data_5OAQ
# 
_entry.id   5OAQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5OAQ         
WWPDB D_1200005488 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5OAQ 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Kallen, J.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_id_ASTM           PRCIEI 
_citation.journal_id_CSD            0795 
_citation.journal_id_ISSN           1469-896X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            26 
_citation.language                  ? 
_citation.page_first                2399 
_citation.page_last                 2409 
_citation.title                     'Effect of the acylation of TEAD4 on its interaction with co-activators YAP and TAZ.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1002/pro.3312 
_citation.pdbx_database_id_PubMed   28960584 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mesrouze, Y.'   1  ? 
primary 'Meyerhofer, M.' 2  ? 
primary 'Bokhovchuk, F.' 3  ? 
primary 'Fontana, P.'    4  ? 
primary 'Zimmermann, C.' 5  ? 
primary 'Martin, T.'     6  ? 
primary 'Delaunay, C.'   7  ? 
primary 'Izaac, A.'      8  ? 
primary 'Kallen, J.'     9  ? 
primary 'Schmelzle, T.'  10 ? 
primary 'Erdmann, D.'    11 ? 
primary 'Chene, P.'      12 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5OAQ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     59.012 
_cell.length_a_esd                 ? 
_cell.length_b                     59.012 
_cell.length_b_esd                 ? 
_cell.length_c                     159.559 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5OAQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcriptional enhancer factor TEF-3' 25597.838 1   ? ? 'C-terminal domain, YAP binding domain' ? 
2 polymer     syn 'Transcriptional coactivator YAP1'      4650.309  1   ? ? ?                                       ? 
3 non-polymer syn GLYCEROL                                92.094    1   ? ? ?                                       ? 
4 non-polymer syn 'MYRISTIC ACID'                         228.371   1   ? ? ?                                       ? 
5 water       nat water                                   18.015    115 ? ? ?                                       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'TEA domain family member 4,TEAD-4,Transcription factor 13-like 1,Transcription factor RTEF-1' 
2 'Yes-associated protein 1,Protein yorkie homolog,Yes-associated protein YAP65 homolog'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFF
LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFI
HKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
;
;GPRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFF
LVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFI
HKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
;
A ? 
2 'polypeptide(L)' no no DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   ARG n 
1 4   SER n 
1 5   VAL n 
1 6   ALA n 
1 7   SER n 
1 8   SER n 
1 9   LYS n 
1 10  LEU n 
1 11  TRP n 
1 12  MET n 
1 13  LEU n 
1 14  GLU n 
1 15  PHE n 
1 16  SER n 
1 17  ALA n 
1 18  PHE n 
1 19  LEU n 
1 20  GLU n 
1 21  GLN n 
1 22  GLN n 
1 23  GLN n 
1 24  ASP n 
1 25  PRO n 
1 26  ASP n 
1 27  THR n 
1 28  TYR n 
1 29  ASN n 
1 30  LYS n 
1 31  HIS n 
1 32  LEU n 
1 33  PHE n 
1 34  VAL n 
1 35  HIS n 
1 36  ILE n 
1 37  GLY n 
1 38  GLN n 
1 39  SER n 
1 40  SER n 
1 41  PRO n 
1 42  SER n 
1 43  TYR n 
1 44  SER n 
1 45  ASP n 
1 46  PRO n 
1 47  TYR n 
1 48  LEU n 
1 49  GLU n 
1 50  ALA n 
1 51  VAL n 
1 52  ASP n 
1 53  ILE n 
1 54  ARG n 
1 55  GLN n 
1 56  ILE n 
1 57  TYR n 
1 58  ASP n 
1 59  LYS n 
1 60  PHE n 
1 61  PRO n 
1 62  GLU n 
1 63  LYS n 
1 64  LYS n 
1 65  GLY n 
1 66  GLY n 
1 67  LEU n 
1 68  LYS n 
1 69  ASP n 
1 70  LEU n 
1 71  PHE n 
1 72  GLU n 
1 73  ARG n 
1 74  GLY n 
1 75  PRO n 
1 76  SER n 
1 77  ASN n 
1 78  ALA n 
1 79  PHE n 
1 80  PHE n 
1 81  LEU n 
1 82  VAL n 
1 83  LYS n 
1 84  PHE n 
1 85  TRP n 
1 86  ALA n 
1 87  ASP n 
1 88  LEU n 
1 89  ASN n 
1 90  THR n 
1 91  ASN n 
1 92  ILE n 
1 93  GLU n 
1 94  ASP n 
1 95  GLU n 
1 96  GLY n 
1 97  SER n 
1 98  SER n 
1 99  PHE n 
1 100 TYR n 
1 101 GLY n 
1 102 VAL n 
1 103 SER n 
1 104 SER n 
1 105 GLN n 
1 106 TYR n 
1 107 GLU n 
1 108 SER n 
1 109 PRO n 
1 110 GLU n 
1 111 ASN n 
1 112 MET n 
1 113 ILE n 
1 114 ILE n 
1 115 THR n 
1 116 CYS n 
1 117 SER n 
1 118 THR n 
1 119 LYS n 
1 120 VAL n 
1 121 CYS n 
1 122 SER n 
1 123 PHE n 
1 124 GLY n 
1 125 LYS n 
1 126 GLN n 
1 127 VAL n 
1 128 VAL n 
1 129 GLU n 
1 130 LYS n 
1 131 VAL n 
1 132 GLU n 
1 133 THR n 
1 134 GLU n 
1 135 TYR n 
1 136 ALA n 
1 137 ARG n 
1 138 TYR n 
1 139 GLU n 
1 140 ASN n 
1 141 GLY n 
1 142 HIS n 
1 143 TYR n 
1 144 SER n 
1 145 TYR n 
1 146 ARG n 
1 147 ILE n 
1 148 HIS n 
1 149 ARG n 
1 150 SER n 
1 151 PRO n 
1 152 LEU n 
1 153 CYS n 
1 154 GLU n 
1 155 TYR n 
1 156 MET n 
1 157 ILE n 
1 158 ASN n 
1 159 PHE n 
1 160 ILE n 
1 161 HIS n 
1 162 LYS n 
1 163 LEU n 
1 164 LYS n 
1 165 HIS n 
1 166 LEU n 
1 167 PRO n 
1 168 GLU n 
1 169 LYS n 
1 170 TYR n 
1 171 MET n 
1 172 MET n 
1 173 ASN n 
1 174 SER n 
1 175 VAL n 
1 176 LEU n 
1 177 GLU n 
1 178 ASN n 
1 179 PHE n 
1 180 THR n 
1 181 ILE n 
1 182 LEU n 
1 183 GLN n 
1 184 VAL n 
1 185 VAL n 
1 186 THR n 
1 187 ASN n 
1 188 ARG n 
1 189 ASP n 
1 190 THR n 
1 191 GLN n 
1 192 GLU n 
1 193 THR n 
1 194 LEU n 
1 195 LEU n 
1 196 CYS n 
1 197 ILE n 
1 198 ALA n 
1 199 TYR n 
1 200 VAL n 
1 201 PHE n 
1 202 GLU n 
1 203 VAL n 
1 204 SER n 
1 205 ALA n 
1 206 SER n 
1 207 GLU n 
1 208 HIS n 
1 209 GLY n 
1 210 ALA n 
1 211 GLN n 
1 212 HIS n 
1 213 HIS n 
1 214 ILE n 
1 215 TYR n 
1 216 ARG n 
1 217 LEU n 
1 218 VAL n 
1 219 LYS n 
1 220 GLU n 
2 1   ASP n 
2 2   SER n 
2 3   GLU n 
2 4   THR n 
2 5   ASP n 
2 6   LEU n 
2 7   GLU n 
2 8   ALA n 
2 9   LEU n 
2 10  PHE n 
2 11  ASN n 
2 12  ALA n 
2 13  VAL n 
2 14  MET n 
2 15  ASN n 
2 16  PRO n 
2 17  LYS n 
2 18  THR n 
2 19  ALA n 
2 20  ASN n 
2 21  VAL n 
2 22  PRO n 
2 23  GLN n 
2 24  THR n 
2 25  VAL n 
2 26  PRO n 
2 27  MET n 
2 28  ARG n 
2 29  LEU n 
2 30  ARG n 
2 31  LYS n 
2 32  LEU n 
2 33  PRO n 
2 34  ASP n 
2 35  SER n 
2 36  PHE n 
2 37  PHE n 
2 38  LYS n 
2 39  PRO n 
2 40  PRO n 
2 41  GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   220 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TEAD4, RTEF1, TCF13L1, TEF3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET28-derived vector' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       41 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TEAD4_HUMAN Q15561 ? 1 
;RSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLV
KFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHK
LKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
;
217 
2 UNP YAP1_HUMAN  P46937 ? 2 DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE 60  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5OAQ A 3 ? 220 ? Q15561 217 ? 434 ? 217 434 
2 2 5OAQ L 1 ? 41  ? P46937 60  ? 100 ? 60  100 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5OAQ GLY A 1 ? UNP Q15561 ? ? 'expression tag' 215 1 
1 5OAQ PRO A 2 ? UNP Q15561 ? ? 'expression tag' 216 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
MYR non-polymer         . 'MYRISTIC ACID' ?                               'C14 H28 O2'     228.371 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5OAQ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.31 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.66 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '15% PEG 3350,2% tacsimate, 0.1M NaCitrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-02-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI 111 channel' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.99999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.99999 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            33.600 
_reflns.entry_id                         5OAQ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.950 
_reflns.d_resolution_low                 19.750 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       21390 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.800 
_reflns.pdbx_Rmerge_I_obs                0.072 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            28.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.075 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1.000 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.950 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            1.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            1.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -1.9900 
_refine.B_iso_max                                54.020 
_refine.B_iso_mean                               29.5820 
_refine.B_iso_min                                15.880 
_refine.correlation_coeff_Fo_to_Fc               0.9350 
_refine.correlation_coeff_Fo_to_Fc_free          0.9320 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5OAQ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.9500 
_refine.ls_d_res_low                             19.7500 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20319 
_refine.ls_number_reflns_R_free                  1070 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9900 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2304 
_refine.ls_R_factor_R_free                       0.2521 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2293 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3KYS 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.1970 
_refine.pdbx_overall_ESU_R_Free                  0.1640 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             3.6770 
_refine.overall_SU_ML                            0.1070 
_refine.overall_SU_R_Cruickshank_DPI             0.1966 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.9500 
_refine_hist.d_res_low                        19.7500 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             115 
_refine_hist.number_atoms_total               2131 
_refine_hist.pdbx_number_residues_total       244 
_refine_hist.pdbx_B_iso_mean_ligand           43.36 
_refine_hist.pdbx_B_iso_mean_solvent          35.07 
_refine_hist.pdbx_number_atoms_protein        1995 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.022  2115 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 1.255  1.959  2870 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 5.899  5.000  259  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 34.581 24.272 103  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 12.749 15.000 370  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 19.422 15.000 10   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.084  0.200  314  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.014  0.021  1605 ? r_gen_planes_refined   ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.9500 
_refine_ls_shell.d_res_low                        2.0000 
_refine_ls_shell.number_reflns_all                1522 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             76 
_refine_ls_shell.number_reflns_R_work             1446 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2740 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2440 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5OAQ 
_struct.title                        'TEAD4 COMPLEXED WITH YAP PEPTIDE AND MYRISTATE (COVALENTLY BOUND)' 
_struct.pdbx_descriptor              'Transcriptional enhancer factor TEF-3, Transcriptional coactivator YAP1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5OAQ 
_struct_keywords.text            'OTHER, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ARG A 54  ? PHE A 60  ? ARG A 268 PHE A 274 5 ? 7  
HELX_P HELX_P2 AA2 GLY A 66  ? GLY A 74  ? GLY A 280 GLY A 288 1 ? 9  
HELX_P HELX_P3 AA3 PRO A 75  ? ASN A 77  ? PRO A 289 ASN A 291 5 ? 3  
HELX_P HELX_P4 AA4 CYS A 153 ? HIS A 165 ? CYS A 367 HIS A 379 1 ? 13 
HELX_P HELX_P5 AA5 GLU A 168 ? GLU A 177 ? GLU A 382 GLU A 391 1 ? 10 
HELX_P HELX_P6 AA6 ASP B 5   ? ASN B 15  ? ASP L 64  ASN L 74  1 ? 11 
HELX_P HELX_P7 AA7 PRO B 16  ? ALA B 19  ? PRO L 75  ALA L 78  5 ? 4  
HELX_P HELX_P8 AA8 PRO B 26  ? ARG B 30  ? PRO L 85  ARG L 89  5 ? 5  
HELX_P HELX_P9 AA9 PRO B 33  ? LYS B 38  ? PRO L 92  LYS L 97  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        one 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            153 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           D 
_struct_conn.ptnr2_label_comp_id           MYR 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           C1 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             367 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            MYR 
_struct_conn.ptnr2_auth_seq_id             502 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.782 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           74 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            288 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    75 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     289 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.53 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 27  ? ILE A 36  ? THR A 241 ILE A 250 
AA1 2 TRP A 11  ? ASP A 24  ? TRP A 225 ASP A 238 
AA1 3 SER A 98  ? SER A 108 ? SER A 312 SER A 322 
AA1 4 HIS A 142 ? PRO A 151 ? HIS A 356 PRO A 365 
AA1 5 ARG A 137 ? GLU A 139 ? ARG A 351 GLU A 353 
AA2 1 ALA A 50  ? ASP A 52  ? ALA A 264 ASP A 266 
AA2 2 GLN A 211 ? VAL A 218 ? GLN A 425 VAL A 432 
AA2 3 PHE A 79  ? ALA A 86  ? PHE A 293 ALA A 300 
AA2 4 THR A 193 ? VAL A 203 ? THR A 407 VAL A 417 
AA2 5 PHE A 179 ? ASN A 187 ? PHE A 393 ASN A 401 
AA2 6 ILE A 114 ? SER A 122 ? ILE A 328 SER A 336 
AA2 7 LYS A 125 ? GLU A 134 ? LYS A 339 GLU A 348 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASN A 29  ? O ASN A 243 N GLN A 21  ? N GLN A 235 
AA1 2 3 N GLU A 20  ? N GLU A 234 O PHE A 99  ? O PHE A 313 
AA1 3 4 N SER A 108 ? N SER A 322 O TYR A 143 ? O TYR A 357 
AA1 4 5 O HIS A 142 ? O HIS A 356 N GLU A 139 ? N GLU A 353 
AA2 1 2 N VAL A 51  ? N VAL A 265 O ARG A 216 ? O ARG A 430 
AA2 2 3 O TYR A 215 ? O TYR A 429 N LEU A 81  ? N LEU A 295 
AA2 3 4 N VAL A 82  ? N VAL A 296 O ALA A 198 ? O ALA A 412 
AA2 4 5 O ILE A 197 ? O ILE A 411 N GLN A 183 ? N GLN A 397 
AA2 5 6 O THR A 180 ? O THR A 394 N CYS A 121 ? N CYS A 335 
AA2 6 7 N VAL A 120 ? N VAL A 334 O VAL A 127 ? O VAL A 341 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 501 ? 8 'binding site for residue GOL A 501' 
AC2 Software A MYR 502 ? 4 'binding site for residue MYR A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 ASP A 58  ? ASP A 272 . ? 1_555 ? 
2  AC1 8 LYS A 59  ? LYS A 273 . ? 1_555 ? 
3  AC1 8 PHE A 123 ? PHE A 337 . ? 1_555 ? 
4  AC1 8 GLY A 124 ? GLY A 338 . ? 1_555 ? 
5  AC1 8 ASN A 178 ? ASN A 392 . ? 1_555 ? 
6  AC1 8 PRO B 22  ? PRO L 81  . ? 7_555 ? 
7  AC1 8 GLN B 23  ? GLN L 82  . ? 7_555 ? 
8  AC1 8 THR B 24  ? THR L 83  . ? 1_555 ? 
9  AC2 4 VAL A 102 ? VAL A 316 . ? 1_555 ? 
10 AC2 4 THR A 118 ? THR A 332 . ? 1_555 ? 
11 AC2 4 CYS A 153 ? CYS A 367 . ? 1_555 ? 
12 AC2 4 ILE A 181 ? ILE A 395 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5OAQ 
_atom_sites.fract_transf_matrix[1][1]   0.016946 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016946 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006267 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 3   ? -5.477  -18.789 28.786 1.00 36.21 ? 217 ARG A N   1 
ATOM   2    C CA  . ARG A 1 3   ? -4.136  -18.411 28.239 1.00 36.29 ? 217 ARG A CA  1 
ATOM   3    C C   . ARG A 1 3   ? -4.168  -18.260 26.714 1.00 35.08 ? 217 ARG A C   1 
ATOM   4    O O   . ARG A 1 3   ? -3.798  -19.174 25.986 1.00 35.58 ? 217 ARG A O   1 
ATOM   5    C CB  . ARG A 1 3   ? -3.039  -19.397 28.695 1.00 36.84 ? 217 ARG A CB  1 
ATOM   6    C CG  . ARG A 1 3   ? -3.375  -20.882 28.598 1.00 39.68 ? 217 ARG A CG  1 
ATOM   7    C CD  . ARG A 1 3   ? -2.121  -21.760 28.739 1.00 44.02 ? 217 ARG A CD  1 
ATOM   8    N NE  . ARG A 1 3   ? -1.367  -21.846 27.486 1.00 46.86 ? 217 ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 3   ? -0.140  -22.355 27.361 1.00 48.41 ? 217 ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 3   ? 0.506   -22.837 28.417 1.00 49.53 ? 217 ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 3   ? 0.449   -22.382 26.169 1.00 48.76 ? 217 ARG A NH2 1 
ATOM   12   N N   . SER A 1 4   ? -4.629  -17.102 26.247 1.00 34.04 ? 218 SER A N   1 
ATOM   13   C CA  . SER A 1 4   ? -4.742  -16.831 24.806 1.00 32.56 ? 218 SER A CA  1 
ATOM   14   C C   . SER A 1 4   ? -3.404  -16.540 24.126 1.00 31.28 ? 218 SER A C   1 
ATOM   15   O O   . SER A 1 4   ? -3.018  -17.231 23.188 1.00 30.77 ? 218 SER A O   1 
ATOM   16   C CB  . SER A 1 4   ? -5.720  -15.683 24.543 1.00 32.65 ? 218 SER A CB  1 
ATOM   17   O OG  . SER A 1 4   ? -6.980  -15.945 25.134 1.00 33.14 ? 218 SER A OG  1 
ATOM   18   N N   . VAL A 1 5   ? -2.707  -15.503 24.579 1.00 30.02 ? 219 VAL A N   1 
ATOM   19   C CA  . VAL A 1 5   ? -1.429  -15.142 23.959 1.00 28.84 ? 219 VAL A CA  1 
ATOM   20   C C   . VAL A 1 5   ? -0.358  -15.986 24.630 1.00 27.93 ? 219 VAL A C   1 
ATOM   21   O O   . VAL A 1 5   ? 0.339   -15.526 25.545 1.00 26.80 ? 219 VAL A O   1 
ATOM   22   C CB  . VAL A 1 5   ? -1.100  -13.619 24.079 1.00 28.66 ? 219 VAL A CB  1 
ATOM   23   C CG1 . VAL A 1 5   ? 0.202   -13.290 23.343 1.00 28.57 ? 219 VAL A CG1 1 
ATOM   24   C CG2 . VAL A 1 5   ? -2.229  -12.777 23.539 1.00 29.73 ? 219 VAL A CG2 1 
ATOM   25   N N   . ALA A 1 6   ? -0.247  -17.226 24.167 1.00 27.18 ? 220 ALA A N   1 
ATOM   26   C CA  . ALA A 1 6   ? 0.636   -18.205 24.779 1.00 27.10 ? 220 ALA A CA  1 
ATOM   27   C C   . ALA A 1 6   ? 1.166   -19.179 23.740 1.00 27.13 ? 220 ALA A C   1 
ATOM   28   O O   . ALA A 1 6   ? 0.398   -19.780 22.977 1.00 26.82 ? 220 ALA A O   1 
ATOM   29   C CB  . ALA A 1 6   ? -0.095  -18.964 25.909 1.00 27.08 ? 220 ALA A CB  1 
ATOM   30   N N   . SER A 1 7   ? 2.484   -19.309 23.713 1.00 26.71 ? 221 SER A N   1 
ATOM   31   C CA  . SER A 1 7   ? 3.161   -20.322 22.921 1.00 26.95 ? 221 SER A CA  1 
ATOM   32   C C   . SER A 1 7   ? 3.435   -21.503 23.844 1.00 26.91 ? 221 SER A C   1 
ATOM   33   O O   . SER A 1 7   ? 2.861   -21.581 24.932 1.00 26.77 ? 221 SER A O   1 
ATOM   34   C CB  . SER A 1 7   ? 4.464   -19.758 22.355 1.00 26.50 ? 221 SER A CB  1 
ATOM   35   O OG  . SER A 1 7   ? 5.386   -19.446 23.400 1.00 27.17 ? 221 SER A OG  1 
ATOM   36   N N   . SER A 1 8   ? 4.318   -22.407 23.432 1.00 27.24 ? 222 SER A N   1 
ATOM   37   C CA  A SER A 1 8   ? 4.706   -23.539 24.274 0.50 27.56 ? 222 SER A CA  1 
ATOM   38   C CA  B SER A 1 8   ? 4.683   -23.530 24.293 0.50 27.48 ? 222 SER A CA  1 
ATOM   39   C C   . SER A 1 8   ? 5.559   -23.078 25.454 1.00 27.42 ? 222 SER A C   1 
ATOM   40   O O   . SER A 1 8   ? 5.566   -23.711 26.513 1.00 28.07 ? 222 SER A O   1 
ATOM   41   C CB  A SER A 1 8   ? 5.475   -24.581 23.457 0.50 27.60 ? 222 SER A CB  1 
ATOM   42   C CB  B SER A 1 8   ? 5.387   -24.626 23.497 0.50 27.47 ? 222 SER A CB  1 
ATOM   43   O OG  A SER A 1 8   ? 6.764   -24.102 23.101 0.50 28.04 ? 222 SER A OG  1 
ATOM   44   O OG  B SER A 1 8   ? 4.511   -25.184 22.543 0.50 27.45 ? 222 SER A OG  1 
ATOM   45   N N   . LYS A 1 9   ? 6.282   -21.975 25.263 1.00 27.03 ? 223 LYS A N   1 
ATOM   46   C CA  . LYS A 1 9   ? 7.251   -21.510 26.255 1.00 26.50 ? 223 LYS A CA  1 
ATOM   47   C C   . LYS A 1 9   ? 6.897   -20.260 27.065 1.00 25.30 ? 223 LYS A C   1 
ATOM   48   O O   . LYS A 1 9   ? 7.540   -20.009 28.087 1.00 24.11 ? 223 LYS A O   1 
ATOM   49   C CB  . LYS A 1 9   ? 8.643   -21.322 25.628 1.00 27.22 ? 223 LYS A CB  1 
ATOM   50   C CG  . LYS A 1 9   ? 9.075   -22.395 24.635 1.00 29.72 ? 223 LYS A CG  1 
ATOM   51   C CD  . LYS A 1 9   ? 9.618   -23.650 25.299 1.00 32.15 ? 223 LYS A CD  1 
ATOM   52   C CE  . LYS A 1 9   ? 10.014  -24.697 24.248 1.00 33.30 ? 223 LYS A CE  1 
ATOM   53   N NZ  . LYS A 1 9   ? 11.171  -24.283 23.383 1.00 33.29 ? 223 LYS A NZ  1 
ATOM   54   N N   . LEU A 1 10  ? 5.918   -19.464 26.626 1.00 23.91 ? 224 LEU A N   1 
ATOM   55   C CA  . LEU A 1 10  ? 5.649   -18.183 27.292 1.00 23.39 ? 224 LEU A CA  1 
ATOM   56   C C   . LEU A 1 10  ? 4.222   -17.736 27.083 1.00 23.63 ? 224 LEU A C   1 
ATOM   57   O O   . LEU A 1 10  ? 3.654   -17.914 26.006 1.00 23.34 ? 224 LEU A O   1 
ATOM   58   C CB  . LEU A 1 10  ? 6.606   -17.083 26.777 1.00 22.55 ? 224 LEU A CB  1 
