data_5O9G
# 
_entry.id   5O9G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5O9G         
WWPDB D_1200005420 
EMDB  EMD-3765     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Structure of nucleosome-Chd1 complex' 
_pdbx_database_related.db_id          EMD-3765 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5O9G 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Farnung, L.' 1 ?                   
'Vos, S.M.'   2 0000-0003-1985-2994 
'Wigge, C.'   3 ?                   
'Cramer, P.'  4 0000-0001-5454-7755 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            550 
_citation.language                  ? 
_citation.page_first                539 
_citation.page_last                 542 
_citation.title                     'Nucleosome-Chd1 structure and implications for chromatin remodelling.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature24046 
_citation.pdbx_database_id_PubMed   29019976 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Farnung, L.' 1 
primary 'Vos, S.M.'   2 
primary 'Wigge, C.'   3 
primary 'Cramer, P.'  4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.2'                       15435.126  2 ?       ? ? ? 
2  polymer     man 'Histone H4'                         11394.426  2 ?       ? ? ? 
3  polymer     man 'Histone H2A'                        14109.436  2 ?       ? ? ? 
4  polymer     man 'Histone H2B 1.1'                    13655.948  1 ?       ? ? ? 
5  polymer     man 'Histone H2B 1.1'                    13526.769  1 ?       ? ? ? 
6  polymer     syn 'DNA (162-MER)'                      64143.914  1 ?       ? ? ? 
7  polymer     syn 'DNA (162-MER)'                      64293.945  1 ?       ? ? ? 
8  polymer     man 'Chromo domain-containing protein 1' 168496.609 1 3.6.4.- ? ? ? 
9  non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"           427.201    1 ?       ? ? ? 
10 non-polymer syn 'BERYLLIUM TRIFLUORIDE ION'          66.007     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4 H2B1.1                        
5 H2B1.1                        
8 'ATP-dependent helicase CHD1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D   ? 
5 'polypeptide(L)'        no no 
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
;MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
H   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)
(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)
(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)
(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)
(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)
(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)
(DT)(DC)(DG)(DA)(DT)(DT)(DA)(DA)(DC)(DG)(DA)(DT)(DG)(DC)(DT)(DG)(DG)(DG)(DC)(DA)
(DT)(DA)(DA)(DG)(DC)(DG)(DT)(DG)(DG)(DT)(DT)(DC)(DA)(DA)(DT)(DA)(DC)(DC)(DG)(DG)
(DC)(DG)(DC)(DA)(DT)(DA)(DA)(DA)(DG)(DG)(DG)(DT)(DA)(DA)(DA)(DT)(DT)(DC)(DG)(DA)
(DA)(DA)(DA)(DC)(DA)(DG)(DC)(DG)
;
;ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCC
CGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGATTAACGATGCTGGGCA
TAAGCGTGGTTCAATACCGGCGCATAAAGGGTAAATTCGAAAACAGCG
;
I   ? 
7 polydeoxyribonucleotide no no 
;(DC)(DG)(DC)(DT)(DG)(DT)(DT)(DT)(DT)(DC)(DG)(DA)(DA)(DT)(DT)(DT)(DA)(DC)(DC)(DC)
(DT)(DT)(DT)(DA)(DT)(DG)(DC)(DG)(DC)(DC)(DG)(DG)(DT)(DA)(DT)(DT)(DG)(DA)(DA)(DC)
(DC)(DA)(DC)(DG)(DC)(DT)(DT)(DA)(DT)(DG)(DC)(DC)(DC)(DA)(DG)(DC)(DA)(DT)(DC)(DG)
(DT)(DT)(DA)(DA)(DT)(DC)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)
(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)
(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)
(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)
(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)
(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)
(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)
(DA)(DT)(DT)(DC)(DT)(DG)(DA)(DT)
;
;CGCTGTTTTCGAATTTACCCTTTATGCGCCGGTATTGAACCACGCTTATGCCCAGCATCGTTAATCGATGTATATATCTG
ACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGC
TAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT
;
J   ? 
8 'polypeptide(L)'        no no 
;MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEED
FEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQSTVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALS
EENVHEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEAT
WENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILA
DEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLM
PGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG
AKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ
AMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT
DNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ
LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGT
LPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLF
NFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLRGGLNTKSPSADIGSK
KLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNP
SSGSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
YSANFWPADVKSTKLMAMYDKITESQKK
;
;MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEED
FEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQSTVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALS
EENVHEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEAT
WENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILA
DEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLM
PGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG
AKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ
AMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT
DNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ
LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGT
LPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLF
NFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLRGGLNTKSPSADIGSK
KLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNP
SSGSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
YSANFWPADVKSTKLMAMYDKITESQKK
;
W   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ALA n 
1 3    ARG n 
1 4    THR n 
1 5    LYS n 
1 6    GLN n 
1 7    THR n 
1 8    ALA n 
1 9    ARG n 
1 10   LYS n 
1 11   SER n 
1 12   THR n 
1 13   GLY n 
1 14   GLY n 
1 15   LYS n 
1 16   ALA n 
1 17   PRO n 
1 18   ARG n 
1 19   LYS n 
1 20   GLN n 
1 21   LEU n 
1 22   ALA n 
1 23   THR n 
1 24   LYS n 
1 25   ALA n 
1 26   ALA n 
1 27   ARG n 
1 28   LYS n 
1 29   SER n 
1 30   ALA n 
1 31   PRO n 
1 32   ALA n 
1 33   THR n 
1 34   GLY n 
1 35   GLY n 
1 36   VAL n 
1 37   LYS n 
1 38   LYS n 
1 39   PRO n 
1 40   HIS n 
1 41   ARG n 
1 42   TYR n 
1 43   ARG n 
1 44   PRO n 
1 45   GLY n 
1 46   THR n 
1 47   VAL n 
1 48   ALA n 
1 49   LEU n 
1 50   ARG n 
1 51   GLU n 
1 52   ILE n 
1 53   ARG n 
1 54   ARG n 
1 55   TYR n 
1 56   GLN n 
1 57   LYS n 
1 58   SER n 
1 59   THR n 
1 60   GLU n 
1 61   LEU n 
1 62   LEU n 
1 63   ILE n 
1 64   ARG n 
1 65   LYS n 
1 66   LEU n 
1 67   PRO n 
1 68   PHE n 
1 69   GLN n 
1 70   ARG n 
1 71   LEU n 
1 72   VAL n 
1 73   ARG n 
1 74   GLU n 
1 75   ILE n 
1 76   ALA n 
1 77   GLN n 
1 78   ASP n 
1 79   PHE n 
1 80   LYS n 
1 81   THR n 
1 82   ASP n 
1 83   LEU n 
1 84   ARG n 
1 85   PHE n 
1 86   GLN n 
1 87   SER n 
1 88   SER n 
1 89   ALA n 
1 90   VAL n 
1 91   MET n 
1 92   ALA n 
1 93   LEU n 
1 94   GLN n 
1 95   GLU n 
1 96   ALA n 
1 97   SER n 
1 98   GLU n 
1 99   ALA n 
1 100  TYR n 
1 101  LEU n 
1 102  VAL n 
1 103  ALA n 
1 104  LEU n 
1 105  PHE n 
1 106  GLU n 
1 107  ASP n 
1 108  THR n 
1 109  ASN n 
1 110  LEU n 
1 111  CYS n 
1 112  ALA n 
1 113  ILE n 
1 114  HIS n 
1 115  ALA n 
1 116  LYS n 
1 117  ARG n 
1 118  VAL n 
1 119  THR n 
1 120  ILE n 
1 121  MET n 
1 122  PRO n 
1 123  LYS n 
1 124  ASP n 
1 125  ILE n 
1 126  GLN n 
1 127  LEU n 
1 128  ALA n 
1 129  ARG n 
1 130  ARG n 
1 131  ILE n 
1 132  ARG n 
1 133  GLY n 
1 134  GLU n 
1 135  ARG n 
1 136  ALA n 
2 1    MET n 
2 2    SER n 
2 3    GLY n 
2 4    ARG n 
2 5    GLY n 
2 6    LYS n 
2 7    GLY n 
2 8    GLY n 
2 9    LYS n 
2 10   GLY n 
2 11   LEU n 
2 12   GLY n 
2 13   LYS n 
2 14   GLY n 
2 15   GLY n 
2 16   ALA n 
2 17   LYS n 
2 18   ARG n 
2 19   HIS n 
2 20   ARG n 
2 21   LYS n 
2 22   VAL n 
2 23   LEU n 
2 24   ARG n 
2 25   ASP n 
2 26   ASN n 
2 27   ILE n 
2 28   GLN n 
2 29   GLY n 
2 30   ILE n 
2 31   THR n 
2 32   LYS n 
2 33   PRO n 
2 34   ALA n 
2 35   ILE n 
2 36   ARG n 
2 37   ARG n 
2 38   LEU n 
2 39   ALA n 
2 40   ARG n 
2 41   ARG n 
2 42   GLY n 
2 43   GLY n 
2 44   VAL n 
2 45   LYS n 
2 46   ARG n 
2 47   ILE n 
2 48   SER n 
2 49   GLY n 
2 50   LEU n 
2 51   ILE n 
2 52   TYR n 
2 53   GLU n 
2 54   GLU n 
2 55   THR n 
2 56   ARG n 
2 57   GLY n 
2 58   VAL n 
2 59   LEU n 
2 60   LYS n 
2 61   VAL n 
2 62   PHE n 
2 63   LEU n 
2 64   GLU n 
2 65   ASN n 
2 66   VAL n 
2 67   ILE n 
2 68   ARG n 
2 69   ASP n 
2 70   ALA n 
2 71   VAL n 
2 72   THR n 
2 73   TYR n 
2 74   THR n 
2 75   GLU n 
2 76   HIS n 
2 77   ALA n 
2 78   LYS n 
2 79   ARG n 
2 80   LYS n 
2 81   THR n 
2 82   VAL n 
2 83   THR n 
2 84   ALA n 
2 85   MET n 
2 86   ASP n 
2 87   VAL n 
2 88   VAL n 
2 89   TYR n 
2 90   ALA n 
2 91   LEU n 
2 92   LYS n 
2 93   ARG n 
2 94   GLN n 
2 95   GLY n 
2 96   ARG n 
2 97   THR n 
2 98   LEU n 
2 99   TYR n 
2 100  GLY n 
2 101  PHE n 
2 102  GLY n 
2 103  GLY n 
3 1    MET n 
3 2    SER n 
3 3    GLY n 
3 4    ARG n 
3 5    GLY n 
3 6    LYS n 
3 7    GLN n 
3 8    GLY n 
3 9    GLY n 
3 10   LYS n 
3 11   THR n 
3 12   ARG n 
3 13   ALA n 
3 14   LYS n 
3 15   ALA n 
3 16   LYS n 
3 17   THR n 
3 18   ARG n 
3 19   SER n 
3 20   SER n 
3 21   ARG n 
3 22   ALA n 
3 23   GLY n 
3 24   LEU n 
3 25   GLN n 
3 26   PHE n 
3 27   PRO n 
3 28   VAL n 
3 29   GLY n 
3 30   ARG n 
3 31   VAL n 
3 32   HIS n 
3 33   ARG n 
3 34   LEU n 
3 35   LEU n 
3 36   ARG n 
3 37   LYS n 
3 38   GLY n 
3 39   ASN n 
3 40   TYR n 
3 41   ALA n 
3 42   GLU n 
3 43   ARG n 
3 44   VAL n 
3 45   GLY n 
3 46   ALA n 
3 47   GLY n 
3 48   ALA n 
3 49   PRO n 
3 50   VAL n 
3 51   TYR n 
3 52   LEU n 
3 53   ALA n 
3 54   ALA n 
3 55   VAL n 
3 56   LEU n 
3 57   GLU n 
3 58   TYR n 
3 59   LEU n 
3 60   THR n 
3 61   ALA n 
3 62   GLU n 
3 63   ILE n 
3 64   LEU n 
3 65   GLU n 
3 66   LEU n 
3 67   ALA n 
3 68   GLY n 
3 69   ASN n 
3 70   ALA n 
3 71   ALA n 
3 72   ARG n 
3 73   ASP n 
3 74   ASN n 
3 75   LYS n 
3 76   LYS n 
3 77   THR n 
3 78   ARG n 
3 79   ILE n 
3 80   ILE n 
3 81   PRO n 
3 82   ARG n 
3 83   HIS n 
3 84   LEU n 
3 85   GLN n 
3 86   LEU n 
3 87   ALA n 
3 88   VAL n 
3 89   ARG n 
3 90   ASN n 
3 91   ASP n 
3 92   GLU n 
3 93   GLU n 
3 94   LEU n 
3 95   ASN n 
3 96   LYS n 
3 97   LEU n 
3 98   LEU n 
3 99   GLY n 
3 100  ARG n 
3 101  VAL n 
3 102  THR n 
3 103  ILE n 
3 104  ALA n 
3 105  GLN n 
3 106  GLY n 
3 107  GLY n 
3 108  VAL n 
3 109  LEU n 
3 110  PRO n 
3 111  ASN n 
3 112  ILE n 
3 113  GLN n 
3 114  SER n 
3 115  VAL n 
3 116  LEU n 
3 117  LEU n 
3 118  PRO n 
3 119  LYS n 
3 120  LYS n 
3 121  THR n 
3 122  GLU n 
3 123  SER n 
3 124  SER n 
3 125  LYS n 
3 126  SER n 
3 127  ALA n 
3 128  LYS n 
3 129  SER n 
3 130  LYS n 
4 1    MET n 
4 2    ALA n 
4 3    LYS n 
4 4    SER n 
4 5    ALA n 
4 6    PRO n 
4 7    ALA n 
4 8    PRO n 
4 9    LYS n 
4 10   LYS n 
4 11   GLY n 
4 12   SER n 
4 13   LYS n 
4 14   LYS n 
4 15   ALA n 
4 16   VAL n 
4 17   THR n 
4 18   LYS n 
4 19   THR n 
4 20   GLN n 
4 21   LYS n 
4 22   LYS n 
4 23   ASP n 
4 24   GLY n 
4 25   LYS n 
4 26   LYS n 
4 27   ARG n 
4 28   ARG n 
4 29   LYS n 
4 30   THR n 
4 31   ARG n 
4 32   LYS n 
4 33   GLU n 
4 34   SER n 
4 35   TYR n 
4 36   ALA n 
4 37   ILE n 
4 38   TYR n 
4 39   VAL n 
4 40   TYR n 
4 41   LYS n 
4 42   VAL n 
4 43   LEU n 
4 44   LYS n 
4 45   GLN n 
4 46   VAL n 
4 47   HIS n 
4 48   PRO n 
4 49   ASP n 
4 50   THR n 
4 51   GLY n 
4 52   ILE n 
4 53   SER n 
4 54   SER n 
4 55   LYS n 
4 56   ALA n 
4 57   MET n 
4 58   SER n 
4 59   ILE n 
4 60   MET n 
4 61   ASN n 
4 62   SER n 
4 63   PHE n 
4 64   VAL n 
4 65   ASN n 
4 66   ASP n 
4 67   VAL n 
4 68   PHE n 
4 69   GLU n 
4 70   ARG n 
4 71   ILE n 
4 72   ALA n 
4 73   GLY n 
4 74   GLU n 
4 75   ALA n 
4 76   SER n 
4 77   ARG n 
4 78   LEU n 
4 79   ALA n 
4 80   HIS n 
4 81   TYR n 
4 82   ASN n 
4 83   LYS n 
4 84   ARG n 
4 85   SER n 
4 86   THR n 
4 87   ILE n 
4 88   THR n 
4 89   SER n 
4 90   ARG n 
4 91   GLU n 
4 92   ILE n 
4 93   GLN n 
4 94   THR n 
4 95   ALA n 
4 96   VAL n 
4 97   ARG n 
4 98   LEU n 
4 99   LEU n 
4 100  LEU n 
4 101  PRO n 
4 102  GLY n 
4 103  GLU n 
4 104  LEU n 
4 105  ALA n 
4 106  LYS n 
4 107  HIS n 
4 108  ALA n 
4 109  VAL n 
4 110  SER n 
4 111  GLU n 
4 112  GLY n 
4 113  THR n 
4 114  LYS n 
4 115  ALA n 
4 116  VAL n 
4 117  THR n 
4 118  LYS n 
4 119  TYR n 
4 120  THR n 
4 121  SER n 
4 122  ALA n 
4 123  LYS n 
5 1    MET n 
5 2    ALA n 
5 3    LYS n 
5 4    SER n 
5 5    ALA n 
5 6    PRO n 
5 7    ALA n 
5 8    PRO n 
5 9    LYS n 
5 10   LYS n 
5 11   GLY n 
5 12   SER n 
5 13   LYS n 
5 14   LYS n 
5 15   ALA n 
5 16   VAL n 
5 17   THR n 
5 18   LYS n 
5 19   THR n 
5 20   GLN n 
5 21   LYS n 
5 22   LYS n 
5 23   ASP n 
5 24   GLY n 
5 25   LYS n 
5 26   LYS n 
5 27   ARG n 
5 28   ARG n 
5 29   LYS n 
5 30   THR n 
5 31   ARG n 
5 32   LYS n 
5 33   GLU n 
5 34   SER n 
5 35   TYR n 
5 36   ALA n 
5 37   ILE n 
5 38   TYR n 
5 39   VAL n 
5 40   TYR n 
5 41   LYS n 
5 42   VAL n 
5 43   LEU n 
5 44   LYS n 
5 45   GLN n 
5 46   VAL n 
5 47   HIS n 
5 48   PRO n 
5 49   ASP n 
5 50   THR n 
5 51   GLY n 
5 52   ILE n 
5 53   SER n 
5 54   SER n 
5 55   LYS n 
5 56   ALA n 
5 57   MET n 
5 58   SER n 
5 59   ILE n 
5 60   MET n 
5 61   ASN n 
5 62   SER n 
5 63   PHE n 
5 64   VAL n 
5 65   ASN n 
5 66   ASP n 
5 67   VAL n 
5 68   PHE n 
5 69   GLU n 
5 70   ARG n 
5 71   ILE n 
5 72   ALA n 
5 73   GLY n 
5 74   GLU n 
5 75   ALA n 
5 76   SER n 
5 77   ARG n 
5 78   LEU n 
5 79   ALA n 
5 80   HIS n 
5 81   TYR n 
5 82   ASN n 
5 83   LYS n 
5 84   ARG n 
5 85   SER n 
5 86   THR n 
5 87   ILE n 
5 88   THR n 
5 89   SER n 
5 90   ARG n 
5 91   GLU n 
5 92   ILE n 
5 93   GLN n 
5 94   THR n 
5 95   ALA n 
5 96   VAL n 
5 97   ARG n 
5 98   LEU n 
5 99   LEU n 
5 100  LEU n 
5 101  PRO n 
5 102  GLY n 
5 103  GLU n 
5 104  LEU n 
5 105  ALA n 
5 106  LYS n 
5 107  HIS n 
5 108  ALA n 
5 109  VAL n 
5 110  SER n 
5 111  GLU n 
5 112  GLY n 
5 113  THR n 
5 114  LYS n 
5 115  ALA n 
5 116  VAL n 
5 117  THR n 
5 118  LYS n 
5 119  TYR n 
5 120  THR n 
5 121  SER n 
5 122  ALA n 
6 1    DA  n 
6 2    DT  n 
6 3    DC  n 
6 4    DA  n 
6 5    DG  n 
6 6    DA  n 
6 7    DA  n 
6 8    DT  n 
6 9    DC  n 
6 10   DC  n 
6 11   DC  n 
6 12   DG  n 
6 13   DG  n 
6 14   DT  n 
6 15   DG  n 
6 16   DC  n 
6 17   DC  n 
6 18   DG  n 
6 19   DA  n 
6 20   DG  n 
6 21   DG  n 
6 22   DC  n 
6 23   DC  n 
6 24   DG  n 
6 25   DC  n 
6 26   DT  n 
6 27   DC  n 
6 28   DA  n 
6 29   DA  n 
6 30   DT  n 
6 31   DT  n 
6 32   DG  n 
6 33   DG  n 
6 34   DT  n 
6 35   DC  n 
6 36   DG  n 
6 37   DT  n 
6 38   DA  n 
6 39   DG  n 
6 40   DA  n 
6 41   DC  n 
6 42   DA  n 
6 43   DG  n 
6 44   DC  n 
6 45   DT  n 
6 46   DC  n 
6 47   DT  n 
6 48   DA  n 
6 49   DG  n 
6 50   DC  n 
6 51   DA  n 
6 52   DC  n 
6 53   DC  n 
6 54   DG  n 
6 55   DC  n 
6 56   DT  n 
6 57   DT  n 
6 58   DA  n 
6 59   DA  n 
6 60   DA  n 
6 61   DC  n 
6 62   DG  n 
6 63   DC  n 
6 64   DA  n 
6 65   DC  n 
6 66   DG  n 
6 67   DT  n 
6 68   DA  n 
6 69   DC  n 
6 70   DG  n 
6 71   DC  n 
6 72   DG  n 
6 73   DC  n 
6 74   DT  n 
6 75   DG  n 
6 76   DT  n 
6 77   DC  n 
6 78   DC  n 
6 79   DC  n 
6 80   DC  n 
6 81   DC  n 
6 82   DG  n 
6 83   DC  n 
6 84   DG  n 
6 85   DT  n 
6 86   DT  n 
6 87   DT  n 
6 88   DT  n 
6 89   DA  n 
6 90   DA  n 
6 91   DC  n 
6 92   DC  n 
6 93   DG  n 
6 94   DC  n 
6 95   DC  n 
6 96   DA  n 
6 97   DA  n 
6 98   DG  n 
6 99   DG  n 
6 100  DG  n 
6 101  DG  n 
6 102  DA  n 
6 103  DT  n 
6 104  DT  n 
6 105  DA  n 
6 106  DC  n 
6 107  DT  n 
6 108  DC  n 
6 109  DC  n 
6 110  DC  n 
6 111  DT  n 
6 112  DA  n 
6 113  DG  n 
6 114  DT  n 
6 115  DC  n 
6 116  DT  n 
6 117  DC  n 
6 118  DC  n 
6 119  DA  n 
6 120  DG  n 
6 121  DG  n 
6 122  DC  n 
6 123  DA  n 
6 124  DC  n 
6 125  DG  n 
6 126  DT  n 
6 127  DG  n 
6 128  DT  n 
6 129  DC  n 
6 130  DA  n 
6 131  DG  n 
6 132  DA  n 
6 133  DT  n 
6 134  DA  n 
6 135  DT  n 
6 136  DA  n 
6 137  DT  n 
6 138  DA  n 
6 139  DC  n 
6 140  DA  n 
6 141  DT  n 
6 142  DC  n 
6 143  DG  n 
6 144  DA  n 
6 145  DT  n 
6 146  DT  n 
6 147  DA  n 
6 148  DA  n 
6 149  DC  n 
6 150  DG  n 
6 151  DA  n 
6 152  DT  n 
6 153  DG  n 
6 154  DC  n 
6 155  DT  n 
6 156  DG  n 
6 157  DG  n 
6 158  DG  n 
6 159  DC  n 
6 160  DA  n 
6 161  DT  n 
6 162  DA  n 
6 163  DA  n 
6 164  DG  n 
6 165  DC  n 
6 166  DG  n 
6 167  DT  n 
6 168  DG  n 
6 169  DG  n 
6 170  DT  n 
6 171  DT  n 
6 172  DC  n 
6 173  DA  n 
6 174  DA  n 
6 175  DT  n 
6 176  DA  n 
6 177  DC  n 
6 178  DC  n 
6 179  DG  n 
6 180  DG  n 
6 181  DC  n 
6 182  DG  n 
6 183  DC  n 
6 184  DA  n 
6 185  DT  n 
6 186  DA  n 
6 187  DA  n 
6 188  DA  n 
6 189  DG  n 
6 190  DG  n 
6 191  DG  n 
6 192  DT  n 
6 193  DA  n 
6 194  DA  n 
6 195  DA  n 
6 196  DT  n 
6 197  DT  n 
6 198  DC  n 
6 199  DG  n 
6 200  DA  n 
6 201  DA  n 
6 202  DA  n 
6 203  DA  n 
6 204  DC  n 
6 205  DA  n 
6 206  DG  n 
6 207  DC  n 
6 208  DG  n 
7 1    DC  n 
7 2    DG  n 
7 3    DC  n 
7 4    DT  n 
7 5    DG  n 
7 6    DT  n 
7 7    DT  n 
7 8    DT  n 
7 9    DT  n 
7 10   DC  n 
7 11   DG  n 
7 12   DA  n 
7 13   DA  n 
7 14   DT  n 
7 15   DT  n 
7 16   DT  n 
7 17   DA  n 
7 18   DC  n 
7 19   DC  n 
7 20   DC  n 
7 21   DT  n 
7 22   DT  n 
7 23   DT  n 
7 24   DA  n 
7 25   DT  n 
7 26   DG  n 
7 27   DC  n 
7 28   DG  n 
7 29   DC  n 
7 30   DC  n 
7 31   DG  n 
7 32   DG  n 
7 33   DT  n 
7 34   DA  n 
7 35   DT  n 
7 36   DT  n 
7 37   DG  n 
7 38   DA  n 
7 39   DA  n 
7 40   DC  n 
7 41   DC  n 
7 42   DA  n 
7 43   DC  n 
7 44   DG  n 
7 45   DC  n 
7 46   DT  n 
7 47   DT  n 
7 48   DA  n 
7 49   DT  n 
7 50   DG  n 
7 51   DC  n 
7 52   DC  n 
7 53   DC  n 
7 54   DA  n 
7 55   DG  n 
7 56   DC  n 
7 57   DA  n 
7 58   DT  n 
7 59   DC  n 
7 60   DG  n 
7 61   DT  n 
7 62   DT  n 
7 63   DA  n 
7 64   DA  n 
7 65   DT  n 
7 66   DC  n 
7 67   DG  n 
7 68   DA  n 
7 69   DT  n 
7 70   DG  n 
7 71   DT  n 
7 72   DA  n 
7 73   DT  n 
7 74   DA  n 
7 75   DT  n 
7 76   DA  n 
7 77   DT  n 
7 78   DC  n 
7 79   DT  n 
7 80   DG  n 
7 81   DA  n 
7 82   DC  n 
7 83   DA  n 
7 84   DC  n 
7 85   DG  n 
7 86   DT  n 
7 87   DG  n 
7 88   DC  n 
7 89   DC  n 
7 90   DT  n 
7 91   DG  n 
7 92   DG  n 
7 93   DA  n 
7 94   DG  n 
7 95   DA  n 
7 96   DC  n 
7 97   DT  n 
7 98   DA  n 
7 99   DG  n 
7 100  DG  n 
7 101  DG  n 
7 102  DA  n 
7 103  DG  n 
7 104  DT  n 
7 105  DA  n 
7 106  DA  n 
7 107  DT  n 
7 108  DC  n 
7 109  DC  n 
7 110  DC  n 
7 111  DC  n 
7 112  DT  n 
7 113  DT  n 
7 114  DG  n 
7 115  DG  n 
7 116  DC  n 
7 117  DG  n 
7 118  DG  n 
7 119  DT  n 
7 120  DT  n 
7 121  DA  n 
7 122  DA  n 
7 123  DA  n 
7 124  DA  n 
7 125  DC  n 
7 126  DG  n 
7 127  DC  n 
7 128  DG  n 
7 129  DG  n 
7 130  DG  n 
7 131  DG  n 
7 132  DG  n 
7 133  DA  n 
7 134  DC  n 
7 135  DA  n 
7 136  DG  n 
7 137  DC  n 
7 138  DG  n 
7 139  DC  n 
7 140  DG  n 
7 141  DT  n 
7 142  DA  n 
7 143  DC  n 
7 144  DG  n 
7 145  DT  n 
7 146  DG  n 
7 147  DC  n 
7 148  DG  n 
7 149  DT  n 
7 150  DT  n 
7 151  DT  n 
7 152  DA  n 
7 153  DA  n 
7 154  DG  n 
7 155  DC  n 
7 156  DG  n 
7 157  DG  n 
7 158  DT  n 
7 159  DG  n 
7 160  DC  n 
7 161  DT  n 
7 162  DA  n 
7 163  DG  n 
7 164  DA  n 
7 165  DG  n 
7 166  DC  n 
7 167  DT  n 
7 168  DG  n 
7 169  DT  n 
7 170  DC  n 
7 171  DT  n 
7 172  DA  n 
7 173  DC  n 
7 174  DG  n 
7 175  DA  n 
7 176  DC  n 
7 177  DC  n 
7 178  DA  n 
7 179  DA  n 
7 180  DT  n 
7 181  DT  n 
7 182  DG  n 
7 183  DA  n 
7 184  DG  n 
7 185  DC  n 
7 186  DG  n 
7 187  DG  n 
7 188  DC  n 
7 189  DC  n 
7 190  DT  n 
7 191  DC  n 
7 192  DG  n 
7 193  DG  n 
7 194  DC  n 
7 195  DA  n 
7 196  DC  n 
7 197  DC  n 
7 198  DG  n 
7 199  DG  n 
7 200  DG  n 
7 201  DA  n 
7 202  DT  n 
7 203  DT  n 
7 204  DC  n 
7 205  DT  n 
7 206  DG  n 
7 207  DA  n 
7 208  DT  n 
8 1    MET n 
8 2    ALA n 
8 3    ALA n 
8 4    LYS n 
8 5    ASP n 
8 6    ILE n 
8 7    SER n 
8 8    THR n 
8 9    GLU n 
8 10   VAL n 
8 11   LEU n 
8 12   GLN n 
8 13   ASN n 
8 14   PRO n 
8 15   GLU n 
8 16   LEU n 
8 17   TYR n 
8 18   GLY n 
8 19   LEU n 
8 20   ARG n 
8 21   ARG n 
8 22   SER n 
8 23   HIS n 
8 24   ARG n 
8 25   ALA n 
8 26   ALA n 
8 27   ALA n 
8 28   HIS n 
8 29   GLN n 
8 30   GLN n 
8 31   ASN n 
8 32   TYR n 
8 33   PHE n 
8 34   ASN n 
8 35   ASP n 
8 36   SER n 
8 37   ASP n 
8 38   ASP n 
8 39   GLU n 
8 40   ASP n 
8 41   ASP n 
8 42   GLU n 
8 43   ASP n 
8 44   ASN n 
8 45   ILE n 
8 46   LYS n 
8 47   GLN n 
8 48   SER n 
8 49   ARG n 
8 50   ARG n 
8 51   LYS n 
8 52   ARG n 
8 53   MET n 
8 54   THR n 
8 55   THR n 
8 56   ILE n 
8 57   GLU n 
8 58   ASP n 
8 59   ASP n 
8 60   GLU n 
8 61   ASP n 
8 62   GLU n 
8 63   PHE n 
8 64   GLU n 
8 65   ASP n 
8 66   GLU n 
8 67   GLU n 
8 68   GLY n 
8 69   GLU n 
8 70   GLU n 
8 71   ASP n 
8 72   SER n 
8 73   GLY n 
8 74   GLU n 
8 75   ASP n 
8 76   GLU n 
8 77   ASP n 
8 78   GLU n 
8 79   GLU n 
8 80   ASP n 
8 81   PHE n 
8 82   GLU n 
8 83   GLU n 
8 84   ASP n 
8 85   ASP n 
8 86   ASP n 
8 87   TYR n 
8 88   TYR n 
8 89   GLY n 
8 90   SER n 
8 91   PRO n 
8 92   ILE n 
8 93   LYS n 
8 94   GLN n 
8 95   ASN n 
8 96   ARG n 
8 97   SER n 
8 98   LYS n 
8 99   PRO n 
8 100  LYS n 
8 101  SER n 
8 102  ARG n 
8 103  THR n 
8 104  LYS n 
8 105  SER n 
8 106  LYS n 
8 107  SER n 
8 108  LYS n 
8 109  SER n 
8 110  LYS n 
8 111  PRO n 
8 112  LYS n 
8 113  SER n 
8 114  GLN n 
8 115  SER n 
8 116  GLU n 
8 117  LYS n 
8 118  GLN n 
8 119  SER n 
8 120  THR n 
8 121  VAL n 
8 122  LYS n 
8 123  ILE n 
8 124  PRO n 
8 125  THR n 
8 126  ARG n 
8 127  PHE n 
8 128  SER n 
8 129  ASN n 
8 130  ARG n 
8 131  GLN n 
8 132  ASN n 
8 133  LYS n 
8 134  THR n 
8 135  VAL n 
8 136  ASN n 
8 137  TYR n 
8 138  ASN n 
8 139  ILE n 
8 140  ASP n 
8 141  TYR n 
8 142  SER n 
8 143  ASP n 
8 144  ASP n 
8 145  ASP n 
8 146  LEU n 
8 147  LEU n 
8 148  GLU n 
8 149  SER n 
8 150  GLU n 
8 151  ASP n 
8 152  ASP n 
8 153  TYR n 
8 154  GLY n 
8 155  SER n 
8 156  GLU n 
8 157  GLU n 
8 158  ALA n 
8 159  LEU n 
8 160  SER n 
8 161  GLU n 
8 162  GLU n 
8 163  ASN n 
8 164  VAL n 
8 165  HIS n 
8 166  GLU n 
8 167  ALA n 
8 168  SER n 
8 169  ALA n 
8 170  ASN n 
8 171  PRO n 
8 172  GLN n 
8 173  PRO n 
8 174  GLU n 
8 175  ASP n 
8 176  PHE n 
8 177  HIS n 
8 178  GLY n 
8 179  ILE n 
8 180  ASP n 
8 181  ILE n 
8 182  VAL n 
8 183  ILE n 
8 184  ASN n 
8 185  HIS n 
8 186  ARG n 
8 187  LEU n 
8 188  LYS n 
8 189  THR n 
8 190  SER n 
8 191  LEU n 
8 192  GLU n 
8 193  GLU n 
8 194  GLY n 
8 195  LYS n 
8 196  VAL n 
8 197  LEU n 
8 198  GLU n 
8 199  LYS n 
8 200  THR n 
8 201  VAL n 
8 202  PRO n 
8 203  ASP n 
8 204  LEU n 
8 205  ASN n 
8 206  ASN n 
8 207  CYS n 
8 208  LYS n 
8 209  GLU n 
8 210  ASN n 
8 211  TYR n 
8 212  GLU n 
8 213  PHE n 
8 214  LEU n 
8 215  ILE n 
8 216  LYS n 
8 217  TRP n 
8 218  THR n 
8 219  ASP n 
8 220  GLU n 
8 221  SER n 
8 222  HIS n 
8 223  LEU n 
8 224  HIS n 
8 225  ASN n 
8 226  THR n 
8 227  TRP n 
8 228  GLU n 
8 229  THR n 
8 230  TYR n 
8 231  GLU n 
8 232  SER n 
8 233  ILE n 
8 234  GLY n 
8 235  GLN n 
8 236  VAL n 
8 237  ARG n 
8 238  GLY n 
8 239  LEU n 
8 240  LYS n 
8 241  ARG n 
8 242  LEU n 
8 243  ASP n 
8 244  ASN n 
8 245  TYR n 
8 246  CYS n 
8 247  LYS n 
8 248  GLN n 
8 249  PHE n 
8 250  ILE n 
8 251  ILE n 
8 252  GLU n 
8 253  ASP n 
8 254  GLN n 
8 255  GLN n 
8 256  VAL n 
8 257  ARG n 
8 258  LEU n 
8 259  ASP n 
8 260  PRO n 
8 261  TYR n 
8 262  VAL n 
8 263  THR n 
8 264  ALA n 
8 265  GLU n 
8 266  ASP n 
8 267  ILE n 
8 268  GLU n 
8 269  ILE n 
8 270  MET n 
8 271  ASP n 
8 272  MET n 
8 273  GLU n 
8 274  ARG n 
8 275  GLU n 
8 276  ARG n 
8 277  ARG n 
8 278  LEU n 
8 279  ASP n 
8 280  GLU n 
8 281  PHE n 
8 282  GLU n 
8 283  GLU n 
8 284  PHE n 
8 285  HIS n 
8 286  VAL n 
8 287  PRO n 
8 288  GLU n 
8 289  ARG n 
8 290  ILE n 
8 291  ILE n 
8 292  ASP n 
8 293  SER n 
8 294  GLN n 
8 295  ARG n 
8 296  ALA n 
8 297  SER n 
8 298  LEU n 
8 299  GLU n 
8 300  ASP n 
8 301  GLY n 
8 302  THR n 
8 303  SER n 
8 304  GLN n 
8 305  LEU n 
8 306  GLN n 
8 307  TYR n 
8 308  LEU n 
8 309  VAL n 
8 310  LYS n 
8 311  TRP n 
8 312  ARG n 
8 313  ARG n 
8 314  LEU n 
8 315  ASN n 
8 316  TYR n 
8 317  ASP n 
8 318  GLU n 
8 319  ALA n 
8 320  THR n 
8 321  TRP n 
8 322  GLU n 
8 323  ASN n 
8 324  ALA n 
8 325  THR n 
8 326  ASP n 
8 327  ILE n 
8 328  VAL n 
8 329  LYS n 
8 330  LEU n 
8 331  ALA n 
8 332  PRO n 
8 333  GLU n 
8 334  GLN n 
8 335  VAL n 
8 336  LYS n 
8 337  HIS n 
8 338  PHE n 
8 339  GLN n 
8 340  ASN n 
8 341  ARG n 
8 342  GLU n 
8 343  ASN n 
8 344  SER n 
8 345  LYS n 
8 346  ILE n 
8 347  LEU n 
8 348  PRO n 
8 349  GLN n 
8 350  TYR n 
8 351  SER n 
8 352  SER n 
8 353  ASN n 
8 354  TYR n 
8 355  THR n 
8 356  SER n 
8 357  GLN n 
8 358  ARG n 
8 359  PRO n 
8 360  ARG n 
8 361  PHE n 
8 362  GLU n 
8 363  LYS n 
8 364  LEU n 
8 365  SER n 
8 366  VAL n 
8 367  GLN n 
8 368  PRO n 
8 369  PRO n 
8 370  PHE n 
8 371  ILE n 
8 372  LYS n 
8 373  GLY n 
8 374  GLY n 
8 375  GLU n 
8 376  LEU n 
8 377  ARG n 
8 378  ASP n 
8 379  PHE n 
8 380  GLN n 
8 381  LEU n 
8 382  THR n 
8 383  GLY n 
8 384  ILE n 
8 385  ASN n 
8 386  TRP n 
8 387  MET n 
8 388  ALA n 
8 389  PHE n 
8 390  LEU n 
8 391  TRP n 
8 392  SER n 
8 393  LYS n 
8 394  GLY n 
8 395  ASP n 
8 396  ASN n 
8 397  GLY n 
8 398  ILE n 
8 399  LEU n 
8 400  ALA n 
8 401  ASP n 
8 402  GLU n 
8 403  MET n 
8 404  GLY n 
8 405  LEU n 
8 406  GLY n 
8 407  LYS n 
8 408  THR n 
8 409  VAL n 
8 410  GLN n 
8 411  THR n 
8 412  VAL n 
8 413  ALA n 
8 414  PHE n 
8 415  ILE n 
8 416  SER n 
8 417  TRP n 
8 418  LEU n 
8 419  ILE n 
8 420  PHE n 
8 421  ALA n 
8 422  ARG n 
8 423  ARG n 
8 424  GLN n 
8 425  ASN n 
8 426  GLY n 
8 427  PRO n 
8 428  HIS n 
8 429  ILE n 
8 430  ILE n 
8 431  VAL n 
8 432  VAL n 
8 433  PRO n 
8 434  LEU n 
8 435  SER n 
8 436  THR n 
8 437  MET n 
8 438  PRO n 
8 439  ALA n 
8 440  TRP n 
8 441  LEU n 
8 442  ASP n 
8 443  THR n 
8 444  PHE n 
8 445  GLU n 
8 446  LYS n 
8 447  TRP n 
8 448  ALA n 
8 449  PRO n 
8 450  ASP n 
8 451  LEU n 
8 452  ASN n 
8 453  CYS n 
8 454  ILE n 
8 455  CYS n 
8 456  TYR n 
8 457  MET n 
8 458  GLY n 
8 459  ASN n 
8 460  GLN n 
8 461  LYS n 
8 462  SER n 
8 463  ARG n 
8 464  ASP n 
8 465  THR n 
8 466  ILE n 
8 467  ARG n 
8 468  GLU n 
8 469  TYR n 
8 470  GLU n 
8 471  PHE n 
8 472  TYR n 
8 473  THR n 
8 474  ASN n 
8 475  PRO n 
8 476  ARG n 
8 477  ALA n 
8 478  LYS n 
8 479  GLY n 
8 480  LYS n 
8 481  LYS n 
8 482  THR n 
8 483  MET n 
8 484  LYS n 
8 485  PHE n 
8 486  ASN n 
8 487  VAL n 
8 488  LEU n 
8 489  LEU n 
8 490  THR n 
8 491  THR n 
8 492  TYR n 
8 493  GLU n 
8 494  TYR n 
8 495  ILE n 
8 496  LEU n 
8 497  LYS n 
8 498  ASP n 
8 499  ARG n 
8 500  ALA n 
8 501  GLU n 
8 502  LEU n 
8 503  GLY n 
8 504  SER n 
8 505  ILE n 
8 506  LYS n 
8 507  TRP n 
8 508  GLN n 
8 509  PHE n 
8 510  MET n 
8 511  ALA n 
8 512  VAL n 
8 513  ASP n 
8 514  GLU n 
8 515  ALA n 
8 516  HIS n 
8 517  ARG n 
8 518  LEU n 
8 519  LYS n 
8 520  ASN n 
8 521  ALA n 
8 522  GLU n 
8 523  SER n 
8 524  SER n 
8 525  LEU n 
8 526  TYR n 
8 527  GLU n 
8 528  SER n 
8 529  LEU n 
8 530  ASN n 
8 531  SER n 
8 532  PHE n 
8 533  LYS n 
8 534  VAL n 
8 535  ALA n 
8 536  ASN n 
8 537  ARG n 
8 538  MET n 
8 539  LEU n 
8 540  ILE n 
8 541  THR n 
8 542  GLY n 
8 543  THR n 
8 544  PRO n 
8 545  LEU n 
8 546  GLN n 
8 547  ASN n 
8 548  ASN n 
8 549  ILE n 
8 550  LYS n 
8 551  GLU n 
8 552  LEU n 
8 553  ALA n 
8 554  ALA n 
8 555  LEU n 
8 556  VAL n 
8 557  ASN n 
8 558  PHE n 
8 559  LEU n 
8 560  MET n 
8 561  PRO n 
8 562  GLY n 
8 563  ARG n 
8 564  PHE n 
8 565  THR n 
8 566  ILE n 
8 567  ASP n 
8 568  GLN n 
8 569  GLU n 
8 570  ILE n 
8 571  ASP n 
8 572  PHE n 
8 573  GLU n 
8 574  ASN n 
8 575  GLN n 
8 576  ASP n 
8 577  GLU n 
8 578  GLU n 
8 579  GLN n 
8 580  GLU n 
8 581  GLU n 
8 582  TYR n 
8 583  ILE n 
8 584  HIS n 
8 585  ASP n 
8 586  LEU n 
8 587  HIS n 
8 588  ARG n 
8 589  ARG n 
8 590  ILE n 
8 591  GLN n 
8 592  PRO n 
8 593  PHE n 
8 594  ILE n 
8 595  LEU n 
8 596  ARG n 
8 597  ARG n 
8 598  LEU n 
8 599  LYS n 
8 600  LYS n 
8 601  ASP n 
8 602  VAL n 
8 603  GLU n 
8 604  LYS n 
8 605  SER n 
8 606  LEU n 
8 607  PRO n 
8 608  SER n 
8 609  LYS n 
8 610  THR n 
8 611  GLU n 
8 612  ARG n 
8 613  ILE n 
8 614  LEU n 
8 615  ARG n 
8 616  VAL n 
8 617  GLU n 
8 618  LEU n 
8 619  SER n 
8 620  ASP n 
8 621  VAL n 
8 622  GLN n 
8 623  THR n 
8 624  GLU n 
8 625  TYR n 
8 626  TYR n 
8 627  LYS n 
8 628  ASN n 
8 629  ILE n 
8 630  LEU n 
8 631  THR n 
8 632  LYS n 
8 633  ASN n 
8 634  TYR n 
8 635  SER n 
8 636  ALA n 
8 637  LEU n 
8 638  THR n 
8 639  ALA n 
8 640  GLY n 
8 641  ALA n 
8 642  LYS n 
8 643  GLY n 
8 644  GLY n 
8 645  HIS n 
8 646  PHE n 
8 647  SER n 
8 648  LEU n 
8 649  LEU n 
8 650  ASN n 
8 651  ILE n 
8 652  MET n 
8 653  ASN n 
8 654  GLU n 
8 655  LEU n 
8 656  LYS n 
8 657  LYS n 
8 658  ALA n 
8 659  SER n 
8 660  ASN n 
8 661  HIS n 
8 662  PRO n 
8 663  TYR n 
8 664  LEU n 
8 665  PHE n 
8 666  ASP n 
8 667  ASN n 
8 668  ALA n 
8 669  GLU n 
8 670  GLU n 
8 671  ARG n 
8 672  VAL n 
8 673  LEU n 
8 674  GLN n 
8 675  LYS n 
8 676  PHE n 
8 677  GLY n 
8 678  ASP n 
8 679  GLY n 
8 680  LYS n 
8 681  MET n 
8 682  THR n 
8 683  ARG n 
8 684  GLU n 
8 685  ASN n 
8 686  VAL n 
8 687  LEU n 
8 688  ARG n 
8 689  GLY n 
8 690  LEU n 
8 691  ILE n 
8 692  MET n 
8 693  SER n 
8 694  SER n 
8 695  GLY n 
8 696  LYS n 
8 697  MET n 
8 698  VAL n 
8 699  LEU n 
8 700  LEU n 
8 701  ASP n 
8 702  GLN n 
8 703  LEU n 
8 704  LEU n 
8 705  THR n 
8 706  ARG n 
8 707  LEU n 
8 708  LYS n 
8 709  LYS n 
8 710  ASP n 
8 711  GLY n 
8 712  HIS n 
8 713  ARG n 
8 714  VAL n 
8 715  LEU n 
8 716  ILE n 
8 717  PHE n 
8 718  SER n 
8 719  GLN n 
8 720  MET n 
8 721  VAL n 
8 722  ARG n 
8 723  MET n 
8 724  LEU n 
8 725  ASP n 
8 726  ILE n 
8 727  LEU n 
8 728  GLY n 
8 729  ASP n 
8 730  TYR n 
8 731  LEU n 
8 732  SER n 
8 733  ILE n 
8 734  LYS n 
8 735  GLY n 
8 736  ILE n 
8 737  ASN n 
8 738  PHE n 
8 739  GLN n 
8 740  ARG n 
8 741  LEU n 
8 742  ASP n 
8 743  GLY n 
8 744  THR n 
8 745  VAL n 
8 746  PRO n 
8 747  SER n 
8 748  ALA n 
8 749  GLN n 
8 750  ARG n 
8 751  ARG n 
8 752  ILE n 
8 753  SER n 
8 754  ILE n 
8 755  ASP n 
8 756  HIS n 
8 757  PHE n 
8 758  ASN n 
8 759  SER n 
8 760  PRO n 
8 761  ASP n 
8 762  SER n 
8 763  ASN n 
8 764  ASP n 
8 765  PHE n 
8 766  VAL n 
8 767  PHE n 
8 768  LEU n 
8 769  LEU n 
8 770  SER n 
8 771  THR n 
8 772  ARG n 
8 773  ALA n 
8 774  GLY n 
8 775  GLY n 
8 776  LEU n 
8 777  GLY n 
8 778  ILE n 
8 779  ASN n 
8 780  LEU n 
8 781  MET n 
8 782  THR n 
8 783  ALA n 
8 784  ASP n 
8 785  THR n 
8 786  VAL n 
8 787  VAL n 
8 788  ILE n 
8 789  PHE n 
8 790  ASP n 
8 791  SER n 
8 792  ASP n 
8 793  TRP n 
8 794  ASN n 
8 795  PRO n 
8 796  GLN n 
8 797  ALA n 
8 798  ASP n 
8 799  LEU n 
8 800  GLN n 
8 801  ALA n 
8 802  MET n 
8 803  ALA n 
8 804  ARG n 
8 805  ALA n 
8 806  HIS n 
8 807  ARG n 
8 808  ILE n 
8 809  GLY n 
8 810  GLN n 
8 811  LYS n 
8 812  ASN n 
8 813  HIS n 
8 814  VAL n 
8 815  MET n 
8 816  VAL n 
8 817  TYR n 
8 818  ARG n 
8 819  LEU n 
8 820  VAL n 
8 821  SER n 
8 822  LYS n 
8 823  ASP n 
8 824  THR n 
8 825  VAL n 
8 826  GLU n 
8 827  GLU n 
8 828  GLU n 
8 829  VAL n 
8 830  LEU n 
8 831  GLU n 
8 832  ARG n 
8 833  ALA n 
8 834  ARG n 
8 835  LYS n 
8 836  LYS n 
8 837  MET n 
8 838  ILE n 
8 839  LEU n 
8 840  GLU n 
8 841  TYR n 
8 842  ALA n 
8 843  ILE n 
8 844  ILE n 
8 845  SER n 
8 846  LEU n 
8 847  GLY n 
8 848  VAL n 
8 849  THR n 
8 850  ASP n 
8 851  GLY n 
8 852  ASN n 
8 853  LYS n 
8 854  TYR n 
8 855  THR n 
8 856  LYS n 
8 857  LYS n 
8 858  ASN n 
8 859  GLU n 
8 860  PRO n 
8 861  ASN n 
8 862  ALA n 
8 863  GLY n 
8 864  GLU n 
8 865  LEU n 
8 866  SER n 
8 867  ALA n 
8 868  ILE n 
8 869  LEU n 
8 870  LYS n 
8 871  PHE n 
8 872  GLY n 
8 873  ALA n 
8 874  GLY n 
8 875  ASN n 
8 876  MET n 
8 877  PHE n 
8 878  THR n 
8 879  ALA n 
8 880  THR n 
8 881  ASP n 
8 882  ASN n 
8 883  GLN n 
8 884  LYS n 
8 885  LYS n 
8 886  LEU n 
8 887  GLU n 
8 888  ASP n 
8 889  LEU n 
8 890  ASN n 
8 891  LEU n 
8 892  ASP n 
8 893  ASP n 
8 894  VAL n 
8 895  LEU n 
8 896  ASN n 
8 897  HIS n 
8 898  ALA n 
8 899  GLU n 
8 900  ASP n 
8 901  HIS n 
8 902  VAL n 
8 903  THR n 
8 904  THR n 
8 905  PRO n 
8 906  ASP n 
8 907  LEU n 
8 908  GLY n 
8 909  GLU n 
8 910  SER n 
8 911  HIS n 
8 912  LEU n 
8 913  GLY n 
8 914  GLY n 
8 915  GLU n 
8 916  GLU n 
8 917  PHE n 
8 918  LEU n 
8 919  LYS n 
8 920  GLN n 
8 921  PHE n 
8 922  GLU n 
8 923  VAL n 
8 924  THR n 
8 925  ASP n 
8 926  TYR n 
8 927  LYS n 
8 928  ALA n 
8 929  ASP n 
8 930  ILE n 
8 931  ASP n 
8 932  TRP n 
8 933  ASP n 
8 934  ASP n 
8 935  ILE n 
8 936  ILE n 
8 937  PRO n 
8 938  GLU n 
8 939  GLU n 
8 940  GLU n 
8 941  LEU n 
8 942  LYS n 
8 943  LYS n 
8 944  LEU n 
8 945  GLN n 
8 946  ASP n 
8 947  GLU n 
8 948  GLU n 
8 949  GLN n 
8 950  LYS n 
8 951  ARG n 
8 952  LYS n 
8 953  ASP n 
8 954  GLU n 
8 955  GLU n 
8 956  TYR n 
8 957  VAL n 
8 958  LYS n 
8 959  GLU n 
8 960  GLN n 
8 961  LEU n 
8 962  GLU n 
8 963  MET n 
8 964  MET n 
8 965  ASN n 
8 966  ARG n 
8 967  ARG n 
8 968  ASP n 
8 969  ASN n 
8 970  ALA n 
8 971  LEU n 
8 972  LYS n 
8 973  LYS n 
8 974  ILE n 
8 975  LYS n 
8 976  ASN n 
8 977  SER n 
8 978  VAL n 
8 979  ASN n 
8 980  GLY n 
8 981  ASP n 
8 982  GLY n 
8 983  THR n 
8 984  ALA n 
8 985  ALA n 
8 986  ASN n 
8 987  SER n 
8 988  ASP n 
8 989  SER n 
8 990  ASP n 
8 991  ASP n 
8 992  ASP n 
8 993  SER n 
8 994  THR n 
8 995  SER n 
8 996  ARG n 
8 997  SER n 
8 998  SER n 
8 999  ARG n 
8 1000 ARG n 
8 1001 ARG n 
8 1002 ALA n 
8 1003 ARG n 
8 1004 ALA n 
8 1005 ASN n 
8 1006 ASP n 
8 1007 MET n 
8 1008 ASP n 
8 1009 SER n 
8 1010 ILE n 
8 1011 GLY n 
8 1012 GLU n 
8 1013 SER n 
8 1014 GLU n 
8 1015 VAL n 
8 1016 ARG n 
8 1017 ALA n 
8 1018 LEU n 
8 1019 TYR n 
8 1020 LYS n 
8 1021 ALA n 
8 1022 ILE n 
8 1023 LEU n 
8 1024 LYS n 
8 1025 PHE n 
8 1026 GLY n 
8 1027 ASN n 
8 1028 LEU n 
8 1029 LYS n 
8 1030 GLU n 
8 1031 ILE n 
8 1032 LEU n 
8 1033 ASP n 
8 1034 GLU n 
8 1035 LEU n 
8 1036 ILE n 
8 1037 ALA n 
8 1038 ASP n 
8 1039 GLY n 
8 1040 THR n 
8 1041 LEU n 
8 1042 PRO n 
8 1043 VAL n 
8 1044 LYS n 
8 1045 SER n 
8 1046 PHE n 
8 1047 GLU n 
8 1048 LYS n 
8 1049 TYR n 
8 1050 GLY n 
8 1051 GLU n 
8 1052 THR n 
8 1053 TYR n 
8 1054 ASP n 
8 1055 GLU n 
8 1056 MET n 
8 1057 MET n 
8 1058 GLU n 
8 1059 ALA n 
8 1060 ALA n 
8 1061 LYS n 
8 1062 ASP n 
8 1063 CYS n 
8 1064 VAL n 
8 1065 HIS n 
8 1066 GLU n 
8 1067 GLU n 
8 1068 GLU n 
8 1069 LYS n 
8 1070 ASN n 
8 1071 ARG n 
8 1072 LYS n 
8 1073 GLU n 
8 1074 ILE n 
8 1075 LEU n 
8 1076 GLU n 
8 1077 LYS n 
8 1078 LEU n 
8 1079 GLU n 
8 1080 LYS n 
8 1081 HIS n 
8 1082 ALA n 
8 1083 THR n 
8 1084 ALA n 
8 1085 TYR n 
8 1086 ARG n 
8 1087 ALA n 
8 1088 LYS n 
8 1089 LEU n 
8 1090 LYS n 
8 1091 SER n 
8 1092 GLY n 
8 1093 GLU n 
8 1094 ILE n 
8 1095 LYS n 
8 1096 ALA n 
8 1097 GLU n 
8 1098 ASN n 
8 1099 GLN n 
8 1100 PRO n 
8 1101 LYS n 
8 1102 ASP n 
8 1103 ASN n 
8 1104 PRO n 
8 1105 LEU n 
8 1106 THR n 
8 1107 ARG n 
8 1108 LEU n 
8 1109 SER n 
8 1110 LEU n 
8 1111 LYS n 
8 1112 LYS n 
8 1113 ARG n 
8 1114 GLU n 
8 1115 LYS n 
8 1116 LYS n 
8 1117 ALA n 
8 1118 VAL n 
8 1119 LEU n 
8 1120 PHE n 
8 1121 ASN n 
8 1122 PHE n 
8 1123 LYS n 
8 1124 GLY n 
8 1125 VAL n 
8 1126 LYS n 
8 1127 SER n 
8 1128 LEU n 
8 1129 ASN n 
8 1130 ALA n 
8 1131 GLU n 
8 1132 SER n 
8 1133 LEU n 
8 1134 LEU n 
8 1135 SER n 
8 1136 ARG n 
8 1137 VAL n 
8 1138 GLU n 
8 1139 ASP n 
8 1140 LEU n 
8 1141 LYS n 
8 1142 TYR n 
8 1143 LEU n 
8 1144 LYS n 
8 1145 ASN n 
8 1146 LEU n 
8 1147 ILE n 
8 1148 ASN n 
8 1149 SER n 
8 1150 ASN n 
8 1151 TYR n 
8 1152 LYS n 
8 1153 ASP n 
8 1154 ASP n 
8 1155 PRO n 
8 1156 LEU n 
8 1157 LYS n 
8 1158 PHE n 
8 1159 SER n 
8 1160 LEU n 
8 1161 GLY n 
8 1162 ASN n 
8 1163 ASN n 
8 1164 THR n 
8 1165 PRO n 
8 1166 LYS n 
8 1167 PRO n 
8 1168 VAL n 
8 1169 GLN n 
8 1170 ASN n 
8 1171 TRP n 
8 1172 SER n 
8 1173 SER n 
8 1174 ASN n 
8 1175 TRP n 
8 1176 THR n 
8 1177 LYS n 
8 1178 GLU n 
8 1179 GLU n 
8 1180 ASP n 
8 1181 GLU n 
8 1182 LYS n 
8 1183 LEU n 
8 1184 LEU n 
8 1185 ILE n 
8 1186 GLY n 
8 1187 VAL n 
8 1188 PHE n 
8 1189 LYS n 
8 1190 TYR n 
8 1191 GLY n 
8 1192 TYR n 
8 1193 GLY n 
8 1194 SER n 
8 1195 TRP n 
8 1196 THR n 
8 1197 GLN n 
8 1198 ILE n 
8 1199 ARG n 
8 1200 ASP n 
8 1201 ASP n 
8 1202 PRO n 
8 1203 PHE n 
8 1204 LEU n 
8 1205 GLY n 
8 1206 ILE n 
8 1207 THR n 
8 1208 ASP n 
8 1209 LYS n 
8 1210 ILE n 
8 1211 PHE n 
8 1212 LEU n 
8 1213 ASN n 
8 1214 GLU n 
8 1215 VAL n 
8 1216 HIS n 
8 1217 ASN n 
8 1218 PRO n 
8 1219 VAL n 
8 1220 ALA n 
8 1221 LYS n 
8 1222 LYS n 
8 1223 SER n 
8 1224 ALA n 
8 1225 SER n 
8 1226 SER n 
8 1227 SER n 
8 1228 ASP n 
8 1229 THR n 
8 1230 THR n 
8 1231 PRO n 
8 1232 THR n 
8 1233 PRO n 
8 1234 SER n 
8 1235 LYS n 
8 1236 LYS n 
8 1237 GLY n 
8 1238 LYS n 
8 1239 GLY n 
8 1240 ILE n 
8 1241 THR n 
8 1242 GLY n 
8 1243 SER n 
8 1244 SER n 
8 1245 LYS n 
8 1246 LYS n 
8 1247 VAL n 
8 1248 PRO n 
8 1249 GLY n 
8 1250 ALA n 
8 1251 ILE n 
8 1252 HIS n 
8 1253 LEU n 
8 1254 GLY n 
8 1255 ARG n 
8 1256 ARG n 
8 1257 VAL n 
8 1258 ASP n 
8 1259 TYR n 
8 1260 LEU n 
8 1261 LEU n 
8 1262 SER n 
8 1263 PHE n 
8 1264 LEU n 
8 1265 ARG n 
8 1266 GLY n 
8 1267 GLY n 
8 1268 LEU n 
8 1269 ASN n 
8 1270 THR n 
8 1271 LYS n 
8 1272 SER n 
8 1273 PRO n 
8 1274 SER n 
8 1275 ALA n 
8 1276 ASP n 
8 1277 ILE n 
8 1278 GLY n 
8 1279 SER n 
8 1280 LYS n 
8 1281 LYS n 
8 1282 LEU n 
8 1283 PRO n 
8 1284 THR n 
8 1285 GLY n 
8 1286 PRO n 
8 1287 SER n 
8 1288 LYS n 
8 1289 LYS n 
8 1290 ARG n 
8 1291 GLN n 
8 1292 ARG n 
8 1293 LYS n 
8 1294 PRO n 
8 1295 ALA n 
8 1296 ASN n 
8 1297 HIS n 
8 1298 SER n 
8 1299 LYS n 
8 1300 SER n 
8 1301 MET n 
8 1302 THR n 
8 1303 PRO n 
8 1304 GLU n 
8 1305 ILE n 
8 1306 THR n 
8 1307 SER n 
8 1308 SER n 
8 1309 GLU n 
8 1310 PRO n 
8 1311 ALA n 
8 1312 ASN n 
8 1313 GLY n 
8 1314 PRO n 
8 1315 PRO n 
8 1316 SER n 
8 1317 LYS n 
8 1318 ARG n 
8 1319 MET n 
8 1320 LYS n 
8 1321 ALA n 
8 1322 LEU n 
8 1323 PRO n 
8 1324 LYS n 
8 1325 GLY n 
8 1326 PRO n 
8 1327 ALA n 
8 1328 ALA n 
8 1329 LEU n 
8 1330 ILE n 
8 1331 ASN n 
8 1332 ASN n 
8 1333 THR n 
8 1334 ARG n 
8 1335 LEU n 
8 1336 SER n 
8 1337 PRO n 
8 1338 ASN n 
8 1339 SER n 
8 1340 PRO n 
8 1341 THR n 
8 1342 PRO n 
8 1343 PRO n 
8 1344 LEU n 
8 1345 LYS n 
8 1346 SER n 
8 1347 LYS n 
8 1348 VAL n 
8 1349 SER n 
8 1350 ARG n 
8 1351 ASP n 
8 1352 ASN n 
8 1353 GLY n 
8 1354 THR n 
8 1355 ARG n 
8 1356 GLN n 
8 1357 SER n 
8 1358 SER n 
8 1359 ASN n 
8 1360 PRO n 
8 1361 SER n 
8 1362 SER n 
8 1363 GLY n 
8 1364 SER n 
8 1365 ALA n 
8 1366 HIS n 
8 1367 GLU n 
8 1368 LYS n 
8 1369 GLU n 
8 1370 TYR n 
8 1371 ASP n 
8 1372 SER n 
8 1373 MET n 
8 1374 ASP n 
8 1375 GLU n 
8 1376 GLU n 
8 1377 ASP n 
8 1378 CYS n 
8 1379 ARG n 
8 1380 HIS n 
8 1381 THR n 
8 1382 MET n 
8 1383 SER n 
8 1384 ALA n 
8 1385 ILE n 
8 1386 ARG n 
8 1387 THR n 
8 1388 SER n 
8 1389 LEU n 
8 1390 LYS n 
8 1391 ARG n 
8 1392 LEU n 
8 1393 ARG n 
8 1394 ARG n 
8 1395 GLY n 
8 1396 GLY n 
8 1397 LYS n 
8 1398 SER n 
8 1399 LEU n 
8 1400 ASP n 
8 1401 ARG n 
8 1402 LYS n 
8 1403 GLU n 
8 1404 TRP n 
8 1405 ALA n 
8 1406 LYS n 
8 1407 ILE n 
8 1408 LEU n 
8 1409 LYS n 
8 1410 THR n 
8 1411 GLU n 
8 1412 LEU n 
8 1413 THR n 
8 1414 THR n 
8 1415 ILE n 
8 1416 GLY n 
8 1417 ASN n 
8 1418 HIS n 
8 1419 ILE n 
8 1420 GLU n 
8 1421 SER n 
8 1422 GLN n 
8 1423 LYS n 
8 1424 GLY n 
8 1425 SER n 
8 1426 SER n 
8 1427 ARG n 
8 1428 LYS n 
8 1429 ALA n 
8 1430 SER n 
8 1431 PRO n 
8 1432 GLU n 
8 1433 LYS n 
8 1434 TYR n 
8 1435 ARG n 
8 1436 LYS n 
8 1437 HIS n 
8 1438 LEU n 
8 1439 TRP n 
8 1440 SER n 
8 1441 TYR n 
8 1442 SER n 
8 1443 ALA n 
8 1444 ASN n 
8 1445 PHE n 
8 1446 TRP n 
8 1447 PRO n 
8 1448 ALA n 
8 1449 ASP n 
8 1450 VAL n 
8 1451 LYS n 
8 1452 SER n 
8 1453 THR n 
8 1454 LYS n 
8 1455 LEU n 
8 1456 MET n 
8 1457 ALA n 
8 1458 MET n 
8 1459 TYR n 
8 1460 ASP n 
8 1461 LYS n 
8 1462 ILE n 
8 1463 THR n 
8 1464 GLU n 
8 1465 SER n 
8 1466 GLN n 
8 1467 LYS n 
8 1468 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 136  'African clawed frog' ? ?                          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 103  'African clawed frog' ? ?                          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130  'African clawed frog' ? 'hist1h2aj, LOC494591'     ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 123  'African clawed frog' ? ?                          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 122  'African clawed frog' ? ?                          ? ? ? ? ? ? 'Xenopus laevis' 8355   ? ? 
? ? ? ? ? ?                'Escherichia coli' 562  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1 1468 ?                     ? 'CHD1, YER164W, SYGP-ORF4' ? ? ? ? ? ? 
'Saccharomyces cerevisiae S288c' 559292 ? ? ? ? ? ? ? 'cabbage looper' 'Trichoplusia ni'  7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 208 'synthetic construct' ? 32630 ? 
7 1 sample 1 208 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 
2 UNP H4_XENLA     P62799 ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
1 
4 UNP H2B11_XENLA  P02281 ? 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 
5 UNP H2B11_XENLA  P02281 ? 5 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
5 
6 PDB 5O9G         5O9G   ? 6 ? 1 
7 PDB 5O9G         5O9G   ? 7 ? 1 
8 UNP CHD1_YEAST   P32657 ? 8 
;MAAKDISTEVLQNPELYGLRRSHRAAAHQQNYFNDSDDEDDEDNIKQSRRKRMTTIEDDEDEFEDEEGEEDSGEDEDEED
FEEDDDYYGSPIKQNRSKPKSRTKSKSKSKPKSQSEKQSTVKIPTRFSNRQNKTVNYNIDYSDDDLLESEDDYGSEEALS
EENVHEASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHNTWETYESIGQVRGLK
RLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEAT
WENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILA
DEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGK
KTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLM
PGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG
AKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQM
VRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQ
AMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTAT
DNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEEFLKQFEVTDYKADIDWDDIIPEEELKKLQDEEQKRKDEEYVKEQ
LEMMNRRDNALKKIKNSVNGDGTAANSDSDDDSTSRSSRRRARANDMDSIGESEVRALYKAILKFGNLKEILDELIADGT
LPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLF
NFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRD
DPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSSKKVPGAIHLGRRVDYLLSFLRGGLNTKSPSADIGSK
KLPTGPSKKRQRKPANHSKSMTPEITSSEPANGPPSKRMKALPKGPAALINNTRLSPNSPTPPLKSKVSRDNGTRQSSNP
SSGSAHEKEYDSMDEEDCRHTMSAIRTSLKRLRRGGKSLDRKEWAKILKTELTTIGNHIESQKGSSRKASPEKYRKHLWS
YSANFWPADVKSTKLMAMYDKITESQKK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5O9G A 1 ? 136  ? P84233 1    ? 136  ? 0    135  
2  2 5O9G B 1 ? 103  ? P62799 1    ? 103  ? 0    102  
3  3 5O9G C 1 ? 130  ? Q6AZJ8 1    ? 130  ? 0    129  
4  4 5O9G D 2 ? 123  ? P02281 5    ? 126  ? 1    122  
5  1 5O9G E 1 ? 136  ? P84233 1    ? 136  ? 0    135  
6  2 5O9G F 1 ? 103  ? P62799 1    ? 103  ? 0    102  
7  3 5O9G G 1 ? 130  ? Q6AZJ8 1    ? 130  ? 0    129  
8  5 5O9G H 2 ? 122  ? P02281 5    ? 125  ? 1    121  
9  6 5O9G I 1 ? 208  ? 5O9G   -72  ? 135  ? -72  135  
10 7 5O9G J 1 ? 208  ? 5O9G   -135 ? 72   ? -135 72   
11 8 5O9G W 1 ? 1468 ? P32657 1    ? 1468 ? 1    1468 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5O9G ALA A 103 ? UNP P84233 GLY 103 conflict                102 1 
4 5O9G MET D 1   ? UNP P02281 ?   ?   'initiating methionine' 0   2 
4 5O9G THR D 30  ? UNP P02281 SER 33  conflict                29  3 
5 5O9G ALA E 103 ? UNP P84233 GLY 103 conflict                102 4 
8 5O9G MET H 1   ? UNP P02281 ?   ?   'initiating methionine' 0   5 
8 5O9G THR H 30  ? UNP P02281 SER 33  conflict                29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
BEF non-polymer         . 'BERYLLIUM TRIFLUORIDE ION'          ? 'Be F3 -1'          66.007  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5O9G 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5O9G 
_struct.title                        'Structure of nucleosome-Chd1 complex' 
_struct.pdbx_descriptor              
'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1, Chromo domain-containing protein 1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5O9G 
_struct_keywords.text            'ATPase, Complex, Nucleosome, DNA, DNA BINDING PROTEIN, Chromatin Remodeling' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 3  ? 
H N N 5  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 9  ? 
M N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 45   ? LYS A 57   ? GLY A 44   LYS A 56   1 ? 13 
HELX_P HELX_P2  AA2 ARG A 64   ? LYS A 80   ? ARG A 63   LYS A 79   1 ? 17 
HELX_P HELX_P3  AA3 GLN A 86   ? ALA A 115  ? GLN A 85   ALA A 114  1 ? 30 
HELX_P HELX_P4  AA4 MET A 121  ? GLY A 133  ? MET A 120  GLY A 132  1 ? 13 
HELX_P HELX_P5  AA5 ASP B 25   ? ILE B 30   ? ASP B 24   ILE B 29   5 ? 6  
HELX_P HELX_P6  AA6 THR B 31   ? GLY B 43   ? THR B 30   GLY B 42   1 ? 13 
HELX_P HELX_P7  AA7 ILE B 51   ? ALA B 77   ? ILE B 50   ALA B 76   1 ? 27 
HELX_P HELX_P8  AA8 ALA B 84   ? GLN B 94   ? ALA B 83   GLN B 93   1 ? 11 
HELX_P HELX_P9  AA9 ARG C 18   ? GLY C 23   ? ARG C 17   GLY C 22   1 ? 6  
HELX_P HELX_P10 AB1 VAL C 28   ? GLY C 38   ? VAL C 27   GLY C 37   1 ? 11 
HELX_P HELX_P11 AB2 GLY C 47   ? ASN C 74   ? GLY C 46   ASN C 73   1 ? 28 
HELX_P HELX_P12 AB3 ILE C 80   ? ARG C 89   ? ILE C 79   ARG C 88   1 ? 10 
HELX_P HELX_P13 AB4 GLU C 92   ? LEU C 98   ? GLU C 91   LEU C 97   1 ? 7  
HELX_P HELX_P14 AB5 GLN C 113  ? LEU C 117  ? GLN C 112  LEU C 116  5 ? 5  
HELX_P HELX_P15 AB6 TYR D 38   ? GLN D 45   ? TYR D 37   GLN D 44   1 ? 8  
HELX_P HELX_P16 AB7 SER D 53   ? ASN D 82   ? SER D 52   ASN D 81   1 ? 30 
HELX_P HELX_P17 AB8 THR D 88   ? LEU D 100  ? THR D 87   LEU D 99   1 ? 13 
HELX_P HELX_P18 AB9 GLY D 102  ? ALA D 122  ? GLY D 101  ALA D 121  1 ? 21 
HELX_P HELX_P19 AC1 GLY E 45   ? GLN E 56   ? GLY E 44   GLN E 55   1 ? 12 
HELX_P HELX_P20 AC2 ARG E 64   ? LYS E 80   ? ARG E 63   LYS E 79   1 ? 17 
HELX_P HELX_P21 AC3 GLN E 86   ? ALA E 115  ? GLN E 85   ALA E 114  1 ? 30 
HELX_P HELX_P22 AC4 MET E 121  ? GLY E 133  ? MET E 120  GLY E 132  1 ? 13 
HELX_P HELX_P23 AC5 ASN F 26   ? ILE F 30   ? ASN F 25   ILE F 29   5 ? 5  
HELX_P HELX_P24 AC6 THR F 31   ? GLY F 43   ? THR F 30   GLY F 42   1 ? 13 
HELX_P HELX_P25 AC7 ILE F 51   ? ALA F 77   ? ILE F 50   ALA F 76   1 ? 27 
HELX_P HELX_P26 AC8 ALA F 84   ? GLY F 95   ? ALA F 83   GLY F 94   1 ? 12 
HELX_P HELX_P27 AC9 THR G 17   ? GLY G 23   ? THR G 16   GLY G 22   1 ? 7  
HELX_P HELX_P28 AD1 PRO G 27   ? GLY G 38   ? PRO G 26   GLY G 37   1 ? 12 
HELX_P HELX_P29 AD2 GLY G 47   ? ASP G 73   ? GLY G 46   ASP G 72   1 ? 27 
HELX_P HELX_P30 AD3 ILE G 80   ? ASN G 90   ? ILE G 79   ASN G 89   1 ? 11 
HELX_P HELX_P31 AD4 ASP G 91   ? LEU G 98   ? ASP G 90   LEU G 97   1 ? 8  
HELX_P HELX_P32 AD5 GLN G 113  ? LEU G 117  ? GLN G 112  LEU G 116  5 ? 5  
HELX_P HELX_P33 AD6 ALA H 36   ? LYS H 44   ? ALA H 35   LYS H 43   1 ? 9  
HELX_P HELX_P34 AD7 SER H 53   ? ASN H 82   ? SER H 52   ASN H 81   1 ? 30 
HELX_P HELX_P35 AD8 THR H 88   ? LEU H 100  ? THR H 87   LEU H 99   1 ? 13 
HELX_P HELX_P36 AD9 GLY H 102  ? ALA H 122  ? GLY H 101  ALA H 121  1 ? 21 
HELX_P HELX_P37 AE1 ASP K 203  ? ASN K 210  ? ASP W 203  ASN W 210  1 ? 8  
HELX_P HELX_P38 AE2 SER K 221  ? ASN K 225  ? SER W 221  ASN W 225  5 ? 5  
HELX_P HELX_P39 AE3 LEU K 239  ? ARG K 257  ? LEU W 239  ARG W 257  1 ? 19 
HELX_P HELX_P40 AE4 ALA K 264  ? GLU K 282  ? ALA W 264  GLU W 282  1 ? 19 
HELX_P HELX_P41 AE5 GLU K 283  ? HIS K 285  ? GLU W 283  HIS W 285  5 ? 3  
HELX_P HELX_P42 AE6 ALA K 331  ? SER K 344  ? ALA W 331  SER W 344  1 ? 14 
HELX_P HELX_P43 AE7 LEU K 347  ? SER K 351  ? LEU W 347  SER W 351  5 ? 5  
HELX_P HELX_P44 AE8 ASP K 378  ? SER K 392  ? ASP W 378  SER W 392  1 ? 15 
HELX_P HELX_P45 AE9 GLY K 406  ? ARG K 422  ? GLY W 406  ARG W 422  1 ? 17 
HELX_P HELX_P46 AF1 THR K 436  ? ALA K 448  ? THR W 436  ALA W 448  1 ? 13 
HELX_P HELX_P47 AF2 GLN K 460  ? PHE K 471  ? GLN W 460  PHE W 471  1 ? 12 
HELX_P HELX_P48 AF3 THR K 491  ? ASP K 498  ? THR W 491  ASP W 498  1 ? 8  
HELX_P HELX_P49 AF4 ARG K 499  ? SER K 504  ? ARG W 499  SER W 504  1 ? 6  
HELX_P HELX_P50 AF5 ALA K 515  ? ASN K 520  ? ALA W 515  ASN W 520  5 ? 6  
HELX_P HELX_P51 AF6 SER K 523  ? ASN K 530  ? SER W 523  ASN W 530  1 ? 8  
HELX_P HELX_P52 AF7 ASN K 548  ? MET K 560  ? ASN W 548  MET W 560  1 ? 13 
HELX_P HELX_P53 AF8 GLU K 578  ? GLN K 591  ? GLU W 578  GLN W 591  1 ? 14 
HELX_P HELX_P54 AF9 LEU K 598  ? LEU K 606  ? LEU W 598  LEU W 606  5 ? 9  
HELX_P HELX_P55 AG1 SER K 619  ? ASN K 628  ? SER W 619  ASN W 628  1 ? 10 
HELX_P HELX_P56 AG2 MET K 652  ? ALA K 658  ? MET W 652  ALA W 658  1 ? 7  
HELX_P HELX_P57 AG3 ALA K 668  ? LEU K 673  ? ALA W 668  LEU W 673  1 ? 6  
HELX_P HELX_P58 AG4 ARG K 683  ? MET K 692  ? ARG W 683  MET W 692  1 ? 10 
HELX_P HELX_P59 AG5 SER K 694  ? LYS K 709  ? SER W 694  LYS W 709  1 ? 16 
HELX_P HELX_P60 AG6 MET K 720  ? LEU K 731  ? MET W 720  LEU W 731  1 ? 12 
HELX_P HELX_P61 AG7 PRO K 746  ? ASN K 758  ? PRO W 746  ASN W 758  1 ? 13 
HELX_P HELX_P62 AG8 GLN K 796  ? ALA K 803  ? GLN W 796  ALA W 803  1 ? 8  
HELX_P HELX_P63 AG9 VAL K 825  ? LYS K 836  ? VAL W 825  LYS W 836  1 ? 12 
HELX_P HELX_P64 AH1 GLY K 1011 ? GLY K 1026 ? GLY W 1011 GLY W 1026 1 ? 16 
HELX_P HELX_P65 AH2 ILE K 1031 ? ALA K 1037 ? ILE W 1031 ALA W 1037 1 ? 7  
HELX_P HELX_P66 AH3 SER K 1045 ? LYS K 1090 ? SER W 1045 LYS W 1090 1 ? 46 
HELX_P HELX_P67 AH4 ASN K 1103 ? ARG K 1113 ? ASN W 1103 ARG W 1113 1 ? 11 
HELX_P HELX_P68 AH5 ALA K 1130 ? SER K 1149 ? ALA W 1130 SER W 1149 1 ? 20 
HELX_P HELX_P69 AH6 ASP K 1154 ? PHE K 1158 ? ASP W 1154 PHE W 1158 5 ? 5  
HELX_P HELX_P70 AH7 THR K 1176 ? TYR K 1190 ? THR W 1176 TYR W 1190 1 ? 15 
HELX_P HELX_P71 AH8 SER K 1194 ? ARG K 1199 ? SER W 1194 ARG W 1199 1 ? 6  
HELX_P HELX_P72 AH9 ILE K 1206 ? ILE K 1210 ? ILE W 1206 ILE W 1210 5 ? 5  
HELX_P HELX_P73 AI1 GLY K 1249 ? GLY K 1266 ? GLY W 1249 GLY W 1266 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? L ADP .   O2B ? ? ? 1_555 M BEF .   BE ? ? W ADP 1501 W BEF 1502 1_555 ? ? ? ? ? ? ?               1.909 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT  208 N3 ? ? I DA  -72  J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT  208 O4 ? ? I DA  -72  J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA  207 N1 ? ? I DT  -71  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA  207 N6 ? ? I DT  -71  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J DG  206 N1 ? ? I DC  -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J DG  206 O6 ? ? I DC  -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG  206 N2 ? ? I DC  -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT  205 N3 ? ? I DA  -69  J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J DT  205 O4 ? ? I DA  -69  J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DG  5   N1  ? ? ? 1_555 J DC  204 N3 ? ? I DG  -68  J DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DG  5   N2  ? ? ? 1_555 J DC  204 O2 ? ? I DG  -68  J DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DG  5   O6  ? ? ? 1_555 J DC  204 N4 ? ? I DG  -68  J DC  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  6   N1  ? ? ? 1_555 J DT  203 N3 ? ? I DA  -67  J DT  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  6   N6  ? ? ? 1_555 J DT  203 O4 ? ? I DA  -67  J DT  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT  202 N3 ? ? I DA  -66  J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT  202 O4 ? ? I DA  -66  J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA  201 N1 ? ? I DT  -65  J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA  201 N6 ? ? I DT  -65  J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  200 N1 ? ? I DC  -64  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  200 O6 ? ? I DC  -64  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  200 N2 ? ? I DC  -64  J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  199 N1 ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG  199 O6 ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  199 N2 ? ? I DC  -63  J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DC  11  N3  ? ? ? 1_555 J DG  198 N1 ? ? I DC  -62  J DG  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DC  11  N4  ? ? ? 1_555 J DG  198 O6 ? ? I DC  -62  J DG  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DC  11  O2  ? ? ? 1_555 J DG  198 N2 ? ? I DC  -62  J DG  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DG  12  N1  ? ? ? 1_555 J DC  197 N3 ? ? I DG  -61  J DC  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DG  12  N2  ? ? ? 1_555 J DC  197 O2 ? ? I DG  -61  J DC  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DG  12  O6  ? ? ? 1_555 J DC  197 N4 ? ? I DG  -61  J DC  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DG  13  N1  ? ? ? 1_555 J DC  196 N3 ? ? I DG  -60  J DC  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DG  13  N2  ? ? ? 1_555 J DC  196 O2 ? ? I DG  -60  J DC  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DG  13  O6  ? ? ? 1_555 J DC  196 N4 ? ? I DG  -60  J DC  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA  195 N1 ? ? I DT  -59  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DT  14  O4  ? ? ? 1_555 J DA  195 N6 ? ? I DT  -59  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC  194 N3 ? ? I DG  -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DG  15  N2  ? ? ? 1_555 J DC  194 O2 ? ? I DG  -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DG  15  O6  ? ? ? 1_555 J DC  194 N4 ? ? I DG  -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG  193 N1 ? ? I DC  -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG  193 O6 ? ? I DC  -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG  193 N2 ? ? I DC  -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DC  17  N3  ? ? ? 1_555 J DG  192 N1 ? ? I DC  -56  J DG  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DC  17  N4  ? ? ? 1_555 J DG  192 O6 ? ? I DC  -56  J DG  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DC  17  O2  ? ? ? 1_555 J DG  192 N2 ? ? I DC  -56  J DG  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC  191 N3 ? ? I DG  -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J DC  191 O2 ? ? I DG  -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J DC  191 N4 ? ? I DG  -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J DT  190 N3 ? ? I DA  -54  J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT  190 O4 ? ? I DA  -54  J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DG  20  N1  ? ? ? 1_555 J DC  189 N3 ? ? I DG  -53  J DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DG  20  N2  ? ? ? 1_555 J DC  189 O2 ? ? I DG  -53  J DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DG  20  O6  ? ? ? 1_555 J DC  189 N4 ? ? I DG  -53  J DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DG  21  N1  ? ? ? 1_555 J DC  188 N3 ? ? I DG  -52  J DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DG  21  N2  ? ? ? 1_555 J DC  188 O2 ? ? I DG  -52  J DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DG  21  O6  ? ? ? 1_555 J DC  188 N4 ? ? I DG  -52  J DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J DG  187 N1 ? ? I DC  -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J DG  187 O6 ? ? I DC  -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG  187 N2 ? ? I DC  -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DC  23  N3  ? ? ? 1_555 J DG  186 N1 ? ? I DC  -50  J DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DC  23  N4  ? ? ? 1_555 J DG  186 O6 ? ? I DC  -50  J DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DC  23  O2  ? ? ? 1_555 J DG  186 N2 ? ? I DC  -50  J DG  50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DG  24  N1  ? ? ? 1_555 J DC  185 N3 ? ? I DG  -49  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DG  24  N2  ? ? ? 1_555 J DC  185 O2 ? ? I DG  -49  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DG  24  O6  ? ? ? 1_555 J DC  185 N4 ? ? I DG  -49  J DC  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J DG  184 N1 ? ? I DC  -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  184 O6 ? ? I DC  -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  184 N2 ? ? I DC  -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DT  26  N3  ? ? ? 1_555 J DA  183 N1 ? ? I DT  -47  J DA  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DT  26  O4  ? ? ? 1_555 J DA  183 N6 ? ? I DT  -47  J DA  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DC  27  N3  ? ? ? 1_555 J DG  182 N1 ? ? I DC  -46  J DG  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DC  27  N4  ? ? ? 1_555 J DG  182 O6 ? ? I DC  -46  J DG  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DC  27  O2  ? ? ? 1_555 J DG  182 N2 ? ? I DC  -46  J DG  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT  181 N3 ? ? I DA  -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT  181 O4 ? ? I DA  -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT  180 N3 ? ? I DA  -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  180 O4 ? ? I DA  -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  31  N3  ? ? ? 1_555 J DA  178 N1 ? ? I DT  -42  J DA  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DT  31  O4  ? ? ? 1_555 J DA  178 N6 ? ? I DT  -42  J DA  42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DG  32  N1  ? ? ? 1_555 J DC  177 N3 ? ? I DG  -41  J DC  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DG  32  N2  ? ? ? 1_555 J DC  177 O2 ? ? I DG  -41  J DC  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DG  32  O6  ? ? ? 1_555 J DC  177 N4 ? ? I DG  -41  J DC  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC  176 N3 ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J DC  176 O2 ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J DC  176 N4 ? ? I DG  -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA  175 N1 ? ? I DT  -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J DA  175 N6 ? ? I DT  -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DC  35  N3  ? ? ? 1_555 J DG  174 N1 ? ? I DC  -38  J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DC  35  N4  ? ? ? 1_555 J DG  174 O6 ? ? I DC  -38  J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DC  35  O2  ? ? ? 1_555 J DG  174 N2 ? ? I DC  -38  J DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DG  36  N1  ? ? ? 1_555 J DC  173 N3 ? ? I DG  -37  J DC  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DG  36  N2  ? ? ? 1_555 J DC  173 O2 ? ? I DG  -37  J DC  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  36  O6  ? ? ? 1_555 J DC  173 N4 ? ? I DG  -37  J DC  37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA  172 N1 ? ? I DT  -36  J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  172 N6 ? ? I DT  -36  J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DA  38  N1  ? ? ? 1_555 J DT  171 N3 ? ? I DA  -35  J DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DA  38  N6  ? ? ? 1_555 J DT  171 O4 ? ? I DA  -35  J DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC  170 N3 ? ? I DG  -34  J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC  170 O2 ? ? I DG  -34  J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC  170 N4 ? ? I DG  -34  J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DA  40  N1  ? ? ? 1_555 J DT  169 N3 ? ? I DA  -33  J DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DA  40  N6  ? ? ? 1_555 J DT  169 O4 ? ? I DA  -33  J DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  41  N3  ? ? ? 1_555 J DG  168 N1 ? ? I DC  -32  J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  41  N4  ? ? ? 1_555 J DG  168 O6 ? ? I DC  -32  J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DC  41  O2  ? ? ? 1_555 J DG  168 N2 ? ? I DC  -32  J DG  32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DG  43  N1  ? ? ? 1_555 J DC  166 N3 ? ? I DG  -30  J DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DG  43  N2  ? ? ? 1_555 J DC  166 O2 ? ? I DG  -30  J DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DG  43  O6  ? ? ? 1_555 J DC  166 N4 ? ? I DG  -30  J DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DC  44  N3  ? ? ? 1_555 J DG  165 N1 ? ? I DC  -29  J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DC  44  N4  ? ? ? 1_555 J DG  165 O6 ? ? I DC  -29  J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG  165 N2 ? ? I DC  -29  J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  164 N1 ? ? I DT  -28  J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  164 N6 ? ? I DT  -28  J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DC  46  N3  ? ? ? 1_555 J DG  163 N1 ? ? I DC  -27  J DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  46  N4  ? ? ? 1_555 J DG  163 O6 ? ? I DC  -27  J DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  46  O2  ? ? ? 1_555 J DG  163 N2 ? ? I DC  -27  J DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DT  47  N3  ? ? ? 1_555 J DA  162 N1 ? ? I DT  -26  J DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DT  47  O4  ? ? ? 1_555 J DA  162 N6 ? ? I DT  -26  J DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DA  48  N1  ? ? ? 1_555 J DT  161 N3 ? ? I DA  -25  J DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DA  48  N6  ? ? ? 1_555 J DT  161 O4 ? ? I DA  -25  J DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG  49  N1  ? ? ? 1_555 J DC  160 N3 ? ? I DG  -24  J DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG  49  N2  ? ? ? 1_555 J DC  160 O2 ? ? I DG  -24  J DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG  49  O6  ? ? ? 1_555 J DC  160 N4 ? ? I DG  -24  J DC  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DC  50  N3  ? ? ? 1_555 J DG  159 N1 ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DC  50  N4  ? ? ? 1_555 J DG  159 O6 ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DC  50  O2  ? ? ? 1_555 J DG  159 N2 ? ? I DC  -23  J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT  158 N3 ? ? I DA  -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J DT  158 O4 ? ? I DA  -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DC  52  N3  ? ? ? 1_555 J DG  157 N1 ? ? I DC  -21  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DC  52  N4  ? ? ? 1_555 J DG  157 O6 ? ? I DC  -21  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DC  52  O2  ? ? ? 1_555 J DG  157 N2 ? ? I DC  -21  J DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG  156 N1 ? ? I DC  -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG  156 O6 ? ? I DC  -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG  156 N2 ? ? I DC  -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  54  N1  ? ? ? 1_555 J DC  155 N3 ? ? I DG  -19  J DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  54  N2  ? ? ? 1_555 J DC  155 O2 ? ? I DG  -19  J DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DG  54  O6  ? ? ? 1_555 J DC  155 N4 ? ? I DG  -19  J DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  55  N3  ? ? ? 1_555 J DG  154 N1 ? ? I DC  -18  J DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DC  55  N4  ? ? ? 1_555 J DG  154 O6 ? ? I DC  -18  J DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DC  55  O2  ? ? ? 1_555 J DG  154 N2 ? ? I DC  -18  J DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DT  56  N3  ? ? ? 1_555 J DA  153 N1 ? ? I DT  -17  J DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DT  56  O4  ? ? ? 1_555 J DA  153 N6 ? ? I DT  -17  J DA  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DT  57  N3  ? ? ? 1_555 J DA  152 N1 ? ? I DT  -16  J DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DT  57  O4  ? ? ? 1_555 J DA  152 N6 ? ? I DT  -16  J DA  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DA  58  N1  ? ? ? 1_555 J DT  151 N3 ? ? I DA  -15  J DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DA  58  N6  ? ? ? 1_555 J DT  151 O4 ? ? I DA  -15  J DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DA  59  N1  ? ? ? 1_555 J DT  150 N3 ? ? I DA  -14  J DT  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DA  59  N6  ? ? ? 1_555 J DT  150 O4 ? ? I DA  -14  J DT  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DA  60  N1  ? ? ? 1_555 J DT  149 N3 ? ? I DA  -13  J DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DA  60  N6  ? ? ? 1_555 J DT  149 O4 ? ? I DA  -13  J DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DC  61  N3  ? ? ? 1_555 J DG  148 N1 ? ? I DC  -12  J DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DC  61  N4  ? ? ? 1_555 J DG  148 O6 ? ? I DC  -12  J DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DC  61  O2  ? ? ? 1_555 J DG  148 N2 ? ? I DC  -12  J DG  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DG  62  N1  ? ? ? 1_555 J DC  147 N3 ? ? I DG  -11  J DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DG  62  N2  ? ? ? 1_555 J DC  147 O2 ? ? I DG  -11  J DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DG  62  O6  ? ? ? 1_555 J DC  147 N4 ? ? I DG  -11  J DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DC  63  N3  ? ? ? 1_555 J DG  146 N1 ? ? I DC  -10  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DC  63  N4  ? ? ? 1_555 J DG  146 O6 ? ? I DC  -10  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DC  63  O2  ? ? ? 1_555 J DG  146 N2 ? ? I DC  -10  J DG  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DA  64  N1  ? ? ? 1_555 J DT  145 N3 ? ? I DA  -9   J DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DA  64  N6  ? ? ? 1_555 J DT  145 O4 ? ? I DA  -9   J DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DC  65  N3  ? ? ? 1_555 J DG  144 N1 ? ? I DC  -8   J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DC  65  N4  ? ? ? 1_555 J DG  144 O6 ? ? I DC  -8   J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DC  65  O2  ? ? ? 1_555 J DG  144 N2 ? ? I DC  -8   J DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DG  66  N1  ? ? ? 1_555 J DC  143 N3 ? ? I DG  -7   J DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DG  66  N2  ? ? ? 1_555 J DC  143 O2 ? ? I DG  -7   J DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DG  66  O6  ? ? ? 1_555 J DC  143 N4 ? ? I DG  -7   J DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DT  67  N3  ? ? ? 1_555 J DA  142 N1 ? ? I DT  -6   J DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DT  67  O4  ? ? ? 1_555 J DA  142 N6 ? ? I DT  -6   J DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DA  68  N1  ? ? ? 1_555 J DT  141 N3 ? ? I DA  -5   J DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DA  68  N6  ? ? ? 1_555 J DT  141 O4 ? ? I DA  -5   J DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG  140 N1 ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG  140 O6 ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG  140 N2 ? ? I DC  -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DG  70  N1  ? ? ? 1_555 J DC  139 N3 ? ? I DG  -3   J DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DG  70  N2  ? ? ? 1_555 J DC  139 O2 ? ? I DG  -3   J DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DG  70  O6  ? ? ? 1_555 J DC  139 N4 ? ? I DG  -3   J DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DC  71  N3  ? ? ? 1_555 J DG  138 N1 ? ? I DC  -2   J DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DC  71  N4  ? ? ? 1_555 J DG  138 O6 ? ? I DC  -2   J DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  71  O2  ? ? ? 1_555 J DG  138 N2 ? ? I DC  -2   J DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DG  72  N1  ? ? ? 1_555 J DC  137 N3 ? ? I DG  -1   J DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DG  72  N2  ? ? ? 1_555 J DC  137 O2 ? ? I DG  -1   J DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DG  72  O6  ? ? ? 1_555 J DC  137 N4 ? ? I DG  -1   J DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DC  73  N3  ? ? ? 1_555 J DG  136 N1 ? ? I DC  0    J DG  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DC  73  N4  ? ? ? 1_555 J DG  136 O6 ? ? I DC  0    J DG  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DC  73  O2  ? ? ? 1_555 J DG  136 N2 ? ? I DC  0    J DG  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA  135 N1 ? ? I DT  1    J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA  135 N6 ? ? I DT  1    J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DG  75  N1  ? ? ? 1_555 J DC  134 N3 ? ? I DG  2    J DC  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DG  75  N2  ? ? ? 1_555 J DC  134 O2 ? ? I DG  2    J DC  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DG  75  O6  ? ? ? 1_555 J DC  134 N4 ? ? I DG  2    J DC  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DT  76  N3  ? ? ? 1_555 J DA  133 N1 ? ? I DT  3    J DA  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DT  76  O4  ? ? ? 1_555 J DA  133 N6 ? ? I DT  3    J DA  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DC  77  N3  ? ? ? 1_555 J DG  132 N1 ? ? I DC  4    J DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DC  77  N4  ? ? ? 1_555 J DG  132 O6 ? ? I DC  4    J DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DC  77  O2  ? ? ? 1_555 J DG  132 N2 ? ? I DC  4    J DG  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG  131 N1 ? ? I DC  5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG  131 O6 ? ? I DC  5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG  131 N2 ? ? I DC  5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DC  79  N3  ? ? ? 1_555 J DG  130 N1 ? ? I DC  6    J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DC  79  N4  ? ? ? 1_555 J DG  130 O6 ? ? I DC  6    J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DC  79  O2  ? ? ? 1_555 J DG  130 N2 ? ? I DC  6    J DG  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DC  80  N3  ? ? ? 1_555 J DG  129 N1 ? ? I DC  7    J DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DC  80  N4  ? ? ? 1_555 J DG  129 O6 ? ? I DC  7    J DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DC  80  O2  ? ? ? 1_555 J DG  129 N2 ? ? I DC  7    J DG  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DC  81  N3  ? ? ? 1_555 J DG  128 N1 ? ? I DC  8    J DG  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DC  81  N4  ? ? ? 1_555 J DG  128 O6 ? ? I DC  8    J DG  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DC  81  O2  ? ? ? 1_555 J DG  128 N2 ? ? I DC  8    J DG  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DG  82  N1  ? ? ? 1_555 J DC  127 N3 ? ? I DG  9    J DC  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DG  82  N2  ? ? ? 1_555 J DC  127 O2 ? ? I DG  9    J DC  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  82  O6  ? ? ? 1_555 J DC  127 N4 ? ? I DG  9    J DC  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  126 N1 ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  126 O6 ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  126 N2 ? ? I DC  10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DG  84  N1  ? ? ? 1_555 J DC  125 N3 ? ? I DG  11   J DC  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DG  84  N2  ? ? ? 1_555 J DC  125 O2 ? ? I DG  11   J DC  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  84  O6  ? ? ? 1_555 J DC  125 N4 ? ? I DG  11   J DC  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA  124 N1 ? ? I DT  12   J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA  124 N6 ? ? I DT  12   J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DT  86  N3  ? ? ? 1_555 J DA  123 N1 ? ? I DT  13   J DA  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DT  86  O4  ? ? ? 1_555 J DA  123 N6 ? ? I DT  13   J DA  -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J DA  122 N1 ? ? I DT  14   J DA  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DT  87  O4  ? ? ? 1_555 J DA  122 N6 ? ? I DT  14   J DA  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DT  88  N3  ? ? ? 1_555 J DA  121 N1 ? ? I DT  15   J DA  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DT  88  O4  ? ? ? 1_555 J DA  121 N6 ? ? I DT  15   J DA  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DA  89  N1  ? ? ? 1_555 J DT  120 N3 ? ? I DA  16   J DT  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DA  89  N6  ? ? ? 1_555 J DT  120 O4 ? ? I DA  16   J DT  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  90  N6  ? ? ? 1_555 J DT  119 O4 ? ? I DA  17   J DT  -17  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog228 hydrog ? ? I DC  91  N3  ? ? ? 1_555 J DG  118 N1 ? ? I DC  18   J DG  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DC  91  N4  ? ? ? 1_555 J DG  118 O6 ? ? I DC  18   J DG  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DC  91  O2  ? ? ? 1_555 J DG  118 N2 ? ? I DC  18   J DG  -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DC  92  N4  ? ? ? 1_555 J DG  117 O6 ? ? I DC  19   J DG  -19  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog232 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J DC  116 N3 ? ? I DG  20   J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DG  93  N2  ? ? ? 1_555 J DC  116 O2 ? ? I DG  20   J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J DC  116 N4 ? ? I DG  20   J DC  -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J DG  117 O6 ? ? I DG  20   J DG  -19  1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog236 hydrog ? ? I DC  94  N3  ? ? ? 1_555 J DG  115 N1 ? ? I DC  21   J DG  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DC  94  N4  ? ? ? 1_555 J DG  115 O6 ? ? I DC  21   J DG  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DC  94  O2  ? ? ? 1_555 J DG  115 N2 ? ? I DC  21   J DG  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DC  95  N3  ? ? ? 1_555 J DG  114 N1 ? ? I DC  22   J DG  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DC  95  N4  ? ? ? 1_555 J DG  114 O6 ? ? I DC  22   J DG  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DC  95  O2  ? ? ? 1_555 J DG  114 N2 ? ? I DC  22   J DG  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DA  96  N1  ? ? ? 1_555 J DT  113 N3 ? ? I DA  23   J DT  -23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DA  96  N6  ? ? ? 1_555 J DT  113 O4 ? ? I DA  23   J DT  -23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DA  97  N1  ? ? ? 1_555 J DT  112 N3 ? ? I DA  24   J DT  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DA  97  N6  ? ? ? 1_555 J DT  112 O4 ? ? I DA  24   J DT  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DG  98  N1  ? ? ? 1_555 J DC  111 N3 ? ? I DG  25   J DC  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DG  98  N2  ? ? ? 1_555 J DC  111 O2 ? ? I DG  25   J DC  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DG  98  O6  ? ? ? 1_555 J DC  111 N4 ? ? I DG  25   J DC  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC  110 N3 ? ? I DG  26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J DC  110 O2 ? ? I DG  26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J DC  110 N4 ? ? I DG  26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DG  100 N1  ? ? ? 1_555 J DC  109 N3 ? ? I DG  27   J DC  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DG  100 N2  ? ? ? 1_555 J DC  109 O2 ? ? I DG  27   J DC  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DG  100 O6  ? ? ? 1_555 J DC  109 N4 ? ? I DG  27   J DC  -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DG  101 N1  ? ? ? 1_555 J DC  108 N3 ? ? I DG  28   J DC  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DG  101 N2  ? ? ? 1_555 J DC  108 O2 ? ? I DG  28   J DC  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DG  101 O6  ? ? ? 1_555 J DC  108 N4 ? ? I DG  28   J DC  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DA  102 N1  ? ? ? 1_555 J DT  107 N3 ? ? I DA  29   J DT  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DA  102 N6  ? ? ? 1_555 J DT  107 O4 ? ? I DA  29   J DT  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA  106 N1 ? ? I DT  30   J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DT  103 O4  ? ? ? 1_555 J DA  106 N6 ? ? I DT  30   J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA  105 N1 ? ? I DT  31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DA  105 N6 ? ? I DT  31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DA  105 N1  ? ? ? 1_555 J DT  104 N3 ? ? I DA  32   J DT  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DA  105 N6  ? ? ? 1_555 J DT  104 O4 ? ? I DA  32   J DT  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DC  106 N3  ? ? ? 1_555 J DG  103 N1 ? ? I DC  33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DC  106 N4  ? ? ? 1_555 J DG  103 O6 ? ? I DC  33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J DG  103 N2 ? ? I DC  33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DT  107 N3  ? ? ? 1_555 J DA  102 N1 ? ? I DT  34   J DA  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DT  107 O4  ? ? ? 1_555 J DA  102 N6 ? ? I DT  34   J DA  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DC  108 N3  ? ? ? 1_555 J DG  101 N1 ? ? I DC  35   J DG  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DC  108 N4  ? ? ? 1_555 J DG  101 O6 ? ? I DC  35   J DG  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DC  108 O2  ? ? ? 1_555 J DG  101 N2 ? ? I DC  35   J DG  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DC  109 N3  ? ? ? 1_555 J DG  100 N1 ? ? I DC  36   J DG  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J DG  100 O6 ? ? I DC  36   J DG  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DC  109 O2  ? ? ? 1_555 J DG  100 N2 ? ? I DC  36   J DG  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DC  110 N3  ? ? ? 1_555 J DG  99  N1 ? ? I DC  37   J DG  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DC  110 N4  ? ? ? 1_555 J DG  99  O6 ? ? I DC  37   J DG  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DC  110 O2  ? ? ? 1_555 J DG  99  N2 ? ? I DC  37   J DG  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA  98  N1 ? ? I DT  38   J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DT  111 O4  ? ? ? 1_555 J DA  98  N6 ? ? I DT  38   J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT  97  N3 ? ? I DA  39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT  97  O4 ? ? I DA  39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DG  113 N1  ? ? ? 1_555 J DC  96  N3 ? ? I DG  40   J DC  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DG  113 N2  ? ? ? 1_555 J DC  96  O2 ? ? I DG  40   J DC  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DG  113 O6  ? ? ? 1_555 J DC  96  N4 ? ? I DG  40   J DC  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DT  114 N3  ? ? ? 1_555 J DA  95  N1 ? ? I DT  41   J DA  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DT  114 O4  ? ? ? 1_555 J DA  95  N6 ? ? I DT  41   J DA  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG  94  N1 ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG  94  O6 ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG  94  N2 ? ? I DC  42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DA  93  N1 ? ? I DT  43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J DA  93  N6 ? ? I DT  43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J DG  94  O6 ? ? I DT  43   J DG  -42  1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     ? 
hydrog295 hydrog ? ? I DT  116 O2  ? ? ? 1_555 J DG  94  N1 ? ? I DT  43   J DG  -42  1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     ? 
hydrog296 hydrog ? ? I DC  117 N3  ? ? ? 1_555 J DG  92  N1 ? ? I DC  44   J DG  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DC  117 N4  ? ? ? 1_555 J DG  92  O6 ? ? I DC  44   J DG  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DC  117 O2  ? ? ? 1_555 J DG  92  N2 ? ? I DC  44   J DG  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DC  118 N3  ? ? ? 1_555 J DG  91  N1 ? ? I DC  45   J DG  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DC  118 N4  ? ? ? 1_555 J DG  91  O6 ? ? I DC  45   J DG  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DC  118 O2  ? ? ? 1_555 J DG  91  N2 ? ? I DC  45   J DG  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DA  119 N1  ? ? ? 1_555 J DT  90  N3 ? ? I DA  46   J DT  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DA  119 N6  ? ? ? 1_555 J DT  90  O4 ? ? I DA  46   J DT  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DG  120 N1  ? ? ? 1_555 J DC  89  N3 ? ? I DG  47   J DC  -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC  89  O2 ? ? I DG  47   J DC  -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DG  120 O6  ? ? ? 1_555 J DC  89  N4 ? ? I DG  47   J DC  -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DG  121 N1  ? ? ? 1_555 J DC  88  N3 ? ? I DG  48   J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC  88  O2 ? ? I DG  48   J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DC  88  N4 ? ? I DG  48   J DC  -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DC  122 N3  ? ? ? 1_555 J DG  87  N1 ? ? I DC  49   J DG  -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DC  122 N4  ? ? ? 1_555 J DG  87  O6 ? ? I DC  49   J DG  -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DC  122 O2  ? ? ? 1_555 J DG  87  N2 ? ? I DC  49   J DG  -49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT  86  N3 ? ? I DA  50   J DT  -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I DA  123 N6  ? ? ? 1_555 J DT  86  O4 ? ? I DA  50   J DT  -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I DC  124 N3  ? ? ? 1_555 J DG  85  N1 ? ? I DC  51   J DG  -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I DC  124 N4  ? ? ? 1_555 J DG  85  O6 ? ? I DC  51   J DG  -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ? ? I DC  124 O2  ? ? ? 1_555 J DG  85  N2 ? ? I DC  51   J DG  -51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? I DG  125 N1  ? ? ? 1_555 J DC  84  N3 ? ? I DG  52   J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? I DG  125 N2  ? ? ? 1_555 J DC  84  O2 ? ? I DG  52   J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? I DG  125 O6  ? ? ? 1_555 J DC  84  N4 ? ? I DG  52   J DC  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? I DT  126 N3  ? ? ? 1_555 J DA  83  N1 ? ? I DT  53   J DA  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? I DT  126 O4  ? ? ? 1_555 J DA  83  N6 ? ? I DT  53   J DA  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? I DG  127 N1  ? ? ? 1_555 J DC  82  N3 ? ? I DG  54   J DC  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ? ? I DG  127 N2  ? ? ? 1_555 J DC  82  O2 ? ? I DG  54   J DC  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog325 hydrog ? ? I DG  127 O6  ? ? ? 1_555 J DC  82  N4 ? ? I DG  54   J DC  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog326 hydrog ? ? I DT  128 N3  ? ? ? 1_555 J DA  81  N1 ? ? I DT  55   J DA  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog327 hydrog ? ? I DT  128 O4  ? ? ? 1_555 J DA  81  N6 ? ? I DT  55   J DA  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog328 hydrog ? ? I DC  129 N3  ? ? ? 1_555 J DG  80  N1 ? ? I DC  56   J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog329 hydrog ? ? I DC  129 N4  ? ? ? 1_555 J DG  80  O6 ? ? I DC  56   J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog330 hydrog ? ? I DC  129 O2  ? ? ? 1_555 J DG  80  N2 ? ? I DC  56   J DG  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog331 hydrog ? ? I DA  130 N1  ? ? ? 1_555 J DT  79  N3 ? ? I DA  57   J DT  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog332 hydrog ? ? I DA  130 N6  ? ? ? 1_555 J DT  79  O4 ? ? I DA  57   J DT  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog333 hydrog ? ? I DG  131 N1  ? ? ? 1_555 J DC  78  N3 ? ? I DG  58   J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog334 hydrog ? ? I DG  131 N2  ? ? ? 1_555 J DC  78  O2 ? ? I DG  58   J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog335 hydrog ? ? I DG  131 O6  ? ? ? 1_555 J DC  78  N4 ? ? I DG  58   J DC  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog336 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT  77  N3 ? ? I DA  59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog337 hydrog ? ? I DA  132 N6  ? ? ? 1_555 J DT  77  O4 ? ? I DA  59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog338 hydrog ? ? I DT  133 N3  ? ? ? 1_555 J DA  76  N1 ? ? I DT  60   J DA  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog339 hydrog ? ? I DT  133 O4  ? ? ? 1_555 J DA  76  N6 ? ? I DT  60   J DA  -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog340 hydrog ? ? I DA  134 N1  ? ? ? 1_555 J DT  75  N3 ? ? I DA  61   J DT  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog341 hydrog ? ? I DA  134 N6  ? ? ? 1_555 J DT  75  O4 ? ? I DA  61   J DT  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog342 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA  74  N1 ? ? I DT  62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog343 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J DA  74  N6 ? ? I DT  62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog344 hydrog ? ? I DA  136 N1  ? ? ? 1_555 J DT  73  N3 ? ? I DA  63   J DT  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog345 hydrog ? ? I DA  136 N6  ? ? ? 1_555 J DT  73  O4 ? ? I DA  63   J DT  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog346 hydrog ? ? I DT  137 N3  ? ? ? 1_555 J DA  72  N1 ? ? I DT  64   J DA  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog347 hydrog ? ? I DT  137 O4  ? ? ? 1_555 J DA  72  N6 ? ? I DT  64   J DA  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog348 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT  71  N3 ? ? I DA  65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog349 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT  71  O4 ? ? I DA  65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog350 hydrog ? ? I DC  139 N3  ? ? ? 1_555 J DG  70  N1 ? ? I DC  66   J DG  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog351 hydrog ? ? I DC  139 N4  ? ? ? 1_555 J DG  70  O6 ? ? I DC  66   J DG  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog352 hydrog ? ? I DC  139 O2  ? ? ? 1_555 J DG  70  N2 ? ? I DC  66   J DG  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog353 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT  69  N3 ? ? I DA  67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog354 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT  69  O4 ? ? I DA  67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog355 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA  68  N1 ? ? I DT  68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog356 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA  68  N6 ? ? I DT  68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog357 hydrog ? ? I DC  142 N3  ? ? ? 1_555 J DG  67  N1 ? ? I DC  69   J DG  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog358 hydrog ? ? I DC  142 N4  ? ? ? 1_555 J DG  67  O6 ? ? I DC  69   J DG  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog359 hydrog ? ? I DC  142 O2  ? ? ? 1_555 J DG  67  N2 ? ? I DC  69   J DG  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog360 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC  66  N3 ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog361 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC  66  O2 ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog362 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC  66  N4 ? ? I DG  70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog363 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  65  N3 ? ? I DA  71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog364 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  65  O4 ? ? I DA  71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog365 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA  64  N1 ? ? I DT  72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog366 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA  64  N6 ? ? I DT  72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog367 hydrog ? ? I DT  146 N3  ? ? ? 1_555 J DA  63  N1 ? ? I DT  73   J DA  -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog368 hydrog ? ? I DT  146 O4  ? ? ? 1_555 J DA  63  N6 ? ? I DT  73   J DA  -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog369 hydrog ? ? I DA  147 N1  ? ? ? 1_555 J DT  62  N3 ? ? I DA  74   J DT  -74  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog370 hydrog ? ? I DA  147 N6  ? ? ? 1_555 J DT  62  O4 ? ? I DA  74   J DT  -74  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog371 hydrog ? ? I DA  148 N1  ? ? ? 1_555 J DT  61  N3 ? ? I DA  75   J DT  -75  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog372 hydrog ? ? I DA  148 N6  ? ? ? 1_555 J DT  61  O4 ? ? I DA  75   J DT  -75  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog373 hydrog ? ? I DC  149 N3  ? ? ? 1_555 J DG  60  N1 ? ? I DC  76   J DG  -76  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog374 hydrog ? ? I DC  149 N4  ? ? ? 1_555 J DG  60  O6 ? ? I DC  76   J DG  -76  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog375 hydrog ? ? I DC  149 O2  ? ? ? 1_555 J DG  60  N2 ? ? I DC  76   J DG  -76  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog376 hydrog ? ? I DG  150 N1  ? ? ? 1_555 J DC  59  N3 ? ? I DG  77   J DC  -77  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog377 hydrog ? ? I DG  150 N2  ? ? ? 1_555 J DC  59  O2 ? ? I DG  77   J DC  -77  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog378 hydrog ? ? I DG  150 O6  ? ? ? 1_555 J DC  59  N4 ? ? I DG  77   J DC  -77  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog379 hydrog ? ? I DA  151 N1  ? ? ? 1_555 J DT  58  N3 ? ? I DA  78   J DT  -78  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog380 hydrog ? ? I DA  151 N6  ? ? ? 1_555 J DT  58  O4 ? ? I DA  78   J DT  -78  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog381 hydrog ? ? I DT  152 N3  ? ? ? 1_555 J DA  57  N1 ? ? I DT  79   J DA  -79  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog382 hydrog ? ? I DT  152 O4  ? ? ? 1_555 J DA  57  N6 ? ? I DT  79   J DA  -79  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog383 hydrog ? ? I DG  153 N1  ? ? ? 1_555 J DC  56  N3 ? ? I DG  80   J DC  -80  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog384 hydrog ? ? I DG  153 N2  ? ? ? 1_555 J DC  56  O2 ? ? I DG  80   J DC  -80  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog385 hydrog ? ? I DG  153 O6  ? ? ? 1_555 J DC  56  N4 ? ? I DG  80   J DC  -80  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog386 hydrog ? ? I DC  154 N3  ? ? ? 1_555 J DG  55  N1 ? ? I DC  81   J DG  -81  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog387 hydrog ? ? I DC  154 N4  ? ? ? 1_555 J DG  55  O6 ? ? I DC  81   J DG  -81  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog388 hydrog ? ? I DC  154 O2  ? ? ? 1_555 J DG  55  N2 ? ? I DC  81   J DG  -81  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog389 hydrog ? ? I DT  155 N3  ? ? ? 1_555 J DA  54  N1 ? ? I DT  82   J DA  -82  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog390 hydrog ? ? I DT  155 O4  ? ? ? 1_555 J DA  54  N6 ? ? I DT  82   J DA  -82  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog391 hydrog ? ? I DG  156 N1  ? ? ? 1_555 J DC  53  N3 ? ? I DG  83   J DC  -83  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog392 hydrog ? ? I DG  156 N2  ? ? ? 1_555 J DC  53  O2 ? ? I DG  83   J DC  -83  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog393 hydrog ? ? I DG  156 O6  ? ? ? 1_555 J DC  53  N4 ? ? I DG  83   J DC  -83  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog394 hydrog ? ? I DG  157 N1  ? ? ? 1_555 J DC  52  N3 ? ? I DG  84   J DC  -84  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog395 hydrog ? ? I DG  157 N2  ? ? ? 1_555 J DC  52  O2 ? ? I DG  84   J DC  -84  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog396 hydrog ? ? I DG  157 O6  ? ? ? 1_555 J DC  52  N4 ? ? I DG  84   J DC  -84  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog397 hydrog ? ? I DG  158 N1  ? ? ? 1_555 J DC  51  N3 ? ? I DG  85   J DC  -85  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog398 hydrog ? ? I DG  158 N2  ? ? ? 1_555 J DC  51  O2 ? ? I DG  85   J DC  -85  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog399 hydrog ? ? I DG  158 O6  ? ? ? 1_555 J DC  51  N4 ? ? I DG  85   J DC  -85  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog400 hydrog ? ? I DC  159 N3  ? ? ? 1_555 J DG  50  N1 ? ? I DC  86   J DG  -86  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog401 hydrog ? ? I DC  159 N4  ? ? ? 1_555 J DG  50  O6 ? ? I DC  86   J DG  -86  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog402 hydrog ? ? I DC  159 O2  ? ? ? 1_555 J DG  50  N2 ? ? I DC  86   J DG  -86  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog403 hydrog ? ? I DA  160 N1  ? ? ? 1_555 J DT  49  N3 ? ? I DA  87   J DT  -87  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog404 hydrog ? ? I DA  160 N6  ? ? ? 1_555 J DT  49  O4 ? ? I DA  87   J DT  -87  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog405 hydrog ? ? I DT  161 N3  ? ? ? 1_555 J DA  48  N1 ? ? I DT  88   J DA  -88  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog406 hydrog ? ? I DT  161 O4  ? ? ? 1_555 J DA  48  N6 ? ? I DT  88   J DA  -88  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog407 hydrog ? ? I DA  162 N1  ? ? ? 1_555 J DT  47  N3 ? ? I DA  89   J DT  -89  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog408 hydrog ? ? I DA  162 N6  ? ? ? 1_555 J DT  47  O4 ? ? I DA  89   J DT  -89  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 3 ? 
AA6 ? 3 ? 
AA7 ? 6 ? 
AA8 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA7 5 6 ? parallel      
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR B 97  ? LEU B 98  ? THR B 96  LEU B 97  
AA1 2 VAL G 101 ? THR G 102 ? VAL G 100 THR G 101 
AA2 1 ARG C 78  ? ILE C 79  ? ARG C 77  ILE C 78  
AA2 2 GLY D 51  ? ILE D 52  ? GLY D 50  ILE D 51  
AA3 1 VAL C 101 ? THR C 102 ? VAL C 100 THR C 101 
AA3 2 THR F 97  ? LEU F 98  ? THR F 96  LEU F 97  
AA4 1 ARG G 78  ? ILE G 79  ? ARG G 77  ILE G 78  
AA4 2 GLY H 51  ? ILE H 52  ? GLY H 50  ILE H 51  
AA5 1 ILE K 179 ? LEU K 187 ? ILE W 179 LEU W 187 
AA5 2 TYR K 211 ? TRP K 217 ? TYR W 211 TRP W 217 
AA5 3 THR K 226 ? GLU K 228 ? THR W 226 GLU W 228 
AA6 1 PRO K 287 ? SER K 297 ? PRO W 287 SER W 297 
AA6 2 SER K 303 ? TRP K 311 ? SER W 303 TRP W 311 
AA6 3 TRP K 321 ? ASN K 323 ? TRP W 321 ASN W 323 
AA7 1 VAL K 487 ? THR K 490 ? VAL W 487 THR W 490 
AA7 2 HIS K 428 ? VAL K 431 ? HIS W 428 VAL W 431 
AA7 3 PHE K 509 ? ASP K 513 ? PHE W 509 ASP W 513 
AA7 4 ASN K 536 ? ILE K 540 ? ASN W 536 ILE W 540 
AA7 5 GLY K 397 ? LEU K 399 ? GLY W 397 LEU W 399 
AA7 6 ILE K 594 ? LEU K 595 ? ILE W 594 LEU W 595 
AA8 1 ARG K 612 ? VAL K 616 ? ARG W 612 VAL W 616 
AA8 2 MET K 815 ? SER K 821 ? MET W 815 SER W 821 
AA8 3 THR K 785 ? ILE K 788 ? THR W 785 ILE W 788 
AA8 4 VAL K 714 ? PHE K 717 ? VAL W 714 PHE W 717 
AA8 5 VAL K 766 ? LEU K 768 ? VAL W 766 LEU W 768 
AA8 6 PHE K 738 ? GLN K 739 ? PHE W 738 GLN W 739 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR B 97  ? N THR B 96  O THR G 102 ? O THR G 101 
AA2 1 2 N ILE C 79  ? N ILE C 78  O GLY D 51  ? O GLY D 50  
AA3 1 2 N THR C 102 ? N THR C 101 O THR F 97  ? O THR F 96  
AA4 1 2 N ILE G 79  ? N ILE G 78  O GLY H 51  ? O GLY H 50  
AA5 1 2 N ASN K 184 ? N ASN W 184 O LEU K 214 ? O LEU W 214 
AA5 2 3 N ILE K 215 ? N ILE W 215 O THR K 226 ? O THR W 226 
AA6 1 2 N ARG K 289 ? N ARG W 289 O LYS K 310 ? O LYS W 310 
AA6 2 3 N TYR K 307 ? N TYR W 307 O GLU K 322 ? O GLU W 322 
AA7 1 2 O LEU K 488 ? O LEU W 488 N ILE K 430 ? N ILE W 430 
AA7 2 3 N VAL K 431 ? N VAL W 431 O ALA K 511 ? O ALA W 511 
AA7 3 4 N VAL K 512 ? N VAL W 512 O ILE K 540 ? O ILE W 540 
AA7 4 5 O LEU K 539 ? O LEU W 539 N LEU K 399 ? N LEU W 399 
AA7 5 6 N ILE K 398 ? N ILE W 398 O LEU K 595 ? O LEU W 595 
AA8 1 2 N VAL K 616 ? N VAL W 616 O VAL K 820 ? O VAL W 820 
AA8 2 3 O LEU K 819 ? O LEU W 819 N ILE K 788 ? N ILE W 788 
AA8 3 4 O VAL K 787 ? O VAL W 787 N LEU K 715 ? N LEU W 715 
AA8 4 5 N VAL K 714 ? N VAL W 714 O PHE K 767 ? O PHE W 767 
AA8 5 6 O LEU K 768 ? O LEU W 768 N GLN K 739 ? N GLN W 739 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software W ADP 1501 ? 12 'binding site for residue ADP W 1501' 
AC2 Software W BEF 1502 ? 6  'binding site for residue BEF W 1502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLU K 375 ? GLU W 375  . ? 1_555 ? 
2  AC1 12 LEU K 376 ? LEU W 376  . ? 1_555 ? 
3  AC1 12 ARG K 377 ? ARG W 377  . ? 1_555 ? 
4  AC1 12 GLY K 406 ? GLY W 406  . ? 1_555 ? 
5  AC1 12 LYS K 407 ? LYS W 407  . ? 1_555 ? 
6  AC1 12 THR K 408 ? THR W 408  . ? 1_555 ? 
7  AC1 12 VAL K 409 ? VAL W 409  . ? 1_555 ? 
8  AC1 12 TRP K 447 ? TRP W 447  . ? 1_555 ? 
9  AC1 12 ASN K 779 ? ASN W 779  . ? 1_555 ? 
10 AC1 12 MET K 781 ? MET W 781  . ? 1_555 ? 
11 AC1 12 ARG K 807 ? ARG W 807  . ? 1_555 ? 
12 AC1 12 BEF M .   ? BEF W 1502 . ? 1_555 ? 
13 AC2 6  MET K 403 ? MET W 403  . ? 1_555 ? 
14 AC2 6  LYS K 407 ? LYS W 407  . ? 1_555 ? 
15 AC2 6  GLU K 514 ? GLU W 514  . ? 1_555 ? 
16 AC2 6  ARG K 804 ? ARG W 804  . ? 1_555 ? 
17 AC2 6  ARG K 807 ? ARG W 807  . ? 1_555 ? 
18 AC2 6  ADP L .   ? ADP W 1501 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5O9G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BE 
C  
F  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1  39   ? 158.400 186.372 129.273 1.00 105.69 ?  38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1  39   ? 159.829 186.133 129.501 1.00 105.60 ?  38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1  39   ? 160.322 184.850 128.839 1.00 105.35 ?  38   PRO A C     1 
ATOM   4     O  O     . PRO A 1  39   ? 159.792 184.449 127.803 1.00 105.24 ?  38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1  39   ? 159.925 186.032 131.025 1.00 105.65 ?  38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1  39   ? 158.789 186.854 131.521 1.00 105.56 ?  38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1  39   ? 157.680 186.651 130.527 1.00 105.63 ?  38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1  40   ? 161.327 184.217 129.438 1.00 104.91 ?  39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1  40   ? 161.886 182.985 128.909 1.00 104.47 ?  39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1  40   ? 161.115 181.781 129.449 1.00 103.78 ?  39   HIS A C     1 
ATOM   11    O  O     . HIS A 1  40   ? 160.149 181.913 130.205 1.00 103.89 ?  39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1  40   ? 163.373 182.887 129.247 1.00 104.71 ?  39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1  40   ? 163.664 182.922 130.716 1.00 105.53 ?  39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1  40   ? 163.441 181.845 131.545 1.00 106.26 ?  39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1  40   ? 164.159 183.906 131.503 1.00 105.83 ?  39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1  40   ? 163.787 182.163 132.780 1.00 106.64 ?  39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1  40   ? 164.226 183.408 132.781 1.00 106.42 ?  39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1  41   ? 161.549 180.587 129.055 1.00 102.61 ?  40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1  41   ? 160.942 179.335 129.491 1.00 101.35 ?  40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1  41   ? 161.922 178.627 130.418 1.00 100.42 ?  40   ARG A C     1 
ATOM   21    O  O     . ARG A 1  41   ? 162.940 178.093 129.964 1.00 100.25 ?  40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1  41   ? 160.579 178.456 128.296 1.00 101.28 ?  40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1  41   ? 159.923 177.137 128.674 1.00 101.37 ?  40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1  41   ? 158.643 177.364 129.463 1.00 101.37 ?  40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1  41   ? 158.003 176.108 129.842 1.00 101.59 ?  40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1  41   ? 157.090 175.483 129.105 1.00 101.46 ?  40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1  41   ? 156.706 175.998 127.944 1.00 101.48 ?  40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1  41   ? 156.560 174.344 129.527 1.00 101.57 ?  40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1  42   ? 161.615 178.624 131.712 1.00 99.16  ?  41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1  42   ? 162.484 177.990 132.689 1.00 98.03  ?  41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1  42   ? 162.385 176.468 132.577 1.00 97.11  ?  41   TYR A C     1 
ATOM   32    O  O     . TYR A 1  42   ? 161.478 175.917 131.945 1.00 97.43  ?  41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1  42   ? 162.125 178.454 134.101 1.00 98.14  ?  41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1  42   ? 163.242 178.292 135.109 1.00 98.35  ?  41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1  42   ? 164.304 179.186 135.146 1.00 98.42  ?  41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1  42   ? 163.229 177.252 136.029 1.00 98.60  ?  41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1  42   ? 165.326 179.045 136.066 1.00 98.76  ?  41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1  42   ? 164.246 177.103 136.952 1.00 98.59  ?  41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1  42   ? 165.292 178.002 136.967 1.00 98.58  ?  41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1  42   ? 166.306 177.857 137.885 1.00 98.52  ?  41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1  43   ? 163.340 175.788 133.199 1.00 95.85  ?  42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1  43   ? 163.369 174.331 133.154 1.00 94.59  ?  42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1  43   ? 162.171 173.759 133.905 1.00 93.40  ?  42   ARG A C     1 
ATOM   44    O  O     . ARG A 1  43   ? 161.956 174.103 135.074 1.00 93.27  ?  42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1  43   ? 164.671 173.805 133.757 1.00 94.87  ?  42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1  43   ? 165.938 174.262 133.041 1.00 95.67  ?  42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1  43   ? 166.212 173.452 131.778 1.00 97.28  ?  42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1  43   ? 165.342 173.827 130.667 1.00 99.36  ?  42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1  43   ? 165.379 173.261 129.465 1.00 100.09 ?  42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1  43   ? 166.246 172.290 129.214 1.00 100.17 ?  42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1  43   ? 164.549 173.666 128.514 1.00 100.62 ?  42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1  44   ? 161.373 172.895 133.279 1.00 92.17  ?  43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  44   ? 160.221 172.313 133.981 1.00 90.70  ?  43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  44   ? 160.674 171.340 135.060 1.00 89.10  ?  43   PRO A C     1 
ATOM   55    O  O     . PRO A 1  44   ? 161.481 170.442 134.809 1.00 88.63  ?  43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  44   ? 159.445 171.604 132.865 1.00 90.74  ?  43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  44   ? 160.479 171.298 131.832 1.00 91.46  ?  43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  44   ? 161.467 172.431 131.884 1.00 92.14  ?  43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1  45   ? 160.148 171.530 136.272 1.00 87.49  ?  44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1  45   ? 160.471 170.710 137.420 1.00 85.06  ?  44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1  45   ? 161.349 171.407 138.442 1.00 83.38  ?  44   GLY A C     1 
ATOM   62    O  O     . GLY A 1  45   ? 161.223 171.133 139.642 1.00 83.21  ?  44   GLY A O     1 
ATOM   63    N  N     . THR A 1  46   ? 162.236 172.297 137.992 1.00 81.61  ?  45   THR A N     1 
ATOM   64    C  CA    . THR A 1  46   ? 163.081 173.030 138.930 1.00 79.61  ?  45   THR A CA    1 
ATOM   65    C  C     . THR A 1  46   ? 162.258 174.012 139.755 1.00 78.49  ?  45   THR A C     1 
ATOM   66    O  O     . THR A 1  46   ? 162.526 174.211 140.947 1.00 78.58  ?  45   THR A O     1 
ATOM   67    C  CB    . THR A 1  46   ? 164.197 173.755 138.177 1.00 79.70  ?  45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  46   ? 164.904 172.821 137.352 1.00 79.40  ?  45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  46   ? 165.175 174.392 139.153 1.00 79.46  ?  45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  47   ? 161.244 174.628 139.139 1.00 77.08  ?  46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  47   ? 160.354 175.522 139.874 1.00 75.46  ?  46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  47   ? 159.628 174.765 140.975 1.00 74.62  ?  46   VAL A C     1 
ATOM   73    O  O     . VAL A 1  47   ? 159.360 175.318 142.050 1.00 74.06  ?  46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  47   ? 159.364 176.201 138.907 1.00 75.26  ?  46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  47   ? 158.519 177.232 139.642 1.00 74.66  ?  46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  47   ? 160.110 176.845 137.750 1.00 74.14  ?  46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1  48   ? 159.301 173.492 140.734 1.00 73.79  ?  47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1  48   ? 158.695 172.673 141.777 1.00 73.27  ?  47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1  48   ? 159.642 172.503 142.957 1.00 72.99  ?  47   ALA A C     1 
ATOM   80    O  O     . ALA A 1  48   ? 159.220 172.567 144.117 1.00 73.36  ?  47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1  48   ? 158.291 171.313 141.209 1.00 73.49  ?  47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1  49   ? 160.931 172.287 142.679 1.00 72.31  ?  48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1  49   ? 161.914 172.201 143.753 1.00 71.17  ?  48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1  49   ? 162.064 173.530 144.481 1.00 70.58  ?  48   LEU A C     1 
ATOM   85    O  O     . LEU A 1  49   ? 162.320 173.546 145.690 1.00 70.57  ?  48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1  49   ? 163.265 171.740 143.201 1.00 71.17  ?  48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1  49   ? 163.526 170.233 143.122 1.00 72.02  ?  48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1  49   ? 162.573 169.543 142.156 1.00 73.06  ?  48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1  49   ? 164.973 169.963 142.734 1.00 72.24  ?  48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1  50   ? 161.914 174.649 143.767 1.00 70.07  ?  49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1  50   ? 161.919 175.948 144.433 1.00 69.88  ?  49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1  50   ? 160.716 176.092 145.357 1.00 69.27  ?  49   ARG A C     1 
ATOM   93    O  O     . ARG A 1  50   ? 160.830 176.654 146.453 1.00 68.79  ?  49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1  50   ? 161.942 177.069 143.396 1.00 70.29  ?  49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1  50   ? 163.173 177.058 142.505 1.00 72.94  ?  49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1  50   ? 163.142 178.199 141.503 1.00 76.69  ?  49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1  50   ? 163.098 179.502 142.160 1.00 79.23  ?  49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1  50   ? 163.064 180.663 141.515 1.00 80.95  ?  49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1  50   ? 163.069 180.687 140.189 1.00 81.56  ?  49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1  50   ? 163.026 181.800 142.195 1.00 80.99  ?  49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1  51   ? 159.554 175.588 144.931 1.00 68.95  ?  50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  51   ? 158.389 175.582 145.806 1.00 68.59  ?  50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  51   ? 158.597 174.663 147.002 1.00 67.38  ?  50   GLU A C     1 
ATOM   104   O  O     . GLU A 1  51   ? 158.049 174.918 148.081 1.00 66.79  ?  50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  51   ? 157.144 175.163 145.025 1.00 68.65  ?  50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  51   ? 156.774 176.106 143.892 1.00 69.03  ?  50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  51   ? 155.520 175.672 143.162 1.00 70.88  ?  50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  51   ? 154.951 174.623 143.529 1.00 74.28  ?  50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  51   ? 155.101 176.380 142.222 1.00 72.14  ?  50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1  52   ? 159.378 173.594 146.833 1.00 66.73  ?  51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1  52   ? 159.728 172.747 147.969 1.00 66.14  ?  51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1  52   ? 160.617 173.509 148.942 1.00 66.89  ?  51   ILE A C     1 
ATOM   113   O  O     . ILE A 1  52   ? 160.411 173.460 150.161 1.00 67.60  ?  51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1  52   ? 160.399 171.449 147.484 1.00 65.79  ?  51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1  52   ? 159.418 170.615 146.658 1.00 66.03  ?  51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1  52   ? 160.923 170.643 148.665 1.00 63.44  ?  51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1  52   ? 160.003 169.321 146.137 1.00 66.33  ?  51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1  53   ? 161.614 174.232 148.423 1.00 67.03  ?  52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  53   ? 162.479 175.028 149.287 1.00 67.52  ?  52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  53   ? 161.708 176.140 149.984 1.00 67.89  ?  52   ARG A C     1 
ATOM   121   O  O     . ARG A 1  53   ? 162.076 176.551 151.091 1.00 68.48  ?  52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  53   ? 163.636 175.615 148.477 1.00 67.88  ?  52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  53   ? 164.630 174.584 147.969 1.00 68.25  ?  52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  53   ? 165.321 173.872 149.121 1.00 69.39  ?  52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  53   ? 166.373 172.974 148.655 1.00 71.26  ?  52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  53   ? 167.641 173.334 148.486 1.00 72.35  ?  52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  53   ? 168.019 174.579 148.745 1.00 69.99  ?  52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  53   ? 168.533 172.451 148.059 1.00 72.91  ?  52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1  54   ? 160.640 176.640 149.359 1.00 67.80  ?  53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1  54   ? 159.840 177.687 149.982 1.00 68.31  ?  53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1  54   ? 158.864 177.127 151.010 1.00 68.53  ?  53   ARG A C     1 
ATOM   132   O  O     . ARG A 1  54   ? 158.585 177.787 152.017 1.00 68.83  ?  53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1  54   ? 159.083 178.478 148.913 1.00 68.41  ?  53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1  54   ? 158.338 179.692 149.446 1.00 68.87  ?  53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1  54   ? 157.616 180.447 148.338 1.00 72.56  ?  53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1  54   ? 156.521 179.673 147.759 1.00 73.94  ?  53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1  54   ? 156.596 179.014 146.607 1.00 74.61  ?  53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1  54   ? 157.719 179.033 145.901 1.00 73.88  ?  53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1  54   ? 155.548 178.337 146.159 1.00 74.21  ?  53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1  55   ? 158.344 175.921 150.782 1.00 68.56  ?  54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1  55   ? 157.371 175.325 151.689 1.00 68.30  ?  54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1  55   ? 158.010 174.574 152.849 1.00 68.30  ?  54   TYR A C     1 
ATOM   143   O  O     . TYR A 1  55   ? 157.339 174.344 153.862 1.00 68.68  ?  54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1  55   ? 156.444 174.376 150.922 1.00 68.37  ?  54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1  55   ? 155.539 175.073 149.930 1.00 67.66  ?  54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1  55   ? 155.229 176.420 150.070 1.00 66.91  ?  54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1  55   ? 154.994 174.384 148.855 1.00 67.44  ?  54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1  55   ? 154.403 177.061 149.167 1.00 67.28  ?  54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1  55   ? 154.167 175.017 147.946 1.00 66.69  ?  54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1  55   ? 153.875 176.355 148.107 1.00 67.34  ?  54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1  55   ? 153.052 176.989 147.205 1.00 68.68  ?  54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1  56   ? 159.282 174.183 152.730 1.00 67.78  ?  55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1  56   ? 159.948 173.507 153.838 1.00 67.50  ?  55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1  56   ? 160.180 174.448 155.013 1.00 67.76  ?  55   GLN A C     1 
ATOM   155   O  O     . GLN A 1  56   ? 160.222 174.000 156.165 1.00 67.78  ?  55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1  56   ? 161.273 172.902 153.372 1.00 67.31  ?  55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1  56   ? 161.131 171.583 152.626 1.00 65.34  ?  55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1  56   ? 160.695 170.443 153.526 1.00 66.38  ?  55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1  56   ? 160.826 170.516 154.748 1.00 63.77  ?  55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1  56   ? 160.173 169.381 152.925 1.00 65.51  ?  55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1  57   ? 160.330 175.745 154.748 1.00 68.12  ?  56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1  57   ? 160.526 176.732 155.801 1.00 68.69  ?  56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1  57   ? 159.218 177.281 156.353 1.00 69.00  ?  56   LYS A C     1 
ATOM   164   O  O     . LYS A 1  57   ? 159.243 178.018 157.345 1.00 69.25  ?  56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1  57   ? 161.387 177.891 155.286 1.00 68.93  ?  56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1  57   ? 162.751 177.467 154.765 1.00 70.35  ?  56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1  57   ? 163.562 176.765 155.843 1.00 72.55  ?  56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1  57   ? 164.921 176.334 155.315 1.00 74.62  ?  56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1  57   ? 165.732 175.640 156.354 1.00 76.51  ?  56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1  58   ? 158.086 176.944 155.740 1.00 69.70  ?  57   SER A N     1 
ATOM   171   C  CA    . SER A 1  58   ? 156.795 177.426 156.206 1.00 70.05  ?  57   SER A CA    1 
ATOM   172   C  C     . SER A 1  58   ? 156.354 176.661 157.446 1.00 70.30  ?  57   SER A C     1 
ATOM   173   O  O     . SER A 1  58   ? 156.509 175.439 157.530 1.00 69.74  ?  57   SER A O     1 
ATOM   174   C  CB    . SER A 1  58   ? 155.744 177.283 155.105 1.00 69.95  ?  57   SER A CB    1 
ATOM   175   O  OG    . SER A 1  58   ? 155.596 175.928 154.717 1.00 71.90  ?  57   SER A OG    1 
ATOM   176   N  N     . THR A 1  59   ? 155.799 177.390 158.413 1.00 70.45  ?  58   THR A N     1 
ATOM   177   C  CA    . THR A 1  59   ? 155.312 176.808 159.656 1.00 70.71  ?  58   THR A CA    1 
ATOM   178   C  C     . THR A 1  59   ? 153.800 176.916 159.801 1.00 70.90  ?  58   THR A C     1 
ATOM   179   O  O     . THR A 1  59   ? 153.261 176.558 160.854 1.00 70.86  ?  58   THR A O     1 
ATOM   180   C  CB    . THR A 1  59   ? 155.995 177.471 160.855 1.00 70.88  ?  58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1  59   ? 155.698 178.873 160.862 1.00 71.41  ?  58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1  59   ? 157.501 177.278 160.783 1.00 70.33  ?  58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1  60   ? 153.105 177.399 158.779 1.00 70.77  ?  59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1  60   ? 151.663 177.557 158.831 1.00 70.22  ?  59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1  60   ? 150.991 176.411 158.076 1.00 69.71  ?  59   GLU A C     1 
ATOM   186   O  O     . GLU A 1  60   ? 151.611 175.388 157.767 1.00 69.85  ?  59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1  60   ? 151.260 178.927 158.277 1.00 69.76  ?  59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1  60   ? 151.581 179.145 156.804 1.00 71.67  ?  59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1  60   ? 153.035 179.503 156.561 1.00 73.69  ?  59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1  60   ? 153.783 179.672 157.547 1.00 76.06  ?  59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1  60   ? 153.429 179.616 155.382 1.00 72.50  ?  59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1  61   ? 149.707 176.577 157.779 1.00 68.76  ?  60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1  61   ? 148.918 175.570 157.087 1.00 67.36  ?  60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1  61   ? 148.841 175.875 155.596 1.00 67.46  ?  60   LEU A C     1 
ATOM   195   O  O     . LEU A 1  61   ? 149.134 176.984 155.145 1.00 67.26  ?  60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1  61   ? 147.508 175.493 157.679 1.00 66.63  ?  60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1  61   ? 147.416 174.945 159.104 1.00 64.38  ?  60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1  61   ? 145.984 174.999 159.611 1.00 59.76  ?  60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1  61   ? 147.953 173.524 159.153 1.00 63.25  ?  60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1  62   ? 148.438 174.863 154.831 1.00 67.40  ?  61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1  62   ? 148.259 174.981 153.388 1.00 67.71  ?  61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1  62   ? 146.807 174.874 152.953 1.00 67.97  ?  61   LEU A C     1 
ATOM   203   O  O     . LEU A 1  62   ? 146.385 175.594 152.045 1.00 68.28  ?  61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1  62   ? 149.079 173.907 152.663 1.00 67.83  ?  61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1  62   ? 150.589 173.926 152.907 1.00 66.73  ?  61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1  62   ? 151.277 172.812 152.132 1.00 65.40  ?  61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1  62   ? 151.173 175.280 152.538 1.00 66.12  ?  61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1  63   ? 146.032 173.987 153.578 1.00 67.71  ?  62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1  63   ? 144.621 173.852 153.243 1.00 67.06  ?  62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1  63   ? 143.851 175.028 153.826 1.00 67.46  ?  62   ILE A C     1 
ATOM   211   O  O     . ILE A 1  63   ? 144.050 175.407 154.988 1.00 66.81  ?  62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1  63   ? 144.072 172.513 153.758 1.00 66.50  ?  62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1  63   ? 144.898 171.350 153.205 1.00 66.47  ?  62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1  63   ? 142.607 172.352 153.377 1.00 66.60  ?  62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1  63   ? 144.416 169.989 153.659 1.00 64.57  ?  62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1  64   ? 142.967 175.611 153.021 1.00 68.15  ?  63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1  64   ? 142.194 176.762 153.458 1.00 68.93  ?  63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1  64   ? 141.204 176.367 154.552 1.00 68.79  ?  63   ARG A C     1 
ATOM   219   O  O     . ARG A 1  64   ? 140.788 175.211 154.670 1.00 68.36  ?  63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1  64   ? 141.464 177.392 152.272 1.00 69.38  ?  63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1  64   ? 142.403 177.950 151.213 1.00 72.66  ?  63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1  64   ? 141.644 178.489 150.014 1.00 80.03  ?  63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1  64   ? 140.940 177.435 149.291 1.00 86.81  ?  63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1  64   ? 141.457 176.755 148.273 1.00 90.33  ?  63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1  64   ? 142.687 177.019 147.854 1.00 90.71  ?  63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1  64   ? 140.745 175.812 147.673 1.00 91.69  ?  63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1  65   ? 140.828 177.357 155.362 1.00 69.01  ?  64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1  65   ? 140.014 177.126 156.550 1.00 69.29  ?  64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1  65   ? 138.522 177.066 156.246 1.00 67.95  ?  64   LYS A C     1 
ATOM   230   O  O     . LYS A 1  65   ? 137.816 176.212 156.793 1.00 68.11  ?  64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1  65   ? 140.283 178.220 157.586 1.00 69.69  ?  64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1  65   ? 141.741 178.343 157.998 1.00 71.56  ?  64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1  65   ? 141.976 179.525 158.934 1.00 71.41  ?  64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1  65   ? 141.469 179.256 160.346 1.00 73.35  ?  64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1  65   ? 139.997 179.443 160.499 1.00 74.62  ?  64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1  66   ? 138.024 177.961 155.386 1.00 66.84  ?  65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1  66   ? 136.584 178.005 155.132 1.00 65.10  ?  65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1  66   ? 136.081 176.757 154.414 1.00 63.25  ?  65   LEU A C     1 
ATOM   239   O  O     . LEU A 1  66   ? 135.028 176.227 154.814 1.00 63.15  ?  65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1  66   ? 136.229 179.288 154.375 1.00 64.96  ?  65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1  66   ? 134.742 179.632 154.268 1.00 66.02  ?  65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1  66   ? 134.063 179.493 155.621 1.00 65.25  ?  65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1  66   ? 134.561 181.041 153.727 1.00 67.23  ?  65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1  67   ? 136.742 176.239 153.370 1.00 61.44  ?  66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1  67   ? 136.287 174.957 152.805 1.00 60.62  ?  66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1  67   ? 136.375 173.808 153.791 1.00 59.75  ?  66   PRO A C     1 
ATOM   247   O  O     . PRO A 1  67   ? 135.527 172.907 153.760 1.00 59.85  ?  66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1  67   ? 137.225 174.743 151.608 1.00 60.82  ?  66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1  67   ? 137.723 176.093 151.266 1.00 61.00  ?  66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1  67   ? 137.830 176.825 152.565 1.00 61.55  ?  66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1  68   ? 137.381 173.815 154.669 1.00 59.16  ?  67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1  68   ? 137.504 172.757 155.665 1.00 58.34  ?  67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1  68   ? 136.356 172.806 156.666 1.00 58.72  ?  67   PHE A C     1 
ATOM   254   O  O     . PHE A 1  68   ? 135.837 171.762 157.076 1.00 58.57  ?  67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1  68   ? 138.850 172.870 156.380 1.00 57.20  ?  67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1  68   ? 139.142 171.730 157.312 1.00 53.52  ?  67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1  68   ? 139.678 170.547 156.832 1.00 47.29  ?  67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1  68   ? 138.887 171.844 158.669 1.00 51.14  ?  67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1  68   ? 139.950 169.496 157.686 1.00 47.13  ?  67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1  68   ? 139.157 170.796 159.528 1.00 51.84  ?  67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1  68   ? 139.690 169.621 159.036 1.00 49.74  ?  67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1  69   ? 135.947 174.010 157.072 1.00 58.59  ?  68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1  69   ? 134.814 174.133 157.983 1.00 59.10  ?  68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1  69   ? 133.507 173.769 157.289 1.00 60.24  ?  68   GLN A C     1 
ATOM   265   O  O     . GLN A 1  69   ? 132.649 173.101 157.879 1.00 60.63  ?  68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1  69   ? 134.746 175.552 158.549 1.00 58.88  ?  68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1  69   ? 133.550 175.813 159.455 1.00 58.70  ?  68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1  69   ? 133.613 175.033 160.755 1.00 62.51  ?  68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1  69   ? 134.668 174.534 161.145 1.00 62.90  ?  68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1  69   ? 132.477 174.926 161.435 1.00 63.85  ?  68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1  70   ? 133.342 174.194 156.034 1.00 60.18  ?  69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1  70   ? 132.115 173.893 155.306 1.00 60.17  ?  69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1  70   ? 131.986 172.404 155.006 1.00 60.22  ?  69   ARG A C     1 
ATOM   274   O  O     . ARG A 1  70   ? 130.867 171.883 154.938 1.00 60.54  ?  69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1  70   ? 132.063 174.706 154.011 1.00 60.16  ?  69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1  70   ? 130.750 174.594 153.253 1.00 59.64  ?  69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1  70   ? 129.574 174.999 154.126 1.00 57.01  ?  69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1  70   ? 129.712 176.361 154.634 1.00 55.80  ?  69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1  70   ? 129.240 177.440 154.018 1.00 58.60  ?  69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1  70   ? 128.596 177.320 152.865 1.00 60.37  ?  69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1  70   ? 129.411 178.641 154.554 1.00 59.04  ?  69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1  71   ? 133.107 171.706 154.831 1.00 60.08  ?  70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1  71   ? 133.081 170.275 154.548 1.00 60.62  ?  70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1  71   ? 132.957 169.443 155.821 1.00 60.90  ?  70   LEU A C     1 
