.16  ? 113 HOH N O     1 
HETATM 7964 O  O     . HOH Z 6 .   ? -27.368 1.262   13.505  1.00 48.98  ? 114 HOH N O     1 
HETATM 7965 O  O     . HOH Z 6 .   ? 36.967  -0.338  -8.151  1.00 62.57  ? 115 HOH N O     1 
HETATM 7966 O  O     . HOH Z 6 .   ? 10.930  2.776   10.306  1.00 36.77  ? 116 HOH N O     1 
HETATM 7967 O  O     . HOH Z 6 .   ? -2.873  -0.119  23.840  1.00 54.15  ? 117 HOH N O     1 
HETATM 7968 O  O     . HOH Z 6 .   ? 26.471  0.432   7.208   1.00 50.21  ? 118 HOH N O     1 
HETATM 7969 O  O     . HOH Z 6 .   ? 3.834   1.110   29.214  1.00 68.09  ? 119 HOH N O     1 
HETATM 7970 O  O     . HOH Z 6 .   ? 33.697  8.939   -19.936 1.00 56.27  ? 120 HOH N O     1 
HETATM 7971 O  O     . HOH Z 6 .   ? 19.228  5.889   3.793   1.00 46.08  ? 121 HOH N O     1 
HETATM 7972 O  O     . HOH Z 6 .   ? 4.264   -3.792  4.710   1.00 44.89  ? 122 HOH N O     1 
HETATM 7973 O  O     . HOH Z 6 .   ? -8.843  7.922   26.125  1.00 50.93  ? 123 HOH N O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   ALA 2   1   ?   ?   ?   A . n 
A 1 3   HIS 3   2   ?   ?   ?   A . n 
A 1 4   ASN 4   3   ?   ?   ?   A . n 
A 1 5   ASN 5   4   ?   ?   ?   A . n 
A 1 6   GLU 6   5   5   GLU GLU A . n 
A 1 7   ASN 7   6   6   ASN ASN A . n 
A 1 8   VAL 8   7   7   VAL VAL A . n 
A 1 9   SER 9   8   8   SER SER A . n 
A 1 10  GLY 10  9   9   GLY GLY A . n 
A 1 11  ILE 11  10  10  ILE ILE A . n 
A 1 12  SER 12  11  11  SER SER A . n 
A 1 13  ALA 13  12  12  ALA ALA A . n 
A 1 14  TYR 14  13  13  TYR TYR A . n 
A 1 15  LEU 15  14  14  LEU LEU A . n 
A 1 16  LEU 16  15  15  LEU LEU A . n 
A 1 17  GLY 17  16  16  GLY GLY A . n 
A 1 18  LEU 18  17  17  LEU LEU A . n 
A 1 19  ILE 19  18  18  ILE ILE A . n 
A 1 20  ILE 20  19  19  ILE ILE A . n 
A 1 21  GLY 21  20  20  GLY GLY A . n 
A 1 22  ASP 22  21  21  ASP ASP A . n 
A 1 23  GLY 23  22  22  GLY GLY A . n 
A 1 24  GLY 24  23  23  GLY GLY A . n 
A 1 25  LEU 25  24  24  LEU LEU A . n 
A 1 26  TYR 26  25  25  TYR TYR A . n 
A 1 27  LYS 27  26  26  LYS LYS A . n 
A 1 28  LEU 28  27  27  LEU LEU A . n 
A 1 29  LYS 29  28  28  LYS LYS A . n 
A 1 30  TYR 30  29  29  TYR TYR A . n 
A 1 31  LYS 31  30  30  LYS LYS A . n 
A 1 32  GLY 32  31  31  GLY GLY A . n 
A 1 33  ASN 33  32  32  ASN ASN A . n 
A 1 34  ARG 34  33  33  ARG ARG A . n 
A 1 35  SER 35  34  34  SER SER A . n 
A 1 36  GLU 36  35  35  GLU GLU A . n 
A 1 37  TYR 37  36  36  TYR TYR A . n 
A 1 38  ARG 38  37  37  ARG ARG A . n 
A 1 39  VAL 39  38  38  VAL VAL A . n 
A 1 40  VAL 40  39  39  VAL VAL A . n 
A 1 41  ILE 41  40  40  ILE ILE A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  GLN 43  42  42  GLN GLN A . n 
A 1 44  LYS 44  43  43  LYS LYS A . n 
A 1 45  SER 45  44  44  SER SER A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  ASN 47  46  46  ASN ASN A . n 
A 1 48  LEU 48  47  47  LEU LEU A . n 
A 1 49  ILE 49  48  48  ILE ILE A . n 
A 1 50  LYS 50  49  49  LYS LYS A . n 
A 1 51  GLN 51  50  50  GLN GLN A . n 
A 1 52  HIS 52  51  51  HIS HIS A . n 
A 1 53  PHE 53  52  52  PHE PHE A . n 
A 1 54  ALA 54  53  53  ALA ALA A . n 
A 1 55  PRO 55  54  54  PRO PRO A . n 
A 1 56  LEU 56  55  55  LEU LEU A . n 
A 1 57  MET 57  56  56  MET MET A . n 
A 1 58  GLN 58  57  57  GLN GLN A . n 
A 1 59  PHE 59  58  58  PHE PHE A . n 
A 1 60  LEU 60  59  59  LEU LEU A . n 
A 1 61  ILE 61  60  60  ILE ILE A . n 
A 1 62  ASP 62  61  61  ASP ASP A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  LEU 64  63  63  LEU LEU A . n 
A 1 65  ASN 65  64  64  ASN ASN A . n 
A 1 66  VAL 66  65  65  VAL VAL A . n 
A 1 67  LYS 67  66  66  LYS LYS A . n 
A 1 68  SER 68  67  67  SER SER A . n 
A 1 69  LYS 69  68  68  LYS LYS A . n 
A 1 70  ILE 70  69  69  ILE ILE A . n 
A 1 71  GLN 71  70  70  GLN GLN A . n 
A 1 72  ILE 72  71  71  ILE ILE A . n 
A 1 73  VAL 73  72  72  VAL VAL A . n 
A 1 74  LYS 74  73  73  LYS LYS A . n 
A 1 75  GLY 75  74  74  GLY GLY A . n 
A 1 76  ASP 76  75  75  ASP ASP A . n 
A 1 77  THR 77  76  76  THR THR A . n 
A 1 78  ARG 78  77  77  ARG ARG A . n 
A 1 79  TYR 79  78  78  TYR TYR A . n 
A 1 80  GLU 80  79  79  GLU GLU A . n 
A 1 81  LEU 81  80  80  LEU LEU A . n 
A 1 82  ARG 82  81  81  ARG ARG A . n 
A 1 83  VAL 83  82  82  VAL VAL A . n 
A 1 84  SER 84  83  83  SER SER A . n 
A 1 85  SER 85  84  84  SER SER A . n 
A 1 86  LYS 86  85  85  LYS LYS A . n 
A 1 87  LYS 87  86  86  LYS LYS A . n 
A 1 88  LEU 88  87  87  LEU LEU A . n 
A 1 89  TYR 89  88  88  TYR TYR A . n 
A 1 90  TYR 90  89  89  TYR TYR A . n 
A 1 91  TYR 91  90  90  TYR TYR A . n 
A 1 92  PHE 92  91  91  PHE PHE A . n 
A 1 93  THR 93  92  92  THR THR A . n 
A 1 94  ASN 94  93  93  ASN ASN A . n 
A 1 95  MET 95  94  94  MET MET A . n 
A 1 96  LEU 96  95  95  LEU LEU A . n 
A 1 97  GLU 97  96  96  GLU GLU A . n 
A 1 98  ARG 98  97  97  ARG ARG A . n 
A 1 99  ILE 99  98  98  ILE ILE A . n 
A 1 100 ARG 100 99  99  ARG ARG A . n 
A 1 101 LEU 101 100 100 LEU LEU A . n 
A 1 102 CYS 102 101 101 CYS CYS A . n 
A 1 103 ASN 103 102 102 ASN ASN A . n 
A 1 104 MET 104 103 103 MET MET A . n 
A 1 105 ARG 105 104 104 ARG ARG A . n 
A 1 106 GLU 106 105 105 GLU GLU A . n 
A 1 107 GLN 107 106 106 GLN GLN A . n 
A 1 108 ILE 108 107 107 ILE ILE A . n 
A 1 109 ALA 109 108 108 ALA ALA A . n 
A 1 110 PHE 110 109 109 PHE PHE A . n 
A 1 111 ILE 111 110 110 ILE ILE A . n 
A 1 112 LYS 112 111 111 LYS LYS A . n 
A 1 113 GLY 113 112 112 GLY GLY A . n 
A 1 114 LEU 114 113 113 LEU LEU A . n 
A 1 115 TYR 115 114 114 TYR TYR A . n 
A 1 116 VAL 116 115 115 VAL VAL A . n 
A 1 117 ALA 117 116 116 ALA ALA A . n 
A 1 118 GLU 118 117 117 GLU GLU A . n 
A 1 119 GLY 119 118 118 GLY GLY A . n 
A 1 120 ASP 120 119 119 ASP ASP A . n 
A 1 121 LYS 121 120 120 LYS LYS A . n 
A 1 122 THR 122 121 121 THR THR A . n 
A 1 123 LEU 123 122 122 LEU LEU A . n 
A 1 124 LYS 124 123 123 LYS LYS A . n 
A 1 125 ARG 125 124 124 ARG ARG A . n 
A 1 126 LEU 126 125 125 LEU LEU A . n 
A 1 127 ARG 127 126 126 ARG ARG A . n 
A 1 128 ILE 128 127 127 ILE ILE A . n 
A 1 129 TRP 129 128 128 TRP TRP A . n 
A 1 130 ASN 130 129 129 ASN ASN A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 ASN 132 131 131 ASN ASN A . n 
A 1 133 LYS 133 132 132 LYS LYS A . n 
A 1 134 ALA 134 133 133 ALA ALA A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 LEU 136 135 135 LEU LEU A . n 
A 1 137 GLU 137 136 136 GLU GLU A . n 
A 1 138 ILE 138 137 137 ILE ILE A . n 
A 1 139 VAL 139 138 138 VAL VAL A . n 
A 1 140 SER 140 139 139 SER SER A . n 
A 1 141 ARG 141 140 140 ARG ARG A . n 
A 1 142 TRP 142 141 141 TRP TRP A . n 
A 1 143 LEU 143 142 142 LEU LEU A . n 
A 1 144 ASN 144 143 143 ASN ASN A . n 
A 1 145 ASN 145 144 144 ASN ASN A . n 
A 1 146 LEU 146 145 145 LEU LEU A . n 
A 1 147 GLY 147 146 146 GLY GLY A . n 
A 1 148 VAL 148 147 147 VAL VAL A . n 
A 1 149 ARG 149 148 148 ARG ARG A . n 
A 1 150 ASN 150 149 149 ASN ASN A . n 
A 1 151 THR 151 150 150 THR THR A . n 
A 1 152 ILE 152 151 151 ILE ILE A . n 
A 1 153 HIS 153 152 152 HIS HIS A . n 
A 1 154 LEU 154 153 153 LEU LEU A . n 
A 1 155 ASP 155 154 154 ASP ASP A . n 
A 1 156 ASP 156 155 155 ASP ASP A . n 
A 1 157 HIS 157 156 156 HIS HIS A . n 
A 1 158 ARG 158 157 157 ARG ARG A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 GLY 160 159 159 GLY GLY A . n 
A 1 161 VAL 161 160 160 VAL VAL A . n 
A 1 162 TYR 162 161 161 TYR TYR A . n 
A 1 163 VAL 163 162 162 VAL VAL A . n 
A 1 164 LEU 164 163 163 LEU LEU A . n 
A 1 165 ASN 165 164 164 ASN ASN A . n 
A 1 166 ILE 166 165 165 ILE ILE A . n 
A 1 167 SER 167 166 166 SER SER A . n 
A 1 168 LEU 168 167 167 LEU LEU A . n 
A 1 169 ARG 169 168 168 ARG ARG A . n 
A 1 170 ASP 170 169 169 ASP ASP A . n 
A 1 171 ARG 171 170 170 ARG ARG A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 LYS 173 172 172 LYS LYS A . n 
A 1 174 PHE 174 173 173 PHE PHE A . n 
A 1 175 VAL 175 174 174 VAL VAL A . n 
A 1 176 HIS 176 175 175 HIS HIS A . n 
A 1 177 THR 177 176 176 THR THR A . n 
A 1 178 ILE 178 177 177 ILE ILE A . n 
A 1 179 LEU 179 178 178 LEU LEU A . n 
A 1 180 SER 180 179 179 SER SER A . n 
A 1 181 SER 181 180 180 SER SER A . n 
A 1 182 HIS 182 181 181 HIS HIS A . n 
A 1 183 LEU 183 182 182 LEU LEU A . n 
A 1 184 ASN 184 183 183 ASN ASN A . n 
A 1 185 PRO 185 184 184 PRO PRO A . n 
A 1 186 LEU 186 185 185 LEU LEU A . n 
A 1 187 PRO 187 186 186 PRO PRO A . n 
A 1 188 PRO 188 187 187 PRO PRO A . n 
A 1 189 GLU 189 188 188 GLU GLU A . n 
A 1 190 ALA 190 189 189 ALA ALA A . n 
A 1 191 ALA 191 190 190 ALA ALA A . n 
A 1 192 ALA 192 191 191 ALA ALA A . n 
A 1 193 LEU 193 192 192 LEU LEU A . n 
A 1 194 GLU 194 193 193 GLU GLU A . n 
A 1 195 HIS 195 194 194 HIS HIS A . n 
A 1 196 HIS 196 195 195 HIS HIS A . n 
A 1 197 HIS 197 196 ?   ?   ?   A . n 
A 1 198 HIS 198 197 ?   ?   ?   A . n 
A 1 199 HIS 199 198 ?   ?   ?   A . n 
A 1 200 HIS 200 199 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  C . n 
B 2 2   DC  2   2   2   DC  DC  C . n 
B 2 3   DC  3   3   3   DC  DC  C . n 
B 2 4   DT  4   4   4   DT  DT  C . n 
B 2 5   DT  5   5   5   DT  DT  C . n 
B 2 6   DG  6   6   6   DG  DG  C . n 
B 2 7   DC  7   7   7   DC  DC  C . n 
B 2 8   DC  8   8   8   DC  DC  C . n 
B 2 9   DG  9   9   9   DG  DG  C . n 
B 2 10  DG  10  10  10  DG  DG  C . n 
B 2 11  DG  11  11  11  DG  DG  C . n 
B 2 12  DT  12  12  12  DT  DT  C . n 
B 2 13  DA  13  13  13  DA  DA  C . n 
B 2 14  DA  14  14  14  DA  DA  C . n 
B 2 15  DG  15  15  15  DG  DG  C . n 
B 2 16  DT  16  16  16  DT  DT  C . n 
B 2 17  DT  17  17  17  DT  DT  C . n 
B 2 18  DC  18  18  18  DC  DC  C . n 
B 2 19  DC  19  19  19  DC  DC  C . n 
B 2 20  DG  20  20  20  DG  DG  C . n 
B 2 21  DG  21  21  21  DG  DG  C . n 
B 2 22  DC  22  22  22  DC  DC  C . n 
B 2 23  DG  23  23  23  DG  DG  C . n 
B 2 24  DC  24  24  24  DC  DC  C . n 
B 2 25  DG  25  25  25  DG  DG  C . n 
C 3 1   DC  1   1   1   DC  DC  D . n 
C 3 2   DG  2   2   2   DG  DG  D . n 
C 3 3   DC  3   3   3   DC  DC  D . n 
C 3 4   DG  4   4   4   DG  DG  D . n 
C 3 5   DC  5   5   5   DC  DC  D . n 
C 3 6   DC  6   6   6   DC  DC  D . n 
C 3 7   DG  7   7   7   DG  DG  D . n 
C 3 8   DG  8   8   8   DG  DG  D . n 
C 3 9   DA  9   9   9   DA  DA  D . n 