ATOM   59   C CG  . LEU A 1 10  ? 6.716   -15.780 27.578 1.00 22.09 ? 224 LEU A CG  1 
ATOM   60   C CD1 . LEU A 1 10  ? 7.409   -16.000 28.931 1.00 20.03 ? 224 LEU A CD1 1 
ATOM   61   C CD2 . LEU A 1 10  ? 7.492   -14.748 26.778 1.00 21.18 ? 224 LEU A CD2 1 
ATOM   62   N N   . TRP A 1 11  ? 3.653   -17.139 28.121 1.00 24.12 ? 225 TRP A N   1 
ATOM   63   C CA  . TRP A 1 11  ? 2.283   -16.673 28.072 1.00 24.51 ? 225 TRP A CA  1 
ATOM   64   C C   . TRP A 1 11  ? 2.247   -15.247 28.580 1.00 24.43 ? 225 TRP A C   1 
ATOM   65   O O   . TRP A 1 11  ? 2.818   -14.944 29.642 1.00 23.87 ? 225 TRP A O   1 
ATOM   66   C CB  . TRP A 1 11  ? 1.393   -17.601 28.912 1.00 25.39 ? 225 TRP A CB  1 
ATOM   67   C CG  . TRP A 1 11  ? 0.033   -17.058 29.274 1.00 27.96 ? 225 TRP A CG  1 
ATOM   68   C CD1 . TRP A 1 11  ? -0.828  -16.336 28.472 1.00 29.84 ? 225 TRP A CD1 1 
ATOM   69   C CD2 . TRP A 1 11  ? -0.640  -17.235 30.525 1.00 30.55 ? 225 TRP A CD2 1 
ATOM   70   N NE1 . TRP A 1 11  ? -1.982  -16.035 29.171 1.00 31.11 ? 225 TRP A NE1 1 
ATOM   71   C CE2 . TRP A 1 11  ? -1.895  -16.581 30.427 1.00 31.41 ? 225 TRP A CE2 1 
ATOM   72   C CE3 . TRP A 1 11  ? -0.307  -17.891 31.722 1.00 31.48 ? 225 TRP A CE3 1 
ATOM   73   C CZ2 . TRP A 1 11  ? -2.816  -16.563 31.481 1.00 33.23 ? 225 TRP A CZ2 1 
ATOM   74   C CZ3 . TRP A 1 11  ? -1.222  -17.871 32.773 1.00 33.45 ? 225 TRP A CZ3 1 
ATOM   75   C CH2 . TRP A 1 11  ? -2.460  -17.205 32.646 1.00 34.79 ? 225 TRP A CH2 1 
ATOM   76   N N   . MET A 1 12  ? 1.620   -14.364 27.797 1.00 23.88 ? 226 MET A N   1 
ATOM   77   C CA  . MET A 1 12  ? 1.423   -12.996 28.215 1.00 23.99 ? 226 MET A CA  1 
ATOM   78   C C   . MET A 1 12  ? 0.067   -12.915 28.896 1.00 24.51 ? 226 MET A C   1 
ATOM   79   O O   . MET A 1 12  ? -0.973  -13.046 28.236 1.00 24.75 ? 226 MET A O   1 
ATOM   80   C CB  . MET A 1 12  ? 1.506   -12.022 27.039 1.00 24.20 ? 226 MET A CB  1 
ATOM   81   C CG  . MET A 1 12  ? 1.505   -10.559 27.487 1.00 24.19 ? 226 MET A CG  1 
ATOM   82   S SD  . MET A 1 12  ? 1.651   -9.352  26.143 1.00 25.84 ? 226 MET A SD  1 
ATOM   83   C CE  . MET A 1 12  ? 0.049   -9.529  25.346 1.00 24.36 ? 226 MET A CE  1 
ATOM   84   N N   . LEU A 1 13  ? 0.101   -12.723 30.214 1.00 24.24 ? 227 LEU A N   1 
ATOM   85   C CA  A LEU A 1 13  ? -1.087  -12.691 31.077 0.50 24.77 ? 227 LEU A CA  1 
ATOM   86   C CA  B LEU A 1 13  ? -1.119  -12.713 31.006 0.50 24.58 ? 227 LEU A CA  1 
ATOM   87   C C   . LEU A 1 13  ? -1.704  -11.310 31.129 1.00 24.63 ? 227 LEU A C   1 
ATOM   88   O O   . LEU A 1 13  ? -2.917  -11.157 31.328 1.00 25.17 ? 227 LEU A O   1 
ATOM   89   C CB  A LEU A 1 13  ? -0.725  -13.053 32.526 0.50 24.62 ? 227 LEU A CB  1 
ATOM   90   C CB  B LEU A 1 13  ? -0.868  -13.343 32.387 0.50 24.41 ? 227 LEU A CB  1 
ATOM   91   C CG  A LEU A 1 13  ? -0.305  -14.449 32.962 0.50 24.95 ? 227 LEU A CG  1 
ATOM   92   C CG  B LEU A 1 13  ? 0.166   -12.674 33.293 0.50 23.73 ? 227 LEU A CG  1 
ATOM   93   C CD1 A LEU A 1 13  ? 1.167   -14.642 32.714 0.50 24.27 ? 227 LEU A CD1 1 
ATOM   94   C CD1 B LEU A 1 13  ? -0.528  -12.042 34.490 0.50 24.48 ? 227 LEU A CD1 1 
ATOM   95   C CD2 A LEU A 1 13  ? -0.611  -14.617 34.439 0.50 25.20 ? 227 LEU A CD2 1 
ATOM   96   C CD2 B LEU A 1 13  ? 1.199   -13.690 33.756 0.50 23.81 ? 227 LEU A CD2 1 
ATOM   97   N N   . GLU A 1 14  ? -0.855  -10.296 30.987 1.00 24.91 ? 228 GLU A N   1 
ATOM   98   C CA  . GLU A 1 14  ? -1.277  -8.908  31.155 1.00 25.75 ? 228 GLU A CA  1 
ATOM   99   C C   . GLU A 1 14  ? -0.560  -8.002  30.165 1.00 25.44 ? 228 GLU A C   1 
ATOM   100  O O   . GLU A 1 14  ? 0.617   -8.183  29.894 1.00 24.44 ? 228 GLU A O   1 
ATOM   101  C CB  . GLU A 1 14  ? -0.982  -8.448  32.590 1.00 26.44 ? 228 GLU A CB  1 
ATOM   102  C CG  . GLU A 1 14  ? -1.513  -7.074  32.952 1.00 31.06 ? 228 GLU A CG  1 
ATOM   103  C CD  . GLU A 1 14  ? -0.439  -5.992  32.983 1.00 37.04 ? 228 GLU A CD  1 
ATOM   104  O OE1 . GLU A 1 14  ? 0.652   -6.207  33.587 1.00 38.30 ? 228 GLU A OE1 1 
ATOM   105  O OE2 . GLU A 1 14  ? -0.708  -4.902  32.427 1.00 40.11 ? 228 GLU A OE2 1 
ATOM   106  N N   . PHE A 1 15  ? -1.284  -7.027  29.630 1.00 25.03 ? 229 PHE A N   1 
ATOM   107  C CA  . PHE A 1 15  ? -0.679  -5.977  28.823 1.00 25.71 ? 229 PHE A CA  1 
ATOM   108  C C   . PHE A 1 15  ? -1.597  -4.794  28.972 1.00 26.02 ? 229 PHE A C   1 
ATOM   109  O O   . PHE A 1 15  ? -2.787  -4.925  28.713 1.00 26.36 ? 229 PHE A O   1 
ATOM   110  C CB  . PHE A 1 15  ? -0.615  -6.408  27.350 1.00 25.15 ? 229 PHE A CB  1 
ATOM   111  C CG  . PHE A 1 15  ? -0.033  -5.367  26.424 1.00 26.30 ? 229 PHE A CG  1 
ATOM   112  C CD1 . PHE A 1 15  ? 1.302   -5.410  26.077 1.00 25.76 ? 229 PHE A CD1 1 
ATOM   113  C CD2 . PHE A 1 15  ? -0.840  -4.353  25.883 1.00 27.67 ? 229 PHE A CD2 1 
ATOM   114  C CE1 . PHE A 1 15  ? 1.853   -4.450  25.214 1.00 27.08 ? 229 PHE A CE1 1 
ATOM   115  C CE2 . PHE A 1 15  ? -0.304  -3.396  25.028 1.00 26.39 ? 229 PHE A CE2 1 
ATOM   116  C CZ  . PHE A 1 15  ? 1.047   -3.450  24.689 1.00 25.98 ? 229 PHE A CZ  1 
ATOM   117  N N   . SER A 1 16  ? -1.072  -3.652  29.401 1.00 26.61 ? 230 SER A N   1 
ATOM   118  C CA  . SER A 1 16  ? -1.878  -2.430  29.381 1.00 27.72 ? 230 SER A CA  1 
ATOM   119  C C   . SER A 1 16  ? -1.069  -1.165  29.115 1.00 27.58 ? 230 SER A C   1 
ATOM   120  O O   . SER A 1 16  ? 0.076   -1.044  29.556 1.00 28.90 ? 230 SER A O   1 
ATOM   121  C CB  . SER A 1 16  ? -2.710  -2.297  30.666 1.00 28.22 ? 230 SER A CB  1 
ATOM   122  O OG  . SER A 1 16  ? -1.895  -1.930  31.749 1.00 30.12 ? 230 SER A OG  1 
ATOM   123  N N   . ALA A 1 17  ? -1.668  -0.244  28.368 1.00 26.09 ? 231 ALA A N   1 
ATOM   124  C CA  . ALA A 1 17  ? -1.111  1.074   28.149 1.00 25.40 ? 231 ALA A CA  1 
ATOM   125  C C   . ALA A 1 17  ? -2.039  2.028   28.876 1.00 24.70 ? 231 ALA A C   1 
ATOM   126  O O   . ALA A 1 17  ? -3.265  1.919   28.760 1.00 24.25 ? 231 ALA A O   1 
ATOM   127  C CB  . ALA A 1 17  ? -1.075  1.403   26.654 1.00 25.23 ? 231 ALA A CB  1 
ATOM   128  N N   . PHE A 1 18  ? -1.462  2.945   29.635 1.00 23.90 ? 232 PHE A N   1 
ATOM   129  C CA  . PHE A 1 18  ? -2.262  3.804   30.494 1.00 24.53 ? 232 PHE A CA  1 
ATOM   130  C C   . PHE A 1 18  ? -1.682  5.194   30.628 1.00 24.75 ? 232 PHE A C   1 
ATOM   131  O O   . PHE A 1 18  ? -0.512  5.424   30.337 1.00 24.03 ? 232 PHE A O   1 
ATOM   132  C CB  . PHE A 1 18  ? -2.407  3.186   31.891 1.00 24.35 ? 232 PHE A CB  1 
ATOM   133  C CG  . PHE A 1 18  ? -1.097  2.913   32.568 1.00 24.22 ? 232 PHE A CG  1 
ATOM   134  C CD1 . PHE A 1 18  ? -0.501  3.885   33.373 1.00 24.87 ? 232 PHE A CD1 1 
ATOM   135  C CD2 . PHE A 1 18  ? -0.445  1.688   32.392 1.00 25.47 ? 232 PHE A CD2 1 
ATOM   136  C CE1 . PHE A 1 18  ? 0.722   3.634   34.007 1.00 25.11 ? 232 PHE A CE1 1 
ATOM   137  C CE2 . PHE A 1 18  ? 0.778   1.433   33.020 1.00 25.75 ? 232 PHE A CE2 1 
ATOM   138  C CZ  . PHE A 1 18  ? 1.357   2.418   33.827 1.00 24.40 ? 232 PHE A CZ  1 
ATOM   139  N N   . LEU A 1 19  ? -2.535  6.107   31.079 1.00 25.54 ? 233 LEU A N   1 
ATOM   140  C CA  . LEU A 1 19  ? -2.137  7.427   31.485 1.00 27.03 ? 233 LEU A CA  1 
ATOM   141  C C   . LEU A 1 19  ? -2.494  7.551   32.975 1.00 28.11 ? 233 LEU A C   1 
ATOM   142  O O   . LEU A 1 19  ? -3.638  7.333   33.370 1.00 27.67 ? 233 LEU A O   1 
ATOM   143  C CB  . LEU A 1 19  ? -2.870  8.488   30.645 1.00 27.17 ? 233 LEU A CB  1 
ATOM   144  C CG  . LEU A 1 19  ? -2.957  9.932   31.175 1.00 27.68 ? 233 LEU A CG  1 
ATOM   145  C CD1 . LEU A 1 19  ? -1.585  10.546  31.465 1.00 27.81 ? 233 LEU A CD1 1 
ATOM   146  C CD2 . LEU A 1 19  ? -3.744  10.821  30.215 1.00 28.67 ? 233 LEU A CD2 1 
ATOM   147  N N   . GLU A 1 20  ? -1.494  7.870   33.785 1.00 29.61 ? 234 GLU A N   1 
ATOM   148  C CA  . GLU A 1 20  ? -1.695  8.091   35.207 1.00 31.38 ? 234 GLU A CA  1 
ATOM   149  C C   . GLU A 1 20  ? -1.470  9.562   35.519 1.00 31.85 ? 234 GLU A C   1 
ATOM   150  O O   . GLU A 1 20  ? -0.436  10.130  35.168 1.00 31.86 ? 234 GLU A O   1 
ATOM   151  C CB  . GLU A 1 20  ? -0.741  7.224   36.016 1.00 31.46 ? 234 GLU A CB  1 
ATOM   152  C CG  . GLU A 1 20  ? -0.736  7.499   37.500 1.00 33.98 ? 234 GLU A CG  1 
ATOM   153  C CD  . GLU A 1 20  ? 0.327   6.692   38.197 1.00 35.92 ? 234 GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 20  ? 1.468   7.176   38.300 1.00 37.54 ? 234 GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 20  ? 0.017   5.562   38.616 1.00 37.28 ? 234 GLU A OE2 1 
ATOM   156  N N   . GLN A 1 21  ? -2.452  10.172  36.166 1.00 33.15 ? 235 GLN A N   1 
ATOM   157  C CA  . GLN A 1 21  ? -2.387  11.582  36.507 1.00 34.31 ? 235 GLN A CA  1 
ATOM   158  C C   . GLN A 1 21  ? -2.383  11.733  38.023 1.00 34.77 ? 235 GLN A C   1 
ATOM   159  O O   . GLN A 1 21  ? -3.258  11.204  38.713 1.00 33.90 ? 235 GLN A O   1 
ATOM   160  C CB  . GLN A 1 21  ? -3.538  12.362  35.842 1.00 34.76 ? 235 GLN A CB  1 
ATOM   161  C CG  . GLN A 1 21  ? -3.336  12.565  34.320 1.00 37.87 ? 235 GLN A CG  1 
ATOM   162  C CD  . GLN A 1 21  ? -4.575  13.055  33.576 1.00 41.86 ? 235 GLN A CD  1 
ATOM   163  O OE1 . GLN A 1 21  ? -5.528  12.296  33.340 1.00 44.30 ? 235 GLN A OE1 1 
ATOM   164  N NE2 . GLN A 1 21  ? -4.552  14.321  33.171 1.00 44.01 ? 235 GLN A NE2 1 
ATOM   165  N N   . GLN A 1 22  ? -1.365  12.427  38.523 1.00 35.90 ? 236 GLN A N   1 
ATOM   166  C CA  . GLN A 1 22  ? -1.213  12.679  39.946 1.00 37.85 ? 236 GLN A CA  1 
ATOM   167  C C   . GLN A 1 22  ? -1.979  13.944  40.302 1.00 38.57 ? 236 GLN A C   1 
ATOM   168  O O   . GLN A 1 22  ? -1.526  15.055  40.009 1.00 38.81 ? 236 GLN A O   1 
ATOM   169  C CB  . GLN A 1 22  ? 0.269   12.821  40.320 1.00 37.94 ? 236 GLN A CB  1 
ATOM   170  C CG  . GLN A 1 22  ? 0.508   13.081  41.816 1.00 39.49 ? 236 GLN A CG  1 
ATOM   171  C CD  . GLN A 1 22  ? 1.977   13.153  42.206 1.00 41.19 ? 236 GLN A CD  1 
ATOM   172  O OE1 . GLN A 1 22  ? 2.867   12.743  41.456 1.00 41.96 ? 236 GLN A OE1 1 
ATOM   173  N NE2 . GLN A 1 22  ? 2.235   13.659  43.405 1.00 42.13 ? 236 GLN A NE2 1 
ATOM   174  N N   . GLN A 1 23  ? -3.153  13.761  40.898 1.00 39.39 ? 237 GLN A N   1 
ATOM   175  C CA  . GLN A 1 23  ? -3.982  14.865  41.376 1.00 40.48 ? 237 GLN A CA  1 
ATOM   176  C C   . GLN A 1 23  ? -3.212  15.620  42.465 1.00 40.74 ? 237 GLN A C   1 
ATOM   177  O O   . GLN A 1 23  ? -2.841  16.788  42.289 1.00 40.88 ? 237 GLN A O   1 
ATOM   178  C CB  . GLN A 1 23  ? -5.302  14.307  41.910 1.00 41.02 ? 237 GLN A CB  1 
ATOM   179  C CG  . GLN A 1 23  ? -6.467  15.277  41.923 1.00 43.32 ? 237 GLN A CG  1 
ATOM   180  C CD  . GLN A 1 23  ? -7.785  14.593  42.241 1.00 46.05 ? 237 GLN A CD  1 
ATOM   181  O OE1 . GLN A 1 23  ? -8.205  13.655  41.546 1.00 48.17 ? 237 GLN A OE1 1 
ATOM   182  N NE2 . GLN A 1 23  ? -8.451  15.060  43.295 1.00 47.16 ? 237 GLN A NE2 1 
ATOM   183  N N   . ASP A 1 24  ? -2.958  14.930  43.577 1.00 40.64 ? 238 ASP A N   1 
ATOM   184  C CA  . ASP A 1 24  ? -2.085  15.409  44.655 1.00 40.00 ? 238 ASP A CA  1 
ATOM   185  C C   . ASP A 1 24  ? -1.156  14.255  45.086 1.00 39.18 ? 238 ASP A C   1 
ATOM   186  O O   . ASP A 1 24  ? -1.295  13.144  44.570 1.00 39.03 ? 238 ASP A O   1 
ATOM   187  C CB  . ASP A 1 24  ? -2.923  15.959  45.821 1.00 40.46 ? 238 ASP A CB  1 
ATOM   188  C CG  . ASP A 1 24  ? -3.955  14.973  46.326 1.00 40.85 ? 238 ASP A CG  1 
ATOM   189  O OD1 . ASP A 1 24  ? -5.158  15.290  46.224 1.00 41.89 ? 238 ASP A OD1 1 
ATOM   190  O OD2 . ASP A 1 24  ? -3.576  13.886  46.828 1.00 41.49 ? 238 ASP A OD2 1 
ATOM   191  N N   . PRO A 1 25  ? -0.200  14.503  46.017 1.00 38.34 ? 239 PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 0.764   13.449  46.395 1.00 37.32 ? 239 PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 0.141   12.122  46.844 1.00 36.01 ? 239 PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 0.826   11.103  46.828 1.00 35.91 ? 239 PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 1.543   14.075  47.558 1.00 37.74 ? 239 PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 1.368   15.541  47.402 1.00 38.10 ? 239 PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 0.036   15.755  46.759 1.00 38.47 ? 239 PRO A CD  1 
ATOM   198  N N   . ASP A 1 26  ? -1.139  12.134  47.220 1.00 34.24 ? 240 ASP A N   1 
ATOM   199  C CA  . ASP A 1 26  ? -1.822  10.913  47.660 1.00 33.32 ? 240 ASP A CA  1 
ATOM   200  C C   . ASP A 1 26  ? -2.913  10.398  46.721 1.00 32.61 ? 240 ASP A C   1 
ATOM   201  O O   . ASP A 1 26  ? -3.588  9.406   47.023 1.00 32.62 ? 240 ASP A O   1 
ATOM   202  C CB  . ASP A 1 26  ? -2.416  11.122  49.055 1.00 33.00 ? 240 ASP A CB  1 
ATOM   203  C CG  . ASP A 1 26  ? -1.363  11.123  50.151 1.00 32.86 ? 240 ASP A CG  1 
ATOM   204  O OD1 . ASP A 1 26  ? -0.206  10.746  49.895 1.00 32.34 ? 240 ASP A OD1 1 
ATOM   205  O OD2 . ASP A 1 26  ? -1.704  11.505  51.284 1.00 32.50 ? 240 ASP A OD2 1 
ATOM   206  N N   . THR A 1 27  ? -3.099  11.063  45.587 1.00 31.77 ? 241 THR A N   1 
ATOM   207  C CA  . THR A 1 27  ? -4.247  10.764  44.733 1.00 31.66 ? 241 THR A CA  1 
ATOM   208  C C   . THR A 1 27  ? -3.818  10.659  43.281 1.00 31.02 ? 241 THR A C   1 
ATOM   209  O O   . THR A 1 27  ? -3.227  11.586  42.736 1.00 29.85 ? 241 THR A O   1 
ATOM   210  C CB  . THR A 1 27  ? -5.345  11.836  44.886 1.00 32.22 ? 241 THR A CB  1 
ATOM   211  O OG1 . THR A 1 27  ? -5.533  12.115  46.282 1.00 33.58 ? 241 THR A OG1 1 
ATOM   212  C CG2 . THR A 1 27  ? -6.672  11.359  44.267 1.00 32.50 ? 241 THR A CG2 1 
ATOM   213  N N   . TYR A 1 28  ? -4.102  9.504   42.682 1.00 30.97 ? 242 TYR A N   1 
ATOM   214  C CA  . TYR A 1 28  ? -3.718  9.208   41.305 1.00 30.89 ? 242 TYR A CA  1 
ATOM   215  C C   . TYR A 1 28  ? -4.917  8.695   40.532 1.00 30.82 ? 242 TYR A C   1 
ATOM   216  O O   . TYR A 1 28  ? -5.608  7.777   40.975 1.00 31.10 ? 242 TYR A O   1 
ATOM   217  C CB  . TYR A 1 28  ? -2.606  8.158   41.267 1.00 31.43 ? 242 TYR A CB  1 
ATOM   218  C CG  . TYR A 1 28  ? -1.328  8.603   41.937 1.00 32.14 ? 242 TYR A CG  1 
ATOM   219  C CD1 . TYR A 1 28  ? -0.261  9.099   41.182 1.00 32.25 ? 242 TYR A CD1 1 
ATOM   220  C CD2 . TYR A 1 28  ? -1.186  8.538   43.330 1.00 31.48 ? 242 TYR A CD2 1 
ATOM   221  C CE1 . TYR A 1 28  ? 0.915   9.515   41.795 1.00 34.79 ? 242 TYR A CE1 1 
ATOM   222  C CE2 . TYR A 1 28  ? -0.018  8.960   43.948 1.00 33.10 ? 242 TYR A CE2 1 
ATOM   223  C CZ  . TYR A 1 28  ? 1.023   9.446   43.180 1.00 34.64 ? 242 TYR A CZ  1 
ATOM   224  O OH  . TYR A 1 28  ? 2.177   9.858   43.793 1.00 36.69 ? 242 TYR A OH  1 
ATOM   225  N N   . ASN A 1 29  ? -5.160  9.291   39.371 1.00 30.35 ? 243 ASN A N   1 
ATOM   226  C CA  . ASN A 1 29  ? -6.198  8.810   38.478 1.00 30.08 ? 243 ASN A CA  1 
ATOM   227  C C   . ASN A 1 29  ? -5.550  8.104   37.300 1.00 29.59 ? 243 ASN A C   1 
ATOM   228  O O   . ASN A 1 29  ? -4.629  8.636   36.677 1.00 29.89 ? 243 ASN A O   1 
ATOM   229  C CB  . ASN A 1 29  ? -7.077  9.966   38.022 1.00 30.16 ? 243 ASN A CB  1 
ATOM   230  C CG  . ASN A 1 29  ? -7.757  10.653  39.188 1.00 32.90 ? 243 ASN A CG  1 
ATOM   231  O OD1 . ASN A 1 29  ? -8.458  10.009  39.968 1.00 34.45 ? 243 ASN A OD1 1 
ATOM   232  N ND2 . ASN A 1 29  ? -7.526  11.958  39.338 1.00 35.18 ? 243 ASN A ND2 1 
ATOM   233  N N   . LYS A 1 30  ? -6.013  6.895   37.019 1.00 28.85 ? 244 LYS A N   1 
ATOM   234  C CA  . LYS A 1 30  ? -5.422  6.097   35.956 1.00 29.02 ? 244 LYS A CA  1 
ATOM   235  C C   . LYS A 1 30  ? -6.458  5.774   34.894 1.00 28.29 ? 244 LYS A C   1 
ATOM   236  O O   . LYS A 1 30  ? -7.523  5.241   35.203 1.00 28.14 ? 244 LYS A O   1 
ATOM   237  C CB  . LYS A 1 30  ? -4.803  4.813   36.523 1.00 29.05 ? 244 LYS A CB  1 
ATOM   238  C CG  . LYS A 1 30  ? -4.225  3.880   35.462 1.00 32.13 ? 244 LYS A CG  1 
ATOM   239  C CD  . LYS A 1 30  ? -3.863  2.521   36.032 1.00 34.87 ? 244 LYS A CD  1 
ATOM   240  C CE  . LYS A 1 30  ? -2.417  2.478   36.440 1.00 37.11 ? 244 LYS A CE  1 
ATOM   241  N NZ  . LYS A 1 30  ? -2.073  1.175   37.071 1.00 39.23 ? 244 LYS A NZ  1 
ATOM   242  N N   . HIS A 1 31  ? -6.125  6.097   33.643 1.00 27.73 ? 245 HIS A N   1 
ATOM   243  C CA  . HIS A 1 31  ? -6.942  5.717   32.503 1.00 26.44 ? 245 HIS A CA  1 
ATOM   244  C C   . HIS A 1 31  ? -6.256  4.650   31.656 1.00 25.83 ? 245 HIS A C   1 
ATOM   245  O O   . HIS A 1 31  ? -5.115  4.817   31.258 1.00 24.99 ? 245 HIS A O   1 
ATOM   246  C CB  . HIS A 1 31  ? -7.237  6.938   31.646 1.00 26.95 ? 245 HIS A CB  1 
ATOM   247  C CG  . HIS A 1 31  ? -7.880  6.608   30.338 1.00 27.39 ? 245 HIS A CG  1 
ATOM   248  N ND1 . HIS A 1 31  ? -9.234  6.378   30.216 1.00 29.36 ? 245 HIS A ND1 1 
ATOM   249  C CD2 . HIS A 1 31  ? -7.357  6.448   29.098 1.00 27.68 ? 245 HIS A CD2 1 
ATOM   250  C CE1 . HIS A 1 31  ? -9.519  6.108   28.954 1.00 28.08 ? 245 HIS A CE1 1 
ATOM   251  N NE2 . HIS A 1 31  ? -8.400  6.144   28.256 1.00 27.11 ? 245 HIS A NE2 1 
ATOM   252  N N   . LEU A 1 32  ? -6.963  3.564   31.365 1.00 25.21 ? 246 LEU A N   1 
ATOM   253  C CA  . LEU A 1 32  ? -6.414  2.521   30.490 1.00 25.07 ? 246 LEU A CA  1 
ATOM   254  C C   . LEU A 1 32  ? -6.783  2.816   29.040 1.00 24.66 ? 246 LEU A C   1 
ATOM   255  O O   . LEU A 1 32  ? -7.968  2.981   28.733 1.00 24.75 ? 246 LEU A O   1 
ATOM   256  C CB  . LEU A 1 32  ? -6.925  1.135   30.898 1.00 25.03 ? 246 LEU A CB  1 
ATOM   257  C CG  . LEU A 1 32  ? -6.586  0.642   32.313 1.00 26.44 ? 246 LEU A CG  1 
ATOM   258  C CD1 . LEU A 1 32  ? -7.023  -0.799  32.489 1.00 24.71 ? 246 LEU A CD1 1 
ATOM   259  C CD2 . LEU A 1 32  ? -5.079  0.810   32.598 1.00 26.20 ? 246 LEU A CD2 1 
ATOM   260  N N   . PHE A 1 33  ? -5.783  2.903   28.161 1.00 23.46 ? 247 PHE A N   1 
ATOM   261  C CA  . PHE A 1 33  ? -6.052  3.070   26.724 1.00 23.25 ? 247 PHE A CA  1 
ATOM   262  C C   . PHE A 1 33  ? -6.428  1.737   26.103 1.00 23.21 ? 247 PHE A C   1 
ATOM   263  O O   . PHE A 1 33  ? -7.362  1.659   25.304 1.00 23.36 ? 247 PHE A O   1 
ATOM   264  C CB  . PHE A 1 33  ? -4.839  3.638   25.985 1.00 23.14 ? 247 PHE A CB  1 
ATOM   265  C CG  . PHE A 1 33  ? -4.463  5.033   26.399 1.00 23.37 ? 247 PHE A CG  1 
ATOM   266  C CD1 . PHE A 1 33  ? -5.249  6.127   26.025 1.00 22.88 ? 247 PHE A CD1 1 
ATOM   267  C CD2 . PHE A 1 33  ? -3.297  5.262   27.120 1.00 24.39 ? 247 PHE A CD2 1 
ATOM   268  C CE1 . PHE A 1 33  ? -4.887  7.422   26.393 1.00 22.36 ? 247 PHE A CE1 1 
ATOM   269  C CE2 . PHE A 1 33  ? -2.925  6.555   27.485 1.00 24.40 ? 247 PHE A CE2 1 
ATOM   270  C CZ  . PHE A 1 33  ? -3.739  7.636   27.123 1.00 23.18 ? 247 PHE A CZ  1 
ATOM   271  N N   . VAL A 1 34  ? -5.658  0.700   26.450 1.00 23.18 ? 248 VAL A N   1 
ATOM   272  C CA  . VAL A 1 34  ? -5.884  -0.669  25.999 1.00 22.94 ? 248 VAL A CA  1 
ATOM   273  C C   . VAL A 1 34  ? -5.482  -1.611  27.150 1.00 23.84 ? 248 VAL A C   1 
ATOM   274  O O   . VAL A 1 34  ? -4.656  -1.255  27.985 1.00 23.08 ? 248 VAL A O   1 
ATOM   275  C CB  . VAL A 1 34  ? -5.072  -1.027  24.701 1.00 23.11 ? 248 VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 34  ? -5.589  -0.246  23.479 1.00 23.19 ? 248 VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 34  ? -3.556  -0.794  24.872 1.00 22.28 ? 248 VAL A CG2 1 
ATOM   278  N N   . HIS A 1 35  ? -6.067  -2.800  27.184 1.00 24.77 ? 249 HIS A N   1 
ATOM   279  C CA  . HIS A 1 35  ? -5.758  -3.765  28.235 1.00 26.72 ? 249 HIS A CA  1 
ATOM   280  C C   . HIS A 1 35  ? -6.145  -5.163  27.842 1.00 27.35 ? 249 HIS A C   1 
ATOM   281  O O   . HIS A 1 35  ? -7.191  -5.384  27.218 1.00 27.68 ? 249 HIS A O   1 
ATOM   282  C CB  . HIS A 1 35  ? -6.401  -3.380  29.583 1.00 27.34 ? 249 HIS A CB  1 
ATOM   283  C CG  . HIS A 1 35  ? -7.892  -3.212  29.540 1.00 29.90 ? 249 HIS A CG  1 
ATOM   284  N ND1 . HIS A 1 35  ? -8.768  -4.251  29.779 1.00 32.94 ? 249 HIS A ND1 1 
ATOM   285  C CD2 . HIS A 1 35  ? -8.661  -2.114  29.342 1.00 31.22 ? 249 HIS A CD2 1 
ATOM   286  C CE1 . HIS A 1 35  ? -10.011 -3.808  29.703 1.00 32.92 ? 249 HIS A CE1 1 
ATOM   287  N NE2 . HIS A 1 35  ? -9.975  -2.513  29.447 1.00 33.03 ? 249 HIS A NE2 1 
ATOM   288  N N   . ILE A 1 36  ? -5.264  -6.096  28.188 1.00 28.39 ? 250 ILE A N   1 
ATOM   289  C CA  . ILE A 1 36  ? -5.520  -7.532  28.149 1.00 29.12 ? 250 ILE A CA  1 
ATOM   290  C C   . ILE A 1 36  ? -5.124  -7.978  29.556 1.00 30.37 ? 250 ILE A C   1 
ATOM   291  O O   . ILE A 1 36  ? -4.061  -7.590  30.064 1.00 29.74 ? 250 ILE A O   1 
ATOM   292  C CB  . ILE A 1 36  ? -4.628  -8.264  27.105 1.00 29.28 ? 250 ILE A CB  1 
ATOM   293  C CG1 . ILE A 1 36  ? -4.927  -7.782  25.677 1.00 28.23 ? 250 ILE A CG1 1 