ATOM   285   O  O     . LEU A 1  71   ? 132.081 168.576 155.916 1.00 61.25  ?  70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1  71   ? 134.339 169.871 153.773 1.00 60.40  ?  70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1  71   ? 134.506 168.378 153.483 1.00 61.23  ?  70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1  71   ? 133.359 167.859 152.628 1.00 63.74  ?  70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1  71   ? 135.845 168.108 152.814 1.00 60.60  ?  70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1  72   ? 133.825 169.695 156.803 1.00 61.46  ?  71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1  72   ? 133.791 168.930 158.047 1.00 61.77  ?  71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1  72   ? 132.482 169.171 158.788 1.00 61.91  ?  71   VAL A C     1 
ATOM   293   O  O     . VAL A 1  72   ? 131.905 168.248 159.377 1.00 61.57  ?  71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1  72   ? 135.014 169.276 158.918 1.00 62.01  ?  71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1  72   ? 134.882 168.663 160.304 1.00 61.55  ?  71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1  72   ? 136.291 168.796 158.246 1.00 61.74  ?  71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1  73   ? 131.984 170.410 158.763 1.00 62.52  ?  72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1  73   ? 130.714 170.697 159.420 1.00 64.03  ?  72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1  73   ? 129.546 170.042 158.693 1.00 63.73  ?  72   ARG A C     1 
ATOM   300   O  O     . ARG A 1  73   ? 128.538 169.699 159.323 1.00 63.37  ?  72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1  73   ? 130.503 172.208 159.523 1.00 63.82  ?  72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1  73   ? 129.305 172.610 160.368 1.00 64.89  ?  72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1  73   ? 129.282 174.107 160.623 1.00 65.13  ?  72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1  73   ? 128.169 174.493 161.485 1.00 67.72  ?  72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1  73   ? 127.984 175.720 161.962 1.00 68.97  ?  72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1  73   ? 128.843 176.685 161.664 1.00 69.62  ?  72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1  73   ? 126.943 175.980 162.739 1.00 70.35  ?  72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1  74   ? 129.662 169.852 157.377 1.00 63.25  ?  73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1  74   ? 128.604 169.179 156.630 1.00 63.79  ?  73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1  74   ? 128.612 167.680 156.904 1.00 64.84  ?  73   GLU A C     1 
ATOM   311   O  O     . GLU A 1  74   ? 127.554 167.068 157.095 1.00 65.64  ?  73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1  74   ? 128.758 169.463 155.135 1.00 63.65  ?  73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1  74   ? 127.699 168.817 154.252 1.00 60.19  ?  73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1  74   ? 128.145 167.487 153.675 1.00 60.10  ?  73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1  74   ? 129.278 167.056 153.976 1.00 57.11  ?  73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1  74   ? 127.365 166.875 152.915 1.00 59.44  ?  73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1  75   ? 129.800 167.070 156.926 1.00 65.59  ?  74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1  75   ? 129.893 165.642 157.215 1.00 66.26  ?  74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1  75   ? 129.445 165.355 158.642 1.00 67.44  ?  74   ILE A C     1 
ATOM   320   O  O     . ILE A 1  75   ? 128.679 164.416 158.891 1.00 67.78  ?  74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1  75   ? 131.324 165.136 156.957 1.00 65.80  ?  74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1  75   ? 131.723 165.376 155.500 1.00 64.06  ?  74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1  75   ? 131.438 163.659 157.304 1.00 65.14  ?  74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1  75   ? 133.119 164.902 155.165 1.00 63.38  ?  74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1  76   ? 129.910 166.159 159.602 1.00 68.32  ?  75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1  76   ? 129.493 165.976 160.987 1.00 69.36  ?  75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1  76   ? 128.014 166.282 161.176 1.00 69.95  ?  75   ALA A C     1 
ATOM   328   O  O     . ALA A 1  76   ? 127.359 165.666 162.024 1.00 70.71  ?  75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1  76   ? 130.339 166.851 161.911 1.00 69.46  ?  75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1  77   ? 127.472 167.227 160.403 1.00 70.22  ?  76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1  77   ? 126.043 167.513 160.486 1.00 70.27  ?  76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1  77   ? 125.219 166.350 159.948 1.00 70.00  ?  76   GLN A C     1 
ATOM   333   O  O     . GLN A 1  77   ? 124.166 166.018 160.505 1.00 69.68  ?  76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1  77   ? 125.718 168.800 159.728 1.00 69.96  ?  76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1  77   ? 124.253 169.205 159.795 1.00 69.83  ?  76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1  77   ? 123.966 170.489 159.041 1.00 71.48  ?  76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1  77   ? 124.866 171.096 158.462 1.00 70.91  ?  76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1  77   ? 122.705 170.908 159.044 1.00 71.88  ?  76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1  78   ? 125.682 165.719 158.866 1.00 70.19  ?  77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1  78   ? 124.986 164.547 158.346 1.00 70.83  ?  77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1  78   ? 125.141 163.347 159.271 1.00 71.23  ?  77   ASP A C     1 
ATOM   342   O  O     . ASP A 1  78   ? 124.257 162.484 159.318 1.00 71.49  ?  77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1  78   ? 125.496 164.208 156.946 1.00 70.66  ?  77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1  78   ? 125.221 165.311 155.943 1.00 72.54  ?  77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1  78   ? 124.226 166.045 156.121 1.00 76.17  ?  77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1  78   ? 126.000 165.444 154.977 1.00 71.89  ?  77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1  79   ? 126.251 163.273 160.010 1.00 72.38  ?  78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1  79   ? 126.441 162.178 160.954 1.00 73.35  ?  78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1  79   ? 125.603 162.374 162.212 1.00 73.73  ?  78   PHE A C     1 
ATOM   350   O  O     . PHE A 1  79   ? 124.994 161.420 162.709 1.00 73.68  ?  78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1  79   ? 127.922 162.044 161.312 1.00 73.86  ?  78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1  79   ? 128.211 160.957 162.308 1.00 74.74  ?  78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1  79   ? 128.291 159.634 161.906 1.00 74.80  ?  78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1  79   ? 128.407 161.259 163.646 1.00 75.66  ?  78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1  79   ? 128.558 158.632 162.821 1.00 74.76  ?  78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1  79   ? 128.674 160.261 164.565 1.00 75.93  ?  78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1  79   ? 128.749 158.946 164.151 1.00 74.45  ?  78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1  80   ? 125.561 163.596 162.738 1.00 73.76  ?  79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1  80   ? 124.787 163.894 163.935 1.00 74.55  ?  79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1  80   ? 124.288 165.328 163.854 1.00 75.74  ?  79   LYS A C     1 
ATOM   361   O  O     . LYS A 1  80   ? 125.081 166.252 163.652 1.00 76.21  ?  79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1  80   ? 125.625 163.690 165.202 1.00 74.11  ?  79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1  80   ? 124.877 163.971 166.495 1.00 74.44  ?  79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1  80   ? 123.680 163.047 166.654 1.00 76.15  ?  79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1  80   ? 122.939 163.323 167.952 1.00 78.20  ?  79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1  80   ? 121.759 162.431 168.120 1.00 79.73  ?  79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1  81   ? 122.980 165.507 164.012 1.00 76.73  ?  80   THR A N     1 
ATOM   368   C  CA    . THR A 1  81   ? 122.387 166.831 163.928 1.00 77.26  ?  80   THR A CA    1 
ATOM   369   C  C     . THR A 1  81   ? 122.638 167.618 165.212 1.00 77.85  ?  80   THR A C     1 
ATOM   370   O  O     . THR A 1  81   ? 122.916 167.056 166.275 1.00 77.39  ?  80   THR A O     1 
ATOM   371   C  CB    . THR A 1  81   ? 120.885 166.736 163.660 1.00 77.38  ?  80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1  81   ? 120.322 168.053 163.611 1.00 77.71  ?  80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1  81   ? 120.197 165.936 164.757 1.00 76.94  ?  80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1  82   ? 122.537 168.944 165.092 1.00 78.63  ?  81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1  82   ? 122.711 169.866 166.209 1.00 79.53  ?  81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1  82   ? 124.071 169.684 166.873 1.00 79.58  ?  81   ASP A C     1 
ATOM   377   O  O     . ASP A 1  82   ? 124.166 169.102 167.959 1.00 79.75  ?  81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1  82   ? 121.587 169.686 167.234 1.00 80.23  ?  81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1  82   ? 121.544 170.805 168.259 1.00 83.17  ?  81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1  82   ? 122.289 171.795 168.098 1.00 84.74  ?  81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1  82   ? 120.762 170.696 169.226 1.00 84.45  ?  81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1  83   ? 125.126 170.178 166.230 1.00 79.31  ?  82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1  83   ? 126.477 170.106 166.765 1.00 78.49  ?  82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1  83   ? 127.145 171.469 166.655 1.00 78.55  ?  82   LEU A C     1 
ATOM   385   O  O     . LEU A 1  83   ? 126.857 172.247 165.741 1.00 78.40  ?  82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1  83   ? 127.322 169.053 166.035 1.00 77.79  ?  82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1  83   ? 126.898 167.592 166.199 1.00 77.71  ?  82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1  83   ? 127.837 166.677 165.429 1.00 76.43  ?  82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1  83   ? 126.856 167.206 167.670 1.00 78.96  ?  82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1  84   ? 128.041 171.749 167.598 1.00 78.58  ?  83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1  84   ? 128.774 173.007 167.640 1.00 78.41  ?  83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1  84   ? 130.254 172.715 167.832 1.00 77.35  ?  83   ARG A C     1 
ATOM   393   O  O     . ARG A 1  84   ? 130.630 171.979 168.750 1.00 76.89  ?  83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1  84   ? 128.262 173.911 168.767 1.00 78.76  ?  83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1  84   ? 126.802 174.303 168.632 1.00 80.12  ?  83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1  84   ? 126.348 175.155 169.803 1.00 82.56  ?  83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1  84   ? 124.943 175.534 169.685 1.00 84.09  ?  83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1  84   ? 124.289 176.263 170.583 1.00 85.47  ?  83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1  84   ? 124.912 176.695 171.671 1.00 85.64  ?  83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1  84   ? 123.011 176.560 170.393 1.00 85.48  ?  83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1  85   ? 131.085 173.289 166.970 1.00 76.12  ?  84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1  85   ? 132.525 173.097 167.029 1.00 75.15  ?  84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1  85   ? 133.194 174.257 167.758 1.00 74.53  ?  84   PHE A C     1 
ATOM   404   O  O     . PHE A 1  85   ? 132.558 175.242 168.140 1.00 74.65  ?  84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1  85   ? 133.110 172.949 165.622 1.00 74.87  ?  84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1  85   ? 132.819 171.625 164.982 1.00 76.29  ?  84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1  85   ? 132.487 170.526 165.755 1.00 75.84  ?  84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1  85   ? 132.882 171.479 163.607 1.00 75.88  ?  84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1  85   ? 132.220 169.305 165.168 1.00 74.46  ?  84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1  85   ? 132.617 170.261 163.014 1.00 76.68  ?  84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1  85   ? 132.286 169.173 163.796 1.00 74.97  ?  84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1  86   ? 134.503 174.125 167.943 1.00 73.47  ?  85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1  86   ? 135.315 175.134 168.600 1.00 72.14  ?  85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1  86   ? 136.337 175.682 167.613 1.00 71.13  ?  85   GLN A C     1 
ATOM   415   O  O     . GLN A 1  86   ? 136.701 175.024 166.634 1.00 70.92  ?  85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1  86   ? 136.017 174.554 169.836 1.00 72.46  ?  85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1  86   ? 136.606 175.589 170.781 1.00 73.25  ?  85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1  86   ? 137.238 174.961 172.007 1.00 74.16  ?  85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1  86   ? 137.207 173.742 172.180 1.00 75.39  ?  85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1  86   ? 137.815 175.791 172.868 1.00 73.45  ?  85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1  87   ? 136.794 176.910 167.877 1.00 70.45  ?  86   SER A N     1 
ATOM   422   C  CA    . SER A 1  87   ? 137.791 177.533 167.012 1.00 70.19  ?  86   SER A CA    1 
ATOM   423   C  C     . SER A 1  87   ? 139.094 176.745 166.996 1.00 69.75  ?  86   SER A C     1 
ATOM   424   O  O     . SER A 1  87   ? 139.799 176.734 165.980 1.00 70.15  ?  86   SER A O     1 
ATOM   425   C  CB    . SER A 1  87   ? 138.048 178.972 167.458 1.00 70.12  ?  86   SER A CB    1 
ATOM   426   O  OG    . SER A 1  87   ? 138.517 179.014 168.794 1.00 70.84  ?  86   SER A OG    1 
ATOM   427   N  N     . SER A 1  88   ? 139.430 176.078 168.101 1.00 69.07  ?  87   SER A N     1 
ATOM   428   C  CA    . SER A 1  88   ? 140.657 175.295 168.164 1.00 68.86  ?  87   SER A CA    1 
ATOM   429   C  C     . SER A 1  88   ? 140.500 173.899 167.578 1.00 69.05  ?  87   SER A C     1 
ATOM   430   O  O     . SER A 1  88   ? 141.491 173.321 167.116 1.00 69.00  ?  87   SER A O     1 
ATOM   431   C  CB    . SER A 1  88   ? 141.139 175.192 169.612 1.00 68.73  ?  87   SER A CB    1 
ATOM   432   O  OG    . SER A 1  88   ? 140.126 174.654 170.443 1.00 67.67  ?  87   SER A OG    1 
ATOM   433   N  N     . ALA A 1  89   ? 139.286 173.340 167.590 1.00 69.27  ?  88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1  89   ? 139.084 172.018 167.007 1.00 69.31  ?  88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1  89   ? 139.323 172.027 165.503 1.00 69.30  ?  88   ALA A C     1 
ATOM   436   O  O     . ALA A 1  89   ? 139.780 171.023 164.945 1.00 69.65  ?  88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1  89   ? 137.677 171.509 167.322 1.00 69.02  ?  88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1  90   ? 139.028 173.145 164.836 1.00 68.65  ?  89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1  90   ? 139.306 173.253 163.407 1.00 68.35  ?  89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1  90   ? 140.808 173.226 163.156 1.00 68.39  ?  89   VAL A C     1 
ATOM   441   O  O     . VAL A 1  90   ? 141.278 172.648 162.169 1.00 67.93  ?  89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1  90   ? 138.656 174.525 162.832 1.00 68.37  ?  89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1  90   ? 138.801 174.564 161.317 1.00 67.93  ?  89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1  90   ? 137.192 174.602 163.236 1.00 68.30  ?  89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1  91   ? 141.585 173.845 164.048 1.00 68.10  ?  90   MET A N     1 
ATOM   446   C  CA    . MET A 1  91   ? 143.037 173.804 163.913 1.00 67.48  ?  90   MET A CA    1 
ATOM   447   C  C     . MET A 1  91   ? 143.576 172.411 164.213 1.00 65.57  ?  90   MET A C     1 
ATOM   448   O  O     . MET A 1  91   ? 144.520 171.950 163.559 1.00 64.80  ?  90   MET A O     1 
ATOM   449   C  CB    . MET A 1  91   ? 143.678 174.836 164.840 1.00 67.68  ?  90   MET A CB    1 
ATOM   450   C  CG    . MET A 1  91   ? 142.921 176.151 164.936 1.00 71.21  ?  90   MET A CG    1 
ATOM   451   S  SD    . MET A 1  91   ? 142.803 177.027 163.366 1.00 78.31  ?  90   MET A SD    1 
ATOM   452   C  CE    . MET A 1  91   ? 141.922 178.500 163.877 1.00 77.98  ?  90   MET A CE    1 
ATOM   453   N  N     . ALA A 1  92   ? 142.988 171.725 165.198 1.00 64.37  ?  91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1  92   ? 143.447 170.383 165.541 1.00 64.07  ?  91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1  92   ? 143.160 169.395 164.417 1.00 64.01  ?  91   ALA A C     1 
ATOM   456   O  O     . ALA A 1  92   ? 144.006 168.555 164.091 1.00 64.62  ?  91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1  92   ? 142.796 169.920 166.843 1.00 63.76  ?  91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1  93   ? 141.971 169.478 163.814 1.00 63.44  ?  92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1  93   ? 141.664 168.609 162.684 1.00 62.25  ?  92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1  93   ? 142.428 169.025 161.434 1.00 61.80  ?  92   LEU A C     1 
ATOM   461   O  O     . LEU A 1  93   ? 142.713 168.183 160.574 1.00 61.99  ?  92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1  93   ? 140.159 168.607 162.415 1.00 62.73  ?  92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1  93   ? 139.270 168.066 163.536 1.00 63.12  ?  92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1  93   ? 137.802 168.145 163.145 1.00 61.76  ?  92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1  93   ? 139.658 166.639 163.890 1.00 64.86  ?  92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1  94   ? 142.771 170.309 161.316 1.00 60.87  ?  93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1  94   ? 143.528 170.778 160.160 1.00 60.49  ?  93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1  94   ? 144.963 170.265 160.199 1.00 61.46  ?  93   GLN A C     1 
ATOM   469   O  O     . GLN A 1  94   ? 145.422 169.591 159.270 1.00 62.01  ?  93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1  94   ? 143.500 172.307 160.101 1.00 59.71  ?  93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1  94   ? 142.526 172.879 159.082 1.00 55.62  ?  93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1  94   ? 143.010 172.715 157.653 1.00 51.89  ?  93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1  94   ? 144.152 172.325 157.411 1.00 53.52  ?  93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1  94   ? 142.140 173.018 156.697 1.00 51.38  ?  93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1  95   ? 145.690 170.580 161.274 1.00 60.89  ?  94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1  95   ? 147.073 170.126 161.385 1.00 60.88  ?  94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1  95   ? 147.147 168.611 161.533 1.00 60.89  ?  94   GLU A C     1 
ATOM   478   O  O     . GLU A 1  95   ? 148.040 167.968 160.967 1.00 61.09  ?  94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1  95   ? 147.759 170.819 162.562 1.00 61.41  ?  94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1  95   ? 147.634 172.333 162.540 1.00 60.51  ?  94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1  95   ? 148.460 173.002 163.618 1.00 61.64  ?  94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1  95   ? 149.308 172.318 164.227 1.00 62.21  ?  94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1  95   ? 148.262 174.212 163.856 1.00 60.77  ?  94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1  96   ? 146.214 168.025 162.287 1.00 60.75  ?  95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1  96   ? 146.188 166.574 162.436 1.00 61.20  ?  95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1  96   ? 145.897 165.890 161.106 1.00 61.58  ?  95   ALA A C     1 
ATOM   487   O  O     . ALA A 1  96   ? 146.421 164.803 160.833 1.00 61.69  ?  95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1  96   ? 145.153 166.172 163.485 1.00 60.64  ?  95   ALA A CB    1 
ATOM   489   N  N     . SER A 1  97   ? 145.065 166.510 160.268 1.00 62.11  ?  96   SER A N     1 
ATOM   490   C  CA    . SER A 1  97   ? 144.789 165.949 158.950 1.00 62.42  ?  96   SER A CA    1 
ATOM   491   C  C     . SER A 1  97   ? 146.005 166.072 158.041 1.00 62.13  ?  96   SER A C     1 
ATOM   492   O  O     . SER A 1  97   ? 146.405 165.101 157.386 1.00 62.49  ?  96   SER A O     1 
ATOM   493   C  CB    . SER A 1  97   ? 143.574 166.639 158.329 1.00 62.79  ?  96   SER A CB    1 
ATOM   494   O  OG    . SER A 1  97   ? 143.797 168.030 158.177 1.00 63.36  ?  96   SER A OG    1 
ATOM   495   N  N     . GLU A 1  98   ? 146.618 167.259 158.000 1.00 60.77  ?  97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1  98   ? 147.808 167.449 157.180 1.00 59.74  ?  97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1  98   ? 148.985 166.615 157.669 1.00 58.34  ?  97   GLU A C     1 
ATOM   498   O  O     . GLU A 1  98   ? 149.950 166.430 156.919 1.00 58.82  ?  97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1  98   ? 148.189 168.931 157.138 1.00 59.21  ?  97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1  98   ? 147.137 169.809 156.475 1.00 59.90  ?  97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1  98   ? 147.572 171.255 156.326 1.00 61.32  ?  97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1  98   ? 148.748 171.562 156.612 1.00 62.53  ?  97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1  98   ? 146.732 172.087 155.920 1.00 62.79  ?  97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1  99   ? 148.930 166.107 158.902 1.00 56.64  ?  98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1  99   ? 149.981 165.217 159.387 1.00 56.38  ?  98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1  99   ? 150.082 163.970 158.516 1.00 56.11  ?  98   ALA A C     1 
ATOM   507   O  O     . ALA A 1  99   ? 151.100 163.737 157.853 1.00 55.00  ?  98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1  99   ? 149.718 164.844 160.847 1.00 56.10  ?  98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1  100  ? 149.025 163.154 158.498 1.00 56.59  ?  99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1  100  ? 149.019 161.971 157.648 1.00 56.98  ?  99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1  100  ? 148.811 162.309 156.179 1.00 57.00  ?  99   TYR A C     1 
ATOM   512   O  O     . TYR A 1  100  ? 149.082 161.464 155.319 1.00 58.41  ?  99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1  100  ? 147.947 160.978 158.111 1.00 57.02  ?  99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1  100  ? 146.547 161.543 158.227 1.00 56.88  ?  99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1  100  ? 145.723 161.653 157.112 1.00 56.40  ?  99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1  100  ? 146.040 161.940 159.456 1.00 56.21  ?  99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1  100  ? 144.442 162.160 157.219 1.00 55.77  ?  99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1  100  ? 144.761 162.445 159.572 1.00 55.16  ?  99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1  100  ? 143.966 162.554 158.452 1.00 56.29  ?  99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1  100  ? 142.692 163.058 158.566 1.00 57.14  ?  99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1  101  ? 148.333 163.518 155.870 1.00 56.57  ?  100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1  101  ? 148.256 163.937 154.477 1.00 55.69  ?  100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1  101  ? 149.625 164.272 153.902 1.00 54.85  ?  100  LEU A C     1 
ATOM   524   O  O     . LEU A 1  101  ? 149.798 164.224 152.679 1.00 55.86  ?  100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1  101  ? 147.320 165.138 154.330 1.00 56.08  ?  100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1  101  ? 145.822 164.832 154.292 1.00 57.12  ?  100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1  101  ? 145.029 166.116 154.115 1.00 60.20  ?  100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1  101  ? 145.502 163.843 153.184 1.00 57.40  ?  100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1  102  ? 150.595 164.610 154.750 1.00 53.69  ?  101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1  102  ? 151.963 164.847 154.298 1.00 51.85  ?  101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1  102  ? 152.815 163.592 154.437 1.00 51.02  ?  101  VAL A C     1 
ATOM   532   O  O     . VAL A 1  102  ? 153.573 163.248 153.527 1.00 49.76  ?  101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1  102  ? 152.573 166.036 155.068 1.00 50.79  ?  101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1  102  ? 154.083 166.085 154.872 1.00 51.04  ?  101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1  102  ? 151.932 167.341 154.617 1.00 49.75  ?  101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1  103  ? 152.698 162.889 155.567 1.00 51.94  ?  102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1  103  ? 153.453 161.652 155.751 1.00 52.51  ?  102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1  103  ? 152.998 160.574 154.775 1.00 53.64  ?  102  ALA A C     1 
ATOM   539   O  O     . ALA A 1  103  ? 153.823 159.814 154.251 1.00 52.81  ?  102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1  103  ? 153.314 161.161 157.192 1.00 52.10  ?  102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1  104  ? 151.690 160.492 154.520 1.00 55.32  ?  103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1  104  ? 151.181 159.515 153.563 1.00 57.40  ?  103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1  104  ? 151.676 159.821 152.155 1.00 58.92  ?  103  LEU A C     1 
ATOM   544   O  O     . LEU A 1  104  ? 151.952 158.903 151.373 1.00 59.13  ?  103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1  104  ? 149.652 159.483 153.611 1.00 57.58  ?  103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1  104  ? 148.913 158.437 152.771 1.00 57.31  ?  103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1  104  ? 147.707 157.913 153.534 1.00 54.49  ?  103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1  104  ? 148.478 159.016 151.432 1.00 55.51  ?  103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1  105  ? 151.792 161.105 151.811 1.00 60.46  ?  104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1  105  ? 152.360 161.475 150.521 1.00 61.81  ?  104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1  105  ? 153.870 161.290 150.483 1.00 62.77  ?  104  PHE A C     1 
ATOM   552   O  O     . PHE A 1  105  ? 154.438 161.160 149.394 1.00 63.54  ?  104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1  105  ? 151.998 162.920 150.176 1.00 62.65  ?  104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1  105  ? 150.817 163.044 149.257 1.00 64.65  ?  104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1  105  ? 149.529 163.110 149.762 1.00 63.96  ?  104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1  105  ? 150.996 163.086 147.885 1.00 65.02  ?  104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1  105  ? 148.442 163.222 148.914 1.00 63.54  ?  104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1  105  ? 149.915 163.197 147.033 1.00 63.80  ?  104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1  105  ? 148.637 163.264 147.548 1.00 63.12  ?  104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1  106  ? 154.530 161.277 151.642 1.00 63.00  ?  105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1  106  ? 155.955 160.968 151.677 1.00 63.58  ?  105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1  106  ? 156.191 159.484 151.430 1.00 64.66  ?  105  GLU A C     1 
ATOM   563   O  O     . GLU A 1  106  ? 157.057 159.105 150.631 1.00 65.02  ?  105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1  106  ? 156.555 161.401 153.016 1.00 63.23  ?  105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1  106  ? 158.054 161.172 153.129 1.00 62.71  ?  105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1  106  ? 158.620 161.650 154.452 1.00 63.40  ?  105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1  106  ? 157.843 162.169 155.283 1.00 62.40  ?  105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1  106  ? 159.843 161.507 154.661 1.00 64.41  ?  105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1  107  ? 155.425 158.625 152.109 1.00 65.38  ?  106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1  107  ? 155.519 157.192 151.848 1.00 66.36  ?  106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1  107  ? 155.090 156.866 150.423 1.00 66.69  ?  106  ASP A C     1 
ATOM   572   O  O     . ASP A 1  107  ? 155.675 155.989 149.775 1.00 67.40  ?  106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1  107  ? 154.672 156.418 152.858 1.00 66.45  ?  106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1  107  ? 155.105 156.664 154.288 1.00 67.21  ?  106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1  107  ? 156.308 156.917 154.511 1.00 68.84  ?  106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1  107  ? 154.243 156.606 155.190 1.00 70.58  ?  106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1  108  ? 154.070 157.564 149.919 1.00 66.34  ?  107  THR A N     1 
ATOM   578   C  CA    . THR A 1  108  ? 153.666 157.390 148.528 1.00 65.77  ?  107  THR A CA    1 
ATOM   579   C  C     . THR A 1  108  ? 154.782 157.812 147.581 1.00 65.38  ?  107  THR A C     1 
ATOM   580   O  O     . THR A 1  108  ? 155.017 157.163 146.554 1.00 65.69  ?  107  THR A O     1 
ATOM   581   C  CB    . THR A 1  108  ? 152.392 158.188 148.250 1.00 65.74  ?  107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1  108  ? 151.347 157.742 149.123 1.00 64.97  ?  107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1  108  ? 151.951 158.010 146.805 1.00 65.49  ?  107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1  109  ? 155.484 158.898 147.914 1.00 64.98  ?  108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1  109  ? 156.630 159.312 147.112 1.00 64.10  ?  108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1  109  ? 157.729 158.259 147.144 1.00 63.77  ?  108  ASN A C     1 
ATOM   587   O  O     . ASN A 1  109  ? 158.418 158.039 146.142 1.00 63.81  ?  108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1  109  ? 157.157 160.659 147.606 1.00 63.07  ?  108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  109  ? 158.341 161.153 146.799 1.00 61.01  ?  108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  109  ? 158.175 161.781 145.753 1.00 60.13  ?  108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  109  ? 159.546 160.875 147.284 1.00 60.42  ?  108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  110  ? 157.907 157.595 148.290 1.00 63.84  ?  109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1  110  ? 158.858 156.490 148.357 1.00 64.09  ?  109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1  110  ? 158.412 155.330 147.476 1.00 64.37  ?  109  LEU A C     1 
ATOM   595   O  O     . LEU A 1  110  ? 159.244 154.662 146.849 1.00 64.65  ?  109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1  110  ? 159.033 156.034 149.806 1.00 64.05  ?  109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  110  ? 159.639 157.061 150.765 1.00 63.35  ?  109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  110  ? 159.742 156.495 152.173 1.00 60.98  ?  109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  110  ? 161.000 157.522 150.268 1.00 61.50  ?  109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1  111  ? 157.101 155.077 147.413 1.00 65.20  ?  110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1  111  ? 156.591 154.045 146.516 1.00 65.50  ?  110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1  111  ? 156.822 154.412 145.057 1.00 65.97  ?  110  CYS A C     1 
ATOM   603   O  O     . CYS A 1  111  ? 157.075 153.530 144.228 1.00 66.33  ?  110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1  111  ? 155.103 153.810 146.773 1.00 65.21  ?  110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1  111  ? 154.711 153.196 148.425 1.00 63.99  ?  110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1  112  ? 156.740 155.702 144.723 1.00 66.37  ?  111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1  112  ? 156.994 156.125 143.351 1.00 66.29  ?  111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1  112  ? 158.479 156.085 143.015 1.00 67.08  ?  111  ALA A C     1 
ATOM   609   O  O     . ALA A 1  112  ? 158.845 155.844 141.859 1.00 67.39  ?  111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1  112  ? 156.435 157.529 143.121 1.00 66.74  ?  111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1  113  ? 159.346 156.318 144.003 1.00 67.67  ?  112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1  113  ? 160.783 156.264 143.754 1.00 68.10  ?  112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1  113  ? 161.245 154.820 143.604 1.00 68.45  ?  112  ILE A C     1 
ATOM   614   O  O     . ILE A 1  113  ? 162.042 154.498 142.715 1.00 68.90  ?  112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1  113  ? 161.548 156.993 144.875 1.00 68.22  ?  112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1  113  ? 161.282 158.498 144.809 1.00 67.44  ?  112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1  113  ? 163.041 156.711 144.781 1.00 68.16  ?  112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1  113  ? 161.662 159.124 143.487 1.00 66.44  ?  112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1  114  ? 160.748 153.926 144.463 1.00 68.53  ?  113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1  114  ? 161.126 152.520 144.363 1.00 69.03  ?  113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1  114  ? 160.616 151.887 143.074 1.00 69.10  ?  113  HIS A C     1 
ATOM   622   O  O     . HIS A 1  114  ? 161.233 150.947 142.561 1.00 68.78  ?  113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1  114  ? 160.602 151.744 145.571 1.00 69.03  ?  113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1  114  ? 160.881 150.275 145.507 1.00 69.04  ?  113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1  114  ? 162.148 149.752 145.647 1.00 69.79  ?  113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1  114  ? 160.058 149.219 145.306 1.00 69.60  ?  113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1  114  ? 162.093 148.437 145.541 1.00 70.40  ?  113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1  114  ? 160.836 148.087 145.335 1.00 70.22  ?  113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1  115  ? 159.505 152.386 142.536 1.00 69.20  ?  114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1  115  ? 158.919 151.846 141.317 1.00 69.50  ?  114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1  115  ? 159.614 152.335 140.052 1.00 69.84  ?  114  ALA A C     1 
ATOM   632   O  O     . ALA A 1  115  ? 159.051 152.182 138.962 1.00 69.75  ?  114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1  115  ? 157.429 152.190 141.255 1.00 69.66  ?  114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1  116  ? 160.809 152.918 140.173 1.00 70.06  ?  115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1  116  ? 161.587 153.386 139.023 1.00 70.12  ?  115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1  116  ? 160.820 154.440 138.226 1.00 69.81  ?  115  LYS A C     1 
ATOM   637   O  O     . LYS A 1  116  ? 160.933 154.523 137.001 1.00 69.68  ?  115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1  116  ? 162.002 152.218 138.123 1.00 70.22  ?  115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1  116  ? 162.836 151.150 138.820 1.00 72.21  ?  115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1  116  ? 162.860 149.847 138.024 1.00 76.29  ?  115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1  116  ? 163.322 150.065 136.588 1.00 77.88  ?  115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1  116  ? 164.731 150.543 136.499 1.00 77.35  ?  115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1  117  ? 160.036 155.254 138.927 1.00 69.43  ?  116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1  117  ? 159.228 156.299 138.315 1.00 69.51  ?  116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1  117  ? 159.522 157.630 138.998 1.00 69.69  ?  116  ARG A C     1 
ATOM   646   O  O     . ARG A 1  117  ? 160.398 157.734 139.861 1.00 70.23  ?  116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1  117  ? 157.733 155.964 138.401 1.00 69.47  ?  116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1  117  ? 157.330 154.697 137.668 1.00 68.19  ?  116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1  117  ? 155.819 154.508 137.696 1.00 68.68  ?  116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1  117  ? 155.400 153.350 136.910 1.00 67.96  ?  116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1  117  ? 155.134 152.154 137.424 1.00 66.53  ?  116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1  117  ? 155.235 151.953 138.730 1.00 65.20  ?  116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1  117  ? 154.763 151.158 136.631 1.00 64.01  ?  116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1  118  ? 158.772 158.657 138.601 1.00 69.48  ?  117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1  118  ? 158.885 159.985 139.195 1.00 69.50  ?  117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1  118  ? 157.478 160.528 139.412 1.00 69.86  ?  117  VAL A C     1 
ATOM   657   O  O     . VAL A 1  118  ? 157.275 161.489 140.163 1.00 70.06  ?  117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1  118  ? 159.726 160.926 138.310 1.00 69.42  ?  117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1  118  ? 158.962 161.306 137.046 1.00 69.65  ?  117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1  118  ? 160.156 162.166 139.086 1.00 70.12  ?  117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1  119  ? 156.497 159.906 138.764 1.00 70.07  ?  118  THR A N     1 
ATOM   662   C  CA    . THR A 1  119  ? 155.099 160.298 138.867 1.00 69.62  ?  118  THR A CA    1 
ATOM   663   C  C     . THR A 1  119  ? 154.358 159.296 139.743 1.00 69.76  ?  118  THR A C     1 
ATOM   664   O  O     . THR A 1  119  ? 154.477 158.083 139.543 1.00 69.99  ?  118  THR A O     1 
ATOM   665   C  CB    . THR A 1  119  ? 154.448 160.378 137.483 1.00 69.41  ?  118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1  119  ? 155.173 161.306 136.666 1.00 68.14  ?  118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1  119  ? 153.000 160.836 137.596 1.00 70.27  ?  118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1  120  ? 153.594 159.808 140.712 1.00 69.71  ?  119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1  120  ? 152.869 158.928 141.622 1.00 69.46  ?  119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1  120  ? 151.686 158.284 140.904 1.00 69.45  ?  119  ILE A C     1 
ATOM   671   O  O     . ILE A 1  120  ? 151.155 158.801 139.913 1.00 70.15  ?  119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1  120  ? 152.412 159.691 142.875 1.00 69.28  ?  119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1  120  ? 151.559 160.898 142.484 1.00 68.63  ?  119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1  120  ? 153.614 160.125 143.702 1.00 69.25  ?  119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1  120  ? 151.043 161.689 143.665 1.00 67.93  ?  119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1  121  ? 151.271 157.135 141.418 1.00 69.08  ?  120  MET A N     1 
ATOM   677   C  CA    . MET A 1  121  ? 150.193 156.335 140.863 1.00 68.38  ?  120  MET A CA    1 
ATOM   678   C  C     . MET A 1  121  ? 149.255 155.905 141.979 1.00 67.20  ?  120  MET A C     1 
ATOM   679   O  O     . MET A 1  121  ? 149.642 155.884 143.152 1.00 66.96  ?  120  MET A O     1 
ATOM   680   C  CB    . MET A 1  121  ? 150.745 155.098 140.137 1.00 68.33  ?  120  MET A CB    1 
ATOM   681   C  CG    . MET A 1  121  ? 151.671 155.418 138.974 1.00 68.83  ?  120  MET A CG    1 
ATOM   682   S  SD    . MET A 1  121  ? 150.849 156.347 137.666 1.00 70.15  ?  120  MET A SD    1 
ATOM   683   C  CE    . MET A 1  121  ? 149.533 155.215 137.225 1.00 70.26  ?  120  MET A CE    1 
ATOM   684   N  N     . PRO A 1  122  ? 148.004 155.569 141.649 1.00 66.67  ?  121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1  122  ? 147.085 155.081 142.691 1.00 66.42  ?  121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1  122  ? 147.561 153.808 143.370 1.00 66.88  ?  121  PRO A C     1 
ATOM   687   O  O     . PRO A 1  122  ? 147.276 153.606 144.558 1.00 67.50  ?  121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1  122  ? 145.774 154.856 141.924 1.00 66.34  ?  121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  122  ? 145.869 155.763 140.742 1.00 65.56  ?  121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  122  ? 147.319 155.773 140.360 1.00 66.31  ?  121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1  123  ? 148.280 152.941 142.652 1.00 66.50  ?  122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1  123  ? 148.829 151.743 143.275 1.00 65.84  ?  122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1  123  ? 149.864 152.077 144.341 1.00 65.12  ?  122  LYS A C     1 
ATOM   694   O  O     . LYS A 1  123  ? 150.094 151.263 145.242 1.00 65.72  ?  122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1  123  ? 149.438 150.824 142.213 1.00 66.57  ?  122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1  123  ? 150.409 151.508 141.265 1.00 67.14  ?  122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1  123  ? 150.976 150.519 140.258 1.00 67.44  ?  122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1  123  ? 151.851 151.213 139.226 1.00 69.43  ?  122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1  123  ? 151.071 152.170 138.393 1.00 71.33  ?  122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1  124  ? 150.493 153.252 144.260 1.00 63.78  ?  123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1  124  ? 151.360 153.699 145.346 1.00 63.06  ?  123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1  124  ? 150.546 154.026 146.591 1.00 63.05  ?  123  ASP A C     1 
ATOM   703   O  O     . ASP A 1  124  ? 150.995 153.778 147.717 1.00 63.04  ?  123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1  124  ? 152.176 154.913 144.903 1.00 62.48  ?  123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1  124  ? 153.080 154.611 143.726 1.00 62.55  ?  123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1  124  ? 153.580 153.471 143.637 1.00 58.77  ?  123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1  124  ? 153.291 155.515 142.890 1.00 60.06  ?  123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1  125  ? 149.348 154.584 146.408 1.00 62.33  ?  124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1  125  ? 148.468 154.847 147.542 1.00 61.40  ?  124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1  125  ? 147.964 153.539 148.137 1.00 61.78  ?  124  ILE A C     1 
ATOM   711   O  O     . ILE A 1  125  ? 147.933 153.369 149.363 1.00 61.43  ?  124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1  125  ? 147.303 155.758 147.112 1.00 60.50  ?  124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1  125  ? 147.825 157.125 146.664 1.00 61.92  ?  124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1  125  ? 146.299 155.914 148.245 1.00 59.46  ?  124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1  125  ? 148.390 157.963 147.788 1.00 61.24  ?  124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1  126  ? 147.571 152.591 147.281 1.00 62.56  ?  125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1  126  ? 147.079 151.308 147.773 1.00 63.23  ?  125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1  126  ? 148.173 150.540 148.505 1.00 63.38  ?  125  GLN A C     1 
ATOM   719   O  O     . GLN A 1  126  ? 147.924 149.942 149.559 1.00 63.54  ?  125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1  126  ? 146.525 150.479 146.613 1.00 63.59  ?  125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  126  ? 145.430 151.172 145.812 1.00 64.54  ?  125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  126  ? 144.169 151.412 146.621 1.00 65.61  ?  125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  126  ? 143.910 150.726 147.610 1.00 67.05  ?  125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  126  ? 143.376 152.392 146.203 1.00 65.68  ?  125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1  127  ? 149.392 150.545 147.961 1.00 63.84  ?  126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1  127  ? 150.503 149.879 148.635 1.00 64.26  ?  126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1  127  ? 150.877 150.599 149.924 1.00 64.63  ?  126  LEU A C     1 
ATOM   728   O  O     . LEU A 1  127  ? 151.279 149.960 150.904 1.00 64.60  ?  126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1  127  ? 151.708 149.788 147.699 1.00 63.92  ?  126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1  127  ? 151.897 148.473 146.938 1.00 64.58  ?  126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1  127  ? 152.133 147.328 147.911 1.00 66.29  ?  126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1  127  ? 150.706 148.176 146.039 1.00 64.55  ?  126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1  128  ? 150.754 151.929 149.944 1.00 64.84  ?  127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1  128  ? 151.037 152.676 151.165 1.00 64.59  ?  127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1  128  ? 150.041 152.329 152.264 1.00 65.14  ?  127  ALA A C     1 
ATOM   736   O  O     . ALA A 1  128  ? 150.426 152.124 153.422 1.00 64.99  ?  127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1  128  ? 151.023 154.177 150.878 1.00 64.58  ?  127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1  129  ? 148.752 152.255 151.919 1.00 65.21  ?  128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1  129  ? 147.747 151.870 152.903 1.00 65.00  ?  128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1  129  ? 147.877 150.404 153.295 1.00 65.62  ?  128  ARG A C     1 
ATOM   741   O  O     . ARG A 1  129  ? 147.486 150.024 154.405 1.00 65.67  ?  128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1  129  ? 146.345 152.153 152.363 1.00 64.62  ?  128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1  129  ? 146.077 153.619 152.070 1.00 65.56  ?  128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1  129  ? 144.667 153.826 151.544 1.00 65.74  ?  128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1  129  ? 143.658 153.370 152.496 1.00 65.87  ?  128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1  129  ? 143.120 154.137 153.438 1.00 63.64  ?  128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1  129  ? 143.492 155.404 153.557 1.00 63.59  ?  128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1  129  ? 142.208 153.637 154.261 1.00 62.60  ?  128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1  130  ? 148.417 149.569 152.405 1.00 66.21  ?  129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1  130  ? 148.610 148.161 152.733 1.00 67.19  ?  129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1  130  ? 149.758 147.978 153.719 1.00 67.65  ?  129  ARG A C     1 
ATOM   752   O  O     . ARG A 1  130  ? 149.620 147.270 154.724 1.00 67.51  ?  129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1  130  ? 148.859 147.355 151.458 1.00 67.40  ?  129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1  130  ? 149.352 145.938 151.704 1.00 69.08  ?  129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1  130  ? 148.321 145.099 152.444 1.00 71.87  ?  129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1  130  ? 147.117 144.877 151.649 1.00 75.08  ?  129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1  130  ? 146.096 144.119 152.036 1.00 75.06  ?  129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1  130  ? 146.132 143.506 153.212 1.00 74.08  ?  129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1  130  ? 145.040 143.972 151.248 1.00 72.52  ?  129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1  131  ? 150.902 148.610 153.447 1.00 68.44  ?  130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1  131  ? 152.046 148.482 154.345 1.00 68.93  ?  130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1  131  ? 151.786 149.208 155.658 1.00 69.69  ?  130  ILE A C     1 
ATOM   763   O  O     . ILE A 1  131  ? 152.245 148.768 156.720 1.00 69.07  ?  130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1  131  ? 153.323 148.998 153.654 1.00 68.82  ?  130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1  131  ? 153.555 148.249 152.342 1.00 69.19  ?  130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1  131  ? 154.531 148.841 154.565 1.00 67.73  ?  130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1  131  ? 154.747 148.749 151.559 1.00 68.64  ?  130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1  132  ? 151.043 150.318 155.618 1.00 71.10  ?  131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1  132  ? 150.746 151.051 156.845 1.00 72.30  ?  131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1  132  ? 149.893 150.217 157.794 1.00 74.20  ?  131  ARG A C     1 
ATOM   771   O  O     . ARG A 1  132  ? 150.062 150.288 159.017 1.00 74.38  ?  131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1  132  ? 150.050 152.370 156.511 1.00 71.89  ?  131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1  132  ? 149.741 153.235 157.722 1.00 71.07  ?  131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1  132  ? 149.142 154.569 157.310 1.00 68.04  ?  131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1  132  ? 150.053 155.340 156.469 1.00 67.64  ?  131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1  132  ? 150.966 156.185 156.936 1.00 68.24  ?  131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1  132  ? 151.094 156.370 158.243 1.00 68.29  ?  131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1  132  ? 151.753 156.845 156.097 1.00 66.64  ?  131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1  133  ? 148.977 149.418 157.251 1.00 76.08  ?  132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1  133  ? 148.136 148.549 158.045 1.00 78.30  ?  132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1  133  ? 146.782 149.122 158.403 1.00 79.91  ?  132  GLY A C     1 
ATOM   782   O  O     . GLY A 1  133  ? 145.960 148.402 158.984 1.00 80.42  ?  132  GLY A O     1 
ATOM   783   N  N     . GLU A 1  134  ? 146.524 150.388 158.078 1.00 81.49  ?  133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1  134  ? 145.253 151.030 158.378 1.00 82.93  ?  133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1  134  ? 144.247 150.906 157.238 1.00 84.45  ?  133  GLU A C     1 
ATOM   786   O  O     . GLU A 1  134  ? 143.329 151.729 157.141 1.00 84.38  ?  133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1  134  ? 145.477 152.504 158.724 1.00 82.86  ?  133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1  134  ? 146.365 152.728 159.937 1.00 83.17  ?  133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1  134  ? 146.542 154.197 160.267 1.00 82.42  ?  133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1  134  ? 145.954 155.042 159.561 1.00 81.20  ?  133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1  134  ? 147.270 154.506 161.234 1.00 80.85  ?  133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1  135  ? 144.399 149.903 156.380 1.00 86.10  ?  134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1  135  ? 143.479 149.700 155.267 1.00 87.50  ?  134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1  135  ? 142.221 148.968 155.724 1.00 87.65  ?  134  ARG A C     1 
ATOM   795   O  O     . ARG A 1  135  ? 142.265 147.781 156.047 1.00 87.88  ?  134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1  135  ? 144.162 148.922 154.141 1.00 87.90  ?  134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1  135  ? 143.256 148.622 152.957 1.00 90.44  ?  134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1  135  ? 142.741 149.900 152.317 1.00 94.22  ?  134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1  135  ? 141.829 149.626 151.209 1.00 96.53  ?  134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1  135  ? 142.216 149.449 149.950 1.00 97.26  ?  134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1  135  ? 143.502 149.514 149.634 1.00 96.94  ?  134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1  135  ? 141.317 149.204 149.007 1.00 97.19  ?  134  ARG A NH2   1 
ATOM   803   N  N     . LYS B 2  17   ? 122.509 185.579 135.715 1.00 30.00  ?  16   LYS B N     1 
ATOM   804   C  CA    . LYS B 2  17   ? 121.322 184.895 136.216 1.00 30.00  ?  16   LYS B CA    1 
ATOM   805   C  C     . LYS B 2  17   ? 120.862 185.494 137.541 1.00 30.00  ?  16   LYS B C     1 
ATOM   806   O  O     . LYS B 2  17   ? 119.767 186.051 137.631 1.00 30.00  ?  16   LYS B O     1 
ATOM   807   C  CB    . LYS B 2  17   ? 121.595 183.398 136.382 1.00 30.00  ?  16   LYS B CB    1 
ATOM   808   C  CG    . LYS B 2  17   ? 121.977 182.689 135.092 1.00 30.00  ?  16   LYS B CG    1 
ATOM   809   C  CD    . LYS B 2  17   ? 122.230 181.209 135.330 1.00 30.00  ?  16   LYS B CD    1 
ATOM   810   C  CE    . LYS B 2  17   ? 122.611 180.498 134.041 1.00 30.00  ?  16   LYS B CE    1 
ATOM   811   N  NZ    . LYS B 2  17   ? 122.863 179.047 134.260 1.00 30.00  ?  16   LYS B NZ    1 
ATOM   812   N  N     . ARG B 2  18   ? 121.713 185.371 138.563 1.00 30.00  ?  17   ARG B N     1 
ATOM   813   C  CA    . ARG B 2  18   ? 121.420 185.875 139.906 1.00 30.00  ?  17   ARG B CA    1 
ATOM   814   C  C     . ARG B 2  18   ? 120.117 185.290 140.446 1.00 30.00  ?  17   ARG B C     1 
ATOM   815   O  O     . ARG B 2  18   ? 119.278 186.000 141.004 1.00 30.00  ?  17   ARG B O     1 
ATOM   816   C  CB    . ARG B 2  18   ? 121.346 187.403 139.899 1.00 30.00  ?  17   ARG B CB    1 
ATOM   817   N  N     . HIS B 2  19   ? 119.948 183.978 140.280 1.00 30.00  ?  18   HIS B N     1 
ATOM   818   C  CA    . HIS B 2  19   ? 118.744 183.279 140.718 1.00 30.00  ?  18   HIS B CA    1 
ATOM   819   C  C     . HIS B 2  19   ? 119.055 182.341 141.879 1.00 30.00  ?  18   HIS B C     1 
ATOM   820   O  O     . HIS B 2  19   ? 118.604 182.579 143.002 1.00 30.00  ?  18   HIS B O     1 
ATOM   821   C  CB    . HIS B 2  19   ? 118.117 182.517 139.548 1.00 30.00  ?  18   HIS B CB    1 
ATOM   822   C  CG    . HIS B 2  19   ? 116.838 181.821 139.896 1.00 30.00  ?  18   HIS B CG    1 
ATOM   823   N  ND1   . HIS B 2  19   ? 116.737 180.449 139.988 1.00 30.00  ?  18   HIS B ND1   1 
ATOM   824   C  CD2   . HIS B 2  19   ? 115.605 182.308 140.173 1.00 30.00  ?  18   HIS B CD2   1 
ATOM   825   C  CE1   . HIS B 2  19   ? 115.497 180.121 140.307 1.00 30.00  ?  18   HIS B CE1   1 
ATOM   826   N  NE2   . HIS B 2  19   ? 114.791 181.231 140.425 1.00 30.00  ?  18   HIS B NE2   1 
ATOM   827   N  N     . ARG B 2  20   ? 119.810 181.272 141.640 1.00 30.00  ?  19   ARG B N     1 
ATOM   828   C  CA    . ARG B 2  20   ? 120.172 180.324 142.681 1.00 30.00  ?  19   ARG B CA    1 
ATOM   829   C  C     . ARG B 2  20   ? 121.661 180.018 142.594 1.00 30.00  ?  19   ARG B C     1 
ATOM   830   O  O     . ARG B 2  20   ? 122.289 180.166 141.543 1.00 30.00  ?  19   ARG B O     1 
ATOM   831   C  CB    . ARG B 2  20   ? 119.357 179.026 142.573 1.00 30.00  ?  19   ARG B CB    1 
ATOM   832   C  CG    . ARG B 2  20   ? 117.874 179.202 142.865 1.00 30.00  ?  19   ARG B CG    1 
ATOM   833   C  CD    . ARG B 2  20   ? 117.107 177.912 142.632 1.00 30.00  ?  19   ARG B CD    1 
ATOM   834   N  NE    . ARG B 2  20   ? 117.638 176.809 143.426 1.00 30.00  ?  19   ARG B NE    1 
ATOM   835   C  CZ    . ARG B 2  20   ? 117.162 175.569 143.392 1.00 30.00  ?  19   ARG B CZ    1 
ATOM   836   N  NH1   . ARG B 2  20   ? 116.141 175.270 142.600 1.00 30.00  ?  19   ARG B NH1   1 
ATOM   837   N  NH2   . ARG B 2  20   ? 117.707 174.626 144.149 1.00 30.00  ?  19   ARG B NH2   1 
ATOM   838   N  N     . LYS B 2  21   ? 122.221 179.593 143.725 1.00 76.18  ?  20   LYS B N     1 
ATOM   839   C  CA    . LYS B 2  21   ? 123.636 179.241 143.828 1.00 76.86  ?  20   LYS B CA    1 
ATOM   840   C  C     . LYS B 2  21   ? 123.727 177.840 144.424 1.00 76.97  ?  20   LYS B C     1 
ATOM   841   O  O     . LYS B 2  21   ? 123.678 177.673 145.646 1.00 77.43  ?  20   LYS B O     1 
ATOM   842   C  CB    . LYS B 2  21   ? 124.399 180.255 144.674 1.00 76.99  ?  20   LYS B CB    1 
ATOM   843   C  CG    . LYS B 2  21   ? 124.432 181.656 144.086 1.00 77.44  ?  20   LYS B CG    1 
ATOM   844   C  CD    . LYS B 2  21   ? 125.104 181.666 142.723 1.00 76.91  ?  20   LYS B CD    1 
ATOM   845   C  CE    . LYS B 2  21   ? 125.155 183.069 142.142 1.00 77.02  ?  20   LYS B CE    1 
ATOM   846   N  NZ    . LYS B 2  21   ? 125.933 183.998 143.006 1.00 75.18  ?  20   LYS B NZ    1 
ATOM   847   N  N     . VAL B 2  22   ? 123.854 176.838 143.561 1.00 76.85  ?  21   VAL B N     1 
ATOM   848   C  CA    . VAL B 2  22   ? 123.970 175.450 143.989 1.00 76.27  ?  21   VAL B CA    1 
ATOM   849   C  C     . VAL B 2  22   ? 125.446 175.088 144.080 1.00 75.96  ?  21   VAL B C     1 
ATOM   850   O  O     . VAL B 2  22   ? 126.193 175.237 143.105 1.00 76.23  ?  21   VAL B O     1 
ATOM   851   C  CB    . VAL B 2  22   ? 123.228 174.511 143.024 1.00 76.10  ?  21   VAL B CB    1 
ATOM   852   C  CG1   . VAL B 2  22   ? 123.362 173.068 143.483 1.00 76.48  ?  21   VAL B CG1   1 
ATOM   853   C  CG2   . VAL B 2  22   ? 121.764 174.910 142.916 1.00 75.67  ?  21   VAL B CG2   1 
ATOM   854   N  N     . LEU B 2  23   ? 125.867 174.615 145.251 1.00 74.79  ?  22   LEU B N     1 
ATOM   855   C  CA    . LEU B 2  23   ? 127.254 174.240 145.492 1.00 73.44  ?  22   LEU B CA    1 
ATOM   856   C  C     . LEU B 2  23   ? 127.509 172.750 145.303 1.00 72.96  ?  22   LEU B C     1 
ATOM   857   O  O     . LEU B 2  23   ? 128.662 172.319 145.402 1.00 72.75  ?  22   LEU B O     1 
ATOM   858   C  CB    . LEU B 2  23   ? 127.675 174.657 146.905 1.00 73.62  ?  22   LEU B CB    1 
ATOM   859   C  CG    . LEU B 2  23   ? 127.567 176.144 147.247 1.00 73.09  ?  22   LEU B CG    1 
ATOM   860   C  CD1   . LEU B 2  23   ? 128.010 176.396 148.681 1.00 72.13  ?  22   LEU B CD1   1 
ATOM   861   C  CD2   . LEU B 2  23   ? 128.384 176.982 146.275 1.00 73.04  ?  22   LEU B CD2   1 
ATOM   862   N  N     . ARG B 2  24   ? 126.467 171.963 145.037 1.00 72.46  ?  23   ARG B N     1 
ATOM   863   C  CA    . ARG B 2  24   ? 126.563 170.506 144.857 1.00 71.93  ?  23   ARG B CA    1 
ATOM   864   C  C     . ARG B 2  24   ? 127.146 169.923 146.144 1.00 71.49  ?  23   ARG B C     1 
ATOM   865   O  O     . ARG B 2  24   ? 126.610 170.197 147.229 1.00 71.04  ?  23   ARG B O     1 
ATOM   866   C  CB    . ARG B 2  24   ? 127.336 170.197 143.579 1.00 72.29  ?  23   ARG B CB    1 
ATOM   867   C  CG    . ARG B 2  24   ? 126.664 170.691 142.308 1.00 72.52  ?  23   ARG B CG    1 
ATOM   868   C  CD    . ARG B 2  24   ? 127.452 170.285 141.072 1.00 71.52  ?  23   ARG B CD    1 
ATOM   869   N  NE    . ARG B 2  24   ? 126.801 170.720 139.839 1.00 68.19  ?  23   ARG B NE    1 
ATOM   870   C  CZ    . ARG B 2  24   ? 127.283 170.499 138.621 1.00 67.09  ?  23   ARG B CZ    1 
ATOM   871   N  NH1   . ARG B 2  24   ? 128.427 169.846 138.467 1.00 64.70  ?  23   ARG B NH1   1 
ATOM   872   N  NH2   . ARG B 2  24   ? 126.622 170.931 137.556 1.00 64.44  ?  23   ARG B NH2   1 
ATOM   873   N  N     . ASP B 2  25   ? 128.211 169.131 146.082 1.00 70.72  ?  24   ASP B N     1 
ATOM   874   C  CA    . ASP B 2  25   ? 128.832 168.575 147.274 1.00 70.37  ?  24   ASP B CA    1 
ATOM   875   C  C     . ASP B 2  25   ? 129.986 169.458 147.733 1.00 70.69  ?  24   ASP B C     1 
ATOM   876   O  O     . ASP B 2  25   ? 130.660 170.106 146.927 1.00 70.85  ?  24   ASP B O     1 
ATOM   877   C  CB    . ASP B 2  25   ? 129.331 167.153 147.009 1.00 70.08  ?  24   ASP B CB    1 
ATOM   878   C  CG    . ASP B 2  25   ? 130.105 167.038 145.710 1.00 71.07  ?  24   ASP B CG    1 
ATOM   879   O  OD1   . ASP B 2  25   ? 130.230 168.056 144.997 1.00 71.50  ?  24   ASP B OD1   1 
ATOM   880   O  OD2   . ASP B 2  25   ? 130.586 165.928 145.398 1.00 70.96  ?  24   ASP B OD2   1 
ATOM   881   N  N     . ASN B 2  26   ? 130.207 169.479 149.046 1.00 70.33  ?  25   ASN B N     1 
ATOM   882   C  CA    . ASN B 2  26   ? 131.268 170.283 149.640 1.00 70.03  ?  25   ASN B CA    1 
ATOM   883   C  C     . ASN B 2  26   ? 132.630 169.602 149.590 1.00 69.53  ?  25   ASN B C     1 
ATOM   884   O  O     . ASN B 2  26   ? 133.586 170.121 150.177 1.00 69.38  ?  25   ASN B O     1 
ATOM   885   C  CB    . ASN B 2  26   ? 130.916 170.632 151.089 1.00 70.18  ?  25   ASN B CB    1 
ATOM   886   C  CG    . ASN B 2  26   ? 129.650 171.461 151.198 1.00 71.11  ?  25   ASN B CG    1 
ATOM   887   O  OD1   . ASN B 2  26   ? 129.319 172.231 150.296 1.00 73.39  ?  25   ASN B OD1   1 
ATOM   888   N  ND2   . ASN B 2  26   ? 128.935 171.306 152.306 1.00 70.38  ?  25   ASN B ND2   1 
ATOM   889   N  N     . ILE B 2  27   ? 132.742 168.458 148.911 1.00 68.75  ?  26   ILE B N     1 
ATOM   890   C  CA    . ILE B 2  27   ? 134.033 167.793 148.793 1.00 68.34  ?  26   ILE B CA    1 
ATOM   891   C  C     . ILE B 2  27   ? 134.934 168.513 147.799 1.00 68.61  ?  26   ILE B C     1 
ATOM   892   O  O     . ILE B 2  27   ? 136.149 168.283 147.785 1.00 68.96  ?  26   ILE B O     1 
ATOM   893   C  CB    . ILE B 2  27   ? 133.836 166.315 148.399 1.00 67.90  ?  26   ILE B CB    1 
ATOM   894   C  CG1   . ILE B 2  27   ? 135.085 165.494 148.728 1.00 67.68  ?  26   ILE B CG1   1 
ATOM   895   C  CG2   . ILE B 2  27   ? 133.496 166.196 146.921 1.00 68.30  ?  26   ILE B CG2   1 
ATOM   896   C  CD1   . ILE B 2  27   ? 135.450 165.490 150.197 1.00 66.44  ?  26   ILE B CD1   1 
ATOM   897   N  N     . GLN B 2  28   ? 134.371 169.394 146.973 1.00 69.00  ?  27   GLN B N     1 
ATOM   898   C  CA    . GLN B 2  28   ? 135.138 170.143 145.987 1.00 69.35  ?  27   GLN B CA    1 
ATOM   899   C  C     . GLN B 2  28   ? 135.870 171.338 146.589 1.00 69.24  ?  27   GLN B C     1 
ATOM   900   O  O     . GLN B 2  28   ? 136.534 172.073 145.850 1.00 69.19  ?  27   GLN B O     1 
ATOM   901   C  CB    . GLN B 2  28   ? 134.211 170.610 144.858 1.00 69.25  ?  27   GLN B CB    1 
ATOM   902   C  CG    . GLN B 2  28   ? 134.901 170.850 143.520 1.00 68.35  ?  27   GLN B CG    1 
ATOM   903   C  CD    . GLN B 2  28   ? 135.421 169.572 142.888 1.00 67.83  ?  27   GLN B CD    1 
ATOM   904   O  OE1   . GLN B 2  28   ? 134.972 168.474 143.216 1.00 68.03  ?  27   GLN B OE1   1 
ATOM   905   N  NE2   . GLN B 2  28   ? 136.375 169.711 141.975 1.00 66.54  ?  27   GLN B NE2   1 
ATOM   906   N  N     . GLY B 2  29   ? 135.767 171.548 147.903 1.00 68.90  ?  28   GLY B N     1 
ATOM   907   C  CA    . GLY B 2  29   ? 136.473 172.660 148.520 1.00 68.99  ?  28   GLY B CA    1 
ATOM   908   C  C     . GLY B 2  29   ? 137.980 172.529 148.410 1.00 68.84  ?  28   GLY B C     1 
ATOM   909   O  O     . GLY B 2  29   ? 138.686 173.520 148.208 1.00 69.37  ?  28   GLY B O     1 
ATOM   910   N  N     . ILE B 2  30   ? 138.491 171.309 148.540 1.00 67.92  ?  29   ILE B N     1 
ATOM   911   C  CA    . ILE B 2  30   ? 139.917 171.046 148.374 1.00 66.44  ?  29   ILE B CA    1 
ATOM   912   C  C     . ILE B 2  30   ? 140.188 170.892 146.880 1.00 66.29  ?  29   ILE B C     1 
ATOM   913   O  O     . ILE B 2  30   ? 139.753 169.921 146.257 1.00 66.30  ?  29   ILE B O     1 
ATOM   914   C  CB    . ILE B 2  30   ? 140.361 169.801 149.152 1.00 66.86  ?  29   ILE B CB    1 
ATOM   915   C  CG1   . ILE B 2  30   ? 140.244 170.032 150.663 1.00 65.54  ?  29   ILE B CG1   1 
ATOM   916   C  CG2   . ILE B 2  30   ? 141.785 169.424 148.785 1.00 66.66  ?  29   ILE B CG2   1 
ATOM   917   C  CD1   . ILE B 2  30   ? 138.900 169.648 151.252 1.00 63.97  ?  29   ILE B CD1   1 
ATOM   918   N  N     . THR B 2  31   ? 140.905 171.852 146.304 1.00 65.79  ?  30   THR B N     1 
ATOM   919   C  CA    . THR B 2  31   ? 141.133 171.886 144.868 1.00 65.94  ?  30   THR B CA    1 
ATOM   920   C  C     . THR B 2  31   ? 142.435 171.161 144.525 1.00 66.04  ?  30   THR B C     1 
ATOM   921   O  O     . THR B 2  31   ? 143.039 170.482 145.360 1.00 65.53  ?  30   THR B O     1 
ATOM   922   C  CB    . THR B 2  31   ? 141.144 173.330 144.370 1.00 66.16  ?  30   THR B CB    1 
ATOM   923   O  OG1   . THR B 2  31   ? 142.207 174.050 145.006 1.00 65.35  ?  30   THR B OG1   1 
ATOM   924   C  CG2   . THR B 2  31   ? 139.819 174.009 144.686 1.00 66.27  ?  30   THR B CG2   1 
ATOM   925   N  N     . LYS B 2  32   ? 142.879 171.303 143.271 1.00 67.06  ?  31   LYS B N     1 
ATOM   926   C  CA    . LYS B 2  32   ? 144.106 170.630 142.845 1.00 68.10  ?  31   LYS B CA    1 
ATOM   927   C  C     . LYS B 2  32   ? 145.359 171.266 143.436 1.00 68.94  ?  31   LYS B C     1 
ATOM   928   O  O     . LYS B 2  32   ? 146.198 170.526 143.981 1.00 69.50  ?  31   LYS B O     1 
ATOM   929   C  CB    . LYS B 2  32   ? 144.164 170.579 141.314 1.00 67.87  ?  31   LYS B CB    1 
ATOM   930   C  CG    . LYS B 2  32   ? 145.430 169.948 140.760 1.00 68.42  ?  31   LYS B CG    1 
ATOM   931   C  CD    . LYS B 2  32   ? 145.523 170.132 139.254 1.00 68.39  ?  31   LYS B CD    1 
ATOM   932   C  CE    . LYS B 2  32   ? 144.320 169.532 138.545 1.00 70.15  ?  31   LYS B CE    1 
ATOM   933   N  NZ    . LYS B 2  32   ? 144.391 169.734 137.072 1.00 70.44  ?  31   LYS B NZ    1 
ATOM   934   N  N     . PRO B 2  33   ? 145.568 172.589 143.368 1.00 69.39  ?  32   PRO B N     1 
ATOM   935   C  CA    . PRO B 2  33   ? 146.822 173.149 143.901 1.00 69.43  ?  32   PRO B CA    1 
ATOM   936   C  C     . PRO B 2  33   ? 146.981 172.995 145.404 1.00 69.83  ?  32   PRO B C     1 
ATOM   937   O  O     . PRO B 2  33   ? 148.104 173.141 145.902 1.00 70.41  ?  32   PRO B O     1 
ATOM   938   C  CB    . PRO B 2  33   ? 146.749 174.628 143.497 1.00 69.44  ?  32   PRO B CB    1 
ATOM   939   C  CG    . PRO B 2  33   ? 145.307 174.896 143.323 1.00 69.96  ?  32   PRO B CG    1 
ATOM   940   C  CD    . PRO B 2  33   ? 144.731 173.640 142.760 1.00 69.70  ?  32   PRO B CD    1 
ATOM   941   N  N     . ALA B 2  34   ? 145.907 172.709 146.142 1.00 69.37  ?  33   ALA B N     1 
ATOM   942   C  CA    . ALA B 2  34   ? 146.038 172.474 147.577 1.00 68.83  ?  33   ALA B CA    1 
ATOM   943   C  C     . ALA B 2  34   ? 146.806 171.186 147.847 1.00 68.96  ?  33   ALA B C     1 
ATOM   944   O  O     . ALA B 2  34   ? 147.842 171.192 148.522 1.00 69.26  ?  33   ALA B O     1 
ATOM   945   C  CB    . ALA B 2  34   ? 144.655 172.432 148.230 1.00 68.46  ?  33   ALA B CB    1 
ATOM   946   N  N     . ILE B 2  35   ? 146.309 170.064 147.319 1.00 69.01  ?  34   ILE B N     1 
ATOM   947   C  CA    . ILE B 2  35   ? 147.027 168.802 147.442 1.00 68.77  ?  34   ILE B CA    1 
ATOM   948   C  C     . ILE B 2  35   ? 148.333 168.837 146.658 1.00 68.88  ?  34   ILE B C     1 
ATOM   949   O  O     . ILE B 2  35   ? 149.266 168.089 146.975 1.00 68.76  ?  34   ILE B O     1 
ATOM   950   C  CB    . ILE B 2  35   ? 146.120 167.639 146.995 1.00 69.02  ?  34   ILE B CB    1 
ATOM   951   C  CG1   . ILE B 2  35   ? 144.783 167.710 147.734 1.00 68.47  ?  34   ILE B CG1   1 
ATOM   952   C  CG2   . ILE B 2  35   ? 146.782 166.296 147.260 1.00 68.56  ?  34   ILE B CG2   1 
ATOM   953   C  CD1   . ILE B 2  35   ? 143.877 166.525 147.492 1.00 69.54  ?  34   ILE B CD1   1 
ATOM   954   N  N     . ARG B 2  36   ? 148.430 169.702 145.645 1.00 68.17  ?  35   ARG B N     1 
ATOM   955   C  CA    . ARG B 2  36   ? 149.709 169.914 144.977 1.00 68.25  ?  35   ARG B CA    1 
ATOM   956   C  C     . ARG B 2  36   ? 150.730 170.519 145.933 1.00 66.98  ?  35   ARG B C     1 
ATOM   957   O  O     . ARG B 2  36   ? 151.910 170.150 145.910 1.00 66.72  ?  35   ARG B O     1 
ATOM   958   C  CB    . ARG B 2  36   ? 149.520 170.812 143.755 1.00 68.11  ?  35   ARG B CB    1 
ATOM   959   C  CG    . ARG B 2  36   ? 150.784 171.043 142.947 1.00 70.51  ?  35   ARG B CG    1 
ATOM   960   C  CD    . ARG B 2  36   ? 151.106 169.843 142.075 1.00 70.81  ?  35   ARG B CD    1 
ATOM   961   N  NE    . ARG B 2  36   ? 150.105 169.650 141.030 1.00 77.99  ?  35   ARG B NE    1 
ATOM   962   C  CZ    . ARG B 2  36   ? 150.152 170.230 139.835 1.00 81.09  ?  35   ARG B CZ    1 
ATOM   963   N  NH1   . ARG B 2  36   ? 151.155 171.042 139.530 1.00 83.27  ?  35   ARG B NH1   1 
ATOM   964   N  NH2   . ARG B 2  36   ? 149.198 169.999 138.945 1.00 82.19  ?  35   ARG B NH2   1 
ATOM   965   N  N     . ARG B 2  37   ? 150.293 171.454 146.783 1.00 64.76  ?  36   ARG B N     1 
ATOM   966   C  CA    . ARG B 2  37   ? 151.192 172.015 147.786 1.00 62.71  ?  36   ARG B CA    1 
ATOM   967   C  C     . ARG B 2  37   ? 151.464 171.025 148.910 1.00 62.44  ?  36   ARG B C     1 
ATOM   968   O  O     . ARG B 2  37   ? 152.561 171.026 149.481 1.00 62.73  ?  36   ARG B O     1 
ATOM   969   C  CB    . ARG B 2  37   ? 150.614 173.313 148.352 1.00 62.44  ?  36   ARG B CB    1 
ATOM   970   C  CG    . ARG B 2  37   ? 150.620 174.477 147.374 1.00 61.24  ?  36   ARG B CG    1 
ATOM   971   C  CD    . ARG B 2  37   ? 150.105 175.750 148.028 1.00 60.47  ?  36   ARG B CD    1 
ATOM   972   N  NE    . ARG B 2  37   ? 148.720 175.622 148.472 1.00 61.89  ?  36   ARG B NE    1 
ATOM   973   C  CZ    . ARG B 2  37   ? 147.666 175.956 147.735 1.00 60.45  ?  36   ARG B CZ    1 
ATOM   974   N  NH1   . ARG B 2  37   ? 147.836 176.439 146.512 1.00 60.33  ?  36   ARG B NH1   1 
ATOM   975   N  NH2   . ARG B 2  37   ? 146.441 175.806 148.219 1.00 57.38  ?  36   ARG B NH2   1 
ATOM   976   N  N     . LEU B 2  38   ? 150.484 170.182 149.246 1.00 61.40  ?  37   LEU B N     1 
ATOM   977   C  CA    . LEU B 2  38   ? 150.716 169.145 150.248 1.00 60.33  ?  37   LEU B CA    1 
ATOM   978   C  C     . LEU B 2  38   ? 151.784 168.165 149.777 1.00 60.09  ?  37   LEU B C     1 
ATOM   979   O  O     . LEU B 2  38   ? 152.703 167.819 150.529 1.00 60.12  ?  37   LEU B O     1 
ATOM   980   C  CB    . LEU B 2  38   ? 149.409 168.414 150.559 1.00 59.52  ?  37   LEU B CB    1 
ATOM   981   C  CG    . LEU B 2  38   ? 148.285 169.254 151.168 1.00 58.64  ?  37   LEU B CG    1 
ATOM   982   C  CD1   . LEU B 2  38   ? 147.053 168.399 151.416 1.00 58.46  ?  37   LEU B CD1   1 
ATOM   983   C  CD2   . LEU B 2  38   ? 148.747 169.922 152.455 1.00 58.30  ?  37   LEU B CD2   1 
ATOM   984   N  N     . ALA B 2  39   ? 151.678 167.708 148.527 1.00 60.16  ?  38   ALA B N     1 
ATOM   985   C  CA    . ALA B 2  39   ? 152.716 166.855 147.963 1.00 59.68  ?  38   ALA B CA    1 
ATOM   986   C  C     . ALA B 2  39   ? 154.015 167.621 147.756 1.00 59.75  ?  38   ALA B C     1 
ATOM   987   O  O     . ALA B 2  39   ? 155.093 167.016 147.735 1.00 59.31  ?  38   ALA B O     1 
ATOM   988   C  CB    . ALA B 2  39   ? 152.240 166.245 146.645 1.00 59.29  ?  38   ALA B CB    1 
ATOM   989   N  N     . ARG B 2  40   ? 153.935 168.944 147.597 1.00 59.05  ?  39   ARG B N     1 
ATOM   990   C  CA    . ARG B 2  40   ? 155.148 169.748 147.493 1.00 58.69  ?  39   ARG B CA    1 
ATOM   991   C  C     . ARG B 2  40   ? 155.905 169.763 148.815 1.00 58.29  ?  39   ARG B C     1 
ATOM   992   O  O     . ARG B 2  40   ? 157.139 169.696 148.832 1.00 58.20  ?  39   ARG B O     1 
ATOM   993   C  CB    . ARG B 2  40   ? 154.803 171.171 147.055 1.00 58.57  ?  39   ARG B CB    1 
ATOM   994   C  CG    . ARG B 2  40   ? 155.951 171.897 146.378 1.00 59.52  ?  39   ARG B CG    1 
ATOM   995   C  CD    . ARG B 2  40   ? 156.209 171.319 144.998 1.00 61.02  ?  39   ARG B CD    1 
ATOM   996   N  NE    . ARG B 2  40   ? 155.177 171.716 144.045 1.00 64.78  ?  39   ARG B NE    1 
ATOM   997   C  CZ    . ARG B 2  40   ? 154.922 171.079 142.908 1.00 67.90  ?  39   ARG B CZ    1 
ATOM   998   N  NH1   . ARG B 2  40   ? 155.617 169.998 142.580 1.00 69.71  ?  39   ARG B NH1   1 
ATOM   999   N  NH2   . ARG B 2  40   ? 153.966 171.517 142.101 1.00 67.85  ?  39   ARG B NH2   1 
ATOM   1000  N  N     . ARG B 2  41   ? 155.180 169.850 149.933 1.00 57.86  ?  40   ARG B N     1 
ATOM   1001  C  CA    . ARG B 2  41   ? 155.820 169.738 151.239 1.00 57.57  ?  40   ARG B CA    1 
ATOM   1002  C  C     . ARG B 2  41   ? 156.282 168.313 151.512 1.00 58.86  ?  40   ARG B C     1 
ATOM   1003  O  O     . ARG B 2  41   ? 157.328 168.110 152.139 1.00 60.00  ?  40   ARG B O     1 
ATOM   1004  C  CB    . ARG B 2  41   ? 154.864 170.209 152.336 1.00 57.32  ?  40   ARG B CB    1 
ATOM   1005  C  CG    . ARG B 2  41   ? 155.421 170.083 153.747 1.00 55.48  ?  40   ARG B CG    1 
ATOM   1006  C  CD    . ARG B 2  41   ? 154.418 170.557 154.786 1.00 55.42  ?  40   ARG B CD    1 
ATOM   1007  N  NE    . ARG B 2  41   ? 154.115 171.979 154.647 1.00 51.12  ?  40   ARG B NE    1 
ATOM   1008  C  CZ    . ARG B 2  41   ? 153.290 172.649 155.445 1.00 54.84  ?  40   ARG B CZ    1 
ATOM   1009  N  NH1   . ARG B 2  41   ? 152.679 172.026 156.444 1.00 52.41  ?  40   ARG B NH1   1 
ATOM   1010  N  NH2   . ARG B 2  41   ? 153.074 173.942 155.244 1.00 55.99  ?  40   ARG B NH2   1 
ATOM   1011  N  N     . GLY B 2  42   ? 155.524 167.317 151.046 1.00 59.85  ?  41   GLY B N     1 
ATOM   1012  C  CA    . GLY B 2  42   ? 155.915 165.931 151.235 1.00 61.31  ?  41   GLY B CA    1 
ATOM   1013  C  C     . GLY B 2  42   ? 157.178 165.538 150.499 1.00 62.05  ?  41   GLY B C     1 
ATOM   1014  O  O     . GLY B 2  42   ? 157.861 164.599 150.921 1.00 62.25  ?  41   GLY B O     1 
ATOM   1015  N  N     . GLY B 2  43   ? 157.503 166.231 149.410 1.00 62.71  ?  42   GLY B N     1 
ATOM   1016  C  CA    . GLY B 2  43   ? 158.713 165.947 148.665 1.00 65.10  ?  42   GLY B CA    1 
ATOM   1017  C  C     . GLY B 2  43   ? 158.464 165.216 147.363 1.00 66.91  ?  42   GLY B C     1 
ATOM   1018  O  O     . GLY B 2  43   ? 159.115 164.207 147.076 1.00 67.30  ?  42   GLY B O     1 
ATOM   1019  N  N     . VAL B 2  44   ? 157.523 165.715 146.565 1.00 68.88  ?  43   VAL B N     1 
ATOM   1020  C  CA    . VAL B 2  44   ? 157.171 165.121 145.281 1.00 69.88  ?  43   VAL B CA    1 
ATOM   1021  C  C     . VAL B 2  44   ? 157.453 166.141 144.189 1.00 70.92  ?  43   VAL B C     1 
ATOM   1022  O  O     . VAL B 2  44   ? 157.041 167.302 144.296 1.00 70.87  ?  43   VAL B O     1 
ATOM   1023  C  CB    . VAL B 2  44   ? 155.699 164.673 145.245 1.00 69.93  ?  43   VAL B CB    1 
ATOM   1024  C  CG1   . VAL B 2  44   ? 155.387 163.982 143.927 1.00 70.93  ?  43   VAL B CG1   1 
ATOM   1025  C  CG2   . VAL B 2  44   ? 155.393 163.755 146.419 1.00 70.22  ?  43   VAL B CG2   1 
ATOM   1026  N  N     . LYS B 2  45   ? 158.155 165.708 143.142 1.00 71.66  ?  44   LYS B N     1 
ATOM   1027  C  CA    . LYS B 2  45   ? 158.492 166.589 142.031 1.00 72.54  ?  44   LYS B CA    1 
ATOM   1028  C  C     . LYS B 2  45   ? 157.265 166.869 141.172 1.00 73.36  ?  44   LYS B C     1 
ATOM   1029  O  O     . LYS B 2  45   ? 156.774 168.002 141.130 1.00 73.60  ?  44   LYS B O     1 
ATOM   1030  C  CB    . LYS B 2  45   ? 159.610 165.978 141.184 1.00 72.49  ?  44   LYS B CB    1 
ATOM   1031  C  CG    . LYS B 2  45   ? 160.122 166.886 140.077 1.00 73.58  ?  44   LYS B CG    1 
ATOM   1032  C  CD    . LYS B 2  45   ? 161.214 166.206 139.266 1.00 75.21  ?  44   LYS B CD    1 
ATOM   1033  C  CE    . LYS B 2  45   ? 161.779 167.137 138.206 1.00 75.22  ?  44   LYS B CE    1 
ATOM   1034  N  NZ    . LYS B 2  45   ? 162.440 168.328 138.808 1.00 77.26  ?  44   LYS B NZ    1 
ATOM   1035  N  N     . ARG B 2  46   ? 156.764 165.844 140.487 1.00 73.84  ?  45   ARG B N     1 
ATOM   1036  C  CA    . ARG B 2  46   ? 155.601 165.969 139.619 1.00 74.10  ?  45   ARG B CA    1 
ATOM   1037  C  C     . ARG B 2  46   ? 154.618 164.853 139.939 1.00 73.97  ?  45   ARG B C     1 
ATOM   1038  O  O     . ARG B 2  46   ? 155.009 163.685 140.033 1.00 73.99  ?  45   ARG B O     1 
ATOM   1039  C  CB    . ARG B 2  46   ? 156.003 165.917 138.141 1.00 74.55  ?  45   ARG B CB    1 
ATOM   1040  C  CG    . ARG B 2  46   ? 156.917 167.052 137.706 1.00 75.36  ?  45   ARG B CG    1 
ATOM   1041  C  CD    . ARG B 2  46   ? 157.324 166.909 136.249 1.00 78.48  ?  45   ARG B CD    1 
ATOM   1042  N  NE    . ARG B 2  46   ? 158.062 165.672 136.008 1.00 82.23  ?  45   ARG B NE    1 
ATOM   1043  C  CZ    . ARG B 2  46   ? 158.538 165.305 134.823 1.00 84.16  ?  45   ARG B CZ    1 
ATOM   1044  N  NH1   . ARG B 2  46   ? 159.198 164.162 134.697 1.00 84.42  ?  45   ARG B NH1   1 
ATOM   1045  N  NH2   . ARG B 2  46   ? 158.354 166.080 133.763 1.00 85.51  ?  45   ARG B NH2   1 
ATOM   1046  N  N     . ILE B 2  47   ? 153.346 165.214 140.104 1.00 73.61  ?  46   ILE B N     1 
ATOM   1047  C  CA    . ILE B 2  47   ? 152.310 164.243 140.437 1.00 73.12  ?  46   ILE B CA    1 
ATOM   1048  C  C     . ILE B 2  47   ? 151.555 163.855 139.173 1.00 72.99  ?  46   ILE B C     1 
ATOM   1049  O  O     . ILE B 2  47   ? 151.938 164.241 138.062 1.00 73.52  ?  46   ILE B O     1 
ATOM   1050  C  CB    . ILE B 2  47   ? 151.351 164.791 141.509 1.00 72.86  ?  46   ILE B CB    1 
ATOM   1051  C  CG1   . ILE B 2  47   ? 150.541 165.967 140.958 1.00 72.57  ?  46   ILE B CG1   1 
ATOM   1052  C  CG2   . ILE B 2  47   ? 152.124 165.215 142.746 1.00 73.45  ?  46   ILE B CG2   1 
ATOM   1053  C  CD1   . ILE B 2  47   ? 149.489 166.479 141.918 1.00 74.07  ?  46   ILE B CD1   1 
ATOM   1054  N  N     . SER B 2  48   ? 150.479 163.087 139.333 1.00 72.52  ?  47   SER B N     1 
ATOM   1055  C  CA    . SER B 2  48   ? 149.699 162.621 138.194 1.00 71.97  ?  47   SER B CA    1 
ATOM   1056  C  C     . SER B 2  48   ? 148.449 163.472 138.008 1.00 71.61  ?  47   SER B C     1 
ATOM   1057  O  O     . SER B 2  48   ? 148.512 164.704 138.083 1.00 71.63  ?  47   SER B O     1 
ATOM   1058  C  CB    . SER B 2  48   ? 149.323 161.148 138.375 1.00 72.12  ?  47   SER B CB    1 
ATOM   1059  O  OG    . SER B 2  48   ? 148.643 160.648 137.237 1.00 71.58  ?  47   SER B OG    1 
ATOM   1060  N  N     . GLY B 2  49   ? 147.313 162.826 137.762 1.00 71.62  ?  48   GLY B N     1 
ATOM   1061  C  CA    . GLY B 2  49   ? 146.059 163.533 137.596 1.00 71.87  ?  48   GLY B CA    1 
ATOM   1062  C  C     . GLY B 2  49   ? 144.969 163.024 138.515 1.00 71.91  ?  48   GLY B C     1 
ATOM   1063  O  O     . GLY B 2  49   ? 144.469 163.768 139.363 1.00 71.52  ?  48   GLY B O     1 
ATOM   1064  N  N     . LEU B 2  50   ? 144.594 161.755 138.365 1.00 72.05  ?  49   LEU B N     1 
ATOM   1065  C  CA    . LEU B 2  50   ? 143.539 161.181 139.192 1.00 72.22  ?  49   LEU B CA    1 
ATOM   1066  C  C     . LEU B 2  50   ? 144.077 160.756 140.553 1.00 72.22  ?  49   LEU B C     1 
ATOM   1067  O  O     . LEU B 2  50   ? 143.903 159.605 140.967 1.00 72.63  ?  49   LEU B O     1 
ATOM   1068  C  CB    . LEU B 2  50   ? 142.883 159.997 138.476 1.00 72.45  ?  49   LEU B CB    1 
ATOM   1069  C  CG    . LEU B 2  50   ? 142.110 160.273 137.183 1.00 72.76  ?  49   LEU B CG    1 
ATOM   1070  C  CD1   . LEU B 2  50   ? 141.640 158.990 136.509 1.00 71.89  ?  49   LEU B CD1   1 
ATOM   1071  C  CD2   . LEU B 2  50   ? 140.935 161.193 137.465 1.00 70.68  ?  49   LEU B CD2   1 
ATOM   1072  N  N     . ILE B 2  51   ? 144.724 161.680 141.256 1.00 71.91  ?  50   ILE B N     1 
ATOM   1073  C  CA    . ILE B 2  51   ? 145.294 161.405 142.567 1.00 71.24  ?  50   ILE B CA    1 
ATOM   1074  C  C     . ILE B 2  51   ? 144.557 162.153 143.670 1.00 71.25  ?  50   ILE B C     1 
ATOM   1075  O  O     . ILE B 2  51   ? 144.335 161.605 144.749 1.00 71.40  ?  50   ILE B O     1 
ATOM   1076  C  CB    . ILE B 2  51   ? 146.800 161.744 142.575 1.00 71.28  ?  50   ILE B CB    1 
ATOM   1077  C  CG1   . ILE B 2  51   ? 147.530 160.958 141.484 1.00 70.91  ?  50   ILE B CG1   1 
ATOM   1078  C  CG2   . ILE B 2  51   ? 147.406 161.449 143.939 1.00 70.61  ?  50   ILE B CG2   1 
ATOM   1079  C  CD1   . ILE B 2  51   ? 147.490 159.458 141.676 1.00 68.90  ?  50   ILE B CD1   1 
ATOM   1080  N  N     . TYR B 2  52   ? 144.168 163.407 143.420 1.00 71.17  ?  51   TYR B N     1 
ATOM   1081  C  CA    . TYR B 2  52   ? 143.459 164.168 144.444 1.00 70.81  ?  51   TYR B CA    1 
ATOM   1082  C  C     . TYR B 2  52   ? 142.055 163.625 144.679 1.00 71.02  ?  51   TYR B C     1 
ATOM   1083  O  O     . TYR B 2  52   ? 141.523 163.747 145.789 1.00 71.83  ?  51   TYR B O     1 
ATOM   1084  C  CB    . TYR B 2  52   ? 143.405 165.649 144.063 1.00 71.31  ?  51   TYR B CB    1 
ATOM   1085  C  CG    . TYR B 2  52   ? 142.963 165.921 142.643 1.00 72.17  ?  51   TYR B CG    1 
ATOM   1086  C  CD1   . TYR B 2  52   ? 141.617 165.925 142.300 1.00 72.04  ?  51   TYR B CD1   1 
ATOM   1087  C  CD2   . TYR B 2  52   ? 143.892 166.189 141.648 1.00 73.98  ?  51   TYR B CD2   1 
ATOM   1088  C  CE1   . TYR B 2  52   ? 141.210 166.177 141.005 1.00 72.58  ?  51   TYR B CE1   1 
ATOM   1089  C  CE2   . TYR B 2  52   ? 143.495 166.446 140.350 1.00 74.18  ?  51   TYR B CE2   1 
ATOM   1090  C  CZ    . TYR B 2  52   ? 142.153 166.436 140.034 1.00 73.72  ?  51   TYR B CZ    1 
ATOM   1091  O  OH    . TYR B 2  52   ? 141.753 166.689 138.743 1.00 73.86  ?  51   TYR B OH    1 
ATOM   1092  N  N     . GLU B 2  53   ? 141.446 163.021 143.656 1.00 70.39  ?  52   GLU B N     1 
ATOM   1093  C  CA    . GLU B 2  53   ? 140.110 162.458 143.817 1.00 69.68  ?  52   GLU B CA    1 
ATOM   1094  C  C     . GLU B 2  53   ? 140.120 161.290 144.797 1.00 69.04  ?  52   GLU B C     1 
ATOM   1095  O  O     . GLU B 2  53   ? 139.222 161.168 145.638 1.00 69.43  ?  52   GLU B O     1 
ATOM   1096  C  CB    . GLU B 2  53   ? 139.562 162.022 142.458 1.00 70.18  ?  52   GLU B CB    1 
ATOM   1097  C  CG    . GLU B 2  53   ? 138.140 161.488 142.494 1.00 71.72  ?  52   GLU B CG    1 
ATOM   1098  C  CD    . GLU B 2  53   ? 137.113 162.564 142.790 1.00 75.09  ?  52   GLU B CD    1 
ATOM   1099  O  OE1   . GLU B 2  53   ? 137.408 163.756 142.562 1.00 75.51  ?  52   GLU B OE1   1 
ATOM   1100  O  OE2   . GLU B 2  53   ? 136.007 162.214 143.252 1.00 76.24  ?  52   GLU B OE2   1 
ATOM   1101  N  N     . GLU B 2  54   ? 141.129 160.420 144.704 1.00 68.09  ?  53   GLU B N     1 
ATOM   1102  C  CA    . GLU B 2  54   ? 141.274 159.353 145.688 1.00 67.50  ?  53   GLU B CA    1 
ATOM   1103  C  C     . GLU B 2  54   ? 141.819 159.886 147.006 1.00 66.73  ?  53   GLU B C     1 
ATOM   1104  O  O     . GLU B 2  54   ? 141.537 159.319 148.069 1.00 66.53  ?  53   GLU B O     1 
ATOM   1105  C  CB    . GLU B 2  54   ? 142.181 158.250 145.141 1.00 67.03  ?  53   GLU B CB    1 
ATOM   1106  C  CG    . GLU B 2  54   ? 142.259 157.007 146.017 1.00 69.55  ?  53   GLU B CG    1 
ATOM   1107  C  CD    . GLU B 2  54   ? 143.136 155.925 145.417 1.00 71.56  ?  53   GLU B CD    1 
ATOM   1108  O  OE1   . GLU B 2  54   ? 143.712 156.160 144.334 1.00 73.03  ?  53   GLU B OE1   1 
ATOM   1109  O  OE2   . GLU B 2  54   ? 143.249 154.841 146.027 1.00 71.76  ?  53   GLU B OE2   1 
ATOM   1110  N  N     . THR B 2  55   ? 142.592 160.974 146.958 1.00 65.45  ?  54   THR B N     1 
ATOM   1111  C  CA    . THR B 2  55   ? 143.106 161.577 148.183 1.00 63.73  ?  54   THR B CA    1 
ATOM   1112  C  C     . THR B 2  55   ? 141.971 162.101 149.054 1.00 63.36  ?  54   THR B C     1 
ATOM   1113  O  O     . THR B 2  55   ? 142.023 161.995 150.286 1.00 63.38  ?  54   THR B O     1 
ATOM   1114  C  CB    . THR B 2  55   ? 144.087 162.700 147.844 1.00 64.01  ?  54   THR B CB    1 
ATOM   1115  O  OG1   . THR B 2  55   ? 145.112 162.195 146.980 1.00 59.55  ?  54   THR B OG1   1 
ATOM   1116  C  CG2   . THR B 2  55   ? 144.727 163.250 149.109 1.00 62.91  ?  54   THR B CG2   1 
ATOM   1117  N  N     . ARG B 2  56   ? 140.934 162.668 148.431 1.00 62.39  ?  55   ARG B N     1 
ATOM   1118  C  CA    . ARG B 2  56   ? 139.758 163.082 149.189 1.00 61.53  ?  55   ARG B CA    1 
ATOM   1119  C  C     . ARG B 2  56   ? 139.082 161.894 149.859 1.00 60.91  ?  55   ARG B C     1 
ATOM   1120  O  O     . ARG B 2  56   ? 138.524 162.032 150.953 1.00 60.12  ?  55   ARG B O     1 
ATOM   1121  C  CB    . ARG B 2  56   ? 138.768 163.813 148.280 1.00 61.40  ?  55   ARG B CB    1 
ATOM   1122  C  CG    . ARG B 2  56   ? 139.301 165.102 147.674 1.00 61.74  ?  55   ARG B CG    1 
ATOM   1123  C  CD    . ARG B 2  56   ? 138.223 165.830 146.883 1.00 60.12  ?  55   ARG B CD    1 
ATOM   1124  N  NE    . ARG B 2  56   ? 138.742 167.021 146.217 1.00 61.51  ?  55   ARG B NE    1 
ATOM   1125  C  CZ    . ARG B 2  56   ? 139.137 167.055 144.949 1.00 62.12  ?  55   ARG B CZ    1 
ATOM   1126  N  NH1   . ARG B 2  56   ? 139.066 165.962 144.203 1.00 61.72  ?  55   ARG B NH1   1 
ATOM   1127  N  NH2   . ARG B 2  56   ? 139.599 168.182 144.424 1.00 62.19  ?  55   ARG B NH2   1 
ATOM   1128  N  N     . GLY B 2  57   ? 139.118 160.722 149.221 1.00 60.39  ?  56   GLY B N     1 
ATOM   1129  C  CA    . GLY B 2  57   ? 138.583 159.531 149.858 1.00 59.80  ?  56   GLY B CA    1 
ATOM   1130  C  C     . GLY B 2  57   ? 139.450 159.049 151.005 1.00 59.91  ?  56   GLY B C     1 
ATOM   1131  O  O     . GLY B 2  57   ? 138.941 158.545 152.010 1.00 59.69  ?  56   GLY B O     1 
ATOM   1132  N  N     . VAL B 2  58   ? 140.771 159.194 150.870 1.00 60.25  ?  57   VAL B N     1 
ATOM   1133  C  CA    . VAL B 2  58   ? 141.673 158.846 151.965 1.00 59.72  ?  57   VAL B CA    1 
ATOM   1134  C  C     . VAL B 2  58   ? 141.415 159.745 153.167 1.00 59.49  ?  57   VAL B C     1 
ATOM   1135  O  O     . VAL B 2  58   ? 141.349 159.276 154.311 1.00 59.34  ?  57   VAL B O     1 
ATOM   1136  C  CB    . VAL B 2  58   ? 143.139 158.928 151.498 1.00 60.32  ?  57   VAL B CB    1 
ATOM   1137  C  CG1   . VAL B 2  58   ? 144.082 158.641 152.656 1.00 60.92  ?  57   VAL B CG1   1 
ATOM   1138  C  CG2   . VAL B 2  58   ? 143.388 157.958 150.353 1.00 61.17  ?  57   VAL B CG2   1 
ATOM   1139  N  N     . LEU B 2  59   ? 141.261 161.050 152.928 1.00 58.87  ?  58   LEU B N     1 
ATOM   1140  C  CA    . LEU B 2  59   ? 140.906 161.961 154.011 1.00 58.15  ?  58   LEU B CA    1 
ATOM   1141  C  C     . LEU B 2  59   ? 139.518 161.659 154.560 1.00 58.45  ?  58   LEU B C     1 
ATOM   1142  O  O     . LEU B 2  59   ? 139.263 161.870 155.752 1.00 58.88  ?  58   LEU B O     1 
ATOM   1143  C  CB    . LEU B 2  59   ? 140.983 163.409 153.525 1.00 58.11  ?  58   LEU B CB    1 
ATOM   1144  C  CG    . LEU B 2  59   ? 140.719 164.505 154.560 1.00 57.74  ?  58   LEU B CG    1 
ATOM   1145  C  CD1   . LEU B 2  59   ? 141.734 164.432 155.690 1.00 59.00  ?  58   LEU B CD1   1 
ATOM   1146  C  CD2   . LEU B 2  59   ? 140.739 165.876 153.904 1.00 58.27  ?  58   LEU B CD2   1 
ATOM   1147  N  N     . LYS B 2  60   ? 138.614 161.162 153.713 1.00 58.63  ?  59   LYS B N     1 
ATOM   1148  C  CA    . LYS B 2  60   ? 137.277 160.805 154.172 1.00 57.83  ?  59   LYS B CA    1 
ATOM   1149  C  C     . LYS B 2  60   ? 137.328 159.630 155.141 1.00 57.36  ?  59   LYS B C     1 
ATOM   1150  O  O     . LYS B 2  60   ? 136.708 159.666 156.211 1.00 57.36  ?  59   LYS B O     1 
ATOM   1151  C  CB    . LYS B 2  60   ? 136.384 160.478 152.974 1.00 58.68  ?  59   LYS B CB    1 
ATOM   1152  C  CG    . LYS B 2  60   ? 134.929 160.229 153.331 1.00 60.38  ?  59   LYS B CG    1 
ATOM   1153  C  CD    . LYS B 2  60   ? 134.237 161.517 153.740 1.00 63.26  ?  59   LYS B CD    1 
ATOM   1154  C  CE    . LYS B 2  60   ? 134.204 162.511 152.590 1.00 66.39  ?  59   LYS B CE    1 
ATOM   1155  N  NZ    . LYS B 2  60   ? 133.475 161.970 151.409 1.00 69.22  ?  59   LYS B NZ    1 
ATOM   1156  N  N     . VAL B 2  61   ? 138.064 158.576 154.781 1.00 55.97  ?  60   VAL B N     1 
ATOM   1157  C  CA    . VAL B 2  61   ? 138.184 157.416 155.659 1.00 54.30  ?  60   VAL B CA    1 
ATOM   1158  C  C     . VAL B 2  61   ? 138.941 157.783 156.929 1.00 54.49  ?  60   VAL B C     1 
ATOM   1159  O  O     . VAL B 2  61   ? 138.553 157.390 158.036 1.00 54.30  ?  60   VAL B O     1 
ATOM   1160  C  CB    . VAL B 2  61   ? 138.858 156.249 154.915 1.00 54.48  ?  60   VAL B CB    1 
ATOM   1161  C  CG1   . VAL B 2  61   ? 139.028 155.053 155.839 1.00 53.35  ?  60   VAL B CG1   1 
ATOM   1162  C  CG2   . VAL B 2  61   ? 138.048 155.866 153.686 1.00 53.99  ?  60   VAL B CG2   1 
ATOM   1163  N  N     . PHE B 2  62   ? 140.027 158.544 156.795 1.00 54.25  ?  61   PHE B N     1 
ATOM   1164  C  CA    . PHE B 2  62   ? 140.801 159.003 157.941 1.00 54.08  ?  61   PHE B CA    1 
ATOM   1165  C  C     . PHE B 2  62   ? 140.199 160.233 158.613 1.00 54.09  ?  61   PHE B C     1 
ATOM   1166  O  O     . PHE B 2  62   ? 140.886 160.892 159.402 1.00 54.29  ?  61   PHE B O     1 
ATOM   1167  C  CB    . PHE B 2  62   ? 142.245 159.292 157.521 1.00 54.16  ?  61   PHE B CB    1 
ATOM   1168  C  CG    . PHE B 2  62   ? 143.047 158.058 157.218 1.00 53.75  ?  61   PHE B CG    1 
ATOM   1169  C  CD1   . PHE B 2  62   ? 142.668 156.827 157.727 1.00 52.00  ?  61   PHE B CD1   1 
ATOM   1170  C  CD2   . PHE B 2  62   ? 144.183 158.131 156.429 1.00 53.77  ?  61   PHE B CD2   1 
ATOM   1171  C  CE1   . PHE B 2  62   ? 143.405 155.690 157.452 1.00 51.97  ?  61   PHE B CE1   1 
ATOM   1172  C  CE2   . PHE B 2  62   ? 144.924 156.997 156.150 1.00 49.89  ?  61   PHE B CE2   1 
ATOM   1173  C  CZ    . PHE B 2  62   ? 144.534 155.776 156.662 1.00 54.52  ?  61   PHE B CZ    1 
ATOM   1174  N  N     . LEU B 2  63   ? 138.946 160.554 158.322 1.00 53.56  ?  62   LEU B N     1 
ATOM   1175  C  CA    . LEU B 2  63   ? 138.268 161.695 158.928 1.00 54.26  ?  62   LEU B CA    1 
ATOM   1176  C  C     . LEU B 2  63   ? 136.948 161.319 159.583 1.00 55.24  ?  62   LEU B C     1 
ATOM   1177  O  O     . LEU B 2  63   ? 136.634 161.838 160.658 1.00 53.85  ?  62   LEU B O     1 
ATOM   1178  C  CB    . LEU B 2  63   ? 138.032 162.787 157.871 1.00 53.29  ?  62   LEU B CB    1 
ATOM   1179  C  CG    . LEU B 2  63   ? 137.406 164.094 158.359 1.00 51.38  ?  62   LEU B CG    1 
ATOM   1180  C  CD1   . LEU B 2  63   ? 138.286 164.755 159.408 1.00 49.73  ?  62   LEU B CD1   1 
ATOM   1181  C  CD2   . LEU B 2  63   ? 137.158 165.036 157.191 1.00 51.71  ?  62   LEU B CD2   1 
ATOM   1182  N  N     . GLU B 2  64   ? 136.169 160.425 158.967 1.00 56.07  ?  63   GLU B N     1 
ATOM   1183  C  CA    . GLU B 2  64   ? 134.891 160.028 159.552 1.00 57.89  ?  63   GLU B CA    1 
ATOM   1184  C  C     . GLU B 2  64   ? 135.076 159.295 160.874 1.00 57.48  ?  63   GLU B C     1 
ATOM   1185  O  O     . GLU B 2  64   ? 134.179 159.321 161.725 1.00 57.87  ?  63   GLU B O     1 
ATOM   1186  C  CB    . GLU B 2  64   ? 134.108 159.156 158.570 1.00 58.84  ?  63   GLU B CB    1 
ATOM   1187  C  CG    . GLU B 2  64   ? 133.633 159.888 157.326 1.00 60.10  ?  63   GLU B CG    1 
ATOM   1188  C  CD    . GLU B 2  64   ? 132.813 159.001 156.409 1.00 60.53  ?  63   GLU B CD    1 
ATOM   1189  O  OE1   . GLU B 2  64   ? 132.721 157.786 156.681 1.00 62.35  ?  63   GLU B OE1   1 
ATOM   1190  O  OE2   . GLU B 2  64   ? 132.258 159.520 155.418 1.00 64.36  ?  63   GLU B OE2   1 
ATOM   1191  N  N     . ASN B 2  65   ? 136.220 158.635 161.066 1.00 57.32  ?  64   ASN B N     1 
ATOM   1192  C  CA    . ASN B 2  65   ? 136.473 157.958 162.334 1.00 58.55  ?  64   ASN B CA    1 
ATOM   1193  C  C     . ASN B 2  65   ? 136.783 158.958 163.441 1.00 58.31  ?  64   ASN B C     1 
ATOM   1194  O  O     . ASN B 2  65   ? 136.283 158.824 164.565 1.00 57.99  ?  64   ASN B O     1 
ATOM   1195  C  CB    . ASN B 2  65   ? 137.614 156.953 162.175 1.00 58.75  ?  64   ASN B CB    1 
ATOM   1196  C  CG    . ASN B 2  65   ? 138.814 157.537 161.453 1.00 59.82  ?  64   ASN B CG    1 
ATOM   1197  O  OD1   . ASN B 2  65   ? 138.930 158.753 161.296 1.00 62.06  ?  64   ASN B OD1   1 
ATOM   1198  N  ND2   . ASN B 2  65   ? 139.717 156.670 161.010 1.00 61.49  ?  64   ASN B ND2   1 
ATOM   1199  N  N     . VAL B 2  66   ? 137.600 159.970 163.143 1.00 58.31  ?  65   VAL B N     1 
ATOM   1200  C  CA    . VAL B 2  66   ? 137.919 160.987 164.140 1.00 58.41  ?  65   VAL B CA    1 
ATOM   1201  C  C     . VAL B 2  66   ? 136.684 161.815 164.473 1.00 58.59  ?  65   VAL B C     1 
ATOM   1202  O  O     . VAL B 2  66   ? 136.430 162.135 165.641 1.00 59.65  ?  65   VAL B O     1 
ATOM   1203  C  CB    . VAL B 2  66   ? 139.081 161.870 163.650 1.00 58.90  ?  65   VAL B CB    1 
ATOM   1204  C  CG1   . VAL B 2  66   ? 139.438 162.913 164.698 1.00 58.58  ?  65   VAL B CG1   1 
ATOM   1205  C  CG2   . VAL B 2  66   ? 140.291 161.013 163.309 1.00 57.84  ?  65   VAL B CG2   1 
ATOM   1206  N  N     . ILE B 2  67   ? 135.895 162.172 163.456 1.00 58.46  ?  66   ILE B N     1 
ATOM   1207  C  CA    . ILE B 2  67   ? 134.661 162.913 163.702 1.00 58.06  ?  66   ILE B CA    1 
ATOM   1208  C  C     . ILE B 2  67   ? 133.678 162.059 164.492 1.00 58.35  ?  66   ILE B C     1 
ATOM   1209  O  O     . ILE B 2  67   ? 132.997 162.549 165.402 1.00 57.35  ?  66   ILE B O     1 
ATOM   1210  C  CB    . ILE B 2  67   ? 134.053 163.400 162.373 1.00 57.52  ?  66   ILE B CB    1 
ATOM   1211  C  CG1   . ILE B 2  67   ? 134.986 164.406 161.696 1.00 55.82  ?  66   ILE B CG1   1 
ATOM   1212  C  CG2   . ILE B 2  67   ? 132.683 164.020 162.603 1.00 58.18  ?  66   ILE B CG2   1 
ATOM   1213  C  CD1   . ILE B 2  67   ? 134.442 164.963 160.400 1.00 51.87  ?  66   ILE B CD1   1 
ATOM   1214  N  N     . ARG B 2  68   ? 133.595 160.767 164.165 1.00 59.11  ?  67   ARG B N     1 
ATOM   1215  C  CA    . ARG B 2  68   ? 132.700 159.869 164.890 1.00 60.52  ?  67   ARG B CA    1 
ATOM   1216  C  C     . ARG B 2  68   ? 133.093 159.771 166.359 1.00 60.24  ?  67   ARG B C     1 
ATOM   1217  O  O     . ARG B 2  68   ? 132.238 159.841 167.250 1.00 61.12  ?  67   ARG B O     1 
ATOM   1218  C  CB    . ARG B 2  68   ? 132.707 158.487 164.234 1.00 60.14  ?  67   ARG B CB    1 
ATOM   1219  C  CG    . ARG B 2  68   ? 131.869 157.448 164.960 1.00 62.66  ?  67   ARG B CG    1 
ATOM   1220  C  CD    . ARG B 2  68   ? 131.948 156.097 164.267 1.00 63.70  ?  67   ARG B CD    1 
ATOM   1221  N  NE    . ARG B 2  68   ? 131.489 156.165 162.883 1.00 73.27  ?  67   ARG B NE    1 
ATOM   1222  C  CZ    . ARG B 2  68   ? 131.472 155.129 162.050 1.00 75.46  ?  67   ARG B CZ    1 
ATOM   1223  N  NH1   . ARG B 2  68   ? 131.890 153.939 162.459 1.00 76.05  ?  67   ARG B NH1   1 
ATOM   1224  N  NH2   . ARG B 2  68   ? 131.038 155.283 160.807 1.00 75.94  ?  67   ARG B NH2   1 
ATOM   1225  N  N     . ASP B 2  69   ? 134.391 159.611 166.630 1.00 60.01  ?  68   ASP B N     1 
ATOM   1226  C  CA    . ASP B 2  69   ? 134.851 159.550 168.013 1.00 59.16  ?  68   ASP B CA    1 
ATOM   1227  C  C     . ASP B 2  69   ? 134.613 160.873 168.731 1.00 58.66  ?  68   ASP B C     1 
ATOM   1228  O  O     . ASP B 2  69   ? 134.292 160.891 169.925 1.00 57.42  ?  68   ASP B O     1 
ATOM   1229  C  CB    . ASP B 2  69   ? 136.331 159.170 168.060 1.00 59.13  ?  68   ASP B CB    1 
ATOM   1230  C  CG    . ASP B 2  69   ? 136.601 157.806 167.456 1.00 60.72  ?  68   ASP B CG    1 
ATOM   1231  O  OD1   . ASP B 2  69   ? 135.690 156.953 167.478 1.00 60.32  ?  68   ASP B OD1   1 
ATOM   1232  O  OD2   . ASP B 2  69   ? 137.726 157.587 166.960 1.00 61.51  ?  68   ASP B OD2   1 
ATOM   1233  N  N     . ALA B 2  70   ? 134.762 161.993 168.018 1.00 58.51  ?  69   ALA B N     1 
ATOM   1234  C  CA    . ALA B 2  70   ? 134.502 163.293 168.627 1.00 59.04  ?  69   ALA B CA    1 
ATOM   1235  C  C     . ALA B 2  70   ? 133.033 163.441 169.005 1.00 59.67  ?  69   ALA B C     1 
ATOM   1236  O  O     . ALA B 2  70   ? 132.709 163.960 170.079 1.00 59.39  ?  69   ALA B O     1 
ATOM   1237  C  CB    . ALA B 2  70   ? 134.930 164.413 167.678 1.00 59.00  ?  69   ALA B CB    1 
ATOM   1238  N  N     . VAL B 2  71   ? 132.129 162.986 168.133 1.00 61.69  ?  70   VAL B N     1 
ATOM   1239  C  CA    . VAL B 2  71   ? 130.705 163.036 168.450 1.00 62.18  ?  70   VAL B CA    1 
ATOM   1240  C  C     . VAL B 2  71   ? 130.377 162.093 169.601 1.00 62.43  ?  70   VAL B C     1 
ATOM   1241  O  O     . VAL B 2  71   ? 129.513 162.396 170.434 1.00 63.71  ?  70   VAL B O     1 
ATOM   1242  C  CB    . VAL B 2  71   ? 129.869 162.717 167.195 1.00 62.16  ?  70   VAL B CB    1 
ATOM   1243  C  CG1   . VAL B 2  71   ? 128.387 162.663 167.533 1.00 64.08  ?  70   VAL B CG1   1 
ATOM   1244  C  CG2   . VAL B 2  71   ? 130.127 163.752 166.112 1.00 62.21  ?  70   VAL B CG2   1 
ATOM   1245  N  N     . THR B 2  72   ? 131.061 160.949 169.682 1.00 62.61  ?  71   THR B N     1 
ATOM   1246  C  CA    . THR B 2  72   ? 130.817 160.019 170.781 1.00 63.12  ?  71   THR B CA    1 
ATOM   1247  C  C     . THR B 2  72   ? 131.252 160.618 172.114 1.00 64.74  ?  71   THR B C     1 
ATOM   1248  O  O     . THR B 2  72   ? 130.494 160.598 173.093 1.00 65.60  ?  71   THR B O     1 
ATOM   1249  C  CB    . THR B 2  72   ? 131.540 158.697 170.523 1.00 62.61  ?  71   THR B CB    1 
ATOM   1250  O  OG1   . THR B 2  72   ? 131.135 158.168 169.255 1.00 63.21  ?  71   THR B OG1   1 
ATOM   1251  C  CG2   . THR B 2  72   ? 131.207 157.690 171.613 1.00 61.83  ?  71   THR B CG2   1 
ATOM   1252  N  N     . TYR B 2  73   ? 132.473 161.158 172.172 1.00 66.19  ?  72   TYR B N     1 
ATOM   1253  C  CA    . TYR B 2  73   ? 132.945 161.796 173.397 1.00 67.35  ?  72   TYR B CA    1 
ATOM   1254  C  C     . TYR B 2  73   ? 132.103 163.013 173.758 1.00 68.59  ?  72   TYR B C     1 
ATOM   1255  O  O     . TYR B 2  73   ? 131.913 163.305 174.944 1.00 68.87  ?  72   TYR B O     1 
ATOM   1256  C  CB    . TYR B 2  73   ? 134.414 162.197 173.255 1.00 67.25  ?  72   TYR B CB    1 
ATOM   1257  C  CG    . TYR B 2  73   ? 135.395 161.075 173.510 1.00 66.72  ?  72   TYR B CG    1 
ATOM   1258  C  CD1   . TYR B 2  73   ? 135.815 160.774 174.799 1.00 65.41  ?  72   TYR B CD1   1 
ATOM   1259  C  CD2   . TYR B 2  73   ? 135.911 160.324 172.463 1.00 66.65  ?  72   TYR B CD2   1 
ATOM   1260  C  CE1   . TYR B 2  73   ? 136.714 159.753 175.038 1.00 64.56  ?  72   TYR B CE1   1 
ATOM   1261  C  CE2   . TYR B 2  73   ? 136.811 159.301 172.692 1.00 66.90  ?  72   TYR B CE2   1 
ATOM   1262  C  CZ    . TYR B 2  73   ? 137.209 159.019 173.981 1.00 66.72  ?  72   TYR B CZ    1 
ATOM   1263  O  OH    . TYR B 2  73   ? 138.105 158.001 174.213 1.00 66.37  ?  72   TYR B OH    1 
ATOM   1264  N  N     . THR B 2  74   ? 131.596 163.734 172.757 1.00 69.59  ?  73   THR B N     1 
ATOM   1265  C  CA    . THR B 2  74   ? 130.754 164.893 173.036 1.00 71.01  ?  73   THR B CA    1 
ATOM   1266  C  C     . THR B 2  74   ? 129.416 164.467 173.628 1.00 73.10  ?  73   THR B C     1 
ATOM   1267  O  O     . THR B 2  74   ? 128.961 165.030 174.631 1.00 73.23  ?  73   THR B O     1 
ATOM   1268  C  CB    . THR B 2  74   ? 130.544 165.710 171.759 1.00 70.52  ?  73   THR B CB    1 
ATOM   1269  O  OG1   . THR B 2  74   ? 131.813 166.147 171.256 1.00 69.29  ?  73   THR B OG1   1 
ATOM   1270  C  CG2   . THR B 2  74   ? 129.671 166.925 172.039 1.00 69.30  ?  73   THR B CG2   1 
ATOM   1271  N  N     . GLU B 2  75   ? 128.773 163.465 173.023 1.00 74.84  ?  74   GLU B N     1 
ATOM   1272  C  CA    . GLU B 2  75   ? 127.478 163.007 173.514 1.00 76.88  ?  74   GLU B CA    1 
ATOM   1273  C  C     . GLU B 2  75   ? 127.598 162.330 174.874 1.00 77.21  ?  74   GLU B C     1 
ATOM   1274  O  O     . GLU B 2  75   ? 126.664 162.396 175.682 1.00 77.76  ?  74   GLU B O     1 
ATOM   1275  C  CB    . GLU B 2  75   ? 126.842 162.058 172.497 1.00 76.73  ?  74   GLU B CB    1 
ATOM   1276  C  CG    . GLU B 2  75   ? 125.443 161.588 172.862 1.00 78.13  ?  74   GLU B CG    1 
ATOM   1277  C  CD    . GLU B 2  75   ? 124.867 160.624 171.844 1.00 79.06  ?  74   GLU B CD    1 
ATOM   1278  O  OE1   . GLU B 2  75   ? 125.559 160.320 170.850 1.00 80.17  ?  74   GLU B OE1   1 
ATOM   1279  O  OE2   . GLU B 2  75   ? 123.720 160.170 172.038 1.00 83.19  ?  74   GLU B OE2   1 
ATOM   1280  N  N     . HIS B 2  76   ? 128.734 161.684 175.149 1.00 77.72  ?  75   HIS B N     1 
ATOM   1281  C  CA    . HIS B 2  76   ? 128.900 160.996 176.424 1.00 78.15  ?  75   HIS B CA    1 
ATOM   1282  C  C     . HIS B 2  76   ? 129.050 161.973 177.585 1.00 78.20  ?  75   HIS B C     1 
ATOM   1283  O  O     . HIS B 2  76   ? 128.721 161.630 178.727 1.00 78.71  ?  75   HIS B O     1 
ATOM   1284  C  CB    . HIS B 2  76   ? 130.107 160.060 176.360 1.00 77.62  ?  75   HIS B CB    1 
ATOM   1285  C  CG    . HIS B 2  76   ? 130.434 159.405 177.665 1.00 77.88  ?  75   HIS B CG    1 
ATOM   1286  N  ND1   . HIS B 2  76   ? 131.499 159.797 178.448 1.00 77.94  ?  75   HIS B ND1   1 
ATOM   1287  C  CD2   . HIS B 2  76   ? 129.833 158.390 178.329 1.00 79.61  ?  75   HIS B CD2   1 
ATOM   1288  C  CE1   . HIS B 2  76   ? 131.542 159.049 179.535 1.00 79.77  ?  75   HIS B CE1   1 
ATOM   1289  N  NE2   . HIS B 2  76   ? 130.543 158.187 179.488 1.00 80.69  ?  75   HIS B NE2   1 
ATOM   1290  N  N     . ALA B 2  77   ? 129.533 163.186 177.320 1.00 78.44  ?  76   ALA B N     1 
ATOM   1291  C  CA    . ALA B 2  77   ? 129.792 164.172 178.360 1.00 78.89  ?  76   ALA B CA    1 
ATOM   1292  C  C     . ALA B 2  77   ? 128.566 165.013 178.703 1.00 79.34  ?  76   ALA B C     1 
ATOM   1293  O  O     . ALA B 2  77   ? 128.714 166.092 179.291 1.00 79.54  ?  76   ALA B O     1 
ATOM   1294  C  CB    . ALA B 2  77   ? 130.951 165.081 177.946 1.00 78.97  ?  76   ALA B CB    1 
ATOM   1295  N  N     . LYS B 2  78   ? 127.366 164.543 178.352 1.00 79.65  ?  77   LYS B N     1 
ATOM   1296  C  CA    . LYS B 2  78   ? 126.113 165.243 178.646 1.00 79.56  ?  77   LYS B CA    1 
ATOM   1297  C  C     . LYS B 2  78   ? 126.122 166.663 178.080 1.00 79.14  ?  77   LYS B C     1 
ATOM   1298  O  O     . LYS B 2  78   ? 125.768 167.630 178.757 1.00 79.13  ?  77   LYS B O     1 
ATOM   1299  C  CB    . LYS B 2  78   ? 125.828 165.255 180.151 1.00 79.80  ?  77   LYS B CB    1 
ATOM   1300  C  CG    . LYS B 2  78   ? 125.510 163.891 180.741 1.00 81.69  ?  77   LYS B CG    1 
ATOM   1301  C  CD    . LYS B 2  78   ? 125.160 164.005 182.215 1.00 84.50  ?  77   LYS B CD    1 
ATOM   1302  C  CE    . LYS B 2  78   ? 124.774 162.659 182.803 1.00 85.52  ?  77   LYS B CE    1 
ATOM   1303  N  NZ    . LYS B 2  78   ? 124.416 162.769 184.243 1.00 86.46  ?  77   LYS B NZ    1 
ATOM   1304  N  N     . ARG B 2  79   ? 126.536 166.784 176.821 1.00 78.54  ?  78   ARG B N     1 
ATOM   1305  C  CA    . ARG B 2  79   ? 126.594 168.084 176.168 1.00 77.80  ?  78   ARG B CA    1 
ATOM   1306  C  C     . ARG B 2  79   ? 126.514 167.890 174.661 1.00 77.42  ?  78   ARG B C     1 
ATOM   1307  O  O     . ARG B 2  79   ? 126.844 166.820 174.142 1.00 76.92  ?  78   ARG B O     1 
ATOM   1308  C  CB    . ARG B 2  79   ? 127.870 168.846 176.546 1.00 78.02  ?  78   ARG B CB    1 
ATOM   1309  C  CG    . ARG B 2  79   ? 129.157 168.079 176.294 1.00 78.33  ?  78   ARG B CG    1 
ATOM   1310  C  CD    . ARG B 2  79   ? 130.364 168.850 176.806 1.00 77.86  ?  78   ARG B CD    1 
ATOM   1311  N  NE    . ARG B 2  79   ? 131.604 168.096 176.649 1.00 77.92  ?  78   ARG B NE    1 
ATOM   1312  C  CZ    . ARG B 2  79   ? 132.792 168.514 177.074 1.00 78.73  ?  78   ARG B CZ    1 
ATOM   1313  N  NH1   . ARG B 2  79   ? 132.906 169.684 177.687 1.00 79.29  ?  78   ARG B NH1   1 
ATOM   1314  N  NH2   . ARG B 2  79   ? 133.867 167.760 176.889 1.00 79.65  ?  78   ARG B NH2   1 
ATOM   1315  N  N     . LYS B 2  80   ? 126.070 168.935 173.969 1.00 77.30  ?  79   LYS B N     1 
ATOM   1316  C  CA    . LYS B 2  80   ? 125.922 168.927 172.519 1.00 77.43  ?  79   LYS B CA    1 
ATOM   1317  C  C     . LYS B 2  80   ? 126.800 169.995 171.878 1.00 76.94  ?  79   LYS B C     1 
ATOM   1318  O  O     . LYS B 2  80   ? 126.385 170.700 170.954 1.00 77.06  ?  79   LYS B O     1 
ATOM   1319  C  CB    . LYS B 2  80   ? 124.459 169.114 172.121 1.00 77.77  ?  79   LYS B CB    1 
ATOM   1320  C  CG    . LYS B 2  80   ? 123.519 168.081 172.722 1.00 79.15  ?  79   LYS B CG    1 
ATOM   1321  C  CD    . LYS B 2  80   ? 122.094 168.284 172.236 1.00 78.93  ?  79   LYS B CD    1 
ATOM   1322  C  CE    . LYS B 2  80   ? 122.002 168.132 170.727 1.00 82.51  ?  79   LYS B CE    1 
ATOM   1323  N  NZ    . LYS B 2  80   ? 120.609 168.317 170.234 1.00 82.75  ?  79   LYS B NZ    1 
ATOM   1324  N  N     . THR B 2  81   ? 128.031 170.124 172.369 1.00 76.33  ?  80   THR B N     1 
ATOM   1325  C  CA    . THR B 2  81   ? 128.989 171.092 171.846 1.00 75.48  ?  80   THR B CA    1 
ATOM   1326  C  C     . THR B 2  81   ? 130.367 170.449 171.844 1.00 74.49  ?  80   THR B C     1 
ATOM   1327  O  O     . THR B 2  81   ? 130.905 170.131 172.908 1.00 74.62  ?  80   THR B O     1 
ATOM   1328  C  CB    . THR B 2  81   ? 128.997 172.378 172.679 1.00 75.59  ?  80   THR B CB    1 
ATOM   1329  O  OG1   . THR B 2  81   ? 127.693 172.972 172.660 1.00 75.91  ?  80   THR B OG1   1 
ATOM   1330  C  CG2   . THR B 2  81   ? 130.009 173.372 172.123 1.00 75.70  ?  80   THR B CG2   1 
ATOM   1331  N  N     . VAL B 2  82   ? 130.933 170.258 170.652 1.00 73.43  ?  81   VAL B N     1 
ATOM   1332  C  CA    . VAL B 2  82   ? 132.247 169.635 170.535 1.00 71.90  ?  81   VAL B CA    1 
ATOM   1333  C  C     . VAL B 2  82   ? 133.317 170.619 170.986 1.00 70.59  ?  81   VAL B C     1 
ATOM   1334  O  O     . VAL B 2  82   ? 133.390 171.753 170.494 1.00 70.42  ?  81   VAL B O     1 
ATOM   1335  C  CB    . VAL B 2  82   ? 132.494 169.167 169.093 1.00 72.09  ?  81   VAL B CB    1 
ATOM   1336  C  CG1   . VAL B 2  82   ? 133.858 168.502 168.974 1.00 71.70  ?  81   VAL B CG1   1 
ATOM   1337  C  CG2   . VAL B 2  82   ? 131.391 168.220 168.647 1.00 70.74  ?  81   VAL B CG2   1 
ATOM   1338  N  N     . THR B 2  83   ? 134.154 170.189 171.922 1.00 69.22  ?  82   THR B N     1 
ATOM   1339  C  CA    . THR B 2  83   ? 135.227 171.010 172.455 1.00 67.48  ?  82   THR B CA    1 
ATOM   1340  C  C     . THR B 2  83   ? 136.549 170.627 171.782 1.00 66.77  ?  82   THR B C     1 
ATOM   1341  O  O     . THR B 2  83   ? 136.564 170.103 170.662 1.00 66.85  ?  82   THR B O     1 
ATOM   1342  C  CB    . THR B 2  83   ? 135.275 170.858 173.980 1.00 67.70  ?  82   THR B CB    1 
ATOM   1343  O  OG1   . THR B 2  83   ? 136.400 171.577 174.501 1.00 66.27  ?  82   THR B OG1   1 
ATOM   1344  C  CG2   . THR B 2  83   ? 135.389 169.390 174.366 1.00 66.79  ?  82   THR B CG2   1 
ATOM   1345  N  N     . ALA B 2  84   ? 137.668 170.886 172.463 1.00 65.30  ?  83   ALA B N     1 
ATOM   1346  C  CA    . ALA B 2  84   ? 138.987 170.555 171.944 1.00 63.33  ?  83   ALA B CA    1 
ATOM   1347  C  C     . ALA B 2  84   ? 139.638 169.364 172.631 1.00 62.12  ?  83   ALA B C     1 
ATOM   1348  O  O     . ALA B 2  84   ? 140.462 168.690 172.006 1.00 61.11  ?  83   ALA B O     1 
ATOM   1349  C  CB    . ALA B 2  84   ? 139.927 171.764 172.061 1.00 62.69  ?  83   ALA B CB    1 
ATOM   1350  N  N     . MET B 2  85   ? 139.295 169.090 173.891 1.00 61.14  ?  84   MET B N     1 
ATOM   1351  C  CA    . MET B 2  85   ? 139.919 167.976 174.597 1.00 61.00  ?  84   MET B CA    1 
ATOM   1352  C  C     . MET B 2  85   ? 139.463 166.632 174.045 1.00 61.78  ?  84   MET B C     1 
ATOM   1353  O  O     . MET B 2  85   ? 140.254 165.682 174.000 1.00 61.76  ?  84   MET B O     1 
ATOM   1354  C  CB    . MET B 2  85   ? 139.612 168.065 176.091 1.00 60.41  ?  84   MET B CB    1 
ATOM   1355  C  CG    . MET B 2  85   ? 140.077 169.356 176.740 1.00 62.30  ?  84   MET B CG    1 
ATOM   1356  S  SD    . MET B 2  85   ? 141.856 169.602 176.577 1.00 60.12  ?  84   MET B SD    1 
ATOM   1357  C  CE    . MET B 2  85   ? 142.483 168.165 177.445 1.00 59.77  ?  84   MET B CE    1 
ATOM   1358  N  N     . ASP B 2  86   ? 138.200 166.531 173.628 1.00 62.36  ?  85   ASP B N     1 
ATOM   1359  C  CA    . ASP B 2  86   ? 137.707 165.278 173.067 1.00 61.98  ?  85   ASP B CA    1 
ATOM   1360  C  C     . ASP B 2  86   ? 138.416 164.928 171.765 1.00 61.51  ?  85   ASP B C     1 
ATOM   1361  O  O     . ASP B 2  86   ? 138.602 163.743 171.463 1.00 61.75  ?  85   ASP B O     1 
ATOM   1362  C  CB    . ASP B 2  86   ? 136.196 165.360 172.852 1.00 62.58  ?  85   ASP B CB    1 
ATOM   1363  C  CG    . ASP B 2  86   ? 135.786 166.566 172.029 1.00 64.18  ?  85   ASP B CG    1 
ATOM   1364  O  OD1   . ASP B 2  86   ? 136.659 167.405 171.721 1.00 64.70  ?  85   ASP B OD1   1 
ATOM   1365  O  OD2   . ASP B 2  86   ? 134.590 166.675 171.689 1.00 66.92  ?  85   ASP B OD2   1 
ATOM   1366  N  N     . VAL B 2  87   ? 138.818 165.935 170.987 1.00 60.94  ?  86   VAL B N     1 
ATOM   1367  C  CA    . VAL B 2  87   ? 139.572 165.673 169.765 1.00 61.10  ?  86   VAL B CA    1 
ATOM   1368  C  C     . VAL B 2  87   ? 140.958 165.138 170.100 1.00 61.77  ?  86   VAL B C     1 
ATOM   1369  O  O     . VAL B 2  87   ? 141.457 164.213 169.447 1.00 62.12  ?  86   VAL B O     1 
ATOM   1370  C  CB    . VAL B 2  87   ? 139.647 166.945 168.901 1.00 60.44  ?  86   VAL B CB    1 
ATOM   1371  C  CG1   . VAL B 2  87   ? 140.388 166.665 167.602 1.00 58.49  ?  86   VAL B CG1   1 
ATOM   1372  C  CG2   . VAL B 2  87   ? 138.250 167.479 168.620 1.00 61.55  ?  86   VAL B CG2   1 
ATOM   1373  N  N     . VAL B 2  88   ? 141.601 165.704 171.124 1.00 61.63  ?  87   VAL B N     1 
ATOM   1374  C  CA    . VAL B 2  88   ? 142.915 165.222 171.537 1.00 61.63  ?  87   VAL B CA    1 
ATOM   1375  C  C     . VAL B 2  88   ? 142.818 163.798 172.073 1.00 62.09  ?  87   VAL B C     1 
ATOM   1376  O  O     . VAL B 2  88   ? 143.690 162.962 171.812 1.00 62.58  ?  87   VAL B O     1 
ATOM   1377  C  CB    . VAL B 2  88   ? 143.532 166.179 172.574 1.00 61.32  ?  87   VAL B CB    1 
ATOM   1378  C  CG1   . VAL B 2  88   ? 144.911 165.694 173.000 1.00 60.38  ?  87   VAL B CG1   1 
ATOM   1379  C  CG2   . VAL B 2  88   ? 143.609 167.590 172.010 1.00 62.51  ?  87   VAL B CG2   1 
ATOM   1380  N  N     . TYR B 2  89   ? 141.755 163.497 172.823 1.00 61.64  ?  88   TYR B N     1 
ATOM   1381  C  CA    . TYR B 2  89   ? 141.574 162.141 173.331 1.00 62.15  ?  88   TYR B CA    1 
ATOM   1382  C  C     . TYR B 2  89   ? 141.307 161.158 172.198 1.00 62.42  ?  88   TYR B C     1 
ATOM   1383  O  O     . TYR B 2  89   ? 141.825 160.034 172.208 1.00 61.85  ?  88   TYR B O     1 
ATOM   1384  C  CB    . TYR B 2  89   ? 140.433 162.107 174.348 1.00 63.01  ?  88   TYR B CB    1 
ATOM   1385  C  CG    . TYR B 2  89   ? 140.656 162.977 175.565 1.00 65.36  ?  88   TYR B CG    1 
ATOM   1386  C  CD1   . TYR B 2  89   ? 141.938 163.251 176.025 1.00 66.82  ?  88   TYR B CD1   1 
ATOM   1387  C  CD2   . TYR B 2  89   ? 139.583 163.526 176.254 1.00 66.56  ?  88   TYR B CD2   1 
ATOM   1388  C  CE1   . TYR B 2  89   ? 142.144 164.047 177.137 1.00 68.25  ?  88   TYR B CE1   1 
ATOM   1389  C  CE2   . TYR B 2  89   ? 139.778 164.322 177.366 1.00 65.49  ?  88   TYR B CE2   1 
ATOM   1390  C  CZ    . TYR B 2  89   ? 141.060 164.580 177.803 1.00 66.11  ?  88   TYR B CZ    1 
ATOM   1391  O  OH    . TYR B 2  89   ? 141.257 165.372 178.910 1.00 66.51  ?  88   TYR B OH    1 
ATOM   1392  N  N     . ALA B 2  90   ? 140.505 161.563 171.211 1.00 61.88  ?  89   ALA B N     1 
ATOM   1393  C  CA    . ALA B 2  90   ? 140.208 160.679 170.089 1.00 61.05  ?  89   ALA B CA    1 
ATOM   1394  C  C     . ALA B 2  90   ? 141.445 160.435 169.234 1.00 60.89  ?  89   ALA B C     1 
ATOM   1395  O  O     . ALA B 2  90   ? 141.653 159.322 168.736 1.00 61.19  ?  89   ALA B O     1 
ATOM   1396  C  CB    . ALA B 2  90   ? 139.076 161.262 169.245 1.00 61.32  ?  89   ALA B CB    1 
ATOM   1397  N  N     . LEU B 2  91   ? 142.279 161.462 169.052 1.00 59.60  ?  90   LEU B N     1 
ATOM   1398  C  CA    . LEU B 2  91   ? 143.498 161.290 168.270 1.00 58.44  ?  90   LEU B CA    1 
ATOM   1399  C  C     . LEU B 2  91   ? 144.520 160.444 169.019 1.00 59.63  ?  90   LEU B C     1 
ATOM   1400  O  O     . LEU B 2  91   ? 145.170 159.576 168.425 1.00 59.43  ?  90   LEU B O     1 
ATOM   1401  C  CB    . LEU B 2  91   ? 144.088 162.652 167.908 1.00 57.15  ?  90   LEU B CB    1 
ATOM   1402  C  CG    . LEU B 2  91   ? 143.297 163.493 166.904 1.00 55.00  ?  90   LEU B CG    1 
ATOM   1403  C  CD1   . LEU B 2  91   ? 143.953 164.850 166.712 1.00 51.03  ?  90   LEU B CD1   1 
ATOM   1404  C  CD2   . LEU B 2  91   ? 143.167 162.763 165.576 1.00 47.94  ?  90   LEU B CD2   1 
ATOM   1405  N  N     . LYS B 2  92   ? 144.677 160.681 170.324 1.00 59.82  ?  91   LYS B N     1 
ATOM   1406  C  CA    . LYS B 2  92   ? 145.601 159.880 171.118 1.00 60.92  ?  91   LYS B CA    1 
ATOM   1407  C  C     . LYS B 2  92   ? 145.129 158.441 171.276 1.00 61.73  ?  91   LYS B C     1 
ATOM   1408  O  O     . LYS B 2  92   ? 145.957 157.553 171.505 1.00 61.73  ?  91   LYS B O     1 
ATOM   1409  C  CB    . LYS B 2  92   ? 145.805 160.515 172.495 1.00 60.73  ?  91   LYS B CB    1 
ATOM   1410  C  CG    . LYS B 2  92   ? 146.601 161.811 172.470 1.00 61.02  ?  91   LYS B CG    1 
ATOM   1411  C  CD    . LYS B 2  92   ? 146.751 162.422 173.861 1.00 61.77  ?  91   LYS B CD    1 
ATOM   1412  C  CE    . LYS B 2  92   ? 147.795 161.695 174.703 1.00 64.64  ?  91   LYS B CE    1 
ATOM   1413  N  NZ    . LYS B 2  92   ? 147.295 160.428 175.308 1.00 65.28  ?  91   LYS B NZ    1 
ATOM   1414  N  N     . ARG B 2  93   ? 143.822 158.190 171.163 1.00 62.57  ?  92   ARG B N     1 
ATOM   1415  C  CA    . ARG B 2  93   ? 143.329 156.819 171.244 1.00 62.59  ?  92   ARG B CA    1 
ATOM   1416  C  C     . ARG B 2  93   ? 143.736 156.013 170.016 1.00 62.51  ?  92   ARG B C     1 
ATOM   1417  O  O     . ARG B 2  93   ? 144.064 154.826 170.126 1.00 62.75  ?  92   ARG B O     1 
ATOM   1418  C  CB    . ARG B 2  93   ? 141.809 156.816 171.410 1.00 63.13  ?  92   ARG B CB    1 
ATOM   1419  C  CG    . ARG B 2  93   ? 141.202 155.427 171.512 1.00 63.59  ?  92   ARG B CG    1 
ATOM   1420  C  CD    . ARG B 2  93   ? 139.687 155.484 171.605 1.00 60.36  ?  92   ARG B CD    1 
ATOM   1421  N  NE    . ARG B 2  93   ? 139.101 154.148 171.666 1.00 60.35  ?  92   ARG B NE    1 
ATOM   1422  C  CZ    . ARG B 2  93   ? 138.770 153.429 170.599 1.00 61.35  ?  92   ARG B CZ    1 
ATOM   1423  N  NH1   . ARG B 2  93   ? 138.966 153.917 169.381 1.00 61.00  ?  92   ARG B NH1   1 
ATOM   1424  N  NH2   . ARG B 2  93   ? 138.244 152.222 170.748 1.00 62.73  ?  92   ARG B NH2   1 
ATOM   1425  N  N     . GLN B 2  94   ? 143.726 156.641 168.842 1.00 62.06  ?  93   GLN B N     1 
ATOM   1426  C  CA    . GLN B 2  94   ? 144.082 155.981 167.594 1.00 61.73  ?  93   GLN B CA    1 
ATOM   1427  C  C     . GLN B 2  94   ? 145.584 155.977 167.331 1.00 60.85  ?  93   GLN B C     1 
ATOM   1428  O  O     . GLN B 2  94   ? 146.011 155.537 166.259 1.00 61.13  ?  93   GLN B O     1 
ATOM   1429  C  CB    . GLN B 2  94   ? 143.355 156.648 166.422 1.00 62.33  ?  93   GLN B CB    1 
ATOM   1430  C  CG    . GLN B 2  94   ? 141.837 156.577 166.504 1.00 63.66  ?  93   GLN B CG    1 
ATOM   1431  C  CD    . GLN B 2  94   ? 141.301 155.173 166.295 1.00 64.78  ?  93   GLN B CD    1 
ATOM   1432  O  OE1   . GLN B 2  94   ? 142.004 154.294 165.797 1.00 66.22  ?  93   GLN B OE1   1 
ATOM   1433  N  NE2   . GLN B 2  94   ? 140.048 154.957 166.676 1.00 64.46  ?  93   GLN B NE2   1 
ATOM   1434  N  N     . GLY B 2  95   ? 146.389 156.452 168.278 1.00 59.59  ?  94   GLY B N     1 
ATOM   1435  C  CA    . GLY B 2  95   ? 147.825 156.487 168.090 1.00 58.50  ?  94   GLY B CA    1 
ATOM   1436  C  C     . GLY B 2  95   ? 148.352 157.734 167.422 1.00 57.90  ?  94   GLY B C     1 
ATOM   1437  O  O     . GLY B 2  95   ? 149.458 157.708 166.873 1.00 57.61  ?  94   GLY B O     1 
ATOM   1438  N  N     . ARG B 2  96   ? 147.595 158.828 167.448 1.00 57.69  ?  95   ARG B N     1 
ATOM   1439  C  CA    . ARG B 2  96   ? 147.987 160.096 166.835 1.00 57.04  ?  95   ARG B CA    1 
ATOM   1440  C  C     . ARG B 2  96   ? 148.115 161.129 167.949 1.00 57.36  ?  95   ARG B C     1 
ATOM   1441  O  O     . ARG B 2  96   ? 147.219 161.947 168.164 1.00 56.75  ?  95   ARG B O     1 
ATOM   1442  C  CB    . ARG B 2  96   ? 146.969 160.530 165.775 1.00 57.11  ?  95   ARG B CB    1 
ATOM   1443  C  CG    . ARG B 2  96   ? 146.712 159.492 164.696 1.00 58.66  ?  95   ARG B CG    1 
ATOM   1444  C  CD    . ARG B 2  96   ? 147.956 159.237 163.859 1.00 59.76  ?  95   ARG B CD    1 
ATOM   1445  N  NE    . ARG B 2  96   ? 148.348 160.407 163.078 1.00 63.49  ?  95   ARG B NE    1 
ATOM   1446  C  CZ    . ARG B 2  96   ? 149.361 160.423 162.218 1.00 63.85  ?  95   ARG B CZ    1 
ATOM   1447  N  NH1   . ARG B 2  96   ? 150.087 159.330 162.025 1.00 61.23  ?  95   ARG B NH1   1 
ATOM   1448  N  NH2   . ARG B 2  96   ? 149.649 161.530 161.548 1.00 60.65  ?  95   ARG B NH2   1 
ATOM   1449  N  N     . THR B 2  97   ? 149.238 161.086 168.661 1.00 57.30  ?  96   THR B N     1 
ATOM   1450  C  CA    . THR B 2  97   ? 149.453 161.999 169.776 1.00 57.18  ?  96   THR B CA    1 
ATOM   1451  C  C     . THR B 2  97   ? 149.631 163.422 169.259 1.00 56.82  ?  96   THR B C     1 
ATOM   1452  O  O     . THR B 2  97   ? 150.489 163.681 168.408 1.00 56.78  ?  96   THR B O     1 
ATOM   1453  C  CB    . THR B 2  97   ? 150.669 161.568 170.592 1.00 57.45  ?  96   THR B CB    1 
ATOM   1454  O  OG1   . THR B 2  97   ? 150.513 160.203 171.000 1.00 57.30  ?  96   THR B OG1   1 
ATOM   1455  C  CG2   . THR B 2  97   ? 150.815 162.441 171.829 1.00 57.20  ?  96   THR B CG2   1 
ATOM   1456  N  N     . LEU B 2  98   ? 148.819 164.343 169.774 1.00 56.29  ?  97   LEU B N     1 
ATOM   1457  C  CA    . LEU B 2  98   ? 148.857 165.743 169.379 1.00 56.11  ?  97   LEU B CA    1 
ATOM   1458  C  C     . LEU B 2  98   ? 148.895 166.617 170.623 1.00 56.64  ?  97   LEU B C     1 
ATOM   1459  O  O     . LEU B 2  98   ? 148.153 166.380 171.582 1.00 56.27  ?  97   LEU B O     1 
ATOM   1460  C  CB    . LEU B 2  98   ? 147.643 166.112 168.515 1.00 55.33  ?  97   LEU B CB    1 
ATOM   1461  C  CG    . LEU B 2  98   ? 147.544 167.563 168.040 1.00 53.07  ?  97   LEU B CG    1 
ATOM   1462  C  CD1   . LEU B 2  98   ? 148.744 167.935 167.184 1.00 52.04  ?  97   LEU B CD1   1 
ATOM   1463  C  CD2   . LEU B 2  98   ? 146.247 167.789 167.277 1.00 49.75  ?  97   LEU B CD2   1 
ATOM   1464  N  N     . TYR B 2  99   ? 149.760 167.624 170.602 1.00 56.89  ?  98   TYR B N     1 
ATOM   1465  C  CA    . TYR B 2  99   ? 149.916 168.555 171.706 1.00 57.65  ?  98   TYR B CA    1 
ATOM   1466  C  C     . TYR B 2  99   ? 149.441 169.944 171.283 1.00 57.51  ?  98   TYR B C     1 
ATOM   1467  O  O     . TYR B 2  99   ? 148.826 170.122 170.225 1.00 57.41  ?  98   TYR B O     1 
ATOM   1468  C  CB    . TYR B 2  99   ? 151.372 168.575 172.175 1.00 58.25  ?  98   TYR B CB    1 
ATOM   1469  C  CG    . TYR B 2  99   ? 151.899 167.233 172.629 1.00 59.38  ?  98   TYR B CG    1 
ATOM   1470  C  CD1   . TYR B 2  99   ? 151.662 166.772 173.916 1.00 60.79  ?  98   TYR B CD1   1 
ATOM   1471  C  CD2   . TYR B 2  99   ? 152.644 166.432 171.773 1.00 60.40  ?  98   TYR B CD2   1 
ATOM   1472  C  CE1   . TYR B 2  99   ? 152.146 165.548 174.337 1.00 62.49  ?  98   TYR B CE1   1 
ATOM   1473  C  CE2   . TYR B 2  99   ? 153.132 165.207 172.186 1.00 62.61  ?  98   TYR B CE2   1 
ATOM   1474  C  CZ    . TYR B 2  99   ? 152.880 164.771 173.468 1.00 61.44  ?  98   TYR B CZ    1 
ATOM   1475  O  OH    . TYR B 2  99   ? 153.364 163.551 173.883 1.00 59.20  ?  98   TYR B OH    1 
ATOM   1476  N  N     . GLY B 2  100  ? 149.727 170.928 172.115 1.00 56.88  ?  99   GLY B N     1 
ATOM   1477  C  CA    . GLY B 2  100  ? 149.383 172.316 171.822 1.00 57.40  ?  99   GLY B CA    1 
ATOM   1478  C  C     . GLY B 2  100  ? 148.036 172.782 172.325 1.00 58.01  ?  99   GLY B C     1 
ATOM   1479  O  O     . GLY B 2  100  ? 147.934 173.844 172.937 1.00 58.14  ?  99   GLY B O     1 
ATOM   1480  N  N     . PHE B 2  101  ? 146.993 172.000 172.073 1.00 57.32  ?  100  PHE B N     1 
ATOM   1481  C  CA    . PHE B 2  101  ? 145.631 172.355 172.472 1.00 56.36  ?  100  PHE B CA    1 
ATOM   1482  C  C     . PHE B 2  101  ? 145.210 171.605 173.729 1.00 56.89  ?  100  PHE B C     1 
ATOM   1483  O  O     . PHE B 2  101  ? 144.163 170.959 173.772 1.00 58.26  ?  100  PHE B O     1 
ATOM   1484  C  CB    . PHE B 2  101  ? 144.664 172.088 171.325 1.00 55.73  ?  100  PHE B CB    1 
ATOM   1485  C  CG    . PHE B 2  101  ? 144.997 172.835 170.065 1.00 54.77  ?  100  PHE B CG    1 
ATOM   1486  C  CD1   . PHE B 2  101  ? 145.589 174.087 170.120 1.00 52.42  ?  100  PHE B CD1   1 
ATOM   1487  C  CD2   . PHE B 2  101  ? 144.725 172.282 168.825 1.00 52.62  ?  100  PHE B CD2   1 
ATOM   1488  C  CE1   . PHE B 2  101  ? 145.898 174.775 168.962 1.00 52.73  ?  100  PHE B CE1   1 
ATOM   1489  C  CE2   . PHE B 2  101  ? 145.032 172.965 167.663 1.00 51.47  ?  100  PHE B CE2   1 
ATOM   1490  C  CZ    . PHE B 2  101  ? 145.620 174.213 167.732 1.00 53.12  ?  100  PHE B CZ    1 
ATOM   1491  N  N     . GLY B 2  102  ? 146.031 171.684 174.774 1.00 56.77  ?  101  GLY B N     1 
ATOM   1492  C  CA    . GLY B 2  102  ? 145.737 171.012 176.022 1.00 56.88  ?  101  GLY B CA    1 
ATOM   1493  C  C     . GLY B 2  102  ? 146.288 169.602 176.075 1.00 57.80  ?  101  GLY B C     1 
ATOM   1494  O  O     . GLY B 2  102  ? 146.966 169.115 175.166 1.00 57.02  ?  101  GLY B O     1 
ATOM   1495  N  N     . GLY B 2  103  ? 145.981 168.932 177.181 1.00 58.91  ?  102  GLY B N     1 
ATOM   1496  C  CA    . GLY B 2  103  ? 146.429 167.568 177.394 1.00 61.04  ?  102  GLY B CA    1 
ATOM   1497  C  C     . GLY B 2  103  ? 147.339 167.418 178.598 1.00 62.49  ?  102  GLY B C     1 
ATOM   1498  O  O     . GLY B 2  103  ? 147.492 166.326 179.145 1.00 62.93  ?  102  GLY B O     1 
ATOM   1499  O  OXT   . GLY B 2  103  ? 147.946 168.385 179.058 1.00 63.61  ?  102  GLY B OXT   1 
ATOM   1500  N  N     . THR C 3  17   ? 122.335 134.091 193.253 1.00 98.09  ?  16   THR C N     1 
ATOM   1501  C  CA    . THR C 3  17   ? 123.438 134.812 192.629 1.00 98.13  ?  16   THR C CA    1 
ATOM   1502  C  C     . THR C 3  17   ? 122.924 135.832 191.619 1.00 98.14  ?  16   THR C C     1 
ATOM   1503  O  O     . THR C 3  17   ? 121.837 135.676 191.063 1.00 98.19  ?  16   THR C O     1 
ATOM   1504  C  CB    . THR C 3  17   ? 124.414 133.852 191.924 1.00 98.06  ?  16   THR C CB    1 
ATOM   1505  O  OG1   . THR C 3  17   ? 123.720 133.125 190.902 1.00 98.23  ?  16   THR C OG1   1 
ATOM   1506  C  CG2   . THR C 3  17   ? 125.010 132.871 192.922 1.00 97.89  ?  16   THR C CG2   1 
ATOM   1507  N  N     . ARG C 3  18   ? 123.715 136.882 191.387 1.00 98.03  ?  17   ARG C N     1 
ATOM   1508  C  CA    . ARG C 3  18   ? 123.326 137.911 190.431 1.00 98.01  ?  17   ARG C CA    1 
ATOM   1509  C  C     . ARG C 3  18   ? 123.430 137.431 188.989 1.00 97.93  ?  17   ARG C C     1 
ATOM   1510  O  O     . ARG C 3  18   ? 122.780 138.006 188.110 1.00 97.65  ?  17   ARG C O     1 
ATOM   1511  C  CB    . ARG C 3  18   ? 124.182 139.163 190.627 1.00 97.88  ?  17   ARG C CB    1 
ATOM   1512  C  CG    . ARG C 3  18   ? 124.044 139.797 192.002 1.00 97.72  ?  17   ARG C CG    1 
ATOM   1513  C  CD    . ARG C 3  18   ? 124.867 141.070 192.114 1.00 97.65  ?  17   ARG C CD    1 
ATOM   1514  N  NE    . ARG C 3  18   ? 126.293 140.820 191.926 1.00 97.81  ?  17   ARG C NE    1 
ATOM   1515  C  CZ    . ARG C 3  18   ? 127.230 141.761 191.991 1.00 97.38  ?  17   ARG C CZ    1 
ATOM   1516  N  NH1   . ARG C 3  18   ? 126.894 143.019 192.239 1.00 97.23  ?  17   ARG C NH1   1 
ATOM   1517  N  NH2   . ARG C 3  18   ? 128.505 141.444 191.807 1.00 96.72  ?  17   ARG C NH2   1 
ATOM   1518  N  N     . SER C 3  19   ? 124.229 136.394 188.728 1.00 97.85  ?  18   SER C N     1 
ATOM   1519  C  CA    . SER C 3  19   ? 124.338 135.870 187.371 1.00 97.88  ?  18   SER C CA    1 
ATOM   1520  C  C     . SER C 3  19   ? 123.052 135.174 186.943 1.00 97.80  ?  18   SER C C     1 
ATOM   1521  O  O     . SER C 3  19   ? 122.639 135.277 185.782 1.00 97.89  ?  18   SER C O     1 
ATOM   1522  C  CB    . SER C 3  19   ? 125.526 134.913 187.271 1.00 97.98  ?  18   SER C CB    1 
ATOM   1523  O  OG    . SER C 3  19   ? 126.737 135.567 187.603 1.00 97.81  ?  18   SER C OG    1 
ATOM   1524  N  N     . SER C 3  20   ? 122.404 134.460 187.867 1.00 97.59  ?  19   SER C N     1 
ATOM   1525  C  CA    . SER C 3  20   ? 121.144 133.803 187.540 1.00 97.24  ?  19   SER C CA    1 
ATOM   1526  C  C     . SER C 3  20   ? 120.000 134.803 187.438 1.00 96.85  ?  19   SER C C     1 
ATOM   1527  O  O     . SER C 3  20   ? 119.089 134.620 186.622 1.00 96.75  ?  19   SER C O     1 
ATOM   1528  C  CB    . SER C 3  20   ? 120.823 132.732 188.583 1.00 97.29  ?  19   SER C CB    1 
ATOM   1529  O  OG    . SER C 3  20   ? 120.712 133.298 189.878 1.00 97.47  ?  19   SER C OG    1 
ATOM   1530  N  N     . ARG C 3  21   ? 120.026 135.861 188.253 1.00 96.41  ?  20   ARG C N     1 
ATOM   1531  C  CA    . ARG C 3  21   ? 118.980 136.875 188.178 1.00 96.23  ?  20   ARG C CA    1 
ATOM   1532  C  C     . ARG C 3  21   ? 119.135 137.752 186.943 1.00 95.79  ?  20   ARG C C     1 
ATOM   1533  O  O     . ARG C 3  21   ? 118.135 138.232 186.397 1.00 95.70  ?  20   ARG C O     1 
ATOM   1534  C  CB    . ARG C 3  21   ? 118.988 137.734 189.442 1.00 96.57  ?  20   ARG C CB    1 
ATOM   1535  C  CG    . ARG C 3  21   ? 118.663 136.973 190.716 1.00 97.47  ?  20   ARG C CG    1 
ATOM   1536  C  CD    . ARG C 3  21   ? 118.708 137.890 191.927 1.00 100.01 ?  20   ARG C CD    1 
ATOM   1537  N  NE    . ARG C 3  21   ? 118.312 137.203 193.153 1.00 101.26 ?  20   ARG C NE    1 
ATOM   1538  C  CZ    . ARG C 3  21   ? 118.281 137.775 194.352 1.00 102.25 ?  20   ARG C CZ    1 
ATOM   1539  N  NH1   . ARG C 3  21   ? 118.625 139.048 194.491 1.00 102.81 ?  20   ARG C NH1   1 
ATOM   1540  N  NH2   . ARG C 3  21   ? 117.908 137.073 195.414 1.00 102.95 ?  20   ARG C NH2   1 
ATOM   1541  N  N     . ALA C 3  22   ? 120.370 137.974 186.490 1.00 95.23  ?  21   ALA C N     1 
ATOM   1542  C  CA    . ALA C 3  22   ? 120.603 138.793 185.308 1.00 94.49  ?  21   ALA C CA    1 
ATOM   1543  C  C     . ALA C 3  22   ? 120.257 138.071 184.013 1.00 94.04  ?  21   ALA C C     1 
ATOM   1544  O  O     . ALA C 3  22   ? 120.131 138.723 182.972 1.00 93.81  ?  21   ALA C O     1 
ATOM   1545  C  CB    . ALA C 3  22   ? 122.061 139.253 185.264 1.00 94.55  ?  21   ALA C CB    1 
ATOM   1546  N  N     . GLY C 3  23   ? 120.102 136.750 184.053 1.00 93.65  ?  22   GLY C N     1 
ATOM   1547  C  CA    . GLY C 3  23   ? 119.775 136.001 182.855 1.00 93.02  ?  22   GLY C CA    1 
ATOM   1548  C  C     . GLY C 3  23   ? 120.929 135.796 181.901 1.00 92.44  ?  22   GLY C C     1 
ATOM   1549  O  O     . GLY C 3  23   ? 120.707 135.666 180.693 1.00 92.27  ?  22   GLY C O     1 
ATOM   1550  N  N     . LEU C 3  24   ? 122.156 135.763 182.407 1.00 92.10  ?  23   LEU C N     1 
ATOM   1551  C  CA    . LEU C 3  24   ? 123.348 135.578 181.591 1.00 91.81  ?  23   LEU C CA    1 
ATOM   1552  C  C     . LEU C 3  24   ? 124.065 134.298 182.021 1.00 91.61  ?  23   LEU C C     1 
ATOM   1553  O  O     . LEU C 3  24   ? 123.559 133.518 182.833 1.00 91.56  ?  23   LEU C O     1 
ATOM   1554  C  CB    . LEU C 3  24   ? 124.262 136.802 181.694 1.00 91.72  ?  23   LEU C CB    1 
ATOM   1555  C  CG    . LEU C 3  24   ? 123.625 138.152 181.358 1.00 91.67  ?  23   LEU C CG    1 
ATOM   1556  C  CD1   . LEU C 3  24   ? 124.653 139.269 181.440 1.00 91.93  ?  23   LEU C CD1   1 