C 3 10  DA  10  10  10  DA  DA  D . n 
C 3 11  DC  11  11  11  DC  DC  D . n 
C 3 12  DT  12  12  12  DT  DT  D . n 
C 3 13  DT  13  13  13  DT  DT  D . n 
C 3 14  DA  14  14  14  DA  DA  D . n 
C 3 15  DC  15  15  15  DC  DC  D . n 
C 3 16  DC  16  16  16  DC  DC  D . n 
C 3 17  DC  17  17  17  DC  DC  D . n 
C 3 18  DG  18  18  18  DG  DG  D . n 
C 3 19  DG  19  19  19  DG  DG  D . n 
C 3 20  DC  20  20  20  DC  DC  D . n 
C 3 21  DA  21  21  21  DA  DA  D . n 
C 3 22  DA  22  22  22  DA  DA  D . n 
C 3 23  DG  23  23  23  DG  DG  D . n 
C 3 24  DG  24  24  24  DG  DG  D . n 
C 3 25  DC  25  25  25  DC  DC  D . n 
D 1 1   MET 1   0   ?   ?   ?   F . n 
D 1 2   ALA 2   1   ?   ?   ?   F . n 
D 1 3   HIS 3   2   ?   ?   ?   F . n 
D 1 4   ASN 4   3   ?   ?   ?   F . n 
D 1 5   ASN 5   4   ?   ?   ?   F . n 
D 1 6   GLU 6   5   5   GLU GLU F . n 
D 1 7   ASN 7   6   6   ASN ASN F . n 
D 1 8   VAL 8   7   7   VAL VAL F . n 
D 1 9   SER 9   8   8   SER SER F . n 
D 1 10  GLY 10  9   9   GLY GLY F . n 
D 1 11  ILE 11  10  10  ILE ILE F . n 
D 1 12  SER 12  11  11  SER SER F . n 
D 1 13  ALA 13  12  12  ALA ALA F . n 
D 1 14  TYR 14  13  13  TYR TYR F . n 
D 1 15  LEU 15  14  14  LEU LEU F . n 
D 1 16  LEU 16  15  15  LEU LEU F . n 
D 1 17  GLY 17  16  16  GLY GLY F . n 
D 1 18  LEU 18  17  17  LEU LEU F . n 
D 1 19  ILE 19  18  18  ILE ILE F . n 
D 1 20  ILE 20  19  19  ILE ILE F . n 
D 1 21  GLY 21  20  20  GLY GLY F . n 
D 1 22  ASP 22  21  21  ASP ASP F . n 
D 1 23  GLY 23  22  22  GLY GLY F . n 
D 1 24  GLY 24  23  23  GLY GLY F . n 
D 1 25  LEU 25  24  24  LEU LEU F . n 
D 1 26  TYR 26  25  25  TYR TYR F . n 
D 1 27  LYS 27  26  26  LYS LYS F . n 
D 1 28  LEU 28  27  27  LEU LEU F . n 
D 1 29  LYS 29  28  28  LYS LYS F . n 
D 1 30  TYR 30  29  29  TYR TYR F . n 
D 1 31  LYS 31  30  30  LYS LYS F . n 
D 1 32  GLY 32  31  31  GLY GLY F . n 
D 1 33  ASN 33  32  32  ASN ASN F . n 
D 1 34  ARG 34  33  33  ARG ARG F . n 
D 1 35  SER 35  34  34  SER SER F . n 
D 1 36  GLU 36  35  35  GLU GLU F . n 
D 1 37  TYR 37  36  36  TYR TYR F . n 
D 1 38  ARG 38  37  37  ARG ARG F . n 
D 1 39  VAL 39  38  38  VAL VAL F . n 
D 1 40  VAL 40  39  39  VAL VAL F . n 
D 1 41  ILE 41  40  40  ILE ILE F . n 
D 1 42  THR 42  41  41  THR THR F . n 
D 1 43  GLN 43  42  42  GLN GLN F . n 
D 1 44  LYS 44  43  43  LYS LYS F . n 
D 1 45  SER 45  44  44  SER SER F . n 
D 1 46  GLU 46  45  45  GLU GLU F . n 
D 1 47  ASN 47  46  46  ASN ASN F . n 
D 1 48  LEU 48  47  47  LEU LEU F . n 
D 1 49  ILE 49  48  48  ILE ILE F . n 
D 1 50  LYS 50  49  49  LYS LYS F . n 
D 1 51  GLN 51  50  50  GLN GLN F . n 
D 1 52  HIS 52  51  51  HIS HIS F . n 
D 1 53  PHE 53  52  52  PHE PHE F . n 
D 1 54  ALA 54  53  53  ALA ALA F . n 
D 1 55  PRO 55  54  54  PRO PRO F . n 
D 1 56  LEU 56  55  55  LEU LEU F . n 
D 1 57  MET 57  56  56  MET MET F . n 
D 1 58  GLN 58  57  57  GLN GLN F . n 
D 1 59  PHE 59  58  58  PHE PHE F . n 
D 1 60  LEU 60  59  59  LEU LEU F . n 
D 1 61  ILE 61  60  60  ILE ILE F . n 
D 1 62  ASP 62  61  61  ASP ASP F . n 
D 1 63  GLU 63  62  62  GLU GLU F . n 
D 1 64  LEU 64  63  63  LEU LEU F . n 
D 1 65  ASN 65  64  64  ASN ASN F . n 
D 1 66  VAL 66  65  65  VAL VAL F . n 
D 1 67  LYS 67  66  66  LYS LYS F . n 
D 1 68  SER 68  67  67  SER SER F . n 
D 1 69  LYS 69  68  68  LYS LYS F . n 
D 1 70  ILE 70  69  69  ILE ILE F . n 
D 1 71  GLN 71  70  70  GLN GLN F . n 
D 1 72  ILE 72  71  71  ILE ILE F . n 
D 1 73  VAL 73  72  72  VAL VAL F . n 
D 1 74  LYS 74  73  73  LYS LYS F . n 
D 1 75  GLY 75  74  74  GLY GLY F . n 
D 1 76  ASP 76  75  75  ASP ASP F . n 
D 1 77  THR 77  76  76  THR THR F . n 
D 1 78  ARG 78  77  77  ARG ARG F . n 
D 1 79  TYR 79  78  78  TYR TYR F . n 
D 1 80  GLU 80  79  79  GLU GLU F . n 
D 1 81  LEU 81  80  80  LEU LEU F . n 
D 1 82  ARG 82  81  81  ARG ARG F . n 
D 1 83  VAL 83  82  82  VAL VAL F . n 
D 1 84  SER 84  83  83  SER SER F . n 
D 1 85  SER 85  84  84  SER SER F . n 
D 1 86  LYS 86  85  85  LYS LYS F . n 
D 1 87  LYS 87  86  86  LYS LYS F . n 
D 1 88  LEU 88  87  87  LEU LEU F . n 
D 1 89  TYR 89  88  88  TYR TYR F . n 
D 1 90  TYR 90  89  89  TYR TYR F . n 
D 1 91  TYR 91  90  90  TYR TYR F . n 
D 1 92  PHE 92  91  91  PHE PHE F . n 
D 1 93  THR 93  92  92  THR THR F . n 
D 1 94  ASN 94  93  93  ASN ASN F . n 
D 1 95  MET 95  94  94  MET MET F . n 
D 1 96  LEU 96  95  95  LEU LEU F . n 
D 1 97  GLU 97  96  96  GLU GLU F . n 
D 1 98  ARG 98  97  97  ARG ARG F . n 
D 1 99  ILE 99  98  98  ILE ILE F . n 
D 1 100 ARG 100 99  99  ARG ARG F . n 
D 1 101 LEU 101 100 100 LEU LEU F . n 
D 1 102 CYS 102 101 101 CYS CYS F . n 
D 1 103 ASN 103 102 102 ASN ASN F . n 
D 1 104 MET 104 103 103 MET MET F . n 
D 1 105 ARG 105 104 104 ARG ARG F . n 
D 1 106 GLU 106 105 105 GLU GLU F . n 
D 1 107 GLN 107 106 106 GLN GLN F . n 
D 1 108 ILE 108 107 107 ILE ILE F . n 
D 1 109 ALA 109 108 108 ALA ALA F . n 
D 1 110 PHE 110 109 109 PHE PHE F . n 
D 1 111 ILE 111 110 110 ILE ILE F . n 
D 1 112 LYS 112 111 111 LYS LYS F . n 
D 1 113 GLY 113 112 112 GLY GLY F . n 
D 1 114 LEU 114 113 113 LEU LEU F . n 
D 1 115 TYR 115 114 114 TYR TYR F . n 
D 1 116 VAL 116 115 115 VAL VAL F . n 
D 1 117 ALA 117 116 116 ALA ALA F . n 
D 1 118 GLU 118 117 117 GLU GLU F . n 
D 1 119 GLY 119 118 118 GLY GLY F . n 
D 1 120 ASP 120 119 119 ASP ASP F . n 
D 1 121 LYS 121 120 120 LYS LYS F . n 
D 1 122 THR 122 121 121 THR THR F . n 
D 1 123 LEU 123 122 122 LEU LEU F . n 
D 1 124 LYS 124 123 123 LYS LYS F . n 
D 1 125 ARG 125 124 124 ARG ARG F . n 
D 1 126 LEU 126 125 125 LEU LEU F . n 
D 1 127 ARG 127 126 126 ARG ARG F . n 
D 1 128 ILE 128 127 127 ILE ILE F . n 
D 1 129 TRP 129 128 128 TRP TRP F . n 
D 1 130 ASN 130 129 129 ASN ASN F . n 
D 1 131 LYS 131 130 130 LYS LYS F . n 
D 1 132 ASN 132 131 131 ASN ASN F . n 
D 1 133 LYS 133 132 132 LYS LYS F . n 
D 1 134 ALA 134 133 133 ALA ALA F . n 
D 1 135 LEU 135 134 134 LEU LEU F . n 
D 1 136 LEU 136 135 135 LEU LEU F . n 
D 1 137 GLU 137 136 136 GLU GLU F . n 
D 1 138 ILE 138 137 137 ILE ILE F . n 
D 1 139 VAL 139 138 138 VAL VAL F . n 
D 1 140 SER 140 139 139 SER SER F . n 
D 1 141 ARG 141 140 140 ARG ARG F . n 
D 1 142 TRP 142 141 141 TRP TRP F . n 
D 1 143 LEU 143 142 142 LEU LEU F . n 
D 1 144 ASN 144 143 143 ASN ASN F . n 
D 1 145 ASN 145 144 144 ASN ASN F . n 
D 1 146 LEU 146 145 145 LEU LEU F . n 
D 1 147 GLY 147 146 146 GLY GLY F . n 
D 1 148 VAL 148 147 147 VAL VAL F . n 
D 1 149 ARG 149 148 148 ARG ARG F . n 
D 1 150 ASN 150 149 149 ASN ASN F . n 
D 1 151 THR 151 150 150 THR THR F . n 
D 1 152 ILE 152 151 151 ILE ILE F . n 
D 1 153 HIS 153 152 152 HIS HIS F . n 
D 1 154 LEU 154 153 153 LEU LEU F . n 
D 1 155 ASP 155 154 154 ASP ASP F . n 
D 1 156 ASP 156 155 155 ASP ASP F . n 
D 1 157 HIS 157 156 156 HIS HIS F . n 
D 1 158 ARG 158 157 157 ARG ARG F . n 
D 1 159 HIS 159 158 158 HIS HIS F . n 
D 1 160 GLY 160 159 159 GLY GLY F . n 
D 1 161 VAL 161 160 160 VAL VAL F . n 
D 1 162 TYR 162 161 161 TYR TYR F . n 
D 1 163 VAL 163 162 162 VAL VAL F . n 
D 1 164 LEU 164 163 163 LEU LEU F . n 
D 1 165 ASN 165 164 164 ASN ASN F . n 
D 1 166 ILE 166 165 165 ILE ILE F . n 
D 1 167 SER 167 166 166 SER SER F . n 
D 1 168 LEU 168 167 167 LEU LEU F . n 
D 1 169 ARG 169 168 168 ARG ARG F . n 
D 1 170 ASP 170 169 169 ASP ASP F . n 
D 1 171 ARG 171 170 170 ARG ARG F . n 
D 1 172 ILE 172 171 171 ILE ILE F . n 
D 1 173 LYS 173 172 172 LYS LYS F . n 
D 1 174 PHE 174 173 173 PHE PHE F . n 
D 1 175 VAL 175 174 174 VAL VAL F . n 
D 1 176 HIS 176 175 175 HIS HIS F . n 
D 1 177 THR 177 176 176 THR THR F . n 
D 1 178 ILE 178 177 177 ILE ILE F . n 
D 1 179 LEU 179 178 178 LEU LEU F . n 
D 1 180 SER 180 179 179 SER SER F . n 
D 1 181 SER 181 180 180 SER SER F . n 
D 1 182 HIS 182 181 181 HIS HIS F . n 
D 1 183 LEU 183 182 182 LEU LEU F . n 
D 1 184 ASN 184 183 183 ASN ASN F . n 
D 1 185 PRO 185 184 ?   ?   ?   F . n 
D 1 186 LEU 186 185 ?   ?   ?   F . n 
D 1 187 PRO 187 186 ?   ?   ?   F . n 
D 1 188 PRO 188 187 ?   ?   ?   F . n 
D 1 189 GLU 189 188 ?   ?   ?   F . n 
D 1 190 ALA 190 189 ?   ?   ?   F . n 
D 1 191 ALA 191 190 ?   ?   ?   F . n 
D 1 192 ALA 192 191 ?   ?   ?   F . n 
D 1 193 LEU 193 192 ?   ?   ?   F . n 
D 1 194 GLU 194 193 ?   ?   ?   F . n 
D 1 195 HIS 195 194 ?   ?   ?   F . n 
D 1 196 HIS 196 195 ?   ?   ?   F . n 
D 1 197 HIS 197 196 ?   ?   ?   F . n 
D 1 198 HIS 198 197 ?   ?   ?   F . n 
D 1 199 HIS 199 198 ?   ?   ?   F . n 
D 1 200 HIS 200 199 ?   ?   ?   F . n 
E 2 1   DG  1   1   1   DG  DG  G . n 
E 2 2   DC  2   2   2   DC  DC  G . n 
E 2 3   DC  3   3   3   DC  DC  G . n 
E 2 4   DT  4   4   4   DT  DT  G . n 
E 2 5   DT  5   5   5   DT  DT  G . n 
E 2 6   DG  6   6   6   DG  DG  G . n 
E 2 7   DC  7   7   7   DC  DC  G . n 
E 2 8   DC  8   8   8   DC  DC  G . n 
E 2 9   DG  9   9   9   DG  DG  G . n 
E 2 10  DG  10  10  10  DG  DG  G . n 
E 2 11  DG  11  11  11  DG  DG  G . n 
E 2 12  DT  12  12  12  DT  DT  G . n 
E 2 13  DA  13  13  13  DA  DA  G . n 
E 2 14  DA  14  14  14  DA  DA  G . n 
E 2 15  DG  15  15  15  DG  DG  G . n 
E 2 16  DT  16  16  16  DT  DT  G . n 
E 2 17  DT  17  17  17  DT  DT  G . n 
E 2 18  DC  18  18  18  DC  DC  G . n 
E 2 19  DC  19  19  19  DC  DC  G . n 
E 2 20  DG  20  20  20  DG  DG  G . n 
E 2 21  DG  21  21  21  DG  DG  G . n 
E 2 22  DC  22  22  22  DC  DC  G . n 
E 2 23  DG  23  23  23  DG  DG  G . n 
E 2 24  DC  24  24  24  DC  DC  G . n 
E 2 25  DG  25  25  25  DG  DG  G . n 
F 3 1   DC  1   1   1   DC  DC  I . n 
F 3 2   DG  2   2   2   DG  DG  I . n 
F 3 3   DC  3   3   3   DC  DC  I . n 
F 3 4   DG  4   4   4   DG  DG  I . n 
F 3 5   DC  5   5   5   DC  DC  I . n 
F 3 6   DC  6   6   6   DC  DC  I . n 
F 3 7   DG  7   7   7   DG  DG  I . n 
F 3 8   DG  8   8   8   DG  DG  I . n 
F 3 9   DA  9   9   9   DA  DA  I . n 
F 3 10  DA  10  10  10  DA  DA  I . n 
F 3 11  DC  11  11  11  DC  DC  I . n 
F 3 12  DT  12  12  12  DT  DT  I . n 
F 3 13  DT  13  13  13  DT  DT  I . n 
F 3 14  DA  14  14  14  DA  DA  I . n 
F 3 15  DC  15  15  15  DC  DC  I . n 
F 3 16  DC  16  16  16  DC  DC  I . n 
F 3 17  DC  17  17  17  DC  DC  I . n 
F 3 18  DG  18  18  18  DG  DG  I . n 