ATOM   294  C CG2 . ILE A 1 36  ? -4.802  -9.777  27.188 1.00 29.15 ? 250 ILE A CG2 1 
ATOM   295  C CD1 . ILE A 1 36  ? -3.885  -8.215  24.654 1.00 28.63 ? 250 ILE A CD1 1 
ATOM   296  N N   . GLY A 1 37  ? -5.973  -8.767  30.203 1.00 31.04 ? 251 GLY A N   1 
ATOM   297  C CA  . GLY A 1 37  ? -5.691  -9.142  31.586 1.00 32.88 ? 251 GLY A CA  1 
ATOM   298  C C   . GLY A 1 37  ? -6.897  -9.635  32.340 1.00 33.71 ? 251 GLY A C   1 
ATOM   299  O O   . GLY A 1 37  ? -7.126  -10.840 32.389 1.00 35.33 ? 251 GLY A O   1 
ATOM   300  N N   . LEU A 1 48  ? -9.709  -19.193 19.740 1.00 31.58 ? 262 LEU A N   1 
ATOM   301  C CA  . LEU A 1 48  ? -8.997  -18.213 18.901 1.00 31.42 ? 262 LEU A CA  1 
ATOM   302  C C   . LEU A 1 48  ? -9.198  -18.382 17.388 1.00 30.72 ? 262 LEU A C   1 
ATOM   303  O O   . LEU A 1 48  ? -8.705  -19.333 16.796 1.00 31.40 ? 262 LEU A O   1 
ATOM   304  C CB  . LEU A 1 48  ? -7.496  -18.205 19.229 1.00 31.14 ? 262 LEU A CB  1 
ATOM   305  C CG  . LEU A 1 48  ? -6.942  -17.077 20.121 1.00 31.98 ? 262 LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 48  ? -7.694  -16.932 21.413 1.00 31.16 ? 262 LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 48  ? -5.435  -17.218 20.382 1.00 31.50 ? 262 LEU A CD2 1 
ATOM   308  N N   . GLU A 1 49  ? -9.892  -17.438 16.763 1.00 30.91 ? 263 GLU A N   1 
ATOM   309  C CA  . GLU A 1 49  ? -9.977  -17.387 15.293 1.00 30.37 ? 263 GLU A CA  1 
ATOM   310  C C   . GLU A 1 49  ? -8.599  -17.190 14.655 1.00 29.85 ? 263 GLU A C   1 
ATOM   311  O O   . GLU A 1 49  ? -7.671  -16.672 15.296 1.00 29.14 ? 263 GLU A O   1 
ATOM   312  C CB  . GLU A 1 49  ? -10.863 -16.236 14.841 1.00 30.85 ? 263 GLU A CB  1 
ATOM   313  C CG  . GLU A 1 49  ? -12.238 -16.158 15.461 1.00 32.60 ? 263 GLU A CG  1 
ATOM   314  C CD  . GLU A 1 49  ? -13.058 -15.065 14.818 1.00 35.62 ? 263 GLU A CD  1 
ATOM   315  O OE1 . GLU A 1 49  ? -13.379 -15.188 13.620 1.00 38.60 ? 263 GLU A OE1 1 
ATOM   316  O OE2 . GLU A 1 49  ? -13.364 -14.072 15.495 1.00 38.60 ? 263 GLU A OE2 1 
ATOM   317  N N   . ALA A 1 50  ? -8.477  -17.602 13.395 1.00 29.03 ? 264 ALA A N   1 
ATOM   318  C CA  . ALA A 1 50  ? -7.210  -17.527 12.666 1.00 28.76 ? 264 ALA A CA  1 
ATOM   319  C C   . ALA A 1 50  ? -7.211  -16.399 11.630 1.00 28.04 ? 264 ALA A C   1 
ATOM   320  O O   . ALA A 1 50  ? -8.228  -16.142 10.976 1.00 28.24 ? 264 ALA A O   1 
ATOM   321  C CB  . ALA A 1 50  ? -6.913  -18.857 12.000 1.00 28.72 ? 264 ALA A CB  1 
ATOM   322  N N   . VAL A 1 51  ? -6.081  -15.719 11.487 1.00 27.05 ? 265 VAL A N   1 
ATOM   323  C CA  . VAL A 1 51  ? -5.928  -14.707 10.434 1.00 26.44 ? 265 VAL A CA  1 
ATOM   324  C C   . VAL A 1 51  ? -4.783  -15.113 9.515  1.00 26.08 ? 265 VAL A C   1 
ATOM   325  O O   . VAL A 1 51  ? -3.729  -15.569 9.976  1.00 25.86 ? 265 VAL A O   1 
ATOM   326  C CB  . VAL A 1 51  ? -5.704  -13.273 10.991 1.00 26.47 ? 265 VAL A CB  1 
ATOM   327  C CG1 . VAL A 1 51  ? -5.311  -12.291 9.868  1.00 26.47 ? 265 VAL A CG1 1 
ATOM   328  C CG2 . VAL A 1 51  ? -6.961  -12.761 11.692 1.00 27.29 ? 265 VAL A CG2 1 
ATOM   329  N N   . ASP A 1 52  ? -5.018  -14.960 8.213  1.00 25.40 ? 266 ASP A N   1 
ATOM   330  C CA  . ASP A 1 52  ? -4.016  -15.195 7.192  1.00 24.78 ? 266 ASP A CA  1 
ATOM   331  C C   . ASP A 1 52  ? -3.001  -14.066 7.304  1.00 24.08 ? 266 ASP A C   1 
ATOM   332  O O   . ASP A 1 52  ? -3.317  -12.915 7.008  1.00 23.50 ? 266 ASP A O   1 
ATOM   333  C CB  . ASP A 1 52  ? -4.674  -15.178 5.799  1.00 25.34 ? 266 ASP A CB  1 
ATOM   334  C CG  . ASP A 1 52  ? -3.713  -15.555 4.676  1.00 25.76 ? 266 ASP A CG  1 
ATOM   335  O OD1 . ASP A 1 52  ? -2.474  -15.572 4.863  1.00 26.33 ? 266 ASP A OD1 1 
ATOM   336  O OD2 . ASP A 1 52  ? -4.218  -15.851 3.577  1.00 29.75 ? 266 ASP A OD2 1 
ATOM   337  N N   . ILE A 1 53  ? -1.784  -14.417 7.734  1.00 23.34 ? 267 ILE A N   1 
ATOM   338  C CA  . ILE A 1 53  ? -0.720  -13.450 7.977  1.00 22.85 ? 267 ILE A CA  1 
ATOM   339  C C   . ILE A 1 53  ? -0.367  -12.658 6.700  1.00 23.18 ? 267 ILE A C   1 
ATOM   340  O O   . ILE A 1 53  ? 0.003   -11.486 6.774  1.00 23.20 ? 267 ILE A O   1 
ATOM   341  C CB  . ILE A 1 53  ? 0.543   -14.140 8.611  1.00 22.64 ? 267 ILE A CB  1 
ATOM   342  C CG1 . ILE A 1 53  ? 1.497   -13.096 9.211  1.00 21.56 ? 267 ILE A CG1 1 
ATOM   343  C CG2 . ILE A 1 53  ? 1.264   -15.051 7.598  1.00 22.08 ? 267 ILE A CG2 1 
ATOM   344  C CD1 . ILE A 1 53  ? 2.603   -13.701 10.109 1.00 19.97 ? 267 ILE A CD1 1 
ATOM   345  N N   . ARG A 1 54  ? -0.502  -13.292 5.535  1.00 23.44 ? 268 ARG A N   1 
ATOM   346  C CA  . ARG A 1 54  ? -0.239  -12.608 4.255  1.00 23.83 ? 268 ARG A CA  1 
ATOM   347  C C   . ARG A 1 54  ? -1.116  -11.366 4.041  1.00 23.71 ? 268 ARG A C   1 
ATOM   348  O O   . ARG A 1 54  ? -0.708  -10.440 3.329  1.00 24.22 ? 268 ARG A O   1 
ATOM   349  C CB  . ARG A 1 54  ? -0.398  -13.577 3.080  1.00 24.13 ? 268 ARG A CB  1 
ATOM   350  C CG  . ARG A 1 54  ? 0.529   -14.779 3.145  1.00 24.12 ? 268 ARG A CG  1 
ATOM   351  C CD  . ARG A 1 54  ? 0.200   -15.806 2.058  1.00 28.25 ? 268 ARG A CD  1 
ATOM   352  N NE  . ARG A 1 54  ? -1.159  -16.323 2.171  1.00 28.97 ? 268 ARG A NE  1 
ATOM   353  C CZ  . ARG A 1 54  ? -1.790  -16.985 1.202  1.00 30.85 ? 268 ARG A CZ  1 
ATOM   354  N NH1 . ARG A 1 54  ? -1.179  -17.218 0.050  1.00 30.51 ? 268 ARG A NH1 1 
ATOM   355  N NH2 . ARG A 1 54  ? -3.036  -17.404 1.385  1.00 31.20 ? 268 ARG A NH2 1 
ATOM   356  N N   . GLN A 1 55  ? -2.297  -11.340 4.666  1.00 23.74 ? 269 GLN A N   1 
ATOM   357  C CA  . GLN A 1 55  ? -3.187  -10.165 4.608  1.00 23.72 ? 269 GLN A CA  1 
ATOM   358  C C   . GLN A 1 55  ? -2.667  -8.953  5.389  1.00 23.61 ? 269 GLN A C   1 
ATOM   359  O O   . GLN A 1 55  ? -3.163  -7.839  5.187  1.00 23.10 ? 269 GLN A O   1 
ATOM   360  C CB  . GLN A 1 55  ? -4.612  -10.494 5.082  1.00 23.98 ? 269 GLN A CB  1 
ATOM   361  C CG  . GLN A 1 55  ? -5.386  -11.486 4.213  1.00 24.81 ? 269 GLN A CG  1 
ATOM   362  C CD  . GLN A 1 55  ? -5.747  -10.900 2.857  1.00 24.37 ? 269 GLN A CD  1 
ATOM   363  O OE1 . GLN A 1 55  ? -6.151  -9.743  2.759  1.00 24.53 ? 269 GLN A OE1 1 
ATOM   364  N NE2 . GLN A 1 55  ? -5.574  -11.689 1.805  1.00 25.72 ? 269 GLN A NE2 1 
ATOM   365  N N   . ILE A 1 56  ? -1.688  -9.154  6.279  1.00 23.36 ? 270 ILE A N   1 
ATOM   366  C CA  . ILE A 1 56  ? -1.177  -8.041  7.098  1.00 22.86 ? 270 ILE A CA  1 
ATOM   367  C C   . ILE A 1 56  ? 0.305   -7.752  6.937  1.00 22.61 ? 270 ILE A C   1 
ATOM   368  O O   . ILE A 1 56  ? 0.797   -6.792  7.526  1.00 22.22 ? 270 ILE A O   1 
ATOM   369  C CB  . ILE A 1 56  ? -1.486  -8.195  8.631  1.00 23.05 ? 270 ILE A CB  1 
ATOM   370  C CG1 . ILE A 1 56  ? -0.755  -9.414  9.223  1.00 23.53 ? 270 ILE A CG1 1 
ATOM   371  C CG2 . ILE A 1 56  ? -2.993  -8.209  8.870  1.00 24.13 ? 270 ILE A CG2 1 
ATOM   372  C CD1 . ILE A 1 56  ? -0.446  -9.296  10.710 1.00 23.26 ? 270 ILE A CD1 1 
ATOM   373  N N   . TYR A 1 57  ? 1.024   -8.579  6.167  1.00 22.62 ? 271 TYR A N   1 
ATOM   374  C CA  . TYR A 1 57  ? 2.462   -8.377  5.986  1.00 22.77 ? 271 TYR A CA  1 
ATOM   375  C C   . TYR A 1 57  ? 2.836   -6.959  5.541  1.00 22.71 ? 271 TYR A C   1 
ATOM   376  O O   . TYR A 1 57  ? 3.917   -6.468  5.897  1.00 22.90 ? 271 TYR A O   1 
ATOM   377  C CB  . TYR A 1 57  ? 3.037   -9.366  4.966  1.00 23.15 ? 271 TYR A CB  1 
ATOM   378  C CG  . TYR A 1 57  ? 3.398   -10.758 5.445  1.00 23.67 ? 271 TYR A CG  1 
ATOM   379  C CD1 . TYR A 1 57  ? 3.864   -10.998 6.741  1.00 24.53 ? 271 TYR A CD1 1 
ATOM   380  C CD2 . TYR A 1 57  ? 3.338   -11.834 4.557  1.00 25.02 ? 271 TYR A CD2 1 
ATOM   381  C CE1 . TYR A 1 57  ? 4.222   -12.277 7.145  1.00 24.27 ? 271 TYR A CE1 1 
ATOM   382  C CE2 . TYR A 1 57  ? 3.692   -13.115 4.951  1.00 26.74 ? 271 TYR A CE2 1 
ATOM   383  C CZ  . TYR A 1 57  ? 4.139   -13.337 6.243  1.00 26.96 ? 271 TYR A CZ  1 
ATOM   384  O OH  . TYR A 1 57  ? 4.491   -14.627 6.622  1.00 26.06 ? 271 TYR A OH  1 
ATOM   385  N N   . ASP A 1 58  ? 1.968   -6.286  4.771  1.00 22.00 ? 272 ASP A N   1 
ATOM   386  C CA  . ASP A 1 58  ? 2.284   -4.919  4.304  1.00 21.48 ? 272 ASP A CA  1 
ATOM   387  C C   . ASP A 1 58  ? 2.299   -3.849  5.405  1.00 21.29 ? 272 ASP A C   1 
ATOM   388  O O   . ASP A 1 58  ? 2.884   -2.782  5.214  1.00 20.49 ? 272 ASP A O   1 
ATOM   389  C CB  . ASP A 1 58  ? 1.359   -4.458  3.161  1.00 21.58 ? 272 ASP A CB  1 
ATOM   390  C CG  . ASP A 1 58  ? -0.094  -4.364  3.598  1.00 22.35 ? 272 ASP A CG  1 
ATOM   391  O OD1 . ASP A 1 58  ? -0.721  -3.284  3.445  1.00 23.95 ? 272 ASP A OD1 1 
ATOM   392  O OD2 . ASP A 1 58  ? -0.603  -5.368  4.119  1.00 23.09 ? 272 ASP A OD2 1 
ATOM   393  N N   . LYS A 1 59  ? 1.690   -4.155  6.548  1.00 21.35 ? 273 LYS A N   1 
ATOM   394  C CA  . LYS A 1 59  ? 1.591   -3.219  7.673  1.00 21.95 ? 273 LYS A CA  1 
ATOM   395  C C   . LYS A 1 59  ? 2.757   -3.344  8.645  1.00 22.27 ? 273 LYS A C   1 
ATOM   396  O O   . LYS A 1 59  ? 2.811   -2.627  9.648  1.00 22.11 ? 273 LYS A O   1 
ATOM   397  C CB  . LYS A 1 59  ? 0.277   -3.438  8.431  1.00 22.04 ? 273 LYS A CB  1 
ATOM   398  C CG  . LYS A 1 59  ? -0.969  -3.308  7.577  1.00 23.81 ? 273 LYS A CG  1 
ATOM   399  C CD  . LYS A 1 59  ? -1.293  -1.847  7.309  1.00 28.74 ? 273 LYS A CD  1 
ATOM   400  C CE  . LYS A 1 59  ? -2.719  -1.720  6.795  1.00 28.31 ? 273 LYS A CE  1 
ATOM   401  N NZ  . LYS A 1 59  ? -2.944  -0.370  6.285  1.00 31.58 ? 273 LYS A NZ  1 
ATOM   402  N N   . PHE A 1 60  ? 3.690   -4.247  8.344  1.00 23.10 ? 274 PHE A N   1 
ATOM   403  C CA  . PHE A 1 60  ? 4.819   -4.505  9.238  1.00 23.83 ? 274 PHE A CA  1 
ATOM   404  C C   . PHE A 1 60  ? 6.133   -4.559  8.481  1.00 25.26 ? 274 PHE A C   1 
ATOM   405  O O   . PHE A 1 60  ? 6.129   -4.678  7.237  1.00 24.90 ? 274 PHE A O   1 
ATOM   406  C CB  . PHE A 1 60  ? 4.565   -5.787  10.047 1.00 24.00 ? 274 PHE A CB  1 
ATOM   407  C CG  . PHE A 1 60  ? 3.374   -5.686  10.929 1.00 23.40 ? 274 PHE A CG  1 
ATOM   408  C CD1 . PHE A 1 60  ? 3.482   -5.086  12.180 1.00 23.29 ? 274 PHE A CD1 1 
ATOM   409  C CD2 . PHE A 1 60  ? 2.115   -6.104  10.480 1.00 21.98 ? 274 PHE A CD2 1 
ATOM   410  C CE1 . PHE A 1 60  ? 2.364   -4.960  12.992 1.00 20.03 ? 274 PHE A CE1 1 
ATOM   411  C CE2 . PHE A 1 60  ? 0.991   -5.972  11.284 1.00 20.74 ? 274 PHE A CE2 1 
ATOM   412  C CZ  . PHE A 1 60  ? 1.117   -5.397  12.540 1.00 21.06 ? 274 PHE A CZ  1 
ATOM   413  N N   . PRO A 1 61  ? 7.270   -4.479  9.222  1.00 26.48 ? 275 PRO A N   1 
ATOM   414  C CA  . PRO A 1 61  ? 8.583   -4.453  8.578  1.00 27.27 ? 275 PRO A CA  1 
ATOM   415  C C   . PRO A 1 61  ? 8.847   -5.729  7.795  1.00 28.06 ? 275 PRO A C   1 
ATOM   416  O O   . PRO A 1 61  ? 8.420   -6.810  8.197  1.00 28.33 ? 275 PRO A O   1 
ATOM   417  C CB  . PRO A 1 61  ? 9.569   -4.314  9.764  1.00 27.05 ? 275 PRO A CB  1 
ATOM   418  C CG  . PRO A 1 61  ? 8.748   -3.719  10.863 1.00 27.00 ? 275 PRO A CG  1 
ATOM   419  C CD  . PRO A 1 61  ? 7.387   -4.357  10.692 1.00 26.05 ? 275 PRO A CD  1 
ATOM   420  N N   . GLU A 1 62  ? 9.501   -5.571  6.652  1.00 29.52 ? 276 GLU A N   1 
ATOM   421  C CA  . GLU A 1 62  ? 9.827   -6.671  5.773  1.00 31.48 ? 276 GLU A CA  1 
ATOM   422  C C   . GLU A 1 62  ? 11.317  -6.946  5.887  1.00 32.28 ? 276 GLU A C   1 
ATOM   423  O O   . GLU A 1 62  ? 11.971  -6.401  6.774  1.00 32.80 ? 276 GLU A O   1 
ATOM   424  C CB  . GLU A 1 62  ? 9.432   -6.309  4.345  1.00 32.06 ? 276 GLU A CB  1 
ATOM   425  C CG  . GLU A 1 62  ? 7.923   -6.167  4.185  1.00 34.05 ? 276 GLU A CG  1 
ATOM   426  C CD  . GLU A 1 62  ? 7.495   -5.631  2.822  1.00 37.63 ? 276 GLU A CD  1 
ATOM   427  O OE1 . GLU A 1 62  ? 6.271   -5.668  2.548  1.00 37.93 ? 276 GLU A OE1 1 
ATOM   428  O OE2 . GLU A 1 62  ? 8.367   -5.176  2.036  1.00 38.38 ? 276 GLU A OE2 1 
ATOM   429  N N   . LYS A 1 63  ? 11.846  -7.795  5.004  1.00 33.22 ? 277 LYS A N   1 
ATOM   430  C CA  . LYS A 1 63  ? 13.273  -8.152  4.998  1.00 33.44 ? 277 LYS A CA  1 
ATOM   431  C C   . LYS A 1 63  ? 13.648  -8.995  6.220  1.00 33.51 ? 277 LYS A C   1 
ATOM   432  O O   . LYS A 1 63  ? 12.780  -9.338  7.032  1.00 33.33 ? 277 LYS A O   1 
ATOM   433  C CB  . LYS A 1 63  ? 14.162  -6.904  4.898  1.00 34.05 ? 277 LYS A CB  1 
ATOM   434  C CG  . LYS A 1 63  ? 13.969  -6.107  3.610  1.00 35.50 ? 277 LYS A CG  1 
ATOM   435  C CD  . LYS A 1 63  ? 14.959  -4.957  3.509  1.00 37.09 ? 277 LYS A CD  1 
ATOM   436  C CE  . LYS A 1 63  ? 14.342  -3.648  3.932  1.00 39.13 ? 277 LYS A CE  1 
ATOM   437  N NZ  . LYS A 1 63  ? 13.410  -3.129  2.890  1.00 41.25 ? 277 LYS A NZ  1 
ATOM   438  N N   . LYS A 1 64  ? 14.935  -9.332  6.333  1.00 33.04 ? 278 LYS A N   1 
ATOM   439  C CA  . LYS A 1 64  ? 15.442  -10.184 7.418  1.00 32.55 ? 278 LYS A CA  1 
ATOM   440  C C   . LYS A 1 64  ? 15.083  -9.600  8.783  1.00 31.56 ? 278 LYS A C   1 
ATOM   441  O O   . LYS A 1 64  ? 15.239  -8.397  9.013  1.00 31.54 ? 278 LYS A O   1 
ATOM   442  C CB  . LYS A 1 64  ? 16.964  -10.378 7.286  1.00 33.21 ? 278 LYS A CB  1 
ATOM   443  C CG  . LYS A 1 64  ? 17.575  -11.355 8.305  1.00 33.62 ? 278 LYS A CG  1 
ATOM   444  C CD  . LYS A 1 64  ? 19.097  -11.230 8.356  1.00 36.26 ? 278 LYS A CD  1 
ATOM   445  C CE  . LYS A 1 64  ? 19.671  -11.993 9.553  1.00 37.33 ? 278 LYS A CE  1 
ATOM   446  N NZ  . LYS A 1 64  ? 19.462  -13.460 9.395  1.00 39.67 ? 278 LYS A NZ  1 
ATOM   447  N N   . GLY A 1 65  ? 14.570  -10.452 9.670  1.00 30.50 ? 279 GLY A N   1 
ATOM   448  C CA  . GLY A 1 65  ? 14.123  -10.021 10.994 1.00 29.44 ? 279 GLY A CA  1 
ATOM   449  C C   . GLY A 1 65  ? 12.751  -9.357  11.013 1.00 28.71 ? 279 GLY A C   1 
ATOM   450  O O   . GLY A 1 65  ? 12.256  -8.991  12.080 1.00 28.03 ? 279 GLY A O   1 
ATOM   451  N N   . GLY A 1 66  ? 12.147  -9.188  9.833  1.00 28.07 ? 280 GLY A N   1 
ATOM   452  C CA  . GLY A 1 66  ? 10.813  -8.595  9.718  1.00 26.99 ? 280 GLY A CA  1 
ATOM   453  C C   . GLY A 1 66  ? 9.770   -9.668  9.982  1.00 26.33 ? 280 GLY A C   1 
ATOM   454  O O   . GLY A 1 66  ? 10.123  -10.819 10.256 1.00 25.69 ? 280 GLY A O   1 
ATOM   455  N N   . LEU A 1 67  ? 8.491   -9.310  9.878  1.00 25.15 ? 281 LEU A N   1 
ATOM   456  C CA  . LEU A 1 67  ? 7.417   -10.238 10.253 1.00 24.65 ? 281 LEU A CA  1 
ATOM   457  C C   . LEU A 1 67  ? 7.392   -11.548 9.461  1.00 25.01 ? 281 LEU A C   1 
ATOM   458  O O   . LEU A 1 67  ? 7.204   -12.628 10.047 1.00 23.87 ? 281 LEU A O   1 
ATOM   459  C CB  . LEU A 1 67  ? 6.046   -9.553  10.235 1.00 24.09 ? 281 LEU A CB  1 
ATOM   460  C CG  . LEU A 1 67  ? 4.823   -10.374 10.647 1.00 23.02 ? 281 LEU A CG  1 
ATOM   461  C CD1 . LEU A 1 67  ? 4.967   -10.990 12.049 1.00 20.66 ? 281 LEU A CD1 1 
ATOM   462  C CD2 . LEU A 1 67  ? 3.538   -9.520  10.540 1.00 22.16 ? 281 LEU A CD2 1 
ATOM   463  N N   . LYS A 1 68  ? 7.564   -11.452 8.139  1.00 24.24 ? 282 LYS A N   1 
ATOM   464  C CA  . LYS A 1 68  ? 7.584   -12.634 7.290  1.00 24.73 ? 282 LYS A CA  1 
ATOM   465  C C   . LYS A 1 68  ? 8.739   -13.578 7.658  1.00 24.26 ? 282 LYS A C   1 
ATOM   466  O O   . LYS A 1 68  ? 8.528   -14.768 7.822  1.00 24.49 ? 282 LYS A O   1 
ATOM   467  C CB  . LYS A 1 68  ? 7.652   -12.252 5.804  1.00 24.76 ? 282 LYS A CB  1 
ATOM   468  C CG  . LYS A 1 68  ? 7.453   -13.417 4.861  1.00 27.42 ? 282 LYS A CG  1 
ATOM   469  C CD  . LYS A 1 68  ? 7.486   -12.939 3.410  1.00 32.00 ? 282 LYS A CD  1 
ATOM   470  C CE  . LYS A 1 68  ? 7.000   -14.017 2.448  1.00 33.83 ? 282 LYS A CE  1 
ATOM   471  N NZ  . LYS A 1 68  ? 8.056   -15.006 2.096  1.00 37.05 ? 282 LYS A NZ  1 
ATOM   472  N N   . ASP A 1 69  ? 9.937   -13.018 7.781  1.00 24.50 ? 283 ASP A N   1 
ATOM   473  C CA  . ASP A 1 69  ? 11.126  -13.763 8.195  1.00 24.90 ? 283 ASP A CA  1 
ATOM   474  C C   . ASP A 1 69  ? 10.906  -14.470 9.535  1.00 24.22 ? 283 ASP A C   1 
ATOM   475  O O   . ASP A 1 69  ? 11.157  -15.668 9.640  1.00 24.00 ? 283 ASP A O   1 
ATOM   476  C CB  . ASP A 1 69  ? 12.325  -12.833 8.283  1.00 24.66 ? 283 ASP A CB  1 
ATOM   477  C CG  . ASP A 1 69  ? 13.625  -13.580 8.551  1.00 26.80 ? 283 ASP A CG  1 
ATOM   478  O OD1 . ASP A 1 69  ? 13.828  -14.671 7.973  1.00 29.31 ? 283 ASP A OD1 1 
ATOM   479  O OD2 . ASP A 1 69  ? 14.434  -13.071 9.342  1.00 27.82 ? 283 ASP A OD2 1 
ATOM   480  N N   . LEU A 1 70  ? 10.428  -13.724 10.539 1.00 24.06 ? 284 LEU A N   1 
ATOM   481  C CA  . LEU A 1 70  ? 10.149  -14.286 11.869 1.00 24.20 ? 284 LEU A CA  1 
ATOM   482  C C   . LEU A 1 70  ? 9.105   -15.381 11.796 1.00 23.90 ? 284 LEU A C   1 
ATOM   483  O O   . LEU A 1 70  ? 9.312   -16.453 12.349 1.00 23.74 ? 284 LEU A O   1 
ATOM   484  C CB  . LEU A 1 70  ? 9.697   -13.205 12.866 1.00 24.34 ? 284 LEU A CB  1 
ATOM   485  C CG  . LEU A 1 70  ? 10.699  -12.161 13.356 1.00 24.63 ? 284 LEU A CG  1 
ATOM   486  C CD1 . LEU A 1 70  ? 9.908   -10.982 13.920 1.00 25.42 ? 284 LEU A CD1 1 
ATOM   487  C CD2 . LEU A 1 70  ? 11.620  -12.735 14.414 1.00 26.67 ? 284 LEU A CD2 1 
ATOM   488  N N   . PHE A 1 71  ? 7.996   -15.126 11.101 1.00 23.88 ? 285 PHE A N   1 
ATOM   489  C CA  . PHE A 1 71  ? 6.960   -16.151 10.925 1.00 24.59 ? 285 PHE A CA  1 
ATOM   490  C C   . PHE A 1 71  ? 7.477   -17.421 10.252 1.00 24.79 ? 285 PHE A C   1 
ATOM   491  O O   . PHE A 1 71  ? 7.172   -18.529 10.707 1.00 24.57 ? 285 PHE A O   1 
ATOM   492  C CB  . PHE A 1 71  ? 5.735   -15.620 10.164 1.00 24.47 ? 285 PHE A CB  1 
ATOM   493  C CG  . PHE A 1 71  ? 4.594   -16.607 10.105 1.00 25.43 ? 285 PHE A CG  1 
ATOM   494  C CD1 . PHE A 1 71  ? 4.315   -17.300 8.926  1.00 26.92 ? 285 PHE A CD1 1 
ATOM   495  C CD2 . PHE A 1 71  ? 3.818   -16.865 11.241 1.00 24.93 ? 285 PHE A CD2 1 
ATOM   496  C CE1 . PHE A 1 71  ? 3.275   -18.227 8.871  1.00 28.27 ? 285 PHE A CE1 1 
ATOM   497  C CE2 . PHE A 1 71  ? 2.774   -17.786 11.203 1.00 26.31 ? 285 PHE A CE2 1 
ATOM   498  C CZ  . PHE A 1 71  ? 2.496   -18.472 10.007 1.00 27.05 ? 285 PHE A CZ  1 
ATOM   499  N N   . GLU A 1 72  ? 8.238   -17.269 9.172  1.00 24.99 ? 286 GLU A N   1 
ATOM   500  C CA  . GLU A 1 72  ? 8.776   -18.435 8.465  1.00 26.51 ? 286 GLU A CA  1 
ATOM   501  C C   . GLU A 1 72  ? 9.724   -19.261 9.338  1.00 26.66 ? 286 GLU A C   1 
ATOM   502  O O   . GLU A 1 72  ? 9.712   -20.486 9.277  1.00 26.85 ? 286 GLU A O   1 
ATOM   503  C CB  . GLU A 1 72  ? 9.478   -18.026 7.173  1.00 26.54 ? 286 GLU A CB  1 
ATOM   504  C CG  . GLU A 1 72  ? 8.502   -17.638 6.073  1.00 29.48 ? 286 GLU A CG  1 
ATOM   505  C CD  . GLU A 1 72  ? 9.174   -16.966 4.896  1.00 32.69 ? 286 GLU A CD  1 
ATOM   506  O OE1 . GLU A 1 72  ? 10.331  -16.489 5.023  1.00 35.50 ? 286 GLU A OE1 1 
ATOM   507  O OE2 . GLU A 1 72  ? 8.525   -16.889 3.838  1.00 35.22 ? 286 GLU A OE2 1 
ATOM   508  N N   . ARG A 1 73  ? 10.530  -18.582 10.148 1.00 26.98 ? 287 ARG A N   1 
ATOM   509  C CA  . ARG A 1 73  ? 11.418  -19.257 11.098 1.00 27.62 ? 287 ARG A CA  1 
ATOM   510  C C   . ARG A 1 73  ? 10.657  -20.041 12.176 1.00 27.43 ? 287 ARG A C   1 
ATOM   511  O O   . ARG A 1 73  ? 11.113  -21.099 12.606 1.00 28.28 ? 287 ARG A O   1 
ATOM   512  C CB  . ARG A 1 73  ? 12.423  -18.270 11.703 1.00 27.95 ? 287 ARG A CB  1 
ATOM   513  C CG  . ARG A 1 73  ? 13.464  -17.774 10.687 1.00 31.01 ? 287 ARG A CG  1 
ATOM   514  C CD  . ARG A 1 73  ? 14.485  -16.791 11.275 1.00 36.80 ? 287 ARG A CD  1 
ATOM   515  N NE  . ARG A 1 73  ? 15.379  -17.429 12.256 1.00 42.10 ? 287 ARG A NE  1 
ATOM   516  C CZ  . ARG A 1 73  ? 16.511  -18.074 11.955 1.00 45.18 ? 287 ARG A CZ  1 
ATOM   517  N NH1 . ARG A 1 73  ? 16.921  -18.176 10.689 1.00 45.52 ? 287 ARG A NH1 1 
ATOM   518  N NH2 . ARG A 1 73  ? 17.243  -18.620 12.923 1.00 45.91 ? 287 ARG A NH2 1 
ATOM   519  N N   . GLY A 1 74  ? 9.498   -19.540 12.599 1.00 26.28 ? 288 GLY A N   1 
ATOM   520  C CA  . GLY A 1 74  ? 8.668   -20.254 13.580 1.00 26.06 ? 288 GLY A CA  1 
ATOM   521  C C   . GLY A 1 74  ? 9.111   -20.078 15.036 1.00 25.43 ? 288 GLY A C   1 
ATOM   522  O O   . GLY A 1 74  ? 9.973   -19.243 15.324 1.00 24.99 ? 288 GLY A O   1 
ATOM   523  N N   . PRO A 1 75  ? 8.506   -20.837 15.971 1.00 25.78 ? 289 PRO A N   1 
ATOM   524  C CA  . PRO A 1 75  ? 7.428   -21.810 15.748 1.00 26.51 ? 289 PRO A CA  1 
ATOM   525  C C   . PRO A 1 75  ? 6.133   -21.099 15.407 1.00 26.92 ? 289 PRO A C   1 
ATOM   526  O O   . PRO A 1 75  ? 5.946   -19.946 15.795 1.00 26.13 ? 289 PRO A O   1 
ATOM   527  C CB  . PRO A 1 75  ? 7.291   -22.505 17.110 1.00 26.51 ? 289 PRO A CB  1 
ATOM   528  C CG  . PRO A 1 75  ? 7.748   -21.455 18.113 1.00 26.54 ? 289 PRO A CG  1 
ATOM   529  C CD  . PRO A 1 75  ? 8.893   -20.761 17.398 1.00 25.81 ? 289 PRO A CD  1 