ATOM   1557  C  CD2   . LEU C 3  24   ? 122.974 138.118 179.983 1.00 91.57  ?  23   LEU C CD2   1 
ATOM   1558  N  N     . GLN C 3  25   ? 125.256 134.088 181.470 1.00 91.43  ?  24   GLN C N     1 
ATOM   1559  C  CA    . GLN C 3  25   ? 126.059 132.909 181.772 1.00 91.17  ?  24   GLN C CA    1 
ATOM   1560  C  C     . GLN C 3  25   ? 127.394 133.244 182.415 1.00 90.90  ?  24   GLN C C     1 
ATOM   1561  O  O     . GLN C 3  25   ? 127.852 132.506 183.292 1.00 91.10  ?  24   GLN C O     1 
ATOM   1562  C  CB    . GLN C 3  25   ? 126.296 132.090 180.494 1.00 91.36  ?  24   GLN C CB    1 
ATOM   1563  C  CG    . GLN C 3  25   ? 125.022 131.703 179.752 1.00 91.76  ?  24   GLN C CG    1 
ATOM   1564  C  CD    . GLN C 3  25   ? 124.113 130.802 180.569 1.00 92.35  ?  24   GLN C CD    1 
ATOM   1565  O  OE1   . GLN C 3  25   ? 124.571 130.059 181.437 1.00 91.45  ?  24   GLN C OE1   1 
ATOM   1566  N  NE2   . GLN C 3  25   ? 122.815 130.866 180.293 1.00 92.54  ?  24   GLN C NE2   1 
ATOM   1567  N  N     . PHE C 3  26   ? 128.032 134.336 182.003 1.00 90.18  ?  25   PHE C N     1 
ATOM   1568  C  CA    . PHE C 3  26   ? 129.289 134.737 182.609 1.00 89.46  ?  25   PHE C CA    1 
ATOM   1569  C  C     . PHE C 3  26   ? 129.057 135.245 184.033 1.00 89.06  ?  25   PHE C C     1 
ATOM   1570  O  O     . PHE C 3  26   ? 127.993 135.789 184.342 1.00 89.32  ?  25   PHE C O     1 
ATOM   1571  C  CB    . PHE C 3  26   ? 129.965 135.816 181.767 1.00 89.28  ?  25   PHE C CB    1 
ATOM   1572  C  CG    . PHE C 3  26   ? 130.580 135.295 180.499 1.00 88.66  ?  25   PHE C CG    1 
ATOM   1573  C  CD1   . PHE C 3  26   ? 130.917 133.957 180.379 1.00 88.14  ?  25   PHE C CD1   1 
ATOM   1574  C  CD2   . PHE C 3  26   ? 130.821 136.140 179.429 1.00 87.55  ?  25   PHE C CD2   1 
ATOM   1575  C  CE1   . PHE C 3  26   ? 131.483 133.471 179.216 1.00 86.90  ?  25   PHE C CE1   1 
ATOM   1576  C  CE2   . PHE C 3  26   ? 131.388 135.660 178.263 1.00 86.94  ?  25   PHE C CE2   1 
ATOM   1577  C  CZ    . PHE C 3  26   ? 131.719 134.324 178.157 1.00 87.57  ?  25   PHE C CZ    1 
ATOM   1578  N  N     . PRO C 3  27   ? 130.035 135.073 184.920 1.00 88.24  ?  26   PRO C N     1 
ATOM   1579  C  CA    . PRO C 3  27   ? 129.846 135.485 186.314 1.00 87.43  ?  26   PRO C CA    1 
ATOM   1580  C  C     . PRO C 3  27   ? 129.784 136.998 186.456 1.00 86.71  ?  26   PRO C C     1 
ATOM   1581  O  O     . PRO C 3  27   ? 130.201 137.758 185.580 1.00 86.72  ?  26   PRO C O     1 
ATOM   1582  C  CB    . PRO C 3  27   ? 131.076 134.911 187.024 1.00 87.28  ?  26   PRO C CB    1 
ATOM   1583  C  CG    . PRO C 3  27   ? 132.110 134.816 185.953 1.00 87.42  ?  26   PRO C CG    1 
ATOM   1584  C  CD    . PRO C 3  27   ? 131.364 134.479 184.693 1.00 88.14  ?  26   PRO C CD    1 
ATOM   1585  N  N     . VAL C 3  28   ? 129.247 137.428 187.599 1.00 86.18  ?  27   VAL C N     1 
ATOM   1586  C  CA    . VAL C 3  28   ? 129.062 138.839 187.903 1.00 85.61  ?  27   VAL C CA    1 
ATOM   1587  C  C     . VAL C 3  28   ? 129.841 139.257 189.143 1.00 85.49  ?  27   VAL C C     1 
ATOM   1588  O  O     . VAL C 3  28   ? 130.466 140.324 189.158 1.00 85.87  ?  27   VAL C O     1 
ATOM   1589  C  CB    . VAL C 3  28   ? 127.563 139.176 188.064 1.00 85.41  ?  27   VAL C CB    1 
ATOM   1590  C  CG1   . VAL C 3  28   ? 127.371 140.650 188.385 1.00 85.16  ?  27   VAL C CG1   1 
ATOM   1591  C  CG2   . VAL C 3  28   ? 126.797 138.796 186.806 1.00 85.09  ?  27   VAL C CG2   1 
ATOM   1592  N  N     . GLY C 3  29   ? 129.823 138.433 190.191 1.00 85.20  ?  28   GLY C N     1 
ATOM   1593  C  CA    . GLY C 3  29   ? 130.549 138.780 191.402 1.00 84.59  ?  28   GLY C CA    1 
ATOM   1594  C  C     . GLY C 3  29   ? 132.054 138.706 191.229 1.00 84.09  ?  28   GLY C C     1 
ATOM   1595  O  O     . GLY C 3  29   ? 132.792 139.516 191.797 1.00 84.03  ?  28   GLY C O     1 
ATOM   1596  N  N     . ARG C 3  30   ? 132.532 137.737 190.445 1.00 83.59  ?  29   ARG C N     1 
ATOM   1597  C  CA    . ARG C 3  30   ? 133.972 137.591 190.256 1.00 83.00  ?  29   ARG C CA    1 
ATOM   1598  C  C     . ARG C 3  30   ? 134.530 138.698 189.369 1.00 83.27  ?  29   ARG C C     1 
ATOM   1599  O  O     . ARG C 3  30   ? 135.576 139.281 189.679 1.00 83.38  ?  29   ARG C O     1 
ATOM   1600  C  CB    . ARG C 3  30   ? 134.290 136.214 189.675 1.00 82.54  ?  29   ARG C CB    1 
ATOM   1601  C  CG    . ARG C 3  30   ? 135.777 135.928 189.539 1.00 81.50  ?  29   ARG C CG    1 
ATOM   1602  C  CD    . ARG C 3  30   ? 136.060 134.435 189.585 1.00 80.62  ?  29   ARG C CD    1 
ATOM   1603  N  NE    . ARG C 3  30   ? 135.393 133.708 188.509 1.00 78.89  ?  29   ARG C NE    1 
ATOM   1604  C  CZ    . ARG C 3  30   ? 135.966 133.392 187.353 1.00 79.39  ?  29   ARG C CZ    1 
ATOM   1605  N  NH1   . ARG C 3  30   ? 137.225 133.738 187.118 1.00 78.46  ?  29   ARG C NH1   1 
ATOM   1606  N  NH2   . ARG C 3  30   ? 135.283 132.727 186.431 1.00 78.75  ?  29   ARG C NH2   1 
ATOM   1607  N  N     . VAL C 3  31   ? 133.847 139.007 188.263 1.00 83.23  ?  30   VAL C N     1 
ATOM   1608  C  CA    . VAL C 3  31   ? 134.277 140.125 187.430 1.00 83.24  ?  30   VAL C CA    1 
ATOM   1609  C  C     . VAL C 3  31   ? 134.083 141.445 188.170 1.00 83.52  ?  30   VAL C C     1 
ATOM   1610  O  O     . VAL C 3  31   ? 134.808 142.417 187.925 1.00 83.69  ?  30   VAL C O     1 
ATOM   1611  C  CB    . VAL C 3  31   ? 133.532 140.105 186.080 1.00 83.06  ?  30   VAL C CB    1 
ATOM   1612  C  CG1   . VAL C 3  31   ? 132.045 140.372 186.275 1.00 82.75  ?  30   VAL C CG1   1 
ATOM   1613  C  CG2   . VAL C 3  31   ? 134.143 141.108 185.113 1.00 82.54  ?  30   VAL C CG2   1 
ATOM   1614  N  N     . HIS C 3  32   ? 133.117 141.500 189.090 1.00 83.84  ?  31   HIS C N     1 
ATOM   1615  C  CA    . HIS C 3  32   ? 132.955 142.684 189.927 1.00 84.08  ?  31   HIS C CA    1 
ATOM   1616  C  C     . HIS C 3  32   ? 134.140 142.847 190.871 1.00 84.19  ?  31   HIS C C     1 
ATOM   1617  O  O     . HIS C 3  32   ? 134.628 143.965 191.083 1.00 84.30  ?  31   HIS C O     1 
ATOM   1618  C  CB    . HIS C 3  32   ? 131.644 142.588 190.707 1.00 84.01  ?  31   HIS C CB    1 
ATOM   1619  C  CG    . HIS C 3  32   ? 131.259 143.853 191.408 1.00 84.45  ?  31   HIS C CG    1 
ATOM   1620  N  ND1   . HIS C 3  32   ? 130.804 144.967 190.737 1.00 84.98  ?  31   HIS C ND1   1 
ATOM   1621  C  CD2   . HIS C 3  32   ? 131.253 144.177 192.723 1.00 85.26  ?  31   HIS C CD2   1 
ATOM   1622  C  CE1   . HIS C 3  32   ? 130.537 145.924 191.608 1.00 85.06  ?  31   HIS C CE1   1 
ATOM   1623  N  NE2   . HIS C 3  32   ? 130.801 145.471 192.820 1.00 84.98  ?  31   HIS C NE2   1 
ATOM   1624  N  N     . ARG C 3  33   ? 134.620 141.739 191.444 1.00 84.04  ?  32   ARG C N     1 
ATOM   1625  C  CA    . ARG C 3  33   ? 135.841 141.791 192.240 1.00 84.18  ?  32   ARG C CA    1 
ATOM   1626  C  C     . ARG C 3  33   ? 137.039 142.172 191.381 1.00 84.52  ?  32   ARG C C     1 
ATOM   1627  O  O     . ARG C 3  33   ? 137.954 142.853 191.858 1.00 84.81  ?  32   ARG C O     1 
ATOM   1628  C  CB    . ARG C 3  33   ? 136.073 140.446 192.932 1.00 84.19  ?  32   ARG C CB    1 
ATOM   1629  C  CG    . ARG C 3  33   ? 137.219 140.434 193.937 1.00 82.92  ?  32   ARG C CG    1 
ATOM   1630  C  CD    . ARG C 3  33   ? 138.496 139.873 193.329 1.00 80.35  ?  32   ARG C CD    1 
ATOM   1631  N  NE    . ARG C 3  33   ? 138.310 138.513 192.831 1.00 79.67  ?  32   ARG C NE    1 
ATOM   1632  C  CZ    . ARG C 3  33   ? 138.493 137.419 193.562 1.00 79.89  ?  32   ARG C CZ    1 
ATOM   1633  N  NH1   . ARG C 3  33   ? 138.868 137.522 194.830 1.00 81.33  ?  32   ARG C NH1   1 
ATOM   1634  N  NH2   . ARG C 3  33   ? 138.301 136.221 193.026 1.00 78.43  ?  32   ARG C NH2   1 
ATOM   1635  N  N     . LEU C 3  34   ? 137.052 141.744 190.115 1.00 84.58  ?  33   LEU C N     1 
ATOM   1636  C  CA    . LEU C 3  34   ? 138.096 142.189 189.198 1.00 84.54  ?  33   LEU C CA    1 
ATOM   1637  C  C     . LEU C 3  34   ? 138.004 143.687 188.938 1.00 84.68  ?  33   LEU C C     1 
ATOM   1638  O  O     . LEU C 3  34   ? 139.026 144.337 188.690 1.00 84.87  ?  33   LEU C O     1 
ATOM   1639  C  CB    . LEU C 3  34   ? 138.010 141.414 187.883 1.00 84.19  ?  33   LEU C CB    1 
ATOM   1640  C  CG    . LEU C 3  34   ? 138.299 139.914 187.950 1.00 84.39  ?  33   LEU C CG    1 
ATOM   1641  C  CD1   . LEU C 3  34   ? 138.179 139.286 186.570 1.00 84.17  ?  33   LEU C CD1   1 
ATOM   1642  C  CD2   . LEU C 3  34   ? 139.676 139.656 188.543 1.00 85.42  ?  33   LEU C CD2   1 
ATOM   1643  N  N     . LEU C 3  35   ? 136.795 144.251 188.988 1.00 85.21  ?  34   LEU C N     1 
ATOM   1644  C  CA    . LEU C 3  35   ? 136.657 145.699 188.881 1.00 86.18  ?  34   LEU C CA    1 
ATOM   1645  C  C     . LEU C 3  35   ? 137.076 146.394 190.170 1.00 86.77  ?  34   LEU C C     1 
ATOM   1646  O  O     . LEU C 3  35   ? 137.499 147.556 190.138 1.00 87.34  ?  34   LEU C O     1 
ATOM   1647  C  CB    . LEU C 3  35   ? 135.218 146.070 188.522 1.00 86.30  ?  34   LEU C CB    1 
ATOM   1648  C  CG    . LEU C 3  35   ? 134.725 145.634 187.141 1.00 86.61  ?  34   LEU C CG    1 
ATOM   1649  C  CD1   . LEU C 3  35   ? 133.270 146.027 186.936 1.00 87.05  ?  34   LEU C CD1   1 
ATOM   1650  C  CD2   . LEU C 3  35   ? 135.602 146.228 186.051 1.00 86.39  ?  34   LEU C CD2   1 
ATOM   1651  N  N     . ARG C 3  36   ? 136.965 145.705 191.308 1.00 87.20  ?  35   ARG C N     1 
ATOM   1652  C  CA    . ARG C 3  36   ? 137.394 146.286 192.576 1.00 87.13  ?  35   ARG C CA    1 
ATOM   1653  C  C     . ARG C 3  36   ? 138.886 146.074 192.809 1.00 86.86  ?  35   ARG C C     1 
ATOM   1654  O  O     . ARG C 3  36   ? 139.613 147.021 193.126 1.00 86.97  ?  35   ARG C O     1 
ATOM   1655  C  CB    . ARG C 3  36   ? 136.582 145.692 193.729 1.00 87.39  ?  35   ARG C CB    1 
ATOM   1656  C  CG    . ARG C 3  36   ? 135.104 146.045 193.701 1.00 88.90  ?  35   ARG C CG    1 
ATOM   1657  C  CD    . ARG C 3  36   ? 134.376 145.445 194.894 1.00 90.93  ?  35   ARG C CD    1 
ATOM   1658  N  NE    . ARG C 3  36   ? 132.970 145.836 194.933 1.00 93.03  ?  35   ARG C NE    1 
ATOM   1659  C  CZ    . ARG C 3  36   ? 132.510 146.906 195.574 1.00 94.68  ?  35   ARG C CZ    1 
ATOM   1660  N  NH1   . ARG C 3  36   ? 133.345 147.696 196.234 1.00 95.41  ?  35   ARG C NH1   1 
ATOM   1661  N  NH2   . ARG C 3  36   ? 131.214 147.185 195.557 1.00 94.92  ?  35   ARG C NH2   1 
ATOM   1662  N  N     . LYS C 3  37   ? 139.359 144.835 192.658 1.00 86.30  ?  36   LYS C N     1 
ATOM   1663  C  CA    . LYS C 3  37   ? 140.766 144.536 192.903 1.00 85.95  ?  36   LYS C CA    1 
ATOM   1664  C  C     . LYS C 3  37   ? 141.664 145.039 191.779 1.00 84.86  ?  36   LYS C C     1 
ATOM   1665  O  O     . LYS C 3  37   ? 142.850 145.302 192.011 1.00 85.54  ?  36   LYS C O     1 
ATOM   1666  C  CB    . LYS C 3  37   ? 140.955 143.029 193.096 1.00 86.19  ?  36   LYS C CB    1 
ATOM   1667  C  CG    . LYS C 3  37   ? 142.357 142.618 193.519 1.00 87.17  ?  36   LYS C CG    1 
ATOM   1668  C  CD    . LYS C 3  37   ? 142.734 143.232 194.857 1.00 87.25  ?  36   LYS C CD    1 
ATOM   1669  C  CE    . LYS C 3  37   ? 141.818 142.741 195.966 1.00 89.26  ?  36   LYS C CE    1 
ATOM   1670  N  NZ    . LYS C 3  37   ? 142.178 143.326 197.287 1.00 90.45  ?  36   LYS C NZ    1 
ATOM   1671  N  N     . GLY C 3  38   ? 141.124 145.190 190.569 1.00 83.26  ?  37   GLY C N     1 
ATOM   1672  C  CA    . GLY C 3  38   ? 141.918 145.634 189.435 1.00 80.92  ?  37   GLY C CA    1 
ATOM   1673  C  C     . GLY C 3  38   ? 142.473 147.038 189.567 1.00 79.47  ?  37   GLY C C     1 
ATOM   1674  O  O     . GLY C 3  38   ? 143.373 147.401 188.799 1.00 79.06  ?  37   GLY C O     1 
ATOM   1675  N  N     . ASN C 3  39   ? 141.961 147.830 190.512 1.00 78.40  ?  38   ASN C N     1 
ATOM   1676  C  CA    . ASN C 3  39   ? 142.419 149.196 190.765 1.00 77.87  ?  38   ASN C CA    1 
ATOM   1677  C  C     . ASN C 3  39   ? 142.269 150.056 189.505 1.00 76.86  ?  38   ASN C C     1 
ATOM   1678  O  O     . ASN C 3  39   ? 143.240 150.480 188.873 1.00 76.65  ?  38   ASN C O     1 
ATOM   1679  C  CB    . ASN C 3  39   ? 143.865 149.197 191.280 1.00 78.24  ?  38   ASN C CB    1 
ATOM   1680  C  CG    . ASN C 3  39   ? 144.246 150.502 191.954 1.00 78.71  ?  38   ASN C CG    1 
ATOM   1681  O  OD1   . ASN C 3  39   ? 143.717 151.564 191.629 1.00 79.07  ?  38   ASN C OD1   1 
ATOM   1682  N  ND2   . ASN C 3  39   ? 145.174 150.425 192.900 1.00 78.57  ?  38   ASN C ND2   1 
ATOM   1683  N  N     . TYR C 3  40   ? 141.005 150.297 189.160 1.00 76.09  ?  39   TYR C N     1 
ATOM   1684  C  CA    . TYR C 3  40   ? 140.635 151.111 188.009 1.00 74.87  ?  39   TYR C CA    1 
ATOM   1685  C  C     . TYR C 3  40   ? 139.939 152.405 188.405 1.00 75.29  ?  39   TYR C C     1 
ATOM   1686  O  O     . TYR C 3  40   ? 140.353 153.486 187.974 1.00 74.73  ?  39   TYR C O     1 
ATOM   1687  C  CB    . TYR C 3  40   ? 139.733 150.306 187.061 1.00 73.60  ?  39   TYR C CB    1 
ATOM   1688  C  CG    . TYR C 3  40   ? 140.423 149.137 186.396 1.00 71.36  ?  39   TYR C CG    1 
ATOM   1689  C  CD1   . TYR C 3  40   ? 141.265 149.329 185.308 1.00 69.81  ?  39   TYR C CD1   1 
ATOM   1690  C  CD2   . TYR C 3  40   ? 140.225 147.840 186.851 1.00 70.06  ?  39   TYR C CD2   1 
ATOM   1691  C  CE1   . TYR C 3  40   ? 141.895 148.264 184.696 1.00 69.21  ?  39   TYR C CE1   1 
ATOM   1692  C  CE2   . TYR C 3  40   ? 140.850 146.769 186.244 1.00 69.34  ?  39   TYR C CE2   1 
ATOM   1693  C  CZ    . TYR C 3  40   ? 141.684 146.987 185.167 1.00 69.75  ?  39   TYR C CZ    1 
ATOM   1694  O  OH    . TYR C 3  40   ? 142.312 145.928 184.555 1.00 70.47  ?  39   TYR C OH    1 
ATOM   1695  N  N     . ALA C 3  41   ? 138.890 152.326 189.222 1.00 76.18  ?  40   ALA C N     1 
ATOM   1696  C  CA    . ALA C 3  41   ? 138.153 153.500 189.664 1.00 77.31  ?  40   ALA C CA    1 
ATOM   1697  C  C     . ALA C 3  41   ? 137.923 153.430 191.167 1.00 77.91  ?  40   ALA C C     1 
ATOM   1698  O  O     . ALA C 3  41   ? 138.044 152.371 191.788 1.00 77.84  ?  40   ALA C O     1 
ATOM   1699  C  CB    . ALA C 3  41   ? 136.808 153.632 188.935 1.00 77.61  ?  40   ALA C CB    1 
ATOM   1700  N  N     . GLU C 3  42   ? 137.587 154.584 191.749 1.00 78.82  ?  41   GLU C N     1 
ATOM   1701  C  CA    . GLU C 3  42   ? 137.323 154.635 193.184 1.00 80.23  ?  41   GLU C CA    1 
ATOM   1702  C  C     . GLU C 3  42   ? 136.005 153.951 193.526 1.00 81.00  ?  41   GLU C C     1 
ATOM   1703  O  O     . GLU C 3  42   ? 135.928 153.189 194.497 1.00 81.49  ?  41   GLU C O     1 
ATOM   1704  C  CB    . GLU C 3  42   ? 137.319 156.085 193.668 1.00 80.23  ?  41   GLU C CB    1 
ATOM   1705  C  CG    . GLU C 3  42   ? 137.157 156.241 195.175 1.00 81.53  ?  41   GLU C CG    1 
ATOM   1706  C  CD    . GLU C 3  42   ? 138.375 155.770 195.949 1.00 83.80  ?  41   GLU C CD    1 
ATOM   1707  O  OE1   . GLU C 3  42   ? 139.468 155.682 195.350 1.00 84.12  ?  41   GLU C OE1   1 
ATOM   1708  O  OE2   . GLU C 3  42   ? 138.241 155.486 197.158 1.00 84.75  ?  41   GLU C OE2   1 
ATOM   1709  N  N     . ARG C 3  43   ? 134.962 154.209 192.745 1.00 81.71  ?  42   ARG C N     1 
ATOM   1710  C  CA    . ARG C 3  43   ? 133.658 153.592 192.932 1.00 82.19  ?  42   ARG C CA    1 
ATOM   1711  C  C     . ARG C 3  43   ? 133.319 152.729 191.723 1.00 82.13  ?  42   ARG C C     1 
ATOM   1712  O  O     . ARG C 3  43   ? 133.950 152.818 190.666 1.00 81.98  ?  42   ARG C O     1 
ATOM   1713  C  CB    . ARG C 3  43   ? 132.570 154.651 193.152 1.00 82.52  ?  42   ARG C CB    1 
ATOM   1714  C  CG    . ARG C 3  43   ? 132.803 155.544 194.359 1.00 84.07  ?  42   ARG C CG    1 
ATOM   1715  C  CD    . ARG C 3  43   ? 132.762 154.746 195.651 1.00 86.80  ?  42   ARG C CD    1 
ATOM   1716  N  NE    . ARG C 3  43   ? 132.900 155.602 196.825 1.00 88.34  ?  42   ARG C NE    1 
ATOM   1717  C  CZ    . ARG C 3  43   ? 131.880 156.182 197.450 1.00 89.70  ?  42   ARG C CZ    1 
ATOM   1718  N  NH1   . ARG C 3  43   ? 130.642 156.000 197.012 1.00 91.06  ?  42   ARG C NH1   1 
ATOM   1719  N  NH2   . ARG C 3  43   ? 132.098 156.945 198.512 1.00 89.83  ?  42   ARG C NH2   1 
ATOM   1720  N  N     . VAL C 3  44   ? 132.304 151.880 191.891 1.00 81.99  ?  43   VAL C N     1 
ATOM   1721  C  CA    . VAL C 3  44   ? 131.838 150.995 190.834 1.00 81.92  ?  43   VAL C CA    1 
ATOM   1722  C  C     . VAL C 3  44   ? 130.334 151.173 190.670 1.00 81.85  ?  43   VAL C C     1 
ATOM   1723  O  O     . VAL C 3  44   ? 129.636 151.637 191.574 1.00 81.63  ?  43   VAL C O     1 
ATOM   1724  C  CB    . VAL C 3  44   ? 132.179 149.515 191.116 1.00 81.99  ?  43   VAL C CB    1 
ATOM   1725  C  CG1   . VAL C 3  44   ? 133.685 149.301 191.089 1.00 81.75  ?  43   VAL C CG1   1 
ATOM   1726  C  CG2   . VAL C 3  44   ? 131.601 149.087 192.453 1.00 81.57  ?  43   VAL C CG2   1 
ATOM   1727  N  N     . GLY C 3  45   ? 129.842 150.796 189.491 1.00 81.87  ?  44   GLY C N     1 
ATOM   1728  C  CA    . GLY C 3  45   ? 128.433 150.911 189.185 1.00 81.87  ?  44   GLY C CA    1 
ATOM   1729  C  C     . GLY C 3  45   ? 127.634 149.709 189.650 1.00 81.82  ?  44   GLY C C     1 
ATOM   1730  O  O     . GLY C 3  45   ? 128.140 148.784 190.285 1.00 81.64  ?  44   GLY C O     1 
ATOM   1731  N  N     . ALA C 3  46   ? 126.345 149.733 189.315 1.00 81.80  ?  45   ALA C N     1 
ATOM   1732  C  CA    . ALA C 3  46   ? 125.420 148.664 189.671 1.00 81.44  ?  45   ALA C CA    1 
ATOM   1733  C  C     . ALA C 3  46   ? 125.140 147.711 188.517 1.00 81.09  ?  45   ALA C C     1 
ATOM   1734  O  O     . ALA C 3  46   ? 125.020 146.502 188.736 1.00 81.29  ?  45   ALA C O     1 
ATOM   1735  C  CB    . ALA C 3  46   ? 124.099 149.254 190.174 1.00 81.32  ?  45   ALA C CB    1 
ATOM   1736  N  N     . GLY C 3  47   ? 125.033 148.226 187.295 1.00 80.33  ?  46   GLY C N     1 
ATOM   1737  C  CA    . GLY C 3  47   ? 124.771 147.387 186.142 1.00 79.81  ?  46   GLY C CA    1 
ATOM   1738  C  C     . GLY C 3  47   ? 125.953 147.278 185.202 1.00 79.60  ?  46   GLY C C     1 
ATOM   1739  O  O     . GLY C 3  47   ? 125.798 146.891 184.040 1.00 79.65  ?  46   GLY C O     1 
ATOM   1740  N  N     . ALA C 3  48   ? 127.148 147.619 185.697 1.00 79.05  ?  47   ALA C N     1 
ATOM   1741  C  CA    . ALA C 3  48   ? 128.338 147.534 184.851 1.00 78.04  ?  47   ALA C CA    1 
ATOM   1742  C  C     . ALA C 3  48   ? 128.770 146.095 184.598 1.00 77.30  ?  47   ALA C C     1 
ATOM   1743  O  O     . ALA C 3  48   ? 128.999 145.742 183.427 1.00 77.25  ?  47   ALA C O     1 
ATOM   1744  C  CB    . ALA C 3  48   ? 129.468 148.375 185.453 1.00 77.94  ?  47   ALA C CB    1 
ATOM   1745  N  N     . PRO C 3  49   ? 128.909 145.220 185.605 1.00 76.57  ?  48   PRO C N     1 
ATOM   1746  C  CA    . PRO C 3  49   ? 129.305 143.834 185.301 1.00 76.40  ?  48   PRO C CA    1 
ATOM   1747  C  C     . PRO C 3  49   ? 128.251 143.056 184.532 1.00 76.19  ?  48   PRO C C     1 
ATOM   1748  O  O     . PRO C 3  49   ? 128.604 142.094 183.839 1.00 76.08  ?  48   PRO C O     1 
ATOM   1749  C  CB    . PRO C 3  49   ? 129.550 143.223 186.686 1.00 76.26  ?  48   PRO C CB    1 
ATOM   1750  C  CG    . PRO C 3  49   ? 128.711 144.029 187.601 1.00 76.77  ?  48   PRO C CG    1 
ATOM   1751  C  CD    . PRO C 3  49   ? 128.764 145.426 187.059 1.00 76.52  ?  48   PRO C CD    1 
ATOM   1752  N  N     . VAL C 3  50   ? 126.976 143.435 184.631 1.00 75.63  ?  49   VAL C N     1 
ATOM   1753  C  CA    . VAL C 3  50   ? 125.944 142.759 183.852 1.00 74.97  ?  49   VAL C CA    1 
ATOM   1754  C  C     . VAL C 3  50   ? 126.038 143.158 182.385 1.00 74.36  ?  49   VAL C C     1 
ATOM   1755  O  O     . VAL C 3  50   ? 125.938 142.312 181.487 1.00 74.40  ?  49   VAL C O     1 
ATOM   1756  C  CB    . VAL C 3  50   ? 124.552 143.060 184.436 1.00 75.16  ?  49   VAL C CB    1 
ATOM   1757  C  CG1   . VAL C 3  50   ? 123.473 142.346 183.636 1.00 75.53  ?  49   VAL C CG1   1 
ATOM   1758  C  CG2   . VAL C 3  50   ? 124.493 142.657 185.901 1.00 74.51  ?  49   VAL C CG2   1 
ATOM   1759  N  N     . TYR C 3  51   ? 126.235 144.451 182.118 1.00 73.33  ?  50   TYR C N     1 
ATOM   1760  C  CA    . TYR C 3  51   ? 126.401 144.913 180.743 1.00 72.64  ?  50   TYR C CA    1 
ATOM   1761  C  C     . TYR C 3  51   ? 127.671 144.339 180.127 1.00 72.79  ?  50   TYR C C     1 
ATOM   1762  O  O     . TYR C 3  51   ? 127.662 143.858 178.987 1.00 72.41  ?  50   TYR C O     1 
ATOM   1763  C  CB    . TYR C 3  51   ? 126.421 146.442 180.711 1.00 72.31  ?  50   TYR C CB    1 
ATOM   1764  C  CG    . TYR C 3  51   ? 126.521 147.040 179.325 1.00 71.29  ?  50   TYR C CG    1 
ATOM   1765  C  CD1   . TYR C 3  51   ? 125.380 147.313 178.583 1.00 72.39  ?  50   TYR C CD1   1 
ATOM   1766  C  CD2   . TYR C 3  51   ? 127.755 147.341 178.764 1.00 69.88  ?  50   TYR C CD2   1 
ATOM   1767  C  CE1   . TYR C 3  51   ? 125.466 147.862 177.317 1.00 72.13  ?  50   TYR C CE1   1 
ATOM   1768  C  CE2   . TYR C 3  51   ? 127.851 147.889 177.500 1.00 72.00  ?  50   TYR C CE2   1 
ATOM   1769  C  CZ    . TYR C 3  51   ? 126.704 148.148 176.782 1.00 72.48  ?  50   TYR C CZ    1 
ATOM   1770  O  OH    . TYR C 3  51   ? 126.796 148.694 175.523 1.00 71.94  ?  50   TYR C OH    1 
ATOM   1771  N  N     . LEU C 3  52   ? 128.778 144.378 180.874 1.00 73.17  ?  51   LEU C N     1 
ATOM   1772  C  CA    . LEU C 3  52   ? 130.032 143.825 180.373 1.00 73.55  ?  51   LEU C CA    1 
ATOM   1773  C  C     . LEU C 3  52   ? 129.920 142.322 180.149 1.00 73.56  ?  51   LEU C C     1 
ATOM   1774  O  O     . LEU C 3  52   ? 130.453 141.791 179.167 1.00 73.43  ?  51   LEU C O     1 
ATOM   1775  C  CB    . LEU C 3  52   ? 131.168 144.143 181.344 1.00 73.69  ?  51   LEU C CB    1 
ATOM   1776  C  CG    . LEU C 3  52   ? 132.556 143.618 180.976 1.00 73.89  ?  51   LEU C CG    1 
ATOM   1777  C  CD1   . LEU C 3  52   ? 132.996 144.163 179.626 1.00 72.81  ?  51   LEU C CD1   1 
ATOM   1778  C  CD2   . LEU C 3  52   ? 133.564 143.977 182.055 1.00 73.53  ?  51   LEU C CD2   1 
ATOM   1779  N  N     . ALA C 3  53   ? 129.227 141.619 181.049 1.00 73.58  ?  52   ALA C N     1 
ATOM   1780  C  CA    . ALA C 3  53   ? 129.019 140.187 180.863 1.00 73.84  ?  52   ALA C CA    1 
ATOM   1781  C  C     . ALA C 3  53   ? 128.141 139.902 179.652 1.00 74.31  ?  52   ALA C C     1 
ATOM   1782  O  O     . ALA C 3  53   ? 128.320 138.875 178.987 1.00 73.97  ?  52   ALA C O     1 
ATOM   1783  C  CB    . ALA C 3  53   ? 128.404 139.577 182.123 1.00 73.83  ?  52   ALA C CB    1 
ATOM   1784  N  N     . ALA C 3  54   ? 127.193 140.793 179.350 1.00 74.38  ?  53   ALA C N     1 
ATOM   1785  C  CA    . ALA C 3  54   ? 126.360 140.608 178.167 1.00 74.61  ?  53   ALA C CA    1 
ATOM   1786  C  C     . ALA C 3  54   ? 127.154 140.851 176.890 1.00 74.77  ?  53   ALA C C     1 
ATOM   1787  O  O     . ALA C 3  54   ? 126.979 140.133 175.898 1.00 75.39  ?  53   ALA C O     1 
ATOM   1788  C  CB    . ALA C 3  54   ? 125.145 141.532 178.230 1.00 74.65  ?  53   ALA C CB    1 
ATOM   1789  N  N     . VAL C 3  55   ? 128.029 141.859 176.894 1.00 74.74  ?  54   VAL C N     1 
ATOM   1790  C  CA    . VAL C 3  55   ? 128.863 142.126 175.725 1.00 73.98  ?  54   VAL C CA    1 
ATOM   1791  C  C     . VAL C 3  55   ? 129.836 140.975 175.493 1.00 73.91  ?  54   VAL C C     1 
ATOM   1792  O  O     . VAL C 3  55   ? 130.010 140.504 174.363 1.00 73.71  ?  54   VAL C O     1 
ATOM   1793  C  CB    . VAL C 3  55   ? 129.602 143.466 175.887 1.00 73.51  ?  54   VAL C CB    1 
ATOM   1794  C  CG1   . VAL C 3  55   ? 130.565 143.686 174.730 1.00 73.45  ?  54   VAL C CG1   1 
ATOM   1795  C  CG2   . VAL C 3  55   ? 128.607 144.611 175.981 1.00 72.66  ?  54   VAL C CG2   1 
ATOM   1796  N  N     . LEU C 3  56   ? 130.485 140.506 176.563 1.00 74.67  ?  55   LEU C N     1 
ATOM   1797  C  CA    . LEU C 3  56   ? 131.390 139.369 176.436 1.00 75.64  ?  55   LEU C CA    1 
ATOM   1798  C  C     . LEU C 3  56   ? 130.645 138.106 176.026 1.00 76.40  ?  55   LEU C C     1 
ATOM   1799  O  O     . LEU C 3  56   ? 131.209 137.249 175.337 1.00 76.18  ?  55   LEU C O     1 
ATOM   1800  C  CB    . LEU C 3  56   ? 132.142 139.144 177.748 1.00 75.64  ?  55   LEU C CB    1 
ATOM   1801  C  CG    . LEU C 3  56   ? 133.129 140.236 178.165 1.00 75.09  ?  55   LEU C CG    1 
ATOM   1802  C  CD1   . LEU C 3  56   ? 133.782 139.888 179.494 1.00 75.27  ?  55   LEU C CD1   1 
ATOM   1803  C  CD2   . LEU C 3  56   ? 134.180 140.453 177.087 1.00 75.40  ?  55   LEU C CD2   1 
ATOM   1804  N  N     . GLU C 3  57   ? 129.382 137.970 176.440 1.00 77.63  ?  56   GLU C N     1 
ATOM   1805  C  CA    . GLU C 3  57   ? 128.582 136.834 175.995 1.00 78.65  ?  56   GLU C CA    1 
ATOM   1806  C  C     . GLU C 3  57   ? 128.235 136.942 174.516 1.00 78.68  ?  56   GLU C C     1 
ATOM   1807  O  O     . GLU C 3  57   ? 128.180 135.923 173.817 1.00 78.37  ?  56   GLU C O     1 
ATOM   1808  C  CB    . GLU C 3  57   ? 127.309 136.725 176.836 1.00 78.95  ?  56   GLU C CB    1 
ATOM   1809  C  CG    . GLU C 3  57   ? 126.427 135.539 176.478 1.00 79.73  ?  56   GLU C CG    1 
ATOM   1810  C  CD    . GLU C 3  57   ? 125.206 135.430 177.369 1.00 81.81  ?  56   GLU C CD    1 
ATOM   1811  O  OE1   . GLU C 3  57   ? 125.102 136.214 178.335 1.00 81.19  ?  56   GLU C OE1   1 
ATOM   1812  O  OE2   . GLU C 3  57   ? 124.351 134.559 177.103 1.00 83.12  ?  56   GLU C OE2   1 
ATOM   1813  N  N     . TYR C 3  58   ? 128.003 138.160 174.022 1.00 79.01  ?  57   TYR C N     1 
ATOM   1814  C  CA    . TYR C 3  58   ? 127.741 138.347 172.598 1.00 79.58  ?  57   TYR C CA    1 
ATOM   1815  C  C     . TYR C 3  58   ? 128.983 138.042 171.770 1.00 80.25  ?  57   TYR C C     1 
ATOM   1816  O  O     . TYR C 3  58   ? 128.910 137.336 170.756 1.00 80.28  ?  57   TYR C O     1 
ATOM   1817  C  CB    . TYR C 3  58   ? 127.251 139.772 172.339 1.00 79.28  ?  57   TYR C CB    1 
ATOM   1818  C  CG    . TYR C 3  58   ? 127.111 140.121 170.874 1.00 79.78  ?  57   TYR C CG    1 
ATOM   1819  C  CD1   . TYR C 3  58   ? 126.001 139.714 170.146 1.00 79.71  ?  57   TYR C CD1   1 
ATOM   1820  C  CD2   . TYR C 3  58   ? 128.086 140.865 170.221 1.00 80.48  ?  57   TYR C CD2   1 
ATOM   1821  C  CE1   . TYR C 3  58   ? 125.868 140.033 168.808 1.00 79.61  ?  57   TYR C CE1   1 
ATOM   1822  C  CE2   . TYR C 3  58   ? 127.962 141.188 168.883 1.00 80.13  ?  57   TYR C CE2   1 
ATOM   1823  C  CZ    . TYR C 3  58   ? 126.851 140.770 168.182 1.00 79.83  ?  57   TYR C CZ    1 
ATOM   1824  O  OH    . TYR C 3  58   ? 126.723 141.090 166.849 1.00 80.12  ?  57   TYR C OH    1 
ATOM   1825  N  N     . LEU C 3  59   ? 130.137 138.569 172.189 1.00 81.01  ?  58   LEU C N     1 
ATOM   1826  C  CA    . LEU C 3  59   ? 131.381 138.279 171.482 1.00 81.56  ?  58   LEU C CA    1 
ATOM   1827  C  C     . LEU C 3  59   ? 131.711 136.793 171.537 1.00 82.00  ?  58   LEU C C     1 
ATOM   1828  O  O     . LEU C 3  59   ? 132.227 136.226 170.566 1.00 82.32  ?  58   LEU C O     1 
ATOM   1829  C  CB    . LEU C 3  59   ? 132.524 139.106 172.071 1.00 81.55  ?  58   LEU C CB    1 
ATOM   1830  C  CG    . LEU C 3  59   ? 132.374 140.627 172.002 1.00 82.05  ?  58   LEU C CG    1 
ATOM   1831  C  CD1   . LEU C 3  59   ? 133.572 141.315 172.638 1.00 81.66  ?  58   LEU C CD1   1 
ATOM   1832  C  CD2   . LEU C 3  59   ? 132.189 141.084 170.564 1.00 81.76  ?  58   LEU C CD2   1 
ATOM   1833  N  N     . THR C 3  60   ? 131.416 136.145 172.666 1.00 82.37  ?  59   THR C N     1 
ATOM   1834  C  CA    . THR C 3  60   ? 131.646 134.708 172.778 1.00 82.96  ?  59   THR C CA    1 
ATOM   1835  C  C     . THR C 3  60   ? 130.723 133.930 171.848 1.00 83.68  ?  59   THR C C     1 
ATOM   1836  O  O     . THR C 3  60   ? 131.146 132.953 171.218 1.00 83.46  ?  59   THR C O     1 
ATOM   1837  C  CB    . THR C 3  60   ? 131.454 134.260 174.227 1.00 82.66  ?  59   THR C CB    1 
ATOM   1838  O  OG1   . THR C 3  60   ? 132.370 134.966 175.073 1.00 83.18  ?  59   THR C OG1   1 
ATOM   1839  C  CG2   . THR C 3  60   ? 131.698 132.765 174.363 1.00 82.28  ?  59   THR C CG2   1 
ATOM   1840  N  N     . ALA C 3  61   ? 129.461 134.352 171.744 1.00 84.77  ?  60   ALA C N     1 
ATOM   1841  C  CA    . ALA C 3  61   ? 128.524 133.666 170.861 1.00 85.63  ?  60   ALA C CA    1 
ATOM   1842  C  C     . ALA C 3  61   ? 128.906 133.850 169.397 1.00 86.41  ?  60   ALA C C     1 
ATOM   1843  O  O     . ALA C 3  61   ? 128.742 132.930 168.587 1.00 86.60  ?  60   ALA C O     1 
ATOM   1844  C  CB    . ALA C 3  61   ? 127.103 134.167 171.113 1.00 85.55  ?  60   ALA C CB    1 
ATOM   1845  N  N     . GLU C 3  62   ? 129.419 135.029 169.038 1.00 87.03  ?  61   GLU C N     1 
ATOM   1846  C  CA    . GLU C 3  62   ? 129.803 135.272 167.650 1.00 87.85  ?  61   GLU C CA    1 
ATOM   1847  C  C     . GLU C 3  62   ? 131.081 134.521 167.293 1.00 88.16  ?  61   GLU C C     1 
ATOM   1848  O  O     . GLU C 3  62   ? 131.144 133.836 166.264 1.00 88.12  ?  61   GLU C O     1 
ATOM   1849  C  CB    . GLU C 3  62   ? 129.971 136.773 167.409 1.00 87.94  ?  61   GLU C CB    1 
ATOM   1850  C  CG    . GLU C 3  62   ? 130.329 137.139 165.976 1.00 89.14  ?  61   GLU C CG    1 
ATOM   1851  C  CD    . GLU C 3  62   ? 129.200 136.865 164.999 1.00 91.05  ?  61   GLU C CD    1 
ATOM   1852  O  OE1   . GLU C 3  62   ? 128.031 136.808 165.436 1.00 91.57  ?  61   GLU C OE1   1 
ATOM   1853  O  OE2   . GLU C 3  62   ? 129.483 136.707 163.793 1.00 91.54  ?  61   GLU C OE2   1 
ATOM   1854  N  N     . ILE C 3  63   ? 132.110 134.636 168.136 1.00 88.78  ?  62   ILE C N     1 
ATOM   1855  C  CA    . ILE C 3  63   ? 133.382 133.978 167.854 1.00 89.82  ?  62   ILE C CA    1 
ATOM   1856  C  C     . ILE C 3  63   ? 133.220 132.462 167.874 1.00 90.04  ?  62   ILE C C     1 
ATOM   1857  O  O     . ILE C 3  63   ? 133.738 131.759 166.999 1.00 89.96  ?  62   ILE C O     1 
ATOM   1858  C  CB    . ILE C 3  63   ? 134.458 134.452 168.849 1.00 90.33  ?  62   ILE C CB    1 
ATOM   1859  C  CG1   . ILE C 3  63   ? 134.772 135.933 168.625 1.00 90.76  ?  62   ILE C CG1   1 
ATOM   1860  C  CG2   . ILE C 3  63   ? 135.720 133.614 168.718 1.00 89.91  ?  62   ILE C CG2   1 
ATOM   1861  C  CD1   . ILE C 3  63   ? 135.298 136.244 167.239 1.00 92.32  ?  62   ILE C CD1   1 
ATOM   1862  N  N     . LEU C 3  64   ? 132.492 131.934 168.861 1.00 90.64  ?  63   LEU C N     1 
ATOM   1863  C  CA    . LEU C 3  64   ? 132.263 130.494 168.910 1.00 91.38  ?  63   LEU C CA    1 
ATOM   1864  C  C     . LEU C 3  64   ? 131.302 130.039 167.819 1.00 92.18  ?  63   LEU C C     1 
ATOM   1865  O  O     . LEU C 3  64   ? 131.337 128.872 167.413 1.00 92.08  ?  63   LEU C O     1 
ATOM   1866  C  CB    . LEU C 3  64   ? 131.737 130.084 170.286 1.00 91.16  ?  63   LEU C CB    1 
ATOM   1867  C  CG    . LEU C 3  64   ? 132.779 129.710 171.345 1.00 90.45  ?  63   LEU C CG    1 
ATOM   1868  C  CD1   . LEU C 3  64   ? 133.658 128.572 170.848 1.00 90.26  ?  63   LEU C CD1   1 
ATOM   1869  C  CD2   . LEU C 3  64   ? 133.626 130.909 171.745 1.00 89.62  ?  63   LEU C CD2   1 
ATOM   1870  N  N     . GLU C 3  65   ? 130.442 130.937 167.335 1.00 93.11  ?  64   GLU C N     1 
ATOM   1871  C  CA    . GLU C 3  65   ? 129.541 130.582 166.242 1.00 94.23  ?  64   GLU C CA    1 
ATOM   1872  C  C     . GLU C 3  65   ? 130.304 130.440 164.931 1.00 94.64  ?  64   GLU C C     1 
ATOM   1873  O  O     . GLU C 3  65   ? 130.206 129.411 164.251 1.00 94.55  ?  64   GLU C O     1 
ATOM   1874  C  CB    . GLU C 3  65   ? 128.434 131.629 166.113 1.00 94.38  ?  64   GLU C CB    1 
ATOM   1875  C  CG    . GLU C 3  65   ? 127.511 131.419 164.921 1.00 96.10  ?  64   GLU C CG    1 
ATOM   1876  C  CD    . GLU C 3  65   ? 126.655 130.173 165.050 1.00 99.35  ?  64   GLU C CD    1 
ATOM   1877  O  OE1   . GLU C 3  65   ? 126.429 129.716 166.191 1.00 100.96 ?  64   GLU C OE1   1 
ATOM   1878  O  OE2   . GLU C 3  65   ? 126.206 129.649 164.009 1.00 100.08 ?  64   GLU C OE2   1 
ATOM   1879  N  N     . LEU C 3  66   ? 131.074 131.467 164.560 1.00 95.30  ?  65   LEU C N     1 
ATOM   1880  C  CA    . LEU C 3  66   ? 131.883 131.378 163.348 1.00 95.71  ?  65   LEU C CA    1 
ATOM   1881  C  C     . LEU C 3  66   ? 132.958 130.308 163.475 1.00 96.20  ?  65   LEU C C     1 
ATOM   1882  O  O     . LEU C 3  66   ? 133.379 129.728 162.467 1.00 96.34  ?  65   LEU C O     1 
ATOM   1883  C  CB    . LEU C 3  66   ? 132.511 132.735 163.032 1.00 95.58  ?  65   LEU C CB    1 
ATOM   1884  C  CG    . LEU C 3  66   ? 131.530 133.867 162.718 1.00 95.26  ?  65   LEU C CG    1 
ATOM   1885  C  CD1   . LEU C 3  66   ? 132.274 135.136 162.339 1.00 95.24  ?  65   LEU C CD1   1 
ATOM   1886  C  CD2   . LEU C 3  66   ? 130.571 133.454 161.612 1.00 95.70  ?  65   LEU C CD2   1 
ATOM   1887  N  N     . ALA C 3  67   ? 133.413 130.032 164.699 1.00 96.96  ?  66   ALA C N     1 
ATOM   1888  C  CA    . ALA C 3  67   ? 134.338 128.925 164.912 1.00 97.96  ?  66   ALA C CA    1 
ATOM   1889  C  C     . ALA C 3  67   ? 133.653 127.581 164.712 1.00 98.70  ?  66   ALA C C     1 
ATOM   1890  O  O     . ALA C 3  67   ? 134.279 126.633 164.223 1.00 98.94  ?  66   ALA C O     1 
ATOM   1891  C  CB    . ALA C 3  67   ? 134.946 129.008 166.312 1.00 97.99  ?  66   ALA C CB    1 
ATOM   1892  N  N     . GLY C 3  68   ? 132.375 127.477 165.084 1.00 99.45  ?  67   GLY C N     1 
ATOM   1893  C  CA    . GLY C 3  68   ? 131.639 126.252 164.823 1.00 100.33 ?  67   GLY C CA    1 
ATOM   1894  C  C     . GLY C 3  68   ? 131.370 126.043 163.345 1.00 101.04 ?  67   GLY C C     1 
ATOM   1895  O  O     . GLY C 3  68   ? 131.477 124.922 162.838 1.00 101.03 ?  67   GLY C O     1 
ATOM   1896  N  N     . ASN C 3  69   ? 131.018 127.117 162.633 1.00 101.58 ?  68   ASN C N     1 
ATOM   1897  C  CA    . ASN C 3  69   ? 130.832 127.012 161.189 1.00 102.15 ?  68   ASN C CA    1 
ATOM   1898  C  C     . ASN C 3  69   ? 132.140 126.654 160.494 1.00 102.78 ?  68   ASN C C     1 
ATOM   1899  O  O     . ASN C 3  69   ? 132.162 125.806 159.593 1.00 102.83 ?  68   ASN C O     1 
ATOM   1900  C  CB    . ASN C 3  69   ? 130.266 128.319 160.634 1.00 101.94 ?  68   ASN C CB    1 
ATOM   1901  C  CG    . ASN C 3  69   ? 128.884 128.632 161.176 1.00 101.76 ?  68   ASN C CG    1 
ATOM   1902  O  OD1   . ASN C 3  69   ? 127.874 128.213 160.610 1.00 102.18 ?  68   ASN C OD1   1 
ATOM   1903  N  ND2   . ASN C 3  69   ? 128.834 129.372 162.277 1.00 101.79 ?  68   ASN C ND2   1 
ATOM   1904  N  N     . ALA C 3  70   ? 133.242 127.289 160.902 1.00 103.60 ?  69   ALA C N     1 
ATOM   1905  C  CA    . ALA C 3  70   ? 134.546 126.938 160.350 1.00 104.33 ?  69   ALA C CA    1 
ATOM   1906  C  C     . ALA C 3  70   ? 134.926 125.503 160.687 1.00 104.82 ?  69   ALA C C     1 
ATOM   1907  O  O     . ALA C 3  70   ? 135.632 124.849 159.912 1.00 104.71 ?  69   ALA C O     1 
ATOM   1908  C  CB    . ALA C 3  70   ? 135.613 127.906 160.861 1.00 104.32 ?  69   ALA C CB    1 
ATOM   1909  N  N     . ALA C 3  71   ? 134.471 124.998 161.837 1.00 105.72 ?  70   ALA C N     1 
ATOM   1910  C  CA    . ALA C 3  71   ? 134.703 123.597 162.168 1.00 106.70 ?  70   ALA C CA    1 
ATOM   1911  C  C     . ALA C 3  71   ? 133.880 122.672 161.283 1.00 107.37 ?  70   ALA C C     1 
ATOM   1912  O  O     . ALA C 3  71   ? 134.342 121.582 160.928 1.00 107.35 ?  70   ALA C O     1 
ATOM   1913  C  CB    . ALA C 3  71   ? 134.388 123.343 163.641 1.00 106.64 ?  70   ALA C CB    1 
ATOM   1914  N  N     . ARG C 3  72   ? 132.665 123.084 160.918 1.00 108.08 ?  71   ARG C N     1 
ATOM   1915  C  CA    . ARG C 3  72   ? 131.841 122.300 160.009 1.00 108.76 ?  71   ARG C CA    1 
ATOM   1916  C  C     . ARG C 3  72   ? 132.279 122.423 158.556 1.00 108.94 ?  71   ARG C C     1 
ATOM   1917  O  O     . ARG C 3  72   ? 131.854 121.609 157.729 1.00 109.11 ?  71   ARG C O     1 
ATOM   1918  C  CB    . ARG C 3  72   ? 130.372 122.713 160.137 1.00 108.84 ?  71   ARG C CB    1 
ATOM   1919  C  CG    . ARG C 3  72   ? 129.747 122.373 161.481 1.00 109.35 ?  71   ARG C CG    1 
ATOM   1920  C  CD    . ARG C 3  72   ? 128.260 122.686 161.492 1.00 109.28 ?  71   ARG C CD    1 
ATOM   1921  N  NE    . ARG C 3  72   ? 127.628 122.292 162.747 1.00 110.64 ?  71   ARG C NE    1 
ATOM   1922  C  CZ    . ARG C 3  72   ? 126.329 122.414 163.000 1.00 111.33 ?  71   ARG C CZ    1 
ATOM   1923  N  NH1   . ARG C 3  72   ? 125.518 122.920 162.081 1.00 112.08 ?  71   ARG C NH1   1 
ATOM   1924  N  NH2   . ARG C 3  72   ? 125.839 122.029 164.170 1.00 111.53 ?  71   ARG C NH2   1 
ATOM   1925  N  N     . ASP C 3  73   ? 133.112 123.414 158.224 1.00 109.19 ?  72   ASP C N     1 
ATOM   1926  C  CA    . ASP C 3  73   ? 133.595 123.540 156.853 1.00 109.50 ?  72   ASP C CA    1 
ATOM   1927  C  C     . ASP C 3  73   ? 134.566 122.423 156.492 1.00 109.70 ?  72   ASP C C     1 
ATOM   1928  O  O     . ASP C 3  73   ? 134.687 122.066 155.314 1.00 109.88 ?  72   ASP C O     1 
ATOM   1929  C  CB    . ASP C 3  73   ? 134.258 124.902 156.649 1.00 109.48 ?  72   ASP C CB    1 
ATOM   1930  C  CG    . ASP C 3  73   ? 133.274 126.050 156.745 1.00 110.29 ?  72   ASP C CG    1 
ATOM   1931  O  OD1   . ASP C 3  73   ? 132.081 125.838 156.441 1.00 110.61 ?  72   ASP C OD1   1 
ATOM   1932  O  OD2   . ASP C 3  73   ? 133.693 127.165 157.122 1.00 110.56 ?  72   ASP C OD2   1 
ATOM   1933  N  N     . ASN C 3  74   ? 135.264 121.862 157.479 1.00 109.98 ?  73   ASN C N     1 
ATOM   1934  C  CA    . ASN C 3  74   ? 136.226 120.792 157.249 1.00 110.04 ?  73   ASN C CA    1 
ATOM   1935  C  C     . ASN C 3  74   ? 135.782 119.466 157.854 1.00 109.93 ?  73   ASN C C     1 
ATOM   1936  O  O     . ASN C 3  74   ? 136.596 118.541 157.954 1.00 109.79 ?  73   ASN C O     1 
ATOM   1937  C  CB    . ASN C 3  74   ? 137.598 121.188 157.800 1.00 110.23 ?  73   ASN C CB    1 
ATOM   1938  C  CG    . ASN C 3  74   ? 138.169 122.413 157.114 1.00 110.51 ?  73   ASN C CG    1 
ATOM   1939  O  OD1   . ASN C 3  74   ? 137.892 122.667 155.942 1.00 111.00 ?  73   ASN C OD1   1 
ATOM   1940  N  ND2   . ASN C 3  74   ? 138.973 123.179 157.842 1.00 109.92 ?  73   ASN C ND2   1 
ATOM   1941  N  N     . LYS C 3  75   ? 134.515 119.354 158.258 1.00 109.86 ?  74   LYS C N     1 
ATOM   1942  C  CA    . LYS C 3  75   ? 133.959 118.134 158.844 1.00 109.87 ?  74   LYS C CA    1 
ATOM   1943  C  C     . LYS C 3  75   ? 134.755 117.705 160.079 1.00 109.66 ?  74   LYS C C     1 
ATOM   1944  O  O     . LYS C 3  75   ? 135.313 116.608 160.149 1.00 109.80 ?  74   LYS C O     1 
ATOM   1945  C  CB    . LYS C 3  75   ? 133.894 117.007 157.807 1.00 109.99 ?  74   LYS C CB    1 
ATOM   1946  C  CG    . LYS C 3  75   ? 133.053 117.335 156.582 1.00 110.56 ?  74   LYS C CG    1 
ATOM   1947  C  CD    . LYS C 3  75   ? 133.031 116.187 155.578 1.00 111.27 ?  74   LYS C CD    1 
ATOM   1948  C  CE    . LYS C 3  75   ? 134.299 116.135 154.730 1.00 111.48 ?  74   LYS C CE    1 
ATOM   1949  N  NZ    . LYS C 3  75   ? 135.473 115.563 155.448 1.00 111.86 ?  74   LYS C NZ    1 
ATOM   1950  N  N     . LYS C 3  76   ? 134.796 118.600 161.063 1.00 109.28 ?  75   LYS C N     1 
ATOM   1951  C  CA    . LYS C 3  76   ? 135.499 118.362 162.315 1.00 108.83 ?  75   LYS C CA    1 
ATOM   1952  C  C     . LYS C 3  76   ? 134.578 118.675 163.484 1.00 108.49 ?  75   LYS C C     1 
ATOM   1953  O  O     . LYS C 3  76   ? 133.863 119.681 163.471 1.00 108.45 ?  75   LYS C O     1 
ATOM   1954  C  CB    . LYS C 3  76   ? 136.774 119.210 162.412 1.00 108.93 ?  75   LYS C CB    1 
ATOM   1955  C  CG    . LYS C 3  76   ? 137.823 118.878 161.363 1.00 109.14 ?  75   LYS C CG    1 
ATOM   1956  C  CD    . LYS C 3  76   ? 138.290 117.437 161.487 1.00 109.94 ?  75   LYS C CD    1 
ATOM   1957  C  CE    . LYS C 3  76   ? 139.344 117.108 160.444 1.00 110.35 ?  75   LYS C CE    1 
ATOM   1958  N  NZ    . LYS C 3  76   ? 139.815 115.699 160.556 1.00 110.30 ?  75   LYS C NZ    1 
ATOM   1959  N  N     . THR C 3  77   ? 134.600 117.806 164.496 1.00 107.90 ?  76   THR C N     1 
ATOM   1960  C  CA    . THR C 3  77   ? 133.770 118.014 165.678 1.00 107.46 ?  76   THR C CA    1 
ATOM   1961  C  C     . THR C 3  77   ? 134.422 119.000 166.642 1.00 106.95 ?  76   THR C C     1 
ATOM   1962  O  O     . THR C 3  77   ? 133.875 120.074 166.915 1.00 106.95 ?  76   THR C O     1 
ATOM   1963  C  CB    . THR C 3  77   ? 133.500 116.678 166.376 1.00 107.59 ?  76   THR C CB    1 
ATOM   1964  O  OG1   . THR C 3  77   ? 132.825 115.792 165.474 1.00 107.80 ?  76   THR C OG1   1 
ATOM   1965  C  CG2   . THR C 3  77   ? 132.637 116.888 167.611 1.00 107.39 ?  76   THR C CG2   1 
ATOM   1966  N  N     . ARG C 3  78   ? 135.594 118.649 167.166 1.00 106.02 ?  77   ARG C N     1 
ATOM   1967  C  CA    . ARG C 3  78   ? 136.308 119.523 168.086 1.00 105.14 ?  77   ARG C CA    1 
ATOM   1968  C  C     . ARG C 3  78   ? 136.963 120.665 167.320 1.00 104.06 ?  77   ARG C C     1 
ATOM   1969  O  O     . ARG C 3  78   ? 137.685 120.439 166.344 1.00 103.85 ?  77   ARG C O     1 
ATOM   1970  C  CB    . ARG C 3  78   ? 137.358 118.733 168.866 1.00 105.52 ?  77   ARG C CB    1 
ATOM   1971  C  CG    . ARG C 3  78   ? 136.778 117.642 169.752 1.00 106.54 ?  77   ARG C CG    1 
ATOM   1972  C  CD    . ARG C 3  78   ? 137.866 116.934 170.543 1.00 108.23 ?  77   ARG C CD    1 
ATOM   1973  N  NE    . ARG C 3  78   ? 137.319 115.900 171.416 1.00 109.09 ?  77   ARG C NE    1 
ATOM   1974  C  CZ    . ARG C 3  78   ? 138.051 115.139 172.223 1.00 109.31 ?  77   ARG C CZ    1 
ATOM   1975  N  NH1   . ARG C 3  78   ? 139.367 115.294 172.270 1.00 109.62 ?  77   ARG C NH1   1 
ATOM   1976  N  NH2   . ARG C 3  78   ? 137.468 114.221 172.983 1.00 109.40 ?  77   ARG C NH2   1 
ATOM   1977  N  N     . ILE C 3  79   ? 136.710 121.891 167.767 1.00 102.72 ?  78   ILE C N     1 
ATOM   1978  C  CA    . ILE C 3  79   ? 137.244 123.076 167.104 1.00 101.17 ?  78   ILE C CA    1 
ATOM   1979  C  C     . ILE C 3  79   ? 138.722 123.216 167.443 1.00 100.33 ?  78   ILE C C     1 
ATOM   1980  O  O     . ILE C 3  79   ? 139.120 123.101 168.608 1.00 100.29 ?  78   ILE C O     1 
ATOM   1981  C  CB    . ILE C 3  79   ? 136.456 124.330 167.515 1.00 101.03 ?  78   ILE C CB    1 
ATOM   1982  C  CG1   . ILE C 3  79   ? 134.980 124.181 167.141 1.00 100.58 ?  78   ILE C CG1   1 
ATOM   1983  C  CG2   . ILE C 3  79   ? 137.044 125.572 166.868 1.00 101.04 ?  78   ILE C CG2   1 
ATOM   1984  C  CD1   . ILE C 3  79   ? 134.129 125.372 167.525 1.00 100.60 ?  78   ILE C CD1   1 
ATOM   1985  N  N     . ILE C 3  80   ? 139.539 123.461 166.423 1.00 99.17  ?  79   ILE C N     1 
ATOM   1986  C  CA    . ILE C 3  80   ? 140.978 123.645 166.593 1.00 98.03  ?  79   ILE C CA    1 
ATOM   1987  C  C     . ILE C 3  80   ? 141.287 125.135 166.489 1.00 97.09  ?  79   ILE C C     1 
ATOM   1988  O  O     . ILE C 3  80   ? 140.457 125.897 165.974 1.00 97.21  ?  79   ILE C O     1 
ATOM   1989  C  CB    . ILE C 3  80   ? 141.766 122.830 165.554 1.00 98.00  ?  79   ILE C CB    1 
ATOM   1990  C  CG1   . ILE C 3  80   ? 141.386 123.261 164.136 1.00 97.99  ?  79   ILE C CG1   1 
ATOM   1991  C  CG2   . ILE C 3  80   ? 141.517 121.341 165.746 1.00 98.27  ?  79   ILE C CG2   1 
ATOM   1992  C  CD1   . ILE C 3  80   ? 142.100 122.486 163.051 1.00 98.27  ?  79   ILE C CD1   1 
ATOM   1993  N  N     . PRO C 3  81   ? 142.445 125.600 166.973 1.00 96.09  ?  80   PRO C N     1 
ATOM   1994  C  CA    . PRO C 3  81   ? 142.773 127.029 166.817 1.00 95.25  ?  80   PRO C CA    1 
ATOM   1995  C  C     . PRO C 3  81   ? 142.824 127.484 165.370 1.00 94.36  ?  80   PRO C C     1 
ATOM   1996  O  O     . PRO C 3  81   ? 142.609 128.673 165.095 1.00 94.46  ?  80   PRO C O     1 
ATOM   1997  C  CB    . PRO C 3  81   ? 144.145 127.147 167.496 1.00 95.38  ?  80   PRO C CB    1 
ATOM   1998  C  CG    . PRO C 3  81   ? 144.183 126.018 168.465 1.00 95.57  ?  80   PRO C CG    1 
ATOM   1999  C  CD    . PRO C 3  81   ? 143.431 124.897 167.812 1.00 96.05  ?  80   PRO C CD    1 
ATOM   2000  N  N     . ARG C 3  82   ? 143.106 126.575 164.432 1.00 93.00  ?  81   ARG C N     1 
ATOM   2001  C  CA    . ARG C 3  82   ? 143.067 126.939 163.020 1.00 91.90  ?  81   ARG C CA    1 
ATOM   2002  C  C     . ARG C 3  82   ? 141.667 127.359 162.596 1.00 91.39  ?  81   ARG C C     1 
ATOM   2003  O  O     . ARG C 3  82   ? 141.514 128.239 161.742 1.00 91.17  ?  81   ARG C O     1 
ATOM   2004  C  CB    . ARG C 3  82   ? 143.561 125.776 162.160 1.00 91.71  ?  81   ARG C CB    1 
ATOM   2005  C  CG    . ARG C 3  82   ? 143.637 126.094 160.675 1.00 91.60  ?  81   ARG C CG    1 
ATOM   2006  C  CD    . ARG C 3  82   ? 144.479 127.336 160.425 1.00 91.79  ?  81   ARG C CD    1 
ATOM   2007  N  NE    . ARG C 3  82   ? 144.485 127.725 159.018 1.00 91.90  ?  81   ARG C NE    1 
ATOM   2008  C  CZ    . ARG C 3  82   ? 145.387 127.313 158.133 1.00 92.33  ?  81   ARG C CZ    1 
ATOM   2009  N  NH1   . ARG C 3  82   ? 146.361 126.496 158.508 1.00 92.07  ?  81   ARG C NH1   1 
ATOM   2010  N  NH2   . ARG C 3  82   ? 145.315 127.719 156.873 1.00 92.38  ?  81   ARG C NH2   1 
ATOM   2011  N  N     . HIS C 3  83   ? 140.634 126.746 163.181 1.00 90.56  ?  82   HIS C N     1 
ATOM   2012  C  CA    . HIS C 3  83   ? 139.270 127.186 162.912 1.00 89.72  ?  82   HIS C CA    1 
ATOM   2013  C  C     . HIS C 3  83   ? 139.013 128.576 163.479 1.00 88.84  ?  82   HIS C C     1 
ATOM   2014  O  O     . HIS C 3  83   ? 138.196 129.325 162.932 1.00 89.04  ?  82   HIS C O     1 
ATOM   2015  C  CB    . HIS C 3  83   ? 138.271 126.181 163.485 1.00 89.86  ?  82   HIS C CB    1 
ATOM   2016  C  CG    . HIS C 3  83   ? 138.395 124.807 162.904 1.00 90.88  ?  82   HIS C CG    1 
ATOM   2017  N  ND1   . HIS C 3  83   ? 137.845 123.693 163.501 1.00 91.83  ?  82   HIS C ND1   1 
ATOM   2018  C  CD2   . HIS C 3  83   ? 139.005 124.366 161.778 1.00 91.85  ?  82   HIS C CD2   1 
ATOM   2019  C  CE1   . HIS C 3  83   ? 138.111 122.626 162.770 1.00 92.82  ?  82   HIS C CE1   1 
ATOM   2020  N  NE2   . HIS C 3  83   ? 138.814 123.007 161.718 1.00 92.79  ?  82   HIS C NE2   1 
ATOM   2021  N  N     . LEU C 3  84   ? 139.694 128.935 164.570 1.00 87.62  ?  83   LEU C N     1 
ATOM   2022  C  CA    . LEU C 3  84   ? 139.595 130.298 165.084 1.00 86.64  ?  83   LEU C CA    1 
ATOM   2023  C  C     . LEU C 3  84   ? 140.282 131.284 164.149 1.00 86.06  ?  83   LEU C C     1 
ATOM   2024  O  O     . LEU C 3  84   ? 139.757 132.374 163.892 1.00 85.67  ?  83   LEU C O     1 
ATOM   2025  C  CB    . LEU C 3  84   ? 140.197 130.383 166.488 1.00 86.38  ?  83   LEU C CB    1 
ATOM   2026  C  CG    . LEU C 3  84   ? 139.349 129.930 167.682 1.00 85.86  ?  83   LEU C CG    1 
ATOM   2027  C  CD1   . LEU C 3  84   ? 137.987 130.609 167.666 1.00 85.80  ?  83   LEU C CD1   1 
ATOM   2028  C  CD2   . LEU C 3  84   ? 139.205 128.415 167.736 1.00 85.29  ?  83   LEU C CD2   1 
ATOM   2029  N  N     . GLN C 3  85   ? 141.457 130.918 163.629 1.00 85.28  ?  84   GLN C N     1 
ATOM   2030  C  CA    . GLN C 3  85   ? 142.161 131.789 162.692 1.00 84.78  ?  84   GLN C CA    1 
ATOM   2031  C  C     . GLN C 3  85   ? 141.347 131.999 161.421 1.00 84.53  ?  84   GLN C C     1 
ATOM   2032  O  O     . GLN C 3  85   ? 141.139 133.136 160.982 1.00 84.95  ?  84   GLN C O     1 
ATOM   2033  C  CB    . GLN C 3  85   ? 143.534 131.201 162.364 1.00 84.58  ?  84   GLN C CB    1 
ATOM   2034  C  CG    . GLN C 3  85   ? 144.361 132.031 161.392 1.00 84.39  ?  84   GLN C CG    1 
ATOM   2035  C  CD    . GLN C 3  85   ? 144.944 133.278 162.030 1.00 84.11  ?  84   GLN C CD    1 
ATOM   2036  O  OE1   . GLN C 3  85   ? 144.846 133.476 163.241 1.00 83.86  ?  84   GLN C OE1   1 
ATOM   2037  N  NE2   . GLN C 3  85   ? 145.559 134.127 161.214 1.00 83.36  ?  84   GLN C NE2   1 
ATOM   2038  N  N     . LEU C 3  86   ? 140.874 130.907 160.815 1.00 83.78  ?  85   LEU C N     1 
ATOM   2039  C  CA    . LEU C 3  86   ? 140.049 131.014 159.618 1.00 82.75  ?  85   LEU C CA    1 
ATOM   2040  C  C     . LEU C 3  86   ? 138.688 131.631 159.908 1.00 82.24  ?  85   LEU C C     1 
ATOM   2041  O  O     . LEU C 3  86   ? 138.029 132.111 158.979 1.00 82.14  ?  85   LEU C O     1 
ATOM   2042  C  CB    . LEU C 3  86   ? 139.866 129.638 158.977 1.00 82.65  ?  85   LEU C CB    1 
ATOM   2043  C  CG    . LEU C 3  86   ? 141.137 128.892 158.566 1.00 82.52  ?  85   LEU C CG    1 
ATOM   2044  C  CD1   . LEU C 3  86   ? 140.790 127.533 157.977 1.00 82.44  ?  85   LEU C CD1   1 
ATOM   2045  C  CD2   . LEU C 3  86   ? 141.952 129.714 157.583 1.00 81.77  ?  85   LEU C CD2   1 
ATOM   2046  N  N     . ALA C 3  87   ? 138.252 131.626 161.169 1.00 81.60  ?  86   ALA C N     1 
ATOM   2047  C  CA    . ALA C 3  87   ? 136.965 132.215 161.515 1.00 81.17  ?  86   ALA C CA    1 
ATOM   2048  C  C     . ALA C 3  87   ? 137.070 133.714 161.766 1.00 81.17  ?  86   ALA C C     1 
ATOM   2049  O  O     . ALA C 3  87   ? 136.097 134.443 161.544 1.00 81.37  ?  86   ALA C O     1 
ATOM   2050  C  CB    . ALA C 3  87   ? 136.380 131.516 162.744 1.00 80.96  ?  86   ALA C CB    1 
ATOM   2051  N  N     . VAL C 3  88   ? 138.226 134.189 162.221 1.00 80.92  ?  87   VAL C N     1 
ATOM   2052  C  CA    . VAL C 3  88   ? 138.415 135.615 162.472 1.00 80.31  ?  87   VAL C CA    1 
ATOM   2053  C  C     . VAL C 3  88   ? 138.946 136.333 161.237 1.00 80.11  ?  87   VAL C C     1 
ATOM   2054  O  O     . VAL C 3  88   ? 138.495 137.433 160.911 1.00 79.93  ?  87   VAL C O     1 
ATOM   2055  C  CB    . VAL C 3  88   ? 139.346 135.819 163.685 1.00 80.41  ?  87   VAL C CB    1 
ATOM   2056  C  CG1   . VAL C 3  88   ? 139.662 137.295 163.874 1.00 80.60  ?  87   VAL C CG1   1 
ATOM   2057  C  CG2   . VAL C 3  88   ? 138.713 135.245 164.944 1.00 79.50  ?  87   VAL C CG2   1 
ATOM   2058  N  N     . ARG C 3  89   ? 139.902 135.725 160.530 1.00 79.80  ?  88   ARG C N     1 
ATOM   2059  C  CA    . ARG C 3  89   ? 140.500 136.380 159.372 1.00 79.62  ?  88   ARG C CA    1 
ATOM   2060  C  C     . ARG C 3  89   ? 139.555 136.443 158.180 1.00 79.95  ?  88   ARG C C     1 
ATOM   2061  O  O     . ARG C 3  89   ? 139.778 137.250 157.272 1.00 80.41  ?  88   ARG C O     1 
ATOM   2062  C  CB    . ARG C 3  89   ? 141.792 135.666 158.970 1.00 79.35  ?  88   ARG C CB    1 
ATOM   2063  C  CG    . ARG C 3  89   ? 142.879 135.704 160.032 1.00 78.02  ?  88   ARG C CG    1 
ATOM   2064  C  CD    . ARG C 3  89   ? 143.198 137.131 160.444 1.00 75.04  ?  88   ARG C CD    1 
ATOM   2065  N  NE    . ARG C 3  89   ? 144.204 137.183 161.501 1.00 72.79  ?  88   ARG C NE    1 
ATOM   2066  C  CZ    . ARG C 3  89   ? 144.646 138.307 162.056 1.00 73.26  ?  88   ARG C CZ    1 
ATOM   2067  N  NH1   . ARG C 3  89   ? 144.170 139.478 161.656 1.00 72.03  ?  88   ARG C NH1   1 
ATOM   2068  N  NH2   . ARG C 3  89   ? 145.563 138.260 163.013 1.00 72.02  ?  88   ARG C NH2   1 
ATOM   2069  N  N     . ASN C 3  90   ? 138.508 135.616 158.159 1.00 79.94  ?  89   ASN C N     1 
ATOM   2070  C  CA    . ASN C 3  90   ? 137.574 135.622 157.041 1.00 79.53  ?  89   ASN C CA    1 
ATOM   2071  C  C     . ASN C 3  90   ? 136.573 136.767 157.118 1.00 79.62  ?  89   ASN C C     1 
ATOM   2072  O  O     . ASN C 3  90   ? 136.057 137.192 156.078 1.00 80.00  ?  89   ASN C O     1 
ATOM   2073  C  CB    . ASN C 3  90   ? 136.826 134.289 156.972 1.00 79.12  ?  89   ASN C CB    1 
ATOM   2074  C  CG    . ASN C 3  90   ? 136.017 134.138 155.699 1.00 79.02  ?  89   ASN C CG    1 
ATOM   2075  O  OD1   . ASN C 3  90   ? 136.330 134.745 154.674 1.00 77.38  ?  89   ASN C OD1   1 
ATOM   2076  N  ND2   . ASN C 3  90   ? 134.970 133.325 155.757 1.00 79.44  ?  89   ASN C ND2   1 
ATOM   2077  N  N     . ASP C 3  91   ? 136.290 137.275 158.312 1.00 79.64  ?  90   ASP C N     1 
ATOM   2078  C  CA    . ASP C 3  91   ? 135.350 138.372 158.477 1.00 79.84  ?  90   ASP C CA    1 
ATOM   2079  C  C     . ASP C 3  91   ? 136.062 139.711 158.303 1.00 79.76  ?  90   ASP C C     1 
ATOM   2080  O  O     . ASP C 3  91   ? 137.292 139.801 158.336 1.00 79.55  ?  90   ASP C O     1 
ATOM   2081  C  CB    . ASP C 3  91   ? 134.677 138.300 159.849 1.00 79.86  ?  90   ASP C CB    1 
ATOM   2082  C  CG    . ASP C 3  91   ? 133.372 139.071 159.903 1.00 80.79  ?  90   ASP C CG    1 
ATOM   2083  O  OD1   . ASP C 3  91   ? 133.212 140.039 159.129 1.00 81.40  ?  90   ASP C OD1   1 
ATOM   2084  O  OD2   . ASP C 3  91   ? 132.504 138.708 160.724 1.00 81.23  ?  90   ASP C OD2   1 
ATOM   2085  N  N     . GLU C 3  92   ? 135.264 140.760 158.110 1.00 80.06  ?  91   GLU C N     1 
ATOM   2086  C  CA    . GLU C 3  92   ? 135.791 142.105 157.911 1.00 80.20  ?  91   GLU C CA    1 
ATOM   2087  C  C     . GLU C 3  92   ? 135.841 142.894 159.215 1.00 79.72  ?  91   GLU C C     1 
ATOM   2088  O  O     . GLU C 3  92   ? 136.890 143.440 159.573 1.00 79.88  ?  91   GLU C O     1 
ATOM   2089  C  CB    . GLU C 3  92   ? 134.945 142.851 156.874 1.00 80.54  ?  91   GLU C CB    1 
ATOM   2090  C  CG    . GLU C 3  92   ? 134.914 142.200 155.498 1.00 82.54  ?  91   GLU C CG    1 
ATOM   2091  C  CD    . GLU C 3  92   ? 136.225 142.345 154.748 1.00 86.08  ?  91   GLU C CD    1 
ATOM   2092  O  OE1   . GLU C 3  92   ? 137.035 143.219 155.123 1.00 87.43  ?  91   GLU C OE1   1 
ATOM   2093  O  OE2   . GLU C 3  92   ? 136.444 141.584 153.782 1.00 87.22  ?  91   GLU C OE2   1 
ATOM   2094  N  N     . GLU C 3  93   ? 134.715 142.965 159.930 1.00 79.15  ?  92   GLU C N     1 
ATOM   2095  C  CA    . GLU C 3  93   ? 134.683 143.697 161.191 1.00 78.42  ?  92   GLU C CA    1 
ATOM   2096  C  C     . GLU C 3  93   ? 135.547 143.019 162.248 1.00 77.55  ?  92   GLU C C     1 
ATOM   2097  O  O     . GLU C 3  93   ? 136.168 143.695 163.076 1.00 77.45  ?  92   GLU C O     1 
ATOM   2098  C  CB    . GLU C 3  93   ? 133.240 143.838 161.677 1.00 78.70  ?  92   GLU C CB    1 
ATOM   2099  C  CG    . GLU C 3  93   ? 132.331 144.575 160.703 1.00 80.05  ?  92   GLU C CG    1 
ATOM   2100  C  CD    . GLU C 3  93   ? 130.944 144.813 161.266 1.00 82.11  ?  92   GLU C CD    1 
ATOM   2101  O  OE1   . GLU C 3  93   ? 130.729 144.512 162.458 1.00 83.24  ?  92   GLU C OE1   1 
ATOM   2102  O  OE2   . GLU C 3  93   ? 130.070 145.302 160.519 1.00 81.74  ?  92   GLU C OE2   1 
ATOM   2103  N  N     . LEU C 3  94   ? 135.603 141.684 162.234 1.00 76.69  ?  93   LEU C N     1 
ATOM   2104  C  CA    . LEU C 3  94   ? 136.472 140.976 163.170 1.00 75.74  ?  93   LEU C CA    1 
ATOM   2105  C  C     . LEU C 3  94   ? 137.944 141.172 162.830 1.00 75.62  ?  93   LEU C C     1 
ATOM   2106  O  O     . LEU C 3  94   ? 138.786 141.214 163.734 1.00 75.85  ?  93   LEU C O     1 
ATOM   2107  C  CB    . LEU C 3  94   ? 136.125 139.487 163.189 1.00 75.98  ?  93   LEU C CB    1 
ATOM   2108  C  CG    . LEU C 3  94   ? 134.727 139.129 163.699 1.00 75.16  ?  93   LEU C CG    1 
ATOM   2109  C  CD1   . LEU C 3  94   ? 134.547 137.620 163.774 1.00 73.94  ?  93   LEU C CD1   1 
ATOM   2110  C  CD2   . LEU C 3  94   ? 134.474 139.769 165.053 1.00 73.56  ?  93   LEU C CD2   1 
ATOM   2111  N  N     . ASN C 3  95   ? 138.276 141.285 161.541 1.00 75.20  ?  94   ASN C N     1 
ATOM   2112  C  CA    . ASN C 3  95   ? 139.656 141.567 161.160 1.00 74.30  ?  94   ASN C CA    1 
ATOM   2113  C  C     . ASN C 3  95   ? 140.040 142.996 161.519 1.00 73.59  ?  94   ASN C C     1 
ATOM   2114  O  O     . ASN C 3  95   ? 141.186 143.261 161.902 1.00 73.97  ?  94   ASN C O     1 
ATOM   2115  C  CB    . ASN C 3  95   ? 139.852 141.314 159.665 1.00 74.52  ?  94   ASN C CB    1 
ATOM   2116  C  CG    . ASN C 3  95   ? 141.293 141.497 159.224 1.00 74.96  ?  94   ASN C CG    1 
ATOM   2117  O  OD1   . ASN C 3  95   ? 142.223 141.347 160.017 1.00 75.27  ?  94   ASN C OD1   1 
ATOM   2118  N  ND2   . ASN C 3  95   ? 141.484 141.823 157.951 1.00 73.02  ?  94   ASN C ND2   1 
ATOM   2119  N  N     . LYS C 3  96   ? 139.095 143.932 161.402 1.00 72.80  ?  95   LYS C N     1 
ATOM   2120  C  CA    . LYS C 3  96   ? 139.369 145.308 161.802 1.00 72.45  ?  95   LYS C CA    1 
ATOM   2121  C  C     . LYS C 3  96   ? 139.500 145.436 163.314 1.00 72.24  ?  95   LYS C C     1 
ATOM   2122  O  O     . LYS C 3  96   ? 140.309 146.235 163.800 1.00 72.23  ?  95   LYS C O     1 
ATOM   2123  C  CB    . LYS C 3  96   ? 138.269 146.234 161.281 1.00 72.55  ?  95   LYS C CB    1 
ATOM   2124  C  CG    . LYS C 3  96   ? 138.489 147.704 161.597 1.00 74.23  ?  95   LYS C CG    1 
ATOM   2125  C  CD    . LYS C 3  96   ? 139.778 148.214 160.975 1.00 77.23  ?  95   LYS C CD    1 
ATOM   2126  C  CE    . LYS C 3  96   ? 140.002 149.683 161.295 1.00 78.33  ?  95   LYS C CE    1 
ATOM   2127  N  NZ    . LYS C 3  96   ? 138.910 150.544 160.760 1.00 77.43  ?  95   LYS C NZ    1 
ATOM   2128  N  N     . LEU C 3  97   ? 138.721 144.659 164.071 1.00 71.91  ?  96   LEU C N     1 
ATOM   2129  C  CA    . LEU C 3  97   ? 138.824 144.704 165.526 1.00 71.20  ?  96   LEU C CA    1 
ATOM   2130  C  C     . LEU C 3  97   ? 140.119 144.063 166.009 1.00 71.20  ?  96   LEU C C     1 
ATOM   2131  O  O     . LEU C 3  97   ? 140.791 144.601 166.897 1.00 71.88  ?  96   LEU C O     1 
ATOM   2132  C  CB    . LEU C 3  97   ? 137.614 144.016 166.159 1.00 71.03  ?  96   LEU C CB    1 
ATOM   2133  C  CG    . LEU C 3  97   ? 137.595 143.926 167.686 1.00 70.70  ?  96   LEU C CG    1 
ATOM   2134  C  CD1   . LEU C 3  97   ? 137.608 145.314 168.309 1.00 70.53  ?  96   LEU C CD1   1 
ATOM   2135  C  CD2   . LEU C 3  97   ? 136.388 143.132 168.165 1.00 70.61  ?  96   LEU C CD2   1 
ATOM   2136  N  N     . LEU C 3  98   ? 140.485 142.920 165.439 1.00 70.62  ?  97   LEU C N     1 
ATOM   2137  C  CA    . LEU C 3  98   ? 141.693 142.196 165.823 1.00 70.15  ?  97   LEU C CA    1 
ATOM   2138  C  C     . LEU C 3  98   ? 142.749 142.369 164.735 1.00 70.23  ?  97   LEU C C     1 
ATOM   2139  O  O     . LEU C 3  98   ? 143.107 141.430 164.020 1.00 69.82  ?  97   LEU C O     1 
ATOM   2140  C  CB    . LEU C 3  98   ? 141.371 140.716 166.069 1.00 70.03  ?  97   LEU C CB    1 
ATOM   2141  C  CG    . LEU C 3  98   ? 140.334 140.413 167.152 1.00 70.35  ?  97   LEU C CG    1 
ATOM   2142  C  CD1   . LEU C 3  98   ? 140.154 138.912 167.318 1.00 71.08  ?  97   LEU C CD1   1 
ATOM   2143  C  CD2   . LEU C 3  98   ? 140.728 141.059 168.471 1.00 71.39  ?  97   LEU C CD2   1 
ATOM   2144  N  N     . GLY C 3  99   ? 143.253 143.595 164.616 1.00 70.14  ?  98   GLY C N     1 
ATOM   2145  C  CA    . GLY C 3  99   ? 144.263 143.904 163.624 1.00 70.13  ?  98   GLY C CA    1 
ATOM   2146  C  C     . GLY C 3  99   ? 145.642 143.401 163.997 1.00 70.08  ?  98   GLY C C     1 
ATOM   2147  O  O     . GLY C 3  99   ? 146.223 142.575 163.286 1.00 69.93  ?  98   GLY C O     1 
ATOM   2148  N  N     . ARG C 3  100  ? 146.178 143.894 165.111 1.00 70.45  ?  99   ARG C N     1 
ATOM   2149  C  CA    . ARG C 3  100  ? 147.495 143.487 165.600 1.00 71.00  ?  99   ARG C CA    1 
ATOM   2150  C  C     . ARG C 3  100  ? 147.415 142.312 166.563 1.00 70.81  ?  99   ARG C C     1 
ATOM   2151  O  O     . ARG C 3  100  ? 148.082 142.304 167.602 1.00 70.92  ?  99   ARG C O     1 
ATOM   2152  C  CB    . ARG C 3  100  ? 148.190 144.676 166.256 1.00 71.05  ?  99   ARG C CB    1 
ATOM   2153  C  CG    . ARG C 3  100  ? 148.415 145.859 165.327 1.00 73.54  ?  99   ARG C CG    1 
ATOM   2154  C  CD    . ARG C 3  100  ? 149.309 145.481 164.157 1.00 78.52  ?  99   ARG C CD    1 
ATOM   2155  N  NE    . ARG C 3  100  ? 149.583 146.622 163.288 1.00 83.50  ?  99   ARG C NE    1 
ATOM   2156  C  CZ    . ARG C 3  100  ? 148.834 146.964 162.244 1.00 85.78  ?  99   ARG C CZ    1 
ATOM   2157  N  NH1   . ARG C 3  100  ? 147.759 146.253 161.936 1.00 86.71  ?  99   ARG C NH1   1 
ATOM   2158  N  NH2   . ARG C 3  100  ? 149.160 148.018 161.509 1.00 86.49  ?  99   ARG C NH2   1 
ATOM   2159  N  N     . VAL C 3  101  ? 146.608 141.303 166.244 1.00 70.71  ?  100  VAL C N     1 
ATOM   2160  C  CA    . VAL C 3  101  ? 146.418 140.133 167.093 1.00 70.87  ?  100  VAL C CA    1 
ATOM   2161  C  C     . VAL C 3  101  ? 146.900 138.907 166.333 1.00 70.95  ?  100  VAL C C     1 
ATOM   2162  O  O     . VAL C 3  101  ? 146.529 138.705 165.171 1.00 71.15  ?  100  VAL C O     1 
ATOM   2163  C  CB    . VAL C 3  101  ? 144.947 139.972 167.517 1.00 70.93  ?  100  VAL C CB    1 
ATOM   2164  C  CG1   . VAL C 3  101  ? 144.782 138.754 168.413 1.00 70.03  ?  100  VAL C CG1   1 
ATOM   2165  C  CG2   . VAL C 3  101  ? 144.456 141.229 168.219 1.00 70.05  ?  100  VAL C CG2   1 
ATOM   2166  N  N     . THR C 3  102  ? 147.724 138.092 166.988 1.00 71.68  ?  101  THR C N     1 
ATOM   2167  C  CA    . THR C 3  102  ? 148.260 136.865 166.406 1.00 72.32  ?  101  THR C CA    1 
ATOM   2168  C  C     . THR C 3  102  ? 147.727 135.683 167.206 1.00 72.61  ?  101  THR C C     1 
ATOM   2169  O  O     . THR C 3  102  ? 148.142 135.464 168.350 1.00 73.21  ?  101  THR C O     1 
ATOM   2170  C  CB    . THR C 3  102  ? 149.789 136.877 166.401 1.00 71.92  ?  101  THR C CB    1 
ATOM   2171  O  OG1   . THR C 3  102  ? 150.257 137.997 165.638 1.00 71.47  ?  101  THR C OG1   1 
ATOM   2172  C  CG2   . THR C 3  102  ? 150.330 135.593 165.790 1.00 71.95  ?  101  THR C CG2   1 
ATOM   2173  N  N     . ILE C 3  103  ? 146.808 134.926 166.606 1.00 73.04  ?  102  ILE C N     1 
ATOM   2174  C  CA    . ILE C 3  103  ? 146.236 133.766 167.278 1.00 73.40  ?  102  ILE C CA    1 
ATOM   2175  C  C     . ILE C 3  103  ? 147.276 132.658 167.359 1.00 74.17  ?  102  ILE C C     1 
ATOM   2176  O  O     . ILE C 3  103  ? 147.993 132.378 166.388 1.00 74.14  ?  102  ILE C O     1 
ATOM   2177  C  CB    . ILE C 3  103  ? 144.968 133.295 166.546 1.00 73.52  ?  102  ILE C CB    1 
ATOM   2178  C  CG1   . ILE C 3  103  ? 143.960 134.441 166.435 1.00 72.62  ?  102  ILE C CG1   1 
ATOM   2179  C  CG2   . ILE C 3  103  ? 144.343 132.106 167.262 1.00 72.00  ?  102  ILE C CG2   1 
ATOM   2180  C  CD1   . ILE C 3  103  ? 142.672 134.059 165.739 1.00 72.77  ?  102  ILE C CD1   1 
ATOM   2181  N  N     . ALA C 3  104  ? 147.367 132.022 168.525 1.00 75.39  ?  103  ALA C N     1 
ATOM   2182  C  CA    . ALA C 3  104  ? 148.356 130.974 168.731 1.00 76.93  ?  103  ALA C CA    1 
ATOM   2183  C  C     . ALA C 3  104  ? 147.995 129.724 167.939 1.00 77.95  ?  103  ALA C C     1 
ATOM   2184  O  O     . ALA C 3  104  ? 146.826 129.335 167.859 1.00 78.05  ?  103  ALA C O     1 
ATOM   2185  C  CB    . ALA C 3  104  ? 148.472 130.638 170.218 1.00 76.69  ?  103  ALA C CB    1 
ATOM   2186  N  N     . GLN C 3  105  ? 149.017 129.095 167.352 1.00 79.29  ?  104  GLN C N     1 
ATOM   2187  C  CA    . GLN C 3  105  ? 148.858 127.869 166.568 1.00 81.00  ?  104  GLN C CA    1 
ATOM   2188  C  C     . GLN C 3  105  ? 147.847 128.063 165.437 1.00 82.00  ?  104  GLN C C     1 
ATOM   2189  O  O     . GLN C 3  105  ? 146.960 127.237 165.213 1.00 82.41  ?  104  GLN C O     1 
ATOM   2190  C  CB    . GLN C 3  105  ? 148.466 126.690 167.463 1.00 80.96  ?  104  GLN C CB    1 
ATOM   2191  C  CG    . GLN C 3  105  ? 149.469 126.381 168.564 1.00 81.95  ?  104  GLN C CG    1 
ATOM   2192  C  CD    . GLN C 3  105  ? 150.795 125.871 168.029 1.00 83.74  ?  104  GLN C CD    1 
ATOM   2193  O  OE1   . GLN C 3  105  ? 150.875 125.374 166.905 1.00 84.69  ?  104  GLN C OE1   1 
ATOM   2194  N  NE2   . GLN C 3  105  ? 151.843 125.993 168.834 1.00 83.89  ?  104  GLN C NE2   1 
ATOM   2195  N  N     . GLY C 3  106  ? 147.990 129.173 164.719 1.00 83.09  ?  105  GLY C N     1 
ATOM   2196  C  CA    . GLY C 3  106  ? 147.098 129.481 163.620 1.00 84.25  ?  105  GLY C CA    1 
ATOM   2197  C  C     . GLY C 3  106  ? 147.770 129.399 162.265 1.00 85.01  ?  105  GLY C C     1 
ATOM   2198  O  O     . GLY C 3  106  ? 148.701 128.610 162.072 1.00 85.53  ?  105  GLY C O     1 
ATOM   2199  N  N     . GLY C 3  107  ? 147.306 130.209 161.318 1.00 85.31  ?  106  GLY C N     1 
ATOM   2200  C  CA    . GLY C 3  107  ? 147.874 130.217 159.984 1.00 85.66  ?  106  GLY C CA    1 
ATOM   2201  C  C     . GLY C 3  107  ? 147.478 131.435 159.177 1.00 86.01  ?  106  GLY C C     1 
ATOM   2202  O  O     . GLY C 3  107  ? 147.191 132.496 159.740 1.00 85.67  ?  106  GLY C O     1 
ATOM   2203  N  N     . VAL C 3  108  ? 147.461 131.296 157.851 1.00 86.60  ?  107  VAL C N     1 
ATOM   2204  C  CA    . VAL C 3  108  ? 147.096 132.379 156.951 1.00 87.08  ?  107  VAL C CA    1 
ATOM   2205  C  C     . VAL C 3  108  ? 145.993 131.896 156.019 1.00 87.29  ?  107  VAL C C     1 
ATOM   2206  O  O     . VAL C 3  108  ? 145.768 130.696 155.850 1.00 87.37  ?  107  VAL C O     1 
ATOM   2207  C  CB    . VAL C 3  108  ? 148.301 132.897 156.135 1.00 87.12  ?  107  VAL C CB    1 
ATOM   2208  C  CG1   . VAL C 3  108  ? 149.358 133.482 157.058 1.00 87.48  ?  107  VAL C CG1   1 
ATOM   2209  C  CG2   . VAL C 3  108  ? 148.885 131.779 155.284 1.00 87.15  ?  107  VAL C CG2   1 
ATOM   2210  N  N     . LEU C 3  109  ? 145.302 132.858 155.410 1.00 87.52  ?  108  LEU C N     1 
ATOM   2211  C  CA    . LEU C 3  109  ? 144.231 132.531 154.480 1.00 87.94  ?  108  LEU C CA    1 
ATOM   2212  C  C     . LEU C 3  109  ? 144.813 132.128 153.126 1.00 88.70  ?  108  LEU C C     1 
ATOM   2213  O  O     . LEU C 3  109  ? 145.794 132.722 152.670 1.00 88.73  ?  108  LEU C O     1 
ATOM   2214  C  CB    . LEU C 3  109  ? 143.289 133.721 154.304 1.00 87.57  ?  108  LEU C CB    1 
ATOM   2215  C  CG    . LEU C 3  109  ? 142.571 134.228 155.555 1.00 86.77  ?  108  LEU C CG    1 
ATOM   2216  C  CD1   . LEU C 3  109  ? 141.714 135.440 155.224 1.00 86.43  ?  108  LEU C CD1   1 
ATOM   2217  C  CD2   . LEU C 3  109  ? 141.727 133.126 156.175 1.00 86.29  ?  108  LEU C CD2   1 
ATOM   2218  N  N     . PRO C 3  110  ? 144.235 131.119 152.468 1.00 89.59  ?  109  PRO C N     1 
ATOM   2219  C  CA    . PRO C 3  110  ? 144.722 130.730 151.138 1.00 90.17  ?  109  PRO C CA    1 
ATOM   2220  C  C     . PRO C 3  110  ? 144.502 131.821 150.103 1.00 90.78  ?  109  PRO C C     1 
ATOM   2221  O  O     . PRO C 3  110  ? 143.579 131.737 149.286 1.00 90.84  ?  109  PRO C O     1 
ATOM   2222  C  CB    . PRO C 3  110  ? 143.901 129.474 150.813 1.00 90.02  ?  109  PRO C CB    1 
ATOM   2223  C  CG    . PRO C 3  110  ? 143.412 128.977 152.140 1.00 90.11  ?  109  PRO C CG    1 
ATOM   2224  C  CD    . PRO C 3  110  ? 143.191 130.207 152.963 1.00 89.80  ?  109  PRO C CD    1 
ATOM   2225  N  N     . ASN C 3  111  ? 145.346 132.850 150.129 1.00 91.46  ?  110  ASN C N     1 
ATOM   2226  C  CA    . ASN C 3  111  ? 145.243 133.989 149.223 1.00 92.15  ?  110  ASN C CA    1 
ATOM   2227  C  C     . ASN C 3  111  ? 146.441 133.965 148.282 1.00 92.45  ?  110  ASN C C     1 
ATOM   2228  O  O     . ASN C 3  111  ? 147.580 134.180 148.711 1.00 92.59  ?  110  ASN C O     1 
ATOM   2229  C  CB    . ASN C 3  111  ? 145.181 135.301 150.003 1.00 92.49  ?  110  ASN C CB    1 
ATOM   2230  C  CG    . ASN C 3  111  ? 145.007 136.506 149.101 1.00 93.24  ?  110  ASN C CG    1 
ATOM   2231  O  OD1   . ASN C 3  111  ? 144.527 136.388 147.973 1.00 94.27  ?  110  ASN C OD1   1 
ATOM   2232  N  ND2   . ASN C 3  111  ? 145.398 137.675 149.594 1.00 93.23  ?  110  ASN C ND2   1 
ATOM   2233  N  N     . ILE C 3  112  ? 146.182 133.705 147.003 1.00 92.80  ?  111  ILE C N     1 
ATOM   2234  C  CA    . ILE C 3  112  ? 147.214 133.655 145.974 1.00 93.28  ?  111  ILE C CA    1 
ATOM   2235  C  C     . ILE C 3  112  ? 146.871 134.685 144.908 1.00 93.70  ?  111  ILE C C     1 
ATOM   2236  O  O     . ILE C 3  112  ? 145.745 134.704 144.398 1.00 94.06  ?  111  ILE C O     1 
ATOM   2237  C  CB    . ILE C 3  112  ? 147.343 132.249 145.357 1.00 93.15  ?  111  ILE C CB    1 
ATOM   2238  C  CG1   . ILE C 3  112  ? 147.973 131.271 146.354 1.00 93.38  ?  111  ILE C CG1   1 
ATOM   2239  C  CG2   . ILE C 3  112  ? 148.159 132.299 144.073 1.00 93.03  ?  111  ILE C CG2   1 
ATOM   2240  C  CD1   . ILE C 3  112  ? 146.984 130.611 147.296 1.00 94.31  ?  111  ILE C CD1   1 
ATOM   2241  N  N     . GLN C 3  113  ? 147.838 135.537 144.576 1.00 94.09  ?  112  GLN C N     1 
ATOM   2242  C  CA    . GLN C 3  113  ? 147.616 136.569 143.575 1.00 94.51  ?  112  GLN C CA    1 
ATOM   2243  C  C     . GLN C 3  113  ? 147.389 135.949 142.201 1.00 94.77  ?  112  GLN C C     1 
ATOM   2244  O  O     . GLN C 3  113  ? 147.979 134.925 141.848 1.00 95.01  ?  112  GLN C O     1 
ATOM   2245  C  CB    . GLN C 3  113  ? 148.805 137.529 143.522 1.00 94.65  ?  112  GLN C CB    1 
ATOM   2246  C  CG    . GLN C 3  113  ? 149.046 138.293 144.817 1.00 95.11  ?  112  GLN C CG    1 
ATOM   2247  C  CD    . GLN C 3  113  ? 147.963 139.319 145.110 1.00 95.42  ?  112  GLN C CD    1 
ATOM   2248  O  OE1   . GLN C 3  113  ? 147.205 139.710 144.222 1.00 95.90  ?  112  GLN C OE1   1 
ATOM   2249  N  NE2   . GLN C 3  113  ? 147.887 139.760 146.362 1.00 95.32  ?  112  GLN C NE2   1 
ATOM   2250  N  N     . SER C 3  114  ? 146.518 136.592 141.420 1.00 95.13  ?  113  SER C N     1 
ATOM   2251  C  CA    . SER C 3  114  ? 146.199 136.095 140.088 1.00 95.48  ?  113  SER C CA    1 
ATOM   2252  C  C     . SER C 3  114  ? 147.335 136.313 139.098 1.00 95.80  ?  113  SER C C     1 
ATOM   2253  O  O     . SER C 3  114  ? 147.351 135.672 138.042 1.00 96.04  ?  113  SER C O     1 
ATOM   2254  C  CB    . SER C 3  114  ? 144.923 136.764 139.573 1.00 95.45  ?  113  SER C CB    1 
ATOM   2255  O  OG    . SER C 3  114  ? 143.825 136.489 140.425 1.00 95.66  ?  113  SER C OG    1 
ATOM   2256  N  N     . VAL C 3  115  ? 148.284 137.201 139.413 1.00 95.95  ?  114  VAL C N     1 
ATOM   2257  C  CA    . VAL C 3  115  ? 149.409 137.454 138.515 1.00 96.28  ?  114  VAL C CA    1 
ATOM   2258  C  C     . VAL C 3  115  ? 150.456 136.353 138.553 1.00 96.73  ?  114  VAL C C     1 
ATOM   2259  O  O     . VAL C 3  115  ? 151.338 136.324 137.686 1.00 96.94  ?  114  VAL C O     1 
ATOM   2260  C  CB    . VAL C 3  115  ? 150.083 138.799 138.845 1.00 96.17  ?  114  VAL C CB    1 
ATOM   2261  C  CG1   . VAL C 3  115  ? 149.092 139.941 138.687 1.00 96.42  ?  114  VAL C CG1   1 
ATOM   2262  C  CG2   . VAL C 3  115  ? 150.656 138.773 140.254 1.00 96.06  ?  114  VAL C CG2   1 
ATOM   2263  N  N     . LEU C 3  116  ? 150.387 135.449 139.527 1.00 97.23  ?  115  LEU C N     1 
ATOM   2264  C  CA    . LEU C 3  116  ? 151.339 134.353 139.643 1.00 97.73  ?  115  LEU C CA    1 
ATOM   2265  C  C     . LEU C 3  116  ? 150.850 133.070 138.985 1.00 98.26  ?  115  LEU C C     1 
ATOM   2266  O  O     . LEU C 3  116  ? 151.554 132.056 139.039 1.00 98.53  ?  115  LEU C O     1 
ATOM   2267  C  CB    . LEU C 3  116  ? 151.656 134.084 141.118 1.00 97.68  ?  115  LEU C CB    1 
ATOM   2268  C  CG    . LEU C 3  116  ? 152.265 135.248 141.903 1.00 97.40  ?  115  LEU C CG    1 
ATOM   2269  C  CD1   . LEU C 3  116  ? 152.527 134.844 143.346 1.00 97.20  ?  115  LEU C CD1   1 
ATOM   2270  C  CD2   . LEU C 3  116  ? 153.544 135.734 141.238 1.00 97.99  ?  115  LEU C CD2   1 
ATOM   2271  N  N     . LEU C 3  117  ? 149.670 133.086 138.369 1.00 98.78  ?  116  LEU C N     1 
ATOM   2272  C  CA    . LEU C 3  117  ? 149.149 131.891 137.720 1.00 99.48  ?  116  LEU C CA    1 
ATOM   2273  C  C     . LEU C 3  117  ? 149.865 131.659 136.390 1.00 100.06 ?  116  LEU C C     1 
ATOM   2274  O  O     . LEU C 3  117  ? 150.183 132.618 135.681 1.00 100.20 ?  116  LEU C O     1 
ATOM   2275  C  CB    . LEU C 3  117  ? 147.646 132.018 137.485 1.00 99.26  ?  116  LEU C CB    1 
ATOM   2276  C  CG    . LEU C 3  117  ? 146.778 132.206 138.731 1.00 99.22  ?  116  LEU C CG    1 
ATOM   2277  C  CD1   . LEU C 3  117  ? 145.310 132.319 138.352 1.00 99.17  ?  116  LEU C CD1   1 
ATOM   2278  C  CD2   . LEU C 3  117  ? 146.996 131.067 139.715 1.00 98.95  ?  116  LEU C CD2   1 
ATOM   2279  N  N     . PRO C 3  118  ? 150.132 130.401 136.030 1.00 100.52 ?  117  PRO C N     1 
ATOM   2280  C  CA    . PRO C 3  118  ? 150.813 130.126 134.757 1.00 100.82 ?  117  PRO C CA    1 
ATOM   2281  C  C     . PRO C 3  118  ? 149.940 130.437 133.551 1.00 101.05 ?  117  PRO C C     1 
ATOM   2282  O  O     . PRO C 3  118  ? 149.088 129.631 133.164 1.00 101.07 ?  117  PRO C O     1 
ATOM   2283  C  CB    . PRO C 3  118  ? 151.137 128.630 134.849 1.00 100.89 ?  117  PRO C CB    1 
ATOM   2284  C  CG    . PRO C 3  118  ? 150.115 128.082 135.791 1.00 100.83 ?  117  PRO C CG    1 
ATOM   2285  C  CD    . PRO C 3  118  ? 149.856 129.171 136.792 1.00 100.60 ?  117  PRO C CD    1 
ATOM   2286  N  N     . LYS C 3  119  ? 150.147 131.605 132.951 1.00 101.36 ?  118  LYS C N     1 
ATOM   2287  C  CA    . LYS C 3  119  ? 149.374 132.016 131.786 1.00 101.61 ?  118  LYS C CA    1 
ATOM   2288  C  C     . LYS C 3  119  ? 150.278 132.674 130.749 1.00 101.60 ?  118  LYS C C     1 
ATOM   2289  O  O     . LYS C 3  119  ? 150.177 132.393 129.555 1.00 101.64 ?  118  LYS C O     1 
ATOM   2290  C  CB    . LYS C 3  119  ? 148.246 132.967 132.199 1.00 101.78 ?  118  LYS C CB    1 
ATOM   2291  C  CG    . LYS C 3  119  ? 147.259 133.307 131.088 1.00 102.71 ?  118  LYS C CG    1 
ATOM   2292  C  CD    . LYS C 3  119  ? 147.587 134.636 130.423 1.00 103.81 ?  118  LYS C CD    1 
ATOM   2293  C  CE    . LYS C 3  119  ? 146.595 134.961 129.319 1.00 103.95 ?  118  LYS C CE    1 
ATOM   2294  N  NZ    . LYS C 3  119  ? 145.201 135.059 129.836 1.00 103.94 ?  118  LYS C NZ    1 
ATOM   2295  N  N     . LYS D 4  29   ? 149.059 123.682 196.599 1.00 116.94 ?  28   LYS D N     1 
ATOM   2296  C  CA    . LYS D 4  29   ? 148.593 123.839 195.226 1.00 117.00 ?  28   LYS D CA    1 
ATOM   2297  C  C     . LYS D 4  29   ? 147.898 125.183 195.035 1.00 116.89 ?  28   LYS D C     1 
ATOM   2298  O  O     . LYS D 4  29   ? 147.126 125.621 195.887 1.00 117.05 ?  28   LYS D O     1 
ATOM   2299  C  CB    . LYS D 4  29   ? 147.649 122.697 194.846 1.00 117.07 ?  28   LYS D CB    1 
ATOM   2300  C  CG    . LYS D 4  29   ? 148.284 121.318 194.920 1.00 117.34 ?  28   LYS D CG    1 
ATOM   2301  C  CD    . LYS D 4  29   ? 149.481 121.211 193.990 1.00 117.42 ?  28   LYS D CD    1 
ATOM   2302  C  CE    . LYS D 4  29   ? 150.131 119.840 194.078 1.00 117.31 ?  28   LYS D CE    1 
ATOM   2303  N  NZ    . LYS D 4  29   ? 150.619 119.543 195.453 1.00 117.29 ?  28   LYS D NZ    1 
ATOM   2304  N  N     . THR D 4  30   ? 148.179 125.833 193.908 1.00 116.42 ?  29   THR D N     1 
ATOM   2305  C  CA    . THR D 4  30   ? 147.602 127.135 193.598 1.00 115.87 ?  29   THR D CA    1 
ATOM   2306  C  C     . THR D 4  30   ? 146.302 126.954 192.825 1.00 115.39 ?  29   THR D C     1 
ATOM   2307  O  O     . THR D 4  30   ? 146.264 126.238 191.819 1.00 115.44 ?  29   THR D O     1 
ATOM   2308  C  CB    . THR D 4  30   ? 148.584 127.982 192.787 1.00 116.03 ?  29   THR D CB    1 
ATOM   2309  O  OG1   . THR D 4  30   ? 149.809 128.126 193.516 1.00 116.15 ?  29   THR D OG1   1 
ATOM   2310  C  CG2   . THR D 4  30   ? 147.999 129.360 192.514 1.00 115.98 ?  29   THR D CG2   1 
ATOM   2311  N  N     . ARG D 4  31   ? 145.240 127.604 193.299 1.00 114.60 ?  30   ARG D N     1 
ATOM   2312  C  CA    . ARG D 4  31   ? 143.932 127.542 192.647 1.00 113.73 ?  30   ARG D CA    1 
ATOM   2313  C  C     . ARG D 4  31   ? 143.832 128.713 191.678 1.00 112.93 ?  30   ARG D C     1 
ATOM   2314  O  O     . ARG D 4  31   ? 143.405 129.812 192.035 1.00 113.11 ?  30   ARG D O     1 
ATOM   2315  C  CB    . ARG D 4  31   ? 142.811 127.565 193.677 1.00 113.80 ?  30   ARG D CB    1 
ATOM   2316  C  CG    . ARG D 4  31   ? 141.426 127.368 193.084 1.00 114.16 ?  30   ARG D CG    1 
ATOM   2317  C  CD    . ARG D 4  31   ? 140.341 127.491 194.141 1.00 114.85 ?  30   ARG D CD    1 
ATOM   2318  N  NE    . ARG D 4  31   ? 140.282 128.835 194.709 1.00 115.17 ?  30   ARG D NE    1 
ATOM   2319  C  CZ    . ARG D 4  31   ? 139.381 129.228 195.604 1.00 115.50 ?  30   ARG D CZ    1 
ATOM   2320  N  NH1   . ARG D 4  31   ? 138.458 128.379 196.035 1.00 115.46 ?  30   ARG D NH1   1 
ATOM   2321  N  NH2   . ARG D 4  31   ? 139.402 130.470 196.067 1.00 115.47 ?  30   ARG D NH2   1 
ATOM   2322  N  N     . LYS D 4  32   ? 144.233 128.474 190.433 1.00 111.60 ?  31   LYS D N     1 
ATOM   2323  C  CA    . LYS D 4  32   ? 144.200 129.511 189.416 1.00 110.29 ?  31   LYS D CA    1 
ATOM   2324  C  C     . LYS D 4  32   ? 142.778 129.716 188.901 1.00 109.00 ?  31   LYS D C     1 
ATOM   2325  O  O     . LYS D 4  32   ? 141.930 128.821 188.957 1.00 108.97 ?  31   LYS D O     1 
ATOM   2326  C  CB    . LYS D 4  32   ? 145.135 129.160 188.258 1.00 110.62 ?  31   LYS D CB    1 
ATOM   2327  C  CG    . LYS D 4  32   ? 144.805 127.845 187.570 1.00 111.78 ?  31   LYS D CG    1 
ATOM   2328  C  CD    . LYS D 4  32   ? 145.810 127.529 186.473 1.00 113.71 ?  31   LYS D CD    1 
ATOM   2329  C  CE    . LYS D 4  32   ? 145.836 128.621 185.416 1.00 114.47 ?  31   LYS D CE    1 
ATOM   2330  N  NZ    . LYS D 4  32   ? 146.824 128.329 184.341 1.00 114.99 ?  31   LYS D NZ    1 
ATOM   2331  N  N     . GLU D 4  33   ? 142.525 130.919 188.393 1.00 107.16 ?  32   GLU D N     1 
ATOM   2332  C  CA    . GLU D 4  33   ? 141.220 131.292 187.867 1.00 105.28 ?  32   GLU D CA    1 
ATOM   2333  C  C     . GLU D 4  33   ? 141.242 131.263 186.345 1.00 104.14 ?  32   GLU D C     1 
ATOM   2334  O  O     . GLU D 4  33   ? 142.209 131.704 185.718 1.00 104.12 ?  32   GLU D O     1 
ATOM   2335  C  CB    . GLU D 4  33   ? 140.813 132.683 188.357 1.00 105.27 ?  32   GLU D CB    1 
ATOM   2336  C  CG    . GLU D 4  33   ? 140.741 132.814 189.869 1.00 104.99 ?  32   GLU D CG    1 
ATOM   2337  C  CD    . GLU D 4  33   ? 140.362 134.212 190.315 1.00 104.61 ?  32   GLU D CD    1 
ATOM   2338  O  OE1   . GLU D 4  33   ? 140.158 135.082 189.442 1.00 103.44 ?  32   GLU D OE1   1 
ATOM   2339  O  OE2   . GLU D 4  33   ? 140.268 134.443 191.539 1.00 104.50 ?  32   GLU D OE2   1 
ATOM   2340  N  N     . SER D 4  34   ? 140.168 130.741 185.757 1.00 102.53 ?  33   SER D N     1 
ATOM   2341  C  CA    . SER D 4  34   ? 140.059 130.652 184.308 1.00 100.96 ?  33   SER D CA    1 
ATOM   2342  C  C     . SER D 4  34   ? 138.593 130.496 183.931 1.00 99.83  ?  33   SER D C     1 
ATOM   2343  O  O     . SER D 4  34   ? 137.804 129.917 184.682 1.00 99.44  ?  33   SER D O     1 
ATOM   2344  C  CB    . SER D 4  34   ? 140.882 129.483 183.754 1.00 100.98 ?  33   SER D CB    1 
ATOM   2345  O  OG    . SER D 4  34   ? 140.830 129.449 182.339 1.00 100.94 ?  33   SER D OG    1 
ATOM   2346  N  N     . TYR D 4  35   ? 138.241 131.021 182.757 1.00 98.57  ?  34   TYR D N     1 
ATOM   2347  C  CA    . TYR D 4  35   ? 136.870 130.954 182.249 1.00 97.39  ?  34   TYR D CA    1 
ATOM   2348  C  C     . TYR D 4  35   ? 136.715 129.661 181.452 1.00 97.21  ?  34   TYR D C     1 
ATOM   2349  O  O     . TYR D 4  35   ? 136.753 129.638 180.220 1.00 97.14  ?  34   TYR D O     1 
ATOM   2350  C  CB    . TYR D 4  35   ? 136.548 132.182 181.406 1.00 96.69  ?  34   TYR D CB    1 
ATOM   2351  C  CG    . TYR D 4  35   ? 136.683 133.494 182.148 1.00 95.57  ?  34   TYR D CG    1 
ATOM   2352  C  CD1   . TYR D 4  35   ? 136.452 133.570 183.515 1.00 94.95  ?  34   TYR D CD1   1 
ATOM   2353  C  CD2   . TYR D 4  35   ? 137.044 134.657 181.480 1.00 94.13  ?  34   TYR D CD2   1 
ATOM   2354  C  CE1   . TYR D 4  35   ? 136.574 134.767 184.195 1.00 94.76  ?  34   TYR D CE1   1 
ATOM   2355  C  CE2   . TYR D 4  35   ? 137.170 135.858 182.152 1.00 93.86  ?  34   TYR D CE2   1 
ATOM   2356  C  CZ    . TYR D 4  35   ? 136.934 135.907 183.509 1.00 94.72  ?  34   TYR D CZ    1 
ATOM   2357  O  OH    . TYR D 4  35   ? 137.057 137.100 184.184 1.00 94.90  ?  34   TYR D OH    1 
ATOM   2358  N  N     . ALA D 4  36   ? 136.530 128.562 182.183 1.00 97.02  ?  35   ALA D N     1 
ATOM   2359  C  CA    . ALA D 4  36   ? 136.446 127.232 181.587 1.00 97.00  ?  35   ALA D CA    1 
ATOM   2360  C  C     . ALA D 4  36   ? 135.006 126.747 181.456 1.00 97.17  ?  35   ALA D C     1 
ATOM   2361  O  O     . ALA D 4  36   ? 134.537 126.475 180.346 1.00 97.30  ?  35   ALA D O     1 
ATOM   2362  C  CB    . ALA D 4  36   ? 137.274 126.237 182.410 1.00 96.94  ?  35   ALA D CB    1 
ATOM   2363  N  N     . ILE D 4  37   ? 134.291 126.636 182.574 1.00 97.51  ?  36   ILE D N     1 
ATOM   2364  C  CA    . ILE D 4  37   ? 132.935 126.098 182.575 1.00 97.75  ?  36   ILE D CA    1 
ATOM   2365  C  C     . ILE D 4  37   ? 131.920 127.219 182.391 1.00 98.02  ?  36   ILE D C     1 
ATOM   2366  O  O     . ILE D 4  37   ? 130.726 127.039 182.655 1.00 98.07  ?  36   ILE D O     1 
ATOM   2367  C  CB    . ILE D 4  37   ? 132.656 125.307 183.866 1.00 97.90  ?  36   ILE D CB    1 
ATOM   2368  C  CG1   . ILE D 4  37   ? 133.048 126.136 185.091 1.00 97.64  ?  36   ILE D CG1   1 
ATOM   2369  C  CG2   . ILE D 4  37   ? 133.396 123.976 183.850 1.00 97.56  ?  36   ILE D CG2   1 
ATOM   2370  C  CD1   . ILE D 4  37   ? 132.970 125.374 186.390 1.00 97.62  ?  36   ILE D CD1   1 
ATOM   2371  N  N     . TYR D 4  38   ? 132.387 128.386 181.937 1.00 98.26  ?  37   TYR D N     1 
ATOM   2372  C  CA    . TYR D 4  38   ? 131.509 129.501 181.612 1.00 98.46  ?  37   TYR D CA    1 
ATOM   2373  C  C     . TYR D 4  38   ? 131.370 129.754 180.119 1.00 98.57  ?  37   TYR D C     1 
ATOM   2374  O  O     . TYR D 4  38   ? 130.449 130.470 179.716 1.00 98.66  ?  37   TYR D O     1 
ATOM   2375  C  CB    . TYR D 4  38   ? 132.005 130.791 182.283 1.00 98.53  ?  37   TYR D CB    1 
ATOM   2376  C  CG    . TYR D 4  38   ? 131.920 130.760 183.787 1.00 98.99  ?  37   TYR D CG    1 
ATOM   2377  C  CD1   . TYR D 4  38   ? 130.717 130.999 184.438 1.00 99.09  ?  37   TYR D CD1   1 
ATOM   2378  C  CD2   . TYR D 4  38   ? 133.041 130.488 184.559 1.00 99.37  ?  37   TYR D CD2   1 
ATOM   2379  C  CE1   . TYR D 4  38   ? 130.633 130.970 185.815 1.00 99.07  ?  37   TYR D CE1   1 
ATOM   2380  C  CE2   . TYR D 4  38   ? 132.967 130.457 185.937 1.00 99.33  ?  37   TYR D CE2   1 
ATOM   2381  C  CZ    . TYR D 4  38   ? 131.761 130.698 186.560 1.00 98.95  ?  37   TYR D CZ    1 
ATOM   2382  O  OH    . TYR D 4  38   ? 131.683 130.668 187.933 1.00 98.86  ?  37   TYR D OH    1 
ATOM   2383  N  N     . VAL D 4  39   ? 132.257 129.195 179.299 1.00 98.68  ?  38   VAL D N     1 
ATOM   2384  C  CA    . VAL D 4  39   ? 132.168 129.369 177.854 1.00 98.75  ?  38   VAL D CA    1 
ATOM   2385  C  C     . VAL D 4  39   ? 131.459 128.190 177.191 1.00 99.02  ?  38   VAL D C     1 
ATOM   2386  O  O     . VAL D 4  39   ? 130.832 128.358 176.140 1.00 99.28  ?  38   VAL D O     1 
ATOM   2387  C  CB    . VAL D 4  39   ? 133.572 129.574 177.258 1.00 98.65  ?  38   VAL D CB    1 
ATOM   2388  C  CG1   . VAL D 4  39   ? 133.493 129.913 175.771 1.00 98.71  ?  38   VAL D CG1   1 
ATOM   2389  C  CG2   . VAL D 4  39   ? 134.322 130.656 178.019 1.00 98.12  ?  38   VAL D CG2   1 
ATOM   2390  N  N     . TYR D 4  40   ? 131.543 126.997 177.788 1.00 99.23  ?  39   TYR D N     1 
ATOM   2391  C  CA    . TYR D 4  40   ? 130.890 125.829 177.206 1.00 99.50  ?  39   TYR D CA    1 
ATOM   2392  C  C     . TYR D 4  40   ? 129.373 125.956 177.228 1.00 99.39  ?  39   TYR D C     1 
ATOM   2393  O  O     . TYR D 4  40   ? 128.688 125.297 176.440 1.00 99.25  ?  39   TYR D O     1 
ATOM   2394  C  CB    . TYR D 4  40   ? 131.323 124.559 177.938 1.00 100.11 ?  39   TYR D CB    1 
ATOM   2395  C  CG    . TYR D 4  40   ? 132.486 123.848 177.284 1.00 100.72 ?  39   TYR D CG    1 
ATOM   2396  C  CD1   . TYR D 4  40   ? 132.283 122.991 176.210 1.00 100.93 ?  39   TYR D CD1   1 
ATOM   2397  C  CD2   . TYR D 4  40   ? 133.786 124.030 177.740 1.00 101.25 ?  39   TYR D CD2   1 
ATOM   2398  C  CE1   . TYR D 4  40   ? 133.340 122.337 175.606 1.00 101.51 ?  39   TYR D CE1   1 
ATOM   2399  C  CE2   . TYR D 4  40   ? 134.852 123.378 177.142 1.00 102.27 ?  39   TYR D CE2   1 
ATOM   2400  C  CZ    . TYR D 4  40   ? 134.622 122.535 176.074 1.00 102.02 ?  39   TYR D CZ    1 
ATOM   2401  O  OH    . TYR D 4  40   ? 135.675 121.880 175.476 1.00 102.13 ?  39   TYR D OH    1 
ATOM   2402  N  N     . LYS D 4  41   ? 128.827 126.783 178.121 1.00 99.16  ?  40   LYS D N     1 
ATOM   2403  C  CA    . LYS D 4  41   ? 127.384 126.996 178.131 1.00 99.08  ?  40   LYS D CA    1 
ATOM   2404  C  C     . LYS D 4  41   ? 126.935 127.746 176.882 1.00 99.06  ?  40   LYS D C     1 
ATOM   2405  O  O     . LYS D 4  41   ? 126.042 127.291 176.157 1.00 99.62  ?  40   LYS D O     1 
ATOM   2406  C  CB    . LYS D 4  41   ? 126.977 127.749 179.397 1.00 99.16  ?  40   LYS D CB    1 
ATOM   2407  C  CG    . LYS D 4  41   ? 127.303 127.003 180.679 1.00 99.31  ?  40   LYS D CG    1 
ATOM   2408  C  CD    . LYS D 4  41   ? 126.867 127.792 181.900 1.00 99.64  ?  40   LYS D CD    1 
ATOM   2409  C  CE    . LYS D 4  41   ? 127.161 127.034 183.185 1.00 99.85  ?  40   LYS D CE    1 
ATOM   2410  N  NZ    . LYS D 4  41   ? 126.709 127.785 184.389 1.00 100.22 ?  40   LYS D NZ    1 
ATOM   2411  N  N     . VAL D 4  42   ? 127.559 128.895 176.608 1.00 98.76  ?  41   VAL D N     1 
ATOM   2412  C  CA    . VAL D 4  42   ? 127.257 129.642 175.391 1.00 98.42  ?  41   VAL D CA    1 
ATOM   2413  C  C     . VAL D 4  42   ? 127.631 128.833 174.156 1.00 98.46  ?  41   VAL D C     1 
ATOM   2414  O  O     . VAL D 4  42   ? 126.999 128.966 173.101 1.00 98.49  ?  41   VAL D O     1 
ATOM   2415  C  CB    . VAL D 4  42   ? 127.978 131.004 175.417 1.00 98.32  ?  41   VAL D CB    1 
ATOM   2416  C  CG1   . VAL D 4  42   ? 127.520 131.880 174.260 1.00 98.35  ?  41   VAL D CG1   1 
ATOM   2417  C  CG2   . VAL D 4  42   ? 127.743 131.700 176.749 1.00 97.93  ?  41   VAL D CG2   1 
ATOM   2418  N  N     . LEU D 4  43   ? 128.655 127.982 174.264 1.00 98.48  ?  42   LEU D N     1 
ATOM   2419  C  CA    . LEU D 4  43   ? 129.020 127.117 173.146 1.00 98.47  ?  42   LEU D CA    1 
ATOM   2420  C  C     . LEU D 4  43   ? 127.919 126.107 172.846 1.00 98.93  ?  42   LEU D C     1 
ATOM   2421  O  O     . LEU D 4  43   ? 127.581 125.878 171.679 1.00 99.15  ?  42   LEU D O     1 
ATOM   2422  C  CB    . LEU D 4  43   ? 130.338 126.401 173.441 1.00 98.21  ?  42   LEU D CB    1 
ATOM   2423  C  CG    . LEU D 4  43   ? 130.790 125.389 172.386 1.00 97.76  ?  42   LEU D CG    1 
ATOM   2424  C  CD1   . LEU D 4  43   ? 130.948 126.062 171.031 1.00 97.04  ?  42   LEU D CD1   1 
ATOM   2425  C  CD2   . LEU D 4  43   ? 132.083 124.706 172.807 1.00 97.92  ?  42   LEU D CD2   1 
ATOM   2426  N  N     . LYS D 4  44   ? 127.350 125.491 173.885 1.00 99.23  ?  43   LYS D N     1 
ATOM   2427  C  CA    . LYS D 4  44   ? 126.263 124.541 173.681 1.00 99.61  ?  43   LYS D CA    1 
ATOM   2428  C  C     . LYS D 4  44   ? 124.961 125.227 173.290 1.00 100.09 ?  43   LYS D C     1 
ATOM   2429  O  O     . LYS D 4  44   ? 124.104 124.590 172.668 1.00 100.27 ?  43   LYS D O     1 
ATOM   2430  C  CB    . LYS D 4  44   ? 126.048 123.698 174.940 1.00 99.40  ?  43   LYS D CB    1 
ATOM   2431  C  CG    . LYS D 4  44   ? 127.212 122.780 175.286 1.00 99.22  ?  43   LYS D CG    1 
ATOM   2432  C  CD    . LYS D 4  44   ? 127.560 121.854 174.131 1.00 98.95  ?  43   LYS D CD    1 
ATOM   2433  C  CE    . LYS D 4  44   ? 128.739 120.956 174.477 1.00 98.58  ?  43   LYS D CE    1 
ATOM   2434  N  NZ    . LYS D 4  44   ? 129.045 119.992 173.384 1.00 99.06  ?  43   LYS D NZ    1 
ATOM   2435  N  N     . GLN D 4  45   ? 124.791 126.505 173.637 1.00 100.41 ?  44   GLN D N     1 
ATOM   2436  C  CA    . GLN D 4  45   ? 123.586 127.230 173.252 1.00 100.88 ?  44   GLN D CA    1 
ATOM   2437  C  C     . GLN D 4  45   ? 123.519 127.522 171.758 1.00 101.23 ?  44   GLN D C     1 
ATOM   2438  O  O     . GLN D 4  45   ? 122.450 127.904 171.270 1.00 101.61 ?  44   GLN D O     1 
ATOM   2439  C  CB    . GLN D 4  45   ? 123.485 128.542 174.033 1.00 100.90 ?  44   GLN D CB    1 
ATOM   2440  C  CG    . GLN D 4  45   ? 123.101 128.372 175.493 1.00 101.46 ?  44   GLN D CG    1 
ATOM   2441  C  CD    . GLN D 4  45   ? 122.995 129.696 176.224 1.00 102.28 ?  44   GLN D CD    1 
ATOM   2442  O  OE1   . GLN D 4  45   ? 123.239 130.757 175.649 1.00 102.59 ?  44   GLN D OE1   1 
ATOM   2443  N  NE2   . GLN D 4  45   ? 122.629 129.641 177.500 1.00 102.50 ?  44   GLN D NE2   1 
ATOM   2444  N  N     . VAL D 4  46   ? 124.620 127.357 171.026 1.00 101.53 ?  45   VAL D N     1 
ATOM   2445  C  CA    . VAL D 4  46   ? 124.635 127.624 169.592 1.00 101.74 ?  45   VAL D CA    1 
ATOM   2446  C  C     . VAL D 4  46   ? 125.134 126.392 168.847 1.00 101.93 ?  45   VAL D C     1 
ATOM   2447  O  O     . VAL D 4  46   ? 124.817 126.196 167.668 1.00 102.24 ?  45   VAL D O     1 
ATOM   2448  C  CB    . VAL D 4  46   ? 125.498 128.856 169.262 1.00 101.66 ?  45   VAL D CB    1 
ATOM   2449  C  CG1   . VAL D 4  46   ? 124.858 130.117 169.823 1.00 101.79 ?  45   VAL D CG1   1 
ATOM   2450  C  CG2   . VAL D 4  46   ? 126.907 128.683 169.808 1.00 101.63 ?  45   VAL D CG2   1 
ATOM   2451  N  N     . HIS D 4  47   ? 125.914 125.554 169.528 1.00 101.98 ?  46   HIS D N     1 
ATOM   2452  C  CA    . HIS D 4  47   ? 126.461 124.335 168.935 1.00 102.29 ?  46   HIS D CA    1 
ATOM   2453  C  C     . HIS D 4  47   ? 126.508 123.251 170.001 1.00 102.64 ?  46   HIS D C     1 
ATOM   2454  O  O     . HIS D 4  47   ? 127.518 123.086 170.698 1.00 102.74 ?  46   HIS D O     1 
ATOM   2455  C  CB    . HIS D 4  47   ? 127.849 124.577 168.339 1.00 102.18 ?  46   HIS D CB    1 
ATOM   2456  C  CG    . HIS D 4  47   ? 127.848 125.498 167.158 1.00 102.28 ?  46   HIS D CG    1 
ATOM   2457  N  ND1   . HIS D 4  47   ? 127.620 125.059 165.872 1.00 102.82 ?  46   HIS D ND1   1 
ATOM   2458  C  CD2   . HIS D 4  47   ? 128.051 126.834 167.069 1.00 102.29 ?  46   HIS D CD2   1 
ATOM   2459  C  CE1   . HIS D 4  47   ? 127.680 126.085 165.042 1.00 102.68 ?  46   HIS D CE1   1 
ATOM   2460  N  NE2   . HIS D 4  47   ? 127.940 127.174 165.743 1.00 102.42 ?  46   HIS D NE2   1 
ATOM   2461  N  N     . PRO D 4  48   ? 125.425 122.489 170.158 1.00 102.91 ?  47   PRO D N     1 
ATOM   2462  C  CA    . PRO D 4  48   ? 125.404 121.440 171.185 1.00 103.07 ?  47   PRO D CA    1 
ATOM   2463  C  C     . PRO D 4  48   ? 126.000 120.126 170.702 1.00 103.31 ?  47   PRO D C     1 
ATOM   2464  O  O     . PRO D 4  48   ? 125.614 119.055 171.180 1.00 103.24 ?  47   PRO D O     1 
ATOM   2465  C  CB    . PRO D 4  48   ? 123.910 121.297 171.492 1.00 103.17 ?  47   PRO D CB    1 
ATOM   2466  C  CG    . PRO D 4  48   ? 123.254 121.599 170.182 1.00 102.90 ?  47   PRO D CG    1 
ATOM   2467  C  CD    . PRO D 4  48   ? 124.116 122.640 169.497 1.00 102.97 ?  47   PRO D CD    1 
ATOM   2468  N  N     . ASP D 4  49   ? 126.944 120.193 169.753 1.00 103.67 ?  48   ASP D N     1 
ATOM   2469  C  CA    . ASP D 4  49   ? 127.552 118.979 169.217 1.00 104.14 ?  48   ASP D CA    1 
ATOM   2470  C  C     . ASP D 4  49   ? 128.993 119.208 168.770 1.00 104.30 ?  48   ASP D C     1 
ATOM   2471  O  O     . ASP D 4  49   ? 129.501 118.466 167.922 1.00 104.56 ?  48   ASP D O     1 
ATOM   2472  C  CB    . ASP D 4  49   ? 126.733 118.430 168.043 1.00 104.36 ?  48   ASP D CB    1 
ATOM   2473  C  CG    . ASP D 4  49   ? 126.630 119.414 166.893 1.00 104.75 ?  48   ASP D CG    1 
ATOM   2474  O  OD1   . ASP D 4  49   ? 126.643 120.636 167.151 1.00 104.72 ?  48   ASP D OD1   1 
ATOM   2475  O  OD2   . ASP D 4  49   ? 126.538 118.965 165.731 1.00 104.68 ?  48   ASP D OD2   1 
ATOM   2476  N  N     . THR D 4  50   ? 129.661 120.219 169.322 1.00 104.39 ?  49   THR D N     1 
ATOM   2477  C  CA    . THR D 4  50   ? 131.041 120.529 168.981 1.00 104.51 ?  49   THR D CA    1 
ATOM   2478  C  C     . THR D 4  50   ? 131.867 120.641 170.255 1.00 104.28 ?  49   THR D C     1 
ATOM   2479  O  O     . THR D 4  50   ? 131.336 120.718 171.366 1.00 104.38 ?  49   THR D O     1 
ATOM   2480  C  CB    . THR D 4  50   ? 131.146 121.831 168.172 1.00 104.67 ?  49   THR D CB    1 
ATOM   2481  O  OG1   . THR D 4  50   ? 130.591 122.913 168.929 1.00 105.40 ?  49   THR D OG1   1 
ATOM   2482  C  CG2   . THR D 4  50   ? 130.402 121.706 166.849 1.00 104.44 ?  49   THR D CG2   1 
ATOM   2483  N  N     . GLY D 4  51   ? 133.186 120.648 170.081 1.00 104.06 ?  50   GLY D N     1 
ATOM   2484  C  CA    . GLY D 4  51   ? 134.101 120.803 171.195 1.00 103.79 ?  50   GLY D CA    1 
ATOM   2485  C  C     . GLY D 4  51   ? 135.160 121.853 170.928 1.00 103.43 ?  50   GLY D C     1 
ATOM   2486  O  O     . GLY D 4  51   ? 135.106 122.545 169.908 1.00 103.58 ?  50   GLY D O     1 
ATOM   2487  N  N     . ILE D 4  52   ? 136.125 121.985 171.833 1.00 102.75 ?  51   ILE D N     1 
ATOM   2488  C  CA    . ILE D 4  52   ? 137.209 122.947 171.663 1.00 101.98 ?  51   ILE D CA    1 
ATOM   2489  C  C     . ILE D 4  52   ? 138.425 122.427 172.417 1.00 101.61 ?  51   ILE D C     1 
ATOM   2490  O  O     . ILE D 4  52   ? 138.303 121.869 173.511 1.00 101.63 ?  51   ILE D O     1 
ATOM   2491  C  CB    . ILE D 4  52   ? 136.787 124.360 172.136 1.00 101.80 ?  51   ILE D CB    1 
ATOM   2492  C  CG1   . ILE D 4  52   ? 137.911 125.372 171.900 1.00 101.92 ?  51   ILE D CG1   1 
ATOM   2493  C  CG2   . ILE D 4  52   ? 136.370 124.350 173.597 1.00 101.65 ?  51   ILE D CG2   1 
ATOM   2494  C  CD1   . ILE D 4  52   ? 138.195 125.632 170.443 1.00 101.69 ?  51   ILE D CD1   1 
ATOM   2495  N  N     . SER D 4  53   ? 139.598 122.598 171.814 1.00 101.07 ?  52   SER D N     1 
ATOM   2496  C  CA    . SER D 4  53   ? 140.840 122.148 172.418 1.00 100.47 ?  52   SER D CA    1 
ATOM   2497  C  C     . SER D 4  53   ? 141.269 123.099 173.535 1.00 100.14 ?  52   SER D C     1 
ATOM   2498  O  O     . SER D 4  53   ? 140.752 124.209 173.680 1.00 100.25 ?  52   SER D O     1 
ATOM   2499  C  CB    . SER D 4  53   ? 141.940 122.035 171.363 1.00 100.53 ?  52   SER D CB    1 
ATOM   2500  O  OG    . SER D 4  53   ? 143.158 121.599 171.941 1.00 99.98  ?  52   SER D OG    1 
ATOM   2501  N  N     . SER D 4  54   ? 142.240 122.645 174.332 1.00 99.55  ?  53   SER D N     1 
ATOM   2502  C  CA    . SER D 4  54   ? 142.713 123.450 175.453 1.00 98.84  ?  53   SER D CA    1 
ATOM   2503  C  C     . SER D 4  54   ? 143.558 124.630 174.989 1.00 98.48  ?  53   SER D C     1 
ATOM   2504  O  O     . SER D 4  54   ? 143.608 125.660 175.671 1.00 98.41  ?  53   SER D O     1 
ATOM   2505  C  CB    . SER D 4  54   ? 143.509 122.580 176.427 1.00 98.82  ?  53   SER D CB    1 
ATOM   2506  O  OG    . SER D 4  54   ? 144.633 121.998 175.790 1.00 98.66  ?  53   SER D OG    1 
ATOM   2507  N  N     . LYS D 4  55   ? 144.227 124.500 173.842 1.00 97.68  ?  54   LYS D N     1 
ATOM   2508  C  CA    . LYS D 4  55   ? 145.043 125.596 173.327 1.00 96.99  ?  54   LYS D CA    1 
ATOM   2509  C  C     . LYS D 4  55   ? 144.174 126.800 172.983 1.00 96.27  ?  54   LYS D C     1 
ATOM   2510  O  O     . LYS D 4  55   ? 144.360 127.897 173.524 1.00 96.31  ?  54   LYS D O     1 
ATOM   2511  C  CB    . LYS D 4  55   ? 145.832 125.126 172.103 1.00 97.20  ?  54   LYS D CB    1 
ATOM   2512  C  CG    . LYS D 4  55   ? 147.188 125.791 171.944 1.00 98.22  ?  54   LYS D CG    1 
ATOM   2513  C  CD    . LYS D 4  55   ? 148.122 125.392 173.075 1.00 99.84  ?  54   LYS D CD    1 
ATOM   2514  C  CE    . LYS D 4  55   ? 149.514 125.968 172.878 1.00 100.73 ?  54   LYS D CE    1 
ATOM   2515  N  NZ    . LYS D 4  55   ? 150.449 125.522 173.947 1.00 101.37 ?  54   LYS D NZ    1 
ATOM   2516  N  N     . ALA D 4  56   ? 143.207 126.607 172.083 1.00 95.25  ?  55   ALA D N     1 
ATOM   2517  C  CA    . ALA D 4  56   ? 142.266 127.673 171.764 1.00 94.06  ?  55   ALA D CA    1 
ATOM   2518  C  C     . ALA D 4  56   ? 141.396 128.042 172.957 1.00 93.37  ?  55   ALA D C     1 
ATOM   2519  O  O     . ALA D 4  56   ? 140.834 129.142 172.982 1.00 93.18  ?  55   ALA D O     1 
ATOM   2520  C  CB    . ALA D 4  56   ? 141.391 127.267 170.578 1.00 94.08  ?  55   ALA D CB    1 
ATOM   2521  N  N     . MET D 4  57   ? 141.263 127.146 173.938 1.00 92.51  ?  56   MET D N     1 
ATOM   2522  C  CA    . MET D 4  57   ? 140.610 127.513 175.190 1.00 91.73  ?  56   MET D CA    1 
ATOM   2523  C  C     . MET D 4  57   ? 141.405 128.590 175.917 1.00 90.58  ?  56   MET D C     1 
ATOM   2524  O  O     . MET D 4  57   ? 140.841 129.582 176.395 1.00 90.47  ?  56   MET D O     1 
ATOM   2525  C  CB    . MET D 4  57   ? 140.436 126.274 176.070 1.00 92.21  ?  56   MET D CB    1 
ATOM   2526  C  CG    . MET D 4  57   ? 140.414 126.557 177.562 1.00 93.48  ?  56   MET D CG    1 
ATOM   2527  S  SD    . MET D 4  57   ? 139.012 127.558 178.090 1.00 97.54  ?  56   MET D SD    1 
ATOM   2528  C  CE    . MET D 4  57   ? 139.506 127.938 179.767 1.00 97.26  ?  56   MET D CE    1 
ATOM   2529  N  N     . SER D 4  58   ? 142.726 128.414 176.004 1.00 89.16  ?  57   SER D N     1 
ATOM   2530  C  CA    . SER D 4  58   ? 143.569 129.453 176.585 1.00 87.68  ?  57   SER D CA    1 
ATOM   2531  C  C     . SER D 4  58   ? 143.582 130.707 175.721 1.00 86.37  ?  57   SER D C     1 
ATOM   2532  O  O     . SER D 4  58   ? 143.686 131.821 176.249 1.00 86.19  ?  57   SER D O     1 
ATOM   2533  C  CB    . SER D 4  58   ? 144.991 128.928 176.784 1.00 87.78  ?  57   SER D CB    1 
ATOM   2534  O  OG    . SER D 4  58   ? 145.566 128.529 175.552 1.00 88.50  ?  57   SER D OG    1 
ATOM   2535  N  N     . ILE D 4  59   ? 143.476 130.547 174.399 1.00 84.48  ?  58   ILE D N     1 
ATOM   2536  C  CA    . ILE D 4  59   ? 143.393 131.705 173.512 1.00 83.06  ?  58   ILE D CA    1 
ATOM   2537  C  C     . ILE D 4  59   ? 142.137 132.513 173.809 1.00 82.15  ?  58   ILE D C     1 
ATOM   2538  O  O     . ILE D 4  59   ? 142.167 133.750 173.842 1.00 81.76  ?  58   ILE D O     1 
ATOM   2539  C  CB    . ILE D 4  59   ? 143.442 131.256 172.040 1.00 83.03  ?  58   ILE D CB    1 
ATOM   2540  C  CG1   . ILE D 4  59   ? 144.759 130.538 171.744 1.00 83.23  ?  58   ILE D CG1   1 
ATOM   2541  C  CG2   . ILE D 4  59   ? 143.260 132.446 171.109 1.00 82.60  ?  58   ILE D CG2   1 
ATOM   2542  C  CD1   . ILE D 4  59   ? 144.838 129.973 170.346 1.00 84.12  ?  58   ILE D CD1   1 
ATOM   2543  N  N     . MET D 4  60   ? 141.012 131.829 174.031 1.00 81.19  ?  59   MET D N     1 
ATOM   2544  C  CA    . MET D 4  60   ? 139.772 132.529 174.347 1.00 79.97  ?  59   MET D CA    1 
ATOM   2545  C  C     . MET D 4  60   ? 139.806 133.125 175.748 1.00 79.30  ?  59   MET D C     1 
ATOM   2546  O  O     . MET D 4  60   ? 139.240 134.200 175.974 1.00 79.19  ?  59   MET D O     1 
ATOM   2547  C  CB    . MET D 4  60   ? 138.581 131.582 174.197 1.00 80.03  ?  59   MET D CB    1 
ATOM   2548  C  CG    . MET D 4  60   ? 138.313 131.144 172.765 1.00 80.37  ?  59   MET D CG    1 
ATOM   2549  S  SD    . MET D 4  60   ? 137.981 132.538 171.672 1.00 83.23  ?  59   MET D SD    1 
ATOM   2550  C  CE    . MET D 4  60   ? 136.527 133.236 172.451 1.00 80.59  ?  59   MET D CE    1 
ATOM   2551  N  N     . ASN D 4  61   ? 140.459 132.448 176.696 1.00 78.21  ?  60   ASN D N     1 
ATOM   2552  C  CA    . ASN D 4  61   ? 140.588 132.995 178.044 1.00 77.20  ?  60   ASN D CA    1 
ATOM   2553  C  C     . ASN D 4  61   ? 141.391 134.290 178.030 1.00 76.52  ?  60   ASN D C     1 
ATOM   2554  O  O     . ASN D 4  61   ? 140.944 135.321 178.549 1.00 76.17  ?  60   ASN D O     1 
ATOM   2555  C  CB    . ASN D 4  61   ? 141.238 131.962 178.965 1.00 77.20  ?  60   ASN D CB    1 
ATOM   2556  C  CG    . ASN D 4  61   ? 141.296 132.422 180.409 1.00 77.85  ?  60   ASN D CG    1 
ATOM   2557  O  OD1   . ASN D 4  61   ? 140.519 133.277 180.834 1.00 78.74  ?  60   ASN D OD1   1 
ATOM   2558  N  ND2   . ASN D 4  61   ? 142.220 131.851 181.173 1.00 78.93  ?  60   ASN D ND2   1 
ATOM   2559  N  N     . SER D 4  62   ? 142.584 134.255 177.430 1.00 75.53  ?  61   SER D N     1 
ATOM   2560  C  CA    . SER D 4  62   ? 143.383 135.467 177.294 1.00 75.06  ?  61   SER D CA    1 
ATOM   2561  C  C     . SER D 4  62   ? 142.701 136.510 176.418 1.00 74.76  ?  61   SER D C     1 
ATOM   2562  O  O     . SER D 4  62   ? 142.987 137.705 176.559 1.00 74.71  ?  61   SER D O     1 
ATOM   2563  C  CB    . SER D 4  62   ? 144.761 135.126 176.724 1.00 75.05  ?  61   SER D CB    1 
ATOM   2564  O  OG    . SER D 4  62   ? 144.645 134.437 175.491 1.00 75.46  ?  61   SER D OG    1 
ATOM   2565  N  N     . PHE D 4  63   ? 141.811 136.088 175.517 1.00 74.07  ?  62   PHE D N     1 
ATOM   2566  C  CA    . PHE D 4  63   ? 141.064 137.047 174.709 1.00 73.40  ?  62   PHE D CA    1 
ATOM   2567  C  C     . PHE D 4  63   ? 140.040 137.790 175.557 1.00 73.10  ?  62   PHE D C     1 
ATOM   2568  O  O     . PHE D 4  63   ? 139.905 139.014 175.454 1.00 72.41  ?  62   PHE D O     1 
ATOM   2569  C  CB    . PHE D 4  63   ? 140.385 136.333 173.538 1.00 73.56  ?  62   PHE D CB    1 
ATOM   2570  C  CG    . PHE D 4  63   ? 139.500 137.227 172.708 1.00 73.81  ?  62   PHE D CG    1 
ATOM   2571  C  CD1   . PHE D 4  63   ? 140.041 138.063 171.745 1.00 74.31  ?  62   PHE D CD1   1 
ATOM   2572  C  CD2   . PHE D 4  63   ? 138.125 137.220 172.885 1.00 73.98  ?  62   PHE D CD2   1 
ATOM   2573  C  CE1   . PHE D 4  63   ? 139.229 138.880 170.980 1.00 74.92  ?  62   PHE D CE1   1 
ATOM   2574  C  CE2   . PHE D 4  63   ? 137.309 138.035 172.123 1.00 73.68  ?  62   PHE D CE2   1 
ATOM   2575  C  CZ    . PHE D 4  63   ? 137.862 138.866 171.169 1.00 73.76  ?  62   PHE D CZ    1 
ATOM   2576  N  N     . VAL D 4  64   ? 139.308 137.063 176.405 1.00 73.14  ?  63   VAL D N     1 
ATOM   2577  C  CA    . VAL D 4  64   ? 138.329 137.702 177.279 1.00 73.09  ?  63   VAL D CA    1 
ATOM   2578  C  C     . VAL D 4  64   ? 139.028 138.584 178.306 1.00 72.88  ?  63   VAL D C     1 
ATOM   2579  O  O     . VAL D 4  64   ? 138.542 139.671 178.645 1.00 72.38  ?  63   VAL D O     1 
ATOM   2580  C  CB    . VAL D 4  64   ? 137.438 136.638 177.948 1.00 73.11  ?  63   VAL D CB    1 
ATOM   2581  C  CG1   . VAL D 4  64   ? 136.474 137.283 178.932 1.00 72.82  ?  63   VAL D CG1   1 
ATOM   2582  C  CG2   . VAL D 4  64   ? 136.669 135.854 176.896 1.00 73.33  ?  63   VAL D CG2   1 
ATOM   2583  N  N     . ASN D 4  65   ? 140.181 138.140 178.811 1.00 72.81  ?  64   ASN D N     1 
ATOM   2584  C  CA    . ASN D 4  65   ? 140.939 138.976 179.738 1.00 72.38  ?  64   ASN D CA    1 
ATOM   2585  C  C     . ASN D 4  65   ? 141.479 140.220 179.044 1.00 72.32  ?  64   ASN D C     1 
ATOM   2586  O  O     . ASN D 4  65   ? 141.550 141.296 179.651 1.00 72.11  ?  64   ASN D O     1 
ATOM   2587  C  CB    . ASN D 4  65   ? 142.076 138.170 180.365 1.00 72.33  ?  64   ASN D CB    1 
ATOM   2588  C  CG    . ASN D 4  65   ? 141.576 137.093 181.307 1.00 73.90  ?  64   ASN D CG    1 
ATOM   2589  O  OD1   . ASN D 4  65   ? 141.386 137.335 182.498 1.00 75.65  ?  64   ASN D OD1   1 
ATOM   2590  N  ND2   . ASN D 4  65   ? 141.360 135.896 180.776 1.00 74.06  ?  64   ASN D ND2   1 
ATOM   2591  N  N     . ASP D 4  66   ? 141.858 140.096 177.770 1.00 71.94  ?  65   ASP D N     1 
ATOM   2592  C  CA    . ASP D 4  66   ? 142.374 141.249 177.038 1.00 72.03  ?  65   ASP D CA    1 
ATOM   2593  C  C     . ASP D 4  66   ? 141.271 142.258 176.741 1.00 72.23  ?  65   ASP D C     1 
ATOM   2594  O  O     . ASP D 4  66   ? 141.473 143.469 176.895 1.00 71.86  ?  65   ASP D O     1 
ATOM   2595  C  CB    . ASP D 4  66   ? 143.047 140.787 175.745 1.00 72.11  ?  65   ASP D CB    1 
ATOM   2596  C  CG    . ASP D 4  66   ? 143.536 141.944 174.896 1.00 73.50  ?  65   ASP D CG    1 
ATOM   2597  O  OD1   . ASP D 4  66   ? 144.447 142.673 175.344 1.00 76.01  ?  65   ASP D OD1   1 
ATOM   2598  O  OD2   . ASP D 4  66   ? 143.013 142.120 173.777 1.00 72.71  ?  65   ASP D OD2   1 
ATOM   2599  N  N     . VAL D 4  67   ? 140.100 141.781 176.310 1.00 72.08  ?  66   VAL D N     1 
ATOM   2600  C  CA    . VAL D 4  67   ? 138.970 142.679 176.087 1.00 71.96  ?  66   VAL D CA    1 
ATOM   2601  C  C     . VAL D 4  67   ? 138.545 143.328 177.397 1.00 71.89  ?  66   VAL D C     1 
ATOM   2602  O  O     . VAL D 4  67   ? 138.193 144.514 177.437 1.00 71.61  ?  66   VAL D O     1 
ATOM   2603  C  CB    . VAL D 4  67   ? 137.805 141.921 175.421 1.00 72.13  ?  66   VAL D CB    1 
ATOM   2604  C  CG1   . VAL D 4  67   ? 136.587 142.821 175.283 1.00 72.27  ?  66   VAL D CG1   1 
ATOM   2605  C  CG2   . VAL D 4  67   ? 138.227 141.391 174.059 1.00 72.21  ?  66   VAL D CG2   1 
ATOM   2606  N  N     . PHE D 4  68   ? 138.584 142.566 178.494 1.00 71.63  ?  67   PHE D N     1 
ATOM   2607  C  CA    . PHE D 4  68   ? 138.290 143.138 179.802 1.00 71.69  ?  67   PHE D CA    1 
ATOM   2608  C  C     . PHE D 4  68   ? 139.303 144.209 180.182 1.00 71.81  ?  67   PHE D C     1 
ATOM   2609  O  O     . PHE D 4  68   ? 138.946 145.202 180.826 1.00 71.74  ?  67   PHE D O     1 
ATOM   2610  C  CB    . PHE D 4  68   ? 138.256 142.036 180.862 1.00 72.03  ?  67   PHE D CB    1 
ATOM   2611  C  CG    . PHE D 4  68   ? 138.132 142.551 182.267 1.00 72.73  ?  67   PHE D CG    1 
ATOM   2612  C  CD1   . PHE D 4  68   ? 136.907 142.970 182.759 1.00 72.86  ?  67   PHE D CD1   1 
ATOM   2613  C  CD2   . PHE D 4  68   ? 139.240 142.619 183.096 1.00 72.96  ?  67   PHE D CD2   1 
ATOM   2614  C  CE1   . PHE D 4  68   ? 136.789 143.448 184.051 1.00 73.51  ?  67   PHE D CE1   1 
ATOM   2615  C  CE2   . PHE D 4  68   ? 139.128 143.096 184.389 1.00 72.69  ?  67   PHE D CE2   1 
ATOM   2616  C  CZ    . PHE D 4  68   ? 137.901 143.511 184.866 1.00 73.27  ?  67   PHE D CZ    1 
ATOM   2617  N  N     . GLU D 4  69   ? 140.565 144.030 179.787 1.00 71.27  ?  68   GLU D N     1 
ATOM   2618  C  CA    . GLU D 4  69   ? 141.577 145.037 180.087 1.00 71.18  ?  68   GLU D CA    1 
ATOM   2619  C  C     . GLU D 4  69   ? 141.370 146.294 179.251 1.00 70.47  ?  68   GLU D C     1 
ATOM   2620  O  O     . GLU D 4  69   ? 141.528 147.412 179.755 1.00 70.00  ?  68   GLU D O     1 
ATOM   2621  C  CB    . GLU D 4  69   ? 142.974 144.460 179.861 1.00 71.91  ?  68   GLU D CB    1 
ATOM   2622  C  CG    . GLU D 4  69   ? 144.103 145.407 180.235 1.00 74.14  ?  68   GLU D CG    1 
ATOM   2623  C  CD    . GLU D 4  69   ? 145.471 144.789 180.035 1.00 77.29  ?  68   GLU D CD    1 
ATOM   2624  O  OE1   . GLU D 4  69   ? 145.540 143.624 179.590 1.00 76.41  ?  68   GLU D OE1   1 
ATOM   2625  O  OE2   . GLU D 4  69   ? 146.478 145.469 180.325 1.00 78.97  ?  68   GLU D OE2   1 
ATOM   2626  N  N     . ARG D 4  70   ? 141.012 146.134 177.974 1.00 69.73  ?  69   ARG D N     1 
ATOM   2627  C  CA    . ARG D 4  70   ? 140.795 147.300 177.122 1.00 69.59  ?  69   ARG D CA    1 
ATOM   2628  C  C     . ARG D 4  70   ? 139.556 148.078 177.546 1.00 69.82  ?  69   ARG D C     1 
ATOM   2629  O  O     . ARG D 4  70   ? 139.579 149.314 177.591 1.00 69.29  ?  69   ARG D O     1 
ATOM   2630  C  CB    . ARG D 4  70   ? 140.682 146.875 175.658 1.00 69.27  ?  69   ARG D CB    1 
ATOM   2631  C  CG    . ARG D 4  70   ? 141.991 146.429 175.030 1.00 70.06  ?  69   ARG D CG    1 
ATOM   2632  C  CD    . ARG D 4  70   ? 141.889 146.442 173.513 1.00 70.06  ?  69   ARG D CD    1 
ATOM   2633  N  NE    . ARG D 4  70   ? 143.143 146.062 172.871 1.00 67.30  ?  69   ARG D NE    1 
ATOM   2634  C  CZ    . ARG D 4  70   ? 143.386 144.859 172.361 1.00 68.86  ?  69   ARG D CZ    1 
ATOM   2635  N  NH1   . ARG D 4  70   ? 142.456 143.915 172.414 1.00 66.82  ?  69   ARG D NH1   1 
ATOM   2636  N  NH2   . ARG D 4  70   ? 144.556 144.600 171.795 1.00 70.41  ?  69   ARG D NH2   1 
ATOM   2637  N  N     . ILE D 4  71   ? 138.462 147.377 177.854 1.00 69.65  ?  70   ILE D N     1 
ATOM   2638  C  CA    . ILE D 4  71   ? 137.243 148.062 178.271 1.00 69.09  ?  70   ILE D CA    1 
ATOM   2639  C  C     . ILE D 4  71   ? 137.420 148.675 179.655 1.00 68.67  ?  70   ILE D C     1 
ATOM   2640  O  O     . ILE D 4  71   ? 136.940 149.783 179.925 1.00 68.37  ?  70   ILE D O     1 
ATOM   2641  C  CB    . ILE D 4  71   ? 136.045 147.096 178.219 1.00 69.62  ?  70   ILE D CB    1 
ATOM   2642  C  CG1   . ILE D 4  71   ? 135.806 146.623 176.784 1.00 69.20  ?  70   ILE D CG1   1 
ATOM   2643  C  CG2   . ILE D 4  71   ? 134.792 147.759 178.774 1.00 68.92  ?  70   ILE D CG2   1 
ATOM   2644  C  CD1   . ILE D 4  71   ? 134.632 145.681 176.636 1.00 68.45  ?  70   ILE D CD1   1 
ATOM   2645  N  N     . ALA D 4  72   ? 138.120 147.973 180.551 1.00 67.81  ?  71   ALA D N     1 
ATOM   2646  C  CA    . ALA D 4  72   ? 138.351 148.510 181.888 1.00 67.32  ?  71   ALA D CA    1 
ATOM   2647  C  C     . ALA D 4  72   ? 139.236 149.750 181.842 1.00 67.16  ?  71   ALA D C     1 
ATOM   2648  O  O     . ALA D 4  72   ? 138.948 150.750 182.511 1.00 67.42  ?  71   ALA D O     1 
ATOM   2649  C  CB    . ALA D 4  72   ? 138.969 147.438 182.785 1.00 67.27  ?  71   ALA D CB    1 
ATOM   2650  N  N     . GLY D 4  73   ? 140.315 149.705 181.058 1.00 66.29  ?  72   GLY D N     1 
ATOM   2651  C  CA    . GLY D 4  73   ? 141.179 150.869 180.944 1.00 64.88  ?  72   GLY D CA    1 
ATOM   2652  C  C     . GLY D 4  73   ? 140.508 152.027 180.230 1.00 64.69  ?  72   GLY D C     1 
ATOM   2653  O  O     . GLY D 4  73   ? 140.684 153.188 180.610 1.00 64.27  ?  72   GLY D O     1 
ATOM   2654  N  N     . GLU D 4  74   ? 139.728 151.728 179.187 1.00 65.00  ?  73   GLU D N     1 
ATOM   2655  C  CA    . GLU D 4  74   ? 139.017 152.780 178.468 1.00 65.34  ?  73   GLU D CA    1 
ATOM   2656  C  C     . GLU D 4  74   ? 137.983 153.452 179.363 1.00 65.15  ?  73   GLU D C     1 
ATOM   2657  O  O     . GLU D 4  74   ? 137.851 154.682 179.357 1.00 64.68  ?  73   GLU D O     1 
ATOM   2658  C  CB    . GLU D 4  74   ? 138.353 152.204 177.217 1.00 65.42  ?  73   GLU D CB    1 
ATOM   2659  C  CG    . GLU D 4  74   ? 137.694 153.242 176.319 1.00 68.05  ?  73   GLU D CG    1 
ATOM   2660  C  CD    . GLU D 4  74   ? 138.698 154.065 175.532 1.00 70.16  ?  73   GLU D CD    1 
ATOM   2661  O  OE1   . GLU D 4  74   ? 139.890 153.693 175.508 1.00 68.65  ?  73   GLU D OE1   1 
ATOM   2662  O  OE2   . GLU D 4  74   ? 138.293 155.084 174.933 1.00 71.14  ?  73   GLU D OE2   1 
ATOM   2663  N  N     . ALA D 4  75   ? 137.242 152.662 180.142 1.00 65.46  ?  74   ALA D N     1 
ATOM   2664  C  CA    . ALA D 4  75   ? 136.302 153.244 181.094 1.00 66.08  ?  74   ALA D CA    1 
ATOM   2665  C  C     . ALA D 4  75   ? 137.026 153.972 182.218 1.00 66.40  ?  74   ALA D C     1 
ATOM   2666  O  O     . ALA D 4  75   ? 136.465 154.895 182.820 1.00 66.18  ?  74   ALA D O     1 
ATOM   2667  C  CB    . ALA D 4  75   ? 135.388 152.160 181.663 1.00 66.44  ?  74   ALA D CB    1 
ATOM   2668  N  N     . SER D 4  76   ? 138.266 153.576 182.514 1.00 66.65  ?  75   SER D N     1 
ATOM   2669  C  CA    . SER D 4  76   ? 139.039 154.262 183.544 1.00 66.86  ?  75   SER D CA    1 
ATOM   2670  C  C     . SER D 4  76   ? 139.465 155.648 183.076 1.00 66.83  ?  75   SER D C     1 
ATOM   2671  O  O     . SER D 4  76   ? 139.245 156.646 183.773 1.00 66.35  ?  75   SER D O     1 
ATOM   2672  C  CB    . SER D 4  76   ? 140.258 153.425 183.930 1.00 66.50  ?  75   SER D CB    1 
ATOM   2673  O  OG    . SER D 4  76   ? 139.872 152.141 184.388 1.00 68.38  ?  75   SER D OG    1 
ATOM   2674  N  N     . ARG D 4  77   ? 140.079 155.730 181.892 1.00 67.26  ?  76   ARG D N     1 
ATOM   2675  C  CA    . ARG D 4  77   ? 140.517 157.025 181.379 1.00 68.43  ?  76   ARG D CA    1 
ATOM   2676  C  C     . ARG D 4  77   ? 139.328 157.910 181.025 1.00 69.61  ?  76   ARG D C     1 
ATOM   2677  O  O     . ARG D 4  77   ? 139.382 159.133 181.206 1.00 69.59  ?  76   ARG D O     1 
ATOM   2678  C  CB    . ARG D 4  77   ? 141.431 156.830 180.168 1.00 68.40  ?  76   ARG D CB    1 
ATOM   2679  C  CG    . ARG D 4  77   ? 140.807 156.045 179.025 1.00 68.35  ?  76   ARG D CG    1 
ATOM   2680  C  CD    . ARG D 4  77   ? 141.783 155.875 177.872 1.00 66.14  ?  76   ARG D CD    1 
ATOM   2681  N  NE    . ARG D 4  77   ? 142.219 157.158 177.329 1.00 65.40  ?  76   ARG D NE    1 
ATOM   2682  C  CZ    . ARG D 4  77   ? 143.074 157.290 176.321 1.00 64.78  ?  76   ARG D CZ    1 
ATOM   2683  N  NH1   . ARG D 4  77   ? 143.589 156.215 175.741 1.00 62.15  ?  76   ARG D NH1   1 
ATOM   2684  N  NH2   . ARG D 4  77   ? 143.415 158.497 175.892 1.00 64.54  ?  76   ARG D NH2   1 
ATOM   2685  N  N     . LEU D 4  78   ? 138.243 157.313 180.526 1.00 70.63  ?  77   LEU D N     1 
ATOM   2686  C  CA    . LEU D 4  78   ? 137.042 158.091 180.242 1.00 71.19  ?  77   LEU D CA    1 
ATOM   2687  C  C     . LEU D 4  78   ? 136.383 158.583 181.523 1.00 71.98  ?  77   LEU D C     1 
ATOM   2688  O  O     . LEU D 4  78   ? 135.818 159.683 181.545 1.00 71.87  ?  77   LEU D O     1 
ATOM   2689  C  CB    . LEU D 4  78   ? 136.056 157.264 179.417 1.00 71.06  ?  77   LEU D CB    1 
ATOM   2690  C  CG    . LEU D 4  78   ? 136.107 157.450 177.897 1.00 70.09  ?  77   LEU D CG    1 
ATOM   2691  C  CD1   . LEU D 4  78   ? 137.496 157.165 177.347 1.00 67.19  ?  77   LEU D CD1   1 
ATOM   2692  C  CD2   . LEU D 4  78   ? 135.069 156.573 177.214 1.00 67.54  ?  77   LEU D CD2   1 
ATOM   2693  N  N     . ALA D 4  79   ? 136.444 157.790 182.595 1.00 72.89  ?  78   ALA D N     1 
ATOM   2694  C  CA    . ALA D 4  79   ? 135.935 158.242 183.882 1.00 74.57  ?  78   ALA D CA    1 
ATOM   2695  C  C     . ALA D 4  79   ? 136.850 159.273 184.529 1.00 75.92  ?  78   ALA D C     1 
ATOM   2696  O  O     . ALA D 4  79   ? 136.392 160.043 185.380 1.00 75.86  ?  78   ALA D O     1 
ATOM   2697  C  CB    . ALA D 4  79   ? 135.740 157.050 184.820 1.00 74.58  ?  78   ALA D CB    1 
ATOM   2698  N  N     . HIS D 4  80   ? 138.126 159.307 184.143 1.00 76.95  ?  79   HIS D N     1 
ATOM   2699  C  CA    . HIS D 4  80   ? 139.067 160.285 184.676 1.00 78.59  ?  79   HIS D CA    1 
ATOM   2700  C  C     . HIS D 4  80   ? 139.044 161.603 183.914 1.00 79.26  ?  79   HIS D C     1 
ATOM   2701  O  O     . HIS D 4  80   ? 139.357 162.649 184.495 1.00 79.28  ?  79   HIS D O     1 
ATOM   2702  C  CB    . HIS D 4  80   ? 140.487 159.712 184.659 1.00 78.86  ?  79   HIS D CB    1 
ATOM   2703  C  CG    . HIS D 4  80   ? 141.534 160.670 185.139 1.00 80.83  ?  79   HIS D CG    1 
ATOM   2704  N  ND1   . HIS D 4  80   ? 141.533 161.198 186.412 1.00 81.82  ?  79   HIS D ND1   1 
ATOM   2705  C  CD2   . HIS D 4  80   ? 142.615 161.195 184.515 1.00 82.35  ?  79   HIS D CD2   1 
ATOM   2706  C  CE1   . HIS D 4  80   ? 142.568 162.006 186.552 1.00 83.05  ?  79   HIS D CE1   1 
ATOM   2707  N  NE2   . HIS D 4  80   ? 143.241 162.022 185.415 1.00 82.70  ?  79   HIS D NE2   1 
ATOM   2708  N  N     . TYR D 4  81   ? 138.683 161.580 182.628 1.00 80.18  ?  80   TYR D N     1 
ATOM   2709  C  CA    . TYR D 4  81   ? 138.658 162.816 181.851 1.00 81.10  ?  80   TYR D CA    1 
ATOM   2710  C  C     . TYR D 4  81   ? 137.523 163.732 182.295 1.00 81.42  ?  80   TYR D C     1 
ATOM   2711  O  O     . TYR D 4  81   ? 137.675 164.959 182.301 1.00 80.96  ?  80   TYR D O     1 
ATOM   2712  C  CB    . TYR D 4  81   ? 138.534 162.502 180.361 1.00 81.65  ?  80   TYR D CB    1 
ATOM   2713  C  CG    . TYR D 4  81   ? 139.740 161.808 179.769 1.00 83.14  ?  80   TYR D CG    1 
ATOM   2714  C  CD1   . TYR D 4  81   ? 141.000 161.955 180.336 1.00 83.91  ?  80   TYR D CD1   1 
ATOM   2715  C  CD2   . TYR D 4  81   ? 139.618 161.004 178.644 1.00 82.56  ?  80   TYR D CD2   1 
ATOM   2716  C  CE1   . TYR D 4  81   ? 142.104 161.322 179.796 1.00 83.29  ?  80   TYR D CE1   1 
ATOM   2717  C  CE2   . TYR D 4  81   ? 140.717 160.365 178.097 1.00 82.72  ?  80   TYR D CE2   1 
ATOM   2718  C  CZ    . TYR D 4  81   ? 141.957 160.528 178.678 1.00 82.79  ?  80   TYR D CZ    1 
ATOM   2719  O  OH    . TYR D 4  81   ? 143.052 159.895 178.137 1.00 83.51  ?  80   TYR D OH    1 
ATOM   2720  N  N     . ASN D 4  82   ? 136.377 163.159 182.662 1.00 81.72  ?  81   ASN D N     1 
ATOM   2721  C  CA    . ASN D 4  82   ? 135.213 163.934 183.066 1.00 81.75  ?  81   ASN D CA    1 
ATOM   2722  C  C     . ASN D 4  82   ? 135.159 164.177 184.570 1.00 81.82  ?  81   ASN D C     1 
ATOM   2723  O  O     . ASN D 4  82   ? 134.105 164.570 185.084 1.00 81.94  ?  81   ASN D O     1 
ATOM   2724  C  CB    . ASN D 4  82   ? 133.930 163.241 182.599 1.00 81.67  ?  81   ASN D CB    1 
ATOM   2725  C  CG    . ASN D 4  82   ? 133.854 163.112 181.090 1.00 81.37  ?  81   ASN D CG    1 
ATOM   2726  O  OD1   . ASN D 4  82   ? 134.869 163.187 180.398 1.00 81.28  ?  81   ASN D OD1   1 
ATOM   2727  N  ND2   . ASN D 4  82   ? 132.646 162.918 180.572 1.00 80.80  ?  81   ASN D ND2   1 
ATOM   2728  N  N     . LYS D 4  83   ? 136.267 163.951 185.280 1.00 82.05  ?  82   LYS D N     1 
ATOM   2729  C  CA    . LYS D 4  83   ? 136.338 164.139 186.731 1.00 82.17  ?  82   LYS D CA    1 
ATOM   2730  C  C     . LYS D 4  83   ? 135.268 163.320 187.452 1.00 81.82  ?  82   LYS D C     1 
ATOM   2731  O  O     . LYS D 4  83   ? 134.658 163.776 188.421 1.00 81.70  ?  82   LYS D O     1 
ATOM   2732  C  CB    . LYS D 4  83   ? 136.232 165.620 187.104 1.00 82.35  ?  82   LYS D CB    1 
ATOM   2733  C  CG    . LYS D 4  83   ? 137.392 166.478 186.618 1.00 84.16  ?  82   LYS D CG    1 
ATOM   2734  C  CD    . LYS D 4  83   ? 138.687 166.132 187.341 1.00 87.29  ?  82   LYS D CD    1 
ATOM   2735  C  CE    . LYS D 4  83   ? 139.692 165.472 186.408 1.00 89.25  ?  82   LYS D CE    1 
ATOM   2736  N  NZ    . LYS D 4  83   ? 140.957 165.123 187.112 1.00 89.80  ?  82   LYS D NZ    1 
ATOM   2737  N  N     . ARG D 4  84   ? 135.042 162.100 186.976 1.00 81.38  ?  83   ARG D N     1 
ATOM   2738  C  CA    . ARG D 4  84   ? 134.033 161.214 187.538 1.00 81.82  ?  83   ARG D CA    1 
ATOM   2739  C  C     . ARG D 4  84   ? 134.692 160.201 188.464 1.00 81.15  ?  83   ARG D C     1 
ATOM   2740  O  O     . ARG D 4  84   ? 135.793 159.716 188.189 1.00 81.39  ?  83   ARG D O     1 
ATOM   2741  C  CB    . ARG D 4  84   ? 133.265 160.494 186.428 1.00 81.82  ?  83   ARG D CB    1 
ATOM   2742  C  CG    . ARG D 4  84   ? 131.830 160.147 186.786 1.00 83.23  ?  83   ARG D CG    1 
ATOM   2743  C  CD    . ARG D 4  84   ? 131.100 159.545 185.596 1.00 83.85  ?  83   ARG D CD    1 
ATOM   2744  N  NE    . ARG D 4  84   ? 129.657 159.478 185.809 1.00 89.35  ?  83   ARG D NE    1 
ATOM   2745  C  CZ    . ARG D 4  84   ? 128.805 160.433 185.451 1.00 91.22  ?  83   ARG D CZ    1 
ATOM   2746  N  NH1   . ARG D 4  84   ? 129.251 161.533 184.859 1.00 91.22  ?  83   ARG D NH1   1 
ATOM   2747  N  NH2   . ARG D 4  84   ? 127.508 160.289 185.682 1.00 91.73  ?  83   ARG D NH2   1 
ATOM   2748  N  N     . SER D 4  85   ? 134.012 159.886 189.564 1.00 80.26  ?  84   SER D N     1 
ATOM   2749  C  CA    . SER D 4  85   ? 134.539 158.982 190.576 1.00 79.27  ?  84   SER D CA    1 
ATOM   2750  C  C     . SER D 4  85   ? 133.948 157.581 190.494 1.00 78.83  ?  84   SER D C     1 
ATOM   2751  O  O     . SER D 4  85   ? 134.300 156.728 191.315 1.00 79.17  ?  84   SER D O     1 
ATOM   2752  C  CB    . SER D 4  85   ? 134.298 159.561 191.975 1.00 79.40  ?  84   SER D CB    1 
ATOM   2753  O  OG    . SER D 4  85   ? 134.932 160.819 192.122 1.00 80.40  ?  84   SER D OG    1 
ATOM   2754  N  N     . THR D 4  86   ? 133.065 157.321 189.532 1.00 78.18  ?  85   THR D N     1 
ATOM   2755  C  CA    . THR D 4  86   ? 132.436 156.016 189.400 1.00 76.85  ?  85   THR D CA    1 
ATOM   2756  C  C     . THR D 4  86   ? 132.327 155.650 187.927 1.00 76.73  ?  85   THR D C     1 
ATOM   2757  O  O     . THR D 4  86   ? 132.387 156.508 187.044 1.00 76.27  ?  85   THR D O     1 
ATOM   2758  C  CB    . THR D 4  86   ? 131.047 155.985 190.053 1.00 76.76  ?  85   THR D CB    1 
ATOM   2759  O  OG1   . THR D 4  86   ? 130.469 154.683 189.890 1.00 75.31  ?  85   THR D OG1   1 
ATOM   2760  C  CG2   . THR D 4  86   ? 130.135 157.024 189.418 1.00 76.52  ?  85   THR D CG2   1 
ATOM   2761  N  N     . ILE D 4  87   ? 132.166 154.354 187.675 1.00 76.73  ?  86   ILE D N     1 
ATOM   2762  C  CA    . ILE D 4  87   ? 131.998 153.816 186.329 1.00 76.57  ?  86   ILE D CA    1 
ATOM   2763  C  C     . ILE D 4  87   ? 130.663 153.083 186.315 1.00 77.06  ?  86   ILE D C     1 
ATOM   2764  O  O     . ILE D 4  87   ? 130.557 151.953 186.806 1.00 77.58  ?  86   ILE D O     1 
ATOM   2765  C  CB    . ILE D 4  87   ? 133.149 152.889 185.923 1.00 76.15  ?  86   ILE D CB    1 
ATOM   2766  C  CG1   . ILE D 4  87   ? 134.476 153.651 185.928 1.00 76.31  ?  86   ILE D CG1   1 
ATOM   2767  C  CG2   . ILE D 4  87   ? 132.887 152.284 184.552 1.00 76.04  ?  86   ILE D CG2   1 
ATOM   2768  C  CD1   . ILE D 4  87   ? 135.661 152.818 185.490 1.00 73.49  ?  86   ILE D CD1   1 
ATOM   2769  N  N     . THR D 4  88   ? 129.637 153.724 185.756 1.00 77.22  ?  87   THR D N     1 
ATOM   2770  C  CA    . THR D 4  88   ? 128.307 153.131 185.701 1.00 77.55  ?  87   THR D CA    1 
ATOM   2771  C  C     . THR D 4  88   ? 128.149 152.269 184.455 1.00 77.69  ?  87   THR D C     1 
ATOM   2772  O  O     . THR D 4  88   ? 129.071 151.542 184.073 1.00 77.93  ?  87   THR D O     1 
ATOM   2773  C  CB    . THR D 4  88   ? 127.231 154.218 185.734 1.00 77.62  ?  87   THR D CB    1 
ATOM   2774  O  OG1   . THR D 4  88   ? 127.400 155.095 184.613 1.00 77.74  ?  87   THR D OG1   1 
ATOM   2775  C  CG2   . THR D 4  88   ? 127.328 155.025 187.020 1.00 77.60  ?  87   THR D CG2   1 
ATOM   2776  N  N     . SER D 4  89   ? 126.982 152.344 183.815 1.00 77.23  ?  88   SER D N     1 
ATOM   2777  C  CA    . SER D 4  89   ? 126.719 151.560 182.615 1.00 76.73  ?  88   SER D CA    1 
ATOM   2778  C  C     . SER D 4  89   ? 127.005 152.329 181.333 1.00 75.97  ?  88   SER D C     1 
ATOM   2779  O  O     . SER D 4  89   ? 127.315 151.712 180.307 1.00 75.88  ?  88   SER D O     1 
ATOM   2780  C  CB    . SER D 4  89   ? 125.265 151.080 182.607 1.00 76.93  ?  88   SER D CB    1 
ATOM   2781  O  OG    . SER D 4  89   ? 124.988 150.269 183.736 1.00 77.73  ?  88   SER D OG    1 
ATOM   2782  N  N     . ARG D 4  90   ? 126.912 153.661 181.366 1.00 75.05  ?  89   ARG D N     1 
ATOM   2783  C  CA    . ARG D 4  90   ? 127.152 154.443 180.158 1.00 74.29  ?  89   ARG D CA    1 
ATOM   2784  C  C     . ARG D 4  90   ? 128.631 154.484 179.795 1.00 74.55  ?  89   ARG D C     1 
ATOM   2785  O  O     . ARG D 4  90   ? 128.971 154.633 178.616 1.00 74.68  ?  89   ARG D O     1 
ATOM   2786  C  CB    . ARG D 4  90   ? 126.609 155.862 180.328 1.00 74.22  ?  89   ARG D CB    1 
ATOM   2787  C  CG    . ARG D 4  90   ? 127.229 156.639 181.476 1.00 73.85  ?  89   ARG D CG    1 
ATOM   2788  C  CD    . ARG D 4  90   ? 126.984 158.128 181.312 1.00 75.16  ?  89   ARG D CD    1 
ATOM   2789  N  NE    . ARG D 4  90   ? 125.564 158.436 181.180 1.00 76.71  ?  89   ARG D NE    1 
ATOM   2790  C  CZ    . ARG D 4  90   ? 125.090 159.616 180.792 1.00 76.57  ?  89   ARG D CZ    1 
ATOM   2791  N  NH1   . ARG D 4  90   ? 125.927 160.599 180.491 1.00 76.37  ?  89   ARG D NH1   1 
ATOM   2792  N  NH2   . ARG D 4  90   ? 123.782 159.811 180.700 1.00 78.03  ?  89   ARG D NH2   1 
ATOM   2793  N  N     . GLU D 4  91   ? 129.519 154.360 180.784 1.00 74.61  ?  90   GLU D N     1 
ATOM   2794  C  CA    . GLU D 4  91   ? 130.949 154.335 180.494 1.00 74.47  ?  90   GLU D CA    1 
ATOM   2795  C  C     . GLU D 4  91   ? 131.330 153.061 179.751 1.00 73.89  ?  90   GLU D C     1 
ATOM   2796  O  O     . GLU D 4  91   ? 132.060 153.104 178.753 1.00 74.30  ?  90   GLU D O     1 
ATOM   2797  C  CB    . GLU D 4  91   ? 131.753 154.466 181.790 1.00 74.71  ?  90   GLU D CB    1 
ATOM   2798  C  CG    . GLU D 4  91   ? 131.678 155.838 182.451 1.00 75.07  ?  90   GLU D CG    1 
ATOM   2799  C  CD    . GLU D 4  91   ? 130.348 156.095 183.136 1.00 76.51  ?  90   GLU D CD    1 
ATOM   2800  O  OE1   . GLU D 4  91   ? 129.589 155.127 183.352 1.00 76.60  ?  90   GLU D OE1   1 
ATOM   2801  O  OE2   . GLU D 4  91   ? 130.061 157.268 183.456 1.00 77.39  ?  90   GLU D OE2   1 
ATOM   2802  N  N     . ILE D 4  92   ? 130.842 151.912 180.225 1.00 72.98  ?  91   ILE D N     1 
ATOM   2803  C  CA    . ILE D 4  92   ? 131.066 150.664 179.505 1.00 72.48  ?  91   ILE D CA    1 
ATOM   2804  C  C     . ILE D 4  92   ? 130.319 150.677 178.178 1.00 72.45  ?  91   ILE D C     1 
ATOM   2805  O  O     . ILE D 4  92   ? 130.757 150.053 177.204 1.00 72.90  ?  91   ILE D O     1 
ATOM   2806  C  CB    . ILE D 4  92   ? 130.654 149.464 180.377 1.00 72.45  ?  91   ILE D CB    1 
ATOM   2807  C  CG1   . ILE D 4  92   ? 131.258 149.589 181.778 1.00 72.58  ?  91   ILE D CG1   1 
ATOM   2808  C  CG2   . ILE D 4  92   ? 131.095 148.158 179.735 1.00 71.55  ?  91   ILE D CG2   1 
ATOM   2809  C  CD1   . ILE D 4  92   ? 132.769 149.538 181.798 1.00 70.71  ?  91   ILE D CD1   1 
ATOM   2810  N  N     . GLN D 4  93   ? 129.192 151.390 178.112 1.00 71.94  ?  92   GLN D N     1 
ATOM   2811  C  CA    . GLN D 4  93   ? 128.435 151.474 176.867 1.00 71.21  ?  92   GLN D CA    1 
ATOM   2812  C  C     . GLN D 4  93   ? 129.228 152.205 175.790 1.00 70.48  ?  92   GLN D C     1 
ATOM   2813  O  O     . GLN D 4  93   ? 129.386 151.701 174.671 1.00 70.60  ?  92   GLN D O     1 
ATOM   2814  C  CB    . GLN D 4  93   ? 127.095 152.167 177.119 1.00 71.67  ?  92   GLN D CB    1 
ATOM   2815  C  CG    . GLN D 4  93   ? 126.201 152.268 175.894 1.00 72.11  ?  92   GLN D CG    1 
ATOM   2816  C  CD    . GLN D 4  93   ? 124.878 152.944 176.195 1.00 72.57  ?  92   GLN D CD    1 
ATOM   2817  O  OE1   . GLN D 4  93   ? 124.655 153.434 177.303 1.00 73.76  ?  92   GLN D OE1   1 
ATOM   2818  N  NE2   . GLN D 4  93   ? 123.990 152.974 175.208 1.00 71.49  ?  92   GLN D NE2   1 
ATOM   2819  N  N     . THR D 4  94   ? 129.738 153.398 176.109 1.00 69.20  ?  93   THR D N     1 
ATOM   2820  C  CA    . THR D 4  94   ? 130.536 154.136 175.136 1.00 68.20  ?  93   THR D CA    1 
ATOM   2821  C  C     . THR D 4  94   ? 131.890 153.475 174.905 1.00 67.70  ?  93   THR D C     1 
ATOM   2822  O  O     . THR D 4  94   ? 132.490 153.654 173.839 1.00 67.24  ?  93   THR D O     1 
ATOM   2823  C  CB    . THR D 4  94   ? 130.720 155.588 175.586 1.00 67.78  ?  93   THR D CB    1 
ATOM   2824  O  OG1   . THR D 4  94   ? 131.432 156.316 174.578 1.00 66.82  ?  93   THR D OG1   1 
ATOM   2825  C  CG2   . THR D 4  94   ? 131.499 155.656 176.891 1.00 67.45  ?  93   THR D CG2   1 
ATOM   2826  N  N     . ALA D 4  95   ? 132.383 152.709 175.882 1.00 67.46  ?  94   ALA D N     1 
ATOM   2827  C  CA    . ALA D 4  95   ? 133.619 151.963 175.674 1.00 67.26  ?  94   ALA D CA    1 
ATOM   2828  C  C     . ALA D 4  95   ? 133.411 150.827 174.681 1.00 67.29  ?  94   ALA D C     1 
ATOM   2829  O  O     . ALA D 4  95   ? 134.306 150.514 173.888 1.00 67.07  ?  94   ALA D O     1 
ATOM   2830  C  CB    . ALA D 4  95   ? 134.142 151.428 177.006 1.00 67.20  ?  94   ALA D CB    1 
ATOM   2831  N  N     . VAL D 4  96   ? 132.234 150.198 174.711 1.00 67.60  ?  95   VAL D N     1 
ATOM   2832  C  CA    . VAL D 4  96   ? 131.920 149.163 173.732 1.00 67.76  ?  95   VAL D CA    1 
ATOM   2833  C  C     . VAL D 4  96   ? 131.647 149.784 172.368 1.00 67.95  ?  95   VAL D C     1 
ATOM   2834  O  O     . VAL D 4  96   ? 132.074 149.255 171.333 1.00 68.34  ?  95   VAL D O     1 
ATOM   2835  C  CB    . VAL D 4  96   ? 130.733 148.312 174.221 1.00 67.75  ?  95   VAL D CB    1 
ATOM   2836  C  CG1   . VAL D 4  96   ? 130.170 147.474 173.087 1.00 68.27  ?  95   VAL D CG1   1 
ATOM   2837  C  CG2   . VAL D 4  96   ? 131.164 147.418 175.374 1.00 68.49  ?  95   VAL D CG2   1 
ATOM   2838  N  N     . ARG D 4  97   ? 130.941 150.918 172.341 1.00 68.00  ?  96   ARG D N     1 
ATOM   2839  C  CA    . ARG D 4  97   ? 130.667 151.586 171.072 1.00 68.42  ?  96   ARG D CA    1 
ATOM   2840  C  C     . ARG D 4  97   ? 131.954 152.051 170.403 1.00 67.93  ?  96   ARG D C     1 
ATOM   2841  O  O     . ARG D 4  97   ? 132.085 151.982 169.175 1.00 68.48  ?  96   ARG D O     1 
ATOM   2842  C  CB    . ARG D 4  97   ? 129.719 152.765 171.288 1.00 68.21  ?  96   ARG D CB    1 
ATOM   2843  C  CG    . ARG D 4  97   ? 128.294 152.366 171.635 1.00 69.74  ?  96   ARG D CG    1 
ATOM   2844  C  CD    . ARG D 4  97   ? 127.385 153.582 171.728 1.00 70.52  ?  96   ARG D CD    1 
ATOM   2845  N  NE    . ARG D 4  97   ? 125.993 153.207 171.954 1.00 77.19  ?  96   ARG D NE    1 
ATOM   2846  C  CZ    . ARG D 4  97   ? 124.991 154.074 172.056 1.00 79.98  ?  96   ARG D CZ    1 
ATOM   2847  N  NH1   . ARG D 4  97   ? 125.223 155.375 171.952 1.00 78.75  ?  96   ARG D NH1   1 
ATOM   2848  N  NH2   . ARG D 4  97   ? 123.755 153.640 172.261 1.00 81.65  ?  96   ARG D NH2   1 
ATOM   2849  N  N     . LEU D 4  98   ? 132.919 152.527 171.193 1.00 67.60  ?  97   LEU D N     1 
ATOM   2850  C  CA    . LEU D 4  98   ? 134.191 152.962 170.629 1.00 66.70  ?  97   LEU D CA    1 