F 3 19  DG  19  19  19  DG  DG  I . n 
F 3 20  DC  20  20  20  DC  DC  I . n 
F 3 21  DA  21  21  21  DA  DA  I . n 
F 3 22  DA  22  22  22  DA  DA  I . n 
F 3 23  DG  23  23  23  DG  DG  I . n 
F 3 24  DG  24  24  24  DG  DG  I . n 
F 3 25  DC  25  25  25  DC  DC  I . n 
G 1 1   MET 1   0   ?   ?   ?   K . n 
G 1 2   ALA 2   1   ?   ?   ?   K . n 
G 1 3   HIS 3   2   ?   ?   ?   K . n 
G 1 4   ASN 4   3   ?   ?   ?   K . n 
G 1 5   ASN 5   4   ?   ?   ?   K . n 
G 1 6   GLU 6   5   5   GLU GLU K . n 
G 1 7   ASN 7   6   6   ASN ASN K . n 
G 1 8   VAL 8   7   7   VAL VAL K . n 
G 1 9   SER 9   8   8   SER SER K . n 
G 1 10  GLY 10  9   9   GLY GLY K . n 
G 1 11  ILE 11  10  10  ILE ILE K . n 
G 1 12  SER 12  11  11  SER SER K . n 
G 1 13  ALA 13  12  12  ALA ALA K . n 
G 1 14  TYR 14  13  13  TYR TYR K . n 
G 1 15  LEU 15  14  14  LEU LEU K . n 
G 1 16  LEU 16  15  15  LEU LEU K . n 
G 1 17  GLY 17  16  16  GLY GLY K . n 
G 1 18  LEU 18  17  17  LEU LEU K . n 
G 1 19  ILE 19  18  18  ILE ILE K . n 
G 1 20  ILE 20  19  19  ILE ILE K . n 
G 1 21  GLY 21  20  20  GLY GLY K . n 
G 1 22  ASP 22  21  21  ASP ASP K . n 
G 1 23  GLY 23  22  22  GLY GLY K . n 
G 1 24  GLY 24  23  23  GLY GLY K . n 
G 1 25  LEU 25  24  24  LEU LEU K . n 
G 1 26  TYR 26  25  25  TYR TYR K . n 
G 1 27  LYS 27  26  26  LYS LYS K . n 
G 1 28  LEU 28  27  27  LEU LEU K . n 
G 1 29  LYS 29  28  28  LYS LYS K . n 
G 1 30  TYR 30  29  29  TYR TYR K . n 
G 1 31  LYS 31  30  30  LYS LYS K . n 
G 1 32  GLY 32  31  31  GLY GLY K . n 
G 1 33  ASN 33  32  32  ASN ASN K . n 
G 1 34  ARG 34  33  33  ARG ARG K . n 
G 1 35  SER 35  34  34  SER SER K . n 
G 1 36  GLU 36  35  35  GLU GLU K . n 
G 1 37  TYR 37  36  36  TYR TYR K . n 
G 1 38  ARG 38  37  37  ARG ARG K . n 
G 1 39  VAL 39  38  38  VAL VAL K . n 
G 1 40  VAL 40  39  39  VAL VAL K . n 
G 1 41  ILE 41  40  40  ILE ILE K . n 
G 1 42  THR 42  41  41  THR THR K . n 
G 1 43  GLN 43  42  42  GLN GLN K . n 
G 1 44  LYS 44  43  43  LYS LYS K . n 
G 1 45  SER 45  44  44  SER SER K . n 
G 1 46  GLU 46  45  45  GLU GLU K . n 
G 1 47  ASN 47  46  46  ASN ASN K . n 
G 1 48  LEU 48  47  47  LEU LEU K . n 
G 1 49  ILE 49  48  48  ILE ILE K . n 
G 1 50  LYS 50  49  49  LYS LYS K . n 
G 1 51  GLN 51  50  50  GLN GLN K . n 
G 1 52  HIS 52  51  51  HIS HIS K . n 
G 1 53  PHE 53  52  52  PHE PHE K . n 
G 1 54  ALA 54  53  53  ALA ALA K . n 
G 1 55  PRO 55  54  54  PRO PRO K . n 
G 1 56  LEU 56  55  55  LEU LEU K . n 
G 1 57  MET 57  56  56  MET MET K . n 
G 1 58  GLN 58  57  57  GLN GLN K . n 
G 1 59  PHE 59  58  58  PHE PHE K . n 
G 1 60  LEU 60  59  59  LEU LEU K . n 
G 1 61  ILE 61  60  60  ILE ILE K . n 
G 1 62  ASP 62  61  61  ASP ASP K . n 
G 1 63  GLU 63  62  62  GLU GLU K . n 
G 1 64  LEU 64  63  63  LEU LEU K . n 
G 1 65  ASN 65  64  64  ASN ASN K . n 
G 1 66  VAL 66  65  65  VAL VAL K . n 
G 1 67  LYS 67  66  66  LYS LYS K . n 
G 1 68  SER 68  67  67  SER SER K . n 
G 1 69  LYS 69  68  68  LYS LYS K . n 
G 1 70  ILE 70  69  69  ILE ILE K . n 
G 1 71  GLN 71  70  70  GLN GLN K . n 
G 1 72  ILE 72  71  71  ILE ILE K . n 
G 1 73  VAL 73  72  72  VAL VAL K . n 
G 1 74  LYS 74  73  73  LYS LYS K . n 
G 1 75  GLY 75  74  74  GLY GLY K . n 
G 1 76  ASP 76  75  75  ASP ASP K . n 
G 1 77  THR 77  76  76  THR THR K . n 
G 1 78  ARG 78  77  77  ARG ARG K . n 
G 1 79  TYR 79  78  78  TYR TYR K . n 
G 1 80  GLU 80  79  79  GLU GLU K . n 
G 1 81  LEU 81  80  80  LEU LEU K . n 
G 1 82  ARG 82  81  81  ARG ARG K . n 
G 1 83  VAL 83  82  82  VAL VAL K . n 
G 1 84  SER 84  83  83  SER SER K . n 
G 1 85  SER 85  84  84  SER SER K . n 
G 1 86  LYS 86  85  85  LYS LYS K . n 
G 1 87  LYS 87  86  86  LYS LYS K . n 
G 1 88  LEU 88  87  87  LEU LEU K . n 
G 1 89  TYR 89  88  88  TYR TYR K . n 
G 1 90  TYR 90  89  89  TYR TYR K . n 
G 1 91  TYR 91  90  90  TYR TYR K . n 
G 1 92  PHE 92  91  91  PHE PHE K . n 
G 1 93  THR 93  92  92  THR THR K . n 
G 1 94  ASN 94  93  93  ASN ASN K . n 
G 1 95  MET 95  94  94  MET MET K . n 
G 1 96  LEU 96  95  95  LEU LEU K . n 
G 1 97  GLU 97  96  96  GLU GLU K . n 
G 1 98  ARG 98  97  97  ARG ARG K . n 
G 1 99  ILE 99  98  98  ILE ILE K . n 
G 1 100 ARG 100 99  99  ARG ARG K . n 
G 1 101 LEU 101 100 100 LEU LEU K . n 
G 1 102 CYS 102 101 101 CYS CYS K . n 
G 1 103 ASN 103 102 102 ASN ASN K . n 
G 1 104 MET 104 103 103 MET MET K . n 
G 1 105 ARG 105 104 104 ARG ARG K . n 
G 1 106 GLU 106 105 105 GLU GLU K . n 
G 1 107 GLN 107 106 106 GLN GLN K . n 
G 1 108 ILE 108 107 107 ILE ILE K . n 
G 1 109 ALA 109 108 108 ALA ALA K . n 
G 1 110 PHE 110 109 109 PHE PHE K . n 
G 1 111 ILE 111 110 110 ILE ILE K . n 
G 1 112 LYS 112 111 111 LYS LYS K . n 
G 1 113 GLY 113 112 112 GLY GLY K . n 
G 1 114 LEU 114 113 113 LEU LEU K . n 
G 1 115 TYR 115 114 114 TYR TYR K . n 
G 1 116 VAL 116 115 115 VAL VAL K . n 
G 1 117 ALA 117 116 116 ALA ALA K . n 
G 1 118 GLU 118 117 117 GLU GLU K . n 
G 1 119 GLY 119 118 118 GLY GLY K . n 
G 1 120 ASP 120 119 119 ASP ASP K . n 
G 1 121 LYS 121 120 120 LYS LYS K . n 
G 1 122 THR 122 121 121 THR THR K . n 
G 1 123 LEU 123 122 122 LEU LEU K . n 
G 1 124 LYS 124 123 123 LYS LYS K . n 
G 1 125 ARG 125 124 124 ARG ARG K . n 
G 1 126 LEU 126 125 125 LEU LEU K . n 
G 1 127 ARG 127 126 126 ARG ARG K . n 
G 1 128 ILE 128 127 127 ILE ILE K . n 
G 1 129 TRP 129 128 128 TRP TRP K . n 
G 1 130 ASN 130 129 129 ASN ASN K . n 
G 1 131 LYS 131 130 130 LYS LYS K . n 
G 1 132 ASN 132 131 131 ASN ASN K . n 
G 1 133 LYS 133 132 132 LYS LYS K . n 
G 1 134 ALA 134 133 133 ALA ALA K . n 
G 1 135 LEU 135 134 134 LEU LEU K . n 
G 1 136 LEU 136 135 135 LEU LEU K . n 
G 1 137 GLU 137 136 136 GLU GLU K . n 
G 1 138 ILE 138 137 137 ILE ILE K . n 
G 1 139 VAL 139 138 138 VAL VAL K . n 
G 1 140 SER 140 139 139 SER SER K . n 
G 1 141 ARG 141 140 140 ARG ARG K . n 
G 1 142 TRP 142 141 141 TRP TRP K . n 
G 1 143 LEU 143 142 142 LEU LEU K . n 
G 1 144 ASN 144 143 143 ASN ASN K . n 
G 1 145 ASN 145 144 144 ASN ASN K . n 
G 1 146 LEU 146 145 145 LEU LEU K . n 
G 1 147 GLY 147 146 146 GLY GLY K . n 
G 1 148 VAL 148 147 147 VAL VAL K . n 
G 1 149 ARG 149 148 148 ARG ARG K . n 
G 1 150 ASN 150 149 149 ASN ASN K . n 
G 1 151 THR 151 150 150 THR THR K . n 
G 1 152 ILE 152 151 151 ILE ILE K . n 
G 1 153 HIS 153 152 152 HIS HIS K . n 
G 1 154 LEU 154 153 153 LEU LEU K . n 
G 1 155 ASP 155 154 154 ASP ASP K . n 
G 1 156 ASP 156 155 155 ASP ASP K . n 
G 1 157 HIS 157 156 156 HIS HIS K . n 
G 1 158 ARG 158 157 157 ARG ARG K . n 
G 1 159 HIS 159 158 158 HIS HIS K . n 
G 1 160 GLY 160 159 159 GLY GLY K . n 
G 1 161 VAL 161 160 160 VAL VAL K . n 
G 1 162 TYR 162 161 161 TYR TYR K . n 
G 1 163 VAL 163 162 162 VAL VAL K . n 
G 1 164 LEU 164 163 163 LEU LEU K . n 
G 1 165 ASN 165 164 164 ASN ASN K . n 
G 1 166 ILE 166 165 165 ILE ILE K . n 
G 1 167 SER 167 166 166 SER SER K . n 
G 1 168 LEU 168 167 167 LEU LEU K . n 
G 1 169 ARG 169 168 168 ARG ARG K . n 
G 1 170 ASP 170 169 169 ASP ASP K . n 
G 1 171 ARG 171 170 170 ARG ARG K . n 
G 1 172 ILE 172 171 171 ILE ILE K . n 
G 1 173 LYS 173 172 172 LYS LYS K . n 
G 1 174 PHE 174 173 173 PHE PHE K . n 
G 1 175 VAL 175 174 174 VAL VAL K . n 
G 1 176 HIS 176 175 175 HIS HIS K . n 
G 1 177 THR 177 176 176 THR THR K . n 
G 1 178 ILE 178 177 177 ILE ILE K . n 
G 1 179 LEU 179 178 178 LEU LEU K . n 
G 1 180 SER 180 179 179 SER SER K . n 
G 1 181 SER 181 180 180 SER SER K . n 
G 1 182 HIS 182 181 181 HIS HIS K . n 
G 1 183 LEU 183 182 182 LEU LEU K . n 
G 1 184 ASN 184 183 183 ASN ASN K . n 
G 1 185 PRO 185 184 ?   ?   ?   K . n 
G 1 186 LEU 186 185 ?   ?   ?   K . n 
G 1 187 PRO 187 186 ?   ?   ?   K . n 
G 1 188 PRO 188 187 ?   ?   ?   K . n 
G 1 189 GLU 189 188 ?   ?   ?   K . n 
G 1 190 ALA 190 189 ?   ?   ?   K . n 
G 1 191 ALA 191 190 ?   ?   ?   K . n 
G 1 192 ALA 192 191 ?   ?   ?   K . n 
G 1 193 LEU 193 192 ?   ?   ?   K . n 
G 1 194 GLU 194 193 ?   ?   ?   K . n 
G 1 195 HIS 195 194 ?   ?   ?   K . n 
G 1 196 HIS 196 195 ?   ?   ?   K . n 
G 1 197 HIS 197 196 ?   ?   ?   K . n 
G 1 198 HIS 198 197 ?   ?   ?   K . n 
G 1 199 HIS 199 198 ?   ?   ?   K . n 
G 1 200 HIS 200 199 ?   ?   ?   K . n 
H 2 1   DG  1   1   1   DG  DG  L . n 
H 2 2   DC  2   2   2   DC  DC  L . n 
H 2 3   DC  3   3   3   DC  DC  L . n 
H 2 4   DT  4   4   4   DT  DT  L . n 
H 2 5   DT  5   5   5   DT  DT  L . n 
H 2 6   DG  6   6   6   DG  DG  L . n 
H 2 7   DC  7   7   7   DC  DC  L . n 
H 2 8   DC  8   8   8   DC  DC  L . n 
H 2 9   DG  9   9   9   DG  DG  L . n 
H 2 10  DG  10  10  10  DG  DG  L . n 
H 2 11  DG  11  11  11  DG  DG  L . n 
H 2 12  DT  12  12  12  DT  DT  L . n 
H 2 13  DA  13  13  13  DA  DA  L . n 
H 2 14  DA  14  14  14  DA  DA  L . n 
H 2 15  DG  15  15  15  DG  DG  L . n 
H 2 16  DT  16  16  16  DT  DT  L . n 
H 2 17  DT  17  17  17  DT  DT  L . n 
H 2 18  DC  18  18  18  DC  DC  L . n 
H 2 19  DC  19  19  19  DC  DC  L . n 
H 2 20  DG  20  20  20  DG  DG  L . n 
H 2 21  DG  21  21  21  DG  DG  L . n 
H 2 22  DC  22  22  22  DC  DC  L . n 
H 2 23  DG  23  23  23  DG  DG  L . n 
H 2 24  DC  24  24  24  DC  DC  L . n 
H 2 25  DG  25  25  25  DG  DG  L . n 
I 3 1   DC  1   1   1   DC  DC  N . n 
I 3 2   DG  2   2   2   DG  DG  N . n 
I 3 3   DC  3   3   3   DC  DC  N . n 
I 3 4   DG  4   4   4   DG  DG  N . n 
I 3 5   DC  5   5   5   DC  DC  N . n 
I 3 6   DC  6   6   6   DC  DC  N . n 
I 3 7   DG  7   7   7   DG  DG  N . n 
I 3 8   DG  8   8   8   DG  DG  N . n 
I 3 9   DA  9   9   9   DA  DA  N . n 
I 3 10  DA  10  10  10  DA  DA  N . n 
I 3 11  DC  11  11  11  DC  DC  N . n 
I 3 12  DT  12  12  12  DT  DT  N . n 
I 3 13  DT  13  13  13  DT  DT  N . n 
I 3 14  DA  14  14  14  DA  DA  N . n 
I 3 15  DC  15  15  15  DC  DC  N . n 
I 3 16  DC  16  16  16  DC  DC  N . n 
I 3 17  DC  17  17  17  DC  DC  N . n 
I 3 18  DG  18  18  18  DG  DG  N . n 
I 3 19  DG  19  19  19  DG  DG  N . n 
I 3 20  DC  20  20  20  DC  DC  N . n 
I 3 21  DA  21  21  21  DA  DA  N . n 
I 3 22  DA  22  22  22  DA  DA  N . n 
I 3 23  DG  23  23  23  DG  DG  N . n 
I 3 24  DG  24  24  24  DG  DG  N . n 
I 3 25  DC  25  25  25  DC  DC  N . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
J 4 MN  1  201 1   MN  Mn  A . 