ATOM   530  N N   . SER A 1 76  ? 5.242   -21.779 14.684 1.00 27.76 ? 290 SER A N   1 
ATOM   531  C CA  . SER A 1 76  ? 4.033   -21.120 14.206 1.00 28.46 ? 290 SER A CA  1 
ATOM   532  C C   . SER A 1 76  ? 3.042   -20.833 15.338 1.00 27.68 ? 290 SER A C   1 
ATOM   533  O O   . SER A 1 76  ? 2.187   -19.952 15.208 1.00 28.70 ? 290 SER A O   1 
ATOM   534  C CB  . SER A 1 76  ? 3.385   -21.922 13.081 1.00 28.73 ? 290 SER A CB  1 
ATOM   535  O OG  . SER A 1 76  ? 3.202   -23.261 13.483 1.00 31.96 ? 290 SER A OG  1 
ATOM   536  N N   . ASN A 1 77  ? 3.189   -21.524 16.465 1.00 26.48 ? 291 ASN A N   1 
ATOM   537  C CA  . ASN A 1 77  ? 2.304   -21.296 17.616 1.00 25.58 ? 291 ASN A CA  1 
ATOM   538  C C   . ASN A 1 77  ? 2.687   -20.086 18.477 1.00 24.02 ? 291 ASN A C   1 
ATOM   539  O O   . ASN A 1 77  ? 2.053   -19.824 19.500 1.00 23.71 ? 291 ASN A O   1 
ATOM   540  C CB  . ASN A 1 77  ? 2.157   -22.572 18.478 1.00 26.04 ? 291 ASN A CB  1 
ATOM   541  C CG  . ASN A 1 77  ? 3.437   -22.944 19.220 1.00 28.17 ? 291 ASN A CG  1 
ATOM   542  O OD1 . ASN A 1 77  ? 4.475   -22.284 19.089 1.00 30.69 ? 291 ASN A OD1 1 
ATOM   543  N ND2 . ASN A 1 77  ? 3.366   -24.010 20.017 1.00 29.21 ? 291 ASN A ND2 1 
ATOM   544  N N   . ALA A 1 78  ? 3.709   -19.341 18.056 1.00 22.45 ? 292 ALA A N   1 
ATOM   545  C CA  . ALA A 1 78  ? 4.136   -18.167 18.807 1.00 21.25 ? 292 ALA A CA  1 
ATOM   546  C C   . ALA A 1 78  ? 3.572   -16.857 18.239 1.00 20.90 ? 292 ALA A C   1 
ATOM   547  O O   . ALA A 1 78  ? 3.828   -15.777 18.787 1.00 19.52 ? 292 ALA A O   1 
ATOM   548  C CB  . ALA A 1 78  ? 5.669   -18.100 18.883 1.00 20.39 ? 292 ALA A CB  1 
ATOM   549  N N   . PHE A 1 79  ? 2.790   -16.957 17.164 1.00 20.05 ? 293 PHE A N   1 
ATOM   550  C CA  . PHE A 1 79  ? 2.379   -15.774 16.401 1.00 20.19 ? 293 PHE A CA  1 
ATOM   551  C C   . PHE A 1 79  ? 0.908   -15.397 16.559 1.00 20.21 ? 293 PHE A C   1 
ATOM   552  O O   . PHE A 1 79  ? 0.002   -16.209 16.337 1.00 20.71 ? 293 PHE A O   1 
ATOM   553  C CB  . PHE A 1 79  ? 2.787   -15.930 14.934 1.00 19.67 ? 293 PHE A CB  1 
ATOM   554  C CG  . PHE A 1 79  ? 4.258   -15.841 14.735 1.00 20.39 ? 293 PHE A CG  1 
ATOM   555  C CD1 . PHE A 1 79  ? 5.096   -16.907 15.101 1.00 20.63 ? 293 PHE A CD1 1 
ATOM   556  C CD2 . PHE A 1 79  ? 4.830   -14.683 14.229 1.00 20.46 ? 293 PHE A CD2 1 
ATOM   557  C CE1 . PHE A 1 79  ? 6.476   -16.804 14.962 1.00 19.83 ? 293 PHE A CE1 1 
ATOM   558  C CE2 . PHE A 1 79  ? 6.211   -14.583 14.066 1.00 21.70 ? 293 PHE A CE2 1 
ATOM   559  C CZ  . PHE A 1 79  ? 7.035   -15.646 14.448 1.00 22.63 ? 293 PHE A CZ  1 
ATOM   560  N N   . PHE A 1 80  ? 0.694   -14.147 16.946 1.00 19.84 ? 294 PHE A N   1 
ATOM   561  C CA  . PHE A 1 80  ? -0.623  -13.633 17.279 1.00 20.15 ? 294 PHE A CA  1 
ATOM   562  C C   . PHE A 1 80  ? -0.861  -12.276 16.675 1.00 19.85 ? 294 PHE A C   1 
ATOM   563  O O   . PHE A 1 80  ? 0.078   -11.515 16.441 1.00 19.52 ? 294 PHE A O   1 
ATOM   564  C CB  . PHE A 1 80  ? -0.784  -13.555 18.804 1.00 20.41 ? 294 PHE A CB  1 
ATOM   565  C CG  . PHE A 1 80  ? -0.697  -14.891 19.463 1.00 20.94 ? 294 PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 80  ? -1.836  -15.686 19.601 1.00 22.18 ? 294 PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 80  ? 0.532   -15.393 19.878 1.00 19.80 ? 294 PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 80  ? -1.750  -16.959 20.183 1.00 23.36 ? 294 PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 80  ? 0.625   -16.659 20.452 1.00 21.81 ? 294 PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 80  ? -0.526  -17.441 20.608 1.00 21.87 ? 294 PHE A CZ  1 
ATOM   571  N N   . LEU A 1 81  ? -2.135  -11.987 16.430 1.00 19.80 ? 295 LEU A N   1 
ATOM   572  C CA  . LEU A 1 81  ? -2.553  -10.670 15.991 1.00 20.56 ? 295 LEU A CA  1 
ATOM   573  C C   . LEU A 1 81  ? -3.618  -10.180 16.950 1.00 20.08 ? 295 LEU A C   1 
ATOM   574  O O   . LEU A 1 81  ? -4.606  -10.873 17.182 1.00 20.51 ? 295 LEU A O   1 
ATOM   575  C CB  . LEU A 1 81  ? -3.092  -10.742 14.555 1.00 20.45 ? 295 LEU A CB  1 
ATOM   576  C CG  . LEU A 1 81  ? -3.814  -9.537  13.958 1.00 22.29 ? 295 LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 81  ? -2.928  -8.318  13.891 1.00 23.89 ? 295 LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 81  ? -4.307  -9.920  12.565 1.00 23.41 ? 295 LEU A CD2 1 
ATOM   579  N N   . VAL A 1 82  ? -3.395  -9.012  17.545 1.00 19.93 ? 296 VAL A N   1 
ATOM   580  C CA  . VAL A 1 82  ? -4.358  -8.443  18.491 1.00 19.61 ? 296 VAL A CA  1 
ATOM   581  C C   . VAL A 1 82  ? -4.995  -7.220  17.846 1.00 19.85 ? 296 VAL A C   1 
ATOM   582  O O   . VAL A 1 82  ? -4.291  -6.313  17.427 1.00 19.82 ? 296 VAL A O   1 
ATOM   583  C CB  . VAL A 1 82  ? -3.682  -8.044  19.841 1.00 19.38 ? 296 VAL A CB  1 
ATOM   584  C CG1 . VAL A 1 82  ? -4.650  -7.207  20.739 1.00 18.56 ? 296 VAL A CG1 1 
ATOM   585  C CG2 . VAL A 1 82  ? -3.174  -9.274  20.583 1.00 20.04 ? 296 VAL A CG2 1 
ATOM   586  N N   . LYS A 1 83  ? -6.323  -7.210  17.753 1.00 20.00 ? 297 LYS A N   1 
ATOM   587  C CA  . LYS A 1 83  ? -7.044  -6.011  17.327 1.00 20.30 ? 297 LYS A CA  1 
ATOM   588  C C   . LYS A 1 83  ? -7.536  -5.279  18.563 1.00 20.66 ? 297 LYS A C   1 
ATOM   589  O O   . LYS A 1 83  ? -8.305  -5.837  19.354 1.00 21.29 ? 297 LYS A O   1 
ATOM   590  C CB  . LYS A 1 83  ? -8.212  -6.361  16.383 1.00 20.50 ? 297 LYS A CB  1 
ATOM   591  C CG  . LYS A 1 83  ? -9.249  -5.221  16.147 1.00 21.71 ? 297 LYS A CG  1 
ATOM   592  C CD  . LYS A 1 83  ? -8.729  -4.119  15.257 1.00 25.87 ? 297 LYS A CD  1 
ATOM   593  C CE  . LYS A 1 83  ? -9.803  -3.025  14.995 1.00 25.15 ? 297 LYS A CE  1 
ATOM   594  N NZ  . LYS A 1 83  ? -10.725 -3.363  13.847 1.00 24.89 ? 297 LYS A NZ  1 
ATOM   595  N N   . PHE A 1 84  ? -7.065  -4.055  18.750 1.00 20.70 ? 298 PHE A N   1 
ATOM   596  C CA  . PHE A 1 84  ? -7.482  -3.240  19.886 1.00 20.57 ? 298 PHE A CA  1 
ATOM   597  C C   . PHE A 1 84  ? -8.482  -2.188  19.417 1.00 21.13 ? 298 PHE A C   1 
ATOM   598  O O   . PHE A 1 84  ? -8.288  -1.553  18.371 1.00 20.50 ? 298 PHE A O   1 
ATOM   599  C CB  . PHE A 1 84  ? -6.302  -2.497  20.498 1.00 20.89 ? 298 PHE A CB  1 
ATOM   600  C CG  . PHE A 1 84  ? -5.537  -3.264  21.577 1.00 21.69 ? 298 PHE A CG  1 
ATOM   601  C CD1 . PHE A 1 84  ? -4.139  -3.252  21.571 1.00 21.19 ? 298 PHE A CD1 1 
ATOM   602  C CD2 . PHE A 1 84  ? -6.199  -3.920  22.625 1.00 23.90 ? 298 PHE A CD2 1 
ATOM   603  C CE1 . PHE A 1 84  ? -3.411  -3.916  22.554 1.00 21.13 ? 298 PHE A CE1 1 
ATOM   604  C CE2 . PHE A 1 84  ? -5.477  -4.596  23.629 1.00 24.36 ? 298 PHE A CE2 1 
ATOM   605  C CZ  . PHE A 1 84  ? -4.069  -4.591  23.585 1.00 22.87 ? 298 PHE A CZ  1 
ATOM   606  N N   . TRP A 1 85  ? -9.534  -2.001  20.206 1.00 21.24 ? 299 TRP A N   1 
ATOM   607  C CA  . TRP A 1 85  ? -10.286 -0.749  20.175 1.00 22.11 ? 299 TRP A CA  1 
ATOM   608  C C   . TRP A 1 85  ? -9.812  0.062   21.375 1.00 22.47 ? 299 TRP A C   1 
ATOM   609  O O   . TRP A 1 85  ? -10.074 -0.312  22.533 1.00 22.45 ? 299 TRP A O   1 
ATOM   610  C CB  . TRP A 1 85  ? -11.800 -1.001  20.224 1.00 22.11 ? 299 TRP A CB  1 
ATOM   611  C CG  . TRP A 1 85  ? -12.354 -1.585  18.950 1.00 23.95 ? 299 TRP A CG  1 
ATOM   612  C CD1 . TRP A 1 85  ? -12.961 -0.895  17.919 1.00 24.06 ? 299 TRP A CD1 1 
ATOM   613  C CD2 . TRP A 1 85  ? -12.361 -2.963  18.564 1.00 24.62 ? 299 TRP A CD2 1 
ATOM   614  N NE1 . TRP A 1 85  ? -13.330 -1.762  16.925 1.00 24.06 ? 299 TRP A NE1 1 
ATOM   615  C CE2 . TRP A 1 85  ? -12.980 -3.036  17.291 1.00 25.13 ? 299 TRP A CE2 1 
ATOM   616  C CE3 . TRP A 1 85  ? -11.893 -4.147  19.161 1.00 24.05 ? 299 TRP A CE3 1 
ATOM   617  C CZ2 . TRP A 1 85  ? -13.152 -4.248  16.610 1.00 25.16 ? 299 TRP A CZ2 1 
ATOM   618  C CZ3 . TRP A 1 85  ? -12.071 -5.343  18.487 1.00 25.19 ? 299 TRP A CZ3 1 
ATOM   619  C CH2 . TRP A 1 85  ? -12.698 -5.383  17.219 1.00 25.63 ? 299 TRP A CH2 1 
ATOM   620  N N   . ALA A 1 86  ? -9.118  1.168   21.103 1.00 22.80 ? 300 ALA A N   1 
ATOM   621  C CA  . ALA A 1 86  ? -8.497  1.968   22.147 1.00 23.51 ? 300 ALA A CA  1 
ATOM   622  C C   . ALA A 1 86  ? -9.487  2.965   22.742 1.00 24.74 ? 300 ALA A C   1 
ATOM   623  O O   . ALA A 1 86  ? -10.312 3.534   22.022 1.00 23.74 ? 300 ALA A O   1 
ATOM   624  C CB  . ALA A 1 86  ? -7.277  2.703   21.609 1.00 23.70 ? 300 ALA A CB  1 
ATOM   625  N N   . ASP A 1 87  ? -9.389  3.158   24.058 1.00 25.49 ? 301 ASP A N   1 
ATOM   626  C CA  . ASP A 1 87  ? -10.192 4.151   24.767 1.00 26.45 ? 301 ASP A CA  1 
ATOM   627  C C   . ASP A 1 87  ? -9.373  5.418   24.912 1.00 27.56 ? 301 ASP A C   1 
ATOM   628  O O   . ASP A 1 87  ? -8.407  5.466   25.682 1.00 26.98 ? 301 ASP A O   1 
ATOM   629  C CB  . ASP A 1 87  ? -10.607 3.610   26.137 1.00 26.33 ? 301 ASP A CB  1 
ATOM   630  C CG  . ASP A 1 87  ? -11.447 4.600   26.950 1.00 27.31 ? 301 ASP A CG  1 
ATOM   631  O OD1 . ASP A 1 87  ? -11.510 5.799   26.612 1.00 27.40 ? 301 ASP A OD1 1 
ATOM   632  O OD2 . ASP A 1 87  ? -12.034 4.166   27.959 1.00 29.06 ? 301 ASP A OD2 1 
ATOM   633  N N   . LEU A 1 88  ? -9.768  6.440   24.163 1.00 28.74 ? 302 LEU A N   1 
ATOM   634  C CA  . LEU A 1 88  ? -9.072  7.709   24.149 1.00 31.06 ? 302 LEU A CA  1 
ATOM   635  C C   . LEU A 1 88  ? -9.825  8.777   24.952 1.00 32.69 ? 302 LEU A C   1 
ATOM   636  O O   . LEU A 1 88  ? -9.462  9.949   24.933 1.00 33.52 ? 302 LEU A O   1 
ATOM   637  C CB  . LEU A 1 88  ? -8.866  8.174   22.698 1.00 31.23 ? 302 LEU A CB  1 
ATOM   638  C CG  . LEU A 1 88  ? -8.163  7.226   21.712 1.00 30.61 ? 302 LEU A CG  1 
ATOM   639  C CD1 . LEU A 1 88  ? -7.811  7.961   20.434 1.00 30.16 ? 302 LEU A CD1 1 
ATOM   640  C CD2 . LEU A 1 88  ? -6.917  6.609   22.319 1.00 30.61 ? 302 LEU A CD2 1 
ATOM   641  N N   . ASN A 1 89  ? -10.865 8.359   25.661 1.00 34.79 ? 303 ASN A N   1 
ATOM   642  C CA  . ASN A 1 89  ? -11.687 9.280   26.446 1.00 37.08 ? 303 ASN A CA  1 
ATOM   643  C C   . ASN A 1 89  ? -11.015 9.609   27.786 1.00 37.73 ? 303 ASN A C   1 
ATOM   644  O O   . ASN A 1 89  ? -11.350 9.036   28.828 1.00 37.82 ? 303 ASN A O   1 
ATOM   645  C CB  . ASN A 1 89  ? -13.093 8.690   26.649 1.00 37.24 ? 303 ASN A CB  1 
ATOM   646  C CG  . ASN A 1 89  ? -14.146 9.751   27.005 1.00 40.01 ? 303 ASN A CG  1 
ATOM   647  O OD1 . ASN A 1 89  ? -15.039 9.497   27.818 1.00 42.71 ? 303 ASN A OD1 1 
ATOM   648  N ND2 . ASN A 1 89  ? -14.055 10.931  26.383 1.00 41.16 ? 303 ASN A ND2 1 
ATOM   649  N N   . THR A 1 90  ? -10.056 10.524  27.745 1.00 39.02 ? 304 THR A N   1 
ATOM   650  C CA  . THR A 1 90  ? -9.342  10.939  28.947 1.00 40.69 ? 304 THR A CA  1 
ATOM   651  C C   . THR A 1 90  ? -8.687  12.292  28.753 1.00 41.64 ? 304 THR A C   1 
ATOM   652  O O   . THR A 1 90  ? -8.328  12.660  27.632 1.00 41.95 ? 304 THR A O   1 
ATOM   653  C CB  . THR A 1 90  ? -8.264  9.907   29.378 1.00 40.82 ? 304 THR A CB  1 
ATOM   654  O OG1 . THR A 1 90  ? -7.774  10.232  30.692 1.00 41.68 ? 304 THR A OG1 1 
ATOM   655  C CG2 . THR A 1 90  ? -7.091  9.860   28.379 1.00 40.79 ? 304 THR A CG2 1 
ATOM   656  N N   . ASN A 1 91  ? -8.546  13.026  29.853 1.00 42.60 ? 305 ASN A N   1 
ATOM   657  C CA  . ASN A 1 91  ? -7.798  14.279  29.872 1.00 43.68 ? 305 ASN A CA  1 
ATOM   658  C C   . ASN A 1 91  ? -6.292  14.028  29.984 1.00 43.68 ? 305 ASN A C   1 
ATOM   659  O O   . ASN A 1 91  ? -5.536  14.267  29.039 1.00 44.21 ? 305 ASN A O   1 
ATOM   660  C CB  . ASN A 1 91  ? -8.273  15.158  31.033 1.00 44.12 ? 305 ASN A CB  1 
ATOM   661  C CG  . ASN A 1 91  ? -7.394  16.377  31.242 1.00 45.43 ? 305 ASN A CG  1 
ATOM   662  O OD1 . ASN A 1 91  ? -7.168  17.160  30.321 1.00 46.56 ? 305 ASN A OD1 1 
ATOM   663  N ND2 . ASN A 1 91  ? -6.889  16.539  32.461 1.00 47.26 ? 305 ASN A ND2 1 
ATOM   664  N N   . GLY A 1 96  ? 2.586   17.948  33.132 1.00 44.17 ? 310 GLY A N   1 
ATOM   665  C CA  . GLY A 1 96  ? 3.245   18.254  34.399 1.00 43.72 ? 310 GLY A CA  1 
ATOM   666  C C   . GLY A 1 96  ? 3.111   17.146  35.430 1.00 43.41 ? 310 GLY A C   1 
ATOM   667  O O   . GLY A 1 96  ? 4.089   16.778  36.079 1.00 43.91 ? 310 GLY A O   1 
ATOM   668  N N   . SER A 1 97  ? 1.894   16.624  35.590 1.00 42.61 ? 311 SER A N   1 
ATOM   669  C CA  . SER A 1 97  ? 1.623   15.548  36.545 1.00 41.65 ? 311 SER A CA  1 
ATOM   670  C C   . SER A 1 97  ? 1.078   14.296  35.851 1.00 40.57 ? 311 SER A C   1 
ATOM   671  O O   . SER A 1 97  ? 0.224   13.583  36.395 1.00 40.41 ? 311 SER A O   1 
ATOM   672  C CB  . SER A 1 97  ? 0.672   16.029  37.650 1.00 41.94 ? 311 SER A CB  1 
ATOM   673  O OG  . SER A 1 97  ? -0.529  16.557  37.105 1.00 43.29 ? 311 SER A OG  1 
ATOM   674  N N   . SER A 1 98  ? 1.600   14.022  34.655 1.00 39.06 ? 312 SER A N   1 
ATOM   675  C CA  . SER A 1 98  ? 1.165   12.882  33.851 1.00 37.37 ? 312 SER A CA  1 
ATOM   676  C C   . SER A 1 98  ? 2.272   11.853  33.700 1.00 35.69 ? 312 SER A C   1 
ATOM   677  O O   . SER A 1 98  ? 3.427   12.201  33.463 1.00 35.32 ? 312 SER A O   1 
ATOM   678  C CB  . SER A 1 98  ? 0.733   13.339  32.457 1.00 37.57 ? 312 SER A CB  1 
ATOM   679  O OG  . SER A 1 98  ? -0.566  13.897  32.473 1.00 39.87 ? 312 SER A OG  1 
ATOM   680  N N   . PHE A 1 99  ? 1.906   10.582  33.824 1.00 33.61 ? 313 PHE A N   1 
ATOM   681  C CA  . PHE A 1 99  ? 2.788   9.498   33.430 1.00 31.77 ? 313 PHE A CA  1 
ATOM   682  C C   . PHE A 1 99  ? 2.085   8.570   32.438 1.00 30.31 ? 313 PHE A C   1 
ATOM   683  O O   . PHE A 1 99  ? 1.054   7.974   32.753 1.00 29.26 ? 313 PHE A O   1 
ATOM   684  C CB  . PHE A 1 99  ? 3.313   8.733   34.652 1.00 32.21 ? 313 PHE A CB  1 
ATOM   685  C CG  . PHE A 1 99  ? 4.208   7.573   34.301 1.00 33.30 ? 313 PHE A CG  1 
ATOM   686  C CD1 . PHE A 1 99  ? 3.717   6.277   34.315 1.00 32.53 ? 313 PHE A CD1 1 
ATOM   687  C CD2 . PHE A 1 99  ? 5.531   7.784   33.928 1.00 34.48 ? 313 PHE A CD2 1 
ATOM   688  C CE1 . PHE A 1 99  ? 4.526   5.203   33.976 1.00 34.29 ? 313 PHE A CE1 1 
ATOM   689  C CE2 . PHE A 1 99  ? 6.357   6.706   33.582 1.00 35.54 ? 313 PHE A CE2 1 
ATOM   690  C CZ  . PHE A 1 99  ? 5.849   5.413   33.610 1.00 35.15 ? 313 PHE A CZ  1 
ATOM   691  N N   . TYR A 1 100 ? 2.655   8.461   31.238 1.00 28.80 ? 314 TYR A N   1 
ATOM   692  C CA  . TYR A 1 100 ? 2.188   7.517   30.231 1.00 27.53 ? 314 TYR A CA  1 
ATOM   693  C C   . TYR A 1 100 ? 3.049   6.260   30.320 1.00 26.80 ? 314 TYR A C   1 
ATOM   694  O O   . TYR A 1 100 ? 4.270   6.323   30.134 1.00 26.39 ? 314 TYR A O   1 
ATOM   695  C CB  . TYR A 1 100 ? 2.307   8.095   28.806 1.00 27.62 ? 314 TYR A CB  1 
ATOM   696  C CG  . TYR A 1 100 ? 1.391   9.246   28.486 1.00 26.99 ? 314 TYR A CG  1 
ATOM   697  C CD1 . TYR A 1 100 ? 1.736   10.556  28.842 1.00 28.60 ? 314 TYR A CD1 1 
ATOM   698  C CD2 . TYR A 1 100 ? 0.194   9.038   27.794 1.00 28.02 ? 314 TYR A CD2 1 
ATOM   699  C CE1 . TYR A 1 100 ? 0.906   11.627  28.541 1.00 27.77 ? 314 TYR A CE1 1 
ATOM   700  C CE2 . TYR A 1 100 ? -0.652  10.112  27.484 1.00 28.78 ? 314 TYR A CE2 1 
ATOM   701  C CZ  . TYR A 1 100 ? -0.291  11.393  27.869 1.00 28.97 ? 314 TYR A CZ  1 
ATOM   702  O OH  . TYR A 1 100 ? -1.119  12.451  27.562 1.00 30.31 ? 314 TYR A OH  1 
ATOM   703  N N   . GLY A 1 101 ? 2.415   5.116   30.574 1.00 25.85 ? 315 GLY A N   1 
ATOM   704  C CA  . GLY A 1 101 ? 3.166   3.871   30.729 1.00 25.02 ? 315 GLY A CA  1 
ATOM   705  C C   . GLY A 1 101 ? 2.522   2.648   30.138 1.00 24.63 ? 315 GLY A C   1 
ATOM   706  O O   . GLY A 1 101 ? 1.358   2.672   29.727 1.00 24.03 ? 315 GLY A O   1 
ATOM   707  N N   . VAL A 1 102 ? 3.302   1.573   30.079 1.00 24.06 ? 316 VAL A N   1 
ATOM   708  C CA  . VAL A 1 102 ? 2.849   0.277   29.607 1.00 24.83 ? 316 VAL A CA  1 
ATOM   709  C C   . VAL A 1 102 ? 3.345   -0.736  30.632 1.00 25.08 ? 316 VAL A C   1 
ATOM   710  O O   . VAL A 1 102 ? 4.495   -0.654  31.071 1.00 26.25 ? 316 VAL A O   1 
ATOM   711  C CB  . VAL A 1 102 ? 3.443   -0.065  28.203 1.00 24.86 ? 316 VAL A CB  1 
ATOM   712  C CG1 . VAL A 1 102 ? 2.894   -1.408  27.667 1.00 26.20 ? 316 VAL A CG1 1 
ATOM   713  C CG2 . VAL A 1 102 ? 3.139   1.052   27.213 1.00 26.49 ? 316 VAL A CG2 1 
ATOM   714  N N   . SER A 1 103 ? 2.488   -1.671  31.024 1.00 25.12 ? 317 SER A N   1 
ATOM   715  C CA  . SER A 1 103 ? 2.898   -2.740  31.907 1.00 24.92 ? 317 SER A CA  1 
ATOM   716  C C   . SER A 1 103 ? 2.485   -4.056  31.269 1.00 25.05 ? 317 SER A C   1 
ATOM   717  O O   . SER A 1 103 ? 1.471   -4.112  30.580 1.00 25.44 ? 317 SER A O   1 
ATOM   718  C CB  . SER A 1 103 ? 2.270   -2.563  33.300 1.00 25.28 ? 317 SER A CB  1 
ATOM   719  O OG  . SER A 1 103 ? 2.888   -1.476  33.991 1.00 26.05 ? 317 SER A OG  1 
ATOM   720  N N   . SER A 1 104 ? 3.288   -5.101  31.460 1.00 24.01 ? 318 SER A N   1 
ATOM   721  C CA  . SER A 1 104 ? 2.960   -6.422  30.957 1.00 23.89 ? 318 SER A CA  1 
ATOM   722  C C   . SER A 1 104 ? 3.566   -7.497  31.866 1.00 23.88 ? 318 SER A C   1 
ATOM   723  O O   . SER A 1 104 ? 4.527   -7.244  32.580 1.00 23.62 ? 318 SER A O   1 
ATOM   724  C CB  . SER A 1 104 ? 3.447   -6.602  29.516 1.00 23.67 ? 318 SER A CB  1 
ATOM   725  O OG  . SER A 1 104 ? 4.839   -6.352  29.431 1.00 25.72 ? 318 SER A OG  1 
ATOM   726  N N   . GLN A 1 105 ? 2.970   -8.679  31.849 1.00 23.90 ? 319 GLN A N   1 
ATOM   727  C CA  . GLN A 1 105 ? 3.417   -9.775  32.690 1.00 24.77 ? 319 GLN A CA  1 
ATOM   728  C C   . GLN A 1 105 ? 3.332   -11.047 31.879 1.00 24.16 ? 319 GLN A C   1 
ATOM   729  O O   . GLN A 1 105 ? 2.401   -11.215 31.077 1.00 23.40 ? 319 GLN A O   1 
ATOM   730  C CB  . GLN A 1 105 ? 2.538   -9.885  33.937 1.00 25.68 ? 319 GLN A CB  1 
ATOM   731  C CG  . GLN A 1 105 ? 3.143   -10.763 35.026 1.00 30.18 ? 319 GLN A CG  1 
ATOM   732  C CD  . GLN A 1 105 ? 2.518   -10.536 36.388 1.00 36.90 ? 319 GLN A CD  1 
ATOM   733  O OE1 . GLN A 1 105 ? 1.881   -9.505  36.637 1.00 39.99 ? 319 GLN A OE1 1 
ATOM   734  N NE2 . GLN A 1 105 ? 2.713   -11.497 37.292 1.00 39.70 ? 319 GLN A NE2 1 
ATOM   735  N N   . TYR A 1 106 ? 4.309   -11.928 32.107 1.00 23.64 ? 320 TYR A N   1 
ATOM   736  C CA  . TYR A 1 106 ? 4.474   -13.179 31.379 1.00 22.98 ? 320 TYR A CA  1 
ATOM   737  C C   . TYR A 1 106 ? 4.775   -14.304 32.349 1.00 23.04 ? 320 TYR A C   1 
ATOM   738  O O   . TYR A 1 106 ? 5.348   -14.089 33.422 1.00 22.87 ? 320 TYR A O   1 
ATOM   739  C CB  . TYR A 1 106 ? 5.631   -13.089 30.366 1.00 22.78 ? 320 TYR A CB  1 
ATOM   740  C CG  . TYR A 1 106 ? 5.588   -11.859 29.505 1.00 23.48 ? 320 TYR A CG  1 
ATOM   741  C CD1 . TYR A 1 106 ? 4.989   -11.889 28.236 1.00 21.50 ? 320 TYR A CD1 1 
ATOM   742  C CD2 . TYR A 1 106 ? 6.108   -10.646 29.972 1.00 23.80 ? 320 TYR A CD2 1 
ATOM   743  C CE1 . TYR A 1 106 ? 4.925   -10.746 27.459 1.00 22.05 ? 320 TYR A CE1 1 
ATOM   744  C CE2 . TYR A 1 106 ? 6.055   -9.506  29.204 1.00 23.16 ? 320 TYR A CE2 1 
ATOM   745  C CZ  . TYR A 1 106 ? 5.457   -9.566  27.945 1.00 23.23 ? 320 TYR A CZ  1 
ATOM   746  O OH  . TYR A 1 106 ? 5.395   -8.430  27.192 1.00 24.96 ? 320 TYR A OH  1 
ATOM   747  N N   . GLU A 1 107 ? 4.418   -15.513 31.945 1.00 23.24 ? 321 GLU A N   1 
ATOM   748  C CA  . GLU A 1 107 ? 4.721   -16.695 32.731 1.00 23.52 ? 321 GLU A CA  1 
ATOM   749  C C   . GLU A 1 107 ? 5.349   -17.771 31.848 1.00 23.20 ? 321 GLU A C   1 
ATOM   750  O O   . GLU A 1 107 ? 4.982   -17.921 30.677 1.00 22.34 ? 321 GLU A O   1 
ATOM   751  C CB  . GLU A 1 107 ? 3.418   -17.183 33.344 1.00 23.75 ? 321 GLU A CB  1 
ATOM   752  C CG  . GLU A 1 107 ? 3.519   -18.278 34.349 1.00 27.56 ? 321 GLU A CG  1 
ATOM   753  C CD  . GLU A 1 107 ? 2.129   -18.732 34.775 1.00 30.41 ? 321 GLU A CD  1 
ATOM   754  O OE1 . GLU A 1 107 ? 1.406   -17.920 35.386 1.00 30.45 ? 321 GLU A OE1 1 
ATOM   755  O OE2 . GLU A 1 107 ? 1.757   -19.883 34.454 1.00 33.59 ? 321 GLU A OE2 1 
ATOM   756  N N   . SER A 1 108 ? 6.304   -18.511 32.403 1.00 23.31 ? 322 SER A N   1 
ATOM   757  C CA  A SER A 1 108 ? 6.944   -19.619 31.687 0.50 23.35 ? 322 SER A CA  1 
ATOM   758  C CA  B SER A 1 108 ? 6.888   -19.642 31.688 0.50 24.22 ? 322 SER A CA  1 
ATOM   759  C C   . SER A 1 108 ? 7.241   -20.794 32.626 1.00 24.34 ? 322 SER A C   1 
ATOM   760  O O   . SER A 1 108 ? 7.451   -20.584 33.825 1.00 23.89 ? 322 SER A O   1 
ATOM   761  C CB  A SER A 1 108 ? 8.241   -19.138 31.037 0.50 22.93 ? 322 SER A CB  1 
ATOM   762  C CB  B SER A 1 108 ? 8.119   -19.208 30.894 0.50 23.97 ? 322 SER A CB  1 
ATOM   763  O OG  A SER A 1 108 ? 8.901   -20.177 30.326 0.50 20.29 ? 322 SER A OG  1 
ATOM   764  O OG  B SER A 1 108 ? 9.100   -18.633 31.729 0.50 26.54 ? 322 SER A OG  1 