ATOM   2851  C  C     . LEU D 4  98   ? 135.128 151.793 170.354 1.00 67.12  ?  97   LEU D C     1 
ATOM   2852  O  O     . LEU D 4  98   ? 136.009 151.902 169.494 1.00 66.92  ?  97   LEU D O     1 
ATOM   2853  C  CB    . LEU D 4  98   ? 134.868 153.965 171.564 1.00 65.77  ?  97   LEU D CB    1 
ATOM   2854  C  CG    . LEU D 4  98   ? 134.229 155.351 171.657 1.00 64.72  ?  97   LEU D CG    1 
ATOM   2855  C  CD1   . LEU D 4  98   ? 134.951 156.198 172.690 1.00 62.26  ?  97   LEU D CD1   1 
ATOM   2856  C  CD2   . LEU D 4  98   ? 134.237 156.033 170.299 1.00 62.30  ?  97   LEU D CD2   1 
ATOM   2857  N  N     . LEU D 4  99   ? 134.960 150.676 171.066 1.00 67.51  ?  98   LEU D N     1 
ATOM   2858  C  CA    . LEU D 4  99   ? 135.836 149.528 170.859 1.00 68.31  ?  98   LEU D CA    1 
ATOM   2859  C  C     . LEU D 4  99   ? 135.371 148.670 169.689 1.00 68.43  ?  98   LEU D C     1 
ATOM   2860  O  O     . LEU D 4  99   ? 136.189 148.241 168.868 1.00 68.24  ?  98   LEU D O     1 
ATOM   2861  C  CB    . LEU D 4  99   ? 135.919 148.694 172.140 1.00 68.66  ?  98   LEU D CB    1 
ATOM   2862  C  CG    . LEU D 4  99   ? 136.916 147.532 172.176 1.00 69.25  ?  98   LEU D CG    1 
ATOM   2863  C  CD1   . LEU D 4  99   ? 137.539 147.420 173.557 1.00 70.44  ?  98   LEU D CD1   1 
ATOM   2864  C  CD2   . LEU D 4  99   ? 136.252 146.215 171.792 1.00 69.50  ?  98   LEU D CD2   1 
ATOM   2865  N  N     . LEU D 4  100  ? 134.064 148.509 169.494 1.00 69.18  ?  99   LEU D N     1 
ATOM   2866  C  CA    . LEU D 4  100  ? 133.541 147.750 168.336 1.00 69.03  ?  99   LEU D CA    1 
ATOM   2867  C  C     . LEU D 4  100  ? 133.484 148.550 167.007 1.00 69.11  ?  99   LEU D C     1 
ATOM   2868  O  O     . LEU D 4  100  ? 133.338 149.766 167.031 1.00 68.67  ?  99   LEU D O     1 
ATOM   2869  C  CB    . LEU D 4  100  ? 132.161 147.189 168.657 1.00 68.80  ?  99   LEU D CB    1 
ATOM   2870  C  CG    . LEU D 4  100  ? 132.005 146.637 170.071 1.00 69.65  ?  99   LEU D CG    1 
ATOM   2871  C  CD1   . LEU D 4  100  ? 130.727 145.820 170.153 1.00 70.04  ?  99   LEU D CD1   1 
ATOM   2872  C  CD2   . LEU D 4  100  ? 133.211 145.789 170.442 1.00 70.78  ?  99   LEU D CD2   1 
ATOM   2873  N  N     . PRO D 4  101  ? 133.634 147.866 165.850 1.00 69.30  ?  100  PRO D N     1 
ATOM   2874  C  CA    . PRO D 4  101  ? 133.609 148.400 164.466 1.00 70.06  ?  100  PRO D CA    1 
ATOM   2875  C  C     . PRO D 4  101  ? 132.302 149.003 163.880 1.00 71.07  ?  100  PRO D C     1 
ATOM   2876  O  O     . PRO D 4  101  ? 132.373 150.081 163.299 1.00 70.64  ?  100  PRO D O     1 
ATOM   2877  C  CB    . PRO D 4  101  ? 134.016 147.186 163.626 1.00 69.61  ?  100  PRO D CB    1 
ATOM   2878  C  CG    . PRO D 4  101  ? 133.631 146.011 164.454 1.00 68.70  ?  100  PRO D CG    1 
ATOM   2879  C  CD    . PRO D 4  101  ? 133.915 146.423 165.867 1.00 68.94  ?  100  PRO D CD    1 
ATOM   2880  N  N     . GLY D 4  102  ? 131.158 148.332 164.021 1.00 72.09  ?  101  GLY D N     1 
ATOM   2881  C  CA    . GLY D 4  102  ? 129.862 148.828 163.597 1.00 72.81  ?  101  GLY D CA    1 
ATOM   2882  C  C     . GLY D 4  102  ? 128.663 148.144 164.222 1.00 73.73  ?  101  GLY D C     1 
ATOM   2883  O  O     . GLY D 4  102  ? 128.227 148.518 165.315 1.00 73.94  ?  101  GLY D O     1 
ATOM   2884  N  N     . GLU D 4  103  ? 128.117 147.139 163.530 1.00 73.74  ?  102  GLU D N     1 
ATOM   2885  C  CA    . GLU D 4  103  ? 126.872 146.519 163.974 1.00 74.51  ?  102  GLU D CA    1 
ATOM   2886  C  C     . GLU D 4  103  ? 127.046 145.769 165.288 1.00 74.51  ?  102  GLU D C     1 
ATOM   2887  O  O     . GLU D 4  103  ? 126.095 145.664 166.073 1.00 74.80  ?  102  GLU D O     1 
ATOM   2888  C  CB    . GLU D 4  103  ? 126.340 145.581 162.889 1.00 74.94  ?  102  GLU D CB    1 
ATOM   2889  C  CG    . GLU D 4  103  ? 124.936 145.057 163.151 1.00 76.57  ?  102  GLU D CG    1 
ATOM   2890  C  CD    . GLU D 4  103  ? 124.421 144.178 162.028 1.00 79.27  ?  102  GLU D CD    1 
ATOM   2891  O  OE1   . GLU D 4  103  ? 125.188 143.910 161.080 1.00 79.04  ?  102  GLU D OE1   1 
ATOM   2892  O  OE2   . GLU D 4  103  ? 123.247 143.756 162.094 1.00 80.64  ?  102  GLU D OE2   1 
ATOM   2893  N  N     . LEU D 4  104  ? 128.246 145.240 165.546 1.00 74.72  ?  103  LEU D N     1 
ATOM   2894  C  CA    . LEU D 4  104  ? 128.493 144.556 166.811 1.00 74.05  ?  103  LEU D CA    1 
ATOM   2895  C  C     . LEU D 4  104  ? 128.311 145.492 167.997 1.00 73.51  ?  103  LEU D C     1 
ATOM   2896  O  O     . LEU D 4  104  ? 127.898 145.054 169.077 1.00 73.06  ?  103  LEU D O     1 
ATOM   2897  C  CB    . LEU D 4  104  ? 129.899 143.953 166.823 1.00 73.92  ?  103  LEU D CB    1 
ATOM   2898  C  CG    . LEU D 4  104  ? 130.078 142.541 166.256 1.00 75.30  ?  103  LEU D CG    1 
ATOM   2899  C  CD1   . LEU D 4  104  ? 129.753 142.484 164.771 1.00 76.61  ?  103  LEU D CD1   1 
ATOM   2900  C  CD2   . LEU D 4  104  ? 131.492 142.040 166.516 1.00 76.64  ?  103  LEU D CD2   1 
ATOM   2901  N  N     . ALA D 4  105  ? 128.612 146.781 167.818 1.00 73.29  ?  104  ALA D N     1 
ATOM   2902  C  CA    . ALA D 4  105  ? 128.399 147.743 168.893 1.00 73.02  ?  104  ALA D CA    1 
ATOM   2903  C  C     . ALA D 4  105  ? 126.914 147.945 169.167 1.00 73.49  ?  104  ALA D C     1 
ATOM   2904  O  O     . ALA D 4  105  ? 126.495 148.008 170.328 1.00 73.21  ?  104  ALA D O     1 
ATOM   2905  C  CB    . ALA D 4  105  ? 129.069 149.073 168.548 1.00 73.15  ?  104  ALA D CB    1 
ATOM   2906  N  N     . LYS D 4  106  ? 126.102 148.042 168.110 1.00 74.13  ?  105  LYS D N     1 
ATOM   2907  C  CA    . LYS D 4  106  ? 124.665 148.210 168.298 1.00 74.58  ?  105  LYS D CA    1 
ATOM   2908  C  C     . LYS D 4  106  ? 124.041 146.972 168.928 1.00 74.39  ?  105  LYS D C     1 
ATOM   2909  O  O     . LYS D 4  106  ? 123.206 147.084 169.835 1.00 74.07  ?  105  LYS D O     1 
ATOM   2910  C  CB    . LYS D 4  106  ? 123.994 148.530 166.962 1.00 74.65  ?  105  LYS D CB    1 
ATOM   2911  C  CG    . LYS D 4  106  ? 122.493 148.759 167.062 1.00 76.11  ?  105  LYS D CG    1 
ATOM   2912  C  CD    . LYS D 4  106  ? 121.894 149.114 165.711 1.00 78.09  ?  105  LYS D CD    1 
ATOM   2913  C  CE    . LYS D 4  106  ? 122.082 147.987 164.709 1.00 78.37  ?  105  LYS D CE    1 
ATOM   2914  N  NZ    . LYS D 4  106  ? 121.547 148.345 163.366 1.00 79.49  ?  105  LYS D NZ    1 
ATOM   2915  N  N     . HIS D 4  107  ? 124.431 145.782 168.463 1.00 74.86  ?  106  HIS D N     1 
ATOM   2916  C  CA    . HIS D 4  107  ? 123.922 144.555 169.066 1.00 75.85  ?  106  HIS D CA    1 
ATOM   2917  C  C     . HIS D 4  107  ? 124.380 144.408 170.511 1.00 76.20  ?  106  HIS D C     1 
ATOM   2918  O  O     . HIS D 4  107  ? 123.637 143.877 171.344 1.00 75.95  ?  106  HIS D O     1 
ATOM   2919  C  CB    . HIS D 4  107  ? 124.356 143.341 168.244 1.00 75.98  ?  106  HIS D CB    1 
ATOM   2920  C  CG    . HIS D 4  107  ? 123.709 143.260 166.897 1.00 77.31  ?  106  HIS D CG    1 
ATOM   2921  N  ND1   . HIS D 4  107  ? 123.946 142.224 166.019 1.00 79.33  ?  106  HIS D ND1   1 
ATOM   2922  C  CD2   . HIS D 4  107  ? 122.831 144.084 166.278 1.00 78.92  ?  106  HIS D CD2   1 
ATOM   2923  C  CE1   . HIS D 4  107  ? 123.243 142.415 164.917 1.00 80.00  ?  106  HIS D CE1   1 
ATOM   2924  N  NE2   . HIS D 4  107  ? 122.558 143.536 165.048 1.00 80.20  ?  106  HIS D NE2   1 
ATOM   2925  N  N     . ALA D 4  108  ? 125.592 144.871 170.828 1.00 77.04  ?  107  ALA D N     1 
ATOM   2926  C  CA    . ALA D 4  108  ? 126.068 144.804 172.204 1.00 77.06  ?  107  ALA D CA    1 
ATOM   2927  C  C     . ALA D 4  108  ? 125.350 145.810 173.096 1.00 77.33  ?  107  ALA D C     1 
ATOM   2928  O  O     . ALA D 4  108  ? 125.171 145.556 174.293 1.00 77.23  ?  107  ALA D O     1 
ATOM   2929  C  CB    . ALA D 4  108  ? 127.578 145.032 172.251 1.00 76.96  ?  107  ALA D CB    1 
ATOM   2930  N  N     . VAL D 4  109  ? 124.937 146.950 172.538 1.00 77.80  ?  108  VAL D N     1 
ATOM   2931  C  CA    . VAL D 4  109  ? 124.178 147.921 173.320 1.00 78.12  ?  108  VAL D CA    1 
ATOM   2932  C  C     . VAL D 4  109  ? 122.757 147.422 173.555 1.00 78.95  ?  108  VAL D C     1 
ATOM   2933  O  O     . VAL D 4  109  ? 122.214 147.554 174.657 1.00 78.88  ?  108  VAL D O     1 
ATOM   2934  C  CB    . VAL D 4  109  ? 124.193 149.296 172.628 1.00 77.80  ?  108  VAL D CB    1 
ATOM   2935  C  CG1   . VAL D 4  109  ? 123.162 150.223 173.254 1.00 77.24  ?  108  VAL D CG1   1 
ATOM   2936  C  CG2   . VAL D 4  109  ? 125.578 149.916 172.714 1.00 78.01  ?  108  VAL D CG2   1 
ATOM   2937  N  N     . SER D 4  110  ? 122.136 146.836 172.529 1.00 80.12  ?  109  SER D N     1 
ATOM   2938  C  CA    . SER D 4  110  ? 120.777 146.325 172.685 1.00 81.36  ?  109  SER D CA    1 
ATOM   2939  C  C     . SER D 4  110  ? 120.743 145.134 173.636 1.00 82.22  ?  109  SER D C     1 
ATOM   2940  O  O     . SER D 4  110  ? 119.915 145.082 174.554 1.00 82.61  ?  109  SER D O     1 
ATOM   2941  C  CB    . SER D 4  110  ? 120.201 145.944 171.321 1.00 81.54  ?  109  SER D CB    1 
ATOM   2942  O  OG    . SER D 4  110  ? 120.158 147.065 170.456 1.00 81.77  ?  109  SER D OG    1 
ATOM   2943  N  N     . GLU D 4  111  ? 121.641 144.166 173.434 1.00 83.16  ?  110  GLU D N     1 
ATOM   2944  C  CA    . GLU D 4  111  ? 121.679 142.999 174.310 1.00 84.45  ?  110  GLU D CA    1 
ATOM   2945  C  C     . GLU D 4  111  ? 122.101 143.383 175.723 1.00 85.06  ?  110  GLU D C     1 
ATOM   2946  O  O     . GLU D 4  111  ? 121.540 142.877 176.704 1.00 85.27  ?  110  GLU D O     1 
ATOM   2947  C  CB    . GLU D 4  111  ? 122.625 141.945 173.734 1.00 84.63  ?  110  GLU D CB    1 
ATOM   2948  C  CG    . GLU D 4  111  ? 122.569 140.598 174.440 1.00 85.88  ?  110  GLU D CG    1 
ATOM   2949  C  CD    . GLU D 4  111  ? 121.309 139.817 174.113 1.00 88.20  ?  110  GLU D CD    1 
ATOM   2950  O  OE1   . GLU D 4  111  ? 120.614 140.182 173.141 1.00 88.03  ?  110  GLU D OE1   1 
ATOM   2951  O  OE2   . GLU D 4  111  ? 121.014 138.836 174.828 1.00 91.08  ?  110  GLU D OE2   1 
ATOM   2952  N  N     . GLY D 4  112  ? 123.082 144.278 175.847 1.00 85.61  ?  111  GLY D N     1 
ATOM   2953  C  CA    . GLY D 4  112  ? 123.533 144.687 177.168 1.00 86.33  ?  111  GLY D CA    1 
ATOM   2954  C  C     . GLY D 4  112  ? 122.467 145.442 177.939 1.00 86.83  ?  111  GLY D C     1 
ATOM   2955  O  O     . GLY D 4  112  ? 122.201 145.144 179.107 1.00 86.75  ?  111  GLY D O     1 
ATOM   2956  N  N     . THR D 4  113  ? 121.841 146.431 177.296 1.00 87.51  ?  112  THR D N     1 
ATOM   2957  C  CA    . THR D 4  113  ? 120.755 147.161 177.943 1.00 88.62  ?  112  THR D CA    1 
ATOM   2958  C  C     . THR D 4  113  ? 119.555 146.262 178.208 1.00 89.44  ?  112  THR D C     1 
ATOM   2959  O  O     . THR D 4  113  ? 118.775 146.528 179.129 1.00 89.25  ?  112  THR D O     1 
ATOM   2960  C  CB    . THR D 4  113  ? 120.337 148.361 177.092 1.00 88.59  ?  112  THR D CB    1 
ATOM   2961  O  OG1   . THR D 4  113  ? 120.123 147.941 175.739 1.00 88.66  ?  112  THR D OG1   1 
ATOM   2962  C  CG2   . THR D 4  113  ? 121.409 149.442 177.127 1.00 88.08  ?  112  THR D CG2   1 
ATOM   2963  N  N     . LYS D 4  114  ? 119.385 145.202 177.414 1.00 90.49  ?  113  LYS D N     1 
ATOM   2964  C  CA    . LYS D 4  114  ? 118.330 144.235 177.700 1.00 91.42  ?  113  LYS D CA    1 
ATOM   2965  C  C     . LYS D 4  114  ? 118.657 143.423 178.947 1.00 92.04  ?  113  LYS D C     1 
ATOM   2966  O  O     . LYS D 4  114  ? 117.768 143.129 179.756 1.00 92.31  ?  113  LYS D O     1 
ATOM   2967  C  CB    . LYS D 4  114  ? 118.119 143.316 176.497 1.00 91.44  ?  113  LYS D CB    1 
ATOM   2968  C  CG    . LYS D 4  114  ? 117.018 142.286 176.692 1.00 91.69  ?  113  LYS D CG    1 
ATOM   2969  C  CD    . LYS D 4  114  ? 116.853 141.413 175.460 1.00 91.58  ?  113  LYS D CD    1 
ATOM   2970  C  CE    . LYS D 4  114  ? 115.744 140.392 175.653 1.00 91.95  ?  113  LYS D CE    1 
ATOM   2971  N  NZ    . LYS D 4  114  ? 115.561 139.536 174.449 1.00 92.53  ?  113  LYS D NZ    1 
ATOM   2972  N  N     . ALA D 4  115  ? 119.930 143.058 179.124 1.00 92.96  ?  114  ALA D N     1 
ATOM   2973  C  CA    . ALA D 4  115  ? 120.325 142.310 180.313 1.00 93.67  ?  114  ALA D CA    1 
ATOM   2974  C  C     . ALA D 4  115  ? 120.249 143.176 181.565 1.00 94.08  ?  114  ALA D C     1 
ATOM   2975  O  O     . ALA D 4  115  ? 119.805 142.711 182.621 1.00 93.88  ?  114  ALA D O     1 
ATOM   2976  C  CB    . ALA D 4  115  ? 121.734 141.744 180.131 1.00 93.62  ?  114  ALA D CB    1 
ATOM   2977  N  N     . VAL D 4  116  ? 120.678 144.437 181.468 1.00 94.82  ?  115  VAL D N     1 
ATOM   2978  C  CA    . VAL D 4  116  ? 120.562 145.347 182.604 1.00 95.71  ?  115  VAL D CA    1 
ATOM   2979  C  C     . VAL D 4  116  ? 119.096 145.640 182.903 1.00 96.39  ?  115  VAL D C     1 
ATOM   2980  O  O     . VAL D 4  116  ? 118.705 145.800 184.065 1.00 96.77  ?  115  VAL D O     1 
ATOM   2981  C  CB    . VAL D 4  116  ? 121.361 146.637 182.339 1.00 95.82  ?  115  VAL D CB    1 
ATOM   2982  C  CG1   . VAL D 4  116  ? 121.236 147.599 183.512 1.00 95.30  ?  115  VAL D CG1   1 
ATOM   2983  C  CG2   . VAL D 4  116  ? 122.823 146.313 182.069 1.00 95.84  ?  115  VAL D CG2   1 
ATOM   2984  N  N     . THR D 4  117  ? 118.261 145.706 181.863 1.00 96.94  ?  116  THR D N     1 
ATOM   2985  C  CA    . THR D 4  117  ? 116.834 145.933 182.073 1.00 97.31  ?  116  THR D CA    1 
ATOM   2986  C  C     . THR D 4  117  ? 116.183 144.744 182.771 1.00 97.67  ?  116  THR D C     1 
ATOM   2987  O  O     . THR D 4  117  ? 115.362 144.922 183.678 1.00 97.63  ?  116  THR D O     1 
ATOM   2988  C  CB    . THR D 4  117  ? 116.145 146.215 180.737 1.00 97.09  ?  116  THR D CB    1 
ATOM   2989  O  OG1   . THR D 4  117  ? 116.767 147.341 180.105 1.00 97.26  ?  116  THR D OG1   1 
ATOM   2990  C  CG2   . THR D 4  117  ? 114.667 146.512 180.949 1.00 97.49  ?  116  THR D CG2   1 
ATOM   2991  N  N     . LYS D 4  118  ? 116.543 143.522 182.367 1.00 98.30  ?  117  LYS D N     1 
ATOM   2992  C  CA    . LYS D 4  118  ? 116.005 142.339 183.030 1.00 99.14  ?  117  LYS D CA    1 
ATOM   2993  C  C     . LYS D 4  118  ? 116.520 142.226 184.460 1.00 99.83  ?  117  LYS D C     1 
ATOM   2994  O  O     . LYS D 4  118  ? 115.793 141.779 185.355 1.00 99.97  ?  117  LYS D O     1 
ATOM   2995  C  CB    . LYS D 4  118  ? 116.357 141.083 182.231 1.00 98.99  ?  117  LYS D CB    1 
ATOM   2996  C  CG    . LYS D 4  118  ? 115.808 139.789 182.817 1.00 99.47  ?  117  LYS D CG    1 
ATOM   2997  C  CD    . LYS D 4  118  ? 116.182 138.594 181.953 1.00 99.79  ?  117  LYS D CD    1 
ATOM   2998  C  CE    . LYS D 4  118  ? 115.625 137.302 182.527 1.00 100.48 ?  117  LYS D CE    1 
ATOM   2999  N  NZ    . LYS D 4  118  ? 114.140 137.331 182.636 1.00 101.18 ?  117  LYS D NZ    1 
ATOM   3000  N  N     . TYR D 4  119  ? 117.774 142.623 184.693 1.00 100.89 ?  118  TYR D N     1 
ATOM   3001  C  CA    . TYR D 4  119  ? 118.326 142.583 186.044 1.00 101.60 ?  118  TYR D CA    1 
ATOM   3002  C  C     . TYR D 4  119  ? 117.688 143.633 186.945 1.00 102.34 ?  118  TYR D C     1 
ATOM   3003  O  O     . TYR D 4  119  ? 117.532 143.402 188.149 1.00 102.68 ?  118  TYR D O     1 
ATOM   3004  C  CB    . TYR D 4  119  ? 119.843 142.771 185.996 1.00 101.26 ?  118  TYR D CB    1 
ATOM   3005  C  CG    . TYR D 4  119  ? 120.506 142.824 187.356 1.00 100.82 ?  118  TYR D CG    1 
ATOM   3006  C  CD1   . TYR D 4  119  ? 120.782 141.660 188.061 1.00 100.04 ?  118  TYR D CD1   1 
ATOM   3007  C  CD2   . TYR D 4  119  ? 120.862 144.038 187.930 1.00 99.94  ?  118  TYR D CD2   1 
ATOM   3008  C  CE1   . TYR D 4  119  ? 121.389 141.703 189.302 1.00 99.62  ?  118  TYR D CE1   1 
ATOM   3009  C  CE2   . TYR D 4  119  ? 121.469 144.091 189.170 1.00 99.33  ?  118  TYR D CE2   1 
ATOM   3010  C  CZ    . TYR D 4  119  ? 121.730 142.920 189.851 1.00 99.81  ?  118  TYR D CZ    1 
ATOM   3011  O  OH    . TYR D 4  119  ? 122.335 142.966 191.086 1.00 100.37 ?  118  TYR D OH    1 
ATOM   3012  N  N     . THR D 4  120  ? 117.314 144.785 186.387 1.00 103.05 ?  119  THR D N     1 
ATOM   3013  C  CA    . THR D 4  120  ? 116.699 145.834 187.194 1.00 104.11 ?  119  THR D CA    1 
ATOM   3014  C  C     . THR D 4  120  ? 115.222 145.552 187.445 1.00 104.86 ?  119  THR D C     1 
ATOM   3015  O  O     . THR D 4  120  ? 114.712 145.825 188.538 1.00 104.92 ?  119  THR D O     1 
ATOM   3016  C  CB    . THR D 4  120  ? 116.873 147.192 186.513 1.00 104.04 ?  119  THR D CB    1 
ATOM   3017  O  OG1   . THR D 4  120  ? 118.262 147.418 186.243 1.00 104.43 ?  119  THR D OG1   1 
ATOM   3018  C  CG2   . THR D 4  120  ? 116.355 148.308 187.408 1.00 104.17 ?  119  THR D CG2   1 
ATOM   3019  N  N     . SER D 4  121  ? 114.523 145.001 186.449 1.00 105.66 ?  120  SER D N     1 
ATOM   3020  C  CA    . SER D 4  121  ? 113.104 144.703 186.615 1.00 106.52 ?  120  SER D CA    1 
ATOM   3021  C  C     . SER D 4  121  ? 112.875 143.593 187.633 1.00 107.16 ?  120  SER D C     1 
ATOM   3022  O  O     . SER D 4  121  ? 111.821 143.554 188.278 1.00 107.29 ?  120  SER D O     1 
ATOM   3023  C  CB    . SER D 4  121  ? 112.487 144.323 185.269 1.00 106.54 ?  120  SER D CB    1 
ATOM   3024  O  OG    . SER D 4  121  ? 113.117 143.176 184.723 1.00 106.73 ?  120  SER D OG    1 
ATOM   3025  N  N     . ALA D 4  122  ? 113.837 142.691 187.790 1.00 107.90 ?  121  ALA D N     1 
ATOM   3026  C  CA    . ALA D 4  122  ? 113.742 141.602 188.745 1.00 108.43 ?  121  ALA D CA    1 
ATOM   3027  C  C     . ALA D 4  122  ? 114.428 142.002 190.051 1.00 108.85 ?  121  ALA D C     1 
ATOM   3028  O  O     . ALA D 4  122  ? 114.771 143.168 190.270 1.00 108.78 ?  121  ALA D O     1 
ATOM   3029  C  CB    . ALA D 4  122  ? 114.342 140.328 188.149 1.00 108.21 ?  121  ALA D CB    1 
ATOM   3030  N  N     . LYS D 4  123  ? 114.632 141.027 190.930 1.00 109.37 ?  122  LYS D N     1 
ATOM   3031  C  CA    . LYS D 4  123  ? 115.280 141.277 192.212 1.00 109.82 ?  122  LYS D CA    1 
ATOM   3032  C  C     . LYS D 4  123  ? 116.787 141.436 192.035 1.00 109.99 ?  122  LYS D C     1 
ATOM   3033  O  O     . LYS D 4  123  ? 117.438 142.189 192.760 1.00 110.17 ?  122  LYS D O     1 
ATOM   3034  C  CB    . LYS D 4  123  ? 114.977 140.143 193.195 1.00 109.82 ?  122  LYS D CB    1 
ATOM   3035  C  CG    . LYS D 4  123  ? 115.529 140.366 194.594 1.00 109.97 ?  122  LYS D CG    1 
ATOM   3036  C  CD    . LYS D 4  123  ? 115.210 139.194 195.508 1.00 110.22 ?  122  LYS D CD    1 
ATOM   3037  C  CE    . LYS D 4  123  ? 115.781 139.408 196.900 1.00 109.99 ?  122  LYS D CE    1 
ATOM   3038  N  NZ    . LYS D 4  123  ? 115.484 138.263 197.804 1.00 109.64 ?  122  LYS D NZ    1 
ATOM   3039  O  OXT   . LYS D 4  123  ? 117.389 140.819 191.157 1.00 110.07 ?  122  LYS D OXT   1 
ATOM   3040  N  N     . HIS E 1  40   ? 160.512 113.147 134.240 1.00 119.50 ?  39   HIS E N     1 
ATOM   3041  C  CA    . HIS E 1  40   ? 160.452 114.349 133.417 1.00 119.61 ?  39   HIS E CA    1 
ATOM   3042  C  C     . HIS E 1  40   ? 160.931 115.570 134.194 1.00 119.38 ?  39   HIS E C     1 
ATOM   3043  O  O     . HIS E 1  40   ? 161.416 115.450 135.319 1.00 119.38 ?  39   HIS E O     1 
ATOM   3044  C  CB    . HIS E 1  40   ? 159.028 114.575 132.902 1.00 119.78 ?  39   HIS E CB    1 
ATOM   3045  C  CG    . HIS E 1  40   ? 158.003 114.693 133.987 1.00 120.27 ?  39   HIS E CG    1 
ATOM   3046  N  ND1   . HIS E 1  40   ? 157.862 115.826 134.760 1.00 120.44 ?  39   HIS E ND1   1 
ATOM   3047  C  CD2   . HIS E 1  40   ? 157.068 113.819 134.429 1.00 120.40 ?  39   HIS E CD2   1 
ATOM   3048  C  CE1   . HIS E 1  40   ? 156.885 115.645 135.630 1.00 120.66 ?  39   HIS E CE1   1 
ATOM   3049  N  NE2   . HIS E 1  40   ? 156.387 114.435 135.450 1.00 120.68 ?  39   HIS E NE2   1 
ATOM   3050  N  N     . ARG E 1  41   ? 160.793 116.746 133.586 1.00 119.05 ?  40   ARG E N     1 
ATOM   3051  C  CA    . ARG E 1  41   ? 161.191 118.010 134.198 1.00 118.59 ?  40   ARG E CA    1 
ATOM   3052  C  C     . ARG E 1  41   ? 159.950 118.877 134.362 1.00 118.11 ?  40   ARG E C     1 
ATOM   3053  O  O     . ARG E 1  41   ? 159.345 119.298 133.370 1.00 118.08 ?  40   ARG E O     1 
ATOM   3054  C  CB    . ARG E 1  41   ? 162.250 118.720 133.356 1.00 118.67 ?  40   ARG E CB    1 
ATOM   3055  C  CG    . ARG E 1  41   ? 162.673 120.069 133.912 1.00 118.79 ?  40   ARG E CG    1 
ATOM   3056  C  CD    . ARG E 1  41   ? 163.195 119.937 135.333 1.00 119.21 ?  40   ARG E CD    1 
ATOM   3057  N  NE    . ARG E 1  41   ? 163.573 121.229 135.897 1.00 119.54 ?  40   ARG E NE    1 
ATOM   3058  C  CZ    . ARG E 1  41   ? 164.778 121.774 135.769 1.00 119.64 ?  40   ARG E CZ    1 
ATOM   3059  N  NH1   . ARG E 1  41   ? 165.725 121.139 135.093 1.00 119.53 ?  40   ARG E NH1   1 
ATOM   3060  N  NH2   . ARG E 1  41   ? 165.035 122.955 136.315 1.00 120.18 ?  40   ARG E NH2   1 
ATOM   3061  N  N     . TYR E 1  42   ? 159.576 119.145 135.609 1.00 117.48 ?  41   TYR E N     1 
ATOM   3062  C  CA    . TYR E 1  42   ? 158.404 119.956 135.893 1.00 116.72 ?  41   TYR E CA    1 
ATOM   3063  C  C     . TYR E 1  42   ? 158.720 121.437 135.697 1.00 116.28 ?  41   TYR E C     1 
ATOM   3064  O  O     . TYR E 1  42   ? 159.880 121.859 135.702 1.00 116.13 ?  41   TYR E O     1 
ATOM   3065  C  CB    . TYR E 1  42   ? 157.913 119.700 137.319 1.00 116.62 ?  41   TYR E CB    1 
ATOM   3066  C  CG    . TYR E 1  42   ? 156.457 120.040 137.547 1.00 116.35 ?  41   TYR E CG    1 
ATOM   3067  C  CD1   . TYR E 1  42   ? 155.452 119.150 137.192 1.00 116.27 ?  41   TYR E CD1   1 
ATOM   3068  C  CD2   . TYR E 1  42   ? 156.088 121.245 138.128 1.00 116.04 ?  41   TYR E CD2   1 
ATOM   3069  C  CE1   . TYR E 1  42   ? 154.120 119.454 137.401 1.00 116.06 ?  41   TYR E CE1   1 
ATOM   3070  C  CE2   . TYR E 1  42   ? 154.760 121.558 138.341 1.00 115.89 ?  41   TYR E CE2   1 
ATOM   3071  C  CZ    . TYR E 1  42   ? 153.781 120.660 137.977 1.00 115.96 ?  41   TYR E CZ    1 
ATOM   3072  O  OH    . TYR E 1  42   ? 152.457 120.971 138.190 1.00 116.24 ?  41   TYR E OH    1 
ATOM   3073  N  N     . ARG E 1  43   ? 157.667 122.226 135.518 1.00 115.82 ?  42   ARG E N     1 
ATOM   3074  C  CA    . ARG E 1  43   ? 157.837 123.660 135.311 1.00 115.43 ?  42   ARG E CA    1 
ATOM   3075  C  C     . ARG E 1  43   ? 158.371 124.313 136.582 1.00 114.98 ?  42   ARG E C     1 
ATOM   3076  O  O     . ARG E 1  43   ? 157.796 124.121 137.660 1.00 115.11 ?  42   ARG E O     1 
ATOM   3077  C  CB    . ARG E 1  43   ? 156.514 124.307 134.904 1.00 115.48 ?  42   ARG E CB    1 
ATOM   3078  C  CG    . ARG E 1  43   ? 155.981 123.884 133.539 1.00 115.58 ?  42   ARG E CG    1 
ATOM   3079  C  CD    . ARG E 1  43   ? 156.734 124.548 132.390 1.00 115.56 ?  42   ARG E CD    1 
ATOM   3080  N  NE    . ARG E 1  43   ? 158.011 123.899 132.106 1.00 115.99 ?  42   ARG E NE    1 
ATOM   3081  C  CZ    . ARG E 1  43   ? 158.841 124.274 131.138 1.00 116.34 ?  42   ARG E CZ    1 
ATOM   3082  N  NH1   . ARG E 1  43   ? 158.529 125.298 130.355 1.00 116.06 ?  42   ARG E NH1   1 
ATOM   3083  N  NH2   . ARG E 1  43   ? 159.982 123.626 130.952 1.00 116.44 ?  42   ARG E NH2   1 
ATOM   3084  N  N     . PRO E 1  44   ? 159.458 125.082 136.502 1.00 114.42 ?  43   PRO E N     1 
ATOM   3085  C  CA    . PRO E 1  44   ? 159.985 125.755 137.700 1.00 113.88 ?  43   PRO E CA    1 
ATOM   3086  C  C     . PRO E 1  44   ? 159.066 126.890 138.129 1.00 113.30 ?  43   PRO E C     1 
ATOM   3087  O  O     . PRO E 1  44   ? 158.791 127.811 137.357 1.00 113.11 ?  43   PRO E O     1 
ATOM   3088  C  CB    . PRO E 1  44   ? 161.353 126.273 137.241 1.00 113.87 ?  43   PRO E CB    1 
ATOM   3089  C  CG    . PRO E 1  44   ? 161.212 126.431 135.761 1.00 114.35 ?  43   PRO E CG    1 
ATOM   3090  C  CD    . PRO E 1  44   ? 160.286 125.335 135.311 1.00 114.46 ?  43   PRO E CD    1 
ATOM   3091  N  N     . GLY E 1  45   ? 158.590 126.818 139.370 1.00 112.65 ?  44   GLY E N     1 
ATOM   3092  C  CA    . GLY E 1  45   ? 157.699 127.833 139.895 1.00 111.88 ?  44   GLY E CA    1 
ATOM   3093  C  C     . GLY E 1  45   ? 156.396 127.268 140.420 1.00 111.37 ?  44   GLY E C     1 
ATOM   3094  O  O     . GLY E 1  45   ? 155.908 127.691 141.472 1.00 111.48 ?  44   GLY E O     1 
ATOM   3095  N  N     . THR E 1  46   ? 155.821 126.306 139.694 1.00 110.83 ?  45   THR E N     1 
ATOM   3096  C  CA    . THR E 1  46   ? 154.565 125.704 140.128 1.00 110.25 ?  45   THR E CA    1 
ATOM   3097  C  C     . THR E 1  46   ? 154.761 124.828 141.360 1.00 109.87 ?  45   THR E C     1 
ATOM   3098  O  O     . THR E 1  46   ? 153.858 124.731 142.201 1.00 109.79 ?  45   THR E O     1 
ATOM   3099  C  CB    . THR E 1  46   ? 153.949 124.894 138.986 1.00 110.23 ?  45   THR E CB    1 
ATOM   3100  O  OG1   . THR E 1  46   ? 153.897 125.700 137.802 1.00 109.95 ?  45   THR E OG1   1 
ATOM   3101  C  CG2   . THR E 1  46   ? 152.538 124.446 139.343 1.00 110.48 ?  45   THR E CG2   1 
ATOM   3102  N  N     . VAL E 1  47   ? 155.926 124.187 141.486 1.00 109.45 ?  46   VAL E N     1 
ATOM   3103  C  CA    . VAL E 1  47   ? 156.225 123.421 142.693 1.00 109.02 ?  46   VAL E CA    1 
ATOM   3104  C  C     . VAL E 1  47   ? 156.218 124.336 143.911 1.00 108.80 ?  46   VAL E C     1 
ATOM   3105  O  O     . VAL E 1  47   ? 155.797 123.938 145.004 1.00 108.71 ?  46   VAL E O     1 
ATOM   3106  C  CB    . VAL E 1  47   ? 157.569 122.684 142.542 1.00 108.97 ?  46   VAL E CB    1 
ATOM   3107  C  CG1   . VAL E 1  47   ? 157.871 121.856 143.782 1.00 108.77 ?  46   VAL E CG1   1 
ATOM   3108  C  CG2   . VAL E 1  47   ? 157.558 121.806 141.301 1.00 108.99 ?  46   VAL E CG2   1 
ATOM   3109  N  N     . ALA E 1  48   ? 156.677 125.578 143.741 1.00 108.41 ?  47   ALA E N     1 
ATOM   3110  C  CA    . ALA E 1  48   ? 156.555 126.555 144.816 1.00 107.84 ?  47   ALA E CA    1 
ATOM   3111  C  C     . ALA E 1  48   ? 155.096 126.853 145.131 1.00 107.41 ?  47   ALA E C     1 
ATOM   3112  O  O     . ALA E 1  48   ? 154.745 127.074 146.295 1.00 107.44 ?  47   ALA E O     1 
ATOM   3113  C  CB    . ALA E 1  48   ? 157.295 127.841 144.448 1.00 107.91 ?  47   ALA E CB    1 
ATOM   3114  N  N     . LEU E 1  49   ? 154.232 126.850 144.112 1.00 106.84 ?  48   LEU E N     1 
ATOM   3115  C  CA    . LEU E 1  49   ? 152.815 127.111 144.342 1.00 106.40 ?  48   LEU E CA    1 
ATOM   3116  C  C     . LEU E 1  49   ? 152.159 125.976 145.120 1.00 106.20 ?  48   LEU E C     1 
ATOM   3117  O  O     . LEU E 1  49   ? 151.391 126.223 146.056 1.00 106.12 ?  48   LEU E O     1 
ATOM   3118  C  CB    . LEU E 1  49   ? 152.097 127.337 143.011 1.00 106.30 ?  48   LEU E CB    1 
ATOM   3119  C  CG    . LEU E 1  49   ? 151.944 128.784 142.530 1.00 106.02 ?  48   LEU E CG    1 
ATOM   3120  C  CD1   . LEU E 1  49   ? 153.297 129.447 142.318 1.00 106.28 ?  48   LEU E CD1   1 
ATOM   3121  C  CD2   . LEU E 1  49   ? 151.110 128.845 141.258 1.00 106.10 ?  48   LEU E CD2   1 
ATOM   3122  N  N     . ARG E 1  50   ? 152.446 124.724 144.750 1.00 105.99 ?  49   ARG E N     1 
ATOM   3123  C  CA    . ARG E 1  50   ? 151.891 123.606 145.506 1.00 105.75 ?  49   ARG E CA    1 
ATOM   3124  C  C     . ARG E 1  50   ? 152.509 123.515 146.896 1.00 105.37 ?  49   ARG E C     1 
ATOM   3125  O  O     . ARG E 1  50   ? 151.866 123.017 147.827 1.00 105.55 ?  49   ARG E O     1 
ATOM   3126  C  CB    . ARG E 1  50   ? 152.075 122.294 144.741 1.00 105.95 ?  49   ARG E CB    1 
ATOM   3127  C  CG    . ARG E 1  50   ? 153.514 121.852 144.564 1.00 106.39 ?  49   ARG E CG    1 
ATOM   3128  C  CD    . ARG E 1  50   ? 153.598 120.574 143.746 1.00 106.78 ?  49   ARG E CD    1 
ATOM   3129  N  NE    . ARG E 1  50   ? 154.978 120.151 143.534 1.00 106.94 ?  49   ARG E NE    1 
ATOM   3130  C  CZ    . ARG E 1  50   ? 155.332 119.078 142.834 1.00 106.85 ?  49   ARG E CZ    1 
ATOM   3131  N  NH1   . ARG E 1  50   ? 154.405 118.313 142.274 1.00 106.79 ?  49   ARG E NH1   1 
ATOM   3132  N  NH2   . ARG E 1  50   ? 156.614 118.770 142.694 1.00 106.21 ?  49   ARG E NH2   1 
ATOM   3133  N  N     . GLU E 1  51   ? 153.747 123.994 147.059 1.00 104.80 ?  50   GLU E N     1 
ATOM   3134  C  CA    . GLU E 1  51   ? 154.310 124.119 148.398 1.00 104.35 ?  50   GLU E CA    1 
ATOM   3135  C  C     . GLU E 1  51   ? 153.588 125.190 149.204 1.00 104.05 ?  50   GLU E C     1 
ATOM   3136  O  O     . GLU E 1  51   ? 153.475 125.071 150.429 1.00 104.14 ?  50   GLU E O     1 
ATOM   3137  C  CB    . GLU E 1  51   ? 155.805 124.429 148.322 1.00 104.48 ?  50   GLU E CB    1 
ATOM   3138  C  CG    . GLU E 1  51   ? 156.671 123.234 147.962 1.00 104.28 ?  50   GLU E CG    1 
ATOM   3139  C  CD    . GLU E 1  51   ? 158.147 123.577 147.913 1.00 104.26 ?  50   GLU E CD    1 
ATOM   3140  O  OE1   . GLU E 1  51   ? 158.494 124.751 148.160 1.00 104.54 ?  50   GLU E OE1   1 
ATOM   3141  O  OE2   . GLU E 1  51   ? 158.960 122.673 147.627 1.00 103.80 ?  50   GLU E OE2   1 
ATOM   3142  N  N     . ILE E 1  52   ? 153.100 126.241 148.541 1.00 103.68 ?  51   ILE E N     1 
ATOM   3143  C  CA    . ILE E 1  52   ? 152.256 127.216 149.223 1.00 103.37 ?  51   ILE E CA    1 
ATOM   3144  C  C     . ILE E 1  52   ? 150.932 126.578 149.624 1.00 103.72 ?  51   ILE E C     1 
ATOM   3145  O  O     . ILE E 1  52   ? 150.433 126.794 150.735 1.00 103.82 ?  51   ILE E O     1 
ATOM   3146  C  CB    . ILE E 1  52   ? 152.044 128.458 148.337 1.00 103.26 ?  51   ILE E CB    1 
ATOM   3147  C  CG1   . ILE E 1  52   ? 153.365 129.199 148.126 1.00 103.08 ?  51   ILE E CG1   1 
ATOM   3148  C  CG2   . ILE E 1  52   ? 151.006 129.387 148.952 1.00 102.71 ?  51   ILE E CG2   1 
ATOM   3149  C  CD1   . ILE E 1  52   ? 153.242 130.433 147.258 1.00 102.82 ?  51   ILE E CD1   1 
ATOM   3150  N  N     . ARG E 1  53   ? 150.348 125.772 148.732 1.00 103.93 ?  52   ARG E N     1 
ATOM   3151  C  CA    . ARG E 1  53   ? 149.100 125.090 149.058 1.00 104.25 ?  52   ARG E CA    1 
ATOM   3152  C  C     . ARG E 1  53   ? 149.284 124.098 150.199 1.00 104.19 ?  52   ARG E C     1 
ATOM   3153  O  O     . ARG E 1  53   ? 148.341 123.845 150.959 1.00 104.11 ?  52   ARG E O     1 
ATOM   3154  C  CB    . ARG E 1  53   ? 148.551 124.374 147.823 1.00 104.18 ?  52   ARG E CB    1 
ATOM   3155  C  CG    . ARG E 1  53   ? 148.300 125.278 146.628 1.00 104.68 ?  52   ARG E CG    1 
ATOM   3156  C  CD    . ARG E 1  53   ? 147.655 124.505 145.487 1.00 104.81 ?  52   ARG E CD    1 
ATOM   3157  N  NE    . ARG E 1  53   ? 147.489 125.323 144.289 1.00 106.20 ?  52   ARG E NE    1 
ATOM   3158  C  CZ    . ARG E 1  53   ? 148.351 125.352 143.278 1.00 106.57 ?  52   ARG E CZ    1 
ATOM   3159  N  NH1   . ARG E 1  53   ? 149.446 124.604 143.316 1.00 106.77 ?  52   ARG E NH1   1 
ATOM   3160  N  NH2   . ARG E 1  53   ? 148.119 126.126 142.227 1.00 106.09 ?  52   ARG E NH2   1 
ATOM   3161  N  N     . ARG E 1  54   ? 150.482 123.527 150.337 1.00 104.38 ?  53   ARG E N     1 
ATOM   3162  C  CA    . ARG E 1  54   ? 150.726 122.570 151.411 1.00 104.58 ?  53   ARG E CA    1 
ATOM   3163  C  C     . ARG E 1  54   ? 151.041 123.271 152.728 1.00 104.63 ?  53   ARG E C     1 
ATOM   3164  O  O     . ARG E 1  54   ? 150.622 122.809 153.795 1.00 104.79 ?  53   ARG E O     1 
ATOM   3165  C  CB    . ARG E 1  54   ? 151.866 121.626 151.025 1.00 104.65 ?  53   ARG E CB    1 
ATOM   3166  C  CG    . ARG E 1  54   ? 152.109 120.506 152.025 1.00 105.12 ?  53   ARG E CG    1 
ATOM   3167  C  CD    . ARG E 1  54   ? 153.279 119.621 151.616 1.00 106.14 ?  53   ARG E CD    1 
ATOM   3168  N  NE    . ARG E 1  54   ? 154.560 120.318 151.696 1.00 106.83 ?  53   ARG E NE    1 
ATOM   3169  C  CZ    . ARG E 1  54   ? 155.195 120.842 150.653 1.00 107.16 ?  53   ARG E CZ    1 
ATOM   3170  N  NH1   . ARG E 1  54   ? 154.671 120.749 149.438 1.00 107.36 ?  53   ARG E NH1   1 
ATOM   3171  N  NH2   . ARG E 1  54   ? 156.357 121.458 150.823 1.00 106.81 ?  53   ARG E NH2   1 
ATOM   3172  N  N     . TYR E 1  55   ? 151.772 124.387 152.674 1.00 104.39 ?  54   TYR E N     1 
ATOM   3173  C  CA    . TYR E 1  55   ? 152.150 125.088 153.896 1.00 104.10 ?  54   TYR E CA    1 
ATOM   3174  C  C     . TYR E 1  55   ? 151.020 125.953 154.440 1.00 103.86 ?  54   TYR E C     1 
ATOM   3175  O  O     . TYR E 1  55   ? 150.990 126.234 155.644 1.00 103.84 ?  54   TYR E O     1 
ATOM   3176  C  CB    . TYR E 1  55   ? 153.394 125.944 153.649 1.00 104.16 ?  54   TYR E CB    1 
ATOM   3177  C  CG    . TYR E 1  55   ? 154.662 125.141 153.462 1.00 104.59 ?  54   TYR E CG    1 
ATOM   3178  C  CD1   . TYR E 1  55   ? 154.757 123.837 153.931 1.00 105.17 ?  54   TYR E CD1   1 
ATOM   3179  C  CD2   . TYR E 1  55   ? 155.765 125.687 152.818 1.00 105.08 ?  54   TYR E CD2   1 
ATOM   3180  C  CE1   . TYR E 1  55   ? 155.914 123.099 153.763 1.00 105.26 ?  54   TYR E CE1   1 
ATOM   3181  C  CE2   . TYR E 1  55   ? 156.926 124.957 152.646 1.00 104.96 ?  54   TYR E CE2   1 
ATOM   3182  C  CZ    . TYR E 1  55   ? 156.995 123.664 153.120 1.00 104.93 ?  54   TYR E CZ    1 
ATOM   3183  O  OH    . TYR E 1  55   ? 158.149 122.933 152.951 1.00 104.80 ?  54   TYR E OH    1 
ATOM   3184  N  N     . GLN E 1  56   ? 150.090 126.384 153.584 1.00 103.67 ?  55   GLN E N     1 
ATOM   3185  C  CA    . GLN E 1  56   ? 148.961 127.176 154.057 1.00 103.59 ?  55   GLN E CA    1 
ATOM   3186  C  C     . GLN E 1  56   ? 147.990 126.357 154.897 1.00 103.64 ?  55   GLN E C     1 
ATOM   3187  O  O     . GLN E 1  56   ? 147.197 126.937 155.645 1.00 103.76 ?  55   GLN E O     1 
ATOM   3188  C  CB    . GLN E 1  56   ? 148.222 127.807 152.876 1.00 103.43 ?  55   GLN E CB    1 
ATOM   3189  C  CG    . GLN E 1  56   ? 148.885 129.060 152.326 1.00 102.88 ?  55   GLN E CG    1 
ATOM   3190  C  CD    . GLN E 1  56   ? 148.183 129.596 151.095 1.00 103.05 ?  55   GLN E CD    1 
ATOM   3191  O  OE1   . GLN E 1  56   ? 147.386 128.898 150.468 1.00 103.74 ?  55   GLN E OE1   1 
ATOM   3192  N  NE2   . GLN E 1  56   ? 148.476 130.842 150.742 1.00 103.06 ?  55   GLN E NE2   1 
ATOM   3193  N  N     . LYS E 1  57   ? 148.031 125.030 154.791 1.00 103.47 ?  56   LYS E N     1 
ATOM   3194  C  CA    . LYS E 1  57   ? 147.175 124.163 155.588 1.00 103.65 ?  56   LYS E CA    1 
ATOM   3195  C  C     . LYS E 1  57   ? 147.854 123.657 156.854 1.00 103.43 ?  56   LYS E C     1 
ATOM   3196  O  O     . LYS E 1  57   ? 147.178 123.077 157.710 1.00 103.28 ?  56   LYS E O     1 
ATOM   3197  C  CB    . LYS E 1  57   ? 146.704 122.969 154.751 1.00 103.83 ?  56   LYS E CB    1 
ATOM   3198  C  CG    . LYS E 1  57   ? 145.888 123.353 153.528 1.00 104.68 ?  56   LYS E CG    1 
ATOM   3199  C  CD    . LYS E 1  57   ? 144.633 124.114 153.919 1.00 105.95 ?  56   LYS E CD    1 
ATOM   3200  C  CE    . LYS E 1  57   ? 143.815 124.498 152.697 1.00 106.22 ?  56   LYS E CE    1 
ATOM   3201  N  NZ    . LYS E 1  57   ? 142.581 125.244 153.068 1.00 105.54 ?  56   LYS E NZ    1 
ATOM   3202  N  N     . SER E 1  58   ? 149.161 123.857 156.992 1.00 103.26 ?  57   SER E N     1 
ATOM   3203  C  CA    . SER E 1  58   ? 149.876 123.410 158.177 1.00 103.09 ?  57   SER E CA    1 
ATOM   3204  C  C     . SER E 1  58   ? 149.683 124.395 159.324 1.00 103.00 ?  57   SER E C     1 
ATOM   3205  O  O     . SER E 1  58   ? 149.587 125.609 159.122 1.00 103.01 ?  57   SER E O     1 
ATOM   3206  C  CB    . SER E 1  58   ? 151.366 123.245 157.875 1.00 103.14 ?  57   SER E CB    1 
ATOM   3207  O  OG    . SER E 1  58   ? 151.940 124.469 157.451 1.00 103.38 ?  57   SER E OG    1 
ATOM   3208  N  N     . THR E 1  59   ? 149.625 123.855 160.542 1.00 102.88 ?  58   THR E N     1 
ATOM   3209  C  CA    . THR E 1  59   ? 149.420 124.650 161.747 1.00 102.78 ?  58   THR E CA    1 
ATOM   3210  C  C     . THR E 1  59   ? 150.570 124.478 162.734 1.00 102.72 ?  58   THR E C     1 
ATOM   3211  O  O     . THR E 1  59   ? 150.383 124.607 163.945 1.00 102.72 ?  58   THR E O     1 
ATOM   3212  C  CB    . THR E 1  59   ? 148.092 124.293 162.413 1.00 102.78 ?  58   THR E CB    1 
ATOM   3213  O  OG1   . THR E 1  59   ? 148.101 122.910 162.792 1.00 103.20 ?  58   THR E OG1   1 
ATOM   3214  C  CG2   . THR E 1  59   ? 146.934 124.543 161.460 1.00 102.26 ?  58   THR E CG2   1 
ATOM   3215  N  N     . GLU E 1  60   ? 151.764 124.186 162.229 1.00 102.92 ?  59   GLU E N     1 
ATOM   3216  C  CA    . GLU E 1  60   ? 152.944 123.992 163.057 1.00 103.08 ?  59   GLU E CA    1 
ATOM   3217  C  C     . GLU E 1  60   ? 154.023 124.993 162.664 1.00 103.03 ?  59   GLU E C     1 
ATOM   3218  O  O     . GLU E 1  60   ? 153.878 125.761 161.709 1.00 103.14 ?  59   GLU E O     1 
ATOM   3219  C  CB    . GLU E 1  60   ? 153.474 122.557 162.934 1.00 103.00 ?  59   GLU E CB    1 
ATOM   3220  C  CG    . GLU E 1  60   ? 153.847 122.150 161.518 1.00 103.60 ?  59   GLU E CG    1 
ATOM   3221  C  CD    . GLU E 1  60   ? 154.357 120.724 161.437 1.00 103.83 ?  59   GLU E CD    1 
ATOM   3222  O  OE1   . GLU E 1  60   ? 154.432 120.056 162.490 1.00 104.00 ?  59   GLU E OE1   1 
ATOM   3223  O  OE2   . GLU E 1  60   ? 154.683 120.271 160.319 1.00 103.62 ?  59   GLU E OE2   1 
ATOM   3224  N  N     . LEU E 1  61   ? 155.118 124.976 163.419 1.00 102.92 ?  60   LEU E N     1 
ATOM   3225  C  CA    . LEU E 1  61   ? 156.228 125.882 163.174 1.00 102.79 ?  60   LEU E CA    1 
ATOM   3226  C  C     . LEU E 1  61   ? 157.065 125.392 161.993 1.00 102.79 ?  60   LEU E C     1 
ATOM   3227  O  O     . LEU E 1  61   ? 156.811 124.335 161.408 1.00 102.73 ?  60   LEU E O     1 
ATOM   3228  C  CB    . LEU E 1  61   ? 157.075 126.034 164.437 1.00 102.82 ?  60   LEU E CB    1 
ATOM   3229  C  CG    . LEU E 1  61   ? 157.357 124.792 165.290 1.00 102.86 ?  60   LEU E CG    1 
ATOM   3230  C  CD1   . LEU E 1  61   ? 158.385 123.868 164.647 1.00 102.57 ?  60   LEU E CD1   1 
ATOM   3231  C  CD2   . LEU E 1  61   ? 157.805 125.204 166.683 1.00 102.93 ?  60   LEU E CD2   1 
ATOM   3232  N  N     . LEU E 1  62   ? 158.080 126.173 161.641 1.00 102.89 ?  61   LEU E N     1 
ATOM   3233  C  CA    . LEU E 1  62   ? 158.984 125.846 160.546 1.00 103.12 ?  61   LEU E CA    1 
ATOM   3234  C  C     . LEU E 1  62   ? 160.444 125.807 160.966 1.00 103.42 ?  61   LEU E C     1 
ATOM   3235  O  O     . LEU E 1  62   ? 161.185 124.928 160.521 1.00 103.60 ?  61   LEU E O     1 
ATOM   3236  C  CB    . LEU E 1  62   ? 158.809 126.852 159.398 1.00 102.94 ?  61   LEU E CB    1 
ATOM   3237  C  CG    . LEU E 1  62   ? 157.409 126.940 158.785 1.00 102.36 ?  61   LEU E CG    1 
ATOM   3238  C  CD1   . LEU E 1  62   ? 157.363 127.988 157.684 1.00 102.30 ?  61   LEU E CD1   1 
ATOM   3239  C  CD2   . LEU E 1  62   ? 156.966 125.583 158.257 1.00 101.85 ?  61   LEU E CD2   1 
ATOM   3240  N  N     . ILE E 1  63   ? 160.877 126.736 161.812 1.00 103.76 ?  62   ILE E N     1 
ATOM   3241  C  CA    . ILE E 1  63   ? 162.252 126.751 162.297 1.00 104.17 ?  62   ILE E CA    1 
ATOM   3242  C  C     . ILE E 1  63   ? 162.370 125.814 163.490 1.00 104.69 ?  62   ILE E C     1 
ATOM   3243  O  O     . ILE E 1  63   ? 161.475 125.750 164.342 1.00 104.73 ?  62   ILE E O     1 
ATOM   3244  C  CB    . ILE E 1  63   ? 162.680 128.184 162.661 1.00 104.10 ?  62   ILE E CB    1 
ATOM   3245  C  CG1   . ILE E 1  63   ? 162.409 129.133 161.492 1.00 103.90 ?  62   ILE E CG1   1 
ATOM   3246  C  CG2   . ILE E 1  63   ? 164.152 128.226 163.048 1.00 103.73 ?  62   ILE E CG2   1 
ATOM   3247  C  CD1   . ILE E 1  63   ? 162.804 130.568 161.763 1.00 103.73 ?  62   ILE E CD1   1 
ATOM   3248  N  N     . ARG E 1  64   ? 163.478 125.079 163.554 1.00 105.25 ?  63   ARG E N     1 
ATOM   3249  C  CA    . ARG E 1  64   ? 163.694 124.127 164.631 1.00 105.76 ?  63   ARG E CA    1 
ATOM   3250  C  C     . ARG E 1  64   ? 163.849 124.852 165.968 1.00 105.61 ?  63   ARG E C     1 
ATOM   3251  O  O     . ARG E 1  64   ? 164.019 126.073 166.035 1.00 105.64 ?  63   ARG E O     1 
ATOM   3252  C  CB    . ARG E 1  64   ? 164.920 123.263 164.342 1.00 106.11 ?  63   ARG E CB    1 
ATOM   3253  C  CG    . ARG E 1  64   ? 164.793 122.421 163.084 1.00 107.52 ?  63   ARG E CG    1 
ATOM   3254  C  CD    . ARG E 1  64   ? 163.586 121.500 163.165 1.00 110.70 ?  63   ARG E CD    1 
ATOM   3255  N  NE    . ARG E 1  64   ? 163.362 120.777 161.916 1.00 113.92 ?  63   ARG E NE    1 
ATOM   3256  C  CZ    . ARG E 1  64   ? 162.571 121.205 160.938 1.00 116.07 ?  63   ARG E CZ    1 
ATOM   3257  N  NH1   . ARG E 1  64   ? 161.923 122.356 161.061 1.00 116.91 ?  63   ARG E NH1   1 
ATOM   3258  N  NH2   . ARG E 1  64   ? 162.426 120.483 159.836 1.00 117.08 ?  63   ARG E NH2   1 
ATOM   3259  N  N     . LYS E 1  65   ? 163.789 124.073 167.049 1.00 105.40 ?  64   LYS E N     1 
ATOM   3260  C  CA    . LYS E 1  65   ? 163.809 124.625 168.397 1.00 105.27 ?  64   LYS E CA    1 
ATOM   3261  C  C     . LYS E 1  65   ? 165.190 124.625 169.039 1.00 104.94 ?  64   LYS E C     1 
ATOM   3262  O  O     . LYS E 1  65   ? 165.420 125.409 169.966 1.00 105.29 ?  64   LYS E O     1 
ATOM   3263  C  CB    . LYS E 1  65   ? 162.841 123.850 169.301 1.00 105.23 ?  64   LYS E CB    1 
ATOM   3264  C  CG    . LYS E 1  65   ? 161.387 123.922 168.861 1.00 105.76 ?  64   LYS E CG    1 
ATOM   3265  C  CD    . LYS E 1  65   ? 160.467 123.129 169.785 1.00 105.77 ?  64   LYS E CD    1 
ATOM   3266  C  CE    . LYS E 1  65   ? 160.190 123.862 171.094 1.00 106.52 ?  64   LYS E CE    1 
ATOM   3267  N  NZ    . LYS E 1  65   ? 161.305 123.763 172.079 1.00 106.50 ?  64   LYS E NZ    1 
ATOM   3268  N  N     . LEU E 1  66   ? 166.107 123.775 168.581 1.00 104.54 ?  65   LEU E N     1 
ATOM   3269  C  CA    . LEU E 1  66   ? 167.430 123.711 169.192 1.00 104.13 ?  65   LEU E CA    1 
ATOM   3270  C  C     . LEU E 1  66   ? 168.377 124.752 168.598 1.00 103.74 ?  65   LEU E C     1 
ATOM   3271  O  O     . LEU E 1  66   ? 169.105 125.405 169.356 1.00 103.98 ?  65   LEU E O     1 
ATOM   3272  C  CB    . LEU E 1  66   ? 168.020 122.303 169.066 1.00 104.27 ?  65   LEU E CB    1 
ATOM   3273  C  CG    . LEU E 1  66   ? 169.327 122.065 169.826 1.00 104.46 ?  65   LEU E CG    1 
ATOM   3274  C  CD1   . LEU E 1  66   ? 169.193 122.515 171.272 1.00 104.38 ?  65   LEU E CD1   1 
ATOM   3275  C  CD2   . LEU E 1  66   ? 169.731 120.602 169.760 1.00 105.07 ?  65   LEU E CD2   1 
ATOM   3276  N  N     . PRO E 1  67   ? 168.426 124.943 167.270 1.00 103.29 ?  66   PRO E N     1 
ATOM   3277  C  CA    . PRO E 1  67   ? 169.215 126.077 166.754 1.00 103.14 ?  66   PRO E CA    1 
ATOM   3278  C  C     . PRO E 1  67   ? 168.685 127.422 167.217 1.00 103.03 ?  66   PRO E C     1 
ATOM   3279  O  O     . PRO E 1  67   ? 169.472 128.304 167.585 1.00 102.95 ?  66   PRO E O     1 
ATOM   3280  C  CB    . PRO E 1  67   ? 169.110 125.912 165.231 1.00 103.05 ?  66   PRO E CB    1 
ATOM   3281  C  CG    . PRO E 1  67   ? 168.840 124.469 165.028 1.00 103.27 ?  66   PRO E CG    1 
ATOM   3282  C  CD    . PRO E 1  67   ? 167.957 124.077 166.172 1.00 103.30 ?  66   PRO E CD    1 
ATOM   3283  N  N     . PHE E 1  68   ? 167.362 127.601 167.209 1.00 102.78 ?  67   PHE E N     1 
ATOM   3284  C  CA    . PHE E 1  68   ? 166.773 128.834 167.720 1.00 102.62 ?  67   PHE E CA    1 
ATOM   3285  C  C     . PHE E 1  68   ? 166.986 128.972 169.222 1.00 102.42 ?  67   PHE E C     1 
ATOM   3286  O  O     . PHE E 1  68   ? 167.167 130.089 169.723 1.00 102.48 ?  67   PHE E O     1 
ATOM   3287  C  CB    . PHE E 1  68   ? 165.283 128.872 167.379 1.00 102.67 ?  67   PHE E CB    1 
ATOM   3288  C  CG    . PHE E 1  68   ? 164.614 130.180 167.696 1.00 102.95 ?  67   PHE E CG    1 
ATOM   3289  C  CD1   . PHE E 1  68   ? 164.747 131.265 166.845 1.00 103.18 ?  67   PHE E CD1   1 
ATOM   3290  C  CD2   . PHE E 1  68   ? 163.838 130.318 168.834 1.00 103.19 ?  67   PHE E CD2   1 
ATOM   3291  C  CE1   . PHE E 1  68   ? 164.127 132.467 167.130 1.00 102.77 ?  67   PHE E CE1   1 
ATOM   3292  C  CE2   . PHE E 1  68   ? 163.214 131.518 169.124 1.00 102.99 ?  67   PHE E CE2   1 
ATOM   3293  C  CZ    . PHE E 1  68   ? 163.359 132.594 168.270 1.00 102.76 ?  67   PHE E CZ    1 
ATOM   3294  N  N     . GLN E 1  69   ? 166.977 127.853 169.951 1.00 102.01 ?  68   GLN E N     1 
ATOM   3295  C  CA    . GLN E 1  69   ? 167.210 127.900 171.391 1.00 101.80 ?  68   GLN E CA    1 
ATOM   3296  C  C     . GLN E 1  69   ? 168.653 128.275 171.705 1.00 101.50 ?  68   GLN E C     1 
ATOM   3297  O  O     . GLN E 1  69   ? 168.916 128.986 172.682 1.00 101.39 ?  68   GLN E O     1 
ATOM   3298  C  CB    . GLN E 1  69   ? 166.853 126.553 172.020 1.00 101.88 ?  68   GLN E CB    1 
ATOM   3299  C  CG    . GLN E 1  69   ? 167.059 126.490 173.525 1.00 102.09 ?  68   GLN E CG    1 
ATOM   3300  C  CD    . GLN E 1  69   ? 166.740 125.123 174.097 1.00 102.36 ?  68   GLN E CD    1 
ATOM   3301  O  OE1   . GLN E 1  69   ? 166.345 124.210 173.372 1.00 102.88 ?  68   GLN E OE1   1 
ATOM   3302  N  NE2   . GLN E 1  69   ? 166.912 124.974 175.406 1.00 102.57 ?  68   GLN E NE2   1 
ATOM   3303  N  N     . ARG E 1  70   ? 169.601 127.804 170.892 1.00 101.05 ?  69   ARG E N     1 
ATOM   3304  C  CA    . ARG E 1  70   ? 170.998 128.171 171.101 1.00 100.77 ?  69   ARG E CA    1 
ATOM   3305  C  C     . ARG E 1  70   ? 171.277 129.596 170.642 1.00 100.30 ?  69   ARG E C     1 
ATOM   3306  O  O     . ARG E 1  70   ? 172.145 130.269 171.210 1.00 100.14 ?  69   ARG E O     1 
ATOM   3307  C  CB    . ARG E 1  70   ? 171.916 127.187 170.375 1.00 100.91 ?  69   ARG E CB    1 
ATOM   3308  C  CG    . ARG E 1  70   ? 171.893 125.778 170.945 1.00 101.64 ?  69   ARG E CG    1 
ATOM   3309  C  CD    . ARG E 1  70   ? 172.819 124.841 170.181 1.00 102.02 ?  69   ARG E CD    1 
ATOM   3310  N  NE    . ARG E 1  70   ? 172.377 124.616 168.806 1.00 101.57 ?  69   ARG E NE    1 
ATOM   3311  C  CZ    . ARG E 1  70   ? 172.903 125.215 167.742 1.00 101.53 ?  69   ARG E CZ    1 
ATOM   3312  N  NH1   . ARG E 1  70   ? 173.898 126.079 167.888 1.00 100.93 ?  69   ARG E NH1   1 
ATOM   3313  N  NH2   . ARG E 1  70   ? 172.435 124.948 166.530 1.00 101.68 ?  69   ARG E NH2   1 
ATOM   3314  N  N     . LEU E 1  71   ? 170.559 130.070 169.623 1.00 99.91  ?  70   LEU E N     1 
ATOM   3315  C  CA    . LEU E 1  71   ? 170.734 131.447 169.173 1.00 99.69  ?  70   LEU E CA    1 
ATOM   3316  C  C     . LEU E 1  71   ? 170.180 132.430 170.198 1.00 99.70  ?  70   LEU E C     1 
ATOM   3317  O  O     . LEU E 1  71   ? 170.877 133.360 170.622 1.00 99.65  ?  70   LEU E O     1 
ATOM   3318  C  CB    . LEU E 1  71   ? 170.065 131.640 167.810 1.00 99.46  ?  70   LEU E CB    1 
ATOM   3319  C  CG    . LEU E 1  71   ? 170.188 133.003 167.122 1.00 98.90  ?  70   LEU E CG    1 
ATOM   3320  C  CD1   . LEU E 1  71   ? 170.358 132.824 165.623 1.00 97.65  ?  70   LEU E CD1   1 
ATOM   3321  C  CD2   . LEU E 1  71   ? 168.973 133.875 167.411 1.00 98.67  ?  70   LEU E CD2   1 
ATOM   3322  N  N     . VAL E 1  72   ? 168.925 132.235 170.611 1.00 99.71  ?  71   VAL E N     1 
ATOM   3323  C  CA    . VAL E 1  72   ? 168.325 133.121 171.603 1.00 99.77  ?  71   VAL E CA    1 
ATOM   3324  C  C     . VAL E 1  72   ? 169.022 132.977 172.950 1.00 99.78  ?  71   VAL E C     1 
ATOM   3325  O  O     . VAL E 1  72   ? 169.197 133.964 173.676 1.00 99.65  ?  71   VAL E O     1 
ATOM   3326  C  CB    . VAL E 1  72   ? 166.814 132.847 171.712 1.00 99.82  ?  71   VAL E CB    1 
ATOM   3327  C  CG1   . VAL E 1  72   ? 166.190 133.689 172.814 1.00 99.88  ?  71   VAL E CG1   1 
ATOM   3328  C  CG2   . VAL E 1  72   ? 166.136 133.126 170.383 1.00 99.39  ?  71   VAL E CG2   1 
ATOM   3329  N  N     . ARG E 1  73   ? 169.440 131.761 173.306 1.00 100.34 ?  72   ARG E N     1 
ATOM   3330  C  CA    . ARG E 1  73   ? 170.139 131.564 174.571 1.00 100.56 ?  72   ARG E CA    1 
ATOM   3331  C  C     . ARG E 1  73   ? 171.538 132.165 174.537 1.00 100.67 ?  72   ARG E C     1 
ATOM   3332  O  O     . ARG E 1  73   ? 172.056 132.586 175.578 1.00 100.65 ?  72   ARG E O     1 
ATOM   3333  C  CB    . ARG E 1  73   ? 170.202 130.075 174.910 1.00 100.51 ?  72   ARG E CB    1 
ATOM   3334  C  CG    . ARG E 1  73   ? 170.666 129.776 176.326 1.00 100.74 ?  72   ARG E CG    1 
ATOM   3335  C  CD    . ARG E 1  73   ? 170.552 128.294 176.645 1.00 101.26 ?  72   ARG E CD    1 
ATOM   3336  N  NE    . ARG E 1  73   ? 170.882 128.009 178.039 1.00 101.39 ?  72   ARG E NE    1 
ATOM   3337  C  CZ    . ARG E 1  73   ? 170.799 126.806 178.596 1.00 101.45 ?  72   ARG E CZ    1 
ATOM   3338  N  NH1   . ARG E 1  73   ? 170.395 125.766 177.877 1.00 100.74 ?  72   ARG E NH1   1 
ATOM   3339  N  NH2   . ARG E 1  73   ? 171.119 126.640 179.872 1.00 101.72 ?  72   ARG E NH2   1 
ATOM   3340  N  N     . GLU E 1  74   ? 172.162 132.219 173.358 1.00 100.77 ?  73   GLU E N     1 
ATOM   3341  C  CA    . GLU E 1  74   ? 173.484 132.827 173.248 1.00 101.13 ?  73   GLU E CA    1 
ATOM   3342  C  C     . GLU E 1  74   ? 173.401 134.349 173.253 1.00 101.39 ?  73   GLU E C     1 
ATOM   3343  O  O     . GLU E 1  74   ? 174.214 135.014 173.904 1.00 101.47 ?  73   GLU E O     1 
ATOM   3344  C  CB    . GLU E 1  74   ? 174.188 132.336 171.983 1.00 101.09 ?  73   GLU E CB    1 
ATOM   3345  C  CG    . GLU E 1  74   ? 175.599 132.879 171.812 1.00 101.69 ?  73   GLU E CG    1 
ATOM   3346  C  CD    . GLU E 1  74   ? 176.261 132.400 170.534 1.00 102.28 ?  73   GLU E CD    1 
ATOM   3347  O  OE1   . GLU E 1  74   ? 175.582 131.732 169.726 1.00 102.03 ?  73   GLU E OE1   1 
ATOM   3348  O  OE2   . GLU E 1  74   ? 177.459 132.691 170.339 1.00 103.02 ?  73   GLU E OE2   1 
ATOM   3349  N  N     . ILE E 1  75   ? 172.430 134.915 172.532 1.00 101.64 ?  74   ILE E N     1 
ATOM   3350  C  CA    . ILE E 1  75   ? 172.260 136.366 172.526 1.00 101.85 ?  74   ILE E CA    1 
ATOM   3351  C  C     . ILE E 1  75   ? 171.835 136.856 173.905 1.00 102.09 ?  74   ILE E C     1 
ATOM   3352  O  O     . ILE E 1  75   ? 172.372 137.840 174.427 1.00 102.07 ?  74   ILE E O     1 
ATOM   3353  C  CB    . ILE E 1  75   ? 171.252 136.783 171.440 1.00 101.74 ?  74   ILE E CB    1 
ATOM   3354  C  CG1   . ILE E 1  75   ? 171.786 136.426 170.051 1.00 101.79 ?  74   ILE E CG1   1 
ATOM   3355  C  CG2   . ILE E 1  75   ? 170.952 138.272 171.532 1.00 101.95 ?  74   ILE E CG2   1 
ATOM   3356  C  CD1   . ILE E 1  75   ? 170.850 136.800 168.922 1.00 102.12 ?  74   ILE E CD1   1 
ATOM   3357  N  N     . ALA E 1  76   ? 170.865 136.172 174.517 1.00 102.31 ?  75   ALA E N     1 
ATOM   3358  C  CA    . ALA E 1  76   ? 170.442 136.534 175.865 1.00 102.63 ?  75   ALA E CA    1 
ATOM   3359  C  C     . ALA E 1  76   ? 171.540 136.271 176.887 1.00 102.93 ?  75   ALA E C     1 
ATOM   3360  O  O     . ALA E 1  76   ? 171.628 136.980 177.896 1.00 102.77 ?  75   ALA E O     1 
ATOM   3361  C  CB    . ALA E 1  76   ? 169.172 135.772 176.242 1.00 102.67 ?  75   ALA E CB    1 
ATOM   3362  N  N     . GLN E 1  77   ? 172.381 135.263 176.647 1.00 103.15 ?  76   GLN E N     1 
ATOM   3363  C  CA    . GLN E 1  77   ? 173.495 135.000 177.551 1.00 103.42 ?  76   GLN E CA    1 
ATOM   3364  C  C     . GLN E 1  77   ? 174.541 136.104 177.469 1.00 103.20 ?  76   GLN E C     1 
ATOM   3365  O  O     . GLN E 1  77   ? 175.102 136.514 178.492 1.00 103.18 ?  76   GLN E O     1 
ATOM   3366  C  CB    . GLN E 1  77   ? 174.119 133.641 177.235 1.00 103.62 ?  76   GLN E CB    1 
ATOM   3367  C  CG    . GLN E 1  77   ? 175.273 133.258 178.146 1.00 105.10 ?  76   GLN E CG    1 
ATOM   3368  C  CD    . GLN E 1  77   ? 175.858 131.901 177.806 1.00 107.03 ?  76   GLN E CD    1 
ATOM   3369  O  OE1   . GLN E 1  77   ? 175.404 131.231 176.879 1.00 108.45 ?  76   GLN E OE1   1 
ATOM   3370  N  NE2   . GLN E 1  77   ? 176.873 131.489 178.557 1.00 107.11 ?  76   GLN E NE2   1 
ATOM   3371  N  N     . ASP E 1  78   ? 174.816 136.600 176.260 1.00 102.97 ?  77   ASP E N     1 
ATOM   3372  C  CA    . ASP E 1  78   ? 175.753 137.709 176.114 1.00 102.85 ?  77   ASP E CA    1 
ATOM   3373  C  C     . ASP E 1  78   ? 175.158 139.014 176.627 1.00 102.57 ?  77   ASP E C     1 
ATOM   3374  O  O     . ASP E 1  78   ? 175.899 139.895 177.078 1.00 102.67 ?  77   ASP E O     1 
ATOM   3375  C  CB    . ASP E 1  78   ? 176.173 137.855 174.652 1.00 102.97 ?  77   ASP E CB    1 
ATOM   3376  C  CG    . ASP E 1  78   ? 176.895 136.629 174.127 1.00 103.97 ?  77   ASP E CG    1 
ATOM   3377  O  OD1   . ASP E 1  78   ? 177.566 135.944 174.928 1.00 105.15 ?  77   ASP E OD1   1 
ATOM   3378  O  OD2   . ASP E 1  78   ? 176.791 136.350 172.914 1.00 104.73 ?  77   ASP E OD2   1 
ATOM   3379  N  N     . PHE E 1  79   ? 173.832 139.157 176.566 1.00 102.29 ?  78   PHE E N     1 
ATOM   3380  C  CA    . PHE E 1  79   ? 173.196 140.362 177.089 1.00 102.09 ?  78   PHE E CA    1 
ATOM   3381  C  C     . PHE E 1  79   ? 173.188 140.364 178.612 1.00 102.34 ?  78   PHE E C     1 
ATOM   3382  O  O     . PHE E 1  79   ? 173.384 141.412 179.238 1.00 102.16 ?  78   PHE E O     1 
ATOM   3383  C  CB    . PHE E 1  79   ? 171.774 140.483 176.541 1.00 101.89 ?  78   PHE E CB    1 
ATOM   3384  C  CG    . PHE E 1  79   ? 171.020 141.672 177.065 1.00 100.89 ?  78   PHE E CG    1 
ATOM   3385  C  CD1   . PHE E 1  79   ? 171.224 142.931 176.525 1.00 100.06 ?  78   PHE E CD1   1 
ATOM   3386  C  CD2   . PHE E 1  79   ? 170.102 141.531 178.093 1.00 99.74  ?  78   PHE E CD2   1 
ATOM   3387  C  CE1   . PHE E 1  79   ? 170.531 144.027 177.003 1.00 99.71  ?  78   PHE E CE1   1 
ATOM   3388  C  CE2   . PHE E 1  79   ? 169.406 142.623 178.576 1.00 99.47  ?  78   PHE E CE2   1 
ATOM   3389  C  CZ    . PHE E 1  79   ? 169.621 143.872 178.030 1.00 99.91  ?  78   PHE E CZ    1 
ATOM   3390  N  N     . LYS E 1  80   ? 172.963 139.204 179.225 1.00 102.82 ?  79   LYS E N     1 
ATOM   3391  C  CA    . LYS E 1  80   ? 172.946 139.086 180.676 1.00 103.46 ?  79   LYS E CA    1 
ATOM   3392  C  C     . LYS E 1  80   ? 173.310 137.659 181.055 1.00 103.89 ?  79   LYS E C     1 
ATOM   3393  O  O     . LYS E 1  80   ? 172.713 136.708 180.541 1.00 103.90 ?  79   LYS E O     1 
ATOM   3394  C  CB    . LYS E 1  80   ? 171.575 139.459 181.248 1.00 103.54 ?  79   LYS E CB    1 
ATOM   3395  C  CG    . LYS E 1  80   ? 171.488 139.369 182.763 1.00 104.31 ?  79   LYS E CG    1 
ATOM   3396  C  CD    . LYS E 1  80   ? 172.481 140.308 183.429 1.00 105.52 ?  79   LYS E CD    1 
ATOM   3397  C  CE    . LYS E 1  80   ? 172.391 140.222 184.943 1.00 106.29 ?  79   LYS E CE    1 
ATOM   3398  N  NZ    . LYS E 1  80   ? 173.359 141.136 185.610 1.00 106.55 ?  79   LYS E NZ    1 
ATOM   3399  N  N     . THR E 1  81   ? 174.283 137.516 181.950 1.00 104.50 ?  80   THR E N     1 
ATOM   3400  C  CA    . THR E 1  81   ? 174.735 136.199 182.366 1.00 104.77 ?  80   THR E CA    1 
ATOM   3401  C  C     . THR E 1  81   ? 173.765 135.585 183.372 1.00 104.78 ?  80   THR E C     1 
ATOM   3402  O  O     . THR E 1  81   ? 173.006 136.283 184.052 1.00 104.54 ?  80   THR E O     1 
ATOM   3403  C  CB    . THR E 1  81   ? 176.136 136.275 182.974 1.00 104.81 ?  80   THR E CB    1 
ATOM   3404  O  OG1   . THR E 1  81   ? 176.542 134.972 183.410 1.00 105.28 ?  80   THR E OG1   1 
ATOM   3405  C  CG2   . THR E 1  81   ? 176.152 137.230 184.159 1.00 104.81 ?  80   THR E CG2   1 
ATOM   3406  N  N     . ASP E 1  82   ? 173.800 134.253 183.452 1.00 105.10 ?  81   ASP E N     1 
ATOM   3407  C  CA    . ASP E 1  82   ? 172.969 133.483 184.372 1.00 105.31 ?  81   ASP E CA    1 
ATOM   3408  C  C     . ASP E 1  82   ? 171.488 133.779 184.163 1.00 105.26 ?  81   ASP E C     1 
ATOM   3409  O  O     . ASP E 1  82   ? 170.881 134.520 184.943 1.00 105.38 ?  81   ASP E O     1 
ATOM   3410  C  CB    . ASP E 1  82   ? 173.371 133.763 185.823 1.00 105.40 ?  81   ASP E CB    1 
ATOM   3411  C  CG    . ASP E 1  82   ? 172.739 132.793 186.803 1.00 105.74 ?  81   ASP E CG    1 
ATOM   3412  O  OD1   . ASP E 1  82   ? 172.124 131.803 186.354 1.00 105.56 ?  81   ASP E OD1   1 
ATOM   3413  O  OD2   . ASP E 1  82   ? 172.858 133.020 188.025 1.00 105.94 ?  81   ASP E OD2   1 
ATOM   3414  N  N     . LEU E 1  83   ? 170.900 133.203 183.117 1.00 105.08 ?  82   LEU E N     1 
ATOM   3415  C  CA    . LEU E 1  83   ? 169.490 133.383 182.812 1.00 104.80 ?  82   LEU E CA    1 
ATOM   3416  C  C     . LEU E 1  83   ? 168.847 132.031 182.536 1.00 104.84 ?  82   LEU E C     1 
ATOM   3417  O  O     . LEU E 1  83   ? 169.470 131.133 181.964 1.00 105.03 ?  82   LEU E O     1 
ATOM   3418  C  CB    . LEU E 1  83   ? 169.284 134.311 181.605 1.00 104.48 ?  82   LEU E CB    1 
ATOM   3419  C  CG    . LEU E 1  83   ? 169.701 135.773 181.774 1.00 104.12 ?  82   LEU E CG    1 
ATOM   3420  C  CD1   . LEU E 1  83   ? 169.410 136.560 180.506 1.00 103.12 ?  82   LEU E CD1   1 
ATOM   3421  C  CD2   . LEU E 1  83   ? 168.998 136.398 182.969 1.00 103.09 ?  82   LEU E CD2   1 
ATOM   3422  N  N     . ARG E 1  84   ? 167.590 131.897 182.952 1.00 104.77 ?  83   ARG E N     1 
ATOM   3423  C  CA    . ARG E 1  84   ? 166.812 130.685 182.738 1.00 104.67 ?  83   ARG E CA    1 
ATOM   3424  C  C     . ARG E 1  84   ? 165.467 131.060 182.135 1.00 103.96 ?  83   ARG E C     1 
ATOM   3425  O  O     . ARG E 1  84   ? 164.786 131.956 182.642 1.00 104.00 ?  83   ARG E O     1 
ATOM   3426  C  CB    . ARG E 1  84   ? 166.612 129.911 184.046 1.00 105.10 ?  83   ARG E CB    1 
ATOM   3427  C  CG    . ARG E 1  84   ? 167.901 129.406 184.672 1.00 107.06 ?  83   ARG E CG    1 
ATOM   3428  C  CD    . ARG E 1  84   ? 167.625 128.615 185.940 1.00 109.92 ?  83   ARG E CD    1 
ATOM   3429  N  NE    . ARG E 1  84   ? 168.853 128.105 186.543 1.00 111.56 ?  83   ARG E NE    1 
ATOM   3430  C  CZ    . ARG E 1  84   ? 168.893 127.372 187.650 1.00 112.63 ?  83   ARG E CZ    1 
ATOM   3431  N  NH1   . ARG E 1  84   ? 167.770 127.059 188.281 1.00 112.55 ?  83   ARG E NH1   1 
ATOM   3432  N  NH2   . ARG E 1  84   ? 170.056 126.951 188.127 1.00 113.58 ?  83   ARG E NH2   1 
ATOM   3433  N  N     . PHE E 1  85   ? 165.090 130.375 181.061 1.00 103.09 ?  84   PHE E N     1 
ATOM   3434  C  CA    . PHE E 1  85   ? 163.852 130.643 180.345 1.00 102.24 ?  84   PHE E CA    1 
ATOM   3435  C  C     . PHE E 1  85   ? 162.887 129.474 180.505 1.00 101.56 ?  84   PHE E C     1 
ATOM   3436  O  O     . PHE E 1  85   ? 163.238 128.407 181.014 1.00 101.78 ?  84   PHE E O     1 
ATOM   3437  C  CB    . PHE E 1  85   ? 164.120 130.916 178.858 1.00 102.25 ?  84   PHE E CB    1 
ATOM   3438  C  CG    . PHE E 1  85   ? 164.956 129.862 178.186 1.00 102.48 ?  84   PHE E CG    1 
ATOM   3439  C  CD1   . PHE E 1  85   ? 164.363 128.758 177.594 1.00 102.28 ?  84   PHE E CD1   1 
ATOM   3440  C  CD2   . PHE E 1  85   ? 166.335 129.979 178.140 1.00 102.28 ?  84   PHE E CD2   1 
ATOM   3441  C  CE1   . PHE E 1  85   ? 165.131 127.790 176.974 1.00 101.96 ?  84   PHE E CE1   1 
ATOM   3442  C  CE2   . PHE E 1  85   ? 167.108 129.015 177.522 1.00 102.00 ?  84   PHE E CE2   1 
ATOM   3443  C  CZ    . PHE E 1  85   ? 166.505 127.919 176.938 1.00 101.83 ?  84   PHE E CZ    1 
ATOM   3444  N  N     . GLN E 1  86   ? 161.656 129.694 180.055 1.00 100.75 ?  85   GLN E N     1 
ATOM   3445  C  CA    . GLN E 1  86   ? 160.597 128.700 180.121 1.00 100.08 ?  85   GLN E CA    1 
ATOM   3446  C  C     . GLN E 1  86   ? 160.474 127.976 178.785 1.00 99.67  ?  85   GLN E C     1 
ATOM   3447  O  O     . GLN E 1  86   ? 160.776 128.533 177.726 1.00 99.79  ?  85   GLN E O     1 
ATOM   3448  C  CB    . GLN E 1  86   ? 159.264 129.359 180.493 1.00 100.03 ?  85   GLN E CB    1 
ATOM   3449  C  CG    . GLN E 1  86   ? 158.118 128.390 180.739 1.00 99.98  ?  85   GLN E CG    1 
ATOM   3450  C  CD    . GLN E 1  86   ? 156.881 129.074 181.287 1.00 100.15 ?  85   GLN E CD    1 
ATOM   3451  O  OE1   . GLN E 1  86   ? 156.929 130.235 181.693 1.00 99.89  ?  85   GLN E OE1   1 
ATOM   3452  N  NE2   . GLN E 1  86   ? 155.765 128.356 181.302 1.00 100.04 ?  85   GLN E NE2   1 
ATOM   3453  N  N     . SER E 1  87   ? 160.035 126.715 178.847 1.00 99.05  ?  86   SER E N     1 
ATOM   3454  C  CA    . SER E 1  87   ? 159.876 125.925 177.630 1.00 98.13  ?  86   SER E CA    1 
ATOM   3455  C  C     . SER E 1  87   ? 158.826 126.533 176.708 1.00 97.47  ?  86   SER E C     1 
ATOM   3456  O  O     . SER E 1  87   ? 158.950 126.461 175.480 1.00 97.44  ?  86   SER E O     1 
ATOM   3457  C  CB    . SER E 1  87   ? 159.510 124.484 177.985 1.00 98.13  ?  86   SER E CB    1 
ATOM   3458  O  OG    . SER E 1  87   ? 158.298 124.432 178.717 1.00 98.39  ?  86   SER E OG    1 
ATOM   3459  N  N     . SER E 1  88   ? 157.781 127.135 177.281 1.00 96.65  ?  87   SER E N     1 
ATOM   3460  C  CA    . SER E 1  88   ? 156.761 127.785 176.467 1.00 95.92  ?  87   SER E CA    1 
ATOM   3461  C  C     . SER E 1  88   ? 157.252 129.097 175.869 1.00 95.22  ?  87   SER E C     1 
ATOM   3462  O  O     . SER E 1  88   ? 156.694 129.552 174.864 1.00 95.20  ?  87   SER E O     1 
ATOM   3463  C  CB    . SER E 1  88   ? 155.501 128.031 177.298 1.00 96.06  ?  87   SER E CB    1 
ATOM   3464  O  OG    . SER E 1  88   ? 155.770 128.891 178.391 1.00 95.97  ?  87   SER E OG    1 
ATOM   3465  N  N     . ALA E 1  89   ? 158.278 129.712 176.462 1.00 94.49  ?  88   ALA E N     1 
ATOM   3466  C  CA    . ALA E 1  89   ? 158.819 130.948 175.907 1.00 94.09  ?  88   ALA E CA    1 
ATOM   3467  C  C     . ALA E 1  89   ? 159.513 130.706 174.573 1.00 93.70  ?  88   ALA E C     1 
ATOM   3468  O  O     . ALA E 1  89   ? 159.544 131.602 173.722 1.00 93.88  ?  88   ALA E O     1 
ATOM   3469  C  CB    . ALA E 1  89   ? 159.785 131.594 176.900 1.00 94.10  ?  88   ALA E CB    1 
ATOM   3470  N  N     . VAL E 1  90   ? 160.075 129.512 174.374 1.00 93.11  ?  89   VAL E N     1 
ATOM   3471  C  CA    . VAL E 1  90   ? 160.677 129.180 173.086 1.00 92.59  ?  89   VAL E CA    1 
ATOM   3472  C  C     . VAL E 1  90   ? 159.613 129.156 171.997 1.00 92.40  ?  89   VAL E C     1 
ATOM   3473  O  O     . VAL E 1  90   ? 159.845 129.605 170.868 1.00 92.51  ?  89   VAL E O     1 
ATOM   3474  C  CB    . VAL E 1  90   ? 161.430 127.840 173.176 1.00 92.74  ?  89   VAL E CB    1 
ATOM   3475  C  CG1   . VAL E 1  90   ? 162.127 127.528 171.860 1.00 92.50  ?  89   VAL E CG1   1 
ATOM   3476  C  CG2   . VAL E 1  90   ? 162.430 127.870 174.323 1.00 92.42  ?  89   VAL E CG2   1 
ATOM   3477  N  N     . MET E 1  91   ? 158.426 128.636 172.320 1.00 91.88  ?  90   MET E N     1 
ATOM   3478  C  CA    . MET E 1  91   ? 157.324 128.664 171.365 1.00 91.41  ?  90   MET E CA    1 
ATOM   3479  C  C     . MET E 1  91   ? 156.779 130.077 171.197 1.00 90.62  ?  90   MET E C     1 
ATOM   3480  O  O     . MET E 1  91   ? 156.358 130.459 170.098 1.00 90.55  ?  90   MET E O     1 
ATOM   3481  C  CB    . MET E 1  91   ? 156.217 127.712 171.814 1.00 91.80  ?  90   MET E CB    1 
ATOM   3482  C  CG    . MET E 1  91   ? 156.643 126.256 171.903 1.00 93.64  ?  90   MET E CG    1 
ATOM   3483  S  SD    . MET E 1  91   ? 157.005 125.540 170.289 1.00 97.84  ?  90   MET E SD    1 
ATOM   3484  C  CE    . MET E 1  91   ? 155.408 125.688 169.492 1.00 96.47  ?  90   MET E CE    1 
ATOM   3485  N  N     . ALA E 1  92   ? 156.783 130.867 172.274 1.00 89.82  ?  91   ALA E N     1 
ATOM   3486  C  CA    . ALA E 1  92   ? 156.277 132.234 172.199 1.00 89.05  ?  91   ALA E CA    1 
ATOM   3487  C  C     . ALA E 1  92   ? 157.132 133.084 171.267 1.00 88.63  ?  91   ALA E C     1 
ATOM   3488  O  O     . ALA E 1  92   ? 156.614 133.735 170.351 1.00 88.57  ?  91   ALA E O     1 
ATOM   3489  C  CB    . ALA E 1  92   ? 156.223 132.850 173.597 1.00 88.84  ?  91   ALA E CB    1 
ATOM   3490  N  N     . LEU E 1  93   ? 158.449 133.094 171.487 1.00 88.10  ?  92   LEU E N     1 
ATOM   3491  C  CA    . LEU E 1  93   ? 159.337 133.818 170.584 1.00 87.39  ?  92   LEU E CA    1 
ATOM   3492  C  C     . LEU E 1  93   ? 159.414 133.148 169.219 1.00 87.29  ?  92   LEU E C     1 
ATOM   3493  O  O     . LEU E 1  93   ? 159.710 133.812 168.219 1.00 87.23  ?  92   LEU E O     1 
ATOM   3494  C  CB    . LEU E 1  93   ? 160.735 133.938 171.194 1.00 87.09  ?  92   LEU E CB    1 
ATOM   3495  C  CG    . LEU E 1  93   ? 160.984 135.058 172.210 1.00 86.87  ?  92   LEU E CG    1 
ATOM   3496  C  CD1   . LEU E 1  93   ? 160.510 136.396 171.661 1.00 86.54  ?  92   LEU E CD1   1 
ATOM   3497  C  CD2   . LEU E 1  93   ? 160.335 134.760 173.555 1.00 86.00  ?  92   LEU E CD2   1 
ATOM   3498  N  N     . GLN E 1  94   ? 159.150 131.843 169.158 1.00 86.90  ?  93   GLN E N     1 
ATOM   3499  C  CA    . GLN E 1  94   ? 159.179 131.106 167.901 1.00 86.54  ?  93   GLN E CA    1 
ATOM   3500  C  C     . GLN E 1  94   ? 158.061 131.568 166.974 1.00 86.22  ?  93   GLN E C     1 
ATOM   3501  O  O     . GLN E 1  94   ? 158.323 132.181 165.934 1.00 86.44  ?  93   GLN E O     1 
ATOM   3502  C  CB    . GLN E 1  94   ? 159.067 129.602 168.162 1.00 86.98  ?  93   GLN E CB    1 
ATOM   3503  C  CG    . GLN E 1  94   ? 159.025 128.749 166.904 1.00 86.78  ?  93   GLN E CG    1 
ATOM   3504  C  CD    . GLN E 1  94   ? 160.338 128.754 166.146 1.00 86.38  ?  93   GLN E CD    1 
ATOM   3505  O  OE1   . GLN E 1  94   ? 160.362 128.603 164.925 1.00 86.64  ?  93   GLN E OE1   1 
ATOM   3506  N  NE2   . GLN E 1  94   ? 161.440 128.917 166.869 1.00 86.96  ?  93   GLN E NE2   1 
ATOM   3507  N  N     . GLU E 1  95   ? 156.810 131.283 167.346 1.00 85.85  ?  94   GLU E N     1 
ATOM   3508  C  CA    . GLU E 1  95   ? 155.686 131.675 166.503 1.00 85.75  ?  94   GLU E CA    1 
ATOM   3509  C  C     . GLU E 1  95   ? 155.506 133.188 166.473 1.00 85.45  ?  94   GLU E C     1 
ATOM   3510  O  O     . GLU E 1  95   ? 155.015 133.733 165.477 1.00 85.15  ?  94   GLU E O     1 
ATOM   3511  C  CB    . GLU E 1  95   ? 154.403 130.991 166.981 1.00 86.02  ?  94   GLU E CB    1 
ATOM   3512  C  CG    . GLU E 1  95   ? 153.874 131.496 168.316 1.00 86.62  ?  94   GLU E CG    1 
ATOM   3513  C  CD    . GLU E 1  95   ? 152.739 130.647 168.851 1.00 88.04  ?  94   GLU E CD    1 
ATOM   3514  O  OE1   . GLU E 1  95   ? 152.821 129.403 168.707 1.00 88.44  ?  94   GLU E OE1   1 
ATOM   3515  O  OE2   . GLU E 1  95   ? 151.773 131.228 169.406 1.00 88.81  ?  94   GLU E OE2   1 
ATOM   3516  N  N     . ALA E 1  96   ? 155.898 133.881 167.546 1.00 85.12  ?  95   ALA E N     1 
ATOM   3517  C  CA    . ALA E 1  96   ? 155.823 135.337 167.550 1.00 85.06  ?  95   ALA E CA    1 
ATOM   3518  C  C     . ALA E 1  96   ? 156.814 135.938 166.564 1.00 84.96  ?  95   ALA E C     1 
ATOM   3519  O  O     . ALA E 1  96   ? 156.523 136.954 165.921 1.00 84.90  ?  95   ALA E O     1 
ATOM   3520  C  CB    . ALA E 1  96   ? 156.070 135.874 168.959 1.00 84.96  ?  95   ALA E CB    1 
ATOM   3521  N  N     . SER E 1  97   ? 157.992 135.326 166.431 1.00 84.97  ?  96   SER E N     1 
ATOM   3522  C  CA    . SER E 1  97   ? 158.944 135.774 165.421 1.00 84.81  ?  96   SER E CA    1 
ATOM   3523  C  C     . SER E 1  97   ? 158.486 135.373 164.024 1.00 84.74  ?  96   SER E C     1 
ATOM   3524  O  O     . SER E 1  97   ? 158.698 136.115 163.058 1.00 84.91  ?  96   SER E O     1 
ATOM   3525  C  CB    . SER E 1  97   ? 160.331 135.206 165.717 1.00 84.88  ?  96   SER E CB    1 
ATOM   3526  O  OG    . SER E 1  97   ? 160.314 133.789 165.716 1.00 84.65  ?  96   SER E OG    1 
ATOM   3527  N  N     . GLU E 1  98   ? 157.852 134.204 163.899 1.00 84.59  ?  97   GLU E N     1 
ATOM   3528  C  CA    . GLU E 1  98   ? 157.349 133.772 162.599 1.00 84.32  ?  97   GLU E CA    1 
ATOM   3529  C  C     . GLU E 1  98   ? 156.226 134.671 162.101 1.00 83.77  ?  97   GLU E C     1 
ATOM   3530  O  O     . GLU E 1  98   ? 156.088 134.869 160.889 1.00 83.92  ?  97   GLU E O     1 
ATOM   3531  C  CB    . GLU E 1  98   ? 156.872 132.321 162.671 1.00 84.53  ?  97   GLU E CB    1 
ATOM   3532  C  CG    . GLU E 1  98   ? 157.987 131.304 162.840 1.00 85.33  ?  97   GLU E CG    1 
ATOM   3533  C  CD    . GLU E 1  98   ? 157.475 129.877 162.860 1.00 86.33  ?  97   GLU E CD    1 
ATOM   3534  O  OE1   . GLU E 1  98   ? 156.241 129.687 162.828 1.00 86.13  ?  97   GLU E OE1   1 
ATOM   3535  O  OE2   . GLU E 1  98   ? 158.306 128.946 162.907 1.00 86.95  ?  97   GLU E OE2   1 
ATOM   3536  N  N     . ALA E 1  99   ? 155.416 135.220 163.010 1.00 82.51  ?  98   ALA E N     1 
ATOM   3537  C  CA    . ALA E 1  99   ? 154.345 136.119 162.592 1.00 81.13  ?  98   ALA E CA    1 
ATOM   3538  C  C     . ALA E 1  99   ? 154.904 137.372 161.929 1.00 80.39  ?  98   ALA E C     1 
ATOM   3539  O  O     . ALA E 1  99   ? 154.393 137.819 160.895 1.00 80.44  ?  98   ALA E O     1 
ATOM   3540  C  CB    . ALA E 1  99   ? 153.471 136.488 163.791 1.00 81.15  ?  98   ALA E CB    1 
ATOM   3541  N  N     . TYR E 1  100  ? 155.960 137.949 162.508 1.00 79.25  ?  99   TYR E N     1 
ATOM   3542  C  CA    . TYR E 1  100  ? 156.583 139.123 161.905 1.00 77.80  ?  99   TYR E CA    1 
ATOM   3543  C  C     . TYR E 1  100  ? 157.342 138.751 160.637 1.00 77.10  ?  99   TYR E C     1 
ATOM   3544  O  O     . TYR E 1  100  ? 157.292 139.480 159.639 1.00 77.23  ?  99   TYR E O     1 
ATOM   3545  C  CB    . TYR E 1  100  ? 157.510 139.797 162.916 1.00 77.63  ?  99   TYR E CB    1 
ATOM   3546  C  CG    . TYR E 1  100  ? 158.000 141.164 162.495 1.00 76.74  ?  99   TYR E CG    1 
ATOM   3547  C  CD1   . TYR E 1  100  ? 157.196 142.287 162.644 1.00 75.81  ?  99   TYR E CD1   1 
ATOM   3548  C  CD2   . TYR E 1  100  ? 159.269 141.334 161.958 1.00 76.45  ?  99   TYR E CD2   1 
ATOM   3549  C  CE1   . TYR E 1  100  ? 157.640 143.539 162.264 1.00 76.10  ?  99   TYR E CE1   1 
ATOM   3550  C  CE2   . TYR E 1  100  ? 159.722 142.582 161.576 1.00 75.12  ?  99   TYR E CE2   1 
ATOM   3551  C  CZ    . TYR E 1  100  ? 158.904 143.681 161.730 1.00 76.02  ?  99   TYR E CZ    1 
ATOM   3552  O  OH    . TYR E 1  100  ? 159.350 144.927 161.351 1.00 76.66  ?  99   TYR E OH    1 
ATOM   3553  N  N     . LEU E 1  101  ? 158.041 137.613 160.653 1.00 76.08  ?  100  LEU E N     1 
ATOM   3554  C  CA    . LEU E 1  101  ? 158.769 137.138 159.482 1.00 74.67  ?  100  LEU E CA    1 
ATOM   3555  C  C     . LEU E 1  101  ? 157.855 136.625 158.378 1.00 73.80  ?  100  LEU E C     1 
ATOM   3556  O  O     . LEU E 1  101  ? 158.357 136.247 157.314 1.00 73.73  ?  100  LEU E O     1 
ATOM   3557  C  CB    . LEU E 1  101  ? 159.756 136.041 159.885 1.00 74.67  ?  100  LEU E CB    1 
ATOM   3558  C  CG    . LEU E 1  101  ? 160.945 136.472 160.746 1.00 74.58  ?  100  LEU E CG    1 
ATOM   3559  C  CD1   . LEU E 1  101  ? 161.833 135.280 161.069 1.00 75.37  ?  100  LEU E CD1   1 
ATOM   3560  C  CD2   . LEU E 1  101  ? 161.742 137.567 160.054 1.00 74.41  ?  100  LEU E CD2   1 
ATOM   3561  N  N     . VAL E 1  102  ? 156.543 136.589 158.601 1.00 73.00  ?  101  VAL E N     1 
ATOM   3562  C  CA    . VAL E 1  102  ? 155.579 136.240 157.570 1.00 72.01  ?  101  VAL E CA    1 
ATOM   3563  C  C     . VAL E 1  102  ? 154.794 137.459 157.103 1.00 71.33  ?  101  VAL E C     1 
ATOM   3564  O  O     . VAL E 1  102  ? 154.550 137.622 155.905 1.00 70.66  ?  101  VAL E O     1 
ATOM   3565  C  CB    . VAL E 1  102  ? 154.631 135.122 158.060 1.00 71.85  ?  101  VAL E CB    1 
ATOM   3566  C  CG1   . VAL E 1  102  ? 153.367 135.071 157.214 1.00 71.96  ?  101  VAL E CG1   1 
ATOM   3567  C  CG2   . VAL E 1  102  ? 155.339 133.776 158.021 1.00 71.58  ?  101  VAL E CG2   1 
ATOM   3568  N  N     . ALA E 1  103  ? 154.406 138.337 158.030 1.00 70.95  ?  102  ALA E N     1 
ATOM   3569  C  CA    . ALA E 1  103  ? 153.715 139.563 157.644 1.00 70.66  ?  102  ALA E CA    1 
ATOM   3570  C  C     . ALA E 1  103  ? 154.651 140.507 156.897 1.00 70.56  ?  102  ALA E C     1 
ATOM   3571  O  O     . ALA E 1  103  ? 154.315 141.004 155.814 1.00 70.09  ?  102  ALA E O     1 
ATOM   3572  C  CB    . ALA E 1  103  ? 153.129 140.247 158.878 1.00 70.74  ?  102  ALA E CB    1 
ATOM   3573  N  N     . LEU E 1  104  ? 155.835 140.765 157.461 1.00 70.72  ?  103  LEU E N     1 
ATOM   3574  C  CA    . LEU E 1  104  ? 156.789 141.646 156.795 1.00 70.87  ?  103  LEU E CA    1 
ATOM   3575  C  C     . LEU E 1  104  ? 157.268 141.043 155.481 1.00 71.80  ?  103  LEU E C     1 
ATOM   3576  O  O     . LEU E 1  104  ? 157.502 141.766 154.505 1.00 72.13  ?  103  LEU E O     1 
ATOM   3577  C  CB    . LEU E 1  104  ? 157.974 141.934 157.717 1.00 70.09  ?  103  LEU E CB    1 
ATOM   3578  C  CG    . LEU E 1  104  ? 159.022 142.908 157.173 1.00 67.79  ?  103  LEU E CG    1 
ATOM   3579  C  CD1   . LEU E 1  104  ? 158.423 144.294 156.985 1.00 65.60  ?  103  LEU E CD1   1 
ATOM   3580  C  CD2   . LEU E 1  104  ? 160.240 142.964 158.082 1.00 64.66  ?  103  LEU E CD2   1 
ATOM   3581  N  N     . PHE E 1  105  ? 157.418 139.717 155.436 1.00 72.79  ?  104  PHE E N     1 
ATOM   3582  C  CA    . PHE E 1  105  ? 157.812 139.062 154.194 1.00 73.72  ?  104  PHE E CA    1 
ATOM   3583  C  C     . PHE E 1  105  ? 156.705 139.137 153.150 1.00 74.32  ?  104  PHE E C     1 
ATOM   3584  O  O     . PHE E 1  105  ? 156.990 139.228 151.951 1.00 74.14  ?  104  PHE E O     1 
ATOM   3585  C  CB    . PHE E 1  105  ? 158.190 137.608 154.466 1.00 74.22  ?  104  PHE E CB    1 
ATOM   3586  C  CG    . PHE E 1  105  ? 159.184 137.046 153.492 1.00 75.25  ?  104  PHE E CG    1 
ATOM   3587  C  CD1   . PHE E 1  105  ? 158.770 136.535 152.275 1.00 75.56  ?  104  PHE E CD1   1 
ATOM   3588  C  CD2   . PHE E 1  105  ? 160.534 137.025 153.798 1.00 76.36  ?  104  PHE E CD2   1 
ATOM   3589  C  CE1   . PHE E 1  105  ? 159.685 136.017 151.379 1.00 75.41  ?  104  PHE E CE1   1 
ATOM   3590  C  CE2   . PHE E 1  105  ? 161.454 136.508 152.907 1.00 76.31  ?  104  PHE E CE2   1 
ATOM   3591  C  CZ    . PHE E 1  105  ? 161.028 136.002 151.696 1.00 75.44  ?  104  PHE E CZ    1 
ATOM   3592  N  N     . GLU E 1  106  ? 155.443 139.098 153.585 1.00 74.83  ?  105  GLU E N     1 
ATOM   3593  C  CA    . GLU E 1  106  ? 154.334 139.259 152.651 1.00 75.64  ?  105  GLU E CA    1 
ATOM   3594  C  C     . GLU E 1  106  ? 154.275 140.682 152.113 1.00 75.42  ?  105  GLU E C     1 
ATOM   3595  O  O     . GLU E 1  106  ? 154.014 140.892 150.922 1.00 75.94  ?  105  GLU E O     1 
ATOM   3596  C  CB    . GLU E 1  106  ? 153.017 138.883 153.330 1.00 75.68  ?  105  GLU E CB    1 
ATOM   3597  C  CG    . GLU E 1  106  ? 151.797 138.992 152.428 1.00 76.66  ?  105  GLU E CG    1 
ATOM   3598  C  CD    . GLU E 1  106  ? 150.512 138.606 153.135 1.00 77.61  ?  105  GLU E CD    1 
ATOM   3599  O  OE1   . GLU E 1  106  ? 150.573 138.253 154.331 1.00 80.31  ?  105  GLU E OE1   1 
ATOM   3600  O  OE2   . GLU E 1  106  ? 149.441 138.656 152.494 1.00 79.44  ?  105  GLU E OE2   1 
ATOM   3601  N  N     . ASP E 1  107  ? 154.515 141.674 152.976 1.00 75.11  ?  106  ASP E N     1 
ATOM   3602  C  CA    . ASP E 1  107  ? 154.605 143.052 152.503 1.00 75.42  ?  106  ASP E CA    1 
ATOM   3603  C  C     . ASP E 1  107  ? 155.765 143.219 151.530 1.00 75.75  ?  106  ASP E C     1 
ATOM   3604  O  O     . ASP E 1  107  ? 155.669 143.982 150.561 1.00 76.20  ?  106  ASP E O     1 
ATOM   3605  C  CB    . ASP E 1  107  ? 154.751 144.007 153.688 1.00 75.16  ?  106  ASP E CB    1 
ATOM   3606  C  CG    . ASP E 1  107  ? 153.570 143.943 154.636 1.00 74.97  ?  106  ASP E CG    1 
ATOM   3607  O  OD1   . ASP E 1  107  ? 152.650 143.136 154.389 1.00 75.40  ?  106  ASP E OD1   1 
ATOM   3608  O  OD2   . ASP E 1  107  ? 153.562 144.700 155.629 1.00 73.91  ?  106  ASP E OD2   1 
ATOM   3609  N  N     . THR E 1  108  ? 156.870 142.510 151.773 1.00 75.68  ?  107  THR E N     1 
ATOM   3610  C  CA    . THR E 1  108  ? 157.978 142.512 150.823 1.00 75.45  ?  107  THR E CA    1 
ATOM   3611  C  C     . THR E 1  108  ? 157.556 141.907 149.490 1.00 75.34  ?  107  THR E C     1 
ATOM   3612  O  O     . THR E 1  108  ? 157.912 142.424 148.423 1.00 75.22  ?  107  THR E O     1 
ATOM   3613  C  CB    . THR E 1  108  ? 159.168 141.748 151.408 1.00 75.49  ?  107  THR E CB    1 
ATOM   3614  O  OG1   . THR E 1  108  ? 159.664 142.441 152.561 1.00 75.53  ?  107  THR E OG1   1 
ATOM   3615  C  CG2   . THR E 1  108  ? 160.282 141.612 150.382 1.00 75.60  ?  107  THR E CG2   1 
ATOM   3616  N  N     . ASN E 1  109  ? 156.790 140.814 149.532 1.00 75.10  ?  108  ASN E N     1 
ATOM   3617  C  CA    . ASN E 1  109  ? 156.296 140.205 148.301 1.00 74.66  ?  108  ASN E CA    1 
ATOM   3618  C  C     . ASN E 1  109  ? 155.402 141.168 147.532 1.00 74.41  ?  108  ASN E C     1 
ATOM   3619  O  O     . ASN E 1  109  ? 155.490 141.260 146.302 1.00 74.42  ?  108  ASN E O     1 
ATOM   3620  C  CB    . ASN E 1  109  ? 155.544 138.914 148.621 1.00 74.49  ?  108  ASN E CB    1 
ATOM   3621  C  CG    . ASN E 1  109  ? 155.007 138.229 147.379 1.00 74.52  ?  108  ASN E CG    1 
ATOM   3622  O  OD1   . ASN E 1  109  ? 153.973 137.563 147.421 1.00 74.59  ?  108  ASN E OD1   1 
ATOM   3623  N  ND2   . ASN E 1  109  ? 155.713 138.386 146.267 1.00 76.00  ?  108  ASN E ND2   1 
ATOM   3624  N  N     . LEU E 1  110  ? 154.534 141.896 148.240 1.00 74.35  ?  109  LEU E N     1 
ATOM   3625  C  CA    . LEU E 1  110  ? 153.697 142.890 147.576 1.00 74.29  ?  109  LEU E CA    1 
ATOM   3626  C  C     . LEU E 1  110  ? 154.530 144.034 147.012 1.00 74.62  ?  109  LEU E C     1 
ATOM   3627  O  O     . LEU E 1  110  ? 154.184 144.592 145.964 1.00 75.03  ?  109  LEU E O     1 
ATOM   3628  C  CB    . LEU E 1  110  ? 152.641 143.419 148.544 1.00 74.03  ?  109  LEU E CB    1 
ATOM   3629  C  CG    . LEU E 1  110  ? 151.663 142.370 149.080 1.00 73.25  ?  109  LEU E CG    1 
ATOM   3630  C  CD1   . LEU E 1  110  ? 150.660 143.000 150.031 1.00 71.98  ?  109  LEU E CD1   1 
ATOM   3631  C  CD2   . LEU E 1  110  ? 150.952 141.664 147.936 1.00 71.65  ?  109  LEU E CD2   1 
ATOM   3632  N  N     . CYS E 1  111  ? 155.625 144.396 147.687 1.00 74.84  ?  110  CYS E N     1 
ATOM   3633  C  CA    . CYS E 1  111  ? 156.537 145.388 147.129 1.00 75.17  ?  110  CYS E CA    1 
ATOM   3634  C  C     . CYS E 1  111  ? 157.206 144.875 145.861 1.00 75.19  ?  110  CYS E C     1 
ATOM   3635  O  O     . CYS E 1  111  ? 157.496 145.659 144.951 1.00 75.20  ?  110  CYS E O     1 
ATOM   3636  C  CB    . CYS E 1  111  ? 157.593 145.780 148.163 1.00 75.22  ?  110  CYS E CB    1 
ATOM   3637  S  SG    . CYS E 1  111  ? 156.955 146.712 149.573 1.00 75.57  ?  110  CYS E SG    1 
ATOM   3638  N  N     . ALA E 1  112  ? 157.460 143.566 145.784 1.00 75.36  ?  111  ALA E N     1 
ATOM   3639  C  CA    . ALA E 1  112  ? 158.026 142.999 144.565 1.00 75.12  ?  111  ALA E CA    1 
ATOM   3640  C  C     . ALA E 1  112  ? 157.003 142.987 143.436 1.00 75.19  ?  111  ALA E C     1 
ATOM   3641  O  O     . ALA E 1  112  ? 157.325 143.342 142.296 1.00 75.40  ?  111  ALA E O     1 
ATOM   3642  C  CB    . ALA E 1  112  ? 158.547 141.587 144.835 1.00 75.15  ?  111  ALA E CB    1 
ATOM   3643  N  N     . ILE E 1  113  ? 155.763 142.587 143.735 1.00 75.09  ?  112  ILE E N     1 
ATOM   3644  C  CA    . ILE E 1  113  ? 154.716 142.572 142.717 1.00 74.93  ?  112  ILE E CA    1 
ATOM   3645  C  C     . ILE E 1  113  ? 154.423 143.982 142.222 1.00 74.88  ?  112  ILE E C     1 
ATOM   3646  O  O     . ILE E 1  113  ? 154.103 144.182 141.043 1.00 74.81  ?  112  ILE E O     1 
ATOM   3647  C  CB    . ILE E 1  113  ? 153.448 141.890 143.271 1.00 74.81  ?  112  ILE E CB    1 
ATOM   3648  C  CG1   . ILE E 1  113  ? 153.761 140.458 143.710 1.00 75.00  ?  112  ILE E CG1   1 
ATOM   3649  C  CG2   . ILE E 1  113  ? 152.334 141.889 142.234 1.00 74.75  ?  112  ILE E CG2   1 
ATOM   3650  C  CD1   . ILE E 1  113  ? 152.571 139.721 144.285 1.00 75.97  ?  112  ILE E CD1   1 
ATOM   3651  N  N     . HIS E 1  114  ? 154.538 144.981 143.102 1.00 74.92  ?  113  HIS E N     1 
ATOM   3652  C  CA    . HIS E 1  114  ? 154.305 146.361 142.690 1.00 75.42  ?  113  HIS E CA    1 
ATOM   3653  C  C     . HIS E 1  114  ? 155.330 146.825 141.662 1.00 76.38  ?  113  HIS E C     1 
ATOM   3654  O  O     . HIS E 1  114  ? 155.015 147.655 140.802 1.00 76.56  ?  113  HIS E O     1 
ATOM   3655  C  CB    . HIS E 1  114  ? 154.323 147.283 143.910 1.00 75.11  ?  113  HIS E CB    1 
ATOM   3656  C  CG    . HIS E 1  114  ? 154.288 148.739 143.567 1.00 73.97  ?  113  HIS E CG    1 
ATOM   3657  N  ND1   . HIS E 1  114  ? 153.338 149.285 142.730 1.00 74.60  ?  113  HIS E ND1   1 
ATOM   3658  C  CD2   . HIS E 1  114  ? 155.087 149.764 143.947 1.00 74.27  ?  113  HIS E CD2   1 
ATOM   3659  C  CE1   . HIS E 1  114  ? 153.554 150.582 142.609 1.00 74.21  ?  113  HIS E CE1   1 
ATOM   3660  N  NE2   . HIS E 1  114  ? 154.609 150.899 143.338 1.00 73.78  ?  113  HIS E NE2   1 
ATOM   3661  N  N     . ALA E 1  115  ? 156.554 146.301 141.729 1.00 77.02  ?  114  ALA E N     1 
ATOM   3662  C  CA    . ALA E 1  115  ? 157.621 146.685 140.816 1.00 77.49  ?  114  ALA E CA    1 
ATOM   3663  C  C     . ALA E 1  115  ? 157.659 145.826 139.556 1.00 78.00  ?  114  ALA E C     1 
ATOM   3664  O  O     . ALA E 1  115  ? 158.685 145.806 138.865 1.00 77.74  ?  114  ALA E O     1 
ATOM   3665  C  CB    . ALA E 1  115  ? 158.972 146.628 141.532 1.00 77.50  ?  114  ALA E CB    1 
ATOM   3666  N  N     . LYS E 1  116  ? 156.568 145.122 139.246 1.00 78.46  ?  115  LYS E N     1 
ATOM   3667  C  CA    . LYS E 1  116  ? 156.477 144.274 138.055 1.00 79.00  ?  115  LYS E CA    1 
ATOM   3668  C  C     . LYS E 1  116  ? 157.586 143.224 138.029 1.00 78.95  ?  115  LYS E C     1 
ATOM   3669  O  O     . LYS E 1  116  ? 158.227 142.993 137.001 1.00 78.81  ?  115  LYS E O     1 
ATOM   3670  C  CB    . LYS E 1  116  ? 156.492 145.111 136.773 1.00 78.98  ?  115  LYS E CB    1 
ATOM   3671  C  CG    . LYS E 1  116  ? 155.242 145.948 136.568 1.00 80.72  ?  115  LYS E CG    1 
ATOM   3672  C  CD    . LYS E 1  116  ? 155.310 146.732 135.268 1.00 81.64  ?  115  LYS E CD    1 
ATOM   3673  C  CE    . LYS E 1  116  ? 154.005 147.463 134.998 1.00 83.37  ?  115  LYS E CE    1 
ATOM   3674  N  NZ    . LYS E 1  116  ? 153.648 148.399 136.099 1.00 82.59  ?  115  LYS E NZ    1 
ATOM   3675  N  N     . ARG E 1  117  ? 157.814 142.580 139.172 1.00 79.08  ?  116  ARG E N     1 
ATOM   3676  C  CA    . ARG E 1  117  ? 158.816 141.531 139.280 1.00 79.46  ?  116  ARG E CA    1 
ATOM   3677  C  C     . ARG E 1  117  ? 158.371 140.519 140.325 1.00 80.00  ?  116  ARG E C     1 
ATOM   3678  O  O     . ARG E 1  117  ? 157.501 140.792 141.156 1.00 80.48  ?  116  ARG E O     1 
ATOM   3679  C  CB    . ARG E 1  117  ? 160.198 142.097 139.638 1.00 79.24  ?  116  ARG E CB    1 
ATOM   3680  C  CG    . ARG E 1  117  ? 160.255 142.811 140.977 1.00 78.46  ?  116  ARG E CG    1 
ATOM   3681  C  CD    . ARG E 1  117  ? 161.692 143.039 141.416 1.00 78.32  ?  116  ARG E CD    1 
ATOM   3682  N  NE    . ARG E 1  117  ? 162.443 143.844 140.456 1.00 78.33  ?  116  ARG E NE    1 
ATOM   3683  C  CZ    . ARG E 1  117  ? 162.673 145.146 140.590 1.00 77.66  ?  116  ARG E CZ    1 
ATOM   3684  N  NH1   . ARG E 1  117  ? 162.212 145.797 141.649 1.00 77.26  ?  116  ARG E NH1   1 
ATOM   3685  N  NH2   . ARG E 1  117  ? 163.367 145.797 139.667 1.00 78.13  ?  116  ARG E NH2   1 
ATOM   3686  N  N     . VAL E 1  118  ? 158.977 139.336 140.268 1.00 80.41  ?  117  VAL E N     1 
ATOM   3687  C  CA    . VAL E 1  118  ? 158.673 138.270 141.211 1.00 80.93  ?  117  VAL E CA    1 
ATOM   3688  C  C     . VAL E 1  118  ? 159.830 137.987 142.163 1.00 81.30  ?  117  VAL E C     1 
ATOM   3689  O  O     . VAL E 1  118  ? 159.587 137.491 143.275 1.00 81.35  ?  117  VAL E O     1 
ATOM   3690  C  CB    . VAL E 1  118  ? 158.250 136.979 140.475 1.00 80.96  ?  117  VAL E CB    1 
ATOM   3691  C  CG1   . VAL E 1  118  ? 159.449 136.304 139.820 1.00 81.49  ?  117  VAL E CG1   1 
ATOM   3692  C  CG2   . VAL E 1  118  ? 157.528 136.026 141.419 1.00 80.82  ?  117  VAL E CG2   1 
ATOM   3693  N  N     . THR E 1  119  ? 161.066 138.300 141.781 1.00 81.91  ?  118  THR E N     1 
ATOM   3694  C  CA    . THR E 1  119  ? 162.216 138.075 142.644 1.00 82.48  ?  118  THR E CA    1 
ATOM   3695  C  C     . THR E 1  119  ? 162.352 139.222 143.637 1.00 82.67  ?  118  THR E C     1 
ATOM   3696  O  O     . THR E 1  119  ? 162.385 140.393 143.246 1.00 82.49  ?  118  THR E O     1 
ATOM   3697  C  CB    . THR E 1  119  ? 163.489 137.940 141.809 1.00 82.58  ?  118  THR E CB    1 
ATOM   3698  O  OG1   . THR E 1  119  ? 163.347 136.849 140.890 1.00 82.92  ?  118  THR E OG1   1 
ATOM   3699  C  CG2   . THR E 1  119  ? 164.687 137.682 142.704 1.00 83.41  ?  118  THR E CG2   1 
ATOM   3700  N  N     . ILE E 1  120  ? 162.427 138.882 144.927 1.00 83.33  ?  119  ILE E N     1 
ATOM   3701  C  CA    . ILE E 1  120  ? 162.524 139.907 145.961 1.00 84.35  ?  119  ILE E CA    1 
ATOM   3702  C  C     . ILE E 1  120  ? 163.925 140.510 145.979 1.00 84.95  ?  119  ILE E C     1 
ATOM   3703  O  O     . ILE E 1  120  ? 164.902 139.920 145.503 1.00 85.44  ?  119  ILE E O     1 
ATOM   3704  C  CB    . ILE E 1  120  ? 162.152 139.331 147.337 1.00 84.41  ?  119  ILE E CB    1 
ATOM   3705  C  CG1   . ILE E 1  120  ? 163.053 138.142 147.674 1.00 84.59  ?  119  ILE E CG1   1 
ATOM   3706  C  CG2   . ILE E 1  120  ? 160.690 138.919 147.364 1.00 85.14  ?  119  ILE E CG2   1 
ATOM   3707  C  CD1   . ILE E 1  120  ? 162.699 137.457 148.971 1.00 84.43  ?  119  ILE E CD1   1 
ATOM   3708  N  N     . MET E 1  121  ? 164.019 141.707 146.543 1.00 85.25  ?  120  MET E N     1 
ATOM   3709  C  CA    . MET E 1  121  ? 165.264 142.450 146.651 1.00 85.73  ?  120  MET E CA    1 
ATOM   3710  C  C     . MET E 1  121  ? 165.366 143.034 148.051 1.00 85.59  ?  120  MET E C     1 
ATOM   3711  O  O     . MET E 1  121  ? 164.349 143.226 148.725 1.00 85.75  ?  120  MET E O     1 
ATOM   3712  C  CB    . MET E 1  121  ? 165.342 143.572 145.605 1.00 85.78  ?  120  MET E CB    1 
ATOM   3713  C  CG    . MET E 1  121  ? 165.340 143.083 144.164 1.00 86.54  ?  120  MET E CG    1 
ATOM   3714  S  SD    . MET E 1  121  ? 166.751 142.028 143.779 1.00 87.11  ?  120  MET E SD    1 
ATOM   3715  C  CE    . MET E 1  121  ? 168.111 143.144 144.116 1.00 87.27  ?  120  MET E CE    1 
ATOM   3716  N  N     . PRO E 1  122  ? 166.586 143.313 148.523 1.00 85.47  ?  121  PRO E N     1 
ATOM   3717  C  CA    . PRO E 1  122  ? 166.725 143.941 149.848 1.00 84.99  ?  121  PRO E CA    1 
ATOM   3718  C  C     . PRO E 1  122  ? 166.038 145.291 149.953 1.00 84.54  ?  121  PRO E C     1 
ATOM   3719  O  O     . PRO E 1  122  ? 165.551 145.648 151.035 1.00 84.72  ?  121  PRO E O     1 
ATOM   3720  C  CB    . PRO E 1  122  ? 168.246 144.065 150.017 1.00 85.22  ?  121  PRO E CB    1 
ATOM   3721  C  CG    . PRO E 1  122  ? 168.812 143.007 149.129 1.00 85.25  ?  121  PRO E CG    1 
ATOM   3722  C  CD    . PRO E 1  122  ? 167.889 142.937 147.949 1.00 85.54  ?  121  PRO E CD    1 
ATOM   3723  N  N     . LYS E 1  123  ? 165.979 146.055 148.859 1.00 83.85  ?  122  LYS E N     1 
ATOM   3724  C  CA    . LYS E 1  123  ? 165.287 147.338 148.883 1.00 83.41  ?  122  LYS E CA    1 
ATOM   3725  C  C     . LYS E 1  123  ? 163.785 147.181 149.083 1.00 83.05  ?  122  LYS E C     1 
ATOM   3726  O  O     . LYS E 1  123  ? 163.119 148.149 149.463 1.00 83.17  ?  122  LYS E O     1 
ATOM   3727  C  CB    . LYS E 1  123  ? 165.569 148.116 147.596 1.00 83.32  ?  122  LYS E CB    1 
ATOM   3728  C  CG    . LYS E 1  123  ? 165.292 147.342 146.318 1.00 83.84  ?  122  LYS E CG    1 
ATOM   3729  C  CD    . LYS E 1  123  ? 165.560 148.200 145.092 1.00 85.39  ?  122  LYS E CD    1 
ATOM   3730  C  CE    . LYS E 1  123  ? 165.319 147.426 143.806 1.00 86.20  ?  122  LYS E CE    1 
ATOM   3731  N  NZ    . LYS E 1  123  ? 166.244 146.267 143.674 1.00 86.30  ?  122  LYS E NZ    1 
ATOM   3732  N  N     . ASP E 1  124  ? 163.238 145.989 148.832 1.00 82.33  ?  123  ASP E N     1 
ATOM   3733  C  CA    . ASP E 1  124  ? 161.835 145.742 149.149 1.00 81.83  ?  123  ASP E CA    1 
ATOM   3734  C  C     . ASP E 1  124  ? 161.628 145.623 150.653 1.00 81.43  ?  123  ASP E C     1 
ATOM   3735  O  O     . ASP E 1  124  ? 160.670 146.182 151.201 1.00 81.64  ?  123  ASP E O     1 
ATOM   3736  C  CB    . ASP E 1  124  ? 161.350 144.478 148.439 1.00 81.76  ?  123  ASP E CB    1 
ATOM   3737  C  CG    . ASP E 1  124  ? 161.484 144.567 146.932 1.00 81.87  ?  123  ASP E CG    1 
ATOM   3738  O  OD1   . ASP E 1  124  ? 161.258 145.662 146.377 1.00 80.17  ?  123  ASP E OD1   1 
ATOM   3739  O  OD2   . ASP E 1  124  ? 161.817 143.541 146.301 1.00 81.86  ?  123  ASP E OD2   1 
ATOM   3740  N  N     . ILE E 1  125  ? 162.517 144.898 151.337 1.00 80.60  ?  124  ILE E N     1 
ATOM   3741  C  CA    . ILE E 1  125  ? 162.426 144.783 152.789 1.00 79.71  ?  124  ILE E CA    1 
ATOM   3742  C  C     . ILE E 1  125  ? 162.699 146.128 153.448 1.00 79.35  ?  124  ILE E C     1 
ATOM   3743  O  O     . ILE E 1  125  ? 161.986 146.538 154.373 1.00 79.31  ?  124  ILE E O     1 
ATOM   3744  C  CB    . ILE E 1  125  ? 163.388 143.696 153.299 1.00 79.67  ?  124  ILE E CB    1 
ATOM   3745  C  CG1   . ILE E 1  125  ? 163.076 142.352 152.638 1.00 80.26  ?  124  ILE E CG1   1 
ATOM   3746  C  CG2   . ILE E 1  125  ? 163.307 143.578 154.814 1.00 79.16  ?  124  ILE E CG2   1 
ATOM   3747  C  CD1   . ILE E 1  125  ? 163.997 141.231 153.066 1.00 79.72  ?  124  ILE E CD1   1 
ATOM   3748  N  N     . GLN E 1  126  ? 163.733 146.837 152.984 1.00 78.96  ?  125  GLN E N     1 
ATOM   3749  C  CA    . GLN E 1  126  ? 164.011 148.167 153.518 1.00 78.63  ?  125  GLN E CA    1 
ATOM   3750  C  C     . GLN E 1  126  ? 162.871 149.134 153.226 1.00 78.10  ?  125  GLN E C     1 
ATOM   3751  O  O     . GLN E 1  126  ? 162.592 150.028 154.034 1.00 78.26  ?  125  GLN E O     1 
ATOM   3752  C  CB    . GLN E 1  126  ? 165.323 148.700 152.943 1.00 78.71  ?  125  GLN E CB    1 
ATOM   3753  C  CG    . GLN E 1  126  ? 166.539 147.858 153.290 1.00 78.98  ?  125  GLN E CG    1 
ATOM   3754  C  CD    . GLN E 1  126  ? 167.819 148.407 152.692 1.00 80.05  ?  125  GLN E CD    1 
ATOM   3755  O  OE1   . GLN E 1  126  ? 167.809 149.428 152.004 1.00 79.39  ?  125  GLN E OE1   1 
ATOM   3756  N  NE2   . GLN E 1  126  ? 168.932 147.730 152.952 1.00 80.67  ?  125  GLN E NE2   1 
ATOM   3757  N  N     . LEU E 1  127  ? 162.200 148.969 152.084 1.00 77.25  ?  126  LEU E N     1 
ATOM   3758  C  CA    . LEU E 1  127  ? 161.056 149.818 151.769 1.00 76.16  ?  126  LEU E CA    1 
ATOM   3759  C  C     . LEU E 1  127  ? 159.883 149.526 152.696 1.00 75.71  ?  126  LEU E C     1 
ATOM   3760  O  O     . LEU E 1  127  ? 159.218 150.452 153.174 1.00 75.95  ?  126  LEU E O     1 
ATOM   3761  C  CB    . LEU E 1  127  ? 160.644 149.629 150.310 1.00 75.85  ?  126  LEU E CB    1 
ATOM   3762  C  CG    . LEU E 1  127  ? 159.466 150.487 149.844 1.00 75.07  ?  126  LEU E CG    1 
ATOM   3763  C  CD1   . LEU E 1  127  ? 159.855 151.957 149.809 1.00 74.72  ?  126  LEU E CD1   1 
ATOM   3764  C  CD2   . LEU E 1  127  ? 158.961 150.025 148.487 1.00 74.75  ?  126  LEU E CD2   1 
ATOM   3765  N  N     . ALA E 1  128  ? 159.612 148.245 152.959 1.00 74.68  ?  127  ALA E N     1 
ATOM   3766  C  CA    . ALA E 1  128  ? 158.526 147.896 153.868 1.00 73.61  ?  127  ALA E CA    1 
ATOM   3767  C  C     . ALA E 1  128  ? 158.813 148.387 155.281 1.00 73.20  ?  127  ALA E C     1 
ATOM   3768  O  O     . ALA E 1  128  ? 157.918 148.901 155.963 1.00 73.21  ?  127  ALA E O     1 
ATOM   3769  C  CB    . ALA E 1  128  ? 158.297 146.385 153.859 1.00 73.44  ?  127  ALA E CB    1 
ATOM   3770  N  N     . ARG E 1  129  ? 160.061 148.243 155.736 1.00 72.89  ?  128  ARG E N     1 
ATOM   3771  C  CA    . ARG E 1  129  ? 160.427 148.739 157.057 1.00 72.16  ?  128  ARG E CA    1 
ATOM   3772  C  C     . ARG E 1  129  ? 160.366 150.260 157.125 1.00 72.01  ?  128  ARG E C     1 
ATOM   3773  O  O     . ARG E 1  129  ? 160.039 150.818 158.179 1.00 71.41  ?  128  ARG E O     1 
ATOM   3774  C  CB    . ARG E 1  129  ? 161.824 148.245 157.435 1.00 71.99  ?  128  ARG E CB    1 
ATOM   3775  C  CG    . ARG E 1  129  ? 161.916 146.741 157.645 1.00 71.61  ?  128  ARG E CG    1 
ATOM   3776  C  CD    . ARG E 1  129  ? 163.347 146.306 157.918 1.00 71.18  ?  128  ARG E CD    1 
ATOM   3777  N  NE    . ARG E 1  129  ? 163.946 147.054 159.019 1.00 69.78  ?  128  ARG E NE    1 
ATOM   3778  C  CZ    . ARG E 1  129  ? 163.890 146.683 160.294 1.00 69.29  ?  128  ARG E CZ    1 
ATOM   3779  N  NH1   . ARG E 1  129  ? 163.260 145.568 160.636 1.00 68.58  ?  128  ARG E NH1   1 
ATOM   3780  N  NH2   . ARG E 1  129  ? 164.465 147.428 161.228 1.00 69.45  ?  128  ARG E NH2   1 
ATOM   3781  N  N     . ARG E 1  130  ? 160.668 150.944 156.019 1.00 72.38  ?  129  ARG E N     1 
ATOM   3782  C  CA    . ARG E 1  130  ? 160.630 152.403 156.022 1.00 73.09  ?  129  ARG E CA    1 
ATOM   3783  C  C     . ARG E 1  130  ? 159.197 152.922 156.003 1.00 73.22  ?  129  ARG E C     1 
ATOM   3784  O  O     . ARG E 1  130  ? 158.881 153.913 156.671 1.00 73.20  ?  129  ARG E O     1 
ATOM   3785  C  CB    . ARG E 1  130  ? 161.417 152.950 154.830 1.00 73.20  ?  129  ARG E CB    1 
ATOM   3786  C  CG    . ARG E 1  130  ? 161.458 154.469 154.755 1.00 75.66  ?  129  ARG E CG    1 
ATOM   3787  C  CD    . ARG E 1  130  ? 162.090 155.068 156.002 1.00 79.48  ?  129  ARG E CD    1 
ATOM   3788  N  NE    . ARG E 1  130  ? 163.462 154.604 156.193 1.00 83.29  ?  129  ARG E NE    1 
ATOM   3789  C  CZ    . ARG E 1  130  ? 164.241 154.971 157.204 1.00 84.47  ?  129  ARG E CZ    1 
ATOM   3790  N  NH1   . ARG E 1  130  ? 163.788 155.811 158.125 1.00 85.49  ?  129  ARG E NH1   1 
ATOM   3791  N  NH2   . ARG E 1  130  ? 165.476 154.497 157.296 1.00 83.96  ?  129  ARG E NH2   1 
ATOM   3792  N  N     . ILE E 1  131  ? 158.317 152.266 155.246 1.00 73.63  ?  130  ILE E N     1 
ATOM   3793  C  CA    . ILE E 1  131  ? 156.932 152.718 155.153 1.00 74.40  ?  130  ILE E CA    1 
ATOM   3794  C  C     . ILE E 1  131  ? 156.157 152.360 156.415 1.00 74.88  ?  130  ILE E C     1 
ATOM   3795  O  O     . ILE E 1  131  ? 155.332 153.148 156.893 1.00 74.81  ?  130  ILE E O     1 
ATOM   3796  C  CB    . ILE E 1  131  ? 156.270 152.135 153.892 1.00 74.78  ?  130  ILE E CB    1 
ATOM   3797  C  CG1   . ILE E 1  131  ? 156.980 152.639 152.634 1.00 75.39  ?  130  ILE E CG1   1 
ATOM   3798  C  CG2   . ILE E 1  131  ? 154.794 152.495 153.846 1.00 74.53  ?  130  ILE E CG2   1 
ATOM   3799  C  CD1   . ILE E 1  131  ? 156.430 152.061 151.351 1.00 75.57  ?  130  ILE E CD1   1 
ATOM   3800  N  N     . ARG E 1  132  ? 156.407 151.175 156.978 1.00 75.66  ?  131  ARG E N     1 
ATOM   3801  C  CA    . ARG E 1  132  ? 155.699 150.774 158.190 1.00 76.37  ?  131  ARG E CA    1 
ATOM   3802  C  C     . ARG E 1  132  ? 156.052 151.682 159.362 1.00 77.78  ?  131  ARG E C     1 
ATOM   3803  O  O     . ARG E 1  132  ? 155.199 151.980 160.206 1.00 78.14  ?  131  ARG E O     1 
ATOM   3804  C  CB    . ARG E 1  132  ? 156.007 149.312 158.520 1.00 76.12  ?  131  ARG E CB    1 
ATOM   3805  C  CG    . ARG E 1  132  ? 155.391 148.826 159.823 1.00 74.58  ?  131  ARG E CG    1 
ATOM   3806  C  CD    . ARG E 1  132  ? 155.346 147.307 159.891 1.00 74.14  ?  131  ARG E CD    1 
ATOM   3807  N  NE    . ARG E 1  132  ? 154.390 146.749 158.940 1.00 74.54  ?  131  ARG E NE    1 
ATOM   3808  C  CZ    . ARG E 1  132  ? 154.100 145.455 158.842 1.00 74.47  ?  131  ARG E CZ    1 
ATOM   3809  N  NH1   . ARG E 1  132  ? 154.693 144.578 159.639 1.00 73.86  ?  131  ARG E NH1   1 
ATOM   3810  N  NH2   . ARG E 1  132  ? 153.215 145.039 157.947 1.00 73.97  ?  131  ARG E NH2   1 
ATOM   3811  N  N     . GLY E 1  133  ? 157.300 152.141 159.424 1.00 79.65  ?  132  GLY E N     1 
ATOM   3812  C  CA    . GLY E 1  133  ? 157.739 153.056 160.455 1.00 81.55  ?  132  GLY E CA    1 
ATOM   3813  C  C     . GLY E 1  133  ? 158.573 152.430 161.552 1.00 82.80  ?  132  GLY E C     1 
ATOM   3814  O  O     . GLY E 1  133  ? 159.114 153.164 162.388 1.00 83.27  ?  132  GLY E O     1 
ATOM   3815  N  N     . GLU E 1  134  ? 158.693 151.103 161.576 1.00 83.99  ?  133  GLU E N     1 
ATOM   3816  C  CA    . GLU E 1  134  ? 159.482 150.430 162.599 1.00 85.22  ?  133  GLU E CA    1 
ATOM   3817  C  C     . GLU E 1  134  ? 160.983 150.585 162.383 1.00 86.69  ?  133  GLU E C     1 
ATOM   3818  O  O     . GLU E 1  134  ? 161.755 150.327 163.313 1.00 86.70  ?  133  GLU E O     1 
ATOM   3819  C  CB    . GLU E 1  134  ? 159.114 148.944 162.648 1.00 84.85  ?  133  GLU E CB    1 
ATOM   3820  C  CG    . GLU E 1  134  ? 159.477 148.246 163.951 1.00 84.65  ?  133  GLU E CG    1 
ATOM   3821  C  CD    . GLU E 1  134  ? 158.650 148.731 165.128 1.00 84.72  ?  133  GLU E CD    1 
ATOM   3822  O  OE1   . GLU E 1  134  ? 157.546 149.272 164.902 1.00 83.93  ?  133  GLU E OE1   1 
ATOM   3823  O  OE2   . GLU E 1  134  ? 159.105 148.573 166.280 1.00 83.72  ?  133  GLU E OE2   1 
ATOM   3824  N  N     . ARG E 1  135  ? 161.410 151.001 161.193 1.00 88.25  ?  134  ARG E N     1 
ATOM   3825  C  CA    . ARG E 1  135  ? 162.828 151.185 160.903 1.00 89.96  ?  134  ARG E CA    1 
ATOM   3826  C  C     . ARG E 1  135  ? 163.366 152.359 161.711 1.00 90.44  ?  134  ARG E C     1 
ATOM   3827  O  O     . ARG E 1  135  ? 163.008 153.514 161.458 1.00 89.96  ?  134  ARG E O     1 
ATOM   3828  C  CB    . ARG E 1  135  ? 163.033 151.411 159.408 1.00 90.25  ?  134  ARG E CB    1 
ATOM   3829  C  CG    . ARG E 1  135  ? 164.483 151.610 158.998 1.00 93.25  ?  134  ARG E CG    1 
ATOM   3830  C  CD    . ARG E 1  135  ? 165.314 150.370 159.286 1.00 96.79  ?  134  ARG E CD    1 
ATOM   3831  N  NE    . ARG E 1  135  ? 166.695 150.524 158.839 1.00 99.48  ?  134  ARG E NE    1 
ATOM   3832  C  CZ    . ARG E 1  135  ? 167.124 150.214 157.620 1.00 100.97 ?  134  ARG E CZ    1 
ATOM   3833  N  NH1   . ARG E 1  135  ? 166.279 149.732 156.720 1.00 101.12 ?  134  ARG E NH1   1 
ATOM   3834  N  NH2   . ARG E 1  135  ? 168.400 150.387 157.300 1.00 100.98 ?  134  ARG E NH2   1 
ATOM   3835  N  N     . ALA E 1  136  ? 164.223 152.068 162.685 1.00 91.24  ?  135  ALA E N     1 
ATOM   3836  C  CA    . ALA E 1  136  ? 164.805 153.105 163.528 1.00 91.70  ?  135  ALA E CA    1 
ATOM   3837  C  C     . ALA E 1  136  ? 165.969 153.792 162.821 1.00 92.00  ?  135  ALA E C     1 
ATOM   3838  O  O     . ALA E 1  136  ? 166.541 153.255 161.873 1.00 92.54  ?  135  ALA E O     1 
ATOM   3839  C  CB    . ALA E 1  136  ? 165.261 152.517 164.854 1.00 91.92  ?  135  ALA E CB    1 
ATOM   3840  O  OXT   . ALA E 1  136  ? 166.366 154.900 163.183 1.00 91.76  ?  135  ALA E OXT   1 
ATOM   3841  N  N     . ASN F 2  26   ? 175.785 131.595 167.075 1.00 107.16 ?  25   ASN F N     1 
ATOM   3842  C  CA    . ASN F 2  26   ? 175.025 130.543 166.410 1.00 107.24 ?  25   ASN F CA    1 
ATOM   3843  C  C     . ASN F 2  26   ? 174.045 131.129 165.399 1.00 107.26 ?  25   ASN F C     1 
ATOM   3844  O  O     . ASN F 2  26   ? 172.900 130.689 165.303 1.00 106.90 ?  25   ASN F O     1 
ATOM   3845  C  CB    . ASN F 2  26   ? 174.276 129.691 167.437 1.00 107.31 ?  25   ASN F CB    1 
ATOM   3846  C  CG    . ASN F 2  26   ? 175.212 128.967 168.385 1.00 107.50 ?  25   ASN F CG    1 
ATOM   3847  O  OD1   . ASN F 2  26   ? 176.310 128.562 168.002 1.00 108.26 ?  25   ASN F OD1   1 
ATOM   3848  N  ND2   . ASN F 2  26   ? 174.782 128.801 169.630 1.00 106.96 ?  25   ASN F ND2   1 
ATOM   3849  N  N     . ILE F 2  27   ? 174.507 132.129 164.644 1.00 107.34 ?  26   ILE F N     1 
ATOM   3850  C  CA    . ILE F 2  27   ? 173.662 132.750 163.632 1.00 107.42 ?  26   ILE F CA    1 
ATOM   3851  C  C     . ILE F 2  27   ? 173.453 131.826 162.438 1.00 107.54 ?  26   ILE F C     1 
ATOM   3852  O  O     . ILE F 2  27   ? 172.479 131.989 161.694 1.00 107.58 ?  26   ILE F O     1 
ATOM   3853  C  CB    . ILE F 2  27   ? 174.266 134.100 163.196 1.00 107.39 ?  26   ILE F CB    1 
ATOM   3854  C  CG1   . ILE F 2  27   ? 173.255 134.914 162.384 1.00 107.27 ?  26   ILE F CG1   1 
ATOM   3855  C  CG2   . ILE F 2  27   ? 175.549 133.887 162.405 1.00 107.60 ?  26   ILE F CG2   1 
ATOM   3856  C  CD1   . ILE F 2  27   ? 171.985 135.241 163.140 1.00 106.63 ?  26   ILE F CD1   1 
ATOM   3857  N  N     . GLN F 2  28   ? 174.334 130.845 162.244 1.00 107.77 ?  27   GLN F N     1 
ATOM   3858  C  CA    . GLN F 2  28   ? 174.217 129.904 161.138 1.00 107.97 ?  27   GLN F CA    1 
ATOM   3859  C  C     . GLN F 2  28   ? 173.128 128.859 161.362 1.00 108.04 ?  27   GLN F C     1 
ATOM   3860  O  O     . GLN F 2  28   ? 172.877 128.048 160.464 1.00 108.17 ?  27   GLN F O     1 
ATOM   3861  C  CB    . GLN F 2  28   ? 175.565 129.213 160.901 1.00 107.99 ?  27   GLN F CB    1 
ATOM   3862  C  CG    . GLN F 2  28   ? 175.756 128.647 159.498 1.00 108.55 ?  27   GLN F CG    1 
ATOM   3863  C  CD    . GLN F 2  28   ? 175.828 129.726 158.433 1.00 109.55 ?  27   GLN F CD    1 
ATOM   3864  O  OE1   . GLN F 2  28   ? 176.120 130.886 158.724 1.00 110.17 ?  27   GLN F OE1   1 
ATOM   3865  N  NE2   . GLN F 2  28   ? 175.560 129.347 157.189 1.00 109.73 ?  27   GLN F NE2   1 
ATOM   3866  N  N     . GLY F 2  29   ? 172.478 128.861 162.528 1.00 108.14 ?  28   GLY F N     1 
ATOM   3867  C  CA    . GLY F 2  29   ? 171.423 127.890 162.776 1.00 108.18 ?  28   GLY F CA    1 
ATOM   3868  C  C     . GLY F 2  29   ? 170.244 128.051 161.836 1.00 108.14 ?  28   GLY F C     1 
ATOM   3869  O  O     . GLY F 2  29   ? 169.642 127.064 161.405 1.00 108.27 ?  28   GLY F O     1 
ATOM   3870  N  N     . ILE F 2  30   ? 169.898 129.294 161.505 1.00 107.91 ?  29   ILE F N     1 
ATOM   3871  C  CA    . ILE F 2  30   ? 168.826 129.568 160.556 1.00 107.50 ?  29   ILE F CA    1 
ATOM   3872  C  C     . ILE F 2  30   ? 169.321 129.238 159.155 1.00 107.38 ?  29   ILE F C     1 
ATOM   3873  O  O     . ILE F 2  30   ? 170.014 130.043 158.522 1.00 107.42 ?  29   ILE F O     1 
ATOM   3874  C  CB    . ILE F 2  30   ? 168.351 131.029 160.650 1.00 107.41 ?  29   ILE F CB    1 
ATOM   3875  C  CG1   . ILE F 2  30   ? 167.926 131.359 162.083 1.00 107.17 ?  29   ILE F CG1   1 
ATOM   3876  C  CG2   . ILE F 2  30   ? 167.205 131.280 159.684 1.00 107.45 ?  29   ILE F CG2   1 
ATOM   3877  C  CD1   . ILE F 2  30   ? 167.455 132.785 162.267 1.00 107.00 ?  29   ILE F CD1   1 
ATOM   3878  N  N     . THR F 2  31   ? 168.973 128.052 158.664 1.00 107.14 ?  30   THR F N     1 
ATOM   3879  C  CA    . THR F 2  31   ? 169.464 127.583 157.378 1.00 106.90 ?  30   THR F CA    1 
ATOM   3880  C  C     . THR F 2  31   ? 168.647 128.188 156.237 1.00 106.77 ?  30   THR F C     1 
ATOM   3881  O  O     . THR F 2  31   ? 167.724 128.981 156.442 1.00 106.83 ?  30   THR F O     1 
ATOM   3882  C  CB    . THR F 2  31   ? 169.431 126.057 157.322 1.00 106.83 ?  30   THR F CB    1 
ATOM   3883  O  OG1   . THR F 2  31   ? 168.085 125.599 157.503 1.00 107.20 ?  30   THR F OG1   1 
ATOM   3884  C  CG2   . THR F 2  31   ? 170.313 125.465 158.411 1.00 106.67 ?  30   THR F CG2   1 
ATOM   3885  N  N     . LYS F 2  32   ? 169.002 127.801 155.007 1.00 106.44 ?  31   LYS F N     1 
ATOM   3886  C  CA    . LYS F 2  32   ? 168.282 128.310 153.840 1.00 106.30 ?  31   LYS F CA    1 
ATOM   3887  C  C     . LYS F 2  32   ? 166.867 127.750 153.738 1.00 106.07 ?  31   LYS F C     1 
ATOM   3888  O  O     . LYS F 2  32   ? 165.937 128.535 153.486 1.00 106.27 ?  31   LYS F O     1 
ATOM   3889  C  CB    . LYS F 2  32   ? 169.097 128.038 152.571 1.00 106.42 ?  31   LYS F CB    1 
ATOM   3890  C  CG    . LYS F 2  32   ? 169.098 129.179 151.559 1.00 106.81 ?  31   LYS F CG    1 
ATOM   3891  C  CD    . LYS F 2  32   ? 167.737 129.364 150.905 1.00 107.84 ?  31   LYS F CD    1 
ATOM   3892  C  CE    . LYS F 2  32   ? 167.753 130.517 149.914 1.00 108.55 ?  31   LYS F CE    1 
ATOM   3893  N  NZ    . LYS F 2  32   ? 168.749 130.302 148.828 1.00 108.55 ?  31   LYS F NZ    1 
ATOM   3894  N  N     . PRO F 2  33   ? 166.621 126.442 153.903 1.00 105.82 ?  32   PRO F N     1 
ATOM   3895  C  CA    . PRO F 2  33   ? 165.238 125.948 153.779 1.00 105.55 ?  32   PRO F CA    1 
ATOM   3896  C  C     . PRO F 2  33   ? 164.277 126.528 154.804 1.00 105.24 ?  32   PRO F C     1 
ATOM   3897  O  O     . PRO F 2  33   ? 163.061 126.473 154.584 1.00 105.42 ?  32   PRO F O     1 
ATOM   3898  C  CB    . PRO F 2  33   ? 165.387 124.429 153.948 1.00 105.53 ?  32   PRO F CB    1 
ATOM   3899  C  CG    . PRO F 2  33   ? 166.688 124.245 154.642 1.00 105.70 ?  32   PRO F CG    1 
ATOM   3900  C  CD    . PRO F 2  33   ? 167.564 125.328 154.110 1.00 105.81 ?  32   PRO F CD    1 
ATOM   3901  N  N     . ALA F 2  34   ? 164.774 127.077 155.914 1.00 104.77 ?  33   ALA F N     1 
ATOM   3902  C  CA    . ALA F 2  34   ? 163.887 127.732 156.871 1.00 104.29 ?  33   ALA F CA    1 
ATOM   3903  C  C     . ALA F 2  34   ? 163.297 129.007 156.280 1.00 103.98 ?  33   ALA F C     1 
ATOM   3904  O  O     . ALA F 2  34   ? 162.073 129.181 156.244 1.00 103.88 ?  33   ALA F O     1 
ATOM   3905  C  CB    . ALA F 2  34   ? 164.640 128.032 158.167 1.00 104.25 ?  33   ALA F CB    1 
ATOM   3906  N  N     . ILE F 2  35   ? 164.159 129.911 155.805 1.00 103.42 ?  34   ILE F N     1 
ATOM   3907  C  CA    . ILE F 2  35   ? 163.696 131.115 155.128 1.00 102.77 ?  34   ILE F CA    1 
ATOM   3908  C  C     . ILE F 2  35   ? 162.959 130.771 153.842 1.00 102.51 ?  34   ILE F C     1 
ATOM   3909  O  O     . ILE F 2  35   ? 162.109 131.544 153.387 1.00 102.54 ?  34   ILE F O     1 
ATOM   3910  C  CB    . ILE F 2  35   ? 164.887 132.060 154.860 1.00 102.82 ?  34   ILE F CB    1 
ATOM   3911  C  CG1   . ILE F 2  35   ? 165.694 132.268 156.142 1.00 102.43 ?  34   ILE F CG1   1 
ATOM   3912  C  CG2   . ILE F 2  35   ? 164.409 133.403 154.328 1.00 102.62 ?  34   ILE F CG2   1 
ATOM   3913  C  CD1   . ILE F 2  35   ? 164.901 132.903 157.263 1.00 102.63 ?  34   ILE F CD1   1 
ATOM   3914  N  N     . ARG F 2  36   ? 163.258 129.616 153.245 1.00 102.07 ?  35   ARG F N     1 
ATOM   3915  C  CA    . ARG F 2  36   ? 162.514 129.172 152.071 1.00 101.94 ?  35   ARG F CA    1 
ATOM   3916  C  C     . ARG F 2  36   ? 161.074 128.833 152.436 1.00 101.58 ?  35   ARG F C     1 
ATOM   3917  O  O     . ARG F 2  36   ? 160.133 129.272 151.764 1.00 101.60 ?  35   ARG F O     1 
ATOM   3918  C  CB    . ARG F 2  36   ? 163.209 127.968 151.434 1.00 101.79 ?  35   ARG F CB    1 
ATOM   3919  C  CG    . ARG F 2  36   ? 162.520 127.440 150.187 1.00 102.22 ?  35   ARG F CG    1 
ATOM   3920  C  CD    . ARG F 2  36   ? 162.539 128.469 149.069 1.00 102.57 ?  35   ARG F CD    1 
ATOM   3921  N  NE    . ARG F 2  36   ? 163.900 128.849 148.702 1.00 104.00 ?  35   ARG F NE    1 
ATOM   3922  C  CZ    . ARG F 2  36   ? 164.629 128.224 147.782 1.00 104.67 ?  35   ARG F CZ    1 
ATOM   3923  N  NH1   . ARG F 2  36   ? 165.859 128.640 147.513 1.00 104.18 ?  35   ARG F NH1   1 
ATOM   3924  N  NH2   . ARG F 2  36   ? 164.128 127.183 147.131 1.00 105.43 ?  35   ARG F NH2   1 
ATOM   3925  N  N     . ARG F 2  37   ? 160.882 128.051 153.502 1.00 101.02 ?  36   ARG F N     1 
ATOM   3926  C  CA    . ARG F 2  37   ? 159.531 127.716 153.940 1.00 100.44 ?  36   ARG F CA    1 
ATOM   3927  C  C     . ARG F 2  37   ? 158.785 128.954 154.422 1.00 99.92  ?  36   ARG F C     1 
ATOM   3928  O  O     . ARG F 2  37   ? 157.573 129.077 154.208 1.00 100.05 ?  36   ARG F O     1 
ATOM   3929  C  CB    . ARG F 2  37   ? 159.579 126.654 155.038 1.00 100.46 ?  36   ARG F CB    1 
ATOM   3930  C  CG    . ARG F 2  37   ? 160.057 125.290 154.566 1.00 101.15 ?  36   ARG F CG    1 
ATOM   3931  C  CD    . ARG F 2  37   ? 160.019 124.268 155.692 1.00 101.77 ?  36   ARG F CD    1 
ATOM   3932  N  NE    . ARG F 2  37   ? 160.887 124.639 156.806 1.00 102.42 ?  36   ARG F NE    1 
ATOM   3933  C  CZ    . ARG F 2  37   ? 162.159 124.270 156.918 1.00 103.16 ?  36   ARG F CZ    1 
ATOM   3934  N  NH1   . ARG F 2  37   ? 162.717 123.516 155.981 1.00 103.38 ?  36   ARG F NH1   1 
ATOM   3935  N  NH2   . ARG F 2  37   ? 162.873 124.654 157.967 1.00 102.91 ?  36   ARG F NH2   1 
ATOM   3936  N  N     . LEU F 2  38   ? 159.490 129.880 155.078 1.00 99.28  ?  37   LEU F N     1 
ATOM   3937  C  CA    . LEU F 2  38   ? 158.868 131.147 155.445 1.00 98.42  ?  37   LEU F CA    1 
ATOM   3938  C  C     . LEU F 2  38   ? 158.473 131.947 154.211 1.00 98.33  ?  37   LEU F C     1 
ATOM   3939  O  O     . LEU F 2  38   ? 157.467 132.666 154.230 1.00 98.45  ?  37   LEU F O     1 
ATOM   3940  C  CB    . LEU F 2  38   ? 159.812 131.963 156.330 1.00 98.08  ?  37   LEU F CB    1 
ATOM   3941  C  CG    . LEU F 2  38   ? 160.120 131.400 157.719 1.00 97.21  ?  37   LEU F CG    1 
ATOM   3942  C  CD1   . LEU F 2  38   ? 161.131 132.279 158.439 1.00 96.77  ?  37   LEU F CD1   1 
ATOM   3943  C  CD2   . LEU F 2  38   ? 158.847 131.265 158.539 1.00 96.99  ?  37   LEU F CD2   1 
ATOM   3944  N  N     . ALA F 2  39   ? 159.247 131.829 153.129 1.00 97.99  ?  38   ALA F N     1 
ATOM   3945  C  CA    . ALA F 2  39   ? 158.904 132.519 151.890 1.00 97.67  ?  38   ALA F CA    1 
ATOM   3946  C  C     . ALA F 2  39   ? 157.689 131.886 151.225 1.00 97.37  ?  38   ALA F C     1 
ATOM   3947  O  O     . ALA F 2  39   ? 156.859 132.590 150.638 1.00 97.68  ?  38   ALA F O     1 
ATOM   3948  C  CB    . ALA F 2  39   ? 160.100 132.516 150.939 1.00 97.74  ?  38   ALA F CB    1 
ATOM   3949  N  N     . ARG F 2  40   ? 157.569 130.559 151.300 1.00 96.84  ?  39   ARG F N     1 
ATOM   3950  C  CA    . ARG F 2  40   ? 156.396 129.899 150.735 1.00 96.29  ?  39   ARG F CA    1 
ATOM   3951  C  C     . ARG F 2  40   ? 155.150 130.206 151.555 1.00 95.90  ?  39   ARG F C     1 
ATOM   3952  O  O     . ARG F 2  40   ? 154.058 130.370 150.998 1.00 96.05  ?  39   ARG F O     1 
ATOM   3953  C  CB    . ARG F 2  40   ? 156.627 128.391 150.645 1.00 96.33  ?  39   ARG F CB    1 
ATOM   3954  C  CG    . ARG F 2  40   ? 157.878 127.995 149.876 1.00 96.58  ?  39   ARG F CG    1 
ATOM   3955  C  CD    . ARG F 2  40   ? 157.981 128.743 148.556 1.00 96.28  ?  39   ARG F CD    1 
ATOM   3956  N  NE    . ARG F 2  40   ? 159.216 128.427 147.844 1.00 96.46  ?  39   ARG F NE    1 
ATOM   3957  C  CZ    . ARG F 2  40   ? 159.649 129.083 146.773 1.00 96.97  ?  39   ARG F CZ    1 
ATOM   3958  N  NH1   . ARG F 2  40   ? 158.949 130.100 146.289 1.00 96.75  ?  39   ARG F NH1   1 
ATOM   3959  N  NH2   . ARG F 2  40   ? 160.784 128.726 146.188 1.00 97.53  ?  39   ARG F NH2   1 
ATOM   3960  N  N     . ARG F 2  41   ? 155.291 130.291 152.880 1.00 95.32  ?  40   ARG F N     1 
ATOM   3961  C  CA    . ARG F 2  41   ? 154.161 130.696 153.708 1.00 94.94  ?  40   ARG F CA    1 
ATOM   3962  C  C     . ARG F 2  41   ? 153.796 132.156 153.471 1.00 95.00  ?  40   ARG F C     1 
ATOM   3963  O  O     . ARG F 2  41   ? 152.620 132.524 153.568 1.00 94.87  ?  40   ARG F O     1 
ATOM   3964  C  CB    . ARG F 2  41   ? 154.473 130.449 155.185 1.00 94.80  ?  40   ARG F CB    1 
ATOM   3965  C  CG    . ARG F 2  41   ? 153.333 130.798 156.130 1.00 94.15  ?  40   ARG F CG    1 
ATOM   3966  C  CD    . ARG F 2  41   ? 153.564 130.226 157.519 1.00 94.63  ?  40   ARG F CD    1 
ATOM   3967  N  NE    . ARG F 2  41   ? 153.560 128.766 157.511 1.00 95.44  ?  40   ARG F NE    1 
ATOM   3968  C  CZ    . ARG F 2  41   ? 153.678 128.012 158.599 1.00 96.09  ?  40   ARG F CZ    1 
ATOM   3969  N  NH1   . ARG F 2  41   ? 153.811 128.580 159.790 1.00 95.73  ?  40   ARG F NH1   1 
ATOM   3970  N  NH2   . ARG F 2  41   ? 153.664 126.690 158.497 1.00 96.44  ?  40   ARG F NH2   1 
ATOM   3971  N  N     . GLY F 2  42   ? 154.783 132.996 153.152 1.00 95.21  ?  41   GLY F N     1 
ATOM   3972  C  CA    . GLY F 2  42   ? 154.488 134.379 152.822 1.00 95.39  ?  41   GLY F CA    1 
ATOM   3973  C  C     . GLY F 2  42   ? 153.788 134.536 151.487 1.00 95.40  ?  41   GLY F C     1 
ATOM   3974  O  O     . GLY F 2  42   ? 152.959 135.436 151.321 1.00 95.70  ?  41   GLY F O     1 
ATOM   3975  N  N     . GLY F 2  43   ? 154.102 133.673 150.524 1.00 95.37  ?  42   GLY F N     1 
ATOM   3976  C  CA    . GLY F 2  43   ? 153.462 133.729 149.226 1.00 95.67  ?  42   GLY F CA    1 
ATOM   3977  C  C     . GLY F 2  43   ? 154.352 134.287 148.135 1.00 96.06  ?  42   GLY F C     1 
ATOM   3978  O  O     . GLY F 2  43   ? 153.959 135.208 147.414 1.00 95.84  ?  42   GLY F O     1 
ATOM   3979  N  N     . VAL F 2  44   ? 155.555 133.735 148.003 1.00 96.50  ?  43   VAL F N     1 
ATOM   3980  C  CA    . VAL F 2  44   ? 156.516 134.150 146.988 1.00 97.16  ?  43   VAL F CA    1 
ATOM   3981  C  C     . VAL F 2  44   ? 156.799 132.961 146.082 1.00 97.39  ?  43   VAL F C     1 
ATOM   3982  O  O     . VAL F 2  44   ? 157.017 131.844 146.566 1.00 97.40  ?  43   VAL F O     1 
ATOM   3983  C  CB    . VAL F 2  44   ? 157.817 134.680 147.618 1.00 97.18  ?  43   VAL F CB    1 
ATOM   3984  C  CG1   . VAL F 2  44   ? 158.764 135.194 146.542 1.00 97.50  ?  43   VAL F CG1   1 
ATOM   3985  C  CG2   . VAL F 2  44   ? 157.513 135.772 148.629 1.00 97.48  ?  43   VAL F CG2   1 
ATOM   3986  N  N     . LYS F 2  45   ? 156.797 133.202 144.769 1.00 97.60  ?  44   LYS F N     1 
ATOM   3987  C  CA    . LYS F 2  45   ? 157.075 132.131 143.818 1.00 97.98  ?  44   LYS F CA    1 
ATOM   3988  C  C     . LYS F 2  45   ? 158.574 131.910 143.642 1.00 98.19  ?  44   LYS F C     1 
ATOM   3989  O  O     . LYS F 2  45   ? 159.026 130.764 143.543 1.00 98.18  ?  44   LYS F O     1 
ATOM   3990  C  CB    . LYS F 2  45   ? 156.417 132.441 142.472 1.00 97.92  ?  44   LYS F CB    1 
ATOM   3991  C  CG    . LYS F 2  45   ? 156.599 131.353 141.422 1.00 98.15  ?  44   LYS F CG    1 
ATOM   3992  C  CD    . LYS F 2  45   ? 155.834 131.672 140.146 1.00 98.39  ?  44   LYS F CD    1 
ATOM   3993  C  CE    . LYS F 2  45   ? 156.309 132.977 139.532 1.00 98.95  ?  44   LYS F CE    1 
ATOM   3994  N  NZ    . LYS F 2  45   ? 157.765 132.941 139.223 1.00 99.28  ?  44   LYS F NZ    1 
ATOM   3995  N  N     . ARG F 2  46   ? 159.358 132.987 143.607 1.00 98.17  ?  45   ARG F N     1 
ATOM   3996  C  CA    . ARG F 2  46   ? 160.801 132.886 143.428 1.00 98.25  ?  45   ARG F CA    1 
ATOM   3997  C  C     . ARG F 2  46   ? 161.484 133.994 144.217 1.00 97.54  ?  45   ARG F C     1 
ATOM   3998  O  O     . ARG F 2  46   ? 161.084 135.158 144.128 1.00 97.27  ?  45   ARG F O     1 
ATOM   3999  C  CB    . ARG F 2  46   ? 161.180 132.977 141.946 1.00 98.38  ?  45   ARG F CB    1 
ATOM   4000  C  CG    . ARG F 2  46   ? 162.671 132.864 141.673 1.00 99.16  ?  45   ARG F CG    1 
ATOM   4001  C  CD    . ARG F 2  46   ? 162.969 132.972 140.185 1.00 99.49  ?  45   ARG F CD    1 
ATOM   4002  N  NE    . ARG F 2  46   ? 164.398 132.867 139.904 1.00 102.73 ?  45   ARG F NE    1 
ATOM   4003  C  CZ    . ARG F 2  46   ? 164.927 132.929 138.687 1.00 104.39 ?  45   ARG F CZ    1 
ATOM   4004  N  NH1   . ARG F 2  46   ? 164.144 133.096 137.629 1.00 105.38 ?  45   ARG F NH1   1 
ATOM   4005  N  NH2   . ARG F 2  46   ? 166.239 132.823 138.525 1.00 105.52 ?  45   ARG F NH2   1 
ATOM   4006  N  N     . ILE F 2  47   ? 162.515 133.628 144.979 1.00 96.97  ?  46   ILE F N     1 
ATOM   4007  C  CA    . ILE F 2  47   ? 163.255 134.584 145.797 1.00 96.49  ?  46   ILE F CA    1 
ATOM   4008  C  C     . ILE F 2  47   ? 164.627 134.823 145.180 1.00 96.04  ?  46   ILE F C     1 
ATOM   4009  O  O     . ILE F 2  47   ? 164.929 134.317 144.094 1.00 96.03  ?  46   ILE F O     1 
ATOM   4010  C  CB    . ILE F 2  47   ? 163.383 134.093 147.251 1.00 96.56  ?  46   ILE F CB    1 
ATOM   4011  C  CG1   . ILE F 2  47   ? 164.148 132.770 147.302 1.00 96.72  ?  46   ILE F CG1   1 
ATOM   4012  C  CG2   . ILE F 2  47   ? 162.009 133.943 147.886 1.00 96.59  ?  46   ILE F CG2   1 
ATOM   4013  C  CD1   . ILE F 2  47   ? 164.353 132.233 148.703 1.00 97.67  ?  46   ILE F CD1   1 
ATOM   4014  N  N     . SER F 2  48   ? 165.468 135.596 145.868 1.00 95.33  ?  47   SER F N     1 
ATOM   4015  C  CA    . SER F 2  48   ? 166.801 135.902 145.362 1.00 94.75  ?  47   SER F CA    1 
ATOM   4016  C  C     . SER F 2  48   ? 167.858 135.085 146.095 1.00 94.40  ?  47   SER F C     1 
ATOM   4017  O  O     . SER F 2  48   ? 167.621 133.925 146.449 1.00 94.61  ?  47   SER F O     1 
ATOM   4018  C  CB    . SER F 2  48   ? 167.089 137.401 145.487 1.00 94.74  ?  47   SER F CB    1 
ATOM   4019  O  OG    . SER F 2  48   ? 168.384 137.728 145.011 1.00 94.69  ?  47   SER F OG    1 
ATOM   4020  N  N     . GLY F 2  49   ? 169.026 135.675 146.326 1.00 93.93  ?  48   GLY F N     1 
ATOM   4021  C  CA    . GLY F 2  49   ? 170.102 134.955 146.974 1.00 93.52  ?  48   GLY F CA    1 
ATOM   4022  C  C     . GLY F 2  49   ? 170.511 135.547 148.304 1.00 93.35  ?  48   GLY F C     1 
ATOM   4023  O  O     . GLY F 2  49   ? 170.349 134.916 149.353 1.00 93.29  ?  48   GLY F O     1 
ATOM   4024  N  N     . LEU F 2  50   ? 171.051 136.763 148.278 1.00 93.23  ?  49   LEU F N     1 
ATOM   4025  C  CA    . LEU F 2  50   ? 171.485 137.426 149.503 1.00 93.09  ?  49   LEU F CA    1 
ATOM   4026  C  C     . LEU F 2  50   ? 170.296 138.132 150.159 1.00 92.98  ?  49   LEU F C     1 
ATOM   4027  O  O     . LEU F 2  50   ? 170.212 139.355 150.250 1.00 93.10  ?  49   LEU F O     1 
ATOM   4028  C  CB    . LEU F 2  50   ? 172.638 138.373 149.201 1.00 93.16  ?  49   LEU F CB    1 
ATOM   4029  C  CG    . LEU F 2  50   ? 173.825 137.578 148.636 1.00 92.65  ?  49   LEU F CG    1 
ATOM   4030  C  CD1   . LEU F 2  50   ? 174.989 138.477 148.275 1.00 92.30  ?  49   LEU F CD1   1 
ATOM   4031  C  CD2   . LEU F 2  50   ? 174.283 136.481 149.599 1.00 93.50  ?  49   LEU F CD2   1 
ATOM   4032  N  N     . ILE F 2  51   ? 169.355 137.305 150.612 1.00 92.62  ?  50   ILE F N     1 
ATOM   4033  C  CA    . ILE F 2  51   ? 168.141 137.771 151.263 1.00 92.30  ?  50   ILE F CA    1 
ATOM   4034  C  C     . ILE F 2  51   ? 168.053 137.279 152.703 1.00 92.09  ?  50   ILE F C     1 
ATOM   4035  O  O     . ILE F 2  51   ? 167.774 138.062 153.611 1.00 92.22  ?  50   ILE F O     1 
ATOM   4036  C  CB    . ILE F 2  51   ? 166.902 137.341 150.448 1.00 92.39  ?  50   ILE F CB    1 
ATOM   4037  C  CG1   . ILE F 2  51   ? 166.925 137.978 149.058 1.00 92.55  ?  50   ILE F CG1   1 
ATOM   4038  C  CG2   . ILE F 2  51   ? 165.641 137.745 151.173 1.00 92.29  ?  50   ILE F CG2   1 
ATOM   4039  C  CD1   . ILE F 2  51   ? 166.854 139.488 149.091 1.00 92.71  ?  50   ILE F CD1   1 
ATOM   4040  N  N     . TYR F 2  52   ? 168.314 135.989 152.938 1.00 91.83  ?  51   TYR F N     1 
ATOM   4041  C  CA    . TYR F 2  52   ? 168.292 135.483 154.307 1.00 91.33  ?  51   TYR F CA    1 
ATOM   4042  C  C     . TYR F 2  52   ? 169.426 136.064 155.142 1.00 90.91  ?  51   TYR F C     1 
ATOM   4043  O  O     . TYR F 2  52   ? 169.313 136.133 156.371 1.00 90.97  ?  51   TYR F O     1 
ATOM   4044  C  CB    . TYR F 2  52   ? 168.352 133.954 154.314 1.00 91.51  ?  51   TYR F CB    1 
ATOM   4045  C  CG    . TYR F 2  52   ? 169.527 133.367 153.565 1.00 91.86  ?  51   TYR F CG    1 
ATOM   4046  C  CD1   . TYR F 2  52   ? 169.439 133.083 152.208 1.00 92.44  ?  51   TYR F CD1   1 
ATOM   4047  C  CD2   . TYR F 2  52   ? 170.721 133.086 154.215 1.00 91.83  ?  51   TYR F CD2   1 
ATOM   4048  C  CE1   . TYR F 2  52   ? 170.511 132.543 151.517 1.00 92.36  ?  51   TYR F CE1   1 
ATOM   4049  C  CE2   . TYR F 2  52   ? 171.798 132.545 153.534 1.00 92.19  ?  51   TYR F CE2   1 
ATOM   4050  C  CZ    . TYR F 2  52   ? 171.688 132.275 152.186 1.00 92.28  ?  51   TYR F CZ    1 
ATOM   4051  O  OH    . TYR F 2  52   ? 172.759 131.737 151.506 1.00 92.18  ?  51   TYR F OH    1 
ATOM   4052  N  N     . GLU F 2  53   ? 170.515 136.495 154.500 1.00 90.43  ?  52   GLU F N     1 
ATOM   4053  C  CA    . GLU F 2  53   ? 171.625 137.082 155.245 1.00 89.74  ?  52   GLU F CA    1 
ATOM   4054  C  C     . GLU F 2  53   ? 171.209 138.381 155.923 1.00 88.89  ?  52   GLU F C     1 
ATOM   4055  O  O     . GLU F 2  53   ? 171.627 138.662 157.052 1.00 89.15  ?  52   GLU F O     1 
ATOM   4056  C  CB    . GLU F 2  53   ? 172.815 137.321 154.318 1.00 90.10  ?  52   GLU F CB    1 
ATOM   4057  C  CG    . GLU F 2  53   ? 173.386 136.056 153.701 1.00 91.08  ?  52   GLU F CG    1 
ATOM   4058  C  CD    . GLU F 2  53   ? 174.187 135.227 154.688 1.00 92.42  ?  52   GLU F CD    1 
ATOM   4059  O  OE1   . GLU F 2  53   ? 174.526 135.743 155.775 1.00 93.23  ?  52   GLU F OE1   1 
ATOM   4060  O  OE2   . GLU F 2  53   ? 174.483 134.056 154.373 1.00 93.05  ?  52   GLU F OE2   1 
ATOM   4061  N  N     . GLU F 2  54   ? 170.391 139.189 155.248 1.00 87.58  ?  53   GLU F N     1 
ATOM   4062  C  CA    . GLU F 2  54   ? 169.859 140.390 155.879 1.00 86.35  ?  53   GLU F CA    1 
ATOM   4063  C  C     . GLU F 2  54   ? 168.611 140.083 156.696 1.00 85.44  ?  53   GLU F C     1 
ATOM   4064  O  O     . GLU F 2  54   ? 168.301 140.811 157.647 1.00 85.16  ?  53   GLU F O     1 
ATOM   4065  C  CB    . GLU F 2  54   ? 169.563 141.452 154.817 1.00 86.21  ?  53   GLU F CB    1 
ATOM   4066  C  CG    . GLU F 2  54   ? 169.327 142.851 155.366 1.00 86.55  ?  53   GLU F CG    1 
ATOM   4067  C  CD    . GLU F 2  54   ? 167.866 143.138 155.654 1.00 87.17  ?  53   GLU F CD    1 
ATOM   4068  O  OE1   . GLU F 2  54   ? 167.003 142.309 155.293 1.00 86.71  ?  53   GLU F OE1   1 
ATOM   4069  O  OE2   . GLU F 2  54   ? 167.585 144.202 156.243 1.00 86.99  ?  53   GLU F OE2   1 
ATOM   4070  N  N     . THR F 2  55   ? 167.899 139.008 156.352 1.00 84.29  ?  54   THR F N     1 
ATOM   4071  C  CA    . THR F 2  55   ? 166.732 138.611 157.131 1.00 83.61  ?  54   THR F CA    1 
ATOM   4072  C  C     . THR F 2  55   ? 167.126 138.211 158.548 1.00 82.84  ?  54   THR F C     1 
ATOM   4073  O  O     . THR F 2  55   ? 166.397 138.494 159.506 1.00 82.65  ?  54   THR F O     1 
ATOM   4074  C  CB    . THR F 2  55   ? 165.999 137.465 156.434 1.00 84.01  ?  54   THR F CB    1 
ATOM   4075  O  OG1   . THR F 2  55   ? 165.701 137.842 155.084 1.00 84.77  ?  54   THR F OG1   1 
ATOM   4076  C  CG2   . THR F 2  55   ? 164.702 137.147 157.159 1.00 83.64  ?  54   THR F CG2   1 
ATOM   4077  N  N     . ARG F 2  56   ? 168.279 137.551 158.701 1.00 81.58  ?  55   ARG F N     1 
ATOM   4078  C  CA    . ARG F 2  56   ? 168.782 137.263 160.041 1.00 80.36  ?  55   ARG F CA    1 
ATOM   4079  C  C     . ARG F 2  56   ? 169.073 138.544 160.811 1.00 79.54  ?  55   ARG F C     1 
ATOM   4080  O  O     . ARG F 2  56   ? 168.939 138.576 162.040 1.00 79.18  ?  55   ARG F O     1 
ATOM   4081  C  CB    . ARG F 2  56   ? 170.039 136.395 159.966 1.00 80.28  ?  55   ARG F CB    1 
ATOM   4082  C  CG    . ARG F 2  56   ? 169.818 135.019 159.360 1.00 80.25  ?  55   ARG F CG    1 
ATOM   4083  C  CD    . ARG F 2  56   ? 171.041 134.134 159.545 1.00 79.79  ?  55   ARG F CD    1 
ATOM   4084  N  NE    . ARG F 2  56   ? 170.925 132.879 158.808 1.00 79.03  ?  55   ARG F NE    1 
ATOM   4085  C  CZ    . ARG F 2  56   ? 171.470 132.662 157.616 1.00 79.26  ?  55   ARG F CZ    1 
ATOM   4086  N  NH1   . ARG F 2  56   ? 172.179 133.615 157.026 1.00 79.80  ?  55   ARG F NH1   1 
ATOM   4087  N  NH2   . ARG F 2  56   ? 171.312 131.490 157.016 1.00 79.64  ?  55   ARG F NH2   1 
ATOM   4088  N  N     . GLY F 2  57   ? 169.470 139.608 160.110 1.00 79.17  ?  56   GLY F N     1 
ATOM   4089  C  CA    . GLY F 2  57   ? 169.666 140.885 160.774 1.00 79.06  ?  56   GLY F CA    1 
ATOM   4090  C  C     . GLY F 2  57   ? 168.356 141.540 161.168 1.00 78.66  ?  56   GLY F C     1 
ATOM   4091  O  O     . GLY F 2  57   ? 168.266 142.185 162.217 1.00 78.57  ?  56   GLY F O     1 
ATOM   4092  N  N     . VAL F 2  58   ? 167.324 141.387 160.335 1.00 78.03  ?  57   VAL F N     1 
ATOM   4093  C  CA    . VAL F 2  58   ? 166.006 141.919 160.677 1.00 77.38  ?  57   VAL F CA    1 
ATOM   4094  C  C     . VAL F 2  58   ? 165.452 141.204 161.903 1.00 76.95  ?  57   VAL F C     1 
ATOM   4095  O  O     . VAL F 2  58   ? 164.930 141.834 162.831 1.00 77.06  ?  57   VAL F O     1 
ATOM   4096  C  CB    . VAL F 2  58   ? 165.050 141.802 159.476 1.00 77.19  ?  57   VAL F CB    1 
ATOM   4097  C  CG1   . VAL F 2  58   ? 163.656 142.277 159.858 1.00 77.87  ?  57   VAL F CG1   1 
ATOM   4098  C  CG2   . VAL F 2  58   ? 165.583 142.597 158.297 1.00 77.72  ?  57   VAL F CG2   1 
ATOM   4099  N  N     . LEU F 2  59   ? 165.558 139.873 161.923 1.00 76.44  ?  58   LEU F N     1 
ATOM   4100  C  CA    . LEU F 2  59   ? 165.114 139.113 163.087 1.00 75.97  ?  58   LEU F CA    1 
ATOM   4101  C  C     . LEU F 2  59   ? 165.978 139.405 164.307 1.00 75.88  ?  58   LEU F C     1 
ATOM   4102  O  O     . LEU F 2  59   ? 165.491 139.333 165.442 1.00 76.32  ?  58   LEU F O     1 
ATOM   4103  C  CB    . LEU F 2  59   ? 165.123 137.618 162.769 1.00 75.95  ?  58   LEU F CB    1 
ATOM   4104  C  CG    . LEU F 2  59   ? 164.618 136.669 163.858 1.00 75.74  ?  58   LEU F CG    1 
ATOM   4105  C  CD1   . LEU F 2  59   ? 163.173 136.983 164.211 1.00 75.66  ?  58   LEU F CD1   1 
ATOM   4106  C  CD2   . LEU F 2  59   ? 164.766 135.220 163.421 1.00 75.84  ?  58   LEU F CD2   1 
ATOM   4107  N  N     . LYS F 2  60   ? 167.253 139.738 164.096 1.00 75.58  ?  59   LYS F N     1 
ATOM   4108  C  CA    . LYS F 2  60   ? 168.128 140.062 165.217 1.00 75.07  ?  59   LYS F CA    1 
ATOM   4109  C  C     . LYS F 2  60   ? 167.757 141.402 165.839 1.00 74.13  ?  59   LYS F C     1 
ATOM   4110  O  O     . LYS F 2  60   ? 167.705 141.530 167.068 1.00 73.63  ?  59   LYS F O     1 
ATOM   4111  C  CB    . LYS F 2  60   ? 169.586 140.063 164.757 1.00 76.29  ?  59   LYS F CB    1 
ATOM   4112  C  CG    . LYS F 2  60   ? 170.595 140.301 165.867 1.00 77.32  ?  59   LYS F CG    1 
ATOM   4113  C  CD    . LYS F 2  60   ? 172.018 140.209 165.339 1.00 80.42  ?  59   LYS F CD    1 
ATOM   4114  C  CE    . LYS F 2  60   ? 173.037 140.427 166.445 1.00 81.53  ?  59   LYS F CE    1 
ATOM   4115  N  NZ    . LYS F 2  60   ? 172.918 141.781 167.051 1.00 84.16  ?  59   LYS F NZ    1 
ATOM   4116  N  N     . VAL F 2  61   ? 167.491 142.413 165.008 1.00 72.93  ?  60   VAL F N     1 
ATOM   4117  C  CA    . VAL F 2  61   ? 167.082 143.713 165.530 1.00 72.02  ?  60   VAL F CA    1 
ATOM   4118  C  C     . VAL F 2  61   ? 165.702 143.623 166.170 1.00 71.78  ?  60   VAL F C     1 
ATOM   4119  O  O     . VAL F 2  61   ? 165.468 144.171 167.254 1.00 71.47  ?  60   VAL F O     1 
ATOM   4120  C  CB    . VAL F 2  61   ? 167.124 144.775 164.416 1.00 71.85  ?  60   VAL F CB    1 
ATOM   4121  C  CG1   . VAL F 2  61   ? 166.573 146.100 164.922 1.00 71.28  ?  60   VAL F CG1   1 
ATOM   4122  C  CG2   . VAL F 2  61   ? 168.546 144.950 163.904 1.00 71.51  ?  60   VAL F CG2   1 
ATOM   4123  N  N     . PHE F 2  62   ? 164.770 142.926 165.519 1.00 71.62  ?  61   PHE F N     1 
ATOM   4124  C  CA    . PHE F 2  62   ? 163.431 142.749 166.069 1.00 71.74  ?  61   PHE F CA    1 
ATOM   4125  C  C     . PHE F 2  62   ? 163.393 141.751 167.220 1.00 71.94  ?  61   PHE F C     1 
ATOM   4126  O  O     . PHE F 2  62   ? 162.337 141.589 167.843 1.00 71.95  ?  61   PHE F O     1 
ATOM   4127  C  CB    . PHE F 2  62   ? 162.469 142.312 164.960 1.00 72.04  ?  61   PHE F CB    1 
ATOM   4128  C  CG    . PHE F 2  62   ? 161.016 142.460 165.319 1.00 72.54  ?  61   PHE F CG    1 
ATOM   4129  C  CD1   . PHE F 2  62   ? 160.427 143.712 165.373 1.00 71.91  ?  61   PHE F CD1   1 
ATOM   4130  C  CD2   . PHE F 2  62   ? 160.238 141.347 165.592 1.00 72.04  ?  61   PHE F CD2   1 
ATOM   4131  C  CE1   . PHE F 2  62   ? 159.091 143.853 165.701 1.00 72.48  ?  61   PHE F CE1   1 
ATOM   4132  C  CE2   . PHE F 2  62   ? 158.901 141.481 165.921 1.00 72.07  ?  61   PHE F CE2   1 
ATOM   4133  C  CZ    . PHE F 2  62   ? 158.328 142.735 165.974 1.00 72.67  ?  61   PHE F CZ    1 
ATOM   4134  N  N     . LEU F 2  63   ? 164.508 141.092 167.525 1.00 72.03  ?  62   LEU F N     1 
ATOM   4135  C  CA    . LEU F 2  63   ? 164.583 140.116 168.605 1.00 71.89  ?  62   LEU F CA    1 
ATOM   4136  C  C     . LEU F 2  63   ? 165.326 140.626 169.829 1.00 72.21  ?  62   LEU F C     1 
ATOM   4137  O  O     . LEU F 2  63   ? 164.960 140.278 170.955 1.00 72.17  ?  62   LEU F O     1 
ATOM   4138  C  CB    . LEU F 2  63   ? 165.253 138.830 168.102 1.00 71.34  ?  62   LEU F CB    1 
ATOM   4139  C  CG    . LEU F 2  63   ? 165.356 137.639 169.058 1.00 71.17  ?  62   LEU F CG    1 
ATOM   4140  C  CD1   . LEU F 2  63   ? 164.986 136.351 168.340 1.00 71.26  ?  62   LEU F CD1   1 
ATOM   4141  C  CD2   . LEU F 2  63   ? 166.757 137.534 169.643 1.00 70.21  ?  62   LEU F CD2   1 
ATOM   4142  N  N     . GLU F 2  64   ? 166.359 141.453 169.641 1.00 72.30  ?  63   GLU F N     1 
ATOM   4143  C  CA    . GLU F 2  64   ? 167.139 141.932 170.778 1.00 72.96  ?  63   GLU F CA    1 
ATOM   4144  C  C     . GLU F 2  64   ? 166.330 142.859 171.676 1.00 73.18  ?  63   GLU F C     1 