K 4 MN  1  202 2   MN  Mn  A . 
L 5 CL  1  203 2   CL  CL  A . 
M 4 MN  1  201 3   MN  Mn  F . 
N 4 MN  1  202 4   MN  Mn  F . 
O 5 CL  1  101 1   CL  CL  G . 
P 4 MN  1  201 5   MN  Mn  K . 
Q 4 MN  1  202 6   MN  Mn  K . 
R 6 HOH 1  301 9   HOH HOH A . 
R 6 HOH 2  302 246 HOH HOH A . 
R 6 HOH 3  303 74  HOH HOH A . 
R 6 HOH 4  304 200 HOH HOH A . 
R 6 HOH 5  305 7   HOH HOH A . 
R 6 HOH 6  306 86  HOH HOH A . 
R 6 HOH 7  307 162 HOH HOH A . 
R 6 HOH 8  308 63  HOH HOH A . 
R 6 HOH 9  309 54  HOH HOH A . 
R 6 HOH 10 310 3   HOH HOH A . 
R 6 HOH 11 311 102 HOH HOH A . 
R 6 HOH 12 312 12  HOH HOH A . 
R 6 HOH 13 313 244 HOH HOH A . 
R 6 HOH 14 314 17  HOH HOH A . 
R 6 HOH 15 315 103 HOH HOH A . 
R 6 HOH 16 316 5   HOH HOH A . 
R 6 HOH 17 317 13  HOH HOH A . 
R 6 HOH 18 318 217 HOH HOH A . 
R 6 HOH 19 319 105 HOH HOH A . 
R 6 HOH 20 320 245 HOH HOH A . 
R 6 HOH 21 321 80  HOH HOH A . 
R 6 HOH 22 322 89  HOH HOH A . 
R 6 HOH 23 323 116 HOH HOH A . 
R 6 HOH 24 324 32  HOH HOH A . 
R 6 HOH 25 325 65  HOH HOH A . 
R 6 HOH 26 326 127 HOH HOH A . 
R 6 HOH 27 327 168 HOH HOH A . 
R 6 HOH 28 328 56  HOH HOH A . 
R 6 HOH 29 329 28  HOH HOH A . 
R 6 HOH 30 330 123 HOH HOH A . 
R 6 HOH 31 331 46  HOH HOH A . 
R 6 HOH 32 332 61  HOH HOH A . 
R 6 HOH 33 333 84  HOH HOH A . 
R 6 HOH 34 334 220 HOH HOH A . 
R 6 HOH 35 335 239 HOH HOH A . 
R 6 HOH 36 336 226 HOH HOH A . 
R 6 HOH 37 337 213 HOH HOH A . 
R 6 HOH 38 338 227 HOH HOH A . 
R 6 HOH 39 339 45  HOH HOH A . 
R 6 HOH 40 340 279 HOH HOH A . 
R 6 HOH 41 341 81  HOH HOH A . 
R 6 HOH 42 342 126 HOH HOH A . 
R 6 HOH 43 343 196 HOH HOH A . 
R 6 HOH 44 344 93  HOH HOH A . 
R 6 HOH 45 345 248 HOH HOH A . 
R 6 HOH 46 346 111 HOH HOH A . 
R 6 HOH 47 347 260 HOH HOH A . 
R 6 HOH 48 348 206 HOH HOH A . 
R 6 HOH 49 349 271 HOH HOH A . 
R 6 HOH 50 350 101 HOH HOH A . 
R 6 HOH 51 351 153 HOH HOH A . 
R 6 HOH 52 352 124 HOH HOH A . 
R 6 HOH 53 353 100 HOH HOH A . 
R 6 HOH 54 354 258 HOH HOH A . 
R 6 HOH 55 355 280 HOH HOH A . 
R 6 HOH 56 356 152 HOH HOH A . 
S 6 HOH 1  101 252 HOH HOH C . 
S 6 HOH 2  102 14  HOH HOH C . 
S 6 HOH 3  103 261 HOH HOH C . 
S 6 HOH 4  104 110 HOH HOH C . 
S 6 HOH 5  105 76  HOH HOH C . 
S 6 HOH 6  106 91  HOH HOH C . 
S 6 HOH 7  107 41  HOH HOH C . 
S 6 HOH 8  108 108 HOH HOH C . 
S 6 HOH 9  109 96  HOH HOH C . 
S 6 HOH 10 110 67  HOH HOH C . 
S 6 HOH 11 111 191 HOH HOH C . 
S 6 HOH 12 112 270 HOH HOH C . 
S 6 HOH 13 113 115 HOH HOH C . 
S 6 HOH 14 114 170 HOH HOH C . 
S 6 HOH 15 115 267 HOH HOH C . 
S 6 HOH 16 116 128 HOH HOH C . 
S 6 HOH 17 117 224 HOH HOH C . 
S 6 HOH 18 118 201 HOH HOH C . 
S 6 HOH 19 119 87  HOH HOH C . 
T 6 HOH 1  101 158 HOH HOH D . 
T 6 HOH 2  102 4   HOH HOH D . 
T 6 HOH 3  103 92  HOH HOH D . 
T 6 HOH 4  104 72  HOH HOH D . 
T 6 HOH 5  105 78  HOH HOH D . 
T 6 HOH 6  106 21  HOH HOH D . 
T 6 HOH 7  107 138 HOH HOH D . 
T 6 HOH 8  108 8   HOH HOH D . 
T 6 HOH 9  109 1   HOH HOH D . 
T 6 HOH 10 110 38  HOH HOH D . 
T 6 HOH 11 111 73  HOH HOH D . 
T 6 HOH 12 112 59  HOH HOH D . 
T 6 HOH 13 113 135 HOH HOH D . 
T 6 HOH 14 114 57  HOH HOH D . 
T 6 HOH 15 115 161 HOH HOH D . 
T 6 HOH 16 116 55  HOH HOH D . 
T 6 HOH 17 117 106 HOH HOH D . 
T 6 HOH 18 118 211 HOH HOH D . 
T 6 HOH 19 119 184 HOH HOH D . 
T 6 HOH 20 120 23  HOH HOH D . 
T 6 HOH 21 121 149 HOH HOH D . 
T 6 HOH 22 122 273 HOH HOH D . 
T 6 HOH 23 123 167 HOH HOH D . 
T 6 HOH 24 124 240 HOH HOH D . 
U 6 HOH 1  301 25  HOH HOH F . 
U 6 HOH 2  302 195 HOH HOH F . 
U 6 HOH 3  303 141 HOH HOH F . 
U 6 HOH 4  304 159 HOH HOH F . 
U 6 HOH 5  305 242 HOH HOH F . 
U 6 HOH 6  306 216 HOH HOH F . 
U 6 HOH 7  307 49  HOH HOH F . 
U 6 HOH 8  308 104 HOH HOH F . 
U 6 HOH 9  309 6   HOH HOH F . 
U 6 HOH 10 310 35  HOH HOH F . 
U 6 HOH 11 311 34  HOH HOH F . 
U 6 HOH 12 312 189 HOH HOH F . 
U 6 HOH 13 313 58  HOH HOH F . 
U 6 HOH 14 314 146 HOH HOH F . 
U 6 HOH 15 315 22  HOH HOH F . 
U 6 HOH 16 316 222 HOH HOH F . 
U 6 HOH 17 317 278 HOH HOH F . 
U 6 HOH 18 318 20  HOH HOH F . 
U 6 HOH 19 319 265 HOH HOH F . 
U 6 HOH 20 320 71  HOH HOH F . 
U 6 HOH 21 321 31  HOH HOH F . 
U 6 HOH 22 322 274 HOH HOH F . 
U 6 HOH 23 323 18  HOH HOH F . 
U 6 HOH 24 324 215 HOH HOH F . 
U 6 HOH 25 325 27  HOH HOH F . 
U 6 HOH 26 326 119 HOH HOH F . 
U 6 HOH 27 327 136 HOH HOH F . 
U 6 HOH 28 328 69  HOH HOH F . 
U 6 HOH 29 329 253 HOH HOH F . 
U 6 HOH 30 330 50  HOH HOH F . 
U 6 HOH 31 331 140 HOH HOH F . 
U 6 HOH 32 332 109 HOH HOH F . 
U 6 HOH 33 333 282 HOH HOH F . 
U 6 HOH 34 334 154 HOH HOH F . 
U 6 HOH 35 335 183 HOH HOH F . 
U 6 HOH 36 336 209 HOH HOH F . 
U 6 HOH 37 337 236 HOH HOH F . 
U 6 HOH 38 338 171 HOH HOH F . 
U 6 HOH 39 339 98  HOH HOH F . 
U 6 HOH 40 340 66  HOH HOH F . 
U 6 HOH 41 341 142 HOH HOH F . 
U 6 HOH 42 342 16  HOH HOH F . 
U 6 HOH 43 343 173 HOH HOH F . 
U 6 HOH 44 344 283 HOH HOH F . 
U 6 HOH 45 345 40  HOH HOH F . 
U 6 HOH 46 346 229 HOH HOH F . 
U 6 HOH 47 347 179 HOH HOH F . 
U 6 HOH 48 348 181 HOH HOH F . 
U 6 HOH 49 349 257 HOH HOH F . 
U 6 HOH 50 350 276 HOH HOH F . 
U 6 HOH 51 351 263 HOH HOH F . 
V 6 HOH 1  201 277 HOH HOH G . 
V 6 HOH 2  202 30  HOH HOH G . 
V 6 HOH 3  203 219 HOH HOH G . 
V 6 HOH 4  204 188 HOH HOH G . 
V 6 HOH 5  205 77  HOH HOH G . 
V 6 HOH 6  206 117 HOH HOH G . 
V 6 HOH 7  207 251 HOH HOH G . 
V 6 HOH 8  208 52  HOH HOH G . 
V 6 HOH 9  209 90  HOH HOH G . 
V 6 HOH 10 210 231 HOH HOH G . 
V 6 HOH 11 211 99  HOH HOH G . 
V 6 HOH 12 212 163 HOH HOH G . 
V 6 HOH 13 213 143 HOH HOH G . 
V 6 HOH 14 214 182 HOH HOH G . 
V 6 HOH 15 215 230 HOH HOH G . 
V 6 HOH 16 216 243 HOH HOH G . 
V 6 HOH 17 217 264 HOH HOH G . 
V 6 HOH 18 218 275 HOH HOH G . 
W 6 HOH 1  101 241 HOH HOH I . 
W 6 HOH 2  102 42  HOH HOH I . 
W 6 HOH 3  103 234 HOH HOH I . 
W 6 HOH 4  104 202 HOH HOH I . 
W 6 HOH 5  105 37  HOH HOH I . 
W 6 HOH 6  106 228 HOH HOH I . 
W 6 HOH 7  107 11  HOH HOH I . 
W 6 HOH 8  108 194 HOH HOH I . 
W 6 HOH 9  109 112 HOH HOH I . 
W 6 HOH 10 110 130 HOH HOH I . 
W 6 HOH 11 111 169 HOH HOH I . 
W 6 HOH 12 112 218 HOH HOH I . 
W 6 HOH 13 113 53  HOH HOH I . 
W 6 HOH 14 114 88  HOH HOH I . 
W 6 HOH 15 115 94  HOH HOH I . 
W 6 HOH 16 116 178 HOH HOH I . 
X 6 HOH 1  301 247 HOH HOH K . 
X 6 HOH 2  302 177 HOH HOH K . 
X 6 HOH 3  303 60  HOH HOH K . 
X 6 HOH 4  304 44  HOH HOH K . 
X 6 HOH 5  305 237 HOH HOH K . 
X 6 HOH 6  306 121 HOH HOH K . 
X 6 HOH 7  307 129 HOH HOH K . 
X 6 HOH 8  308 24  HOH HOH K . 
X 6 HOH 9  309 39  HOH HOH K . 
X 6 HOH 10 310 47  HOH HOH K . 
X 6 HOH 11 311 107 HOH HOH K . 
X 6 HOH 12 312 131 HOH HOH K . 
X 6 HOH 13 313 19  HOH HOH K . 
X 6 HOH 14 314 10  HOH HOH K . 
X 6 HOH 15 315 203 HOH HOH K . 
X 6 HOH 16 316 148 HOH HOH K . 
X 6 HOH 17 317 133 HOH HOH K . 
X 6 HOH 18 318 145 HOH HOH K . 
X 6 HOH 19 319 83  HOH HOH K . 
X 6 HOH 20 320 36  HOH HOH K . 
X 6 HOH 21 321 68  HOH HOH K . 
X 6 HOH 22 322 29  HOH HOH K . 
X 6 HOH 23 323 62  HOH HOH K . 
X 6 HOH 24 324 82  HOH HOH K . 
X 6 HOH 25 325 238 HOH HOH K . 
X 6 HOH 26 326 249 HOH HOH K . 
X 6 HOH 27 327 214 HOH HOH K . 
X 6 HOH 28 328 210 HOH HOH K . 
X 6 HOH 29 329 174 HOH HOH K . 
X 6 HOH 30 330 204 HOH HOH K . 
X 6 HOH 31 331 139 HOH HOH K . 
X 6 HOH 32 332 235 HOH HOH K . 
X 6 HOH 33 333 156 HOH HOH K . 
X 6 HOH 34 334 150 HOH HOH K . 
X 6 HOH 35 335 122 HOH HOH K . 
X 6 HOH 36 336 199 HOH HOH K . 
X 6 HOH 37 337 125 HOH HOH K . 
X 6 HOH 38 338 193 HOH HOH K . 
X 6 HOH 39 339 272 HOH HOH K . 