ATOM   765  N N   . PRO A 1 109 ? 7.272   -22.036 32.082 1.00 25.37 ? 323 PRO A N   1 
ATOM   766  C CA  . PRO A 1 109 ? 7.785   -23.136 32.907 1.00 26.10 ? 323 PRO A CA  1 
ATOM   767  C C   . PRO A 1 109 ? 9.304   -23.074 33.028 1.00 26.76 ? 323 PRO A C   1 
ATOM   768  O O   . PRO A 1 109 ? 9.877   -23.745 33.882 1.00 27.27 ? 323 PRO A O   1 
ATOM   769  C CB  . PRO A 1 109 ? 7.370   -24.398 32.135 1.00 26.33 ? 323 PRO A CB  1 
ATOM   770  C CG  . PRO A 1 109 ? 7.096   -23.943 30.753 1.00 26.94 ? 323 PRO A CG  1 
ATOM   771  C CD  . PRO A 1 109 ? 6.612   -22.531 30.857 1.00 25.17 ? 323 PRO A CD  1 
ATOM   772  N N   . GLU A 1 110 ? 9.947   -22.272 32.179 1.00 27.24 ? 324 GLU A N   1 
ATOM   773  C CA  . GLU A 1 110 ? 11.404  -22.173 32.150 1.00 28.29 ? 324 GLU A CA  1 
ATOM   774  C C   . GLU A 1 110 ? 11.900  -20.853 32.716 1.00 27.53 ? 324 GLU A C   1 
ATOM   775  O O   . GLU A 1 110 ? 11.197  -19.842 32.648 1.00 27.26 ? 324 GLU A O   1 
ATOM   776  C CB  . GLU A 1 110 ? 11.927  -22.317 30.711 1.00 28.90 ? 324 GLU A CB  1 
ATOM   777  C CG  . GLU A 1 110 ? 11.990  -23.752 30.228 1.00 32.13 ? 324 GLU A CG  1 
ATOM   778  C CD  . GLU A 1 110 ? 12.098  -23.862 28.723 1.00 37.05 ? 324 GLU A CD  1 
ATOM   779  O OE1 . GLU A 1 110 ? 13.123  -23.416 28.153 1.00 39.05 ? 324 GLU A OE1 1 
ATOM   780  O OE2 . GLU A 1 110 ? 11.154  -24.402 28.104 1.00 39.69 ? 324 GLU A OE2 1 
ATOM   781  N N   . ASN A 1 111 ? 13.109  -20.878 33.275 1.00 27.08 ? 325 ASN A N   1 
ATOM   782  C CA  A ASN A 1 111 ? 13.799  -19.687 33.755 0.50 27.13 ? 325 ASN A CA  1 
ATOM   783  C CA  B ASN A 1 111 ? 13.748  -19.642 33.711 0.50 27.12 ? 325 ASN A CA  1 
ATOM   784  C C   . ASN A 1 111 ? 14.718  -19.160 32.646 1.00 27.17 ? 325 ASN A C   1 
ATOM   785  O O   . ASN A 1 111 ? 15.819  -19.662 32.469 1.00 28.43 ? 325 ASN A O   1 
ATOM   786  C CB  A ASN A 1 111 ? 14.587  -20.046 35.028 0.50 26.74 ? 325 ASN A CB  1 
ATOM   787  C CB  B ASN A 1 111 ? 14.364  -19.722 35.123 0.50 26.86 ? 325 ASN A CB  1 
ATOM   788  C CG  A ASN A 1 111 ? 15.490  -18.924 35.513 0.50 26.33 ? 325 ASN A CG  1 
ATOM   789  C CG  B ASN A 1 111 ? 15.351  -20.857 35.284 0.50 26.10 ? 325 ASN A CG  1 
ATOM   790  O OD1 A ASN A 1 111 ? 15.369  -17.778 35.084 0.50 24.98 ? 325 ASN A OD1 1 
ATOM   791  O OD1 B ASN A 1 111 ? 15.805  -21.441 34.309 0.50 25.73 ? 325 ASN A OD1 1 
ATOM   792  N ND2 A ASN A 1 111 ? 16.412  -19.260 36.411 0.50 24.09 ? 325 ASN A ND2 1 
ATOM   793  N ND2 B ASN A 1 111 ? 15.692  -21.173 36.532 0.50 25.66 ? 325 ASN A ND2 1 
ATOM   794  N N   . MET A 1 112 ? 14.255  -18.184 31.889 1.00 27.48 ? 326 MET A N   1 
ATOM   795  C CA  . MET A 1 112 ? 15.012  -17.685 30.761 1.00 26.80 ? 326 MET A CA  1 
ATOM   796  C C   . MET A 1 112 ? 15.344  -16.252 30.992 1.00 25.25 ? 326 MET A C   1 
ATOM   797  O O   . MET A 1 112 ? 14.774  -15.611 31.865 1.00 25.88 ? 326 MET A O   1 
ATOM   798  C CB  . MET A 1 112 ? 14.173  -17.792 29.499 1.00 27.37 ? 326 MET A CB  1 
ATOM   799  C CG  . MET A 1 112 ? 13.526  -19.156 29.336 1.00 28.78 ? 326 MET A CG  1 
ATOM   800  S SD  . MET A 1 112 ? 12.375  -19.079 28.000 1.00 32.60 ? 326 MET A SD  1 
ATOM   801  C CE  . MET A 1 112 ? 11.002  -18.191 28.747 1.00 30.29 ? 326 MET A CE  1 
ATOM   802  N N   . ILE A 1 113 ? 16.310  -15.759 30.241 1.00 24.11 ? 327 ILE A N   1 
ATOM   803  C CA  . ILE A 1 113 ? 16.469  -14.329 30.118 1.00 23.42 ? 327 ILE A CA  1 
ATOM   804  C C   . ILE A 1 113 ? 15.773  -13.966 28.816 1.00 23.05 ? 327 ILE A C   1 
ATOM   805  O O   . ILE A 1 113 ? 16.111  -14.490 27.760 1.00 22.45 ? 327 ILE A O   1 
ATOM   806  C CB  . ILE A 1 113 ? 17.927  -13.898 30.097 1.00 23.17 ? 327 ILE A CB  1 
ATOM   807  C CG1 . ILE A 1 113 ? 18.595  -14.279 31.428 1.00 23.13 ? 327 ILE A CG1 1 
ATOM   808  C CG2 . ILE A 1 113 ? 18.013  -12.385 29.840 1.00 21.96 ? 327 ILE A CG2 1 
ATOM   809  C CD1 . ILE A 1 113 ? 20.121  -14.318 31.352 1.00 27.77 ? 327 ILE A CD1 1 
ATOM   810  N N   . ILE A 1 114 ? 14.793  -13.079 28.902 1.00 23.43 ? 328 ILE A N   1 
ATOM   811  C CA  . ILE A 1 114 ? 14.020  -12.737 27.713 1.00 23.43 ? 328 ILE A CA  1 
ATOM   812  C C   . ILE A 1 114 ? 14.277  -11.304 27.280 1.00 23.74 ? 328 ILE A C   1 
ATOM   813  O O   . ILE A 1 114 ? 14.596  -10.428 28.107 1.00 23.42 ? 328 ILE A O   1 
ATOM   814  C CB  . ILE A 1 114 ? 12.510  -13.034 27.897 1.00 23.79 ? 328 ILE A CB  1 
ATOM   815  C CG1 . ILE A 1 114 ? 11.860  -12.060 28.895 1.00 24.88 ? 328 ILE A CG1 1 
ATOM   816  C CG2 . ILE A 1 114 ? 12.315  -14.493 28.340 1.00 24.58 ? 328 ILE A CG2 1 
ATOM   817  C CD1 . ILE A 1 114 ? 10.332  -12.203 29.034 1.00 25.68 ? 328 ILE A CD1 1 
ATOM   818  N N   . THR A 1 115 ? 14.185  -11.074 25.973 1.00 23.66 ? 329 THR A N   1 
ATOM   819  C CA  A THR A 1 115 ? 14.218  -9.711  25.475 0.50 23.54 ? 329 THR A CA  1 
ATOM   820  C CA  B THR A 1 115 ? 14.248  -9.732  25.429 0.50 23.32 ? 329 THR A CA  1 
ATOM   821  C C   . THR A 1 115 ? 12.898  -9.404  24.780 1.00 23.42 ? 329 THR A C   1 
ATOM   822  O O   . THR A 1 115 ? 12.357  -10.221 24.021 1.00 23.00 ? 329 THR A O   1 
ATOM   823  C CB  A THR A 1 115 ? 15.430  -9.407  24.560 0.50 23.76 ? 329 THR A CB  1 
ATOM   824  C CB  B THR A 1 115 ? 15.381  -9.593  24.393 0.50 23.58 ? 329 THR A CB  1 
ATOM   825  O OG1 A THR A 1 115 ? 15.477  -10.351 23.485 0.50 24.37 ? 329 THR A OG1 1 
ATOM   826  O OG1 B THR A 1 115 ? 16.589  -10.180 24.902 0.50 23.46 ? 329 THR A OG1 1 
ATOM   827  C CG2 A THR A 1 115 ? 16.743  -9.469  25.355 0.50 23.77 ? 329 THR A CG2 1 
ATOM   828  C CG2 B THR A 1 115 ? 15.626  -8.143  24.087 0.50 22.76 ? 329 THR A CG2 1 
ATOM   829  N N   . CYS A 1 116 ? 12.362  -8.232  25.082 1.00 22.73 ? 330 CYS A N   1 
ATOM   830  C CA  . CYS A 1 116 ? 11.112  -7.801  24.483 1.00 22.96 ? 330 CYS A CA  1 
ATOM   831  C C   . CYS A 1 116 ? 11.419  -6.589  23.622 1.00 22.82 ? 330 CYS A C   1 
ATOM   832  O O   . CYS A 1 116 ? 11.916  -5.579  24.120 1.00 23.43 ? 330 CYS A O   1 
ATOM   833  C CB  . CYS A 1 116 ? 10.078  -7.449  25.552 1.00 22.36 ? 330 CYS A CB  1 
ATOM   834  S SG  . CYS A 1 116 ? 8.525   -6.814  24.838 1.00 26.49 ? 330 CYS A SG  1 
ATOM   835  N N   . SER A 1 117 ? 11.173  -6.726  22.326 1.00 22.81 ? 331 SER A N   1 
ATOM   836  C CA  . SER A 1 117 ? 11.396  -5.652  21.363 1.00 23.11 ? 331 SER A CA  1 
ATOM   837  C C   . SER A 1 117 ? 10.034  -5.167  20.882 1.00 22.35 ? 331 SER A C   1 
ATOM   838  O O   . SER A 1 117 ? 9.219   -5.962  20.412 1.00 21.95 ? 331 SER A O   1 
ATOM   839  C CB  . SER A 1 117 ? 12.218  -6.170  20.180 1.00 23.67 ? 331 SER A CB  1 
ATOM   840  O OG  . SER A 1 117 ? 11.943  -5.408  18.991 1.00 28.31 ? 331 SER A OG  1 
ATOM   841  N N   . THR A 1 118 ? 9.789   -3.869  21.003 1.00 22.33 ? 332 THR A N   1 
ATOM   842  C CA  . THR A 1 118 ? 8.507   -3.313  20.608 1.00 22.01 ? 332 THR A CA  1 
ATOM   843  C C   . THR A 1 118 ? 8.790   -2.285  19.521 1.00 21.62 ? 332 THR A C   1 
ATOM   844  O O   . THR A 1 118 ? 9.525   -1.309  19.749 1.00 21.07 ? 332 THR A O   1 
ATOM   845  C CB  . THR A 1 118 ? 7.769   -2.716  21.809 1.00 22.99 ? 332 THR A CB  1 
ATOM   846  O OG1 . THR A 1 118 ? 7.637   -3.720  22.825 1.00 23.79 ? 332 THR A OG1 1 
ATOM   847  C CG2 . THR A 1 118 ? 6.364   -2.252  21.412 1.00 24.06 ? 332 THR A CG2 1 
ATOM   848  N N   . LYS A 1 119 ? 8.243   -2.531  18.333 1.00 20.21 ? 333 LYS A N   1 
ATOM   849  C CA  . LYS A 1 119 ? 8.444   -1.631  17.201 1.00 20.48 ? 333 LYS A CA  1 
ATOM   850  C C   . LYS A 1 119 ? 7.155   -0.912  16.827 1.00 20.64 ? 333 LYS A C   1 
ATOM   851  O O   . LYS A 1 119 ? 6.121   -1.549  16.604 1.00 20.10 ? 333 LYS A O   1 
ATOM   852  C CB  . LYS A 1 119 ? 8.980   -2.388  15.988 1.00 20.68 ? 333 LYS A CB  1 
ATOM   853  C CG  . LYS A 1 119 ? 10.364  -2.949  16.196 1.00 22.25 ? 333 LYS A CG  1 
ATOM   854  C CD  . LYS A 1 119 ? 10.762  -3.824  15.046 1.00 25.97 ? 333 LYS A CD  1 
ATOM   855  C CE  . LYS A 1 119 ? 12.217  -4.237  15.207 1.00 27.33 ? 333 LYS A CE  1 
ATOM   856  N NZ  . LYS A 1 119 ? 12.608  -5.040  14.041 1.00 27.07 ? 333 LYS A NZ  1 
ATOM   857  N N   . VAL A 1 120 ? 7.235   0.411   16.757 1.00 19.67 ? 334 VAL A N   1 
ATOM   858  C CA  . VAL A 1 120 ? 6.124   1.232   16.297 1.00 20.36 ? 334 VAL A CA  1 
ATOM   859  C C   . VAL A 1 120 ? 6.322   1.455   14.808 1.00 19.98 ? 334 VAL A C   1 
ATOM   860  O O   . VAL A 1 120 ? 7.406   1.876   14.377 1.00 20.46 ? 334 VAL A O   1 
ATOM   861  C CB  . VAL A 1 120 ? 6.052   2.577   17.064 1.00 20.07 ? 334 VAL A CB  1 
ATOM   862  C CG1 . VAL A 1 120 ? 4.813   3.358   16.673 1.00 21.70 ? 334 VAL A CG1 1 
ATOM   863  C CG2 . VAL A 1 120 ? 6.023   2.330   18.563 1.00 20.24 ? 334 VAL A CG2 1 
ATOM   864  N N   . CYS A 1 121 ? 5.292   1.144   14.025 1.00 20.30 ? 335 CYS A N   1 
ATOM   865  C CA  . CYS A 1 121 ? 5.412   1.139   12.571 1.00 21.05 ? 335 CYS A CA  1 
ATOM   866  C C   . CYS A 1 121 ? 4.358   2.007   11.944 1.00 21.72 ? 335 CYS A C   1 
ATOM   867  O O   . CYS A 1 121 ? 3.225   2.064   12.419 1.00 21.18 ? 335 CYS A O   1 
ATOM   868  C CB  . CYS A 1 121 ? 5.265   -0.282  12.011 1.00 20.79 ? 335 CYS A CB  1 
ATOM   869  S SG  . CYS A 1 121 ? 6.423   -1.496  12.719 1.00 24.07 ? 335 CYS A SG  1 
ATOM   870  N N   . SER A 1 122 ? 4.736   2.668   10.858 1.00 21.68 ? 336 SER A N   1 
ATOM   871  C CA  . SER A 1 122 ? 3.813   3.511   10.122 1.00 22.78 ? 336 SER A CA  1 
ATOM   872  C C   . SER A 1 122 ? 3.962   3.177   8.658  1.00 23.61 ? 336 SER A C   1 
ATOM   873  O O   . SER A 1 122 ? 5.072   3.187   8.125  1.00 22.90 ? 336 SER A O   1 
ATOM   874  C CB  . SER A 1 122 ? 4.132   4.995   10.338 1.00 22.63 ? 336 SER A CB  1 
ATOM   875  O OG  . SER A 1 122 ? 3.210   5.807   9.633  1.00 22.56 ? 336 SER A OG  1 
ATOM   876  N N   . PHE A 1 123 ? 2.831   2.901   8.013  1.00 25.11 ? 337 PHE A N   1 
ATOM   877  C CA  . PHE A 1 123 ? 2.820   2.320   6.679  1.00 26.29 ? 337 PHE A CA  1 
ATOM   878  C C   . PHE A 1 123 ? 3.865   1.200   6.553  1.00 26.56 ? 337 PHE A C   1 
ATOM   879  O O   . PHE A 1 123 ? 4.647   1.150   5.602  1.00 27.33 ? 337 PHE A O   1 
ATOM   880  C CB  . PHE A 1 123 ? 3.036   3.401   5.628  1.00 26.74 ? 337 PHE A CB  1 
ATOM   881  C CG  . PHE A 1 123 ? 1.858   4.323   5.466  1.00 27.78 ? 337 PHE A CG  1 
ATOM   882  C CD1 . PHE A 1 123 ? 1.805   5.525   6.144  1.00 29.90 ? 337 PHE A CD1 1 
ATOM   883  C CD2 . PHE A 1 123 ? 0.795   3.973   4.649  1.00 29.82 ? 337 PHE A CD2 1 
ATOM   884  C CE1 . PHE A 1 123 ? 0.708   6.381   5.990  1.00 28.64 ? 337 PHE A CE1 1 
ATOM   885  C CE2 . PHE A 1 123 ? -0.301  4.827   4.495  1.00 30.04 ? 337 PHE A CE2 1 
ATOM   886  C CZ  . PHE A 1 123 ? -0.334  6.027   5.181  1.00 29.78 ? 337 PHE A CZ  1 
ATOM   887  N N   . GLY A 1 124 ? 3.876   0.308   7.534  1.00 26.29 ? 338 GLY A N   1 
ATOM   888  C CA  . GLY A 1 124 ? 4.791   -0.818  7.503  1.00 26.32 ? 338 GLY A CA  1 
ATOM   889  C C   . GLY A 1 124 ? 6.260   -0.529  7.758  1.00 26.23 ? 338 GLY A C   1 
ATOM   890  O O   . GLY A 1 124 ? 7.060   -1.472  7.800  1.00 27.20 ? 338 GLY A O   1 
ATOM   891  N N   . LYS A 1 125 ? 6.634   0.745   7.926  1.00 25.31 ? 339 LYS A N   1 
ATOM   892  C CA  . LYS A 1 125 ? 8.033   1.102   8.216  1.00 24.74 ? 339 LYS A CA  1 
ATOM   893  C C   . LYS A 1 125 ? 8.273   1.343   9.715  1.00 23.92 ? 339 LYS A C   1 
ATOM   894  O O   . LYS A 1 125 ? 7.485   2.008   10.356 1.00 22.25 ? 339 LYS A O   1 
ATOM   895  C CB  . LYS A 1 125 ? 8.464   2.332   7.405  1.00 25.27 ? 339 LYS A CB  1 
ATOM   896  C CG  . LYS A 1 125 ? 8.005   2.315   5.915  1.00 26.76 ? 339 LYS A CG  1 
ATOM   897  C CD  . LYS A 1 125 ? 8.628   1.173   5.109  1.00 28.86 ? 339 LYS A CD  1 
ATOM   898  C CE  . LYS A 1 125 ? 8.321   1.340   3.632  1.00 31.49 ? 339 LYS A CE  1 
ATOM   899  N NZ  . LYS A 1 125 ? 8.911   0.278   2.808  1.00 33.58 ? 339 LYS A NZ  1 
ATOM   900  N N   . GLN A 1 126 ? 9.375   0.809   10.254 1.00 23.39 ? 340 GLN A N   1 
ATOM   901  C CA  . GLN A 1 126 ? 9.731   1.024   11.656 1.00 23.14 ? 340 GLN A CA  1 
ATOM   902  C C   . GLN A 1 126 ? 10.026  2.491   11.938 1.00 23.32 ? 340 GLN A C   1 
ATOM   903  O O   . GLN A 1 126 ? 10.882  3.092   11.267 1.00 22.66 ? 340 GLN A O   1 
ATOM   904  C CB  . GLN A 1 126 ? 10.961  0.192   12.028 1.00 24.08 ? 340 GLN A CB  1 
ATOM   905  C CG  . GLN A 1 126 ? 11.372  0.321   13.490 1.00 25.43 ? 340 GLN A CG  1 
ATOM   906  C CD  . GLN A 1 126 ? 12.592  -0.511  13.804 1.00 29.63 ? 340 GLN A CD  1 
ATOM   907  O OE1 . GLN A 1 126 ? 12.722  -1.621  13.317 1.00 30.67 ? 340 GLN A OE1 1 
ATOM   908  N NE2 . GLN A 1 126 ? 13.500  0.035   14.609 1.00 32.26 ? 340 GLN A NE2 1 
ATOM   909  N N   . VAL A 1 127 ? 9.317   3.055   12.922 1.00 22.52 ? 341 VAL A N   1 
ATOM   910  C CA  A VAL A 1 127 ? 9.576   4.429   13.317 0.50 22.97 ? 341 VAL A CA  1 
ATOM   911  C CA  B VAL A 1 127 ? 9.495   4.441   13.367 0.50 22.69 ? 341 VAL A CA  1 
ATOM   912  C C   . VAL A 1 127 ? 10.403  4.525   14.597 1.00 23.27 ? 341 VAL A C   1 
ATOM   913  O O   . VAL A 1 127 ? 11.319  5.343   14.655 1.00 22.77 ? 341 VAL A O   1 
ATOM   914  C CB  A VAL A 1 127 ? 8.307   5.347   13.323 0.50 23.02 ? 341 VAL A CB  1 
ATOM   915  C CB  B VAL A 1 127 ? 8.144   5.101   13.736 0.50 22.70 ? 341 VAL A CB  1 
ATOM   916  C CG1 A VAL A 1 127 ? 7.678   5.395   11.937 0.50 22.62 ? 341 VAL A CG1 1 
ATOM   917  C CG1 B VAL A 1 127 ? 8.326   6.582   14.016 0.50 22.40 ? 341 VAL A CG1 1 
ATOM   918  C CG2 A VAL A 1 127 ? 7.281   4.919   14.360 0.50 23.54 ? 341 VAL A CG2 1 
ATOM   919  C CG2 B VAL A 1 127 ? 7.112   4.898   12.641 0.50 21.63 ? 341 VAL A CG2 1 
ATOM   920  N N   . VAL A 1 128 ? 10.098  3.689   15.595 1.00 23.11 ? 342 VAL A N   1 
ATOM   921  C CA  A VAL A 1 128 ? 10.894  3.593   16.822 0.50 24.16 ? 342 VAL A CA  1 
ATOM   922  C CA  B VAL A 1 128 ? 10.861  3.622   16.849 0.50 24.03 ? 342 VAL A CA  1 
ATOM   923  C C   . VAL A 1 128 ? 10.835  2.181   17.343 1.00 24.56 ? 342 VAL A C   1 
ATOM   924  O O   . VAL A 1 128 ? 9.869   1.456   17.089 1.00 23.98 ? 342 VAL A O   1 
ATOM   925  C CB  A VAL A 1 128 ? 10.441  4.551   17.968 0.50 24.06 ? 342 VAL A CB  1 
ATOM   926  C CB  B VAL A 1 128 ? 10.265  4.519   17.980 0.50 23.88 ? 342 VAL A CB  1 
ATOM   927  C CG1 A VAL A 1 128 ? 10.907  5.954   17.714 0.50 24.39 ? 342 VAL A CG1 1 
ATOM   928  C CG1 B VAL A 1 128 ? 11.354  4.936   18.988 0.50 24.12 ? 342 VAL A CG1 1 
ATOM   929  C CG2 A VAL A 1 128 ? 8.939   4.509   18.213 0.50 24.47 ? 342 VAL A CG2 1 
ATOM   930  C CG2 B VAL A 1 128 ? 9.574   5.751   17.419 0.50 23.74 ? 342 VAL A CG2 1 
ATOM   931  N N   . GLU A 1 129 ? 11.886  1.786   18.053 1.00 25.48 ? 343 GLU A N   1 
ATOM   932  C CA  . GLU A 1 129 ? 11.934  0.491   18.704 1.00 26.53 ? 343 GLU A CA  1 
ATOM   933  C C   . GLU A 1 129 ? 12.310  0.721   20.170 1.00 27.44 ? 343 GLU A C   1 
ATOM   934  O O   . GLU A 1 129 ? 13.170  1.555   20.471 1.00 27.33 ? 343 GLU A O   1 
ATOM   935  C CB  . GLU A 1 129 ? 12.954  -0.434  18.034 1.00 27.21 ? 343 GLU A CB  1 
ATOM   936  C CG  . GLU A 1 129 ? 12.996  -1.837  18.661 1.00 28.89 ? 343 GLU A CG  1 
ATOM   937  C CD  . GLU A 1 129 ? 14.053  -2.744  18.061 1.00 31.36 ? 343 GLU A CD  1 
ATOM   938  O OE1 . GLU A 1 129 ? 15.052  -2.242  17.514 1.00 35.23 ? 343 GLU A OE1 1 
ATOM   939  O OE2 . GLU A 1 129 ? 13.893  -3.972  18.149 1.00 30.44 ? 343 GLU A OE2 1 
ATOM   940  N N   . LYS A 1 130 ? 11.639  0.006   21.068 1.00 27.57 ? 344 LYS A N   1 
ATOM   941  C CA  . LYS A 1 130 ? 12.052  -0.073  22.474 1.00 28.29 ? 344 LYS A CA  1 
ATOM   942  C C   . LYS A 1 130 ? 12.479  -1.516  22.730 1.00 27.65 ? 344 LYS A C   1 
ATOM   943  O O   . LYS A 1 130 ? 11.809  -2.451  22.294 1.00 27.15 ? 344 LYS A O   1 
ATOM   944  C CB  . LYS A 1 130 ? 10.890  0.335   23.380 1.00 28.53 ? 344 LYS A CB  1 
ATOM   945  C CG  . LYS A 1 130 ? 11.129  0.175   24.877 1.00 31.99 ? 344 LYS A CG  1 
ATOM   946  C CD  . LYS A 1 130 ? 9.870   0.571   25.668 1.00 33.97 ? 344 LYS A CD  1 
ATOM   947  C CE  . LYS A 1 130 ? 8.693   -0.384  25.371 1.00 36.94 ? 344 LYS A CE  1 
ATOM   948  N NZ  . LYS A 1 130 ? 7.471   -0.042  26.154 1.00 37.67 ? 344 LYS A NZ  1 
ATOM   949  N N   . VAL A 1 131 ? 13.605  -1.691  23.417 1.00 26.92 ? 345 VAL A N   1 
ATOM   950  C CA  . VAL A 1 131 ? 14.119  -3.010  23.708 1.00 26.80 ? 345 VAL A CA  1 
ATOM   951  C C   . VAL A 1 131 ? 14.311  -3.141  25.216 1.00 27.22 ? 345 VAL A C   1 
ATOM   952  O O   . VAL A 1 131 ? 14.895  -2.257  25.849 1.00 27.11 ? 345 VAL A O   1 
ATOM   953  C CB  . VAL A 1 131 ? 15.440  -3.286  22.955 1.00 26.90 ? 345 VAL A CB  1 
ATOM   954  C CG1 . VAL A 1 131 ? 16.017  -4.645  23.358 1.00 27.19 ? 345 VAL A CG1 1 
ATOM   955  C CG2 . VAL A 1 131 ? 15.221  -3.238  21.451 1.00 26.86 ? 345 VAL A CG2 1 
ATOM   956  N N   . GLU A 1 132 ? 13.781  -4.226  25.779 1.00 26.95 ? 346 GLU A N   1 
ATOM   957  C CA  . GLU A 1 132 ? 13.821  -4.462  27.217 1.00 27.45 ? 346 GLU A CA  1 
ATOM   958  C C   . GLU A 1 132 ? 14.256  -5.872  27.519 1.00 26.70 ? 346 GLU A C   1 
ATOM   959  O O   . GLU A 1 132 ? 13.846  -6.813  26.850 1.00 26.49 ? 346 GLU A O   1 
ATOM   960  C CB  . GLU A 1 132 ? 12.456  -4.204  27.847 1.00 27.58 ? 346 GLU A CB  1 
ATOM   961  C CG  . GLU A 1 132 ? 12.036  -2.753  27.754 1.00 30.22 ? 346 GLU A CG  1 
ATOM   962  C CD  . GLU A 1 132 ? 10.554  -2.584  27.875 1.00 33.30 ? 346 GLU A CD  1 
ATOM   963  O OE1 . GLU A 1 132 ? 9.806   -3.265  27.129 1.00 34.86 ? 346 GLU A OE1 1 
ATOM   964  O OE2 . GLU A 1 132 ? 10.143  -1.774  28.724 1.00 35.25 ? 346 GLU A OE2 1 
ATOM   965  N N   . THR A 1 133 ? 15.094  -6.011  28.536 1.00 26.30 ? 347 THR A N   1 
ATOM   966  C CA  . THR A 1 133 ? 15.594  -7.314  28.936 1.00 25.48 ? 347 THR A CA  1 
ATOM   967  C C   . THR A 1 133 ? 14.968  -7.645  30.276 1.00 24.92 ? 347 THR A C   1 
ATOM   968  O O   . THR A 1 133 ? 14.977  -6.820  31.195 1.00 24.90 ? 347 THR A O   1 
ATOM   969  C CB  . THR A 1 133 ? 17.128  -7.296  29.042 1.00 26.56 ? 347 THR A CB  1 
ATOM   970  O OG1 . THR A 1 133 ? 17.687  -6.916  27.777 1.00 26.87 ? 347 THR A OG1 1 
ATOM   971  C CG2 . THR A 1 133 ? 17.657  -8.669  29.429 1.00 24.75 ? 347 THR A CG2 1 
ATOM   972  N N   . GLU A 1 134 ? 14.407  -8.837  30.393 1.00 23.72 ? 348 GLU A N   1 
ATOM   973  C CA  . GLU A 1 134 ? 13.734  -9.213  31.629 1.00 23.90 ? 348 GLU A CA  1 
ATOM   974  C C   . GLU A 1 134 ? 14.213  -10.562 32.160 1.00 23.04 ? 348 GLU A C   1 
ATOM   975  O O   . GLU A 1 134 ? 14.416  -11.508 31.406 1.00 22.39 ? 348 GLU A O   1 
ATOM   976  C CB  . GLU A 1 134 ? 12.214  -9.228  31.439 1.00 24.31 ? 348 GLU A CB  1 
ATOM   977  C CG  . GLU A 1 134 ? 11.632  -7.908  30.906 1.00 27.21 ? 348 GLU A CG  1 
ATOM   978  C CD  . GLU A 1 134 ? 11.827  -6.708  31.832 1.00 33.11 ? 348 GLU A CD  1 
ATOM   979  O OE1 . GLU A 1 134 ? 11.854  -5.575  31.305 1.00 36.95 ? 348 GLU A OE1 1 
ATOM   980  O OE2 . GLU A 1 134 ? 11.947  -6.868  33.074 1.00 36.29 ? 348 GLU A OE2 1 
ATOM   981  N N   . TYR A 1 135 ? 14.380  -10.622 33.474 1.00 22.85 ? 349 TYR A N   1 
ATOM   982  C CA  . TYR A 1 135 ? 14.852  -11.817 34.166 1.00 22.27 ? 349 TYR A CA  1 
ATOM   983  C C   . TYR A 1 135 ? 13.692  -12.437 34.935 1.00 22.24 ? 349 TYR A C   1 
ATOM   984  O O   . TYR A 1 135 ? 12.732  -11.738 35.300 1.00 22.17 ? 349 TYR A O   1 
ATOM   985  C CB  . TYR A 1 135 ? 15.991  -11.444 35.114 1.00 22.12 ? 349 TYR A CB  1 
ATOM   986  C CG  . TYR A 1 135 ? 17.233  -10.967 34.385 1.00 24.13 ? 349 TYR A CG  1 
ATOM   987  C CD1 . TYR A 1 135 ? 18.320  -11.822 34.173 1.00 25.72 ? 349 TYR A CD1 1 
ATOM   988  C CD2 . TYR A 1 135 ? 17.326  -9.660  33.924 1.00 25.53 ? 349 TYR A CD2 1 
ATOM   989  C CE1 . TYR A 1 135 ? 19.456  -11.378 33.480 1.00 26.56 ? 349 TYR A CE1 1 
ATOM   990  C CE2 . TYR A 1 135 ? 18.441  -9.213  33.246 1.00 26.65 ? 349 TYR A CE2 1 
ATOM   991  C CZ  . TYR A 1 135 ? 19.493  -10.073 33.020 1.00 27.76 ? 349 TYR A CZ  1 
ATOM   992  O OH  . TYR A 1 135 ? 20.588  -9.594  32.344 1.00 30.47 ? 349 TYR A OH  1 
ATOM   993  N N   . ALA A 1 136 ? 13.803  -13.734 35.204 1.00 21.55 ? 350 ALA A N   1 
ATOM   994  C CA  . ALA A 1 136 ? 12.724  -14.535 35.793 1.00 21.54 ? 350 ALA A CA  1 
ATOM   995  C C   . ALA A 1 136 ? 12.654  -14.362 37.302 1.00 21.91 ? 350 ALA A C   1 
ATOM   996  O O   . ALA A 1 136 ? 13.674  -14.122 37.956 1.00 22.11 ? 350 ALA A O   1 
ATOM   997  C CB  . ALA A 1 136 ? 12.935  -16.001 35.468 1.00 21.19 ? 350 ALA A CB  1 
ATOM   998  N N   . ARG A 1 137 ? 11.453  -14.500 37.841 1.00 22.97 ? 351 ARG A N   1 
ATOM   999  C CA  . ARG A 1 137 ? 11.264  -14.679 39.283 1.00 24.36 ? 351 ARG A CA  1 
ATOM   1000 C C   . ARG A 1 137 ? 10.541  -15.995 39.514 1.00 25.46 ? 351 ARG A C   1 