ATOM   4145  O  O     . GLU F 2  64   ? 166.616 142.959 172.875 1.00 73.01  ?  63   GLU F O     1 
ATOM   4146  C  CB    . GLU F 2  64   ? 168.404 142.639 170.292 1.00 73.40  ?  63   GLU F CB    1 
ATOM   4147  C  CG    . GLU F 2  64   ? 169.479 141.701 169.772 1.00 74.35  ?  63   GLU F CG    1 
ATOM   4148  C  CD    . GLU F 2  64   ? 170.751 142.430 169.388 1.00 76.65  ?  63   GLU F CD    1 
ATOM   4149  O  OE1   . GLU F 2  64   ? 170.727 143.677 169.322 1.00 78.14  ?  63   GLU F OE1   1 
ATOM   4150  O  OE2   . GLU F 2  64   ? 171.776 141.756 169.154 1.00 76.05  ?  63   GLU F OE2   1 
ATOM   4151  N  N     . ASN F 2  65   ? 165.327 143.546 171.126 1.00 73.26  ?  64   ASN F N     1 
ATOM   4152  C  CA    . ASN F 2  65   ? 164.496 144.414 171.952 1.00 73.89  ?  64   ASN F CA    1 
ATOM   4153  C  C     . ASN F 2  65   ? 163.485 143.611 172.762 1.00 74.11  ?  64   ASN F C     1 
ATOM   4154  O  O     . ASN F 2  65   ? 163.223 143.934 173.926 1.00 74.41  ?  64   ASN F O     1 
ATOM   4155  C  CB    . ASN F 2  65   ? 163.785 145.451 171.081 1.00 73.88  ?  64   ASN F CB    1 
ATOM   4156  C  CG    . ASN F 2  65   ? 162.898 144.819 170.028 1.00 74.11  ?  64   ASN F CG    1 
ATOM   4157  O  OD1   . ASN F 2  65   ? 163.146 143.699 169.584 1.00 76.03  ?  64   ASN F OD1   1 
ATOM   4158  N  ND2   . ASN F 2  65   ? 161.857 145.536 169.622 1.00 73.74  ?  64   ASN F ND2   1 
ATOM   4159  N  N     . VAL F 2  66   ? 162.912 142.562 172.167 1.00 74.17  ?  65   VAL F N     1 
ATOM   4160  C  CA    . VAL F 2  66   ? 161.977 141.715 172.902 1.00 74.24  ?  65   VAL F CA    1 
ATOM   4161  C  C     . VAL F 2  66   ? 162.709 140.930 173.983 1.00 74.38  ?  65   VAL F C     1 
ATOM   4162  O  O     . VAL F 2  66   ? 162.216 140.790 175.109 1.00 74.59  ?  65   VAL F O     1 
ATOM   4163  C  CB    . VAL F 2  66   ? 161.224 140.784 171.935 1.00 74.14  ?  65   VAL F CB    1 
ATOM   4164  C  CG1   . VAL F 2  66   ? 160.179 139.971 172.685 1.00 73.93  ?  65   VAL F CG1   1 
ATOM   4165  C  CG2   . VAL F 2  66   ? 160.581 141.588 170.815 1.00 74.67  ?  65   VAL F CG2   1 
ATOM   4166  N  N     . ILE F 2  67   ? 163.894 140.406 173.661 1.00 74.30  ?  66   ILE F N     1 
ATOM   4167  C  CA    . ILE F 2  67   ? 164.690 139.705 174.663 1.00 74.19  ?  66   ILE F CA    1 
ATOM   4168  C  C     . ILE F 2  67   ? 165.161 140.674 175.740 1.00 73.94  ?  66   ILE F C     1 
ATOM   4169  O  O     . ILE F 2  67   ? 165.188 140.335 176.930 1.00 73.52  ?  66   ILE F O     1 
ATOM   4170  C  CB    . ILE F 2  67   ? 165.869 138.976 173.994 1.00 74.00  ?  66   ILE F CB    1 
ATOM   4171  C  CG1   . ILE F 2  67   ? 165.355 137.876 173.064 1.00 74.58  ?  66   ILE F CG1   1 
ATOM   4172  C  CG2   . ILE F 2  67   ? 166.803 138.386 175.038 1.00 74.23  ?  66   ILE F CG2   1 
ATOM   4173  C  CD1   . ILE F 2  67   ? 164.489 136.848 173.757 1.00 75.18  ?  66   ILE F CD1   1 
ATOM   4174  N  N     . ARG F 2  68   ? 165.533 141.894 175.343 1.00 74.04  ?  67   ARG F N     1 
ATOM   4175  C  CA    . ARG F 2  68   ? 165.911 142.911 176.320 1.00 74.61  ?  67   ARG F CA    1 
ATOM   4176  C  C     . ARG F 2  68   ? 164.763 143.205 177.277 1.00 74.62  ?  67   ARG F C     1 
ATOM   4177  O  O     . ARG F 2  68   ? 164.970 143.324 178.491 1.00 74.37  ?  67   ARG F O     1 
ATOM   4178  C  CB    . ARG F 2  68   ? 166.356 144.186 175.603 1.00 74.68  ?  67   ARG F CB    1 
ATOM   4179  C  CG    . ARG F 2  68   ? 166.708 145.337 176.533 1.00 75.76  ?  67   ARG F CG    1 
ATOM   4180  C  CD    . ARG F 2  68   ? 167.110 146.578 175.751 1.00 78.74  ?  67   ARG F CD    1 
ATOM   4181  N  NE    . ARG F 2  68   ? 168.276 146.337 174.908 1.00 81.50  ?  67   ARG F NE    1 
ATOM   4182  C  CZ    . ARG F 2  68   ? 168.837 147.254 174.126 1.00 81.72  ?  67   ARG F CZ    1 
ATOM   4183  N  NH1   . ARG F 2  68   ? 168.340 148.482 174.077 1.00 81.76  ?  67   ARG F NH1   1 
ATOM   4184  N  NH2   . ARG F 2  68   ? 169.898 146.943 173.393 1.00 81.27  ?  67   ARG F NH2   1 
ATOM   4185  N  N     . ASP F 2  69   ? 163.541 143.315 176.749 1.00 75.19  ?  68   ASP F N     1 
ATOM   4186  C  CA    . ASP F 2  69   ? 162.383 143.515 177.612 1.00 75.73  ?  68   ASP F CA    1 
ATOM   4187  C  C     . ASP F 2  69   ? 162.128 142.303 178.498 1.00 75.83  ?  68   ASP F C     1 
ATOM   4188  O  O     . ASP F 2  69   ? 161.690 142.457 179.643 1.00 75.30  ?  68   ASP F O     1 
ATOM   4189  C  CB    . ASP F 2  69   ? 161.146 143.828 176.771 1.00 75.88  ?  68   ASP F CB    1 
ATOM   4190  C  CG    . ASP F 2  69   ? 161.271 145.135 176.013 1.00 77.61  ?  68   ASP F CG    1 
ATOM   4191  O  OD1   . ASP F 2  69   ? 162.324 145.796 176.133 1.00 78.70  ?  68   ASP F OD1   1 
ATOM   4192  O  OD2   . ASP F 2  69   ? 160.315 145.503 175.298 1.00 78.06  ?  68   ASP F OD2   1 
ATOM   4193  N  N     . ALA F 2  70   ? 162.397 141.097 177.991 1.00 75.77  ?  69   ALA F N     1 
ATOM   4194  C  CA    . ALA F 2  70   ? 162.223 139.901 178.809 1.00 75.92  ?  69   ALA F CA    1 
ATOM   4195  C  C     . ALA F 2  70   ? 163.200 139.887 179.977 1.00 76.20  ?  69   ALA F C     1 
ATOM   4196  O  O     . ALA F 2  70   ? 162.830 139.520 181.099 1.00 76.24  ?  69   ALA F O     1 
ATOM   4197  C  CB    . ALA F 2  70   ? 162.389 138.646 177.952 1.00 75.66  ?  69   ALA F CB    1 
ATOM   4198  N  N     . VAL F 2  71   ? 164.451 140.285 179.734 1.00 76.52  ?  70   VAL F N     1 
ATOM   4199  C  CA    . VAL F 2  71   ? 165.425 140.372 180.818 1.00 76.72  ?  70   VAL F CA    1 
ATOM   4200  C  C     . VAL F 2  71   ? 165.075 141.519 181.759 1.00 76.84  ?  70   VAL F C     1 
ATOM   4201  O  O     . VAL F 2  71   ? 165.393 141.471 182.953 1.00 76.96  ?  70   VAL F O     1 
ATOM   4202  C  CB    . VAL F 2  71   ? 166.848 140.517 180.243 1.00 76.85  ?  70   VAL F CB    1 
ATOM   4203  C  CG1   . VAL F 2  71   ? 167.886 140.554 181.357 1.00 77.55  ?  70   VAL F CG1   1 
ATOM   4204  C  CG2   . VAL F 2  71   ? 167.149 139.380 179.278 1.00 77.04  ?  70   VAL F CG2   1 
ATOM   4205  N  N     . THR F 2  72   ? 164.409 142.557 181.249 1.00 76.91  ?  71   THR F N     1 
ATOM   4206  C  CA    . THR F 2  72   ? 164.006 143.668 182.107 1.00 77.01  ?  71   THR F CA    1 
ATOM   4207  C  C     . THR F 2  72   ? 162.896 143.248 183.064 1.00 77.74  ?  71   THR F C     1 
ATOM   4208  O  O     . THR F 2  72   ? 163.012 143.427 184.283 1.00 77.95  ?  71   THR F O     1 
ATOM   4209  C  CB    . THR F 2  72   ? 163.563 144.858 181.254 1.00 76.73  ?  71   THR F CB    1 
ATOM   4210  O  OG1   . THR F 2  72   ? 164.624 145.233 180.366 1.00 76.77  ?  71   THR F OG1   1 
ATOM   4211  C  CG2   . THR F 2  72   ? 163.210 146.044 182.139 1.00 76.40  ?  71   THR F CG2   1 
ATOM   4212  N  N     . TYR F 2  73   ? 161.809 142.682 182.529 1.00 78.44  ?  72   TYR F N     1 
ATOM   4213  C  CA    . TYR F 2  73   ? 160.723 142.209 183.382 1.00 79.00  ?  72   TYR F CA    1 
ATOM   4214  C  C     . TYR F 2  73   ? 161.172 141.063 184.280 1.00 80.47  ?  72   TYR F C     1 
ATOM   4215  O  O     . TYR F 2  73   ? 160.653 140.906 185.391 1.00 80.77  ?  72   TYR F O     1 
ATOM   4216  C  CB    . TYR F 2  73   ? 159.531 141.772 182.529 1.00 78.03  ?  72   TYR F CB    1 
ATOM   4217  C  CG    . TYR F 2  73   ? 158.704 142.912 181.974 1.00 76.29  ?  72   TYR F CG    1 
ATOM   4218  C  CD1   . TYR F 2  73   ? 159.067 143.551 180.796 1.00 75.17  ?  72   TYR F CD1   1 
ATOM   4219  C  CD2   . TYR F 2  73   ? 157.554 143.341 182.624 1.00 74.39  ?  72   TYR F CD2   1 
ATOM   4220  C  CE1   . TYR F 2  73   ? 158.312 144.590 180.284 1.00 75.17  ?  72   TYR F CE1   1 
ATOM   4221  C  CE2   . TYR F 2  73   ? 156.792 144.379 182.118 1.00 73.65  ?  72   TYR F CE2   1 
ATOM   4222  C  CZ    . TYR F 2  73   ? 157.176 145.000 180.949 1.00 75.08  ?  72   TYR F CZ    1 
ATOM   4223  O  OH    . TYR F 2  73   ? 156.422 146.033 180.442 1.00 73.67  ?  72   TYR F OH    1 
ATOM   4224  N  N     . THR F 2  74   ? 162.129 140.254 183.820 1.00 81.72  ?  73   THR F N     1 
ATOM   4225  C  CA    . THR F 2  74   ? 162.626 139.156 184.642 1.00 83.07  ?  73   THR F CA    1 
ATOM   4226  C  C     . THR F 2  74   ? 163.461 139.678 185.806 1.00 84.13  ?  73   THR F C     1 
ATOM   4227  O  O     . THR F 2  74   ? 163.230 139.310 186.964 1.00 84.18  ?  73   THR F O     1 
ATOM   4228  C  CB    . THR F 2  74   ? 163.442 138.185 183.786 1.00 83.06  ?  73   THR F CB    1 
ATOM   4229  O  OG1   . THR F 2  74   ? 162.601 137.616 182.774 1.00 84.00  ?  73   THR F OG1   1 
ATOM   4230  C  CG2   . THR F 2  74   ? 164.021 137.071 184.646 1.00 82.74  ?  73   THR F CG2   1 
ATOM   4231  N  N     . GLU F 2  75   ? 164.433 140.547 185.517 1.00 85.57  ?  74   GLU F N     1 
ATOM   4232  C  CA    . GLU F 2  75   ? 165.290 141.083 186.569 1.00 87.11  ?  74   GLU F CA    1 
ATOM   4233  C  C     . GLU F 2  75   ? 164.514 141.964 187.540 1.00 87.45  ?  74   GLU F C     1 
ATOM   4234  O  O     . GLU F 2  75   ? 164.825 141.986 188.736 1.00 88.09  ?  74   GLU F O     1 
ATOM   4235  C  CB    . GLU F 2  75   ? 166.449 141.867 185.951 1.00 87.63  ?  74   GLU F CB    1 
ATOM   4236  C  CG    . GLU F 2  75   ? 167.451 142.398 186.962 1.00 90.03  ?  74   GLU F CG    1 
ATOM   4237  C  CD    . GLU F 2  75   ? 168.585 143.161 186.309 1.00 93.09  ?  74   GLU F CD    1 
ATOM   4238  O  OE1   . GLU F 2  75   ? 168.595 143.259 185.064 1.00 94.24  ?  74   GLU F OE1   1 
ATOM   4239  O  OE2   . GLU F 2  75   ? 169.467 143.661 187.038 1.00 95.04  ?  74   GLU F OE2   1 
ATOM   4240  N  N     . HIS F 2  76   ? 163.506 142.692 187.053 1.00 87.72  ?  75   HIS F N     1 
ATOM   4241  C  CA    . HIS F 2  76   ? 162.715 143.538 187.938 1.00 88.16  ?  75   HIS F CA    1 
ATOM   4242  C  C     . HIS F 2  76   ? 161.850 142.725 188.893 1.00 88.62  ?  75   HIS F C     1 
ATOM   4243  O  O     . HIS F 2  76   ? 161.440 143.247 189.935 1.00 88.30  ?  75   HIS F O     1 
ATOM   4244  C  CB    . HIS F 2  76   ? 161.842 144.489 187.116 1.00 87.96  ?  75   HIS F CB    1 
ATOM   4245  C  CG    . HIS F 2  76   ? 161.061 145.462 187.945 1.00 87.44  ?  75   HIS F CG    1 
ATOM   4246  N  ND1   . HIS F 2  76   ? 159.683 145.466 187.986 1.00 87.40  ?  75   HIS F ND1   1 
ATOM   4247  C  CD2   . HIS F 2  76   ? 161.465 146.458 188.769 1.00 87.53  ?  75   HIS F CD2   1 
ATOM   4248  C  CE1   . HIS F 2  76   ? 159.272 146.426 188.796 1.00 87.28  ?  75   HIS F CE1   1 
ATOM   4249  N  NE2   . HIS F 2  76   ? 160.333 147.042 189.284 1.00 87.36  ?  75   HIS F NE2   1 
ATOM   4250  N  N     . ALA F 2  77   ? 161.574 141.463 188.570 1.00 89.41  ?  76   ALA F N     1 
ATOM   4251  C  CA    . ALA F 2  77   ? 160.769 140.598 189.421 1.00 89.90  ?  76   ALA F CA    1 
ATOM   4252  C  C     . ALA F 2  77   ? 161.563 139.985 190.570 1.00 90.43  ?  76   ALA F C     1 
ATOM   4253  O  O     . ALA F 2  77   ? 161.050 139.081 191.239 1.00 90.61  ?  76   ALA F O     1 
ATOM   4254  C  CB    . ALA F 2  77   ? 160.127 139.487 188.585 1.00 89.90  ?  76   ALA F CB    1 
ATOM   4255  N  N     . LYS F 2  78   ? 162.792 140.449 190.802 1.00 90.81  ?  77   LYS F N     1 
ATOM   4256  C  CA    . LYS F 2  78   ? 163.650 139.980 191.890 1.00 91.26  ?  77   LYS F CA    1 
ATOM   4257  C  C     . LYS F 2  78   ? 163.952 138.488 191.793 1.00 91.27  ?  77   LYS F C     1 
ATOM   4258  O  O     . LYS F 2  78   ? 164.296 137.854 192.796 1.00 91.30  ?  77   LYS F O     1 
ATOM   4259  C  CB    . LYS F 2  78   ? 163.040 140.307 193.259 1.00 91.28  ?  77   LYS F CB    1 
ATOM   4260  C  CG    . LYS F 2  78   ? 162.783 141.789 193.485 1.00 91.91  ?  77   LYS F CG    1 
ATOM   4261  C  CD    . LYS F 2  78   ? 162.129 142.036 194.836 1.00 93.37  ?  77   LYS F CD    1 
ATOM   4262  C  CE    . LYS F 2  78   ? 161.892 143.519 195.074 1.00 94.65  ?  77   LYS F CE    1 
ATOM   4263  N  NZ    . LYS F 2  78   ? 161.262 143.776 196.399 1.00 95.75  ?  77   LYS F NZ    1 
ATOM   4264  N  N     . ARG F 2  79   ? 163.832 137.914 190.597 1.00 91.60  ?  78   ARG F N     1 
ATOM   4265  C  CA    . ARG F 2  79   ? 164.094 136.501 190.376 1.00 92.44  ?  78   ARG F CA    1 
ATOM   4266  C  C     . ARG F 2  79   ? 164.759 136.319 189.020 1.00 92.98  ?  78   ARG F C     1 
ATOM   4267  O  O     . ARG F 2  79   ? 164.502 137.073 188.077 1.00 92.76  ?  78   ARG F O     1 
ATOM   4268  C  CB    . ARG F 2  79   ? 162.807 135.665 190.450 1.00 92.63  ?  78   ARG F CB    1 
ATOM   4269  C  CG    . ARG F 2  79   ? 162.247 135.508 191.856 1.00 92.84  ?  78   ARG F CG    1 
ATOM   4270  C  CD    . ARG F 2  79   ? 160.971 134.683 191.861 1.00 92.55  ?  78   ARG F CD    1 
ATOM   4271  N  NE    . ARG F 2  79   ? 160.513 134.395 193.218 1.00 93.38  ?  78   ARG F NE    1 
ATOM   4272  C  CZ    . ARG F 2  79   ? 159.702 135.183 193.916 1.00 93.32  ?  78   ARG F CZ    1 
ATOM   4273  N  NH1   . ARG F 2  79   ? 159.256 136.315 193.388 1.00 93.49  ?  78   ARG F NH1   1 
ATOM   4274  N  NH2   . ARG F 2  79   ? 159.337 134.841 195.144 1.00 93.09  ?  78   ARG F NH2   1 
ATOM   4275  N  N     . LYS F 2  80   ? 165.616 135.305 188.933 1.00 93.75  ?  79   LYS F N     1 
ATOM   4276  C  CA    . LYS F 2  80   ? 166.372 135.028 187.713 1.00 94.34  ?  79   LYS F CA    1 
ATOM   4277  C  C     . LYS F 2  80   ? 165.755 133.834 186.984 1.00 94.49  ?  79   LYS F C     1 
ATOM   4278  O  O     . LYS F 2  80   ? 166.316 132.740 186.914 1.00 94.80  ?  79   LYS F O     1 
ATOM   4279  C  CB    . LYS F 2  80   ? 167.842 134.791 188.045 1.00 94.50  ?  79   LYS F CB    1 
ATOM   4280  C  CG    . LYS F 2  80   ? 168.522 135.969 188.727 1.00 95.40  ?  79   LYS F CG    1 
ATOM   4281  C  CD    . LYS F 2  80   ? 169.985 135.675 189.018 1.00 97.39  ?  79   LYS F CD    1 
ATOM   4282  C  CE    . LYS F 2  80   ? 170.652 136.833 189.743 1.00 98.32  ?  79   LYS F CE    1 
ATOM   4283  N  NZ    . LYS F 2  80   ? 172.082 136.546 190.042 1.00 99.27  ?  79   LYS F NZ    1 
ATOM   4284  N  N     . THR F 2  81   ? 164.566 134.073 186.435 1.00 94.42  ?  80   THR F N     1 
ATOM   4285  C  CA    . THR F 2  81   ? 163.855 133.049 185.673 1.00 94.33  ?  80   THR F CA    1 
ATOM   4286  C  C     . THR F 2  81   ? 162.909 133.740 184.706 1.00 93.98  ?  80   THR F C     1 
ATOM   4287  O  O     . THR F 2  81   ? 161.999 134.456 185.137 1.00 93.98  ?  80   THR F O     1 
ATOM   4288  C  CB    . THR F 2  81   ? 163.084 132.103 186.596 1.00 94.44  ?  80   THR F CB    1 
ATOM   4289  O  OG1   . THR F 2  81   ? 164.004 131.383 187.426 1.00 94.37  ?  80   THR F OG1   1 
ATOM   4290  C  CG2   . THR F 2  81   ? 162.265 131.113 185.780 1.00 94.78  ?  80   THR F CG2   1 
ATOM   4291  N  N     . VAL F 2  82   ? 163.120 133.530 183.409 1.00 93.49  ?  81   VAL F N     1 
ATOM   4292  C  CA    . VAL F 2  82   ? 162.265 134.116 182.382 1.00 92.87  ?  81   VAL F CA    1 
ATOM   4293  C  C     . VAL F 2  82   ? 161.044 133.217 182.215 1.00 92.73  ?  81   VAL F C     1 
ATOM   4294  O  O     . VAL F 2  82   ? 161.150 132.096 181.712 1.00 92.75  ?  81   VAL F O     1 
ATOM   4295  C  CB    . VAL F 2  82   ? 163.013 134.288 181.056 1.00 92.64  ?  81   VAL F CB    1 
ATOM   4296  C  CG1   . VAL F 2  82   ? 162.103 134.916 180.011 1.00 92.13  ?  81   VAL F CG1   1 
ATOM   4297  C  CG2   . VAL F 2  82   ? 164.264 135.129 181.258 1.00 92.18  ?  81   VAL F CG2   1 
ATOM   4298  N  N     . THR F 2  83   ? 159.881 133.709 182.637 1.00 92.16  ?  82   THR F N     1 
ATOM   4299  C  CA    . THR F 2  83   ? 158.648 132.939 182.538 1.00 91.49  ?  82   THR F CA    1 
ATOM   4300  C  C     . THR F 2  83   ? 157.987 133.145 181.181 1.00 90.64  ?  82   THR F C     1 
ATOM   4301  O  O     . THR F 2  83   ? 158.664 133.439 180.191 1.00 90.70  ?  82   THR F O     1 
ATOM   4302  C  CB    . THR F 2  83   ? 157.680 133.324 183.660 1.00 91.69  ?  82   THR F CB    1 
ATOM   4303  O  OG1   . THR F 2  83   ? 157.361 134.717 183.561 1.00 92.24  ?  82   THR F OG1   1 
ATOM   4304  C  CG2   . THR F 2  83   ? 158.306 133.048 185.019 1.00 91.87  ?  82   THR F CG2   1 
ATOM   4305  N  N     . ALA F 2  84   ? 156.662 132.989 181.127 1.00 89.61  ?  83   ALA F N     1 
ATOM   4306  C  CA    . ALA F 2  84   ? 155.911 133.167 179.894 1.00 88.49  ?  83   ALA F CA    1 
ATOM   4307  C  C     . ALA F 2  84   ? 155.030 134.406 179.886 1.00 87.87  ?  83   ALA F C     1 
ATOM   4308  O  O     . ALA F 2  84   ? 154.691 134.893 178.803 1.00 87.79  ?  83   ALA F O     1 
ATOM   4309  C  CB    . ALA F 2  84   ? 155.035 131.935 179.619 1.00 88.12  ?  83   ALA F CB    1 
ATOM   4310  N  N     . MET F 2  85   ? 154.651 134.925 181.057 1.00 87.03  ?  84   MET F N     1 
ATOM   4311  C  CA    . MET F 2  85   ? 153.811 136.116 181.096 1.00 86.67  ?  84   MET F CA    1 
ATOM   4312  C  C     . MET F 2  85   ? 154.595 137.371 180.734 1.00 86.63  ?  84   MET F C     1 
ATOM   4313  O  O     . MET F 2  85   ? 154.028 138.309 180.162 1.00 86.18  ?  84   MET F O     1 
ATOM   4314  C  CB    . MET F 2  85   ? 153.173 136.265 182.478 1.00 86.69  ?  84   MET F CB    1 
ATOM   4315  C  CG    . MET F 2  85   ? 154.167 136.295 183.628 1.00 86.14  ?  84   MET F CG    1 
ATOM   4316  S  SD    . MET F 2  85   ? 153.366 136.454 185.235 1.00 85.04  ?  84   MET F SD    1 
ATOM   4317  C  CE    . MET F 2  85   ? 152.349 134.980 185.254 1.00 84.38  ?  84   MET F CE    1 
ATOM   4318  N  N     . ASP F 2  86   ? 155.892 137.407 181.051 1.00 86.45  ?  85   ASP F N     1 
ATOM   4319  C  CA    . ASP F 2  86   ? 156.705 138.569 180.705 1.00 86.17  ?  85   ASP F CA    1 
ATOM   4320  C  C     . ASP F 2  86   ? 156.859 138.718 179.197 1.00 85.31  ?  85   ASP F C     1 
ATOM   4321  O  O     . ASP F 2  86   ? 156.965 139.842 178.694 1.00 85.58  ?  85   ASP F O     1 
ATOM   4322  C  CB    . ASP F 2  86   ? 158.075 138.471 181.375 1.00 86.71  ?  85   ASP F CB    1 
ATOM   4323  C  CG    . ASP F 2  86   ? 158.775 137.156 181.087 1.00 88.36  ?  85   ASP F CG    1 
ATOM   4324  O  OD1   . ASP F 2  86   ? 158.157 136.276 180.453 1.00 89.88  ?  85   ASP F OD1   1 
ATOM   4325  O  OD2   . ASP F 2  86   ? 159.945 137.003 181.497 1.00 90.61  ?  85   ASP F OD2   1 
ATOM   4326  N  N     . VAL F 2  87   ? 156.875 137.603 178.463 1.00 83.93  ?  86   VAL F N     1 
ATOM   4327  C  CA    . VAL F 2  87   ? 156.932 137.675 177.007 1.00 82.74  ?  86   VAL F CA    1 
ATOM   4328  C  C     . VAL F 2  87   ? 155.639 138.259 176.454 1.00 81.99  ?  86   VAL F C     1 
ATOM   4329  O  O     . VAL F 2  87   ? 155.657 139.076 175.525 1.00 82.34  ?  86   VAL F O     1 
ATOM   4330  C  CB    . VAL F 2  87   ? 157.226 136.285 176.415 1.00 82.75  ?  86   VAL F CB    1 
ATOM   4331  C  CG1   . VAL F 2  87   ? 157.274 136.352 174.896 1.00 82.95  ?  86   VAL F CG1   1 
ATOM   4332  C  CG2   . VAL F 2  87   ? 158.531 135.737 176.973 1.00 82.96  ?  86   VAL F CG2   1 
ATOM   4333  N  N     . VAL F 2  88   ? 154.498 137.857 177.018 1.00 80.43  ?  87   VAL F N     1 
ATOM   4334  C  CA    . VAL F 2  88   ? 153.218 138.401 176.575 1.00 78.76  ?  87   VAL F CA    1 
ATOM   4335  C  C     . VAL F 2  88   ? 153.125 139.884 176.908 1.00 77.84  ?  87   VAL F C     1 
ATOM   4336  O  O     . VAL F 2  88   ? 152.588 140.677 176.125 1.00 77.96  ?  87   VAL F O     1 
ATOM   4337  C  CB    . VAL F 2  88   ? 152.057 137.604 177.198 1.00 78.56  ?  87   VAL F CB    1 
ATOM   4338  C  CG1   . VAL F 2  88   ? 150.719 138.120 176.688 1.00 77.77  ?  87   VAL F CG1   1 
ATOM   4339  C  CG2   . VAL F 2  88   ? 152.212 136.122 176.897 1.00 77.95  ?  87   VAL F CG2   1 
ATOM   4340  N  N     . TYR F 2  89   ? 153.650 140.286 178.068 1.00 76.68  ?  88   TYR F N     1 
ATOM   4341  C  CA    . TYR F 2  89   ? 153.640 141.701 178.429 1.00 75.98  ?  88   TYR F CA    1 
ATOM   4342  C  C     . TYR F 2  89   ? 154.550 142.510 177.513 1.00 75.56  ?  88   TYR F C     1 
ATOM   4343  O  O     . TYR F 2  89   ? 154.214 143.638 177.132 1.00 75.98  ?  88   TYR F O     1 
ATOM   4344  C  CB    . TYR F 2  89   ? 154.059 141.874 179.889 1.00 75.75  ?  88   TYR F CB    1 
ATOM   4345  C  CG    . TYR F 2  89   ? 153.142 141.194 180.881 1.00 75.60  ?  88   TYR F CG    1 
ATOM   4346  C  CD1   . TYR F 2  89   ? 151.801 140.981 180.586 1.00 76.06  ?  88   TYR F CD1   1 
ATOM   4347  C  CD2   . TYR F 2  89   ? 153.618 140.763 182.112 1.00 75.44  ?  88   TYR F CD2   1 
ATOM   4348  C  CE1   . TYR F 2  89   ? 150.961 140.359 181.490 1.00 77.20  ?  88   TYR F CE1   1 
ATOM   4349  C  CE2   . TYR F 2  89   ? 152.786 140.139 183.022 1.00 75.95  ?  88   TYR F CE2   1 
ATOM   4350  C  CZ    . TYR F 2  89   ? 151.458 139.941 182.706 1.00 76.51  ?  88   TYR F CZ    1 
ATOM   4351  O  OH    . TYR F 2  89   ? 150.626 139.321 183.609 1.00 76.78  ?  88   TYR F OH    1 
ATOM   4352  N  N     . ALA F 2  90   ? 155.705 141.949 177.146 1.00 74.44  ?  89   ALA F N     1 
ATOM   4353  C  CA    . ALA F 2  90   ? 156.627 142.662 176.268 1.00 73.72  ?  89   ALA F CA    1 
ATOM   4354  C  C     . ALA F 2  90   ? 156.072 142.775 174.854 1.00 73.02  ?  89   ALA F C     1 
ATOM   4355  O  O     . ALA F 2  90   ? 156.249 143.804 174.192 1.00 72.72  ?  89   ALA F O     1 
ATOM   4356  C  CB    . ALA F 2  90   ? 157.987 141.965 176.258 1.00 74.05  ?  89   ALA F CB    1 
ATOM   4357  N  N     . LEU F 2  91   ? 155.399 141.727 174.371 1.00 72.25  ?  90   LEU F N     1 
ATOM   4358  C  CA    . LEU F 2  91   ? 154.828 141.776 173.029 1.00 70.94  ?  90   LEU F CA    1 
ATOM   4359  C  C     . LEU F 2  91   ? 153.612 142.693 172.978 1.00 70.97  ?  90   LEU F C     1 
ATOM   4360  O  O     . LEU F 2  91   ? 153.438 143.449 172.014 1.00 71.18  ?  90   LEU F O     1 
ATOM   4361  C  CB    . LEU F 2  91   ? 154.463 140.368 172.561 1.00 69.92  ?  90   LEU F CB    1 
ATOM   4362  C  CG    . LEU F 2  91   ? 155.635 139.420 172.296 1.00 68.91  ?  90   LEU F CG    1 
ATOM   4363  C  CD1   . LEU F 2  91   ? 155.133 138.055 171.854 1.00 68.05  ?  90   LEU F CD1   1 
ATOM   4364  C  CD2   . LEU F 2  91   ? 156.578 140.010 171.259 1.00 65.84  ?  90   LEU F CD2   1 
ATOM   4365  N  N     . LYS F 2  92   ? 152.757 142.641 174.003 1.00 70.75  ?  91   LYS F N     1 
ATOM   4366  C  CA    . LYS F 2  92   ? 151.607 143.536 174.057 1.00 71.02  ?  91   LYS F CA    1 
ATOM   4367  C  C     . LYS F 2  92   ? 152.013 144.981 174.304 1.00 71.10  ?  91   LYS F C     1 
ATOM   4368  O  O     . LYS F 2  92   ? 151.267 145.893 173.931 1.00 71.35  ?  91   LYS F O     1 
ATOM   4369  C  CB    . LYS F 2  92   ? 150.630 143.080 175.142 1.00 71.22  ?  91   LYS F CB    1 
ATOM   4370  C  CG    . LYS F 2  92   ? 149.895 141.789 174.820 1.00 72.06  ?  91   LYS F CG    1 
ATOM   4371  C  CD    . LYS F 2  92   ? 148.952 141.368 175.944 1.00 73.84  ?  91   LYS F CD    1 
ATOM   4372  C  CE    . LYS F 2  92   ? 147.672 142.198 175.968 1.00 75.95  ?  91   LYS F CE    1 
ATOM   4373  N  NZ    . LYS F 2  92   ? 147.842 143.539 176.596 1.00 77.96  ?  91   LYS F NZ    1 
ATOM   4374  N  N     . ARG F 2  93   ? 153.173 145.211 174.922 1.00 70.97  ?  92   ARG F N     1 
ATOM   4375  C  CA    . ARG F 2  93   ? 153.630 146.579 175.144 1.00 70.70  ?  92   ARG F CA    1 
ATOM   4376  C  C     . ARG F 2  93   ? 154.048 147.240 173.837 1.00 70.62  ?  92   ARG F C     1 
ATOM   4377  O  O     . ARG F 2  93   ? 153.769 148.424 173.616 1.00 70.89  ?  92   ARG F O     1 
ATOM   4378  C  CB    . ARG F 2  93   ? 154.784 146.589 176.146 1.00 70.73  ?  92   ARG F CB    1 
ATOM   4379  C  CG    . ARG F 2  93   ? 155.352 147.969 176.423 1.00 70.78  ?  92   ARG F CG    1 
ATOM   4380  C  CD    . ARG F 2  93   ? 156.544 147.898 177.361 1.00 68.92  ?  92   ARG F CD    1 
ATOM   4381  N  NE    . ARG F 2  93   ? 157.155 149.208 177.560 1.00 67.08  ?  92   ARG F NE    1 
ATOM   4382  C  CZ    . ARG F 2  93   ? 158.095 149.719 176.771 1.00 67.17  ?  92   ARG F CZ    1 
ATOM   4383  N  NH1   . ARG F 2  93   ? 158.534 149.031 175.727 1.00 68.04  ?  92   ARG F NH1   1 
ATOM   4384  N  NH2   . ARG F 2  93   ? 158.594 150.920 177.026 1.00 69.17  ?  92   ARG F NH2   1 
ATOM   4385  N  N     . GLN F 2  94   ? 154.714 146.492 172.956 1.00 70.56  ?  93   GLN F N     1 
ATOM   4386  C  CA    . GLN F 2  94   ? 155.157 147.034 171.678 1.00 70.88  ?  93   GLN F CA    1 
ATOM   4387  C  C     . GLN F 2  94   ? 154.030 147.157 170.662 1.00 70.79  ?  93   GLN F C     1 
ATOM   4388  O  O     . GLN F 2  94   ? 154.215 147.818 169.634 1.00 71.10  ?  93   GLN F O     1 
ATOM   4389  C  CB    . GLN F 2  94   ? 156.276 146.165 171.097 1.00 70.98  ?  93   GLN F CB    1 
ATOM   4390  C  CG    . GLN F 2  94   ? 157.493 146.026 171.998 1.00 72.15  ?  93   GLN F CG    1 
ATOM   4391  C  CD    . GLN F 2  94   ? 158.276 147.318 172.132 1.00 73.21  ?  93   GLN F CD    1 
ATOM   4392  O  OE1   . GLN F 2  94   ? 158.142 148.228 171.313 1.00 73.22  ?  93   GLN F OE1   1 
ATOM   4393  N  NE2   . GLN F 2  94   ? 159.100 147.405 173.169 1.00 73.64  ?  93   GLN F NE2   1 
ATOM   4394  N  N     . GLY F 2  95   ? 152.883 146.546 170.919 1.00 70.27  ?  94   GLY F N     1 
ATOM   4395  C  CA    . GLY F 2  95   ? 151.749 146.608 170.029 1.00 70.17  ?  94   GLY F CA    1 
ATOM   4396  C  C     . GLY F 2  95   ? 151.429 145.333 169.267 1.00 70.15  ?  94   GLY F C     1 
ATOM   4397  O  O     . GLY F 2  95   ? 150.679 145.398 168.285 1.00 69.09  ?  94   GLY F O     1 
ATOM   4398  N  N     . ARG F 2  96   ? 151.969 144.187 169.682 1.00 70.59  ?  95   ARG F N     1 
ATOM   4399  C  CA    . ARG F 2  96   ? 151.722 142.899 169.031 1.00 71.65  ?  95   ARG F CA    1 
ATOM   4400  C  C     . ARG F 2  96   ? 151.183 141.943 170.090 1.00 72.22  ?  95   ARG F C     1 
ATOM   4401  O  O     . ARG F 2  96   ? 151.950 141.228 170.742 1.00 72.18  ?  95   ARG F O     1 
ATOM   4402  C  CB    . ARG F 2  96   ? 152.989 142.361 168.374 1.00 71.97  ?  95   ARG F CB    1 
ATOM   4403  C  CG    . ARG F 2  96   ? 153.600 143.302 167.352 1.00 73.23  ?  95   ARG F CG    1 
ATOM   4404  C  CD    . ARG F 2  96   ? 152.654 143.534 166.187 1.00 75.83  ?  95   ARG F CD    1 
ATOM   4405  N  NE    . ARG F 2  96   ? 152.346 142.294 165.481 1.00 78.17  ?  95   ARG F NE    1 
ATOM   4406  C  CZ    . ARG F 2  96   ? 153.052 141.822 164.460 1.00 77.83  ?  95   ARG F CZ    1 
ATOM   4407  N  NH1   . ARG F 2  96   ? 154.111 142.487 164.021 1.00 75.60  ?  95   ARG F NH1   1 
ATOM   4408  N  NH2   . ARG F 2  96   ? 152.701 140.684 163.876 1.00 77.21  ?  95   ARG F NH2   1 
ATOM   4409  N  N     . THR F 2  97   ? 149.864 141.932 170.257 1.00 73.05  ?  96   THR F N     1 
ATOM   4410  C  CA    . THR F 2  97   ? 149.243 141.075 171.257 1.00 73.80  ?  96   THR F CA    1 
ATOM   4411  C  C     . THR F 2  97   ? 149.351 139.610 170.853 1.00 74.45  ?  96   THR F C     1 
ATOM   4412  O  O     . THR F 2  97   ? 149.197 139.256 169.680 1.00 75.20  ?  96   THR F O     1 
ATOM   4413  C  CB    . THR F 2  97   ? 147.776 141.458 171.450 1.00 73.72  ?  96   THR F CB    1 
ATOM   4414  O  OG1   . THR F 2  97   ? 147.074 141.309 170.209 1.00 73.55  ?  96   THR F OG1   1 
ATOM   4415  C  CG2   . THR F 2  97   ? 147.660 142.901 171.924 1.00 73.84  ?  96   THR F CG2   1 
ATOM   4416  N  N     . LEU F 2  98   ? 149.621 138.756 171.839 1.00 75.12  ?  97   LEU F N     1 
ATOM   4417  C  CA    . LEU F 2  98   ? 149.739 137.318 171.635 1.00 75.57  ?  97   LEU F CA    1 
ATOM   4418  C  C     . LEU F 2  98   ? 148.875 136.600 172.660 1.00 75.99  ?  97   LEU F C     1 
ATOM   4419  O  O     . LEU F 2  98   ? 148.871 136.966 173.840 1.00 75.91  ?  97   LEU F O     1 
ATOM   4420  C  CB    . LEU F 2  98   ? 151.196 136.856 171.752 1.00 75.66  ?  97   LEU F CB    1 
ATOM   4421  C  CG    . LEU F 2  98   ? 151.470 135.361 171.566 1.00 76.80  ?  97   LEU F CG    1 
ATOM   4422  C  CD1   . LEU F 2  98   ? 151.059 134.897 170.176 1.00 77.41  ?  97   LEU F CD1   1 
ATOM   4423  C  CD2   . LEU F 2  98   ? 152.936 135.054 171.826 1.00 77.23  ?  97   LEU F CD2   1 
ATOM   4424  N  N     . TYR F 2  99   ? 148.151 135.583 172.208 1.00 76.31  ?  98   TYR F N     1 
ATOM   4425  C  CA    . TYR F 2  99   ? 147.265 134.793 173.048 1.00 76.62  ?  98   TYR F CA    1 
ATOM   4426  C  C     . TYR F 2  99   ? 147.801 133.370 173.174 1.00 77.38  ?  98   TYR F C     1 
ATOM   4427  O  O     . TYR F 2  99   ? 148.795 132.992 172.548 1.00 77.44  ?  98   TYR F O     1 
ATOM   4428  C  CB    . TYR F 2  99   ? 145.844 134.798 172.479 1.00 76.31  ?  98   TYR F CB    1 
ATOM   4429  C  CG    . TYR F 2  99   ? 145.174 136.154 172.496 1.00 75.77  ?  98   TYR F CG    1 
ATOM   4430  C  CD1   . TYR F 2  99   ? 145.568 137.136 173.396 1.00 74.86  ?  98   TYR F CD1   1 
ATOM   4431  C  CD2   . TYR F 2  99   ? 144.144 136.451 171.613 1.00 74.36  ?  98   TYR F CD2   1 
ATOM   4432  C  CE1   . TYR F 2  99   ? 144.955 138.376 173.414 1.00 75.10  ?  98   TYR F CE1   1 
ATOM   4433  C  CE2   . TYR F 2  99   ? 143.526 137.686 171.624 1.00 75.42  ?  98   TYR F CE2   1 
ATOM   4434  C  CZ    . TYR F 2  99   ? 143.935 138.645 172.526 1.00 75.31  ?  98   TYR F CZ    1 
ATOM   4435  O  OH    . TYR F 2  99   ? 143.319 139.875 172.536 1.00 76.01  ?  98   TYR F OH    1 
ATOM   4436  N  N     . GLY F 2  100  ? 147.126 132.574 174.001 1.00 77.67  ?  99   GLY F N     1 
ATOM   4437  C  CA    . GLY F 2  100  ? 147.496 131.184 174.177 1.00 78.32  ?  99   GLY F CA    1 
ATOM   4438  C  C     . GLY F 2  100  ? 148.404 130.942 175.364 1.00 78.63  ?  99   GLY F C     1 
ATOM   4439  O  O     . GLY F 2  100  ? 148.073 130.156 176.257 1.00 79.24  ?  99   GLY F O     1 
ATOM   4440  N  N     . PHE F 2  101  ? 149.552 131.616 175.389 1.00 78.80  ?  100  PHE F N     1 
ATOM   4441  C  CA    . PHE F 2  101  ? 150.537 131.431 176.455 1.00 78.69  ?  100  PHE F CA    1 
ATOM   4442  C  C     . PHE F 2  101  ? 150.284 132.416 177.598 1.00 79.01  ?  100  PHE F C     1 
ATOM   4443  O  O     . PHE F 2  101  ? 151.149 133.195 177.999 1.00 79.54  ?  100  PHE F O     1 
ATOM   4444  C  CB    . PHE F 2  101  ? 151.948 131.575 175.897 1.00 78.11  ?  100  PHE F CB    1 
ATOM   4445  C  CG    . PHE F 2  101  ? 152.298 130.548 174.859 1.00 78.17  ?  100  PHE F CG    1 
ATOM   4446  C  CD1   . PHE F 2  101  ? 151.723 129.288 174.889 1.00 77.32  ?  100  PHE F CD1   1 
ATOM   4447  C  CD2   . PHE F 2  101  ? 153.200 130.843 173.851 1.00 77.67  ?  100  PHE F CD2   1 
ATOM   4448  C  CE1   . PHE F 2  101  ? 152.043 128.342 173.934 1.00 78.18  ?  100  PHE F CE1   1 
ATOM   4449  C  CE2   . PHE F 2  101  ? 153.524 129.901 172.893 1.00 76.26  ?  100  PHE F CE2   1 
ATOM   4450  C  CZ    . PHE F 2  101  ? 152.944 128.649 172.934 1.00 76.92  ?  100  PHE F CZ    1 
ATOM   4451  N  N     . GLY F 2  102  ? 149.064 132.364 178.125 1.00 79.25  ?  101  GLY F N     1 
ATOM   4452  C  CA    . GLY F 2  102  ? 148.678 133.227 179.223 1.00 79.69  ?  101  GLY F CA    1 
ATOM   4453  C  C     . GLY F 2  102  ? 148.281 134.619 178.778 1.00 79.96  ?  101  GLY F C     1 
ATOM   4454  O  O     . GLY F 2  102  ? 148.683 135.076 177.704 1.00 79.92  ?  101  GLY F O     1 
ATOM   4455  N  N     . GLY F 2  103  ? 147.491 135.304 179.599 1.00 80.49  ?  102  GLY F N     1 
ATOM   4456  C  CA    . GLY F 2  103  ? 147.044 136.648 179.282 1.00 80.68  ?  102  GLY F CA    1 
ATOM   4457  C  C     . GLY F 2  103  ? 145.774 137.044 180.008 1.00 80.57  ?  102  GLY F C     1 
ATOM   4458  O  O     . GLY F 2  103  ? 145.465 138.228 180.146 1.00 80.43  ?  102  GLY F O     1 
ATOM   4459  O  OXT   . GLY F 2  103  ? 145.019 136.192 180.476 1.00 80.45  ?  102  GLY F OXT   1 
ATOM   4460  N  N     . ALA G 3  15   ? 164.878 173.154 205.450 1.00 103.23 ?  14   ALA G N     1 
ATOM   4461  C  CA    . ALA G 3  15   ? 163.910 173.681 204.496 1.00 103.23 ?  14   ALA G CA    1 
ATOM   4462  C  C     . ALA G 3  15   ? 162.495 173.237 204.854 1.00 103.20 ?  14   ALA G C     1 
ATOM   4463  O  O     . ALA G 3  15   ? 162.273 172.621 205.897 1.00 103.31 ?  14   ALA G O     1 
ATOM   4464  C  CB    . ALA G 3  15   ? 164.263 173.242 203.084 1.00 103.19 ?  14   ALA G CB    1 
ATOM   4465  N  N     . LYS G 3  16   ? 161.539 173.555 203.981 1.00 102.91 ?  15   LYS G N     1 
ATOM   4466  C  CA    . LYS G 3  16   ? 160.140 173.203 204.200 1.00 102.52 ?  15   LYS G CA    1 
ATOM   4467  C  C     . LYS G 3  16   ? 159.608 172.285 203.108 1.00 102.11 ?  15   LYS G C     1 
ATOM   4468  O  O     . LYS G 3  16   ? 159.225 171.148 203.400 1.00 102.29 ?  15   LYS G O     1 
ATOM   4469  C  CB    . LYS G 3  16   ? 159.289 174.476 204.299 1.00 102.59 ?  15   LYS G CB    1 
ATOM   4470  C  CG    . LYS G 3  16   ? 159.683 175.399 205.440 1.00 102.82 ?  15   LYS G CG    1 
ATOM   4471  C  CD    . LYS G 3  16   ? 159.556 174.700 206.784 1.00 103.56 ?  15   LYS G CD    1 
ATOM   4472  C  CE    . LYS G 3  16   ? 159.951 175.622 207.926 1.00 103.40 ?  15   LYS G CE    1 
ATOM   4473  N  NZ    . LYS G 3  16   ? 159.832 174.950 209.249 1.00 103.43 ?  15   LYS G NZ    1 
ATOM   4474  N  N     . THR G 3  17   ? 159.570 172.742 201.860 1.00 101.20 ?  16   THR G N     1 
ATOM   4475  C  CA    . THR G 3  17   ? 159.062 171.915 200.775 1.00 100.29 ?  16   THR G CA    1 
ATOM   4476  C  C     . THR G 3  17   ? 160.068 170.830 200.407 1.00 99.28  ?  16   THR G C     1 
ATOM   4477  O  O     . THR G 3  17   ? 161.282 170.996 200.559 1.00 99.33  ?  16   THR G O     1 
ATOM   4478  C  CB    . THR G 3  17   ? 158.750 172.772 199.548 1.00 100.43 ?  16   THR G CB    1 
ATOM   4479  O  OG1   . THR G 3  17   ? 159.944 173.429 199.104 1.00 101.10 ?  16   THR G OG1   1 
ATOM   4480  C  CG2   . THR G 3  17   ? 157.697 173.818 199.882 1.00 100.47 ?  16   THR G CG2   1 
ATOM   4481  N  N     . ARG G 3  18   ? 159.546 169.704 199.916 1.00 97.99  ?  17   ARG G N     1 
ATOM   4482  C  CA    . ARG G 3  18   ? 160.404 168.594 199.521 1.00 96.78  ?  17   ARG G CA    1 
ATOM   4483  C  C     . ARG G 3  18   ? 161.180 168.885 198.244 1.00 95.87  ?  17   ARG G C     1 
ATOM   4484  O  O     . ARG G 3  18   ? 162.200 168.234 197.992 1.00 95.58  ?  17   ARG G O     1 
ATOM   4485  C  CB    . ARG G 3  18   ? 159.573 167.321 199.349 1.00 96.90  ?  17   ARG G CB    1 
ATOM   4486  C  CG    . ARG G 3  18   ? 158.914 166.836 200.630 1.00 97.29  ?  17   ARG G CG    1 
ATOM   4487  C  CD    . ARG G 3  18   ? 158.061 165.601 200.384 1.00 97.54  ?  17   ARG G CD    1 
ATOM   4488  N  NE    . ARG G 3  18   ? 156.967 165.866 199.455 1.00 97.94  ?  17   ARG G NE    1 
ATOM   4489  C  CZ    . ARG G 3  18   ? 156.060 164.964 199.093 1.00 97.70  ?  17   ARG G CZ    1 
ATOM   4490  N  NH1   . ARG G 3  18   ? 156.114 163.733 199.583 1.00 96.54  ?  17   ARG G NH1   1 
ATOM   4491  N  NH2   . ARG G 3  18   ? 155.099 165.293 198.241 1.00 98.16  ?  17   ARG G NH2   1 
ATOM   4492  N  N     . SER G 3  19   ? 160.722 169.843 197.434 1.00 94.81  ?  18   SER G N     1 
ATOM   4493  C  CA    . SER G 3  19   ? 161.447 170.189 196.216 1.00 93.73  ?  18   SER G CA    1 
ATOM   4494  C  C     . SER G 3  19   ? 162.784 170.843 196.537 1.00 93.01  ?  18   SER G C     1 
ATOM   4495  O  O     . SER G 3  19   ? 163.786 170.586 195.859 1.00 93.10  ?  18   SER G O     1 
ATOM   4496  C  CB    . SER G 3  19   ? 160.594 171.107 195.341 1.00 93.69  ?  18   SER G CB    1 
ATOM   4497  O  OG    . SER G 3  19   ? 159.377 170.479 194.978 1.00 93.39  ?  18   SER G OG    1 
ATOM   4498  N  N     . SER G 3  20   ? 162.821 171.691 197.566 1.00 91.87  ?  19   SER G N     1 
ATOM   4499  C  CA    . SER G 3  20   ? 164.075 172.314 197.972 1.00 90.54  ?  19   SER G CA    1 
ATOM   4500  C  C     . SER G 3  20   ? 164.977 171.342 198.720 1.00 89.00  ?  19   SER G C     1 
ATOM   4501  O  O     . SER G 3  20   ? 166.205 171.446 198.625 1.00 88.89  ?  19   SER G O     1 
ATOM   4502  C  CB    . SER G 3  20   ? 163.796 173.544 198.838 1.00 90.88  ?  19   SER G CB    1 
ATOM   4503  O  OG    . SER G 3  20   ? 163.047 173.196 199.989 1.00 92.00  ?  19   SER G OG    1 
ATOM   4504  N  N     . ARG G 3  21   ? 164.394 170.397 199.462 1.00 87.25  ?  20   ARG G N     1 
ATOM   4505  C  CA    . ARG G 3  21   ? 165.203 169.409 200.166 1.00 85.89  ?  20   ARG G CA    1 
ATOM   4506  C  C     . ARG G 3  21   ? 165.807 168.392 199.206 1.00 84.57  ?  20   ARG G C     1 
ATOM   4507  O  O     . ARG G 3  21   ? 166.919 167.905 199.440 1.00 84.61  ?  20   ARG G O     1 
ATOM   4508  C  CB    . ARG G 3  21   ? 164.362 168.700 201.228 1.00 86.20  ?  20   ARG G CB    1 
ATOM   4509  C  CG    . ARG G 3  21   ? 163.775 169.626 202.279 1.00 87.96  ?  20   ARG G CG    1 
ATOM   4510  C  CD    . ARG G 3  21   ? 162.930 168.857 203.281 1.00 91.51  ?  20   ARG G CD    1 
ATOM   4511  N  NE    . ARG G 3  21   ? 162.340 169.734 204.288 1.00 96.24  ?  20   ARG G NE    1 
ATOM   4512  C  CZ    . ARG G 3  21   ? 161.551 169.316 205.272 1.00 98.66  ?  20   ARG G CZ    1 
ATOM   4513  N  NH1   . ARG G 3  21   ? 161.252 168.029 205.385 1.00 98.64  ?  20   ARG G NH1   1 
ATOM   4514  N  NH2   . ARG G 3  21   ? 161.059 170.185 206.145 1.00 99.50  ?  20   ARG G NH2   1 
ATOM   4515  N  N     . ALA G 3  22   ? 165.095 168.059 198.128 1.00 83.12  ?  21   ALA G N     1 
ATOM   4516  C  CA    . ALA G 3  22   ? 165.603 167.101 197.155 1.00 81.47  ?  21   ALA G CA    1 
ATOM   4517  C  C     . ALA G 3  22   ? 166.599 167.720 196.185 1.00 80.36  ?  21   ALA G C     1 
ATOM   4518  O  O     . ALA G 3  22   ? 167.360 166.983 195.547 1.00 80.04  ?  21   ALA G O     1 
ATOM   4519  C  CB    . ALA G 3  22   ? 164.444 166.479 196.374 1.00 81.61  ?  21   ALA G CB    1 
ATOM   4520  N  N     . GLY G 3  23   ? 166.613 169.044 196.058 1.00 79.42  ?  22   GLY G N     1 
ATOM   4521  C  CA    . GLY G 3  23   ? 167.532 169.695 195.146 1.00 78.55  ?  22   GLY G CA    1 
ATOM   4522  C  C     . GLY G 3  23   ? 167.089 169.705 193.702 1.00 77.91  ?  22   GLY G C     1 
ATOM   4523  O  O     . GLY G 3  23   ? 167.935 169.696 192.802 1.00 77.81  ?  22   GLY G O     1 
ATOM   4524  N  N     . LEU G 3  24   ? 165.785 169.723 193.451 1.00 77.43  ?  23   LEU G N     1 
ATOM   4525  C  CA    . LEU G 3  24   ? 165.235 169.731 192.103 1.00 76.57  ?  23   LEU G CA    1 
ATOM   4526  C  C     . LEU G 3  24   ? 164.447 171.024 191.884 1.00 76.44  ?  23   LEU G C     1 
ATOM   4527  O  O     . LEU G 3  24   ? 164.459 171.935 192.717 1.00 76.05  ?  23   LEU G O     1 
ATOM   4528  C  CB    . LEU G 3  24   ? 164.367 168.492 191.872 1.00 76.09  ?  23   LEU G CB    1 
ATOM   4529  C  CG    . LEU G 3  24   ? 165.021 167.141 192.171 1.00 76.07  ?  23   LEU G CG    1 
ATOM   4530  C  CD1   . LEU G 3  24   ? 164.073 165.998 191.838 1.00 76.24  ?  23   LEU G CD1   1 
ATOM   4531  C  CD2   . LEU G 3  24   ? 166.333 166.993 191.416 1.00 75.05  ?  23   LEU G CD2   1 
ATOM   4532  N  N     . GLN G 3  25   ? 163.756 171.097 190.749 1.00 76.59  ?  24   GLN G N     1 
ATOM   4533  C  CA    . GLN G 3  25   ? 162.948 172.258 190.402 1.00 76.83  ?  24   GLN G CA    1 
ATOM   4534  C  C     . GLN G 3  25   ? 161.469 171.949 190.238 1.00 76.84  ?  24   GLN G C     1 
ATOM   4535  O  O     . GLN G 3  25   ? 160.640 172.819 190.514 1.00 77.18  ?  24   GLN G O     1 
ATOM   4536  C  CB    . GLN G 3  25   ? 163.466 172.903 189.106 1.00 76.64  ?  24   GLN G CB    1 
ATOM   4537  C  CG    . GLN G 3  25   ? 164.910 173.378 189.180 1.00 77.00  ?  24   GLN G CG    1 
ATOM   4538  C  CD    . GLN G 3  25   ? 165.105 174.520 190.160 1.00 77.02  ?  24   GLN G CD    1 
ATOM   4539  O  OE1   . GLN G 3  25   ? 164.164 175.246 190.483 1.00 78.64  ?  24   GLN G OE1   1 
ATOM   4540  N  NE2   . GLN G 3  25   ? 166.332 174.683 190.640 1.00 77.36  ?  24   GLN G NE2   1 
ATOM   4541  N  N     . PHE G 3  26   ? 161.115 170.745 189.797 1.00 76.62  ?  25   PHE G N     1 
ATOM   4542  C  CA    . PHE G 3  26   ? 159.715 170.390 189.648 1.00 76.72  ?  25   PHE G CA    1 
ATOM   4543  C  C     . PHE G 3  26   ? 159.077 170.156 191.017 1.00 76.80  ?  25   PHE G C     1 
ATOM   4544  O  O     . PHE G 3  26   ? 159.738 169.691 191.950 1.00 76.89  ?  25   PHE G O     1 
ATOM   4545  C  CB    . PHE G 3  26   ? 159.569 169.143 188.781 1.00 76.80  ?  25   PHE G CB    1 
ATOM   4546  C  CG    . PHE G 3  26   ? 159.811 169.392 187.320 1.00 76.11  ?  25   PHE G CG    1 
ATOM   4547  C  CD1   . PHE G 3  26   ? 159.639 170.657 186.783 1.00 76.72  ?  25   PHE G CD1   1 
ATOM   4548  C  CD2   . PHE G 3  26   ? 160.210 168.363 186.483 1.00 75.85  ?  25   PHE G CD2   1 
ATOM   4549  C  CE1   . PHE G 3  26   ? 159.859 170.893 185.440 1.00 77.26  ?  25   PHE G CE1   1 
ATOM   4550  C  CE2   . PHE G 3  26   ? 160.432 168.593 185.138 1.00 74.82  ?  25   PHE G CE2   1 
ATOM   4551  C  CZ    . PHE G 3  26   ? 160.256 169.860 184.617 1.00 76.53  ?  25   PHE G CZ    1 
ATOM   4552  N  N     . PRO G 3  27   ? 157.791 170.476 191.165 1.00 76.56  ?  26   PRO G N     1 
ATOM   4553  C  CA    . PRO G 3  27   ? 157.137 170.322 192.472 1.00 76.15  ?  26   PRO G CA    1 
ATOM   4554  C  C     . PRO G 3  27   ? 156.955 168.853 192.827 1.00 75.77  ?  26   PRO G C     1 
ATOM   4555  O  O     . PRO G 3  27   ? 156.450 168.062 192.028 1.00 75.91  ?  26   PRO G O     1 
ATOM   4556  C  CB    . PRO G 3  27   ? 155.792 171.031 192.282 1.00 75.79  ?  26   PRO G CB    1 
ATOM   4557  C  CG    . PRO G 3  27   ? 155.532 170.945 190.815 1.00 75.98  ?  26   PRO G CG    1 
ATOM   4558  C  CD    . PRO G 3  27   ? 156.876 171.024 190.148 1.00 76.40  ?  26   PRO G CD    1 
ATOM   4559  N  N     . VAL G 3  28   ? 157.373 168.495 194.042 1.00 75.47  ?  27   VAL G N     1 
ATOM   4560  C  CA    . VAL G 3  28   ? 157.234 167.118 194.503 1.00 75.10  ?  27   VAL G CA    1 
ATOM   4561  C  C     . VAL G 3  28   ? 155.818 166.857 195.002 1.00 74.85  ?  27   VAL G C     1 
ATOM   4562  O  O     . VAL G 3  28   ? 155.273 165.763 194.814 1.00 74.96  ?  27   VAL G O     1 
ATOM   4563  C  CB    . VAL G 3  28   ? 158.287 166.817 195.585 1.00 75.33  ?  27   VAL G CB    1 
ATOM   4564  C  CG1   . VAL G 3  28   ? 158.177 165.375 196.056 1.00 75.37  ?  27   VAL G CG1   1 
ATOM   4565  C  CG2   . VAL G 3  28   ? 159.683 167.105 195.057 1.00 75.35  ?  27   VAL G CG2   1 
ATOM   4566  N  N     . GLY G 3  29   ? 155.198 167.853 195.638 1.00 74.06  ?  28   GLY G N     1 
ATOM   4567  C  CA    . GLY G 3  29   ? 153.847 167.673 196.139 1.00 73.13  ?  28   GLY G CA    1 
ATOM   4568  C  C     . GLY G 3  29   ? 152.805 167.583 195.043 1.00 72.61  ?  28   GLY G C     1 
ATOM   4569  O  O     . GLY G 3  29   ? 151.801 166.881 195.197 1.00 72.39  ?  28   GLY G O     1 
ATOM   4570  N  N     . ARG G 3  30   ? 153.023 168.283 193.927 1.00 72.06  ?  29   ARG G N     1 
ATOM   4571  C  CA    . ARG G 3  30   ? 152.062 168.256 192.828 1.00 71.03  ?  29   ARG G CA    1 
ATOM   4572  C  C     . ARG G 3  30   ? 151.939 166.856 192.239 1.00 71.09  ?  29   ARG G C     1 
ATOM   4573  O  O     . ARG G 3  30   ? 150.838 166.299 192.155 1.00 71.08  ?  29   ARG G O     1 
ATOM   4574  C  CB    . ARG G 3  30   ? 152.475 169.256 191.747 1.00 70.08  ?  29   ARG G CB    1 
ATOM   4575  C  CG    . ARG G 3  30   ? 151.594 169.230 190.506 1.00 67.48  ?  29   ARG G CG    1 
ATOM   4576  C  CD    . ARG G 3  30   ? 150.479 170.262 190.586 1.00 61.07  ?  29   ARG G CD    1 
ATOM   4577  N  NE    . ARG G 3  30   ? 150.998 171.627 190.544 1.00 58.74  ?  29   ARG G NE    1 
ATOM   4578  C  CZ    . ARG G 3  30   ? 150.238 172.716 190.496 1.00 61.45  ?  29   ARG G CZ    1 
ATOM   4579  N  NH1   . ARG G 3  30   ? 148.917 172.606 190.482 1.00 60.69  ?  29   ARG G NH1   1 
ATOM   4580  N  NH2   . ARG G 3  30   ? 150.799 173.917 190.460 1.00 62.11  ?  29   ARG G NH2   1 
ATOM   4581  N  N     . VAL G 3  31   ? 153.065 166.273 191.819 1.00 71.12  ?  30   VAL G N     1 
ATOM   4582  C  CA    . VAL G 3  31   ? 153.039 164.938 191.227 1.00 71.46  ?  30   VAL G CA    1 
ATOM   4583  C  C     . VAL G 3  31   ? 152.582 163.902 192.246 1.00 72.49  ?  30   VAL G C     1 
ATOM   4584  O  O     . VAL G 3  31   ? 151.907 162.927 191.892 1.00 72.17  ?  30   VAL G O     1 
ATOM   4585  C  CB    . VAL G 3  31   ? 154.424 164.598 190.637 1.00 71.07  ?  30   VAL G CB    1 
ATOM   4586  C  CG1   . VAL G 3  31   ? 155.519 164.819 191.670 1.00 70.97  ?  30   VAL G CG1   1 
ATOM   4587  C  CG2   . VAL G 3  31   ? 154.455 163.171 190.109 1.00 69.21  ?  30   VAL G CG2   1 
ATOM   4588  N  N     . HIS G 3  32   ? 152.920 164.098 193.523 1.00 73.96  ?  31   HIS G N     1 
ATOM   4589  C  CA    . HIS G 3  32   ? 152.458 163.179 194.558 1.00 75.41  ?  31   HIS G CA    1 
ATOM   4590  C  C     . HIS G 3  32   ? 150.940 163.222 194.693 1.00 76.05  ?  31   HIS G C     1 
ATOM   4591  O  O     . HIS G 3  32   ? 150.288 162.176 194.800 1.00 76.68  ?  31   HIS G O     1 
ATOM   4592  C  CB    . HIS G 3  32   ? 153.130 163.514 195.890 1.00 75.57  ?  31   HIS G CB    1 
ATOM   4593  C  CG    . HIS G 3  32   ? 152.887 162.499 196.964 1.00 76.80  ?  31   HIS G CG    1 
ATOM   4594  N  ND1   . HIS G 3  32   ? 153.196 162.729 198.287 1.00 78.88  ?  31   HIS G ND1   1 
ATOM   4595  C  CD2   . HIS G 3  32   ? 152.370 161.249 196.910 1.00 77.82  ?  31   HIS G CD2   1 
ATOM   4596  C  CE1   . HIS G 3  32   ? 152.877 161.666 199.003 1.00 80.21  ?  31   HIS G CE1   1 
ATOM   4597  N  NE2   . HIS G 3  32   ? 152.374 160.753 198.191 1.00 79.38  ?  31   HIS G NE2   1 
ATOM   4598  N  N     . ARG G 3  33   ? 150.360 164.425 194.685 1.00 76.29  ?  32   ARG G N     1 
ATOM   4599  C  CA    . ARG G 3  33   ? 148.907 164.545 194.730 1.00 76.63  ?  32   ARG G CA    1 
ATOM   4600  C  C     . ARG G 3  33   ? 148.265 163.981 193.469 1.00 77.06  ?  32   ARG G C     1 
ATOM   4601  O  O     . ARG G 3  33   ? 147.156 163.438 193.527 1.00 77.30  ?  32   ARG G O     1 
ATOM   4602  C  CB    . ARG G 3  33   ? 148.506 166.008 194.933 1.00 76.67  ?  32   ARG G CB    1 
ATOM   4603  C  CG    . ARG G 3  33   ? 147.028 166.231 195.233 1.00 76.16  ?  32   ARG G CG    1 
ATOM   4604  C  CD    . ARG G 3  33   ? 146.241 166.587 193.979 1.00 75.48  ?  32   ARG G CD    1 
ATOM   4605  N  NE    . ARG G 3  33   ? 146.708 167.831 193.374 1.00 75.31  ?  32   ARG G NE    1 
ATOM   4606  C  CZ    . ARG G 3  33   ? 146.213 169.031 193.657 1.00 74.49  ?  32   ARG G CZ    1 
ATOM   4607  N  NH1   . ARG G 3  33   ? 145.231 169.153 194.539 1.00 73.05  ?  32   ARG G NH1   1 
ATOM   4608  N  NH2   . ARG G 3  33   ? 146.699 170.109 193.058 1.00 74.14  ?  32   ARG G NH2   1 
ATOM   4609  N  N     . LEU G 3  34   ? 148.942 164.102 192.323 1.00 77.11  ?  33   LEU G N     1 
ATOM   4610  C  CA    . LEU G 3  34   ? 148.434 163.480 191.105 1.00 77.51  ?  33   LEU G CA    1 
ATOM   4611  C  C     . LEU G 3  34   ? 148.455 161.961 191.206 1.00 78.34  ?  33   LEU G C     1 
ATOM   4612  O  O     . LEU G 3  34   ? 147.579 161.292 190.646 1.00 79.14  ?  33   LEU G O     1 
ATOM   4613  C  CB    . LEU G 3  34   ? 149.245 163.945 189.895 1.00 77.06  ?  33   LEU G CB    1 
ATOM   4614  C  CG    . LEU G 3  34   ? 149.120 165.425 189.525 1.00 77.36  ?  33   LEU G CG    1 
ATOM   4615  C  CD1   . LEU G 3  34   ? 149.967 165.748 188.303 1.00 77.43  ?  33   LEU G CD1   1 
ATOM   4616  C  CD2   . LEU G 3  34   ? 147.666 165.800 189.288 1.00 76.75  ?  33   LEU G CD2   1 
ATOM   4617  N  N     . LEU G 3  35   ? 149.441 161.399 191.911 1.00 78.81  ?  34   LEU G N     1 
ATOM   4618  C  CA    . LEU G 3  35   ? 149.446 159.960 192.149 1.00 79.58  ?  34   LEU G CA    1 
ATOM   4619  C  C     . LEU G 3  35   ? 148.372 159.558 193.151 1.00 80.49  ?  34   LEU G C     1 
ATOM   4620  O  O     . LEU G 3  35   ? 147.830 158.450 193.064 1.00 80.64  ?  34   LEU G O     1 
ATOM   4621  C  CB    . LEU G 3  35   ? 150.824 159.510 192.635 1.00 79.16  ?  34   LEU G CB    1 
ATOM   4622  C  CG    . LEU G 3  35   ? 151.978 159.664 191.643 1.00 78.41  ?  34   LEU G CG    1 
ATOM   4623  C  CD1   . LEU G 3  35   ? 153.284 159.187 192.259 1.00 77.29  ?  34   LEU G CD1   1 
ATOM   4624  C  CD2   . LEU G 3  35   ? 151.682 158.911 190.355 1.00 77.98  ?  34   LEU G CD2   1 
ATOM   4625  N  N     . ARG G 3  36   ? 148.053 160.436 194.103 1.00 81.48  ?  35   ARG G N     1 
ATOM   4626  C  CA    . ARG G 3  36   ? 146.983 160.159 195.053 1.00 82.58  ?  35   ARG G CA    1 
ATOM   4627  C  C     . ARG G 3  36   ? 145.597 160.339 194.447 1.00 82.07  ?  35   ARG G C     1 
ATOM   4628  O  O     . ARG G 3  36   ? 144.621 159.827 195.006 1.00 82.57  ?  35   ARG G O     1 
ATOM   4629  C  CB    . ARG G 3  36   ? 147.120 161.060 196.283 1.00 82.45  ?  35   ARG G CB    1 
ATOM   4630  C  CG    . ARG G 3  36   ? 148.362 160.797 197.119 1.00 84.16  ?  35   ARG G CG    1 
ATOM   4631  C  CD    . ARG G 3  36   ? 148.444 161.761 198.291 1.00 84.83  ?  35   ARG G CD    1 
ATOM   4632  N  NE    . ARG G 3  36   ? 149.590 161.483 199.153 1.00 89.35  ?  35   ARG G NE    1 
ATOM   4633  C  CZ    . ARG G 3  36   ? 149.548 160.687 200.216 1.00 90.72  ?  35   ARG G CZ    1 
ATOM   4634  N  NH1   . ARG G 3  36   ? 148.414 160.088 200.554 1.00 90.63  ?  35   ARG G NH1   1 
ATOM   4635  N  NH2   . ARG G 3  36   ? 150.639 160.490 200.943 1.00 92.20  ?  35   ARG G NH2   1 
ATOM   4636  N  N     . LYS G 3  37   ? 145.489 161.050 193.325 1.00 81.42  ?  36   LYS G N     1 
ATOM   4637  C  CA    . LYS G 3  37   ? 144.206 161.313 192.686 1.00 80.80  ?  36   LYS G CA    1 
ATOM   4638  C  C     . LYS G 3  37   ? 144.039 160.621 191.343 1.00 80.24  ?  36   LYS G C     1 
ATOM   4639  O  O     . LYS G 3  37   ? 142.910 160.298 190.967 1.00 80.28  ?  36   LYS G O     1 
ATOM   4640  C  CB    . LYS G 3  37   ? 144.009 162.824 192.498 1.00 81.00  ?  36   LYS G CB    1 
ATOM   4641  C  CG    . LYS G 3  37   ? 142.619 163.228 192.030 1.00 81.40  ?  36   LYS G CG    1 
ATOM   4642  C  CD    . LYS G 3  37   ? 141.551 162.796 193.023 1.00 82.00  ?  36   LYS G CD    1 
ATOM   4643  C  CE    . LYS G 3  37   ? 141.738 163.474 194.371 1.00 82.90  ?  36   LYS G CE    1 
ATOM   4644  N  NZ    . LYS G 3  37   ? 140.703 163.049 195.354 1.00 84.74  ?  36   LYS G NZ    1 
ATOM   4645  N  N     . GLY G 3  38   ? 145.131 160.375 190.617 1.00 79.14  ?  37   GLY G N     1 
ATOM   4646  C  CA    . GLY G 3  38   ? 145.051 159.729 189.317 1.00 78.12  ?  37   GLY G CA    1 
ATOM   4647  C  C     . GLY G 3  38   ? 144.532 158.305 189.352 1.00 77.65  ?  37   GLY G C     1 
ATOM   4648  O  O     . GLY G 3  38   ? 144.202 157.762 188.291 1.00 77.30  ?  37   GLY G O     1 
ATOM   4649  N  N     . ASN G 3  39   ? 144.457 157.693 190.536 1.00 77.16  ?  38   ASN G N     1 
ATOM   4650  C  CA    . ASN G 3  39   ? 143.933 156.339 190.712 1.00 76.97  ?  38   ASN G CA    1 
ATOM   4651  C  C     . ASN G 3  39   ? 144.734 155.331 189.883 1.00 76.22  ?  38   ASN G C     1 
ATOM   4652  O  O     . ASN G 3  39   ? 144.224 154.687 188.964 1.00 76.38  ?  38   ASN G O     1 
ATOM   4653  C  CB    . ASN G 3  39   ? 142.439 156.283 190.371 1.00 77.23  ?  38   ASN G CB    1 
ATOM   4654  C  CG    . ASN G 3  39   ? 141.748 155.069 190.962 1.00 78.30  ?  38   ASN G CG    1 
ATOM   4655  O  OD1   . ASN G 3  39   ? 142.314 153.978 191.016 1.00 79.64  ?  38   ASN G OD1   1 
ATOM   4656  N  ND2   . ASN G 3  39   ? 140.515 155.258 191.416 1.00 76.70  ?  38   ASN G ND2   1 
ATOM   4657  N  N     . TYR G 3  40   ? 146.016 155.209 190.230 1.00 75.29  ?  39   TYR G N     1 
ATOM   4658  C  CA    . TYR G 3  40   ? 146.917 154.279 189.570 1.00 74.07  ?  39   TYR G CA    1 
ATOM   4659  C  C     . TYR G 3  40   ? 147.487 153.213 190.492 1.00 74.81  ?  39   TYR G C     1 
ATOM   4660  O  O     . TYR G 3  40   ? 147.926 152.169 189.998 1.00 74.30  ?  39   TYR G O     1 
ATOM   4661  C  CB    . TYR G 3  40   ? 148.084 155.034 188.912 1.00 72.54  ?  39   TYR G CB    1 
ATOM   4662  C  CG    . TYR G 3  40   ? 147.657 155.984 187.815 1.00 70.50  ?  39   TYR G CG    1 
ATOM   4663  C  CD1   . TYR G 3  40   ? 146.569 155.693 187.003 1.00 67.92  ?  39   TYR G CD1   1 
ATOM   4664  C  CD2   . TYR G 3  40   ? 148.340 157.173 187.595 1.00 68.17  ?  39   TYR G CD2   1 
ATOM   4665  C  CE1   . TYR G 3  40   ? 146.174 156.559 185.999 1.00 67.40  ?  39   TYR G CE1   1 
ATOM   4666  C  CE2   . TYR G 3  40   ? 147.953 158.045 186.594 1.00 67.43  ?  39   TYR G CE2   1 
ATOM   4667  C  CZ    . TYR G 3  40   ? 146.870 157.732 185.800 1.00 67.89  ?  39   TYR G CZ    1 
ATOM   4668  O  OH    . TYR G 3  40   ? 146.481 158.597 184.803 1.00 68.82  ?  39   TYR G OH    1 
ATOM   4669  N  N     . ALA G 3  41   ? 147.495 153.440 191.804 1.00 75.85  ?  40   ALA G N     1 
ATOM   4670  C  CA    . ALA G 3  41   ? 148.008 152.465 192.754 1.00 77.26  ?  40   ALA G CA    1 
ATOM   4671  C  C     . ALA G 3  41   ? 147.348 152.695 194.104 1.00 78.34  ?  40   ALA G C     1 
ATOM   4672  O  O     . ALA G 3  41   ? 146.978 153.821 194.448 1.00 77.99  ?  40   ALA G O     1 
ATOM   4673  C  CB    . ALA G 3  41   ? 149.533 152.549 192.885 1.00 77.40  ?  40   ALA G CB    1 
ATOM   4674  N  N     . GLU G 3  42   ? 147.204 151.610 194.869 1.00 79.96  ?  41   GLU G N     1 
ATOM   4675  C  CA    . GLU G 3  42   ? 146.589 151.714 196.187 1.00 81.81  ?  41   GLU G CA    1 
ATOM   4676  C  C     . GLU G 3  42   ? 147.507 152.416 197.180 1.00 82.19  ?  41   GLU G C     1 
ATOM   4677  O  O     . GLU G 3  42   ? 147.026 153.118 198.078 1.00 82.38  ?  41   GLU G O     1 
ATOM   4678  C  CB    . GLU G 3  42   ? 146.212 150.324 196.700 1.00 82.20  ?  41   GLU G CB    1 
ATOM   4679  C  CG    . GLU G 3  42   ? 145.462 150.321 198.025 1.00 85.18  ?  41   GLU G CG    1 
ATOM   4680  C  CD    . GLU G 3  42   ? 144.065 150.903 197.911 1.00 89.32  ?  41   GLU G CD    1 
ATOM   4681  O  OE1   . GLU G 3  42   ? 143.517 150.931 196.789 1.00 89.83  ?  41   GLU G OE1   1 
ATOM   4682  O  OE2   . GLU G 3  42   ? 143.514 151.333 198.946 1.00 90.69  ?  41   GLU G OE2   1 
ATOM   4683  N  N     . ARG G 3  43   ? 148.819 152.249 197.034 1.00 82.69  ?  42   ARG G N     1 
ATOM   4684  C  CA    . ARG G 3  43   ? 149.787 152.854 197.935 1.00 83.09  ?  42   ARG G CA    1 
ATOM   4685  C  C     . ARG G 3  43   ? 150.950 153.404 197.122 1.00 82.80  ?  42   ARG G C     1 
ATOM   4686  O  O     . ARG G 3  43   ? 151.322 152.845 196.087 1.00 82.91  ?  42   ARG G O     1 
ATOM   4687  C  CB    . ARG G 3  43   ? 150.289 151.840 198.975 1.00 83.42  ?  42   ARG G CB    1 
ATOM   4688  C  CG    . ARG G 3  43   ? 151.153 152.435 200.076 1.00 85.57  ?  42   ARG G CG    1 
ATOM   4689  C  CD    . ARG G 3  43   ? 151.479 151.396 201.137 1.00 88.59  ?  42   ARG G CD    1 
ATOM   4690  N  NE    . ARG G 3  43   ? 150.273 150.871 201.771 1.00 91.13  ?  42   ARG G NE    1 
ATOM   4691  C  CZ    . ARG G 3  43   ? 150.274 149.955 202.734 1.00 93.22  ?  42   ARG G CZ    1 
ATOM   4692  N  NH1   . ARG G 3  43   ? 151.420 149.457 203.179 1.00 93.84  ?  42   ARG G NH1   1 
ATOM   4693  N  NH2   . ARG G 3  43   ? 149.128 149.535 203.254 1.00 94.53  ?  42   ARG G NH2   1 
ATOM   4694  N  N     . VAL G 3  44   ? 151.514 154.511 197.594 1.00 82.10  ?  43   VAL G N     1 
ATOM   4695  C  CA    . VAL G 3  44   ? 152.641 155.152 196.937 1.00 81.45  ?  43   VAL G CA    1 
ATOM   4696  C  C     . VAL G 3  44   ? 153.896 154.929 197.776 1.00 80.80  ?  43   VAL G C     1 
ATOM   4697  O  O     . VAL G 3  44   ? 153.836 154.502 198.929 1.00 81.15  ?  43   VAL G O     1 
ATOM   4698  C  CB    . VAL G 3  44   ? 152.393 156.654 196.695 1.00 81.58  ?  43   VAL G CB    1 
ATOM   4699  C  CG1   . VAL G 3  44   ? 151.138 156.857 195.860 1.00 80.94  ?  43   VAL G CG1   1 
ATOM   4700  C  CG2   . VAL G 3  44   ? 152.287 157.394 198.019 1.00 81.26  ?  43   VAL G CG2   1 
ATOM   4701  N  N     . GLY G 3  45   ? 155.045 155.227 197.179 1.00 79.78  ?  44   GLY G N     1 
ATOM   4702  C  CA    . GLY G 3  45   ? 156.326 155.068 197.833 1.00 78.46  ?  44   GLY G CA    1 
ATOM   4703  C  C     . GLY G 3  45   ? 156.791 156.335 198.519 1.00 77.58  ?  44   GLY G C     1 
ATOM   4704  O  O     . GLY G 3  45   ? 156.008 157.242 198.814 1.00 78.00  ?  44   GLY G O     1 
ATOM   4705  N  N     . ALA G 3  46   ? 158.097 156.392 198.774 1.00 76.36  ?  45   ALA G N     1 
ATOM   4706  C  CA    . ALA G 3  46   ? 158.714 157.536 199.432 1.00 74.66  ?  45   ALA G CA    1 
ATOM   4707  C  C     . ALA G 3  46   ? 159.650 158.327 198.534 1.00 73.33  ?  45   ALA G C     1 
ATOM   4708  O  O     . ALA G 3  46   ? 159.828 159.526 198.757 1.00 73.38  ?  45   ALA G O     1 
ATOM   4709  C  CB    . ALA G 3  46   ? 159.489 157.082 200.676 1.00 74.82  ?  45   ALA G CB    1 
ATOM   4710  N  N     . GLY G 3  47   ? 160.249 157.692 197.530 1.00 71.65  ?  46   GLY G N     1 
ATOM   4711  C  CA    . GLY G 3  47   ? 161.156 158.381 196.633 1.00 70.14  ?  46   GLY G CA    1 
ATOM   4712  C  C     . GLY G 3  47   ? 160.696 158.362 195.190 1.00 68.96  ?  46   GLY G C     1 
ATOM   4713  O  O     . GLY G 3  47   ? 161.490 158.596 194.274 1.00 68.21  ?  46   GLY G O     1 
ATOM   4714  N  N     . ALA G 3  48   ? 159.406 158.083 194.976 1.00 68.10  ?  47   ALA G N     1 
ATOM   4715  C  CA    . ALA G 3  48   ? 158.885 158.044 193.610 1.00 66.73  ?  47   ALA G CA    1 
ATOM   4716  C  C     . ALA G 3  48   ? 158.712 159.436 193.011 1.00 65.95  ?  47   ALA G C     1 
ATOM   4717  O  O     . ALA G 3  48   ? 159.169 159.653 191.875 1.00 66.10  ?  47   ALA G O     1 
ATOM   4718  C  CB    . ALA G 3  48   ? 157.582 157.240 193.572 1.00 66.60  ?  47   ALA G CB    1 
ATOM   4719  N  N     . PRO G 3  49   ? 158.076 160.409 193.681 1.00 65.03  ?  48   PRO G N     1 
ATOM   4720  C  CA    . PRO G 3  49   ? 157.930 161.729 193.046 1.00 65.24  ?  48   PRO G CA    1 
ATOM   4721  C  C     . PRO G 3  49   ? 159.250 162.449 192.836 1.00 65.39  ?  48   PRO G C     1 
ATOM   4722  O  O     . PRO G 3  49   ? 159.369 163.232 191.885 1.00 65.41  ?  48   PRO G O     1 
ATOM   4723  C  CB    . PRO G 3  49   ? 157.021 162.490 194.022 1.00 64.96  ?  48   PRO G CB    1 
ATOM   4724  C  CG    . PRO G 3  49   ? 157.241 161.827 195.328 1.00 65.93  ?  48   PRO G CG    1 
ATOM   4725  C  CD    . PRO G 3  49   ? 157.423 160.377 195.003 1.00 65.08  ?  48   PRO G CD    1 
ATOM   4726  N  N     . VAL G 3  50   ? 160.245 162.212 193.692 1.00 65.46  ?  49   VAL G N     1 
ATOM   4727  C  CA    . VAL G 3  50   ? 161.553 162.828 193.492 1.00 65.22  ?  49   VAL G CA    1 
ATOM   4728  C  C     . VAL G 3  50   ? 162.256 162.203 192.293 1.00 64.97  ?  49   VAL G C     1 
ATOM   4729  O  O     . VAL G 3  50   ? 162.877 162.903 191.484 1.00 64.94  ?  49   VAL G O     1 
ATOM   4730  C  CB    . VAL G 3  50   ? 162.397 162.709 194.774 1.00 65.58  ?  49   VAL G CB    1 
ATOM   4731  C  CG1   . VAL G 3  50   ? 163.769 163.331 194.569 1.00 65.53  ?  49   VAL G CG1   1 
ATOM   4732  C  CG2   . VAL G 3  50   ? 161.677 163.364 195.944 1.00 66.39  ?  49   VAL G CG2   1 
ATOM   4733  N  N     . TYR G 3  51   ? 162.163 160.878 192.156 1.00 64.72  ?  50   TYR G N     1 
ATOM   4734  C  CA    . TYR G 3  51   ? 162.776 160.196 191.021 1.00 65.15  ?  50   TYR G CA    1 
ATOM   4735  C  C     . TYR G 3  51   ? 162.125 160.624 189.711 1.00 65.64  ?  50   TYR G C     1 
ATOM   4736  O  O     . TYR G 3  51   ? 162.814 160.958 188.738 1.00 65.94  ?  50   TYR G O     1 
ATOM   4737  C  CB    . TYR G 3  51   ? 162.668 158.682 191.214 1.00 65.38  ?  50   TYR G CB    1 
ATOM   4738  C  CG    . TYR G 3  51   ? 163.532 157.862 190.283 1.00 65.82  ?  50   TYR G CG    1 
ATOM   4739  C  CD1   . TYR G 3  51   ? 163.074 157.486 189.027 1.00 65.03  ?  50   TYR G CD1   1 
ATOM   4740  C  CD2   . TYR G 3  51   ? 164.801 157.450 190.668 1.00 68.31  ?  50   TYR G CD2   1 
ATOM   4741  C  CE1   . TYR G 3  51   ? 163.859 156.732 188.177 1.00 66.68  ?  50   TYR G CE1   1 
ATOM   4742  C  CE2   . TYR G 3  51   ? 165.593 156.695 189.825 1.00 67.94  ?  50   TYR G CE2   1 
ATOM   4743  C  CZ    . TYR G 3  51   ? 165.117 156.339 188.581 1.00 67.62  ?  50   TYR G CZ    1 
ATOM   4744  O  OH    . TYR G 3  51   ? 165.901 155.588 187.739 1.00 66.96  ?  50   TYR G OH    1 
ATOM   4745  N  N     . LEU G 3  52   ? 160.790 160.623 189.671 1.00 65.66  ?  51   LEU G N     1 
ATOM   4746  C  CA    . LEU G 3  52   ? 160.082 161.048 188.468 1.00 65.43  ?  51   LEU G CA    1 
ATOM   4747  C  C     . LEU G 3  52   ? 160.351 162.515 188.159 1.00 65.13  ?  51   LEU G C     1 
ATOM   4748  O  O     . LEU G 3  52   ? 160.470 162.900 186.990 1.00 65.58  ?  51   LEU G O     1 
ATOM   4749  C  CB    . LEU G 3  52   ? 158.583 160.795 188.627 1.00 65.88  ?  51   LEU G CB    1 
ATOM   4750  C  CG    . LEU G 3  52   ? 157.687 161.209 187.458 1.00 65.97  ?  51   LEU G CG    1 
ATOM   4751  C  CD1   . LEU G 3  52   ? 158.124 160.516 186.179 1.00 66.97  ?  51   LEU G CD1   1 
ATOM   4752  C  CD2   . LEU G 3  52   ? 156.230 160.903 187.766 1.00 64.76  ?  51   LEU G CD2   1 
ATOM   4753  N  N     . ALA G 3  53   ? 160.455 163.349 189.197 1.00 64.54  ?  52   ALA G N     1 
ATOM   4754  C  CA    . ALA G 3  53   ? 160.779 164.755 188.983 1.00 64.38  ?  52   ALA G CA    1 
ATOM   4755  C  C     . ALA G 3  53   ? 162.184 164.928 188.422 1.00 64.48  ?  52   ALA G C     1 
ATOM   4756  O  O     . ALA G 3  53   ? 162.420 165.834 187.614 1.00 65.07  ?  52   ALA G O     1 
ATOM   4757  C  CB    . ALA G 3  53   ? 160.627 165.536 190.289 1.00 64.39  ?  52   ALA G CB    1 
ATOM   4758  N  N     . ALA G 3  54   ? 163.125 164.076 188.834 1.00 63.77  ?  53   ALA G N     1 
ATOM   4759  C  CA    . ALA G 3  54   ? 164.479 164.157 188.295 1.00 63.20  ?  53   ALA G CA    1 
ATOM   4760  C  C     . ALA G 3  54   ? 164.524 163.689 186.846 1.00 62.48  ?  53   ALA G C     1 
ATOM   4761  O  O     . ALA G 3  54   ? 165.198 164.304 186.010 1.00 62.68  ?  53   ALA G O     1 
ATOM   4762  C  CB    . ALA G 3  54   ? 165.438 163.335 189.156 1.00 63.69  ?  53   ALA G CB    1 
ATOM   4763  N  N     . VAL G 3  55   ? 163.812 162.604 186.532 1.00 61.30  ?  54   VAL G N     1 
ATOM   4764  C  CA    . VAL G 3  55   ? 163.773 162.111 185.157 1.00 59.32  ?  54   VAL G CA    1 
ATOM   4765  C  C     . VAL G 3  55   ? 163.136 163.147 184.239 1.00 58.42  ?  54   VAL G C     1 
ATOM   4766  O  O     . VAL G 3  55   ? 163.653 163.447 183.156 1.00 58.19  ?  54   VAL G O     1 
ATOM   4767  C  CB    . VAL G 3  55   ? 163.032 160.763 185.091 1.00 58.77  ?  54   VAL G CB    1 
ATOM   4768  C  CG1   . VAL G 3  55   ? 162.868 160.318 183.646 1.00 56.45  ?  54   VAL G CG1   1 
ATOM   4769  C  CG2   . VAL G 3  55   ? 163.779 159.711 185.895 1.00 58.05  ?  54   VAL G CG2   1 
ATOM   4770  N  N     . LEU G 3  56   ? 162.002 163.712 184.662 1.00 57.78  ?  55   LEU G N     1 
ATOM   4771  C  CA    . LEU G 3  56   ? 161.359 164.756 183.869 1.00 58.09  ?  55   LEU G CA    1 
ATOM   4772  C  C     . LEU G 3  56   ? 162.248 165.987 183.755 1.00 57.84  ?  55   LEU G C     1 
ATOM   4773  O  O     . LEU G 3  56   ? 162.247 166.670 182.723 1.00 57.65  ?  55   LEU G O     1 
ATOM   4774  C  CB    . LEU G 3  56   ? 160.006 165.124 184.479 1.00 58.42  ?  55   LEU G CB    1 
ATOM   4775  C  CG    . LEU G 3  56   ? 158.903 164.065 184.405 1.00 57.83  ?  55   LEU G CG    1 
ATOM   4776  C  CD1   . LEU G 3  56   ? 157.638 164.559 185.090 1.00 55.78  ?  55   LEU G CD1   1 
ATOM   4777  C  CD2   . LEU G 3  56   ? 158.621 163.686 182.961 1.00 55.11  ?  55   LEU G CD2   1 
ATOM   4778  N  N     . GLU G 3  57   ? 163.018 166.286 184.805 1.00 58.57  ?  56   GLU G N     1 
ATOM   4779  C  CA    . GLU G 3  57   ? 163.944 167.412 184.745 1.00 59.37  ?  56   GLU G CA    1 
ATOM   4780  C  C     . GLU G 3  57   ? 165.034 167.172 183.708 1.00 59.16  ?  56   GLU G C     1 
ATOM   4781  O  O     . GLU G 3  57   ? 165.438 168.098 182.994 1.00 58.58  ?  56   GLU G O     1 
ATOM   4782  C  CB    . GLU G 3  57   ? 164.555 167.666 186.123 1.00 59.21  ?  56   GLU G CB    1 
ATOM   4783  C  CG    . GLU G 3  57   ? 165.539 168.824 186.159 1.00 60.86  ?  56   GLU G CG    1 
ATOM   4784  C  CD    . GLU G 3  57   ? 166.116 169.060 187.541 1.00 60.90  ?  56   GLU G CD    1 
ATOM   4785  O  OE1   . GLU G 3  57   ? 165.711 168.349 188.485 1.00 60.35  ?  56   GLU G OE1   1 
ATOM   4786  O  OE2   . GLU G 3  57   ? 166.975 169.956 187.682 1.00 65.27  ?  56   GLU G OE2   1 
ATOM   4787  N  N     . TYR G 3  58   ? 165.525 165.934 183.609 1.00 59.35  ?  57   TYR G N     1 
ATOM   4788  C  CA    . TYR G 3  58   ? 166.503 165.615 182.573 1.00 59.91  ?  57   TYR G CA    1 
ATOM   4789  C  C     . TYR G 3  58   ? 165.876 165.682 181.186 1.00 59.85  ?  57   TYR G C     1 
ATOM   4790  O  O     . TYR G 3  58   ? 166.503 166.171 180.237 1.00 60.04  ?  57   TYR G O     1 
ATOM   4791  C  CB    . TYR G 3  58   ? 167.106 164.233 182.825 1.00 61.13  ?  57   TYR G CB    1 
ATOM   4792  C  CG    . TYR G 3  58   ? 168.085 163.784 181.761 1.00 63.08  ?  57   TYR G CG    1 
ATOM   4793  C  CD1   . TYR G 3  58   ? 169.400 164.230 181.767 1.00 64.82  ?  57   TYR G CD1   1 
ATOM   4794  C  CD2   . TYR G 3  58   ? 167.694 162.912 180.752 1.00 63.27  ?  57   TYR G CD2   1 
ATOM   4795  C  CE1   . TYR G 3  58   ? 170.299 163.822 180.798 1.00 65.10  ?  57   TYR G CE1   1 
ATOM   4796  C  CE2   . TYR G 3  58   ? 168.585 162.499 179.778 1.00 63.87  ?  57   TYR G CE2   1 
ATOM   4797  C  CZ    . TYR G 3  58   ? 169.886 162.957 179.806 1.00 65.32  ?  57   TYR G CZ    1 
ATOM   4798  O  OH    . TYR G 3  58   ? 170.776 162.549 178.839 1.00 65.04  ?  57   TYR G OH    1 
ATOM   4799  N  N     . LEU G 3  59   ? 164.637 165.201 181.052 1.00 59.20  ?  58   LEU G N     1 
ATOM   4800  C  CA    . LEU G 3  59   ? 163.954 165.236 179.763 1.00 58.14  ?  58   LEU G CA    1 
ATOM   4801  C  C     . LEU G 3  59   ? 163.782 166.670 179.274 1.00 57.58  ?  58   LEU G C     1 
ATOM   4802  O  O     . LEU G 3  59   ? 164.191 167.014 178.159 1.00 57.01  ?  58   LEU G O     1 
ATOM   4803  C  CB    . LEU G 3  59   ? 162.599 164.532 179.866 1.00 58.17  ?  58   LEU G CB    1 
ATOM   4804  C  CG    . LEU G 3  59   ? 162.623 163.023 180.112 1.00 59.01  ?  58   LEU G CG    1 
ATOM   4805  C  CD1   . LEU G 3  59   ? 161.207 162.479 180.210 1.00 58.44  ?  58   LEU G CD1   1 
ATOM   4806  C  CD2   . LEU G 3  59   ? 163.401 162.308 179.018 1.00 58.95  ?  58   LEU G CD2   1 
ATOM   4807  N  N     . THR G 3  60   ? 163.177 167.527 180.101 1.00 56.60  ?  59   THR G N     1 
ATOM   4808  C  CA    . THR G 3  60   ? 163.015 168.923 179.710 1.00 56.96  ?  59   THR G CA    1 
ATOM   4809  C  C     . THR G 3  60   ? 164.350 169.649 179.610 1.00 58.05  ?  59   THR G C     1 
ATOM   4810  O  O     . THR G 3  60   ? 164.440 170.658 178.904 1.00 57.88  ?  59   THR G O     1 
ATOM   4811  C  CB    . THR G 3  60   ? 162.096 169.656 180.692 1.00 57.14  ?  59   THR G CB    1 
ATOM   4812  O  OG1   . THR G 3  60   ? 161.802 170.964 180.184 1.00 55.10  ?  59   THR G OG1   1 
ATOM   4813  C  CG2   . THR G 3  60   ? 162.758 169.791 182.054 1.00 54.09  ?  59   THR G CG2   1 
ATOM   4814  N  N     . ALA G 3  61   ? 165.386 169.156 180.291 1.00 59.13  ?  60   ALA G N     1 
ATOM   4815  C  CA    . ALA G 3  61   ? 166.705 169.767 180.174 1.00 59.46  ?  60   ALA G CA    1 
ATOM   4816  C  C     . ALA G 3  61   ? 167.298 169.521 178.793 1.00 60.11  ?  60   ALA G C     1 
ATOM   4817  O  O     . ALA G 3  61   ? 167.767 170.455 178.131 1.00 60.36  ?  60   ALA G O     1 
ATOM   4818  C  CB    . ALA G 3  61   ? 167.629 169.230 181.267 1.00 59.91  ?  60   ALA G CB    1 
ATOM   4819  N  N     . GLU G 3  62   ? 167.277 168.266 178.336 1.00 60.93  ?  61   GLU G N     1 
ATOM   4820  C  CA    . GLU G 3  62   ? 167.807 167.959 177.011 1.00 62.14  ?  61   GLU G CA    1 
ATOM   4821  C  C     . GLU G 3  62   ? 166.925 168.543 175.913 1.00 62.83  ?  61   GLU G C     1 
ATOM   4822  O  O     . GLU G 3  62   ? 167.432 169.029 174.894 1.00 63.42  ?  61   GLU G O     1 
ATOM   4823  C  CB    . GLU G 3  62   ? 167.951 166.447 176.840 1.00 63.22  ?  61   GLU G CB    1 
ATOM   4824  C  CG    . GLU G 3  62   ? 168.599 166.030 175.529 1.00 63.56  ?  61   GLU G CG    1 
ATOM   4825  C  CD    . GLU G 3  62   ? 168.800 164.531 175.428 1.00 68.86  ?  61   GLU G CD    1 
ATOM   4826  O  OE1   . GLU G 3  62   ? 168.457 163.816 176.394 1.00 67.41  ?  61   GLU G OE1   1 
ATOM   4827  O  OE2   . GLU G 3  62   ? 169.302 164.067 174.383 1.00 70.81  ?  61   GLU G OE2   1 
ATOM   4828  N  N     . ILE G 3  63   ? 165.604 168.509 176.104 1.00 63.59  ?  62   ILE G N     1 
ATOM   4829  C  CA    . ILE G 3  63   ? 164.695 169.046 175.097 1.00 64.29  ?  62   ILE G CA    1 
ATOM   4830  C  C     . ILE G 3  63   ? 164.858 170.556 174.978 1.00 64.63  ?  62   ILE G C     1 
ATOM   4831  O  O     . ILE G 3  63   ? 164.898 171.104 173.870 1.00 64.83  ?  62   ILE G O     1 
ATOM   4832  C  CB    . ILE G 3  63   ? 163.243 168.650 175.422 1.00 64.91  ?  62   ILE G CB    1 
ATOM   4833  C  CG1   . ILE G 3  63   ? 163.036 167.151 175.187 1.00 64.81  ?  62   ILE G CG1   1 
ATOM   4834  C  CG2   . ILE G 3  63   ? 162.261 169.466 174.593 1.00 63.41  ?  62   ILE G CG2   1 
ATOM   4835  C  CD1   . ILE G 3  63   ? 163.350 166.705 173.774 1.00 64.58  ?  62   ILE G CD1   1 
ATOM   4836  N  N     . LEU G 3  64   ? 164.963 171.255 176.112 1.00 65.30  ?  63   LEU G N     1 
ATOM   4837  C  CA    . LEU G 3  64   ? 165.182 172.697 176.059 1.00 66.70  ?  63   LEU G CA    1 
ATOM   4838  C  C     . LEU G 3  64   ? 166.586 173.034 175.577 1.00 67.75  ?  63   LEU G C     1 
ATOM   4839  O  O     . LEU G 3  64   ? 166.812 174.131 175.055 1.00 68.26  ?  63   LEU G O     1 
ATOM   4840  C  CB    . LEU G 3  64   ? 164.924 173.326 177.428 1.00 66.47  ?  63   LEU G CB    1 
ATOM   4841  C  CG    . LEU G 3  64   ? 163.458 173.506 177.826 1.00 66.02  ?  63   LEU G CG    1 
ATOM   4842  C  CD1   . LEU G 3  64   ? 163.354 174.138 179.204 1.00 64.99  ?  63   LEU G CD1   1 
ATOM   4843  C  CD2   . LEU G 3  64   ? 162.720 174.342 176.791 1.00 65.90  ?  63   LEU G CD2   1 
ATOM   4844  N  N     . GLU G 3  65   ? 167.537 172.112 175.743 1.00 68.37  ?  64   GLU G N     1 
ATOM   4845  C  CA    . GLU G 3  65   ? 168.885 172.339 175.232 1.00 68.51  ?  64   GLU G CA    1 
ATOM   4846  C  C     . GLU G 3  65   ? 168.912 172.262 173.710 1.00 67.96  ?  64   GLU G C     1 
ATOM   4847  O  O     . GLU G 3  65   ? 169.379 173.190 173.036 1.00 68.36  ?  64   GLU G O     1 
ATOM   4848  C  CB    . GLU G 3  65   ? 169.852 171.326 175.845 1.00 69.18  ?  64   GLU G CB    1 
ATOM   4849  C  CG    . GLU G 3  65   ? 171.281 171.438 175.340 1.00 71.21  ?  64   GLU G CG    1 
ATOM   4850  C  CD    . GLU G 3  65   ? 171.961 172.722 175.780 1.00 71.61  ?  64   GLU G CD    1 
ATOM   4851  O  OE1   . GLU G 3  65   ? 171.548 173.297 176.809 1.00 72.28  ?  64   GLU G OE1   1 
ATOM   4852  O  OE2   . GLU G 3  65   ? 172.909 173.158 175.094 1.00 71.67  ?  64   GLU G OE2   1 
ATOM   4853  N  N     . LEU G 3  66   ? 168.408 171.159 173.149 1.00 67.37  ?  65   LEU G N     1 
ATOM   4854  C  CA    . LEU G 3  66   ? 168.324 171.041 171.698 1.00 66.74  ?  65   LEU G CA    1 
ATOM   4855  C  C     . LEU G 3  66   ? 167.370 172.063 171.096 1.00 65.84  ?  65   LEU G C     1 
ATOM   4856  O  O     . LEU G 3  66   ? 167.496 172.390 169.911 1.00 64.88  ?  65   LEU G O     1 
ATOM   4857  C  CB    . LEU G 3  66   ? 167.896 169.626 171.306 1.00 66.24  ?  65   LEU G CB    1 
ATOM   4858  C  CG    . LEU G 3  66   ? 168.882 168.509 171.656 1.00 66.90  ?  65   LEU G CG    1 
ATOM   4859  C  CD1   . LEU G 3  66   ? 168.387 167.165 171.145 1.00 68.70  ?  65   LEU G CD1   1 
ATOM   4860  C  CD2   . LEU G 3  66   ? 170.263 168.821 171.100 1.00 68.97  ?  65   LEU G CD2   1 
ATOM   4861  N  N     . ALA G 3  67   ? 166.417 172.569 171.883 1.00 65.75  ?  66   ALA G N     1 
ATOM   4862  C  CA    . ALA G 3  67   ? 165.581 173.668 171.415 1.00 66.23  ?  66   ALA G CA    1 
ATOM   4863  C  C     . ALA G 3  67   ? 166.358 174.978 171.404 1.00 65.57  ?  66   ALA G C     1 
ATOM   4864  O  O     . ALA G 3  67   ? 166.158 175.819 170.520 1.00 64.98  ?  66   ALA G O     1 
ATOM   4865  C  CB    . ALA G 3  67   ? 164.334 173.791 172.290 1.00 66.51  ?  66   ALA G CB    1 
ATOM   4866  N  N     . GLY G 3  68   ? 167.243 175.170 172.384 1.00 65.91  ?  67   GLY G N     1 
ATOM   4867  C  CA    . GLY G 3  68   ? 168.100 176.343 172.371 1.00 65.78  ?  67   GLY G CA    1 
ATOM   4868  C  C     . GLY G 3  68   ? 169.056 176.341 171.195 1.00 65.46  ?  67   GLY G C     1 
ATOM   4869  O  O     . GLY G 3  68   ? 169.254 177.370 170.543 1.00 64.50  ?  67   GLY G O     1 
ATOM   4870  N  N     . ASN G 3  69   ? 169.660 175.185 170.904 1.00 65.95  ?  68   ASN G N     1 
ATOM   4871  C  CA    . ASN G 3  69   ? 170.496 175.079 169.713 1.00 66.95  ?  68   ASN G CA    1 
ATOM   4872  C  C     . ASN G 3  69   ? 169.668 175.251 168.445 1.00 67.47  ?  68   ASN G C     1 
ATOM   4873  O  O     . ASN G 3  69   ? 170.103 175.914 167.495 1.00 67.48  ?  68   ASN G O     1 
ATOM   4874  C  CB    . ASN G 3  69   ? 171.229 173.738 169.704 1.00 67.03  ?  68   ASN G CB    1 
ATOM   4875  C  CG    . ASN G 3  69   ? 172.145 173.567 170.901 1.00 68.22  ?  68   ASN G CG    1 
ATOM   4876  O  OD1   . ASN G 3  69   ? 171.986 174.241 171.919 1.00 67.50  ?  68   ASN G OD1   1 
ATOM   4877  N  ND2   . ASN G 3  69   ? 173.110 172.662 170.784 1.00 68.45  ?  68   ASN G ND2   1 
ATOM   4878  N  N     . ALA G 3  70   ? 168.464 174.673 168.418 1.00 68.12  ?  69   ALA G N     1 
ATOM   4879  C  CA    . ALA G 3  70   ? 167.555 174.850 167.292 1.00 68.11  ?  69   ALA G CA    1 
ATOM   4880  C  C     . ALA G 3  70   ? 167.036 176.276 167.176 1.00 68.36  ?  69   ALA G C     1 
ATOM   4881  O  O     . ALA G 3  70   ? 166.401 176.605 166.168 1.00 68.13  ?  69   ALA G O     1 
ATOM   4882  C  CB    . ALA G 3  70   ? 166.379 173.879 167.408 1.00 67.54  ?  69   ALA G CB    1 
ATOM   4883  N  N     . ALA G 3  71   ? 167.276 177.119 168.181 1.00 69.43  ?  70   ALA G N     1 
ATOM   4884  C  CA    . ALA G 3  71   ? 166.968 178.539 168.096 1.00 71.05  ?  70   ALA G CA    1 
ATOM   4885  C  C     . ALA G 3  71   ? 168.188 179.391 167.778 1.00 72.78  ?  70   ALA G C     1 
ATOM   4886  O  O     . ALA G 3  71   ? 168.031 180.499 167.254 1.00 72.79  ?  70   ALA G O     1 
ATOM   4887  C  CB    . ALA G 3  71   ? 166.340 179.028 169.407 1.00 70.69  ?  70   ALA G CB    1 
ATOM   4888  N  N     . ARG G 3  72   ? 169.393 178.901 168.079 1.00 74.74  ?  71   ARG G N     1 
ATOM   4889  C  CA    . ARG G 3  72   ? 170.610 179.633 167.754 1.00 76.14  ?  71   ARG G CA    1 
ATOM   4890  C  C     . ARG G 3  72   ? 171.116 179.342 166.348 1.00 76.58  ?  71   ARG G C     1 
ATOM   4891  O  O     . ARG G 3  72   ? 171.820 180.181 165.775 1.00 76.95  ?  71   ARG G O     1 
ATOM   4892  C  CB    . ARG G 3  72   ? 171.712 179.307 168.765 1.00 76.79  ?  71   ARG G CB    1 
ATOM   4893  C  CG    . ARG G 3  72   ? 171.449 179.834 170.163 1.00 79.73  ?  71   ARG G CG    1 
ATOM   4894  C  CD    . ARG G 3  72   ? 172.627 179.561 171.079 1.00 84.81  ?  71   ARG G CD    1 
ATOM   4895  N  NE    . ARG G 3  72   ? 172.419 180.113 172.414 1.00 90.04  ?  71   ARG G NE    1 
ATOM   4896  C  CZ    . ARG G 3  72   ? 173.311 180.046 173.396 1.00 91.70  ?  71   ARG G CZ    1 
ATOM   4897  N  NH1   . ARG G 3  72   ? 174.478 179.449 173.193 1.00 91.17  ?  71   ARG G NH1   1 
ATOM   4898  N  NH2   . ARG G 3  72   ? 173.038 180.575 174.580 1.00 91.01  ?  71   ARG G NH2   1 
ATOM   4899  N  N     . ASP G 3  73   ? 170.780 178.180 165.782 1.00 76.80  ?  72   ASP G N     1 
ATOM   4900  C  CA    . ASP G 3  73   ? 171.229 177.863 164.431 1.00 77.74  ?  72   ASP G CA    1 
ATOM   4901  C  C     . ASP G 3  73   ? 170.556 178.731 163.375 1.00 78.31  ?  72   ASP G C     1 
ATOM   4902  O  O     . ASP G 3  73   ? 171.096 178.873 162.273 1.00 78.53  ?  72   ASP G O     1 
ATOM   4903  C  CB    . ASP G 3  73   ? 170.985 176.383 164.124 1.00 77.97  ?  72   ASP G CB    1 
ATOM   4904  C  CG    . ASP G 3  73   ? 169.526 175.988 164.255 1.00 79.29  ?  72   ASP G CG    1 
ATOM   4905  O  OD1   . ASP G 3  73   ? 168.708 176.839 164.660 1.00 81.08  ?  72   ASP G OD1   1 
ATOM   4906  O  OD2   . ASP G 3  73   ? 169.196 174.822 163.952 1.00 80.85  ?  72   ASP G OD2   1 
ATOM   4907  N  N     . ASN G 3  74   ? 169.397 179.311 163.684 1.00 78.95  ?  73   ASN G N     1 
ATOM   4908  C  CA    . ASN G 3  74   ? 168.673 180.170 162.756 1.00 79.58  ?  73   ASN G CA    1 
ATOM   4909  C  C     . ASN G 3  74   ? 168.630 181.622 163.215 1.00 79.36  ?  73   ASN G C     1 
ATOM   4910  O  O     . ASN G 3  74   ? 167.880 182.419 162.642 1.00 79.52  ?  73   ASN G O     1 
ATOM   4911  C  CB    . ASN G 3  74   ? 167.251 179.645 162.548 1.00 79.81  ?  73   ASN G CB    1 
ATOM   4912  C  CG    . ASN G 3  74   ? 167.225 178.257 161.943 1.00 81.57  ?  73   ASN G CG    1 
ATOM   4913  O  OD1   . ASN G 3  74   ? 168.125 177.879 161.194 1.00 83.07  ?  73   ASN G OD1   1 
ATOM   4914  N  ND2   . ASN G 3  74   ? 166.191 177.489 162.266 1.00 81.18  ?  73   ASN G ND2   1 
ATOM   4915  N  N     . LYS G 3  75   ? 169.412 181.978 164.236 1.00 78.78  ?  74   LYS G N     1 
ATOM   4916  C  CA    . LYS G 3  75   ? 169.485 183.337 164.775 1.00 78.51  ?  74   LYS G CA    1 
ATOM   4917  C  C     . LYS G 3  75   ? 168.104 183.816 165.236 1.00 77.32  ?  74   LYS G C     1 
ATOM   4918  O  O     . LYS G 3  75   ? 167.514 184.750 164.691 1.00 77.35  ?  74   LYS G O     1 
ATOM   4919  C  CB    . LYS G 3  75   ? 170.093 184.301 163.748 1.00 78.69  ?  74   LYS G CB    1 
ATOM   4920  C  CG    . LYS G 3  75   ? 171.507 183.941 163.321 1.00 81.44  ?  74   LYS G CG    1 
ATOM   4921  C  CD    . LYS G 3  75   ? 172.075 184.939 162.317 1.00 85.29  ?  74   LYS G CD    1 
ATOM   4922  C  CE    . LYS G 3  75   ? 171.556 184.695 160.904 1.00 86.67  ?  74   LYS G CE    1 
ATOM   4923  N  NZ    . LYS G 3  75   ? 170.171 185.201 160.684 1.00 88.90  ?  74   LYS G NZ    1 
ATOM   4924  N  N     . LYS G 3  76   ? 167.606 183.140 166.270 1.00 76.07  ?  75   LYS G N     1 
ATOM   4925  C  CA    . LYS G 3  76   ? 166.314 183.455 166.859 1.00 75.19  ?  75   LYS G CA    1 
ATOM   4926  C  C     . LYS G 3  76   ? 166.442 183.511 168.374 1.00 74.47  ?  75   LYS G C     1 
ATOM   4927  O  O     . LYS G 3  76   ? 167.298 182.849 168.968 1.00 74.77  ?  75   LYS G O     1 
ATOM   4928  C  CB    . LYS G 3  76   ? 165.244 182.428 166.461 1.00 75.50  ?  75   LYS G CB    1 
ATOM   4929  C  CG    . LYS G 3  76   ? 164.903 182.424 164.977 1.00 75.57  ?  75   LYS G CG    1 
ATOM   4930  C  CD    . LYS G 3  76   ? 164.342 183.767 164.538 1.00 78.16  ?  75   LYS G CD    1 
ATOM   4931  C  CE    . LYS G 3  76   ? 163.978 183.768 163.062 1.00 79.47  ?  75   LYS G CE    1 
ATOM   4932  N  NZ    . LYS G 3  76   ? 163.435 185.089 162.641 1.00 80.00  ?  75   LYS G NZ    1 
ATOM   4933  N  N     . THR G 3  77   ? 165.577 184.312 168.996 1.00 72.80  ?  76   THR G N     1 
ATOM   4934  C  CA    . THR G 3  77   ? 165.598 184.506 170.442 1.00 71.36  ?  76   THR G CA    1 
ATOM   4935  C  C     . THR G 3  77   ? 164.597 183.603 171.155 1.00 70.54  ?  76   THR G C     1 
ATOM   4936  O  O     . THR G 3  77   ? 164.988 182.734 171.939 1.00 70.79  ?  76   THR G O     1 
ATOM   4937  C  CB    . THR G 3  77   ? 165.325 185.978 170.781 1.00 71.14  ?  76   THR G CB    1 
ATOM   4938  O  OG1   . THR G 3  77   ? 166.336 186.803 170.189 1.00 71.42  ?  76   THR G OG1   1 
ATOM   4939  C  CG2   . THR G 3  77   ? 165.327 186.185 172.287 1.00 70.29  ?  76   THR G CG2   1 
ATOM   4940  N  N     . ARG G 3  78   ? 163.306 183.796 170.898 1.00 69.59  ?  77   ARG G N     1 
ATOM   4941  C  CA    . ARG G 3  78   ? 162.281 182.997 171.552 1.00 68.20  ?  77   ARG G CA    1 
ATOM   4942  C  C     . ARG G 3  78   ? 162.154 181.632 170.887 1.00 66.60  ?  77   ARG G C     1 
ATOM   4943  O  O     . ARG G 3  78   ? 162.484 181.453 169.711 1.00 66.63  ?  77   ARG G O     1 
ATOM   4944  C  CB    . ARG G 3  78   ? 160.934 183.720 171.523 1.00 68.70  ?  77   ARG G CB    1 
ATOM   4945  C  CG    . ARG G 3  78   ? 160.925 185.044 172.270 1.00 71.37  ?  77   ARG G CG    1 
ATOM   4946  C  CD    . ARG G 3  78   ? 159.545 185.676 172.257 1.00 76.34  ?  77   ARG G CD    1 
ATOM   4947  N  NE    . ARG G 3  78   ? 159.510 186.925 173.010 1.00 80.52  ?  77   ARG G NE    1 
ATOM   4948  C  CZ    . ARG G 3  78   ? 158.416 187.658 173.188 1.00 82.57  ?  77   ARG G CZ    1 
ATOM   4949  N  NH1   . ARG G 3  78   ? 157.262 187.266 172.667 1.00 82.63  ?  77   ARG G NH1   1 
ATOM   4950  N  NH2   . ARG G 3  78   ? 158.476 188.782 173.889 1.00 83.57  ?  77   ARG G NH2   1 
ATOM   4951  N  N     . ILE G 3  79   ? 161.666 180.665 171.657 1.00 64.73  ?  78   ILE G N     1 
ATOM   4952  C  CA    . ILE G 3  79   ? 161.505 179.295 171.182 1.00 63.46  ?  78   ILE G CA    1 
ATOM   4953  C  C     . ILE G 3  79   ? 160.158 179.176 170.481 1.00 62.16  ?  78   ILE G C     1 
ATOM   4954  O  O     . ILE G 3  79   ? 159.114 179.491 171.064 1.00 61.98  ?  78   ILE G O     1 
ATOM   4955  C  CB    . ILE G 3  79   ? 161.614 178.289 172.338 1.00 63.49  ?  78   ILE G CB    1 
ATOM   4956  C  CG1   . ILE G 3  79   ? 162.961 178.431 173.048 1.00 64.09  ?  78   ILE G CG1   1 
ATOM   4957  C  CG2   . ILE G 3  79   ? 161.424 176.868 171.826 1.00 63.75  ?  78   ILE G CG2   1 
ATOM   4958  C  CD1   . ILE G 3  79   ? 164.150 178.101 172.177 1.00 64.17  ?  78   ILE G CD1   1 
ATOM   4959  N  N     . ILE G 3  80   ? 160.180 178.721 169.233 1.00 60.66  ?  79   ILE G N     1 
ATOM   4960  C  CA    . ILE G 3  80   ? 158.961 178.490 168.461 1.00 59.17  ?  79   ILE G CA    1 
ATOM   4961  C  C     . ILE G 3  80   ? 158.739 176.985 168.362 1.00 59.27  ?  79   ILE G C     1 
ATOM   4962  O  O     . ILE G 3  80   ? 159.691 176.212 168.541 1.00 59.13  ?  79   ILE G O     1 
ATOM   4963  C  CB    . ILE G 3  80   ? 159.047 179.142 167.071 1.00 58.37  ?  79   ILE G CB    1 
ATOM   4964  C  CG1   . ILE G 3  80   ? 160.176 178.514 166.252 1.00 57.60  ?  79   ILE G CG1   1 
ATOM   4965  C  CG2   . ILE G 3  80   ? 159.251 180.644 167.200 1.00 59.84  ?  79   ILE G CG2   1 
ATOM   4966  C  CD1   . ILE G 3  80   ? 160.340 179.119 164.873 1.00 58.22  ?  79   ILE G CD1   1 
ATOM   4967  N  N     . PRO G 3  81   ? 157.512 176.521 168.102 1.00 59.16  ?  80   PRO G N     1 
ATOM   4968  C  CA    . PRO G 3  81   ? 157.299 175.069 167.969 1.00 59.21  ?  80   PRO G CA    1 
ATOM   4969  C  C     . PRO G 3  81   ? 158.099 174.439 166.843 1.00 59.73  ?  80   PRO G C     1 
ATOM   4970  O  O     . PRO G 3  81   ? 158.408 173.242 166.912 1.00 59.89  ?  80   PRO G O     1 
ATOM   4971  C  CB    . PRO G 3  81   ? 155.788 174.960 167.719 1.00 59.02  ?  80   PRO G CB    1 
ATOM   4972  C  CG    . PRO G 3  81   ? 155.217 176.198 168.320 1.00 59.37  ?  80   PRO G CG    1 
ATOM   4973  C  CD    . PRO G 3  81   ? 156.242 177.268 168.082 1.00 58.99  ?  80   PRO G CD    1 
ATOM   4974  N  N     . ARG G 3  82   ? 158.443 175.205 165.804 1.00 59.79  ?  81   ARG G N     1 
ATOM   4975  C  CA    . ARG G 3  82   ? 159.273 174.661 164.735 1.00 59.45  ?  81   ARG G CA    1 
ATOM   4976  C  C     . ARG G 3  82   ? 160.665 174.303 165.238 1.00 59.15  ?  81   ARG G C     1 
ATOM   4977  O  O     . ARG G 3  82   ? 161.274 173.347 164.745 1.00 60.58  ?  81   ARG G O     1 
ATOM   4978  C  CB    . ARG G 3  82   ? 159.361 175.654 163.576 1.00 59.52  ?  81   ARG G CB    1 
ATOM   4979  C  CG    . ARG G 3  82   ? 160.071 175.109 162.345 1.00 61.18  ?  81   ARG G CG    1 
ATOM   4980  C  CD    . ARG G 3  82   ? 159.427 173.814 161.871 1.00 64.01  ?  81   ARG G CD    1 
ATOM   4981  N  NE    . ARG G 3  82   ? 160.113 173.247 160.713 1.00 65.07  ?  81   ARG G NE    1 
ATOM   4982  C  CZ    . ARG G 3  82   ? 159.783 173.500 159.451 1.00 65.21  ?  81   ARG G CZ    1 
ATOM   4983  N  NH1   . ARG G 3  82   ? 158.773 174.314 159.178 1.00 63.86  ?  81   ARG G NH1   1 
ATOM   4984  N  NH2   . ARG G 3  82   ? 160.463 172.938 158.460 1.00 67.57  ?  81   ARG G NH2   1 
ATOM   4985  N  N     . HIS G 3  83   ? 161.182 175.051 166.216 1.00 57.32  ?  82   HIS G N     1 
ATOM   4986  C  CA    . HIS G 3  83   ? 162.458 174.691 166.824 1.00 54.81  ?  82   HIS G CA    1 
ATOM   4987  C  C     . HIS G 3  83   ? 162.355 173.386 167.603 1.00 54.47  ?  82   HIS G C     1 
ATOM   4988  O  O     . HIS G 3  83   ? 163.328 172.626 167.669 1.00 54.29  ?  82   HIS G O     1 
ATOM   4989  C  CB    . HIS G 3  83   ? 162.946 175.818 167.733 1.00 52.69  ?  82   HIS G CB    1 
ATOM   4990  C  CG    . HIS G 3  83   ? 163.263 177.088 167.005 1.00 51.99  ?  82   HIS G CG    1 
ATOM   4991  N  ND1   . HIS G 3  83   ? 163.465 178.287 167.653 1.00 47.59  ?  82   HIS G ND1   1 
ATOM   4992  C  CD2   . HIS G 3  83   ? 163.416 177.344 165.684 1.00 48.00  ?  82   HIS G CD2   1 
ATOM   4993  C  CE1   . HIS G 3  83   ? 163.726 179.228 166.764 1.00 50.63  ?  82   HIS G CE1   1 
ATOM   4994  N  NE2   . HIS G 3  83   ? 163.703 178.682 165.561 1.00 50.29  ?  82   HIS G NE2   1 
ATOM   4995  N  N     . LEU G 3  84   ? 161.192 173.110 168.198 1.00 53.27  ?  83   LEU G N     1 
ATOM   4996  C  CA    . LEU G 3  84   ? 160.994 171.830 168.870 1.00 53.85  ?  83   LEU G CA    1 
ATOM   4997  C  C     . LEU G 3  84   ? 160.877 170.694 167.862 1.00 54.32  ?  83   LEU G C     1 
ATOM   4998  O  O     . LEU G 3  84   ? 161.430 169.609 168.074 1.00 54.38  ?  83   LEU G O     1 
ATOM   4999  C  CB    . LEU G 3  84   ? 159.752 171.891 169.760 1.00 53.42  ?  83   LEU G CB    1 
ATOM   5000  C  CG    . LEU G 3  84   ? 159.790 172.880 170.927 1.00 52.06  ?  83   LEU G CG    1 
ATOM   5001  C  CD1   . LEU G 3  84   ? 158.444 172.930 171.633 1.00 50.02  ?  83   LEU G CD1   1 
ATOM   5002  C  CD2   . LEU G 3  84   ? 160.894 172.513 171.905 1.00 50.82  ?  83   LEU G CD2   1 
ATOM   5003  N  N     . GLN G 3  85   ? 160.163 170.928 166.757 1.00 54.45  ?  84   GLN G N     1 
ATOM   5004  C  CA    . GLN G 3  85   ? 160.034 169.908 165.721 1.00 55.21  ?  84   GLN G CA    1 
ATOM   5005  C  C     . GLN G 3  85   ? 161.392 169.564 165.119 1.00 54.82  ?  84   GLN G C     1 
ATOM   5006  O  O     . GLN G 3  85   ? 161.784 168.392 165.069 1.00 54.45  ?  84   GLN G O     1 
ATOM   5007  C  CB    . GLN G 3  85   ? 159.067 170.386 164.637 1.00 55.71  ?  84   GLN G CB    1 
ATOM   5008  C  CG    . GLN G 3  85   ? 158.911 169.431 163.461 1.00 58.09  ?  84   GLN G CG    1 
ATOM   5009  C  CD    . GLN G 3  85   ? 158.097 168.197 163.805 1.00 61.30  ?  84   GLN G CD    1 
ATOM   5010  O  OE1   . GLN G 3  85   ? 157.533 168.091 164.894 1.00 64.78  ?  84   GLN G OE1   1 
ATOM   5011  N  NE2   . GLN G 3  85   ? 158.031 167.255 162.871 1.00 58.08  ?  84   GLN G NE2   1 
ATOM   5012  N  N     . LEU G 3  86   ? 162.128 170.579 164.660 1.00 53.95  ?  85   LEU G N     1 
ATOM   5013  C  CA    . LEU G 3  86   ? 163.459 170.346 164.113 1.00 53.50  ?  85   LEU G CA    1 
ATOM   5014  C  C     . LEU G 3  86   ? 164.448 169.889 165.177 1.00 53.21  ?  85   LEU G C     1 
ATOM   5015  O  O     . LEU G 3  86   ? 165.489 169.319 164.834 1.00 52.49  ?  85   LEU G O     1 
ATOM   5016  C  CB    . LEU G 3  86   ? 163.980 171.613 163.433 1.00 53.12  ?  85   LEU G CB    1 
ATOM   5017  C  CG    . LEU G 3  86   ? 163.124 172.181 162.300 1.00 53.46  ?  85   LEU G CG    1 
ATOM   5018  C  CD1   . LEU G 3  86   ? 163.767 173.430 161.717 1.00 51.67  ?  85   LEU G CD1   1 
ATOM   5019  C  CD2   . LEU G 3  86   ? 162.897 171.136 161.219 1.00 56.56  ?  85   LEU G CD2   1 
ATOM   5020  N  N     . ALA G 3  87   ? 164.148 170.124 166.456 1.00 52.12  ?  86   ALA G N     1 
ATOM   5021  C  CA    . ALA G 3  87   ? 165.042 169.691 167.522 1.00 52.48  ?  86   ALA G CA    1 
ATOM   5022  C  C     . ALA G 3  87   ? 164.823 168.231 167.895 1.00 53.84  ?  86   ALA G C     1 
ATOM   5023  O  O     . ALA G 3  87   ? 165.759 167.567 168.354 1.00 53.96  ?  86   ALA G O     1 
ATOM   5024  C  CB    . ALA G 3  87   ? 164.862 170.580 168.753 1.00 51.89  ?  86   ALA G CB    1 
ATOM   5025  N  N     . VAL G 3  88   ? 163.610 167.717 167.709 1.00 54.81  ?  87   VAL G N     1 
ATOM   5026  C  CA    . VAL G 3  88   ? 163.319 166.322 168.031 1.00 55.86  ?  87   VAL G CA    1 
ATOM   5027  C  C     . VAL G 3  88   ? 163.522 165.417 166.822 1.00 56.45  ?  87   VAL G C     1 
ATOM   5028  O  O     . VAL G 3  88   ? 164.056 164.312 166.951 1.00 56.28  ?  87   VAL G O     1 
ATOM   5029  C  CB    . VAL G 3  88   ? 161.888 166.201 168.593 1.00 56.48  ?  87   VAL G CB    1 
ATOM   5030  C  CG1   . VAL G 3  88   ? 161.520 164.741 168.811 1.00 55.43  ?  87   VAL G CG1   1 
ATOM   5031  C  CG2   . VAL G 3  88   ? 161.761 166.980 169.893 1.00 55.89  ?  87   VAL G CG2   1 
ATOM   5032  N  N     . ARG G 3  89   ? 163.112 165.868 165.634 1.00 56.88  ?  88   ARG G N     1 
ATOM   5033  C  CA    . ARG G 3  89   ? 163.216 165.033 164.442 1.00 58.23  ?  88   ARG G CA    1 
ATOM   5034  C  C     . ARG G 3  89   ? 164.659 164.792 164.015 1.00 58.65  ?  88   ARG G C     1 
ATOM   5035  O  O     . ARG G 3  89   ? 164.931 163.790 163.346 1.00 59.17  ?  88   ARG G O     1 
ATOM   5036  C  CB    . ARG G 3  89   ? 162.433 165.662 163.288 1.00 58.48  ?  88   ARG G CB    1 
ATOM   5037  C  CG    . ARG G 3  89   ? 160.931 165.720 163.511 1.00 59.54  ?  88   ARG G CG    1 
ATOM   5038  C  CD    . ARG G 3  89   ? 160.342 164.332 163.703 1.00 57.75  ?  88   ARG G CD    1 
ATOM   5039  N  NE    . ARG G 3  89   ? 158.898 164.376 163.915 1.00 55.48  ?  88   ARG G NE    1 
ATOM   5040  C  CZ    . ARG G 3  89   ? 158.137 163.302 164.104 1.00 54.29  ?  88   ARG G CZ    1 
ATOM   5041  N  NH1   . ARG G 3  89   ? 158.681 162.093 164.107 1.00 55.15  ?  88   ARG G NH1   1 
ATOM   5042  N  NH2   . ARG G 3  89   ? 156.831 163.437 164.290 1.00 53.14  ?  88   ARG G NH2   1 
ATOM   5043  N  N     . ASN G 3  90   ? 165.586 165.679 164.383 1.00 59.35  ?  89   ASN G N     1 
ATOM   5044  C  CA    . ASN G 3  90   ? 166.980 165.503 163.997 1.00 59.19  ?  89   ASN G CA    1 
ATOM   5045  C  C     . ASN G 3  90   ? 167.704 164.466 164.846 1.00 59.78  ?  89   ASN G C     1 
ATOM   5046  O  O     . ASN G 3  90   ? 168.734 163.940 164.410 1.00 60.13  ?  89   ASN G O     1 
ATOM   5047  C  CB    . ASN G 3  90   ? 167.724 166.838 164.073 1.00 58.03  ?  89   ASN G CB    1 
ATOM   5048  C  CG    . ASN G 3  90   ? 167.322 167.792 162.965 1.00 56.36  ?  89   ASN G CG    1 
ATOM   5049  O  OD1   . ASN G 3  90   ? 166.971 167.370 161.864 1.00 52.99  ?  89   ASN G OD1   1 
ATOM   5050  N  ND2   . ASN G 3  90   ? 167.372 169.088 163.253 1.00 55.31  ?  89   ASN G ND2   1 
ATOM   5051  N  N     . ASP G 3  91   ? 167.197 164.161 166.036 1.00 59.89  ?  90   ASP G N     1 
ATOM   5052  C  CA    . ASP G 3  91   ? 167.816 163.171 166.903 1.00 61.30  ?  90   ASP G CA    1 
ATOM   5053  C  C     . ASP G 3  91   ? 167.219 161.793 166.646 1.00 62.07  ?  90   ASP G C     1 
ATOM   5054  O  O     . ASP G 3  91   ? 166.030 161.654 166.347 1.00 62.44  ?  90   ASP G O     1 
ATOM   5055  C  CB    . ASP G 3  91   ? 167.639 163.551 168.374 1.00 61.67  ?  90   ASP G CB    1 
ATOM   5056  C  CG    . ASP G 3  91   ? 168.412 162.639 169.307 1.00 63.53  ?  90   ASP G CG    1 
ATOM   5057  O  OD1   . ASP G 3  91   ? 169.649 162.784 169.392 1.00 62.96  ?  90   ASP G OD1   1 
ATOM   5058  O  OD2   . ASP G 3  91   ? 167.782 161.775 169.953 1.00 67.02  ?  90   ASP G OD2   1 
ATOM   5059  N  N     . GLU G 3  92   ? 168.064 160.768 166.767 1.00 62.45  ?  91   GLU G N     1 
ATOM   5060  C  CA    . GLU G 3  92   ? 167.618 159.401 166.521 1.00 63.85  ?  91   GLU G CA    1 
ATOM   5061  C  C     . GLU G 3  92   ? 166.802 158.861 167.691 1.00 64.01  ?  91   GLU G C     1 
ATOM   5062  O  O     . GLU G 3  92   ? 165.709 158.317 167.497 1.00 65.26  ?  91   GLU G O     1 
ATOM   5063  C  CB    . GLU G 3  92   ? 168.822 158.498 166.246 1.00 64.21  ?  91   GLU G CB    1 
ATOM   5064  C  CG    . GLU G 3  92   ? 169.649 158.909 165.036 1.00 67.52  ?  91   GLU G CG    1 
ATOM   5065  C  CD    . GLU G 3  92   ? 168.922 158.684 163.723 1.00 72.61  ?  91   GLU G CD    1 
ATOM   5066  O  OE1   . GLU G 3  92   ? 167.966 157.881 163.697 1.00 73.00  ?  91   GLU G OE1   1 
ATOM   5067  O  OE2   . GLU G 3  92   ? 169.309 159.312 162.714 1.00 73.54  ?  91   GLU G OE2   1 
ATOM   5068  N  N     . GLU G 3  93   ? 167.319 159.005 168.914 1.00 63.92  ?  92   GLU G N     1 
ATOM   5069  C  CA    . GLU G 3  93   ? 166.617 158.474 170.078 1.00 63.75  ?  92   GLU G CA    1 
ATOM   5070  C  C     . GLU G 3  93   ? 165.349 159.262 170.382 1.00 63.07  ?  92   GLU G C     1 
ATOM   5071  O  O     . GLU G 3  93   ? 164.364 158.686 170.859 1.00 62.89  ?  92   GLU G O     1 
ATOM   5072  C  CB    . GLU G 3  93   ? 167.545 158.466 171.292 1.00 64.17  ?  92   GLU G CB    1 
ATOM   5073  C  CG    . GLU G 3  93   ? 168.798 157.625 171.104 1.00 67.46  ?  92   GLU G CG    1 
ATOM   5074  C  CD    . GLU G 3  93   ? 169.661 157.575 172.349 1.00 72.46  ?  92   GLU G CD    1 
ATOM   5075  O  OE1   . GLU G 3  93   ? 169.240 158.123 173.389 1.00 74.79  ?  92   GLU G OE1   1 
ATOM   5076  O  OE2   . GLU G 3  93   ? 170.762 156.987 172.287 1.00 73.53  ?  92   GLU G OE2   1 
ATOM   5077  N  N     . LEU G 3  94   ? 165.350 160.571 170.119 1.00 62.38  ?  93   LEU G N     1 
ATOM   5078  C  CA    . LEU G 3  94   ? 164.142 161.362 170.333 1.00 61.75  ?  93   LEU G CA    1 
ATOM   5079  C  C     . LEU G 3  94   ? 163.066 161.011 169.313 1.00 62.04  ?  93   LEU G C     1 
ATOM   5080  O  O     . LEU G 3  94   ? 161.875 160.980 169.645 1.00 61.78  ?  93   LEU G O     1 
ATOM   5081  C  CB    . LEU G 3  94   ? 164.469 162.853 170.279 1.00 61.37  ?  93   LEU G CB    1 
ATOM   5082  C  CG    . LEU G 3  94   ? 165.338 163.399 171.413 1.00 60.75  ?  93   LEU G CG    1 
ATOM   5083  C  CD1   . LEU G 3  94   ? 165.515 164.902 171.272 1.00 60.24  ?  93   LEU G CD1   1 
ATOM   5084  C  CD2   . LEU G 3  94   ? 164.739 163.050 172.766 1.00 57.01  ?  93   LEU G CD2   1 
ATOM   5085  N  N     . ASN G 3  95   ? 163.465 160.745 168.067 1.00 62.16  ?  94   ASN G N     1 
ATOM   5086  C  CA    . ASN G 3  95   ? 162.498 160.315 167.063 1.00 62.17  ?  94   ASN G CA    1 
ATOM   5087  C  C     . ASN G 3  95   ? 161.992 158.907 167.347 1.00 61.89  ?  94   ASN G C     1 
ATOM   5088  O  O     . ASN G 3  95   ? 160.829 158.599 167.065 1.00 63.59  ?  94   ASN G O     1 
ATOM   5089  C  CB    . ASN G 3  95   ? 163.120 160.386 165.668 1.00 62.23  ?  94   ASN G CB    1 
ATOM   5090  C  CG    . ASN G 3  95   ? 162.119 160.088 164.568 1.00 62.41  ?  94   ASN G CG    1 
ATOM   5091  O  OD1   . ASN G 3  95   ? 160.915 160.279 164.738 1.00 60.62  ?  94   ASN G OD1   1 
ATOM   5092  N  ND2   . ASN G 3  95   ? 162.615 159.617 163.429 1.00 61.73  ?  94   ASN G ND2   1 
ATOM   5093  N  N     . LYS G 3  96   ? 162.846 158.043 167.903 1.00 60.96  ?  95   LYS G N     1 
ATOM   5094  C  CA    . LYS G 3  96   ? 162.401 156.705 168.278 1.00 59.90  ?  95   LYS G CA    1 
ATOM   5095  C  C     . LYS G 3  96   ? 161.442 156.758 169.461 1.00 59.38  ?  95   LYS G C     1 
ATOM   5096  O  O     . LYS G 3  96   ? 160.480 155.983 169.523 1.00 59.48  ?  95   LYS G O     1 
ATOM   5097  C  CB    . LYS G 3  96   ? 163.607 155.823 168.600 1.00 60.06  ?  95   LYS G CB    1 
ATOM   5098  C  CG    . LYS G 3  96   ? 163.254 154.391 168.965 1.00 61.20  ?  95   LYS G CG    1 
ATOM   5099  C  CD    . LYS G 3  96   ? 162.525 153.695 167.827 1.00 67.23  ?  95   LYS G CD    1 
ATOM   5100  C  CE    . LYS G 3  96   ? 162.180 152.260 168.189 1.00 70.98  ?  95   LYS G CE    1 
ATOM   5101  N  NZ    . LYS G 3  96   ? 163.397 151.457 168.495 1.00 71.98  ?  95   LYS G NZ    1 
ATOM   5102  N  N     . LEU G 3  97   ? 161.686 157.667 170.407 1.00 58.58  ?  96   LEU G N     1 
ATOM   5103  C  CA    . LEU G 3  97   ? 160.782 157.813 171.543 1.00 57.60  ?  96   LEU G CA    1 
ATOM   5104  C  C     . LEU G 3  97   ? 159.464 158.451 171.122 1.00 56.17  ?  96   LEU G C     1 
ATOM   5105  O  O     . LEU G 3  97   ? 158.390 158.002 171.538 1.00 56.32  ?  96   LEU G O     1 
ATOM   5106  C  CB    . LEU G 3  97   ? 161.451 158.639 172.642 1.00 57.44  ?  96   LEU G CB    1 
ATOM   5107  C  CG    . LEU G 3  97   ? 160.584 159.013 173.846 1.00 58.17  ?  96   LEU G CG    1 
ATOM   5108  C  CD1   . LEU G 3  97   ? 160.076 157.767 174.554 1.00 57.68  ?  96   LEU G CD1   1 
ATOM   5109  C  CD2   . LEU G 3  97   ? 161.355 159.905 174.807 1.00 57.98  ?  96   LEU G CD2   1 
ATOM   5110  N  N     . LEU G 3  98   ? 159.525 159.492 170.299 1.00 54.89  ?  97   LEU G N     1 
ATOM   5111  C  CA    . LEU G 3  98   ? 158.327 160.187 169.830 1.00 53.89  ?  97   LEU G CA    1 
ATOM   5112  C  C     . LEU G 3  98   ? 158.003 159.783 168.392 1.00 53.15  ?  97   LEU G C     1 
ATOM   5113  O  O     . LEU G 3  98   ? 157.975 160.599 167.471 1.00 53.60  ?  97   LEU G O     1 
ATOM   5114  C  CB    . LEU G 3  98   ? 158.510 161.697 169.956 1.00 53.15  ?  97   LEU G CB    1 
ATOM   5115  C  CG    . LEU G 3  98   ? 158.823 162.218 171.361 1.00 53.30  ?  97   LEU G CG    1 
ATOM   5116  C  CD1   . LEU G 3  98   ? 158.938 163.734 171.363 1.00 56.21  ?  97   LEU G CD1   1 
ATOM   5117  C  CD2   . LEU G 3  98   ? 157.769 161.754 172.355 1.00 52.63  ?  97   LEU G CD2   1 
ATOM   5118  N  N     . GLY G 3  99   ? 157.755 158.487 168.214 1.00 51.38  ?  98   GLY G N     1 
ATOM   5119  C  CA    . GLY G 3  99   ? 157.428 157.952 166.907 1.00 49.75  ?  98   GLY G CA    1 
ATOM   5120  C  C     . GLY G 3  99   ? 156.052 158.363 166.425 1.00 48.94  ?  98   GLY G C     1 
ATOM   5121  O  O     . GLY G 3  99   ? 155.920 159.013 165.384 1.00 49.00  ?  98   GLY G O     1 
ATOM   5122  N  N     . ARG G 3  100  ? 155.020 157.988 167.175 1.00 48.87  ?  99   ARG G N     1 
ATOM   5123  C  CA    . ARG G 3  100  ? 153.641 158.341 166.837 1.00 50.03  ?  99   ARG G CA    1 
ATOM   5124  C  C     . ARG G 3  100  ? 153.233 159.663 167.481 1.00 50.33  ?  99   ARG G C     1 
ATOM   5125  O  O     . ARG G 3  100  ? 152.189 159.773 168.122 1.00 50.62  ?  99   ARG G O     1 
ATOM   5126  C  CB    . ARG G 3  100  ? 152.701 157.216 167.255 1.00 49.99  ?  99   ARG G CB    1 
ATOM   5127  C  CG    . ARG G 3  100  ? 153.042 155.863 166.655 1.00 55.81  ?  99   ARG G CG    1 
ATOM   5128  C  CD    . ARG G 3  100  ? 152.992 155.900 165.137 1.00 62.46  ?  99   ARG G CD    1 
ATOM   5129  N  NE    . ARG G 3  100  ? 153.314 154.602 164.550 1.00 65.65  ?  99   ARG G NE    1 
ATOM   5130  C  CZ    . ARG G 3  100  ? 153.329 154.355 163.244 1.00 68.63  ?  99   ARG G CZ    1 
ATOM   5131  N  NH1   . ARG G 3  100  ? 153.038 155.319 162.382 1.00 67.71  ?  99   ARG G NH1   1 
ATOM   5132  N  NH2   . ARG G 3  100  ? 153.633 153.143 162.800 1.00 69.38  ?  99   ARG G NH2   1 
ATOM   5133  N  N     . VAL G 3  101  ? 154.070 160.683 167.312 1.00 49.62  ?  100  VAL G N     1 
ATOM   5134  C  CA    . VAL G 3  101  ? 153.855 161.992 167.916 1.00 50.70  ?  100  VAL G CA    1 
ATOM   5135  C  C     . VAL G 3  101  ? 153.877 163.043 166.817 1.00 51.28  ?  100  VAL G C     1 
ATOM   5136  O  O     . VAL G 3  101  ? 154.818 163.092 166.017 1.00 52.39  ?  100  VAL G O     1 
ATOM   5137  C  CB    . VAL G 3  101  ? 154.916 162.308 168.987 1.00 50.29  ?  100  VAL G CB    1 
ATOM   5138  C  CG1   . VAL G 3  101  ? 154.802 163.755 169.437 1.00 51.50  ?  100  VAL G CG1   1 
ATOM   5139  C  CG2   . VAL G 3  101  ? 154.770 161.366 170.169 1.00 50.57  ?  100  VAL G CG2   1 
ATOM   5140  N  N     . THR G 3  102  ? 152.846 163.882 166.781 1.00 51.51  ?  101  THR G N     1 
ATOM   5141  C  CA    . THR G 3  102  ? 152.743 164.970 165.815 1.00 51.94  ?  101  THR G CA    1 
ATOM   5142  C  C     . THR G 3  102  ? 152.730 166.284 166.583 1.00 51.28  ?  101  THR G C     1 
ATOM   5143  O  O     . THR G 3  102  ? 151.779 166.570 167.319 1.00 52.26  ?  101  THR G O     1 
ATOM   5144  C  CB    . THR G 3  102  ? 151.491 164.822 164.953 1.00 52.17  ?  101  THR G CB    1 
ATOM   5145  O  OG1   . THR G 3  102  ? 151.565 163.600 164.208 1.00 54.84  ?  101  THR G OG1   1 
ATOM   5146  C  CG2   . THR G 3  102  ? 151.370 165.991 163.989 1.00 49.86  ?  101  THR G CG2   1 
ATOM   5147  N  N     . ILE G 3  103  ? 153.784 167.077 166.417 1.00 50.67  ?  102  ILE G N     1 
ATOM   5148  C  CA    . ILE G 3  103  ? 153.893 168.357 167.107 1.00 50.15  ?  102  ILE G CA    1 
ATOM   5149  C  C     . ILE G 3  103  ? 153.124 169.413 166.326 1.00 49.48  ?  102  ILE G C     1 
ATOM   5150  O  O     . ILE G 3  103  ? 153.314 169.570 165.113 1.00 48.78  ?  102  ILE G O     1 
ATOM   5151  C  CB    . ILE G 3  103  ? 155.365 168.760 167.281 1.00 50.44  ?  102  ILE G CB    1 
ATOM   5152  C  CG1   . ILE G 3  103  ? 156.119 167.698 168.084 1.00 46.11  ?  102  ILE G CG1   1 
ATOM   5153  C  CG2   . ILE G 3  103  ? 155.464 170.123 167.952 1.00 50.38  ?  102  ILE G CG2   1 
ATOM   5154  C  CD1   . ILE G 3  103  ? 157.578 168.021 168.302 1.00 43.71  ?  102  ILE G CD1   1 
ATOM   5155  N  N     . ALA G 3  104  ? 152.257 170.144 167.020 1.00 50.11  ?  103  ALA G N     1 
ATOM   5156  C  CA    . ALA G 3  104  ? 151.464 171.188 166.392 1.00 51.69  ?  103  ALA G CA    1 
ATOM   5157  C  C     . ALA G 3  104  ? 152.326 172.402 166.058 1.00 52.46  ?  103  ALA G C     1 
ATOM   5158  O  O     . ALA G 3  104  ? 153.332 172.678 166.718 1.00 53.49  ?  103  ALA G O     1 
ATOM   5159  C  CB    . ALA G 3  104  ? 150.307 171.601 167.303 1.00 50.96  ?  103  ALA G CB    1 
ATOM   5160  N  N     . GLN G 3  105  ? 151.915 173.125 165.010 1.00 53.73  ?  104  GLN G N     1 
ATOM   5161  C  CA    . GLN G 3  105  ? 152.594 174.340 164.547 1.00 55.68  ?  104  GLN G CA    1 
ATOM   5162  C  C     . GLN G 3  105  ? 154.067 174.076 164.233 1.00 56.44  ?  104  GLN G C     1 
ATOM   5163  O  O     . GLN G 3  105  ? 154.943 174.895 164.524 1.00 55.98  ?  104  GLN G O     1 
ATOM   5164  C  CB    . GLN G 3  105  ? 152.438 175.480 165.559 1.00 56.29  ?  104  GLN G CB    1 
ATOM   5165  C  CG    . GLN G 3  105  ? 150.989 175.907 165.804 1.00 58.71  ?  104  GLN G CG    1 
ATOM   5166  C  CD    . GLN G 3  105  ? 150.361 176.583 164.597 1.00 64.59  ?  104  GLN G CD    1 
ATOM   5167  O  OE1   . GLN G 3  105  ? 151.062 177.044 163.697 1.00 67.30  ?  104  GLN G OE1   1 
ATOM   5168  N  NE2   . GLN G 3  105  ? 149.034 176.644 164.573 1.00 64.58  ?  104  GLN G NE2   1 
ATOM   5169  N  N     . GLY G 3  106  ? 154.338 172.924 163.619 1.00 57.07  ?  105  GLY G N     1 
ATOM   5170  C  CA    . GLY G 3  106  ? 155.687 172.533 163.255 1.00 57.64  ?  105  GLY G CA    1 
ATOM   5171  C  C     . GLY G 3  106  ? 155.890 172.357 161.762 1.00 58.66  ?  105  GLY G C     1 
ATOM   5172  O  O     . GLY G 3  106  ? 155.445 173.191 160.968 1.00 60.40  ?  105  GLY G O     1 
ATOM   5173  N  N     . GLY G 3  107  ? 156.557 171.276 161.373 1.00 58.91  ?  106  GLY G N     1 
ATOM   5174  C  CA    . GLY G 3  107  ? 156.866 171.056 159.971 1.00 58.95  ?  106  GLY G CA    1 
ATOM   5175  C  C     . GLY G 3  107  ? 157.516 169.707 159.755 1.00 59.81  ?  106  GLY G C     1 
ATOM   5176  O  O     . GLY G 3  107  ? 157.344 168.785 160.553 1.00 58.67  ?  106  GLY G O     1 
ATOM   5177  N  N     . VAL G 3  108  ? 158.265 169.595 158.656 1.00 61.13  ?  107  VAL G N     1 
ATOM   5178  C  CA    . VAL G 3  108  ? 158.995 168.379 158.320 1.00 62.50  ?  107  VAL G CA    1 
ATOM   5179  C  C     . VAL G 3  108  ? 160.457 168.736 158.080 1.00 63.60  ?  107  VAL G C     1 
ATOM   5180  O  O     . VAL G 3  108  ? 160.835 169.906 158.014 1.00 63.91  ?  107  VAL G O     1 
ATOM   5181  C  CB    . VAL G 3  108  ? 158.408 167.650 157.091 1.00 62.18  ?  107  VAL G CB    1 
ATOM   5182  C  CG1   . VAL G 3  108  ? 156.996 167.133 157.391 1.00 63.27  ?  107  VAL G CG1   1 
ATOM   5183  C  CG2   . VAL G 3  108  ? 158.433 168.559 155.859 1.00 61.22  ?  107  VAL G CG2   1 
ATOM   5184  N  N     . LEU G 3  109  ? 161.282 167.700 157.956 1.00 64.45  ?  108  LEU G N     1 
ATOM   5185  C  CA    . LEU G 3  109  ? 162.697 167.928 157.700 1.00 65.06  ?  108  LEU G CA    1 
ATOM   5186  C  C     . LEU G 3  109  ? 162.942 168.123 156.207 1.00 66.31  ?  108  LEU G C     1 
ATOM   5187  O  O     . LEU G 3  109  ? 162.370 167.401 155.384 1.00 66.01  ?  108  LEU G O     1 
ATOM   5188  C  CB    . LEU G 3  109  ? 163.533 166.756 158.200 1.00 64.15  ?  108  LEU G CB    1 
ATOM   5189  C  CG    . LEU G 3  109  ? 163.435 166.459 159.697 1.00 62.18  ?  108  LEU G CG    1 
ATOM   5190  C  CD1   . LEU G 3  109  ? 164.215 165.201 160.049 1.00 60.27  ?  108  LEU G CD1   1 
ATOM   5191  C  CD2   . LEU G 3  109  ? 163.920 167.649 160.515 1.00 58.46  ?  108  LEU G CD2   1 
ATOM   5192  N  N     . PRO G 3  110  ? 163.778 169.094 155.846 1.00 67.87  ?  109  PRO G N     1 
ATOM   5193  C  CA    . PRO G 3  110  ? 164.113 169.291 154.429 1.00 69.10  ?  109  PRO G CA    1 
ATOM   5194  C  C     . PRO G 3  110  ? 164.901 168.121 153.861 1.00 70.43  ?  109  PRO G C     1 
ATOM   5195  O  O     . PRO G 3  110  ? 166.123 168.203 153.700 1.00 70.49  ?  109  PRO G O     1 
ATOM   5196  C  CB    . PRO G 3  110  ? 164.946 170.580 154.439 1.00 68.24  ?  109  PRO G CB    1 
ATOM   5197  C  CG    . PRO G 3  110  ? 164.623 171.247 155.744 1.00 68.08  ?  109  PRO G CG    1 
ATOM   5198  C  CD    . PRO G 3  110  ? 164.364 170.134 156.706 1.00 67.95  ?  109  PRO G CD    1 
ATOM   5199  N  N     . ASN G 3  111  ? 164.208 167.028 153.555 1.00 72.66  ?  110  ASN G N     1 
ATOM   5200  C  CA    . ASN G 3  111  ? 164.826 165.814 153.034 1.00 75.10  ?  110  ASN G CA    1 
ATOM   5201  C  C     . ASN G 3  111  ? 164.461 165.686 151.561 1.00 76.22  ?  110  ASN G C     1 
ATOM   5202  O  O     . ASN G 3  111  ? 163.297 165.450 151.221 1.00 76.27  ?  110  ASN G O     1 
ATOM   5203  C  CB    . ASN G 3  111  ? 164.374 164.588 153.824 1.00 75.41  ?  110  ASN G CB    1 
ATOM   5204  C  CG    . ASN G 3  111  ? 165.045 163.313 153.355 1.00 77.60  ?  110  ASN G CG    1 
ATOM   5205  O  OD1   . ASN G 3  111  ? 166.119 163.348 152.753 1.00 80.48  ?  110  ASN G OD1   1 
ATOM   5206  N  ND2   . ASN G 3  111  ? 164.415 162.177 153.629 1.00 78.60  ?  110  ASN G ND2   1 
ATOM   5207  N  N     . ILE G 3  112  ? 165.456 165.844 150.693 1.00 78.06  ?  111  ILE G N     1 
ATOM   5208  C  CA    . ILE G 3  112  ? 165.281 165.735 149.250 1.00 79.75  ?  111  ILE G CA    1 
ATOM   5209  C  C     . ILE G 3  112  ? 166.110 164.556 148.764 1.00 81.64  ?  111  ILE G C     1 
ATOM   5210  O  O     . ILE G 3  112  ? 167.304 164.462 149.073 1.00 82.20  ?  111  ILE G O     1 
ATOM   5211  C  CB    . ILE G 3  112  ? 165.687 167.031 148.522 1.00 79.45  ?  111  ILE G CB    1 
ATOM   5212  C  CG1   . ILE G 3  112  ? 164.646 168.133 148.748 1.00 79.70  ?  111  ILE G CG1   1 
ATOM   5213  C  CG2   . ILE G 3  112  ? 165.876 166.774 147.035 1.00 78.76  ?  111  ILE G CG2   1 
ATOM   5214  C  CD1   . ILE G 3  112  ? 164.827 168.915 150.035 1.00 79.28  ?  111  ILE G CD1   1 
ATOM   5215  N  N     . GLN G 3  113  ? 165.477 163.658 148.014 1.00 83.95  ?  112  GLN G N     1 
ATOM   5216  C  CA    . GLN G 3  113  ? 166.168 162.481 147.508 1.00 85.48  ?  112  GLN G CA    1 
ATOM   5217  C  C     . GLN G 3  113  ? 167.255 162.879 146.516 1.00 86.89  ?  112  GLN G C     1 
ATOM   5218  O  O     . GLN G 3  113  ? 167.134 163.866 145.785 1.00 86.61  ?  112  GLN G O     1 
ATOM   5219  C  CB    . GLN G 3  113  ? 165.176 161.526 146.843 1.00 85.44  ?  112  GLN G CB    1 
ATOM   5220  C  CG    . GLN G 3  113  ? 164.032 161.085 147.745 1.00 84.97  ?  112  GLN G CG    1 
ATOM   5221  C  CD    . GLN G 3  113  ? 164.494 160.230 148.910 1.00 85.66  ?  112  GLN G CD    1 
ATOM   5222  O  OE1   . GLN G 3  113  ? 165.558 159.612 148.861 1.00 86.42  ?  112  GLN G OE1   1 
ATOM   5223  N  NE2   . GLN G 3  113  ? 163.693 160.190 149.968 1.00 83.31  ?  112  GLN G NE2   1 
ATOM   5224  N  N     . SER G 3  114  ? 168.334 162.091 146.498 1.00 88.69  ?  113  SER G N     1 
ATOM   5225  C  CA    . SER G 3  114  ? 169.447 162.385 145.602 1.00 90.29  ?  113  SER G CA    1 
ATOM   5226  C  C     . SER G 3  114  ? 169.090 162.105 144.148 1.00 91.43  ?  113  SER G C     1 
ATOM   5227  O  O     . SER G 3  114  ? 169.636 162.747 143.244 1.00 91.76  ?  113  SER G O     1 
ATOM   5228  C  CB    . SER G 3  114  ? 170.678 161.577 146.011 1.00 90.06  ?  113  SER G CB    1 
ATOM   5229  O  OG    . SER G 3  114  ? 171.079 161.891 147.333 1.00 91.25  ?  113  SER G OG    1 
ATOM   5230  N  N     . VAL G 3  115  ? 168.182 161.156 143.902 1.00 92.80  ?  114  VAL G N     1 
ATOM   5231  C  CA    . VAL G 3  115  ? 167.780 160.834 142.534 1.00 93.95  ?  114  VAL G CA    1 
ATOM   5232  C  C     . VAL G 3  115  ? 166.804 161.842 141.952 1.00 94.81  ?  114  VAL G C     1 
ATOM   5233  O  O     . VAL G 3  115  ? 166.560 161.822 140.739 1.00 95.23  ?  114  VAL G O     1 
ATOM   5234  C  CB    . VAL G 3  115  ? 167.154 159.428 142.462 1.00 93.88  ?  114  VAL G CB    1 
ATOM   5235  C  CG1   . VAL G 3  115  ? 168.162 158.377 142.901 1.00 93.88  ?  114  VAL G CG1   1 
ATOM   5236  C  CG2   . VAL G 3  115  ? 165.898 159.362 143.316 1.00 94.17  ?  114  VAL G CG2   1 
ATOM   5237  N  N     . LEU G 3  116  ? 166.237 162.722 142.778 1.00 95.93  ?  115  LEU G N     1 
ATOM   5238  C  CA    . LEU G 3  116  ? 165.304 163.730 142.293 1.00 97.08  ?  115  LEU G CA    1 
ATOM   5239  C  C     . LEU G 3  116  ? 165.997 164.960 141.724 1.00 98.04  ?  115  LEU G C     1 
ATOM   5240  O  O     . LEU G 3  116  ? 165.322 165.812 141.135 1.00 98.09  ?  115  LEU G O     1 
ATOM   5241  C  CB    . LEU G 3  116  ? 164.355 164.152 143.418 1.00 96.96  ?  115  LEU G CB    1 
ATOM   5242  C  CG    . LEU G 3  116  ? 163.367 163.089 143.901 1.00 96.54  ?  115  LEU G CG    1 
ATOM   5243  C  CD1   . LEU G 3  116  ? 162.536 163.616 145.060 1.00 95.51  ?  115  LEU G CD1   1 
ATOM   5244  C  CD2   . LEU G 3  116  ? 162.472 162.638 142.758 1.00 95.88  ?  115  LEU G CD2   1 
ATOM   5245  N  N     . LEU G 3  117  ? 167.311 165.075 141.883 1.00 99.25  ?  116  LEU G N     1 
ATOM   5246  C  CA    . LEU G 3  117  ? 168.021 166.225 141.346 1.00 100.15 ?  116  LEU G CA    1 
ATOM   5247  C  C     . LEU G 3  117  ? 168.132 166.111 139.827 1.00 100.98 ?  116  LEU G C     1 
ATOM   5248  O  O     . LEU G 3  117  ? 168.309 165.009 139.297 1.00 101.01 ?  116  LEU G O     1 
ATOM   5249  C  CB    . LEU G 3  117  ? 169.413 166.334 141.966 1.00 99.89  ?  116  LEU G CB    1 
ATOM   5250  C  CG    . LEU G 3  117  ? 169.460 166.497 143.486 1.00 100.15 ?  116  LEU G CG    1 
ATOM   5251  C  CD1   . LEU G 3  117  ? 170.898 166.602 143.968 1.00 100.64 ?  116  LEU G CD1   1 
ATOM   5252  C  CD2   . LEU G 3  117  ? 168.653 167.711 143.919 1.00 99.93  ?  116  LEU G CD2   1 
ATOM   5253  N  N     . PRO G 3  118  ? 168.031 167.226 139.101 1.00 101.91 ?  117  PRO G N     1 
ATOM   5254  C  CA    . PRO G 3  118  ? 168.134 167.165 137.636 1.00 102.71 ?  117  PRO G CA    1 
ATOM   5255  C  C     . PRO G 3  118  ? 169.532 166.796 137.166 1.00 103.54 ?  117  PRO G C     1 
ATOM   5256  O  O     . PRO G 3  118  ? 170.472 167.586 137.298 1.00 103.66 ?  117  PRO G O     1 
ATOM   5257  C  CB    . PRO G 3  118  ? 167.746 168.583 137.198 1.00 102.72 ?  117  PRO G CB    1 
ATOM   5258  C  CG    . PRO G 3  118  ? 168.062 169.441 138.378 1.00 102.43 ?  117  PRO G CG    1 
ATOM   5259  C  CD    . PRO G 3  118  ? 167.783 168.595 139.586 1.00 101.83 ?  117  PRO G CD    1 
ATOM   5260  N  N     . LYS G 3  119  ? 169.677 165.594 136.616 1.00 104.40 ?  118  LYS G N     1 
ATOM   5261  C  CA    . LYS G 3  119  ? 170.968 165.123 136.131 1.00 105.31 ?  118  LYS G CA    1 
ATOM   5262  C  C     . LYS G 3  119  ? 170.795 164.305 134.856 1.00 105.39 ?  118  LYS G C     1 
ATOM   5263  O  O     . LYS G 3  119  ? 171.539 164.478 133.890 1.00 105.81 ?  118  LYS G O     1 
ATOM   5264  C  CB    . LYS G 3  119  ? 171.675 164.296 137.210 1.00 105.39 ?  118  LYS G CB    1 
ATOM   5265  C  CG    . LYS G 3  119  ? 173.102 163.887 136.866 1.00 106.03 ?  118  LYS G CG    1 
ATOM   5266  C  CD    . LYS G 3  119  ? 173.170 162.461 136.339 1.00 106.03 ?  118  LYS G CD    1 
ATOM   5267  C  CE    . LYS G 3  119  ? 174.599 162.063 136.008 1.00 107.29 ?  118  LYS G CE    1 
ATOM   5268  N  NZ    . LYS G 3  119  ? 175.484 162.132 137.203 1.00 107.47 ?  118  LYS G NZ    1 
ATOM   5269  N  N     . THR H 5  30   ? 138.126 180.171 187.333 1.00 99.03  ?  29   THR H N     1 
ATOM   5270  C  CA    . THR H 5  30   ? 138.629 178.839 187.646 1.00 99.04  ?  29   THR H CA    1 
ATOM   5271  C  C     . THR H 5  30   ? 140.148 178.786 187.532 1.00 99.06  ?  29   THR H C     1 
ATOM   5272  O  O     . THR H 5  30   ? 140.708 179.007 186.458 1.00 99.17  ?  29   THR H O     1 
ATOM   5273  C  CB    . THR H 5  30   ? 138.015 177.772 186.719 1.00 98.95  ?  29   THR H CB    1 
ATOM   5274  O  OG1   . THR H 5  30   ? 136.590 177.767 186.870 1.00 99.06  ?  29   THR H OG1   1 
ATOM   5275  C  CG2   . THR H 5  30   ? 138.561 176.394 187.059 1.00 99.10  ?  29   THR H CG2   1 
ATOM   5276  N  N     . ARG H 5  31   ? 140.812 178.491 188.647 1.00 98.84  ?  30   ARG H N     1 
ATOM   5277  C  CA    . ARG H 5  31   ? 142.270 178.406 188.685 1.00 98.57  ?  30   ARG H CA    1 
ATOM   5278  C  C     . ARG H 5  31   ? 142.693 177.073 188.081 1.00 97.49  ?  30   ARG H C     1 
ATOM   5279  O  O     . ARG H 5  31   ? 142.591 176.025 188.722 1.00 97.76  ?  30   ARG H O     1 
ATOM   5280  C  CB    . ARG H 5  31   ? 142.779 178.552 190.114 1.00 99.09  ?  30   ARG H CB    1 
ATOM   5281  C  CG    . ARG H 5  31   ? 144.294 178.543 190.235 1.00 101.74 ?  30   ARG H CG    1 
ATOM   5282  C  CD    . ARG H 5  31   ? 144.732 178.525 191.690 1.00 104.82 ?  30   ARG H CD    1 
ATOM   5283  N  NE    . ARG H 5  31   ? 144.287 177.316 192.377 1.00 107.19 ?  30   ARG H NE    1 
ATOM   5284  C  CZ    . ARG H 5  31   ? 144.544 177.042 193.651 1.00 108.34 ?  30   ARG H CZ    1 
ATOM   5285  N  NH1   . ARG H 5  31   ? 145.246 177.894 194.387 1.00 108.66 ?  30   ARG H NH1   1 
ATOM   5286  N  NH2   . ARG H 5  31   ? 144.100 175.916 194.192 1.00 108.28 ?  30   ARG H NH2   1 
ATOM   5287  N  N     . LYS H 5  32   ? 143.170 177.110 186.841 1.00 95.84  ?  31   LYS H N     1 
ATOM   5288  C  CA    . LYS H 5  32   ? 143.611 175.901 186.164 1.00 94.41  ?  31   LYS H CA    1 
ATOM   5289  C  C     . LYS H 5  32   ? 145.060 175.585 186.515 1.00 93.00  ?  31   LYS H C     1 
ATOM   5290  O  O     . LYS H 5  32   ? 145.857 176.475 186.824 1.00 92.71  ?  31   LYS H O     1 
ATOM   5291  C  CB    . LYS H 5  32   ? 143.459 176.047 184.649 1.00 94.72  ?  31   LYS H CB    1 
ATOM   5292  C  CG    . LYS H 5  32   ? 144.237 177.210 184.055 1.00 95.97  ?  31   LYS H CG    1 
ATOM   5293  C  CD    . LYS H 5  32   ? 144.017 177.311 182.554 1.00 97.10  ?  31   LYS H CD    1 
ATOM   5294  C  CE    . LYS H 5  32   ? 144.462 176.043 181.843 1.00 98.10  ?  31   LYS H CE    1 
ATOM   5295  N  NZ    . LYS H 5  32   ? 144.246 176.126 180.373 1.00 98.44  ?  31   LYS H NZ    1 
ATOM   5296  N  N     . GLU H 5  33   ? 145.394 174.298 186.466 1.00 90.94  ?  32   GLU H N     1 
ATOM   5297  C  CA    . GLU H 5  33   ? 146.736 173.832 186.784 1.00 88.79  ?  32   GLU H CA    1 
ATOM   5298  C  C     . GLU H 5  33   ? 147.576 173.764 185.515 1.00 87.68  ?  32   GLU H C     1 
ATOM   5299  O  O     . GLU H 5  33   ? 147.151 173.182 184.512 1.00 87.77  ?  32   GLU H O     1 
ATOM   5300  C  CB    . GLU H 5  33   ? 146.686 172.462 187.461 1.00 88.67  ?  32   GLU H CB    1 
ATOM   5301  C  CG    . GLU H 5  33   ? 145.905 172.442 188.765 1.00 88.20  ?  32   GLU H CG    1 
ATOM   5302  C  CD    . GLU H 5  33   ? 145.882 171.070 189.408 1.00 88.02  ?  32   GLU H CD    1 
ATOM   5303  O  OE1   . GLU H 5  33   ? 146.479 170.134 188.836 1.00 87.33  ?  32   GLU H OE1   1 
ATOM   5304  O  OE2   . GLU H 5  33   ? 145.268 170.927 190.486 1.00 86.90  ?  32   GLU H OE2   1 
ATOM   5305  N  N     . SER H 5  34   ? 148.766 174.359 185.565 1.00 86.04  ?  33   SER H N     1 
ATOM   5306  C  CA    . SER H 5  34   ? 149.666 174.368 184.421 1.00 84.06  ?  33   SER H CA    1 
ATOM   5307  C  C     . SER H 5  34   ? 151.085 174.608 184.913 1.00 83.20  ?  33   SER H C     1 
ATOM   5308  O  O     . SER H 5  34   ? 151.308 175.433 185.802 1.00 83.07  ?  33   SER H O     1 
ATOM   5309  C  CB    . SER H 5  34   ? 149.265 175.442 183.402 1.00 83.90  ?  33   SER H CB    1 
ATOM   5310  O  OG    . SER H 5  34   ? 150.140 175.438 182.287 1.00 82.78  ?  33   SER H OG    1 
ATOM   5311  N  N     . TYR H 5  35   ? 152.036 173.881 184.330 1.00 81.52  ?  34   TYR H N     1 
ATOM   5312  C  CA    . TYR H 5  35   ? 153.447 174.020 184.682 1.00 79.71  ?  34   TYR H CA    1 
ATOM   5313  C  C     . TYR H 5  35   ? 153.984 175.278 184.010 1.00 79.05  ?  34   TYR H C     1 
ATOM   5314  O  O     . TYR H 5  35   ? 154.330 175.266 182.827 1.00 79.07  ?  34   TYR H O     1 
ATOM   5315  C  CB    . TYR H 5  35   ? 154.230 172.781 184.260 1.00 79.70  ?  34   TYR H CB    1 
ATOM   5316  C  CG    . TYR H 5  35   ? 153.772 171.504 184.932 1.00 79.26  ?  34   TYR H CG    1 
ATOM   5317  C  CD1   . TYR H 5  35   ? 153.189 171.528 186.193 1.00 78.10  ?  34   TYR H CD1   1 
ATOM   5318  C  CD2   . TYR H 5  35   ? 153.920 170.273 184.304 1.00 79.43  ?  34   TYR H CD2   1 
ATOM   5319  C  CE1   . TYR H 5  35   ? 152.768 170.364 186.809 1.00 78.45  ?  34   TYR H CE1   1 
ATOM   5320  C  CE2   . TYR H 5  35   ? 153.502 169.104 184.913 1.00 79.41  ?  34   TYR H CE2   1 
ATOM   5321  C  CZ    . TYR H 5  35   ? 152.927 169.155 186.165 1.00 79.10  ?  34   TYR H CZ    1 
ATOM   5322  O  OH    . TYR H 5  35   ? 152.510 167.994 186.775 1.00 80.27  ?  34   TYR H OH    1 
ATOM   5323  N  N     . ALA H 5  36   ? 154.049 176.373 184.766 1.00 78.01  ?  35   ALA H N     1 
ATOM   5324  C  CA    . ALA H 5  36   ? 154.480 177.662 184.241 1.00 77.11  ?  35   ALA H CA    1 
ATOM   5325  C  C     . ALA H 5  36   ? 155.794 178.125 184.858 1.00 76.53  ?  35   ALA H C     1 
ATOM   5326  O  O     . ALA H 5  36   ? 156.793 178.268 184.149 1.00 75.97  ?  35   ALA H O     1 
ATOM   5327  C  CB    . ALA H 5  36   ? 153.382 178.712 184.462 1.00 76.88  ?  35   ALA H CB    1 
ATOM   5328  N  N     . ILE H 5  37   ? 155.822 178.361 186.173 1.00 76.18  ?  36   ILE H N     1 
ATOM   5329  C  CA    . ILE H 5  37   ? 157.042 178.834 186.817 1.00 76.06  ?  36   ILE H CA    1 
ATOM   5330  C  C     . ILE H 5  37   ? 158.071 177.725 186.988 1.00 75.98  ?  36   ILE H C     1 
ATOM   5331  O  O     . ILE H 5  37   ? 159.243 178.013 187.258 1.00 76.13  ?  36   ILE H O     1 
ATOM   5332  C  CB    . ILE H 5  37   ? 156.727 179.467 188.185 1.00 76.25  ?  36   ILE H CB    1 
ATOM   5333  C  CG1   . ILE H 5  37   ? 156.127 178.421 189.124 1.00 75.65  ?  36   ILE H CG1   1 
ATOM   5334  C  CG2   . ILE H 5  37   ? 155.790 180.655 188.029 1.00 75.30  ?  36   ILE H CG2   1 
ATOM   5335  C  CD1   . ILE H 5  37   ? 155.699 178.982 190.455 1.00 76.03  ?  36   ILE H CD1   1 
ATOM   5336  N  N     . TYR H 5  38   ? 157.670 176.463 186.847 1.00 75.59  ?  37   TYR H N     1 
ATOM   5337  C  CA    . TYR H 5  38   ? 158.594 175.350 187.020 1.00 75.37  ?  37   TYR H CA    1 
ATOM   5338  C  C     . TYR H 5  38   ? 159.393 175.041 185.760 1.00 75.26  ?  37   TYR H C     1 
ATOM   5339  O  O     . TYR H 5  38   ? 160.238 174.140 185.788 1.00 75.77  ?  37   TYR H O     1 
ATOM   5340  C  CB    . TYR H 5  38   ? 157.832 174.101 187.472 1.00 75.40  ?  37   TYR H CB    1 
ATOM   5341  C  CG    . TYR H 5  38   ? 156.974 174.321 188.699 1.00 76.08  ?  37   TYR H CG    1 
ATOM   5342  C  CD1   . TYR H 5  38   ? 157.547 174.458 189.957 1.00 75.81  ?  37   TYR H CD1   1 
ATOM   5343  C  CD2   . TYR H 5  38   ? 155.590 174.390 188.599 1.00 76.21  ?  37   TYR H CD2   1 
ATOM   5344  C  CE1   . TYR H 5  38   ? 156.766 174.659 191.081 1.00 75.77  ?  37   TYR H CE1   1 
ATOM   5345  C  CE2   . TYR H 5  38   ? 154.801 174.591 189.718 1.00 75.95  ?  37   TYR H CE2   1 
ATOM   5346  C  CZ    . TYR H 5  38   ? 155.394 174.724 190.956 1.00 75.62  ?  37   TYR H CZ    1 
ATOM   5347  O  OH    . TYR H 5  38   ? 154.614 174.924 192.072 1.00 75.75  ?  37   TYR H OH    1 
ATOM   5348  N  N     . VAL H 5  39   ? 159.155 175.763 184.667 1.00 74.99  ?  38   VAL H N     1 
ATOM   5349  C  CA    . VAL H 5  39   ? 159.890 175.556 183.425 1.00 74.55  ?  38   VAL H CA    1 
ATOM   5350  C  C     . VAL H 5  39   ? 160.920 176.668 183.272 1.00 74.54  ?  38   VAL H C     1 
ATOM   5351  O  O     . VAL H 5  39   ? 161.996 176.459 182.701 1.00 75.06  ?  38   VAL H O     1 
ATOM   5352  C  CB    . VAL H 5  39   ? 158.938 175.501 182.216 1.00 74.38  ?  38   VAL H CB    1 
ATOM   5353  C  CG1   . VAL H 5  39   ? 159.696 175.129 180.950 1.00 74.02  ?  38   VAL H CG1   1 
ATOM   5354  C  CG2   . VAL H 5  39   ? 157.809 174.514 182.477 1.00 73.87  ?  38   VAL H CG2   1 
ATOM   5355  N  N     . TYR H 5  40   ? 160.598 177.856 183.790 1.00 74.24  ?  39   TYR H N     1 
ATOM   5356  C  CA    . TYR H 5  40   ? 161.538 178.972 183.730 1.00 74.35  ?  39   TYR H CA    1 
ATOM   5357  C  C     . TYR H 5  40   ? 162.780 178.699 184.570 1.00 73.71  ?  39   TYR H C     1 
ATOM   5358  O  O     . TYR H 5  40   ? 163.897 179.037 184.162 1.00 73.50  ?  39   TYR H O     1 
ATOM   5359  C  CB    . TYR H 5  40   ? 160.857 180.261 184.192 1.00 75.05  ?  39   TYR H CB    1 
ATOM   5360  C  CG    . TYR H 5  40   ? 159.868 180.830 183.200 1.00 75.77  ?  39   TYR H CG    1 
ATOM   5361  C  CD1   . TYR H 5  40   ? 159.949 180.514 181.851 1.00 77.80  ?  39   TYR H CD1   1 
ATOM   5362  C  CD2   . TYR H 5  40   ? 158.857 181.688 183.614 1.00 75.58  ?  39   TYR H CD2   1 
ATOM   5363  C  CE1   . TYR H 5  40   ? 159.049 181.034 180.941 1.00 78.78  ?  39   TYR H CE1   1 
ATOM   5364  C  CE2   . TYR H 5  40   ? 157.952 182.213 182.710 1.00 77.21  ?  39   TYR H CE2   1 
ATOM   5365  C  CZ    . TYR H 5  40   ? 158.053 181.882 181.375 1.00 77.98  ?  39   TYR H CZ    1 
ATOM   5366  O  OH    . TYR H 5  40   ? 157.156 182.400 180.469 1.00 76.93  ?  39   TYR H OH    1 
ATOM   5367  N  N     . LYS H 5  41   ? 162.603 178.091 185.747 1.00 72.61  ?  40   LYS H N     1 
ATOM   5368  C  CA    . LYS H 5  41   ? 163.743 177.804 186.612 1.00 71.70  ?  40   LYS H CA    1 
ATOM   5369  C  C     . LYS H 5  41   ? 164.699 176.808 185.970 1.00 71.31  ?  40   LYS H C     1 
ATOM   5370  O  O     . LYS H 5  41   ? 165.900 176.827 186.260 1.00 72.26  ?  40   LYS H O     1 
ATOM   5371  C  CB    . LYS H 5  41   ? 163.259 177.277 187.963 1.00 71.47  ?  40   LYS H CB    1 
ATOM   5372  C  CG    . LYS H 5  41   ? 162.360 178.239 188.716 1.00 71.82  ?  40   LYS H CG    1 
ATOM   5373  C  CD    . LYS H 5  41   ? 161.909 177.646 190.039 1.00 73.64  ?  40   LYS H CD    1 
ATOM   5374  C  CE    . LYS H 5  41   ? 161.009 178.610 190.793 1.00 75.35  ?  40   LYS H CE    1 
ATOM   5375  N  NZ    . LYS H 5  41   ? 160.558 178.044 192.094 1.00 77.97  ?  40   LYS H NZ    1 
ATOM   5376  N  N     . VAL H 5  42   ? 164.190 175.933 185.101 1.00 69.99  ?  41   VAL H N     1 
ATOM   5377  C  CA    . VAL H 5  42   ? 165.056 174.984 184.411 1.00 68.80  ?  41   VAL H CA    1 
ATOM   5378  C  C     . VAL H 5  42   ? 165.624 175.593 183.133 1.00 68.98  ?  41   VAL H C     1 
ATOM   5379  O  O     . VAL H 5  42   ? 166.746 175.265 182.730 1.00 69.06  ?  41   VAL H O     1 
ATOM   5380  C  CB    . VAL H 5  42   ? 164.291 173.681 184.119 1.00 68.67  ?  41   VAL H CB    1 
ATOM   5381  C  CG1   . VAL H 5  42   ? 165.233 172.612 183.573 1.00 68.06  ?  41   VAL H CG1   1 
ATOM   5382  C  CG2   . VAL H 5  42   ? 163.583 173.188 185.372 1.00 67.96  ?  41   VAL H CG2   1 
ATOM   5383  N  N     . LEU H 5  43   ? 164.876 176.487 182.483 1.00 69.21  ?  42   LEU H N     1 
ATOM   5384  C  CA    . LEU H 5  43   ? 165.355 177.096 181.247 1.00 69.18  ?  42   LEU H CA    1 
ATOM   5385  C  C     . LEU H 5  43   ? 166.460 178.110 181.519 1.00 69.16  ?  42   LEU H C     1 
ATOM   5386  O  O     . LEU H 5  43   ? 167.420 178.213 180.746 1.00 69.36  ?  42   LEU H O     1 
ATOM   5387  C  CB    . LEU H 5  43   ? 164.193 177.753 180.502 1.00 69.16  ?  42   LEU H CB    1 
ATOM   5388  C  CG    . LEU H 5  43   ? 164.517 178.415 179.161 1.00 68.84  ?  42   LEU H CG    1 
ATOM   5389  C  CD1   . LEU H 5  43   ? 165.101 177.403 178.189 1.00 67.12  ?  42   LEU H CD1   1 
ATOM   5390  C  CD2   . LEU H 5  43   ? 163.280 179.077 178.573 1.00 69.03  ?  42   LEU H CD2   1 
ATOM   5391  N  N     . LYS H 5  44   ? 166.347 178.864 182.616 1.00 68.88  ?  43   LYS H N     1 
ATOM   5392  C  CA    . LYS H 5  44   ? 167.354 179.870 182.935 1.00 68.73  ?  43   LYS H CA    1 
ATOM   5393  C  C     . LYS H 5  44   ? 168.682 179.255 183.358 1.00 68.10  ?  43   LYS H C     1 
ATOM   5394  O  O     . LYS H 5  44   ? 169.694 179.964 183.391 1.00 67.83  ?  43   LYS H O     1 
ATOM   5395  C  CB    . LYS H 5  44   ? 166.845 180.801 184.036 1.00 69.01  ?  43   LYS H CB    1 
ATOM   5396  C  CG    . LYS H 5  44   ? 165.663 181.661 183.627 1.00 69.57  ?  43   LYS H CG    1 
ATOM   5397  C  CD    . LYS H 5  44   ? 165.936 182.401 182.331 1.00 71.79  ?  43   LYS H CD    1 
ATOM   5398  C  CE    . LYS H 5  44   ? 164.775 183.311 181.977 1.00 73.90  ?  43   LYS H CE    1 
ATOM   5399  N  NZ    . LYS H 5  44   ? 165.037 184.092 180.739 1.00 75.21  ?  43   LYS H NZ    1 
ATOM   5400  N  N     . GLN H 5  45   ? 168.705 177.963 183.685 1.00 67.34  ?  44   GLN H N     1 
ATOM   5401  C  CA    . GLN H 5  45   ? 169.945 177.312 184.086 1.00 66.87  ?  44   GLN H CA    1 
ATOM   5402  C  C     . GLN H 5  45   ? 170.800 176.881 182.903 1.00 66.97  ?  44   GLN H C     1 
ATOM   5403  O  O     . GLN H 5  45   ? 171.973 176.545 183.098 1.00 68.51  ?  44   GLN H O     1 
ATOM   5404  C  CB    . GLN H 5  45   ? 169.642 176.100 184.971 1.00 66.38  ?  44   GLN H CB    1 
ATOM   5405  C  CG    . GLN H 5  45   ? 169.113 176.463 186.351 1.00 65.55  ?  44   GLN H CG    1 
ATOM   5406  C  CD    . GLN H 5  45   ? 168.815 175.246 187.207 1.00 64.50  ?  44   GLN H CD    1 
ATOM   5407  O  OE1   . GLN H 5  45   ? 169.019 174.108 186.783 1.00 67.63  ?  44   GLN H OE1   1 
ATOM   5408  N  NE2   . GLN H 5  45   ? 168.329 175.481 188.420 1.00 60.53  ?  44   GLN H NE2   1 
ATOM   5409  N  N     . VAL H 5  46   ? 170.249 176.882 181.691 1.00 67.56  ?  45   VAL H N     1 
ATOM   5410  C  CA    . VAL H 5  46   ? 170.997 176.476 180.507 1.00 68.06  ?  45   VAL H CA    1 
ATOM   5411  C  C     . VAL H 5  46   ? 170.994 177.615 179.497 1.00 68.67  ?  45   VAL H C     1 
ATOM   5412  O  O     . VAL H 5  46   ? 171.904 177.727 178.668 1.00 69.30  ?  45   VAL H O     1 
ATOM   5413  C  CB    . VAL H 5  46   ? 170.415 175.188 179.896 1.00 67.48  ?  45   VAL H CB    1 
ATOM   5414  C  CG1   . VAL H 5  46   ? 170.674 174.001 180.814 1.00 67.04  ?  45   VAL H CG1   1 
ATOM   5415  C  CG2   . VAL H 5  46   ? 168.927 175.351 179.638 1.00 68.12  ?  45   VAL H CG2   1 
ATOM   5416  N  N     . HIS H 5  47   ? 169.976 178.469 179.567 1.00 69.61  ?  46   HIS H N     1 
ATOM   5417  C  CA    . HIS H 5  47   ? 169.840 179.603 178.651 1.00 70.73  ?  46   HIS H CA    1 
ATOM   5418  C  C     . HIS H 5  47   ? 169.188 180.755 179.395 1.00 71.42  ?  46   HIS H C     1 
ATOM   5419  O  O     . HIS H 5  47   ? 167.967 180.945 179.344 1.00 71.87  ?  46   HIS H O     1 
ATOM   5420  C  CB    . HIS H 5  47   ? 169.026 179.223 177.413 1.00 70.38  ?  46   HIS H CB    1 
ATOM   5421  C  CG    . HIS H 5  47   ? 169.680 178.188 176.553 1.00 70.84  ?  46   HIS H CG    1 
ATOM   5422  N  ND1   . HIS H 5  47   ? 169.382 176.846 176.649 1.00 72.22  ?  46   HIS H ND1   1 
ATOM   5423  C  CD2   . HIS H 5  47   ? 170.615 178.297 175.580 1.00 72.43  ?  46   HIS H CD2   1 
ATOM   5424  C  CE1   . HIS H 5  47   ? 170.107 176.173 175.773 1.00 71.49  ?  46   HIS H CE1   1 
ATOM   5425  N  NE2   . HIS H 5  47   ? 170.863 177.029 175.112 1.00 72.63  ?  46   HIS H NE2   1 
ATOM   5426  N  N     . PRO H 5  48   ? 169.982 181.557 180.106 1.00 72.24  ?  47   PRO H N     1 
ATOM   5427  C  CA    . PRO H 5  48   ? 169.412 182.691 180.844 1.00 72.59  ?  47   PRO H CA    1 
ATOM   5428  C  C     . PRO H 5  48   ? 169.251 183.928 179.975 1.00 73.27  ?  47   PRO H C     1 
ATOM   5429  O  O     . PRO H 5  48   ? 169.262 185.054 180.482 1.00 74.15  ?  47   PRO H O     1 
ATOM   5430  C  CB    . PRO H 5  48   ? 170.436 182.918 181.960 1.00 72.30  ?  47   PRO H CB    1 
ATOM   5431  C  CG    . PRO H 5  48   ? 171.740 182.528 181.324 1.00 72.24  ?  47   PRO H CG    1 
ATOM   5432  C  CD    . PRO H 5  48   ? 171.433 181.425 180.330 1.00 72.25  ?  47   PRO H CD    1 
ATOM   5433  N  N     . ASP H 5  49   ? 169.103 183.731 178.657 1.00 73.72  ?  48   ASP H N     1 
ATOM   5434  C  CA    . ASP H 5  49   ? 168.990 184.870 177.751 1.00 74.57  ?  48   ASP H CA    1 
ATOM   5435  C  C     . ASP H 5  49   ? 168.116 184.577 176.533 1.00 74.60  ?  48   ASP H C     1 
ATOM   5436  O  O     . ASP H 5  49   ? 168.255 185.264 175.514 1.00 74.44  ?  48   ASP H O     1 
ATOM   5437  C  CB    . ASP H 5  49   ? 170.379 185.316 177.279 1.00 75.23  ?  48   ASP H CB    1 