X 6 HOH 40 340 176 HOH HOH K . 
X 6 HOH 41 341 254 HOH HOH K . 
X 6 HOH 42 342 160 HOH HOH K . 
X 6 HOH 43 343 132 HOH HOH K . 
X 6 HOH 44 344 266 HOH HOH K . 
X 6 HOH 45 345 180 HOH HOH K . 
X 6 HOH 46 346 165 HOH HOH K . 
X 6 HOH 47 347 281 HOH HOH K . 
X 6 HOH 48 348 259 HOH HOH K . 
X 6 HOH 49 349 262 HOH HOH K . 
Y 6 HOH 1  101 147 HOH HOH L . 
Y 6 HOH 2  102 233 HOH HOH L . 
Y 6 HOH 3  103 164 HOH HOH L . 
Y 6 HOH 4  104 85  HOH HOH L . 
Y 6 HOH 5  105 48  HOH HOH L . 
Y 6 HOH 6  106 64  HOH HOH L . 
Y 6 HOH 7  107 192 HOH HOH L . 
Y 6 HOH 8  108 151 HOH HOH L . 
Y 6 HOH 9  109 190 HOH HOH L . 
Y 6 HOH 10 110 15  HOH HOH L . 
Y 6 HOH 11 111 114 HOH HOH L . 
Y 6 HOH 12 112 120 HOH HOH L . 
Y 6 HOH 13 113 33  HOH HOH L . 
Y 6 HOH 14 114 185 HOH HOH L . 
Y 6 HOH 15 115 97  HOH HOH L . 
Y 6 HOH 16 116 187 HOH HOH L . 
Y 6 HOH 17 117 269 HOH HOH L . 
Y 6 HOH 18 118 256 HOH HOH L . 
Y 6 HOH 19 119 198 HOH HOH L . 
Y 6 HOH 20 120 51  HOH HOH L . 
Y 6 HOH 21 121 268 HOH HOH L . 
Y 6 HOH 22 122 137 HOH HOH L . 
Y 6 HOH 23 123 232 HOH HOH L . 
Y 6 HOH 24 124 205 HOH HOH L . 
Y 6 HOH 25 125 144 HOH HOH L . 
Y 6 HOH 26 126 225 HOH HOH L . 
Y 6 HOH 27 127 186 HOH HOH L . 
Z 6 HOH 1  101 113 HOH HOH N . 
Z 6 HOH 2  102 255 HOH HOH N . 
Z 6 HOH 3  103 134 HOH HOH N . 
Z 6 HOH 4  104 223 HOH HOH N . 
Z 6 HOH 5  105 166 HOH HOH N . 
Z 6 HOH 6  106 207 HOH HOH N . 
Z 6 HOH 7  107 2   HOH HOH N . 
Z 6 HOH 8  108 26  HOH HOH N . 
Z 6 HOH 9  109 172 HOH HOH N . 
Z 6 HOH 10 110 70  HOH HOH N . 
Z 6 HOH 11 111 79  HOH HOH N . 
Z 6 HOH 12 112 208 HOH HOH N . 
Z 6 HOH 13 113 75  HOH HOH N . 
Z 6 HOH 14 114 157 HOH HOH N . 
Z 6 HOH 15 115 221 HOH HOH N . 
Z 6 HOH 16 116 43  HOH HOH N . 
Z 6 HOH 17 117 95  HOH HOH N . 
Z 6 HOH 18 118 155 HOH HOH N . 
Z 6 HOH 19 119 175 HOH HOH N . 
Z 6 HOH 20 120 197 HOH HOH N . 
Z 6 HOH 21 121 118 HOH HOH N . 
Z 6 HOH 22 122 250 HOH HOH N . 
Z 6 HOH 23 123 212 HOH HOH N . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
3 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,J,K,L,R,S,T 
2 1 D,E,F,M,N,O,U,V,W 
3 1 G,H,I,P,Q,X,Y,Z   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7950  ? 
1 MORE         -70   ? 
1 'SSA (A^2)'  14260 ? 
2 'ABSA (A^2)' 7820  ? 
2 MORE         -64   ? 
2 'SSA (A^2)'  14120 ? 
3 'ABSA (A^2)' 7620  ? 
3 MORE         -57   ? 
3 'SSA (A^2)'  13920 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A GLY 21  ? A GLY 20  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 OE2 ? A GLU 118 ? A GLU 117 ? 1_555 106.9 ? 
2  O   ? A GLY 21  ? A GLY 20  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 OP2 ? B DG  15  ? C DG  15  ? 1_555 79.3  ? 
3  OE2 ? A GLU 118 ? A GLU 117 ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 OP2 ? B DG  15  ? C DG  15  ? 1_555 123.2 ? 
4  O   ? A GLY 21  ? A GLY 20  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 OP1 ? C DC  15  ? D DC  15  ? 1_555 175.8 ? 
5  OE2 ? A GLU 118 ? A GLU 117 ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 OP1 ? C DC  15  ? D DC  15  ? 1_555 75.6  ? 
6  OP2 ? B DG  15  ? C DG  15  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 OP1 ? C DC  15  ? D DC  15  ? 1_555 102.2 ? 
7  O   ? A GLY 21  ? A GLY 20  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? S HOH .   ? C HOH 118 ? 1_555 87.3  ? 
8  OE2 ? A GLU 118 ? A GLU 117 ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? S HOH .   ? C HOH 118 ? 1_555 151.3 ? 
9  OP2 ? B DG  15  ? C DG  15  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? S HOH .   ? C HOH 118 ? 1_555 83.4  ? 
10 OP1 ? C DC  15  ? D DC  15  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? S HOH .   ? C HOH 118 ? 1_555 89.1  ? 
11 O   ? A GLY 21  ? A GLY 20  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? R HOH .   ? A HOH 316 ? 1_555 91.5  ? 
12 OE2 ? A GLU 118 ? A GLU 117 ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? R HOH .   ? A HOH 316 ? 1_555 87.6  ? 
13 OP2 ? B DG  15  ? C DG  15  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? R HOH .   ? A HOH 316 ? 1_555 149.2 ? 
14 OP1 ? C DC  15  ? D DC  15  ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? R HOH .   ? A HOH 316 ? 1_555 85.2  ? 
15 O   ? S HOH .   ? C HOH 118 ? 1_555 MN ? K MN . ? A MN 202 ? 1_555 O   ? R HOH .   ? A HOH 316 ? 1_555 66.7  ? 
16 OD1 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OD2 ? A ASP 22  ? A ASP 21  ? 1_555 50.0  ? 
17 OD1 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? A ALA 117 ? A ALA 116 ? 1_555 83.5  ? 
18 OD2 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? A ALA 117 ? A ALA 116 ? 1_555 90.8  ? 
19 OD1 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OP1 ? B DA  14  ? C DA  14  ? 1_555 99.0  ? 
20 OD2 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OP1 ? B DA  14  ? C DA  14  ? 1_555 89.1  ? 
21 O   ? A ALA 117 ? A ALA 116 ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OP1 ? B DA  14  ? C DA  14  ? 1_555 176.7 ? 
22 OD1 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OP2 ? C DC  16  ? D DC  16  ? 1_555 79.7  ? 
23 OD2 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OP2 ? C DC  16  ? D DC  16  ? 1_555 129.7 ? 
24 O   ? A ALA 117 ? A ALA 116 ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OP2 ? C DC  16  ? D DC  16  ? 1_555 84.2  ? 
25 OP1 ? B DA  14  ? C DA  14  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 OP2 ? C DC  16  ? D DC  16  ? 1_555 98.4  ? 
26 OD1 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? T HOH .   ? D HOH 120 ? 1_555 159.9 ? 
27 OD2 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? T HOH .   ? D HOH 120 ? 1_555 149.4 ? 
28 O   ? A ALA 117 ? A ALA 116 ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? T HOH .   ? D HOH 120 ? 1_555 90.0  ? 
29 OP1 ? B DA  14  ? C DA  14  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? T HOH .   ? D HOH 120 ? 1_555 88.4  ? 
30 OP2 ? C DC  16  ? D DC  16  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? T HOH .   ? D HOH 120 ? 1_555 80.8  ? 
31 OD1 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? R HOH .   ? A HOH 317 ? 1_555 124.0 ? 
32 OD2 ? A ASP 22  ? A ASP 21  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? R HOH .   ? A HOH 317 ? 1_555 74.4  ? 
33 O   ? A ALA 117 ? A ALA 116 ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? R HOH .   ? A HOH 317 ? 1_555 91.6  ? 
34 OP1 ? B DA  14  ? C DA  14  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? R HOH .   ? A HOH 317 ? 1_555 85.2  ? 
35 OP2 ? C DC  16  ? D DC  16  ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? R HOH .   ? A HOH 317 ? 1_555 155.4 ? 
36 O   ? T HOH .   ? D HOH 120 ? 1_555 MN ? J MN . ? A MN 201 ? 1_555 O   ? R HOH .   ? A HOH 317 ? 1_555 75.0  ? 
37 O   ? D GLY 21  ? F GLY 20  ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 OE2 ? D GLU 118 ? F GLU 117 ? 1_555 91.7  ? 
38 O   ? D GLY 21  ? F GLY 20  ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 OP2 ? E DG  15  ? G DG  15  ? 1_555 72.8  ? 
39 OE2 ? D GLU 118 ? F GLU 117 ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 OP2 ? E DG  15  ? G DG  15  ? 1_555 110.1 ? 
40 O   ? D GLY 21  ? F GLY 20  ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 OP1 ? F DC  15  ? I DC  15  ? 1_555 163.0 ? 
41 OE2 ? D GLU 118 ? F GLU 117 ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 OP1 ? F DC  15  ? I DC  15  ? 1_555 72.7  ? 
42 OP2 ? E DG  15  ? G DG  15  ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 OP1 ? F DC  15  ? I DC  15  ? 1_555 105.7 ? 
43 O   ? D GLY 21  ? F GLY 20  ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 O   ? U HOH .   ? F HOH 315 ? 1_555 97.6  ? 
44 OE2 ? D GLU 118 ? F GLU 117 ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 O   ? U HOH .   ? F HOH 315 ? 1_555 80.4  ? 
45 OP2 ? E DG  15  ? G DG  15  ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 O   ? U HOH .   ? F HOH 315 ? 1_555 165.6 ? 
46 OP1 ? F DC  15  ? I DC  15  ? 1_555 MN ? N MN . ? F MN 202 ? 1_555 O   ? U HOH .   ? F HOH 315 ? 1_555 86.6  ? 
47 OD1 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OD2 ? D ASP 22  ? F ASP 21  ? 1_555 48.3  ? 
48 OD1 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 O   ? D ALA 117 ? F ALA 116 ? 1_555 81.5  ? 
49 OD2 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 O   ? D ALA 117 ? F ALA 116 ? 1_555 88.4  ? 
50 OD1 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OP1 ? E DA  14  ? G DA  14  ? 1_555 98.0  ? 
51 OD2 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OP1 ? E DA  14  ? G DA  14  ? 1_555 90.0  ? 
52 O   ? D ALA 117 ? F ALA 116 ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OP1 ? E DA  14  ? G DA  14  ? 1_555 178.2 ? 
53 OD1 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OP2 ? F DC  16  ? I DC  16  ? 1_555 78.2  ? 
54 OD2 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OP2 ? F DC  16  ? I DC  16  ? 1_555 125.9 ? 
55 O   ? D ALA 117 ? F ALA 116 ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OP2 ? F DC  16  ? I DC  16  ? 1_555 74.6  ? 
56 OP1 ? E DA  14  ? G DA  14  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 OP2 ? F DC  16  ? I DC  16  ? 1_555 107.0 ? 
57 OD1 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 O   ? U HOH .   ? F HOH 309 ? 1_555 124.8 ? 
58 OD2 ? D ASP 22  ? F ASP 21  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 O   ? U HOH .   ? F HOH 309 ? 1_555 78.2  ? 
59 O   ? D ALA 117 ? F ALA 116 ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 O   ? U HOH .   ? F HOH 309 ? 1_555 84.8  ? 
60 OP1 ? E DA  14  ? G DA  14  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 O   ? U HOH .   ? F HOH 309 ? 1_555 94.1  ? 
61 OP2 ? F DC  16  ? I DC  16  ? 1_555 MN ? M MN . ? F MN 201 ? 1_555 O   ? U HOH .   ? F HOH 309 ? 1_555 146.7 ? 
62 O   ? G GLY 21  ? K GLY 20  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 OE2 ? G GLU 118 ? K GLU 117 ? 1_555 98.0  ? 
63 O   ? G GLY 21  ? K GLY 20  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 OP2 ? H DG  15  ? L DG  15  ? 1_555 76.8  ? 
64 OE2 ? G GLU 118 ? K GLU 117 ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 OP2 ? H DG  15  ? L DG  15  ? 1_555 125.0 ? 
65 O   ? G GLY 21  ? K GLY 20  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 OP1 ? I DC  15  ? N DC  15  ? 1_555 178.9 ? 
66 OE2 ? G GLU 118 ? K GLU 117 ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 OP1 ? I DC  15  ? N DC  15  ? 1_555 81.1  ? 
67 OP2 ? H DG  15  ? L DG  15  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 OP1 ? I DC  15  ? N DC  15  ? 1_555 104.2 ? 
68 O   ? G GLY 21  ? K GLY 20  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? X HOH .   ? K HOH 326 ? 1_555 99.7  ? 
69 OE2 ? G GLU 118 ? K GLU 117 ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? X HOH .   ? K HOH 326 ? 1_555 89.9  ? 
70 OP2 ? H DG  15  ? L DG  15  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? X HOH .   ? K HOH 326 ? 1_555 145.0 ? 
71 OP1 ? I DC  15  ? N DC  15  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? X HOH .   ? K HOH 326 ? 1_555 79.7  ? 
72 O   ? G GLY 21  ? K GLY 20  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? Y HOH .   ? L HOH 124 ? 1_555 98.7  ? 
73 OE2 ? G GLU 118 ? K GLU 117 ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? Y HOH .   ? L HOH 124 ? 1_555 152.3 ? 
74 OP2 ? H DG  15  ? L DG  15  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? Y HOH .   ? L HOH 124 ? 1_555 80.4  ? 
75 OP1 ? I DC  15  ? N DC  15  ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? Y HOH .   ? L HOH 124 ? 1_555 81.9  ? 
76 O   ? X HOH .   ? K HOH 326 ? 1_555 MN ? Q MN . ? K MN 202 ? 1_555 O   ? Y HOH .   ? L HOH 124 ? 1_555 65.6  ? 
77 OD1 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OD2 ? G ASP 22  ? K ASP 21  ? 1_555 49.5  ? 
78 OD1 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? G ALA 117 ? K ALA 116 ? 1_555 82.6  ? 
79 OD2 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? G ALA 117 ? K ALA 116 ? 1_555 92.7  ? 
80 OD1 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OP1 ? H DA  14  ? L DA  14  ? 1_555 97.4  ? 
81 OD2 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OP1 ? H DA  14  ? L DA  14  ? 1_555 87.8  ? 
82 O   ? G ALA 117 ? K ALA 116 ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OP1 ? H DA  14  ? L DA  14  ? 1_555 179.3 ? 
83 OD1 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OP2 ? I DC  16  ? N DC  16  ? 1_555 83.8  ? 
84 OD2 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OP2 ? I DC  16  ? N DC  16  ? 1_555 133.2 ? 
85 O   ? G ALA 117 ? K ALA 116 ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OP2 ? I DC  16  ? N DC  16  ? 1_555 76.2  ? 
86 OP1 ? H DA  14  ? L DA  14  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 OP2 ? I DC  16  ? N DC  16  ? 1_555 103.2 ? 