ATOM   1001 O O   . ARG A 1 137 ? 9.524   -16.277 38.872 1.00 24.94 ? 351 ARG A O   1 
ATOM   1002 C CB  . ARG A 1 137 ? 10.480  -13.501 39.892 1.00 24.15 ? 351 ARG A CB  1 
ATOM   1003 C CG  . ARG A 1 137 ? 10.234  -13.610 41.417 1.00 24.57 ? 351 ARG A CG  1 
ATOM   1004 C CD  . ARG A 1 137 ? 9.510   -12.379 41.969 1.00 23.87 ? 351 ARG A CD  1 
ATOM   1005 N NE  . ARG A 1 137 ? 10.421  -11.241 42.117 1.00 26.30 ? 351 ARG A NE  1 
ATOM   1006 C CZ  . ARG A 1 137 ? 10.089  -9.983  41.842 1.00 28.40 ? 351 ARG A CZ  1 
ATOM   1007 N NH1 . ARG A 1 137 ? 8.867   -9.695  41.412 1.00 31.33 ? 351 ARG A NH1 1 
ATOM   1008 N NH2 . ARG A 1 137 ? 10.971  -9.016  41.992 1.00 30.04 ? 351 ARG A NH2 1 
ATOM   1009 N N   . TYR A 1 138 ? 11.066  -16.820 40.416 1.00 26.73 ? 352 TYR A N   1 
ATOM   1010 C CA  . TYR A 1 138 ? 10.377  -18.062 40.736 1.00 28.88 ? 352 TYR A CA  1 
ATOM   1011 C C   . TYR A 1 138 ? 9.030   -17.733 41.377 1.00 30.15 ? 352 TYR A C   1 
ATOM   1012 O O   . TYR A 1 138 ? 8.949   -16.846 42.227 1.00 29.26 ? 352 TYR A O   1 
ATOM   1013 C CB  . TYR A 1 138 ? 11.224  -18.937 41.661 1.00 29.33 ? 352 TYR A CB  1 
ATOM   1014 C CG  . TYR A 1 138 ? 10.570  -20.243 42.046 1.00 31.62 ? 352 TYR A CG  1 
ATOM   1015 C CD1 . TYR A 1 138 ? 9.728   -20.324 43.161 1.00 32.96 ? 352 TYR A CD1 1 
ATOM   1016 C CD2 . TYR A 1 138 ? 10.799  -21.404 41.303 1.00 33.94 ? 352 TYR A CD2 1 
ATOM   1017 C CE1 . TYR A 1 138 ? 9.116   -21.525 43.512 1.00 34.54 ? 352 TYR A CE1 1 
ATOM   1018 C CE2 . TYR A 1 138 ? 10.205  -22.614 41.656 1.00 35.02 ? 352 TYR A CE2 1 
ATOM   1019 C CZ  . TYR A 1 138 ? 9.368   -22.665 42.761 1.00 36.75 ? 352 TYR A CZ  1 
ATOM   1020 O OH  . TYR A 1 138 ? 8.774   -23.855 43.108 1.00 39.03 ? 352 TYR A OH  1 
ATOM   1021 N N   . GLU A 1 139 ? 7.995   -18.458 40.958 1.00 32.65 ? 353 GLU A N   1 
ATOM   1022 C CA  . GLU A 1 139 ? 6.620   -18.220 41.377 1.00 35.01 ? 353 GLU A CA  1 
ATOM   1023 C C   . GLU A 1 139 ? 5.842   -19.526 41.234 1.00 36.13 ? 353 GLU A C   1 
ATOM   1024 O O   . GLU A 1 139 ? 5.325   -19.825 40.155 1.00 36.64 ? 353 GLU A O   1 
ATOM   1025 C CB  . GLU A 1 139 ? 5.980   -17.150 40.480 1.00 35.73 ? 353 GLU A CB  1 
ATOM   1026 C CG  . GLU A 1 139 ? 4.689   -16.520 41.013 1.00 37.49 ? 353 GLU A CG  1 
ATOM   1027 C CD  . GLU A 1 139 ? 3.879   -15.801 39.924 1.00 40.24 ? 353 GLU A CD  1 
ATOM   1028 O OE1 . GLU A 1 139 ? 3.557   -16.425 38.884 1.00 41.27 ? 353 GLU A OE1 1 
ATOM   1029 O OE2 . GLU A 1 139 ? 3.546   -14.613 40.118 1.00 41.72 ? 353 GLU A OE2 1 
ATOM   1030 N N   . ASN A 1 140 ? 5.767   -20.314 42.309 1.00 37.06 ? 354 ASN A N   1 
ATOM   1031 C CA  . ASN A 1 140 ? 4.846   -21.463 42.344 1.00 37.51 ? 354 ASN A CA  1 
ATOM   1032 C C   . ASN A 1 140 ? 5.166   -22.565 41.342 1.00 37.42 ? 354 ASN A C   1 
ATOM   1033 O O   . ASN A 1 140 ? 4.274   -23.063 40.648 1.00 38.19 ? 354 ASN A O   1 
ATOM   1034 C CB  . ASN A 1 140 ? 3.400   -20.979 42.120 1.00 38.16 ? 354 ASN A CB  1 
ATOM   1035 C CG  . ASN A 1 140 ? 2.955   -19.951 43.151 1.00 39.57 ? 354 ASN A CG  1 
ATOM   1036 O OD1 . ASN A 1 140 ? 3.117   -20.156 44.355 1.00 42.45 ? 354 ASN A OD1 1 
ATOM   1037 N ND2 . ASN A 1 140 ? 2.384   -18.840 42.683 1.00 40.68 ? 354 ASN A ND2 1 
ATOM   1038 N N   . GLY A 1 141 ? 6.430   -22.953 41.253 1.00 37.12 ? 355 GLY A N   1 
ATOM   1039 C CA  . GLY A 1 141 ? 6.830   -23.969 40.287 1.00 36.89 ? 355 GLY A CA  1 
ATOM   1040 C C   . GLY A 1 141 ? 7.116   -23.429 38.887 1.00 36.21 ? 355 GLY A C   1 
ATOM   1041 O O   . GLY A 1 141 ? 7.908   -24.019 38.143 1.00 36.71 ? 355 GLY A O   1 
ATOM   1042 N N   . HIS A 1 142 ? 6.477   -22.319 38.520 1.00 35.53 ? 356 HIS A N   1 
ATOM   1043 C CA  . HIS A 1 142 ? 6.767   -21.662 37.238 1.00 34.29 ? 356 HIS A CA  1 
ATOM   1044 C C   . HIS A 1 142 ? 7.572   -20.372 37.451 1.00 33.09 ? 356 HIS A C   1 
ATOM   1045 O O   . HIS A 1 142 ? 7.970   -20.057 38.586 1.00 34.03 ? 356 HIS A O   1 
ATOM   1046 C CB  . HIS A 1 142 ? 5.469   -21.399 36.458 1.00 34.51 ? 356 HIS A CB  1 
ATOM   1047 C CG  . HIS A 1 142 ? 4.532   -20.456 37.145 1.00 35.25 ? 356 HIS A CG  1 
ATOM   1048 N ND1 . HIS A 1 142 ? 3.376   -20.877 37.766 1.00 37.19 ? 356 HIS A ND1 1 
ATOM   1049 C CD2 . HIS A 1 142 ? 4.585   -19.116 37.320 1.00 35.85 ? 356 HIS A CD2 1 
ATOM   1050 C CE1 . HIS A 1 142 ? 2.758   -19.837 38.294 1.00 35.60 ? 356 HIS A CE1 1 
ATOM   1051 N NE2 . HIS A 1 142 ? 3.471   -18.756 38.038 1.00 36.32 ? 356 HIS A NE2 1 
ATOM   1052 N N   . TYR A 1 143 ? 7.818   -19.626 36.375 1.00 30.66 ? 357 TYR A N   1 
ATOM   1053 C CA  . TYR A 1 143 ? 8.589   -18.386 36.471 1.00 28.56 ? 357 TYR A CA  1 
ATOM   1054 C C   . TYR A 1 143 ? 7.804   -17.204 35.898 1.00 27.82 ? 357 TYR A C   1 
ATOM   1055 O O   . TYR A 1 143 ? 7.127   -17.334 34.861 1.00 27.05 ? 357 TYR A O   1 
ATOM   1056 C CB  . TYR A 1 143 ? 9.960   -18.529 35.784 1.00 28.23 ? 357 TYR A CB  1 
ATOM   1057 C CG  . TYR A 1 143 ? 10.796  -19.631 36.389 1.00 27.24 ? 357 TYR A CG  1 
ATOM   1058 C CD1 . TYR A 1 143 ? 11.640  -19.382 37.474 1.00 26.22 ? 357 TYR A CD1 1 
ATOM   1059 C CD2 . TYR A 1 143 ? 10.711  -20.931 35.903 1.00 24.66 ? 357 TYR A CD2 1 
ATOM   1060 C CE1 . TYR A 1 143 ? 12.395  -20.403 38.053 1.00 25.32 ? 357 TYR A CE1 1 
ATOM   1061 C CE2 . TYR A 1 143 ? 11.458  -21.961 36.476 1.00 25.90 ? 357 TYR A CE2 1 
ATOM   1062 C CZ  . TYR A 1 143 ? 12.294  -21.683 37.551 1.00 26.63 ? 357 TYR A CZ  1 
ATOM   1063 O OH  . TYR A 1 143 ? 13.033  -22.697 38.109 1.00 27.06 ? 357 TYR A OH  1 
ATOM   1064 N N   . SER A 1 144 ? 7.884   -16.065 36.579 1.00 26.39 ? 358 SER A N   1 
ATOM   1065 C CA  . SER A 1 144 ? 7.215   -14.848 36.118 1.00 26.13 ? 358 SER A CA  1 
ATOM   1066 C C   . SER A 1 144 ? 8.186   -13.775 35.641 1.00 24.81 ? 358 SER A C   1 
ATOM   1067 O O   . SER A 1 144 ? 9.322   -13.650 36.136 1.00 24.25 ? 358 SER A O   1 
ATOM   1068 C CB  . SER A 1 144 ? 6.284   -14.272 37.193 1.00 26.31 ? 358 SER A CB  1 
ATOM   1069 O OG  . SER A 1 144 ? 7.010   -14.062 38.392 1.00 30.50 ? 358 SER A OG  1 
ATOM   1070 N N   . TYR A 1 145 ? 7.713   -13.003 34.669 1.00 23.98 ? 359 TYR A N   1 
ATOM   1071 C CA  . TYR A 1 145 ? 8.448   -11.873 34.107 1.00 23.44 ? 359 TYR A CA  1 
ATOM   1072 C C   . TYR A 1 145 ? 7.481   -10.728 34.085 1.00 24.33 ? 359 TYR A C   1 
ATOM   1073 O O   . TYR A 1 145 ? 6.342   -10.891 33.678 1.00 24.15 ? 359 TYR A O   1 
ATOM   1074 C CB  . TYR A 1 145 ? 8.904   -12.153 32.672 1.00 21.92 ? 359 TYR A CB  1 
ATOM   1075 C CG  . TYR A 1 145 ? 9.712   -13.420 32.541 1.00 20.74 ? 359 TYR A CG  1 
ATOM   1076 C CD1 . TYR A 1 145 ? 11.105  -13.377 32.498 1.00 19.21 ? 359 TYR A CD1 1 
ATOM   1077 C CD2 . TYR A 1 145 ? 9.084   -14.662 32.458 1.00 21.10 ? 359 TYR A CD2 1 
ATOM   1078 C CE1 . TYR A 1 145 ? 11.856  -14.560 32.390 1.00 19.98 ? 359 TYR A CE1 1 
ATOM   1079 C CE2 . TYR A 1 145 ? 9.829   -15.843 32.356 1.00 21.43 ? 359 TYR A CE2 1 
ATOM   1080 C CZ  . TYR A 1 145 ? 11.197  -15.780 32.317 1.00 20.03 ? 359 TYR A CZ  1 
ATOM   1081 O OH  . TYR A 1 145 ? 11.913  -16.953 32.214 1.00 22.10 ? 359 TYR A OH  1 
ATOM   1082 N N   . ARG A 1 146 ? 7.934   -9.572  34.539 1.00 25.80 ? 360 ARG A N   1 
ATOM   1083 C CA  . ARG A 1 146 ? 7.088   -8.408  34.534 1.00 27.99 ? 360 ARG A CA  1 
ATOM   1084 C C   . ARG A 1 146 ? 7.855   -7.233  33.958 1.00 28.74 ? 360 ARG A C   1 
ATOM   1085 O O   . ARG A 1 146 ? 9.010   -6.974  34.343 1.00 28.36 ? 360 ARG A O   1 
ATOM   1086 C CB  . ARG A 1 146 ? 6.564   -8.113  35.944 1.00 28.22 ? 360 ARG A CB  1 
ATOM   1087 C CG  . ARG A 1 146 ? 5.506   -7.018  35.965 1.00 31.58 ? 360 ARG A CG  1 
ATOM   1088 C CD  . ARG A 1 146 ? 4.719   -7.007  37.255 1.00 36.50 ? 360 ARG A CD  1 
ATOM   1089 N NE  . ARG A 1 146 ? 3.866   -5.816  37.332 1.00 42.19 ? 360 ARG A NE  1 
ATOM   1090 C CZ  . ARG A 1 146 ? 2.684   -5.683  36.727 1.00 44.22 ? 360 ARG A CZ  1 
ATOM   1091 N NH1 . ARG A 1 146 ? 1.998   -4.553  36.860 1.00 45.93 ? 360 ARG A NH1 1 
ATOM   1092 N NH2 . ARG A 1 146 ? 2.182   -6.669  35.992 1.00 44.98 ? 360 ARG A NH2 1 
ATOM   1093 N N   . ILE A 1 147 ? 7.221   -6.539  33.012 1.00 29.52 ? 361 ILE A N   1 
ATOM   1094 C CA  . ILE A 1 147 ? 7.725   -5.247  32.567 1.00 30.37 ? 361 ILE A CA  1 
ATOM   1095 C C   . ILE A 1 147 ? 6.792   -4.224  33.217 1.00 30.72 ? 361 ILE A C   1 
ATOM   1096 O O   . ILE A 1 147 ? 5.647   -4.048  32.797 1.00 31.09 ? 361 ILE A O   1 
ATOM   1097 C CB  . ILE A 1 147 ? 7.790   -5.144  31.010 1.00 30.61 ? 361 ILE A CB  1 
ATOM   1098 C CG1 . ILE A 1 147 ? 8.548   -6.343  30.421 1.00 30.82 ? 361 ILE A CG1 1 
ATOM   1099 C CG2 . ILE A 1 147 ? 8.437   -3.832  30.582 1.00 31.77 ? 361 ILE A CG2 1 
ATOM   1100 C CD1 . ILE A 1 147 ? 8.479   -6.479  28.882 1.00 33.05 ? 361 ILE A CD1 1 
ATOM   1101 N N   . HIS A 1 148 ? 7.270   -3.605  34.291 1.00 30.89 ? 362 HIS A N   1 
ATOM   1102 C CA  . HIS A 1 148 ? 6.436   -2.758  35.154 1.00 31.21 ? 362 HIS A CA  1 
ATOM   1103 C C   . HIS A 1 148 ? 6.617   -1.274  34.819 1.00 30.76 ? 362 HIS A C   1 
ATOM   1104 O O   . HIS A 1 148 ? 7.729   -0.746  34.914 1.00 30.97 ? 362 HIS A O   1 
ATOM   1105 C CB  . HIS A 1 148 ? 6.796   -3.019  36.629 1.00 31.64 ? 362 HIS A CB  1 
ATOM   1106 C CG  . HIS A 1 148 ? 5.813   -2.457  37.614 1.00 33.36 ? 362 HIS A CG  1 
ATOM   1107 N ND1 . HIS A 1 148 ? 6.158   -1.504  38.549 1.00 35.17 ? 362 HIS A ND1 1 
ATOM   1108 C CD2 . HIS A 1 148 ? 4.503   -2.729  37.823 1.00 34.88 ? 362 HIS A CD2 1 
ATOM   1109 C CE1 . HIS A 1 148 ? 5.104   -1.210  39.289 1.00 34.88 ? 362 HIS A CE1 1 
ATOM   1110 N NE2 . HIS A 1 148 ? 4.085   -1.939  38.868 1.00 35.36 ? 362 HIS A NE2 1 
ATOM   1111 N N   . ARG A 1 149 ? 5.529   -0.618  34.416 1.00 30.67 ? 363 ARG A N   1 
ATOM   1112 C CA  . ARG A 1 149 ? 5.505   0.830   34.128 1.00 30.48 ? 363 ARG A CA  1 
ATOM   1113 C C   . ARG A 1 149 ? 6.646   1.298   33.220 1.00 30.34 ? 363 ARG A C   1 
ATOM   1114 O O   . ARG A 1 149 ? 7.345   2.267   33.523 1.00 30.54 ? 363 ARG A O   1 
ATOM   1115 C CB  . ARG A 1 149 ? 5.466   1.643   35.426 1.00 31.02 ? 363 ARG A CB  1 
ATOM   1116 C CG  . ARG A 1 149 ? 4.204   1.389   36.249 1.00 31.93 ? 363 ARG A CG  1 
ATOM   1117 C CD  . ARG A 1 149 ? 4.290   1.939   37.664 1.00 34.12 ? 363 ARG A CD  1 
ATOM   1118 N NE  . ARG A 1 149 ? 4.410   3.397   37.705 1.00 36.13 ? 363 ARG A NE  1 
ATOM   1119 C CZ  . ARG A 1 149 ? 3.389   4.249   37.785 1.00 35.66 ? 363 ARG A CZ  1 
ATOM   1120 N NH1 . ARG A 1 149 ? 2.136   3.816   37.822 1.00 36.56 ? 363 ARG A NH1 1 
ATOM   1121 N NH2 . ARG A 1 149 ? 3.631   5.550   37.819 1.00 36.48 ? 363 ARG A NH2 1 
ATOM   1122 N N   . SER A 1 150 ? 6.836   0.578   32.122 1.00 29.86 ? 364 SER A N   1 
ATOM   1123 C CA  . SER A 1 150 ? 7.734   0.984   31.055 1.00 30.11 ? 364 SER A CA  1 
ATOM   1124 C C   . SER A 1 150 ? 7.242   2.351   30.546 1.00 29.64 ? 364 SER A C   1 
ATOM   1125 O O   . SER A 1 150 ? 6.068   2.491   30.200 1.00 29.25 ? 364 SER A O   1 
ATOM   1126 C CB  . SER A 1 150 ? 7.665   -0.063  29.946 1.00 30.25 ? 364 SER A CB  1 
ATOM   1127 O OG  . SER A 1 150 ? 8.611   0.165   28.910 1.00 33.37 ? 364 SER A OG  1 
ATOM   1128 N N   . PRO A 1 151 ? 8.117   3.382   30.537 1.00 29.25 ? 365 PRO A N   1 
ATOM   1129 C CA  . PRO A 1 151 ? 7.611   4.669   30.067 1.00 28.35 ? 365 PRO A CA  1 
ATOM   1130 C C   . PRO A 1 151 ? 7.275   4.608   28.588 1.00 27.83 ? 365 PRO A C   1 
ATOM   1131 O O   . PRO A 1 151 ? 8.033   4.051   27.797 1.00 27.51 ? 365 PRO A O   1 
ATOM   1132 C CB  . PRO A 1 151 ? 8.780   5.630   30.324 1.00 28.75 ? 365 PRO A CB  1 
ATOM   1133 C CG  . PRO A 1 151 ? 9.722   4.883   31.230 1.00 29.97 ? 365 PRO A CG  1 
ATOM   1134 C CD  . PRO A 1 151 ? 9.542   3.450   30.899 1.00 29.28 ? 365 PRO A CD  1 
ATOM   1135 N N   . LEU A 1 152 ? 6.120   5.145   28.214 1.00 27.15 ? 366 LEU A N   1 
ATOM   1136 C CA  . LEU A 1 152 ? 5.743   5.213   26.817 1.00 26.96 ? 366 LEU A CA  1 
ATOM   1137 C C   . LEU A 1 152 ? 6.665   6.202   26.099 1.00 27.08 ? 366 LEU A C   1 
ATOM   1138 O O   . LEU A 1 152 ? 6.915   7.278   26.621 1.00 26.87 ? 366 LEU A O   1 
ATOM   1139 C CB  . LEU A 1 152 ? 4.293   5.683   26.718 1.00 27.26 ? 366 LEU A CB  1 
ATOM   1140 C CG  . LEU A 1 152 ? 3.536   5.436   25.420 1.00 27.29 ? 366 LEU A CG  1 
ATOM   1141 C CD1 . LEU A 1 152 ? 3.504   3.942   25.095 1.00 28.82 ? 366 LEU A CD1 1 
ATOM   1142 C CD2 . LEU A 1 152 ? 2.117   6.005   25.509 1.00 27.42 ? 366 LEU A CD2 1 
ATOM   1143 N N   . CYS A 1 153 ? 7.166   5.859   24.913 1.00 27.34 ? 367 CYS A N   1 
ATOM   1144 C CA  . CYS A 1 153 ? 8.061   6.786   24.192 1.00 28.62 ? 367 CYS A CA  1 
ATOM   1145 C C   . CYS A 1 153 ? 7.347   8.059   23.769 1.00 27.24 ? 367 CYS A C   1 
ATOM   1146 O O   . CYS A 1 153 ? 6.105   8.097   23.631 1.00 26.30 ? 367 CYS A O   1 
ATOM   1147 C CB  . CYS A 1 153 ? 8.729   6.158   22.960 1.00 29.66 ? 367 CYS A CB  1 
ATOM   1148 S SG  . CYS A 1 153 ? 7.596   5.304   21.932 1.00 36.89 ? 367 CYS A SG  1 
ATOM   1149 N N   . GLU A 1 154 ? 8.153   9.093   23.557 1.00 25.95 ? 368 GLU A N   1 
ATOM   1150 C CA  . GLU A 1 154 ? 7.643   10.392  23.172 1.00 25.74 ? 368 GLU A CA  1 
ATOM   1151 C C   . GLU A 1 154 ? 6.837   10.344  21.892 1.00 24.14 ? 368 GLU A C   1 
ATOM   1152 O O   . GLU A 1 154 ? 5.824   11.028  21.777 1.00 23.43 ? 368 GLU A O   1 
ATOM   1153 C CB  . GLU A 1 154 ? 8.786   11.409  23.054 1.00 26.19 ? 368 GLU A CB  1 
ATOM   1154 C CG  . GLU A 1 154 ? 9.412   11.726  24.400 1.00 29.06 ? 368 GLU A CG  1 
ATOM   1155 C CD  . GLU A 1 154 ? 8.385   12.146  25.453 1.00 33.29 ? 368 GLU A CD  1 
ATOM   1156 O OE1 . GLU A 1 154 ? 8.506   11.667  26.607 1.00 37.33 ? 368 GLU A OE1 1 
ATOM   1157 O OE2 . GLU A 1 154 ? 7.453   12.931  25.137 1.00 33.99 ? 368 GLU A OE2 1 
ATOM   1158 N N   . TYR A 1 155 ? 7.269   9.526   20.936 1.00 23.65 ? 369 TYR A N   1 
ATOM   1159 C CA  . TYR A 1 155 ? 6.509   9.378   19.699 1.00 22.86 ? 369 TYR A CA  1 
ATOM   1160 C C   . TYR A 1 155 ? 5.053   8.964   19.969 1.00 22.86 ? 369 TYR A C   1 
ATOM   1161 O O   . TYR A 1 155 ? 4.102   9.515   19.387 1.00 22.18 ? 369 TYR A O   1 
ATOM   1162 C CB  . TYR A 1 155 ? 7.162   8.354   18.782 1.00 22.51 ? 369 TYR A CB  1 
ATOM   1163 C CG  . TYR A 1 155 ? 6.409   8.183   17.490 1.00 23.17 ? 369 TYR A CG  1 
ATOM   1164 C CD1 . TYR A 1 155 ? 6.737   8.937   16.361 1.00 20.54 ? 369 TYR A CD1 1 
ATOM   1165 C CD2 . TYR A 1 155 ? 5.359   7.276   17.400 1.00 22.66 ? 369 TYR A CD2 1 
ATOM   1166 C CE1 . TYR A 1 155 ? 6.043   8.773   15.172 1.00 22.57 ? 369 TYR A CE1 1 
ATOM   1167 C CE2 . TYR A 1 155 ? 4.653   7.104   16.234 1.00 23.39 ? 369 TYR A CE2 1 
ATOM   1168 C CZ  . TYR A 1 155 ? 4.985   7.855   15.123 1.00 23.60 ? 369 TYR A CZ  1 
ATOM   1169 O OH  . TYR A 1 155 ? 4.271   7.664   13.979 1.00 23.36 ? 369 TYR A OH  1 
ATOM   1170 N N   . MET A 1 156 ? 4.887   7.967   20.831 1.00 22.97 ? 370 MET A N   1 
ATOM   1171 C CA  . MET A 1 156 ? 3.559   7.489   21.183 1.00 23.21 ? 370 MET A CA  1 
ATOM   1172 C C   . MET A 1 156 ? 2.739   8.502   21.978 1.00 23.42 ? 370 MET A C   1 
ATOM   1173 O O   . MET A 1 156 ? 1.545   8.640   21.750 1.00 23.71 ? 370 MET A O   1 
ATOM   1174 C CB  . MET A 1 156 ? 3.661   6.160   21.927 1.00 23.72 ? 370 MET A CB  1 
ATOM   1175 C CG  . MET A 1 156 ? 3.969   5.002   21.007 1.00 23.79 ? 370 MET A CG  1 
ATOM   1176 S SD  . MET A 1 156 ? 2.850   4.921   19.597 1.00 29.73 ? 370 MET A SD  1 
ATOM   1177 C CE  . MET A 1 156 ? 1.235   4.913   20.405 1.00 28.00 ? 370 MET A CE  1 
ATOM   1178 N N   . ILE A 1 157 ? 3.381   9.224   22.893 1.00 24.14 ? 371 ILE A N   1 
ATOM   1179 C CA  . ILE A 1 157 ? 2.707   10.301  23.619 1.00 24.35 ? 371 ILE A CA  1 
ATOM   1180 C C   . ILE A 1 157 ? 2.209   11.355  22.606 1.00 24.90 ? 371 ILE A C   1 
ATOM   1181 O O   . ILE A 1 157 ? 1.036   11.767  22.639 1.00 25.67 ? 371 ILE A O   1 
ATOM   1182 C CB  . ILE A 1 157 ? 3.642   10.929  24.707 1.00 24.64 ? 371 ILE A CB  1 
ATOM   1183 C CG1 . ILE A 1 157 ? 4.069   9.868   25.733 1.00 23.86 ? 371 ILE A CG1 1 
ATOM   1184 C CG2 . ILE A 1 157 ? 2.981   12.130  25.399 1.00 24.73 ? 371 ILE A CG2 1 
ATOM   1185 C CD1 . ILE A 1 157 ? 4.964   10.387  26.864 1.00 24.52 ? 371 ILE A CD1 1 
ATOM   1186 N N   . ASN A 1 158 ? 3.098   11.763  21.702 1.00 25.40 ? 372 ASN A N   1 
ATOM   1187 C CA  . ASN A 1 158 ? 2.775   12.762  20.659 1.00 25.84 ? 372 ASN A CA  1 
ATOM   1188 C C   . ASN A 1 158 ? 1.690   12.281  19.695 1.00 25.51 ? 372 ASN A C   1 
ATOM   1189 O O   . ASN A 1 158 ? 0.829   13.064  19.275 1.00 24.72 ? 372 ASN A O   1 
ATOM   1190 C CB  . ASN A 1 158 ? 4.035   13.136  19.868 1.00 26.20 ? 372 ASN A CB  1 
ATOM   1191 C CG  . ASN A 1 158 ? 5.035   13.922  20.697 1.00 28.77 ? 372 ASN A CG  1 
ATOM   1192 O OD1 . ASN A 1 158 ? 4.693   14.482  21.739 1.00 31.39 ? 372 ASN A OD1 1 
ATOM   1193 N ND2 . ASN A 1 158 ? 6.285   13.948  20.247 1.00 31.37 ? 372 ASN A ND2 1 
ATOM   1194 N N   . PHE A 1 159 ? 1.755   10.998  19.332 1.00 25.08 ? 373 PHE A N   1 
ATOM   1195 C CA  . PHE A 1 159 ? 0.749   10.378  18.447 1.00 25.03 ? 373 PHE A CA  1 
ATOM   1196 C C   . PHE A 1 159 ? -0.637  10.428  19.087 1.00 25.16 ? 373 PHE A C   1 
ATOM   1197 O O   . PHE A 1 159 ? -1.611  10.802  18.438 1.00 25.36 ? 373 PHE A O   1 
ATOM   1198 C CB  . PHE A 1 159 ? 1.130   8.926   18.118 1.00 24.49 ? 373 PHE A CB  1 
ATOM   1199 C CG  . PHE A 1 159 ? 0.304   8.306   17.019 1.00 24.81 ? 373 PHE A CG  1 
ATOM   1200 C CD1 . PHE A 1 159 ? 0.660   8.471   15.686 1.00 26.27 ? 373 PHE A CD1 1 
ATOM   1201 C CD2 . PHE A 1 159 ? -0.802  7.519   17.321 1.00 25.24 ? 373 PHE A CD2 1 
ATOM   1202 C CE1 . PHE A 1 159 ? -0.092  7.874   14.658 1.00 26.11 ? 373 PHE A CE1 1 
ATOM   1203 C CE2 . PHE A 1 159 ? -1.560  6.920   16.302 1.00 26.28 ? 373 PHE A CE2 1 
ATOM   1204 C CZ  . PHE A 1 159 ? -1.203  7.104   14.972 1.00 26.28 ? 373 PHE A CZ  1 
ATOM   1205 N N   . ILE A 1 160 ? -0.721  10.042  20.356 1.00 25.64 ? 374 ILE A N   1 
ATOM   1206 C CA  . ILE A 1 160 ? -1.977  10.115  21.105 1.00 25.60 ? 374 ILE A CA  1 
ATOM   1207 C C   . ILE A 1 160 ? -2.501  11.551  21.147 1.00 26.66 ? 374 ILE A C   1 
ATOM   1208 O O   . ILE A 1 160 ? -3.688  11.783  20.943 1.00 26.05 ? 374 ILE A O   1 
ATOM   1209 C CB  . ILE A 1 160 ? -1.818  9.556   22.531 1.00 25.69 ? 374 ILE A CB  1 
ATOM   1210 C CG1 . ILE A 1 160 ? -1.574  8.036   22.476 1.00 24.65 ? 374 ILE A CG1 1 
ATOM   1211 C CG2 . ILE A 1 160 ? -3.054  9.917   23.412 1.00 24.50 ? 374 ILE A CG2 1 
ATOM   1212 C CD1 . ILE A 1 160 ? -0.975  7.455   23.748 1.00 25.96 ? 374 ILE A CD1 1 
ATOM   1213 N N   . HIS A 1 161 ? -1.606  12.507  21.389 1.00 27.91 ? 375 HIS A N   1 
ATOM   1214 C CA  . HIS A 1 161 ? -1.982  13.924  21.392 1.00 29.33 ? 375 HIS A CA  1 
ATOM   1215 C C   . HIS A 1 161 ? -2.592  14.344  20.058 1.00 29.16 ? 375 HIS A C   1 
ATOM   1216 O O   . HIS A 1 161 ? -3.646  14.973  20.017 1.00 28.82 ? 375 HIS A O   1 
ATOM   1217 C CB  . HIS A 1 161 ? -0.777  14.810  21.704 1.00 29.89 ? 375 HIS A CB  1 
ATOM   1218 C CG  . HIS A 1 161 ? -0.585  15.077  23.162 1.00 33.06 ? 375 HIS A CG  1 
ATOM   1219 N ND1 . HIS A 1 161 ? 0.502   14.609  23.867 1.00 35.55 ? 375 HIS A ND1 1 
ATOM   1220 C CD2 . HIS A 1 161 ? -1.335  15.774  24.048 1.00 35.69 ? 375 HIS A CD2 1 
ATOM   1221 C CE1 . HIS A 1 161 ? 0.413   14.999  25.125 1.00 35.37 ? 375 HIS A CE1 1 
ATOM   1222 N NE2 . HIS A 1 161 ? -0.693  15.707  25.262 1.00 37.95 ? 375 HIS A NE2 1 
ATOM   1223 N N   . LYS A 1 162 ? -1.921  13.992  18.970 1.00 29.32 ? 376 LYS A N   1 
ATOM   1224 C CA  . LYS A 1 162 ? -2.381  14.376  17.647 1.00 29.70 ? 376 LYS A CA  1 
ATOM   1225 C C   . LYS A 1 162 ? -3.714  13.727  17.303 1.00 29.80 ? 376 LYS A C   1 
ATOM   1226 O O   . LYS A 1 162 ? -4.604  14.386  16.752 1.00 28.62 ? 376 LYS A O   1 
ATOM   1227 C CB  . LYS A 1 162 ? -1.324  14.052  16.597 1.00 29.76 ? 376 LYS A CB  1 
ATOM   1228 C CG  . LYS A 1 162 ? -0.254  15.076  16.508 1.00 31.21 ? 376 LYS A CG  1 
ATOM   1229 C CD  . LYS A 1 162 ? 0.802   14.655  15.516 1.00 32.46 ? 376 LYS A CD  1 
ATOM   1230 C CE  . LYS A 1 162 ? 1.800   15.754  15.323 1.00 35.00 ? 376 LYS A CE  1 
ATOM   1231 N NZ  . LYS A 1 162 ? 1.116   16.980  14.816 1.00 36.94 ? 376 LYS A NZ  1 
ATOM   1232 N N   . LEU A 1 163 ? -3.861  12.445  17.646 1.00 30.36 ? 377 LEU A N   1 
ATOM   1233 C CA  . LEU A 1 163 ? -5.133  11.735  17.456 1.00 31.85 ? 377 LEU A CA  1 
ATOM   1234 C C   . LEU A 1 163 ? -6.315  12.452  18.110 1.00 33.32 ? 377 LEU A C   1 
ATOM   1235 O O   . LEU A 1 163 ? -7.341  12.687  17.471 1.00 32.85 ? 377 LEU A O   1 
ATOM   1236 C CB  . LEU A 1 163 ? -5.062  10.319  18.015 1.00 31.84 ? 377 LEU A CB  1 
ATOM   1237 C CG  . LEU A 1 163 ? -4.425  9.205   17.200 1.00 31.44 ? 377 LEU A CG  1 