ATOM   5438  C  CG    . ASP H 5  49   ? 171.105 184.234 176.504 1.00 76.19  ?  48   ASP H CG    1 
ATOM   5439  O  OD1   . ASP H 5  49   ? 170.890 183.040 176.804 1.00 77.25  ?  48   ASP H OD1   1 
ATOM   5440  O  OD2   . ASP H 5  49   ? 171.887 184.577 175.593 1.00 76.78  ?  48   ASP H OD2   1 
ATOM   5441  N  N     . THR H 5  50   ? 167.233 183.585 176.602 1.00 74.58  ?  49   THR H N     1 
ATOM   5442  C  CA    . THR H 5  50   ? 166.339 183.242 175.509 1.00 74.32  ?  49   THR H CA    1 
ATOM   5443  C  C     . THR H 5  50   ? 164.892 183.360 175.967 1.00 74.64  ?  49   THR H C     1 
ATOM   5444  O  O     . THR H 5  50   ? 164.595 183.388 177.164 1.00 74.88  ?  49   THR H O     1 
ATOM   5445  C  CB    . THR H 5  50   ? 166.603 181.821 174.991 1.00 74.04  ?  49   THR H CB    1 
ATOM   5446  O  OG1   . THR H 5  50   ? 166.436 180.883 176.061 1.00 73.17  ?  49   THR H OG1   1 
ATOM   5447  C  CG2   . THR H 5  50   ? 168.016 181.708 174.436 1.00 74.02  ?  49   THR H CG2   1 
ATOM   5448  N  N     . GLY H 5  51   ? 163.987 183.426 174.990 1.00 74.20  ?  50   GLY H N     1 
ATOM   5449  C  CA    . GLY H 5  51   ? 162.572 183.537 175.251 1.00 73.77  ?  50   GLY H CA    1 
ATOM   5450  C  C     . GLY H 5  51   ? 161.829 182.237 174.993 1.00 72.97  ?  50   GLY H C     1 
ATOM   5451  O  O     . GLY H 5  51   ? 162.414 181.188 174.719 1.00 73.21  ?  50   GLY H O     1 
ATOM   5452  N  N     . ILE H 5  52   ? 160.505 182.326 175.080 1.00 71.73  ?  51   ILE H N     1 
ATOM   5453  C  CA    . ILE H 5  52   ? 159.637 181.169 174.899 1.00 70.34  ?  51   ILE H CA    1 
ATOM   5454  C  C     . ILE H 5  52   ? 158.246 181.675 174.546 1.00 69.87  ?  51   ILE H C     1 
ATOM   5455  O  O     . ILE H 5  52   ? 157.746 182.630 175.147 1.00 69.97  ?  51   ILE H O     1 
ATOM   5456  C  CB    . ILE H 5  52   ? 159.629 180.274 176.162 1.00 70.34  ?  51   ILE H CB    1 
ATOM   5457  C  CG1   . ILE H 5  52   ? 158.613 179.138 176.021 1.00 69.30  ?  51   ILE H CG1   1 
ATOM   5458  C  CG2   . ILE H 5  52   ? 159.351 181.104 177.408 1.00 70.19  ?  51   ILE H CG2   1 
ATOM   5459  C  CD1   . ILE H 5  52   ? 158.903 178.194 174.875 1.00 69.10  ?  51   ILE H CD1   1 
ATOM   5460  N  N     . SER H 5  53   ? 157.631 181.037 173.556 1.00 69.55  ?  52   SER H N     1 
ATOM   5461  C  CA    . SER H 5  53   ? 156.289 181.390 173.124 1.00 68.81  ?  52   SER H CA    1 
ATOM   5462  C  C     . SER H 5  53   ? 155.245 180.647 173.956 1.00 68.34  ?  52   SER H C     1 
ATOM   5463  O  O     . SER H 5  53   ? 155.557 179.740 174.731 1.00 68.56  ?  52   SER H O     1 
ATOM   5464  C  CB    . SER H 5  53   ? 156.108 181.081 171.638 1.00 68.37  ?  52   SER H CB    1 
ATOM   5465  O  OG    . SER H 5  53   ? 154.789 181.374 171.212 1.00 67.44  ?  52   SER H OG    1 
ATOM   5466  N  N     . SER H 5  54   ? 153.983 181.043 173.779 1.00 68.12  ?  53   SER H N     1 
ATOM   5467  C  CA    . SER H 5  54   ? 152.893 180.433 174.533 1.00 67.63  ?  53   SER H CA    1 
ATOM   5468  C  C     . SER H 5  54   ? 152.501 179.076 173.958 1.00 67.56  ?  53   SER H C     1 
ATOM   5469  O  O     . SER H 5  54   ? 152.220 178.137 174.713 1.00 67.31  ?  53   SER H O     1 
ATOM   5470  C  CB    . SER H 5  54   ? 151.684 181.368 174.555 1.00 67.17  ?  53   SER H CB    1 
ATOM   5471  O  OG    . SER H 5  54   ? 151.220 181.629 173.242 1.00 67.78  ?  53   SER H OG    1 
ATOM   5472  N  N     . LYS H 5  55   ? 152.470 178.958 172.629 1.00 67.20  ?  54   LYS H N     1 
ATOM   5473  C  CA    . LYS H 5  55   ? 152.137 177.681 172.007 1.00 67.40  ?  54   LYS H CA    1 
ATOM   5474  C  C     . LYS H 5  55   ? 153.174 176.620 172.353 1.00 67.48  ?  54   LYS H C     1 
ATOM   5475  O  O     . LYS H 5  55   ? 152.827 175.496 172.732 1.00 67.39  ?  54   LYS H O     1 
ATOM   5476  C  CB    . LYS H 5  55   ? 152.014 177.848 170.492 1.00 67.57  ?  54   LYS H CB    1 
ATOM   5477  C  CG    . LYS H 5  55   ? 150.799 178.653 170.047 1.00 68.87  ?  54   LYS H CG    1 
ATOM   5478  C  CD    . LYS H 5  55   ? 149.503 177.998 170.503 1.00 68.04  ?  54   LYS H CD    1 
ATOM   5479  C  CE    . LYS H 5  55   ? 148.285 178.759 169.999 1.00 69.33  ?  54   LYS H CE    1 
ATOM   5480  N  NZ    . LYS H 5  55   ? 148.230 178.807 168.512 1.00 70.86  ?  54   LYS H NZ    1 
ATOM   5481  N  N     . ALA H 5  56   ? 154.460 176.964 172.233 1.00 67.61  ?  55   ALA H N     1 
ATOM   5482  C  CA    . ALA H 5  56   ? 155.511 176.029 172.619 1.00 66.70  ?  55   ALA H CA    1 
ATOM   5483  C  C     . ALA H 5  56   ? 155.467 175.729 174.111 1.00 66.31  ?  55   ALA H C     1 
ATOM   5484  O  O     . ALA H 5  56   ? 155.838 174.628 174.535 1.00 65.46  ?  55   ALA H O     1 
ATOM   5485  C  CB    . ALA H 5  56   ? 156.881 176.583 172.227 1.00 66.84  ?  55   ALA H CB    1 
ATOM   5486  N  N     . MET H 5  57   ? 155.019 176.693 174.920 1.00 66.16  ?  56   MET H N     1 
ATOM   5487  C  CA    . MET H 5  57   ? 154.839 176.438 176.345 1.00 66.66  ?  56   MET H CA    1 
ATOM   5488  C  C     . MET H 5  57   ? 153.752 175.398 176.578 1.00 66.60  ?  56   MET H C     1 
ATOM   5489  O  O     . MET H 5  57   ? 153.888 174.528 177.447 1.00 66.75  ?  56   MET H O     1 
ATOM   5490  C  CB    . MET H 5  57   ? 154.505 177.740 177.072 1.00 67.01  ?  56   MET H CB    1 
ATOM   5491  C  CG    . MET H 5  57   ? 154.593 177.650 178.585 1.00 68.77  ?  56   MET H CG    1 
ATOM   5492  S  SD    . MET H 5  57   ? 156.269 177.309 179.156 1.00 74.24  ?  56   MET H SD    1 
ATOM   5493  C  CE    . MET H 5  57   ? 156.051 177.430 180.928 1.00 71.98  ?  56   MET H CE    1 
ATOM   5494  N  N     . SER H 5  58   ? 152.662 175.469 175.808 1.00 65.76  ?  57   SER H N     1 
ATOM   5495  C  CA    . SER H 5  58   ? 151.647 174.425 175.880 1.00 64.69  ?  57   SER H CA    1 
ATOM   5496  C  C     . SER H 5  58   ? 152.180 173.095 175.364 1.00 63.55  ?  57   SER H C     1 
ATOM   5497  O  O     . SER H 5  58   ? 151.764 172.034 175.845 1.00 62.82  ?  57   SER H O     1 
ATOM   5498  C  CB    . SER H 5  58   ? 150.403 174.842 175.097 1.00 64.46  ?  57   SER H CB    1 
ATOM   5499  O  OG    . SER H 5  58   ? 150.714 175.093 173.738 1.00 66.64  ?  57   SER H OG    1 
ATOM   5500  N  N     . ILE H 5  59   ? 153.095 173.129 174.391 1.00 62.68  ?  58   ILE H N     1 
ATOM   5501  C  CA    . ILE H 5  59   ? 153.726 171.899 173.918 1.00 62.23  ?  58   ILE H CA    1 
ATOM   5502  C  C     . ILE H 5  59   ? 154.534 171.254 175.036 1.00 62.16  ?  58   ILE H C     1 
ATOM   5503  O  O     . ILE H 5  59   ? 154.493 170.032 175.227 1.00 62.11  ?  58   ILE H O     1 
ATOM   5504  C  CB    . ILE H 5  59   ? 154.601 172.184 172.682 1.00 62.12  ?  58   ILE H CB    1 
ATOM   5505  C  CG1   . ILE H 5  59   ? 153.749 172.695 171.518 1.00 61.61  ?  58   ILE H CG1   1 
ATOM   5506  C  CG2   . ILE H 5  59   ? 155.372 170.936 172.272 1.00 63.55  ?  58   ILE H CG2   1 
ATOM   5507  C  CD1   . ILE H 5  59   ? 152.843 171.648 170.914 1.00 63.25  ?  58   ILE H CD1   1 
ATOM   5508  N  N     . MET H 5  60   ? 155.276 172.062 175.797 1.00 61.66  ?  59   MET H N     1 
ATOM   5509  C  CA    . MET H 5  60   ? 156.060 171.515 176.900 1.00 61.28  ?  59   MET H CA    1 
ATOM   5510  C  C     . MET H 5  60   ? 155.162 171.030 178.032 1.00 60.80  ?  59   MET H C     1 
ATOM   5511  O  O     . MET H 5  60   ? 155.427 169.982 178.633 1.00 60.79  ?  59   MET H O     1 
ATOM   5512  C  CB    . MET H 5  60   ? 157.049 172.560 177.413 1.00 61.82  ?  59   MET H CB    1 
ATOM   5513  C  CG    . MET H 5  60   ? 158.062 173.019 176.377 1.00 62.45  ?  59   MET H CG    1 
ATOM   5514  S  SD    . MET H 5  60   ? 159.071 171.671 175.731 1.00 70.10  ?  59   MET H SD    1 
ATOM   5515  C  CE    . MET H 5  60   ? 159.838 171.067 177.232 1.00 63.96  ?  59   MET H CE    1 
ATOM   5516  N  N     . ASN H 5  61   ? 154.098 171.774 178.337 1.00 59.81  ?  60   ASN H N     1 
ATOM   5517  C  CA    . ASN H 5  61   ? 153.204 171.382 179.422 1.00 58.69  ?  60   ASN H CA    1 
ATOM   5518  C  C     . ASN H 5  61   ? 152.485 170.078 179.092 1.00 58.45  ?  60   ASN H C     1 
ATOM   5519  O  O     . ASN H 5  61   ? 152.546 169.107 179.856 1.00 57.76  ?  60   ASN H O     1 
ATOM   5520  C  CB    . ASN H 5  61   ? 152.202 172.503 179.706 1.00 57.76  ?  60   ASN H CB    1 
ATOM   5521  C  CG    . ASN H 5  61   ? 151.269 172.174 180.855 1.00 56.24  ?  60   ASN H CG    1 
ATOM   5522  O  OD1   . ASN H 5  61   ? 151.602 171.376 181.731 1.00 56.49  ?  60   ASN H OD1   1 
ATOM   5523  N  ND2   . ASN H 5  61   ? 150.090 172.786 180.854 1.00 53.47  ?  60   ASN H ND2   1 
ATOM   5524  N  N     . SER H 5  62   ? 151.802 170.038 177.945 1.00 58.29  ?  61   SER H N     1 
ATOM   5525  C  CA    . SER H 5  62   ? 151.120 168.814 177.539 1.00 59.45  ?  61   SER H CA    1 
ATOM   5526  C  C     . SER H 5  62   ? 152.106 167.680 177.291 1.00 58.95  ?  61   SER H C     1 
ATOM   5527  O  O     . SER H 5  62   ? 151.741 166.504 177.398 1.00 57.90  ?  61   SER H O     1 
ATOM   5528  C  CB    . SER H 5  62   ? 150.275 169.074 176.291 1.00 60.22  ?  61   SER H CB    1 
ATOM   5529  O  OG    . SER H 5  62   ? 151.058 169.639 175.255 1.00 62.97  ?  61   SER H OG    1 
ATOM   5530  N  N     . PHE H 5  63   ? 153.358 168.012 176.971 1.00 60.13  ?  62   PHE H N     1 
ATOM   5531  C  CA    . PHE H 5  63   ? 154.384 166.986 176.824 1.00 60.04  ?  62   PHE H CA    1 
ATOM   5532  C  C     . PHE H 5  63   ? 154.715 166.345 178.167 1.00 59.85  ?  62   PHE H C     1 
ATOM   5533  O  O     . PHE H 5  63   ? 154.755 165.115 178.286 1.00 59.60  ?  62   PHE H O     1 
ATOM   5534  C  CB    . PHE H 5  63   ? 155.636 167.589 176.188 1.00 60.13  ?  62   PHE H CB    1 
ATOM   5535  C  CG    . PHE H 5  63   ? 156.764 166.614 176.029 1.00 60.57  ?  62   PHE H CG    1 
ATOM   5536  C  CD1   . PHE H 5  63   ? 156.774 165.717 174.975 1.00 62.49  ?  62   PHE H CD1   1 
ATOM   5537  C  CD2   . PHE H 5  63   ? 157.815 166.596 176.930 1.00 60.69  ?  62   PHE H CD2   1 
ATOM   5538  C  CE1   . PHE H 5  63   ? 157.811 164.816 174.824 1.00 61.88  ?  62   PHE H CE1   1 
ATOM   5539  C  CE2   . PHE H 5  63   ? 158.856 165.698 176.785 1.00 60.36  ?  62   PHE H CE2   1 
ATOM   5540  C  CZ    . PHE H 5  63   ? 158.853 164.807 175.730 1.00 61.04  ?  62   PHE H CZ    1 
ATOM   5541  N  N     . VAL H 5  64   ? 154.957 167.167 179.192 1.00 59.27  ?  63   VAL H N     1 
ATOM   5542  C  CA    . VAL H 5  64   ? 155.242 166.630 180.520 1.00 59.37  ?  63   VAL H CA    1 
ATOM   5543  C  C     . VAL H 5  64   ? 154.038 165.864 181.054 1.00 59.70  ?  63   VAL H C     1 
ATOM   5544  O  O     . VAL H 5  64   ? 154.186 164.833 181.723 1.00 59.85  ?  63   VAL H O     1 
ATOM   5545  C  CB    . VAL H 5  64   ? 155.667 167.760 181.476 1.00 59.91  ?  63   VAL H CB    1 
ATOM   5546  C  CG1   . VAL H 5  64   ? 155.861 167.221 182.885 1.00 59.89  ?  63   VAL H CG1   1 
ATOM   5547  C  CG2   . VAL H 5  64   ? 156.945 168.418 180.980 1.00 59.12  ?  63   VAL H CG2   1 
ATOM   5548  N  N     . ASN H 5  65   ? 152.827 166.348 180.763 1.00 59.24  ?  64   ASN H N     1 
ATOM   5549  C  CA    . ASN H 5  65   ? 151.629 165.624 181.180 1.00 58.48  ?  64   ASN H CA    1 
ATOM   5550  C  C     . ASN H 5  65   ? 151.532 164.271 180.486 1.00 58.49  ?  64   ASN H C     1 
ATOM   5551  O  O     . ASN H 5  65   ? 151.185 163.263 181.115 1.00 57.91  ?  64   ASN H O     1 
ATOM   5552  C  CB    . ASN H 5  65   ? 150.381 166.462 180.899 1.00 57.37  ?  64   ASN H CB    1 
ATOM   5553  C  CG    . ASN H 5  65   ? 150.298 167.697 181.774 1.00 59.64  ?  64   ASN H CG    1 
ATOM   5554  O  OD1   . ASN H 5  65   ? 150.061 168.804 181.289 1.00 61.31  ?  64   ASN H OD1   1 
ATOM   5555  N  ND2   . ASN H 5  65   ? 150.495 167.514 183.075 1.00 58.99  ?  64   ASN H ND2   1 
ATOM   5556  N  N     . ASP H 5  66   ? 151.843 164.226 179.187 1.00 58.16  ?  65   ASP H N     1 
ATOM   5557  C  CA    . ASP H 5  66   ? 151.775 162.967 178.454 1.00 59.12  ?  65   ASP H CA    1 
ATOM   5558  C  C     . ASP H 5  66   ? 152.819 161.977 178.953 1.00 59.76  ?  65   ASP H C     1 
ATOM   5559  O  O     . ASP H 5  66   ? 152.519 160.791 179.134 1.00 58.17  ?  65   ASP H O     1 
ATOM   5560  C  CB    . ASP H 5  66   ? 151.949 163.218 176.957 1.00 59.51  ?  65   ASP H CB    1 
ATOM   5561  C  CG    . ASP H 5  66   ? 151.896 161.941 176.144 1.00 61.17  ?  65   ASP H CG    1 
ATOM   5562  O  OD1   . ASP H 5  66   ? 150.811 161.327 176.070 1.00 63.49  ?  65   ASP H OD1   1 
ATOM   5563  O  OD2   . ASP H 5  66   ? 152.939 161.551 175.579 1.00 59.10  ?  65   ASP H OD2   1 
ATOM   5564  N  N     . VAL H 5  67   ? 154.051 162.441 179.176 1.00 61.41  ?  66   VAL H N     1 
ATOM   5565  C  CA    . VAL H 5  67   ? 155.086 161.561 179.713 1.00 61.29  ?  66   VAL H CA    1 
ATOM   5566  C  C     . VAL H 5  67   ? 154.699 161.078 181.105 1.00 60.85  ?  66   VAL H C     1 
ATOM   5567  O  O     . VAL H 5  67   ? 154.980 159.935 181.484 1.00 60.01  ?  66   VAL H O     1 
ATOM   5568  C  CB    . VAL H 5  67   ? 156.451 162.275 179.715 1.00 61.74  ?  66   VAL H CB    1 
ATOM   5569  C  CG1   . VAL H 5  67   ? 157.526 161.371 180.300 1.00 62.89  ?  66   VAL H CG1   1 
ATOM   5570  C  CG2   . VAL H 5  67   ? 156.828 162.701 178.306 1.00 62.58  ?  66   VAL H CG2   1 
ATOM   5571  N  N     . PHE H 5  68   ? 154.037 161.938 181.883 1.00 60.79  ?  67   PHE H N     1 
ATOM   5572  C  CA    . PHE H 5  68   ? 153.545 161.518 183.191 1.00 61.24  ?  67   PHE H CA    1 
ATOM   5573  C  C     . PHE H 5  68   ? 152.490 160.427 183.057 1.00 61.75  ?  67   PHE H C     1 
ATOM   5574  O  O     . PHE H 5  68   ? 152.441 159.496 183.869 1.00 61.82  ?  67   PHE H O     1 
ATOM   5575  C  CB    . PHE H 5  68   ? 152.987 162.720 183.952 1.00 60.97  ?  67   PHE H CB    1 
ATOM   5576  C  CG    . PHE H 5  68   ? 152.302 162.357 185.238 1.00 61.02  ?  67   PHE H CG    1 
ATOM   5577  C  CD1   . PHE H 5  68   ? 153.039 162.040 186.366 1.00 61.49  ?  67   PHE H CD1   1 
ATOM   5578  C  CD2   . PHE H 5  68   ? 150.919 162.338 185.319 1.00 61.07  ?  67   PHE H CD2   1 
ATOM   5579  C  CE1   . PHE H 5  68   ? 152.411 161.705 187.550 1.00 60.77  ?  67   PHE H CE1   1 
ATOM   5580  C  CE2   . PHE H 5  68   ? 150.285 162.005 186.501 1.00 61.26  ?  67   PHE H CE2   1 
ATOM   5581  C  CZ    . PHE H 5  68   ? 151.032 161.689 187.618 1.00 61.78  ?  67   PHE H CZ    1 
ATOM   5582  N  N     . GLU H 5  69   ? 151.637 160.523 182.034 1.00 61.73  ?  68   GLU H N     1 
ATOM   5583  C  CA    . GLU H 5  69   ? 150.635 159.484 181.815 1.00 61.85  ?  68   GLU H CA    1 
ATOM   5584  C  C     . GLU H 5  69   ? 151.277 158.182 181.352 1.00 60.94  ?  68   GLU H C     1 
ATOM   5585  O  O     . GLU H 5  69   ? 150.815 157.093 181.713 1.00 60.44  ?  68   GLU H O     1 
ATOM   5586  C  CB    . GLU H 5  69   ? 149.595 159.962 180.802 1.00 63.09  ?  68   GLU H CB    1 
ATOM   5587  C  CG    . GLU H 5  69   ? 148.740 161.118 181.290 1.00 66.32  ?  68   GLU H CG    1 
ATOM   5588  C  CD    . GLU H 5  69   ? 147.749 161.588 180.246 1.00 72.24  ?  68   GLU H CD    1 
ATOM   5589  O  OE1   . GLU H 5  69   ? 147.720 160.997 179.145 1.00 72.94  ?  68   GLU H OE1   1 
ATOM   5590  O  OE2   . GLU H 5  69   ? 147.000 162.547 180.524 1.00 72.03  ?  68   GLU H OE2   1 
ATOM   5591  N  N     . ARG H 5  70   ? 152.344 158.270 180.555 1.00 60.52  ?  69   ARG H N     1 
ATOM   5592  C  CA    . ARG H 5  70   ? 153.000 157.064 180.061 1.00 61.33  ?  69   ARG H CA    1 
ATOM   5593  C  C     . ARG H 5  70   ? 153.764 156.357 181.175 1.00 63.15  ?  69   ARG H C     1 
ATOM   5594  O  O     . ARG H 5  70   ? 153.682 155.131 181.316 1.00 62.74  ?  69   ARG H O     1 
ATOM   5595  C  CB    . ARG H 5  70   ? 153.934 157.410 178.900 1.00 60.80  ?  69   ARG H CB    1 
ATOM   5596  C  CG    . ARG H 5  70   ? 153.223 157.929 177.658 1.00 58.75  ?  69   ARG H CG    1 
ATOM   5597  C  CD    . ARG H 5  70   ? 154.209 158.207 176.534 1.00 56.46  ?  69   ARG H CD    1 
ATOM   5598  N  NE    . ARG H 5  70   ? 153.546 158.686 175.324 1.00 53.14  ?  69   ARG H NE    1 
ATOM   5599  C  CZ    . ARG H 5  70   ? 154.181 158.999 174.200 1.00 53.43  ?  69   ARG H CZ    1 
ATOM   5600  N  NH1   . ARG H 5  70   ? 155.501 158.885 174.127 1.00 52.87  ?  69   ARG H NH1   1 
ATOM   5601  N  NH2   . ARG H 5  70   ? 153.498 159.427 173.147 1.00 52.06  ?  69   ARG H NH2   1 
ATOM   5602  N  N     . ILE H 5  71   ? 154.513 157.115 181.978 1.00 64.16  ?  70   ILE H N     1 
ATOM   5603  C  CA    . ILE H 5  71   ? 155.284 156.508 183.059 1.00 64.99  ?  70   ILE H CA    1 
ATOM   5604  C  C     . ILE H 5  71   ? 154.360 156.015 184.165 1.00 65.47  ?  70   ILE H C     1 
ATOM   5605  O  O     . ILE H 5  71   ? 154.548 154.919 184.707 1.00 65.96  ?  70   ILE H O     1 
ATOM   5606  C  CB    . ILE H 5  71   ? 156.332 157.504 183.590 1.00 65.72  ?  70   ILE H CB    1 
ATOM   5607  C  CG1   . ILE H 5  71   ? 157.321 157.877 182.483 1.00 65.40  ?  70   ILE H CG1   1 
ATOM   5608  C  CG2   . ILE H 5  71   ? 157.067 156.923 184.789 1.00 65.71  ?  70   ILE H CG2   1 
ATOM   5609  C  CD1   . ILE H 5  71   ? 158.408 158.834 182.922 1.00 64.60  ?  70   ILE H CD1   1 
ATOM   5610  N  N     . ALA H 5  72   ? 153.343 156.809 184.512 1.00 65.49  ?  71   ALA H N     1 
ATOM   5611  C  CA    . ALA H 5  72   ? 152.408 156.397 185.554 1.00 66.15  ?  71   ALA H CA    1 
ATOM   5612  C  C     . ALA H 5  72   ? 151.587 155.190 185.117 1.00 66.78  ?  71   ALA H C     1 
ATOM   5613  O  O     . ALA H 5  72   ? 151.323 154.289 185.922 1.00 67.61  ?  71   ALA H O     1 
ATOM   5614  C  CB    . ALA H 5  72   ? 151.492 157.562 185.929 1.00 65.96  ?  71   ALA H CB    1 
ATOM   5615  N  N     . GLY H 5  73   ? 151.174 155.154 183.849 1.00 67.23  ?  72   GLY H N     1 
ATOM   5616  C  CA    . GLY H 5  73   ? 150.422 154.009 183.361 1.00 68.07  ?  72   GLY H CA    1 
ATOM   5617  C  C     . GLY H 5  73   ? 151.268 152.755 183.252 1.00 68.86  ?  72   GLY H C     1 
ATOM   5618  O  O     . GLY H 5  73   ? 150.830 151.666 183.633 1.00 68.65  ?  72   GLY H O     1 
ATOM   5619  N  N     . GLU H 5  74   ? 152.490 152.889 182.726 1.00 70.34  ?  73   GLU H N     1 
ATOM   5620  C  CA    . GLU H 5  74   ? 153.385 151.739 182.631 1.00 71.36  ?  73   GLU H CA    1 
ATOM   5621  C  C     . GLU H 5  74   ? 153.730 151.193 184.012 1.00 71.77  ?  73   GLU H C     1 
ATOM   5622  O  O     . GLU H 5  74   ? 153.731 149.974 184.222 1.00 72.16  ?  73   GLU H O     1 
ATOM   5623  C  CB    . GLU H 5  74   ? 154.656 152.119 181.869 1.00 71.02  ?  73   GLU H CB    1 
ATOM   5624  C  CG    . GLU H 5  74   ? 155.558 150.937 181.533 1.00 73.59  ?  73   GLU H CG    1 
ATOM   5625  C  CD    . GLU H 5  74   ? 154.951 150.014 180.492 1.00 75.51  ?  73   GLU H CD    1 
ATOM   5626  O  OE1   . GLU H 5  74   ? 154.042 150.459 179.759 1.00 72.80  ?  73   GLU H OE1   1 
ATOM   5627  O  OE2   . GLU H 5  74   ? 155.381 148.844 180.404 1.00 76.85  ?  73   GLU H OE2   1 
ATOM   5628  N  N     . ALA H 5  75   ? 154.016 152.079 184.970 1.00 72.06  ?  74   ALA H N     1 
ATOM   5629  C  CA    . ALA H 5  75   ? 154.268 151.645 186.339 1.00 72.76  ?  74   ALA H CA    1 
ATOM   5630  C  C     . ALA H 5  75   ? 153.017 151.092 187.008 1.00 73.39  ?  74   ALA H C     1 
ATOM   5631  O  O     . ALA H 5  75   ? 153.129 150.281 187.935 1.00 73.05  ?  74   ALA H O     1 
ATOM   5632  C  CB    . ALA H 5  75   ? 154.832 152.802 187.164 1.00 72.50  ?  74   ALA H CB    1 
ATOM   5633  N  N     . SER H 5  76   ? 151.831 151.512 186.565 1.00 74.15  ?  75   SER H N     1 
ATOM   5634  C  CA    . SER H 5  76   ? 150.599 150.982 187.139 1.00 74.71  ?  75   SER H CA    1 
ATOM   5635  C  C     . SER H 5  76   ? 150.337 149.564 186.651 1.00 74.75  ?  75   SER H C     1 
ATOM   5636  O  O     . SER H 5  76   ? 150.054 148.664 187.452 1.00 74.73  ?  75   SER H O     1 
ATOM   5637  C  CB    . SER H 5  76   ? 149.422 151.897 186.798 1.00 74.33  ?  75   SER H CB    1 
ATOM   5638  O  OG    . SER H 5  76   ? 148.211 151.399 187.343 1.00 75.23  ?  75   SER H OG    1 
ATOM   5639  N  N     . ARG H 5  77   ? 150.423 149.345 185.336 1.00 75.02  ?  76   ARG H N     1 
ATOM   5640  C  CA    . ARG H 5  77   ? 150.204 148.005 184.799 1.00 75.82  ?  76   ARG H CA    1 
ATOM   5641  C  C     . ARG H 5  77   ? 151.312 147.051 185.232 1.00 76.41  ?  76   ARG H C     1 
ATOM   5642  O  O     . ARG H 5  77   ? 151.051 145.873 185.504 1.00 76.61  ?  76   ARG H O     1 
ATOM   5643  C  CB    . ARG H 5  77   ? 150.093 148.057 183.274 1.00 75.82  ?  76   ARG H CB    1 
ATOM   5644  C  CG    . ARG H 5  77   ? 151.300 148.658 182.571 1.00 75.70  ?  76   ARG H CG    1 
ATOM   5645  C  CD    . ARG H 5  77   ? 151.123 148.674 181.061 1.00 75.59  ?  76   ARG H CD    1 
ATOM   5646  N  NE    . ARG H 5  77   ? 151.000 147.328 180.507 1.00 75.91  ?  76   ARG H NE    1 
ATOM   5647  C  CZ    . ARG H 5  77   ? 150.867 147.061 179.212 1.00 75.88  ?  76   ARG H CZ    1 
ATOM   5648  N  NH1   . ARG H 5  77   ? 150.840 148.048 178.327 1.00 76.65  ?  76   ARG H NH1   1 
ATOM   5649  N  NH2   . ARG H 5  77   ? 150.762 145.805 178.800 1.00 75.91  ?  76   ARG H NH2   1 
ATOM   5650  N  N     . LEU H 5  78   ? 152.552 147.541 185.312 1.00 77.04  ?  77   LEU H N     1 
ATOM   5651  C  CA    . LEU H 5  78   ? 153.640 146.699 185.799 1.00 77.34  ?  77   LEU H CA    1 
ATOM   5652  C  C     . LEU H 5  78   ? 153.482 146.405 187.285 1.00 77.77  ?  77   LEU H C     1 
ATOM   5653  O  O     . LEU H 5  78   ? 153.802 145.302 187.745 1.00 77.72  ?  77   LEU H O     1 
ATOM   5654  C  CB    . LEU H 5  78   ? 154.988 147.362 185.517 1.00 77.42  ?  77   LEU H CB    1 
ATOM   5655  C  CG    . LEU H 5  78   ? 156.236 146.619 186.000 1.00 77.03  ?  77   LEU H CG    1 
ATOM   5656  C  CD1   . LEU H 5  78   ? 156.233 145.178 185.517 1.00 76.20  ?  77   LEU H CD1   1 
ATOM   5657  C  CD2   . LEU H 5  78   ? 157.491 147.332 185.534 1.00 74.25  ?  77   LEU H CD2   1 
ATOM   5658  N  N     . ALA H 5  79   ? 152.988 147.379 188.054 1.00 78.18  ?  78   ALA H N     1 
ATOM   5659  C  CA    . ALA H 5  79   ? 152.705 147.127 189.462 1.00 78.74  ?  78   ALA H CA    1 
ATOM   5660  C  C     . ALA H 5  79   ? 151.554 146.145 189.631 1.00 79.37  ?  78   ALA H C     1 
ATOM   5661  O  O     . ALA H 5  79   ? 151.489 145.435 190.641 1.00 79.40  ?  78   ALA H O     1 
ATOM   5662  C  CB    . ALA H 5  79   ? 152.400 148.440 190.181 1.00 78.65  ?  78   ALA H CB    1 
ATOM   5663  N  N     . HIS H 5  80   ? 150.642 146.085 188.658 1.00 79.72  ?  79   HIS H N     1 
ATOM   5664  C  CA    . HIS H 5  80   ? 149.540 145.133 188.709 1.00 80.24  ?  79   HIS H CA    1 
ATOM   5665  C  C     . HIS H 5  80   ? 149.936 143.754 188.197 1.00 80.28  ?  79   HIS H C     1 
ATOM   5666  O  O     . HIS H 5  80   ? 149.270 142.768 188.533 1.00 80.34  ?  79   HIS H O     1 
ATOM   5667  C  CB    . HIS H 5  80   ? 148.351 145.663 187.903 1.00 80.40  ?  79   HIS H CB    1 
ATOM   5668  C  CG    . HIS H 5  80   ? 147.075 144.915 188.137 1.00 82.03  ?  79   HIS H CG    1 
ATOM   5669  N  ND1   . HIS H 5  80   ? 146.046 144.896 187.221 1.00 82.34  ?  79   HIS H ND1   1 
ATOM   5670  C  CD2   . HIS H 5  80   ? 146.658 144.168 189.187 1.00 82.96  ?  79   HIS H CD2   1 
ATOM   5671  C  CE1   . HIS H 5  80   ? 145.052 144.164 187.694 1.00 81.94  ?  79   HIS H CE1   1 
ATOM   5672  N  NE2   . HIS H 5  80   ? 145.398 143.711 188.885 1.00 82.92  ?  79   HIS H NE2   1 
ATOM   5673  N  N     . TYR H 5  81   ? 151.002 143.660 187.398 1.00 80.52  ?  80   TYR H N     1 
ATOM   5674  C  CA    . TYR H 5  81   ? 151.423 142.364 186.873 1.00 80.67  ?  80   TYR H CA    1 
ATOM   5675  C  C     . TYR H 5  81   ? 152.030 141.494 187.968 1.00 81.01  ?  80   TYR H C     1 
ATOM   5676  O  O     . TYR H 5  81   ? 151.659 140.324 188.122 1.00 80.61  ?  80   TYR H O     1 
ATOM   5677  C  CB    . TYR H 5  81   ? 152.418 142.559 185.729 1.00 80.49  ?  80   TYR H CB    1 
ATOM   5678  C  CG    . TYR H 5  81   ? 151.801 143.105 184.461 1.00 80.74  ?  80   TYR H CG    1 
ATOM   5679  C  CD1   . TYR H 5  81   ? 150.448 142.938 184.197 1.00 79.98  ?  80   TYR H CD1   1 
ATOM   5680  C  CD2   . TYR H 5  81   ? 152.572 143.786 183.528 1.00 80.78  ?  80   TYR H CD2   1 
ATOM   5681  C  CE1   . TYR H 5  81   ? 149.880 143.435 183.040 1.00 79.85  ?  80   TYR H CE1   1 
ATOM   5682  C  CE2   . TYR H 5  81   ? 152.012 144.286 182.368 1.00 79.94  ?  80   TYR H CE2   1 
ATOM   5683  C  CZ    . TYR H 5  81   ? 150.666 144.108 182.129 1.00 79.70  ?  80   TYR H CZ    1 
ATOM   5684  O  OH    . TYR H 5  81   ? 150.103 144.604 180.976 1.00 79.95  ?  80   TYR H OH    1 
ATOM   5685  N  N     . ASN H 5  82   ? 152.967 142.046 188.738 1.00 81.69  ?  81   ASN H N     1 
ATOM   5686  C  CA    . ASN H 5  82   ? 153.673 141.301 189.771 1.00 82.52  ?  81   ASN H CA    1 
ATOM   5687  C  C     . ASN H 5  82   ? 152.919 141.264 191.097 1.00 82.86  ?  81   ASN H C     1 
ATOM   5688  O  O     . ASN H 5  82   ? 153.537 141.021 192.141 1.00 82.97  ?  81   ASN H O     1 
ATOM   5689  C  CB    . ASN H 5  82   ? 155.071 141.888 189.981 1.00 82.71  ?  81   ASN H CB    1 
ATOM   5690  C  CG    . ASN H 5  82   ? 155.924 141.824 188.730 1.00 83.19  ?  81   ASN H CG    1 
ATOM   5691  O  OD1   . ASN H 5  82   ? 155.767 140.927 187.902 1.00 82.95  ?  81   ASN H OD1   1 
ATOM   5692  N  ND2   . ASN H 5  82   ? 156.835 142.780 188.585 1.00 84.22  ?  81   ASN H ND2   1 
ATOM   5693  N  N     . LYS H 5  83   ? 151.604 141.497 191.077 1.00 83.37  ?  82   LYS H N     1 
ATOM   5694  C  CA    . LYS H 5  83   ? 150.771 141.487 192.282 1.00 83.75  ?  82   LYS H CA    1 
ATOM   5695  C  C     . LYS H 5  83   ? 151.285 142.464 193.336 1.00 83.93  ?  82   LYS H C     1 
ATOM   5696  O  O     . LYS H 5  83   ? 151.184 142.208 194.538 1.00 84.02  ?  82   LYS H O     1 
ATOM   5697  C  CB    . LYS H 5  83   ? 150.660 140.077 192.871 1.00 83.66  ?  82   LYS H CB    1 
ATOM   5698  C  CG    . LYS H 5  83   ? 149.962 139.073 191.967 1.00 83.83  ?  82   LYS H CG    1 
ATOM   5699  C  CD    . LYS H 5  83   ? 148.503 139.442 191.750 1.00 84.78  ?  82   LYS H CD    1 
ATOM   5700  C  CE    . LYS H 5  83   ? 148.220 139.748 190.287 1.00 86.27  ?  82   LYS H CE    1 
ATOM   5701  N  NZ    . LYS H 5  83   ? 146.793 140.110 190.064 1.00 87.06  ?  82   LYS H NZ    1 
ATOM   5702  N  N     . ARG H 5  84   ? 151.839 143.590 192.893 1.00 84.04  ?  83   ARG H N     1 
ATOM   5703  C  CA    . ARG H 5  84   ? 152.383 144.593 193.796 1.00 84.50  ?  83   ARG H CA    1 
ATOM   5704  C  C     . ARG H 5  84   ? 151.298 145.599 194.158 1.00 83.95  ?  83   ARG H C     1 
ATOM   5705  O  O     . ARG H 5  84   ? 150.599 146.112 193.277 1.00 84.21  ?  83   ARG H O     1 
ATOM   5706  C  CB    . ARG H 5  84   ? 153.575 145.304 193.153 1.00 85.03  ?  83   ARG H CB    1 
ATOM   5707  C  CG    . ARG H 5  84   ? 154.396 146.144 194.115 1.00 87.47  ?  83   ARG H CG    1 
ATOM   5708  C  CD    . ARG H 5  84   ? 155.145 145.274 195.110 1.00 91.33  ?  83   ARG H CD    1 
ATOM   5709  N  NE    . ARG H 5  84   ? 156.007 146.065 195.983 1.00 94.79  ?  83   ARG H NE    1 
ATOM   5710  C  CZ    . ARG H 5  84   ? 156.839 145.547 196.880 1.00 95.52  ?  83   ARG H CZ    1 
ATOM   5711  N  NH1   . ARG H 5  84   ? 156.926 144.232 197.025 1.00 95.89  ?  83   ARG H NH1   1 
ATOM   5712  N  NH2   . ARG H 5  84   ? 157.587 146.344 197.632 1.00 95.20  ?  83   ARG H NH2   1 
ATOM   5713  N  N     . SER H 5  85   ? 151.158 145.876 195.452 1.00 83.30  ?  84   SER H N     1 
ATOM   5714  C  CA    . SER H 5  85   ? 150.146 146.796 195.951 1.00 83.01  ?  84   SER H CA    1 
ATOM   5715  C  C     . SER H 5  85   ? 150.689 148.200 196.183 1.00 82.77  ?  84   SER H C     1 
ATOM   5716  O  O     . SER H 5  85   ? 150.041 148.998 196.868 1.00 82.76  ?  84   SER H O     1 
ATOM   5717  C  CB    . SER H 5  85   ? 149.532 146.253 197.243 1.00 83.03  ?  84   SER H CB    1 
ATOM   5718  O  OG    . SER H 5  85   ? 148.927 144.990 197.029 1.00 84.52  ?  84   SER H OG    1 
ATOM   5719  N  N     . THR H 5  86   ? 151.857 148.521 195.631 1.00 82.44  ?  85   THR H N     1 
ATOM   5720  C  CA    . THR H 5  86   ? 152.447 149.839 195.804 1.00 81.76  ?  85   THR H CA    1 
ATOM   5721  C  C     . THR H 5  86   ? 153.374 150.127 194.631 1.00 81.31  ?  85   THR H C     1 
ATOM   5722  O  O     . THR H 5  86   ? 153.671 149.252 193.815 1.00 81.32  ?  85   THR H O     1 
ATOM   5723  C  CB    . THR H 5  86   ? 153.207 149.949 197.131 1.00 81.74  ?  85   THR H CB    1 
ATOM   5724  O  OG1   . THR H 5  86   ? 153.763 151.263 197.259 1.00 82.68  ?  85   THR H OG1   1 
ATOM   5725  C  CG2   . THR H 5  86   ? 154.328 148.922 197.189 1.00 80.62  ?  85   THR H CG2   1 
ATOM   5726  N  N     . ILE H 5  87   ? 153.826 151.377 194.555 1.00 80.77  ?  86   ILE H N     1 
ATOM   5727  C  CA    . ILE H 5  87   ? 154.760 151.826 193.528 1.00 80.38  ?  86   ILE H CA    1 
ATOM   5728  C  C     . ILE H 5  87   ? 155.863 152.609 194.226 1.00 80.34  ?  86   ILE H C     1 
ATOM   5729  O  O     . ILE H 5  87   ? 155.611 153.685 194.781 1.00 80.57  ?  86   ILE H O     1 
ATOM   5730  C  CB    . ILE H 5  87   ? 154.081 152.684 192.452 1.00 80.55  ?  86   ILE H CB    1 
ATOM   5731  C  CG1   . ILE H 5  87   ? 153.075 151.851 191.655 1.00 80.75  ?  86   ILE H CG1   1 
ATOM   5732  C  CG2   . ILE H 5  87   ? 155.122 153.297 191.526 1.00 79.93  ?  86   ILE H CG2   1 
ATOM   5733  C  CD1   . ILE H 5  87   ? 152.402 152.613 190.535 1.00 79.96  ?  86   ILE H CD1   1 
ATOM   5734  N  N     . THR H 5  88   ? 157.083 152.073 194.200 1.00 79.80  ?  87   THR H N     1 
ATOM   5735  C  CA    . THR H 5  88   ? 158.219 152.735 194.829 1.00 79.08  ?  87   THR H CA    1 
ATOM   5736  C  C     . THR H 5  88   ? 159.111 153.386 193.779 1.00 78.23  ?  87   THR H C     1 
ATOM   5737  O  O     . THR H 5  88   ? 158.616 153.980 192.816 1.00 78.39  ?  87   THR H O     1 
ATOM   5738  C  CB    . THR H 5  88   ? 159.024 151.740 195.668 1.00 79.05  ?  87   THR H CB    1 
ATOM   5739  O  OG1   . THR H 5  88   ? 159.512 150.687 194.827 1.00 79.65  ?  87   THR H OG1   1 
ATOM   5740  C  CG2   . THR H 5  88   ? 158.152 151.143 196.764 1.00 80.07  ?  87   THR H CG2   1 
ATOM   5741  N  N     . SER H 5  89   ? 160.428 153.280 193.957 1.00 77.24  ?  88   SER H N     1 
ATOM   5742  C  CA    . SER H 5  89   ? 161.376 153.857 193.015 1.00 76.20  ?  88   SER H CA    1 
ATOM   5743  C  C     . SER H 5  89   ? 161.847 152.867 191.959 1.00 75.42  ?  88   SER H C     1 
ATOM   5744  O  O     . SER H 5  89   ? 162.246 153.291 190.867 1.00 75.18  ?  88   SER H O     1 
ATOM   5745  C  CB    . SER H 5  89   ? 162.593 154.414 193.761 1.00 76.23  ?  88   SER H CB    1 
ATOM   5746  O  OG    . SER H 5  89   ? 162.212 155.423 194.680 1.00 76.23  ?  88   SER H OG    1 
ATOM   5747  N  N     . ARG H 5  90   ? 161.812 151.565 192.254 1.00 74.64  ?  89   ARG H N     1 
ATOM   5748  C  CA    . ARG H 5  90   ? 162.257 150.578 191.277 1.00 74.22  ?  89   ARG H CA    1 
ATOM   5749  C  C     . ARG H 5  90   ? 161.298 150.477 190.098 1.00 73.98  ?  89   ARG H C     1 
ATOM   5750  O  O     . ARG H 5  90   ? 161.738 150.255 188.964 1.00 74.13  ?  89   ARG H O     1 
ATOM   5751  C  CB    . ARG H 5  90   ? 162.428 149.213 191.946 1.00 74.22  ?  89   ARG H CB    1 
ATOM   5752  C  CG    . ARG H 5  90   ? 161.203 148.725 192.705 1.00 75.40  ?  89   ARG H CG    1 
ATOM   5753  C  CD    . ARG H 5  90   ? 161.407 147.325 193.270 1.00 77.65  ?  89   ARG H CD    1 
ATOM   5754  N  NE    . ARG H 5  90   ? 162.492 147.268 194.246 1.00 79.97  ?  89   ARG H NE    1 
ATOM   5755  C  CZ    . ARG H 5  90   ? 163.712 146.808 193.985 1.00 81.54  ?  89   ARG H CZ    1 
ATOM   5756  N  NH1   . ARG H 5  90   ? 164.009 146.360 192.772 1.00 83.35  ?  89   ARG H NH1   1 
ATOM   5757  N  NH2   . ARG H 5  90   ? 164.636 146.796 194.936 1.00 81.76  ?  89   ARG H NH2   1 
ATOM   5758  N  N     . GLU H 5  91   ? 159.994 150.638 190.339 1.00 73.34  ?  90   GLU H N     1 
ATOM   5759  C  CA    . GLU H 5  91   ? 159.029 150.588 189.245 1.00 72.28  ?  90   GLU H CA    1 
ATOM   5760  C  C     . GLU H 5  91   ? 159.222 151.758 188.288 1.00 71.02  ?  90   GLU H C     1 
ATOM   5761  O  O     . GLU H 5  91   ? 159.166 151.583 187.065 1.00 71.03  ?  90   GLU H O     1 
ATOM   5762  C  CB    . GLU H 5  91   ? 157.602 150.575 189.797 1.00 72.56  ?  90   GLU H CB    1 
ATOM   5763  C  CG    . GLU H 5  91   ? 157.224 149.309 190.556 1.00 74.37  ?  90   GLU H CG    1 
ATOM   5764  C  CD    . GLU H 5  91   ? 157.778 149.278 191.968 1.00 76.66  ?  90   GLU H CD    1 
ATOM   5765  O  OE1   . GLU H 5  91   ? 158.289 150.319 192.432 1.00 76.73  ?  90   GLU H OE1   1 
ATOM   5766  O  OE2   . GLU H 5  91   ? 157.701 148.212 192.614 1.00 76.38  ?  90   GLU H OE2   1 
ATOM   5767  N  N     . ILE H 5  92   ? 159.448 152.958 188.826 1.00 69.28  ?  91   ILE H N     1 
ATOM   5768  C  CA    . ILE H 5  92   ? 159.736 154.104 187.971 1.00 68.05  ?  91   ILE H CA    1 
ATOM   5769  C  C     . ILE H 5  92   ? 161.094 153.939 187.303 1.00 67.63  ?  91   ILE H C     1 
ATOM   5770  O  O     . ILE H 5  92   ? 161.304 154.411 186.179 1.00 67.09  ?  91   ILE H O     1 
ATOM   5771  C  CB    . ILE H 5  92   ? 159.656 155.410 188.783 1.00 68.26  ?  91   ILE H CB    1 
ATOM   5772  C  CG1   . ILE H 5  92   ? 158.343 155.472 189.566 1.00 67.84  ?  91   ILE H CG1   1 
ATOM   5773  C  CG2   . ILE H 5  92   ? 159.777 156.620 187.868 1.00 66.39  ?  91   ILE H CG2   1 
ATOM   5774  C  CD1   . ILE H 5  92   ? 157.108 155.469 188.692 1.00 66.55  ?  91   ILE H CD1   1 
ATOM   5775  N  N     . GLN H 5  93   ? 162.033 153.261 187.968 1.00 67.64  ?  92   GLN H N     1 
ATOM   5776  C  CA    . GLN H 5  93   ? 163.348 153.036 187.377 1.00 67.84  ?  92   GLN H CA    1 
ATOM   5777  C  C     . GLN H 5  93   ? 163.254 152.138 186.150 1.00 67.15  ?  92   GLN H C     1 
ATOM   5778  O  O     . GLN H 5  93   ? 163.772 152.477 185.079 1.00 67.89  ?  92   GLN H O     1 
ATOM   5779  C  CB    . GLN H 5  93   ? 164.293 152.433 188.417 1.00 68.54  ?  92   GLN H CB    1 
ATOM   5780  C  CG    . GLN H 5  93   ? 165.682 152.120 187.884 1.00 68.48  ?  92   GLN H CG    1 
ATOM   5781  C  CD    . GLN H 5  93   ? 166.581 151.494 188.933 1.00 69.51  ?  92   GLN H CD    1 
ATOM   5782  O  OE1   . GLN H 5  93   ? 166.177 151.306 190.080 1.00 71.28  ?  92   GLN H OE1   1 
ATOM   5783  N  NE2   . GLN H 5  93   ? 167.808 151.169 188.543 1.00 69.75  ?  92   GLN H NE2   1 
ATOM   5784  N  N     . THR H 5  94   ? 162.595 150.984 186.285 1.00 66.09  ?  93   THR H N     1 
ATOM   5785  C  CA    . THR H 5  94   ? 162.465 150.081 185.147 1.00 65.32  ?  93   THR H CA    1 
ATOM   5786  C  C     . THR H 5  94   ? 161.516 150.636 184.092 1.00 64.79  ?  93   THR H C     1 
ATOM   5787  O  O     . THR H 5  94   ? 161.673 150.337 182.903 1.00 63.93  ?  93   THR H O     1 
ATOM   5788  C  CB    . THR H 5  94   ? 161.998 148.700 185.613 1.00 65.31  ?  93   THR H CB    1 
ATOM   5789  O  OG1   . THR H 5  94   ? 161.852 147.835 184.479 1.00 65.22  ?  93   THR H OG1   1 
ATOM   5790  C  CG2   . THR H 5  94   ? 160.670 148.797 186.340 1.00 64.26  ?  93   THR H CG2   1 
ATOM   5791  N  N     . ALA H 5  95   ? 160.533 151.444 184.500 1.00 64.68  ?  94   ALA H N     1 
ATOM   5792  C  CA    . ALA H 5  95   ? 159.665 152.092 183.522 1.00 64.69  ?  94   ALA H CA    1 
ATOM   5793  C  C     . ALA H 5  95   ? 160.441 153.110 182.695 1.00 64.69  ?  94   ALA H C     1 
ATOM   5794  O  O     . ALA H 5  95   ? 160.219 153.236 181.485 1.00 64.99  ?  94   ALA H O     1 
ATOM   5795  C  CB    . ALA H 5  95   ? 158.481 152.755 184.224 1.00 64.36  ?  94   ALA H CB    1 
ATOM   5796  N  N     . VAL H 5  96   ? 161.356 153.841 183.334 1.00 65.12  ?  95   VAL H N     1 
ATOM   5797  C  CA    . VAL H 5  96   ? 162.219 154.761 182.601 1.00 65.86  ?  95   VAL H CA    1 
ATOM   5798  C  C     . VAL H 5  96   ? 163.172 153.990 181.696 1.00 66.75  ?  95   VAL H C     1 
ATOM   5799  O  O     . VAL H 5  96   ? 163.389 154.365 180.537 1.00 66.89  ?  95   VAL H O     1 
ATOM   5800  C  CB    . VAL H 5  96   ? 162.975 155.674 183.584 1.00 65.57  ?  95   VAL H CB    1 
ATOM   5801  C  CG1   . VAL H 5  96   ? 164.186 156.299 182.914 1.00 65.72  ?  95   VAL H CG1   1 
ATOM   5802  C  CG2   . VAL H 5  96   ? 162.048 156.754 184.118 1.00 66.22  ?  95   VAL H CG2   1 
ATOM   5803  N  N     . ARG H 5  97   ? 163.746 152.895 182.201 1.00 67.30  ?  96   ARG H N     1 
ATOM   5804  C  CA    . ARG H 5  97   ? 164.644 152.083 181.387 1.00 68.08  ?  96   ARG H CA    1 
ATOM   5805  C  C     . ARG H 5  97   ? 163.924 151.399 180.232 1.00 67.38  ?  96   ARG H C     1 
ATOM   5806  O  O     . ARG H 5  97   ? 164.578 150.998 179.263 1.00 67.24  ?  96   ARG H O     1 
ATOM   5807  C  CB    . ARG H 5  97   ? 165.347 151.037 182.255 1.00 69.23  ?  96   ARG H CB    1 
ATOM   5808  C  CG    . ARG H 5  97   ? 166.376 151.617 183.212 1.00 72.62  ?  96   ARG H CG    1 
ATOM   5809  C  CD    . ARG H 5  97   ? 167.161 150.519 183.913 1.00 77.71  ?  96   ARG H CD    1 
ATOM   5810  N  NE    . ARG H 5  97   ? 168.228 151.063 184.748 1.00 81.53  ?  96   ARG H NE    1 
ATOM   5811  C  CZ    . ARG H 5  97   ? 169.081 150.324 185.449 1.00 83.86  ?  96   ARG H CZ    1 
ATOM   5812  N  NH1   . ARG H 5  97   ? 168.996 149.001 185.419 1.00 84.28  ?  96   ARG H NH1   1 
ATOM   5813  N  NH2   . ARG H 5  97   ? 170.020 150.907 186.181 1.00 84.45  ?  96   ARG H NH2   1 
ATOM   5814  N  N     . LEU H 5  98   ? 162.601 151.255 180.310 1.00 66.73  ?  97   LEU H N     1 
ATOM   5815  C  CA    . LEU H 5  98   ? 161.834 150.668 179.218 1.00 65.38  ?  97   LEU H CA    1 
ATOM   5816  C  C     . LEU H 5  98   ? 161.377 151.710 178.204 1.00 65.51  ?  97   LEU H C     1 
ATOM   5817  O  O     . LEU H 5  98   ? 161.499 151.488 176.994 1.00 65.19  ?  97   LEU H O     1 
ATOM   5818  C  CB    . LEU H 5  98   ? 160.622 149.913 179.769 1.00 64.37  ?  97   LEU H CB    1 
ATOM   5819  C  CG    . LEU H 5  98   ? 160.904 148.518 180.330 1.00 63.70  ?  97   LEU H CG    1 
ATOM   5820  C  CD1   . LEU H 5  98   ? 159.641 147.902 180.909 1.00 62.65  ?  97   LEU H CD1   1 
ATOM   5821  C  CD2   . LEU H 5  98   ? 161.494 147.626 179.249 1.00 59.97  ?  97   LEU H CD2   1 
ATOM   5822  N  N     . LEU H 5  99   ? 160.849 152.844 178.671 1.00 65.63  ?  98   LEU H N     1 
ATOM   5823  C  CA    . LEU H 5  99   ? 160.395 153.877 177.745 1.00 66.71  ?  98   LEU H CA    1 
ATOM   5824  C  C     . LEU H 5  99   ? 161.562 154.557 177.039 1.00 67.21  ?  98   LEU H C     1 
ATOM   5825  O  O     . LEU H 5  99   ? 161.388 155.103 175.944 1.00 67.36  ?  98   LEU H O     1 
ATOM   5826  C  CB    . LEU H 5  99   ? 159.545 154.910 178.484 1.00 66.96  ?  98   LEU H CB    1 
ATOM   5827  C  CG    . LEU H 5  99   ? 158.178 154.430 178.977 1.00 68.09  ?  98   LEU H CG    1 
ATOM   5828  C  CD1   . LEU H 5  99   ? 157.457 155.535 179.729 1.00 67.91  ?  98   LEU H CD1   1 
ATOM   5829  C  CD2   . LEU H 5  99   ? 157.334 153.938 177.812 1.00 67.29  ?  98   LEU H CD2   1 
ATOM   5830  N  N     . LEU H 5  100  ? 162.784 154.409 177.542 1.00 68.48  ?  99   LEU H N     1 
ATOM   5831  C  CA    . LEU H 5  100  ? 163.947 155.013 176.871 1.00 68.89  ?  99   LEU H CA    1 
ATOM   5832  C  C     . LEU H 5  100  ? 165.000 153.957 176.459 1.00 69.43  ?  99   LEU H C     1 
ATOM   5833  O  O     . LEU H 5  100  ? 165.295 153.051 177.234 1.00 69.71  ?  99   LEU H O     1 
ATOM   5834  C  CB    . LEU H 5  100  ? 164.547 156.117 177.736 1.00 68.84  ?  99   LEU H CB    1 
ATOM   5835  C  CG    . LEU H 5  100  ? 163.474 157.000 178.377 1.00 69.85  ?  99   LEU H CG    1 
ATOM   5836  C  CD1   . LEU H 5  100  ? 164.020 158.393 178.643 1.00 70.48  ?  99   LEU H CD1   1 
ATOM   5837  C  CD2   . LEU H 5  100  ? 162.237 157.081 177.496 1.00 72.05  ?  99   LEU H CD2   1 
ATOM   5838  N  N     . PRO H 5  101  ? 165.459 154.037 175.203 1.00 70.00  ?  100  PRO H N     1 
ATOM   5839  C  CA    . PRO H 5  101  ? 166.364 153.035 174.634 1.00 70.57  ?  100  PRO H CA    1 
ATOM   5840  C  C     . PRO H 5  101  ? 167.694 152.885 175.346 1.00 71.55  ?  100  PRO H C     1 
ATOM   5841  O  O     . PRO H 5  101  ? 168.120 151.750 175.542 1.00 71.78  ?  100  PRO H O     1 
ATOM   5842  C  CB    . PRO H 5  101  ? 166.586 153.533 173.197 1.00 70.25  ?  100  PRO H CB    1 
ATOM   5843  C  CG    . PRO H 5  101  ? 166.127 154.953 173.185 1.00 70.45  ?  100  PRO H CG    1 
ATOM   5844  C  CD    . PRO H 5  101  ? 165.040 155.035 174.209 1.00 70.23  ?  100  PRO H CD    1 
ATOM   5845  N  N     . GLY H 5  102  ? 168.351 153.972 175.721 1.00 72.20  ?  101  GLY H N     1 
ATOM   5846  C  CA    . GLY H 5  102  ? 169.611 153.807 176.411 1.00 72.60  ?  101  GLY H CA    1 
ATOM   5847  C  C     . GLY H 5  102  ? 170.143 154.979 177.193 1.00 72.54  ?  101  GLY H C     1 
ATOM   5848  O  O     . GLY H 5  102  ? 170.007 155.076 178.412 1.00 72.57  ?  101  GLY H O     1 
ATOM   5849  N  N     . GLU H 5  103  ? 170.753 155.883 176.446 1.00 72.64  ?  102  GLU H N     1 
ATOM   5850  C  CA    . GLU H 5  103  ? 171.416 157.060 177.001 1.00 73.31  ?  102  GLU H CA    1 
ATOM   5851  C  C     . GLU H 5  103  ? 170.506 157.801 177.973 1.00 72.94  ?  102  GLU H C     1 
ATOM   5852  O  O     . GLU H 5  103  ? 170.890 158.073 179.117 1.00 72.65  ?  102  GLU H O     1 
ATOM   5853  C  CB    . GLU H 5  103  ? 171.867 157.991 175.875 1.00 73.80  ?  102  GLU H CB    1 
ATOM   5854  C  CG    . GLU H 5  103  ? 172.514 159.274 176.371 1.00 76.30  ?  102  GLU H CG    1 
ATOM   5855  C  CD    . GLU H 5  103  ? 172.925 160.200 175.244 1.00 78.97  ?  102  GLU H CD    1 
ATOM   5856  O  OE1   . GLU H 5  103  ? 172.676 159.859 174.068 1.00 78.83  ?  102  GLU H OE1   1 
ATOM   5857  O  OE2   . GLU H 5  103  ? 173.499 161.270 175.535 1.00 82.17  ?  102  GLU H OE2   1 
ATOM   5858  N  N     . LEU H 5  104  ? 169.294 158.146 177.529 1.00 72.95  ?  103  LEU H N     1 
ATOM   5859  C  CA    . LEU H 5  104  ? 168.355 158.839 178.405 1.00 72.48  ?  103  LEU H CA    1 
ATOM   5860  C  C     . LEU H 5  104  ? 167.973 157.981 179.604 1.00 72.56  ?  103  LEU H C     1 
ATOM   5861  O  O     . LEU H 5  104  ? 167.697 158.512 180.686 1.00 72.54  ?  103  LEU H O     1 
ATOM   5862  C  CB    . LEU H 5  104  ? 167.105 159.249 177.624 1.00 72.34  ?  103  LEU H CB    1 
ATOM   5863  C  CG    . LEU H 5  104  ? 167.165 160.519 176.769 1.00 72.65  ?  103  LEU H CG    1 
ATOM   5864  C  CD1   . LEU H 5  104  ? 168.033 160.332 175.530 1.00 70.40  ?  103  LEU H CD1   1 
ATOM   5865  C  CD2   . LEU H 5  104  ? 165.761 160.961 176.381 1.00 72.34  ?  103  LEU H CD2   1 
ATOM   5866  N  N     . ALA H 5  105  ? 167.955 156.658 179.433 1.00 72.31  ?  104  ALA H N     1 
ATOM   5867  C  CA    . ALA H 5  105  ? 167.681 155.772 180.558 1.00 72.06  ?  104  ALA H CA    1 
ATOM   5868  C  C     . ALA H 5  105  ? 168.853 155.738 181.530 1.00 72.40  ?  104  ALA H C     1 
ATOM   5869  O  O     . ALA H 5  105  ? 168.653 155.726 182.750 1.00 72.27  ?  104  ALA H O     1 
ATOM   5870  C  CB    . ALA H 5  105  ? 167.359 154.366 180.053 1.00 71.96  ?  104  ALA H CB    1 
ATOM   5871  N  N     . LYS H 5  106  ? 170.082 155.726 181.011 1.00 72.71  ?  105  LYS H N     1 
ATOM   5872  C  CA    . LYS H 5  106  ? 171.256 155.699 181.878 1.00 72.92  ?  105  LYS H CA    1 
ATOM   5873  C  C     . LYS H 5  106  ? 171.377 156.991 182.677 1.00 72.44  ?  105  LYS H C     1 
ATOM   5874  O  O     . LYS H 5  106  ? 171.491 156.968 183.909 1.00 72.00  ?  105  LYS H O     1 
ATOM   5875  C  CB    . LYS H 5  106  ? 172.515 155.456 181.044 1.00 73.08  ?  105  LYS H CB    1 
ATOM   5876  C  CG    . LYS H 5  106  ? 173.805 155.469 181.848 1.00 75.21  ?  105  LYS H CG    1 
ATOM   5877  C  CD    . LYS H 5  106  ? 175.015 155.265 180.952 1.00 77.93  ?  105  LYS H CD    1 
ATOM   5878  C  CE    . LYS H 5  106  ? 175.122 156.367 179.912 1.00 79.84  ?  105  LYS H CE    1 
ATOM   5879  N  NZ    . LYS H 5  106  ? 176.276 156.153 178.997 1.00 81.73  ?  105  LYS H NZ    1 
ATOM   5880  N  N     . HIS H 5  107  ? 171.355 158.135 181.988 1.00 72.59  ?  106  HIS H N     1 
ATOM   5881  C  CA    . HIS H 5  107  ? 171.462 159.415 182.682 1.00 73.74  ?  106  HIS H CA    1 
ATOM   5882  C  C     . HIS H 5  107  ? 170.245 159.685 183.557 1.00 73.60  ?  106  HIS H C     1 
ATOM   5883  O  O     . HIS H 5  107  ? 170.366 160.343 184.597 1.00 73.35  ?  106  HIS H O     1 
ATOM   5884  C  CB    . HIS H 5  107  ? 171.652 160.548 181.673 1.00 74.24  ?  106  HIS H CB    1 
ATOM   5885  C  CG    . HIS H 5  107  ? 172.937 160.469 180.909 1.00 76.85  ?  106  HIS H CG    1 
ATOM   5886  N  ND1   . HIS H 5  107  ? 173.249 161.340 179.887 1.00 79.22  ?  106  HIS H ND1   1 
ATOM   5887  C  CD2   . HIS H 5  107  ? 173.990 159.625 181.018 1.00 78.05  ?  106  HIS H CD2   1 
ATOM   5888  C  CE1   . HIS H 5  107  ? 174.438 161.035 179.399 1.00 80.53  ?  106  HIS H CE1   1 
ATOM   5889  N  NE2   . HIS H 5  107  ? 174.909 159.998 180.068 1.00 80.75  ?  106  HIS H NE2   1 
ATOM   5890  N  N     . ALA H 5  108  ? 169.071 159.189 183.159 1.00 73.97  ?  107  ALA H N     1 
ATOM   5891  C  CA    . ALA H 5  108  ? 167.879 159.372 183.980 1.00 73.62  ?  107  ALA H CA    1 
ATOM   5892  C  C     . ALA H 5  108  ? 167.946 158.525 185.245 1.00 73.73  ?  107  ALA H C     1 
ATOM   5893  O  O     . ALA H 5  108  ? 167.447 158.935 186.299 1.00 73.11  ?  107  ALA H O     1 
ATOM   5894  C  CB    . ALA H 5  108  ? 166.627 159.039 183.171 1.00 73.54  ?  107  ALA H CB    1 
ATOM   5895  N  N     . VAL H 5  109  ? 168.551 157.339 185.159 1.00 73.92  ?  108  VAL H N     1 
ATOM   5896  C  CA    . VAL H 5  109  ? 168.738 156.516 186.350 1.00 74.44  ?  108  VAL H CA    1 
ATOM   5897  C  C     . VAL H 5  109  ? 169.792 157.133 187.261 1.00 75.32  ?  108  VAL H C     1 
ATOM   5898  O  O     . VAL H 5  109  ? 169.640 157.144 188.489 1.00 75.24  ?  108  VAL H O     1 
ATOM   5899  C  CB    . VAL H 5  109  ? 169.097 155.072 185.952 1.00 74.52  ?  108  VAL H CB    1 
ATOM   5900  C  CG1   . VAL H 5  109  ? 169.713 154.326 187.126 1.00 72.80  ?  108  VAL H CG1   1 
ATOM   5901  C  CG2   . VAL H 5  109  ? 167.861 154.337 185.456 1.00 74.64  ?  108  VAL H CG2   1 
ATOM   5902  N  N     . SER H 5  110  ? 170.868 157.666 186.678 1.00 76.43  ?  109  SER H N     1 
ATOM   5903  C  CA    . SER H 5  110  ? 171.911 158.297 187.482 1.00 77.67  ?  109  SER H CA    1 
ATOM   5904  C  C     . SER H 5  110  ? 171.375 159.522 188.214 1.00 77.79  ?  109  SER H C     1 
ATOM   5905  O  O     . SER H 5  110  ? 171.517 159.642 189.438 1.00 77.73  ?  109  SER H O     1 
ATOM   5906  C  CB    . SER H 5  110  ? 173.098 158.677 186.596 1.00 77.93  ?  109  SER H CB    1 
ATOM   5907  O  OG    . SER H 5  110  ? 173.680 157.532 185.999 1.00 80.18  ?  109  SER H OG    1 
ATOM   5908  N  N     . GLU H 5  111  ? 170.753 160.446 187.478 1.00 78.54  ?  110  GLU H N     1 
ATOM   5909  C  CA    . GLU H 5  111  ? 170.220 161.652 188.103 1.00 79.62  ?  110  GLU H CA    1 
ATOM   5910  C  C     . GLU H 5  111  ? 169.071 161.324 189.049 1.00 80.02  ?  110  GLU H C     1 
ATOM   5911  O  O     . GLU H 5  111  ? 168.910 161.975 190.089 1.00 80.46  ?  110  GLU H O     1 
ATOM   5912  C  CB    . GLU H 5  111  ? 169.769 162.641 187.027 1.00 79.93  ?  110  GLU H CB    1 
ATOM   5913  C  CG    . GLU H 5  111  ? 169.209 163.946 187.568 1.00 82.02  ?  110  GLU H CG    1 
ATOM   5914  C  CD    . GLU H 5  111  ? 170.259 164.798 188.253 1.00 85.60  ?  110  GLU H CD    1 
ATOM   5915  O  OE1   . GLU H 5  111  ? 171.459 164.635 187.943 1.00 86.40  ?  110  GLU H OE1   1 
ATOM   5916  O  OE2   . GLU H 5  111  ? 169.884 165.633 189.103 1.00 88.02  ?  110  GLU H OE2   1 
ATOM   5917  N  N     . GLY H 5  112  ? 168.267 160.316 188.709 1.00 79.76  ?  111  GLY H N     1 
ATOM   5918  C  CA    . GLY H 5  112  ? 167.164 159.940 189.579 1.00 79.60  ?  111  GLY H CA    1 
ATOM   5919  C  C     . GLY H 5  112  ? 167.638 159.380 190.907 1.00 79.88  ?  111  GLY H C     1 
ATOM   5920  O  O     . GLY H 5  112  ? 167.174 159.797 191.972 1.00 79.73  ?  111  GLY H O     1 
ATOM   5921  N  N     . THR H 5  113  ? 168.572 158.426 190.862 1.00 79.94  ?  112  THR H N     1 
ATOM   5922  C  CA    . THR H 5  113  ? 169.122 157.876 192.096 1.00 79.98  ?  112  THR H CA    1 
ATOM   5923  C  C     . THR H 5  113  ? 169.909 158.922 192.872 1.00 80.57  ?  112  THR H C     1 
ATOM   5924  O  O     . THR H 5  113  ? 169.961 158.869 194.106 1.00 80.57  ?  112  THR H O     1 
ATOM   5925  C  CB    . THR H 5  113  ? 170.007 156.666 191.790 1.00 79.78  ?  112  THR H CB    1 
ATOM   5926  O  OG1   . THR H 5  113  ? 170.987 157.023 190.808 1.00 79.30  ?  112  THR H OG1   1 
ATOM   5927  C  CG2   . THR H 5  113  ? 169.167 155.508 191.272 1.00 79.64  ?  112  THR H CG2   1 
ATOM   5928  N  N     . LYS H 5  114  ? 170.529 159.877 192.173 1.00 81.00  ?  113  LYS H N     1 
ATOM   5929  C  CA    . LYS H 5  114  ? 171.217 160.962 192.866 1.00 81.69  ?  113  LYS H CA    1 
ATOM   5930  C  C     . LYS H 5  114  ? 170.226 161.867 193.588 1.00 81.97  ?  113  LYS H C     1 
ATOM   5931  O  O     . LYS H 5  114  ? 170.512 162.361 194.686 1.00 82.05  ?  113  LYS H O     1 
ATOM   5932  C  CB    . LYS H 5  114  ? 172.060 161.767 191.877 1.00 81.73  ?  113  LYS H CB    1 
ATOM   5933  C  CG    . LYS H 5  114  ? 172.863 162.890 192.515 1.00 82.31  ?  113  LYS H CG    1 
ATOM   5934  C  CD    . LYS H 5  114  ? 173.690 163.638 191.483 1.00 82.16  ?  113  LYS H CD    1 
ATOM   5935  C  CE    . LYS H 5  114  ? 174.502 164.751 192.128 1.00 83.32  ?  113  LYS H CE    1 
ATOM   5936  N  NZ    . LYS H 5  114  ? 175.330 165.489 191.135 1.00 85.15  ?  113  LYS H NZ    1 
ATOM   5937  N  N     . ALA H 5  115  ? 169.052 162.090 192.991 1.00 82.74  ?  114  ALA H N     1 
ATOM   5938  C  CA    . ALA H 5  115  ? 168.039 162.919 193.636 1.00 83.55  ?  114  ALA H CA    1 
ATOM   5939  C  C     . ALA H 5  115  ? 167.401 162.196 194.816 1.00 84.04  ?  114  ALA H C     1 
ATOM   5940  O  O     . ALA H 5  115  ? 167.147 162.806 195.862 1.00 83.97  ?  114  ALA H O     1 
ATOM   5941  C  CB    . ALA H 5  115  ? 166.975 163.333 192.620 1.00 83.56  ?  114  ALA H CB    1 
ATOM   5942  N  N     . VAL H 5  116  ? 167.133 160.896 194.666 1.00 84.52  ?  115  VAL H N     1 
ATOM   5943  C  CA    . VAL H 5  116  ? 166.564 160.125 195.767 1.00 85.02  ?  115  VAL H CA    1 
ATOM   5944  C  C     . VAL H 5  116  ? 167.561 160.018 196.914 1.00 85.13  ?  115  VAL H C     1 
ATOM   5945  O  O     . VAL H 5  116  ? 167.185 160.088 198.090 1.00 85.36  ?  115  VAL H O     1 
ATOM   5946  C  CB    . VAL H 5  116  ? 166.114 158.739 195.269 1.00 85.14  ?  115  VAL H CB    1 
ATOM   5947  C  CG1   . VAL H 5  116  ? 165.626 157.883 196.428 1.00 85.17  ?  115  VAL H CG1   1 
ATOM   5948  C  CG2   . VAL H 5  116  ? 165.024 158.884 194.219 1.00 85.76  ?  115  VAL H CG2   1 
ATOM   5949  N  N     . THR H 5  117  ? 168.847 159.854 196.594 1.00 85.29  ?  116  THR H N     1 
ATOM   5950  C  CA    . THR H 5  117  ? 169.867 159.815 197.637 1.00 85.25  ?  116  THR H CA    1 
ATOM   5951  C  C     . THR H 5  117  ? 170.020 161.176 198.306 1.00 85.13  ?  116  THR H C     1 
ATOM   5952  O  O     . THR H 5  117  ? 170.228 161.256 199.523 1.00 84.96  ?  116  THR H O     1 
ATOM   5953  C  CB    . THR H 5  117  ? 171.203 159.352 197.052 1.00 85.15  ?  116  THR H CB    1 
ATOM   5954  O  OG1   . THR H 5  117  ? 171.025 158.096 196.385 1.00 85.51  ?  116  THR H OG1   1 
ATOM   5955  C  CG2   . THR H 5  117  ? 172.242 159.189 198.153 1.00 86.05  ?  116  THR H CG2   1 
ATOM   5956  N  N     . LYS H 5  118  ? 169.914 162.256 197.528 1.00 85.35  ?  117  LYS H N     1 
ATOM   5957  C  CA    . LYS H 5  118  ? 170.001 163.593 198.107 1.00 85.70  ?  117  LYS H CA    1 
ATOM   5958  C  C     . LYS H 5  118  ? 168.829 163.867 199.042 1.00 86.25  ?  117  LYS H C     1 
ATOM   5959  O  O     . LYS H 5  118  ? 169.006 164.469 200.107 1.00 86.34  ?  117  LYS H O     1 
ATOM   5960  C  CB    . LYS H 5  118  ? 170.060 164.642 196.997 1.00 85.50  ?  117  LYS H CB    1 
ATOM   5961  C  CG    . LYS H 5  118  ? 170.247 166.065 197.498 1.00 85.26  ?  117  LYS H CG    1 
ATOM   5962  C  CD    . LYS H 5  118  ? 171.537 166.205 198.289 1.00 87.59  ?  117  LYS H CD    1 
ATOM   5963  C  CE    . LYS H 5  118  ? 171.731 167.631 198.777 1.00 89.43  ?  117  LYS H CE    1 
ATOM   5964  N  NZ    . LYS H 5  118  ? 170.600 168.074 199.637 1.00 90.47  ?  117  LYS H NZ    1 
ATOM   5965  N  N     . TYR H 5  119  ? 167.627 163.429 198.665 1.00 87.28  ?  118  TYR H N     1 
ATOM   5966  C  CA    . TYR H 5  119  ? 166.461 163.645 199.513 1.00 88.20  ?  118  TYR H CA    1 
ATOM   5967  C  C     . TYR H 5  119  ? 166.465 162.739 200.737 1.00 88.92  ?  118  TYR H C     1 
ATOM   5968  O  O     . TYR H 5  119  ? 166.002 163.149 201.807 1.00 88.92  ?  118  TYR H O     1 
ATOM   5969  C  CB    . TYR H 5  119  ? 165.178 163.431 198.709 1.00 88.06  ?  118  TYR H CB    1 
ATOM   5970  C  CG    . TYR H 5  119  ? 163.913 163.527 199.531 1.00 87.92  ?  118  TYR H CG    1 
ATOM   5971  C  CD1   . TYR H 5  119  ? 163.378 164.762 199.873 1.00 87.32  ?  118  TYR H CD1   1 
ATOM   5972  C  CD2   . TYR H 5  119  ? 163.250 162.384 199.959 1.00 87.09  ?  118  TYR H CD2   1 
ATOM   5973  C  CE1   . TYR H 5  119  ? 162.222 164.856 200.621 1.00 87.07  ?  118  TYR H CE1   1 
ATOM   5974  C  CE2   . TYR H 5  119  ? 162.094 162.468 200.708 1.00 86.67  ?  118  TYR H CE2   1 
ATOM   5975  C  CZ    . TYR H 5  119  ? 161.584 163.707 201.036 1.00 87.27  ?  118  TYR H CZ    1 
ATOM   5976  O  OH    . TYR H 5  119  ? 160.432 163.798 201.781 1.00 88.33  ?  118  TYR H OH    1 
ATOM   5977  N  N     . THR H 5  120  ? 166.975 161.514 200.602 1.00 89.95  ?  119  THR H N     1 
ATOM   5978  C  CA    . THR H 5  120  ? 166.997 160.599 201.738 1.00 91.21  ?  119  THR H CA    1 
ATOM   5979  C  C     . THR H 5  120  ? 168.075 160.993 202.740 1.00 92.30  ?  119  THR H C     1 
ATOM   5980  O  O     . THR H 5  120  ? 167.855 160.926 203.956 1.00 92.31  ?  119  THR H O     1 
ATOM   5981  C  CB    . THR H 5  120  ? 167.213 159.164 201.257 1.00 91.05  ?  119  THR H CB    1 
ATOM   5982  O  OG1   . THR H 5  120  ? 166.196 158.818 200.308 1.00 90.81  ?  119  THR H OG1   1 
ATOM   5983  C  CG2   . THR H 5  120  ? 167.153 158.194 202.428 1.00 91.24  ?  119  THR H CG2   1 
ATOM   5984  N  N     . SER H 5  121  ? 169.245 161.409 202.251 1.00 93.45  ?  120  SER H N     1 
ATOM   5985  C  CA    . SER H 5  121  ? 170.329 161.796 203.143 1.00 94.34  ?  120  SER H CA    1 
ATOM   5986  C  C     . SER H 5  121  ? 170.025 163.079 203.906 1.00 94.84  ?  120  SER H C     1 
ATOM   5987  O  O     . SER H 5  121  ? 170.582 163.288 204.988 1.00 95.01  ?  120  SER H O     1 
ATOM   5988  C  CB    . SER H 5  121  ? 171.627 161.958 202.351 1.00 94.31  ?  120  SER H CB    1 
ATOM   5989  O  OG    . SER H 5  121  ? 171.492 162.956 201.354 1.00 94.62  ?  120  SER H OG    1 
ATOM   5990  N  N     . ALA H 5  122  ? 169.160 163.935 203.372 1.00 95.16  ?  121  ALA H N     1 
ATOM   5991  C  CA    . ALA H 5  122  ? 168.812 165.186 204.036 1.00 95.44  ?  121  ALA H CA    1 
ATOM   5992  C  C     . ALA H 5  122  ? 167.453 165.083 204.719 1.00 95.39  ?  121  ALA H C     1 
ATOM   5993  O  O     . ALA H 5  122  ? 166.787 164.050 204.648 1.00 95.43  ?  121  ALA H O     1 
ATOM   5994  C  CB    . ALA H 5  122  ? 168.819 166.334 203.038 1.00 95.50  ?  121  ALA H CB    1 
ATOM   5995  O  "O5'" . DA  I 6  1    ? 141.381 118.695 118.711 1.00 164.04 ?  -72  DA  I "O5'" 1 
ATOM   5996  C  "C5'" . DA  I 6  1    ? 141.130 117.916 119.875 1.00 164.81 ?  -72  DA  I "C5'" 1 
ATOM   5997  C  "C4'" . DA  I 6  1    ? 141.999 116.671 119.888 1.00 165.30 ?  -72  DA  I "C4'" 1 
ATOM   5998  O  "O4'" . DA  I 6  1    ? 143.394 117.053 119.753 1.00 165.00 ?  -72  DA  I "O4'" 1 
ATOM   5999  C  "C3'" . DA  I 6  1    ? 141.910 115.838 121.165 1.00 165.88 ?  -72  DA  I "C3'" 1 
ATOM   6000  O  "O3'" . DA  I 6  1    ? 141.968 114.451 120.854 1.00 167.29 ?  -72  DA  I "O3'" 1 
ATOM   6001  C  "C2'" . DA  I 6  1    ? 143.134 116.286 121.954 1.00 165.26 ?  -72  DA  I "C2'" 1 
ATOM   6002  C  "C1'" . DA  I 6  1    ? 144.138 116.548 120.841 1.00 164.45 ?  -72  DA  I "C1'" 1 
ATOM   6003  N  N9    . DA  I 6  1    ? 145.157 117.531 121.201 1.00 164.19 ?  -72  DA  I N9    1 
ATOM   6004  C  C8    . DA  I 6  1    ? 144.960 118.852 121.495 1.00 163.93 ?  -72  DA  I C8    1 
ATOM   6005  N  N7    . DA  I 6  1    ? 146.062 119.499 121.789 1.00 163.75 ?  -72  DA  I N7    1 
ATOM   6006  C  C5    . DA  I 6  1    ? 147.052 118.537 121.680 1.00 163.94 ?  -72  DA  I C5    1 
ATOM   6007  C  C6    . DA  I 6  1    ? 148.449 118.586 121.865 1.00 164.04 ?  -72  DA  I C6    1 
ATOM   6008  N  N6    . DA  I 6  1    ? 149.107 119.696 122.214 1.00 164.15 ?  -72  DA  I N6    1 
ATOM   6009  N  N1    . DA  I 6  1    ? 149.145 117.445 121.677 1.00 164.03 ?  -72  DA  I N1    1 
ATOM   6010  C  C2    . DA  I 6  1    ? 148.482 116.335 121.328 1.00 163.98 ?  -72  DA  I C2    1 
ATOM   6011  N  N3    . DA  I 6  1    ? 147.176 116.167 121.125 1.00 164.06 ?  -72  DA  I N3    1 
ATOM   6012  C  C4    . DA  I 6  1    ? 146.511 117.317 121.319 1.00 164.07 ?  -72  DA  I C4    1 
ATOM   6013  P  P     . DT  I 6  2    ? 141.705 113.356 122.000 1.00 168.64 ?  -71  DT  I P     1 
ATOM   6014  O  OP1   . DT  I 6  2    ? 141.080 112.178 121.359 1.00 168.62 ?  -71  DT  I OP1   1 
ATOM   6015  O  OP2   . DT  I 6  2    ? 141.018 114.033 123.122 1.00 168.65 ?  -71  DT  I OP2   1 
ATOM   6016  O  "O5'" . DT  I 6  2    ? 143.173 112.954 122.494 1.00 169.24 ?  -71  DT  I "O5'" 1 
ATOM   6017  C  "C5'" . DT  I 6  2    ? 144.070 112.311 121.597 1.00 170.04 ?  -71  DT  I "C5'" 1 
ATOM   6018  C  "C4'" . DT  I 6  2    ? 145.374 111.952 122.290 1.00 170.81 ?  -71  DT  I "C4'" 1 
ATOM   6019  O  "O4'" . DT  I 6  2    ? 146.170 113.149 122.494 1.00 171.04 ?  -71  DT  I "O4'" 1 
ATOM   6020  C  "C3'" . DT  I 6  2    ? 145.225 111.301 123.670 1.00 171.10 ?  -71  DT  I "C3'" 1 
ATOM   6021  O  "O3'" . DT  I 6  2    ? 146.128 110.207 123.782 1.00 171.46 ?  -71  DT  I "O3'" 1 
ATOM   6022  C  "C2'" . DT  I 6  2    ? 145.600 112.433 124.626 1.00 171.13 ?  -71  DT  I "C2'" 1 
ATOM   6023  C  "C1'" . DT  I 6  2    ? 146.661 113.149 123.813 1.00 171.28 ?  -71  DT  I "C1'" 1 
ATOM   6024  N  N1    . DT  I 6  2    ? 146.911 114.560 124.234 1.00 171.40 ?  -71  DT  I N1    1 
ATOM   6025  C  C2    . DT  I 6  2    ? 148.199 114.955 124.506 1.00 171.39 ?  -71  DT  I C2    1 
ATOM   6026  O  O2    . DT  I 6  2    ? 149.157 114.207 124.426 1.00 171.41 ?  -71  DT  I O2    1 
ATOM   6027  N  N3    . DT  I 6  2    ? 148.331 116.265 124.879 1.00 171.43 ?  -71  DT  I N3    1 
ATOM   6028  C  C4    . DT  I 6  2    ? 147.324 117.203 125.003 1.00 171.44 ?  -71  DT  I C4    1 
ATOM   6029  O  O4    . DT  I 6  2    ? 147.545 118.360 125.346 1.00 171.47 ?  -71  DT  I O4    1 
ATOM   6030  C  C5    . DT  I 6  2    ? 145.995 116.726 124.702 1.00 171.44 ?  -71  DT  I C5    1 
ATOM   6031  C  C7    . DT  I 6  2    ? 144.821 117.655 124.804 1.00 171.34 ?  -71  DT  I C7    1 
ATOM   6032  C  C6    . DT  I 6  2    ? 145.853 115.441 124.334 1.00 171.49 ?  -71  DT  I C6    1 
ATOM   6033  P  P     . DC  I 6  3    ? 145.764 108.938 124.699 1.00 171.55 ?  -70  DC  I P     1 
ATOM   6034  O  OP1   . DC  I 6  3    ? 144.735 108.151 123.983 1.00 171.54 ?  -70  DC  I OP1   1 
ATOM   6035  O  OP2   . DC  I 6  3    ? 145.491 109.430 126.067 1.00 171.66 ?  -70  DC  I OP2   1 
ATOM   6036  O  "O5'" . DC  I 6  3    ? 147.123 108.094 124.738 1.00 171.68 ?  -70  DC  I "O5'" 1 
ATOM   6037  C  "C5'" . DC  I 6  3    ? 148.366 108.732 124.455 1.00 171.59 ?  -70  DC  I "C5'" 1 
ATOM   6038  C  "C4'" . DC  I 6  3    ? 149.385 108.455 125.548 1.00 171.46 ?  -70  DC  I "C4'" 1 
ATOM   6039  O  "O4'" . DC  I 6  3    ? 149.788 109.710 126.158 1.00 171.21 ?  -70  DC  I "O4'" 1 
ATOM   6040  C  "C3'" . DC  I 6  3    ? 148.880 107.592 126.697 1.00 171.53 ?  -70  DC  I "C3'" 1 
ATOM   6041  O  "O3'" . DC  I 6  3    ? 149.967 106.884 127.287 1.00 171.70 ?  -70  DC  I "O3'" 1 
ATOM   6042  C  "C2'" . DC  I 6  3    ? 148.319 108.638 127.649 1.00 171.24 ?  -70  DC  I "C2'" 1 
ATOM   6043  C  "C1'" . DC  I 6  3    ? 149.346 109.755 127.502 1.00 170.90 ?  -70  DC  I "C1'" 1 
ATOM   6044  N  N1    . DC  I 6  3    ? 148.789 111.109 127.773 1.00 170.64 ?  -70  DC  I N1    1 
ATOM   6045  C  C2    . DC  I 6  3    ? 149.640 112.145 128.177 1.00 170.36 ?  -70  DC  I C2    1 
ATOM   6046  O  O2    . DC  I 6  3    ? 150.851 111.919 128.300 1.00 170.23 ?  -70  DC  I O2    1 
ATOM   6047  N  N3    . DC  I 6  3    ? 149.111 113.371 128.421 1.00 170.34 ?  -70  DC  I N3    1 
ATOM   6048  C  C4    . DC  I 6  3    ? 147.799 113.572 128.276 1.00 170.46 ?  -70  DC  I C4    1 
ATOM   6049  N  N4    . DC  I 6  3    ? 147.320 114.795 128.526 1.00 170.47 ?  -70  DC  I N4    1 
ATOM   6050  C  C5    . DC  I 6  3    ? 146.919 112.529 127.869 1.00 170.37 ?  -70  DC  I C5    1 
ATOM   6051  C  C6    . DC  I 6  3    ? 147.451 111.327 127.631 1.00 170.54 ?  -70  DC  I C6    1 
ATOM   6052  P  P     . DA  I 6  4    ? 149.699 105.554 128.150 1.00 171.70 ?  -69  DA  I P     1 
ATOM   6053  O  OP1   . DA  I 6  4    ? 150.039 104.396 127.294 1.00 171.74 ?  -69  DA  I OP1   1 
ATOM   6054  O  OP2   . DA  I 6  4    ? 148.350 105.653 128.748 1.00 171.48 ?  -69  DA  I OP2   1 
ATOM   6055  O  "O5'" . DA  I 6  4    ? 150.770 105.643 129.337 1.00 170.86 ?  -69  DA  I "O5'" 1 
ATOM   6056  C  "C5'" . DA  I 6  4    ? 152.144 105.380 129.075 1.00 169.81 ?  -69  DA  I "C5'" 1 
ATOM   6057  C  "C4'" . DA  I 6  4    ? 153.041 106.348 129.831 1.00 169.19 ?  -69  DA  I "C4'" 1 
ATOM   6058  O  "O4'" . DA  I 6  4    ? 152.448 107.674 129.820 1.00 168.74 ?  -69  DA  I "O4'" 1 
ATOM   6059  C  "C3'" . DA  I 6  4    ? 153.274 106.015 131.299 1.00 169.10 ?  -69  DA  I "C3'" 1 
ATOM   6060  O  "O3'" . DA  I 6  4    ? 154.572 106.463 131.683 1.00 169.26 ?  -69  DA  I "O3'" 1 
ATOM   6061  C  "C2'" . DA  I 6  4    ? 152.174 106.815 131.991 1.00 168.72 ?  -69  DA  I "C2'" 1 
ATOM   6062  C  "C1'" . DA  I 6  4    ? 152.143 108.078 131.142 1.00 168.16 ?  -69  DA  I "C1'" 1 
ATOM   6063  N  N9    . DA  I 6  4    ? 150.844 108.743 131.124 1.00 167.93 ?  -69  DA  I N9    1 
ATOM   6064  C  C8    . DA  I 6  4    ? 149.646 108.197 130.759 1.00 167.85 ?  -69  DA  I C8    1 
ATOM   6065  N  N7    . DA  I 6  4    ? 148.638 109.034 130.830 1.00 167.88 ?  -69  DA  I N7    1 
ATOM   6066  C  C5    . DA  I 6  4    ? 149.216 110.214 131.265 1.00 167.82 ?  -69  DA  I C5    1 
ATOM   6067  C  C6    . DA  I 6  4    ? 148.680 111.487 131.540 1.00 167.80 ?  -69  DA  I C6    1 
ATOM   6068  N  N6    . DA  I 6  4    ? 147.383 111.784 131.405 1.00 167.79 ?  -69  DA  I N6    1 
ATOM   6069  N  N1    . DA  I 6  4    ? 149.531 112.447 131.961 1.00 167.80 ?  -69  DA  I N1    1 
ATOM   6070  C  C2    . DA  I 6  4    ? 150.828 112.144 132.094 1.00 167.81 ?  -69  DA  I C2    1 
ATOM   6071  N  N3    . DA  I 6  4    ? 151.447 110.986 131.866 1.00 167.79 ?  -69  DA  I N3    1 
ATOM   6072  C  C4    . DA  I 6  4    ? 150.576 110.054 131.450 1.00 167.84 ?  -69  DA  I C4    1 
ATOM   6073  P  P     . DG  I 6  5    ? 155.225 106.015 133.082 1.00 169.42 ?  -68  DG  I P     1 
ATOM   6074  O  OP1   . DG  I 6  5    ? 156.415 105.194 132.768 1.00 169.58 ?  -68  DG  I OP1   1 
ATOM   6075  O  OP2   . DG  I 6  5    ? 154.166 105.461 133.954 1.00 169.05 ?  -68  DG  I OP2   1 
ATOM   6076  O  "O5'" . DG  I 6  5    ? 155.715 107.398 133.718 1.00 169.19 ?  -68  DG  I "O5'" 1 
ATOM   6077  C  "C5'" . DG  I 6  5    ? 154.990 108.593 133.449 1.00 168.64 ?  -68  DG  I "C5'" 1 
ATOM   6078  C  "C4'" . DG  I 6  5    ? 155.361 109.687 134.430 1.00 168.22 ?  -68  DG  I "C4'" 1 
ATOM   6079  O  "O4'" . DG  I 6  5    ? 154.280 110.650 134.495 1.00 168.40 ?  -68  DG  I "O4'" 1 
ATOM   6080  C  "C3'" . DG  I 6  5    ? 155.540 109.220 135.861 1.00 167.61 ?  -68  DG  I "C3'" 1 
ATOM   6081  O  "O3'" . DG  I 6  5    ? 156.309 110.172 136.584 1.00 166.35 ?  -68  DG  I "O3'" 1 
ATOM   6082  C  "C2'" . DG  I 6  5    ? 154.100 109.195 136.347 1.00 167.93 ?  -68  DG  I "C2'" 1 
ATOM   6083  C  "C1'" . DG  I 6  5    ? 153.545 110.460 135.692 1.00 168.42 ?  -68  DG  I "C1'" 1 
ATOM   6084  N  N9    . DG  I 6  5    ? 152.127 110.369 135.356 1.00 168.53 ?  -68  DG  I N9    1 
ATOM   6085  C  C8    . DG  I 6  5    ? 151.461 109.271 134.867 1.00 168.54 ?  -68  DG  I C8    1 
ATOM   6086  N  N7    . DG  I 6  5    ? 150.192 109.485 134.656 1.00 168.55 ?  -68  DG  I N7    1 
ATOM   6087  C  C5    . DG  I 6  5    ? 150.004 110.811 135.029 1.00 168.48 ?  -68  DG  I C5    1 
ATOM   6088  C  C6    . DG  I 6  5    ? 148.831 111.603 135.017 1.00 168.48 ?  -68  DG  I C6    1 
ATOM   6089  O  O6    . DG  I 6  5    ? 147.690 111.278 134.666 1.00 168.48 ?  -68  DG  I O6    1 
ATOM   6090  N  N1    . DG  I 6  5    ? 149.078 112.896 135.473 1.00 168.52 ?  -68  DG  I N1    1 
ATOM   6091  C  C2    . DG  I 6  5    ? 150.303 113.364 135.889 1.00 168.62 ?  -68  DG  I C2    1 
ATOM   6092  N  N2    . DG  I 6  5    ? 150.350 114.641 136.295 1.00 168.46 ?  -68  DG  I N2    1 
ATOM   6093  N  N3    . DG  I 6  5    ? 151.410 112.631 135.902 1.00 168.74 ?  -68  DG  I N3    1 
ATOM   6094  C  C4    . DG  I 6  5    ? 151.186 111.369 135.460 1.00 168.58 ?  -68  DG  I C4    1 
ATOM   6095  P  P     . DA  I 6  6    ? 157.654 109.724 137.340 1.00 165.50 ?  -67  DA  I P     1 
ATOM   6096  O  OP1   . DA  I 6  6    ? 158.773 109.851 136.380 1.00 165.51 ?  -67  DA  I OP1   1 
ATOM   6097  O  OP2   . DA  I 6  6    ? 157.389 108.424 137.994 1.00 165.76 ?  -67  DA  I OP2   1 
ATOM   6098  O  "O5'" . DA  I 6  6    ? 157.828 110.824 138.488 1.00 163.95 ?  -67  DA  I "O5'" 1 
ATOM   6099  C  "C5'" . DA  I 6  6    ? 156.991 110.788 139.639 1.00 161.38 ?  -67  DA  I "C5'" 1 
ATOM   6100  C  "C4'" . DA  I 6  6    ? 156.547 112.186 140.032 1.00 159.41 ?  -67  DA  I "C4'" 1 
ATOM   6101  O  "O4'" . DA  I 6  6    ? 155.276 112.482 139.398 1.00 158.63 ?  -67  DA  I "O4'" 1 
ATOM   6102  C  "C3'" . DA  I 6  6    ? 156.293 112.376 141.516 1.00 158.37 ?  -67  DA  I "C3'" 1 
ATOM   6103  O  "O3'" . DA  I 6  6    ? 156.415 113.751 141.857 1.00 157.32 ?  -67  DA  I "O3'" 1 
ATOM   6104  C  "C2'" . DA  I 6  6    ? 154.855 111.895 141.648 1.00 157.93 ?  -67  DA  I "C2'" 1 
ATOM   6105  C  "C1'" . DA  I 6  6    ? 154.233 112.429 140.359 1.00 157.53 ?  -67  DA  I "C1'" 1 
ATOM   6106  N  N9    . DA  I 6  6    ? 153.168 111.580 139.831 1.00 157.22 ?  -67  DA  I N9    1 
ATOM   6107  C  C8    . DA  I 6  6    ? 153.282 110.279 139.431 1.00 157.11 ?  -67  DA  I C8    1 
ATOM   6108  N  N7    . DA  I 6  6    ? 152.162 109.759 138.991 1.00 157.09 ?  -67  DA  I N7    1 
ATOM   6109  C  C5    . DA  I 6  6    ? 151.246 110.790 139.109 1.00 157.03 ?  -67  DA  I C5    1 
ATOM   6110  C  C6    . DA  I 6  6    ? 149.873 110.874 138.807 1.00 157.12 ?  -67  DA  I C6    1 
ATOM   6111  N  N6    . DA  I 6  6    ? 149.171 109.855 138.304 1.00 157.15 ?  -67  DA  I N6    1 
ATOM   6112  N  N1    . DA  I 6  6    ? 149.248 112.049 139.042 1.00 157.22 ?  -67  DA  I N1    1 
ATOM   6113  C  C2    . DA  I 6  6    ? 149.960 113.066 139.547 1.00 157.22 ?  -67  DA  I C2    1 
ATOM   6114  N  N3    . DA  I 6  6    ? 151.256 113.105 139.870 1.00 157.23 ?  -67  DA  I N3    1 
ATOM   6115  C  C4    . DA  I 6  6    ? 151.846 111.923 139.624 1.00 157.16 ?  -67  DA  I C4    1 
ATOM   6116  P  P     . DA  I 6  7    ? 157.001 114.180 143.291 1.00 156.58 ?  -66  DA  I P     1 
ATOM   6117  O  OP1   . DA  I 6  7    ? 158.154 115.076 143.054 1.00 156.32 ?  -66  DA  I OP1   1 
ATOM   6118  O  OP2   . DA  I 6  7    ? 157.178 112.948 144.090 1.00 156.89 ?  -66  DA  I OP2   1 
ATOM   6119  O  "O5'" . DA  I 6  7    ? 155.815 115.027 143.952 1.00 155.66 ?  -66  DA  I "O5'" 1 
ATOM   6120  C  "C5'" . DA  I 6  7    ? 154.591 114.389 144.296 1.00 154.37 ?  -66  DA  I "C5'" 1 
ATOM   6121  C  "C4'" . DA  I 6  7    ? 153.430 115.363 144.209 1.00 153.29 ?  -66  DA  I "C4'" 1 
ATOM   6122  O  "O4'" . DA  I 6  7    ? 152.473 114.880 143.237 1.00 153.01 ?  -66  DA  I "O4'" 1 
ATOM   6123  C  "C3'" . DA  I 6  7    ? 152.639 115.532 145.494 1.00 152.77 ?  -66  DA  I "C3'" 1 
ATOM   6124  O  "O3'" . DA  I 6  7    ? 151.999 116.802 145.512 1.00 152.21 ?  -66  DA  I "O3'" 1 
ATOM   6125  C  "C2'" . DA  I 6  7    ? 151.626 114.398 145.399 1.00 152.72 ?  -66  DA  I "C2'" 1 
ATOM   6126  C  "C1'" . DA  I 6  7    ? 151.337 114.349 143.897 1.00 152.61 ?  -66  DA  I "C1'" 1 
ATOM   6127  N  N9    . DA  I 6  7    ? 151.106 112.996 143.400 1.00 152.47 ?  -66  DA  I N9    1 
ATOM   6128  C  C8    . DA  I 6  7    ? 152.018 111.981 143.324 1.00 152.41 ?  -66  DA  I C8    1 
ATOM   6129  N  N7    . DA  I 6  7    ? 151.530 110.865 142.836 1.00 152.41 ?  -66  DA  I N7    1 
ATOM   6130  C  C5    . DA  I 6  7    ? 150.206 111.168 142.574 1.00 152.33 ?  -66  DA  I C5    1 
ATOM   6131  C  C6    . DA  I 6  7    ? 149.144 110.408 142.045 1.00 152.42 ?  -66  DA  I C6    1 
ATOM   6132  N  N6    . DA  I 6  7    ? 149.267 109.130 141.671 1.00 152.30 ?  -66  DA  I N6    1 
ATOM   6133  N  N1    . DA  I 6  7    ? 147.948 111.015 141.915 1.00 152.48 ?  -66  DA  I N1    1 
ATOM   6134  C  C2    . DA  I 6  7    ? 147.828 112.295 142.289 1.00 152.38 ?  -66  DA  I C2    1 
ATOM   6135  N  N3    . DA  I 6  7    ? 148.749 113.109 142.799 1.00 152.24 ?  -66  DA  I N3    1 
ATOM   6136  C  C4    . DA  I 6  7    ? 149.927 112.479 142.917 1.00 152.30 ?  -66  DA  I C4    1 
ATOM   6137  P  P     . DT  I 6  8    ? 151.305 117.338 146.859 1.00 151.76 ?  -65  DT  I P     1 
ATOM   6138  O  OP1   . DT  I 6  8    ? 151.237 118.813 146.767 1.00 151.45 ?  -65  DT  I OP1   1 
ATOM   6139  O  OP2   . DT  I 6  8    ? 151.994 116.705 148.005 1.00 151.76 ?  -65  DT  I OP2   1 
ATOM   6140  O  "O5'" . DT  I 6  8    ? 149.820 116.746 146.790 1.00 151.02 ?  -65  DT  I "O5'" 1 
ATOM   6141  C  "C5'" . DT  I 6  8    ? 148.954 117.131 145.729 1.00 150.49 ?  -65  DT  I "C5'" 1 
ATOM   6142  C  "C4'" . DT  I 6  8    ? 147.585 116.488 145.877 1.00 149.84 ?  -65  DT  I "C4'" 1 
ATOM   6143  O  "O4'" . DT  I 6  8    ? 147.589 115.166 145.278 1.00 149.47 ?  -65  DT  I "O4'" 1 
ATOM   6144  C  "C3'" . DT  I 6  8    ? 147.097 116.303 147.320 1.00 149.46 ?  -65  DT  I "C3'" 1 
ATOM   6145  O  "O3'" . DT  I 6  8    ? 145.768 116.796 147.440 1.00 149.48 ?  -65  DT  I "O3'" 1 
ATOM   6146  C  "C2'" . DT  I 6  8    ? 147.156 114.786 147.523 1.00 149.10 ?  -65  DT  I "C2'" 1 
ATOM   6147  C  "C1'" . DT  I 6  8    ? 146.879 114.290 146.117 1.00 148.56 ?  -65  DT  I "C1'" 1 
ATOM   6148  N  N1    . DT  I 6  8    ? 147.347 112.897 145.863 1.00 148.39 ?  -65  DT  I N1    1 
ATOM   6149  C  C2    . DT  I 6  8    ? 146.457 111.970 145.374 1.00 148.14 ?  -65  DT  I C2    1 
ATOM   6150  O  O2    . DT  I 6  8    ? 145.290 112.225 145.136 1.00 147.89 ?  -65  DT  I O2    1 
ATOM   6151  N  N3    . DT  I 6  8    ? 146.984 110.723 145.171 1.00 148.14 ?  -65  DT  I N3    1 
ATOM   6152  C  C4    . DT  I 6  8    ? 148.284 110.317 145.403 1.00 148.04 ?  -65  DT  I C4    1 
ATOM   6153  O  O4    . DT  I 6  8    ? 148.662 109.170 145.189 1.00 148.01 ?  -65  DT  I O4    1 
ATOM   6154  C  C5    . DT  I 6  8    ? 149.167 111.338 145.916 1.00 147.89 ?  -65  DT  I C5    1 
ATOM   6155  C  C7    . DT  I 6  8    ? 150.601 111.014 146.209 1.00 147.99 ?  -65  DT  I C7    1 
ATOM   6156  C  C6    . DT  I 6  8    ? 148.661 112.565 146.119 1.00 148.22 ?  -65  DT  I C6    1 
ATOM   6157  P  P     . DC  I 6  9    ? 145.072 116.943 148.882 1.00 149.78 ?  -64  DC  I P     1 
ATOM   6158  O  OP1   . DC  I 6  9    ? 144.598 118.339 148.998 1.00 149.58 ?  -64  DC  I OP1   1 
ATOM   6159  O  OP2   . DC  I 6  9    ? 145.986 116.398 149.910 1.00 149.69 ?  -64  DC  I OP2   1 
ATOM   6160  O  "O5'" . DC  I 6  9    ? 143.801 115.975 148.788 1.00 149.97 ?  -64  DC  I "O5'" 1 
ATOM   6161  C  "C5'" . DC  I 6  9    ? 142.864 116.140 147.727 1.00 150.22 ?  -64  DC  I "C5'" 1 
ATOM   6162  C  "C4'" . DC  I 6  9    ? 141.933 114.943 147.628 1.00 150.27 ?  -64  DC  I "C4'" 1 
ATOM   6163  O  "O4'" . DC  I 6  9    ? 142.679 113.775 147.191 1.00 150.24 ?  -64  DC  I "O4'" 1 
ATOM   6164  C  "C3'" . DC  I 6  9    ? 141.242 114.546 148.934 1.00 150.37 ?  -64  DC  I "C3'" 1 
ATOM   6165  O  "O3'" . DC  I 6  9    ? 139.876 114.242 148.683 1.00 151.07 ?  -64  DC  I "O3'" 1 
ATOM   6166  C  "C2'" . DC  I 6  9    ? 142.021 113.310 149.380 1.00 150.14 ?  -64  DC  I "C2'" 1 
ATOM   6167  C  "C1'" . DC  I 6  9    ? 142.396 112.690 148.045 1.00 149.84 ?  -64  DC  I "C1'" 1 
ATOM   6168  N  N1    . DC  I 6  9    ? 143.604 111.816 148.109 1.00 149.58 ?  -64  DC  I N1    1 
ATOM   6169  C  C2    . DC  I 6  9    ? 143.517 110.473 147.715 1.00 149.43 ?  -64  DC  I C2    1 
ATOM   6170  O  O2    . DC  I 6  9    ? 142.432 110.030 147.318 1.00 149.33 ?  -64  DC  I O2    1 
ATOM   6171  N  N3    . DC  I 6  9    ? 144.629 109.697 147.779 1.00 149.40 ?  -64  DC  I N3    1 
ATOM   6172  C  C4    . DC  I 6  9    ? 145.780 110.217 148.214 1.00 149.44 ?  -64  DC  I C4    1 
ATOM   6173  N  N4    . DC  I 6  9    ? 146.853 109.419 148.262 1.00 149.45 ?  -64  DC  I N4    1 
ATOM   6174  C  C5    . DC  I 6  9    ? 145.885 111.580 148.620 1.00 149.30 ?  -64  DC  I C5    1 
ATOM   6175  C  C6    . DC  I 6  9    ? 144.785 112.334 148.550 1.00 149.41 ?  -64  DC  I C6    1 
ATOM   6176  P  P     . DC  I 6  10   ? 138.840 114.091 149.901 1.00 152.15 ?  -63  DC  I P     1 
ATOM   6177  O  OP1   . DC  I 6  10   ? 137.627 114.864 149.551 1.00 152.25 ?  -63  DC  I OP1   1 
ATOM   6178  O  OP2   . DC  I 6  10   ? 139.563 114.390 151.157 1.00 152.00 ?  -63  DC  I OP2   1 
ATOM   6179  O  "O5'" . DC  I 6  10   ? 138.475 112.533 149.899 1.00 152.49 ?  -63  DC  I "O5'" 1 
ATOM   6180  C  "C5'" . DC  I 6  10   ? 137.875 111.949 148.749 1.00 152.97 ?  -63  DC  I "C5'" 1 
ATOM   6181  C  "C4'" . DC  I 6  10   ? 137.834 110.435 148.863 1.00 153.58 ?  -63  DC  I "C4'" 1 
ATOM   6182  O  "O4'" . DC  I 6  10   ? 139.180 109.899 148.774 1.00 153.56 ?  -63  DC  I "O4'" 1 
ATOM   6183  C  "C3'" . DC  I 6  10   ? 137.242 109.895 150.168 1.00 154.04 ?  -63  DC  I "C3'" 1 
ATOM   6184  O  "O3'" . DC  I 6  10   ? 136.347 108.826 149.884 1.00 154.66 ?  -63  DC  I "O3'" 1 
ATOM   6185  C  "C2'" . DC  I 6  10   ? 138.471 109.413 150.940 1.00 153.90 ?  -63  DC  I "C2'" 1 
ATOM   6186  C  "C1'" . DC  I 6  10   ? 139.385 108.969 149.811 1.00 153.55 ?  -63  DC  I "C1'" 1 
ATOM   6187  N  N1    . DC  I 6  10   ? 140.832 108.978 150.172 1.00 153.42 ?  -63  DC  I N1    1 
ATOM   6188  C  C2    . DC  I 6  10   ? 141.582 107.802 150.058 1.00 153.24 ?  -63  DC  I C2    1 
ATOM   6189  O  O2    . DC  I 6  10   ? 141.026 106.772 149.659 1.00 153.03 ?  -63  DC  I O2    1 
ATOM   6190  N  N3    . DC  I 6  10   ? 142.899 107.829 150.389 1.00 153.26 ?  -63  DC  I N3    1 
ATOM   6191  C  C4    . DC  I 6  10   ? 143.456 108.965 150.815 1.00 153.30 ?  -63  DC  I C4    1 
ATOM   6192  N  N4    . DC  I 6  10   ? 144.756 108.949 151.130 1.00 153.37 ?  -63  DC  I N4    1 
ATOM   6193  C  C5    . DC  I 6  10   ? 142.705 110.171 150.937 1.00 153.20 ?  -63  DC  I C5    1 
ATOM   6194  C  C6    . DC  I 6  10   ? 141.411 110.131 150.608 1.00 153.29 ?  -63  DC  I C6    1 
ATOM   6195  P  P     . DC  I 6  11   ? 135.358 108.266 151.020 1.00 155.02 ?  -62  DC  I P     1 
ATOM   6196  O  OP1   . DC  I 6  11   ? 134.009 108.164 150.422 1.00 155.31 ?  -62  DC  I OP1   1 
ATOM   6197  O  OP2   . DC  I 6  11   ? 135.558 109.071 152.245 1.00 154.88 ?  -62  DC  I OP2   1 
ATOM   6198  O  "O5'" . DC  I 6  11   ? 135.903 106.789 151.302 1.00 155.24 ?  -62  DC  I "O5'" 1 
ATOM   6199  C  "C5'" . DC  I 6  11   ? 135.943 105.837 150.245 1.00 155.06 ?  -62  DC  I "C5'" 1 
ATOM   6200  C  "C4'" . DC  I 6  11   ? 136.634 104.560 150.689 1.00 154.82 ?  -62  DC  I "C4'" 1 
ATOM   6201  O  "O4'" . DC  I 6  11   ? 138.062 104.791 150.806 1.00 154.23 ?  -62  DC  I "O4'" 1 
ATOM   6202  C  "C3'" . DC  I 6  11   ? 136.174 104.012 152.041 1.00 154.97 ?  -62  DC  I "C3'" 1 
ATOM   6203  O  "O3'" . DC  I 6  11   ? 135.988 102.605 151.954 1.00 155.99 ?  -62  DC  I "O3'" 1 
ATOM   6204  C  "C2'" . DC  I 6  11   ? 137.324 104.372 152.981 1.00 154.25 ?  -62  DC  I "C2'" 1 
ATOM   6205  C  "C1'" . DC  I 6  11   ? 138.521 104.304 152.046 1.00 153.74 ?  -62  DC  I "C1'" 1 
ATOM   6206  N  N1    . DC  I 6  11   ? 139.671 105.148 152.483 1.00 153.53 ?  -62  DC  I N1    1 
ATOM   6207  C  C2    . DC  I 6  11   ? 140.928 104.562 152.683 1.00 153.45 ?  -62  DC  I C2    1 
ATOM   6208  O  O2    . DC  I 6  11   ? 141.060 103.346 152.496 1.00 153.24 ?  -62  DC  I O2    1 
ATOM   6209  N  N3    . DC  I 6  11   ? 141.962 105.348 153.079 1.00 153.40 ?  -62  DC  I N3    1 
ATOM   6210  C  C4    . DC  I 6  11   ? 141.770 106.656 153.269 1.00 153.29 ?  -62  DC  I C4    1 
ATOM   6211  N  N4    . DC  I 6  11   ? 142.814 107.396 153.658 1.00 153.34 ?  -62  DC  I N4    1 
ATOM   6212  C  C5    . DC  I 6  11   ? 140.497 107.267 153.071 1.00 153.20 ?  -62  DC  I C5    1 
ATOM   6213  C  C6    . DC  I 6  11   ? 139.488 106.484 152.680 1.00 153.42 ?  -62  DC  I C6    1 
ATOM   6214  P  P     . DG  I 6  12   ? 135.184 101.822 153.104 1.00 156.53 ?  -61  DG  I P     1 
ATOM   6215  O  OP1   . DG  I 6  12   ? 134.283 100.853 152.441 1.00 156.17 ?  -61  DG  I OP1   1 
ATOM   6216  O  OP2   . DG  I 6  12   ? 134.623 102.831 154.030 1.00 156.43 ?  -61  DG  I OP2   1 
ATOM   6217  O  "O5'" . DG  I 6  12   ? 136.324 101.018 153.883 1.00 157.11 ?  -61  DG  I "O5'" 1 
ATOM   6218  C  "C5'" . DG  I 6  12   ? 137.146 100.093 153.180 1.00 158.02 ?  -61  DG  I "C5'" 1 
ATOM   6219  C  "C4'" . DG  I 6  12   ? 138.383 99.745  153.988 1.00 158.68 ?  -61  DG  I "C4'" 1 
ATOM   6220  O  "O4'" . DG  I 6  12   ? 139.279 100.880 154.014 1.00 158.57 ?  -61  DG  I "O4'" 1 
ATOM   6221  C  "C3'" . DG  I 6  12   ? 138.112 99.374  155.451 1.00 159.18 ?  -61  DG  I "C3'" 1 
ATOM   6222  O  "O3'" . DG  I 6  12   ? 138.579 98.056  155.720 1.00 159.92 ?  -61  DG  I "O3'" 1 
ATOM   6223  C  "C2'" . DG  I 6  12   ? 138.879 100.426 156.264 1.00 158.98 ?  -61  DG  I "C2'" 1 
ATOM   6224  C  "C1'" . DG  I 6  12   ? 139.908 100.938 155.266 1.00 158.60 ?  -61  DG  I "C1'" 1 
ATOM   6225  N  N9    . DG  I 6  12   ? 140.319 102.318 155.514 1.00 158.53 ?  -61  DG  I N9    1 
ATOM   6226  C  C8    . DG  I 6  12   ? 139.534 103.442 155.428 1.00 158.57 ?  -61  DG  I C8    1 
ATOM   6227  N  N7    . DG  I 6  12   ? 140.172 104.546 155.706 1.00 158.65 ?  -61  DG  I N7    1 
ATOM   6228  C  C5    . DG  I 6  12   ? 141.464 104.128 155.998 1.00 158.60 ?  -61  DG  I C5    1 
ATOM   6229  C  C6    . DG  I 6  12   ? 142.604 104.881 156.369 1.00 158.60 ?  -61  DG  I C6    1 
ATOM   6230  O  O6    . DG  I 6  12   ? 142.698 106.107 156.520 1.00 158.53 ?  -61  DG  I O6    1 
ATOM   6231  N  N1    . DG  I 6  12   ? 143.715 104.067 156.575 1.00 158.55 ?  -61  DG  I N1    1 
ATOM   6232  C  C2    . DG  I 6  12   ? 143.724 102.698 156.436 1.00 158.60 ?  -61  DG  I C2    1 
ATOM   6233  N  N2    . DG  I 6  12   ? 144.888 102.078 156.676 1.00 158.57 ?  -61  DG  I N2    1 
ATOM   6234  N  N3    . DG  I 6  12   ? 142.662 101.981 156.088 1.00 158.51 ?  -61  DG  I N3    1 
ATOM   6235  C  C4    . DG  I 6  12   ? 141.572 102.759 155.884 1.00 158.54 ?  -61  DG  I C4    1 
ATOM   6236  P  P     . DG  I 6  13   ? 138.086 97.281  157.039 1.00 160.26 ?  -60  DG  I P     1 
ATOM   6237  O  OP1   . DG  I 6  13   ? 137.984 95.843  156.707 1.00 160.37 ?  -60  DG  I OP1   1 
ATOM   6238  O  OP2   . DG  I 6  13   ? 136.903 98.000  157.561 1.00 159.90 ?  -60  DG  I OP2   1 
ATOM   6239  O  "O5'" . DG  I 6  13   ? 139.285 97.490  158.079 1.00 160.36 ?  -60  DG  I "O5'" 1 
ATOM   6240  C  "C5'" . DG  I 6  13   ? 140.544 96.869  157.845 1.00 160.71 ?  -60  DG  I "C5'" 1 
ATOM   6241  C  "C4'" . DG  I 6  13   ? 141.646 97.561  158.629 1.00 161.27 ?  -60  DG  I "C4'" 1 
ATOM   6242  O  "O4'" . DG  I 6  13   ? 141.710 98.946  158.246 1.00 161.44 ?  -60  DG  I "O4'" 1 
ATOM   6243  C  "C3'" . DG  I 6  13   ? 141.450 97.581  160.143 1.00 161.71 ?  -60  DG  I "C3'" 1 
ATOM   6244  O  "O3'" . DG  I 6  13   ? 142.193 96.527  160.753 1.00 162.10 ?  -60  DG  I "O3'" 1 
ATOM   6245  C  "C2'" . DG  I 6  13   ? 141.977 98.959  160.579 1.00 161.81 ?  -60  DG  I "C2'" 1 
ATOM   6246  C  "C1'" . DG  I 6  13   ? 142.366 99.646  159.269 1.00 161.89 ?  -60  DG  I "C1'" 1 
ATOM   6247  N  N9    . DG  I 6  13   ? 141.971 101.052 159.217 1.00 162.03 ?  -60  DG  I N9    1 
ATOM   6248  C  C8    . DG  I 6  13   ? 140.742 101.557 158.867 1.00 162.12 ?  -60  DG  I C8    1 
ATOM   6249  N  N7    . DG  I 6  13   ? 140.681 102.860 158.922 1.00 162.29 ?  -60  DG  I N7    1 
ATOM   6250  C  C5    . DG  I 6  13   ? 141.950 103.242 159.339 1.00 162.15 ?  -60  DG  I C5    1 
ATOM   6251  C  C6    . DG  I 6  13   ? 142.483 104.533 159.579 1.00 161.96 ?  -60  DG  I C6    1 
ATOM   6252  O  O6    . DG  I 6  13   ? 141.920 105.631 159.464 1.00 161.95 ?  -60  DG  I O6    1 
ATOM   6253  N  N1    . DG  I 6  13   ? 143.813 104.472 159.989 1.00 161.95 ?  -60  DG  I N1    1 
ATOM   6254  C  C2    . DG  I 6  13   ? 144.535 103.312 160.147 1.00 162.12 ?  -60  DG  I C2    1 
ATOM   6255  N  N2    . DG  I 6  13   ? 145.806 103.448 160.553 1.00 162.11 ?  -60  DG  I N2    1 
ATOM   6256  N  N3    . DG  I 6  13   ? 144.047 102.099 159.927 1.00 162.19 ?  -60  DG  I N3    1 
ATOM   6257  C  C4    . DG  I 6  13   ? 142.754 102.140 159.527 1.00 162.19 ?  -60  DG  I C4    1 
ATOM   6258  P  P     . DT  I 6  14   ? 142.112 96.294  162.343 1.00 162.14 ?  -59  DT  I P     1 
ATOM   6259  O  OP1   . DT  I 6  14   ? 142.532 94.901  162.615 1.00 162.10 ?  -59  DT  I OP1   1 
ATOM   6260  O  OP2   . DT  I 6  14   ? 140.783 96.761  162.796 1.00 161.96 ?  -59  DT  I OP2   1 
ATOM   6261  O  "O5'" . DT  I 6  14   ? 143.213 97.292  162.943 1.00 162.63 ?  -59  DT  I "O5'" 1 
ATOM   6262  C  "C5'" . DT  I 6  14   ? 144.560 97.220  162.487 1.00 163.17 ?  -59  DT  I "C5'" 1 
ATOM   6263  C  "C4'" . DT  I 6  14   ? 145.423 98.292  163.136 1.00 163.62 ?  -59  DT  I "C4'" 1 
ATOM   6264  O  "O4'" . DT  I 6  14   ? 145.022 99.607  162.666 1.00 163.84 ?  -59  DT  I "O4'" 1 
ATOM   6265  C  "C3'" . DT  I 6  14   ? 145.363 98.348  164.666 1.00 163.77 ?  -59  DT  I "C3'" 1 
ATOM   6266  O  "O3'" . DT  I 6  14   ? 146.682 98.475  165.188 1.00 164.28 ?  -59  DT  I "O3'" 1 
ATOM   6267  C  "C2'" . DT  I 6  14   ? 144.529 99.602  164.935 1.00 163.63 ?  -59  DT  I "C2'" 1 
ATOM   6268  C  "C1'" . DT  I 6  14   ? 144.938 100.481 163.767 1.00 163.89 ?  -59  DT  I "C1'" 1 
ATOM   6269  N  N1    . DT  I 6  14   ? 143.956 101.562 163.444 1.00 163.83 ?  -59  DT  I N1    1 
ATOM   6270  C  C2    . DT  I 6  14   ? 144.335 102.882 163.565 1.00 163.78 ?  -59  DT  I C2    1 
ATOM   6271  O  O2    . DT  I 6  14   ? 145.444 103.228 163.932 1.00 163.76 ?  -59  DT  I O2    1 
ATOM   6272  N  N3    . DT  I 6  14   ? 143.360 103.789 163.237 1.00 163.91 ?  -59  DT  I N3    1 
ATOM   6273  C  C4    . DT  I 6  14   ? 142.073 103.514 162.811 1.00 164.02 ?  -59  DT  I C4    1 
ATOM   6274  O  O4    . DT  I 6  14   ? 141.266 104.396 162.540 1.00 163.91 ?  -59  DT  I O4    1 
ATOM   6275  C  C5    . DT  I 6  14   ? 141.743 102.114 162.706 1.00 163.99 ?  -59  DT  I C5    1 
ATOM   6276  C  C7    . DT  I 6  14   ? 140.375 101.696 162.255 1.00 163.97 ?  -59  DT  I C7    1 
ATOM   6277  C  C6    . DT  I 6  14   ? 142.689 101.218 163.024 1.00 163.88 ?  -59  DT  I C6    1 
ATOM   6278  P  P     . DG  I 6  15   ? 146.988 98.179  166.738 1.00 164.88 ?  -58  DG  I P     1 
ATOM   6279  O  OP1   . DG  I 6  15   ? 147.996 97.098  166.786 1.00 164.62 ?  -58  DG  I OP1   1 
ATOM   6280  O  OP2   . DG  I 6  15   ? 145.701 98.015  167.450 1.00 164.94 ?  -58  DG  I OP2   1 
ATOM   6281  O  "O5'" . DG  I 6  15   ? 147.662 99.535  167.253 1.00 164.59 ?  -58  DG  I "O5'" 1 
ATOM   6282  C  "C5'" . DG  I 6  15   ? 147.657 100.689 166.417 1.00 164.01 ?  -58  DG  I "C5'" 1 
ATOM   6283  C  "C4'" . DG  I 6  15   ? 147.519 101.955 167.241 1.00 163.43 ?  -58  DG  I "C4'" 1 
ATOM   6284  O  "O4'" . DG  I 6  15   ? 146.457 102.779 166.683 1.00 163.46 ?  -58  DG  I "O4'" 1 
ATOM   6285  C  "C3'" . DG  I 6  15   ? 147.123 101.737 168.701 1.00 162.78 ?  -58  DG  I "C3'" 1 
ATOM   6286  O  "O3'" . DG  I 6  15   ? 147.568 102.839 169.484 1.00 161.63 ?  -58  DG  I "O3'" 1 
ATOM   6287  C  "C2'" . DG  I 6  15   ? 145.608 101.765 168.591 1.00 163.01 ?  -58  DG  I "C2'" 1 
ATOM   6288  C  "C1'" . DG  I 6  15   ? 145.476 102.970 167.680 1.00 163.65 ?  -58  DG  I "C1'" 1 
ATOM   6289  N  N9    . DG  I 6  15   ? 144.168 103.135 167.056 1.00 163.85 ?  -58  DG  I N9    1 
ATOM   6290  C  C8    . DG  I 6  15   ? 143.269 102.155 166.713 1.00 163.93 ?  -58  DG  I C8    1 
ATOM   6291  N  N7    . DG  I 6  15   ? 142.176 102.622 166.170 1.00 163.87 ?  -58  DG  I N7    1 
ATOM   6292  C  C5    . DG  I 6  15   ? 142.364 103.999 166.162 1.00 163.96 ?  -58  DG  I C5    1 
ATOM   6293  C  C6    . DG  I 6  15   ? 141.522 105.039 165.694 1.00 163.83 ?  -58  DG  I C6    1 
ATOM   6294  O  O6    . DG  I 6  15   ? 140.398 104.949 165.179 1.00 163.81 ?  -58  DG  I O6    1 
ATOM   6295  N  N1    . DG  I 6  15   ? 142.103 106.292 165.878 1.00 163.82 ?  -58  DG  I N1    1 
ATOM   6296  C  C2    . DG  I 6  15   ? 143.341 106.511 166.438 1.00 163.94 ?  -58  DG  I C2    1 
ATOM   6297  N  N2    . DG  I 6  15   ? 143.740 107.787 166.533 1.00 163.88 ?  -58  DG  I N2    1 
ATOM   6298  N  N3    . DG  I 6  15   ? 144.134 105.549 166.875 1.00 164.11 ?  -58  DG  I N3    1 
ATOM   6299  C  C4    . DG  I 6  15   ? 143.585 104.325 166.705 1.00 164.08 ?  -58  DG  I C4    1 
ATOM   6300  P  P     . DC  I 6  16   ? 149.071 102.928 170.045 1.00 160.93 ?  -57  DC  I P     1 
ATOM   6301  O  OP1   . DC  I 6  16   ? 150.019 102.536 168.978 1.00 160.66 ?  -57  DC  I OP1   1 
ATOM   6302  O  OP2   . DC  I 6  16   ? 149.098 102.219 171.343 1.00 160.86 ?  -57  DC  I OP2   1 
ATOM   6303  O  "O5'" . DC  I 6  16   ? 149.251 104.491 170.338 1.00 159.93 ?  -57  DC  I "O5'" 1 
ATOM   6304  C  "C5'" . DC  I 6  16   ? 148.620 105.448 169.483 1.00 158.49 ?  -57  DC  I "C5'" 1 
ATOM   6305  C  "C4'" . DC  I 6  16   ? 148.238 106.701 170.254 1.00 157.41 ?  -57  DC  I "C4'" 1 
ATOM   6306  O  "O4'" . DC  I 6  16   ? 146.885 107.099 169.896 1.00 157.00 ?  -57  DC  I "O4'" 1 
ATOM   6307  C  "C3'" . DC  I 6  16   ? 148.213 106.541 171.764 1.00 156.86 ?  -57  DC  I "C3'" 1 
ATOM   6308  O  "O3'" . DC  I 6  16   ? 148.422 107.802 172.379 1.00 156.27 ?  -57  DC  I "O3'" 1 
ATOM   6309  C  "C2'" . DC  I 6  16   ? 146.792 106.049 171.994 1.00 156.83 ?  -57  DC  I "C2'" 1 
ATOM   6310  C  "C1'" . DC  I 6  16   ? 146.022 106.918 171.008 1.00 157.09 ?  -57  DC  I "C1'" 1 
ATOM   6311  N  N1    . DC  I 6  16   ? 144.756 106.296 170.522 1.00 157.18 ?  -57  DC  I N1    1 
ATOM   6312  C  C2    . DC  I 6  16   ? 143.746 107.102 169.977 1.00 157.30 ?  -57  DC  I C2    1 
ATOM   6313  O  O2    . DC  I 6  16   ? 143.905 108.327 169.921 1.00 157.20 ?  -57  DC  I O2    1 
ATOM   6314  N  N3    . DC  I 6  16   ? 142.603 106.516 169.540 1.00 157.24 ?  -57  DC  I N3    1 
ATOM   6315  C  C4    . DC  I 6  16   ? 142.458 105.192 169.623 1.00 157.17 ?  -57  DC  I C4    1 
ATOM   6316  N  N4    . DC  I 6  16   ? 141.318 104.657 169.174 1.00 157.16 ?  -57  DC  I N4    1 
ATOM   6317  C  C5    . DC  I 6  16   ? 143.475 104.357 170.171 1.00 157.18 ?  -57  DC  I C5    1 
ATOM   6318  C  C6    . DC  I 6  16   ? 144.595 104.945 170.602 1.00 157.18 ?  -57  DC  I C6    1 
ATOM   6319  P  P     . DC  I 6  17   ? 149.531 107.975 173.528 1.00 155.86 ?  -56  DC  I P     1 
ATOM   6320  O  OP1   . DC  I 6  17   ? 150.852 108.085 172.870 1.00 155.87 ?  -56  DC  I OP1   1 
ATOM   6321  O  OP2   . DC  I 6  17   ? 149.297 106.920 174.539 1.00 155.72 ?  -56  DC  I OP2   1 
ATOM   6322  O  "O5'" . DC  I 6  17   ? 149.165 109.382 174.194 1.00 154.68 ?  -56  DC  I "O5'" 1 
ATOM   6323  C  "C5'" . DC  I 6  17   ? 148.846 110.497 173.368 1.00 152.91 ?  -56  DC  I "C5'" 1 
ATOM   6324  C  "C4'" . DC  I 6  17   ? 147.555 111.159 173.821 1.00 151.47 ?  -56  DC  I "C4'" 1 
ATOM   6325  O  "O4'" . DC  I 6  17   ? 146.422 110.315 173.474 1.00 151.07 ?  -56  DC  I "O4'" 1 
ATOM   6326  C  "C3'" . DC  I 6  17   ? 147.448 111.410 175.324 1.00 150.70 ?  -56  DC  I "C3'" 1 
ATOM   6327  O  "O3'" . DC  I 6  17   ? 146.812 112.659 175.561 1.00 149.52 ?  -56  DC  I "O3'" 1 
ATOM   6328  C  "C2'" . DC  I 6  17   ? 146.582 110.246 175.799 1.00 150.79 ?  -56  DC  I "C2'" 1 
ATOM   6329  C  "C1'" . DC  I 6  17   ? 145.632 110.095 174.623 1.00 150.70 ?  -56  DC  I "C1'" 1 
ATOM   6330  N  N1    . DC  I 6  17   ? 145.009 108.742 174.520 1.00 150.51 ?  -56  DC  I N1    1 
ATOM   6331  C  C2    . DC  I 6  17   ? 143.745 108.604 173.935 1.00 150.33 ?  -56  DC  I C2    1 
ATOM   6332  O  O2    . DC  I 6  17   ? 143.163 109.610 173.512 1.00 150.38 ?  -56  DC  I O2    1 
ATOM   6333  N  N3    . DC  I 6  17   ? 143.193 107.368 173.846 1.00 150.39 ?  -56  DC  I N3    1 
ATOM   6334  C  C4    . DC  I 6  17   ? 143.854 106.307 174.315 1.00 150.69 ?  -56  DC  I C4    1 
ATOM   6335  N  N4    . DC  I 6  17   ? 143.273 105.107 174.206 1.00 150.67 ?  -56  DC  I N4    1 
ATOM   6336  C  C5    . DC  I 6  17   ? 145.141 106.430 174.918 1.00 150.74 ?  -56  DC  I C5    1 
ATOM   6337  C  C6    . DC  I 6  17   ? 145.676 107.652 174.997 1.00 150.67 ?  -56  DC  I C6    1 
ATOM   6338  P  P     . DG  I 6  18   ? 147.655 113.905 176.125 1.00 148.21 ?  -55  DG  I P     1 
ATOM   6339  O  OP1   . DG  I 6  18   ? 148.543 114.374 175.038 1.00 148.02 ?  -55  DG  I OP1   1 
ATOM   6340  O  OP2   . DG  I 6  18   ? 148.232 113.505 177.427 1.00 148.03 ?  -55  DG  I OP2   1 
ATOM   6341  O  "O5'" . DG  I 6  18   ? 146.545 115.024 176.403 1.00 148.12 ?  -55  DG  I "O5'" 1 
ATOM   6342  C  "C5'" . DG  I 6  18   ? 145.772 115.548 175.326 1.00 148.30 ?  -55  DG  I "C5'" 1 
ATOM   6343  C  "C4'" . DG  I 6  18   ? 144.294 115.602 175.685 1.00 148.35 ?  -55  DG  I "C4'" 1 
ATOM   6344  O  "O4'" . DG  I 6  18   ? 143.752 114.255 175.740 1.00 148.72 ?  -55  DG  I "O4'" 1 
ATOM   6345  C  "C3'" . DG  I 6  18   ? 143.968 116.232 177.037 1.00 148.27 ?  -55  DG  I "C3'" 1 
ATOM   6346  O  "O3'" . DG  I 6  18   ? 142.714 116.903 176.962 1.00 147.47 ?  -55  DG  I "O3'" 1 
ATOM   6347  C  "C2'" . DG  I 6  18   ? 143.888 115.014 177.950 1.00 148.84 ?  -55  DG  I "C2'" 1 
ATOM   6348  C  "C1'" . DG  I 6  18   ? 143.214 114.012 177.025 1.00 149.64 ?  -55  DG  I "C1'" 1 
ATOM   6349  N  N9    . DG  I 6  18   ? 143.468 112.616 177.370 1.00 149.95 ?  -55  DG  I N9    1 
ATOM   6350  C  C8    . DG  I 6  18   ? 144.583 112.103 177.987 1.00 150.11 ?  -55  DG  I C8    1 
ATOM   6351  N  N7    . DG  I 6  18   ? 144.531 110.811 178.159 1.00 150.06 ?  -55  DG  I N7    1 
ATOM   6352  C  C5    . DG  I 6  18   ? 143.308 110.442 177.614 1.00 150.19 ?  -55  DG  I C5    1 
ATOM   6353  C  C6    . DG  I 6  18   ? 142.702 109.167 177.510 1.00 150.07 ?  -55  DG  I C6    1 
ATOM   6354  O  O6    . DG  I 6  18   ? 143.144 108.073 177.890 1.00 150.14 ?  -55  DG  I O6    1 
ATOM   6355  N  N1    . DG  I 6  18   ? 141.456 109.237 176.891 1.00 150.09 ?  -55  DG  I N1    1 
ATOM   6356  C  C2    . DG  I 6  18   ? 140.870 110.394 176.433 1.00 150.14 ?  -55  DG  I C2    1 
ATOM   6357  N  N2    . DG  I 6  18   ? 139.663 110.269 175.862 1.00 150.17 ?  -55  DG  I N2    1 
ATOM   6358  N  N3    . DG  I 6  18   ? 141.428 111.594 176.524 1.00 150.06 ?  -55  DG  I N3    1 
ATOM   6359  C  C4    . DG  I 6  18   ? 142.642 111.542 177.124 1.00 150.13 ?  -55  DG  I C4    1 
ATOM   6360  P  P     . DA  I 6  19   ? 142.506 118.330 177.672 1.00 147.11 ?  -54  DA  I P     1 
ATOM   6361  O  OP1   . DA  I 6  19   ? 143.144 119.351 176.813 1.00 147.28 ?  -54  DA  I OP1   1 
ATOM   6362  O  OP2   . DA  I 6  19   ? 142.920 118.193 179.086 1.00 147.00 ?  -54  DA  I OP2   1 
ATOM   6363  O  "O5'" . DA  I 6  19   ? 140.919 118.548 177.644 1.00 147.24 ?  -54  DA  I "O5'" 1 
ATOM   6364  C  "C5'" . DA  I 6  19   ? 140.261 118.858 176.417 1.00 147.67 ?  -54  DA  I "C5'" 1 
ATOM   6365  C  "C4'" . DA  I 6  19   ? 138.847 118.291 176.383 1.00 147.89 ?  -54  DA  I "C4'" 1 
ATOM   6366  O  "O4'" . DA  I 6  19   ? 138.889 116.850 176.541 1.00 148.06 ?  -54  DA  I "O4'" 1 
ATOM   6367  C  "C3'" . DA  I 6  19   ? 137.904 118.794 177.468 1.00 147.96 ?  -54  DA  I "C3'" 1 
ATOM   6368  O  "O3'" . DA  I 6  19   ? 136.567 118.815 176.965 1.00 148.21 ?  -54  DA  I "O3'" 1 
ATOM   6369  C  "C2'" . DA  I 6  19   ? 138.081 117.753 178.572 1.00 148.16 ?  -54  DA  I "C2'" 1 
ATOM   6370  C  "C1'" . DA  I 6  19   ? 138.307 116.471 177.776 1.00 148.86 ?  -54  DA  I "C1'" 1 
ATOM   6371  N  N9    . DA  I 6  19   ? 139.219 115.536 178.427 1.00 149.20 ?  -54  DA  I N9    1 
ATOM   6372  C  C8    . DA  I 6  19   ? 140.488 115.800 178.859 1.00 149.32 ?  -54  DA  I C8    1 
ATOM   6373  N  N7    . DA  I 6  19   ? 141.089 114.770 179.399 1.00 149.45 ?  -54  DA  I N7    1 
ATOM   6374  C  C5    . DA  I 6  19   ? 140.157 113.753 179.308 1.00 149.48 ?  -54  DA  I C5    1 
ATOM   6375  C  C6    . DA  I 6  19   ? 140.191 112.405 179.705 1.00 149.29 ?  -54  DA  I C6    1 
ATOM   6376  N  N6    . DA  I 6  19   ? 141.251 111.844 180.293 1.00 149.27 ?  -54  DA  I N6    1 
ATOM   6377  N  N1    . DA  I 6  19   ? 139.093 111.656 179.475 1.00 149.19 ?  -54  DA  I N1    1 
ATOM   6378  C  C2    . DA  I 6  19   ? 138.035 112.228 178.884 1.00 149.16 ?  -54  DA  I C2    1 
ATOM   6379  N  N3    . DA  I 6  19   ? 137.887 113.487 178.466 1.00 149.27 ?  -54  DA  I N3    1 
ATOM   6380  C  C4    . DA  I 6  19   ? 138.996 114.204 178.710 1.00 149.46 ?  -54  DA  I C4    1 
ATOM   6381  P  P     . DG  I 6  20   ? 135.321 119.114 177.937 1.00 148.20 ?  -53  DG  I P     1 
ATOM   6382  O  OP1   . DG  I 6  20   ? 134.294 119.804 177.129 1.00 147.79 ?  -53  DG  I OP1   1 
ATOM   6383  O  OP2   . DG  I 6  20   ? 135.814 119.748 179.180 1.00 147.76 ?  -53  DG  I OP2   1 
ATOM   6384  O  "O5'" . DG  I 6  20   ? 134.758 117.662 178.293 1.00 148.81 ?  -53  DG  I "O5'" 1 
ATOM   6385  C  "C5'" . DG  I 6  20   ? 134.069 116.902 177.300 1.00 149.15 ?  -53  DG  I "C5'" 1 
ATOM   6386  C  "C4'" . DG  I 6  20   ? 133.089 115.923 177.933 1.00 149.52 ?  -53  DG  I "C4'" 1 
ATOM   6387  O  "O4'" . DG  I 6  20   ? 133.813 114.836 178.559 1.00 149.44 ?  -53  DG  I "O4'" 1 
ATOM   6388  C  "C3'" . DG  I 6  20   ? 132.195 116.501 179.018 1.00 149.75 ?  -53  DG  I "C3'" 1 
ATOM   6389  O  "O3'" . DG  I 6  20   ? 130.940 115.830 179.025 1.00 150.52 ?  -53  DG  I "O3'" 1 
ATOM   6390  C  "C2'" . DG  I 6  20   ? 132.984 116.228 180.296 1.00 149.68 ?  -53  DG  I "C2'" 1 
ATOM   6391  C  "C1'" . DG  I 6  20   ? 133.729 114.932 179.970 1.00 149.92 ?  -53  DG  I "C1'" 1 
ATOM   6392  N  N9    . DG  I 6  20   ? 135.088 114.903 180.500 1.00 150.06 ?  -53  DG  I N9    1 
ATOM   6393  C  C8    . DG  I 6  20   ? 136.011 115.916 180.443 1.00 150.11 ?  -53  DG  I C8    1 
ATOM   6394  N  N7    . DG  I 6  20   ? 137.154 115.614 180.989 1.00 150.21 ?  -53  DG  I N7    1 
ATOM   6395  C  C5    . DG  I 6  20   ? 136.981 114.313 181.439 1.00 150.27 ?  -53  DG  I C5    1 
ATOM   6396  C  C6    . DG  I 6  20   ? 137.883 113.459 182.112 1.00 150.17 ?  -53  DG  I C6    1 
ATOM   6397  O  O6    . DG  I 6  20   ? 139.047 113.694 182.461 1.00 149.94 ?  -53  DG  I O6    1 
ATOM   6398  N  N1    . DG  I 6  20   ? 137.311 112.220 182.392 1.00 150.11 ?  -53  DG  I N1    1 
ATOM   6399  C  C2    . DG  I 6  20   ? 136.028 111.852 182.057 1.00 149.98 ?  -53  DG  I C2    1 
ATOM   6400  N  N2    . DG  I 6  20   ? 135.653 110.610 182.409 1.00 150.07 ?  -53  DG  I N2    1 
ATOM   6401  N  N3    . DG  I 6  20   ? 135.171 112.644 181.422 1.00 149.91 ?  -53  DG  I N3    1 
ATOM   6402  C  C4    . DG  I 6  20   ? 135.715 113.856 181.145 1.00 150.13 ?  -53  DG  I C4    1 
ATOM   6403  P  P     . DG  I 6  21   ? 129.834 116.193 180.133 1.00 151.26 ?  -52  DG  I P     1 
ATOM   6404  O  OP1   . DG  I 6  21   ? 128.509 115.841 179.576 1.00 150.93 ?  -52  DG  I OP1   1 
ATOM   6405  O  OP2   . DG  I 6  21   ? 130.091 117.575 180.594 1.00 151.29 ?  -52  DG  I OP2   1 
ATOM   6406  O  "O5'" . DG  I 6  21   ? 130.166 115.199 181.343 1.00 151.28 ?  -52  DG  I "O5'" 1 
ATOM   6407  C  "C5'" . DG  I 6  21   ? 130.287 113.803 181.099 1.00 151.57 ?  -52  DG  I "C5'" 1 
ATOM   6408  C  "C4'" . DG  I 6  21   ? 130.725 113.068 182.354 1.00 151.93 ?  -52  DG  I "C4'" 1 
ATOM   6409  O  "O4'" . DG  I 6  21   ? 132.158 113.218 182.540 1.00 152.11 ?  -52  DG  I "O4'" 1 
ATOM   6410  C  "C3'" . DG  I 6  21   ? 130.071 113.553 183.651 1.00 152.22 ?  -52  DG  I "C3'" 1 
ATOM   6411  O  "O3'" . DG  I 6  21   ? 129.626 112.438 184.412 1.00 152.23 ?  -52  DG  I "O3'" 1 
ATOM   6412  C  "C2'" . DG  I 6  21   ? 131.201 114.302 184.358 1.00 152.40 ?  -52  DG  I "C2'" 1 
ATOM   6413  C  "C1'" . DG  I 6  21   ? 132.417 113.524 183.889 1.00 152.42 ?  -52  DG  I "C1'" 1 
ATOM   6414  N  N9    . DG  I 6  21   ? 133.666 114.281 183.964 1.00 152.35 ?  -52  DG  I N9    1 
ATOM   6415  C  C8    . DG  I 6  21   ? 133.919 115.514 183.416 1.00 152.41 ?  -52  DG  I C8    1 
ATOM   6416  N  N7    . DG  I 6  21   ? 135.128 115.947 183.640 1.00 152.46 ?  -52  DG  I N7    1 
ATOM   6417  C  C5    . DG  I 6  21   ? 135.717 114.937 184.389 1.00 152.50 ?  -52  DG  I C5    1 
ATOM   6418  C  C6    . DG  I 6  21   ? 137.023 114.846 184.926 1.00 152.55 ?  -52  DG  I C6    1 
ATOM   6419  O  O6    . DG  I 6  21   ? 137.947 115.667 184.842 1.00 152.51 ?  -52  DG  I O6    1 
ATOM   6420  N  N1    . DG  I 6  21   ? 137.214 113.653 185.620 1.00 152.58 ?  -52  DG  I N1    1 
ATOM   6421  C  C2    . DG  I 6  21   ? 136.260 112.673 185.777 1.00 152.66 ?  -52  DG  I C2    1 
ATOM   6422  N  N2    . DG  I 6  21   ? 136.624 111.588 186.479 1.00 152.56 ?  -52  DG  I N2    1 
ATOM   6423  N  N3    . DG  I 6  21   ? 135.031 112.747 185.277 1.00 152.64 ?  -52  DG  I N3    1 
ATOM   6424  C  C4    . DG  I 6  21   ? 134.832 113.902 184.595 1.00 152.44 ?  -52  DG  I C4    1 
ATOM   6425  P  P     . DC  I 6  22   ? 128.578 112.637 185.613 1.00 152.10 ?  -51  DC  I P     1 
ATOM   6426  O  OP1   . DC  I 6  22   ? 127.430 111.740 185.355 1.00 151.95 ?  -51  DC  I OP1   1 
ATOM   6427  O  OP2   . DC  I 6  22   ? 128.348 114.089 185.788 1.00 151.64 ?  -51  DC  I OP2   1 
ATOM   6428  O  "O5'" . DC  I 6  22   ? 129.369 112.105 186.898 1.00 152.07 ?  -51  DC  I "O5'" 1 
ATOM   6429  C  "C5'" . DC  I 6  22   ? 129.859 110.769 186.924 1.00 152.12 ?  -51  DC  I "C5'" 1 
ATOM   6430  C  "C4'" . DC  I 6  22   ? 130.884 110.589 188.029 1.00 152.15 ?  -51  DC  I "C4'" 1 
ATOM   6431  O  "O4'" . DC  I 6  22   ? 132.092 111.324 187.698 1.00 152.03 ?  -51  DC  I "O4'" 1 
ATOM   6432  C  "C3'" . DC  I 6  22   ? 130.443 111.085 189.409 1.00 152.26 ?  -51  DC  I "C3'" 1 
ATOM   6433  O  "O3'" . DC  I 6  22   ? 130.749 110.111 190.398 1.00 152.39 ?  -51  DC  I "O3'" 1 
ATOM   6434  C  "C2'" . DC  I 6  22   ? 131.256 112.363 189.609 1.00 152.09 ?  -51  DC  I "C2'" 1 
ATOM   6435  C  "C1'" . DC  I 6  22   ? 132.519 112.050 188.825 1.00 151.82 ?  -51  DC  I "C1'" 1 
ATOM   6436  N  N1    . DC  I 6  22   ? 133.242 113.266 188.358 1.00 151.78 ?  -51  DC  I N1    1 
ATOM   6437  C  C2    . DC  I 6  22   ? 134.543 113.516 188.809 1.00 151.65 ?  -51  DC  I C2    1 
ATOM   6438  O  O2    . DC  I 6  22   ? 135.070 112.719 189.594 1.00 151.50 ?  -51  DC  I O2    1 
ATOM   6439  N  N3    . DC  I 6  22   ? 135.183 114.631 188.376 1.00 151.56 ?  -51  DC  I N3    1 
ATOM   6440  C  C4    . DC  I 6  22   ? 134.573 115.467 187.532 1.00 151.56 ?  -51  DC  I C4    1 
ATOM   6441  N  N4    . DC  I 6  22   ? 135.243 116.553 187.132 1.00 151.55 ?  -51  DC  I N4    1 
ATOM   6442  C  C5    . DC  I 6  22   ? 133.248 115.228 187.065 1.00 151.56 ?  -51  DC  I C5    1 
ATOM   6443  C  C6    . DC  I 6  22   ? 132.628 114.126 187.498 1.00 151.74 ?  -51  DC  I C6    1 
ATOM   6444  P  P     . DC  I 6  23   ? 130.071 110.199 191.853 1.00 152.29 ?  -50  DC  I P     1 
ATOM   6445  O  OP1   . DC  I 6  23   ? 129.701 108.824 192.258 1.00 152.00 ?  -50  DC  I OP1   1 
ATOM   6446  O  OP2   . DC  I 6  23   ? 129.036 111.255 191.804 1.00 151.75 ?  -50  DC  I OP2   1 
ATOM   6447  O  "O5'" . DC  I 6  23   ? 131.254 110.715 192.798 1.00 152.23 ?  -50  DC  I "O5'" 1 
ATOM   6448  C  "C5'" . DC  I 6  23   ? 132.401 109.899 193.011 1.00 152.21 ?  -50  DC  I "C5'" 1 
ATOM   6449  C  "C4'" . DC  I 6  23   ? 133.384 110.577 193.951 1.00 152.37 ?  -50  DC  I "C4'" 1 
ATOM   6450  O  "O4'" . DC  I 6  23   ? 134.141 111.581 193.226 1.00 152.46 ?  -50  DC  I "O4'" 1 
ATOM   6451  C  "C3'" . DC  I 6  23   ? 132.749 111.295 195.144 1.00 152.56 ?  -50  DC  I "C3'" 1 
ATOM   6452  O  "O3'" . DC  I 6  23   ? 133.484 111.013 196.327 1.00 152.76 ?  -50  DC  I "O3'" 1 
ATOM   6453  C  "C2'" . DC  I 6  23   ? 132.842 112.771 194.761 1.00 152.49 ?  -50  DC  I "C2'" 1 
ATOM   6454  C  "C1'" . DC  I 6  23   ? 134.118 112.799 193.935 1.00 152.41 ?  -50  DC  I "C1'" 1 
ATOM   6455  N  N1    . DC  I 6  23   ? 134.159 113.913 192.948 1.00 152.43 ?  -50  DC  I N1    1 
ATOM   6456  C  C2    . DC  I 6  23   ? 135.263 114.773 192.913 1.00 152.16 ?  -50  DC  I C2    1 
ATOM   6457  O  O2    . DC  I 6  23   ? 136.198 114.597 193.704 1.00 152.09 ?  -50  DC  I O2    1 
ATOM   6458  N  N3    . DC  I 6  23   ? 135.280 115.778 192.003 1.00 152.10 ?  -50  DC  I N3    1 
ATOM   6459  C  C4    . DC  I 6  23   ? 134.258 115.937 191.162 1.00 152.18 ?  -50  DC  I C4    1 
ATOM   6460  N  N4    . DC  I 6  23   ? 134.323 116.947 190.288 1.00 152.26 ?  -50  DC  I N4    1 
ATOM   6461  C  C5    . DC  I 6  23   ? 133.122 115.076 191.188 1.00 152.31 ?  -50  DC  I C5    1 
ATOM   6462  C  C6    . DC  I 6  23   ? 133.117 114.085 192.084 1.00 152.56 ?  -50  DC  I C6    1 
ATOM   6463  P  P     . DG  I 6  24   ? 132.929 111.498 197.755 1.00 152.69 ?  -49  DG  I P     1 
ATOM   6464  O  OP1   . DG  I 6  24   ? 133.422 110.545 198.774 1.00 152.87 ?  -49  DG  I OP1   1 
ATOM   6465  O  OP2   . DG  I 6  24   ? 131.476 111.739 197.615 1.00 152.50 ?  -49  DG  I OP2   1 
ATOM   6466  O  "O5'" . DG  I 6  24   ? 133.642 112.911 197.982 1.00 151.71 ?  -49  DG  I "O5'" 1 
ATOM   6467  C  "C5'" . DG  I 6  24   ? 135.062 112.989 198.041 1.00 151.19 ?  -49  DG  I "C5'" 1 
ATOM   6468  C  "C4'" . DG  I 6  24   ? 135.530 114.431 198.150 1.00 151.07 ?  -49  DG  I "C4'" 1 
ATOM   6469  O  "O4'" . DG  I 6  24   ? 135.410 115.092 196.860 1.00 151.15 ?  -49  DG  I "O4'" 1 
ATOM   6470  C  "C3'" . DG  I 6  24   ? 134.743 115.307 199.133 1.00 150.62 ?  -49  DG  I "C3'" 1 
ATOM   6471  O  "O3'" . DG  I 6  24   ? 135.622 116.248 199.737 1.00 149.80 ?  -49  DG  I "O3'" 1 
ATOM   6472  C  "C2'" . DG  I 6  24   ? 133.774 116.022 198.200 1.00 150.76 ?  -49  DG  I "C2'" 1 
ATOM   6473  C  "C1'" . DG  I 6  24   ? 134.721 116.304 197.053 1.00 150.93 ?  -49  DG  I "C1'" 1 
ATOM   6474  N  N9    . DG  I 6  24   ? 134.082 116.702 195.804 1.00 150.91 ?  -49  DG  I N9    1 
ATOM   6475  C  C8    . DG  I 6  24   ? 132.928 116.201 195.252 1.00 151.02 ?  -49  DG  I C8    1 
ATOM   6476  N  N7    . DG  I 6  24   ? 132.613 116.763 194.115 1.00 151.24 ?  -49  DG  I N7    1 
ATOM   6477  C  C5    . DG  I 6  24   ? 133.624 117.693 193.904 1.00 151.14 ?  -49  DG  I C5    1 
ATOM   6478  C  C6    . DG  I 6  24   ? 133.826 118.605 192.838 1.00 150.99 ?  -49  DG  I C6    1 
ATOM   6479  O  O6    . DG  I 6  24   ? 133.127 118.776 191.828 1.00 150.87 ?  -49  DG  I O6    1 
ATOM   6480  N  N1    . DG  I 6  24   ? 134.979 119.365 193.022 1.00 151.04 ?  -49  DG  I N1    1 
ATOM   6481  C  C2    . DG  I 6  24   ? 135.828 119.258 194.101 1.00 151.06 ?  -49  DG  I C2    1 
ATOM   6482  N  N2    . DG  I 6  24   ? 136.895 120.074 194.111 1.00 150.94 ?  -49  DG  I N2    1 
ATOM   6483  N  N3    . DG  I 6  24   ? 135.649 118.411 195.101 1.00 151.21 ?  -49  DG  I N3    1 
ATOM   6484  C  C4    . DG  I 6  24   ? 134.532 117.665 194.937 1.00 151.16 ?  -49  DG  I C4    1 
ATOM   6485  P  P     . DC  I 6  25   ? 136.507 115.865 201.022 1.00 149.28 ?  -48  DC  I P     1 
ATOM   6486  O  OP1   . DC  I 6  25   ? 137.322 114.670 200.708 1.00 149.08 ?  -48  DC  I OP1   1 
ATOM   6487  O  OP2   . DC  I 6  25   ? 135.604 115.851 202.193 1.00 149.21 ?  -48  DC  I OP2   1 
ATOM   6488  O  "O5'" . DC  I 6  25   ? 137.488 117.120 201.175 1.00 148.28 ?  -48  DC  I "O5'" 1 
ATOM   6489  C  "C5'" . DC  I 6  25   ? 137.907 117.841 200.013 1.00 146.77 ?  -48  DC  I "C5'" 1 
ATOM   6490  C  "C4'" . DC  I 6  25   ? 137.746 119.337 200.221 1.00 145.42 ?  -48  DC  I "C4'" 1 
ATOM   6491  O  "O4'" . DC  I 6  25   ? 137.004 119.909 199.106 1.00 145.32 ?  -48  DC  I "O4'" 1 
ATOM   6492  C  "C3'" . DC  I 6  25   ? 136.949 119.721 201.465 1.00 144.47 ?  -48  DC  I "C3'" 1 
ATOM   6493  O  "O3'" . DC  I 6  25   ? 137.332 121.024 201.916 1.00 142.62 ?  -48  DC  I "O3'" 1 
ATOM   6494  C  "C2'" . DC  I 6  25   ? 135.538 119.749 200.903 1.00 144.91 ?  -48  DC  I "C2'" 1 
ATOM   6495  C  "C1'" . DC  I 6  25   ? 135.810 120.483 199.601 1.00 145.40 ?  -48  DC  I "C1'" 1 
ATOM   6496  N  N1    . DC  I 6  25   ? 134.737 120.345 198.574 1.00 145.60 ?  -48  DC  I N1    1 
ATOM   6497  C  C2    . DC  I 6  25   ? 134.801 121.110 197.404 1.00 145.98 ?  -48  DC  I C2    1 
ATOM   6498  O  O2    . DC  I 6  25   ? 135.744 121.894 197.242 1.00 145.92 ?  -48  DC  I O2    1 
ATOM   6499  N  N3    . DC  I 6  25   ? 133.817 120.986 196.480 1.00 146.07 ?  -48  DC  I N3    1 
ATOM   6500  C  C4    . DC  I 6  25   ? 132.810 120.135 196.690 1.00 145.69 ?  -48  DC  I C4    1 
ATOM   6501  N  N4    . DC  I 6  25   ? 131.865 120.042 195.749 1.00 145.63 ?  -48  DC  I N4    1 
ATOM   6502  C  C5    . DC  I 6  25   ? 132.726 119.347 197.876 1.00 145.64 ?  -48  DC  I C5    1 
ATOM   6503  C  C6    . DC  I 6  25   ? 133.700 119.484 198.783 1.00 145.56 ?  -48  DC  I C6    1 
ATOM   6504  P  P     . DT  I 6  26   ? 138.848 121.361 202.337 1.00 140.51 ?  -47  DT  I P     1 
ATOM   6505  O  OP1   . DT  I 6  26   ? 139.590 120.100 202.564 1.00 140.63 ?  -47  DT  I OP1   1 
ATOM   6506  O  OP2   . DT  I 6  26   ? 138.774 122.355 203.430 1.00 140.32 ?  -47  DT  I OP2   1 
ATOM   6507  O  "O5'" . DT  I 6  26   ? 139.440 122.116 201.054 1.00 138.88 ?  -47  DT  I "O5'" 1 
ATOM   6508  C  "C5'" . DT  I 6  26   ? 138.560 122.820 200.176 1.00 135.88 ?  -47  DT  I "C5'" 1 
ATOM   6509  C  "C4'" . DT  I 6  26   ? 139.077 124.216 199.876 1.00 134.09 ?  -47  DT  I "C4'" 1 
ATOM   6510  O  "O4'" . DT  I 6  26   ? 138.107 124.926 199.078 1.00 134.06 ?  -47  DT  I "O4'" 1 
ATOM   6511  C  "C3'" . DT  I 6  26   ? 139.273 125.103 201.086 1.00 132.87 ?  -47  DT  I "C3'" 1 
ATOM   6512  O  "O3'" . DT  I 6  26   ? 140.205 126.137 200.766 1.00 131.02 ?  -47  DT  I "O3'" 1 
ATOM   6513  C  "C2'" . DT  I 6  26   ? 137.858 125.649 201.328 1.00 133.46 ?  -47  DT  I "C2'" 1 
ATOM   6514  C  "C1'" . DT  I 6  26   ? 137.220 125.627 199.931 1.00 134.07 ?  -47  DT  I "C1'" 1 
ATOM   6515  N  N1    . DT  I 6  26   ? 135.897 124.929 199.888 1.00 134.24 ?  -47  DT  I N1    1 
ATOM   6516  C  C2    . DT  I 6  26   ? 135.085 125.087 198.786 1.00 134.24 ?  -47  DT  I C2    1 
ATOM   6517  O  O2    . DT  I 6  26   ? 135.380 125.789 197.835 1.00 134.12 ?  -47  DT  I O2    1 
ATOM   6518  N  N3    . DT  I 6  26   ? 133.905 124.391 198.840 1.00 134.35 ?  -47  DT  I N3    1 
ATOM   6519  C  C4    . DT  I 6  26   ? 133.469 123.567 199.863 1.00 134.25 ?  -47  DT  I C4    1 
ATOM   6520  O  O4    . DT  I 6  26   ? 132.392 122.981 199.822 1.00 134.02 ?  -47  DT  I O4    1 
ATOM   6521  C  C5    . DT  I 6  26   ? 134.369 123.443 200.984 1.00 134.10 ?  -47  DT  I C5    1 
ATOM   6522  C  C7    . DT  I 6  26   ? 134.000 122.581 202.154 1.00 134.01 ?  -47  DT  I C7    1 
ATOM   6523  C  C6    . DT  I 6  26   ? 135.524 124.121 200.942 1.00 133.92 ?  -47  DT  I C6    1 
ATOM   6524  P  P     . DC  I 6  27   ? 140.355 127.443 201.691 1.00 129.34 ?  -46  DC  I P     1 
ATOM   6525  O  OP1   . DC  I 6  27   ? 141.729 127.954 201.490 1.00 128.91 ?  -46  DC  I OP1   1 
ATOM   6526  O  OP2   . DC  I 6  27   ? 139.899 127.128 203.063 1.00 128.78 ?  -46  DC  I OP2   1 
ATOM   6527  O  "O5'" . DC  I 6  27   ? 139.335 128.484 201.033 1.00 127.45 ?  -46  DC  I "O5'" 1 
ATOM   6528  C  "C5'" . DC  I 6  27   ? 139.377 128.722 199.627 1.00 125.07 ?  -46  DC  I "C5'" 1 
ATOM   6529  C  "C4'" . DC  I 6  27   ? 138.262 129.660 199.195 1.00 123.49 ?  -46  DC  I "C4'" 1 
ATOM   6530  O  "O4'" . DC  I 6  27   ? 136.989 128.959 199.222 1.00 123.81 ?  -46  DC  I "O4'" 1 
ATOM   6531  C  "C3'" . DC  I 6  27   ? 138.079 130.895 200.072 1.00 121.97 ?  -46  DC  I "C3'" 1 
ATOM   6532  O  "O3'" . DC  I 6  27   ? 137.704 132.006 199.266 1.00 119.73 ?  -46  DC  I "O3'" 1 
ATOM   6533  C  "C2'" . DC  I 6  27   ? 136.948 130.472 201.003 1.00 122.24 ?  -46  DC  I "C2'" 1 
ATOM   6534  C  "C1'" . DC  I 6  27   ? 136.084 129.652 200.057 1.00 123.16 ?  -46  DC  I "C1'" 1 
ATOM   6535  N  N1    . DC  I 6  27   ? 135.222 128.649 200.747 1.00 123.48 ?  -46  DC  I N1    1 
ATOM   6536  C  C2    . DC  I 6  27   ? 134.024 128.235 200.151 1.00 123.40 ?  -46  DC  I C2    1 
ATOM   6537  O  O2    . DC  I 6  27   ? 133.695 128.714 199.060 1.00 123.10 ?  -46  DC  I O2    1 
ATOM   6538  N  N3    . DC  I 6  27   ? 133.255 127.318 200.791 1.00 123.53 ?  -46  DC  I N3    1 
ATOM   6539  C  C4    . DC  I 6  27   ? 133.645 126.825 201.969 1.00 123.47 ?  -46  DC  I C4    1 
ATOM   6540  N  N4    . DC  I 6  27   ? 132.858 125.922 202.564 1.00 123.26 ?  -46  DC  I N4    1 
ATOM   6541  C  C5    . DC  I 6  27   ? 134.862 127.234 202.589 1.00 123.43 ?  -46  DC  I C5    1 
ATOM   6542  C  C6    . DC  I 6  27   ? 135.610 128.140 201.951 1.00 123.54 ?  -46  DC  I C6    1 
ATOM   6543  P  P     . DA  I 6  28   ? 138.684 133.272 199.122 1.00 117.73 ?  -45  DA  I P     1 
ATOM   6544  O  OP1   . DA  I 6  28   ? 139.898 132.819 198.408 1.00 117.23 ?  -45  DA  I OP1   1 
ATOM   6545  O  OP2   . DA  I 6  28   ? 138.807 133.898 200.457 1.00 117.17 ?  -45  DA  I OP2   1 
ATOM   6546  O  "O5'" . DA  I 6  28   ? 137.875 134.281 198.179 1.00 115.96 ?  -45  DA  I "O5'" 1 
ATOM   6547  C  "C5'" . DA  I 6  28   ? 137.659 133.960 196.806 1.00 112.72 ?  -45  DA  I "C5'" 1 
ATOM   6548  C  "C4'" . DA  I 6  28   ? 136.191 134.108 196.429 1.00 109.86 ?  -45  DA  I "C4'" 1 
ATOM   6549  O  "O4'" . DA  I 6  28   ? 135.385 133.212 197.240 1.00 109.20 ?  -45  DA  I "O4'" 1 
ATOM   6550  C  "C3'" . DA  I 6  28   ? 135.594 135.497 196.640 1.00 108.30 ?  -45  DA  I "C3'" 1 
ATOM   6551  O  "O3'" . DA  I 6  28   ? 134.575 135.729 195.671 1.00 106.18 ?  -45  DA  I "O3'" 1 
ATOM   6552  C  "C2'" . DA  I 6  28   ? 135.007 135.381 198.041 1.00 108.34 ?  -45  DA  I "C2'" 1 
ATOM   6553  C  "C1'" . DA  I 6  28   ? 134.458 133.962 198.001 1.00 108.74 ?  -45  DA  I "C1'" 1 
ATOM   6554  N  N9    . DA  I 6  28   ? 134.333 133.339 199.315 1.00 108.68 ?  -45  DA  I N9    1 
ATOM   6555  C  C8    . DA  I 6  28   ? 135.224 133.411 200.348 1.00 108.54 ?  -45  DA  I C8    1 
ATOM   6556  N  N7    . DA  I 6  28   ? 134.854 132.742 201.414 1.00 108.55 ?  -45  DA  I N7    1 
ATOM   6557  C  C5    . DA  I 6  28   ? 133.641 132.182 201.052 1.00 108.56 ?  -45  DA  I C5    1 
ATOM   6558  C  C6    . DA  I 6  28   ? 132.734 131.355 201.744 1.00 108.47 ?  -45  DA  I C6    1 
ATOM   6559  N  N6    . DA  I 6  28   ? 132.934 130.932 202.996 1.00 108.68 ?  -45  DA  I N6    1 
ATOM   6560  N  N1    . DA  I 6  28   ? 131.612 130.977 201.097 1.00 108.57 ?  -45  DA  I N1    1 
ATOM   6561  C  C2    . DA  I 6  28   ? 131.417 131.402 199.842 1.00 108.53 ?  -45  DA  I C2    1 
ATOM   6562  N  N3    . DA  I 6  28   ? 132.196 132.181 199.090 1.00 108.87 ?  -45  DA  I N3    1 
ATOM   6563  C  C4    . DA  I 6  28   ? 133.303 132.540 199.761 1.00 108.80 ?  -45  DA  I C4    1 
ATOM   6564  P  P     . DA  I 6  29   ? 134.089 137.223 195.330 1.00 104.41 ?  -44  DA  I P     1 
ATOM   6565  O  OP1   . DA  I 6  29   ? 134.721 137.612 194.050 1.00 104.96 ?  -44  DA  I OP1   1 
ATOM   6566  O  OP2   . DA  I 6  29   ? 134.288 138.064 196.531 1.00 104.76 ?  -44  DA  I OP2   1 
ATOM   6567  O  "O5'" . DA  I 6  29   ? 132.512 137.067 195.096 1.00 104.27 ?  -44  DA  I "O5'" 1 
ATOM   6568  C  "C5'" . DA  I 6  29   ? 132.027 136.303 193.994 1.00 103.18 ?  -44  DA  I "C5'" 1 
ATOM   6569  C  "C4'" . DA  I 6  29   ? 130.619 135.787 194.257 1.00 101.88 ?  -44  DA  I "C4'" 1 
ATOM   6570  O  "O4'" . DA  I 6  29   ? 130.613 134.969 195.455 1.00 101.56 ?  -44  DA  I "O4'" 1 
ATOM   6571  C  "C3'" . DA  I 6  29   ? 129.558 136.861 194.475 1.00 102.38 ?  -44  DA  I "C3'" 1 
ATOM   6572  O  "O3'" . DA  I 6  29   ? 128.317 136.435 193.928 1.00 103.65 ?  -44  DA  I "O3'" 1 
ATOM   6573  C  "C2'" . DA  I 6  29   ? 129.491 136.975 195.995 1.00 101.52 ?  -44  DA  I "C2'" 1 
ATOM   6574  C  "C1'" . DA  I 6  29   ? 129.774 135.544 196.440 1.00 101.33 ?  -44  DA  I "C1'" 1 
ATOM   6575  N  N9    . DA  I 6  29   ? 130.468 135.468 197.721 1.00 101.43 ?  -44  DA  I N9    1 
ATOM   6576  C  C8    . DA  I 6  29   ? 131.686 136.006 198.022 1.00 101.17 ?  -44  DA  I C8    1 
ATOM   6577  N  N7    . DA  I 6  29   ? 132.073 135.786 199.255 1.00 100.85 ?  -44  DA  I N7    1 
ATOM   6578  C  C5    . DA  I 6  29   ? 131.041 135.045 199.801 1.00 101.34 ?  -44  DA  I C5    1 
ATOM   6579  C  C6    . DA  I 6  29   ? 130.847 134.496 201.083 1.00 100.99 ?  -44  DA  I C6    1 
ATOM   6580  N  N6    . DA  I 6  29   ? 131.734 134.619 202.076 1.00 101.34 ?  -44  DA  I N6    1 
ATOM   6581  N  N1    . DA  I 6  29   ? 129.705 133.815 201.304 1.00 101.09 ?  -44  DA  I N1    1 
ATOM   6582  C  C2    . DA  I 6  29   ? 128.821 133.695 200.305 1.00 100.95 ?  -44  DA  I C2    1 
ATOM   6583  N  N3    . DA  I 6  29   ? 128.893 134.167 199.059 1.00 101.34 ?  -44  DA  I N3    1 
ATOM   6584  C  C4    . DA  I 6  29   ? 130.041 134.838 198.870 1.00 101.63 ?  -44  DA  I C4    1 
ATOM   6585  P  P     . DT  I 6  30   ? 127.052 137.426 193.924 1.00 104.44 ?  -43  DT  I P     1 
ATOM   6586  O  OP1   . DT  I 6  30   ? 126.240 137.108 192.728 1.00 103.86 ?  -43  DT  I OP1   1 
ATOM   6587  O  OP2   . DT  I 6  30   ? 127.553 138.803 194.125 1.00 103.88 ?  -43  DT  I OP2   1 
ATOM   6588  O  "O5'" . DT  I 6  30   ? 126.230 137.003 195.230 1.00 106.34 ?  -43  DT  I "O5'" 1 
ATOM   6589  C  "C5'" . DT  I 6  30   ? 125.775 135.663 195.378 1.00 108.34 ?  -43  DT  I "C5'" 1 
ATOM   6590  C  "C4'" . DT  I 6  30   ? 124.745 135.553 196.490 1.00 110.22 ?  -43  DT  I "C4'" 1 
ATOM   6591  O  "O4'" . DT  I 6  30   ? 125.412 135.373 197.768 1.00 110.05 ?  -43  DT  I "O4'" 1 
ATOM   6592  C  "C3'" . DT  I 6  30   ? 123.833 136.768 196.659 1.00 111.69 ?  -43  DT  I "C3'" 1 
ATOM   6593  O  "O3'" . DT  I 6  30   ? 122.517 136.332 196.970 1.00 114.84 ?  -43  DT  I "O3'" 1 
ATOM   6594  C  "C2'" . DT  I 6  30   ? 124.469 137.502 197.838 1.00 110.55 ?  -43  DT  I "C2'" 1 
ATOM   6595  C  "C1'" . DT  I 6  30   ? 124.930 136.330 198.685 1.00 110.66 ?  -43  DT  I "C1'" 1 
ATOM   6596  N  N1    . DT  I 6  30   ? 126.027 136.654 199.643 1.00 111.06 ?  -43  DT  I N1    1 
ATOM   6597  C  C2    . DT  I 6  30   ? 125.858 136.366 200.978 1.00 111.29 ?  -43  DT  I C2    1 
ATOM   6598  O  O2    . DT  I 6  30   ? 124.841 135.869 201.429 1.00 111.45 ?  -43  DT  I O2    1 
ATOM   6599  N  N3    . DT  I 6  30   ? 126.925 136.685 201.773 1.00 111.10 ?  -43  DT  I N3    1 
ATOM   6600  C  C4    . DT  I 6  30   ? 128.123 137.249 201.376 1.00 111.25 ?  -43  DT  I C4    1 
ATOM   6601  O  O4    . DT  I 6  30   ? 129.025 137.501 202.168 1.00 111.24 ?  -43  DT  I O4    1 
ATOM   6602  C  C5    . DT  I 6  30   ? 128.239 137.522 199.964 1.00 111.23 ?  -43  DT  I C5    1 
ATOM   6603  C  C7    . DT  I 6  30   ? 129.492 138.138 199.419 1.00 110.92 ?  -43  DT  I C7    1 
ATOM   6604  C  C6    . DT  I 6  30   ? 127.200 137.210 199.173 1.00 111.37 ?  -43  DT  I C6    1 
ATOM   6605  P  P     . DT  I 6  31   ? 121.241 137.074 196.337 1.00 117.09 ?  -42  DT  I P     1 
ATOM   6606  O  OP1   . DT  I 6  31   ? 120.455 136.054 195.608 1.00 117.19 ?  -42  DT  I OP1   1 
ATOM   6607  O  OP2   . DT  I 6  31   ? 121.723 138.280 195.628 1.00 116.55 ?  -42  DT  I OP2   1 
ATOM   6608  O  "O5'" . DT  I 6  31   ? 120.409 137.553 197.616 1.00 118.59 ?  -42  DT  I "O5'" 1 
ATOM   6609  C  "C5'" . DT  I 6  31   ? 121.054 138.306 198.634 1.00 121.45 ?  -42  DT  I "C5'" 1 
ATOM   6610  C  "C4'" . DT  I 6  31   ? 120.495 137.963 200.002 1.00 124.13 ?  -42  DT  I "C4'" 1 
ATOM   6611  O  "O4'" . DT  I 6  31   ? 121.592 137.691 200.913 1.00 124.89 ?  -42  DT  I "O4'" 1 
ATOM   6612  C  "C3'" . DT  I 6  31   ? 119.702 139.079 200.661 1.00 125.68 ?  -42  DT  I "C3'" 1 
ATOM   6613  O  "O3'" . DT  I 6  31   ? 118.775 138.538 201.593 1.00 128.04 ?  -42  DT  I "O3'" 1 
ATOM   6614  C  "C2'" . DT  I 6  31   ? 120.798 139.865 201.361 1.00 125.76 ?  -42  DT  I "C2'" 1 
ATOM   6615  C  "C1'" . DT  I 6  31   ? 121.708 138.744 201.854 1.00 126.19 ?  -42  DT  I "C1'" 1 
ATOM   6616  N  N1    . DT  I 6  31   ? 123.147 139.140 201.948 1.00 126.66 ?  -42  DT  I N1    1 
ATOM   6617  C  C2    . DT  I 6  31   ? 123.783 139.093 203.170 1.00 126.77 ?  -42  DT  I C2    1 
ATOM   6618  O  O2    . DT  I 6  31   ? 123.233 138.741 204.197 1.00 126.95 ?  -42  DT  I O2    1 
ATOM   6619  N  N3    . DT  I 6  31   ? 125.100 139.475 203.142 1.00 126.67 ?  -42  DT  I N3    1 
ATOM   6620  C  C4    . DT  I 6  31   ? 125.827 139.890 202.042 1.00 126.73 ?  -42  DT  I C4    1 
ATOM   6621  O  O4    . DT  I 6  31   ? 127.006 140.215 202.122 1.00 126.80 ?  -42  DT  I O4    1 
ATOM   6622  C  C5    . DT  I 6  31   ? 125.101 139.918 200.795 1.00 126.90 ?  -42  DT  I C5    1 
ATOM   6623  C  C7    . DT  I 6  31   ? 125.786 140.356 199.535 1.00 126.78 ?  -42  DT  I C7    1 
ATOM   6624  C  C6    . DT  I 6  31   ? 123.812 139.546 200.808 1.00 126.86 ?  -42  DT  I C6    1 
ATOM   6625  P  P     . DG  I 6  32   ? 117.583 139.453 202.166 1.00 129.59 ?  -41  DG  I P     1 
ATOM   6626  O  OP1   . DG  I 6  32   ? 116.533 138.548 202.682 1.00 129.52 ?  -41  DG  I OP1   1 
ATOM   6627  O  OP2   . DG  I 6  32   ? 117.248 140.452 201.127 1.00 129.54 ?  -41  DG  I OP2   1 
ATOM   6628  O  "O5'" . DG  I 6  32   ? 118.247 140.231 203.398 1.00 131.37 ?  -41  DG  I "O5'" 1 
ATOM   6629  C  "C5'" . DG  I 6  32   ? 118.554 139.531 204.599 1.00 134.55 ?  -41  DG  I "C5'" 1 
ATOM   6630  C  "C4'" . DG  I 6  32   ? 119.043 140.485 205.677 1.00 137.25 ?  -41  DG  I "C4'" 1 
ATOM   6631  O  "O4'" . DG  I 6  32   ? 120.483 140.637 205.582 1.00 138.39 ?  -41  DG  I "O4'" 1 
ATOM   6632  C  "C3'" . DG  I 6  32   ? 118.453 141.894 205.616 1.00 138.81 ?  -41  DG  I "C3'" 1 
ATOM   6633  O  "O3'" . DG  I 6  32   ? 118.076 142.318 206.920 1.00 140.36 ?  -41  DG  I "O3'" 1 
ATOM   6634  C  "C2'" . DG  I 6  32   ? 119.596 142.740 205.053 1.00 139.20 ?  -41  DG  I "C2'" 1 
ATOM   6635  C  "C1'" . DG  I 6  32   ? 120.825 142.005 205.568 1.00 139.70 ?  -41  DG  I "C1'" 1 
ATOM   6636  N  N9    . DG  I 6  32   ? 121.992 142.168 204.709 1.00 140.07 ?  -41  DG  I N9    1 
ATOM   6637  C  C8    . DG  I 6  32   ? 122.009 142.153 203.338 1.00 140.18 ?  -41  DG  I C8    1 
ATOM   6638  N  N7    . DG  I 6  32   ? 123.196 142.309 202.828 1.00 140.31 ?  -41  DG  I N7    1 
ATOM   6639  C  C5    . DG  I 6  32   ? 124.024 142.441 203.932 1.00 140.21 ?  -41  DG  I C5    1 
ATOM   6640  C  C6    . DG  I 6  32   ? 125.421 142.637 203.998 1.00 139.88 ?  -41  DG  I C6    1 
ATOM   6641  O  O6    . DG  I 6  32   ? 126.225 142.737 203.061 1.00 139.92 ?  -41  DG  I O6    1 
ATOM   6642  N  N1    . DG  I 6  32   ? 125.867 142.722 205.313 1.00 139.99 ?  -41  DG  I N1    1 
ATOM   6643  C  C2    . DG  I 6  32   ? 125.065 142.622 206.426 1.00 140.17 ?  -41  DG  I C2    1 
ATOM   6644  N  N2    . DG  I 6  32   ? 125.680 142.724 207.615 1.00 140.22 ?  -41  DG  I N2    1 
ATOM   6645  N  N3    . DG  I 6  32   ? 123.751 142.436 206.378 1.00 140.24 ?  -41  DG  I N3    1 
ATOM   6646  C  C4    . DG  I 6  32   ? 123.301 142.356 205.101 1.00 140.22 ?  -41  DG  I C4    1 
ATOM   6647  P  P     . DG  I 6  33   ? 117.239 143.675 207.124 1.00 141.49 ?  -40  DG  I P     1 
ATOM   6648  O  OP1   . DG  I 6  33   ? 116.187 143.400 208.127 1.00 141.43 ?  -40  DG  I OP1   1 
ATOM   6649  O  OP2   . DG  I 6  33   ? 116.861 144.191 205.790 1.00 141.29 ?  -40  DG  I OP2   1 
ATOM   6650  O  "O5'" . DG  I 6  33   ? 118.304 144.681 207.762 1.00 142.11 ?  -40  DG  I "O5'" 1 
ATOM   6651  C  "C5'" . DG  I 6  33   ? 118.977 144.327 208.963 1.00 143.17 ?  -40  DG  I "C5'" 1 
ATOM   6652  C  "C4'" . DG  I 6  33   ? 120.243 145.144 209.139 1.00 144.00 ?  -40  DG  I "C4'" 1 
ATOM   6653  O  "O4'" . DG  I 6  33   ? 121.163 144.849 208.071 1.00 144.73 ?  -40  DG  I "O4'" 1 
ATOM   6654  C  "C3'" . DG  I 6  33   ? 120.045 146.662 209.106 1.00 144.39 ?  -40  DG  I "C3'" 1 
ATOM   6655  O  "O3'" . DG  I 6  33   ? 120.188 147.198 210.415 1.00 144.77 ?  -40  DG  I "O3'" 1 
ATOM   6656  C  "C2'" . DG  I 6  33   ? 121.141 147.180 208.155 1.00 144.84 ?  -40  DG  I "C2'" 1 
ATOM   6657  C  "C1'" . DG  I 6  33   ? 122.011 145.952 207.913 1.00 145.27 ?  -40  DG  I "C1'" 1 
ATOM   6658  N  N9    . DG  I 6  33   ? 122.592 145.907 206.574 1.00 145.39 ?  -40  DG  I N9    1 
ATOM   6659  C  C8    . DG  I 6  33   ? 121.919 145.774 205.383 1.00 145.48 ?  -40  DG  I C8    1 
ATOM   6660  N  N7    . DG  I 6  33   ? 122.704 145.769 204.341 1.00 145.46 ?  -40  DG  I N7    1 
ATOM   6661  C  C5    . DG  I 6  33   ? 123.979 145.908 204.875 1.00 145.51 ?  -40  DG  I C5    1 
ATOM   6662  C  C6    . DG  I 6  33   ? 125.236 145.966 204.230 1.00 145.46 ?  -40  DG  I C6    1 
ATOM   6663  O  O6    . DG  I 6  33   ? 125.481 145.907 203.018 1.00 145.43 ?  -40  DG  I O6    1 
ATOM   6664  N  N1    . DG  I 6  33   ? 126.279 146.112 205.143 1.00 145.51 ?  -40  DG  I N1    1 
ATOM   6665  C  C2    . DG  I 6  33   ? 126.124 146.192 206.507 1.00 145.59 ?  -40  DG  I C2    1 
ATOM   6666  N  N2    . DG  I 6  33   ? 127.246 146.329 207.229 1.00 145.39 ?  -40  DG  I N2    1 
ATOM   6667  N  N3    . DG  I 6  33   ? 124.951 146.137 207.124 1.00 145.75 ?  -40  DG  I N3    1 
ATOM   6668  C  C4    . DG  I 6  33   ? 123.926 145.995 206.248 1.00 145.57 ?  -40  DG  I C4    1 
ATOM   6669  P  P     . DT  I 6  34   ? 119.986 148.771 210.675 1.00 145.08 ?  -39  DT  I P     1 
ATOM   6670  O  OP1   . DT  I 6  34   ? 119.578 148.943 212.087 1.00 145.44 ?  -39  DT  I OP1   1 
ATOM   6671  O  OP2   . DT  I 6  34   ? 119.127 149.301 209.592 1.00 144.78 ?  -39  DT  I OP2   1 
ATOM   6672  O  "O5'" . DT  I 6  34   ? 121.452 149.381 210.483 1.00 144.54 ?  -39  DT  I "O5'" 1 
ATOM   6673  C  "C5'" . DT  I 6  34   ? 122.556 148.806 211.174 1.00 143.87 ?  -39  DT  I "C5'" 1 
ATOM   6674  C  "C4'" . DT  I 6  34   ? 123.848 149.518 210.815 1.00 143.49 ?  -39  DT  I "C4'" 1 
ATOM   6675  O  "O4'" . DT  I 6  34   ? 124.229 149.183 209.454 1.00 143.71 ?  -39  DT  I "O4'" 1 
ATOM   6676  C  "C3'" . DT  I 6  34   ? 123.780 151.047 210.880 1.00 143.21 ?  -39  DT  I "C3'" 1 
ATOM   6677  O  "O3'" . DT  I 6  34   ? 124.910 151.560 211.575 1.00 142.06 ?  -39  DT  I "O3'" 1 
ATOM   6678  C  "C2'" . DT  I 6  34   ? 123.785 151.468 209.411 1.00 143.56 ?  -39  DT  I "C2'" 1 
ATOM   6679  C  "C1'" . DT  I 6  34   ? 124.604 150.357 208.776 1.00 144.10 ?  -39  DT  I "C1'" 1 
ATOM   6680  N  N1    . DT  I 6  34   ? 124.331 150.177 207.319 1.00 144.40 ?  -39  DT  I N1    1 
ATOM   6681  C  C2    . DT  I 6  34   ? 125.379 150.216 206.426 1.00 144.34 ?  -39  DT  I C2    1 
ATOM   6682  O  O2    . DT  I 6  34   ? 126.537 150.385 206.761 1.00 144.31 ?  -39  DT  I O2    1 
ATOM   6683  N  N3    . DT  I 6  34   ? 125.018 150.045 205.115 1.00 144.22 ?  -39  DT  I N3    1 
ATOM   6684  C  C4    . DT  I 6  34   ? 123.742 149.846 204.618 1.00 144.20 ?  -39  DT  I C4    1 
ATOM   6685  O  O4    . DT  I 6  34   ? 123.517 149.702 203.421 1.00 144.20 ?  -39  DT  I O4    1 
ATOM   6686  C  C5    . DT  I 6  34   ? 122.691 149.820 205.609 1.00 144.29 ?  -39  DT  I C5    1 
ATOM   6687  C  C7    . DT  I 6  34   ? 121.266 149.611 205.190 1.00 144.27 ?  -39  DT  I C7    1 
ATOM   6688  C  C6    . DT  I 6  34   ? 123.033 149.986 206.895 1.00 144.40 ?  -39  DT  I C6    1 
ATOM   6689  P  P     . DC  I 6  35   ? 124.901 153.069 212.130 1.00 140.87 ?  -38  DC  I P     1 
ATOM   6690  O  OP1   . DC  I 6  35   ? 125.420 153.040 213.515 1.00 140.47 ?  -38  DC  I OP1   1 
ATOM   6691  O  OP2   . DC  I 6  35   ? 123.565 153.642 211.857 1.00 140.48 ?  -38  DC  I OP2   1 
ATOM   6692  O  "O5'" . DC  I 6  35   ? 125.959 153.826 211.198 1.00 140.43 ?  -38  DC  I "O5'" 1 
ATOM   6693  C  "C5'" . DC  I 6  35   ? 127.329 153.442 211.225 1.00 139.00 ?  -38  DC  I "C5'" 1 
ATOM   6694  C  "C4'" . DC  I 6  35   ? 128.043 153.896 209.964 1.00 137.61 ?  -38  DC  I "C4'" 1 
ATOM   6695  O  "O4'" . DC  I 6  35   ? 127.374 153.345 208.802 1.00 137.57 ?  -38  DC  I "O4'" 1 
ATOM   6696  C  "C3'" . DC  I 6  35   ? 128.089 155.417 209.753 1.00 136.52 ?  -38  DC  I "C3'" 1 
ATOM   6697  O  "O3'" . DC  I 6  35   ? 129.432 155.844 209.542 1.00 134.40 ?  -38  DC  I "O3'" 1 
ATOM   6698  C  "C2'" . DC  I 6  35   ? 127.228 155.643 208.508 1.00 137.04 ?  -38  DC  I "C2'" 1 
ATOM   6699  C  "C1'" . DC  I 6  35   ? 127.363 154.313 207.788 1.00 138.04 ?  -38  DC  I "C1'" 1 
ATOM   6700  N  N1    . DC  I 6  35   ? 126.235 154.032 206.860 1.00 138.41 ?  -38  DC  I N1    1 
ATOM   6701  C  C2    . DC  I 6  35   ? 126.491 153.885 205.495 1.00 138.75 ?  -38  DC  I C2    1 
ATOM   6702  O  O2    . DC  I 6  35   ? 127.655 153.985 205.092 1.00 138.72 ?  -38  DC  I O2    1 
ATOM   6703  N  N3    . DC  I 6  35   ? 125.453 153.643 204.655 1.00 138.63 ?  -38  DC  I N3    1 
ATOM   6704  C  C4    . DC  I 6  35   ? 124.212 153.549 205.138 1.00 138.34 ?  -38  DC  I C4    1 
ATOM   6705  N  N4    . DC  I 6  35   ? 123.219 153.307 204.275 1.00 138.40 ?  -38  DC  I N4    1 
ATOM   6706  C  C5    . DC  I 6  35   ? 123.934 153.700 206.528 1.00 138.36 ?  -38  DC  I C5    1 
ATOM   6707  C  C6    . DC  I 6  35   ? 124.965 153.942 207.344 1.00 138.27 ?  -38  DC  I C6    1 
ATOM   6708  P  P     . DG  I 6  36   ? 129.786 157.412 209.490 1.00 133.11 ?  -37  DG  I P     1 
ATOM   6709  O  OP1   . DG  I 6  36   ? 131.048 157.606 210.238 1.00 133.04 ?  -37  DG  I OP1   1 
ATOM   6710  O  OP2   . DG  I 6  36   ? 128.578 158.170 209.886 1.00 132.66 ?  -37  DG  I OP2   1 
ATOM   6711  O  "O5'" . DG  I 6  36   ? 130.061 157.697 207.939 1.00 133.11 ?  -37  DG  I "O5'" 1 
ATOM   6712  C  "C5'" . DG  I 6  36   ? 131.217 157.149 207.311 1.00 131.21 ?  -37  DG  I "C5'" 1 
ATOM   6713  C  "C4'" . DG  I 6  36   ? 131.330 157.611 205.866 1.00 129.43 ?  -37  DG  I "C4'" 1 
ATOM   6714  O  "O4'" . DG  I 6  36   ? 130.327 156.943 205.057 1.00 129.32 ?  -37  DG  I "O4'" 1 
ATOM   6715  C  "C3'" . DG  I 6  36   ? 131.138 159.110 205.642 1.00 127.93 ?  -37  DG  I "C3'" 1 
ATOM   6716  O  "O3'" . DG  I 6  36   ? 132.102 159.584 204.705 1.00 125.53 ?  -37  DG  I "O3'" 1 
ATOM   6717  C  "C2'" . DG  I 6  36   ? 129.713 159.207 205.094 1.00 128.36 ?  -37  DG  I "C2'" 1 
ATOM   6718  C  "C1'" . DG  I 6  36   ? 129.569 157.893 204.340 1.00 129.26 ?  -37  DG  I "C1'" 1 
ATOM   6719  N  N9    . DG  I 6  36   ? 128.192 157.410 204.273 1.00 129.40 ?  -37  DG  I N9    1 
ATOM   6720  C  C8    . DG  I 6  36   ? 127.308 157.299 205.318 1.00 129.69 ?  -37  DG  I C8    1 
ATOM   6721  N  N7    . DG  I 6  36   ? 126.144 156.829 204.968 1.00 129.75 ?  -37  DG  I N7    1 
ATOM   6722  C  C5    . DG  I 6  36   ? 126.264 156.604 203.603 1.00 129.55 ?  -37  DG  I C5    1 
ATOM   6723  C  C6    . DG  I 6  36   ? 125.321 156.096 202.678 1.00 129.57 ?  -37  DG  I C6    1 
ATOM   6724  O  O6    . DG  I 6  36   ? 124.157 155.730 202.891 1.00 129.49 ?  -37  DG  I O6    1 
ATOM   6725  N  N1    . DG  I 6  36   ? 125.846 156.029 201.390 1.00 129.67 ?  -37  DG  I N1    1 
ATOM   6726  C  C2    . DG  I 6  36   ? 127.121 156.407 201.039 1.00 129.57 ?  -37  DG  I C2    1 
ATOM   6727  N  N2    . DG  I 6  36   ? 127.449 156.270 199.745 1.00 129.43 ?  -37  DG  I N2    1 
ATOM   6728  N  N3    . DG  I 6  36   ? 128.016 156.885 201.898 1.00 129.69 ?  -37  DG  I N3    1 
ATOM   6729  C  C4    . DG  I 6  36   ? 127.520 156.956 203.158 1.00 129.55 ?  -37  DG  I C4    1 
ATOM   6730  P  P     . DT  I 6  37   ? 132.094 161.118 204.223 1.00 124.00 ?  -36  DT  I P     1 
ATOM   6731  O  OP1   . DT  I 6  37   ? 133.498 161.505 203.962 1.00 123.74 ?  -36  DT  I OP1   1 