87 OD1 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 315 ? 1_555 122.8 ? 
88 OD2 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 315 ? 1_555 74.5  ? 
89 O   ? G ALA 117 ? K ALA 116 ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 315 ? 1_555 90.5  ? 
90 OP1 ? H DA  14  ? L DA  14  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 315 ? 1_555 90.1  ? 
91 OP2 ? I DC  16  ? N DC  16  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 315 ? 1_555 148.8 ? 
92 OD1 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 330 ? 1_555 159.8 ? 
93 OD2 ? G ASP 22  ? K ASP 21  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 330 ? 1_555 150.6 ? 
94 O   ? G ALA 117 ? K ALA 116 ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 330 ? 1_555 95.2  ? 
95 OP1 ? H DA  14  ? L DA  14  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 330 ? 1_555 84.6  ? 
96 OP2 ? I DC  16  ? N DC  16  ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 330 ? 1_555 76.2  ? 
97 O   ? X HOH .   ? K HOH 315 ? 1_555 MN ? P MN . ? K MN 201 ? 1_555 O   ? X HOH .   ? K HOH 330 ? 1_555 77.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-12-06 
2 'Structure model' 1 1 2018-01-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            citation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? '(1.10.1_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .                    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O     F LYS 68  ? ? O F HOH 301 ? ? 1.83 
2  1 O     L HOH 110 ? ? O N HOH 101 ? ? 1.84 
3  1 O     A LYS 68  ? ? O A HOH 301 ? ? 1.87 
4  1 OD1   K ASN 144 ? ? O K HOH 301 ? ? 1.89 
5  1 O     F HOH 338 ? ? O F HOH 344 ? ? 1.91 
6  1 O     F HOH 347 ? ? O F HOH 348 ? ? 1.92 
7  1 "O5'" I DC  1   ? ? O I HOH 101 ? ? 1.97 
8  1 OD2   A ASP 61  ? ? O A HOH 302 ? ? 2.00 
9  1 "O4'" I DA  14  ? ? O I HOH 102 ? ? 2.01 
10 1 O     A HOH 302 ? ? O A HOH 354 ? ? 2.06 
11 1 O     F HOH 315 ? ? O F HOH 345 ? ? 2.06 
12 1 OD1   K ASP 21  ? ? O K HOH 302 ? ? 2.07 
13 1 O     F GLU 5   ? ? O F HOH 302 ? ? 2.09 
14 1 O     F HOH 307 ? ? O F HOH 330 ? ? 2.10 
15 1 O     K HOH 312 ? ? O L HOH 112 ? ? 2.11 
16 1 OP1   G DA  13  ? ? O G HOH 201 ? ? 2.13 
17 1 OD1   F ASP 21  ? ? O F HOH 303 ? ? 2.13 
18 1 O     F HOH 347 ? ? O F HOH 349 ? ? 2.15 
19 1 O     F HOH 322 ? ? O F HOH 350 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" D DG  18  ? ? "C1'" D DG  18  ? ? N9  D DG  18  ? ? 110.11 108.30 1.81  0.30 N 
2 1 "O4'" G DG  21  ? ? "C1'" G DG  21  ? ? N9  G DG  21  ? ? 110.30 108.30 2.00  0.30 N 
3 1 NE    K ARG 104 ? ? CZ    K ARG 104 ? ? NH2 K ARG 104 ? ? 117.30 120.30 -3.00 0.50 N 
4 1 "O4'" N DA  22  ? ? "C1'" N DA  22  ? ? N9  N DA  22  ? ? 113.11 108.30 4.81  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 6   ? ? 66.72   -49.48 
2  1 ASN A 129 ? ? -172.26 148.63 
3  1 ILE A 177 ? ? -107.39 -64.02 
4  1 ASN F 6   ? ? 66.36   -47.85 
5  1 HIS F 51  ? ? -130.94 -48.49 
6  1 LEU F 122 ? ? 65.26   -2.02  
7  1 ASN F 129 ? ? -171.12 149.78 
8  1 SER F 179 ? ? -83.93  41.96  
9  1 LEU F 182 ? ? -59.69  10.52  
10 1 ASN K 6   ? ? 55.82   -45.16 
11 1 HIS K 51  ? ? -127.05 -51.66 
12 1 ASP K 119 ? ? -69.32  97.21  
13 1 LEU K 122 ? ? 66.16   -1.05  
14 1 ASN K 129 ? ? -172.43 148.02 
15 1 LEU K 182 ? ? 58.68   19.89  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      D 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       124 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.72 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0   ? A MET 1   
2  1 Y 1 A ALA 1   ? A ALA 2   
3  1 Y 1 A HIS 2   ? A HIS 3   
4  1 Y 1 A ASN 3   ? A ASN 4   
5  1 Y 1 A ASN 4   ? A ASN 5   
6  1 Y 1 A HIS 196 ? A HIS 197 
7  1 Y 1 A HIS 197 ? A HIS 198 
8  1 Y 1 A HIS 198 ? A HIS 199 
9  1 Y 1 A HIS 199 ? A HIS 200 
10 1 Y 1 F MET 0   ? D MET 1   
11 1 Y 1 F ALA 1   ? D ALA 2   
12 1 Y 1 F HIS 2   ? D HIS 3   
13 1 Y 1 F ASN 3   ? D ASN 4   
14 1 Y 1 F ASN 4   ? D ASN 5   
15 1 Y 1 F PRO 184 ? D PRO 185 
16 1 Y 1 F LEU 185 ? D LEU 186 
17 1 Y 1 F PRO 186 ? D PRO 187 
18 1 Y 1 F PRO 187 ? D PRO 188 
19 1 Y 1 F GLU 188 ? D GLU 189 
20 1 Y 1 F ALA 189 ? D ALA 190 
21 1 Y 1 F ALA 190 ? D ALA 191 
22 1 Y 1 F ALA 191 ? D ALA 192 
23 1 Y 1 F LEU 192 ? D LEU 193 
24 1 Y 1 F GLU 193 ? D GLU 194 
25 1 Y 1 F HIS 194 ? D HIS 195 
26 1 Y 1 F HIS 195 ? D HIS 196 
27 1 Y 1 F HIS 196 ? D HIS 197 
28 1 Y 1 F HIS 197 ? D HIS 198 
29 1 Y 1 F HIS 198 ? D HIS 199 
30 1 Y 1 F HIS 199 ? D HIS 200 
31 1 Y 1 K MET 0   ? G MET 1   
32 1 Y 1 K ALA 1   ? G ALA 2   
33 1 Y 1 K HIS 2   ? G HIS 3   
34 1 Y 1 K ASN 3   ? G ASN 4   
35 1 Y 1 K ASN 4   ? G ASN 5   
36 1 Y 1 K PRO 184 ? G PRO 185 
37 1 Y 1 K LEU 185 ? G LEU 186 
38 1 Y 1 K PRO 186 ? G PRO 187 
39 1 Y 1 K PRO 187 ? G PRO 188 
40 1 Y 1 K GLU 188 ? G GLU 189 
41 1 Y 1 K ALA 189 ? G ALA 190 
42 1 Y 1 K ALA 190 ? G ALA 191 
43 1 Y 1 K ALA 191 ? G ALA 192 
44 1 Y 1 K LEU 192 ? G LEU 193 
45 1 Y 1 K GLU 193 ? G GLU 194 
46 1 Y 1 K HIS 194 ? G HIS 195 
47 1 Y 1 K HIS 195 ? G HIS 196 
48 1 Y 1 K HIS 196 ? G HIS 197 
49 1 Y 1 K HIS 197 ? G HIS 198 
50 1 Y 1 K HIS 198 ? G HIS 199 
51 1 Y 1 K HIS 199 ? G HIS 200 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5O6I 'double helix'        
5O6I 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 25 1_555 -0.775 -0.075 -0.174 -4.049  -5.836  2.885  1  C_DG1:DC25_D  C 1  ? D 25 ? 19 1 
1 B DC 2  1_555 C DG 24 1_555 -0.063 -0.140 -0.221 11.245  -4.580  3.469  2  C_DC2:DG24_D  C 2  ? D 24 ? 19 1 
1 B DC 3  1_555 C DG 23 1_555 0.303  -0.128 0.720  1.078   -16.325 -5.271 3  C_DC3:DG23_D  C 3  ? D 23 ? 19 1 
1 B DT 4  1_555 C DA 22 1_555 -0.176 -0.032 0.794  -5.252  -16.686 -0.749 4  C_DT4:DA22_D  C 4  ? D 22 ? 20 1 
1 B DT 5  1_555 C DA 21 1_555 0.216  0.097  0.258  -4.270  -5.100  6.843  5  C_DT5:DA21_D  C 5  ? D 21 ? 20 1 
1 B DG 6  1_555 C DC 20 1_555 -0.470 -0.161 0.504  2.728   -8.199  1.082  6  C_DG6:DC20_D  C 6  ? D 20 ? 19 1 
1 B DC 7  1_555 C DG 19 1_555 0.201  -0.124 0.012  3.206   -8.280  -1.818 7  C_DC7:DG19_D  C 7  ? D 19 ? 19 1 
1 B DC 8  1_555 C DG 18 1_555 0.012  -0.170 0.517  -11.079 -11.181 3.612  8  C_DC8:DG18_D  C 8  ? D 18 ? 19 1 
1 B DG 9  1_555 C DC 17 1_555 0.008  -0.205 0.235  7.415   -14.457 -0.373 9  C_DG9:DC17_D  C 9  ? D 17 ? 19 1 
1 B DG 10 1_555 C DC 16 1_555 -0.417 -0.018 -0.037 -3.552  -14.637 3.300  10 C_DG10:DC16_D C 10 ? D 16 ? 19 1 
1 B DG 11 1_555 C DC 15 1_555 -0.060 0.025  0.451  20.028  -15.839 1.311  11 C_DG11:DC15_D C 11 ? D 15 ? 19 1 
1 B DT 12 1_555 C DA 14 1_555 0.062  -0.097 0.581  12.421  -29.858 3.941  12 C_DT12:DA14_D C 12 ? D 14 ? 20 1 
1 B DA 13 1_555 C DT 13 1_555 0.036  -0.199 0.557  -3.096  -17.258 4.335  13 C_DA13:DT13_D C 13 ? D 13 ? 20 1 
1 B DA 14 1_555 C DT 12 1_555 0.185  -0.203 0.798  -8.667  -13.491 -5.088 14 C_DA14:DT12_D C 14 ? D 12 ? 20 1 
1 B DG 15 1_555 C DC 11 1_555 -0.494 -0.111 0.096  -11.751 -18.550 3.659  15 C_DG15:DC11_D C 15 ? D 11 ? 19 1 
1 B DT 16 1_555 C DA 10 1_555 -0.037 -0.160 0.583  -7.679  -17.769 3.266  16 C_DT16:DA10_D C 16 ? D 10 ? 20 1 
1 B DT 17 1_555 C DA 9  1_555 -0.354 -0.135 -0.260 -7.015  0.799   1.027  17 C_DT17:DA9_D  C 17 ? D 9  ? 20 1 
1 B DC 18 1_555 C DG 8  1_555 0.420  -0.220 0.090  1.154   -12.966 0.468  18 C_DC18:DG8_D  C 18 ? D 8  ? 19 1 
1 B DC 19 1_555 C DG 7  1_555 0.319  -0.402 0.066  -8.139  -5.879  2.237  19 C_DC19:DG7_D  C 19 ? D 7  ? 19 1 
1 B DG 20 1_555 C DC 6  1_555 -0.295 -0.416 0.029  0.551   -7.419  4.510  20 C_DG20:DC6_D  C 20 ? D 6  ? 19 1 
1 B DG 21 1_555 C DC 5  1_555 -0.626 -0.123 0.333  -6.055  -15.718 -0.722 21 C_DG21:DC5_D  C 21 ? D 5  ? 19 1 
1 B DC 22 1_555 C DG 4  1_555 0.528  -0.162 -0.042 -2.156  -6.144  4.222  22 C_DC22:DG4_D  C 22 ? D 4  ? 19 1 
1 B DG 23 1_555 C DC 3  1_555 -0.687 -0.101 0.269  2.425   -2.624  3.488  23 C_DG23:DC3_D  C 23 ? D 3  ? 19 1 
1 B DC 24 1_555 C DG 2  1_555 0.571  -0.262 -0.432 10.821  -7.283  2.486  24 C_DC24:DG2_D  C 24 ? D 2  ? 19 1 
1 B DG 25 1_555 C DC 1  1_555 -0.262 -0.345 0.113  9.807   4.662   -0.484 25 C_DG25:DC1_D  C 25 ? D 1  ? 19 1 
1 E DG 1  1_555 F DC 25 1_555 -0.413 -0.247 -0.014 -7.360  -9.219  -0.620 26 G_DG1:DC25_I  G 1  ? I 25 ? 19 1 
1 E DC 2  1_555 F DG 24 1_555 0.205  -0.159 0.094  1.525   -7.827  5.168  27 G_DC2:DG24_I  G 2  ? I 24 ? 19 1 
1 E DC 3  1_555 F DG 23 1_555 -0.215 -0.056 -0.006 2.212   -12.178 2.528  28 G_DC3:DG23_I  G 3  ? I 23 ? 19 1 
1 E DT 4  1_555 F DA 22 1_555 -0.347 -0.032 0.423  -7.117  -18.988 -0.941 29 G_DT4:DA22_I  G 4  ? I 22 ? 20 1 
1 E DT 5  1_555 F DA 21 1_555 0.043  -0.111 0.256  -6.006  -4.360  3.427  30 G_DT5:DA21_I  G 5  ? I 21 ? 20 1 
1 E DG 6  1_555 F DC 20 1_555 -0.663 -0.064 0.547  6.647   -6.311  -0.953 31 G_DG6:DC20_I  G 6  ? I 20 ? 19 1 
1 E DC 7  1_555 F DG 19 1_555 0.289  -0.196 0.240  -6.142  -7.016  -1.872 32 G_DC7:DG19_I  G 7  ? I 19 ? 19 1 
1 E DC 8  1_555 F DG 18 1_555 -0.014 -0.084 0.017  -1.617  0.207   2.070  33 G_DC8:DG18_I  G 8  ? I 18 ? 19 1 
1 E DG 9  1_555 F DC 17 1_555 -0.090 -0.027 0.312  5.664   -12.203 1.409  34 G_DG9:DC17_I  G 9  ? I 17 ? 19 1 
1 E DG 10 1_555 F DC 16 1_555 0.026  -0.103 0.264  -1.598  -14.017 -1.247 35 G_DG10:DC16_I G 10 ? I 16 ? 19 1 
1 E DG 11 1_555 F DC 15 1_555 -0.052 -0.161 0.697  17.640  -15.342 1.385  36 G_DG11:DC15_I G 11 ? I 15 ? 19 1 
1 E DT 12 1_555 F DA 14 1_555 -0.275 -0.199 0.339  17.102  -31.700 -1.170 37 G_DT12:DA14_I G 12 ? I 14 ? 20 1 
1 E DA 13 1_555 F DT 13 1_555 0.007  -0.258 0.689  -0.399  -14.053 4.116  38 G_DA13:DT13_I G 13 ? I 13 ? 20 1 