ATOM   1238 C CD1 . LEU A 1 163 ? -4.594  7.913   17.975 1.00 30.50 ? 377 LEU A CD1 1 
ATOM   1239 C CD2 . LEU A 1 163 ? -5.039  9.091   15.792 1.00 30.88 ? 377 LEU A CD2 1 
ATOM   1240 N N   . LYS A 1 164 ? -6.154  12.796  19.385 1.00 34.87 ? 378 LYS A N   1 
ATOM   1241 C CA  . LYS A 1 164 ? -7.230  13.391  20.178 1.00 36.97 ? 378 LYS A CA  1 
ATOM   1242 C C   . LYS A 1 164 ? -7.572  14.800  19.698 1.00 38.04 ? 378 LYS A C   1 
ATOM   1243 O O   . LYS A 1 164 ? -8.679  15.296  19.931 1.00 38.62 ? 378 LYS A O   1 
ATOM   1244 C CB  . LYS A 1 164 ? -6.840  13.403  21.661 1.00 36.93 ? 378 LYS A CB  1 
ATOM   1245 C CG  . LYS A 1 164 ? -7.014  12.049  22.348 1.00 37.77 ? 378 LYS A CG  1 
ATOM   1246 C CD  . LYS A 1 164 ? -6.450  12.045  23.777 1.00 40.14 ? 378 LYS A CD  1 
ATOM   1247 C CE  . LYS A 1 164 ? -7.185  13.015  24.700 1.00 41.19 ? 378 LYS A CE  1 
ATOM   1248 N NZ  . LYS A 1 164 ? -8.670  12.811  24.691 1.00 42.58 ? 378 LYS A NZ  1 
ATOM   1249 N N   . HIS A 1 165 ? -6.619  15.428  19.013 1.00 39.43 ? 379 HIS A N   1 
ATOM   1250 C CA  . HIS A 1 165 ? -6.793  16.790  18.504 1.00 40.77 ? 379 HIS A CA  1 
ATOM   1251 C C   . HIS A 1 165 ? -7.335  16.869  17.082 1.00 41.23 ? 379 HIS A C   1 
ATOM   1252 O O   . HIS A 1 165 ? -7.525  17.966  16.549 1.00 41.09 ? 379 HIS A O   1 
ATOM   1253 C CB  . HIS A 1 165 ? -5.505  17.600  18.672 1.00 41.19 ? 379 HIS A CB  1 
ATOM   1254 C CG  . HIS A 1 165 ? -5.349  18.170  20.049 1.00 42.70 ? 379 HIS A CG  1 
ATOM   1255 N ND1 . HIS A 1 165 ? -4.435  17.686  20.959 1.00 43.88 ? 379 HIS A ND1 1 
ATOM   1256 C CD2 . HIS A 1 165 ? -6.029  19.156  20.685 1.00 43.67 ? 379 HIS A CD2 1 
ATOM   1257 C CE1 . HIS A 1 165 ? -4.539  18.366  22.088 1.00 45.33 ? 379 HIS A CE1 1 
ATOM   1258 N NE2 . HIS A 1 165 ? -5.503  19.259  21.950 1.00 45.03 ? 379 HIS A NE2 1 
ATOM   1259 N N   . LEU A 1 166 ? -7.590  15.706  16.482 1.00 41.93 ? 380 LEU A N   1 
ATOM   1260 C CA  . LEU A 1 166 ? -8.341  15.620  15.231 1.00 43.00 ? 380 LEU A CA  1 
ATOM   1261 C C   . LEU A 1 166 ? -9.815  15.943  15.514 1.00 44.05 ? 380 LEU A C   1 
ATOM   1262 O O   . LEU A 1 166 ? -10.315 15.623  16.592 1.00 44.30 ? 380 LEU A O   1 
ATOM   1263 C CB  . LEU A 1 166 ? -8.227  14.220  14.614 1.00 42.44 ? 380 LEU A CB  1 
ATOM   1264 C CG  . LEU A 1 166 ? -6.918  13.782  13.945 1.00 41.61 ? 380 LEU A CG  1 
ATOM   1265 C CD1 . LEU A 1 166 ? -6.849  12.268  13.827 1.00 39.18 ? 380 LEU A CD1 1 
ATOM   1266 C CD2 . LEU A 1 166 ? -6.769  14.418  12.565 1.00 40.88 ? 380 LEU A CD2 1 
ATOM   1267 N N   . PRO A 1 167 ? -10.508 16.583  14.553 1.00 45.15 ? 381 PRO A N   1 
ATOM   1268 C CA  . PRO A 1 167 ? -11.925 16.939  14.742 1.00 46.11 ? 381 PRO A CA  1 
ATOM   1269 C C   . PRO A 1 167 ? -12.879 15.743  14.856 1.00 46.88 ? 381 PRO A C   1 
ATOM   1270 O O   . PRO A 1 167 ? -13.829 15.790  15.642 1.00 47.35 ? 381 PRO A O   1 
ATOM   1271 C CB  . PRO A 1 167 ? -12.258 17.752  13.485 1.00 46.11 ? 381 PRO A CB  1 
ATOM   1272 C CG  . PRO A 1 167 ? -10.943 18.233  12.971 1.00 45.72 ? 381 PRO A CG  1 
ATOM   1273 C CD  . PRO A 1 167 ? -9.956  17.163  13.314 1.00 45.23 ? 381 PRO A CD  1 
ATOM   1274 N N   . GLU A 1 168 ? -12.628 14.683  14.091 1.00 47.41 ? 382 GLU A N   1 
ATOM   1275 C CA  . GLU A 1 168 ? -13.613 13.612  13.945 1.00 47.69 ? 382 GLU A CA  1 
ATOM   1276 C C   . GLU A 1 168 ? -13.070 12.208  14.220 1.00 47.49 ? 382 GLU A C   1 
ATOM   1277 O O   . GLU A 1 168 ? -11.926 11.885  13.877 1.00 47.51 ? 382 GLU A O   1 
ATOM   1278 C CB  . GLU A 1 168 ? -14.227 13.661  12.542 1.00 48.21 ? 382 GLU A CB  1 
ATOM   1279 C CG  . GLU A 1 168 ? -14.696 15.051  12.081 1.00 50.26 ? 382 GLU A CG  1 
ATOM   1280 C CD  . GLU A 1 168 ? -16.079 15.454  12.619 1.00 53.24 ? 382 GLU A CD  1 
ATOM   1281 O OE1 . GLU A 1 168 ? -16.749 14.636  13.299 1.00 53.70 ? 382 GLU A OE1 1 
ATOM   1282 O OE2 . GLU A 1 168 ? -16.496 16.606  12.351 1.00 54.02 ? 382 GLU A OE2 1 
ATOM   1283 N N   . LYS A 1 169 ? -13.911 11.373  14.825 1.00 46.68 ? 383 LYS A N   1 
ATOM   1284 C CA  . LYS A 1 169 ? -13.538 10.006  15.177 1.00 45.84 ? 383 LYS A CA  1 
ATOM   1285 C C   . LYS A 1 169 ? -13.155 9.221   13.928 1.00 44.75 ? 383 LYS A C   1 
ATOM   1286 O O   . LYS A 1 169 ? -12.270 8.347   13.977 1.00 44.96 ? 383 LYS A O   1 
ATOM   1287 C CB  . LYS A 1 169 ? -14.688 9.311   15.929 1.00 46.16 ? 383 LYS A CB  1 
ATOM   1288 C CG  . LYS A 1 169 ? -14.356 7.905   16.466 1.00 47.52 ? 383 LYS A CG  1 
ATOM   1289 C CD  . LYS A 1 169 ? -15.507 7.277   17.269 1.00 48.89 ? 383 LYS A CD  1 
ATOM   1290 C CE  . LYS A 1 169 ? -16.438 6.449   16.382 1.00 50.15 ? 383 LYS A CE  1 
ATOM   1291 N NZ  . LYS A 1 169 ? -15.815 5.175   15.900 1.00 50.35 ? 383 LYS A NZ  1 
ATOM   1292 N N   . TYR A 1 170 ? -13.815 9.535   12.809 1.00 43.01 ? 384 TYR A N   1 
ATOM   1293 C CA  . TYR A 1 170 ? -13.560 8.827   11.557 1.00 41.36 ? 384 TYR A CA  1 
ATOM   1294 C C   . TYR A 1 170 ? -12.132 9.114   11.103 1.00 39.30 ? 384 TYR A C   1 
ATOM   1295 O O   . TYR A 1 170 ? -11.471 8.241   10.541 1.00 39.39 ? 384 TYR A O   1 
ATOM   1296 C CB  . TYR A 1 170 ? -14.600 9.185   10.467 1.00 41.94 ? 384 TYR A CB  1 
ATOM   1297 C CG  . TYR A 1 170 ? -14.190 10.319  9.556  1.00 43.52 ? 384 TYR A CG  1 
ATOM   1298 C CD1 . TYR A 1 170 ? -13.516 10.069  8.357  1.00 45.18 ? 384 TYR A CD1 1 
ATOM   1299 C CD2 . TYR A 1 170 ? -14.471 11.644  9.891  1.00 45.70 ? 384 TYR A CD2 1 
ATOM   1300 C CE1 . TYR A 1 170 ? -13.125 11.115  7.520  1.00 46.41 ? 384 TYR A CE1 1 
ATOM   1301 C CE2 . TYR A 1 170 ? -14.090 12.699  9.061  1.00 46.36 ? 384 TYR A CE2 1 
ATOM   1302 C CZ  . TYR A 1 170 ? -13.417 12.427  7.879  1.00 47.27 ? 384 TYR A CZ  1 
ATOM   1303 O OH  . TYR A 1 170 ? -13.031 13.468  7.060  1.00 48.46 ? 384 TYR A OH  1 
ATOM   1304 N N   . MET A 1 171 ? -11.665 10.337  11.364 1.00 37.10 ? 385 MET A N   1 
ATOM   1305 C CA  . MET A 1 171 ? -10.295 10.736  11.037 1.00 34.87 ? 385 MET A CA  1 
ATOM   1306 C C   . MET A 1 171 ? -9.289  9.918   11.858 1.00 32.98 ? 385 MET A C   1 
ATOM   1307 O O   . MET A 1 171 ? -8.237  9.529   11.347 1.00 32.37 ? 385 MET A O   1 
ATOM   1308 C CB  . MET A 1 171 ? -10.075 12.243  11.269 1.00 35.04 ? 385 MET A CB  1 
ATOM   1309 C CG  . MET A 1 171 ? -10.801 13.183  10.276 1.00 36.70 ? 385 MET A CG  1 
ATOM   1310 S SD  . MET A 1 171 ? -10.222 14.900  10.372 1.00 41.15 ? 385 MET A SD  1 
ATOM   1311 C CE  . MET A 1 171 ? -10.999 15.594  8.905  1.00 40.60 ? 385 MET A CE  1 
ATOM   1312 N N   . MET A 1 172 ? -9.613  9.679   13.130 1.00 30.94 ? 386 MET A N   1 
ATOM   1313 C CA  . MET A 1 172 ? -8.747  8.881   14.017 1.00 29.77 ? 386 MET A CA  1 
ATOM   1314 C C   . MET A 1 172 ? -8.548  7.457   13.482 1.00 28.34 ? 386 MET A C   1 
ATOM   1315 O O   . MET A 1 172 ? -7.425  6.972   13.405 1.00 27.49 ? 386 MET A O   1 
ATOM   1316 C CB  . MET A 1 172 ? -9.289  8.858   15.453 1.00 29.65 ? 386 MET A CB  1 
ATOM   1317 C CG  . MET A 1 172 ? -9.190  10.199  16.181 1.00 31.57 ? 386 MET A CG  1 
ATOM   1318 S SD  . MET A 1 172 ? -9.966  10.139  17.820 1.00 35.21 ? 386 MET A SD  1 
ATOM   1319 C CE  . MET A 1 172 ? -10.374 11.876  18.083 1.00 36.16 ? 386 MET A CE  1 
ATOM   1320 N N   . ASN A 1 173 ? -9.637  6.799   13.093 1.00 27.62 ? 387 ASN A N   1 
ATOM   1321 C CA  . ASN A 1 173 ? -9.540  5.479   12.486 1.00 27.12 ? 387 ASN A CA  1 
ATOM   1322 C C   . ASN A 1 173 ? -8.809  5.484   11.153 1.00 26.75 ? 387 ASN A C   1 
ATOM   1323 O O   . ASN A 1 173 ? -8.091  4.544   10.847 1.00 25.90 ? 387 ASN A O   1 
ATOM   1324 C CB  . ASN A 1 173 ? -10.913 4.838   12.339 1.00 26.98 ? 387 ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 173 ? -11.508 4.460   13.665 1.00 27.67 ? 387 ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 173 ? -10.784 4.211   14.638 1.00 25.84 ? 387 ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 173 ? -12.835 4.428   13.726 1.00 28.64 ? 387 ASN A ND2 1 
ATOM   1328 N N   . SER A 1 174 ? -8.986  6.547   10.374 1.00 26.99 ? 388 SER A N   1 
ATOM   1329 C CA  . SER A 1 174 ? -8.264  6.687   9.098  1.00 27.65 ? 388 SER A CA  1 
ATOM   1330 C C   . SER A 1 174 ? -6.758  6.729   9.334  1.00 26.54 ? 388 SER A C   1 
ATOM   1331 O O   . SER A 1 174 ? -6.004  6.072   8.627  1.00 25.87 ? 388 SER A O   1 
ATOM   1332 C CB  . SER A 1 174 ? -8.707  7.947   8.346  1.00 27.91 ? 388 SER A CB  1 
ATOM   1333 O OG  . SER A 1 174 ? -10.075 7.835   7.996  1.00 31.97 ? 388 SER A OG  1 
ATOM   1334 N N   . VAL A 1 175 ? -6.332  7.497   10.331 1.00 26.04 ? 389 VAL A N   1 
ATOM   1335 C CA  . VAL A 1 175 ? -4.917  7.538   10.705 1.00 25.93 ? 389 VAL A CA  1 
ATOM   1336 C C   . VAL A 1 175 ? -4.479  6.156   11.173 1.00 25.87 ? 389 VAL A C   1 
ATOM   1337 O O   . VAL A 1 175 ? -3.463  5.631   10.718 1.00 26.26 ? 389 VAL A O   1 
ATOM   1338 C CB  . VAL A 1 175 ? -4.634  8.577   11.821 1.00 25.48 ? 389 VAL A CB  1 
ATOM   1339 C CG1 . VAL A 1 175 ? -3.208  8.412   12.350 1.00 26.12 ? 389 VAL A CG1 1 
ATOM   1340 C CG2 . VAL A 1 175 ? -4.850  10.005  11.311 1.00 25.99 ? 389 VAL A CG2 1 
ATOM   1341 N N   . LEU A 1 176 ? -5.271  5.553   12.056 1.00 25.69 ? 390 LEU A N   1 
ATOM   1342 C CA  . LEU A 1 176 ? -4.915  4.259   12.654 1.00 26.29 ? 390 LEU A CA  1 
ATOM   1343 C C   . LEU A 1 176 ? -4.828  3.068   11.668 1.00 27.07 ? 390 LEU A C   1 
ATOM   1344 O O   . LEU A 1 176 ? -4.174  2.042   11.956 1.00 26.29 ? 390 LEU A O   1 
ATOM   1345 C CB  . LEU A 1 176 ? -5.848  3.943   13.823 1.00 25.86 ? 390 LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 176 ? -5.674  4.790   15.088 1.00 24.65 ? 390 LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 176 ? -6.784  4.479   16.058 1.00 23.65 ? 390 LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 176 ? -4.300  4.523   15.737 1.00 22.44 ? 390 LEU A CD2 1 
ATOM   1349 N N   . GLU A 1 177 ? -5.455  3.209   10.500 1.00 27.70 ? 391 GLU A N   1 
ATOM   1350 C CA  . GLU A 1 177 ? -5.342  2.178   9.455  1.00 28.66 ? 391 GLU A CA  1 
ATOM   1351 C C   . GLU A 1 177 ? -3.878  1.864   9.154  1.00 28.01 ? 391 GLU A C   1 
ATOM   1352 O O   . GLU A 1 177 ? -3.538  0.715   8.877  1.00 28.25 ? 391 GLU A O   1 
ATOM   1353 C CB  . GLU A 1 177 ? -6.048  2.615   8.161  1.00 29.48 ? 391 GLU A CB  1 
ATOM   1354 C CG  . GLU A 1 177 ? -7.564  2.475   8.185  1.00 33.08 ? 391 GLU A CG  1 
ATOM   1355 C CD  . GLU A 1 177 ? -8.076  1.178   7.565  1.00 36.27 ? 391 GLU A CD  1 
ATOM   1356 O OE1 . GLU A 1 177 ? -9.181  0.730   7.953  1.00 38.79 ? 391 GLU A OE1 1 
ATOM   1357 O OE2 . GLU A 1 177 ? -7.397  0.600   6.692  1.00 37.21 ? 391 GLU A OE2 1 
ATOM   1358 N N   . ASN A 1 178 ? -3.013  2.874   9.223  1.00 26.97 ? 392 ASN A N   1 
ATOM   1359 C CA  . ASN A 1 178 ? -1.613  2.694   8.868  1.00 27.14 ? 392 ASN A CA  1 
ATOM   1360 C C   . ASN A 1 178 ? -0.623  2.899   10.013 1.00 26.31 ? 392 ASN A C   1 
ATOM   1361 O O   . ASN A 1 178 ? 0.514   3.364   9.815  1.00 26.42 ? 392 ASN A O   1 
ATOM   1362 C CB  . ASN A 1 178 ? -1.277  3.560   7.669  1.00 27.82 ? 392 ASN A CB  1 
ATOM   1363 C CG  . ASN A 1 178 ? -2.193  3.273   6.506  1.00 30.66 ? 392 ASN A CG  1 
ATOM   1364 O OD1 . ASN A 1 178 ? -2.181  2.171   5.955  1.00 34.73 ? 392 ASN A OD1 1 
ATOM   1365 N ND2 . ASN A 1 178 ? -3.027  4.240   6.157  1.00 30.03 ? 392 ASN A ND2 1 
ATOM   1366 N N   . PHE A 1 179 ? -1.087  2.559   11.208 1.00 24.41 ? 393 PHE A N   1 
ATOM   1367 C CA  . PHE A 1 179 ? -0.288  2.617   12.409 1.00 23.18 ? 393 PHE A CA  1 
ATOM   1368 C C   . PHE A 1 179 ? -0.359  1.243   13.051 1.00 21.79 ? 393 PHE A C   1 
ATOM   1369 O O   . PHE A 1 179 ? -1.446  0.757   13.355 1.00 21.97 ? 393 PHE A O   1 
ATOM   1370 C CB  . PHE A 1 179 ? -0.845  3.665   13.374 1.00 23.37 ? 393 PHE A CB  1 
ATOM   1371 C CG  . PHE A 1 179 ? -0.226  3.601   14.750 1.00 23.55 ? 393 PHE A CG  1 
ATOM   1372 C CD1 . PHE A 1 179 ? 0.936   4.314   15.034 1.00 24.13 ? 393 PHE A CD1 1 
ATOM   1373 C CD2 . PHE A 1 179 ? -0.792  2.807   15.743 1.00 24.39 ? 393 PHE A CD2 1 
ATOM   1374 C CE1 . PHE A 1 179 ? 1.518   4.246   16.287 1.00 24.12 ? 393 PHE A CE1 1 
ATOM   1375 C CE2 . PHE A 1 179 ? -0.214  2.727   17.012 1.00 24.66 ? 393 PHE A CE2 1 
ATOM   1376 C CZ  . PHE A 1 179 ? 0.939   3.445   17.280 1.00 25.98 ? 393 PHE A CZ  1 
ATOM   1377 N N   . THR A 1 180 ? 0.792   0.617   13.278 1.00 20.46 ? 394 THR A N   1 
ATOM   1378 C CA  . THR A 1 180 ? 0.793   -0.694  13.925 1.00 19.17 ? 394 THR A CA  1 
ATOM   1379 C C   . THR A 1 180 ? 1.937   -0.797  14.935 1.00 18.83 ? 394 THR A C   1 
ATOM   1380 O O   . THR A 1 180 ? 2.869   0.041   14.947 1.00 18.21 ? 394 THR A O   1 
ATOM   1381 C CB  . THR A 1 180 ? 0.908   -1.873  12.913 1.00 19.28 ? 394 THR A CB  1 
ATOM   1382 O OG1 . THR A 1 180 ? 2.149   -1.789  12.196 1.00 19.19 ? 394 THR A OG1 1 
ATOM   1383 C CG2 . THR A 1 180 ? -0.273  -1.911  11.934 1.00 18.99 ? 394 THR A CG2 1 
ATOM   1384 N N   . ILE A 1 181 ? 1.833   -1.807  15.795 1.00 18.45 ? 395 ILE A N   1 
ATOM   1385 C CA  . ILE A 1 181 ? 2.916   -2.137  16.744 1.00 18.23 ? 395 ILE A CA  1 
ATOM   1386 C C   . ILE A 1 181 ? 3.248   -3.612  16.629 1.00 18.11 ? 395 ILE A C   1 
ATOM   1387 O O   . ILE A 1 181 ? 2.341   -4.461  16.520 1.00 17.82 ? 395 ILE A O   1 
ATOM   1388 C CB  . ILE A 1 181 ? 2.569   -1.720  18.191 1.00 19.03 ? 395 ILE A CB  1 
ATOM   1389 C CG1 . ILE A 1 181 ? 2.476   -0.193  18.259 1.00 18.87 ? 395 ILE A CG1 1 
ATOM   1390 C CG2 . ILE A 1 181 ? 3.633   -2.247  19.201 1.00 18.58 ? 395 ILE A CG2 1 
ATOM   1391 C CD1 . ILE A 1 181 ? 1.866   0.337   19.527 1.00 23.80 ? 395 ILE A CD1 1 
ATOM   1392 N N   . LEU A 1 182 ? 4.547   -3.907  16.582 1.00 17.54 ? 396 LEU A N   1 
ATOM   1393 C CA  . LEU A 1 182 ? 4.998   -5.282  16.553 1.00 17.91 ? 396 LEU A CA  1 
ATOM   1394 C C   . LEU A 1 182 ? 5.836   -5.574  17.796 1.00 18.14 ? 396 LEU A C   1 
ATOM   1395 O O   . LEU A 1 182 ? 6.844   -4.904  18.039 1.00 17.74 ? 396 LEU A O   1 
ATOM   1396 C CB  . LEU A 1 182 ? 5.785   -5.575  15.275 1.00 18.14 ? 396 LEU A CB  1 
ATOM   1397 C CG  . LEU A 1 182 ? 6.213   -7.040  15.115 1.00 18.90 ? 396 LEU A CG  1 
ATOM   1398 C CD1 . LEU A 1 182 ? 4.976   -7.946  14.932 1.00 16.81 ? 396 LEU A CD1 1 
ATOM   1399 C CD2 . LEU A 1 182 ? 7.170   -7.180  13.955 1.00 18.86 ? 396 LEU A CD2 1 
ATOM   1400 N N   . GLN A 1 183 ? 5.404   -6.569  18.570 1.00 17.76 ? 397 GLN A N   1 
ATOM   1401 C CA  . GLN A 1 183 ? 6.103   -6.962  19.789 1.00 19.12 ? 397 GLN A CA  1 
ATOM   1402 C C   . GLN A 1 183 ? 6.693   -8.349  19.613 1.00 19.05 ? 397 GLN A C   1 
ATOM   1403 O O   . GLN A 1 183 ? 5.961   -9.320  19.325 1.00 19.80 ? 397 GLN A O   1 
ATOM   1404 C CB  . GLN A 1 183 ? 5.128   -6.924  20.978 1.00 19.37 ? 397 GLN A CB  1 
ATOM   1405 C CG  . GLN A 1 183 ? 5.748   -7.220  22.341 1.00 22.94 ? 397 GLN A CG  1 
ATOM   1406 C CD  . GLN A 1 183 ? 4.692   -7.395  23.445 1.00 26.01 ? 397 GLN A CD  1 
ATOM   1407 O OE1 . GLN A 1 183 ? 3.557   -6.930  23.314 1.00 25.53 ? 397 GLN A OE1 1 
ATOM   1408 N NE2 . GLN A 1 183 ? 5.074   -8.071  24.538 1.00 25.02 ? 397 GLN A NE2 1 
ATOM   1409 N N   . VAL A 1 184 ? 8.014   -8.445  19.759 1.00 18.63 ? 398 VAL A N   1 
ATOM   1410 C CA  . VAL A 1 184 ? 8.717   -9.717  19.603 1.00 18.47 ? 398 VAL A CA  1 
ATOM   1411 C C   . VAL A 1 184 ? 9.475   -10.016 20.895 1.00 18.08 ? 398 VAL A C   1 
ATOM   1412 O O   . VAL A 1 184 ? 10.358  -9.252  21.314 1.00 18.16 ? 398 VAL A O   1 
ATOM   1413 C CB  . VAL A 1 184 ? 9.690   -9.718  18.382 1.00 17.92 ? 398 VAL A CB  1 
ATOM   1414 C CG1 . VAL A 1 184 ? 10.404  -11.057 18.267 1.00 20.45 ? 398 VAL A CG1 1 
ATOM   1415 C CG2 . VAL A 1 184 ? 8.945   -9.427  17.061 1.00 19.30 ? 398 VAL A CG2 1 
ATOM   1416 N N   . VAL A 1 185 ? 9.106   -11.125 21.518 1.00 18.08 ? 399 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 185 ? 9.694   -11.534 22.792 1.00 17.60 ? 399 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 185 ? 10.524  -12.752 22.467 1.00 17.46 ? 399 VAL A C   1 
ATOM   1419 O O   . VAL A 1 185 ? 10.012  -13.727 21.931 1.00 17.89 ? 399 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 185 ? 8.638   -11.890 23.847 1.00 17.80 ? 399 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 185 ? 9.330   -12.295 25.163 1.00 18.26 ? 399 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 185 ? 7.690   -10.704 24.100 1.00 18.98 ? 399 VAL A CG2 1 
ATOM   1423 N N   . THR A 1 186 ? 11.810  -12.681 22.789 1.00 17.48 ? 400 THR A N   1 
ATOM   1424 C CA  A THR A 1 186 ? 12.788  -13.672 22.385 0.50 17.63 ? 400 THR A CA  1 
ATOM   1425 C CA  B THR A 1 186 ? 12.723  -13.759 22.426 0.50 17.44 ? 400 THR A CA  1 
ATOM   1426 C C   . THR A 1 186 ? 13.518  -14.219 23.626 1.00 17.63 ? 400 THR A C   1 
ATOM   1427 O O   . THR A 1 186 ? 13.688  -13.491 24.599 1.00 17.99 ? 400 THR A O   1 
ATOM   1428 C CB  A THR A 1 186 ? 13.783  -12.975 21.429 0.50 17.84 ? 400 THR A CB  1 
ATOM   1429 C CB  B THR A 1 186 ? 13.733  -13.324 21.367 0.50 17.36 ? 400 THR A CB  1 
ATOM   1430 O OG1 A THR A 1 186 ? 13.062  -12.430 20.311 0.50 18.80 ? 400 THR A OG1 1 
ATOM   1431 O OG1 B THR A 1 186 ? 14.350  -12.104 21.805 0.50 16.52 ? 400 THR A OG1 1 
ATOM   1432 C CG2 A THR A 1 186 ? 14.838  -13.899 20.926 0.50 15.88 ? 400 THR A CG2 1 
ATOM   1433 C CG2 B THR A 1 186 ? 13.045  -13.127 20.006 0.50 17.15 ? 400 THR A CG2 1 
ATOM   1434 N N   . ASN A 1 187 ? 13.965  -15.461 23.558 1.00 17.99 ? 401 ASN A N   1 
ATOM   1435 C CA  . ASN A 1 187 ? 14.919  -15.993 24.520 1.00 19.78 ? 401 ASN A CA  1 
ATOM   1436 C C   . ASN A 1 187 ? 16.255  -15.350 24.142 1.00 19.86 ? 401 ASN A C   1 
ATOM   1437 O O   . ASN A 1 187 ? 16.752  -15.583 23.035 1.00 20.62 ? 401 ASN A O   1 
ATOM   1438 C CB  . ASN A 1 187 ? 14.968  -17.516 24.393 1.00 19.51 ? 401 ASN A CB  1 
ATOM   1439 C CG  . ASN A 1 187 ? 16.027  -18.154 25.288 1.00 20.66 ? 401 ASN A CG  1 
ATOM   1440 O OD1 . ASN A 1 187 ? 17.140  -17.665 25.374 1.00 22.49 ? 401 ASN A OD1 1 
ATOM   1441 N ND2 . ASN A 1 187 ? 15.675  -19.259 25.944 1.00 20.79 ? 401 ASN A ND2 1 
ATOM   1442 N N   . ARG A 1 188 ? 16.824  -14.523 25.015 1.00 20.05 ? 402 ARG A N   1 
ATOM   1443 C CA  . ARG A 1 188 ? 18.016  -13.766 24.636 1.00 21.34 ? 402 ARG A CA  1 
ATOM   1444 C C   . ARG A 1 188 ? 19.164  -14.659 24.140 1.00 22.22 ? 402 ARG A C   1 
ATOM   1445 O O   . ARG A 1 188 ? 19.821  -14.332 23.150 1.00 22.43 ? 402 ARG A O   1 
ATOM   1446 C CB  . ARG A 1 188 ? 18.529  -12.862 25.760 1.00 21.62 ? 402 ARG A CB  1 
ATOM   1447 C CG  . ARG A 1 188 ? 19.622  -11.903 25.262 1.00 23.59 ? 402 ARG A CG  1 
ATOM   1448 C CD  . ARG A 1 188 ? 20.156  -10.980 26.331 1.00 27.61 ? 402 ARG A CD  1 
ATOM   1449 N NE  . ARG A 1 188 ? 20.844  -11.709 27.387 1.00 30.17 ? 402 ARG A NE  1 
ATOM   1450 C CZ  . ARG A 1 188 ? 21.304  -11.147 28.505 1.00 32.32 ? 402 ARG A CZ  1 
ATOM   1451 N NH1 . ARG A 1 188 ? 21.154  -9.836  28.717 1.00 32.77 ? 402 ARG A NH1 1 
ATOM   1452 N NH2 . ARG A 1 188 ? 21.908  -11.895 29.412 1.00 30.01 ? 402 ARG A NH2 1 
ATOM   1453 N N   . ASP A 1 189 ? 19.384  -15.772 24.842 1.00 23.27 ? 403 ASP A N   1 
ATOM   1454 C CA  . ASP A 1 189 ? 20.527  -16.663 24.594 1.00 23.98 ? 403 ASP A CA  1 
ATOM   1455 C C   . ASP A 1 189 ? 20.369  -17.453 23.288 1.00 23.55 ? 403 ASP A C   1 
ATOM   1456 O O   . ASP A 1 189 ? 21.307  -17.554 22.490 1.00 24.52 ? 403 ASP A O   1 
ATOM   1457 C CB  . ASP A 1 189 ? 20.709  -17.625 25.790 1.00 24.01 ? 403 ASP A CB  1 
ATOM   1458 C CG  . ASP A 1 189 ? 21.255  -16.927 27.064 1.00 27.11 ? 403 ASP A CG  1 
ATOM   1459 O OD1 . ASP A 1 189 ? 21.729  -15.778 26.980 1.00 29.56 ? 403 ASP A OD1 1 
ATOM   1460 O OD2 . ASP A 1 189 ? 21.223  -17.544 28.160 1.00 28.83 ? 403 ASP A OD2 1 
ATOM   1461 N N   . THR A 1 190 ? 19.178  -18.009 23.074 1.00 22.93 ? 404 THR A N   1 
ATOM   1462 C CA  . THR A 1 190 ? 18.927  -18.882 21.927 1.00 22.13 ? 404 THR A CA  1 
ATOM   1463 C C   . THR A 1 190 ? 18.317  -18.164 20.708 1.00 22.46 ? 404 THR A C   1 
ATOM   1464 O O   . THR A 1 190 ? 18.312  -18.712 19.606 1.00 21.66 ? 404 THR A O   1 
ATOM   1465 C CB  . THR A 1 190 ? 17.989  -20.030 22.332 1.00 21.82 ? 404 THR A CB  1 
ATOM   1466 O OG1 . THR A 1 190 ? 16.655  -19.523 22.500 1.00 20.24 ? 404 THR A OG1 1 
ATOM   1467 C CG2 . THR A 1 190 ? 18.472  -20.650 23.652 1.00 20.22 ? 404 THR A CG2 1 
ATOM   1468 N N   . GLN A 1 191 ? 17.786  -16.959 20.929 1.00 22.00 ? 405 GLN A N   1 
ATOM   1469 C CA  . GLN A 1 191 ? 17.089  -16.196 19.880 1.00 22.78 ? 405 GLN A CA  1 
ATOM   1470 C C   . GLN A 1 191 ? 15.786  -16.836 19.356 1.00 22.69 ? 405 GLN A C   1 
ATOM   1471 O O   . GLN A 1 191 ? 15.211  -16.379 18.348 1.00 22.98 ? 405 GLN A O   1 