ATOM   6732  O  OP2   . DT  I 6  37   ? 131.287 161.910 205.178 1.00 124.16 ?  -36  DT  I OP2   1 
ATOM   6733  O  "O5'" . DT  I 6  37   ? 131.315 161.069 202.829 1.00 123.32 ?  -36  DT  I "O5'" 1 
ATOM   6734  C  "C5'" . DT  I 6  37   ? 131.746 160.172 201.811 1.00 121.36 ?  -36  DT  I "C5'" 1 
ATOM   6735  C  "C4'" . DT  I 6  37   ? 130.844 160.253 200.592 1.00 120.00 ?  -36  DT  I "C4'" 1 
ATOM   6736  O  "O4'" . DT  I 6  37   ? 129.565 159.626 200.881 1.00 120.81 ?  -36  DT  I "O4'" 1 
ATOM   6737  C  "C3'" . DT  I 6  37   ? 130.517 161.672 200.117 1.00 118.77 ?  -36  DT  I "C3'" 1 
ATOM   6738  O  "O3'" . DT  I 6  37   ? 130.493 161.703 198.697 1.00 116.49 ?  -36  DT  I "O3'" 1 
ATOM   6739  C  "C2'" . DT  I 6  37   ? 129.121 161.894 200.693 1.00 119.67 ?  -36  DT  I "C2'" 1 
ATOM   6740  C  "C1'" . DT  I 6  37   ? 128.534 160.509 200.506 1.00 121.33 ?  -36  DT  I "C1'" 1 
ATOM   6741  N  N1    . DT  I 6  37   ? 127.329 160.231 201.339 1.00 121.85 ?  -36  DT  I N1    1 
ATOM   6742  C  C2    . DT  I 6  37   ? 126.218 159.688 200.739 1.00 121.94 ?  -36  DT  I C2    1 
ATOM   6743  O  O2    . DT  I 6  37   ? 126.164 159.423 199.551 1.00 122.03 ?  -36  DT  I O2    1 
ATOM   6744  N  N3    . DT  I 6  37   ? 125.163 159.465 201.579 1.00 121.72 ?  -36  DT  I N3    1 
ATOM   6745  C  C4    . DT  I 6  37   ? 125.107 159.722 202.936 1.00 121.89 ?  -36  DT  I C4    1 
ATOM   6746  O  O4    . DT  I 6  37   ? 124.106 159.485 203.606 1.00 122.05 ?  -36  DT  I O4    1 
ATOM   6747  C  C5    . DT  I 6  37   ? 126.306 160.292 203.506 1.00 122.03 ?  -36  DT  I C5    1 
ATOM   6748  C  C7    . DT  I 6  37   ? 126.364 160.617 204.970 1.00 121.65 ?  -36  DT  I C7    1 
ATOM   6749  C  C6    . DT  I 6  37   ? 127.349 160.516 202.689 1.00 121.98 ?  -36  DT  I C6    1 
ATOM   6750  P  P     . DA  I 6  38   ? 131.806 162.101 197.860 1.00 114.68 ?  -35  DA  I P     1 
ATOM   6751  O  OP1   . DA  I 6  38   ? 132.878 161.143 198.209 1.00 114.09 ?  -35  DA  I OP1   1 
ATOM   6752  O  OP2   . DA  I 6  38   ? 132.029 163.553 198.036 1.00 113.86 ?  -35  DA  I OP2   1 
ATOM   6753  O  "O5'" . DA  I 6  38   ? 131.372 161.852 196.340 1.00 114.53 ?  -35  DA  I "O5'" 1 
ATOM   6754  C  "C5'" . DA  I 6  38   ? 130.728 160.633 195.975 1.00 114.24 ?  -35  DA  I "C5'" 1 
ATOM   6755  C  "C4'" . DA  I 6  38   ? 130.155 160.716 194.569 1.00 114.07 ?  -35  DA  I "C4'" 1 
ATOM   6756  O  "O4'" . DA  I 6  38   ? 128.715 160.757 194.623 1.00 114.46 ?  -35  DA  I "O4'" 1 
ATOM   6757  C  "C3'" . DA  I 6  38   ? 130.560 161.944 193.771 1.00 113.94 ?  -35  DA  I "C3'" 1 
ATOM   6758  O  "O3'" . DA  I 6  38   ? 130.678 161.600 192.391 1.00 113.18 ?  -35  DA  I "O3'" 1 
ATOM   6759  C  "C2'" . DA  I 6  38   ? 129.418 162.947 194.020 1.00 114.28 ?  -35  DA  I "C2'" 1 
ATOM   6760  C  "C1'" . DA  I 6  38   ? 128.279 162.099 194.604 1.00 114.83 ?  -35  DA  I "C1'" 1 
ATOM   6761  N  N9    . DA  I 6  38   ? 127.913 162.474 195.967 1.00 114.96 ?  -35  DA  I N9    1 
ATOM   6762  C  C8    . DA  I 6  38   ? 128.674 163.174 196.859 1.00 115.06 ?  -35  DA  I C8    1 
ATOM   6763  N  N7    . DA  I 6  38   ? 128.096 163.358 198.021 1.00 115.21 ?  -35  DA  I N7    1 
ATOM   6764  C  C5    . DA  I 6  38   ? 126.868 162.734 197.884 1.00 115.02 ?  -35  DA  I C5    1 
ATOM   6765  C  C6    . DA  I 6  38   ? 125.783 162.576 198.767 1.00 114.95 ?  -35  DA  I C6    1 
ATOM   6766  N  N6    . DA  I 6  38   ? 125.775 163.058 200.014 1.00 115.14 ?  -35  DA  I N6    1 
ATOM   6767  N  N1    . DA  I 6  38   ? 124.702 161.902 198.318 1.00 114.91 ?  -35  DA  I N1    1 
ATOM   6768  C  C2    . DA  I 6  38   ? 124.719 161.420 197.068 1.00 115.04 ?  -35  DA  I C2    1 
ATOM   6769  N  N3    . DA  I 6  38   ? 125.680 161.507 196.147 1.00 115.34 ?  -35  DA  I N3    1 
ATOM   6770  C  C4    . DA  I 6  38   ? 126.738 162.182 196.624 1.00 115.01 ?  -35  DA  I C4    1 
ATOM   6771  P  P     . DG  I 6  39   ? 130.927 162.731 191.277 1.00 112.42 ?  -34  DG  I P     1 
ATOM   6772  O  OP1   . DG  I 6  39   ? 131.654 162.090 190.159 1.00 111.79 ?  -34  DG  I OP1   1 
ATOM   6773  O  OP2   . DG  I 6  39   ? 131.510 163.924 191.931 1.00 111.08 ?  -34  DG  I OP2   1 
ATOM   6774  O  "O5'" . DG  I 6  39   ? 129.452 163.098 190.782 1.00 114.52 ?  -34  DG  I "O5'" 1 
ATOM   6775  C  "C5'" . DG  I 6  39   ? 128.542 162.056 190.445 1.00 118.15 ?  -34  DG  I "C5'" 1 
ATOM   6776  C  "C4'" . DG  I 6  39   ? 127.107 162.551 190.481 1.00 120.64 ?  -34  DG  I "C4'" 1 
ATOM   6777  O  "O4'" . DG  I 6  39   ? 126.793 163.049 191.811 1.00 121.35 ?  -34  DG  I "O4'" 1 
ATOM   6778  C  "C3'" . DG  I 6  39   ? 126.791 163.699 189.521 1.00 122.05 ?  -34  DG  I "C3'" 1 
ATOM   6779  O  "O3'" . DG  I 6  39   ? 125.477 163.539 189.002 1.00 123.65 ?  -34  DG  I "O3'" 1 
ATOM   6780  C  "C2'" . DG  I 6  39   ? 126.879 164.919 190.430 1.00 122.23 ?  -34  DG  I "C2'" 1 
ATOM   6781  C  "C1'" . DG  I 6  39   ? 126.273 164.355 191.703 1.00 123.20 ?  -34  DG  I "C1'" 1 
ATOM   6782  N  N9    . DG  I 6  39   ? 126.614 165.102 192.911 1.00 123.79 ?  -34  DG  I N9    1 
ATOM   6783  C  C8    . DG  I 6  39   ? 127.770 165.802 193.158 1.00 124.10 ?  -34  DG  I C8    1 
ATOM   6784  N  N7    . DG  I 6  39   ? 127.791 166.372 194.332 1.00 124.22 ?  -34  DG  I N7    1 
ATOM   6785  C  C5    . DG  I 6  39   ? 126.569 166.028 194.898 1.00 124.18 ?  -34  DG  I C5    1 
ATOM   6786  C  C6    . DG  I 6  39   ? 126.024 166.358 196.163 1.00 123.77 ?  -34  DG  I C6    1 
ATOM   6787  O  O6    . DG  I 6  39   ? 126.528 167.042 197.064 1.00 123.79 ?  -34  DG  I O6    1 
ATOM   6788  N  N1    . DG  I 6  39   ? 124.757 165.805 196.338 1.00 123.81 ?  -34  DG  I N1    1 
ATOM   6789  C  C2    . DG  I 6  39   ? 124.101 165.033 195.408 1.00 124.02 ?  -34  DG  I C2    1 
ATOM   6790  N  N2    . DG  I 6  39   ? 122.885 164.585 195.753 1.00 124.21 ?  -34  DG  I N2    1 
ATOM   6791  N  N3    . DG  I 6  39   ? 124.602 164.717 194.221 1.00 124.16 ?  -34  DG  I N3    1 
ATOM   6792  C  C4    . DG  I 6  39   ? 125.834 165.247 194.036 1.00 124.07 ?  -34  DG  I C4    1 
ATOM   6793  P  P     . DA  I 6  40   ? 125.218 163.565 187.417 1.00 124.41 ?  -33  DA  I P     1 
ATOM   6794  O  OP1   . DA  I 6  40   ? 125.522 162.214 186.893 1.00 124.20 ?  -33  DA  I OP1   1 
ATOM   6795  O  OP2   . DA  I 6  40   ? 125.915 164.746 186.861 1.00 123.96 ?  -33  DA  I OP2   1 
ATOM   6796  O  "O5'" . DA  I 6  40   ? 123.642 163.815 187.292 1.00 125.71 ?  -33  DA  I "O5'" 1 
ATOM   6797  C  "C5'" . DA  I 6  40   ? 122.726 162.795 187.681 1.00 127.34 ?  -33  DA  I "C5'" 1 
ATOM   6798  C  "C4'" . DA  I 6  40   ? 121.416 163.392 188.171 1.00 128.63 ?  -33  DA  I "C4'" 1 
ATOM   6799  O  "O4'" . DA  I 6  40   ? 121.611 163.993 189.477 1.00 128.70 ?  -33  DA  I "O4'" 1 
ATOM   6800  C  "C3'" . DA  I 6  40   ? 120.823 164.479 187.281 1.00 129.54 ?  -33  DA  I "C3'" 1 
ATOM   6801  O  "O3'" . DA  I 6  40   ? 119.410 164.348 187.221 1.00 130.83 ?  -33  DA  I "O3'" 1 
ATOM   6802  C  "C2'" . DA  I 6  40   ? 121.240 165.775 187.974 1.00 129.32 ?  -33  DA  I "C2'" 1 
ATOM   6803  C  "C1'" . DA  I 6  40   ? 121.286 165.369 189.443 1.00 129.32 ?  -33  DA  I "C1'" 1 
ATOM   6804  N  N9    . DA  I 6  40   ? 122.307 166.089 190.196 1.00 129.61 ?  -33  DA  I N9    1 
ATOM   6805  C  C8    . DA  I 6  40   ? 123.644 166.125 189.923 1.00 129.50 ?  -33  DA  I C8    1 
ATOM   6806  N  N7    . DA  I 6  40   ? 124.336 166.855 190.762 1.00 129.45 ?  -33  DA  I N7    1 
ATOM   6807  C  C5    . DA  I 6  40   ? 123.391 167.329 191.651 1.00 129.36 ?  -33  DA  I C5    1 
ATOM   6808  C  C6    . DA  I 6  40   ? 123.493 168.160 192.778 1.00 129.34 ?  -33  DA  I C6    1 
ATOM   6809  N  N6    . DA  I 6  40   ? 124.651 168.672 193.207 1.00 129.44 ?  -33  DA  I N6    1 
ATOM   6810  N  N1    . DA  I 6  40   ? 122.360 168.447 193.449 1.00 129.43 ?  -33  DA  I N1    1 
ATOM   6811  C  C2    . DA  I 6  40   ? 121.202 167.932 193.014 1.00 129.43 ?  -33  DA  I C2    1 
ATOM   6812  N  N3    . DA  I 6  40   ? 120.981 167.136 191.965 1.00 129.42 ?  -33  DA  I N3    1 
ATOM   6813  C  C4    . DA  I 6  40   ? 122.130 166.868 191.321 1.00 129.46 ?  -33  DA  I C4    1 
ATOM   6814  P  P     . DC  I 6  41   ? 118.558 165.278 186.225 1.00 131.27 ?  -32  DC  I P     1 
ATOM   6815  O  OP1   . DC  I 6  41   ? 117.294 164.573 185.918 1.00 130.91 ?  -32  DC  I OP1   1 
ATOM   6816  O  OP2   . DC  I 6  41   ? 119.454 165.698 185.125 1.00 131.14 ?  -32  DC  I OP2   1 
ATOM   6817  O  "O5'" . DC  I 6  41   ? 118.220 166.572 187.103 1.00 131.99 ?  -32  DC  I "O5'" 1 
ATOM   6818  C  "C5'" . DC  I 6  41   ? 117.294 166.478 188.178 1.00 133.11 ?  -32  DC  I "C5'" 1 
ATOM   6819  C  "C4'" . DC  I 6  41   ? 116.960 167.854 188.724 1.00 133.92 ?  -32  DC  I "C4'" 1 
ATOM   6820  O  "O4'" . DC  I 6  41   ? 118.021 168.301 189.607 1.00 133.88 ?  -32  DC  I "O4'" 1 
ATOM   6821  C  "C3'" . DC  I 6  41   ? 116.795 168.948 187.664 1.00 134.62 ?  -32  DC  I "C3'" 1 
ATOM   6822  O  "O3'" . DC  I 6  41   ? 115.617 169.702 187.924 1.00 136.08 ?  -32  DC  I "O3'" 1 
ATOM   6823  C  "C2'" . DC  I 6  41   ? 118.055 169.799 187.829 1.00 134.50 ?  -32  DC  I "C2'" 1 
ATOM   6824  C  "C1'" . DC  I 6  41   ? 118.330 169.641 189.313 1.00 134.33 ?  -32  DC  I "C1'" 1 
ATOM   6825  N  N1    . DC  I 6  41   ? 119.747 169.896 189.695 1.00 134.65 ?  -32  DC  I N1    1 
ATOM   6826  C  C2    . DC  I 6  41   ? 120.035 170.800 190.723 1.00 134.63 ?  -32  DC  I C2    1 
ATOM   6827  O  O2    . DC  I 6  41   ? 119.110 171.376 191.311 1.00 134.48 ?  -32  DC  I O2    1 
ATOM   6828  N  N3    . DC  I 6  41   ? 121.325 171.015 191.061 1.00 134.62 ?  -32  DC  I N3    1 
ATOM   6829  C  C4    . DC  I 6  41   ? 122.303 170.377 190.422 1.00 134.44 ?  -32  DC  I C4    1 
ATOM   6830  N  N4    . DC  I 6  41   ? 123.557 170.647 190.796 1.00 134.34 ?  -32  DC  I N4    1 
ATOM   6831  C  C5    . DC  I 6  41   ? 122.037 169.457 189.365 1.00 134.62 ?  -32  DC  I C5    1 
ATOM   6832  C  C6    . DC  I 6  41   ? 120.755 169.245 189.040 1.00 134.82 ?  -32  DC  I C6    1 
ATOM   6833  P  P     . DA  I 6  42   ? 114.855 170.450 186.724 1.00 136.92 ?  -31  DA  I P     1 
ATOM   6834  O  OP1   . DA  I 6  42   ? 113.400 170.261 186.922 1.00 136.91 ?  -31  DA  I OP1   1 
ATOM   6835  O  OP2   . DA  I 6  42   ? 115.488 170.013 185.459 1.00 136.47 ?  -31  DA  I OP2   1 
ATOM   6836  O  "O5'" . DA  I 6  42   ? 115.208 171.994 186.950 1.00 137.02 ?  -31  DA  I "O5'" 1 
ATOM   6837  C  "C5'" . DA  I 6  42   ? 115.532 172.461 188.255 1.00 137.67 ?  -31  DA  I "C5'" 1 
ATOM   6838  C  "C4'" . DA  I 6  42   ? 115.139 173.917 188.428 1.00 138.60 ?  -31  DA  I "C4'" 1 
ATOM   6839  O  "O4'" . DA  I 6  42   ? 116.172 174.602 189.169 1.00 138.90 ?  -31  DA  I "O4'" 1 
ATOM   6840  C  "C3'" . DA  I 6  42   ? 115.027 174.712 187.146 1.00 139.42 ?  -31  DA  I "C3'" 1 
ATOM   6841  O  "O3'" . DA  I 6  42   ? 114.265 175.894 187.395 1.00 140.55 ?  -31  DA  I "O3'" 1 
ATOM   6842  C  "C2'" . DA  I 6  42   ? 116.493 175.027 186.855 1.00 139.59 ?  -31  DA  I "C2'" 1 
ATOM   6843  C  "C1'" . DA  I 6  42   ? 117.074 175.217 188.261 1.00 139.63 ?  -31  DA  I "C1'" 1 
ATOM   6844  N  N9    . DA  I 6  42   ? 118.385 174.600 188.444 1.00 139.77 ?  -31  DA  I N9    1 
ATOM   6845  C  C8    . DA  I 6  42   ? 118.875 173.500 187.796 1.00 139.68 ?  -31  DA  I C8    1 
ATOM   6846  N  N7    . DA  I 6  42   ? 120.084 173.158 188.175 1.00 139.81 ?  -31  DA  I N7    1 
ATOM   6847  C  C5    . DA  I 6  42   ? 120.405 174.091 189.146 1.00 139.88 ?  -31  DA  I C5    1 
ATOM   6848  C  C6    . DA  I 6  42   ? 121.555 174.279 189.939 1.00 139.85 ?  -31  DA  I C6    1 
ATOM   6849  N  N6    . DA  I 6  42   ? 122.634 173.492 189.868 1.00 139.69 ?  -31  DA  I N6    1 
ATOM   6850  N  N1    . DA  I 6  42   ? 121.553 175.309 190.811 1.00 139.77 ?  -31  DA  I N1    1 
ATOM   6851  C  C2    . DA  I 6  42   ? 120.470 176.094 190.879 1.00 139.57 ?  -31  DA  I C2    1 
ATOM   6852  N  N3    . DA  I 6  42   ? 119.335 176.018 190.185 1.00 139.72 ?  -31  DA  I N3    1 
ATOM   6853  C  C4    . DA  I 6  42   ? 119.367 174.985 189.329 1.00 139.84 ?  -31  DA  I C4    1 
ATOM   6854  P  P     . DG  I 6  43   ? 114.290 177.139 186.377 1.00 141.33 ?  -30  DG  I P     1 
ATOM   6855  O  OP1   . DG  I 6  43   ? 113.021 177.871 186.586 1.00 141.60 ?  -30  DG  I OP1   1 
ATOM   6856  O  OP2   . DG  I 6  43   ? 114.629 176.657 185.019 1.00 141.33 ?  -30  DG  I OP2   1 
ATOM   6857  O  "O5'" . DG  I 6  43   ? 115.490 178.050 186.918 1.00 141.99 ?  -30  DG  I "O5'" 1 
ATOM   6858  C  "C5'" . DG  I 6  43   ? 115.477 178.507 188.270 1.00 142.93 ?  -30  DG  I "C5'" 1 
ATOM   6859  C  "C4'" . DG  I 6  43   ? 116.777 179.210 188.632 1.00 143.53 ?  -30  DG  I "C4'" 1 
ATOM   6860  O  "O4'" . DG  I 6  43   ? 117.876 178.256 188.634 1.00 144.04 ?  -30  DG  I "O4'" 1 
ATOM   6861  C  "C3'" . DG  I 6  43   ? 117.203 180.332 187.683 1.00 143.57 ?  -30  DG  I "C3'" 1 
ATOM   6862  O  "O3'" . DG  I 6  43   ? 117.798 181.386 188.432 1.00 143.14 ?  -30  DG  I "O3'" 1 
ATOM   6863  C  "C2'" . DG  I 6  43   ? 118.232 179.636 186.799 1.00 143.99 ?  -30  DG  I "C2'" 1 
ATOM   6864  C  "C1'" . DG  I 6  43   ? 118.918 178.756 187.827 1.00 144.42 ?  -30  DG  I "C1'" 1 
ATOM   6865  N  N9    . DG  I 6  43   ? 119.660 177.632 187.255 1.00 144.45 ?  -30  DG  I N9    1 
ATOM   6866  C  C8    . DG  I 6  43   ? 119.240 176.778 186.266 1.00 144.57 ?  -30  DG  I C8    1 
ATOM   6867  N  N7    . DG  I 6  43   ? 120.115 175.859 185.965 1.00 144.81 ?  -30  DG  I N7    1 
ATOM   6868  C  C5    . DG  I 6  43   ? 121.190 176.125 186.802 1.00 144.76 ?  -30  DG  I C5    1 
ATOM   6869  C  C6    . DG  I 6  43   ? 122.435 175.463 186.927 1.00 144.64 ?  -30  DG  I C6    1 
ATOM   6870  O  O6    . DG  I 6  43   ? 122.846 174.477 186.299 1.00 144.55 ?  -30  DG  I O6    1 
ATOM   6871  N  N1    . DG  I 6  43   ? 123.239 176.055 187.897 1.00 144.66 ?  -30  DG  I N1    1 
ATOM   6872  C  C2    . DG  I 6  43   ? 122.885 177.150 188.652 1.00 144.74 ?  -30  DG  I C2    1 
ATOM   6873  N  N2    . DG  I 6  43   ? 123.792 177.580 189.540 1.00 144.65 ?  -30  DG  I N2    1 
ATOM   6874  N  N3    . DG  I 6  43   ? 121.721 177.779 188.544 1.00 144.83 ?  -30  DG  I N3    1 
ATOM   6875  C  C4    . DG  I 6  43   ? 120.925 177.213 187.605 1.00 144.70 ?  -30  DG  I C4    1 
ATOM   6876  P  P     . DC  I 6  44   ? 117.912 182.866 187.816 1.00 143.23 ?  -29  DC  I P     1 
ATOM   6877  O  OP1   . DC  I 6  44   ? 116.899 183.705 188.494 1.00 142.94 ?  -29  DC  I OP1   1 
ATOM   6878  O  OP2   . DC  I 6  44   ? 117.897 182.751 186.341 1.00 143.12 ?  -29  DC  I OP2   1 
ATOM   6879  O  "O5'" . DC  I 6  44   ? 119.372 183.355 188.261 1.00 142.54 ?  -29  DC  I "O5'" 1 
ATOM   6880  C  "C5'" . DC  I 6  44   ? 119.705 183.446 189.647 1.00 141.06 ?  -29  DC  I "C5'" 1 
ATOM   6881  C  "C4'" . DC  I 6  44   ? 121.179 183.779 189.844 1.00 139.88 ?  -29  DC  I "C4'" 1 
ATOM   6882  O  "O4'" . DC  I 6  44   ? 121.991 182.604 189.589 1.00 139.41 ?  -29  DC  I "O4'" 1 
ATOM   6883  C  "C3'" . DC  I 6  44   ? 121.729 184.878 188.943 1.00 139.40 ?  -29  DC  I "C3'" 1 
ATOM   6884  O  "O3'" . DC  I 6  44   ? 122.681 185.659 189.653 1.00 138.51 ?  -29  DC  I "O3'" 1 
ATOM   6885  C  "C2'" . DC  I 6  44   ? 122.380 184.100 187.802 1.00 139.50 ?  -29  DC  I "C2'" 1 
ATOM   6886  C  "C1'" . DC  I 6  44   ? 122.863 182.830 188.497 1.00 139.27 ?  -29  DC  I "C1'" 1 
ATOM   6887  N  N1    . DC  I 6  44   ? 122.812 181.624 187.620 1.00 139.14 ?  -29  DC  I N1    1 
ATOM   6888  C  C2    . DC  I 6  44   ? 123.971 180.866 187.390 1.00 139.25 ?  -29  DC  I C2    1 
ATOM   6889  O  O2    . DC  I 6  44   ? 125.039 181.208 187.914 1.00 139.24 ?  -29  DC  I O2    1 
ATOM   6890  N  N3    . DC  I 6  44   ? 123.887 179.771 186.592 1.00 139.17 ?  -29  DC  I N3    1 
ATOM   6891  C  C4    . DC  I 6  44   ? 122.720 179.433 186.042 1.00 139.10 ?  -29  DC  I C4    1 
ATOM   6892  N  N4    . DC  I 6  44   ? 122.683 178.349 185.262 1.00 139.09 ?  -29  DC  I N4    1 
ATOM   6893  C  C5    . DC  I 6  44   ? 121.540 180.193 186.263 1.00 139.09 ?  -29  DC  I C5    1 
ATOM   6894  C  C6    . DC  I 6  44   ? 121.627 181.261 187.058 1.00 139.03 ?  -29  DC  I C6    1 
ATOM   6895  P  P     . DT  I 6  45   ? 123.209 187.045 189.036 1.00 138.05 ?  -28  DT  I P     1 
ATOM   6896  O  OP1   . DT  I 6  45   ? 123.616 187.913 190.163 1.00 138.14 ?  -28  DT  I OP1   1 
ATOM   6897  O  OP2   . DT  I 6  45   ? 122.196 187.522 188.069 1.00 137.41 ?  -28  DT  I OP2   1 
ATOM   6898  O  "O5'" . DT  I 6  45   ? 124.514 186.623 188.211 1.00 139.15 ?  -28  DT  I "O5'" 1 
ATOM   6899  C  "C5'" . DT  I 6  45   ? 125.620 186.031 188.884 1.00 139.72 ?  -28  DT  I "C5'" 1 
ATOM   6900  C  "C4'" . DT  I 6  45   ? 126.740 185.718 187.908 1.00 140.07 ?  -28  DT  I "C4'" 1 
ATOM   6901  O  "O4'" . DT  I 6  45   ? 126.493 184.434 187.274 1.00 139.99 ?  -28  DT  I "O4'" 1 
ATOM   6902  C  "C3'" . DT  I 6  45   ? 126.906 186.731 186.770 1.00 140.33 ?  -28  DT  I "C3'" 1 
ATOM   6903  O  "O3'" . DT  I 6  45   ? 128.284 187.036 186.577 1.00 140.73 ?  -28  DT  I "O3'" 1 
ATOM   6904  C  "C2'" . DT  I 6  45   ? 126.325 185.997 185.566 1.00 140.25 ?  -28  DT  I "C2'" 1 
ATOM   6905  C  "C1'" . DT  I 6  45   ? 126.699 184.563 185.888 1.00 140.11 ?  -28  DT  I "C1'" 1 
ATOM   6906  N  N1    . DT  I 6  45   ? 125.862 183.558 185.176 1.00 140.20 ?  -28  DT  I N1    1 
ATOM   6907  C  C2    . DT  I 6  45   ? 126.462 182.450 184.623 1.00 140.22 ?  -28  DT  I C2    1 
ATOM   6908  O  O2    . DT  I 6  45   ? 127.658 182.233 184.695 1.00 140.01 ?  -28  DT  I O2    1 
ATOM   6909  N  N3    . DT  I 6  45   ? 125.604 181.594 183.987 1.00 140.05 ?  -28  DT  I N3    1 
ATOM   6910  C  C4    . DT  I 6  45   ? 124.234 181.736 183.846 1.00 139.99 ?  -28  DT  I C4    1 
ATOM   6911  O  O4    . DT  I 6  45   ? 123.548 180.912 183.254 1.00 139.95 ?  -28  DT  I O4    1 
ATOM   6912  C  C5    . DT  I 6  45   ? 123.671 182.923 184.441 1.00 140.07 ?  -28  DT  I C5    1 
ATOM   6913  C  C7    . DT  I 6  45   ? 122.198 183.188 184.347 1.00 140.21 ?  -28  DT  I C7    1 
ATOM   6914  C  C6    . DT  I 6  45   ? 124.503 183.768 185.067 1.00 140.13 ?  -28  DT  I C6    1 
ATOM   6915  P  P     . DC  I 6  46   ? 128.716 188.410 185.863 1.00 141.08 ?  -27  DC  I P     1 
ATOM   6916  O  OP1   . DC  I 6  46   ? 130.193 188.429 185.777 1.00 140.55 ?  -27  DC  I OP1   1 
ATOM   6917  O  OP2   . DC  I 6  46   ? 128.011 189.510 186.557 1.00 141.03 ?  -27  DC  I OP2   1 
ATOM   6918  O  "O5'" . DC  I 6  46   ? 128.098 188.294 184.389 1.00 140.45 ?  -27  DC  I "O5'" 1 
ATOM   6919  C  "C5'" . DC  I 6  46   ? 128.951 188.298 183.246 1.00 139.51 ?  -27  DC  I "C5'" 1 
ATOM   6920  C  "C4'" . DC  I 6  46   ? 129.550 186.923 183.005 1.00 138.74 ?  -27  DC  I "C4'" 1 
ATOM   6921  O  "O4'" . DC  I 6  46   ? 128.518 185.908 183.144 1.00 139.15 ?  -27  DC  I "O4'" 1 
ATOM   6922  C  "C3'" . DC  I 6  46   ? 130.148 186.714 181.617 1.00 137.87 ?  -27  DC  I "C3'" 1 
ATOM   6923  O  "O3'" . DC  I 6  46   ? 131.269 185.844 181.703 1.00 136.30 ?  -27  DC  I "O3'" 1 
ATOM   6924  C  "C2'" . DC  I 6  46   ? 128.995 186.064 180.860 1.00 138.32 ?  -27  DC  I "C2'" 1 
ATOM   6925  C  "C1'" . DC  I 6  46   ? 128.414 185.171 181.942 1.00 139.10 ?  -27  DC  I "C1'" 1 
ATOM   6926  N  N1    . DC  I 6  46   ? 126.978 184.801 181.738 1.00 139.34 ?  -27  DC  I N1    1 
ATOM   6927  C  C2    . DC  I 6  46   ? 126.654 183.571 181.153 1.00 139.31 ?  -27  DC  I C2    1 
ATOM   6928  O  O2    . DC  I 6  46   ? 127.562 182.817 180.787 1.00 139.46 ?  -27  DC  I O2    1 
ATOM   6929  N  N3    . DC  I 6  46   ? 125.347 183.244 180.989 1.00 139.31 ?  -27  DC  I N3    1 
ATOM   6930  C  C4    . DC  I 6  46   ? 124.393 184.085 181.393 1.00 139.34 ?  -27  DC  I C4    1 
ATOM   6931  N  N4    . DC  I 6  46   ? 123.119 183.720 181.213 1.00 139.46 ?  -27  DC  I N4    1 
ATOM   6932  C  C5    . DC  I 6  46   ? 124.704 185.338 181.999 1.00 139.37 ?  -27  DC  I C5    1 
ATOM   6933  C  C6    . DC  I 6  46   ? 125.995 185.650 182.152 1.00 139.30 ?  -27  DC  I C6    1 
ATOM   6934  P  P     . DT  I 6  47   ? 132.439 185.915 180.604 1.00 135.12 ?  -26  DT  I P     1 
ATOM   6935  O  OP1   . DT  I 6  47   ? 133.669 186.374 181.287 1.00 134.98 ?  -26  DT  I OP1   1 
ATOM   6936  O  OP2   . DT  I 6  47   ? 131.918 186.673 179.445 1.00 134.79 ?  -26  DT  I OP2   1 
ATOM   6937  O  "O5'" . DT  I 6  47   ? 132.636 184.392 180.155 1.00 133.80 ?  -26  DT  I "O5'" 1 
ATOM   6938  C  "C5'" . DT  I 6  47   ? 131.516 183.628 179.719 1.00 131.61 ?  -26  DT  I "C5'" 1 
ATOM   6939  C  "C4'" . DT  I 6  47   ? 131.722 183.132 178.301 1.00 129.97 ?  -26  DT  I "C4'" 1 
ATOM   6940  O  "O4'" . DT  I 6  47   ? 130.442 182.729 177.744 1.00 130.05 ?  -26  DT  I "O4'" 1 
ATOM   6941  C  "C3'" . DT  I 6  47   ? 132.259 184.175 177.335 1.00 128.25 ?  -26  DT  I "C3'" 1 
ATOM   6942  O  "O3'" . DT  I 6  47   ? 132.929 183.536 176.253 1.00 125.08 ?  -26  DT  I "O3'" 1 
ATOM   6943  C  "C2'" . DT  I 6  47   ? 130.976 184.852 176.873 1.00 129.00 ?  -26  DT  I "C2'" 1 
ATOM   6944  C  "C1'" . DT  I 6  47   ? 130.044 183.652 176.744 1.00 130.12 ?  -26  DT  I "C1'" 1 
ATOM   6945  N  N1    . DT  I 6  47   ? 128.602 183.984 176.952 1.00 130.60 ?  -26  DT  I N1    1 
ATOM   6946  C  C2    . DT  I 6  47   ? 127.642 183.071 176.578 1.00 130.68 ?  -26  DT  I C2    1 
ATOM   6947  O  O2    . DT  I 6  47   ? 127.906 181.991 176.082 1.00 130.76 ?  -26  DT  I O2    1 
ATOM   6948  N  N3    . DT  I 6  47   ? 126.352 183.467 176.816 1.00 130.48 ?  -26  DT  I N3    1 
ATOM   6949  C  C4    . DT  I 6  47   ? 125.934 184.661 177.373 1.00 130.51 ?  -26  DT  I C4    1 
ATOM   6950  O  O4    . DT  I 6  47   ? 124.750 184.928 177.545 1.00 130.42 ?  -26  DT  I O4    1 
ATOM   6951  C  C5    . DT  I 6  47   ? 126.989 185.575 177.740 1.00 130.75 ?  -26  DT  I C5    1 
ATOM   6952  C  C7    . DT  I 6  47   ? 126.654 186.903 178.352 1.00 130.60 ?  -26  DT  I C7    1 
ATOM   6953  C  C6    . DT  I 6  47   ? 128.258 185.197 177.514 1.00 130.74 ?  -26  DT  I C6    1 
ATOM   6954  P  P     . DA  I 6  48   ? 134.301 184.144 175.678 1.00 122.73 ?  -25  DA  I P     1 
ATOM   6955  O  OP1   . DA  I 6  48   ? 135.394 183.718 176.580 1.00 122.30 ?  -25  DA  I OP1   1 
ATOM   6956  O  OP2   . DA  I 6  48   ? 134.080 185.585 175.420 1.00 122.34 ?  -25  DA  I OP2   1 
ATOM   6957  O  "O5'" . DA  I 6  48   ? 134.484 183.416 174.264 1.00 122.34 ?  -25  DA  I "O5'" 1 
ATOM   6958  C  "C5'" . DA  I 6  48   ? 134.793 182.025 174.210 1.00 120.22 ?  -25  DA  I "C5'" 1 
ATOM   6959  C  "C4'" . DA  I 6  48   ? 133.867 181.293 173.249 1.00 118.45 ?  -25  DA  I "C4'" 1 
ATOM   6960  O  "O4'" . DA  I 6  48   ? 132.491 181.666 173.520 1.00 118.82 ?  -25  DA  I "O4'" 1 
ATOM   6961  C  "C3'" . DA  I 6  48   ? 134.084 181.593 171.770 1.00 116.90 ?  -25  DA  I "C3'" 1 
ATOM   6962  O  "O3'" . DA  I 6  48   ? 133.707 180.456 170.998 1.00 114.53 ?  -25  DA  I "O3'" 1 
ATOM   6963  C  "C2'" . DA  I 6  48   ? 133.134 182.762 171.540 1.00 117.75 ?  -25  DA  I "C2'" 1 
ATOM   6964  C  "C1'" . DA  I 6  48   ? 131.950 182.356 172.407 1.00 119.25 ?  -25  DA  I "C1'" 1 
ATOM   6965  N  N9    . DA  I 6  48   ? 131.172 183.485 172.907 1.00 119.58 ?  -25  DA  I N9    1 
ATOM   6966  C  C8    . DA  I 6  48   ? 131.654 184.669 173.390 1.00 119.79 ?  -25  DA  I C8    1 
ATOM   6967  N  N7    . DA  I 6  48   ? 130.717 185.501 173.780 1.00 119.97 ?  -25  DA  I N7    1 
ATOM   6968  C  C5    . DA  I 6  48   ? 129.539 184.811 173.545 1.00 120.08 ?  -25  DA  I C5    1 
ATOM   6969  C  C6    . DA  I 6  48   ? 128.185 185.145 173.750 1.00 119.90 ?  -25  DA  I C6    1 
ATOM   6970  N  N6    . DA  I 6  48   ? 127.786 186.314 174.262 1.00 119.63 ?  -25  DA  I N6    1 
ATOM   6971  N  N1    . DA  I 6  48   ? 127.255 184.229 173.406 1.00 120.09 ?  -25  DA  I N1    1 
ATOM   6972  C  C2    . DA  I 6  48   ? 127.661 183.060 172.895 1.00 119.83 ?  -25  DA  I C2    1 
ATOM   6973  N  N3    . DA  I 6  48   ? 128.901 182.634 172.658 1.00 119.86 ?  -25  DA  I N3    1 
ATOM   6974  C  C4    . DA  I 6  48   ? 129.801 183.565 173.009 1.00 119.89 ?  -25  DA  I C4    1 
ATOM   6975  P  P     . DG  I 6  49   ? 134.104 180.343 169.444 1.00 113.07 ?  -24  DG  I P     1 
ATOM   6976  O  OP1   . DG  I 6  49   ? 135.017 179.187 169.306 1.00 112.45 ?  -24  DG  I OP1   1 
ATOM   6977  O  OP2   . DG  I 6  49   ? 134.533 181.675 168.963 1.00 113.35 ?  -24  DG  I OP2   1 
ATOM   6978  O  "O5'" . DG  I 6  49   ? 132.720 179.982 168.727 1.00 112.82 ?  -24  DG  I "O5'" 1 
ATOM   6979  C  "C5'" . DG  I 6  49   ? 132.036 178.779 169.068 1.00 111.79 ?  -24  DG  I "C5'" 1 
ATOM   6980  C  "C4'" . DG  I 6  49   ? 130.571 178.848 168.670 1.00 110.28 ?  -24  DG  I "C4'" 1 
ATOM   6981  O  "O4'" . DG  I 6  49   ? 129.916 179.922 169.397 1.00 109.67 ?  -24  DG  I "O4'" 1 
ATOM   6982  C  "C3'" . DG  I 6  49   ? 130.309 179.124 167.190 1.00 109.56 ?  -24  DG  I "C3'" 1 
ATOM   6983  O  "O3'" . DG  I 6  49   ? 129.162 178.403 166.765 1.00 107.53 ?  -24  DG  I "O3'" 1 
ATOM   6984  C  "C2'" . DG  I 6  49   ? 130.058 180.628 167.169 1.00 110.03 ?  -24  DG  I "C2'" 1 
ATOM   6985  C  "C1'" . DG  I 6  49   ? 129.320 180.822 168.485 1.00 110.98 ?  -24  DG  I "C1'" 1 
ATOM   6986  N  N9    . DG  I 6  49   ? 129.435 182.171 169.032 1.00 111.13 ?  -24  DG  I N9    1 
ATOM   6987  C  C8    . DG  I 6  49   ? 130.594 182.861 169.288 1.00 111.45 ?  -24  DG  I C8    1 
ATOM   6988  N  N7    . DG  I 6  49   ? 130.392 184.049 169.787 1.00 111.30 ?  -24  DG  I N7    1 
ATOM   6989  C  C5    . DG  I 6  49   ? 129.010 184.155 169.865 1.00 111.18 ?  -24  DG  I C5    1 
ATOM   6990  C  C6    . DG  I 6  49   ? 128.203 185.222 170.328 1.00 111.45 ?  -24  DG  I C6    1 
ATOM   6991  O  O6    . DG  I 6  49   ? 128.562 186.320 170.772 1.00 111.50 ?  -24  DG  I O6    1 
ATOM   6992  N  N1    . DG  I 6  49   ? 126.846 184.919 170.237 1.00 111.56 ?  -24  DG  I N1    1 
ATOM   6993  C  C2    . DG  I 6  49   ? 126.334 183.733 169.762 1.00 111.47 ?  -24  DG  I C2    1 
ATOM   6994  N  N2    . DG  I 6  49   ? 124.996 183.627 169.749 1.00 111.52 ?  -24  DG  I N2    1 
ATOM   6995  N  N3    . DG  I 6  49   ? 127.080 182.725 169.327 1.00 111.48 ?  -24  DG  I N3    1 
ATOM   6996  C  C4    . DG  I 6  49   ? 128.405 183.006 169.408 1.00 111.21 ?  -24  DG  I C4    1 
ATOM   6997  P  P     . DC  I 6  50   ? 129.128 177.713 165.314 1.00 106.35 ?  -23  DC  I P     1 
ATOM   6998  O  OP1   . DC  I 6  50   ? 129.111 176.248 165.516 1.00 106.27 ?  -23  DC  I OP1   1 
ATOM   6999  O  OP2   . DC  I 6  50   ? 130.190 178.332 164.491 1.00 107.12 ?  -23  DC  I OP2   1 
ATOM   7000  O  "O5'" . DC  I 6  50   ? 127.717 178.166 164.713 1.00 108.95 ?  -23  DC  I "O5'" 1 
ATOM   7001  C  "C5'" . DC  I 6  50   ? 126.520 177.923 165.444 1.00 112.09 ?  -23  DC  I "C5'" 1 
ATOM   7002  C  "C4'" . DC  I 6  50   ? 125.368 178.719 164.861 1.00 114.21 ?  -23  DC  I "C4'" 1 
ATOM   7003  O  "O4'" . DC  I 6  50   ? 124.965 179.747 165.800 1.00 114.49 ?  -23  DC  I "O4'" 1 
ATOM   7004  C  "C3'" . DC  I 6  50   ? 125.698 179.465 163.583 1.00 115.98 ?  -23  DC  I "C3'" 1 
ATOM   7005  O  "O3'" . DC  I 6  50   ? 125.492 178.621 162.458 1.00 118.06 ?  -23  DC  I "O3'" 1 
ATOM   7006  C  "C2'" . DC  I 6  50   ? 124.696 180.611 163.611 1.00 115.44 ?  -23  DC  I "C2'" 1 
ATOM   7007  C  "C1'" . DC  I 6  50   ? 124.574 180.917 165.099 1.00 115.23 ?  -23  DC  I "C1'" 1 
ATOM   7008  N  N1    . DC  I 6  50   ? 125.428 182.056 165.563 1.00 115.42 ?  -23  DC  I N1    1 
ATOM   7009  C  C2    . DC  I 6  50   ? 124.855 183.319 165.785 1.00 115.59 ?  -23  DC  I C2    1 
ATOM   7010  O  O2    . DC  I 6  50   ? 123.645 183.489 165.574 1.00 116.04 ?  -23  DC  I O2    1 
ATOM   7011  N  N3    . DC  I 6  50   ? 125.651 184.330 166.216 1.00 116.05 ?  -23  DC  I N3    1 
ATOM   7012  C  C4    . DC  I 6  50   ? 126.951 184.113 166.430 1.00 115.86 ?  -23  DC  I C4    1 
ATOM   7013  N  N4    . DC  I 6  50   ? 127.696 185.136 166.856 1.00 115.72 ?  -23  DC  I N4    1 
ATOM   7014  C  C5    . DC  I 6  50   ? 127.546 182.839 166.211 1.00 115.94 ?  -23  DC  I C5    1 
ATOM   7015  C  C6    . DC  I 6  50   ? 126.756 181.850 165.789 1.00 115.91 ?  -23  DC  I C6    1 
ATOM   7016  P  P     . DA  I 6  51   ? 126.349 178.838 161.115 1.00 118.94 ?  -22  DA  I P     1 
ATOM   7017  O  OP1   . DA  I 6  51   ? 126.172 177.631 160.279 1.00 119.15 ?  -22  DA  I OP1   1 
ATOM   7018  O  OP2   . DA  I 6  51   ? 127.708 179.268 161.512 1.00 118.67 ?  -22  DA  I OP2   1 
ATOM   7019  O  "O5'" . DA  I 6  51   ? 125.635 180.076 160.395 1.00 120.48 ?  -22  DA  I "O5'" 1 
ATOM   7020  C  "C5'" . DA  I 6  51   ? 124.305 179.948 159.909 1.00 123.90 ?  -22  DA  I "C5'" 1 
ATOM   7021  C  "C4'" . DA  I 6  51   ? 123.605 181.297 159.878 1.00 126.86 ?  -22  DA  I "C4'" 1 
ATOM   7022  O  "O4'" . DA  I 6  51   ? 123.679 181.910 161.192 1.00 128.00 ?  -22  DA  I "O4'" 1 
ATOM   7023  C  "C3'" . DA  I 6  51   ? 124.213 182.321 158.936 1.00 128.67 ?  -22  DA  I "C3'" 1 
ATOM   7024  O  "O3'" . DA  I 6  51   ? 123.656 182.183 157.632 1.00 130.91 ?  -22  DA  I "O3'" 1 
ATOM   7025  C  "C2'" . DA  I 6  51   ? 123.787 183.628 159.593 1.00 129.22 ?  -22  DA  I "C2'" 1 
ATOM   7026  C  "C1'" . DA  I 6  51   ? 123.953 183.294 161.069 1.00 129.82 ?  -22  DA  I "C1'" 1 
ATOM   7027  N  N9    . DA  I 6  51   ? 125.302 183.564 161.578 1.00 130.15 ?  -22  DA  I N9    1 
ATOM   7028  C  C8    . DA  I 6  51   ? 126.359 182.698 161.624 1.00 130.14 ?  -22  DA  I C8    1 
ATOM   7029  N  N7    . DA  I 6  51   ? 127.453 183.218 162.129 1.00 130.58 ?  -22  DA  I N7    1 
ATOM   7030  C  C5    . DA  I 6  51   ? 127.095 184.521 162.428 1.00 130.61 ?  -22  DA  I C5    1 
ATOM   7031  C  C6    . DA  I 6  51   ? 127.812 185.599 162.990 1.00 130.33 ?  -22  DA  I C6    1 
ATOM   7032  N  N6    . DA  I 6  51   ? 129.096 185.520 163.361 1.00 130.38 ?  -22  DA  I N6    1 
ATOM   7033  N  N1    . DA  I 6  51   ? 127.157 186.765 163.155 1.00 130.21 ?  -22  DA  I N1    1 
ATOM   7034  C  C2    . DA  I 6  51   ? 125.874 186.844 162.780 1.00 130.43 ?  -22  DA  I C2    1 
ATOM   7035  N  N3    . DA  I 6  51   ? 125.095 185.903 162.246 1.00 130.86 ?  -22  DA  I N3    1 
ATOM   7036  C  C4    . DA  I 6  51   ? 125.773 184.754 162.093 1.00 130.61 ?  -22  DA  I C4    1 
ATOM   7037  P  P     . DC  I 6  52   ? 124.531 182.557 156.336 1.00 132.74 ?  -21  DC  I P     1 
ATOM   7038  O  OP1   . DC  I 6  52   ? 123.764 182.146 155.139 1.00 132.78 ?  -21  DC  I OP1   1 
ATOM   7039  O  OP2   . DC  I 6  52   ? 125.896 182.028 156.550 1.00 132.06 ?  -21  DC  I OP2   1 
ATOM   7040  O  "O5'" . DC  I 6  52   ? 124.617 184.155 156.375 1.00 134.52 ?  -21  DC  I "O5'" 1 
ATOM   7041  C  "C5'" . DC  I 6  52   ? 123.425 184.937 156.385 1.00 137.54 ?  -21  DC  I "C5'" 1 
ATOM   7042  C  "C4'" . DC  I 6  52   ? 123.662 186.273 157.068 1.00 140.03 ?  -21  DC  I "C4'" 1 
ATOM   7043  O  "O4'" . DC  I 6  52   ? 124.689 186.121 158.084 1.00 140.92 ?  -21  DC  I "O4'" 1 
ATOM   7044  C  "C3'" . DC  I 6  52   ? 124.142 187.392 156.137 1.00 141.52 ?  -21  DC  I "C3'" 1 
ATOM   7045  O  "O3'" . DC  I 6  52   ? 123.254 188.504 156.184 1.00 143.45 ?  -21  DC  I "O3'" 1 
ATOM   7046  C  "C2'" . DC  I 6  52   ? 125.526 187.760 156.670 1.00 141.44 ?  -21  DC  I "C2'" 1 
ATOM   7047  C  "C1'" . DC  I 6  52   ? 125.482 187.276 158.109 1.00 141.47 ?  -21  DC  I "C1'" 1 
ATOM   7048  N  N1    . DC  I 6  52   ? 126.837 186.927 158.610 1.00 141.47 ?  -21  DC  I N1    1 
ATOM   7049  C  C2    . DC  I 6  52   ? 127.656 187.932 159.138 1.00 141.46 ?  -21  DC  I C2    1 
ATOM   7050  O  O2    . DC  I 6  52   ? 127.224 189.089 159.217 1.00 141.41 ?  -21  DC  I O2    1 
ATOM   7051  N  N3    . DC  I 6  52   ? 128.904 187.612 159.556 1.00 141.48 ?  -21  DC  I N3    1 
ATOM   7052  C  C4    . DC  I 6  52   ? 129.339 186.356 159.456 1.00 141.52 ?  -21  DC  I C4    1 
ATOM   7053  N  N4    . DC  I 6  52   ? 130.576 186.088 159.887 1.00 141.48 ?  -21  DC  I N4    1 
ATOM   7054  C  C5    . DC  I 6  52   ? 128.524 185.318 158.911 1.00 141.55 ?  -21  DC  I C5    1 
ATOM   7055  C  C6    . DC  I 6  52   ? 127.295 185.647 158.497 1.00 141.38 ?  -21  DC  I C6    1 
ATOM   7056  P  P     . DC  I 6  53   ? 123.256 189.583 154.991 1.00 144.90 ?  -20  DC  I P     1 
ATOM   7057  O  OP1   . DC  I 6  53   ? 121.900 189.581 154.404 1.00 144.52 ?  -20  DC  I OP1   1 
ATOM   7058  O  OP2   . DC  I 6  53   ? 124.422 189.306 154.122 1.00 144.95 ?  -20  DC  I OP2   1 
ATOM   7059  O  "O5'" . DC  I 6  53   ? 123.521 190.983 155.726 1.00 145.70 ?  -20  DC  I "O5'" 1 
ATOM   7060  C  "C5'" . DC  I 6  53   ? 124.576 191.093 156.677 1.00 147.01 ?  -20  DC  I "C5'" 1 
ATOM   7061  C  "C4'" . DC  I 6  53   ? 125.182 192.485 156.681 1.00 148.23 ?  -20  DC  I "C4'" 1 
ATOM   7062  O  "O4'" . DC  I 6  53   ? 126.472 192.435 157.343 1.00 148.27 ?  -20  DC  I "O4'" 1 
ATOM   7063  C  "C3'" . DC  I 6  53   ? 125.473 193.069 155.310 1.00 149.02 ?  -20  DC  I "C3'" 1 
ATOM   7064  O  "O3'" . DC  I 6  53   ? 125.521 194.493 155.393 1.00 150.19 ?  -20  DC  I "O3'" 1 
ATOM   7065  C  "C2'" . DC  I 6  53   ? 126.845 192.481 155.004 1.00 148.66 ?  -20  DC  I "C2'" 1 
ATOM   7066  C  "C1'" . DC  I 6  53   ? 127.512 192.496 156.380 1.00 148.42 ?  -20  DC  I "C1'" 1 
ATOM   7067  N  N1    . DC  I 6  53   ? 128.433 191.339 156.596 1.00 148.39 ?  -20  DC  I N1    1 
ATOM   7068  C  C2    . DC  I 6  53   ? 129.722 191.553 157.100 1.00 148.25 ?  -20  DC  I C2    1 
ATOM   7069  O  O2    . DC  I 6  53   ? 130.087 192.701 157.371 1.00 148.11 ?  -20  DC  I O2    1 
ATOM   7070  N  N3    . DC  I 6  53   ? 130.544 190.488 157.277 1.00 148.27 ?  -20  DC  I N3    1 
ATOM   7071  C  C4    . DC  I 6  53   ? 130.121 189.261 156.975 1.00 148.33 ?  -20  DC  I C4    1 
ATOM   7072  N  N4    . DC  I 6  53   ? 130.966 188.240 157.170 1.00 148.36 ?  -20  DC  I N4    1 
ATOM   7073  C  C5    . DC  I 6  53   ? 128.816 189.025 156.454 1.00 148.24 ?  -20  DC  I C5    1 
ATOM   7074  C  C6    . DC  I 6  53   ? 128.014 190.081 156.286 1.00 148.38 ?  -20  DC  I C6    1 
ATOM   7075  P  P     . DG  I 6  54   ? 125.499 195.398 154.064 1.00 151.04 ?  -19  DG  I P     1 
ATOM   7076  O  OP1   . DG  I 6  54   ? 124.275 196.227 154.118 1.00 151.15 ?  -19  DG  I OP1   1 
ATOM   7077  O  OP2   . DG  I 6  54   ? 125.741 194.529 152.891 1.00 150.77 ?  -19  DG  I OP2   1 
ATOM   7078  O  "O5'" . DG  I 6  54   ? 126.772 196.352 154.239 1.00 151.21 ?  -19  DG  I "O5'" 1 
ATOM   7079  C  "C5'" . DG  I 6  54   ? 127.916 195.873 154.933 1.00 151.26 ?  -19  DG  I "C5'" 1 
ATOM   7080  C  "C4'" . DG  I 6  54   ? 129.064 196.860 154.856 1.00 151.25 ?  -19  DG  I "C4'" 1 
ATOM   7081  O  "O4'" . DG  I 6  54   ? 130.247 196.238 155.409 1.00 151.49 ?  -19  DG  I "O4'" 1 
ATOM   7082  C  "C3'" . DG  I 6  54   ? 129.470 197.256 153.449 1.00 151.12 ?  -19  DG  I "C3'" 1 
ATOM   7083  O  "O3'" . DG  I 6  54   ? 130.218 198.465 153.478 1.00 151.06 ?  -19  DG  I "O3'" 1 
ATOM   7084  C  "C2'" . DG  I 6  54   ? 130.344 196.081 153.047 1.00 151.03 ?  -19  DG  I "C2'" 1 
ATOM   7085  C  "C1'" . DG  I 6  54   ? 131.073 195.774 154.356 1.00 151.37 ?  -19  DG  I "C1'" 1 
ATOM   7086  N  N9    . DG  I 6  54   ? 131.312 194.350 154.541 1.00 151.48 ?  -19  DG  I N9    1 
ATOM   7087  C  C8    . DG  I 6  54   ? 130.431 193.330 154.282 1.00 151.57 ?  -19  DG  I C8    1 
ATOM   7088  N  N7    . DG  I 6  54   ? 130.921 192.148 154.521 1.00 151.55 ?  -19  DG  I N7    1 
ATOM   7089  C  C5    . DG  I 6  54   ? 132.209 192.398 154.973 1.00 151.39 ?  -19  DG  I C5    1 
ATOM   7090  C  C6    . DG  I 6  54   ? 133.216 191.499 155.385 1.00 151.30 ?  -19  DG  I C6    1 
ATOM   7091  O  O6    . DG  I 6  54   ? 133.166 190.263 155.441 1.00 151.50 ?  -19  DG  I O6    1 
ATOM   7092  N  N1    . DG  I 6  54   ? 134.378 192.165 155.758 1.00 151.46 ?  -19  DG  I N1    1 
ATOM   7093  C  C2    . DG  I 6  54   ? 134.549 193.529 155.735 1.00 151.61 ?  -19  DG  I C2    1 
ATOM   7094  N  N2    . DG  I 6  54   ? 135.746 193.987 156.136 1.00 151.54 ?  -19  DG  I N2    1 
ATOM   7095  N  N3    . DG  I 6  54   ? 133.611 194.386 155.349 1.00 151.50 ?  -19  DG  I N3    1 
ATOM   7096  C  C4    . DG  I 6  54   ? 132.470 193.750 154.982 1.00 151.42 ?  -19  DG  I C4    1 
ATOM   7097  P  P     . DC  I 6  55   ? 130.712 199.144 152.107 1.00 150.83 ?  -18  DC  I P     1 
ATOM   7098  O  OP1   . DC  I 6  55   ? 131.078 200.546 152.410 1.00 150.56 ?  -18  DC  I OP1   1 
ATOM   7099  O  OP2   . DC  I 6  55   ? 129.690 198.857 151.076 1.00 150.40 ?  -18  DC  I OP2   1 
ATOM   7100  O  "O5'" . DC  I 6  55   ? 132.039 198.332 151.721 1.00 150.46 ?  -18  DC  I "O5'" 1 
ATOM   7101  C  "C5'" . DC  I 6  55   ? 133.145 198.302 152.619 1.00 149.68 ?  -18  DC  I "C5'" 1 
ATOM   7102  C  "C4'" . DC  I 6  55   ? 134.264 197.424 152.078 1.00 148.82 ?  -18  DC  I "C4'" 1 
ATOM   7103  O  "O4'" . DC  I 6  55   ? 134.086 196.057 152.528 1.00 148.65 ?  -18  DC  I "O4'" 1 
ATOM   7104  C  "C3'" . DC  I 6  55   ? 134.363 197.358 150.546 1.00 148.53 ?  -18  DC  I "C3'" 1 
ATOM   7105  O  "O3'" . DC  I 6  55   ? 135.659 197.769 150.121 1.00 147.80 ?  -18  DC  I "O3'" 1 
ATOM   7106  C  "C2'" . DC  I 6  55   ? 134.109 195.880 150.223 1.00 148.62 ?  -18  DC  I "C2'" 1 
ATOM   7107  C  "C1'" . DC  I 6  55   ? 134.544 195.206 151.512 1.00 148.66 ?  -18  DC  I "C1'" 1 
ATOM   7108  N  N1    . DC  I 6  55   ? 133.963 193.842 151.706 1.00 148.78 ?  -18  DC  I N1    1 
ATOM   7109  C  C2    . DC  I 6  55   ? 134.763 192.818 152.228 1.00 149.05 ?  -18  DC  I C2    1 
ATOM   7110  O  O2    . DC  I 6  55   ? 135.936 193.064 152.533 1.00 149.16 ?  -18  DC  I O2    1 
ATOM   7111  N  N3    . DC  I 6  55   ? 134.229 191.582 152.387 1.00 148.97 ?  -18  DC  I N3    1 
ATOM   7112  C  C4    . DC  I 6  55   ? 132.958 191.355 152.045 1.00 148.68 ?  -18  DC  I C4    1 
ATOM   7113  N  N4    . DC  I 6  55   ? 132.473 190.121 152.223 1.00 148.54 ?  -18  DC  I N4    1 
ATOM   7114  C  C5    . DC  I 6  55   ? 132.129 192.385 151.507 1.00 149.00 ?  -18  DC  I C5    1 
ATOM   7115  C  C6    . DC  I 6  55   ? 132.667 193.600 151.356 1.00 148.94 ?  -18  DC  I C6    1 
ATOM   7116  P  P     . DT  I 6  56   ? 135.930 198.114 148.574 1.00 147.06 ?  -17  DT  I P     1 
ATOM   7117  O  OP1   . DT  I 6  56   ? 137.195 198.878 148.495 1.00 147.02 ?  -17  DT  I OP1   1 
ATOM   7118  O  OP2   . DT  I 6  56   ? 134.688 198.706 148.030 1.00 146.75 ?  -17  DT  I OP2   1 
ATOM   7119  O  "O5'" . DT  I 6  56   ? 136.124 196.681 147.887 1.00 146.13 ?  -17  DT  I "O5'" 1 
ATOM   7120  C  "C5'" . DT  I 6  56   ? 137.399 196.289 147.385 1.00 144.76 ?  -17  DT  I "C5'" 1 
ATOM   7121  C  "C4'" . DT  I 6  56   ? 138.339 195.906 148.516 1.00 143.73 ?  -17  DT  I "C4'" 1 
ATOM   7122  O  "O4'" . DT  I 6  56   ? 137.648 195.040 149.451 1.00 143.69 ?  -17  DT  I "O4'" 1 
ATOM   7123  C  "C3'" . DT  I 6  56   ? 139.582 195.144 148.080 1.00 143.11 ?  -17  DT  I "C3'" 1 
ATOM   7124  O  "O3'" . DT  I 6  56   ? 140.690 195.488 148.902 1.00 142.03 ?  -17  DT  I "O3'" 1 
ATOM   7125  C  "C2'" . DT  I 6  56   ? 139.176 193.684 148.257 1.00 143.36 ?  -17  DT  I "C2'" 1 
ATOM   7126  C  "C1'" . DT  I 6  56   ? 138.212 193.742 149.434 1.00 143.91 ?  -17  DT  I "C1'" 1 
ATOM   7127  N  N1    . DT  I 6  56   ? 137.097 192.753 149.338 1.00 144.00 ?  -17  DT  I N1    1 
ATOM   7128  C  C2    . DT  I 6  56   ? 137.296 191.461 149.770 1.00 144.00 ?  -17  DT  I C2    1 
ATOM   7129  O  O2    . DT  I 6  56   ? 138.350 191.068 150.238 1.00 144.00 ?  -17  DT  I O2    1 
ATOM   7130  N  N3    . DT  I 6  56   ? 136.205 190.639 149.643 1.00 144.19 ?  -17  DT  I N3    1 
ATOM   7131  C  C4    . DT  I 6  56   ? 134.963 190.976 149.132 1.00 144.15 ?  -17  DT  I C4    1 
ATOM   7132  O  O4    . DT  I 6  56   ? 134.043 190.170 149.055 1.00 144.08 ?  -17  DT  I O4    1 
ATOM   7133  C  C5    . DT  I 6  56   ? 134.826 192.345 148.694 1.00 144.26 ?  -17  DT  I C5    1 
ATOM   7134  C  C7    . DT  I 6  56   ? 133.526 192.826 148.119 1.00 144.21 ?  -17  DT  I C7    1 
ATOM   7135  C  C6    . DT  I 6  56   ? 135.886 193.156 148.817 1.00 144.24 ?  -17  DT  I C6    1 
ATOM   7136  P  P     . DT  I 6  57   ? 142.133 195.725 148.236 1.00 140.75 ?  -16  DT  I P     1 
ATOM   7137  O  OP1   . DT  I 6  57   ? 143.053 196.196 149.294 1.00 140.78 ?  -16  DT  I OP1   1 
ATOM   7138  O  OP2   . DT  I 6  57   ? 141.928 196.545 147.022 1.00 140.83 ?  -16  DT  I OP2   1 
ATOM   7139  O  "O5'" . DT  I 6  57   ? 142.584 194.263 147.766 1.00 139.21 ?  -16  DT  I "O5'" 1 
ATOM   7140  C  "C5'" . DT  I 6  57   ? 142.855 193.256 148.735 1.00 136.93 ?  -16  DT  I "C5'" 1 
ATOM   7141  C  "C4'" . DT  I 6  57   ? 143.051 191.900 148.076 1.00 134.94 ?  -16  DT  I "C4'" 1 
ATOM   7142  O  "O4'" . DT  I 6  57   ? 141.759 191.282 147.821 1.00 135.02 ?  -16  DT  I "O4'" 1 
ATOM   7143  C  "C3'" . DT  I 6  57   ? 143.776 191.923 146.728 1.00 133.39 ?  -16  DT  I "C3'" 1 
ATOM   7144  O  "O3'" . DT  I 6  57   ? 144.637 190.794 146.634 1.00 130.18 ?  -16  DT  I "O3'" 1 
ATOM   7145  C  "C2'" . DT  I 6  57   ? 142.622 191.822 145.733 1.00 134.26 ?  -16  DT  I "C2'" 1 
ATOM   7146  C  "C1'" . DT  I 6  57   ? 141.712 190.861 146.476 1.00 135.41 ?  -16  DT  I "C1'" 1 
ATOM   7147  N  N1    . DT  I 6  57   ? 140.287 190.869 146.019 1.00 135.79 ?  -16  DT  I N1    1 
ATOM   7148  C  C2    . DT  I 6  57   ? 139.537 189.725 146.161 1.00 135.93 ?  -16  DT  I C2    1 
ATOM   7149  O  O2    . DT  I 6  57   ? 139.978 188.695 146.638 1.00 135.91 ?  -16  DT  I O2    1 
ATOM   7150  N  N3    . DT  I 6  57   ? 138.244 189.825 145.724 1.00 136.14 ?  -16  DT  I N3    1 
ATOM   7151  C  C4    . DT  I 6  57   ? 137.635 190.934 145.168 1.00 136.02 ?  -16  DT  I C4    1 
ATOM   7152  O  O4    . DT  I 6  57   ? 136.462 190.922 144.805 1.00 135.83 ?  -16  DT  I O4    1 
ATOM   7153  C  C5    . DT  I 6  57   ? 138.476 192.104 145.046 1.00 136.02 ?  -16  DT  I C5    1 
ATOM   7154  C  C7    . DT  I 6  57   ? 137.927 193.371 144.458 1.00 135.76 ?  -16  DT  I C7    1 
ATOM   7155  C  C6    . DT  I 6  57   ? 139.749 192.013 145.467 1.00 135.93 ?  -16  DT  I C6    1 
ATOM   7156  P  P     . DA  I 6  58   ? 146.070 190.912 145.916 1.00 127.08 ?  -15  DA  I P     1 
ATOM   7157  O  OP1   . DA  I 6  58   ? 146.961 191.688 146.808 1.00 126.96 ?  -15  DA  I OP1   1 
ATOM   7158  O  OP2   . DA  I 6  58   ? 145.840 191.366 144.527 1.00 125.91 ?  -15  DA  I OP2   1 
ATOM   7159  O  "O5'" . DA  I 6  58   ? 146.593 189.400 145.858 1.00 125.14 ?  -15  DA  I "O5'" 1 
ATOM   7160  C  "C5'" . DA  I 6  58   ? 146.790 188.667 147.064 1.00 121.31 ?  -15  DA  I "C5'" 1 
ATOM   7161  C  "C4'" . DA  I 6  58   ? 146.144 187.292 146.982 1.00 118.12 ?  -15  DA  I "C4'" 1 
ATOM   7162  O  "O4'" . DA  I 6  58   ? 144.723 187.436 146.713 1.00 117.75 ?  -15  DA  I "O4'" 1 
ATOM   7163  C  "C3'" . DA  I 6  58   ? 146.688 186.382 145.884 1.00 115.86 ?  -15  DA  I "C3'" 1 
ATOM   7164  O  "O3'" . DA  I 6  58   ? 146.692 185.029 146.333 1.00 112.21 ?  -15  DA  I "O3'" 1 
ATOM   7165  C  "C2'" . DA  I 6  58   ? 145.692 186.594 144.749 1.00 116.50 ?  -15  DA  I "C2'" 1 
ATOM   7166  C  "C1'" . DA  I 6  58   ? 144.388 186.764 145.514 1.00 117.53 ?  -15  DA  I "C1'" 1 
ATOM   7167  N  N9    . DA  I 6  58   ? 143.397 187.567 144.800 1.00 117.66 ?  -15  DA  I N9    1 
ATOM   7168  C  C8    . DA  I 6  58   ? 143.563 188.836 144.323 1.00 117.77 ?  -15  DA  I C8    1 
ATOM   7169  N  N7    . DA  I 6  58   ? 142.503 189.319 143.720 1.00 117.97 ?  -15  DA  I N7    1 
ATOM   7170  C  C5    . DA  I 6  58   ? 141.573 188.299 143.811 1.00 117.81 ?  -15  DA  I C5    1 
ATOM   7171  C  C6    . DA  I 6  58   ? 140.242 188.188 143.362 1.00 117.46 ?  -15  DA  I C6    1 
ATOM   7172  N  N6    . DA  I 6  58   ? 139.605 189.166 142.710 1.00 117.48 ?  -15  DA  I N6    1 
ATOM   7173  N  N1    . DA  I 6  58   ? 139.590 187.033 143.611 1.00 117.50 ?  -15  DA  I N1    1 
ATOM   7174  C  C2    . DA  I 6  58   ? 140.233 186.058 144.267 1.00 117.55 ?  -15  DA  I C2    1 
ATOM   7175  N  N3    . DA  I 6  58   ? 141.484 186.046 144.736 1.00 117.69 ?  -15  DA  I N3    1 
ATOM   7176  C  C4    . DA  I 6  58   ? 142.105 187.208 144.473 1.00 117.85 ?  -15  DA  I C4    1 
ATOM   7177  P  P     . DA  I 6  59   ? 147.448 183.890 145.486 1.00 109.75 ?  -14  DA  I P     1 
ATOM   7178  O  OP1   . DA  I 6  59   ? 148.346 183.169 146.415 1.00 109.05 ?  -14  DA  I OP1   1 
ATOM   7179  O  OP2   . DA  I 6  59   ? 148.007 184.510 144.264 1.00 108.49 ?  -14  DA  I OP2   1 
ATOM   7180  O  "O5'" . DA  I 6  59   ? 146.272 182.900 145.045 1.00 106.43 ?  -14  DA  I "O5'" 1 
ATOM   7181  C  "C5'" . DA  I 6  59   ? 145.564 182.156 146.032 1.00 101.21 ?  -14  DA  I "C5'" 1 
ATOM   7182  C  "C4'" . DA  I 6  59   ? 144.307 181.524 145.454 1.00 97.58  ?  -14  DA  I "C4'" 1 
ATOM   7183  O  "O4'" . DA  I 6  59   ? 143.426 182.556 144.934 1.00 97.40  ?  -14  DA  I "O4'" 1 
ATOM   7184  C  "C3'" . DA  I 6  59   ? 144.529 180.559 144.293 1.00 94.47  ?  -14  DA  I "C3'" 1 
ATOM   7185  O  "O3'" . DA  I 6  59   ? 143.532 179.556 144.330 1.00 89.42  ?  -14  DA  I "O3'" 1 
ATOM   7186  C  "C2'" . DA  I 6  59   ? 144.337 181.467 143.086 1.00 95.33  ?  -14  DA  I "C2'" 1 
ATOM   7187  C  "C1'" . DA  I 6  59   ? 143.165 182.302 143.567 1.00 99.03  ?  -14  DA  I "C1'" 1 
ATOM   7188  N  N9    . DA  I 6  59   ? 143.019 183.582 142.885 1.00 100.14 ?  -14  DA  I N9    1 
ATOM   7189  C  C8    . DA  I 6  59   ? 143.941 184.584 142.815 1.00 100.80 ?  -14  DA  I C8    1 
ATOM   7190  N  N7    . DA  I 6  59   ? 143.531 185.636 142.149 1.00 101.21 ?  -14  DA  I N7    1 
ATOM   7191  C  C5    . DA  I 6  59   ? 142.248 185.300 141.755 1.00 101.16 ?  -14  DA  I C5    1 
ATOM   7192  C  C6    . DA  I 6  59   ? 141.272 185.993 141.015 1.00 100.50 ?  -14  DA  I C6    1 
ATOM   7193  N  N6    . DA  I 6  59   ? 141.462 187.220 140.522 1.00 100.58 ?  -14  DA  I N6    1 
ATOM   7194  N  N1    . DA  I 6  59   ? 140.092 185.375 140.799 1.00 100.69 ?  -14  DA  I N1    1 
ATOM   7195  C  C2    . DA  I 6  59   ? 139.909 184.145 141.296 1.00 100.81 ?  -14  DA  I C2    1 
ATOM   7196  N  N3    . DA  I 6  59   ? 140.751 183.395 142.008 1.00 101.03 ?  -14  DA  I N3    1 
ATOM   7197  C  C4    . DA  I 6  59   ? 141.913 184.038 142.204 1.00 101.40 ?  -14  DA  I C4    1 
ATOM   7198  P  P     . DA  I 6  60   ? 143.879 178.041 143.931 1.00 86.45  ?  -13  DA  I P     1 
ATOM   7199  O  OP1   . DA  I 6  60   ? 144.467 177.398 145.127 1.00 86.74  ?  -13  DA  I OP1   1 
ATOM   7200  O  OP2   . DA  I 6  60   ? 144.631 178.064 142.656 1.00 84.67  ?  -13  DA  I OP2   1 
ATOM   7201  O  "O5'" . DA  I 6  60   ? 142.444 177.392 143.649 1.00 89.16  ?  -13  DA  I "O5'" 1 
ATOM   7202  C  "C5'" . DA  I 6  60   ? 141.310 178.237 143.486 1.00 89.50  ?  -13  DA  I "C5'" 1 
ATOM   7203  C  "C4'" . DA  I 6  60   ? 140.222 177.542 142.689 1.00 88.97  ?  -13  DA  I "C4'" 1 
ATOM   7204  O  "O4'" . DA  I 6  60   ? 139.717 178.445 141.686 1.00 87.58  ?  -13  DA  I "O4'" 1 
ATOM   7205  C  "C3'" . DA  I 6  60   ? 140.677 176.335 141.899 1.00 89.75  ?  -13  DA  I "C3'" 1 
ATOM   7206  O  "O3'" . DA  I 6  60   ? 139.553 175.519 141.589 1.00 91.78  ?  -13  DA  I "O3'" 1 
ATOM   7207  C  "C2'" . DA  I 6  60   ? 141.273 176.977 140.646 1.00 88.47  ?  -13  DA  I "C2'" 1 
ATOM   7208  C  "C1'" . DA  I 6  60   ? 140.427 178.246 140.476 1.00 89.27  ?  -13  DA  I "C1'" 1 
ATOM   7209  N  N9    . DA  I 6  60   ? 141.225 179.440 140.221 1.00 89.71  ?  -13  DA  I N9    1 
ATOM   7210  C  C8    . DA  I 6  60   ? 142.490 179.695 140.669 1.00 90.35  ?  -13  DA  I C8    1 
ATOM   7211  N  N7    . DA  I 6  60   ? 142.961 180.857 140.289 1.00 90.67  ?  -13  DA  I N7    1 
ATOM   7212  C  C5    . DA  I 6  60   ? 141.933 181.406 139.545 1.00 90.87  ?  -13  DA  I C5    1 
ATOM   7213  C  C6    . DA  I 6  60   ? 141.808 182.629 138.866 1.00 89.87  ?  -13  DA  I C6    1 
ATOM   7214  N  N6    . DA  I 6  60   ? 142.775 183.550 138.837 1.00 89.82  ?  -13  DA  I N6    1 
ATOM   7215  N  N1    . DA  I 6  60   ? 140.649 182.869 138.213 1.00 89.88  ?  -13  DA  I N1    1 
ATOM   7216  C  C2    . DA  I 6  60   ? 139.686 181.940 138.254 1.00 90.23  ?  -13  DA  I C2    1 
ATOM   7217  N  N3    . DA  I 6  60   ? 139.690 180.753 138.859 1.00 90.81  ?  -13  DA  I N3    1 
ATOM   7218  C  C4    . DA  I 6  60   ? 140.854 180.546 139.493 1.00 90.82  ?  -13  DA  I C4    1 
ATOM   7219  P  P     . DC  I 6  61   ? 139.704 174.249 140.617 1.00 91.83  ?  -12  DC  I P     1 
ATOM   7220  O  OP1   . DC  I 6  61   ? 138.686 173.259 141.034 1.00 91.20  ?  -12  DC  I OP1   1 
ATOM   7221  O  OP2   . DC  I 6  61   ? 141.129 173.853 140.578 1.00 91.76  ?  -12  DC  I OP2   1 
ATOM   7222  O  "O5'" . DC  I 6  61   ? 139.302 174.825 139.179 1.00 93.16  ?  -12  DC  I "O5'" 1 
ATOM   7223  C  "C5'" . DC  I 6  61   ? 138.111 175.594 139.032 1.00 96.17  ?  -12  DC  I "C5'" 1 
ATOM   7224  C  "C4'" . DC  I 6  61   ? 137.919 176.040 137.592 1.00 99.52  ?  -12  DC  I "C4'" 1 
ATOM   7225  O  "O4'" . DC  I 6  61   ? 138.677 177.256 137.344 1.00 100.08 ?  -12  DC  I "O4'" 1 
ATOM   7226  C  "C3'" . DC  I 6  61   ? 138.377 175.037 136.534 1.00 101.74 ?  -12  DC  I "C3'" 1 
ATOM   7227  O  "O3'" . DC  I 6  61   ? 137.477 175.056 135.437 1.00 105.75 ?  -12  DC  I "O3'" 1 
ATOM   7228  C  "C2'" . DC  I 6  61   ? 139.747 175.576 136.137 1.00 100.94 ?  -12  DC  I "C2'" 1 
ATOM   7229  C  "C1'" . DC  I 6  61   ? 139.496 177.072 136.210 1.00 101.21 ?  -12  DC  I "C1'" 1 
ATOM   7230  N  N1    . DC  I 6  61   ? 140.733 177.881 136.386 1.00 101.45 ?  -12  DC  I N1    1 
ATOM   7231  C  C2    . DC  I 6  61   ? 140.879 179.087 135.691 1.00 101.68 ?  -12  DC  I C2    1 
ATOM   7232  O  O2    . DC  I 6  61   ? 139.974 179.463 134.934 1.00 101.94 ?  -12  DC  I O2    1 
ATOM   7233  N  N3    . DC  I 6  61   ? 142.013 179.812 135.869 1.00 101.77 ?  -12  DC  I N3    1 
ATOM   7234  C  C4    . DC  I 6  61   ? 142.965 179.372 136.695 1.00 101.59 ?  -12  DC  I C4    1 
ATOM   7235  N  N4    . DC  I 6  61   ? 144.065 180.118 136.837 1.00 101.41 ?  -12  DC  I N4    1 
ATOM   7236  C  C5    . DC  I 6  61   ? 142.832 178.146 137.409 1.00 101.41 ?  -12  DC  I C5    1 
ATOM   7237  C  C6    . DC  I 6  61   ? 141.712 177.440 137.226 1.00 101.51 ?  -12  DC  I C6    1 
ATOM   7238  P  P     . DG  I 6  62   ? 137.328 173.773 134.482 1.00 107.71 ?  -11  DG  I P     1 
ATOM   7239  O  OP1   . DG  I 6  62   ? 136.043 173.120 134.814 1.00 108.05 ?  -11  DG  I OP1   1 
ATOM   7240  O  OP2   . DG  I 6  62   ? 138.587 172.999 134.556 1.00 106.97 ?  -11  DG  I OP2   1 
ATOM   7241  O  "O5'" . DG  I 6  62   ? 137.224 174.403 133.015 1.00 109.22 ?  -11  DG  I "O5'" 1 
ATOM   7242  C  "C5'" . DG  I 6  62   ? 136.185 175.329 132.713 1.00 112.73 ?  -11  DG  I "C5'" 1 
ATOM   7243  C  "C4'" . DG  I 6  62   ? 136.554 176.199 131.521 1.00 115.98 ?  -11  DG  I "C4'" 1 
ATOM   7244  O  "O4'" . DG  I 6  62   ? 137.648 177.084 131.877 1.00 116.80 ?  -11  DG  I "O4'" 1 
ATOM   7245  C  "C3'" . DG  I 6  62   ? 137.006 175.445 130.277 1.00 117.79 ?  -11  DG  I "C3'" 1 
ATOM   7246  O  "O3'" . DG  I 6  62   ? 136.521 176.101 129.114 1.00 119.78 ?  -11  DG  I "O3'" 1 
ATOM   7247  C  "C2'" . DG  I 6  62   ? 138.531 175.503 130.365 1.00 117.90 ?  -11  DG  I "C2'" 1 
ATOM   7248  C  "C1'" . DG  I 6  62   ? 138.764 176.851 131.039 1.00 118.68 ?  -11  DG  I "C1'" 1 
ATOM   7249  N  N9    . DG  I 6  62   ? 139.961 176.884 131.874 1.00 119.17 ?  -11  DG  I N9    1 
ATOM   7250  C  C8    . DG  I 6  62   ? 140.306 175.983 132.849 1.00 119.43 ?  -11  DG  I C8    1 
ATOM   7251  N  N7    . DG  I 6  62   ? 141.427 176.267 133.449 1.00 119.29 ?  -11  DG  I N7    1 
ATOM   7252  C  C5    . DG  I 6  62   ? 141.855 177.436 132.836 1.00 119.40 ?  -11  DG  I C5    1 
ATOM   7253  C  C6    . DG  I 6  62   ? 143.013 178.213 133.068 1.00 119.49 ?  -11  DG  I C6    1 
ATOM   7254  O  O6    . DG  I 6  62   ? 143.918 178.014 133.891 1.00 119.06 ?  -11  DG  I O6    1 
ATOM   7255  N  N1    . DG  I 6  62   ? 143.070 179.319 132.226 1.00 119.67 ?  -11  DG  I N1    1 
ATOM   7256  C  C2    . DG  I 6  62   ? 142.125 179.635 131.277 1.00 119.47 ?  -11  DG  I C2    1 
ATOM   7257  N  N2    . DG  I 6  62   ? 142.351 180.746 130.559 1.00 119.40 ?  -11  DG  I N2    1 
ATOM   7258  N  N3    . DG  I 6  62   ? 141.032 178.915 131.049 1.00 119.19 ?  -11  DG  I N3    1 
ATOM   7259  C  C4    . DG  I 6  62   ? 140.963 177.832 131.863 1.00 119.31 ?  -11  DG  I C4    1 
ATOM   7260  P  P     . DC  I 6  63   ? 136.727 175.440 127.665 1.00 121.32 ?  -10  DC  I P     1 
ATOM   7261  O  OP1   . DC  I 6  63   ? 135.604 175.878 126.807 1.00 121.52 ?  -10  DC  I OP1   1 
ATOM   7262  O  OP2   . DC  I 6  63   ? 136.982 173.995 127.861 1.00 121.44 ?  -10  DC  I OP2   1 
ATOM   7263  O  "O5'" . DC  I 6  63   ? 138.077 176.109 127.133 1.00 121.92 ?  -10  DC  I "O5'" 1 
ATOM   7264  C  "C5'" . DC  I 6  63   ? 138.190 177.526 127.072 1.00 123.18 ?  -10  DC  I "C5'" 1 
ATOM   7265  C  "C4'" . DC  I 6  63   ? 139.606 177.937 126.717 1.00 124.83 ?  -10  DC  I "C4'" 1 
ATOM   7266  O  "O4'" . DC  I 6  63   ? 140.433 177.898 127.897 1.00 125.47 ?  -10  DC  I "O4'" 1 
ATOM   7267  C  "C3'" . DC  I 6  63   ? 140.299 177.030 125.696 1.00 125.56 ?  -10  DC  I "C3'" 1 
ATOM   7268  O  "O3'" . DC  I 6  63   ? 140.414 177.693 124.443 1.00 126.40 ?  -10  DC  I "O3'" 1 
ATOM   7269  C  "C2'" . DC  I 6  63   ? 141.679 176.736 126.306 1.00 125.58 ?  -10  DC  I "C2'" 1 
ATOM   7270  C  "C1'" . DC  I 6  63   ? 141.757 177.694 127.489 1.00 125.76 ?  -10  DC  I "C1'" 1 
ATOM   7271  N  N1    . DC  I 6  63   ? 142.538 177.149 128.635 1.00 125.98 ?  -10  DC  I N1    1 
ATOM   7272  C  C2    . DC  I 6  63   ? 143.706 177.801 129.048 1.00 126.02 ?  -10  DC  I C2    1 
ATOM   7273  O  O2    . DC  I 6  63   ? 144.062 178.829 128.461 1.00 126.14 ?  -10  DC  I O2    1 
ATOM   7274  N  N3    . DC  I 6  63   ? 144.412 177.289 130.086 1.00 125.97 ?  -10  DC  I N3    1 
ATOM   7275  C  C4    . DC  I 6  63   ? 143.992 176.176 130.694 1.00 125.94 ?  -10  DC  I C4    1 
ATOM   7276  N  N4    . DC  I 6  63   ? 144.719 175.710 131.715 1.00 126.02 ?  -10  DC  I N4    1 
ATOM   7277  C  C5    . DC  I 6  63   ? 142.808 175.495 130.283 1.00 126.18 ?  -10  DC  I C5    1 
ATOM   7278  C  C6    . DC  I 6  63   ? 142.121 176.010 129.259 1.00 126.18 ?  -10  DC  I C6    1 
ATOM   7279  P  P     . DA  I 6  64   ? 140.908 176.879 123.148 1.00 126.88 ?  -9   DA  I P     1 
ATOM   7280  O  OP1   . DA  I 6  64   ? 140.393 177.583 121.952 1.00 127.25 ?  -9   DA  I OP1   1 
ATOM   7281  O  OP2   . DA  I 6  64   ? 140.574 175.454 123.363 1.00 126.89 ?  -9   DA  I OP2   1 
ATOM   7282  O  "O5'" . DA  I 6  64   ? 142.502 177.020 123.186 1.00 127.46 ?  -9   DA  I "O5'" 1 
ATOM   7283  C  "C5'" . DA  I 6  64   ? 143.102 178.307 123.099 1.00 128.70 ?  -9   DA  I "C5'" 1 
ATOM   7284  C  "C4'" . DA  I 6  64   ? 144.619 178.208 123.118 1.00 129.73 ?  -9   DA  I "C4'" 1 
ATOM   7285  O  "O4'" . DA  I 6  64   ? 145.083 177.984 124.474 1.00 130.42 ?  -9   DA  I "O4'" 1 
ATOM   7286  C  "C3'" . DA  I 6  64   ? 145.213 177.087 122.264 1.00 130.21 ?  -9   DA  I "C3'" 1 
ATOM   7287  O  "O3'" . DA  I 6  64   ? 146.295 177.598 121.495 1.00 130.33 ?  -9   DA  I "O3'" 1 
ATOM   7288  C  "C2'" . DA  I 6  64   ? 145.682 176.056 123.296 1.00 130.63 ?  -9   DA  I "C2'" 1 
ATOM   7289  C  "C1'" . DA  I 6  64   ? 146.022 176.933 124.490 1.00 131.47 ?  -9   DA  I "C1'" 1 
ATOM   7290  N  N9    . DA  I 6  64   ? 145.903 176.247 125.773 1.00 131.81 ?  -9   DA  I N9    1 
ATOM   7291  C  C8    . DA  I 6  64   ? 144.802 175.595 126.252 1.00 131.86 ?  -9   DA  I C8    1 
ATOM   7292  N  N7    . DA  I 6  64   ? 144.969 175.078 127.444 1.00 131.81 ?  -9   DA  I N7    1 
ATOM   7293  C  C5    . DA  I 6  64   ? 146.269 175.416 127.774 1.00 131.87 ?  -9   DA  I C5    1 
ATOM   7294  C  C6    . DA  I 6  64   ? 147.052 175.159 128.914 1.00 131.98 ?  -9   DA  I C6    1 
ATOM   7295  N  N6    . DA  I 6  64   ? 146.607 174.471 129.967 1.00 131.74 ?  -9   DA  I N6    1 
ATOM   7296  N  N1    . DA  I 6  64   ? 148.314 175.634 128.928 1.00 132.08 ?  -9   DA  I N1    1 
ATOM   7297  C  C2    . DA  I 6  64   ? 148.756 176.322 127.868 1.00 131.87 ?  -9   DA  I C2    1 
ATOM   7298  N  N3    . DA  I 6  64   ? 148.113 176.627 126.739 1.00 131.77 ?  -9   DA  I N3    1 
ATOM   7299  C  C4    . DA  I 6  64   ? 146.861 176.142 126.758 1.00 131.93 ?  -9   DA  I C4    1 
ATOM   7300  P  P     . DC  I 6  65   ? 147.094 176.655 120.468 1.00 130.62 ?  -8   DC  I P     1 
ATOM   7301  O  OP1   . DC  I 6  65   ? 147.400 177.470 119.272 1.00 130.05 ?  -8   DC  I OP1   1 
ATOM   7302  O  OP2   . DC  I 6  65   ? 146.352 175.384 120.313 1.00 130.75 ?  -8   DC  I OP2   1 
ATOM   7303  O  "O5'" . DC  I 6  65   ? 148.462 176.346 121.235 1.00 130.30 ?  -8   DC  I "O5'" 1 
ATOM   7304  C  "C5'" . DC  I 6  65   ? 149.207 177.416 121.807 1.00 128.73 ?  -8   DC  I "C5'" 1 
ATOM   7305  C  "C4'" . DC  I 6  65   ? 150.518 176.917 122.388 1.00 127.43 ?  -8   DC  I "C4'" 1 
ATOM   7306  O  "O4'" . DC  I 6  65   ? 150.303 176.430 123.741 1.00 127.36 ?  -8   DC  I "O4'" 1 
ATOM   7307  C  "C3'" . DC  I 6  65   ? 151.170 175.769 121.620 1.00 126.76 ?  -8   DC  I "C3'" 1 
ATOM   7308  O  "O3'" . DC  I 6  65   ? 152.576 175.962 121.574 1.00 125.80 ?  -8   DC  I "O3'" 1 
ATOM   7309  C  "C2'" . DC  I 6  65   ? 150.794 174.543 122.450 1.00 126.94 ?  -8   DC  I "C2'" 1 
ATOM   7310  C  "C1'" . DC  I 6  65   ? 150.802 175.115 123.859 1.00 127.56 ?  -8   DC  I "C1'" 1 
ATOM   7311  N  N1    . DC  I 6  65   ? 149.930 174.367 124.811 1.00 127.73 ?  -8   DC  I N1    1 
ATOM   7312  C  C2    . DC  I 6  65   ? 150.436 173.964 126.056 1.00 127.68 ?  -8   DC  I C2    1 
ATOM   7313  O  O2    . DC  I 6  65   ? 151.608 174.235 126.347 1.00 127.73 ?  -8   DC  I O2    1 
ATOM   7314  N  N3    . DC  I 6  65   ? 149.621 173.289 126.908 1.00 127.71 ?  -8   DC  I N3    1 
ATOM   7315  C  C4    . DC  I 6  65   ? 148.362 173.019 126.552 1.00 127.83 ?  -8   DC  I C4    1 
ATOM   7316  N  N4    . DC  I 6  65   ? 147.592 172.352 127.419 1.00 127.62 ?  -8   DC  I N4    1 
ATOM   7317  C  C5    . DC  I 6  65   ? 147.834 173.419 125.290 1.00 128.02 ?  -8   DC  I C5    1 
ATOM   7318  C  C6    . DC  I 6  65   ? 148.643 174.086 124.462 1.00 128.09 ?  -8   DC  I C6    1 
ATOM   7319  P  P     . DG  I 6  66   ? 153.495 175.054 120.618 1.00 124.81 ?  -7   DG  I P     1 
ATOM   7320  O  OP1   . DG  I 6  66   ? 154.329 175.969 119.808 1.00 124.84 ?  -7   DG  I OP1   1 
ATOM   7321  O  OP2   . DG  I 6  66   ? 152.632 174.060 119.941 1.00 124.28 ?  -7   DG  I OP2   1 
ATOM   7322  O  "O5'" . DG  I 6  66   ? 154.441 174.274 121.642 1.00 125.42 ?  -7   DG  I "O5'" 1 
ATOM   7323  C  "C5'" . DG  I 6  66   ? 155.189 175.007 122.603 1.00 126.17 ?  -7   DG  I "C5'" 1 
ATOM   7324  C  "C4'" . DG  I 6  66   ? 155.745 174.095 123.684 1.00 126.78 ?  -7   DG  I "C4'" 1 
ATOM   7325  O  "O4'" . DG  I 6  66   ? 154.669 173.609 124.532 1.00 127.69 ?  -7   DG  I "O4'" 1 
ATOM   7326  C  "C3'" . DG  I 6  66   ? 156.475 172.853 123.187 1.00 126.54 ?  -7   DG  I "C3'" 1 
ATOM   7327  O  "O3'" . DG  I 6  66   ? 157.551 172.582 124.063 1.00 124.93 ?  -7   DG  I "O3'" 1 
ATOM   7328  C  "C2'" . DG  I 6  66   ? 155.394 171.776 123.283 1.00 127.48 ?  -7   DG  I "C2'" 1 
ATOM   7329  C  "C1'" . DG  I 6  66   ? 154.693 172.195 124.563 1.00 129.09 ?  -7   DG  I "C1'" 1 
ATOM   7330  N  N9    . DG  I 6  66   ? 153.313 171.725 124.690 1.00 129.64 ?  -7   DG  I N9    1 
ATOM   7331  C  C8    . DG  I 6  66   ? 152.301 171.870 123.774 1.00 130.05 ?  -7   DG  I C8    1 
ATOM   7332  N  N7    . DG  I 6  66   ? 151.160 171.377 124.176 1.00 130.47 ?  -7   DG  I N7    1 
ATOM   7333  C  C5    . DG  I 6  66   ? 151.432 170.881 125.445 1.00 130.23 ?  -7   DG  I C5    1 
ATOM   7334  C  C6    . DG  I 6  66   ? 150.581 170.231 126.374 1.00 129.86 ?  -7   DG  I C6    1 
ATOM   7335  O  O6    . DG  I 6  66   ? 149.378 169.953 126.254 1.00 129.90 ?  -7   DG  I O6    1 
ATOM   7336  N  N1    . DG  I 6  66   ? 151.259 169.890 127.542 1.00 129.85 ?  -7   DG  I N1    1 
ATOM   7337  C  C2    . DG  I 6  66   ? 152.591 170.144 127.781 1.00 130.05 ?  -7   DG  I C2    1 
ATOM   7338  N  N2    . DG  I 6  66   ? 153.072 169.746 128.970 1.00 129.92 ?  -7   DG  I N2    1 
ATOM   7339  N  N3    . DG  I 6  66   ? 153.395 170.757 126.922 1.00 130.17 ?  -7   DG  I N3    1 
ATOM   7340  C  C4    . DG  I 6  66   ? 152.751 171.094 125.779 1.00 130.15 ?  -7   DG  I C4    1 
ATOM   7341  P  P     . DT  I 6  67   ? 158.800 171.689 123.597 1.00 123.18 ?  -6   DT  I P     1 
ATOM   7342  O  OP1   . DT  I 6  67   ? 159.860 172.611 123.132 1.00 122.47 ?  -6   DT  I OP1   1 
ATOM   7343  O  OP2   . DT  I 6  67   ? 158.308 170.620 122.699 1.00 122.32 ?  -6   DT  I OP2   1 
ATOM   7344  O  "O5'" . DT  I 6  67   ? 159.272 171.008 124.962 1.00 122.99 ?  -6   DT  I "O5'" 1 
ATOM   7345  C  "C5'" . DT  I 6  67   ? 158.373 170.961 126.069 1.00 122.32 ?  -6   DT  I "C5'" 1 
ATOM   7346  C  "C4'" . DT  I 6  67   ? 158.234 169.543 126.582 1.00 121.85 ?  -6   DT  I "C4'" 1 
ATOM   7347  O  "O4'" . DT  I 6  67   ? 156.830 169.156 126.591 1.00 122.19 ?  -6   DT  I "O4'" 1 
ATOM   7348  C  "C3'" . DT  I 6  67   ? 158.948 168.491 125.736 1.00 121.22 ?  -6   DT  I "C3'" 1 
ATOM   7349  O  "O3'" . DT  I 6  67   ? 159.445 167.456 126.575 1.00 119.95 ?  -6   DT  I "O3'" 1 
ATOM   7350  C  "C2'" . DT  I 6  67   ? 157.817 167.984 124.848 1.00 121.94 ?  -6   DT  I "C2'" 1 
ATOM   7351  C  "C1'" . DT  I 6  67   ? 156.683 167.962 125.857 1.00 123.35 ?  -6   DT  I "C1'" 1 
ATOM   7352  N  N1    . DT  I 6  67   ? 155.313 167.923 125.253 1.00 124.04 ?  -6   DT  I N1    1 
ATOM   7353  C  C2    . DT  I 6  67   ? 154.268 167.426 125.999 1.00 124.29 ?  -6   DT  I C2    1 
ATOM   7354  O  O2    . DT  I 6  67   ? 154.399 167.014 127.137 1.00 124.61 ?  -6   DT  I O2    1 
ATOM   7355  N  N3    . DT  I 6  67   ? 153.055 167.423 125.362 1.00 124.27 ?  -6   DT  I N3    1 
ATOM   7356  C  C4    . DT  I 6  67   ? 152.787 167.868 124.080 1.00 124.62 ?  -6   DT  I C4    1 
ATOM   7357  O  O4    . DT  I 6  67   ? 151.660 167.827 123.595 1.00 124.66 ?  -6   DT  I O4    1 
ATOM   7358  C  C5    . DT  I 6  67   ? 153.927 168.375 123.349 1.00 125.05 ?  -6   DT  I C5    1 
ATOM   7359  C  C7    . DT  I 6  67   ? 153.759 168.879 121.946 1.00 124.59 ?  -6   DT  I C7    1 
ATOM   7360  C  C6    . DT  I 6  67   ? 155.122 168.376 123.964 1.00 124.71 ?  -6   DT  I C6    1 
ATOM   7361  P  P     . DA  I 6  68   ? 160.854 167.612 127.334 1.00 118.15 ?  -5   DA  I P     1 
ATOM   7362  O  OP1   . DA  I 6  68   ? 161.040 169.020 127.748 1.00 117.53 ?  -5   DA  I OP1   1 
ATOM   7363  O  OP2   . DA  I 6  68   ? 161.882 166.961 126.493 1.00 117.66 ?  -5   DA  I OP2   1 
ATOM   7364  O  "O5'" . DA  I 6  68   ? 160.664 166.720 128.647 1.00 116.93 ?  -5   DA  I "O5'" 1 
ATOM   7365  C  "C5'" . DA  I 6  68   ? 159.371 166.595 129.238 1.00 114.16 ?  -5   DA  I "C5'" 1 
ATOM   7366  C  "C4'" . DA  I 6  68   ? 159.025 165.136 129.475 1.00 112.05 ?  -5   DA  I "C4'" 1 
ATOM   7367  O  "O4'" . DA  I 6  68   ? 157.868 164.769 128.675 1.00 112.56 ?  -5   DA  I "O4'" 1 
ATOM   7368  C  "C3'" . DA  I 6  68   ? 160.113 164.148 129.083 1.00 110.92 ?  -5   DA  I "C3'" 1 
ATOM   7369  O  "O3'" . DA  I 6  68   ? 160.004 162.975 129.879 1.00 108.92 ?  -5   DA  I "O3'" 1 
ATOM   7370  C  "C2'" . DA  I 6  68   ? 159.762 163.864 127.628 1.00 111.54 ?  -5   DA  I "C2'" 1 
ATOM   7371  C  "C1'" . DA  I 6  68   ? 158.242 163.804 127.707 1.00 112.73 ?  -5   DA  I "C1'" 1 
ATOM   7372  N  N9    . DA  I 6  68   ? 157.571 164.133 126.452 1.00 113.22 ?  -5   DA  I N9    1 
ATOM   7373  C  C8    . DA  I 6  68   ? 158.133 164.689 125.338 1.00 112.96 ?  -5   DA  I C8    1 
ATOM   7374  N  N7    . DA  I 6  68   ? 157.283 164.883 124.356 1.00 112.84 ?  -5   DA  I N7    1 
ATOM   7375  C  C5    . DA  I 6  68   ? 156.078 164.427 124.863 1.00 113.46 ?  -5   DA  I C5    1 
ATOM   7376  C  C6    . DA  I 6  68   ? 154.781 164.357 124.313 1.00 113.08 ?  -5   DA  I C6    1 
ATOM   7377  N  N6    . DA  I 6  68   ? 154.481 164.771 123.077 1.00 112.94 ?  -5   DA  I N6    1 
ATOM   7378  N  N1    . DA  I 6  68   ? 153.802 163.842 125.086 1.00 113.00 ?  -5   DA  I N1    1 
ATOM   7379  C  C2    . DA  I 6  68   ? 154.112 163.426 126.320 1.00 112.86 ?  -5   DA  I C2    1 
ATOM   7380  N  N3    . DA  I 6  68   ? 155.287 163.446 126.945 1.00 113.32 ?  -5   DA  I N3    1 
ATOM   7381  C  C4    . DA  I 6  68   ? 156.238 163.961 126.154 1.00 113.52 ?  -5   DA  I C4    1 
ATOM   7382  P  P     . DC  I 6  69   ? 160.796 162.854 131.273 1.00 106.87 ?  -4   DC  I P     1 
ATOM   7383  O  OP1   . DC  I 6  69   ? 160.739 164.162 131.962 1.00 106.10 ?  -4   DC  I OP1   1 
ATOM   7384  O  OP2   . DC  I 6  69   ? 162.109 162.236 130.985 1.00 106.12 ?  -4   DC  I OP2   1 
ATOM   7385  O  "O5'" . DC  I 6  69   ? 159.933 161.796 132.106 1.00 104.94 ?  -4   DC  I "O5'" 1 
ATOM   7386  C  "C5'" . DC  I 6  69   ? 158.515 161.939 132.192 1.00 103.44 ?  -4   DC  I "C5'" 1 
ATOM   7387  C  "C4'" . DC  I 6  69   ? 157.822 160.583 132.241 1.00 102.40 ?  -4   DC  I "C4'" 1 
ATOM   7388  O  "O4'" . DC  I 6  69   ? 157.258 160.273 130.942 1.00 102.52 ?  -4   DC  I "O4'" 1 
ATOM   7389  C  "C3'" . DC  I 6  69   ? 158.716 159.402 132.577 1.00 101.00 ?  -4   DC  I "C3'" 1 
ATOM   7390  O  "O3'" . DC  I 6  69   ? 157.944 158.373 133.180 1.00 98.65  ?  -4   DC  I "O3'" 1 
ATOM   7391  C  "C2'" . DC  I 6  69   ? 159.224 158.980 131.202 1.00 102.03 ?  -4   DC  I "C2'" 1 
ATOM   7392  C  "C1'" . DC  I 6  69   ? 158.005 159.241 130.318 1.00 102.85 ?  -4   DC  I "C1'" 1 
ATOM   7393  N  N1    . DC  I 6  69   ? 158.356 159.700 128.946 1.00 103.54 ?  -4   DC  I N1    1 
ATOM   7394  C  C2    . DC  I 6  69   ? 157.370 159.740 127.955 1.00 103.75 ?  -4   DC  I C2    1 
ATOM   7395  O  O2    . DC  I 6  69   ? 156.220 159.377 128.231 1.00 103.65 ?  -4   DC  I O2    1 
ATOM   7396  N  N3    . DC  I 6  69   ? 157.705 160.171 126.712 1.00 103.68 ?  -4   DC  I N3    1 
ATOM   7397  C  C4    . DC  I 6  69   ? 158.957 160.553 126.453 1.00 103.43 ?  -4   DC  I C4    1 
ATOM   7398  N  N4    . DC  I 6  69   ? 159.242 160.972 125.215 1.00 103.26 ?  -4   DC  I N4    1 
ATOM   7399  C  C5    . DC  I 6  69   ? 159.974 160.518 127.452 1.00 103.55 ?  -4   DC  I C5    1 
ATOM   7400  C  C6    . DC  I 6  69   ? 159.632 160.095 128.672 1.00 103.66 ?  -4   DC  I C6    1 
ATOM   7401  P  P     . DG  I 6  70   ? 158.592 157.422 134.301 1.00 96.66  ?  -3   DG  I P     1 
ATOM   7402  O  OP1   . DG  I 6  70   ? 158.420 158.091 135.609 1.00 97.23  ?  -3   DG  I OP1   1 
ATOM   7403  O  OP2   . DG  I 6  70   ? 159.946 157.042 133.840 1.00 96.26  ?  -3   DG  I OP2   1 
ATOM   7404  O  "O5'" . DG  I 6  70   ? 157.673 156.112 134.264 1.00 97.49  ?  -3   DG  I "O5'" 1 
ATOM   7405  C  "C5'" . DG  I 6  70   ? 156.274 156.219 134.504 1.00 97.84  ?  -3   DG  I "C5'" 1 
ATOM   7406  C  "C4'" . DG  I 6  70   ? 155.478 155.461 133.454 1.00 97.82  ?  -3   DG  I "C4'" 1 
ATOM   7407  O  "O4'" . DG  I 6  70   ? 155.841 155.935 132.129 1.00 98.01  ?  -3   DG  I "O4'" 1 
ATOM   7408  C  "C3'" . DG  I 6  70   ? 155.699 153.950 133.426 1.00 98.62  ?  -3   DG  I "C3'" 1 
ATOM   7409  O  "O3'" . DG  I 6  70   ? 154.490 153.300 133.051 1.00 99.62  ?  -3   DG  I "O3'" 1 
ATOM   7410  C  "C2'" . DG  I 6  70   ? 156.766 153.797 132.349 1.00 98.21  ?  -3   DG  I "C2'" 1 
ATOM   7411  C  "C1'" . DG  I 6  70   ? 156.321 154.856 131.353 1.00 98.41  ?  -3   DG  I "C1'" 1 
ATOM   7412  N  N9    . DG  I 6  70   ? 157.394 155.348 130.494 1.00 98.49  ?  -3   DG  I N9    1 
ATOM   7413  C  C8    . DG  I 6  70   ? 158.688 155.625 130.862 1.00 98.47  ?  -3   DG  I C8    1 
ATOM   7414  N  N7    . DG  I 6  70   ? 159.426 156.062 129.879 1.00 97.95  ?  -3   DG  I N7    1 
ATOM   7415  C  C5    . DG  I 6  70   ? 158.566 156.080 128.789 1.00 98.25  ?  -3   DG  I C5    1 
ATOM   7416  C  C6    . DG  I 6  70   ? 158.803 156.462 127.447 1.00 98.39  ?  -3   DG  I C6    1 
ATOM   7417  O  O6    . DG  I 6  70   ? 159.856 156.876 126.942 1.00 98.73  ?  -3   DG  I O6    1 
ATOM   7418  N  N1    . DG  I 6  70   ? 157.659 156.326 126.661 1.00 98.85  ?  -3   DG  I N1    1 
ATOM   7419  C  C2    . DG  I 6  70   ? 156.440 155.877 127.118 1.00 98.85  ?  -3   DG  I C2    1 
ATOM   7420  N  N2    . DG  I 6  70   ? 155.448 155.811 126.216 1.00 98.74  ?  -3   DG  I N2    1 
ATOM   7421  N  N3    . DG  I 6  70   ? 156.207 155.517 128.374 1.00 99.00  ?  -3   DG  I N3    1 
ATOM   7422  C  C4    . DG  I 6  70   ? 157.311 155.644 129.151 1.00 98.81  ?  -3   DG  I C4    1 
ATOM   7423  P  P     . DC  I 6  71   ? 154.267 151.738 133.359 1.00 100.21 ?  -2   DC  I P     1 
ATOM   7424  O  OP1   . DC  I 6  71   ? 153.319 151.640 134.491 1.00 99.87  ?  -2   DC  I OP1   1 
ATOM   7425  O  OP2   . DC  I 6  71   ? 155.591 151.085 133.454 1.00 98.68  ?  -2   DC  I OP2   1 
ATOM   7426  O  "O5'" . DC  I 6  71   ? 153.545 151.194 132.038 1.00 102.70 ?  -2   DC  I "O5'" 1 
ATOM   7427  C  "C5'" . DC  I 6  71   ? 152.337 151.801 131.588 1.00 105.64 ?  -2   DC  I "C5'" 1 
ATOM   7428  C  "C4'" . DC  I 6  71   ? 152.045 151.432 130.142 1.00 107.76 ?  -2   DC  I "C4'" 1 
ATOM   7429  O  "O4'" . DC  I 6  71   ? 152.964 152.129 129.261 1.00 106.97 ?  -2   DC  I "O4'" 1 
ATOM   7430  C  "C3'" . DC  I 6  71   ? 152.177 149.948 129.812 1.00 109.69 ?  -2   DC  I "C3'" 1 
ATOM   7431  O  "O3'" . DC  I 6  71   ? 151.130 149.550 128.938 1.00 112.81 ?  -2   DC  I "O3'" 1 
ATOM   7432  C  "C2'" . DC  I 6  71   ? 153.544 149.855 129.137 1.00 108.74 ?  -2   DC  I "C2'" 1 
ATOM   7433  C  "C1'" . DC  I 6  71   ? 153.650 151.205 128.440 1.00 107.33 ?  -2   DC  I "C1'" 1 
ATOM   7434  N  N1    . DC  I 6  71   ? 155.056 151.683 128.287 1.00 107.28 ?  -2   DC  I N1    1 
ATOM   7435  C  C2    . DC  I 6  71   ? 155.551 152.021 127.017 1.00 107.36 ?  -2   DC  I C2    1 
ATOM   7436  O  O2    . DC  I 6  71   ? 154.811 151.913 126.031 1.00 106.84 ?  -2   DC  I O2    1 
ATOM   7437  N  N3    . DC  I 6  71   ? 156.833 152.458 126.911 1.00 107.19 ?  -2   DC  I N3    1 
ATOM   7438  C  C4    . DC  I 6  71   ? 157.597 152.558 128.002 1.00 107.11 ?  -2   DC  I C4    1 
ATOM   7439  N  N4    . DC  I 6  71   ? 158.852 152.993 127.856 1.00 107.66 ?  -2   DC  I N4    1 
ATOM   7440  C  C5    . DC  I 6  71   ? 157.108 152.218 129.294 1.00 106.69 ?  -2   DC  I C5    1 
ATOM   7441  C  C6    . DC  I 6  71   ? 155.847 151.794 129.390 1.00 106.87 ?  -2   DC  I C6    1 
ATOM   7442  P  P     . DG  I 6  72   ? 150.939 148.001 128.558 1.00 115.34 ?  -1   DG  I P     1 
ATOM   7443  O  OP1   . DG  I 6  72   ? 149.495 147.765 128.340 1.00 114.64 ?  -1   DG  I OP1   1 
ATOM   7444  O  OP2   . DG  I 6  72   ? 151.671 147.197 129.562 1.00 115.30 ?  -1   DG  I OP2   1 
ATOM   7445  O  "O5'" . DG  I 6  72   ? 151.702 147.858 127.160 1.00 118.56 ?  -1   DG  I "O5'" 1 
ATOM   7446  C  "C5'" . DG  I 6  72   ? 151.333 148.688 126.064 1.00 123.25 ?  -1   DG  I "C5'" 1 
ATOM   7447  C  "C4'" . DG  I 6  72   ? 152.259 148.465 124.882 1.00 127.02 ?  -1   DG  I "C4'" 1 
ATOM   7448  O  "O4'" . DG  I 6  72   ? 153.493 149.200 125.083 1.00 127.98 ?  -1   DG  I "O4'" 1 
ATOM   7449  C  "C3'" . DG  I 6  72   ? 152.654 147.006 124.643 1.00 129.08 ?  -1   DG  I "C3'" 1 
ATOM   7450  O  "O3'" . DG  I 6  72   ? 152.421 146.652 123.287 1.00 132.20 ?  -1   DG  I "O3'" 1 
ATOM   7451  C  "C2'" . DG  I 6  72   ? 154.143 146.960 124.994 1.00 129.14 ?  -1   DG  I "C2'" 1 
ATOM   7452  C  "C1'" . DG  I 6  72   ? 154.586 148.390 124.728 1.00 129.42 ?  -1   DG  I "C1'" 1 
ATOM   7453  N  N9    . DG  I 6  72   ? 155.736 148.794 125.533 1.00 129.69 ?  -1   DG  I N9    1 
ATOM   7454  C  C8    . DG  I 6  72   ? 155.827 148.773 126.903 1.00 129.89 ?  -1   DG  I C8    1 
ATOM   7455  N  N7    . DG  I 6  72   ? 156.974 149.191 127.356 1.00 130.19 ?  -1   DG  I N7    1 
ATOM   7456  C  C5    . DG  I 6  72   ? 157.696 149.509 126.215 1.00 129.99 ?  -1   DG  I C5    1 
ATOM   7457  C  C6    . DG  I 6  72   ? 159.012 150.010 126.083 1.00 129.64 ?  -1   DG  I C6    1 
ATOM   7458  O  O6    . DG  I 6  72   ? 159.820 150.281 126.982 1.00 129.43 ?  -1   DG  I O6    1 
ATOM   7459  N  N1    . DG  I 6  72   ? 159.364 150.192 124.749 1.00 129.94 ?  -1   DG  I N1    1 
ATOM   7460  C  C2    . DG  I 6  72   ? 158.546 149.923 123.675 1.00 129.98 ?  -1   DG  I C2    1 
ATOM   7461  N  N2    . DG  I 6  72   ? 159.060 150.164 122.459 1.00 129.88 ?  -1   DG  I N2    1 
ATOM   7462  N  N3    . DG  I 6  72   ? 157.308 149.452 123.785 1.00 129.76 ?  -1   DG  I N3    1 
ATOM   7463  C  C4    . DG  I 6  72   ? 156.951 149.269 125.081 1.00 129.85 ?  -1   DG  I C4    1 
ATOM   7464  P  P     . DC  I 6  73   ? 152.527 145.117 122.823 1.00 134.15 ?  0    DC  I P     1 
ATOM   7465  O  OP1   . DC  I 6  73   ? 151.530 144.903 121.751 1.00 133.95 ?  0    DC  I OP1   1 
ATOM   7466  O  OP2   . DC  I 6  73   ? 152.493 144.272 124.038 1.00 133.70 ?  0    DC  I OP2   1 
ATOM   7467  O  "O5'" . DC  I 6  73   ? 153.993 145.012 122.195 1.00 135.81 ?  0    DC  I "O5'" 1 
ATOM   7468  C  "C5'" . DC  I 6  73   ? 154.371 145.885 121.140 1.00 138.92 ?  0    DC  I "C5'" 1 
ATOM   7469  C  "C4'" . DC  I 6  73   ? 155.879 145.911 120.970 1.00 141.28 ?  0    DC  I "C4'" 1 
ATOM   7470  O  "O4'" . DC  I 6  73   ? 156.489 146.528 122.122 1.00 142.13 ?  0    DC  I "O4'" 1 
ATOM   7471  C  "C3'" . DC  I 6  73   ? 156.542 144.536 120.830 1.00 142.72 ?  0    DC  I "C3'" 1 
ATOM   7472  O  "O3'" . DC  I 6  73   ? 157.057 144.376 119.513 1.00 144.70 ?  0    DC  I "O3'" 1 
ATOM   7473  C  "C2'" . DC  I 6  73   ? 157.665 144.536 121.884 1.00 142.58 ?  0    DC  I "C2'" 1 
ATOM   7474  C  "C1'" . DC  I 6  73   ? 157.781 146.007 122.257 1.00 142.80 ?  0    DC  I "C1'" 1 
ATOM   7475  N  N1    . DC  I 6  73   ? 158.252 146.236 123.655 1.00 143.22 ?  0    DC  I N1    1 
ATOM   7476  C  C2    . DC  I 6  73   ? 159.530 146.758 123.874 1.00 143.23 ?  0    DC  I C2    1 
ATOM   7477  O  O2    . DC  I 6  73   ? 160.243 147.020 122.899 1.00 143.16 ?  0    DC  I O2    1 
ATOM   7478  N  N3    . DC  I 6  73   ? 159.951 146.957 125.148 1.00 143.12 ?  0    DC  I N3    1 
ATOM   7479  C  C4    . DC  I 6  73   ? 159.148 146.655 126.171 1.00 143.08 ?  0    DC  I C4    1 
ATOM   7480  N  N4    . DC  I 6  73   ? 159.603 146.871 127.411 1.00 142.93 ?  0    DC  I N4    1 
ATOM   7481  C  C5    . DC  I 6  73   ? 157.840 146.122 125.967 1.00 143.37 ?  0    DC  I C5    1 
ATOM   7482  C  C6    . DC  I 6  73   ? 157.437 145.931 124.706 1.00 143.50 ?  0    DC  I C6    1 
ATOM   7483  P  P     . DT  I 6  74   ? 157.777 143.005 119.082 1.00 146.13 ?  1    DT  I P     1 
ATOM   7484  O  OP1   . DT  I 6  74   ? 157.556 142.823 117.631 1.00 146.23 ?  1    DT  I OP1   1 
ATOM   7485  O  OP2   . DT  I 6  74   ? 157.348 141.948 120.025 1.00 146.03 ?  1    DT  I OP2   1 
ATOM   7486  O  "O5'" . DT  I 6  74   ? 159.331 143.293 119.334 1.00 146.86 ?  1    DT  I "O5'" 1 
ATOM   7487  C  "C5'" . DT  I 6  74   ? 159.963 144.392 118.685 1.00 148.56 ?  1    DT  I "C5'" 1 
ATOM   7488  C  "C4'" . DT  I 6  74   ? 161.454 144.410 118.976 1.00 150.05 ?  1    DT  I "C4'" 1 
ATOM   7489  O  "O4'" . DT  I 6  74   ? 161.687 144.942 120.304 1.00 150.58 ?  1    DT  I "O4'" 1 
ATOM   7490  C  "C3'" . DT  I 6  74   ? 162.137 143.039 118.929 1.00 150.65 ?  1    DT  I "C3'" 1 
ATOM   7491  O  "O3'" . DT  I 6  74   ? 163.261 143.082 118.060 1.00 151.59 ?  1    DT  I "O3'" 1 
ATOM   7492  C  "C2'" . DT  I 6  74   ? 162.554 142.779 120.380 1.00 150.65 ?  1    DT  I "C2'" 1 
ATOM   7493  C  "C1'" . DT  I 6  74   ? 162.688 144.187 120.939 1.00 150.84 ?  1    DT  I "C1'" 1 
ATOM   7494  N  N1    . DT  I 6  74   ? 162.464 144.259 122.412 1.00 150.90 ?  1    DT  I N1    1 
ATOM   7495  C  C2    . DT  I 6  74   ? 163.455 144.760 123.228 1.00 150.94 ?  1    DT  I C2    1 
ATOM   7496  O  O2    . DT  I 6  74   ? 164.527 145.159 122.810 1.00 151.15 ?  1    DT  I O2    1 
ATOM   7497  N  N3    . DT  I 6  74   ? 163.138 144.781 124.563 1.00 151.01 ?  1    DT  I N3    1 
ATOM   7498  C  C4    . DT  I 6  74   ? 161.959 144.357 125.148 1.00 150.99 ?  1    DT  I C4    1 
ATOM   7499  O  O4    . DT  I 6  74   ? 161.766 144.414 126.358 1.00 151.05 ?  1    DT  I O4    1 
ATOM   7500  C  C5    . DT  I 6  74   ? 160.968 143.841 124.235 1.00 151.06 ?  1    DT  I C5    1 
ATOM   7501  C  C7    . DT  I 6  74   ? 159.651 143.348 124.755 1.00 150.96 ?  1    DT  I C7    1 
ATOM   7502  C  C6    . DT  I 6  74   ? 161.264 143.818 122.929 1.00 151.08 ?  1    DT  I C6    1 
ATOM   7503  P  P     . DG  I 6  75   ? 163.939 141.716 117.552 1.00 152.05 ?  2    DG  I P     1 
ATOM   7504  O  OP1   . DG  I 6  75   ? 164.473 141.957 116.193 1.00 151.86 ?  2    DG  I OP1   1 
ATOM   7505  O  OP2   . DG  I 6  75   ? 162.970 140.621 117.779 1.00 151.89 ?  2    DG  I OP2   1 
ATOM   7506  O  "O5'" . DG  I 6  75   ? 165.162 141.501 118.559 1.00 151.82 ?  2    DG  I "O5'" 1 
ATOM   7507  C  "C5'" . DG  I 6  75   ? 166.187 142.481 118.648 1.00 151.68 ?  2    DG  I "C5'" 1 
ATOM   7508  C  "C4'" . DG  I 6  75   ? 166.986 142.313 119.927 1.00 151.84 ?  2    DG  I "C4'" 1 
ATOM   7509  O  "O4'" . DG  I 6  75   ? 166.160 142.643 121.059 1.00 151.84 ?  2    DG  I "O4'" 1 
ATOM   7510  C  "C3'" . DG  I 6  75   ? 167.498 140.894 120.188 1.00 151.83 ?  2    DG  I "C3'" 1 
ATOM   7511  O  "O3'" . DG  I 6  75   ? 168.904 140.836 119.962 1.00 151.94 ?  2    DG  I "O3'" 1 
ATOM   7512  C  "C2'" . DG  I 6  75   ? 167.143 140.613 121.661 1.00 151.62 ?  2    DG  I "C2'" 1 
ATOM   7513  C  "C1'" . DG  I 6  75   ? 166.657 141.962 122.177 1.00 151.33 ?  2    DG  I "C1'" 1 
ATOM   7514  N  N9    . DG  I 6  75   ? 165.590 141.856 123.170 1.00 151.10 ?  2    DG  I N9    1 
ATOM   7515  C  C8    . DG  I 6  75   ? 164.318 141.375 122.971 1.00 150.91 ?  2    DG  I C8    1 
ATOM   7516  N  N7    . DG  I 6  75   ? 163.578 141.402 124.045 1.00 150.88 ?  2    DG  I N7    1 
ATOM   7517  C  C5    . DG  I 6  75   ? 164.413 141.932 125.020 1.00 150.92 ?  2    DG  I C5    1 
ATOM   7518  C  C6    . DG  I 6  75   ? 164.164 142.200 126.388 1.00 151.02 ?  2    DG  I C6    1 
ATOM   7519  O  O6    . DG  I 6  75   ? 163.121 142.014 127.031 1.00 150.93 ?  2    DG  I O6    1 
ATOM   7520  N  N1    . DG  I 6  75   ? 165.283 142.735 127.020 1.00 151.16 ?  2    DG  I N1    1 
ATOM   7521  C  C2    . DG  I 6  75   ? 166.491 142.983 126.407 1.00 150.98 ?  2    DG  I C2    1 
ATOM   7522  N  N2    . DG  I 6  75   ? 167.456 143.507 127.177 1.00 150.93 ?  2    DG  I N2    1 
ATOM   7523  N  N3    . DG  I 6  75   ? 166.735 142.739 125.126 1.00 150.97 ?  2    DG  I N3    1 
ATOM   7524  C  C4    . DG  I 6  75   ? 165.655 142.216 124.497 1.00 150.96 ?  2    DG  I C4    1 
ATOM   7525  P  P     . DT  I 6  76   ? 169.732 139.498 120.291 1.00 151.90 ?  3    DT  I P     1 
ATOM   7526  O  OP1   . DT  I 6  76   ? 170.914 139.482 119.401 1.00 151.92 ?  3    DT  I OP1   1 
ATOM   7527  O  OP2   . DT  I 6  76   ? 168.797 138.351 120.278 1.00 151.92 ?  3    DT  I OP2   1 
ATOM   7528  O  "O5'" . DT  I 6  76   ? 170.230 139.722 121.795 1.00 151.41 ?  3    DT  I "O5'" 1 
ATOM   7529  C  "C5'" . DT  I 6  76   ? 170.861 140.946 122.154 1.00 150.53 ?  3    DT  I "C5'" 1 
ATOM   7530  C  "C4'" . DT  I 6  76   ? 171.196 140.973 123.635 1.00 149.88 ?  3    DT  I "C4'" 1 
ATOM   7531  O  "O4'" . DT  I 6  76   ? 169.976 141.105 124.413 1.00 149.98 ?  3    DT  I "O4'" 1 
ATOM   7532  C  "C3'" . DT  I 6  76   ? 171.908 139.724 124.162 1.00 149.40 ?  3    DT  I "C3'" 1 
ATOM   7533  O  "O3'" . DT  I 6  76   ? 172.982 140.105 125.012 1.00 148.36 ?  3    DT  I "O3'" 1 
ATOM   7534  C  "C2'" . DT  I 6  76   ? 170.809 138.998 124.934 1.00 149.73 ?  3    DT  I "C2'" 1 
ATOM   7535  C  "C1'" . DT  I 6  76   ? 169.992 140.164 125.460 1.00 150.08 ?  3    DT  I "C1'" 1 
ATOM   7536  N  N1    . DT  I 6  76   ? 168.584 139.805 125.802 1.00 150.28 ?  3    DT  I N1    1 
ATOM   7537  C  C2    . DT  I 6  76   ? 168.110 140.061 127.070 1.00 150.11 ?  3    DT  I C2    1 
ATOM   7538  O  O2    . DT  I 6  76   ? 168.784 140.576 127.944 1.00 149.78 ?  3    DT  I O2    1 
ATOM   7539  N  N3    . DT  I 6  76   ? 166.806 139.693 127.279 1.00 150.19 ?  3    DT  I N3    1 
ATOM   7540  C  C4    . DT  I 6  76   ? 165.948 139.106 126.365 1.00 150.16 ?  3    DT  I C4    1 
ATOM   7541  O  O4    . DT  I 6  76   ? 164.792 138.811 126.645 1.00 150.01 ?  3    DT  I O4    1 
ATOM   7542  C  C5    . DT  I 6  76   ? 166.509 138.863 125.058 1.00 150.11 ?  3    DT  I C5    1 
ATOM   7543  C  C7    . DT  I 6  76   ? 165.673 138.230 123.986 1.00 149.98 ?  3    DT  I C7    1 
ATOM   7544  C  C6    . DT  I 6  76   ? 167.785 139.219 124.843 1.00 150.31 ?  3    DT  I C6    1 
ATOM   7545  P  P     . DC  I 6  77   ? 174.065 139.020 125.498 1.00 147.37 ?  4    DC  I P     1 
ATOM   7546  O  OP1   . DC  I 6  77   ? 175.405 139.563 125.185 1.00 147.33 ?  4    DC  I OP1   1 
ATOM   7547  O  OP2   . DC  I 6  77   ? 173.673 137.695 124.967 1.00 147.28 ?  4    DC  I OP2   1 
ATOM   7548  O  "O5'" . DC  I 6  77   ? 173.882 138.990 127.086 1.00 146.41 ?  4    DC  I "O5'" 1 
ATOM   7549  C  "C5'" . DC  I 6  77   ? 173.980 140.199 127.831 1.00 144.47 ?  4    DC  I "C5'" 1 
ATOM   7550  C  "C4'" . DC  I 6  77   ? 173.559 139.987 129.276 1.00 142.61 ?  4    DC  I "C4'" 1 
ATOM   7551  O  "O4'" . DC  I 6  77   ? 172.124 139.776 129.344 1.00 141.92 ?  4    DC  I "O4'" 1 
ATOM   7552  C  "C3'" . DC  I 6  77   ? 174.202 138.792 129.972 1.00 141.74 ?  4    DC  I "C3'" 1 
ATOM   7553  O  "O3'" . DC  I 6  77   ? 174.547 139.143 131.305 1.00 141.04 ?  4    DC  I "O3'" 1 
ATOM   7554  C  "C2'" . DC  I 6  77   ? 173.106 137.728 129.930 1.00 141.28 ?  4    DC  I "C2'" 1 
ATOM   7555  C  "C1'" . DC  I 6  77   ? 171.843 138.572 130.027 1.00 141.00 ?  4    DC  I "C1'" 1 
ATOM   7556  N  N1    . DC  I 6  77   ? 170.655 137.943 129.379 1.00 140.76 ?  4    DC  I N1    1 
ATOM   7557  C  C2    . DC  I 6  77   ? 169.462 137.791 130.099 1.00 140.74 ?  4    DC  I C2    1 
ATOM   7558  O  O2    . DC  I 6  77   ? 169.411 138.175 131.273 1.00 140.68 ?  4    DC  I O2    1 
ATOM   7559  N  N3    . DC  I 6  77   ? 168.393 137.223 129.483 1.00 140.72 ?  4    DC  I N3    1 
ATOM   7560  C  C4    . DC  I 6  77   ? 168.489 136.821 128.214 1.00 140.64 ?  4    DC  I C4    1 
ATOM   7561  N  N4    . DC  I 6  77   ? 167.414 136.267 127.644 1.00 140.58 ?  4    DC  I N4    1 
ATOM   7562  C  C5    . DC  I 6  77   ? 169.694 136.970 127.470 1.00 140.61 ?  4    DC  I C5    1 
ATOM   7563  C  C6    . DC  I 6  77   ? 170.739 137.531 128.084 1.00 140.71 ?  4    DC  I C6    1 
ATOM   7564  P  P     . DC  I 6  78   ? 175.343 138.109 132.242 1.00 140.78 ?  5    DC  I P     1 
ATOM   7565  O  OP1   . DC  I 6  78   ? 176.304 138.891 133.051 1.00 140.59 ?  5    DC  I OP1   1 
ATOM   7566  O  OP2   . DC  I 6  78   ? 175.832 136.999 131.395 1.00 140.30 ?  5    DC  I OP2   1 
ATOM   7567  O  "O5'" . DC  I 6  78   ? 174.209 137.532 133.209 1.00 140.25 ?  5    DC  I "O5'" 1 
ATOM   7568  C  "C5'" . DC  I 6  78   ? 173.336 138.429 133.890 1.00 139.26 ?  5    DC  I "C5'" 1 
ATOM   7569  C  "C4'" . DC  I 6  78   ? 172.245 137.672 134.626 1.00 138.68 ?  5    DC  I "C4'" 1 
ATOM   7570  O  "O4'" . DC  I 6  78   ? 171.214 137.254 133.688 1.00 138.47 ?  5    DC  I "O4'" 1 
ATOM   7571  C  "C3'" . DC  I 6  78   ? 172.705 136.397 135.334 1.00 138.30 ?  5    DC  I "C3'" 1 
ATOM   7572  O  "O3'" . DC  I 6  78   ? 172.000 136.247 136.558 1.00 137.31 ?  5    DC  I "O3'" 1 
ATOM   7573  C  "C2'" . DC  I 6  78   ? 172.302 135.314 134.340 1.00 138.57 ?  5    DC  I "C2'" 1 
ATOM   7574  C  "C1'" . DC  I 6  78   ? 170.980 135.874 133.859 1.00 138.74 ?  5    DC  I "C1'" 1 
ATOM   7575  N  N1    . DC  I 6  78   ? 170.502 135.300 132.570 1.00 138.92 ?  5    DC  I N1    1 
ATOM   7576  C  C2    . DC  I 6  78   ? 169.180 134.862 132.465 1.00 138.89 ?  5    DC  I C2    1 
ATOM   7577  O  O2    . DC  I 6  78   ? 168.436 134.966 133.447 1.00 138.86 ?  5    DC  I O2    1 
ATOM   7578  N  N3    . DC  I 6  78   ? 168.749 134.344 131.289 1.00 138.71 ?  5    DC  I N3    1 
ATOM   7579  C  C4    . DC  I 6  78   ? 169.587 134.253 130.254 1.00 138.73 ?  5    DC  I C4    1 
ATOM   7580  N  N4    . DC  I 6  78   ? 169.120 133.734 129.113 1.00 138.74 ?  5    DC  I N4    1 
ATOM   7581  C  C5    . DC  I 6  78   ? 170.941 134.693 130.343 1.00 138.99 ?  5    DC  I C5    1 
ATOM   7582  C  C6    . DC  I 6  78   ? 171.352 135.203 131.509 1.00 139.12 ?  5    DC  I C6    1 
ATOM   7583  P  P     . DC  I 6  79   ? 172.549 136.921 137.909 1.00 136.36 ?  6    DC  I P     1 
ATOM   7584  O  OP1   . DC  I 6  79   ? 172.333 138.382 137.812 1.00 136.29 ?  6    DC  I OP1   1 
ATOM   7585  O  OP2   . DC  I 6  79   ? 173.909 136.393 138.155 1.00 136.16 ?  6    DC  I OP2   1 
ATOM   7586  O  "O5'" . DC  I 6  79   ? 171.581 136.335 139.038 1.00 135.18 ?  6    DC  I "O5'" 1 
ATOM   7587  C  "C5'" . DC  I 6  79   ? 170.176 136.252 138.800 1.00 133.56 ?  6    DC  I "C5'" 1 
ATOM   7588  C  "C4'" . DC  I 6  79   ? 169.602 134.971 139.383 1.00 132.33 ?  6    DC  I "C4'" 1 
ATOM   7589  O  "O4'" . DC  I 6  79   ? 169.320 134.028 138.313 1.00 132.06 ?  6    DC  I "O4'" 1 
ATOM   7590  C  "C3'" . DC  I 6  79   ? 170.523 134.234 140.347 1.00 131.52 ?  6    DC  I "C3'" 1 
ATOM   7591  O  "O3'" . DC  I 6  79   ? 169.752 133.554 141.331 1.00 130.37 ?  6    DC  I "O3'" 1 
ATOM   7592  C  "C2'" . DC  I 6  79   ? 171.239 133.256 139.423 1.00 131.41 ?  6    DC  I "C2'" 1 
ATOM   7593  C  "C1'" . DC  I 6  79   ? 170.114 132.867 138.472 1.00 131.86 ?  6    DC  I "C1'" 1 
ATOM   7594  N  N1    . DC  I 6  79   ? 170.593 132.438 137.124 1.00 132.04 ?  6    DC  I N1    1 
ATOM   7595  C  C2    . DC  I 6  79   ? 169.687 131.893 136.205 1.00 132.31 ?  6    DC  I C2    1 
ATOM   7596  O  O2    . DC  I 6  79   ? 168.500 131.770 136.528 1.00 132.43 ?  6    DC  I O2    1 
ATOM   7597  N  N3    . DC  I 6  79   ? 170.141 131.515 134.982 1.00 132.41 ?  6    DC  I N3    1 
ATOM   7598  C  C4    . DC  I 6  79   ? 171.431 131.665 134.673 1.00 132.28 ?  6    DC  I C4    1 
ATOM   7599  N  N4    . DC  I 6  79   ? 171.835 131.279 133.458 1.00 132.06 ?  6    DC  I N4    1 
ATOM   7600  C  C5    . DC  I 6  79   ? 172.366 132.214 135.598 1.00 132.41 ?  6    DC  I C5    1 
ATOM   7601  C  C6    . DC  I 6  79   ? 171.908 132.588 136.796 1.00 132.19 ?  6    DC  I C6    1 
ATOM   7602  P  P     . DC  I 6  80   ? 169.903 133.942 142.883 1.00 128.92 ?  7    DC  I P     1 
ATOM   7603  O  OP1   . DC  I 6  80   ? 169.961 135.418 142.971 1.00 128.95 ?  7    DC  I OP1   1 
ATOM   7604  O  OP2   . DC  I 6  80   ? 171.004 133.128 143.445 1.00 128.86 ?  7    DC  I OP2   1 
ATOM   7605  O  "O5'" . DC  I 6  80   ? 168.536 133.440 143.546 1.00 127.96 ?  7    DC  I "O5'" 1 
ATOM   7606  C  "C5'" . DC  I 6  80   ? 168.336 132.055 143.812 1.00 126.31 ?  7    DC  I "C5'" 1 
ATOM   7607  C  "C4'" . DC  I 6  80   ? 167.253 131.482 142.917 1.00 125.38 ?  7    DC  I "C4'" 1 
ATOM   7608  O  "O4'" . DC  I 6  80   ? 167.765 131.351 141.562 1.00 125.26 ?  7    DC  I "O4'" 1 
ATOM   7609  C  "C3'" . DC  I 6  80   ? 166.781 130.087 143.298 1.00 124.99 ?  7    DC  I "C3'" 1 
ATOM   7610  O  "O3'" . DC  I 6  80   ? 165.448 129.892 142.836 1.00 124.02 ?  7    DC  I "O3'" 1 
ATOM   7611  C  "C2'" . DC  I 6  80   ? 167.764 129.215 142.530 1.00 125.42 ?  7    DC  I "C2'" 1 
ATOM   7612  C  "C1'" . DC  I 6  80   ? 167.843 129.979 141.217 1.00 125.57 ?  7    DC  I "C1'" 1 
ATOM   7613  N  N1    . DC  I 6  80   ? 169.106 129.753 140.451 1.00 125.60 ?  7    DC  I N1    1 
ATOM   7614  C  C2    . DC  I 6  80   ? 169.059 129.089 139.219 1.00 125.41 ?  7    DC  I C2    1 
ATOM   7615  O  O2    . DC  I 6  80   ? 167.970 128.686 138.793 1.00 125.37 ?  7    DC  I O2    1 
ATOM   7616  N  N3    . DC  I 6  80   ? 170.214 128.899 138.530 1.00 125.53 ?  7    DC  I N3    1 
ATOM   7617  C  C4    . DC  I 6  80   ? 171.368 129.349 139.027 1.00 125.57 ?  7    DC  I C4    1 
ATOM   7618  N  N4    . DC  I 6  80   ? 172.482 129.142 138.314 1.00 125.74 ?  7    DC  I N4    1 
ATOM   7619  C  C5    . DC  I 6  80   ? 171.434 130.028 140.279 1.00 125.40 ?  7    DC  I C5    1 
ATOM   7620  C  C6    . DC  I 6  80   ? 170.290 130.211 140.947 1.00 125.64 ?  7    DC  I C6    1 
ATOM   7621  P  P     . DC  I 6  81   ? 164.511 128.762 143.490 1.00 122.86 ?  8    DC  I P     1 
ATOM   7622  O  OP1   . DC  I 6  81   ? 163.677 129.417 144.522 1.00 123.05 ?  8    DC  I OP1   1 
ATOM   7623  O  OP2   . DC  I 6  81   ? 165.364 127.611 143.860 1.00 122.53 ?  8    DC  I OP2   1 
ATOM   7624  O  "O5'" . DC  I 6  81   ? 163.567 128.306 142.281 1.00 123.47 ?  8    DC  I "O5'" 1 
ATOM   7625  C  "C5'" . DC  I 6  81   ? 164.126 128.088 140.988 1.00 124.48 ?  8    DC  I "C5'" 1 
ATOM   7626  C  "C4'" . DC  I 6  81   ? 163.505 126.872 140.328 1.00 125.32 ?  8    DC  I "C4'" 1 
ATOM   7627  O  "O4'" . DC  I 6  81   ? 164.465 126.289 139.414 1.00 125.77 ?  8    DC  I "O4'" 1 
ATOM   7628  C  "C3'" . DC  I 6  81   ? 163.179 125.739 141.275 1.00 125.82 ?  8    DC  I "C3'" 1 
ATOM   7629  O  "O3'" . DC  I 6  81   ? 162.312 124.821 140.628 1.00 127.35 ?  8    DC  I "O3'" 1 
ATOM   7630  C  "C2'" . DC  I 6  81   ? 164.559 125.136 141.472 1.00 125.46 ?  8    DC  I "C2'" 1 
ATOM   7631  C  "C1'" . DC  I 6  81   ? 165.099 125.183 140.042 1.00 125.81 ?  8    DC  I "C1'" 1 
ATOM   7632  N  N1    . DC  I 6  81   ? 166.569 125.387 139.961 1.00 125.86 ?  8    DC  I N1    1 
ATOM   7633  C  C2    . DC  I 6  81   ? 167.290 124.825 138.900 1.00 126.00 ?  8    DC  I C2    1 
ATOM   7634  O  O2    . DC  I 6  81   ? 166.687 124.160 138.048 1.00 125.95 ?  8    DC  I O2    1 
ATOM   7635  N  N3    . DC  I 6  81   ? 168.630 125.035 138.835 1.00 126.03 ?  8    DC  I N3    1 
ATOM   7636  C  C4    . DC  I 6  81   ? 169.237 125.762 139.775 1.00 125.95 ?  8    DC  I C4    1 
ATOM   7637  N  N4    . DC  I 6  81   ? 170.559 125.944 139.677 1.00 125.98 ?  8    DC  I N4    1 
ATOM   7638  C  C5    . DC  I 6  81   ? 168.517 126.336 140.862 1.00 125.73 ?  8    DC  I C5    1 
ATOM   7639  C  C6    . DC  I 6  81   ? 167.199 126.130 140.912 1.00 125.57 ?  8    DC  I C6    1 
ATOM   7640  P  P     . DG  I 6  82   ? 161.363 123.852 141.488 1.00 128.68 ?  9    DG  I P     1 
ATOM   7641  O  OP1   . DG  I 6  82   ? 159.981 124.356 141.334 1.00 128.24 ?  9    DG  I OP1   1 
ATOM   7642  O  OP2   . DG  I 6  82   ? 161.951 123.715 142.839 1.00 128.76 ?  9    DG  I OP2   1 
ATOM   7643  O  "O5'" . DG  I 6  82   ? 161.488 122.437 140.748 1.00 129.78 ?  9    DG  I "O5'" 1 
ATOM   7644  C  "C5'" . DG  I 6  82   ? 161.110 122.312 139.378 1.00 131.84 ?  9    DG  I "C5'" 1 
ATOM   7645  C  "C4'" . DG  I 6  82   ? 161.615 121.005 138.783 1.00 133.15 ?  9    DG  I "C4'" 1 
ATOM   7646  O  "O4'" . DG  I 6  82   ? 163.035 121.105 138.507 1.00 133.38 ?  9    DG  I "O4'" 1 
ATOM   7647  C  "C3'" . DG  I 6  82   ? 161.437 119.775 139.664 1.00 134.38 ?  9    DG  I "C3'" 1 
ATOM   7648  O  "O3'" . DG  I 6  82   ? 161.111 118.643 138.868 1.00 136.08 ?  9    DG  I "O3'" 1 
ATOM   7649  C  "C2'" . DG  I 6  82   ? 162.798 119.619 140.340 1.00 134.09 ?  9    DG  I "C2'" 1 
ATOM   7650  C  "C1'" . DG  I 6  82   ? 163.768 120.197 139.310 1.00 134.26 ?  9    DG  I "C1'" 1 
ATOM   7651  N  N9    . DG  I 6  82   ? 164.870 120.932 139.923 1.00 134.41 ?  9    DG  I N9    1 
ATOM   7652  C  C8    . DG  I 6  82   ? 164.782 121.781 140.998 1.00 134.72 ?  9    DG  I C8    1 
ATOM   7653  N  N7    . DG  I 6  82   ? 165.922 122.306 141.340 1.00 134.90 ?  9    DG  I N7    1 
ATOM   7654  C  C5    . DG  I 6  82   ? 166.828 121.783 140.432 1.00 134.75 ?  9    DG  I C5    1 
ATOM   7655  C  C6    . DG  I 6  82   ? 168.218 122.000 140.316 1.00 134.58 ?  9    DG  I C6    1 
ATOM   7656  O  O6    . DG  I 6  82   ? 168.937 122.726 141.014 1.00 134.54 ?  9    DG  I O6    1 
ATOM   7657  N  N1    . DG  I 6  82   ? 168.769 121.276 139.264 1.00 134.74 ?  9    DG  I N1    1 
ATOM   7658  C  C2    . DG  I 6  82   ? 168.064 120.441 138.428 1.00 134.91 ?  9    DG  I C2    1 
ATOM   7659  N  N2    . DG  I 6  82   ? 168.772 119.825 137.467 1.00 134.74 ?  9    DG  I N2    1 
ATOM   7660  N  N3    . DG  I 6  82   ? 166.752 120.227 138.525 1.00 134.98 ?  9    DG  I N3    1 
ATOM   7661  C  C4    . DG  I 6  82   ? 166.202 120.930 139.549 1.00 134.72 ?  9    DG  I C4    1 
ATOM   7662  P  P     . DC  I 6  83   ? 160.798 117.230 139.565 1.00 137.46 ?  10   DC  I P     1 
ATOM   7663  O  OP1   . DC  I 6  83   ? 159.936 116.455 138.646 1.00 137.71 ?  10   DC  I OP1   1 
ATOM   7664  O  OP2   . DC  I 6  83   ? 160.342 117.501 140.947 1.00 136.94 ?  10   DC  I OP2   1 
ATOM   7665  O  "O5'" . DC  I 6  83   ? 162.231 116.523 139.649 1.00 139.11 ?  10   DC  I "O5'" 1 
ATOM   7666  C  "C5'" . DC  I 6  83   ? 163.014 116.380 138.473 1.00 142.03 ?  10   DC  I "C5'" 1 
ATOM   7667  C  "C4'" . DC  I 6  83   ? 164.438 115.974 138.809 1.00 143.97 ?  10   DC  I "C4'" 1 
ATOM   7668  O  "O4'" . DC  I 6  83   ? 165.148 117.093 139.387 1.00 144.14 ?  10   DC  I "O4'" 1 
ATOM   7669  C  "C3'" . DC  I 6  83   ? 164.571 114.821 139.813 1.00 145.27 ?  10   DC  I "C3'" 1 
ATOM   7670  O  "O3'" . DC  I 6  83   ? 165.223 113.719 139.193 1.00 147.48 ?  10   DC  I "O3'" 1 
ATOM   7671  C  "C2'" . DC  I 6  83   ? 165.412 115.409 140.961 1.00 144.82 ?  10   DC  I "C2'" 1 
ATOM   7672  C  "C1'" . DC  I 6  83   ? 166.092 116.592 140.292 1.00 144.56 ?  10   DC  I "C1'" 1 
ATOM   7673  N  N1    . DC  I 6  83   ? 166.477 117.684 141.237 1.00 144.73 ?  10   DC  I N1    1 
ATOM   7674  C  C2    . DC  I 6  83   ? 167.814 118.087 141.315 1.00 144.82 ?  10   DC  I C2    1 
ATOM   7675  O  O2    . DC  I 6  83   ? 168.649 117.527 140.598 1.00 144.88 ?  10   DC  I O2    1 
ATOM   7676  N  N3    . DC  I 6  83   ? 168.151 119.082 142.176 1.00 144.71 ?  10   DC  I N3    1 
ATOM   7677  C  C4    . DC  I 6  83   ? 167.213 119.657 142.931 1.00 144.60 ?  10   DC  I C4    1 
ATOM   7678  N  N4    . DC  I 6  83   ? 167.588 120.634 143.766 1.00 144.79 ?  10   DC  I N4    1 
ATOM   7679  C  C5    . DC  I 6  83   ? 165.845 119.257 142.864 1.00 144.67 ?  10   DC  I C5    1 
ATOM   7680  C  C6    . DC  I 6  83   ? 165.526 118.277 142.012 1.00 144.73 ?  10   DC  I C6    1 
ATOM   7681  P  P     . DG  I 6  84   ? 165.263 112.281 139.910 1.00 149.46 ?  11   DG  I P     1 
ATOM   7682  O  OP1   . DG  I 6  84   ? 164.837 111.277 138.910 1.00 149.43 ?  11   DG  I OP1   1 
ATOM   7683  O  OP2   . DG  I 6  84   ? 164.541 112.381 141.198 1.00 149.78 ?  11   DG  I OP2   1 
ATOM   7684  O  "O5'" . DG  I 6  84   ? 166.815 112.063 140.226 1.00 150.88 ?  11   DG  I "O5'" 1 
ATOM   7685  C  "C5'" . DG  I 6  84   ? 167.770 112.160 139.175 1.00 153.40 ?  11   DG  I "C5'" 1 
ATOM   7686  C  "C4'" . DG  I 6  84   ? 169.162 112.413 139.727 1.00 155.37 ?  11   DG  I "C4'" 1 
ATOM   7687  O  "O4'" . DG  I 6  84   ? 169.212 113.725 140.340 1.00 155.80 ?  11   DG  I "O4'" 1 
ATOM   7688  C  "C3'" . DG  I 6  84   ? 169.627 111.418 140.796 1.00 156.43 ?  11   DG  I "C3'" 1 
ATOM   7689  O  "O3'" . DG  I 6  84   ? 170.851 110.813 140.399 1.00 157.84 ?  11   DG  I "O3'" 1 
ATOM   7690  C  "C2'" . DG  I 6  84   ? 169.802 112.272 142.058 1.00 156.49 ?  11   DG  I "C2'" 1 
ATOM   7691  C  "C1'" . DG  I 6  84   ? 170.028 113.659 141.480 1.00 156.53 ?  11   DG  I "C1'" 1 
ATOM   7692  N  N9    . DG  I 6  84   ? 169.646 114.736 142.390 1.00 156.68 ?  11   DG  I N9    1 
ATOM   7693  C  C8    . DG  I 6  84   ? 168.376 115.060 142.802 1.00 156.77 ?  11   DG  I C8    1 
ATOM   7694  N  N7    . DG  I 6  84   ? 168.338 116.070 143.626 1.00 156.83 ?  11   DG  I N7    1 
ATOM   7695  C  C5    . DG  I 6  84   ? 169.668 116.445 143.766 1.00 156.74 ?  11   DG  I C5    1 
ATOM   7696  C  C6    . DG  I 6  84   ? 170.246 117.484 144.534 1.00 156.70 ?  11   DG  I C6    1 
ATOM   7697  O  O6    . DG  I 6  84   ? 169.675 118.305 145.264 1.00 156.53 ?  11   DG  I O6    1 
ATOM   7698  N  N1    . DG  I 6  84   ? 171.632 117.520 144.395 1.00 156.91 ?  11   DG  I N1    1 
ATOM   7699  C  C2    . DG  I 6  84   ? 172.367 116.658 143.614 1.00 156.86 ?  11   DG  I C2    1 
ATOM   7700  N  N2    . DG  I 6  84   ? 173.695 116.843 143.601 1.00 156.78 ?  11   DG  I N2    1 
ATOM   7701  N  N3    . DG  I 6  84   ? 171.835 115.681 142.888 1.00 156.70 ?  11   DG  I N3    1 
ATOM   7702  C  C4    . DG  I 6  84   ? 170.487 115.634 143.013 1.00 156.73 ?  11   DG  I C4    1 
ATOM   7703  P  P     . DT  I 6  85   ? 171.497 109.636 141.282 1.00 158.95 ?  12   DT  I P     1 
ATOM   7704  O  OP1   . DT  I 6  85   ? 172.263 108.760 140.368 1.00 158.78 ?  12   DT  I OP1   1 
ATOM   7705  O  OP2   . DT  I 6  85   ? 170.424 109.060 142.124 1.00 158.88 ?  12   DT  I OP2   1 
ATOM   7706  O  "O5'" . DT  I 6  85   ? 172.520 110.399 142.245 1.00 159.51 ?  12   DT  I "O5'" 1 
ATOM   7707  C  "C5'" . DT  I 6  85   ? 173.543 111.216 141.688 1.00 160.37 ?  12   DT  I "C5'" 1 
ATOM   7708  C  "C4'" . DT  I 6  85   ? 174.365 111.875 142.781 1.00 161.22 ?  12   DT  I "C4'" 1 
ATOM   7709  O  "O4'" . DT  I 6  85   ? 173.617 112.969 143.362 1.00 161.63 ?  12   DT  I "O4'" 1 
ATOM   7710  C  "C3'" . DT  I 6  85   ? 174.755 110.952 143.941 1.00 161.69 ?  12   DT  I "C3'" 1 
ATOM   7711  O  "O3'" . DT  I 6  85   ? 176.169 110.926 144.088 1.00 162.23 ?  12   DT  I "O3'" 1 
ATOM   7712  C  "C2'" . DT  I 6  85   ? 174.068 111.570 145.166 1.00 161.75 ?  12   DT  I "C2'" 1 
ATOM   7713  C  "C1'" . DT  I 6  85   ? 173.875 113.016 144.741 1.00 161.59 ?  12   DT  I "C1'" 1 
ATOM   7714  N  N1    . DT  I 6  85   ? 172.724 113.690 145.414 1.00 161.50 ?  12   DT  I N1    1 
ATOM   7715  C  C2    . DT  I 6  85   ? 172.959 114.776 146.226 1.00 161.47 ?  12   DT  I C2    1 
ATOM   7716  O  O2    . DT  I 6  85   ? 174.071 115.228 146.432 1.00 161.31 ?  12   DT  I O2    1 
ATOM   7717  N  N3    . DT  I 6  85   ? 171.835 115.322 146.790 1.00 161.32 ?  12   DT  I N3    1 
ATOM   7718  C  C4    . DT  I 6  85   ? 170.529 114.899 146.629 1.00 161.36 ?  12   DT  I C4    1 
ATOM   7719  O  O4    . DT  I 6  85   ? 169.585 115.456 147.181 1.00 161.18 ?  12   DT  I O4    1 
ATOM   7720  C  C5    . DT  I 6  85   ? 170.353 113.754 145.766 1.00 161.45 ?  12   DT  I C5    1 
ATOM   7721  C  C7    . DT  I 6  85   ? 168.981 113.202 145.518 1.00 161.49 ?  12   DT  I C7    1 
ATOM   7722  C  C6    . DT  I 6  85   ? 171.445 113.213 145.205 1.00 161.43 ?  12   DT  I C6    1 
ATOM   7723  P  P     . DT  I 6  86   ? 176.853 109.965 145.180 1.00 162.68 ?  13   DT  I P     1 
ATOM   7724  O  OP1   . DT  I 6  86   ? 178.152 109.520 144.630 1.00 163.00 ?  13   DT  I OP1   1 
ATOM   7725  O  OP2   . DT  I 6  86   ? 175.851 108.958 145.596 1.00 162.11 ?  13   DT  I OP2   1 
ATOM   7726  O  "O5'" . DT  I 6  86   ? 177.124 110.935 146.423 1.00 162.20 ?  13   DT  I "O5'" 1 
ATOM   7727  C  "C5'" . DT  I 6  86   ? 177.902 112.111 146.243 1.00 161.22 ?  13   DT  I "C5'" 1 
ATOM   7728  C  "C4'" . DT  I 6  86   ? 177.987 112.911 147.531 1.00 160.75 ?  13   DT  I "C4'" 1 
ATOM   7729  O  "O4'" . DT  I 6  86   ? 176.711 113.551 147.798 1.00 160.65 ?  13   DT  I "O4'" 1 
ATOM   7730  C  "C3'" . DT  I 6  86   ? 178.329 112.096 148.782 1.00 160.44 ?  13   DT  I "C3'" 1 
ATOM   7731  O  "O3'" . DT  I 6  86   ? 179.354 112.755 149.521 1.00 160.01 ?  13   DT  I "O3'" 1 
ATOM   7732  C  "C2'" . DT  I 6  86   ? 177.007 112.053 149.552 1.00 160.27 ?  13   DT  I "C2'" 1 
ATOM   7733  C  "C1'" . DT  I 6  86   ? 176.380 113.377 149.154 1.00 160.43 ?  13   DT  I "C1'" 1 
ATOM   7734  N  N1    . DT  I 6  86   ? 174.890 113.408 149.286 1.00 160.27 ?  13   DT  I N1    1 
ATOM   7735  C  C2    . DT  I 6  86   ? 174.300 114.411 150.024 1.00 160.20 ?  13   DT  I C2    1 
ATOM   7736  O  O2    . DT  I 6  86   ? 174.932 115.286 150.588 1.00 160.12 ?  13   DT  I O2    1 
ATOM   7737  N  N3    . DT  I 6  86   ? 172.931 114.352 150.077 1.00 160.16 ?  13   DT  I N3    1 
ATOM   7738  C  C4    . DT  I 6  86   ? 172.111 113.413 149.480 1.00 160.27 ?  13   DT  I C4    1 
ATOM   7739  O  O4    . DT  I 6  86   ? 170.890 113.444 149.586 1.00 160.37 ?  13   DT  I O4    1 
ATOM   7740  C  C5    . DT  I 6  86   ? 172.792 112.391 148.722 1.00 160.16 ?  13   DT  I C5    1 
ATOM   7741  C  C7    . DT  I 6  86   ? 172.004 111.317 148.034 1.00 160.14 ?  13   DT  I C7    1 
ATOM   7742  C  C6    . DT  I 6  86   ? 174.133 112.439 148.660 1.00 160.14 ?  13   DT  I C6    1 
ATOM   7743  P  P     . DT  I 6  87   ? 179.816 112.201 150.957 1.00 160.00 ?  14   DT  I P     1 
ATOM   7744  O  OP1   . DT  I 6  87   ? 181.201 112.667 151.189 1.00 159.95 ?  14   DT  I OP1   1 
ATOM   7745  O  OP2   . DT  I 6  87   ? 179.513 110.754 151.012 1.00 159.70 ?  14   DT  I OP2   1 
ATOM   7746  O  "O5'" . DT  I 6  87   ? 178.845 112.954 151.981 1.00 159.67 ?  14   DT  I "O5'" 1 
ATOM   7747  C  "C5'" . DT  I 6  87   ? 179.237 113.146 153.332 1.00 158.50 ?  14   DT  I "C5'" 1 
ATOM   7748  C  "C4'" . DT  I 6  87   ? 178.758 114.495 153.835 1.00 157.62 ?  14   DT  I "C4'" 1 
ATOM   7749  O  "O4'" . DT  I 6  87   ? 177.439 114.769 153.291 1.00 157.42 ?  14   DT  I "O4'" 1 
ATOM   7750  C  "C3'" . DT  I 6  87   ? 178.597 114.602 155.344 1.00 157.20 ?  14   DT  I "C3'" 1 
ATOM   7751  O  "O3'" . DT  I 6  87   ? 178.747 115.961 155.745 1.00 156.61 ?  14   DT  I "O3'" 1 
ATOM   7752  C  "C2'" . DT  I 6  87   ? 177.164 114.125 155.531 1.00 157.24 ?  14   DT  I "C2'" 1 
ATOM   7753  C  "C1'" . DT  I 6  87   ? 176.489 114.790 154.340 1.00 157.44 ?  14   DT  I "C1'" 1 
ATOM   7754  N  N1    . DT  I 6  87   ? 175.250 114.098 153.874 1.00 157.56 ?  14   DT  I N1    1 
ATOM   7755  C  C2    . DT  I 6  87   ? 174.023 114.623 154.207 1.00 157.53 ?  14   DT  I C2    1 
ATOM   7756  O  O2    . DT  I 6  87   ? 173.888 115.630 154.879 1.00 157.38 ?  14   DT  I O2    1 
ATOM   7757  N  N3    . DT  I 6  87   ? 172.951 113.922 153.725 1.00 157.58 ?  14   DT  I N3    1 
ATOM   7758  C  C4    . DT  I 6  87   ? 172.980 112.773 152.957 1.00 157.53 ?  14   DT  I C4    1 
ATOM   7759  O  O4    . DT  I 6  87   ? 171.957 112.215 152.572 1.00 157.48 ?  14   DT  I O4    1 
ATOM   7760  C  C5    . DT  I 6  87   ? 174.297 112.277 152.640 1.00 157.54 ?  14   DT  I C5    1 
ATOM   7761  C  C7    . DT  I 6  87   ? 174.453 111.035 151.814 1.00 157.52 ?  14   DT  I C7    1 
ATOM   7762  C  C6    . DT  I 6  87   ? 175.357 112.957 153.105 1.00 157.65 ?  14   DT  I C6    1 
ATOM   7763  P  P     . DT  I 6  88   ? 178.984 116.339 157.290 1.00 156.08 ?  15   DT  I P     1 
ATOM   7764  O  OP1   . DT  I 6  88   ? 180.316 116.974 157.389 1.00 156.19 ?  15   DT  I OP1   1 
ATOM   7765  O  OP2   . DT  I 6  88   ? 178.679 115.147 158.113 1.00 155.89 ?  15   DT  I OP2   1 
ATOM   7766  O  "O5'" . DT  I 6  88   ? 177.867 117.446 157.588 1.00 156.16 ?  15   DT  I "O5'" 1 
ATOM   7767  C  "C5'" . DT  I 6  88   ? 176.513 117.213 157.210 1.00 156.32 ?  15   DT  I "C5'" 1 
ATOM   7768  C  "C4'" . DT  I 6  88   ? 175.593 117.303 158.413 1.00 156.53 ?  15   DT  I "C4'" 1 
ATOM   7769  O  "O4'" . DT  I 6  88   ? 174.336 116.635 158.109 1.00 156.92 ?  15   DT  I "O4'" 1 
ATOM   7770  C  "C3'" . DT  I 6  88   ? 176.116 116.617 159.667 1.00 156.50 ?  15   DT  I "C3'" 1 
ATOM   7771  O  "O3'" . DT  I 6  88   ? 175.563 117.238 160.821 1.00 156.17 ?  15   DT  I "O3'" 1 
ATOM   7772  C  "C2'" . DT  I 6  88   ? 175.580 115.205 159.489 1.00 156.75 ?  15   DT  I "C2'" 1 
ATOM   7773  C  "C1'" . DT  I 6  88   ? 174.189 115.502 158.946 1.00 157.37 ?  15   DT  I "C1'" 1 
ATOM   7774  N  N1    . DT  I 6  88   ? 173.601 114.387 158.145 1.00 157.67 ?  15   DT  I N1    1 
ATOM   7775  C  C2    . DT  I 6  88   ? 172.235 114.315 157.995 1.00 157.88 ?  15   DT  I C2    1 
ATOM   7776  O  O2    . DT  I 6  88   ? 171.465 115.122 158.484 1.00 158.05 ?  15   DT  I O2    1 
ATOM   7777  N  N3    . DT  I 6  88   ? 171.797 113.256 157.243 1.00 157.78 ?  15   DT  I N3    1 
ATOM   7778  C  C4    . DT  I 6  88   ? 172.572 112.282 156.642 1.00 157.72 ?  15   DT  I C4    1 
ATOM   7779  O  O4    . DT  I 6  88   ? 172.085 111.368 155.984 1.00 157.78 ?  15   DT  I O4    1 
ATOM   7780  C  C5    . DT  I 6  88   ? 173.995 112.415 156.840 1.00 157.80 ?  15   DT  I C5    1 
ATOM   7781  C  C7    . DT  I 6  88   ? 174.935 111.415 156.235 1.00 157.79 ?  15   DT  I C7    1 
ATOM   7782  C  C6    . DT  I 6  88   ? 174.435 113.448 157.575 1.00 157.80 ?  15   DT  I C6    1 
ATOM   7783  P  P     . DA  I 6  89   ? 176.521 117.775 161.993 1.00 156.07 ?  16   DA  I P     1 
ATOM   7784  O  OP1   . DA  I 6  89   ? 177.154 119.025 161.516 1.00 155.79 ?  16   DA  I OP1   1 
ATOM   7785  O  OP2   . DA  I 6  89   ? 177.366 116.645 162.439 1.00 156.04 ?  16   DA  I OP2   1 
ATOM   7786  O  "O5'" . DA  I 6  89   ? 175.509 118.130 163.182 1.00 155.43 ?  16   DA  I "O5'" 1 
ATOM   7787  C  "C5'" . DA  I 6  89   ? 174.553 119.173 163.017 1.00 154.24 ?  16   DA  I "C5'" 1 
ATOM   7788  C  "C4'" . DA  I 6  89   ? 173.171 118.731 163.475 1.00 153.35 ?  16   DA  I "C4'" 1 
ATOM   7789  O  "O4'" . DA  I 6  89   ? 172.703 117.638 162.639 1.00 153.14 ?  16   DA  I "O4'" 1 
ATOM   7790  C  "C3'" . DA  I 6  89   ? 173.087 118.216 164.912 1.00 152.79 ?  16   DA  I "C3'" 1 
ATOM   7791  O  "O3'" . DA  I 6  89   ? 171.822 118.556 165.463 1.00 151.60 ?  16   DA  I "O3'" 1 
ATOM   7792  C  "C2'" . DA  I 6  89   ? 173.209 116.708 164.720 1.00 152.94 ?  16   DA  I "C2'" 1 
ATOM   7793  C  "C1'" . DA  I 6  89   ? 172.389 116.527 163.453 1.00 153.18 ?  16   DA  I "C1'" 1 
ATOM   7794  N  N9    . DA  I 6  89   ? 172.694 115.310 162.709 1.00 153.25 ?  16   DA  I N9    1 
ATOM   7795  C  C8    . DA  I 6  89   ? 173.930 114.790 162.443 1.00 153.18 ?  16   DA  I C8    1 
ATOM   7796  N  N7    . DA  I 6  89   ? 173.897 113.683 161.738 1.00 153.19 ?  16   DA  I N7    1 
ATOM   7797  C  C5    . DA  I 6  89   ? 172.547 113.467 161.520 1.00 153.19 ?  16   DA  I C5    1 
ATOM   7798  C  C6    . DA  I 6  89   ? 171.844 112.455 160.834 1.00 153.23 ?  16   DA  I C6    1 
ATOM   7799  N  N6    . DA  I 6  89   ? 172.445 111.433 160.216 1.00 153.12 ?  16   DA  I N6    1 
ATOM   7800  N  N1    . DA  I 6  89   ? 170.496 112.534 160.811 1.00 153.28 ?  16   DA  I N1    1 
ATOM   7801  C  C2    . DA  I 6  89   ? 169.903 113.563 161.427 1.00 153.15 ?  16   DA  I C2    1 
ATOM   7802  N  N3    . DA  I 6  89   ? 170.455 114.569 162.103 1.00 153.12 ?  16   DA  I N3    1 
ATOM   7803  C  C4    . DA  I 6  89   ? 171.792 114.461 162.111 1.00 153.21 ?  16   DA  I C4    1 
ATOM   7804  P  P     . DA  I 6  90   ? 171.662 119.833 166.425 1.00 150.59 ?  17   DA  I P     1 
ATOM   7805  O  OP1   . DA  I 6  90   ? 172.123 121.022 165.676 1.00 150.34 ?  17   DA  I OP1   1 
ATOM   7806  O  OP2   . DA  I 6  90   ? 172.281 119.497 167.726 1.00 150.20 ?  17   DA  I OP2   1 
ATOM   7807  O  "O5'" . DA  I 6  90   ? 170.081 119.942 166.647 1.00 150.48 ?  17   DA  I "O5'" 1 
ATOM   7808  C  "C5'" . DA  I 6  90   ? 169.238 120.372 165.581 1.00 150.61 ?  17   DA  I "C5'" 1 
ATOM   7809  C  "C4'" . DA  I 6  90   ? 167.902 119.642 165.605 1.00 150.61 ?  17   DA  I "C4'" 1 
ATOM   7810  O  "O4'" . DA  I 6  90   ? 168.041 118.341 164.977 1.00 150.89 ?  17   DA  I "O4'" 1 
ATOM   7811  C  "C3'" . DA  I 6  90   ? 167.318 119.379 166.990 1.00 150.27 ?  17   DA  I "C3'" 1 
ATOM   7812  O  "O3'" . DA  I 6  90   ? 165.902 119.498 166.943 1.00 149.64 ?  17   DA  I "O3'" 1 
ATOM   7813  C  "C2'" . DA  I 6  90   ? 167.752 117.943 167.276 1.00 150.77 ?  17   DA  I "C2'" 1 
ATOM   7814  C  "C1'" . DA  I 6  90   ? 167.681 117.321 165.888 1.00 151.17 ?  17   DA  I "C1'" 1 
ATOM   7815  N  N9    . DA  I 6  90   ? 168.602 116.205 165.697 1.00 151.35 ?  17   DA  I N9    1 
ATOM   7816  C  C8    . DA  I 6  90   ? 169.938 116.183 165.984 1.00 151.40 ?  17   DA  I C8    1 
ATOM   7817  N  N7    . DA  I 6  90   ? 170.522 115.045 165.696 1.00 151.30 ?  17   DA  I N7    1 
ATOM   7818  C  C5    . DA  I 6  90   ? 169.501 114.269 165.176 1.00 151.27 ?  17   DA  I C5    1 
ATOM   7819  C  C6    . DA  I 6  90   ? 169.470 112.951 164.682 1.00 151.29 ?  17   DA  I C6    1 
ATOM   7820  N  N6    . DA  I 6  90   ? 170.547 112.161 164.630 1.00 151.33 ?  17   DA  I N6    1 
ATOM   7821  N  N1    . DA  I 6  90   ? 168.287 112.477 164.239 1.00 151.45 ?  17   DA  I N1    1 
ATOM   7822  C  C2    . DA  I 6  90   ? 167.213 113.274 164.292 1.00 151.42 ?  17   DA  I C2    1 
ATOM   7823  N  N3    . DA  I 6  90   ? 167.119 114.527 164.735 1.00 151.45 ?  17   DA  I N3    1 
ATOM   7824  C  C4    . DA  I 6  90   ? 168.310 114.969 165.167 1.00 151.37 ?  17   DA  I C4    1 
ATOM   7825  P  P     . DC  I 6  91   ? 165.036 119.429 168.295 1.00 149.30 ?  18   DC  I P     1 
ATOM   7826  O  OP1   . DC  I 6  91   ? 163.810 120.231 168.080 1.00 149.38 ?  18   DC  I OP1   1 
ATOM   7827  O  OP2   . DC  I 6  91   ? 165.936 119.749 169.425 1.00 149.00 ?  18   DC  I OP2   1 
ATOM   7828  O  "O5'" . DC  I 6  91   ? 164.628 117.887 168.412 1.00 150.48 ?  18   DC  I "O5'" 1 
ATOM   7829  C  "C5'" . DC  I 6  91   ? 163.878 117.269 167.372 1.00 152.05 ?  18   DC  I "C5'" 1 
ATOM   7830  C  "C4'" . DC  I 6  91   ? 163.525 115.835 167.731 1.00 153.20 ?  18   DC  I "C4'" 1 
ATOM   7831  O  "O4'" . DC  I 6  91   ? 164.700 114.991 167.597 1.00 153.53 ?  18   DC  I "O4'" 1 
ATOM   7832  C  "C3'" . DC  I 6  91   ? 163.017 115.630 169.159 1.00 153.86 ?  18   DC  I "C3'" 1 
ATOM   7833  O  "O3'" . DC  I 6  91   ? 161.960 114.684 169.160 1.00 154.47 ?  18   DC  I "O3'" 1 
ATOM   7834  C  "C2'" . DC  I 6  91   ? 164.247 115.088 169.885 1.00 153.97 ?  18   DC  I "C2'" 1 
ATOM   7835  C  "C1'" . DC  I 6  91   ? 164.892 114.260 168.787 1.00 154.09 ?  18   DC  I "C1'" 1 
ATOM   7836  N  N1    . DC  I 6  91   ? 166.355 114.045 168.973 1.00 154.23 ?  18   DC  I N1    1 
ATOM   7837  C  C2    . DC  I 6  91   ? 166.938 112.844 168.552 1.00 154.33 ?  18   DC  I C2    1 
ATOM   7838  O  O2    . DC  I 6  91   ? 166.226 111.962 168.057 1.00 154.36 ?  18   DC  I O2    1 
ATOM   7839  N  N3    . DC  I 6  91   ? 168.270 112.660 168.731 1.00 154.32 ?  18   DC  I N3    1 
ATOM   7840  C  C4    . DC  I 6  91   ? 169.009 113.627 169.279 1.00 154.35 ?  18   DC  I C4    1 
ATOM   7841  N  N4    . DC  I 6  91   ? 170.319 113.402 169.428 1.00 154.40 ?  18   DC  I N4    1 
ATOM   7842  C  C5    . DC  I 6  91   ? 168.435 114.861 169.708 1.00 154.18 ?  18   DC  I C5    1 
ATOM   7843  C  C6    . DC  I 6  91   ? 167.118 115.026 169.537 1.00 154.15 ?  18   DC  I C6    1 
ATOM   7844  P  P     . DC  I 6  92   ? 160.515 115.082 169.739 1.00 154.81 ?  19   DC  I P     1 
ATOM   7845  O  OP1   . DC  I 6  92   ? 159.755 115.731 168.647 1.00 154.31 ?  19   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I 6  92   ? 160.725 115.798 171.016 1.00 154.26 ?  19   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I 6  92   ? 159.839 113.672 170.072 1.00 156.15 ?  19   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I 6  92   ? 159.730 112.678 169.059 1.00 157.96 ?  19   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I 6  92   ? 159.788 111.287 169.665 1.00 159.29 ?  19   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I 6  92   ? 161.144 110.768 169.569 1.00 159.21 ?  19   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I 6  92   ? 159.408 111.216 171.147 1.00 160.54 ?  19   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I 6  92   ? 158.551 110.105 171.383 1.00 162.86 ?  19   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I 6  92   ? 160.755 111.039 171.843 1.00 160.08 ?  19   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I 6  92   ? 161.515 110.225 170.813 1.00 159.49 ?  19   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I 6  92   ? 162.998 110.315 170.960 1.00 159.42 ?  19   DC  I N1    1 
ATOM   7856  C  C2    . DC  I 6  92   ? 163.740 109.158 171.223 1.00 159.37 ?  19   DC  I C2    1 
ATOM   7857  O  O2    . DC  I 6  92   ? 163.154 108.073 171.316 1.00 159.24 ?  19   DC  I O2    1 
ATOM   7858  N  N3    . DC  I 6  92   ? 165.085 109.257 171.362 1.00 159.29 ?  19   DC  I N3    1 
ATOM   7859  C  C4    . DC  I 6  92   ? 165.680 110.445 171.253 1.00 159.27 ?  19   DC  I C4    1 
ATOM   7860  N  N4    . DC  I 6  92   ? 167.009 110.495 171.397 1.00 159.31 ?  19   DC  I N4    1 
ATOM   7861  C  C5    . DC  I 6  92   ? 164.941 111.635 170.992 1.00 159.22 ?  19   DC  I C5    1 
ATOM   7862  C  C6    . DC  I 6  92   ? 163.616 111.525 170.855 1.00 159.27 ?  19   DC  I C6    1 
ATOM   7863  P  P     . DG  I 6  93   ? 157.854 109.914 172.819 1.00 164.67 ?  20   DG  I P     1 
ATOM   7864  O  OP1   . DG  I 6  93   ? 156.717 108.982 172.644 1.00 164.51 ?  20   DG  I OP1   1 
ATOM   7865  O  OP2   . DG  I 6  93   ? 157.620 111.260 173.386 1.00 164.28 ?  20   DG  I OP2   1 
ATOM   7866  O  "O5'" . DG  I 6  93   ? 158.980 109.198 173.704 1.00 166.23 ?  20   DG  I "O5'" 1 
ATOM   7867  C  "C5'" . DG  I 6  93   ? 159.519 107.948 173.290 1.00 168.54 ?  20   DG  I "C5'" 1 
ATOM   7868  C  "C4'" . DG  I 6  93   ? 160.796 107.624 174.048 1.00 170.47 ?  20   DG  I "C4'" 1 
ATOM   7869  O  "O4'" . DG  I 6  93   ? 161.842 108.532 173.657 1.00 170.97 ?  20   DG  I "O4'" 1 
ATOM   7870  C  "C3'" . DG  I 6  93   ? 160.699 107.749 175.571 1.00 171.58 ?  20   DG  I "C3'" 1 
ATOM   7871  O  "O3'" . DG  I 6  93   ? 160.652 106.457 176.162 1.00 172.92 ?  20   DG  I "O3'" 1 
ATOM   7872  C  "C2'" . DG  I 6  93   ? 161.975 108.514 175.980 1.00 171.63 ?  20   DG  I "C2'" 1 
ATOM   7873  C  "C1'" . DG  I 6  93   ? 162.786 108.565 174.690 1.00 171.77 ?  20   DG  I "C1'" 1 
ATOM   7874  N  N9    . DG  I 6  93   ? 163.593 109.776 174.555 1.00 171.90 ?  20   DG  I N9    1 
ATOM   7875  C  C8    . DG  I 6  93   ? 163.143 111.043 174.275 1.00 171.99 ?  20   DG  I C8    1 
ATOM   7876  N  N7    . DG  I 6  93   ? 164.095 111.932 174.216 1.00 172.08 ?  20   DG  I N7    1 
ATOM   7877  C  C5    . DG  I 6  93   ? 165.253 111.210 174.477 1.00 172.03 ?  20   DG  I C5    1 
ATOM   7878  C  C6    . DG  I 6  93   ? 166.599 111.641 174.546 1.00 171.99 ?  20   DG  I C6    1 
ATOM   7879  O  O6    . DG  I 6  93   ? 167.048 112.784 174.386 1.00 171.98 ?  20   DG  I O6    1 
ATOM   7880  N  N1    . DG  I 6  93   ? 167.465 110.587 174.835 1.00 172.01 ?  20   DG  I N1    1 
ATOM   7881  C  C2    . DG  I 6  93   ? 167.076 109.282 175.034 1.00 172.06 ?  20   DG  I C2    1 
ATOM   7882  N  N2    . DG  I 6  93   ? 168.052 108.400 175.302 1.00 172.03 ?  20   DG  I N2    1 
ATOM   7883  N  N3    . DG  I 6  93   ? 165.816 108.866 174.969 1.00 172.05 ?  20   DG  I N3    1 
ATOM   7884  C  C4    . DG  I 6  93   ? 164.962 109.881 174.688 1.00 172.00 ?  20   DG  I C4    1 
ATOM   7885  P  P     . DC  I 6  94   ? 160.506 106.300 177.754 1.00 173.88 ?  21   DC  I P     1 
ATOM   7886  O  OP1   . DC  I 6  94   ? 159.927 104.965 178.024 1.00 173.91 ?  21   DC  I OP1   1 
ATOM   7887  O  OP2   . DC  I 6  94   ? 159.826 107.513 178.261 1.00 173.90 ?  21   DC  I OP2   1 
ATOM   7888  O  "O5'" . DC  I 6  94   ? 162.016 106.325 178.283 1.00 174.32 ?  21   DC  I "O5'" 1 
ATOM   7889  C  "C5'" . DC  I 6  94   ? 162.982 105.452 177.709 1.00 174.81 ?  21   DC  I "C5'" 1 
ATOM   7890  C  "C4'" . DC  I 6  94   ? 164.364 105.727 178.274 1.00 175.15 ?  21   DC  I "C4'" 1 
ATOM   7891  O  "O4'" . DC  I 6  94   ? 164.874 106.971 177.737 1.00 175.19 ?  21   DC  I "O4'" 1 
ATOM   7892  C  "C3'" . DC  I 6  94   ? 164.426 105.857 179.801 1.00 175.39 ?  21   DC  I "C3'" 1 
ATOM   7893  O  "O3'" . DC  I 6  94   ? 165.327 104.894 180.334 1.00 175.77 ?  21   DC  I "O3'" 1 
ATOM   7894  C  "C2'" . DC  I 6  94   ? 164.919 107.291 180.041 1.00 175.28 ?  21   DC  I "C2'" 1 
ATOM   7895  C  "C1'" . DC  I 6  94   ? 165.622 107.619 178.732 1.00 175.18 ?  21   DC  I "C1'" 1 
ATOM   7896  N  N1    . DC  I 6  94   ? 165.656 109.080 178.427 1.00 175.13 ?  21   DC  I N1    1 
ATOM   7897  C  C2    . DC  I 6  94   ? 166.872 109.773 178.481 1.00 175.00 ?  21   DC  I C2    1 
ATOM   7898  O  O2    . DC  I 6  94   ? 167.903 109.156 178.777 1.00 174.87 ?  21   DC  I O2    1 
ATOM   7899  N  N3    . DC  I 6  94   ? 166.882 111.102 178.203 1.00 174.94 ?  21   DC  I N3    1 
ATOM   7900  C  C4    . DC  I 6  94   ? 165.745 111.727 177.889 1.00 174.97 ?  21   DC  I C4    1 
ATOM   7901  N  N4    . DC  I 6  94   ? 165.800 113.037 177.623 1.00 175.00 ?  21   DC  I N4    1 
ATOM   7902  C  C5    . DC  I 6  94   ? 164.499 111.037 177.832 1.00 174.91 ?  21   DC  I C5    1 
ATOM   7903  C  C6    . DC  I 6  94   ? 164.501 109.729 178.106 1.00 175.08 ?  21   DC  I C6    1 
ATOM   7904  P  P     . DC  I 6  95   ? 165.410 104.650 181.920 1.00 175.98 ?  22   DC  I P     1 
ATOM   7905  O  OP1   . DC  I 6  95   ? 165.945 103.287 182.132 1.00 175.90 ?  22   DC  I OP1   1 
ATOM   7906  O  OP2   . DC  I 6  95   ? 164.108 105.029 182.513 1.00 175.79 ?  22   DC  I OP2   1 
ATOM   7907  O  "O5'" . DC  I 6  95   ? 166.499 105.710 182.411 1.00 176.03 ?  22   DC  I "O5'" 1 
ATOM   7908  C  "C5'" . DC  I 6  95   ? 167.798 105.711 181.833 1.00 175.89 ?  22   DC  I "C5'" 1 
ATOM   7909  C  "C4'" . DC  I 6  95   ? 168.668 106.780 182.465 1.00 175.65 ?  22   DC  I "C4'" 1 
ATOM   7910  O  "O4'" . DC  I 6  95   ? 168.469 108.039 181.784 1.00 175.68 ?  22   DC  I "O4'" 1 
ATOM   7911  C  "C3'" . DC  I 6  95   ? 168.383 107.049 183.947 1.00 175.57 ?  22   DC  I "C3'" 1 
ATOM   7912  O  "O3'" . DC  I 6  95   ? 169.516 106.701 184.734 1.00 175.33 ?  22   DC  I "O3'" 1 
ATOM   7913  C  "C2'" . DC  I 6  95   ? 168.084 108.555 184.016 1.00 175.51 ?  22   DC  I "C2'" 1 
ATOM   7914  C  "C1'" . DC  I 6  95   ? 168.661 109.074 182.708 1.00 175.30 ?  22   DC  I "C1'" 1 
ATOM   7915  N  N1    . DC  I 6  95   ? 167.977 110.301 182.202 1.00 175.15 ?  22   DC  I N1    1 
ATOM   7916  C  C2    . DC  I 6  95   ? 168.686 111.507 182.119 1.00 175.08 ?  22   DC  I C2    1 
ATOM   7917  O  O2    . DC  I 6  95   ? 169.873 111.533 182.465 1.00 175.02 ?  22   DC  I O2    1 
ATOM   7918  N  N3    . DC  I 6  95   ? 168.047 112.613 181.662 1.00 174.94 ?  22   DC  I N3    1 
ATOM   7919  C  C4    . DC  I 6  95   ? 166.764 112.542 181.301 1.00 174.91 ?  22   DC  I C4    1 
ATOM   7920  N  N4    . DC  I 6  95   ? 166.174 113.656 180.855 1.00 174.83 ?  22   DC  I N4    1 
ATOM   7921  C  C5    . DC  I 6  95   ? 166.027 111.324 181.381 1.00 174.97 ?  22   DC  I C5    1 
ATOM   7922  C  C6    . DC  I 6  95   ? 166.666 110.240 181.833 1.00 175.02 ?  22   DC  I C6    1 
ATOM   7923  P  P     . DA  I 6  96   ? 169.442 106.769 186.338 1.00 175.24 ?  23   DA  I P     1 
ATOM   7924  O  OP1   . DA  I 6  96   ? 170.242 105.642 186.867 1.00 175.32 ?  23   DA  I OP1   1 
ATOM   7925  O  OP2   . DA  I 6  96   ? 168.021 106.903 186.729 1.00 175.18 ?  23   DA  I OP2   1 
ATOM   7926  O  "O5'" . DA  I 6  96   ? 170.189 108.138 186.695 1.00 174.53 ?  23   DA  I "O5'" 1 
ATOM   7927  C  "C5'" . DA  I 6  96   ? 171.549 108.316 186.322 1.00 173.62 ?  23   DA  I "C5'" 1 
ATOM   7928  C  "C4'" . DA  I 6  96   ? 171.974 109.765 186.478 1.00 172.98 ?  23   DA  I "C4'" 1 
ATOM   7929  O  "O4'" . DA  I 6  96   ? 171.191 110.607 185.587 1.00 173.12 ?  23   DA  I "O4'" 1 
ATOM   7930  C  "C3'" . DA  I 6  96   ? 171.794 110.352 187.884 1.00 172.16 ?  23   DA  I "C3'" 1 
ATOM   7931  O  "O3'" . DA  I 6  96   ? 172.952 111.107 188.243 1.00 170.46 ?  23   DA  I "O3'" 1 
ATOM   7932  C  "C2'" . DA  I 6  96   ? 170.568 111.250 187.722 1.00 172.45 ?  23   DA  I "C2'" 1 
ATOM   7933  C  "C1'" . DA  I 6  96   ? 170.764 111.739 186.301 1.00 172.88 ?  23   DA  I "C1'" 1 
ATOM   7934  N  N9    . DA  I 6  96   ? 169.549 112.267 185.689 1.00 172.92 ?  23   DA  I N9    1 
ATOM   7935  C  C8    . DA  I 6  96   ? 168.391 111.590 185.432 1.00 172.87 ?  23   DA  I C8    1 
ATOM   7936  N  N7    . DA  I 6  96   ? 167.459 112.328 184.876 1.00 172.90 ?  23   DA  I N7    1 
ATOM   7937  C  C5    . DA  I 6  96   ? 168.046 113.577 184.766 1.00 172.89 ?  23   DA  I C5    1 
ATOM   7938  C  C6    . DA  I 6  96   ? 167.579 114.804 184.259 1.00 172.85 ?  23   DA  I C6    1 
ATOM   7939  N  N6    . DA  I 6  96   ? 166.356 114.970 183.745 1.00 172.86 ?  23   DA  I N6    1 
ATOM   7940  N  N1    . DA  I 6  96   ? 168.420 115.859 184.299 1.00 172.81 ?  23   DA  I N1    1 
ATOM   7941  C  C2    . DA  I 6  96   ? 169.643 115.689 184.814 1.00 172.86 ?  23   DA  I C2    1 
ATOM   7942  N  N3    . DA  I 6  96   ? 170.193 114.586 185.319 1.00 172.84 ?  23   DA  I N3    1 
ATOM   7943  C  C4    . DA  I 6  96   ? 169.333 113.557 185.265 1.00 172.90 ?  23   DA  I C4    1 
ATOM   7944  P  P     . DA  I 6  97   ? 173.160 111.629 189.750 1.00 168.85 ?  24   DA  I P     1 
ATOM   7945  O  OP1   . DA  I 6  97   ? 174.450 111.085 190.227 1.00 168.92 ?  24   DA  I OP1   1 
ATOM   7946  O  OP2   . DA  I 6  97   ? 171.927 111.360 190.522 1.00 168.62 ?  24   DA  I OP2   1 
ATOM   7947  O  "O5'" . DA  I 6  97   ? 173.307 113.216 189.587 1.00 167.36 ?  24   DA  I "O5'" 1 
ATOM   7948  C  "C5'" . DA  I 6  97   ? 172.792 113.862 188.426 1.00 165.07 ?  24   DA  I "C5'" 1 
ATOM   7949  C  "C4'" . DA  I 6  97   ? 172.312 115.263 188.751 1.00 163.58 ?  24   DA  I "C4'" 1 
ATOM   7950  O  "O4'" . DA  I 6  97   ? 171.110 115.557 187.979 1.00 163.33 ?  24   DA  I "O4'" 1 
ATOM   7951  C  "C3'" . DA  I 6  97   ? 171.920 115.489 190.215 1.00 162.58 ?  24   DA  I "C3'" 1 
ATOM   7952  O  "O3'" . DA  I 6  97   ? 172.217 116.823 190.580 1.00 161.20 ?  24   DA  I "O3'" 1 
ATOM   7953  C  "C2'" . DA  I 6  97   ? 170.415 115.280 190.168 1.00 162.76 ?  24   DA  I "C2'" 1 
ATOM   7954  C  "C1'" . DA  I 6  97   ? 170.115 116.002 188.870 1.00 163.24 ?  24   DA  I "C1'" 1 
ATOM   7955  N  N9    . DA  I 6  97   ? 168.790 115.729 188.319 1.00 163.31 ?  24   DA  I N9    1 
ATOM   7956  C  C8    . DA  I 6  97   ? 168.114 114.541 188.325 1.00 163.33 ?  24   DA  I C8    1 
ATOM   7957  N  N7    . DA  I 6  97   ? 166.927 114.606 187.766 1.00 163.33 ?  24   DA  I N7    1 
ATOM   7958  C  C5    . DA  I 6  97   ? 166.817 115.931 187.372 1.00 163.40 ?  24   DA  I C5    1 
ATOM   7959  C  C6    . DA  I 6  97   ? 165.795 116.651 186.718 1.00 163.33 ?  24   DA  I C6    1 
ATOM   7960  N  N6    . DA  I 6  97   ? 164.638 116.102 186.331 1.00 163.29 ?  24   DA  I N6    1 
ATOM   7961  N  N1    . DA  I 6  97   ? 166.009 117.962 186.475 1.00 163.36 ?  24   DA  I N1    1 
ATOM   7962  C  C2    . DA  I 6  97   ? 167.168 118.507 186.863 1.00 163.37 ?  24   DA  I C2    1 
ATOM   7963  N  N3    . DA  I 6  97   ? 168.197 117.935 187.483 1.00 163.41 ?  24   DA  I N3    1 
ATOM   7964  C  C4    . DA  I 6  97   ? 167.955 116.635 187.710 1.00 163.41 ?  24   DA  I C4    1 
ATOM   7965  P  P     . DG  I 6  98   ? 173.541 117.180 191.415 1.00 160.00 ?  25   DG  I P     1 
ATOM   7966  O  OP1   . DG  I 6  98   ? 174.710 116.684 190.653 1.00 159.94 ?  25   DG  I OP1   1 
ATOM   7967  O  OP2   . DG  I 6  98   ? 173.328 116.734 192.810 1.00 160.09 ?  25   DG  I OP2   1 
ATOM   7968  O  "O5'" . DG  I 6  98   ? 173.551 118.779 191.403 1.00 158.30 ?  25   DG  I "O5'" 1 
ATOM   7969  C  "C5'" . DG  I 6  98   ? 173.086 119.481 190.248 1.00 155.21 ?  25   DG  I "C5'" 1 
ATOM   7970  C  "C4'" . DG  I 6  98   ? 172.094 120.567 190.632 1.00 152.87 ?  25   DG  I "C4'" 1 
ATOM   7971  O  "O4'" . DG  I 6  98   ? 170.767 120.227 190.131 1.00 152.20 ?  25   DG  I "O4'" 1 
ATOM   7972  C  "C3'" . DG  I 6  98   ? 171.919 120.781 192.136 1.00 151.45 ?  25   DG  I "C3'" 1 
ATOM   7973  O  "O3'" . DG  I 6  98   ? 171.649 122.151 192.392 1.00 149.49 ?  25   DG  I "O3'" 1 
ATOM   7974  C  "C2'" . DG  I 6  98   ? 170.692 119.931 192.427 1.00 151.65 ?  25   DG  I "C2'" 1 
ATOM   7975  C  "C1'" . DG  I 6  98   ? 169.857 120.273 191.208 1.00 151.95 ?  25   DG  I "C1'" 1 
ATOM   7976  N  N9    . DG  I 6  98   ? 168.756 119.347 190.953 1.00 152.01 ?  25   DG  I N9    1 
ATOM   7977  C  C8    . DG  I 6  98   ? 168.704 118.013 191.276 1.00 152.00 ?  25   DG  I C8    1 
ATOM   7978  N  N7    . DG  I 6  98   ? 167.587 117.437 190.928 1.00 151.94 ?  25   DG  I N7    1 
ATOM   7979  C  C5    . DG  I 6  98   ? 166.846 118.456 190.341 1.00 151.97 ?  25   DG  I C5    1 
ATOM   7980  C  C6    . DG  I 6  98   ? 165.549 118.431 189.775 1.00 152.02 ?  25   DG  I C6    1 
ATOM   7981  O  O6    . DG  I 6  98   ? 164.775 117.470 189.678 1.00 152.02 ?  25   DG  I O6    1 
ATOM   7982  N  N1    . DG  I 6  98   ? 165.172 119.682 189.289 1.00 152.09 ?  25   DG  I N1    1 
ATOM   7983  C  C2    . DG  I 6  98   ? 165.952 120.814 189.344 1.00 151.93 ?  25   DG  I C2    1 
ATOM   7984  N  N2    . DG  I 6  98   ? 165.423 121.934 188.825 1.00 151.97 ?  25   DG  I N2    1 
ATOM   7985  N  N3    . DG  I 6  98   ? 167.170 120.849 189.873 1.00 151.99 ?  25   DG  I N3    1 
ATOM   7986  C  C4    . DG  I 6  98   ? 167.551 119.638 190.350 1.00 152.04 ?  25   DG  I C4    1 
ATOM   7987  P  P     . DG  I 6  99   ? 172.826 123.154 192.824 1.00 148.49 ?  26   DG  I P     1 
ATOM   7988  O  OP1   . DG  I 6  99   ? 173.904 123.052 191.816 1.00 148.35 ?  26   DG  I OP1   1 
ATOM   7989  O  OP2   . DG  I 6  99   ? 173.124 122.905 194.251 1.00 148.34 ?  26   DG  I OP2   1 
ATOM   7990  O  "O5'" . DG  I 6  99   ? 172.144 124.598 192.711 1.00 148.04 ?  26   DG  I "O5'" 1 
ATOM   7991  C  "C5'" . DG  I 6  99   ? 171.427 124.955 191.530 1.00 146.54 ?  26   DG  I "C5'" 1 
ATOM   7992  C  "C4'" . DG  I 6  99   ? 170.124 125.666 191.870 1.00 145.27 ?  26   DG  I "C4'" 1 
ATOM   7993  O  "O4'" . DG  I 6  99   ? 169.020 124.722 191.830 1.00 145.28 ?  26   DG  I "O4'" 1 
ATOM   7994  C  "C3'" . DG  I 6  99   ? 170.069 126.305 193.252 1.00 144.05 ?  26   DG  I "C3'" 1 
ATOM   7995  O  "O3'" . DG  I 6  99   ? 169.248 127.462 193.204 1.00 141.81 ?  26   DG  I "O3'" 1 
ATOM   7996  C  "C2'" . DG  I 6  99   ? 169.423 125.204 194.090 1.00 144.64 ?  26   DG  I "C2'" 1 
ATOM   7997  C  "C1'" . DG  I 6  99   ? 168.406 124.644 193.103 1.00 145.75 ?  26   DG  I "C1'" 1 
ATOM   7998  N  N9    . DG  I 6  99   ? 168.049 123.248 193.345 1.00 145.99 ?  26   DG  I N9    1 
ATOM   7999  C  C8    . DG  I 6  99   ? 168.809 122.299 193.982 1.00 146.11 ?  26   DG  I C8    1 
ATOM   8000  N  N7    . DG  I 6  99   ? 168.238 121.128 194.040 1.00 146.17 ?  26   DG  I N7    1 
ATOM   8001  C  C5    . DG  I 6  99   ? 167.024 121.307 193.391 1.00 146.10 ?  26   DG  I C5    1 
ATOM   8002  C  C6    . DG  I 6  99   ? 165.979 120.385 193.144 1.00 145.95 ?  26   DG  I C6    1 
ATOM   8003  O  O6    . DG  I 6  99   ? 165.921 119.187 193.456 1.00 146.04 ?  26   DG  I O6    1 
ATOM   8004  N  N1    . DG  I 6  99   ? 164.922 120.976 192.458 1.00 145.96 ?  26   DG  I N1    1 
ATOM   8005  C  C2    . DG  I 6  99   ? 164.878 122.294 192.063 1.00 146.17 ?  26   DG  I C2    1 
ATOM   8006  N  N2    . DG  I 6  99   ? 163.774 122.684 191.409 1.00 146.15 ?  26   DG  I N2    1 
ATOM   8007  N  N3    . DG  I 6  99   ? 165.852 123.168 192.288 1.00 146.13 ?  26   DG  I N3    1 
ATOM   8008  C  C4    . DG  I 6  99   ? 166.891 122.607 192.956 1.00 146.09 ?  26   DG  I C4    1 
ATOM   8009  P  P     . DG  I 6  100  ? 169.894 128.924 193.039 1.00 139.51 ?  27   DG  I P     1 
ATOM   8010  O  OP1   . DG  I 6  100  ? 170.923 128.848 191.978 1.00 139.22 ?  27   DG  I OP1   1 
ATOM   8011  O  OP2   . DG  I 6  100  ? 170.263 129.409 194.388 1.00 139.25 ?  27   DG  I OP2   1 
ATOM   8012  O  "O5'" . DG  I 6  100  ? 168.676 129.819 192.512 1.00 138.10 ?  27   DG  I "O5'" 1 
ATOM   8013  C  "C5'" . DG  I 6  100  ? 168.221 129.682 191.167 1.00 135.43 ?  27   DG  I "C5'" 1 
ATOM   8014  C  "C4'" . DG  I 6  100  ? 166.715 129.466 191.108 1.00 133.62 ?  27   DG  I "C4'" 1 
ATOM   8015  O  "O4'" . DG  I 6  100  ? 166.377 128.178 191.689 1.00 133.38 ?  27   DG  I "O4'" 1 
ATOM   8016  C  "C3'" . DG  I 6  100  ? 165.871 130.495 191.857 1.00 132.66 ?  27   DG  I "C3'" 1 
ATOM   8017  O  "O3'" . DG  I 6  100  ? 164.663 130.726 191.143 1.00 131.01 ?  27   DG  I "O3'" 1 
ATOM   8018  C  "C2'" . DG  I 6  100  ? 165.601 129.795 193.186 1.00 133.04 ?  27   DG  I "C2'" 1 
ATOM   8019  C  "C1'" . DG  I 6  100  ? 165.427 128.358 192.720 1.00 133.75 ?  27   DG  I "C1'" 1 
ATOM   8020  N  N9    . DG  I 6  100  ? 165.683 127.360 193.754 1.00 134.00 ?  27   DG  I N9    1 
ATOM   8021  C  C8    . DG  I 6  100  ? 166.733 127.338 194.638 1.00 134.06 ?  27   DG  I C8    1 
ATOM   8022  N  N7    . DG  I 6  100  ? 166.714 126.312 195.442 1.00 134.11 ?  27   DG  I N7    1 
ATOM   8023  C  C5    . DG  I 6  100  ? 165.581 125.605 195.065 1.00 134.10 ?  27   DG  I C5    1 
ATOM   8024  C  C6    . DG  I 6  100  ? 165.047 124.403 195.584 1.00 134.15 ?  27   DG  I C6    1 