1 E DA 14 1_555 F DT 12 1_555 0.319  -0.199 0.290  -10.914 -17.184 -1.122 39 G_DA14:DT12_I G 14 ? I 12 ? 20 1 
1 E DG 15 1_555 F DC 11 1_555 -0.639 -0.102 0.210  -9.311  -15.411 3.848  40 G_DG15:DC11_I G 15 ? I 11 ? 19 1 
1 E DT 16 1_555 F DA 10 1_555 -0.128 -0.082 0.726  -10.101 -15.109 3.362  41 G_DT16:DA10_I G 16 ? I 10 ? 20 1 
1 E DT 17 1_555 F DA 9  1_555 -0.414 -0.282 -0.132 -4.413  1.646   1.300  42 G_DT17:DA9_I  G 17 ? I 9  ? 20 1 
1 E DC 18 1_555 F DG 8  1_555 0.514  -0.317 0.065  2.788   -16.868 1.722  43 G_DC18:DG8_I  G 18 ? I 8  ? 19 1 
1 E DC 19 1_555 F DG 7  1_555 0.045  -0.370 0.073  -4.754  -6.378  -0.483 44 G_DC19:DG7_I  G 19 ? I 7  ? 19 1 
1 E DG 20 1_555 F DC 6  1_555 0.061  -0.228 -0.110 12.464  0.800   -2.663 45 G_DG20:DC6_I  G 20 ? I 6  ? 19 1 
1 E DG 21 1_555 F DC 5  1_555 -0.180 -0.025 0.118  -1.015  -6.958  3.266  46 G_DG21:DC5_I  G 21 ? I 5  ? 19 1 
1 E DC 22 1_555 F DG 4  1_555 0.229  -0.247 0.079  -0.156  -5.495  -1.051 47 G_DC22:DG4_I  G 22 ? I 4  ? 19 1 
1 E DG 23 1_555 F DC 3  1_555 -0.154 -0.256 0.094  -3.264  -4.484  0.395  48 G_DG23:DC3_I  G 23 ? I 3  ? 19 1 
1 E DC 24 1_555 F DG 2  1_555 0.488  -0.227 -0.214 6.898   -4.357  1.584  49 G_DC24:DG2_I  G 24 ? I 2  ? 19 1 
1 E DG 25 1_555 F DC 1  1_555 -0.086 -0.264 0.237  14.311  5.633   -1.350 50 G_DG25:DC1_I  G 25 ? I 1  ? 19 1 
1 H DG 1  1_555 I DC 25 1_555 -0.257 -0.089 0.042  -6.250  -6.534  -1.315 51 L_DG1:DC25_N  L 1  ? N 25 ? 19 1 
1 H DC 2  1_555 I DG 24 1_555 0.520  0.022  0.215  1.180   -5.539  2.533  52 L_DC2:DG24_N  L 2  ? N 24 ? 19 1 
1 H DC 3  1_555 I DG 23 1_555 -0.248 -0.281 0.221  -7.522  -20.702 -0.087 53 L_DC3:DG23_N  L 3  ? N 23 ? 19 1 
1 H DT 4  1_555 I DA 22 1_555 -0.247 -0.283 0.923  -4.841  -20.350 -0.835 54 L_DT4:DA22_N  L 4  ? N 22 ? 20 1 
1 H DT 5  1_555 I DA 21 1_555 0.135  -0.152 0.240  -4.559  -4.684  4.223  55 L_DT5:DA21_N  L 5  ? N 21 ? 20 1 
1 H DG 6  1_555 I DC 20 1_555 -0.485 -0.117 0.396  1.864   -7.273  0.272  56 L_DG6:DC20_N  L 6  ? N 20 ? 19 1 
1 H DC 7  1_555 I DG 19 1_555 0.265  -0.120 0.107  -5.892  -9.032  1.142  57 L_DC7:DG19_N  L 7  ? N 19 ? 19 1 
1 H DC 8  1_555 I DG 18 1_555 0.253  -0.087 -0.023 -1.623  0.255   4.080  58 L_DC8:DG18_N  L 8  ? N 18 ? 19 1 
1 H DG 9  1_555 I DC 17 1_555 -0.101 -0.163 0.279  6.445   -8.488  2.064  59 L_DG9:DC17_N  L 9  ? N 17 ? 19 1 
1 H DG 10 1_555 I DC 16 1_555 -0.381 -0.033 0.213  -2.474  -15.041 -0.607 60 L_DG10:DC16_N L 10 ? N 16 ? 19 1 
1 H DG 11 1_555 I DC 15 1_555 0.248  -0.121 0.779  22.418  -15.583 0.114  61 L_DG11:DC15_N L 11 ? N 15 ? 19 1 
1 H DT 12 1_555 I DA 14 1_555 0.251  -0.149 0.625  13.857  -31.037 0.431  62 L_DT12:DA14_N L 12 ? N 14 ? 20 1 
1 H DA 13 1_555 I DT 13 1_555 -0.010 -0.277 0.643  -3.178  -14.305 1.524  63 L_DA13:DT13_N L 13 ? N 13 ? 20 1 
1 H DA 14 1_555 I DT 12 1_555 0.060  -0.069 0.152  -17.796 -16.743 -1.361 64 L_DA14:DT12_N L 14 ? N 12 ? 20 1 
1 H DG 15 1_555 I DC 11 1_555 -0.366 -0.072 0.187  -11.091 -15.592 2.728  65 L_DG15:DC11_N L 15 ? N 11 ? 19 1 
1 H DT 16 1_555 I DA 10 1_555 -0.341 0.004  0.391  -9.889  -14.129 3.783  66 L_DT16:DA10_N L 16 ? N 10 ? 20 1 
1 H DT 17 1_555 I DA 9  1_555 -0.301 -0.122 0.002  -6.759  0.968   2.391  67 L_DT17:DA9_N  L 17 ? N 9  ? 20 1 
1 H DC 18 1_555 I DG 8  1_555 0.375  -0.144 0.045  -0.959  -17.380 3.083  68 L_DC18:DG8_N  L 18 ? N 8  ? 19 1 
1 H DC 19 1_555 I DG 7  1_555 0.199  -0.233 0.001  -5.657  -7.079  0.484  69 L_DC19:DG7_N  L 19 ? N 7  ? 19 1 
1 H DG 20 1_555 I DC 6  1_555 -0.171 -0.107 0.035  15.539  0.980   -0.928 70 L_DG20:DC6_N  L 20 ? N 6  ? 19 1 
1 H DG 21 1_555 I DC 5  1_555 -0.277 -0.290 -0.067 -2.912  -7.296  -1.489 71 L_DG21:DC5_N  L 21 ? N 5  ? 19 1 
1 H DC 22 1_555 I DG 4  1_555 0.334  -0.327 -0.146 2.745   -6.825  0.357  72 L_DC22:DG4_N  L 22 ? N 4  ? 19 1 
1 H DG 23 1_555 I DC 3  1_555 -0.522 -0.214 -0.003 1.888   -1.476  4.215  73 L_DG23:DC3_N  L 23 ? N 3  ? 19 1 
1 H DC 24 1_555 I DG 2  1_555 0.447  -0.168 -0.460 8.680   -2.140  1.935  74 L_DC24:DG2_N  L 24 ? N 2  ? 19 1 
1 H DG 25 1_555 I DC 1  1_555 -0.315 -0.153 -0.106 17.404  11.787  -1.225 75 L_DG25:DC1_N  L 25 ? N 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 25 1_555 B DC 2  1_555 C DG 24 1_555 0.274  0.204  2.934 1.451   4.354   29.712 -0.413 -0.260 2.943 8.427   
-2.808  30.056 1  CC_DG1DC2:DG24DC25_DD   C 1  ? D 25 ? C 2  ? D 24 ? 
1 B DC 2  1_555 C DG 24 1_555 B DC 3  1_555 C DG 23 1_555 -0.558 0.092  3.733 -7.352  -0.099  39.314 0.148  -0.162 3.773 -0.146  
10.813  39.969 2  CC_DC2DC3:DG23DG24_DD   C 2  ? D 24 ? C 3  ? D 23 ? 
1 B DC 3  1_555 C DG 23 1_555 B DT 4  1_555 C DA 22 1_555 0.082  -0.838 3.453 1.523   2.172   30.463 -2.040 0.161  3.387 4.124   
-2.892  30.575 3  CC_DC3DT4:DA22DG23_DD   C 3  ? D 23 ? C 4  ? D 22 ? 
1 B DT 4  1_555 C DA 22 1_555 B DT 5  1_555 C DA 21 1_555 1.504  0.472  3.287 8.032   1.599   39.540 0.494  -1.228 3.529 2.333   
-11.720 40.346 4  CC_DT4DT5:DA21DA22_DD   C 4  ? D 22 ? C 5  ? D 21 ? 
1 B DT 5  1_555 C DA 21 1_555 B DG 6  1_555 C DC 20 1_555 -1.256 0.612  3.181 -5.732  0.746   33.697 0.922  1.226  3.355 1.276   
9.799   34.175 5  CC_DT5DG6:DC20DA21_DD   C 5  ? D 21 ? C 6  ? D 20 ? 
1 B DG 6  1_555 C DC 20 1_555 B DC 7  1_555 C DG 19 1_555 0.311  -0.785 3.274 4.183   3.464   33.657 -1.888 0.132  3.194 5.935   
-7.166  34.080 6  CC_DG6DC7:DG19DC20_DD   C 6  ? D 20 ? C 7  ? D 19 ? 
1 B DC 7  1_555 C DG 19 1_555 B DC 8  1_555 C DG 18 1_555 0.888  -0.477 3.549 -0.638  5.756   34.663 -1.712 -1.574 3.412 9.578   
1.062   35.129 7  CC_DC7DC8:DG18DG19_DD   C 7  ? D 19 ? C 8  ? D 18 ? 
1 B DC 8  1_555 C DG 18 1_555 B DG 9  1_555 C DC 17 1_555 -1.064 0.343  2.863 1.074   9.229   30.524 -0.865 2.110  2.807 17.041  
-1.982  31.875 8  CC_DC8DG9:DC17DG18_DD   C 8  ? D 18 ? C 9  ? D 17 ? 
1 B DG 9  1_555 C DC 17 1_555 B DG 10 1_555 C DC 16 1_555 -0.429 -0.257 3.499 -0.092  5.555   35.665 -1.252 0.679  3.423 9.001   
0.149   36.082 9  CC_DG9DG10:DC16DC17_DD  C 9  ? D 17 ? C 10 ? D 16 ? 
1 B DG 10 1_555 C DC 16 1_555 B DG 11 1_555 C DC 15 1_555 0.158  0.408  2.820 -5.809  9.214   30.640 -0.689 -1.176 2.750 16.785  
10.582  32.474 10 CC_DG10DG11:DC15DC16_DD C 10 ? D 16 ? C 11 ? D 15 ? 
1 B DG 11 1_555 C DC 15 1_555 B DT 12 1_555 C DA 14 1_555 -0.628 0.759  3.702 -1.139  -14.720 37.901 2.895  0.767  3.220 -21.684 
1.678   40.576 11 CC_DG11DT12:DA14DC15_DD C 11 ? D 15 ? C 12 ? D 14 ? 
1 B DT 12 1_555 C DA 14 1_555 B DA 13 1_555 C DT 13 1_555 0.409  2.464  3.848 1.128   -23.924 53.013 3.883  -0.360 2.615 -25.391 
-1.197  57.813 12 CC_DT12DA13:DT13DA14_DD C 12 ? D 14 ? C 13 ? D 13 ? 
1 B DA 13 1_555 C DT 13 1_555 B DA 14 1_555 C DT 12 1_555 0.182  -0.667 3.550 -4.538  -5.309  32.362 -0.187 -1.161 3.554 -9.390  
8.025   33.087 13 CC_DA13DA14:DT12DT13_DD C 13 ? D 13 ? C 14 ? D 12 ? 
1 B DA 14 1_555 C DT 12 1_555 B DG 15 1_555 C DC 11 1_555 0.451  -0.295 3.734 6.987   3.741   32.759 -1.211 0.533  3.694 6.514   
-12.167 33.678 14 CC_DA14DG15:DC11DT12_DD C 14 ? D 12 ? C 15 ? D 11 ? 
1 B DG 15 1_555 C DC 11 1_555 B DT 16 1_555 C DA 10 1_555 -0.357 -0.519 3.314 -3.486  4.191   33.950 -1.539 0.054  3.248 7.120   
5.922   34.372 15 CC_DG15DT16:DA10DC11_DD C 15 ? D 11 ? C 16 ? D 10 ? 
1 B DT 16 1_555 C DA 10 1_555 B DT 17 1_555 C DA 9  1_555 0.736  0.349  3.420 7.641   -1.957  37.017 0.806  -0.088 3.476 -3.040  
-11.870 37.819 16 CC_DT16DT17:DA9DA10_DD  C 16 ? D 10 ? C 17 ? D 9  ? 
1 B DT 17 1_555 C DA 9  1_555 B DC 18 1_555 C DG 8  1_555 -0.630 -0.135 3.564 -6.890  -9.075  33.405 1.281  -0.102 3.537 -15.246 
11.576  35.243 17 CC_DT17DC18:DG8DA9_DD   C 17 ? D 9  ? C 18 ? D 8  ? 
1 B DC 18 1_555 C DG 8  1_555 B DC 19 1_555 C DG 7  1_555 -0.178 -1.317 3.650 1.673   3.744   32.840 -3.002 0.621  3.469 6.589   
-2.945  33.088 18 CC_DC18DC19:DG7DG8_DD   C 18 ? D 8  ? C 19 ? D 7  ? 
1 B DC 19 1_555 C DG 7  1_555 B DG 20 1_555 C DC 6  1_555 0.335  -0.768 3.047 2.204   9.873   27.363 -3.461 -0.235 2.634 20.022  
-4.469  29.140 19 CC_DC19DG20:DC6DG7_DD   C 19 ? D 7  ? C 20 ? D 6  ? 
1 B DG 20 1_555 C DC 6  1_555 B DG 21 1_555 C DC 5  1_555 0.628  -1.797 3.430 1.461   1.049   27.689 -4.011 -0.942 3.389 2.190   
-3.048  27.746 20 CC_DG20DG21:DC5DC6_DD   C 20 ? D 6  ? C 21 ? D 5  ? 
1 B DG 21 1_555 C DC 5  1_555 B DC 22 1_555 C DG 4  1_555 0.698  -0.760 3.154 5.802   4.125   42.929 -1.411 -0.399 3.135 5.590   
-7.863  43.488 21 CC_DG21DC22:DG4DC5_DD   C 21 ? D 5  ? C 22 ? D 4  ? 
1 B DC 22 1_555 C DG 4  1_555 B DG 23 1_555 C DC 3  1_555 -0.141 -0.534 3.313 -2.195  1.559   28.653 -1.427 -0.214 3.281 3.140   
4.423   28.776 22 CC_DC22DG23:DC3DG4_DD   C 22 ? D 4  ? C 23 ? D 3  ? 
1 B DG 23 1_555 C DC 3  1_555 B DC 24 1_555 C DG 2  1_555 -0.233 -0.352 3.061 5.775   6.887   33.497 -1.565 1.210  2.857 11.690  
-9.802  34.648 23 CC_DG23DC24:DG2DC3_DD   C 23 ? D 3  ? C 24 ? D 2  ? 
1 B DC 24 1_555 C DG 2  1_555 B DG 25 1_555 C DC 1  1_555 -0.530 0.082  3.320 -7.081  8.888   33.330 -1.239 -0.219 3.276 14.965  
11.923  35.162 24 CC_DC24DG25:DC1DG2_DD   C 24 ? D 2  ? C 25 ? D 1  ? 
1 E DG 1  1_555 F DC 25 1_555 E DC 2  1_555 F DG 24 1_555 0.657  -0.292 3.072 0.494   5.740   30.171 -1.603 -1.150 2.977 10.903  
-0.938  30.704 25 GG_DG1DC2:DG24DC25_II   G 1  ? I 25 ? G 2  ? I 24 ? 
1 E DC 2  1_555 F DG 24 1_555 E DC 3  1_555 F DG 23 1_555 0.176  -0.159 3.282 2.671   3.996   33.480 -0.921 0.130  3.246 6.892   
-4.607  33.814 26 GG_DC2DC3:DG23DG24_II   G 2  ? I 24 ? G 3  ? I 23 ? 
1 E DC 3  1_555 F DG 23 1_555 E DT 4  1_555 F DA 22 1_555 -0.341 -0.670 3.565 -1.795  4.311   30.499 -2.164 0.263  3.454 8.136   
3.388   30.846 27 GG_DC3DT4:DA22DG23_II   G 3  ? I 23 ? G 4  ? I 22 ? 