ATOM   8025  O  O6    . DG  I 6  100  ? 165.487 123.704 196.507 1.00 134.16 ?  27   DG  I O6    1 
ATOM   8026  N  N1    . DG  I 6  100  ? 163.882 124.027 194.918 1.00 133.90 ?  27   DG  I N1    1 
ATOM   8027  C  C2    . DG  I 6  100  ? 163.307 124.727 193.881 1.00 133.88 ?  27   DG  I C2    1 
ATOM   8028  N  N2    . DG  I 6  100  ? 162.181 124.214 193.361 1.00 134.07 ?  27   DG  I N2    1 
ATOM   8029  N  N3    . DG  I 6  100  ? 163.801 125.857 193.387 1.00 134.16 ?  27   DG  I N3    1 
ATOM   8030  C  C4    . DG  I 6  100  ? 164.935 126.235 194.026 1.00 134.09 ?  27   DG  I C4    1 
ATOM   8031  P  P     . DG  I 6  101  ? 163.965 132.172 191.166 1.00 129.56 ?  28   DG  I P     1 
ATOM   8032  O  OP1   . DG  I 6  101  ? 164.347 132.868 189.916 1.00 129.05 ?  28   DG  I OP1   1 
ATOM   8033  O  OP2   . DG  I 6  101  ? 164.259 132.795 192.475 1.00 128.93 ?  28   DG  I OP2   1 
ATOM   8034  O  "O5'" . DG  I 6  101  ? 162.400 131.841 191.116 1.00 130.83 ?  28   DG  I "O5'" 1 
ATOM   8035  C  "C5'" . DG  I 6  101  ? 161.838 131.214 189.966 1.00 132.88 ?  28   DG  I "C5'" 1 
ATOM   8036  C  "C4'" . DG  I 6  101  ? 160.555 130.472 190.314 1.00 134.43 ?  28   DG  I "C4'" 1 
ATOM   8037  O  "O4'" . DG  I 6  101  ? 160.867 129.314 191.132 1.00 135.32 ?  28   DG  I "O4'" 1 
ATOM   8038  C  "C3'" . DG  I 6  101  ? 159.527 131.280 191.101 1.00 135.16 ?  28   DG  I "C3'" 1 
ATOM   8039  O  "O3'" . DG  I 6  101  ? 158.212 130.934 190.682 1.00 135.61 ?  28   DG  I "O3'" 1 
ATOM   8040  C  "C2'" . DG  I 6  101  ? 159.786 130.850 192.541 1.00 135.57 ?  28   DG  I "C2'" 1 
ATOM   8041  C  "C1'" . DG  I 6  101  ? 160.174 129.389 192.362 1.00 136.65 ?  28   DG  I "C1'" 1 
ATOM   8042  N  N9    . DG  I 6  101  ? 161.056 128.891 193.413 1.00 137.04 ?  28   DG  I N9    1 
ATOM   8043  C  C8    . DG  I 6  101  ? 162.269 129.416 193.784 1.00 137.27 ?  28   DG  I C8    1 
ATOM   8044  N  N7    . DG  I 6  101  ? 162.844 128.762 194.753 1.00 137.27 ?  28   DG  I N7    1 
ATOM   8045  C  C5    . DG  I 6  101  ? 161.959 127.735 195.045 1.00 137.44 ?  28   DG  I C5    1 
ATOM   8046  C  C6    . DG  I 6  101  ? 162.049 126.704 196.008 1.00 137.46 ?  28   DG  I C6    1 
ATOM   8047  O  O6    . DG  I 6  101  ? 162.957 126.491 196.822 1.00 137.35 ?  28   DG  I O6    1 
ATOM   8048  N  N1    . DG  I 6  101  ? 160.934 125.868 195.976 1.00 137.36 ?  28   DG  I N1    1 
ATOM   8049  C  C2    . DG  I 6  101  ? 159.867 126.011 195.119 1.00 137.28 ?  28   DG  I C2    1 
ATOM   8050  N  N2    . DG  I 6  101  ? 158.882 125.105 195.235 1.00 137.16 ?  28   DG  I N2    1 
ATOM   8051  N  N3    . DG  I 6  101  ? 159.772 126.974 194.207 1.00 137.42 ?  28   DG  I N3    1 
ATOM   8052  C  C4    . DG  I 6  101  ? 160.852 127.796 194.227 1.00 137.37 ?  28   DG  I C4    1 
ATOM   8053  P  P     . DA  I 6  102  ? 156.940 131.733 191.255 1.00 136.09 ?  29   DA  I P     1 
ATOM   8054  O  OP1   . DA  I 6  102  ? 155.944 131.823 190.165 1.00 135.35 ?  29   DA  I OP1   1 
ATOM   8055  O  OP2   . DA  I 6  102  ? 157.433 132.970 191.901 1.00 135.72 ?  29   DA  I OP2   1 
ATOM   8056  O  "O5'" . DA  I 6  102  ? 156.364 130.773 192.399 1.00 137.52 ?  29   DA  I "O5'" 1 
ATOM   8057  C  "C5'" . DA  I 6  102  ? 155.823 129.502 192.052 1.00 140.02 ?  29   DA  I "C5'" 1 
ATOM   8058  C  "C4'" . DA  I 6  102  ? 155.325 128.762 193.284 1.00 141.88 ?  29   DA  I "C4'" 1 
ATOM   8059  O  "O4'" . DA  I 6  102  ? 156.454 128.291 194.066 1.00 142.73 ?  29   DA  I "O4'" 1 
ATOM   8060  C  "C3'" . DA  I 6  102  ? 154.458 129.585 194.236 1.00 142.92 ?  29   DA  I "C3'" 1 
ATOM   8061  O  "O3'" . DA  I 6  102  ? 153.365 128.797 194.691 1.00 144.39 ?  29   DA  I "O3'" 1 
ATOM   8062  C  "C2'" . DA  I 6  102  ? 155.419 129.933 195.373 1.00 143.04 ?  29   DA  I "C2'" 1 
ATOM   8063  C  "C1'" . DA  I 6  102  ? 156.315 128.706 195.408 1.00 143.30 ?  29   DA  I "C1'" 1 
ATOM   8064  N  N9    . DA  I 6  102  ? 157.650 128.970 195.939 1.00 143.52 ?  29   DA  I N9    1 
ATOM   8065  C  C8    . DA  I 6  102  ? 158.537 129.909 195.497 1.00 143.60 ?  29   DA  I C8    1 
ATOM   8066  N  N7    . DA  I 6  102  ? 159.671 129.920 196.155 1.00 143.70 ?  29   DA  I N7    1 
ATOM   8067  C  C5    . DA  I 6  102  ? 159.522 128.911 197.091 1.00 143.60 ?  29   DA  I C5    1 
ATOM   8068  C  C6    . DA  I 6  102  ? 160.375 128.417 198.096 1.00 143.41 ?  29   DA  I C6    1 
ATOM   8069  N  N6    . DA  I 6  102  ? 161.601 128.900 198.321 1.00 143.49 ?  29   DA  I N6    1 
ATOM   8070  N  N1    . DA  I 6  102  ? 159.921 127.400 198.861 1.00 143.43 ?  29   DA  I N1    1 
ATOM   8071  C  C2    . DA  I 6  102  ? 158.693 126.920 198.628 1.00 143.45 ?  29   DA  I C2    1 
ATOM   8072  N  N3    . DA  I 6  102  ? 157.800 127.303 197.714 1.00 143.57 ?  29   DA  I N3    1 
ATOM   8073  C  C4    . DA  I 6  102  ? 158.282 128.312 196.971 1.00 143.59 ?  29   DA  I C4    1 
ATOM   8074  P  P     . DT  I 6  103  ? 152.281 129.409 195.708 1.00 145.85 ?  30   DT  I P     1 
ATOM   8075  O  OP1   . DT  I 6  103  ? 150.966 128.838 195.345 1.00 145.49 ?  30   DT  I OP1   1 
ATOM   8076  O  OP2   . DT  I 6  103  ? 152.451 130.878 195.748 1.00 145.92 ?  30   DT  I OP2   1 
ATOM   8077  O  "O5'" . DT  I 6  103  ? 152.717 128.814 197.127 1.00 147.18 ?  30   DT  I "O5'" 1 
ATOM   8078  C  "C5'" . DT  I 6  103  ? 152.819 127.405 197.301 1.00 148.67 ?  30   DT  I "C5'" 1 
ATOM   8079  C  "C4'" . DT  I 6  103  ? 152.973 127.048 198.769 1.00 149.53 ?  30   DT  I "C4'" 1 
ATOM   8080  O  "O4'" . DT  I 6  103  ? 154.363 127.185 199.163 1.00 149.87 ?  30   DT  I "O4'" 1 
ATOM   8081  C  "C3'" . DT  I 6  103  ? 152.162 127.913 199.732 1.00 150.03 ?  30   DT  I "C3'" 1 
ATOM   8082  O  "O3'" . DT  I 6  103  ? 151.530 127.093 200.702 1.00 150.56 ?  30   DT  I "O3'" 1 
ATOM   8083  C  "C2'" . DT  I 6  103  ? 153.210 128.833 200.361 1.00 150.28 ?  30   DT  I "C2'" 1 
ATOM   8084  C  "C1'" . DT  I 6  103  ? 154.455 127.959 200.338 1.00 150.49 ?  30   DT  I "C1'" 1 
ATOM   8085  N  N1    . DT  I 6  103  ? 155.731 128.734 200.280 1.00 150.73 ?  30   DT  I N1    1 
ATOM   8086  C  C2    . DT  I 6  103  ? 156.737 128.452 201.177 1.00 150.89 ?  30   DT  I C2    1 
ATOM   8087  O  O2    . DT  I 6  103  ? 156.643 127.597 202.039 1.00 151.00 ?  30   DT  I O2    1 
ATOM   8088  N  N3    . DT  I 6  103  ? 157.866 129.215 201.028 1.00 150.95 ?  30   DT  I N3    1 
ATOM   8089  C  C4    . DT  I 6  103  ? 158.085 130.208 200.090 1.00 150.77 ?  30   DT  I C4    1 
ATOM   8090  O  O4    . DT  I 6  103  ? 159.133 130.841 200.033 1.00 150.80 ?  30   DT  I O4    1 
ATOM   8091  C  C5    . DT  I 6  103  ? 156.992 130.450 199.181 1.00 150.86 ?  30   DT  I C5    1 
ATOM   8092  C  C7    . DT  I 6  103  ? 157.114 131.506 198.123 1.00 150.79 ?  30   DT  I C7    1 
ATOM   8093  C  C6    . DT  I 6  103  ? 155.883 129.709 199.315 1.00 150.82 ?  30   DT  I C6    1 
ATOM   8094  P  P     . DT  I 6  104  ? 150.367 127.693 201.635 1.00 151.16 ?  31   DT  I P     1 
ATOM   8095  O  OP1   . DT  I 6  104  ? 149.317 126.658 201.764 1.00 151.14 ?  31   DT  I OP1   1 
ATOM   8096  O  OP2   . DT  I 6  104  ? 150.018 129.035 201.118 1.00 150.54 ?  31   DT  I OP2   1 
ATOM   8097  O  "O5'" . DT  I 6  104  ? 151.082 127.879 203.052 1.00 151.53 ?  31   DT  I "O5'" 1 
ATOM   8098  C  "C5'" . DT  I 6  104  ? 151.728 126.772 203.665 1.00 151.75 ?  31   DT  I "C5'" 1 
ATOM   8099  C  "C4'" . DT  I 6  104  ? 152.558 127.221 204.852 1.00 152.03 ?  31   DT  I "C4'" 1 
ATOM   8100  O  "O4'" . DT  I 6  104  ? 153.760 127.885 204.385 1.00 152.01 ?  31   DT  I "O4'" 1 
ATOM   8101  C  "C3'" . DT  I 6  104  ? 151.858 128.205 205.796 1.00 152.16 ?  31   DT  I "C3'" 1 
ATOM   8102  O  "O3'" . DT  I 6  104  ? 151.910 127.716 207.131 1.00 152.72 ?  31   DT  I "O3'" 1 
ATOM   8103  C  "C2'" . DT  I 6  104  ? 152.653 129.505 205.633 1.00 151.95 ?  31   DT  I "C2'" 1 
ATOM   8104  C  "C1'" . DT  I 6  104  ? 154.019 128.992 205.208 1.00 152.15 ?  31   DT  I "C1'" 1 
ATOM   8105  N  N1    . DT  I 6  104  ? 154.817 129.988 204.431 1.00 152.30 ?  31   DT  I N1    1 
ATOM   8106  C  C2    . DT  I 6  104  ? 156.087 130.312 204.853 1.00 152.32 ?  31   DT  I C2    1 
ATOM   8107  O  O2    . DT  I 6  104  ? 156.608 129.825 205.840 1.00 152.31 ?  31   DT  I O2    1 
ATOM   8108  N  N3    . DT  I 6  104  ? 156.732 131.236 204.072 1.00 152.30 ?  31   DT  I N3    1 
ATOM   8109  C  C4    . DT  I 6  104  ? 156.243 131.855 202.935 1.00 152.24 ?  31   DT  I C4    1 
ATOM   8110  O  O4    . DT  I 6  104  ? 156.899 132.673 202.300 1.00 152.36 ?  31   DT  I O4    1 
ATOM   8111  C  C5    . DT  I 6  104  ? 154.907 131.472 202.548 1.00 152.27 ?  31   DT  I C5    1 
ATOM   8112  C  C7    . DT  I 6  104  ? 154.272 132.080 201.333 1.00 152.18 ?  31   DT  I C7    1 
ATOM   8113  C  C6    . DT  I 6  104  ? 154.265 130.568 203.306 1.00 152.33 ?  31   DT  I C6    1 
ATOM   8114  P  P     . DA  I 6  105  ? 151.132 128.480 208.312 1.00 153.10 ?  32   DA  I P     1 
ATOM   8115  O  OP1   . DA  I 6  105  ? 150.537 127.448 209.188 1.00 152.98 ?  32   DA  I OP1   1 
ATOM   8116  O  OP2   . DA  I 6  105  ? 150.263 129.515 207.709 1.00 152.78 ?  32   DA  I OP2   1 
ATOM   8117  O  "O5'" . DA  I 6  105  ? 152.302 129.214 209.117 1.00 153.55 ?  32   DA  I "O5'" 1 
ATOM   8118  C  "C5'" . DA  I 6  105  ? 153.372 128.448 209.658 1.00 154.17 ?  32   DA  I "C5'" 1 
ATOM   8119  C  "C4'" . DA  I 6  105  ? 154.539 129.338 210.046 1.00 154.66 ?  32   DA  I "C4'" 1 
ATOM   8120  O  "O4'" . DA  I 6  105  ? 155.102 129.949 208.857 1.00 154.79 ?  32   DA  I "O4'" 1 
ATOM   8121  C  "C3'" . DA  I 6  105  ? 154.189 130.485 210.999 1.00 154.86 ?  32   DA  I "C3'" 1 
ATOM   8122  O  "O3'" . DA  I 6  105  ? 155.070 130.476 212.115 1.00 155.29 ?  32   DA  I "O3'" 1 
ATOM   8123  C  "C2'" . DA  I 6  105  ? 154.369 131.744 210.147 1.00 154.91 ?  32   DA  I "C2'" 1 
ATOM   8124  C  "C1'" . DA  I 6  105  ? 155.405 131.294 209.130 1.00 155.21 ?  32   DA  I "C1'" 1 
ATOM   8125  N  N9    . DA  I 6  105  ? 155.352 132.046 207.879 1.00 155.34 ?  32   DA  I N9    1 
ATOM   8126  C  C8    . DA  I 6  105  ? 154.329 132.067 206.975 1.00 155.33 ?  32   DA  I C8    1 
ATOM   8127  N  N7    . DA  I 6  105  ? 154.554 132.837 205.936 1.00 155.33 ?  32   DA  I N7    1 
ATOM   8128  C  C5    . DA  I 6  105  ? 155.812 133.361 206.178 1.00 155.36 ?  32   DA  I C5    1 
ATOM   8129  C  C6    . DA  I 6  105  ? 156.626 134.253 205.449 1.00 155.36 ?  32   DA  I C6    1 
ATOM   8130  N  N6    . DA  I 6  105  ? 156.265 134.791 204.280 1.00 155.28 ?  32   DA  I N6    1 
ATOM   8131  N  N1    . DA  I 6  105  ? 157.828 134.571 205.973 1.00 155.33 ?  32   DA  I N1    1 
ATOM   8132  C  C2    . DA  I 6  105  ? 158.185 134.030 207.144 1.00 155.33 ?  32   DA  I C2    1 
ATOM   8133  N  N3    . DA  I 6  105  ? 157.508 133.182 207.918 1.00 155.46 ?  32   DA  I N3    1 
ATOM   8134  C  C4    . DA  I 6  105  ? 156.320 132.884 207.372 1.00 155.40 ?  32   DA  I C4    1 
ATOM   8135  P  P     . DC  I 6  106  ? 154.681 131.265 213.459 1.00 155.50 ?  33   DC  I P     1 
ATOM   8136  O  OP1   . DC  I 6  106  ? 154.943 130.362 214.601 1.00 155.43 ?  33   DC  I OP1   1 
ATOM   8137  O  OP2   . DC  I 6  106  ? 153.330 131.841 213.272 1.00 155.39 ?  33   DC  I OP2   1 
ATOM   8138  O  "O5'" . DC  I 6  106  ? 155.725 132.475 213.507 1.00 154.85 ?  33   DC  I "O5'" 1 
ATOM   8139  C  "C5'" . DC  I 6  106  ? 157.122 132.205 213.544 1.00 153.87 ?  33   DC  I "C5'" 1 
ATOM   8140  C  "C4'" . DC  I 6  106  ? 157.920 133.474 213.305 1.00 153.32 ?  33   DC  I "C4'" 1 
ATOM   8141  O  "O4'" . DC  I 6  106  ? 157.832 133.844 211.907 1.00 153.44 ?  33   DC  I "O4'" 1 
ATOM   8142  C  "C3'" . DC  I 6  106  ? 157.446 134.689 214.109 1.00 152.65 ?  33   DC  I "C3'" 1 
ATOM   8143  O  "O3'" . DC  I 6  106  ? 158.522 135.230 214.865 1.00 151.58 ?  33   DC  I "O3'" 1 
ATOM   8144  C  "C2'" . DC  I 6  106  ? 156.947 135.675 213.048 1.00 152.94 ?  33   DC  I "C2'" 1 
ATOM   8145  C  "C1'" . DC  I 6  106  ? 157.699 135.237 211.802 1.00 153.39 ?  33   DC  I "C1'" 1 
ATOM   8146  N  N1    . DC  I 6  106  ? 156.966 135.546 210.541 1.00 153.56 ?  33   DC  I N1    1 
ATOM   8147  C  C2    . DC  I 6  106  ? 157.546 136.390 209.586 1.00 153.53 ?  33   DC  I C2    1 
ATOM   8148  O  O2    . DC  I 6  106  ? 158.668 136.862 209.805 1.00 153.52 ?  33   DC  I O2    1 
ATOM   8149  N  N3    . DC  I 6  106  ? 156.858 136.663 208.448 1.00 153.61 ?  33   DC  I N3    1 
ATOM   8150  C  C4    . DC  I 6  106  ? 155.648 136.130 208.255 1.00 153.60 ?  33   DC  I C4    1 
ATOM   8151  N  N4    . DC  I 6  106  ? 155.004 136.424 207.120 1.00 153.56 ?  33   DC  I N4    1 
ATOM   8152  C  C5    . DC  I 6  106  ? 155.042 135.273 209.220 1.00 153.75 ?  33   DC  I C5    1 
ATOM   8153  C  C6    . DC  I 6  106  ? 155.731 135.009 210.334 1.00 153.88 ?  33   DC  I C6    1 
ATOM   8154  P  P     . DT  I 6  107  ? 158.277 136.492 215.829 1.00 150.98 ?  34   DT  I P     1 
ATOM   8155  O  OP1   . DT  I 6  107  ? 159.224 136.378 216.960 1.00 151.13 ?  34   DT  I OP1   1 
ATOM   8156  O  OP2   . DT  I 6  107  ? 156.825 136.587 216.101 1.00 150.43 ?  34   DT  I OP2   1 
ATOM   8157  O  "O5'" . DT  I 6  107  ? 158.698 137.745 214.928 1.00 149.77 ?  34   DT  I "O5'" 1 
ATOM   8158  C  "C5'" . DT  I 6  107  ? 159.992 137.782 214.340 1.00 147.43 ?  34   DT  I "C5'" 1 
ATOM   8159  C  "C4'" . DT  I 6  107  ? 160.124 138.938 213.363 1.00 145.96 ?  34   DT  I "C4'" 1 
ATOM   8160  O  "O4'" . DT  I 6  107  ? 159.266 138.720 212.209 1.00 146.06 ?  34   DT  I "O4'" 1 
ATOM   8161  C  "C3'" . DT  I 6  107  ? 159.746 140.319 213.915 1.00 144.82 ?  34   DT  I "C3'" 1 
ATOM   8162  O  "O3'" . DT  I 6  107  ? 160.702 141.273 213.469 1.00 143.15 ?  34   DT  I "O3'" 1 
ATOM   8163  C  "C2'" . DT  I 6  107  ? 158.379 140.567 213.279 1.00 145.31 ?  34   DT  I "C2'" 1 
ATOM   8164  C  "C1'" . DT  I 6  107  ? 158.593 139.921 211.926 1.00 145.90 ?  34   DT  I "C1'" 1 
ATOM   8165  N  N1    . DT  I 6  107  ? 157.336 139.617 211.179 1.00 145.98 ?  34   DT  I N1    1 
ATOM   8166  C  C2    . DT  I 6  107  ? 157.178 140.122 209.911 1.00 145.75 ?  34   DT  I C2    1 
ATOM   8167  O  O2    . DT  I 6  107  ? 158.014 140.816 209.360 1.00 145.54 ?  34   DT  I O2    1 
ATOM   8168  N  N3    . DT  I 6  107  ? 155.999 139.789 209.304 1.00 145.70 ?  34   DT  I N3    1 
ATOM   8169  C  C4    . DT  I 6  107  ? 154.980 139.014 209.824 1.00 145.70 ?  34   DT  I C4    1 
ATOM   8170  O  O4    . DT  I 6  107  ? 153.955 138.771 209.195 1.00 145.71 ?  34   DT  I O4    1 
ATOM   8171  C  C5    . DT  I 6  107  ? 155.207 138.513 211.160 1.00 145.72 ?  34   DT  I C5    1 
ATOM   8172  C  C7    . DT  I 6  107  ? 154.170 137.663 211.832 1.00 145.69 ?  34   DT  I C7    1 
ATOM   8173  C  C6    . DT  I 6  107  ? 156.362 138.836 211.767 1.00 145.98 ?  34   DT  I C6    1 
ATOM   8174  P  P     . DC  I 6  108  ? 160.839 142.709 214.178 1.00 142.31 ?  35   DC  I P     1 
ATOM   8175  O  OP1   . DC  I 6  108  ? 161.812 142.567 215.283 1.00 142.57 ?  35   DC  I OP1   1 
ATOM   8176  O  OP2   . DC  I 6  108  ? 159.486 143.241 214.457 1.00 141.96 ?  35   DC  I OP2   1 
ATOM   8177  O  "O5'" . DC  I 6  108  ? 161.491 143.618 213.035 1.00 140.74 ?  35   DC  I "O5'" 1 
ATOM   8178  C  "C5'" . DC  I 6  108  ? 161.401 143.210 211.670 1.00 137.61 ?  35   DC  I "C5'" 1 
ATOM   8179  C  "C4'" . DC  I 6  108  ? 160.860 144.332 210.803 1.00 135.26 ?  35   DC  I "C4'" 1 
ATOM   8180  O  "O4'" . DC  I 6  108  ? 159.645 143.887 210.132 1.00 135.15 ?  35   DC  I "O4'" 1 
ATOM   8181  C  "C3'" . DC  I 6  108  ? 160.451 145.589 211.564 1.00 133.51 ?  35   DC  I "C3'" 1 
ATOM   8182  O  "O3'" . DC  I 6  108  ? 160.527 146.712 210.700 1.00 130.93 ?  35   DC  I "O3'" 1 
ATOM   8183  C  "C2'" . DC  I 6  108  ? 159.000 145.271 211.879 1.00 133.80 ?  35   DC  I "C2'" 1 
ATOM   8184  C  "C1'" . DC  I 6  108  ? 158.581 144.729 210.525 1.00 134.42 ?  35   DC  I "C1'" 1 
ATOM   8185  N  N1    . DC  I 6  108  ? 157.310 143.951 210.534 1.00 134.36 ?  35   DC  I N1    1 
ATOM   8186  C  C2    . DC  I 6  108  ? 156.498 143.953 209.395 1.00 134.36 ?  35   DC  I C2    1 
ATOM   8187  O  O2    . DC  I 6  108  ? 156.863 144.595 208.403 1.00 134.26 ?  35   DC  I O2    1 
ATOM   8188  N  N3    . DC  I 6  108  ? 155.342 143.245 209.410 1.00 134.22 ?  35   DC  I N3    1 
ATOM   8189  C  C4    . DC  I 6  108  ? 154.991 142.566 210.503 1.00 134.25 ?  35   DC  I C4    1 
ATOM   8190  N  N4    . DC  I 6  108  ? 153.842 141.882 210.475 1.00 134.04 ?  35   DC  I N4    1 
ATOM   8191  C  C5    . DC  I 6  108  ? 155.804 142.557 211.676 1.00 134.47 ?  35   DC  I C5    1 
ATOM   8192  C  C6    . DC  I 6  108  ? 156.942 143.258 211.648 1.00 134.45 ?  35   DC  I C6    1 
ATOM   8193  P  P     . DC  I 6  109  ? 161.885 147.556 210.546 1.00 129.23 ?  36   DC  I P     1 
ATOM   8194  O  OP1   . DC  I 6  109  ? 162.980 146.628 210.185 1.00 129.08 ?  36   DC  I OP1   1 
ATOM   8195  O  OP2   . DC  I 6  109  ? 162.014 148.415 211.744 1.00 128.68 ?  36   DC  I OP2   1 
ATOM   8196  O  "O5'" . DC  I 6  109  ? 161.582 148.503 209.293 1.00 127.27 ?  36   DC  I "O5'" 1 
ATOM   8197  C  "C5'" . DC  I 6  109  ? 160.817 148.001 208.193 1.00 123.97 ?  36   DC  I "C5'" 1 
ATOM   8198  C  "C4'" . DC  I 6  109  ? 159.780 149.017 207.742 1.00 121.51 ?  36   DC  I "C4'" 1 
ATOM   8199  O  "O4'" . DC  I 6  109  ? 158.442 148.494 207.981 1.00 121.25 ?  36   DC  I "O4'" 1 
ATOM   8200  C  "C3'" . DC  I 6  109  ? 159.828 150.354 208.473 1.00 119.61 ?  36   DC  I "C3'" 1 
ATOM   8201  O  "O3'" . DC  I 6  109  ? 159.357 151.386 207.617 1.00 116.50 ?  36   DC  I "O3'" 1 
ATOM   8202  C  "C2'" . DC  I 6  109  ? 158.854 150.109 209.616 1.00 119.82 ?  36   DC  I "C2'" 1 
ATOM   8203  C  "C1'" . DC  I 6  109  ? 157.761 149.344 208.884 1.00 120.99 ?  36   DC  I "C1'" 1 
ATOM   8204  N  N1    . DC  I 6  109  ? 156.905 148.504 209.776 1.00 121.37 ?  36   DC  I N1    1 
ATOM   8205  C  C2    . DC  I 6  109  ? 155.715 147.955 209.281 1.00 121.71 ?  36   DC  I C2    1 
ATOM   8206  O  O2    . DC  I 6  109  ? 155.391 148.176 208.108 1.00 121.92 ?  36   DC  I O2    1 
ATOM   8207  N  N3    . DC  I 6  109  ? 154.952 147.192 210.104 1.00 121.56 ?  36   DC  I N3    1 
ATOM   8208  C  C4    . DC  I 6  109  ? 155.338 146.977 211.363 1.00 121.54 ?  36   DC  I C4    1 
ATOM   8209  N  N4    . DC  I 6  109  ? 154.556 146.219 212.140 1.00 121.41 ?  36   DC  I N4    1 
ATOM   8210  C  C5    . DC  I 6  109  ? 156.542 147.533 211.884 1.00 121.87 ?  36   DC  I C5    1 
ATOM   8211  C  C6    . DC  I 6  109  ? 157.289 148.279 211.064 1.00 121.90 ?  36   DC  I C6    1 
ATOM   8212  P  P     . DC  I 6  110  ? 160.357 152.152 206.617 1.00 114.48 ?  37   DC  I P     1 
ATOM   8213  O  OP1   . DC  I 6  110  ? 161.352 151.186 206.101 1.00 114.01 ?  37   DC  I OP1   1 
ATOM   8214  O  OP2   . DC  I 6  110  ? 160.818 153.377 207.306 1.00 113.74 ?  37   DC  I OP2   1 
ATOM   8215  O  "O5'" . DC  I 6  110  ? 159.404 152.601 205.414 1.00 113.15 ?  37   DC  I "O5'" 1 
ATOM   8216  C  "C5'" . DC  I 6  110  ? 158.346 151.743 204.985 1.00 110.06 ?  37   DC  I "C5'" 1 
ATOM   8217  C  "C4'" . DC  I 6  110  ? 157.021 152.489 204.947 1.00 107.58 ?  37   DC  I "C4'" 1 
ATOM   8218  O  "O4'" . DC  I 6  110  ? 156.161 152.020 206.024 1.00 106.65 ?  37   DC  I "O4'" 1 
ATOM   8219  C  "C3'" . DC  I 6  110  ? 157.122 153.998 205.144 1.00 106.60 ?  37   DC  I "C3'" 1 
ATOM   8220  O  "O3'" . DC  I 6  110  ? 156.033 154.639 204.494 1.00 105.70 ?  37   DC  I "O3'" 1 
ATOM   8221  C  "C2'" . DC  I 6  110  ? 156.975 154.109 206.653 1.00 106.22 ?  37   DC  I "C2'" 1 
ATOM   8222  C  "C1'" . DC  I 6  110  ? 155.857 153.105 206.879 1.00 106.76 ?  37   DC  I "C1'" 1 
ATOM   8223  N  N1    . DC  I 6  110  ? 155.759 152.600 208.278 1.00 106.75 ?  37   DC  I N1    1 
ATOM   8224  C  C2    . DC  I 6  110  ? 154.676 151.793 208.645 1.00 106.48 ?  37   DC  I C2    1 
ATOM   8225  O  O2    . DC  I 6  110  ? 153.817 151.516 207.800 1.00 106.50 ?  37   DC  I O2    1 
ATOM   8226  N  N3    . DC  I 6  110  ? 154.597 151.338 209.919 1.00 106.83 ?  37   DC  I N3    1 
ATOM   8227  C  C4    . DC  I 6  110  ? 155.543 151.660 210.803 1.00 106.87 ?  37   DC  I C4    1 
ATOM   8228  N  N4    . DC  I 6  110  ? 155.424 151.187 212.049 1.00 106.84 ?  37   DC  I N4    1 
ATOM   8229  C  C5    . DC  I 6  110  ? 156.651 152.485 210.449 1.00 106.73 ?  37   DC  I C5    1 
ATOM   8230  C  C6    . DC  I 6  110  ? 156.720 152.926 209.188 1.00 107.20 ?  37   DC  I C6    1 
ATOM   8231  P  P     . DT  I 6  111  ? 156.122 155.066 202.948 1.00 104.18 ?  38   DT  I P     1 
ATOM   8232  O  OP1   . DT  I 6  111  ? 156.924 154.060 202.216 1.00 103.41 ?  38   DT  I OP1   1 
ATOM   8233  O  OP2   . DT  I 6  111  ? 156.521 156.490 202.905 1.00 103.72 ?  38   DT  I OP2   1 
ATOM   8234  O  "O5'" . DT  I 6  111  ? 154.602 154.973 202.458 1.00 103.80 ?  38   DT  I "O5'" 1 
ATOM   8235  C  "C5'" . DT  I 6  111  ? 153.792 153.871 202.870 1.00 102.80 ?  38   DT  I "C5'" 1 
ATOM   8236  C  "C4'" . DT  I 6  111  ? 152.389 154.329 203.238 1.00 102.34 ?  38   DT  I "C4'" 1 
ATOM   8237  O  "O4'" . DT  I 6  111  ? 152.149 154.094 204.655 1.00 102.32 ?  38   DT  I "O4'" 1 
ATOM   8238  C  "C3'" . DT  I 6  111  ? 152.114 155.812 203.025 1.00 102.13 ?  38   DT  I "C3'" 1 
ATOM   8239  O  "O3'" . DT  I 6  111  ? 150.732 155.995 202.737 1.00 101.65 ?  38   DT  I "O3'" 1 
ATOM   8240  C  "C2'" . DT  I 6  111  ? 152.471 156.387 204.390 1.00 102.25 ?  38   DT  I "C2'" 1 
ATOM   8241  C  "C1'" . DT  I 6  111  ? 151.862 155.325 205.292 1.00 102.94 ?  38   DT  I "C1'" 1 
ATOM   8242  N  N1    . DT  I 6  111  ? 152.426 155.288 206.678 1.00 103.51 ?  38   DT  I N1    1 
ATOM   8243  C  C2    . DT  I 6  111  ? 151.749 154.595 207.657 1.00 103.69 ?  38   DT  I C2    1 
ATOM   8244  O  O2    . DT  I 6  111  ? 150.701 154.009 207.455 1.00 103.67 ?  38   DT  I O2    1 
ATOM   8245  N  N3    . DT  I 6  111  ? 152.346 154.612 208.890 1.00 103.55 ?  38   DT  I N3    1 
ATOM   8246  C  C4    . DT  I 6  111  ? 153.529 155.239 209.236 1.00 103.45 ?  38   DT  I C4    1 
ATOM   8247  O  O4    . DT  I 6  111  ? 153.986 155.197 210.373 1.00 103.50 ?  38   DT  I O4    1 
ATOM   8248  C  C5    . DT  I 6  111  ? 154.189 155.949 208.164 1.00 103.65 ?  38   DT  I C5    1 
ATOM   8249  C  C7    . DT  I 6  111  ? 155.478 156.672 208.423 1.00 103.35 ?  38   DT  I C7    1 
ATOM   8250  C  C6    . DT  I 6  111  ? 153.613 155.939 206.950 1.00 104.00 ?  38   DT  I C6    1 
ATOM   8251  P  P     . DA  I 6  112  ? 150.260 156.644 201.345 1.00 100.78 ?  39   DA  I P     1 
ATOM   8252  O  OP1   . DA  I 6  112  ? 150.608 155.694 200.266 1.00 101.70 ?  39   DA  I OP1   1 
ATOM   8253  O  OP2   . DA  I 6  112  ? 150.770 158.032 201.299 1.00 100.63 ?  39   DA  I OP2   1 
ATOM   8254  O  "O5'" . DA  I 6  112  ? 148.664 156.708 201.477 1.00 103.42 ?  39   DA  I "O5'" 1 
ATOM   8255  C  "C5'" . DA  I 6  112  ? 147.889 155.517 201.351 1.00 106.88 ?  39   DA  I "C5'" 1 
ATOM   8256  C  "C4'" . DA  I 6  112  ? 146.700 155.518 202.305 1.00 109.26 ?  39   DA  I "C4'" 1 
ATOM   8257  O  "O4'" . DA  I 6  112  ? 147.167 155.522 203.676 1.00 109.92 ?  39   DA  I "O4'" 1 
ATOM   8258  C  "C3'" . DA  I 6  112  ? 145.754 156.704 202.181 1.00 110.78 ?  39   DA  I "C3'" 1 
ATOM   8259  O  "O3'" . DA  I 6  112  ? 144.419 156.286 202.450 1.00 113.11 ?  39   DA  I "O3'" 1 
ATOM   8260  C  "C2'" . DA  I 6  112  ? 146.269 157.678 203.242 1.00 110.68 ?  39   DA  I "C2'" 1 
ATOM   8261  C  "C1'" . DA  I 6  112  ? 146.852 156.750 204.309 1.00 110.56 ?  39   DA  I "C1'" 1 
ATOM   8262  N  N9    . DA  I 6  112  ? 148.079 157.266 204.911 1.00 110.44 ?  39   DA  I N9    1 
ATOM   8263  C  C8    . DA  I 6  112  ? 149.085 157.930 204.272 1.00 110.52 ?  39   DA  I C8    1 
ATOM   8264  N  N7    . DA  I 6  112  ? 150.078 158.271 205.055 1.00 110.39 ?  39   DA  I N7    1 
ATOM   8265  C  C5    . DA  I 6  112  ? 149.703 157.792 206.298 1.00 110.43 ?  39   DA  I C5    1 
ATOM   8266  C  C6    . DA  I 6  112  ? 150.333 157.832 207.558 1.00 110.57 ?  39   DA  I C6    1 
ATOM   8267  N  N6    . DA  I 6  112  ? 151.524 158.404 207.765 1.00 110.54 ?  39   DA  I N6    1 
ATOM   8268  N  N1    . DA  I 6  112  ? 149.688 157.264 208.599 1.00 110.78 ?  39   DA  I N1    1 
ATOM   8269  C  C2    . DA  I 6  112  ? 148.495 156.692 208.382 1.00 110.76 ?  39   DA  I C2    1 
ATOM   8270  N  N3    . DA  I 6  112  ? 147.806 156.592 207.244 1.00 111.13 ?  39   DA  I N3    1 
ATOM   8271  C  C4    . DA  I 6  112  ? 148.474 157.164 206.229 1.00 110.74 ?  39   DA  I C4    1 
ATOM   8272  P  P     . DG  I 6  113  ? 143.195 157.315 202.291 1.00 115.07 ?  40   DG  I P     1 
ATOM   8273  O  OP1   . DG  I 6  113  ? 142.033 156.550 201.786 1.00 116.12 ?  40   DG  I OP1   1 
ATOM   8274  O  OP2   . DG  I 6  113  ? 143.678 158.492 201.535 1.00 115.10 ?  40   DG  I OP2   1 
ATOM   8275  O  "O5'" . DG  I 6  113  ? 142.890 157.778 203.791 1.00 117.27 ?  40   DG  I "O5'" 1 
ATOM   8276  C  "C5'" . DG  I 6  113  ? 142.470 156.819 204.757 1.00 119.58 ?  40   DG  I "C5'" 1 
ATOM   8277  C  "C4'" . DG  I 6  113  ? 142.617 157.366 206.166 1.00 121.45 ?  40   DG  I "C4'" 1 
ATOM   8278  O  "O4'" . DG  I 6  113  ? 144.014 157.530 206.477 1.00 122.22 ?  40   DG  I "O4'" 1 
ATOM   8279  C  "C3'" . DG  I 6  113  ? 141.984 158.739 206.394 1.00 122.52 ?  40   DG  I "C3'" 1 
ATOM   8280  O  "O3'" . DG  I 6  113  ? 140.770 158.608 207.125 1.00 124.52 ?  40   DG  I "O3'" 1 
ATOM   8281  C  "C2'" . DG  I 6  113  ? 143.038 159.529 207.192 1.00 122.49 ?  40   DG  I "C2'" 1 
ATOM   8282  C  "C1'" . DG  I 6  113  ? 144.125 158.500 207.481 1.00 122.76 ?  40   DG  I "C1'" 1 
ATOM   8283  N  N9    . DG  I 6  113  ? 145.468 159.067 207.440 1.00 122.85 ?  40   DG  I N9    1 
ATOM   8284  C  C8    . DG  I 6  113  ? 146.164 159.460 206.324 1.00 123.00 ?  40   DG  I C8    1 
ATOM   8285  N  N7    . DG  I 6  113  ? 147.344 159.946 206.591 1.00 122.96 ?  40   DG  I N7    1 
ATOM   8286  C  C5    . DG  I 6  113  ? 147.438 159.870 207.975 1.00 122.87 ?  40   DG  I C5    1 
ATOM   8287  C  C6    . DG  I 6  113  ? 148.492 160.248 208.839 1.00 122.69 ?  40   DG  I C6    1 
ATOM   8288  O  O6    . DG  I 6  113  ? 149.588 160.742 208.544 1.00 122.76 ?  40   DG  I O6    1 
ATOM   8289  N  N1    . DG  I 6  113  ? 148.178 160.004 210.174 1.00 122.93 ?  40   DG  I N1    1 
ATOM   8290  C  C2    . DG  I 6  113  ? 146.994 159.464 210.619 1.00 123.17 ?  40   DG  I C2    1 
ATOM   8291  N  N2    . DG  I 6  113  ? 146.870 159.302 211.946 1.00 123.13 ?  40   DG  I N2    1 
ATOM   8292  N  N3    . DG  I 6  113  ? 145.997 159.104 209.818 1.00 123.12 ?  40   DG  I N3    1 
ATOM   8293  C  C4    . DG  I 6  113  ? 146.289 159.336 208.513 1.00 122.90 ?  40   DG  I C4    1 
ATOM   8294  P  P     . DT  I 6  114  ? 139.784 159.868 207.283 1.00 125.78 ?  41   DT  I P     1 
ATOM   8295  O  OP1   . DT  I 6  114  ? 138.469 159.357 207.729 1.00 125.17 ?  41   DT  I OP1   1 
ATOM   8296  O  OP2   . DT  I 6  114  ? 139.880 160.666 206.041 1.00 125.30 ?  41   DT  I OP2   1 
ATOM   8297  O  "O5'" . DT  I 6  114  ? 140.434 160.726 208.469 1.00 127.01 ?  41   DT  I "O5'" 1 
ATOM   8298  C  "C5'" . DT  I 6  114  ? 140.616 160.138 209.754 1.00 128.86 ?  41   DT  I "C5'" 1 
ATOM   8299  C  "C4'" . DT  I 6  114  ? 141.475 161.022 210.643 1.00 130.40 ?  41   DT  I "C4'" 1 
ATOM   8300  O  "O4'" . DT  I 6  114  ? 142.816 161.088 210.123 1.00 130.79 ?  41   DT  I "O4'" 1 
ATOM   8301  C  "C3'" . DT  I 6  114  ? 141.015 162.478 210.755 1.00 131.52 ?  41   DT  I "C3'" 1 
ATOM   8302  O  "O3'" . DT  I 6  114  ? 140.369 162.695 212.004 1.00 133.39 ?  41   DT  I "O3'" 1 
ATOM   8303  C  "C2'" . DT  I 6  114  ? 142.310 163.304 210.641 1.00 131.13 ?  41   DT  I "C2'" 1 
ATOM   8304  C  "C1'" . DT  I 6  114  ? 143.408 162.246 210.641 1.00 130.62 ?  41   DT  I "C1'" 1 
ATOM   8305  N  N1    . DT  I 6  114  ? 144.584 162.616 209.803 1.00 130.39 ?  41   DT  I N1    1 
ATOM   8306  C  C2    . DT  I 6  114  ? 145.725 163.069 210.420 1.00 129.89 ?  41   DT  I C2    1 
ATOM   8307  O  O2    . DT  I 6  114  ? 145.832 163.182 211.628 1.00 130.23 ?  41   DT  I O2    1 
ATOM   8308  N  N3    . DT  I 6  114  ? 146.744 163.398 209.568 1.00 129.70 ?  41   DT  I N3    1 
ATOM   8309  C  C4    . DT  I 6  114  ? 146.739 163.318 208.188 1.00 130.18 ?  41   DT  I C4    1 
ATOM   8310  O  O4    . DT  I 6  114  ? 147.712 163.639 207.513 1.00 130.35 ?  41   DT  I O4    1 
ATOM   8311  C  C5    . DT  I 6  114  ? 145.509 162.837 207.602 1.00 130.30 ?  41   DT  I C5    1 
ATOM   8312  C  C7    . DT  I 6  114  ? 145.382 162.710 206.113 1.00 130.35 ?  41   DT  I C7    1 
ATOM   8313  C  C6    . DT  I 6  114  ? 144.501 162.515 208.429 1.00 130.46 ?  41   DT  I C6    1 
ATOM   8314  P  P     . DC  I 6  115  ? 139.648 164.101 212.302 1.00 134.61 ?  42   DC  I P     1 
ATOM   8315  O  OP1   . DC  I 6  115  ? 138.643 163.878 213.365 1.00 134.99 ?  42   DC  I OP1   1 
ATOM   8316  O  OP2   . DC  I 6  115  ? 139.230 164.666 211.000 1.00 134.39 ?  42   DC  I OP2   1 
ATOM   8317  O  "O5'" . DC  I 6  115  ? 140.820 165.025 212.882 1.00 135.35 ?  42   DC  I "O5'" 1 
ATOM   8318  C  "C5'" . DC  I 6  115  ? 141.472 164.671 214.097 1.00 136.26 ?  42   DC  I "C5'" 1 
ATOM   8319  C  "C4'" . DC  I 6  115  ? 142.522 165.704 214.473 1.00 137.11 ?  42   DC  I "C4'" 1 
ATOM   8320  O  "O4'" . DC  I 6  115  ? 143.705 165.525 213.646 1.00 137.24 ?  42   DC  I "O4'" 1 
ATOM   8321  C  "C3'" . DC  I 6  115  ? 142.092 167.169 214.291 1.00 137.52 ?  42   DC  I "C3'" 1 
ATOM   8322  O  "O3'" . DC  I 6  115  ? 142.421 167.930 215.451 1.00 138.49 ?  42   DC  I "O3'" 1 
ATOM   8323  C  "C2'" . DC  I 6  115  ? 142.906 167.624 213.085 1.00 137.32 ?  42   DC  I "C2'" 1 
ATOM   8324  C  "C1'" . DC  I 6  115  ? 144.164 166.792 213.253 1.00 137.38 ?  42   DC  I "C1'" 1 
ATOM   8325  N  N1    . DC  I 6  115  ? 144.952 166.672 211.999 1.00 137.35 ?  42   DC  I N1    1 
ATOM   8326  C  C2    . DC  I 6  115  ? 146.281 167.109 211.973 1.00 137.36 ?  42   DC  I C2    1 
ATOM   8327  O  O2    . DC  I 6  115  ? 146.798 167.557 213.003 1.00 137.19 ?  42   DC  I O2    1 
ATOM   8328  N  N3    . DC  I 6  115  ? 146.977 167.012 210.818 1.00 137.40 ?  42   DC  I N3    1 
ATOM   8329  C  C4    . DC  I 6  115  ? 146.400 166.515 209.727 1.00 137.36 ?  42   DC  I C4    1 
ATOM   8330  N  N4    . DC  I 6  115  ? 147.135 166.462 208.613 1.00 137.24 ?  42   DC  I N4    1 
ATOM   8331  C  C5    . DC  I 6  115  ? 145.041 166.084 209.723 1.00 137.21 ?  42   DC  I C5    1 
ATOM   8332  C  C6    . DC  I 6  115  ? 144.362 166.179 210.872 1.00 137.20 ?  42   DC  I C6    1 
ATOM   8333  P  P     . DT  I 6  116  ? 142.024 169.488 215.541 1.00 138.98 ?  43   DT  I P     1 
ATOM   8334  O  OP1   . DT  I 6  116  ? 142.075 169.875 216.968 1.00 138.59 ?  43   DT  I OP1   1 
ATOM   8335  O  OP2   . DT  I 6  116  ? 140.776 169.685 214.771 1.00 138.68 ?  43   DT  I OP2   1 
ATOM   8336  O  "O5'" . DT  I 6  116  ? 143.201 170.244 214.758 1.00 138.95 ?  43   DT  I "O5'" 1 
ATOM   8337  C  "C5'" . DT  I 6  116  ? 144.536 170.186 215.249 1.00 138.55 ?  43   DT  I "C5'" 1 
ATOM   8338  C  "C4'" . DT  I 6  116  ? 145.476 171.020 214.389 1.00 138.33 ?  43   DT  I "C4'" 1 
ATOM   8339  O  "O4'" . DT  I 6  116  ? 145.824 170.294 213.181 1.00 138.51 ?  43   DT  I "O4'" 1 
ATOM   8340  C  "C3'" . DT  I 6  116  ? 144.920 172.377 213.925 1.00 137.89 ?  43   DT  I "C3'" 1 
ATOM   8341  O  "O3'" . DT  I 6  116  ? 145.838 173.414 214.257 1.00 137.33 ?  43   DT  I "O3'" 1 
ATOM   8342  C  "C2'" . DT  I 6  116  ? 144.788 172.213 212.408 1.00 138.19 ?  43   DT  I "C2'" 1 
ATOM   8343  C  "C1'" . DT  I 6  116  ? 145.891 171.213 212.121 1.00 138.62 ?  43   DT  I "C1'" 1 
ATOM   8344  N  N1    . DT  I 6  116  ? 145.725 170.482 210.829 1.00 138.54 ?  43   DT  I N1    1 
ATOM   8345  C  C2    . DT  I 6  116  ? 146.805 170.355 209.986 1.00 138.35 ?  43   DT  I C2    1 
ATOM   8346  O  O2    . DT  I 6  116  ? 147.907 170.811 210.239 1.00 138.51 ?  43   DT  I O2    1 
ATOM   8347  N  N3    . DT  I 6  116  ? 146.553 169.666 208.830 1.00 138.21 ?  43   DT  I N3    1 
ATOM   8348  C  C4    . DT  I 6  116  ? 145.350 169.111 208.435 1.00 138.48 ?  43   DT  I C4    1 
ATOM   8349  O  O4    . DT  I 6  116  ? 145.228 168.505 207.375 1.00 138.70 ?  43   DT  I O4    1 
ATOM   8350  C  C5    . DT  I 6  116  ? 144.256 169.279 209.365 1.00 138.46 ?  43   DT  I C5    1 
ATOM   8351  C  C7    . DT  I 6  116  ? 142.901 168.716 209.047 1.00 138.40 ?  43   DT  I C7    1 
ATOM   8352  C  C6    . DT  I 6  116  ? 144.493 169.951 210.502 1.00 138.49 ?  43   DT  I C6    1 
ATOM   8353  P  P     . DC  I 6  117  ? 145.398 174.958 214.163 1.00 137.07 ?  44   DC  I P     1 
ATOM   8354  O  OP1   . DC  I 6  117  ? 146.329 175.736 215.008 1.00 136.85 ?  44   DC  I OP1   1 
ATOM   8355  O  OP2   . DC  I 6  117  ? 143.941 175.031 214.410 1.00 136.63 ?  44   DC  I OP2   1 
ATOM   8356  O  "O5'" . DC  I 6  117  ? 145.657 175.345 212.631 1.00 135.97 ?  44   DC  I "O5'" 1 
ATOM   8357  C  "C5'" . DC  I 6  117  ? 146.090 176.661 212.289 1.00 134.45 ?  44   DC  I "C5'" 1 
ATOM   8358  C  "C4'" . DC  I 6  117  ? 147.589 176.685 212.039 1.00 133.08 ?  44   DC  I "C4'" 1 
ATOM   8359  O  "O4'" . DC  I 6  117  ? 147.969 175.506 211.292 1.00 132.53 ?  44   DC  I "O4'" 1 
ATOM   8360  C  "C3'" . DC  I 6  117  ? 148.082 177.840 211.190 1.00 132.41 ?  44   DC  I "C3'" 1 
ATOM   8361  O  "O3'" . DC  I 6  117  ? 149.482 178.028 211.414 1.00 131.38 ?  44   DC  I "O3'" 1 
ATOM   8362  C  "C2'" . DC  I 6  117  ? 147.796 177.321 209.784 1.00 132.34 ?  44   DC  I "C2'" 1 
ATOM   8363  C  "C1'" . DC  I 6  117  ? 148.157 175.844 209.925 1.00 132.54 ?  44   DC  I "C1'" 1 
ATOM   8364  N  N1    . DC  I 6  117  ? 147.317 174.920 209.103 1.00 132.48 ?  44   DC  I N1    1 
ATOM   8365  C  C2    . DC  I 6  117  ? 147.915 174.140 208.106 1.00 132.34 ?  44   DC  I C2    1 
ATOM   8366  O  O2    . DC  I 6  117  ? 149.124 174.261 207.880 1.00 132.32 ?  44   DC  I O2    1 
ATOM   8367  N  N3    . DC  I 6  117  ? 147.142 173.299 207.376 1.00 132.24 ?  44   DC  I N3    1 
ATOM   8368  C  C4    . DC  I 6  117  ? 145.837 173.199 207.632 1.00 132.33 ?  44   DC  I C4    1 
ATOM   8369  N  N4    . DC  I 6  117  ? 145.119 172.347 206.891 1.00 132.47 ?  44   DC  I N4    1 
ATOM   8370  C  C5    . DC  I 6  117  ? 145.210 173.972 208.654 1.00 132.23 ?  44   DC  I C5    1 
ATOM   8371  C  C6    . DC  I 6  117  ? 145.981 174.808 209.360 1.00 132.36 ?  44   DC  I C6    1 
ATOM   8372  P  P     . DC  I 6  118  ? 150.335 179.052 210.514 1.00 130.75 ?  45   DC  I P     1 
ATOM   8373  O  OP1   . DC  I 6  118  ? 151.474 179.521 211.333 1.00 130.18 ?  45   DC  I OP1   1 
ATOM   8374  O  OP2   . DC  I 6  118  ? 149.404 180.042 209.929 1.00 130.23 ?  45   DC  I OP2   1 
ATOM   8375  O  "O5'" . DC  I 6  118  ? 150.908 178.135 209.334 1.00 130.34 ?  45   DC  I "O5'" 1 
ATOM   8376  C  "C5'" . DC  I 6  118  ? 152.318 177.972 209.177 1.00 128.58 ?  45   DC  I "C5'" 1 
ATOM   8377  C  "C4'" . DC  I 6  118  ? 152.783 178.493 207.825 1.00 127.40 ?  45   DC  I "C4'" 1 
ATOM   8378  O  "O4'" . DC  I 6  118  ? 151.884 178.021 206.790 1.00 127.66 ?  45   DC  I "O4'" 1 
ATOM   8379  C  "C3'" . DC  I 6  118  ? 152.799 180.009 207.683 1.00 126.67 ?  45   DC  I "C3'" 1 
ATOM   8380  O  "O3'" . DC  I 6  118  ? 153.774 180.392 206.721 1.00 125.18 ?  45   DC  I "O3'" 1 
ATOM   8381  C  "C2'" . DC  I 6  118  ? 151.390 180.297 207.183 1.00 127.08 ?  45   DC  I "C2'" 1 
ATOM   8382  C  "C1'" . DC  I 6  118  ? 151.152 179.110 206.253 1.00 128.12 ?  45   DC  I "C1'" 1 
ATOM   8383  N  N1    . DC  I 6  118  ? 149.721 178.707 206.152 1.00 128.55 ?  45   DC  I N1    1 
ATOM   8384  C  C2    . DC  I 6  118  ? 149.353 177.679 205.280 1.00 128.69 ?  45   DC  I C2    1 
ATOM   8385  O  O2    . DC  I 6  118  ? 150.219 177.126 204.596 1.00 128.50 ?  45   DC  I O2    1 
ATOM   8386  N  N3    . DC  I 6  118  ? 148.048 177.322 205.198 1.00 128.78 ?  45   DC  I N3    1 
ATOM   8387  C  C4    . DC  I 6  118  ? 147.137 177.943 205.946 1.00 128.67 ?  45   DC  I C4    1 
ATOM   8388  N  N4    . DC  I 6  118  ? 145.862 177.554 205.833 1.00 128.56 ?  45   DC  I N4    1 
ATOM   8389  C  C5    . DC  I 6  118  ? 147.492 178.994 206.842 1.00 128.69 ?  45   DC  I C5    1 
ATOM   8390  C  C6    . DC  I 6  118  ? 148.782 179.337 206.915 1.00 128.72 ?  45   DC  I C6    1 
ATOM   8391  P  P     . DA  I 6  119  ? 154.687 181.692 206.961 1.00 20.00  ?  46   DA  I P     1 
ATOM   8392  O  OP1   . DA  I 6  119  ? 155.618 181.383 208.070 1.00 20.00  ?  46   DA  I OP1   1 
ATOM   8393  O  OP2   . DA  I 6  119  ? 153.789 182.864 207.059 1.00 20.00  ?  46   DA  I OP2   1 
ATOM   8394  O  "O5'" . DA  I 6  119  ? 155.522 181.830 205.603 1.00 20.00  ?  46   DA  I "O5'" 1 
ATOM   8395  C  "C5'" . DA  I 6  119  ? 156.341 180.754 205.157 1.00 20.00  ?  46   DA  I "C5'" 1 
ATOM   8396  C  "C4'" . DA  I 6  119  ? 155.838 180.195 203.835 1.00 20.00  ?  46   DA  I "C4'" 1 
ATOM   8397  O  "O4'" . DA  I 6  119  ? 154.408 179.945 203.921 1.00 20.00  ?  46   DA  I "O4'" 1 
ATOM   8398  C  "C3'" . DA  I 6  119  ? 156.022 181.110 202.625 1.00 20.00  ?  46   DA  I "C3'" 1 
ATOM   8399  O  "O3'" . DA  I 6  119  ? 156.259 180.321 201.469 1.00 20.00  ?  46   DA  I "O3'" 1 
ATOM   8400  C  "C2'" . DA  I 6  119  ? 154.670 181.807 202.541 1.00 20.00  ?  46   DA  I "C2'" 1 
ATOM   8401  C  "C1'" . DA  I 6  119  ? 153.749 180.652 202.890 1.00 20.00  ?  46   DA  I "C1'" 1 
ATOM   8402  N  N9    . DA  I 6  119  ? 152.434 181.063 203.375 1.00 20.00  ?  46   DA  I N9    1 
ATOM   8403  C  C8    . DA  I 6  119  ? 152.158 182.056 204.272 1.00 20.00  ?  46   DA  I C8    1 
ATOM   8404  N  N7    . DA  I 6  119  ? 150.878 182.197 204.527 1.00 20.00  ?  46   DA  I N7    1 
ATOM   8405  C  C5    . DA  I 6  119  ? 150.274 181.227 203.744 1.00 20.00  ?  46   DA  I C5    1 
ATOM   8406  C  C6    . DA  I 6  119  ? 148.926 180.855 203.563 1.00 20.00  ?  46   DA  I C6    1 
ATOM   8407  N  N6    . DA  I 6  119  ? 147.907 181.453 204.190 1.00 20.00  ?  46   DA  I N6    1 
ATOM   8408  N  N1    . DA  I 6  119  ? 148.664 179.843 202.708 1.00 20.00  ?  46   DA  I N1    1 
ATOM   8409  C  C2    . DA  I 6  119  ? 149.688 179.247 202.085 1.00 20.00  ?  46   DA  I C2    1 
ATOM   8410  N  N3    . DA  I 6  119  ? 150.992 179.507 202.175 1.00 20.00  ?  46   DA  I N3    1 
ATOM   8411  C  C4    . DA  I 6  119  ? 151.219 180.517 203.030 1.00 20.00  ?  46   DA  I C4    1 
ATOM   8412  P  P     . DG  I 6  120  ? 157.381 180.749 200.403 1.00 0.00   ?  47   DG  I P     1 
ATOM   8413  O  OP1   . DG  I 6  120  ? 158.679 180.233 200.892 1.00 0.00   ?  47   DG  I OP1   1 
ATOM   8414  O  OP2   . DG  I 6  120  ? 157.219 182.194 200.128 1.00 0.00   ?  47   DG  I OP2   1 
ATOM   8415  O  "O5'" . DG  I 6  120  ? 156.971 179.947 199.080 1.00 0.00   ?  47   DG  I "O5'" 1 
ATOM   8416  C  "C5'" . DG  I 6  120  ? 156.837 178.528 199.118 1.00 0.00   ?  47   DG  I "C5'" 1 
ATOM   8417  C  "C4'" . DG  I 6  120  ? 155.941 178.024 197.993 1.00 0.00   ?  47   DG  I "C4'" 1 
ATOM   8418  O  "O4'" . DG  I 6  120  ? 154.547 178.166 198.369 1.00 0.00   ?  47   DG  I "O4'" 1 
ATOM   8419  C  "C3'" . DG  I 6  120  ? 156.089 178.748 196.663 1.00 0.00   ?  47   DG  I "C3'" 1 
ATOM   8420  O  "O3'" . DG  I 6  120  ? 155.867 177.840 195.592 1.00 0.00   ?  47   DG  I "O3'" 1 
ATOM   8421  C  "C2'" . DG  I 6  120  ? 154.996 179.811 196.732 1.00 0.00   ?  47   DG  I "C2'" 1 
ATOM   8422  C  "C1'" . DG  I 6  120  ? 153.900 179.101 197.524 1.00 0.00   ?  47   DG  I "C1'" 1 
ATOM   8423  N  N9    . DG  I 6  120  ? 153.120 179.999 198.372 1.00 20.00  ?  47   DG  I N9    1 
ATOM   8424  C  C8    . DG  I 6  120  ? 153.610 180.869 199.314 1.00 20.00  ?  47   DG  I C8    1 
ATOM   8425  N  N7    . DG  I 6  120  ? 152.684 181.540 199.935 1.00 20.00  ?  47   DG  I N7    1 
ATOM   8426  C  C5    . DG  I 6  120  ? 151.499 181.084 199.378 1.00 20.00  ?  47   DG  I C5    1 
ATOM   8427  C  C6    . DG  I 6  120  ? 150.164 181.453 199.660 1.00 20.00  ?  47   DG  I C6    1 
ATOM   8428  O  O6    . DG  I 6  120  ? 149.758 182.282 200.485 1.00 20.00  ?  47   DG  I O6    1 
ATOM   8429  N  N1    . DG  I 6  120  ? 149.256 180.753 198.871 1.00 20.00  ?  47   DG  I N1    1 
ATOM   8430  C  C2    . DG  I 6  120  ? 149.596 179.813 197.925 1.00 20.00  ?  47   DG  I C2    1 
ATOM   8431  N  N2    . DG  I 6  120  ? 148.577 179.241 197.260 1.00 20.00  ?  47   DG  I N2    1 
ATOM   8432  N  N3    . DG  I 6  120  ? 150.848 179.455 197.650 1.00 20.00  ?  47   DG  I N3    1 
ATOM   8433  C  C4    . DG  I 6  120  ? 151.745 180.131 198.414 1.00 20.00  ?  47   DG  I C4    1 
ATOM   8434  P  P     . DG  I 6  121  ? 156.051 178.320 194.070 1.00 0.00   ?  48   DG  I P     1 
ATOM   8435  O  OP1   . DG  I 6  121  ? 156.428 177.133 193.271 1.00 0.00   ?  48   DG  I OP1   1 
ATOM   8436  O  OP2   . DG  I 6  121  ? 156.929 179.512 194.075 1.00 0.00   ?  48   DG  I OP2   1 
ATOM   8437  O  "O5'" . DG  I 6  121  ? 154.584 178.787 193.637 1.00 0.00   ?  48   DG  I "O5'" 1 
ATOM   8438  C  "C5'" . DG  I 6  121  ? 153.510 177.854 193.657 1.00 0.00   ?  48   DG  I "C5'" 1 
ATOM   8439  C  "C4'" . DG  I 6  121  ? 152.213 178.501 193.201 1.00 0.00   ?  48   DG  I "C4'" 1 
ATOM   8440  O  "O4'" . DG  I 6  121  ? 151.640 179.275 194.288 1.00 0.00   ?  48   DG  I "O4'" 1 
ATOM   8441  C  "C3'" . DG  I 6  121  ? 152.345 179.459 192.016 1.00 0.00   ?  48   DG  I "C3'" 1 
ATOM   8442  O  "O3'" . DG  I 6  121  ? 151.265 179.256 191.118 1.00 0.00   ?  48   DG  I "O3'" 1 
ATOM   8443  C  "C2'" . DG  I 6  121  ? 152.277 180.837 192.674 1.00 0.00   ?  48   DG  I "C2'" 1 
ATOM   8444  C  "C1'" . DG  I 6  121  ? 151.328 180.572 193.831 1.00 0.00   ?  48   DG  I "C1'" 1 
ATOM   8445  N  N9    . DG  I 6  121  ? 151.488 181.499 194.948 1.00 20.00  ?  48   DG  I N9    1 
ATOM   8446  C  C8    . DG  I 6  121  ? 152.658 181.829 195.585 1.00 20.00  ?  48   DG  I C8    1 
ATOM   8447  N  N7    . DG  I 6  121  ? 152.500 182.678 196.560 1.00 20.00  ?  48   DG  I N7    1 
ATOM   8448  C  C5    . DG  I 6  121  ? 151.135 182.930 196.573 1.00 20.00  ?  48   DG  I C5    1 
ATOM   8449  C  C6    . DG  I 6  121  ? 150.373 183.775 197.412 1.00 20.00  ?  48   DG  I C6    1 
ATOM   8450  O  O6    . DG  I 6  121  ? 150.769 184.490 198.343 1.00 20.00  ?  48   DG  I O6    1 
ATOM   8451  N  N1    . DG  I 6  121  ? 149.020 183.739 197.089 1.00 20.00  ?  48   DG  I N1    1 
ATOM   8452  C  C2    . DG  I 6  121  ? 148.472 182.983 196.077 1.00 20.00  ?  48   DG  I C2    1 
ATOM   8453  N  N2    . DG  I 6  121  ? 147.144 183.077 195.913 1.00 20.00  ?  48   DG  I N2    1 
ATOM   8454  N  N3    . DG  I 6  121  ? 149.176 182.186 195.283 1.00 20.00  ?  48   DG  I N3    1 
ATOM   8455  C  C4    . DG  I 6  121  ? 150.496 182.210 195.587 1.00 20.00  ?  48   DG  I C4    1 
ATOM   8456  P  P     . DC  I 6  122  ? 151.369 179.746 189.591 1.00 0.00   ?  49   DC  I P     1 
ATOM   8457  O  OP1   . DC  I 6  122  ? 151.238 178.550 188.731 1.00 0.00   ?  49   DC  I OP1   1 
ATOM   8458  O  OP2   . DC  I 6  122  ? 152.564 180.611 189.466 1.00 0.00   ?  49   DC  I OP2   1 
ATOM   8459  O  "O5'" . DC  I 6  122  ? 150.071 180.660 189.402 1.00 0.00   ?  49   DC  I "O5'" 1 
ATOM   8460  C  "C5'" . DC  I 6  122  ? 148.787 180.140 189.733 1.00 0.00   ?  49   DC  I "C5'" 1 
ATOM   8461  C  "C4'" . DC  I 6  122  ? 147.775 181.258 189.913 1.00 0.00   ?  49   DC  I "C4'" 1 
ATOM   8462  O  "O4'" . DC  I 6  122  ? 148.035 181.962 191.157 1.00 0.00   ?  49   DC  I "O4'" 1 
ATOM   8463  C  "C3'" . DC  I 6  122  ? 147.780 182.321 188.812 1.00 0.00   ?  49   DC  I "C3'" 1 
ATOM   8464  O  "O3'" . DC  I 6  122  ? 146.443 182.656 188.455 1.00 0.00   ?  49   DC  I "O3'" 1 
ATOM   8465  C  "C2'" . DC  I 6  122  ? 148.500 183.498 189.469 1.00 0.00   ?  49   DC  I "C2'" 1 
ATOM   8466  C  "C1'" . DC  I 6  122  ? 148.055 183.349 190.914 1.00 0.00   ?  49   DC  I "C1'" 1 
ATOM   8467  N  N1    . DC  I 6  122  ? 148.978 183.992 191.895 1.00 20.00  ?  49   DC  I N1    1 
ATOM   8468  C  C2    . DC  I 6  122  ? 148.479 184.928 192.810 1.00 20.00  ?  49   DC  I C2    1 
ATOM   8469  O  O2    . DC  I 6  122  ? 147.274 185.212 192.791 1.00 20.00  ?  49   DC  I O2    1 
ATOM   8470  N  N3    . DC  I 6  122  ? 149.333 185.502 193.693 1.00 20.00  ?  49   DC  I N3    1 
ATOM   8471  C  C4    . DC  I 6  122  ? 150.626 185.172 193.683 1.00 20.00  ?  49   DC  I C4    1 
ATOM   8472  N  N4    . DC  I 6  122  ? 151.430 185.764 194.573 1.00 20.00  ?  49   DC  I N4    1 
ATOM   8473  C  C5    . DC  I 6  122  ? 151.152 184.223 192.759 1.00 20.00  ?  49   DC  I C5    1 
ATOM   8474  C  C6    . DC  I 6  122  ? 150.301 183.664 191.892 1.00 20.00  ?  49   DC  I C6    1 
ATOM   8475  P  P     . DA  I 6  123  ? 146.106 183.177 186.972 1.00 0.00   ?  50   DA  I P     1 
ATOM   8476  O  OP1   . DA  I 6  123  ? 145.145 182.226 186.370 1.00 0.00   ?  50   DA  I OP1   1 
ATOM   8477  O  OP2   . DA  I 6  123  ? 147.390 183.455 186.292 1.00 0.00   ?  50   DA  I OP2   1 
ATOM   8478  O  "O5'" . DA  I 6  123  ? 145.370 184.576 187.218 1.00 0.00   ?  50   DA  I "O5'" 1 
ATOM   8479  C  "C5'" . DA  I 6  123  ? 145.892 185.486 188.176 1.00 0.00   ?  50   DA  I "C5'" 1 
ATOM   8480  C  "C4'" . DA  I 6  123  ? 145.217 186.840 188.076 1.00 0.00   ?  50   DA  I "C4'" 1 
ATOM   8481  O  "O4'" . DA  I 6  123  ? 145.610 187.644 189.210 1.00 0.00   ?  50   DA  I "O4'" 1 
ATOM   8482  C  "C3'" . DA  I 6  123  ? 145.619 187.667 186.872 1.00 0.00   ?  50   DA  I "C3'" 1 
ATOM   8483  O  "O3'" . DA  I 6  123  ? 144.635 188.665 186.623 1.00 0.00   ?  50   DA  I "O3'" 1 
ATOM   8484  C  "C2'" . DA  I 6  123  ? 146.932 188.282 187.344 1.00 0.00   ?  50   DA  I "C2'" 1 
ATOM   8485  C  "C1'" . DA  I 6  123  ? 146.659 188.521 188.831 1.00 0.00   ?  50   DA  I "C1'" 1 
ATOM   8486  N  N9    . DA  I 6  123  ? 147.814 188.249 189.680 1.00 0.00   ?  50   DA  I N9    1 
ATOM   8487  C  C8    . DA  I 6  123  ? 148.752 187.270 189.505 1.00 0.00   ?  50   DA  I C8    1 
ATOM   8488  N  N7    . DA  I 6  123  ? 149.685 187.260 190.427 1.00 0.00   ?  50   DA  I N7    1 
ATOM   8489  C  C5    . DA  I 6  123  ? 149.333 188.304 191.266 1.00 0.00   ?  50   DA  I C5    1 
ATOM   8490  C  C6    . DA  I 6  123  ? 149.920 188.819 192.438 1.00 0.00   ?  50   DA  I C6    1 
ATOM   8491  N  N6    . DA  I 6  123  ? 151.034 188.320 192.982 1.00 0.00   ?  50   DA  I N6    1 
ATOM   8492  N  N1    . DA  I 6  123  ? 149.317 189.873 193.029 1.00 0.00   ?  50   DA  I N1    1 
ATOM   8493  C  C2    . DA  I 6  123  ? 148.201 190.367 192.480 1.00 0.00   ?  50   DA  I C2    1 
ATOM   8494  N  N3    . DA  I 6  123  ? 147.559 189.970 191.384 1.00 0.00   ?  50   DA  I N3    1 
ATOM   8495  C  C4    . DA  I 6  123  ? 148.182 188.925 190.819 1.00 0.00   ?  50   DA  I C4    1 
ATOM   8496  P  P     . DC  I 6  124  ? 144.882 189.793 185.505 1.00 0.00   ?  51   DC  I P     1 
ATOM   8497  O  OP1   . DC  I 6  124  ? 143.553 190.228 185.021 1.00 0.00   ?  51   DC  I OP1   1 
ATOM   8498  O  OP2   . DC  I 6  124  ? 145.876 189.277 184.538 1.00 0.00   ?  51   DC  I OP2   1 
ATOM   8499  O  "O5'" . DC  I 6  124  ? 145.551 191.000 186.317 1.00 0.00   ?  51   DC  I "O5'" 1 
ATOM   8500  C  "C5'" . DC  I 6  124  ? 144.841 191.611 187.388 1.00 0.00   ?  51   DC  I "C5'" 1 
ATOM   8501  C  "C4'" . DC  I 6  124  ? 145.642 192.746 188.007 1.00 0.00   ?  51   DC  I "C4'" 1 
ATOM   8502  O  "O4'" . DC  I 6  124  ? 146.681 192.209 188.869 1.00 0.00   ?  51   DC  I "O4'" 1 
ATOM   8503  C  "C3'" . DC  I 6  124  ? 146.354 193.670 187.012 1.00 0.00   ?  51   DC  I "C3'" 1 
ATOM   8504  O  "O3'" . DC  I 6  124  ? 146.186 195.023 187.418 1.00 0.00   ?  51   DC  I "O3'" 1 
ATOM   8505  C  "C2'" . DC  I 6  124  ? 147.815 193.234 187.127 1.00 0.00   ?  51   DC  I "C2'" 1 
ATOM   8506  C  "C1'" . DC  I 6  124  ? 147.884 192.890 188.603 1.00 0.00   ?  51   DC  I "C1'" 1 
ATOM   8507  N  N1    . DC  I 6  124  ? 149.028 192.009 188.975 1.00 20.00  ?  51   DC  I N1    1 
ATOM   8508  C  C2    . DC  I 6  124  ? 149.760 192.288 190.135 1.00 20.00  ?  51   DC  I C2    1 
ATOM   8509  O  O2    . DC  I 6  124  ? 149.447 193.264 190.826 1.00 20.00  ?  51   DC  I O2    1 
ATOM   8510  N  N3    . DC  I 6  124  ? 150.798 191.481 190.469 1.00 20.00  ?  51   DC  I N3    1 
ATOM   8511  C  C4    . DC  I 6  124  ? 151.106 190.438 189.696 1.00 20.00  ?  51   DC  I C4    1 
ATOM   8512  N  N4    . DC  I 6  124  ? 152.136 189.668 190.066 1.00 20.00  ?  51   DC  I N4    1 
ATOM   8513  C  C5    . DC  I 6  124  ? 150.370 190.136 188.511 1.00 20.00  ?  51   DC  I C5    1 
ATOM   8514  C  C6    . DC  I 6  124  ? 149.350 190.941 188.192 1.00 20.00  ?  51   DC  I C6    1 
ATOM   8515  P  P     . DG  I 6  125  ? 146.292 196.220 186.351 1.00 0.00   ?  52   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 6  125  ? 144.914 196.607 185.979 1.00 0.00   ?  52   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 6  125  ? 147.250 195.813 185.299 1.00 0.00   ?  52   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 6  125  ? 146.956 197.413 187.186 1.00 0.00   ?  52   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 6  125  ? 146.309 197.913 188.354 1.00 0.00   ?  52   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 6  125  ? 147.306 198.573 189.294 1.00 0.00   ?  52   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 6  125  ? 148.205 197.569 189.835 1.00 0.00   ?  52   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 6  125  ? 148.192 199.641 188.658 1.00 0.00   ?  52   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 6  125  ? 148.389 200.717 189.565 1.00 0.00   ?  52   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 6  125  ? 149.495 198.896 188.381 1.00 0.00   ?  52   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 6  125  ? 149.546 197.899 189.532 1.00 0.00   ?  52   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 6  125  ? 150.250 196.665 189.195 1.00 20.00  ?  52   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 6  125  ? 149.866 195.729 188.266 1.00 20.00  ?  52   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 6  125  ? 150.689 194.723 188.171 1.00 20.00  ?  52   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 6  125  ? 151.679 195.002 189.103 1.00 20.00  ?  52   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 6  125  ? 152.835 194.264 189.449 1.00 20.00  ?  52   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 6  125  ? 153.221 193.182 188.985 1.00 20.00  ?  52   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 6  125  ? 153.576 194.900 190.442 1.00 20.00  ?  52   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 6  125  ? 153.245 196.103 191.024 1.00 20.00  ?  52   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 6  125  ? 154.079 196.559 191.971 1.00 20.00  ?  52   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 6  125  ? 152.158 196.803 190.712 1.00 20.00  ?  52   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 6  125  ? 151.425 196.195 189.745 1.00 20.00  ?  52   DG  I C4    1 
ATOM   8537  P  P     . DT  I 6  126  ? 149.111 202.065 189.071 1.00 0.00   ?  53   DT  I P     1 
ATOM   8538  O  OP1   . DT  I 6  126  ? 148.606 203.176 189.908 1.00 0.00   ?  53   DT  I OP1   1 
ATOM   8539  O  OP2   . DT  I 6  126  ? 148.976 202.132 187.599 1.00 0.00   ?  53   DT  I OP2   1 
ATOM   8540  O  "O5'" . DT  I 6  126  ? 150.655 201.822 189.411 1.00 0.00   ?  53   DT  I "O5'" 1 
ATOM   8541  C  "C5'" . DT  I 6  126  ? 151.061 201.623 190.760 1.00 0.00   ?  53   DT  I "C5'" 1 
ATOM   8542  C  "C4'" . DT  I 6  126  ? 152.575 201.558 190.868 1.00 0.00   ?  53   DT  I "C4'" 1 
ATOM   8543  O  "O4'" . DT  I 6  126  ? 153.029 200.206 190.604 1.00 0.00   ?  53   DT  I "O4'" 1 
ATOM   8544  C  "C3'" . DT  I 6  126  ? 153.335 202.467 189.898 1.00 0.00   ?  53   DT  I "C3'" 1 
ATOM   8545  O  "O3'" . DT  I 6  126  ? 154.327 203.203 190.603 1.00 0.00   ?  53   DT  I "O3'" 1 
ATOM   8546  C  "C2'" . DT  I 6  126  ? 153.958 201.490 188.898 1.00 0.00   ?  53   DT  I "C2'" 1 
ATOM   8547  C  "C1'" . DT  I 6  126  ? 154.149 200.249 189.753 1.00 0.00   ?  53   DT  I "C1'" 1 
ATOM   8548  N  N1    . DT  I 6  126  ? 154.188 198.982 188.967 1.00 20.00  ?  53   DT  I N1    1 
ATOM   8549  C  C2    . DT  I 6  126  ? 155.237 198.107 189.144 1.00 20.00  ?  53   DT  I C2    1 
ATOM   8550  O  O2    . DT  I 6  126  ? 156.157 198.314 189.915 1.00 20.00  ?  53   DT  I O2    1 
ATOM   8551  N  N3    . DT  I 6  126  ? 155.171 196.974 188.376 1.00 20.00  ?  53   DT  I N3    1 
ATOM   8552  C  C4    . DT  I 6  126  ? 154.182 196.636 187.469 1.00 20.00  ?  53   DT  I C4    1 
ATOM   8553  O  O4    . DT  I 6  126  ? 154.209 195.593 186.825 1.00 20.00  ?  53   DT  I O4    1 
ATOM   8554  C  C5    . DT  I 6  126  ? 153.114 197.594 187.334 1.00 20.00  ?  53   DT  I C5    1 
ATOM   8555  C  C7    . DT  I 6  126  ? 151.991 197.334 186.377 1.00 20.00  ?  53   DT  I C7    1 
ATOM   8556  C  C6    . DT  I 6  126  ? 153.166 198.706 188.081 1.00 20.00  ?  53   DT  I C6    1 
ATOM   8557  P  P     . DG  I 6  127  ? 155.187 204.334 189.854 1.00 0.00   ?  54   DG  I P     1 
ATOM   8558  O  OP1   . DG  I 6  127  ? 155.384 205.448 190.809 1.00 0.00   ?  54   DG  I OP1   1 
ATOM   8559  O  OP2   . DG  I 6  127  ? 154.556 204.600 188.542 1.00 0.00   ?  54   DG  I OP2   1 
ATOM   8560  O  "O5'" . DG  I 6  127  ? 156.597 203.627 189.593 1.00 0.00   ?  54   DG  I "O5'" 1 
ATOM   8561  C  "C5'" . DG  I 6  127  ? 157.338 203.096 190.687 1.00 0.00   ?  54   DG  I "C5'" 1 
ATOM   8562  C  "C4'" . DG  I 6  127  ? 158.596 202.394 190.204 1.00 0.00   ?  54   DG  I "C4'" 1 
ATOM   8563  O  "O4'" . DG  I 6  127  ? 158.254 201.085 189.675 1.00 0.00   ?  54   DG  I "O4'" 1 
ATOM   8564  C  "C3'" . DG  I 6  127  ? 159.350 203.118 189.087 1.00 0.00   ?  54   DG  I "C3'" 1 
ATOM   8565  O  "O3'" . DG  I 6  127  ? 160.751 203.028 189.309 1.00 0.00   ?  54   DG  I "O3'" 1 
ATOM   8566  C  "C2'" . DG  I 6  127  ? 158.934 202.344 187.840 1.00 0.00   ?  54   DG  I "C2'" 1 
ATOM   8567  C  "C1'" . DG  I 6  127  ? 158.819 200.937 188.392 1.00 0.00   ?  54   DG  I "C1'" 1 
ATOM   8568  N  N9    . DG  I 6  127  ? 157.958 200.064 187.602 1.00 20.00  ?  54   DG  I N9    1 
ATOM   8569  C  C8    . DG  I 6  127  ? 156.680 200.326 187.173 1.00 20.00  ?  54   DG  I C8    1 
ATOM   8570  N  N7    . DG  I 6  127  ? 156.151 199.350 186.487 1.00 20.00  ?  54   DG  I N7    1 
ATOM   8571  C  C5    . DG  I 6  127  ? 157.144 198.378 186.460 1.00 20.00  ?  54   DG  I C5    1 
ATOM   8572  C  C6    . DG  I 6  127  ? 157.148 197.095 185.864 1.00 20.00  ?  54   DG  I C6    1 
ATOM   8573  O  O6    . DG  I 6  127  ? 156.245 196.545 185.216 1.00 20.00  ?  54   DG  I O6    1 
ATOM   8574  N  N1    . DG  I 6  127  ? 158.356 196.435 186.073 1.00 20.00  ?  54   DG  I N1    1 
ATOM   8575  C  C2    . DG  I 6  127  ? 159.424 196.948 186.775 1.00 20.00  ?  54   DG  I C2    1 
ATOM   8576  N  N2    . DG  I 6  127  ? 160.508 196.165 186.877 1.00 20.00  ?  54   DG  I N2    1 
ATOM   8577  N  N3    . DG  I 6  127  ? 159.430 198.147 187.339 1.00 20.00  ?  54   DG  I N3    1 
ATOM   8578  C  C4    . DG  I 6  127  ? 158.261 198.803 187.143 1.00 20.00  ?  54   DG  I C4    1 
ATOM   8579  P  P     . DT  I 6  128  ? 161.533 204.226 190.041 1.00 0.00   ?  55   DT  I P     1 
ATOM   8580  O  OP1   . DT  I 6  128  ? 161.389 204.028 191.500 1.00 0.00   ?  55   DT  I OP1   1 
ATOM   8581  O  OP2   . DT  I 6  128  ? 161.088 205.495 189.423 1.00 0.00   ?  55   DT  I OP2   1 
ATOM   8582  O  "O5'" . DT  I 6  128  ? 163.062 203.992 189.635 1.00 0.00   ?  55   DT  I "O5'" 1 
ATOM   8583  C  "C5'" . DT  I 6  128  ? 163.528 204.391 188.349 1.00 0.00   ?  55   DT  I "C5'" 1 
ATOM   8584  C  "C4'" . DT  I 6  128  ? 164.336 203.283 187.698 1.00 0.00   ?  55   DT  I "C4'" 1 
ATOM   8585  O  "O4'" . DT  I 6  128  ? 163.433 202.298 187.127 1.00 0.00   ?  55   DT  I "O4'" 1 
ATOM   8586  C  "C3'" . DT  I 6  128  ? 165.218 203.730 186.541 1.00 0.00   ?  55   DT  I "C3'" 1 
ATOM   8587  O  "O3'" . DT  I 6  128  ? 166.321 202.841 186.407 1.00 0.00   ?  55   DT  I "O3'" 1 
ATOM   8588  C  "C2'" . DT  I 6  128  ? 164.264 203.611 185.361 1.00 0.00   ?  55   DT  I "C2'" 1 
ATOM   8589  C  "C1'" . DT  I 6  128  ? 163.531 202.322 185.713 1.00 0.00   ?  55   DT  I "C1'" 1 
ATOM   8590  N  N1    . DT  I 6  128  ? 162.153 202.232 185.143 1.00 20.00  ?  55   DT  I N1    1 
ATOM   8591  C  C2    . DT  I 6  128  ? 161.775 201.090 184.474 1.00 20.00  ?  55   DT  I C2    1 
ATOM   8592  O  O2    . DT  I 6  128  ? 162.515 200.138 184.306 1.00 20.00  ?  55   DT  I O2    1 
ATOM   8593  N  N3    . DT  I 6  128  ? 160.491 201.105 183.995 1.00 20.00  ?  55   DT  I N3    1 
ATOM   8594  C  C4    . DT  I 6  128  ? 159.565 202.126 184.123 1.00 20.00  ?  55   DT  I C4    1 
ATOM   8595  O  O4    . DT  I 6  128  ? 158.432 202.045 183.659 1.00 20.00  ?  55   DT  I O4    1 
ATOM   8596  C  C5    . DT  I 6  128  ? 160.026 203.294 184.837 1.00 20.00  ?  55   DT  I C5    1 
ATOM   8597  C  C7    . DT  I 6  128  ? 159.110 204.466 185.038 1.00 20.00  ?  55   DT  I C7    1 
ATOM   8598  C  C6    . DT  I 6  128  ? 161.282 203.289 185.310 1.00 20.00  ?  55   DT  I C6    1 
ATOM   8599  P  P     . DC  I 6  129  ? 167.680 203.330 185.704 1.00 0.00   ?  56   DC  I P     1 
ATOM   8600  O  OP1   . DC  I 6  129  ? 168.745 203.311 186.730 1.00 0.00   ?  56   DC  I OP1   1 
ATOM   8601  O  OP2   . DC  I 6  129  ? 167.386 204.583 184.973 1.00 0.00   ?  56   DC  I OP2   1 
ATOM   8602  O  "O5'" . DC  I 6  129  ? 167.984 202.189 184.624 1.00 0.00   ?  56   DC  I "O5'" 1 
ATOM   8603  C  "C5'" . DC  I 6  129  ? 168.277 200.863 185.053 1.00 0.00   ?  56   DC  I "C5'" 1 
ATOM   8604  C  "C4'" . DC  I 6  129  ? 168.175 199.877 183.898 1.00 0.00   ?  56   DC  I "C4'" 1 
ATOM   8605  O  "O4'" . DC  I 6  129  ? 166.783 199.703 183.522 1.00 0.00   ?  56   DC  I "O4'" 1 
ATOM   8606  C  "C3'" . DC  I 6  129  ? 168.908 200.288 182.621 1.00 0.00   ?  56   DC  I "C3'" 1 
ATOM   8607  O  "O3'" . DC  I 6  129  ? 169.487 199.142 182.012 1.00 0.00   ?  56   DC  I "O3'" 1 
ATOM   8608  C  "C2'" . DC  I 6  129  ? 167.786 200.863 181.762 1.00 0.00   ?  56   DC  I "C2'" 1 
ATOM   8609  C  "C1'" . DC  I 6  129  ? 166.635 199.945 182.139 1.00 0.00   ?  56   DC  I "C1'" 1 
ATOM   8610  N  N1    . DC  I 6  129  ? 165.287 200.538 181.907 1.00 20.00  ?  56   DC  I N1    1 
ATOM   8611  C  C2    . DC  I 6  129  ? 164.317 199.804 181.215 1.00 20.00  ?  56   DC  I C2    1 
ATOM   8612  O  O2    . DC  I 6  129  ? 164.600 198.675 180.799 1.00 20.00  ?  56   DC  I O2    1 
ATOM   8613  N  N3    . DC  I 6  129  ? 163.094 200.356 181.017 1.00 20.00  ?  56   DC  I N3    1 
ATOM   8614  C  C4    . DC  I 6  129  ? 162.831 201.579 181.480 1.00 20.00  ?  56   DC  I C4    1 
ATOM   8615  N  N4    . DC  I 6  129  ? 161.612 202.085 181.266 1.00 20.00  ?  56   DC  I N4    1 
ATOM   8616  C  C5    . DC  I 6  129  ? 163.807 202.340 182.188 1.00 20.00  ?  56   DC  I C5    1 
ATOM   8617  C  C6    . DC  I 6  129  ? 165.008 201.785 182.379 1.00 20.00  ?  56   DC  I C6    1 
ATOM   8618  P  P     . DA  I 6  130  ? 170.975 199.205 181.409 1.00 0.00   ?  57   DA  I P     1 
ATOM   8619  O  OP1   . DA  I 6  130  ? 171.908 198.736 182.457 1.00 0.00   ?  57   DA  I OP1   1 
ATOM   8620  O  OP2   . DA  I 6  130  ? 171.159 200.544 180.806 1.00 0.00   ?  57   DA  I OP2   1 
ATOM   8621  O  "O5'" . DA  I 6  130  ? 170.949 198.133 180.221 1.00 0.00   ?  57   DA  I "O5'" 1 
ATOM   8622  C  "C5'" . DA  I 6  130  ? 170.339 198.465 178.978 1.00 0.00   ?  57   DA  I "C5'" 1 
ATOM   8623  C  "C4'" . DA  I 6  130  ? 169.744 197.236 178.315 1.00 0.00   ?  57   DA  I "C4'" 1 
ATOM   8624  O  "O4'" . DA  I 6  130  ? 168.313 197.215 178.544 1.00 0.00   ?  57   DA  I "O4'" 1 
ATOM   8625  C  "C3'" . DA  I 6  130  ? 169.886 197.201 176.806 1.00 0.00   ?  57   DA  I "C3'" 1 
ATOM   8626  O  "O3'" . DA  I 6  130  ? 169.757 195.862 176.335 1.00 0.00   ?  57   DA  I "O3'" 1 
ATOM   8627  C  "C2'" . DA  I 6  130  ? 168.707 198.061 176.373 1.00 0.00   ?  57   DA  I "C2'" 1 
ATOM   8628  C  "C1'" . DA  I 6  130  ? 167.634 197.647 177.374 1.00 0.00   ?  57   DA  I "C1'" 1 
ATOM   8629  N  N9    . DA  I 6  130  ? 166.728 198.732 177.745 1.00 20.00  ?  57   DA  I N9    1 
ATOM   8630  C  C8    . DA  I 6  130  ? 166.971 199.726 178.649 1.00 20.00  ?  57   DA  I C8    1 
ATOM   8631  N  N7    . DA  I 6  130  ? 165.976 200.566 178.794 1.00 20.00  ?  57   DA  I N7    1 
ATOM   8632  C  C5    . DA  I 6  130  ? 165.007 200.089 177.928 1.00 20.00  ?  57   DA  I C5    1 
ATOM   8633  C  C6    . DA  I 6  130  ? 163.710 200.542 177.617 1.00 20.00  ?  57   DA  I C6    1 
ATOM   8634  N  N6    . DA  I 6  130  ? 163.155 201.621 178.177 1.00 20.00  ?  57   DA  I N6    1 
ATOM   8635  N  N1    . DA  I 6  130  ? 163.002 199.840 176.705 1.00 20.00  ?  57   DA  I N1    1 
ATOM   8636  C  C2    . DA  I 6  130  ? 163.565 198.761 176.144 1.00 20.00  ?  57   DA  I C2    1 
ATOM   8637  N  N3    . DA  I 6  130  ? 164.775 198.237 176.360 1.00 20.00  ?  57   DA  I N3    1 
ATOM   8638  C  C4    . DA  I 6  130  ? 165.452 198.958 177.270 1.00 20.00  ?  57   DA  I C4    1 
ATOM   8639  P  P     . DG  I 6  131  ? 170.174 195.485 174.828 1.00 0.00   ?  58   DG  I P     1 
ATOM   8640  O  OP1   . DG  I 6  131  ? 169.006 194.828 174.199 1.00 0.00   ?  58   DG  I OP1   1 
ATOM   8641  O  OP2   . DG  I 6  131  ? 171.468 194.768 174.889 1.00 0.00   ?  58   DG  I OP2   1 
ATOM   8642  O  "O5'" . DG  I 6  131  ? 170.438 196.904 174.133 1.00 0.00   ?  58   DG  I "O5'" 1 
ATOM   8643  C  "C5'" . DG  I 6  131  ? 170.400 197.033 172.715 1.00 0.00   ?  58   DG  I "C5'" 1 
ATOM   8644  C  "C4'" . DG  I 6  131  ? 168.984 197.302 172.232 1.00 0.00   ?  58   DG  I "C4'" 1 
ATOM   8645  O  "O4'" . DG  I 6  131  ? 168.255 198.036 173.240 1.00 0.00   ?  58   DG  I "O4'" 1 
ATOM   8646  C  "C3'" . DG  I 6  131  ? 168.884 198.135 170.947 1.00 0.00   ?  58   DG  I "C3'" 1 
ATOM   8647  O  "O3'" . DG  I 6  131  ? 168.297 197.368 169.903 1.00 0.00   ?  58   DG  I "O3'" 1 
ATOM   8648  C  "C2'" . DG  I 6  131  ? 167.999 199.330 171.329 1.00 0.00   ?  58   DG  I "C2'" 1 
ATOM   8649  C  "C1'" . DG  I 6  131  ? 167.313 198.847 172.595 1.00 0.00   ?  58   DG  I "C1'" 1 
ATOM   8650  N  N9    . DG  I 6  131  ? 166.925 199.934 173.489 1.00 20.00  ?  58   DG  I N9    1 
ATOM   8651  C  C8    . DG  I 6  131  ? 167.682 200.510 174.479 1.00 20.00  ?  58   DG  I C8    1 
ATOM   8652  N  N7    . DG  I 6  131  ? 167.067 201.472 175.111 1.00 20.00  ?  58   DG  I N7    1 
ATOM   8653  C  C5    . DG  I 6  131  ? 165.827 201.544 174.491 1.00 20.00  ?  58   DG  I C5    1 
ATOM   8654  C  C6    . DG  I 6  131  ? 164.729 202.400 174.742 1.00 20.00  ?  58   DG  I C6    1 
ATOM   8655  O  O6    . DG  I 6  131  ? 164.629 203.299 175.588 1.00 20.00  ?  58   DG  I O6    1 
ATOM   8656  N  N1    . DG  I 6  131  ? 163.666 202.136 173.883 1.00 20.00  ?  58   DG  I N1    1 
ATOM   8657  C  C2    . DG  I 6  131  ? 163.664 201.169 172.906 1.00 20.00  ?  58   DG  I C2    1 
ATOM   8658  N  N2    . DG  I 6  131  ? 162.548 201.060 172.172 1.00 20.00  ?  58   DG  I N2    1 
ATOM   8659  N  N3    . DG  I 6  131  ? 164.684 200.362 172.662 1.00 20.00  ?  58   DG  I N3    1 
ATOM   8660  C  C4    . DG  I 6  131  ? 165.727 200.605 173.490 1.00 20.00  ?  58   DG  I C4    1 
ATOM   8661  P  P     . DA  I 6  132  ? 168.417 197.862 168.379 1.00 0.00   ?  59   DA  I P     1 
ATOM   8662  O  OP1   . DA  I 6  132  ? 168.104 196.709 167.507 1.00 0.00   ?  59   DA  I OP1   1 
ATOM   8663  O  OP2   . DA  I 6  132  ? 169.714 198.561 168.239 1.00 0.00   ?  59   DA  I OP2   1 
ATOM   8664  O  "O5'" . DA  I 6  132  ? 167.255 198.955 168.229 1.00 0.00   ?  59   DA  I "O5'" 1 
ATOM   8665  C  "C5'" . DA  I 6  132  ? 165.891 198.556 168.299 1.00 0.00   ?  59   DA  I "C5'" 1 
ATOM   8666  C  "C4'" . DA  I 6  132  ? 164.962 199.709 167.953 1.00 0.00   ?  59   DA  I "C4'" 1 
ATOM   8667  O  "O4'" . DA  I 6  132  ? 164.697 200.505 169.136 1.00 0.00   ?  59   DA  I "O4'" 1 
ATOM   8668  C  "C3'" . DA  I 6  132  ? 165.486 200.681 166.890 1.00 0.00   ?  59   DA  I "C3'" 1 
ATOM   8669  O  "O3'" . DA  I 6  132  ? 164.463 200.932 165.930 1.00 0.00   ?  59   DA  I "O3'" 1 
ATOM   8670  C  "C2'" . DA  I 6  132  ? 165.832 201.938 167.695 1.00 0.00   ?  59   DA  I "C2'" 1 
ATOM   8671  C  "C1'" . DA  I 6  132  ? 164.807 201.871 168.813 1.00 0.00   ?  59   DA  I "C1'" 1 
ATOM   8672  N  N9    . DA  I 6  132  ? 165.194 202.596 170.022 1.00 20.00  ?  59   DA  I N9    1 
ATOM   8673  C  C8    . DA  I 6  132  ? 166.361 202.469 170.722 1.00 20.00  ?  59   DA  I C8    1 
ATOM   8674  N  N7    . DA  I 6  132  ? 166.429 203.240 171.783 1.00 20.00  ?  59   DA  I N7    1 
ATOM   8675  C  C5    . DA  I 6  132  ? 165.219 203.915 171.782 1.00 20.00  ?  59   DA  I C5    1 
ATOM   8676  C  C6    . DA  I 6  132  ? 164.669 204.882 172.650 1.00 20.00  ?  59   DA  I C6    1 
ATOM   8677  N  N6    . DA  I 6  132  ? 165.306 205.348 173.730 1.00 20.00  ?  59   DA  I N6    1 
ATOM   8678  N  N1    . DA  I 6  132  ? 163.436 205.353 172.363 1.00 20.00  ?  59   DA  I N1    1 
ATOM   8679  C  C2    . DA  I 6  132  ? 162.803 204.878 171.282 1.00 20.00  ?  59   DA  I C2    1 
ATOM   8680  N  N3    . DA  I 6  132  ? 163.218 203.973 170.395 1.00 20.00  ?  59   DA  I N3    1 
ATOM   8681  C  C4    . DA  I 6  132  ? 164.444 203.527 170.706 1.00 20.00  ?  59   DA  I C4    1 
ATOM   8682  P  P     . DT  I 6  133  ? 164.702 201.968 164.724 1.00 0.00   ?  60   DT  I P     1 
ATOM   8683  O  OP1   . DT  I 6  133  ? 163.912 201.486 163.570 1.00 0.00   ?  60   DT  I OP1   1 
ATOM   8684  O  OP2   . DT  I 6  133  ? 166.159 202.181 164.572 1.00 0.00   ?  60   DT  I OP2   1 
ATOM   8685  O  "O5'" . DT  I 6  133  ? 164.047 203.327 165.256 1.00 0.00   ?  60   DT  I "O5'" 1 
ATOM   8686  C  "C5'" . DT  I 6  133  ? 162.674 203.349 165.639 1.00 0.00   ?  60   DT  I "C5'" 1 
ATOM   8687  C  "C4'" . DT  I 6  133  ? 162.185 204.775 165.830 1.00 0.00   ?  60   DT  I "C4'" 1 
ATOM   8688  O  "O4'" . DT  I 6  133  ? 162.574 205.256 167.145 1.00 0.00   ?  60   DT  I "O4'" 1 
ATOM   8689  C  "C3'" . DT  I 6  133  ? 162.739 205.790 164.824 1.00 0.00   ?  60   DT  I "C3'" 1 
ATOM   8690  O  "O3'" . DT  I 6  133  ? 161.696 206.640 164.362 1.00 0.00   ?  60   DT  I "O3'" 1 
ATOM   8691  C  "C2'" . DT  I 6  133  ? 163.767 206.565 165.644 1.00 0.00   ?  60   DT  I "C2'" 1 
ATOM   8692  C  "C1'" . DT  I 6  133  ? 163.119 206.546 167.016 1.00 0.00   ?  60   DT  I "C1'" 1 
ATOM   8693  N  N1    . DT  I 6  133  ? 164.078 206.780 168.131 1.00 20.00  ?  60   DT  I N1    1 
ATOM   8694  C  C2    . DT  I 6  133  ? 163.785 207.731 169.081 1.00 20.00  ?  60   DT  I C2    1 
ATOM   8695  O  O2    . DT  I 6  133  ? 162.765 208.397 169.066 1.00 20.00  ?  60   DT  I O2    1 
ATOM   8696  N  N3    . DT  I 6  133  ? 164.731 207.874 170.060 1.00 20.00  ?  60   DT  I N3    1 
ATOM   8697  C  C4    . DT  I 6  133  ? 165.920 207.177 170.179 1.00 20.00  ?  60   DT  I C4    1 
ATOM   8698  O  O4    . DT  I 6  133  ? 166.709 207.377 171.096 1.00 20.00  ?  60   DT  I O4    1 
ATOM   8699  C  C5    . DT  I 6  133  ? 166.168 206.197 169.146 1.00 20.00  ?  60   DT  I C5    1 
ATOM   8700  C  C7    . DT  I 6  133  ? 167.426 205.379 169.168 1.00 20.00  ?  60   DT  I C7    1 
ATOM   8701  C  C6    . DT  I 6  133  ? 165.247 206.050 168.183 1.00 20.00  ?  60   DT  I C6    1 
ATOM   8702  P  P     . DA  I 6  134  ? 161.797 207.326 162.913 1.00 0.00   ?  61   DA  I P     1 
ATOM   8703  O  OP1   . DA  I 6  134  ? 160.567 208.123 162.702 1.00 0.00   ?  61   DA  I OP1   1 
ATOM   8704  O  OP2   . DA  I 6  134  ? 162.153 206.264 161.946 1.00 0.00   ?  61   DA  I OP2   1 
ATOM   8705  O  "O5'" . DA  I 6  134  ? 163.056 208.309 163.037 1.00 0.00   ?  61   DA  I "O5'" 1 
ATOM   8706  C  "C5'" . DA  I 6  134  ? 162.876 209.723 162.991 1.00 0.00   ?  61   DA  I "C5'" 1 
ATOM   8707  C  "C4'" . DA  I 6  134  ? 162.328 210.248 164.307 1.00 0.00   ?  61   DA  I "C4'" 1 
ATOM   8708  O  "O4'" . DA  I 6  134  ? 163.090 209.689 165.411 1.00 0.00   ?  61   DA  I "O4'" 1 
ATOM   8709  C  "C3'" . DA  I 6  134  ? 162.394 211.769 164.471 1.00 0.00   ?  61   DA  I "C3'" 1 
ATOM   8710  O  "O3'" . DA  I 6  134  ? 161.190 212.251 165.055 1.00 0.00   ?  61   DA  I "O3'" 1 
ATOM   8711  C  "C2'" . DA  I 6  134  ? 163.585 211.966 165.405 1.00 0.00   ?  61   DA  I "C2'" 1 
ATOM   8712  C  "C1'" . DA  I 6  134  ? 163.483 210.727 166.277 1.00 0.00   ?  61   DA  I "C1'" 1 
ATOM   8713  N  N9    . DA  I 6  134  ? 164.744 210.357 166.915 1.00 20.00  ?  61   DA  I N9    1 
ATOM   8714  C  C8    . DA  I 6  134  ? 165.608 209.371 166.527 1.00 20.00  ?  61   DA  I C8    1 
ATOM   8715  N  N7    . DA  I 6  134  ? 166.669 209.267 167.294 1.00 20.00  ?  61   DA  I N7    1 
ATOM   8716  C  C5    . DA  I 6  134  ? 166.487 210.253 168.250 1.00 20.00  ?  61   DA  I C5    1 
ATOM   8717  C  C6    . DA  I 6  134  ? 167.262 210.662 169.355 1.00 20.00  ?  61   DA  I C6    1 
ATOM   8718  N  N6    . DA  I 6  134  ? 168.426 210.095 169.690 1.00 20.00  ?  61   DA  I N6    1 
ATOM   8719  N  N1    . DA  I 6  134  ? 166.791 211.680 170.107 1.00 20.00  ?  61   DA  I N1    1 
ATOM   8720  C  C2    . DA  I 6  134  ? 165.628 212.247 169.767 1.00 20.00  ?  61   DA  I C2    1 
ATOM   8721  N  N3    . DA  I 6  134  ? 164.812 211.948 168.758 1.00 20.00  ?  61   DA  I N3    1 
ATOM   8722  C  C4    . DA  I 6  134  ? 165.305 210.934 168.030 1.00 20.00  ?  61   DA  I C4    1 
ATOM   8723  P  P     . DT  I 6  135  ? 160.707 213.760 164.782 1.00 0.00   ?  62   DT  I P     1 
ATOM   8724  O  OP1   . DT  I 6  135  ? 159.360 213.914 165.375 1.00 0.00   ?  62   DT  I OP1   1 
ATOM   8725  O  OP2   . DT  I 6  135  ? 160.916 214.046 163.346 1.00 0.00   ?  62   DT  I OP2   1 
ATOM   8726  O  "O5'" . DT  I 6  135  ? 161.743 214.656 165.610 1.00 0.00   ?  62   DT  I "O5'" 1 
ATOM   8727  C  "C5'" . DT  I 6  135  ? 161.728 214.639 167.034 1.00 0.00   ?  62   DT  I "C5'" 1 
ATOM   8728  C  "C4'" . DT  I 6  135  ? 162.599 215.750 167.592 1.00 0.00   ?  62   DT  I "C4'" 1 
ATOM   8729  O  "O4'" . DT  I 6  135  ? 163.827 215.188 168.133 1.00 0.00   ?  62   DT  I "O4'" 1 
ATOM   8730  C  "C3'" . DT  I 6  135  ? 163.035 216.804 166.570 1.00 0.00   ?  62   DT  I "C3'" 1 
ATOM   8731  O  "O3'" . DT  I 6  135  ? 162.996 218.097 167.163 1.00 0.00   ?  62   DT  I "O3'" 1 
ATOM   8732  C  "C2'" . DT  I 6  135  ? 164.466 216.383 166.248 1.00 0.00   ?  62   DT  I "C2'" 1 
ATOM   8733  C  "C1'" . DT  I 6  135  ? 164.925 215.901 167.611 1.00 0.00   ?  62   DT  I "C1'" 1 
ATOM   8734  N  N1    . DT  I 6  135  ? 166.114 215.001 167.573 1.00 20.00  ?  62   DT  I N1    1 
ATOM   8735  C  C2    . DT  I 6  135  ? 167.101 215.159 168.517 1.00 20.00  ?  62   DT  I C2    1 
ATOM   8736  O  O2    . DT  I 6  135  ? 167.055 216.002 169.395 1.00 20.00  ?  62   DT  I O2    1 
ATOM   8737  N  N3    . DT  I 6  135  ? 168.150 214.288 168.402 1.00 20.00  ?  62   DT  I N3    1 
ATOM   8738  C  C4    . DT  I 6  135  ? 168.310 213.295 167.452 1.00 20.00  ?  62   DT  I C4    1 
ATOM   8739  O  O4    . DT  I 6  135  ? 169.293 212.561 167.432 1.00 20.00  ?  62   DT  I O4    1 
ATOM   8740  C  C5    . DT  I 6  135  ? 167.240 213.183 166.489 1.00 20.00  ?  62   DT  I C5    1 
ATOM   8741  C  C7    . DT  I 6  135  ? 167.302 212.144 165.409 1.00 20.00  ?  62   DT  I C7    1 
ATOM   8742  C  C6    . DT  I 6  135  ? 166.205 214.033 166.594 1.00 20.00  ?  62   DT  I C6    1 
ATOM   8743  P  P     . DA  I 6  136  ? 162.846 219.407 166.243 1.00 0.00   ?  63   DA  I P     1 
ATOM   8744  O  OP1   . DA  I 6  136  ? 161.445 219.871 166.352 1.00 0.00   ?  63   DA  I OP1   1 
ATOM   8745  O  OP2   . DA  I 6  136  ? 163.416 219.096 164.914 1.00 0.00   ?  63   DA  I OP2   1 
ATOM   8746  O  "O5'" . DA  I 6  136  ? 163.803 220.482 166.945 1.00 0.00   ?  63   DA  I "O5'" 1 
ATOM   8747  C  "C5'" . DA  I 6  136  ? 163.496 220.971 168.247 1.00 0.00   ?  63   DA  I "C5'" 1 
ATOM   8748  C  "C4'" . DA  I 6  136  ? 164.754 221.436 168.963 1.00 0.00   ?  63   DA  I "C4'" 1 
ATOM   8749  O  "O4'" . DA  I 6  136  ? 165.682 220.325 169.077 1.00 0.00   ?  63   DA  I "O4'" 1 
ATOM   8750  C  "C3'" . DA  I 6  136  ? 165.518 222.560 168.265 1.00 0.00   ?  63   DA  I "C3'" 1 
ATOM   8751  O  "O3'" . DA  I 6  136  ? 166.036 223.479 169.221 1.00 0.00   ?  63   DA  I "O3'" 1 
ATOM   8752  C  "C2'" . DA  I 6  136  ? 166.637 221.825 167.536 1.00 0.00   ?  63   DA  I "C2'" 1 
ATOM   8753  C  "C1'" . DA  I 6  136  ? 166.913 220.654 168.468 1.00 0.00   ?  63   DA  I "C1'" 1 
ATOM   8754  N  N9    . DA  I 6  136  ? 167.402 219.476 167.762 1.00 20.00  ?  63   DA  I N9    1 
ATOM   8755  C  C8    . DA  I 6  136  ? 166.781 218.820 166.738 1.00 20.00  ?  63   DA  I C8    1 
ATOM   8756  N  N7    . DA  I 6  136  ? 167.456 217.795 166.279 1.00 20.00  ?  63   DA  I N7    1 
ATOM   8757  C  C5    . DA  I 6  136  ? 168.600 217.776 167.056 1.00 20.00  ?  63   DA  I C5    1 
ATOM   8758  C  C6    . DA  I 6  136  ? 169.721 216.926 167.069 1.00 20.00  ?  63   DA  I C6    1 
ATOM   8759  N  N6    . DA  I 6  136  ? 169.864 215.892 166.236 1.00 20.00  ?  63   DA  I N6    1 
ATOM   8760  N  N1    . DA  I 6  136  ? 170.690 217.181 167.972 1.00 20.00  ?  63   DA  I N1    1 
ATOM   8761  C  C2    . DA  I 6  136  ? 170.539 218.219 168.804 1.00 20.00  ?  63   DA  I C2    1 
ATOM   8762  N  N3    . DA  I 6  136  ? 169.532 219.088 168.886 1.00 20.00  ?  63   DA  I N3    1 
ATOM   8763  C  C4    . DA  I 6  136  ? 168.586 218.807 167.976 1.00 20.00  ?  63   DA  I C4    1 
ATOM   8764  P  P     . DT  I 6  137  ? 166.754 224.830 168.728 1.00 0.00   ?  64   DT  I P     1 
ATOM   8765  O  OP1   . DT  I 6  137  ? 166.640 225.827 169.815 1.00 0.00   ?  64   DT  I OP1   1 
ATOM   8766  O  OP2   . DT  I 6  137  ? 166.224 225.148 167.383 1.00 0.00   ?  64   DT  I OP2   1 
ATOM   8767  O  "O5'" . DT  I 6  137  ? 168.292 224.414 168.562 1.00 0.00   ?  64   DT  I "O5'" 1 
ATOM   8768  C  "C5'" . DT  I 6  137  ? 169.051 224.032 169.704 1.00 0.00   ?  64   DT  I "C5'" 1 
ATOM   8769  C  "C4'" . DT  I 6  137  ? 170.473 223.658 169.317 1.00 0.00   ?  64   DT  I "C4'" 1 
ATOM   8770  O  "O4'" . DT  I 6  137  ? 170.486 222.360 168.690 1.00 0.00   ?  64   DT  I "O4'" 1 
ATOM   8771  C  "C3'" . DT  I 6  137  ? 171.153 224.606 168.322 1.00 0.00   ?  64   DT  I "C3'" 1 
ATOM   8772  O  "O3'" . DT  I 6  137  ? 172.162 225.368 168.981 1.00 0.00   ?  64   DT  I "O3'" 1 
ATOM   8773  C  "C2'" . DT  I 6  137  ? 171.756 223.678 167.250 1.00 0.00   ?  64   DT  I "C2'" 1 
ATOM   8774  C  "C1'" . DT  I 6  137  ? 171.620 222.292 167.872 1.00 0.00   ?  64   DT  I "C1'" 1 
ATOM   8775  N  N1    . DT  I 6  137  ? 171.428 221.205 166.864 1.00 20.00  ?  64   DT  I N1    1 
ATOM   8776  C  C2    . DT  I 6  137  ? 172.424 220.273 166.682 1.00 20.00  ?  64   DT  I C2    1 
ATOM   8777  O  O2    . DT  I 6  137  ? 173.470 220.282 167.307 1.00 20.00  ?  64   DT  I O2    1 
ATOM   8778  N  N3    . DT  I 6  137  ? 172.156 219.325 165.728 1.00 20.00  ?  64   DT  I N3    1 
ATOM   8779  C  C4    . DT  I 6  137  ? 171.012 219.220 164.956 1.00 20.00  ?  64   DT  I C4    1 
ATOM   8780  O  O4    . DT  I 6  137  ? 170.861 218.331 164.125 1.00 20.00  ?  64   DT  I O4    1 
ATOM   8781  C  C5    . DT  I 6  137  ? 170.008 220.230 165.199 1.00 20.00  ?  64   DT  I C5    1 
ATOM   8782  C  C7    . DT  I 6  137  ? 168.727 220.220 164.420 1.00 20.00  ?  64   DT  I C7    1 
ATOM   8783  C  C6    . DT  I 6  137  ? 170.262 221.163 166.128 1.00 20.00  ?  64   DT  I C6    1 
ATOM   8784  P  P     . DA  I 6  138  ? 172.977 226.500 168.180 1.00 0.00   ?  65   DA  I P     1 
ATOM   8785  O  OP1   . DA  I 6  138  ? 173.435 227.503 169.166 1.00 0.00   ?  65   DA  I OP1   1 
ATOM   8786  O  OP2   . DA  I 6  138  ? 172.149 226.926 167.030 1.00 0.00   ?  65   DA  I OP2   1 
ATOM   8787  O  "O5'" . DA  I 6  138  ? 174.253 225.723 167.605 1.00 0.00   ?  65   DA  I "O5'" 1 
ATOM   8788  C  "C5'" . DA  I 6  138  ? 175.185 225.125 168.500 1.00 0.00   ?  65   DA  I "C5'" 1 
ATOM   8789  C  "C4'" . DA  I 6  138  ? 176.107 224.167 167.764 1.00 0.00   ?  65   DA  I "C4'" 1 
ATOM   8790  O  "O4'" . DA  I 6  138  ? 175.327 223.122 167.156 1.00 0.00   ?  65   DA  I "O4'" 1 
ATOM   8791  C  "C3'" . DA  I 6  138  ? 176.909 224.791 166.620 1.00 0.00   ?  65   DA  I "C3'" 1 
ATOM   8792  O  "O3'" . DA  I 6  138  ? 178.258 225.012 167.024 1.00 0.00   ?  65   DA  I "O3'" 1 
ATOM   8793  C  "C2'" . DA  I 6  138  ? 176.827 223.763 165.478 1.00 0.00   ?  65   DA  I "C2'" 1 
ATOM   8794  C  "C1'" . DA  I 6  138  ? 176.070 222.590 166.095 1.00 0.00   ?  65   DA  I "C1'" 1 
ATOM   8795  N  N9    . DA  I 6  138  ? 175.159 221.939 165.158 1.00 20.00  ?  65   DA  I N9    1 
ATOM   8796  C  C8    . DA  I 6  138  ? 173.886 222.322 164.839 1.00 20.00  ?  65   DA  I C8    1 
ATOM   8797  N  N7    . DA  I 6  138  ? 173.305 221.544 163.954 1.00 20.00  ?  65   DA  I N7    1 
ATOM   8798  C  C5    . DA  I 6  138  ? 174.269 220.591 163.666 1.00 20.00  ?  65   DA  I C5    1 
ATOM   8799  C  C6    . DA  I 6  138  ? 174.280 219.479 162.797 1.00 20.00  ?  65   DA  I C6    1 
ATOM   8800  N  N6    . DA  I 6  138  ? 173.242 219.133 162.029 1.00 20.00  ?  65   DA  I N6    1 
ATOM   8801  N  N1    . DA  I 6  138  ? 175.406 218.734 162.750 1.00 20.00  ?  65   DA  I N1    1 
ATOM   8802  C  C2    . DA  I 6  138  ? 176.443 219.085 163.519 1.00 20.00  ?  65   DA  I C2    1 
ATOM   8803  N  N3    . DA  I 6  138  ? 176.549 220.102 164.371 1.00 20.00  ?  65   DA  I N3    1 
ATOM   8804  C  C4    . DA  I 6  138  ? 175.418 220.822 164.399 1.00 20.00  ?  65   DA  I C4    1 
ATOM   8805  P  P     . DC  I 6  139  ? 179.268 225.805 166.056 1.00 0.00   ?  66   DC  I P     1 
ATOM   8806  O  OP1   . DC  I 6  139  ? 180.375 226.328 166.888 1.00 0.00   ?  66   DC  I OP1   1 
ATOM   8807  O  OP2   . DC  I 6  139  ? 178.460 226.735 165.237 1.00 0.00   ?  66   DC  I OP2   1 
ATOM   8808  O  "O5'" . DC  I 6  139  ? 179.846 224.674 165.080 1.00 0.00   ?  66   DC  I "O5'" 1 
ATOM   8809  C  "C5'" . DC  I 6  139  ? 180.662 223.630 165.602 1.00 0.00   ?  66   DC  I "C5'" 1 
ATOM   8810  C  "C4'" . DC  I 6  139  ? 181.062 222.652 164.509 1.00 0.00   ?  66   DC  I "C4'" 1 
ATOM   8811  O  "O4'" . DC  I 6  139  ? 179.884 221.981 164.001 1.00 0.00   ?  66   DC  I "O4'" 1 
ATOM   8812  C  "C3'" . DC  I 6  139  ? 181.755 223.283 163.292 1.00 0.00   ?  66   DC  I "C3'" 1 
ATOM   8813  O  "O3'" . DC  I 6  139  ? 183.046 222.711 163.108 1.00 0.00   ?  66   DC  I "O3'" 1 
ATOM   8814  C  "C2'" . DC  I 6  139  ? 180.826 222.960 162.116 1.00 0.00   ?  66   DC  I "C2'" 1 
ATOM   8815  C  "C1'" . DC  I 6  139  ? 180.058 221.753 162.628 1.00 0.00   ?  66   DC  I "C1'" 1 
ATOM   8816  N  N1    . DC  I 6  139  ? 178.721 221.597 161.994 1.00 20.00  ?  66   DC  I N1    1 
ATOM   8817  C  C2    . DC  I 6  139  ? 178.505 220.559 161.081 1.00 20.00  ?  66   DC  I C2    1 
ATOM   8818  O  O2    . DC  I 6  139  ? 179.428 219.777 160.826 1.00 20.00  ?  66   DC  I O2    1 
ATOM   8819  N  N3    . DC  I 6  139  ? 177.285 220.434 160.504 1.00 20.00  ?  66   DC  I N3    1 
ATOM   8820  C  C4    . DC  I 6  139  ? 176.313 221.297 160.806 1.00 20.00  ?  66   DC  I C4    1 
ATOM   8821  N  N4    . DC  I 6  139  ? 175.126 221.136 160.213 1.00 20.00  ?  66   DC  I N4    1 
ATOM   8822  C  C5    . DC  I 6  139  ? 176.516 222.365 161.729 1.00 20.00  ?  66   DC  I C5    1 
ATOM   8823  C  C6    . DC  I 6  139  ? 177.723 222.476 162.293 1.00 20.00  ?  66   DC  I C6    1 
ATOM   8824  P  P     . DA  I 6  140  ? 184.089 223.384 162.085 1.00 0.00   ?  67   DA  I P     1 
ATOM   8825  O  OP1   . DA  I 6  140  ? 185.440 223.255 162.673 1.00 0.00   ?  67   DA  I OP1   1 
ATOM   8826  O  OP2   . DA  I 6  140  ? 183.568 224.722 161.727 1.00 0.00   ?  67   DA  I OP2   1 
ATOM   8827  O  "O5'" . DA  I 6  140  ? 183.999 222.464 160.778 1.00 0.00   ?  67   DA  I "O5'" 1 
ATOM   8828  C  "C5'" . DA  I 6  140  ? 184.425 221.106 160.831 1.00 0.00   ?  67   DA  I "C5'" 1 
ATOM   8829  C  "C4'" . DA  I 6  140  ? 184.070 220.375 159.547 1.00 0.00   ?  67   DA  I "C4'" 1 
ATOM   8830  O  "O4'" . DA  I 6  140  ? 182.630 220.248 159.440 1.00 0.00   ?  67   DA  I "O4'" 1 
ATOM   8831  C  "C3'" . DA  I 6  140  ? 184.541 221.058 158.256 1.00 0.00   ?  67   DA  I "C3'" 1 
ATOM   8832  O  "O3'" . DA  I 6  140  ? 185.293 220.144 157.464 1.00 0.00   ?  67   DA  I "O3'" 1 
ATOM   8833  C  "C2'" . DA  I 6  140  ? 183.241 221.471 157.559 1.00 0.00   ?  67   DA  I "C2'" 1 
ATOM   8834  C  "C1'" . DA  I 6  140  ? 182.250 220.456 158.105 1.00 0.00   ?  67   DA  I "C1'" 1 
ATOM   8835  N  N9    . DA  I 6  140  ? 180.867 220.926 158.079 1.00 20.00  ?  67   DA  I N9    1 
ATOM   8836  C  C8    . DA  I 6  140  ? 180.341 221.976 158.777 1.00 20.00  ?  67   DA  I C8    1 
ATOM   8837  N  N7    . DA  I 6  140  ? 179.063 222.175 158.553 1.00 20.00  ?  67   DA  I N7    1 
ATOM   8838  C  C5    . DA  I 6  140  ? 178.727 221.187 157.644 1.00 20.00  ?  67   DA  I C5    1 
ATOM   8839  C  C6    . DA  I 6  140  ? 177.513 220.855 157.006 1.00 20.00  ?  67   DA  I C6    1 
ATOM   8840  N  N6    . DA  I 6  140  ? 176.371 221.520 157.207 1.00 20.00  ?  67   DA  I N6    1 
ATOM   8841  N  N1    . DA  I 6  140  ? 177.520 219.810 156.152 1.00 20.00  ?  67   DA  I N1    1 
ATOM   8842  C  C2    . DA  I 6  140  ? 178.667 219.147 155.954 1.00 20.00  ?  67   DA  I C2    1 
ATOM   8843  N  N3    . DA  I 6  140  ? 179.866 219.365 156.494 1.00 20.00  ?  67   DA  I N3    1 
ATOM   8844  C  C4    . DA  I 6  140  ? 179.827 220.409 157.337 1.00 20.00  ?  67   DA  I C4    1 
ATOM   8845  P  P     . DT  I 6  141  ? 185.950 220.623 156.077 1.00 0.00   ?  68   DT  I P     1 
ATOM   8846  O  OP1   . DT  I 6  141  ? 187.150 219.790 155.842 1.00 0.00   ?  68   DT  I OP1   1 
ATOM   8847  O  OP2   . DT  I 6  141  ? 186.079 222.097 156.119 1.00 0.00   ?  68   DT  I OP2   1 
ATOM   8848  O  "O5'" . DT  I 6  141  ? 184.847 220.253 154.979 1.00 0.00   ?  68   DT  I "O5'" 1 
ATOM   8849  C  "C5'" . DT  I 6  141  ? 184.475 218.893 154.778 1.00 0.00   ?  68   DT  I "C5'" 1 
ATOM   8850  C  "C4'" . DT  I 6  141  ? 183.521 218.755 153.603 1.00 0.00   ?  68   DT  I "C4'" 1 
ATOM   8851  O  "O4'" . DT  I 6  141  ? 182.200 219.223 153.984 1.00 0.00   ?  68   DT  I "O4'" 1 
ATOM   8852  C  "C3'" . DT  I 6  141  ? 183.911 219.549 152.348 1.00 0.00   ?  68   DT  I "C3'" 1 
ATOM   8853  O  "O3'" . DT  I 6  141  ? 183.883 218.701 151.203 1.00 0.00   ?  68   DT  I "O3'" 1 
ATOM   8854  C  "C2'" . DT  I 6  141  ? 182.839 220.637 152.264 1.00 0.00   ?  68   DT  I "C2'" 1 
ATOM   8855  C  "C1'" . DT  I 6  141  ? 181.655 219.939 152.906 1.00 0.00   ?  68   DT  I "C1'" 1 
ATOM   8856  N  N1    . DT  I 6  141  ? 180.616 220.877 153.417 1.00 20.00  ?  68   DT  I N1    1 
ATOM   8857  C  C2    . DT  I 6  141  ? 179.323 220.752 152.966 1.00 20.00  ?  68   DT  I C2    1 
ATOM   8858  O  O2    . DT  I 6  141  ? 178.972 219.899 152.171 1.00 20.00  ?  68   DT  I O2    1 
ATOM   8859  N  N3    . DT  I 6  141  ? 178.444 221.663 153.487 1.00 20.00  ?  68   DT  I N3    1 
ATOM   8860  C  C4    . DT  I 6  141  ? 178.725 222.671 154.392 1.00 20.00  ?  68   DT  I C4    1 
ATOM   8861  O  O4    . DT  I 6  141  ? 177.864 223.443 154.802 1.00 20.00  ?  68   DT  I O4    1 
ATOM   8862  C  C5    . DT  I 6  141  ? 180.102 222.750 154.821 1.00 20.00  ?  68   DT  I C5    1 
ATOM   8863  C  C7    . DT  I 6  141  ? 180.528 223.803 155.801 1.00 20.00  ?  68   DT  I C7    1 
ATOM   8864  C  C6    . DT  I 6  141  ? 180.971 221.861 154.316 1.00 20.00  ?  68   DT  I C6    1 
ATOM   8865  P  P     . DC  I 6  142  ? 184.754 219.066 149.902 1.00 0.00   ?  69   DC  I P     1 
ATOM   8866  O  OP1   . DC  I 6  142  ? 184.545 217.995 148.903 1.00 0.00   ?  69   DC  I OP1   1 
ATOM   8867  O  OP2   . DC  I 6  142  ? 186.125 219.381 150.361 1.00 0.00   ?  69   DC  I OP2   1 
ATOM   8868  O  "O5'" . DC  I 6  142  ? 184.097 220.424 149.364 1.00 0.00   ?  69   DC  I "O5'" 1 
ATOM   8869  C  "C5'" . DC  I 6  142  ? 183.518 220.477 148.062 1.00 0.00   ?  69   DC  I "C5'" 1 
ATOM   8870  C  "C4'" . DC  I 6  142  ? 182.097 219.940 148.075 1.00 0.00   ?  69   DC  I "C4'" 1 
ATOM   8871  O  "O4'" . DC  I 6  142  ? 181.370 220.510 149.198 1.00 0.00   ?  69   DC  I "O4'" 1 
ATOM   8872  C  "C3'" . DC  I 6  142  ? 181.273 220.266 146.827 1.00 0.00   ?  69   DC  I "C3'" 1 
ATOM   8873  O  "O3'" . DC  I 6  142  ? 180.480 219.141 146.452 1.00 0.00   ?  69   DC  I "O3'" 1 
ATOM   8874  C  "C2'" . DC  I 6  142  ? 180.406 221.434 147.285 1.00 0.00   ?  69   DC  I "C2'" 1 
ATOM   8875  C  "C1'" . DC  I 6  142  ? 180.159 221.066 148.738 1.00 0.00   ?  69   DC  I "C1'" 1 
ATOM   8876  N  N1    . DC  I 6  142  ? 179.807 222.234 149.602 1.00 20.00  ?  69   DC  I N1    1 
ATOM   8877  C  C2    . DC  I 6  142  ? 178.479 222.673 149.666 1.00 20.00  ?  69   DC  I C2    1 
ATOM   8878  O  O2    . DC  I 6  142  ? 177.618 222.086 149.000 1.00 20.00  ?  69   DC  I O2    1 
ATOM   8879  N  N3    . DC  I 6  142  ? 178.175 223.735 150.455 1.00 20.00  ?  69   DC  I N3    1 
ATOM   8880  C  C4    . DC  I 6  142  ? 179.135 224.341 151.157 1.00 20.00  ?  69   DC  I C4    1 
ATOM   8881  N  N4    . DC  I 6  142  ? 178.791 225.383 151.922 1.00 20.00  ?  69   DC  I N4    1 
ATOM   8882  C  C5    . DC  I 6  142  ? 180.493 223.906 151.106 1.00 20.00  ?  69   DC  I C5    1 
ATOM   8883  C  C6    . DC  I 6  142  ? 180.780 222.859 150.324 1.00 20.00  ?  69   DC  I C6    1 
ATOM   8884  P  P     . DG  I 6  143  ? 180.246 218.797 144.899 1.00 0.00   ?  70   DG  I P     1 
ATOM   8885  O  OP1   . DG  I 6  143  ? 180.817 217.455 144.648 1.00 0.00   ?  70   DG  I OP1   1 
ATOM   8886  O  OP2   . DG  I 6  143  ? 180.715 219.956 144.107 1.00 0.00   ?  70   DG  I OP2   1 
ATOM   8887  O  "O5'" . DG  I 6  143  ? 178.654 218.715 144.752 1.00 0.00   ?  70   DG  I "O5'" 1 
ATOM   8888  C  "C5'" . DG  I 6  143  ? 177.837 219.755 145.276 1.00 0.00   ?  70   DG  I "C5'" 1 
ATOM   8889  C  "C4'" . DG  I 6  143  ? 176.559 219.907 144.468 1.00 0.00   ?  70   DG  I "C4'" 1 
ATOM   8890  O  "O4'" . DG  I 6  143  ? 175.708 220.879 145.110 1.00 0.00   ?  70   DG  I "O4'" 1 
ATOM   8891  C  "C3'" . DG  I 6  143  ? 176.751 220.450 143.066 1.00 0.00   ?  70   DG  I "C3'" 1 
ATOM   8892  O  "O3'" . DG  I 6  143  ? 175.624 220.132 142.259 1.00 0.00   ?  70   DG  I "O3'" 1 
ATOM   8893  C  "C2'" . DG  I 6  143  ? 176.846 221.950 143.319 1.00 0.00   ?  70   DG  I "C2'" 1 
ATOM   8894  C  "C1'" . DG  I 6  143  ? 175.907 222.150 144.514 1.00 0.00   ?  70   DG  I "C1'" 1 
ATOM   8895  N  N9    . DG  I 6  143  ? 176.454 223.047 145.525 1.00 20.00  ?  70   DG  I N9    1 
ATOM   8896  C  C8    . DG  I 6  143  ? 177.752 223.089 145.970 1.00 20.00  ?  70   DG  I C8    1 
ATOM   8897  N  N7    . DG  I 6  143  ? 177.961 223.994 146.881 1.00 20.00  ?  70   DG  I N7    1 
ATOM   8898  C  C5    . DG  I 6  143  ? 176.722 224.593 147.056 1.00 20.00  ?  70   DG  I C5    1 
ATOM   8899  C  C6    . DG  I 6  143  ? 176.337 225.641 147.918 1.00 20.00  ?  70   DG  I C6    1 
ATOM   8900  O  O6    . DG  I 6  143  ? 177.041 226.267 148.722 1.00 20.00  ?  70   DG  I O6    1 
ATOM   8901  N  N1    . DG  I 6  143  ? 174.987 225.951 147.782 1.00 20.00  ?  70   DG  I N1    1 
ATOM   8902  C  C2    . DG  I 6  143  ? 174.117 225.321 146.921 1.00 20.00  ?  70   DG  I C2    1 
ATOM   8903  N  N2    . DG  I 6  143  ? 172.849 225.755 146.928 1.00 20.00  ?  70   DG  I N2    1 
ATOM   8904  N  N3    . DG  I 6  143  ? 174.468 224.333 146.106 1.00 20.00  ?  70   DG  I N3    1 
ATOM   8905  C  C4    . DG  I 6  143  ? 175.781 224.023 146.227 1.00 20.00  ?  70   DG  I C4    1 
ATOM   8906  P  P     . DA  I 6  144  ? 175.571 220.602 140.723 1.00 0.00   ?  71   DA  I P     1 
ATOM   8907  O  OP1   . DA  I 6  144  ? 174.653 219.688 140.008 1.00 0.00   ?  71   DA  I OP1   1 
ATOM   8908  O  OP2   . DA  I 6  144  ? 176.965 220.761 140.252 1.00 0.00   ?  71   DA  I OP2   1 
ATOM   8909  O  "O5'" . DA  I 6  144  ? 174.905 222.057 140.785 1.00 0.00   ?  71   DA  I "O5'" 1 
ATOM   8910  C  "C5'" . DA  I 6  144  ? 173.572 222.207 141.260 1.00 0.00   ?  71   DA  I "C5'" 1 
ATOM   8911  C  "C4'" . DA  I 6  144  ? 173.241 223.669 141.510 1.00 0.00   ?  71   DA  I "C4'" 1 
ATOM   8912  O  "O4'" . DA  I 6  144  ? 174.025 224.165 142.616 1.00 0.00   ?  71   DA  I "O4'" 1 
ATOM   8913  C  "C3'" . DA  I 6  144  ? 173.513 224.612 140.333 1.00 0.00   ?  71   DA  I "C3'" 1 
ATOM   8914  O  "O3'" . DA  I 6  144  ? 172.284 225.178 139.879 1.00 0.00   ?  71   DA  I "O3'" 1 
ATOM   8915  C  "C2'" . DA  I 6  144  ? 174.464 225.680 140.902 1.00 0.00   ?  71   DA  I "C2'" 1 
ATOM   8916  C  "C1'" . DA  I 6  144  ? 174.292 225.526 142.406 1.00 0.00   ?  71   DA  I "C1'" 1 
ATOM   8917  N  N9    . DA  I 6  144  ? 175.485 225.879 143.173 1.00 20.00  ?  71   DA  I N9    1 
ATOM   8918  C  C8    . DA  I 6  144  ? 176.727 225.319 143.068 1.00 20.00  ?  71   DA  I C8    1 
ATOM   8919  N  N7    . DA  I 6  144  ? 177.610 225.827 143.894 1.00 20.00  ?  71   DA  I N7    1 
ATOM   8920  C  C5    . DA  I 6  144  ? 176.898 226.786 144.594 1.00 20.00  ?  71   DA  I C5    1 
ATOM   8921  C  C6    . DA  I 6  144  ? 177.265 227.681 145.618 1.00 20.00  ?  71   DA  I C6    1 
ATOM   8922  N  N6    . DA  I 6  144  ? 178.499 227.747 146.131 1.00 20.00  ?  71   DA  I N6    1 
ATOM   8923  N  N1    . DA  I 6  144  ? 176.312 228.506 146.100 1.00 20.00  ?  71   DA  I N1    1 
ATOM   8924  C  C2    . DA  I 6  144  ? 175.078 228.435 145.585 1.00 20.00  ?  71   DA  I C2    1 
ATOM   8925  N  N3    . DA  I 6  144  ? 174.615 227.638 144.622 1.00 20.00  ?  71   DA  I N3    1 
ATOM   8926  C  C4    . DA  I 6  144  ? 175.585 226.830 144.165 1.00 20.00  ?  71   DA  I C4    1 
ATOM   8927  P  P     . DT  I 6  145  ? 172.268 226.332 138.760 1.00 0.00   ?  72   DT  I P     1 
ATOM   8928  O  OP1   . DT  I 6  145  ? 170.997 226.196 138.015 1.00 0.00   ?  72   DT  I OP1   1 
ATOM   8929  O  OP2   . DT  I 6  145  ? 173.548 226.301 138.018 1.00 0.00   ?  72   DT  I OP2   1 
ATOM   8930  O  "O5'" . DT  I 6  145  ? 172.207 227.682 139.614 1.00 0.00   ?  72   DT  I "O5'" 1 
ATOM   8931  C  "C5'" . DT  I 6  145  ? 171.205 227.838 140.614 1.00 0.00   ?  72   DT  I "C5'" 1 
ATOM   8932  C  "C4'" . DT  I 6  145  ? 171.241 229.234 141.209 1.00 0.00   ?  72   DT  I "C4'" 1 
ATOM   8933  O  "O4'" . DT  I 6  145  ? 172.366 229.350 142.119 1.00 0.00   ?  72   DT  I "O4'" 1 
ATOM   8934  C  "C3'" . DT  I 6  145  ? 171.388 230.365 140.191 1.00 0.00   ?  72   DT  I "C3'" 1 
ATOM   8935  O  "O3'" . DT  I 6  145  ? 170.461 231.401 140.482 1.00 0.00   ?  72   DT  I "O3'" 1 
ATOM   8936  C  "C2'" . DT  I 6  145  ? 172.834 230.830 140.373 1.00 0.00   ?  72   DT  I "C2'" 1 
ATOM   8937  C  "C1'" . DT  I 6  145  ? 173.079 230.533 141.844 1.00 0.00   ?  72   DT  I "C1'" 1 
ATOM   8938  N  N1    . DT  I 6  145  ? 174.516 230.298 142.177 1.00 0.00   ?  72   DT  I N1    1 
ATOM   8939  C  C2    . DT  I 6  145  ? 175.111 231.042 143.173 1.00 0.00   ?  72   DT  I C2    1 
ATOM   8940  O  O2    . DT  I 6  145  ? 174.524 231.900 143.807 1.00 0.00   ?  72   DT  I O2    1 
ATOM   8941  N  N3    . DT  I 6  145  ? 176.430 230.741 143.401 1.00 0.00   ?  72   DT  I N3    1 
ATOM   8942  C  C4    . DT  I 6  145  ? 177.195 229.791 142.747 1.00 0.00   ?  72   DT  I C4    1 
ATOM   8943  O  O4    . DT  I 6  145  ? 178.374 229.593 143.022 1.00 0.00   ?  72   DT  I O4    1 
ATOM   8944  C  C5    . DT  I 6  145  ? 176.510 229.048 141.717 1.00 0.00   ?  72   DT  I C5    1 
ATOM   8945  C  C7    . DT  I 6  145  ? 177.239 227.993 140.939 1.00 0.00   ?  72   DT  I C7    1 
ATOM   8946  C  C6    . DT  I 6  145  ? 175.220 229.333 141.485 1.00 0.00   ?  72   DT  I C6    1 
ATOM   8947  P  P     . DT  I 6  146  ? 170.184 232.565 139.410 1.00 0.00   ?  73   DT  I P     1 
ATOM   8948  O  OP1   . DT  I 6  146  ? 168.729 232.839 139.412 1.00 0.00   ?  73   DT  I OP1   1 
ATOM   8949  O  OP2   . DT  I 6  146  ? 170.859 232.190 138.148 1.00 0.00   ?  73   DT  I OP2   1 
ATOM   8950  O  "O5'" . DT  I 6  146  ? 170.947 233.829 140.021 1.00 0.00   ?  73   DT  I "O5'" 1 
ATOM   8951  C  "C5'" . DT  I 6  146  ? 170.670 234.246 141.351 1.00 0.00   ?  73   DT  I "C5'" 1 
ATOM   8952  C  "C4'" . DT  I 6  146  ? 171.693 235.260 141.825 1.00 0.00   ?  73   DT  I "C4'" 1 
ATOM   8953  O  "O4'" . DT  I 6  146  ? 172.967 234.601 142.058 1.00 0.00   ?  73   DT  I "O4'" 1 
ATOM   8954  C  "C3'" . DT  I 6  146  ? 171.977 236.402 140.842 1.00 0.00   ?  73   DT  I "C3'" 1 
ATOM   8955  O  "O3'" . DT  I 6  146  ? 171.976 237.647 141.531 1.00 0.00   ?  73   DT  I "O3'" 1 
ATOM   8956  C  "C2'" . DT  I 6  146  ? 173.365 236.062 140.301 1.00 0.00   ?  73   DT  I "C2'" 1 
ATOM   8957  C  "C1'" . DT  I 6  146  ? 173.991 235.390 141.508 1.00 0.00   ?  73   DT  I "C1'" 1 
ATOM   8958  N  N1    . DT  I 6  146  ? 175.156 234.516 141.178 1.00 20.00  ?  73   DT  I N1    1 
ATOM   8959  C  C2    . DT  I 6  146  ? 176.331 234.678 141.873 1.00 20.00  ?  73   DT  I C2    1 
ATOM   8960  O  O2    . DT  I 6  146  ? 176.476 235.503 142.757 1.00 20.00  ?  73   DT  I O2    1 
ATOM   8961  N  N3    . DT  I 6  146  ? 177.341 233.835 141.494 1.00 20.00  ?  73   DT  I N3    1 
ATOM   8962  C  C4    . DT  I 6  146  ? 177.297 232.866 140.510 1.00 20.00  ?  73   DT  I C4    1 
ATOM   8963  O  O4    . DT  I 6  146  ? 178.262 232.156 140.245 1.00 20.00  ?  73   DT  I O4    1 
ATOM   8964  C  C5    . DT  I 6  146  ? 176.036 232.748 139.817 1.00 20.00  ?  73   DT  I C5    1 
ATOM   8965  C  C7    . DT  I 6  146  ? 175.870 231.731 138.727 1.00 20.00  ?  73   DT  I C7    1 
ATOM   8966  C  C6    . DT  I 6  146  ? 175.038 233.571 140.179 1.00 20.00  ?  73   DT  I C6    1 
ATOM   8967  P  P     . DA  I 6  147  ? 171.746 239.020 140.728 1.00 0.00   ?  74   DA  I P     1 
ATOM   8968  O  OP1   . DA  I 6  147  ? 170.503 239.636 141.242 1.00 0.00   ?  74   DA  I OP1   1 
ATOM   8969  O  OP2   . DA  I 6  147  ? 171.877 238.730 139.283 1.00 0.00   ?  74   DA  I OP2   1 
ATOM   8970  O  "O5'" . DA  I 6  147  ? 172.990 239.928 141.162 1.00 0.00   ?  74   DA  I "O5'" 1 
ATOM   8971  C  "C5'" . DA  I 6  147  ? 173.170 240.281 142.530 1.00 0.00   ?  74   DA  I "C5'" 1 
ATOM   8972  C  "C4'" . DA  I 6  147  ? 174.622 240.626 142.812 1.00 0.00   ?  74   DA  I "C4'" 1 
ATOM   8973  O  "O4'" . DA  I 6  147  ? 175.440 239.438 142.651 1.00 0.00   ?  74   DA  I "O4'" 1 
ATOM   8974  C  "C3'" . DA  I 6  147  ? 175.222 241.694 141.892 1.00 0.00   ?  74   DA  I "C3'" 1 
ATOM   8975  O  "O3'" . DA  I 6  147  ? 175.913 242.675 142.653 1.00 0.00   ?  74   DA  I "O3'" 1 
ATOM   8976  C  "C2'" . DA  I 6  147  ? 176.178 240.909 140.997 1.00 0.00   ?  74   DA  I "C2'" 1 
ATOM   8977  C  "C1'" . DA  I 6  147  ? 176.586 239.758 141.901 1.00 0.00   ?  74   DA  I "C1'" 1 
ATOM   8978  N  N9    . DA  I 6  147  ? 176.999 238.578 141.153 1.00 0.00   ?  74   DA  I N9    1 
ATOM   8979  C  C8    . DA  I 6  147  ? 176.223 237.818 140.326 1.00 0.00   ?  74   DA  I C8    1 
ATOM   8980  N  N7    . DA  I 6  147  ? 176.864 236.821 139.765 1.00 0.00   ?  74   DA  I N7    1 
ATOM   8981  C  C5    . DA  I 6  147  ? 178.153 236.939 140.254 1.00 0.00   ?  74   DA  I C5    1 
ATOM   8982  C  C6    . DA  I 6  147  ? 179.320 236.184 140.039 1.00 0.00   ?  74   DA  I C6    1 
ATOM   8983  N  N6    . DA  I 6  147  ? 179.364 235.115 139.240 1.00 0.00   ?  74   DA  I N6    1 
ATOM   8984  N  N1    . DA  I 6  147  ? 180.443 236.572 140.679 1.00 0.00   ?  74   DA  I N1    1 
ATOM   8985  C  C2    . DA  I 6  147  ? 180.392 237.643 141.480 1.00 0.00   ?  74   DA  I C2    1 
ATOM   8986  N  N3    . DA  I 6  147  ? 179.355 238.432 141.758 1.00 0.00   ?  74   DA  I N3    1 
ATOM   8987  C  C4    . DA  I 6  147  ? 178.255 238.019 141.110 1.00 0.00   ?  74   DA  I C4    1 
ATOM   8988  P  P     . DA  I 6  148  ? 176.482 243.994 141.932 1.00 0.00   ?  75   DA  I P     1 
ATOM   8989  O  OP1   . DA  I 6  148  ? 176.466 245.089 142.926 1.00 0.00   ?  75   DA  I OP1   1 
ATOM   8990  O  OP2   . DA  I 6  148  ? 175.754 244.154 140.654 1.00 0.00   ?  75   DA  I OP2   1 
ATOM   8991  O  "O5'" . DA  I 6  148  ? 178.002 243.625 141.589 1.00 0.00   ?  75   DA  I "O5'" 1 
ATOM   8992  C  "C5'" . DA  I 6  148  ? 178.942 243.430 142.641 1.00 0.00   ?  75   DA  I "C5'" 1 
ATOM   8993  C  "C4'" . DA  I 6  148  ? 180.287 242.982 142.092 1.00 0.00   ?  75   DA  I "C4'" 1 
ATOM   8994  O  "O4'" . DA  I 6  148  ? 180.166 241.653 141.532 1.00 0.00   ?  75   DA  I "O4'" 1 
ATOM   8995  C  "C3'" . DA  I 6  148  ? 180.863 243.866 140.975 1.00 0.00   ?  75   DA  I "C3'" 1 
ATOM   8996  O  "O3'" . DA  I 6  148  ? 182.121 244.412 141.367 1.00 0.00   ?  75   DA  I "O3'" 1 
ATOM   8997  C  "C2'" . DA  I 6  148  ? 181.012 242.919 139.779 1.00 0.00   ?  75   DA  I "C2'" 1 
ATOM   8998  C  "C1'" . DA  I 6  148  ? 181.041 241.552 140.443 1.00 0.00   ?  75   DA  I "C1'" 1 
ATOM   8999  N  N9    . DA  I 6  148  ? 180.586 240.481 139.562 1.00 20.00  ?  75   DA  I N9    1 
ATOM   9000  C  C8    . DA  I 6  148  ? 179.308 240.243 139.140 1.00 20.00  ?  75   DA  I C8    1 
ATOM   9001  N  N7    . DA  I 6  148  ? 179.201 239.212 138.334 1.00 20.00  ?  75   DA  I N7    1 
ATOM   9002  C  C5    . DA  I 6  148  ? 180.500 238.747 138.214 1.00 20.00  ?  75   DA  I C5    1 
ATOM   9003  C  C6    . DA  I 6  148  ? 181.064 237.673 137.495 1.00 20.00  ?  75   DA  I C6    1 
ATOM   9004  N  N6    . DA  I 6  148  ? 180.347 236.843 136.731 1.00 20.00  ?  75   DA  I N6    1 
ATOM   9005  N  N1    . DA  I 6  148  ? 182.398 237.487 137.592 1.00 20.00  ?  75   DA  I N1    1 
ATOM   9006  C  C2    . DA  I 6  148  ? 183.111 238.321 138.357 1.00 20.00  ?  75   DA  I C2    1 
ATOM   9007  N  N3    . DA  I 6  148  ? 182.694 239.361 139.077 1.00 20.00  ?  75   DA  I N3    1 
ATOM   9008  C  C4    . DA  I 6  148  ? 181.366 239.519 138.964 1.00 20.00  ?  75   DA  I C4    1 
ATOM   9009  P  P     . DC  I 6  149  ? 182.832 245.535 140.461 1.00 0.00   ?  76   DC  I P     1 
ATOM   9010  O  OP1   . DC  I 6  149  ? 183.548 246.457 141.371 1.00 0.00   ?  76   DC  I OP1   1 
ATOM   9011  O  OP2   . DC  I 6  149  ? 181.815 246.072 139.529 1.00 0.00   ?  76   DC  I OP2   1 
ATOM   9012  O  "O5'" . DC  I 6  149  ? 183.905 244.720 139.593 1.00 0.00   ?  76   DC  I "O5'" 1 
ATOM   9013  C  "C5'" . DC  I 6  149  ? 185.066 244.181 140.219 1.00 0.00   ?  76   DC  I "C5'" 1 
ATOM   9014  C  "C4'" . DC  I 6  149  ? 185.890 243.361 139.237 1.00 0.00   ?  76   DC  I "C4'" 1 
ATOM   9015  O  "O4'" . DC  I 6  149  ? 185.097 242.253 138.735 1.00 0.00   ?  76   DC  I "O4'" 1 
ATOM   9016  C  "C3'" . DC  I 6  149  ? 186.391 244.124 137.999 1.00 0.00   ?  76   DC  I "C3'" 1 
ATOM   9017  O  "O3'" . DC  I 6  149  ? 187.786 243.886 137.805 1.00 0.00   ?  76   DC  I "O3'" 1 
ATOM   9018  C  "C2'" . DC  I 6  149  ? 185.564 243.531 136.859 1.00 0.00   ?  76   DC  I "C2'" 1 
ATOM   9019  C  "C1'" . DC  I 6  149  ? 185.345 242.116 137.360 1.00 0.00   ?  76   DC  I "C1'" 1 
ATOM   9020  N  N1    . DC  I 6  149  ? 184.191 241.428 136.718 1.00 20.00  ?  76   DC  I N1    1 
ATOM   9021  C  C2    . DC  I 6  149  ? 184.428 240.358 135.852 1.00 20.00  ?  76   DC  I C2    1 
ATOM   9022  O  O2    . DC  I 6  149  ? 185.591 239.994 135.647 1.00 20.00  ?  76   DC  I O2    1 
ATOM   9023  N  N3    . DC  I 6  149  ? 183.375 239.744 135.261 1.00 20.00  ?  76   DC  I N3    1 
ATOM   9024  C  C4    . DC  I 6  149  ? 182.134 240.163 135.508 1.00 20.00  ?  76   DC  I C4    1 
ATOM   9025  N  N4    . DC  I 6  149  ? 181.127 239.523 134.903 1.00 20.00  ?  76   DC  I N4    1 
ATOM   9026  C  C5    . DC  I 6  149  ? 181.872 241.259 136.383 1.00 20.00  ?  76   DC  I C5    1 
ATOM   9027  C  C6    . DC  I 6  149  ? 182.920 241.855 136.963 1.00 20.00  ?  76   DC  I C6    1 
ATOM   9028  P  P     . DG  I 6  150  ? 188.646 244.846 136.843 1.00 0.00   ?  77   DG  I P     1 
ATOM   9029  O  OP1   . DG  I 6  150  ? 189.844 245.269 137.602 1.00 0.00   ?  77   DG  I OP1   1 
ATOM   9030  O  OP2   . DG  I 6  150  ? 187.734 245.868 136.284 1.00 0.00   ?  77   DG  I OP2   1 
ATOM   9031  O  "O5'" . DG  I 6  150  ? 189.108 243.891 135.641 1.00 0.00   ?  77   DG  I "O5'" 1 
ATOM   9032  C  "C5'" . DG  I 6  150  ? 190.305 243.121 135.758 1.00 0.00   ?  77   DG  I "C5'" 1 
ATOM   9033  C  "C4'" . DG  I 6  150  ? 190.598 242.359 134.472 1.00 0.00   ?  77   DG  I "C4'" 1 
ATOM   9034  O  "O4'" . DG  I 6  150  ? 189.512 241.432 134.196 1.00 0.00   ?  77   DG  I "O4'" 1 
ATOM   9035  C  "C3'" . DG  I 6  150  ? 190.742 243.224 133.217 1.00 0.00   ?  77   DG  I "C3'" 1 
ATOM   9036  O  "O3'" . DG  I 6  150  ? 191.766 242.697 132.370 1.00 0.00   ?  77   DG  I "O3'" 1 
ATOM   9037  C  "C2'" . DG  I 6  150  ? 189.368 243.100 132.570 1.00 0.00   ?  77   DG  I "C2'" 1 
ATOM   9038  C  "C1'" . DG  I 6  150  ? 189.024 241.656 132.891 1.00 0.00   ?  77   DG  I "C1'" 1 
ATOM   9039  N  N9    . DG  I 6  150  ? 187.590 241.392 132.877 1.00 20.00  ?  77   DG  I N9    1 
ATOM   9040  C  C8    . DG  I 6  150  ? 186.629 242.038 133.613 1.00 20.00  ?  77   DG  I C8    1 
ATOM   9041  N  N7    . DG  I 6  150  ? 185.423 241.601 133.389 1.00 20.00  ?  77   DG  I N7    1 
ATOM   9042  C  C5    . DG  I 6  150  ? 185.592 240.595 132.448 1.00 20.00  ?  77   DG  I C5    1 
ATOM   9043  C  C6    . DG  I 6  150  ? 184.635 239.758 131.830 1.00 20.00  ?  77   DG  I C6    1 
ATOM   9044  O  O6    . DG  I 6  150  ? 183.407 239.736 131.996 1.00 20.00  ?  77   DG  I O6    1 
ATOM   9045  N  N1    . DG  I 6  150  ? 185.226 238.880 130.928 1.00 20.00  ?  77   DG  I N1    1 
ATOM   9046  C  C2    . DG  I 6  150  ? 186.572 238.814 130.656 1.00 20.00  ?  77   DG  I C2    1 
ATOM   9047  N  N2    . DG  I 6  150  ? 186.949 237.893 129.754 1.00 20.00  ?  77   DG  I N2    1 
ATOM   9048  N  N3    . DG  I 6  150  ? 187.483 239.592 131.231 1.00 20.00  ?  77   DG  I N3    1 
ATOM   9049  C  C4    . DG  I 6  150  ? 186.921 240.457 132.114 1.00 20.00  ?  77   DG  I C4    1 
ATOM   9050  P  P     . DA  I 6  151  ? 192.398 243.600 131.197 1.00 0.00   ?  78   DA  I P     1 
ATOM   9051  O  OP1   . DA  I 6  151  ? 193.850 243.713 131.459 1.00 0.00   ?  78   DA  I OP1   1 
ATOM   9052  O  OP2   . DA  I 6  151  ? 191.580 244.826 131.070 1.00 0.00   ?  78   DA  I OP2   1 
ATOM   9053  O  "O5'" . DA  I 6  151  ? 192.183 242.725 129.871 1.00 0.00   ?  78   DA  I "O5'" 1 
ATOM   9054  C  "C5'" . DA  I 6  151  ? 190.913 242.139 129.602 1.00 0.00   ?  78   DA  I "C5'" 1 
ATOM   9055  C  "C4'" . DA  I 6  151  ? 190.739 241.849 128.122 1.00 0.00   ?  78   DA  I "C4'" 1 
ATOM   9056  O  "O4'" . DA  I 6  151  ? 189.467 241.182 127.917 1.00 0.00   ?  78   DA  I "O4'" 1 
ATOM   9057  C  "C3'" . DA  I 6  151  ? 190.680 243.078 127.230 1.00 0.00   ?  78   DA  I "C3'" 1 
ATOM   9058  O  "O3'" . DA  I 6  151  ? 191.039 242.728 125.896 1.00 0.00   ?  78   DA  I "O3'" 1 
ATOM   9059  C  "C2'" . DA  I 6  151  ? 189.209 243.453 127.327 1.00 0.00   ?  78   DA  I "C2'" 1 
ATOM   9060  C  "C1'" . DA  I 6  151  ? 188.550 242.077 127.310 1.00 0.00   ?  78   DA  I "C1'" 1 
ATOM   9061  N  N9    . DA  I 6  151  ? 187.291 242.026 128.048 1.00 20.00  ?  78   DA  I N9    1 
ATOM   9062  C  C8    . DA  I 6  151  ? 186.949 242.764 129.147 1.00 20.00  ?  78   DA  I C8    1 
ATOM   9063  N  N7    . DA  I 6  151  ? 185.745 242.508 129.603 1.00 20.00  ?  78   DA  I N7    1 
ATOM   9064  C  C5    . DA  I 6  151  ? 185.266 241.532 128.744 1.00 20.00  ?  78   DA  I C5    1 
ATOM   9065  C  C6    . DA  I 6  151  ? 184.043 240.833 128.688 1.00 20.00  ?  78   DA  I C6    1 
ATOM   9066  N  N6    . DA  I 6  151  ? 183.044 241.030 129.554 1.00 20.00  ?  78   DA  I N6    1 
ATOM   9067  N  N1    . DA  I 6  151  ? 183.886 239.925 127.700 1.00 20.00  ?  78   DA  I N1    1 
ATOM   9068  C  C2    . DA  I 6  151  ? 184.893 239.731 126.841 1.00 20.00  ?  78   DA  I C2    1 
ATOM   9069  N  N3    . DA  I 6  151  ? 186.082 240.328 126.791 1.00 20.00  ?  78   DA  I N3    1 
ATOM   9070  C  C4    . DA  I 6  151  ? 186.207 241.224 127.780 1.00 20.00  ?  78   DA  I C4    1 
ATOM   9071  P  P     . DT  I 6  152  ? 191.387 243.871 124.820 1.00 0.00   ?  79   DT  I P     1 
ATOM   9072  O  OP1   . DT  I 6  152  ? 191.921 243.204 123.612 1.00 0.00   ?  79   DT  I OP1   1 
ATOM   9073  O  OP2   . DT  I 6  152  ? 192.200 244.898 125.510 1.00 0.00   ?  79   DT  I OP2   1 
ATOM   9074  O  "O5'" . DT  I 6  152  ? 189.967 244.525 124.473 1.00 0.00   ?  79   DT  I "O5'" 1 
ATOM   9075  C  "C5'" . DT  I 6  152  ? 189.421 244.408 123.161 1.00 0.00   ?  79   DT  I "C5'" 1 
ATOM   9076  C  "C4'" . DT  I 6  152  ? 188.689 243.088 122.990 1.00 0.00   ?  79   DT  I "C4'" 1 
ATOM   9077  O  "O4'" . DT  I 6  152  ? 187.868 242.828 124.161 1.00 0.00   ?  79   DT  I "O4'" 1 
ATOM   9078  C  "C3'" . DT  I 6  152  ? 187.736 243.029 121.794 1.00 0.00   ?  79   DT  I "C3'" 1 
ATOM   9079  O  "O3'" . DT  I 6  152  ? 187.751 241.722 121.228 1.00 0.00   ?  79   DT  I "O3'" 1 
ATOM   9080  C  "C2'" . DT  I 6  152  ? 186.388 243.339 122.435 1.00 0.00   ?  79   DT  I "C2'" 1 
ATOM   9081  C  "C1'" . DT  I 6  152  ? 186.534 242.606 123.756 1.00 0.00   ?  79   DT  I "C1'" 1 
ATOM   9082  N  N1    . DT  I 6  152  ? 185.618 243.087 124.833 1.00 20.00  ?  79   DT  I N1    1 
ATOM   9083  C  C2    . DT  I 6  152  ? 184.368 242.524 124.953 1.00 20.00  ?  79   DT  I C2    1 
ATOM   9084  O  O2    . DT  I 6  152  ? 183.955 241.652 124.209 1.00 20.00  ?  79   DT  I O2    1 
ATOM   9085  N  N3    . DT  I 6  152  ? 183.608 243.027 125.977 1.00 20.00  ?  79   DT  I N3    1 
ATOM   9086  C  C4    . DT  I 6  152  ? 183.972 244.009 126.881 1.00 20.00  ?  79   DT  I C4    1 
ATOM   9087  O  O4    . DT  I 6  152  ? 183.221 244.393 127.770 1.00 20.00  ?  79   DT  I O4    1 
ATOM   9088  C  C5    . DT  I 6  152  ? 185.298 244.553 126.701 1.00 20.00  ?  79   DT  I C5    1 
ATOM   9089  C  C7    . DT  I 6  152  ? 185.802 245.627 127.619 1.00 20.00  ?  79   DT  I C7    1 
ATOM   9090  C  C6    . DT  I 6  152  ? 186.048 244.070 125.699 1.00 20.00  ?  79   DT  I C6    1 
ATOM   9091  P  P     . DG  I 6  153  ? 187.766 241.529 119.632 1.00 0.00   ?  80   DG  I P     1 
ATOM   9092  O  OP1   . DG  I 6  153  ? 189.038 240.863 119.276 1.00 0.00   ?  80   DG  I OP1   1 
ATOM   9093  O  OP2   . DG  I 6  153  ? 187.420 242.830 119.018 1.00 0.00   ?  80   DG  I OP2   1 
ATOM   9094  O  "O5'" . DG  I 6  153  ? 186.557 240.516 119.352 1.00 0.00   ?  80   DG  I "O5'" 1 
ATOM   9095  C  "C5'" . DG  I 6  153  ? 185.244 240.832 119.805 1.00 0.00   ?  80   DG  I "C5'" 1 
ATOM   9096  C  "C4'" . DG  I 6  153  ? 184.218 240.570 118.717 1.00 0.00   ?  80   DG  I "C4'" 1 
ATOM   9097  O  "O4'" . DG  I 6  153  ? 182.981 241.219 119.072 1.00 0.00   ?  80   DG  I "O4'" 1 
ATOM   9098  C  "C3'" . DG  I 6  153  ? 184.556 241.171 117.373 1.00 0.00   ?  80   DG  I "C3'" 1 
ATOM   9099  O  "O3'" . DG  I 6  153  ? 183.747 240.578 116.362 1.00 0.00   ?  80   DG  I "O3'" 1 
ATOM   9100  C  "C2'" . DG  I 6  153  ? 184.186 242.635 117.594 1.00 0.00   ?  80   DG  I "C2'" 1 
ATOM   9101  C  "C1'" . DG  I 6  153  ? 182.980 242.534 118.540 1.00 0.00   ?  80   DG  I "C1'" 1 
ATOM   9102  N  N9    . DG  I 6  153  ? 183.046 243.467 119.658 1.00 20.00  ?  80   DG  I N9    1 
ATOM   9103  C  C8    . DG  I 6  153  ? 184.126 244.223 120.040 1.00 20.00  ?  80   DG  I C8    1 
ATOM   9104  N  N7    . DG  I 6  153  ? 183.898 244.961 121.090 1.00 20.00  ?  80   DG  I N7    1 
ATOM   9105  C  C5    . DG  I 6  153  ? 182.584 244.671 121.430 1.00 20.00  ?  80   DG  I C5    1 
ATOM   9106  C  C6    . DG  I 6  153  ? 181.786 245.170 122.486 1.00 20.00  ?  80   DG  I C6    1 
ATOM   9107  O  O6    . DG  I 6  153  ? 182.094 245.994 123.357 1.00 20.00  ?  80   DG  I O6    1 
ATOM   9108  N  N1    . DG  I 6  153  ? 180.508 244.617 122.471 1.00 20.00  ?  80   DG  I N1    1 
ATOM   9109  C  C2    . DG  I 6  153  ? 180.058 243.697 121.551 1.00 20.00  ?  80   DG  I C2    1 
ATOM   9110  N  N2    . DG  I 6  153  ? 178.794 243.275 121.697 1.00 20.00  ?  80   DG  I N2    1 
ATOM   9111  N  N3    . DG  I 6  153  ? 180.798 243.221 120.558 1.00 20.00  ?  80   DG  I N3    1 
ATOM   9112  C  C4    . DG  I 6  153  ? 182.045 243.751 120.559 1.00 20.00  ?  80   DG  I C4    1 
ATOM   9113  P  P     . DC  I 6  154  ? 184.105 240.784 114.809 1.00 0.00   ?  81   DC  I P     1 
ATOM   9114  O  OP1   . DC  I 6  154  ? 183.242 239.873 114.025 1.00 0.00   ?  81   DC  I OP1   1 
ATOM   9115  O  OP2   . DC  I 6  154  ? 185.576 240.696 114.677 1.00 0.00   ?  81   DC  I OP2   1 
ATOM   9116  O  "O5'" . DC  I 6  154  ? 183.678 242.299 114.513 1.00 0.00   ?  81   DC  I "O5'" 1 
ATOM   9117  C  "C5'" . DC  I 6  154  ? 182.719 242.591 113.500 1.00 0.00   ?  81   DC  I "C5'" 1 
ATOM   9118  C  "C4'" . DC  I 6  154  ? 181.303 242.509 114.047 1.00 0.00   ?  81   DC  I "C4'" 1 
ATOM   9119  O  "O4'" . DC  I 6  154  ? 181.291 242.943 115.432 1.00 0.00   ?  81   DC  I "O4'" 1 
ATOM   9120  C  "C3'" . DC  I 6  154  ? 180.289 243.392 113.334 1.00 0.00   ?  81   DC  I "C3'" 1 
ATOM   9121  O  "O3'" . DC  I 6  154  ? 178.996 242.805 113.403 1.00 0.00   ?  81   DC  I "O3'" 1 
ATOM   9122  C  "C2'" . DC  I 6  154  ? 180.360 244.683 114.141 1.00 0.00   ?  81   DC  I "C2'" 1 
ATOM   9123  C  "C1'" . DC  I 6  154  ? 180.559 244.150 115.555 1.00 0.00   ?  81   DC  I "C1'" 1 
ATOM   9124  N  N1    . DC  I 6  154  ? 181.329 245.073 116.435 1.00 20.00  ?  81   DC  I N1    1 
ATOM   9125  C  C2    . DC  I 6  154  ? 180.705 245.672 117.536 1.00 20.00  ?  81   DC  I C2    1 
ATOM   9126  O  O2    . DC  I 6  154  ? 179.514 245.428 117.765 1.00 20.00  ?  81   DC  I O2    1 
ATOM   9127  N  N3    . DC  I 6  154  ? 181.428 246.508 118.324 1.00 20.00  ?  81   DC  I N3    1 
ATOM   9128  C  C4    . DC  I 6  154  ? 182.712 246.745 118.044 1.00 20.00  ?  81   DC  I C4    1 
ATOM   9129  N  N4    . DC  I 6  154  ? 183.386 247.575 118.847 1.00 20.00  ?  81   DC  I N4    1 
ATOM   9130  C  C5    . DC  I 6  154  ? 183.362 246.143 116.927 1.00 20.00  ?  81   DC  I C5    1 
ATOM   9131  C  C6    . DC  I 6  154  ? 182.640 245.324 116.158 1.00 20.00  ?  81   DC  I C6    1 
ATOM   9132  P  P     . DT  I 6  155  ? 177.825 243.317 112.428 1.00 0.00   ?  82   DT  I P     1 
ATOM   9133  O  OP1   . DT  I 6  155  ? 176.781 242.268 112.392 1.00 0.00   ?  82   DT  I OP1   1 
ATOM   9134  O  OP2   . DT  I 6  155  ? 178.455 243.770 111.169 1.00 0.00   ?  82   DT  I OP2   1 
ATOM   9135  O  "O5'" . DT  I 6  155  ? 177.236 244.604 113.175 1.00 0.00   ?  82   DT  I "O5'" 1 
ATOM   9136  C  "C5'" . DT  I 6  155  ? 176.518 244.451 114.394 1.00 0.00   ?  82   DT  I "C5'" 1 
ATOM   9137  C  "C4'" . DT  I 6  155  ? 176.112 245.801 114.960 1.00 0.00   ?  82   DT  I "C4'" 1 
ATOM   9138  O  "O4'" . DT  I 6  155  ? 177.217 246.375 115.692 1.00 0.00   ?  82   DT  I "O4'" 1 
ATOM   9139  C  "C3'" . DT  I 6  155  ? 175.703 246.849 113.916 1.00 0.00   ?  82   DT  I "C3'" 1 
ATOM   9140  O  "O3'" . DT  I 6  155  ? 174.327 247.186 114.070 1.00 0.00   ?  82   DT  I "O3'" 1 
ATOM   9141  C  "C2'" . DT  I 6  155  ? 176.616 248.053 114.201 1.00 0.00   ?  82   DT  I "C2'" 1 
ATOM   9142  C  "C1'" . DT  I 6  155  ? 177.120 247.769 115.609 1.00 0.00   ?  82   DT  I "C1'" 1 
ATOM   9143  N  N1    . DT  I 6  155  ? 178.460 248.362 115.890 1.00 20.00  ?  82   DT  I N1    1 
ATOM   9144  C  C2    . DT  I 6  155  ? 178.612 249.199 116.971 1.00 20.00  ?  82   DT  I C2    1 
ATOM   9145  O  O2    . DT  I 6  155  ? 177.702 249.484 117.728 1.00 20.00  ?  82   DT  I O2    1 
ATOM   9146  N  N3    . DT  I 6  155  ? 179.879 249.695 117.138 1.00 20.00  ?  82   DT  I N3    1 
ATOM   9147  C  C4    . DT  I 6  155  ? 180.985 249.443 116.346 1.00 20.00  ?  82   DT  I C4    1 
ATOM   9148  O  O4    . DT  I 6  155  ? 182.084 249.936 116.578 1.00 20.00  ?  82   DT  I O4    1 
ATOM   9149  C  C5    . DT  I 6  155  ? 180.755 248.560 115.227 1.00 20.00  ?  82   DT  I C5    1 
ATOM   9150  C  C7    . DT  I 6  155  ? 181.880 248.214 114.296 1.00 20.00  ?  82   DT  I C7    1 
ATOM   9151  C  C6    . DT  I 6  155  ? 179.518 248.069 115.054 1.00 20.00  ?  82   DT  I C6    1 
ATOM   9152  P  P     . DG  I 6  156  ? 173.617 248.189 113.033 1.00 0.00   ?  83   DG  I P     1 
ATOM   9153  O  OP1   . DG  I 6  156  ? 172.203 247.773 112.905 1.00 0.00   ?  83   DG  I OP1   1 
ATOM   9154  O  OP2   . DG  I 6  156  ? 174.467 248.272 111.824 1.00 0.00   ?  83   DG  I OP2   1 
ATOM   9155  O  "O5'" . DG  I 6  156  ? 173.670 249.607 113.771 1.00 0.00   ?  83   DG  I "O5'" 1 
ATOM   9156  C  "C5'" . DG  I 6  156  ? 172.925 249.812 114.967 1.00 0.00   ?  83   DG  I "C5'" 1 
ATOM   9157  C  "C4'" . DG  I 6  156  ? 173.300 251.130 115.624 1.00 0.00   ?  83   DG  I "C4'" 1 
ATOM   9158  O  "O4'" . DG  I 6  156  ? 174.697 251.104 116.002 1.00 0.00   ?  83   DG  I "O4'" 1 
ATOM   9159  C  "C3'" . DG  I 6  156  ? 173.114 252.373 114.744 1.00 0.00   ?  83   DG  I "C3'" 1 
ATOM   9160  O  "O3'" . DG  I 6  156  ? 172.295 253.330 115.411 1.00 0.00   ?  83   DG  I "O3'" 1 
ATOM   9161  C  "C2'" . DG  I 6  156  ? 174.538 252.899 114.533 1.00 0.00   ?  83   DG  I "C2'" 1 
ATOM   9162  C  "C1'" . DG  I 6  156  ? 175.258 252.367 115.760 1.00 0.00   ?  83   DG  I "C1'" 1 
ATOM   9163  N  N9    . DG  I 6  156  ? 176.696 252.207 115.566 1.00 0.00   ?  83   DG  I N9    1 
ATOM   9164  C  C8    . DG  I 6  156  ? 177.325 251.317 114.730 1.00 0.00   ?  83   DG  I C8    1 
ATOM   9165  N  N7    . DG  I 6  156  ? 178.626 251.402 114.765 1.00 0.00   ?  83   DG  I N7    1 
ATOM   9166  C  C5    . DG  I 6  156  ? 178.875 252.413 115.684 1.00 0.00   ?  83   DG  I C5    1 
ATOM   9167  C  C6    . DG  I 6  156  ? 180.102 252.951 116.136 1.00 0.00   ?  83   DG  I C6    1 
ATOM   9168  O  O6    . DG  I 6  156  ? 181.250 252.629 115.803 1.00 0.00   ?  83   DG  I O6    1 
ATOM   9169  N  N1    . DG  I 6  156  ? 179.907 253.966 117.071 1.00 0.00   ?  83   DG  I N1    1 
ATOM   9170  C  C2    . DG  I 6  156  ? 178.681 254.404 117.513 1.00 0.00   ?  83   DG  I C2    1 
ATOM   9171  N  N2    . DG  I 6  156  ? 178.688 255.394 118.418 1.00 0.00   ?  83   DG  I N2    1 
ATOM   9172  N  N3    . DG  I 6  156  ? 177.524 253.907 117.096 1.00 0.00   ?  83   DG  I N3    1 
ATOM   9173  C  C4    . DG  I 6  156  ? 177.697 252.918 116.186 1.00 0.00   ?  83   DG  I C4    1 
ATOM   9174  P  P     . DG  I 6  157  ? 171.787 254.641 114.632 1.00 0.00   ?  84   DG  I P     1 
ATOM   9175  O  OP1   . DG  I 6  157  ? 170.429 254.962 115.123 1.00 0.00   ?  84   DG  I OP1   1 
ATOM   9176  O  OP2   . DG  I 6  157  ? 172.004 254.408 113.186 1.00 0.00   ?  84   DG  I OP2   1 
ATOM   9177  O  "O5'" . DG  I 6  157  ? 172.802 255.789 115.099 1.00 0.00   ?  84   DG  I "O5'" 1 
ATOM   9178  C  "C5'" . DG  I 6  157  ? 172.814 256.225 116.457 1.00 0.00   ?  84   DG  I "C5'" 1 
ATOM   9179  C  "C4'" . DG  I 6  157  ? 173.890 257.276 116.682 1.00 0.00   ?  84   DG  I "C4'" 1 
ATOM   9180  O  "O4'" . DG  I 6  157  ? 175.205 256.657 116.600 1.00 0.00   ?  84   DG  I "O4'" 1 
ATOM   9181  C  "C3'" . DG  I 6  157  ? 173.900 258.428 115.665 1.00 0.00   ?  84   DG  I "C3'" 1 
ATOM   9182  O  "O3'" . DG  I 6  157  ? 174.059 259.680 116.332 1.00 0.00   ?  84   DG  I "O3'" 1 
ATOM   9183  C  "C2'" . DG  I 6  157  ? 175.110 258.108 114.796 1.00 0.00   ?  84   DG  I "C2'" 1 
ATOM   9184  C  "C1'" . DG  I 6  157  ? 176.036 257.472 115.812 1.00 0.00   ?  84   DG  I "C1'" 1 
ATOM   9185  N  N9    . DG  I 6  157  ? 177.079 256.657 115.201 1.00 0.00   ?  84   DG  I N9    1 
ATOM   9186  C  C8    . DG  I 6  157  ? 176.907 255.586 114.360 1.00 0.00   ?  84   DG  I C8    1 
ATOM   9187  N  N7    . DG  I 6  157  ? 178.030 255.063 113.950 1.00 0.00   ?  84   DG  I N7    1 
ATOM   9188  C  C5    . DG  I 6  157  ? 179.008 255.843 114.554 1.00 0.00   ?  84   DG  I C5    1 
ATOM   9189  C  C6    . DG  I 6  157  ? 180.417 255.753 114.484 1.00 0.00   ?  84   DG  I C6    1 
ATOM   9190  O  O6    . DG  I 6  157  ? 181.105 254.942 113.850 1.00 0.00   ?  84   DG  I O6    1 
ATOM   9191  N  N1    . DG  I 6  157  ? 181.035 256.740 115.247 1.00 0.00   ?  84   DG  I N1    1 
ATOM   9192  C  C2    . DG  I 6  157  ? 180.376 257.693 115.986 1.00 0.00   ?  84   DG  I C2    1 
ATOM   9193  N  N2    . DG  I 6  157  ? 181.141 258.565 116.660 1.00 0.00   ?  84   DG  I N2    1 
ATOM   9194  N  N3    . DG  I 6  157  ? 179.055 257.786 116.061 1.00 0.00   ?  84   DG  I N3    1 
ATOM   9195  C  C4    . DG  I 6  157  ? 178.438 256.832 115.322 1.00 0.00   ?  84   DG  I C4    1 
ATOM   9196  P  P     . DG  I 6  158  ? 173.642 261.050 115.599 1.00 0.00   ?  85   DG  I P     1 
ATOM   9197  O  OP1   . DG  I 6  158  ? 174.025 262.172 116.484 1.00 0.00   ?  85   DG  I OP1   1 
ATOM   9198  O  OP2   . DG  I 6  158  ? 172.234 260.906 115.167 1.00 0.00   ?  85   DG  I OP2   1 
ATOM   9199  O  "O5'" . DG  I 6  158  ? 174.554 261.088 114.281 1.00 0.00   ?  85   DG  I "O5'" 1 
ATOM   9200  C  "C5'" . DG  I 6  158  ? 175.356 262.233 113.988 1.00 0.00   ?  85   DG  I "C5'" 1 
ATOM   9201  C  "C4'" . DG  I 6  158  ? 176.703 262.146 114.686 1.00 0.00   ?  85   DG  I "C4'" 1 
ATOM   9202  O  "O4'" . DG  I 6  158  ? 177.241 260.803 114.547 1.00 0.00   ?  85   DG  I "O4'" 1 
ATOM   9203  C  "C3'" . DG  I 6  158  ? 177.780 263.087 114.140 1.00 0.00   ?  85   DG  I "C3'" 1 
ATOM   9204  O  "O3'" . DG  I 6  158  ? 178.566 263.600 115.212 1.00 0.00   ?  85   DG  I "O3'" 1 
ATOM   9205  C  "C2'" . DG  I 6  158  ? 178.599 262.170 113.237 1.00 0.00   ?  85   DG  I "C2'" 1 
ATOM   9206  C  "C1'" . DG  I 6  158  ? 178.552 260.878 114.031 1.00 0.00   ?  85   DG  I "C1'" 1 
ATOM   9207  N  N9    . DG  I 6  158  ? 178.817 259.673 113.245 1.00 20.00  ?  85   DG  I N9    1 
ATOM   9208  C  C8    . DG  I 6  158  ? 177.887 258.827 112.690 1.00 20.00  ?  85   DG  I C8    1 
ATOM   9209  N  N7    . DG  I 6  158  ? 178.415 257.818 112.054 1.00 20.00  ?  85   DG  I N7    1 
ATOM   9210  C  C5    . DG  I 6  158  ? 179.785 258.003 112.198 1.00 20.00  ?  85   DG  I C5    1 
ATOM   9211  C  C6    . DG  I 6  158  ? 180.866 257.223 111.718 1.00 20.00  ?  85   DG  I C6    1 
ATOM   9212  O  O6    . DG  I 6  158  ? 180.823 256.179 111.051 1.00 20.00  ?  85   DG  I O6    1 
ATOM   9213  N  N1    . DG  I 6  158  ? 182.097 257.760 112.090 1.00 20.00  ?  85   DG  I N1    1 
ATOM   9214  C  C2    . DG  I 6  158  ? 182.262 258.909 112.831 1.00 20.00  ?  85   DG  I C2    1 
ATOM   9215  N  N2    . DG  I 6  158  ? 183.527 259.275 113.090 1.00 20.00  ?  85   DG  I N2    1 
ATOM   9216  N  N3    . DG  I 6  158  ? 181.256 259.649 113.286 1.00 20.00  ?  85   DG  I N3    1 
ATOM   9217  C  C4    . DG  I 6  158  ? 180.050 259.137 112.933 1.00 20.00  ?  85   DG  I C4    1 
ATOM   9218  P  P     . DC  I 6  159  ? 179.417 264.951 115.023 1.00 0.00   ?  86   DC  I P     1 
ATOM   9219  O  OP1   . DC  I 6  159  ? 179.799 265.430 116.370 1.00 0.00   ?  86   DC  I OP1   1 
ATOM   9220  O  OP2   . DC  I 6  159  ? 178.659 265.840 114.115 1.00 0.00   ?  86   DC  I OP2   1 
ATOM   9221  O  "O5'" . DC  I 6  159  ? 180.738 264.473 114.257 1.00 0.00   ?  86   DC  I "O5'" 1 
ATOM   9222  C  "C5'" . DC  I 6  159  ? 181.514 265.414 113.524 1.00 0.00   ?  86   DC  I "C5'" 1 
ATOM   9223  C  "C4'" . DC  I 6  159  ? 182.982 265.025 113.522 1.00 0.00   ?  86   DC  I "C4'" 1 
ATOM   9224  O  "O4'" . DC  I 6  159  ? 183.109 263.606 113.250 1.00 0.00   ?  86   DC  I "O4'" 1 
ATOM   9225  C  "C3'" . DC  I 6  159  ? 183.824 265.713 112.459 1.00 0.00   ?  86   DC  I "C3'" 1 
ATOM   9226  O  "O3'" . DC  I 6  159  ? 185.173 265.805 112.895 1.00 0.00   ?  86   DC  I "O3'" 1 
ATOM   9227  C  "C2'" . DC  I 6  159  ? 183.680 264.765 111.273 1.00 0.00   ?  86   DC  I "C2'" 1 
ATOM   9228  C  "C1'" . DC  I 6  159  ? 183.676 263.406 111.966 1.00 0.00   ?  86   DC  I "C1'" 1 
ATOM   9229  N  N1    . DC  I 6  159  ? 182.865 262.373 111.260 1.00 20.00  ?  86   DC  I N1    1 
ATOM   9230  C  C2    . DC  I 6  159  ? 183.502 261.300 110.624 1.00 20.00  ?  86   DC  I C2    1 
ATOM   9231  O  O2    . DC  I 6  159  ? 184.736 261.230 110.647 1.00 20.00  ?  86   DC  I O2    1 
ATOM   9232  N  N3    . DC  I 6  159  ? 182.744 260.367 109.995 1.00 20.00  ?  86   DC  I N3    1 
ATOM   9233  C  C4    . DC  I 6  159  ? 181.414 260.479 109.992 1.00 20.00  ?  86   DC  I C4    1 
ATOM   9234  N  N4    . DC  I 6  159  ? 180.705 259.537 109.361 1.00 20.00  ?  86   DC  I N4    1 
ATOM   9235  C  C5    . DC  I 6  159  ? 180.750 261.563 110.636 1.00 20.00  ?  86   DC  I C5    1 
ATOM   9236  C  C6    . DC  I 6  159  ? 181.506 262.475 111.253 1.00 20.00  ?  86   DC  I C6    1 
ATOM   9237  P  P     . DA  I 6  160  ? 186.173 266.859 112.209 1.00 0.00   ?  87   DA  I P     1 
ATOM   9238  O  OP1   . DA  I 6  160  ? 187.073 267.378 113.262 1.00 0.00   ?  87   DA  I OP1   1 
ATOM   9239  O  OP2   . DA  I 6  160  ? 185.353 267.799 111.413 1.00 0.00   ?  87   DA  I OP2   1 
ATOM   9240  O  "O5'" . DA  I 6  160  ? 187.025 265.969 111.190 1.00 0.00   ?  87   DA  I "O5'" 1 
ATOM   9241  C  "C5'" . DA  I 6  160  ? 187.827 266.596 110.198 1.00 0.00   ?  87   DA  I "C5'" 1 
ATOM   9242  C  "C4'" . DA  I 6  160  ? 188.853 265.626 109.642 1.00 0.00   ?  87   DA  I "C4'" 1 
ATOM   9243  O  "O4'" . DA  I 6  160  ? 188.220 264.348 109.388 1.00 0.00   ?  87   DA  I "O4'" 1 
ATOM   9244  C  "C3'" . DA  I 6  160  ? 189.454 266.030 108.310 1.00 0.00   ?  87   DA  I "C3'" 1 
ATOM   9245  O  "O3'" . DA  I 6  160  ? 190.715 265.394 108.138 1.00 0.00   ?  87   DA  I "O3'" 1 
ATOM   9246  C  "C2'" . DA  I 6  160  ? 188.417 265.496 107.327 1.00 0.00   ?  87   DA  I "C2'" 1 
ATOM   9247  C  "C1'" . DA  I 6  160  ? 188.004 264.186 107.996 1.00 0.00   ?  87   DA  I "C1'" 1 
ATOM   9248  N  N9    . DA  I 6  160  ? 186.599 263.838 107.794 1.00 20.00  ?  87   DA  I N9    1 
ATOM   9249  C  C8    . DA  I 6  160  ? 185.510 264.503 108.284 1.00 20.00  ?  87   DA  I C8    1 
ATOM   9250  N  N7    . DA  I 6  160  ? 184.364 263.957 107.954 1.00 20.00  ?  87   DA  I N7    1 
ATOM   9251  C  C5    . DA  I 6  160  ? 184.726 262.855 107.198 1.00 20.00  ?  87   DA  I C5    1 
ATOM   9252  C  C6    . DA  I 6  160  ? 183.968 261.858 106.550 1.00 20.00  ?  87   DA  I C6    1 
ATOM   9253  N  N6    . DA  I 6  160  ? 182.632 261.823 106.570 1.00 20.00  ?  87   DA  I N6    1 
ATOM   9254  N  N1    . DA  I 6  160  ? 184.639 260.898 105.879 1.00 20.00  ?  87   DA  I N1    1 
ATOM   9255  C  C2    . DA  I 6  160  ? 185.978 260.941 105.859 1.00 20.00  ?  87   DA  I C2    1 
ATOM   9256  N  N3    . DA  I 6  160  ? 186.797 261.823 106.433 1.00 20.00  ?  87   DA  I N3    1 
ATOM   9257  C  C4    . DA  I 6  160  ? 186.100 262.764 107.091 1.00 20.00  ?  87   DA  I C4    1 
ATOM   9258  P  P     . DT  I 6  161  ? 191.595 265.684 106.826 1.00 0.00   ?  88   DT  I P     1 
ATOM   9259  O  OP1   . DT  I 6  161  ? 192.999 265.342 107.146 1.00 0.00   ?  88   DT  I OP1   1 
ATOM   9260  O  OP2   . DT  I 6  161  ? 191.258 267.044 106.351 1.00 0.00   ?  88   DT  I OP2   1 
ATOM   9261  O  "O5'" . DT  I 6  161  ? 191.040 264.634 105.755 1.00 0.00   ?  88   DT  I "O5'" 1 
ATOM   9262  C  "C5'" . DT  I 6  161  ? 191.343 264.792 104.376 1.00 0.00   ?  88   DT  I "C5'" 1 
ATOM   9263  C  "C4'" . DT  I 6  161  ? 190.995 263.532 103.605 1.00 0.00   ?  88   DT  I "C4'" 1 
ATOM   9264  O  "O4'" . DT  I 6  161  ? 189.666 263.083 103.983 1.00 0.00   ?  88   DT  I "O4'" 1 
ATOM   9265  C  "C3'" . DT  I 6  161  ? 190.979 263.689 102.083 1.00 0.00   ?  88   DT  I "C3'" 1 
ATOM   9266  O  "O3'" . DT  I 6  161  ? 191.594 262.563 101.469 1.00 0.00   ?  88   DT  I "O3'" 1 
ATOM   9267  C  "C2'" . DT  I 6  161  ? 189.490 263.767 101.753 1.00 0.00   ?  88   DT  I "C2'" 1 
ATOM   9268  C  "C1'" . DT  I 6  161  ? 188.888 262.874 102.827 1.00 0.00   ?  88   DT  I "C1'" 1 
ATOM   9269  N  N1    . DT  I 6  161  ? 187.468 263.207 103.143 1.00 20.00  ?  88   DT  I N1    1 
ATOM   9270  C  C2    . DT  I 6  161  ? 186.466 262.383 102.686 1.00 20.00  ?  88   DT  I C2    1 
ATOM   9271  O  O2    . DT  I 6  161  ? 186.674 261.377 102.032 1.00 20.00  ?  88   DT  I O2    1 
ATOM   9272  N  N3    . DT  I 6  161  ? 185.199 262.780 103.025 1.00 20.00  ?  88   DT  I N3    1 
ATOM   9273  C  C4    . DT  I 6  161  ? 184.842 263.896 103.759 1.00 20.00  ?  88   DT  I C4    1 
ATOM   9274  O  O4    . DT  I 6  161  ? 183.673 264.168 104.013 1.00 20.00  ?  88   DT  I O4    1 
ATOM   9275  C  C5    . DT  I 6  161  ? 185.941 264.719 104.206 1.00 20.00  ?  88   DT  I C5    1 
ATOM   9276  C  C7    . DT  I 6  161  ? 185.676 265.957 105.010 1.00 20.00  ?  88   DT  I C7    1 
ATOM   9277  C  C6    . DT  I 6  161  ? 187.186 264.340 103.879 1.00 20.00  ?  88   DT  I C6    1 
ATOM   9278  P  P     . DA  I 6  162  ? 192.027 262.622 99.922  1.00 0.00   ?  89   DA  I P     1 
ATOM   9279  O  OP1   . DA  I 6  162  ? 193.325 261.924 99.792  1.00 0.00   ?  89   DA  I OP1   1 
ATOM   9280  O  OP2   . DA  I 6  162  ? 191.897 264.025 99.472  1.00 0.00   ?  89   DA  I OP2   1 
ATOM   9281  O  "O5'" . DA  I 6  162  ? 190.902 261.763 99.177  1.00 0.00   ?  89   DA  I "O5'" 1 
ATOM   9282  C  "C5'" . DA  I 6  162  ? 190.907 261.659 97.758  1.00 0.00   ?  89   DA  I "C5'" 1 
ATOM   9283  C  "C4'" . DA  I 6  162  ? 189.986 260.544 97.299  1.00 0.00   ?  89   DA  I "C4'" 1 
ATOM   9284  O  "O4'" . DA  I 6  162  ? 188.792 260.542 98.120  1.00 0.00   ?  89   DA  I "O4'" 1 
ATOM   9285  C  "C3'" . DA  I 6  162  ? 189.487 260.671 95.870  1.00 0.00   ?  89   DA  I "C3'" 1 
ATOM   9286  O  "O3'" . DA  I 6  162  ? 189.161 259.387 95.352  1.00 0.00   ?  89   DA  I "O3'" 1 
ATOM   9287  C  "C2'" . DA  I 6  162  ? 188.244 261.534 96.042  1.00 0.00   ?  89   DA  I "C2'" 1 
ATOM   9288  C  "C1'" . DA  I 6  162  ? 187.691 261.026 97.374  1.00 0.00   ?  89   DA  I "C1'" 1 
ATOM   9289  N  N9    . DA  I 6  162  ? 187.022 262.062 98.156  1.00 0.00   ?  89   DA  I N9    1 
ATOM   9290  C  C8    . DA  I 6  162  ? 187.609 263.111 98.807  1.00 0.00   ?  89   DA  I C8    1 
ATOM   9291  N  N7    . DA  I 6  162  ? 186.757 263.890 99.431  1.00 0.00   ?  89   DA  I N7    1 
ATOM   9292  C  C5    . DA  I 6  162  ? 185.526 263.312 99.171  1.00 0.00   ?  89   DA  I C5    1 
ATOM   9293  C  C6    . DA  I 6  162  ? 184.213 263.658 99.551  1.00 0.00   ?  89   DA  I C6    1 
ATOM   9294  N  N6    . DA  I 6  162  ? 183.921 264.722 100.308 1.00 0.00   ?  89   DA  I N6    1 
ATOM   9295  N  N1    . DA  I 6  162  ? 183.209 262.866 99.121  1.00 0.00   ?  89   DA  I N1    1 
ATOM   9296  C  C2    . DA  I 6  162  ? 183.505 261.804 98.364  1.00 0.00   ?  89   DA  I C2    1 
ATOM   9297  N  N3    . DA  I 6  162  ? 184.695 261.378 97.944  1.00 0.00   ?  89   DA  I N3    1 
ATOM   9298  C  C4    . DA  I 6  162  ? 185.672 262.184 98.386  1.00 0.00   ?  89   DA  I C4    1 
ATOM   9299  P  P     . DT  J 7  47   ? 173.656 265.322 98.384  1.00 0.00   ?  -89  DT  J P     1 
ATOM   9300  O  OP1   . DT  J 7  47   ? 172.593 265.512 97.371  1.00 0.00   ?  -89  DT  J OP1   1 
ATOM   9301  O  OP2   . DT  J 7  47   ? 173.313 265.313 99.824  1.00 0.00   ?  -89  DT  J OP2   1 
ATOM   9302  O  "O5'" . DT  J 7  47   ? 174.452 263.974 98.057  1.00 0.00   ?  -89  DT  J "O5'" 1 
ATOM   9303  C  "C5'" . DT  J 7  47   ? 174.254 262.817 98.861  1.00 0.00   ?  -89  DT  J "C5'" 1 
ATOM   9304  C  "C4'" . DT  J 7  47   ? 175.107 261.664 98.366  1.00 0.00   ?  -89  DT  J "C4'" 1 
ATOM   9305  O  "O4'" . DT  J 7  47   ? 176.475 262.124 98.187  1.00 0.00   ?  -89  DT  J "O4'" 1 
ATOM   9306  C  "C3'" . DT  J 7  47   ? 175.199 260.478 99.321  1.00 0.00   ?  -89  DT  J "C3'" 1 
ATOM   9307  O  "O3'" . DT  J 7  47   ? 175.404 259.270 98.589  1.00 0.00   ?  -89  DT  J "O3'" 1 
ATOM   9308  C  "C2'" . DT  J 7  47   ? 176.422 260.838 100.147 1.00 0.00   ?  -89  DT  J "C2'" 1 
ATOM   9309  C  "C1'" . DT  J 7  47   ? 177.327 261.431 99.076  1.00 0.00   ?  -89  DT  J "C1'" 1 
ATOM   9310  N  N1    . DT  J 7  47   ? 178.339 262.381 99.617  1.00 0.00   ?  -89  DT  J N1    1 
ATOM   9311  C  C2    . DT  J 7  47   ? 179.674 262.138 99.393  1.00 0.00   ?  -89  DT  J C2    1 
ATOM   9312  O  O2    . DT  J 7  47   ? 180.081 261.177 98.766  1.00 0.00   ?  -89  DT  J O2    1 
ATOM   9313  N  N3    . DT  J 7  47   ? 180.523 263.062 99.940  1.00 0.00   ?  -89  DT  J N3    1 
ATOM   9314  C  C4    . DT  J 7  47   ? 180.180 264.184 100.671 1.00 0.00   ?  -89  DT  J C4    1 
ATOM   9315  O  O4    . DT  J 7  47   ? 181.021 264.958 101.118 1.00 0.00   ?  -89  DT  J O4    1 
ATOM   9316  C  C5    . DT  J 7  47