1 E DT 4  1_555 F DA 22 1_555 E DT 5  1_555 F DA 21 1_555 1.109  0.321  3.378 3.440   0.240   38.476 0.455  -1.232 3.463 0.364   
-5.207  38.624 28 GG_DT4DT5:DA21DA22_II   G 4  ? I 22 ? G 5  ? I 21 ? 
1 E DT 5  1_555 F DA 21 1_555 E DG 6  1_555 F DC 20 1_555 -0.799 0.282  2.989 -4.637  -2.239  33.943 0.803  0.680  3.044 -3.807  
7.886   34.320 29 GG_DT5DG6:DC20DA21_II   G 5  ? I 21 ? G 6  ? I 20 ? 
1 E DG 6  1_555 F DC 20 1_555 E DC 7  1_555 F DG 19 1_555 0.602  -0.909 3.620 2.443   4.473   35.900 -2.149 -0.592 3.517 7.211   
-3.939  36.248 30 GG_DG6DC7:DG19DC20_II   G 6  ? I 20 ? G 7  ? I 19 ? 
1 E DC 7  1_555 F DG 19 1_555 E DC 8  1_555 F DG 18 1_555 0.831  0.081  3.165 5.900   9.325   32.613 -1.312 -0.489 3.167 16.043  
-10.150 34.381 31 GG_DC7DC8:DG18DG19_II   G 7  ? I 19 ? G 8  ? I 18 ? 
1 E DC 8  1_555 F DG 18 1_555 E DG 9  1_555 F DC 17 1_555 -1.029 0.436  3.197 -4.608  9.359   29.922 -0.969 1.017  3.299 17.471  
8.602   31.649 32 GG_DC8DG9:DC17DG18_II   G 8  ? I 18 ? G 9  ? I 17 ? 
1 E DG 9  1_555 F DC 17 1_555 E DG 10 1_555 F DC 16 1_555 -0.862 -0.509 3.374 -3.166  5.433   37.750 -1.482 0.905  3.331 8.326   
4.852   38.251 33 GG_DG9DG10:DC16DC17_II  G 9  ? I 17 ? G 10 ? I 16 ? 
1 E DG 10 1_555 F DC 16 1_555 E DG 11 1_555 F DC 15 1_555 0.237  0.236  2.895 -5.675  5.275   30.923 -0.421 -1.348 2.809 9.702   
10.440  31.856 34 GG_DG10DG11:DC15DC16_II G 10 ? I 16 ? G 11 ? I 15 ? 
1 E DG 11 1_555 F DC 15 1_555 E DT 12 1_555 F DA 14 1_555 -0.843 0.597  3.608 2.602   -15.857 35.349 2.967  1.611  3.013 -24.606 
-4.037  38.723 35 GG_DG11DT12:DA14DC15_II G 11 ? I 15 ? G 12 ? I 14 ? 
1 E DT 12 1_555 F DA 14 1_555 E DA 13 1_555 F DT 13 1_555 0.822  2.293  3.909 -1.446  -23.705 53.585 3.691  -0.926 2.737 -24.962 
1.523   58.254 36 GG_DT12DA13:DT13DA14_II G 12 ? I 14 ? G 13 ? I 13 ? 
1 E DA 13 1_555 F DT 13 1_555 E DA 14 1_555 F DT 12 1_555 0.177  -0.534 3.750 1.047   -4.119  32.443 -0.124 -0.105 3.791 -7.333  
-1.864  32.713 37 GG_DA13DA14:DT12DT13_II G 13 ? I 13 ? G 14 ? I 12 ? 
1 E DA 14 1_555 F DT 12 1_555 E DG 15 1_555 F DC 11 1_555 0.230  -0.373 3.539 2.231   2.084   30.870 -1.130 0.035  3.514 3.904   
-4.179  31.017 38 GG_DA14DG15:DC11DT12_II G 14 ? I 12 ? G 15 ? I 11 ? 
1 E DG 15 1_555 F DC 11 1_555 E DT 16 1_555 F DA 10 1_555 -0.470 -0.640 3.443 -1.419  3.251   35.550 -1.535 0.551  3.389 5.309   
2.316   35.721 39 GG_DG15DT16:DA10DC11_II G 15 ? I 11 ? G 16 ? I 10 ? 
1 E DT 16 1_555 F DA 10 1_555 E DT 17 1_555 F DA 9  1_555 0.738  0.389  3.273 6.326   -1.894  35.622 0.897  -0.283 3.327 -3.063  
-10.231 36.209 40 GG_DT16DT17:DA9DA10_II  G 16 ? I 10 ? G 17 ? I 9  ? 
1 E DT 17 1_555 F DA 9  1_555 E DC 18 1_555 F DG 8  1_555 -0.528 -0.101 3.530 -4.798  -10.539 36.272 1.316  0.141  3.465 -16.422 
7.476   38.016 41 GG_DT17DC18:DG8DA9_II   G 17 ? I 9  ? G 18 ? I 8  ? 
1 E DC 18 1_555 F DG 8  1_555 E DC 19 1_555 F DG 7  1_555 -0.233 -1.418 3.519 2.194   6.048   26.817 -4.494 1.040  3.101 12.807  
-4.646  27.564 42 GG_DC18DC19:DG7DG8_II   G 18 ? I 8  ? G 19 ? I 7  ? 
1 E DC 19 1_555 F DG 7  1_555 E DG 20 1_555 F DC 6  1_555 -0.106 -0.612 2.901 2.542   14.942  31.120 -2.994 0.513  2.356 26.007  
-4.424  34.533 43 GG_DC19DG20:DC6DG7_II   G 19 ? I 7  ? G 20 ? I 6  ? 
1 E DG 20 1_555 F DC 6  1_555 E DG 21 1_555 F DC 5  1_555 0.715  -1.677 3.633 -2.004  -0.888  27.908 -3.233 -2.006 3.624 -1.837  
4.146   27.992 44 GG_DG20DG21:DC5DC6_II   G 20 ? I 6  ? G 21 ? I 5  ? 
1 E DG 21 1_555 F DC 5  1_555 E DC 22 1_555 F DG 4  1_555 0.110  -0.932 3.343 1.815   2.256   39.461 -1.645 0.053  3.288 3.335   
-2.684  39.563 45 GG_DG21DC22:DG4DC5_II   G 21 ? I 5  ? G 22 ? I 4  ? 
1 E DC 22 1_555 F DG 4  1_555 E DG 23 1_555 F DC 3  1_555 -0.252 -0.766 3.492 -3.788  -1.121  36.781 -1.045 -0.151 3.520 -1.770  
5.982   36.986 46 GG_DC22DG23:DC3DG4_II   G 22 ? I 4  ? G 23 ? I 3  ? 
1 E DG 23 1_555 F DC 3  1_555 E DC 24 1_555 F DG 2  1_555 -0.240 -0.414 3.064 1.738   6.461   26.904 -2.302 0.887  2.867 13.620  
-3.664  27.708 47 GG_DG23DC24:DG2DC3_II   G 23 ? I 3  ? G 24 ? I 2  ? 
1 E DC 24 1_555 F DG 2  1_555 E DG 25 1_555 F DC 1  1_555 -0.867 0.236  3.116 -5.397  8.383   32.503 -0.917 0.633  3.177 14.556  
9.371   33.958 48 GG_DC24DG25:DC1DG2_II   G 24 ? I 2  ? G 25 ? I 1  ? 
1 H DG 1  1_555 I DC 25 1_555 H DC 2  1_555 I DG 24 1_555 0.874  -0.231 3.216 -0.058  -0.469  34.402 -0.319 -1.486 3.217 -0.793  
0.098   34.405 49 LL_DG1DC2:DG24DC25_NN   L 1  ? N 25 ? L 2  ? N 24 ? 
1 H DC 2  1_555 I DG 24 1_555 H DC 3  1_555 I DG 23 1_555 -0.574 -0.082 3.329 4.293   8.994   30.252 -1.801 1.836  3.071 16.675  
-7.960  31.815 50 LL_DC2DC3:DG23DG24_NN   L 2  ? N 24 ? L 3  ? N 23 ? 
1 H DC 3  1_555 I DG 23 1_555 H DT 4  1_555 I DA 22 1_555 0.212  -0.589 3.575 -10.299 2.799   34.343 -1.386 -1.932 3.320 4.604   
16.941  35.915 51 LL_DC3DT4:DA22DG23_NN   L 3  ? N 23 ? L 4  ? N 22 ? 
1 H DT 4  1_555 I DA 22 1_555 H DT 5  1_555 I DA 21 1_555 0.908  0.481  3.419 7.350   1.878   36.904 0.483  -0.380 3.548 2.929   
-11.462 37.649 52 LL_DT4DT5:DA21DA22_NN   L 4  ? N 22 ? L 5  ? N 21 ? 
1 H DT 5  1_555 I DA 21 1_555 H DG 6  1_555 I DC 20 1_555 -0.965 0.497  3.094 -4.583  0.024   35.077 0.815  0.937  3.191 0.039   
7.563   35.366 53 LL_DT5DG6:DC20DA21_NN   L 5  ? N 21 ? L 6  ? N 20 ? 
1 H DG 6  1_555 I DC 20 1_555 H DC 7  1_555 I DG 19 1_555 0.362  -0.830 3.546 1.396   3.132   35.227 -1.862 -0.375 3.473 5.161   
-2.300  35.388 54 LL_DG6DC7:DG19DC20_NN   L 6  ? N 20 ? L 7  ? N 19 ? 
1 H DC 7  1_555 I DG 19 1_555 H DC 8  1_555 I DG 18 1_555 0.926  0.182  3.213 5.865   10.392  32.343 -1.340 -0.635 3.231 17.913  
-10.109 34.419 55 LL_DC7DC8:DG18DG19_NN   L 7  ? N 19 ? L 8  ? N 18 ? 
1 H DC 8  1_555 I DG 18 1_555 H DG 9  1_555 I DC 17 1_555 -1.223 0.411  3.055 -6.465  8.558   29.809 -0.816 1.057  3.235 15.998  
12.086  31.639 56 LL_DC8DG9:DC17DG18_NN   L 8  ? N 18 ? L 9  ? N 17 ? 
1 H DG 9  1_555 I DC 17 1_555 H DG 10 1_555 I DC 16 1_555 -0.873 -0.620 3.470 -2.451  5.196   36.496 -1.720 1.029  3.403 8.234   
3.885   36.930 57 LL_DG9DG10:DC16DC17_NN  L 9  ? N 17 ? L 10 ? N 16 ? 
1 H DG 10 1_555 I DC 16 1_555 H DG 11 1_555 I DC 15 1_555 0.372  0.141  2.796 -5.061  4.018   32.189 -0.337 -1.396 2.705 7.156   
9.015   32.814 58 LL_DG10DG11:DC15DC16_NN L 10 ? N 16 ? L 11 ? N 15 ? 
1 H DG 11 1_555 I DC 15 1_555 H DT 12 1_555 I DA 14 1_555 -0.702 0.640  3.908 1.367   -16.312 36.652 3.099  1.206  3.315 -24.495 
-2.052  40.026 59 LL_DG11DT12:DA14DC15_NN L 11 ? N 15 ? L 12 ? N 14 ? 
1 H DT 12 1_555 I DA 14 1_555 H DA 13 1_555 I DT 13 1_555 0.623  2.025  3.863 0.222   -22.783 50.384 3.643  -0.661 2.781 -25.330 
-0.246  54.988 60 LL_DT12DA13:DT13DA14_NN L 12 ? N 14 ? L 13 ? N 13 ? 
1 H DA 13 1_555 I DT 13 1_555 H DA 14 1_555 I DT 12 1_555 0.131  -0.496 3.884 1.057   -3.267  31.262 -0.184 -0.004 3.917 -6.040  
-1.954  31.445 61 LL_DA13DA14:DT12DT13_NN L 13 ? N 13 ? L 14 ? N 12 ? 
1 H DA 14 1_555 I DT 12 1_555 H DG 15 1_555 I DC 11 1_555 0.114  -0.289 3.375 1.737   0.506   33.174 -0.593 0.101  3.372 0.885   
-3.040  33.222 62 LL_DA14DG15:DC11DT12_NN L 14 ? N 12 ? L 15 ? N 11 ? 
1 H DG 15 1_555 I DC 11 1_555 H DT 16 1_555 I DA 10 1_555 -0.423 -0.590 3.394 -0.326  3.500   32.746 -1.655 0.690  3.319 6.186   
0.576   32.929 63 LL_DG15DT16:DA10DC11_NN L 15 ? N 11 ? L 16 ? N 10 ? 
1 H DT 16 1_555 I DA 10 1_555 H DT 17 1_555 I DA 9  1_555 0.772  0.444  3.363 3.611   0.339   36.658 0.655  -0.713 3.425 0.538   
-5.725  36.831 64 LL_DT16DT17:DA9DA10_NN  L 16 ? N 10 ? L 17 ? N 9  ? 
1 H DT 17 1_555 I DA 9  1_555 H DC 18 1_555 I DG 8  1_555 -0.773 -0.148 3.498 -3.954  -10.517 35.001 1.334  0.638  3.462 -16.955 
6.374   36.706 65 LL_DT17DC18:DG8DA9_NN   L 17 ? N 9  ? L 18 ? N 8  ? 
1 H DC 18 1_555 I DG 8  1_555 H DC 19 1_555 I DG 7  1_555 -0.299 -1.298 3.527 1.242   6.015   28.640 -3.916 0.870  3.179 11.986  
-2.474  29.278 66 LL_DC18DC19:DG7DG8_NN   L 18 ? N 8  ? L 19 ? N 7  ? 
1 H DC 19 1_555 I DG 7  1_555 H DG 20 1_555 I DC 6  1_555 0.036  -0.720 2.777 0.413   13.473  27.894 -3.446 -0.003 2.204 26.106  
-0.800  30.922 67 LL_DC19DG20:DC6DG7_NN   L 19 ? N 7  ? L 20 ? N 6  ? 
1 H DG 20 1_555 I DC 6  1_555 H DG 21 1_555 I DC 5  1_555 0.379  -1.684 3.844 0.103   0.346   30.187 -3.316 -0.703 3.827 0.664   
-0.197  30.190 68 LL_DG20DG21:DC5DC6_NN   L 20 ? N 6  ? L 21 ? N 5  ? 
1 H DG 21 1_555 I DC 5  1_555 H DC 22 1_555 I DG 4  1_555 0.649  -0.727 3.166 3.402   3.734   38.687 -1.524 -0.576 3.129 5.607   
-5.109  39.003 69 LL_DG21DC22:DG4DC5_NN   L 21 ? N 5  ? L 22 ? N 4  ? 
1 H DC 22 1_555 I DG 4  1_555 H DG 23 1_555 I DC 3  1_555 0.180  -0.552 3.409 -2.568  2.879   32.001 -1.523 -0.797 3.324 5.198   
4.637   32.227 70 LL_DC22DG23:DC3DG4_NN   L 22 ? N 4  ? L 23 ? N 3  ? 
1 H DG 23 1_555 I DC 3  1_555 H DC 24 1_555 I DG 2  1_555 -0.405 -0.482 3.090 3.457   7.404   30.363 -2.170 1.345  2.834 13.824  
-6.454  31.419 71 LL_DG23DC24:DG2DC3_NN   L 23 ? N 3  ? L 24 ? N 2  ? 
1 H DC 24 1_555 I DG 2  1_555 H DG 25 1_555 I DC 1  1_555 -0.828 -0.042 3.169 -6.606  8.104   30.327 -1.530 0.314  3.160 14.944  
12.181  32.039 72 LL_DC24DG25:DC1DG2_NN   L 24 ? N 2  ? L 25 ? N 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION' MN  
5 'CHLORIDE ION'       CL  
6 water                HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'mass spectrometry' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#