ATOM   1472 C CB  . GLN A 1 191 ? 18.055  -15.787 18.745 1.00 23.18 ? 405 GLN A CB  1 
ATOM   1473 C CG  . GLN A 1 191 ? 19.127  -14.786 19.202 1.00 25.63 ? 405 GLN A CG  1 
ATOM   1474 C CD  . GLN A 1 191 ? 18.543  -13.454 19.623 1.00 29.99 ? 405 GLN A CD  1 
ATOM   1475 O OE1 . GLN A 1 191 ? 17.873  -12.794 18.828 1.00 33.95 ? 405 GLN A OE1 1 
ATOM   1476 N NE2 . GLN A 1 191 ? 18.776  -13.052 20.883 1.00 30.71 ? 405 GLN A NE2 1 
ATOM   1477 N N   . GLU A 1 192 ? 15.305  -17.870 20.055 1.00 22.00 ? 406 GLU A N   1 
ATOM   1478 C CA  . GLU A 1 192 ? 13.997  -18.465 19.780 1.00 22.18 ? 406 GLU A CA  1 
ATOM   1479 C C   . GLU A 1 192 ? 12.898  -17.423 20.013 1.00 21.34 ? 406 GLU A C   1 
ATOM   1480 O O   . GLU A 1 192 ? 12.899  -16.732 21.036 1.00 20.85 ? 406 GLU A O   1 
ATOM   1481 C CB  . GLU A 1 192 ? 13.718  -19.701 20.658 1.00 22.86 ? 406 GLU A CB  1 
ATOM   1482 C CG  . GLU A 1 192 ? 12.299  -20.279 20.445 1.00 25.71 ? 406 GLU A CG  1 
ATOM   1483 C CD  . GLU A 1 192 ? 11.890  -21.443 21.369 1.00 30.67 ? 406 GLU A CD  1 
ATOM   1484 O OE1 . GLU A 1 192 ? 10.745  -21.917 21.204 1.00 31.18 ? 406 GLU A OE1 1 
ATOM   1485 O OE2 . GLU A 1 192 ? 12.674  -21.891 22.240 1.00 30.99 ? 406 GLU A OE2 1 
ATOM   1486 N N   . THR A 1 193 ? 11.990  -17.297 19.049 1.00 20.34 ? 407 THR A N   1 
ATOM   1487 C CA  . THR A 1 193 ? 10.789  -16.465 19.233 1.00 19.33 ? 407 THR A CA  1 
ATOM   1488 C C   . THR A 1 193 ? 9.846   -17.151 20.211 1.00 18.74 ? 407 THR A C   1 
ATOM   1489 O O   . THR A 1 193 ? 9.302   -18.204 19.905 1.00 19.08 ? 407 THR A O   1 
ATOM   1490 C CB  . THR A 1 193 ? 10.065  -16.235 17.877 1.00 19.65 ? 407 THR A CB  1 
ATOM   1491 O OG1 . THR A 1 193 ? 10.979  -15.621 16.971 1.00 18.37 ? 407 THR A OG1 1 
ATOM   1492 C CG2 . THR A 1 193 ? 8.858   -15.310 18.033 1.00 18.52 ? 407 THR A CG2 1 
ATOM   1493 N N   . LEU A 1 194 ? 9.663   -16.545 21.382 1.00 19.14 ? 408 LEU A N   1 
ATOM   1494 C CA  . LEU A 1 194 ? 8.741   -17.021 22.414 1.00 18.86 ? 408 LEU A CA  1 
ATOM   1495 C C   . LEU A 1 194 ? 7.314   -16.529 22.170 1.00 18.75 ? 408 LEU A C   1 
ATOM   1496 O O   . LEU A 1 194 ? 6.353   -17.274 22.388 1.00 18.51 ? 408 LEU A O   1 
ATOM   1497 C CB  . LEU A 1 194 ? 9.226   -16.543 23.810 1.00 18.92 ? 408 LEU A CB  1 
ATOM   1498 C CG  . LEU A 1 194 ? 10.670  -16.988 24.130 1.00 18.92 ? 408 LEU A CG  1 
ATOM   1499 C CD1 . LEU A 1 194 ? 11.198  -16.351 25.438 1.00 17.65 ? 408 LEU A CD1 1 
ATOM   1500 C CD2 . LEU A 1 194 ? 10.797  -18.518 24.173 1.00 20.43 ? 408 LEU A CD2 1 
ATOM   1501 N N   . LEU A 1 195 ? 7.190   -15.267 21.744 1.00 19.00 ? 409 LEU A N   1 
ATOM   1502 C CA  . LEU A 1 195 ? 5.911   -14.661 21.345 1.00 19.56 ? 409 LEU A CA  1 
ATOM   1503 C C   . LEU A 1 195 ? 6.171   -13.580 20.325 1.00 19.52 ? 409 LEU A C   1 
ATOM   1504 O O   . LEU A 1 195 ? 7.096   -12.779 20.475 1.00 19.74 ? 409 LEU A O   1 
ATOM   1505 C CB  . LEU A 1 195 ? 5.176   -14.001 22.542 1.00 19.62 ? 409 LEU A CB  1 
ATOM   1506 C CG  . LEU A 1 195 ? 4.539   -14.891 23.614 1.00 21.16 ? 409 LEU A CG  1 
ATOM   1507 C CD1 . LEU A 1 195 ? 4.037   -14.041 24.765 1.00 21.48 ? 409 LEU A CD1 1 
ATOM   1508 C CD2 . LEU A 1 195 ? 3.418   -15.767 23.042 1.00 22.08 ? 409 LEU A CD2 1 
ATOM   1509 N N   . CYS A 1 196 ? 5.325   -13.527 19.301 1.00 19.88 ? 410 CYS A N   1 
ATOM   1510 C CA  . CYS A 1 196 ? 5.364   -12.402 18.390 1.00 19.58 ? 410 CYS A CA  1 
ATOM   1511 C C   . CYS A 1 196 ? 3.940   -11.901 18.218 1.00 18.94 ? 410 CYS A C   1 
ATOM   1512 O O   . CYS A 1 196 ? 3.042   -12.643 17.804 1.00 18.97 ? 410 CYS A O   1 
ATOM   1513 C CB  . CYS A 1 196 ? 6.026   -12.776 17.059 1.00 19.70 ? 410 CYS A CB  1 
ATOM   1514 S SG  . CYS A 1 196 ? 5.854   -11.507 15.738 1.00 20.78 ? 410 CYS A SG  1 
ATOM   1515 N N   . ILE A 1 197 ? 3.721   -10.657 18.601 1.00 18.41 ? 411 ILE A N   1 
ATOM   1516 C CA  . ILE A 1 197 ? 2.366   -10.123 18.612 1.00 18.75 ? 411 ILE A CA  1 
ATOM   1517 C C   . ILE A 1 197 ? 2.278   -8.885  17.732 1.00 18.51 ? 411 ILE A C   1 
ATOM   1518 O O   . ILE A 1 197 ? 2.995   -7.894  17.947 1.00 18.70 ? 411 ILE A O   1 
ATOM   1519 C CB  . ILE A 1 197 ? 1.870   -9.771  20.036 1.00 18.81 ? 411 ILE A CB  1 
ATOM   1520 C CG1 . ILE A 1 197 ? 2.097   -10.948 21.003 1.00 20.21 ? 411 ILE A CG1 1 
ATOM   1521 C CG2 . ILE A 1 197 ? 0.398   -9.431  19.972 1.00 19.09 ? 411 ILE A CG2 1 
ATOM   1522 C CD1 . ILE A 1 197 ? 2.575   -10.536 22.376 1.00 19.79 ? 411 ILE A CD1 1 
ATOM   1523 N N   . ALA A 1 198 ? 1.388   -8.963  16.750 1.00 17.97 ? 412 ALA A N   1 
ATOM   1524 C CA  . ALA A 1 198 ? 1.121   -7.876  15.838 1.00 18.09 ? 412 ALA A CA  1 
ATOM   1525 C C   . ALA A 1 198 ? -0.115  -7.160  16.357 1.00 18.15 ? 412 ALA A C   1 
ATOM   1526 O O   . ALA A 1 198 ? -1.123  -7.807  16.628 1.00 18.94 ? 412 ALA A O   1 
ATOM   1527 C CB  . ALA A 1 198 ? 0.873   -8.429  14.434 1.00 18.03 ? 412 ALA A CB  1 
ATOM   1528 N N   . TYR A 1 199 ? -0.028  -5.848  16.537 1.00 18.39 ? 413 TYR A N   1 
ATOM   1529 C CA  . TYR A 1 199 ? -1.159  -5.066  17.051 1.00 18.52 ? 413 TYR A CA  1 
ATOM   1530 C C   . TYR A 1 199 ? -1.706  -4.099  16.018 1.00 18.50 ? 413 TYR A C   1 
ATOM   1531 O O   . TYR A 1 199 ? -0.947  -3.331  15.397 1.00 17.85 ? 413 TYR A O   1 
ATOM   1532 C CB  . TYR A 1 199 ? -0.744  -4.228  18.255 1.00 19.10 ? 413 TYR A CB  1 
ATOM   1533 C CG  . TYR A 1 199 ? -0.315  -5.011  19.474 1.00 19.56 ? 413 TYR A CG  1 
ATOM   1534 C CD1 . TYR A 1 199 ? -1.244  -5.416  20.426 1.00 20.42 ? 413 TYR A CD1 1 
ATOM   1535 C CD2 . TYR A 1 199 ? 1.018   -5.312  19.689 1.00 20.93 ? 413 TYR A CD2 1 
ATOM   1536 C CE1 . TYR A 1 199 ? -0.848  -6.114  21.577 1.00 20.45 ? 413 TYR A CE1 1 
ATOM   1537 C CE2 . TYR A 1 199 ? 1.435   -6.002  20.840 1.00 19.52 ? 413 TYR A CE2 1 
ATOM   1538 C CZ  . TYR A 1 199 ? 0.500   -6.401  21.771 1.00 20.93 ? 413 TYR A CZ  1 
ATOM   1539 O OH  . TYR A 1 199 ? 0.922   -7.092  22.888 1.00 20.81 ? 413 TYR A OH  1 
ATOM   1540 N N   . VAL A 1 200 ? -3.029  -4.153  15.852 1.00 18.18 ? 414 VAL A N   1 
ATOM   1541 C CA  A VAL A 1 200 ? -3.771  -3.263  14.964 0.50 18.49 ? 414 VAL A CA  1 
ATOM   1542 C CA  B VAL A 1 200 ? -3.752  -3.228  14.983 0.50 18.41 ? 414 VAL A CA  1 
ATOM   1543 C C   . VAL A 1 200 ? -4.831  -2.528  15.799 1.00 18.76 ? 414 VAL A C   1 
ATOM   1544 O O   . VAL A 1 200 ? -5.312  -3.070  16.813 1.00 18.79 ? 414 VAL A O   1 
ATOM   1545 C CB  A VAL A 1 200 ? -4.387  -4.064  13.779 0.50 18.03 ? 414 VAL A CB  1 
ATOM   1546 C CB  B VAL A 1 200 ? -4.338  -3.911  13.707 0.50 17.91 ? 414 VAL A CB  1 
ATOM   1547 C CG1 A VAL A 1 200 ? -5.273  -3.196  12.913 0.50 17.92 ? 414 VAL A CG1 1 
ATOM   1548 C CG1 B VAL A 1 200 ? -3.207  -4.435  12.798 0.50 18.32 ? 414 VAL A CG1 1 
ATOM   1549 C CG2 A VAL A 1 200 ? -3.278  -4.697  12.921 0.50 18.61 ? 414 VAL A CG2 1 
ATOM   1550 C CG2 B VAL A 1 200 ? -5.327  -5.023  14.060 0.50 17.61 ? 414 VAL A CG2 1 
ATOM   1551 N N   . PHE A 1 201 ? -5.192  -1.313  15.374 1.00 19.83 ? 415 PHE A N   1 
ATOM   1552 C CA  . PHE A 1 201 ? -5.982  -0.391  16.186 1.00 21.13 ? 415 PHE A CA  1 
ATOM   1553 C C   . PHE A 1 201 ? -7.145  0.316   15.481 1.00 22.15 ? 415 PHE A C   1 
ATOM   1554 O O   . PHE A 1 201 ? -7.039  0.721   14.316 1.00 22.55 ? 415 PHE A O   1 
ATOM   1555 C CB  . PHE A 1 201 ? -5.059  0.723   16.729 1.00 21.76 ? 415 PHE A CB  1 
ATOM   1556 C CG  . PHE A 1 201 ? -3.971  0.223   17.624 1.00 23.20 ? 415 PHE A CG  1 
ATOM   1557 C CD1 . PHE A 1 201 ? -2.761  -0.217  17.088 1.00 24.52 ? 415 PHE A CD1 1 
ATOM   1558 C CD2 . PHE A 1 201 ? -4.164  0.164   19.007 1.00 23.68 ? 415 PHE A CD2 1 
ATOM   1559 C CE1 . PHE A 1 201 ? -1.743  -0.705  17.929 1.00 23.18 ? 415 PHE A CE1 1 
ATOM   1560 C CE2 . PHE A 1 201 ? -3.153  -0.309  19.854 1.00 23.11 ? 415 PHE A CE2 1 
ATOM   1561 C CZ  . PHE A 1 201 ? -1.939  -0.745  19.300 1.00 23.66 ? 415 PHE A CZ  1 
ATOM   1562 N N   . GLU A 1 202 ? -8.241  0.451   16.223 1.00 22.75 ? 416 GLU A N   1 
ATOM   1563 C CA  . GLU A 1 202 ? -9.315  1.401   15.933 1.00 24.39 ? 416 GLU A CA  1 
ATOM   1564 C C   . GLU A 1 202 ? -9.608  2.130   17.242 1.00 25.06 ? 416 GLU A C   1 
ATOM   1565 O O   . GLU A 1 202 ? -9.118  1.732   18.295 1.00 24.61 ? 416 GLU A O   1 
ATOM   1566 C CB  . GLU A 1 202 ? -10.584 0.665   15.461 1.00 24.62 ? 416 GLU A CB  1 
ATOM   1567 C CG  . GLU A 1 202 ? -10.593 0.291   13.995 1.00 26.13 ? 416 GLU A CG  1 
ATOM   1568 C CD  . GLU A 1 202 ? -11.957 -0.179  13.498 1.00 29.27 ? 416 GLU A CD  1 
ATOM   1569 O OE1 . GLU A 1 202 ? -12.343 -1.328  13.769 1.00 28.96 ? 416 GLU A OE1 1 
ATOM   1570 O OE2 . GLU A 1 202 ? -12.639 0.599   12.799 1.00 32.55 ? 416 GLU A OE2 1 
ATOM   1571 N N   . VAL A 1 203 ? -10.411 3.187   17.172 1.00 26.12 ? 417 VAL A N   1 
ATOM   1572 C CA  . VAL A 1 203 ? -10.897 3.881   18.362 1.00 27.98 ? 417 VAL A CA  1 
ATOM   1573 C C   . VAL A 1 203 ? -12.163 3.196   18.875 1.00 28.59 ? 417 VAL A C   1 
ATOM   1574 O O   . VAL A 1 203 ? -13.032 2.810   18.096 1.00 28.00 ? 417 VAL A O   1 
ATOM   1575 C CB  . VAL A 1 203 ? -11.162 5.378   18.056 1.00 28.29 ? 417 VAL A CB  1 
ATOM   1576 C CG1 . VAL A 1 203 ? -11.825 6.092   19.235 1.00 29.45 ? 417 VAL A CG1 1 
ATOM   1577 C CG2 . VAL A 1 203 ? -9.855  6.061   17.719 1.00 27.58 ? 417 VAL A CG2 1 
ATOM   1578 N N   . SER A 1 204 ? -12.253 3.034   20.193 1.00 29.98 ? 418 SER A N   1 
ATOM   1579 C CA  . SER A 1 204 ? -13.466 2.515   20.811 1.00 31.73 ? 418 SER A CA  1 
ATOM   1580 C C   . SER A 1 204 ? -14.626 3.516   20.708 1.00 33.22 ? 418 SER A C   1 
ATOM   1581 O O   . SER A 1 204 ? -14.430 4.718   20.869 1.00 32.75 ? 418 SER A O   1 
ATOM   1582 C CB  . SER A 1 204 ? -13.234 2.194   22.279 1.00 31.11 ? 418 SER A CB  1 
ATOM   1583 O OG  . SER A 1 204 ? -14.325 1.430   22.767 1.00 33.34 ? 418 SER A OG  1 
ATOM   1584 N N   . ALA A 1 205 ? -15.820 2.998   20.433 1.00 35.80 ? 419 ALA A N   1 
ATOM   1585 C CA  . ALA A 1 205 ? -17.054 3.798   20.446 1.00 38.82 ? 419 ALA A CA  1 
ATOM   1586 C C   . ALA A 1 205 ? -17.984 3.266   21.526 1.00 40.72 ? 419 ALA A C   1 
ATOM   1587 O O   . ALA A 1 205 ? -19.110 3.742   21.691 1.00 41.68 ? 419 ALA A O   1 
ATOM   1588 C CB  . ALA A 1 205 ? -17.736 3.731   19.099 1.00 39.00 ? 419 ALA A CB  1 
ATOM   1589 N N   . SER A 1 206 ? -17.487 2.278   22.265 1.00 42.85 ? 420 SER A N   1 
ATOM   1590 C CA  . SER A 1 206 ? -18.275 1.512   23.218 1.00 44.22 ? 420 SER A CA  1 
ATOM   1591 C C   . SER A 1 206 ? -18.456 2.234   24.543 1.00 45.15 ? 420 SER A C   1 
ATOM   1592 O O   . SER A 1 206 ? -17.579 2.974   25.001 1.00 45.60 ? 420 SER A O   1 
ATOM   1593 C CB  . SER A 1 206 ? -17.607 0.152   23.456 1.00 44.35 ? 420 SER A CB  1 
ATOM   1594 O OG  . SER A 1 206 ? -18.311 -0.625  24.412 1.00 45.23 ? 420 SER A OG  1 
ATOM   1595 N N   . GLU A 1 207 ? -19.608 1.999   25.160 1.00 45.98 ? 421 GLU A N   1 
ATOM   1596 C CA  . GLU A 1 207 ? -19.870 2.460   26.513 1.00 46.27 ? 421 GLU A CA  1 
ATOM   1597 C C   . GLU A 1 207 ? -19.036 1.656   27.511 1.00 46.00 ? 421 GLU A C   1 
ATOM   1598 O O   . GLU A 1 207 ? -18.799 2.107   28.633 1.00 46.33 ? 421 GLU A O   1 
ATOM   1599 C CB  . GLU A 1 207 ? -21.354 2.313   26.827 1.00 46.69 ? 421 GLU A CB  1 
ATOM   1600 C CG  . GLU A 1 207 ? -21.841 3.185   27.971 1.00 48.23 ? 421 GLU A CG  1 
ATOM   1601 C CD  . GLU A 1 207 ? -23.351 3.319   27.993 1.00 50.42 ? 421 GLU A CD  1 
ATOM   1602 O OE1 . GLU A 1 207 ? -24.043 2.442   27.422 1.00 51.20 ? 421 GLU A OE1 1 
ATOM   1603 O OE2 . GLU A 1 207 ? -23.843 4.306   28.583 1.00 51.14 ? 421 GLU A OE2 1 
ATOM   1604 N N   . HIS A 1 208 ? -18.585 0.473   27.088 1.00 45.44 ? 422 HIS A N   1 
ATOM   1605 C CA  . HIS A 1 208 ? -17.754 -0.395  27.926 1.00 44.69 ? 422 HIS A CA  1 
ATOM   1606 C C   . HIS A 1 208 ? -16.235 -0.130  27.811 1.00 43.35 ? 422 HIS A C   1 
ATOM   1607 O O   . HIS A 1 208 ? -15.433 -0.803  28.475 1.00 43.78 ? 422 HIS A O   1 
ATOM   1608 C CB  . HIS A 1 208 ? -18.073 -1.878  27.659 1.00 45.29 ? 422 HIS A CB  1 
ATOM   1609 C CG  . HIS A 1 208 ? -19.415 -2.326  28.170 1.00 47.33 ? 422 HIS A CG  1 
ATOM   1610 N ND1 . HIS A 1 208 ? -20.136 -1.623  29.117 1.00 48.69 ? 422 HIS A ND1 1 
ATOM   1611 C CD2 . HIS A 1 208 ? -20.150 -3.430  27.884 1.00 48.29 ? 422 HIS A CD2 1 
ATOM   1612 C CE1 . HIS A 1 208 ? -21.262 -2.266  29.376 1.00 49.00 ? 422 HIS A CE1 1 
ATOM   1613 N NE2 . HIS A 1 208 ? -21.293 -3.366  28.644 1.00 48.84 ? 422 HIS A NE2 1 
ATOM   1614 N N   . GLY A 1 209 ? -15.840 0.841   26.983 1.00 41.38 ? 423 GLY A N   1 
ATOM   1615 C CA  . GLY A 1 209 ? -14.432 1.254   26.893 1.00 37.94 ? 423 GLY A CA  1 
ATOM   1616 C C   . GLY A 1 209 ? -13.576 0.418   25.950 1.00 36.03 ? 423 GLY A C   1 
ATOM   1617 O O   . GLY A 1 209 ? -14.059 -0.073  24.924 1.00 35.62 ? 423 GLY A O   1 
ATOM   1618 N N   . ALA A 1 210 ? -12.301 0.259   26.306 1.00 33.47 ? 424 ALA A N   1 
ATOM   1619 C CA  . ALA A 1 210 ? -11.349 -0.520  25.511 1.00 31.43 ? 424 ALA A CA  1 
ATOM   1620 C C   . ALA A 1 210 ? -11.794 -1.968  25.327 1.00 30.30 ? 424 ALA A C   1 
ATOM   1621 O O   . ALA A 1 210 ? -12.285 -2.622  26.263 1.00 29.40 ? 424 ALA A O   1 
ATOM   1622 C CB  . ALA A 1 210 ? -9.960  -0.467  26.145 1.00 31.39 ? 424 ALA A CB  1 
ATOM   1623 N N   . GLN A 1 211 ? -11.651 -2.465  24.111 1.00 28.44 ? 425 GLN A N   1 
ATOM   1624 C CA  . GLN A 1 211 ? -11.954 -3.865  23.840 1.00 28.38 ? 425 GLN A CA  1 
ATOM   1625 C C   . GLN A 1 211 ? -10.838 -4.449  22.994 1.00 27.14 ? 425 GLN A C   1 
ATOM   1626 O O   . GLN A 1 211 ? -9.964  -3.712  22.551 1.00 26.41 ? 425 GLN A O   1 
ATOM   1627 C CB  . GLN A 1 211 ? -13.313 -4.017  23.130 1.00 28.73 ? 425 GLN A CB  1 
ATOM   1628 C CG  . GLN A 1 211 ? -14.506 -3.386  23.856 1.00 31.58 ? 425 GLN A CG  1 
ATOM   1629 C CD  . GLN A 1 211 ? -14.937 -4.158  25.094 1.00 36.02 ? 425 GLN A CD  1 
ATOM   1630 O OE1 . GLN A 1 211 ? -14.777 -5.383  25.177 1.00 39.34 ? 425 GLN A OE1 1 
ATOM   1631 N NE2 . GLN A 1 211 ? -15.504 -3.442  26.065 1.00 37.03 ? 425 GLN A NE2 1 
ATOM   1632 N N   . HIS A 1 212 ? -10.871 -5.763  22.781 1.00 26.78 ? 426 HIS A N   1 
ATOM   1633 C CA  . HIS A 1 212 ? -9.883  -6.446  21.937 1.00 26.80 ? 426 HIS A CA  1 
ATOM   1634 C C   . HIS A 1 212 ? -10.395 -7.797  21.439 1.00 26.71 ? 426 HIS A C   1 
ATOM   1635 O O   . HIS A 1 212 ? -11.242 -8.426  22.078 1.00 26.68 ? 426 HIS A O   1 
ATOM   1636 C CB  . HIS A 1 212 ? -8.586  -6.676  22.717 1.00 27.40 ? 426 HIS A CB  1 
ATOM   1637 C CG  . HIS A 1 212 ? -8.740  -7.627  23.864 1.00 28.70 ? 426 HIS A CG  1 
ATOM   1638 N ND1 . HIS A 1 212 ? -9.072  -7.216  25.135 1.00 30.70 ? 426 HIS A ND1 1 
ATOM   1639 C CD2 . HIS A 1 212 ? -8.619  -8.973  23.925 1.00 30.51 ? 426 HIS A CD2 1 
ATOM   1640 C CE1 . HIS A 1 212 ? -9.135  -8.265  25.935 1.00 29.78 ? 426 HIS A CE1 1 
ATOM   1641 N NE2 . HIS A 1 212 ? -8.871  -9.345  25.224 1.00 30.27 ? 426 HIS A NE2 1 
ATOM   1642 N N   . HIS A 1 213 ? -9.872  -8.225  20.294 1.00 26.28 ? 427 HIS A N   1 
ATOM   1643 C CA  . HIS A 1 213 ? -9.985  -9.598  19.827 1.00 26.35 ? 427 HIS A CA  1 
ATOM   1644 C C   . HIS A 1 213 ? -8.554  -10.078 19.647 1.00 25.05 ? 427 HIS A C   1 
ATOM   1645 O O   . HIS A 1 213 ? -7.695  -9.324  19.173 1.00 24.57 ? 427 HIS A O   1 
ATOM   1646 C CB  . HIS A 1 213 ? -10.666 -9.679  18.446 1.00 26.81 ? 427 HIS A CB  1 
ATOM   1647 C CG  . HIS A 1 213 ? -12.164 -9.670  18.480 1.00 30.50 ? 427 HIS A CG  1 
ATOM   1648 N ND1 . HIS A 1 213 ? -12.908 -10.606 19.166 1.00 33.44 ? 427 HIS A ND1 1 
ATOM   1649 C CD2 . HIS A 1 213 ? -13.057 -8.858  17.864 1.00 32.69 ? 427 HIS A CD2 1 
ATOM   1650 C CE1 . HIS A 1 213 ? -14.194 -10.345 19.005 1.00 34.19 ? 427 HIS A CE1 1 
ATOM   1651 N NE2 . HIS A 1 213 ? -14.312 -9.293  18.214 1.00 33.61 ? 427 HIS A NE2 1 
ATOM   1652 N N   . ILE A 1 214 ? -8.313  -11.333 19.993 1.00 23.99 ? 428 ILE A N   1 
ATOM   1653 C CA  . ILE A 1 214 ? -7.015  -11.988 19.788 1.00 23.42 ? 428 ILE A CA  1 
ATOM   1654 C C   . ILE A 1 214 ? -7.147  -13.102 18.747 1.00 23.11 ? 428 ILE A C   1 
ATOM   1655 O O   . ILE A 1 214 ? -8.046  -13.954 18.849 1.00 22.53 ? 428 ILE A O   1 
ATOM   1656 C CB  . ILE A 1 214 ? -6.460  -12.566 21.126 1.00 23.82 ? 428 ILE A CB  1 
ATOM   1657 C CG1 . ILE A 1 214 ? -6.463  -11.476 22.213 1.00 23.42 ? 428 ILE A CG1 1 
ATOM   1658 C CG2 . ILE A 1 214 ? -5.042  -13.150 20.921 1.00 22.88 ? 428 ILE A CG2 1 
ATOM   1659 C CD1 . ILE A 1 214 ? -6.281  -12.002 23.657 1.00 24.34 ? 428 ILE A CD1 1 
ATOM   1660 N N   . TYR A 1 215 ? -6.258  -13.087 17.748 1.00 22.80 ? 429 TYR A N   1 
ATOM   1661 C CA  . TYR A 1 215 ? -6.259  -14.071 16.660 1.00 22.38 ? 429 TYR A CA  1 
ATOM   1662 C C   . TYR A 1 215 ? -4.928  -14.823 16.611 1.00 22.78 ? 429 TYR A C   1 
ATOM   1663 O O   . TYR A 1 215 ? -3.883  -14.285 16.988 1.00 21.64 ? 429 TYR A O   1 
ATOM   1664 C CB  . TYR A 1 215 ? -6.519  -13.395 15.291 1.00 22.49 ? 429 TYR A CB  1 
ATOM   1665 C CG  . TYR A 1 215 ? -7.781  -12.545 15.241 1.00 22.06 ? 429 TYR A CG  1 
ATOM   1666 C CD1 . TYR A 1 215 ? -9.007  -13.112 14.873 1.00 22.83 ? 429 TYR A CD1 1 
ATOM   1667 C CD2 . TYR A 1 215 ? -7.757  -11.193 15.571 1.00 21.65 ? 429 TYR A CD2 1 
ATOM   1668 C CE1 . TYR A 1 215 ? -10.163 -12.359 14.843 1.00 21.57 ? 429 TYR A CE1 1 
ATOM   1669 C CE2 . TYR A 1 215 ? -8.927  -10.421 15.555 1.00 21.14 ? 429 TYR A CE2 1 
ATOM   1670 C CZ  . TYR A 1 215 ? -10.127 -11.024 15.187 1.00 23.11 ? 429 TYR A CZ  1 
ATOM   1671 O OH  . TYR A 1 215 ? -11.305 -10.301 15.144 1.00 23.04 ? 429 TYR A OH  1 
ATOM   1672 N N   . ARG A 1 216 ? -4.975  -16.074 16.158 1.00 23.00 ? 430 ARG A N   1 
ATOM   1673 C CA  . ARG A 1 216 ? -3.759  -16.794 15.757 1.00 23.92 ? 430 ARG A CA  1 
ATOM   1674 C C   . ARG A 1 216 ? -3.414  -16.392 14.332 1.00 23.95 ? 430 ARG A C   1 
ATOM   1675 O O   . ARG A 1 216 ? -4.304  -16.325 13.474 1.00 24.04 ? 430 ARG A O   1 
ATOM   1676 C CB  . ARG A 1 216 ? -3.977  -18.304 15.799 1.00 24.43 ? 430 ARG A CB  1 
ATOM   1677 C CG  . ARG A 1 216 ? -4.402  -18.867 17.158 1.00 27.07 ? 430 ARG A CG  1 
ATOM   1678 C CD  . ARG A 1 216 ? -4.886  -20.330 17.047 1.00 31.50 ? 430 ARG A CD  1 
ATOM   1679 N NE  . ARG A 1 216 ? -6.230  -20.439 16.455 1.00 34.70 ? 430 ARG A NE  1 
ATOM   1680 C CZ  . ARG A 1 216 ? -6.504  -20.996 15.276 1.00 35.25 ? 430 ARG A CZ  1 
ATOM   1681 N NH1 . ARG A 1 216 ? -7.762  -21.034 14.842 1.00 36.21 ? 430 ARG A NH1 1 
ATOM   1682 N NH2 . ARG A 1 216 ? -5.537  -21.526 14.532 1.00 36.02 ? 430 ARG A NH2 1 
ATOM   1683 N N   . LEU A 1 217 ? -2.137  -16.106 14.087 1.00 23.98 ? 431 LEU A N   1 
ATOM   1684 C CA  . LEU A 1 217 ? -1.627  -15.852 12.737 1.00 23.79 ? 431 LEU A CA  1 
ATOM   1685 C C   . LEU A 1 217 ? -1.224  -17.165 12.075 1.00 24.55 ? 431 LEU A C   1 
ATOM   1686 O O   . LEU A 1 217 ? -0.441  -17.933 12.634 1.00 23.05 ? 431 LEU A O   1 
ATOM   1687 C CB  . LEU A 1 217 ? -0.431  -14.893 12.759 1.00 23.41 ? 431 LEU A CB  1 
ATOM   1688 C CG  . LEU A 1 217 ? -0.761  -13.426 13.034 1.00 22.08 ? 431 LEU A CG  1 
ATOM   1689 C CD1 . LEU A 1 217 ? 0.516   -12.604 13.193 1.00 22.36 ? 431 LEU A CD1 1 
ATOM   1690 C CD2 . LEU A 1 217 ? -1.635  -12.875 11.880 1.00 20.90 ? 431 LEU A CD2 1 
ATOM   1691 N N   . VAL A 1 218 ? -1.781  -17.409 10.891 1.00 25.54 ? 432 VAL A N   1 
ATOM   1692 C CA  . VAL A 1 218 ? -1.571  -18.651 10.146 1.00 26.85 ? 432 VAL A CA  1 
ATOM   1693 C C   . VAL A 1 218 ? -1.090  -18.357 8.732  1.00 28.21 ? 432 VAL A C   1 
ATOM   1694 O O   . VAL A 1 218 ? -1.322  -17.259 8.203  1.00 27.83 ? 432 VAL A O   1 
ATOM   1695 C CB  . VAL A 1 218 ? -2.854  -19.547 10.113 1.00 26.61 ? 432 VAL A CB  1 
ATOM   1696 C CG1 . VAL A 1 218 ? -3.203  -20.047 11.522 1.00 27.00 ? 432 VAL A CG1 1 
ATOM   1697 C CG2 . VAL A 1 218 ? -4.035  -18.818 9.463  1.00 26.40 ? 432 VAL A CG2 1 
ATOM   1698 N N   . LYS A 1 219 ? -0.453  -19.354 8.118  1.00 29.99 ? 433 LYS A N   1 
ATOM   1699 C CA  . LYS A 1 219 ? 0.287   -19.178 6.863  1.00 32.27 ? 433 LYS A CA  1 
ATOM   1700 C C   . LYS A 1 219 ? -0.593  -18.955 5.629  1.00 33.72 ? 433 LYS A C   1 
ATOM   1701 O O   . LYS A 1 219 ? -0.133  -18.407 4.614  1.00 33.94 ? 433 LYS A O   1 
ATOM   1702 C CB  . LYS A 1 219 ? 1.246   -20.354 6.641  1.00 32.15 ? 433 LYS A CB  1 
ATOM   1703 C CG  . LYS A 1 219 ? 0.576   -21.686 6.343  1.00 34.42 ? 433 LYS A CG  1 
ATOM   1704 C CD  . LYS A 1 219 ? 1.519   -22.586 5.539  1.00 37.38 ? 433 LYS A CD  1 
ATOM   1705 C CE  . LYS A 1 219 ? 0.742   -23.610 4.733  1.00 39.75 ? 433 LYS A CE  1 
ATOM   1706 N NZ  . LYS A 1 219 ? 0.385   -24.796 5.553  1.00 41.07 ? 433 LYS A NZ  1 
ATOM   1707 N N   . GLU A 1 220 ? -1.842  -19.402 5.729  1.00 35.22 ? 434 GLU A N   1 
ATOM   1708 C CA  . GLU A 1 220 ? -2.840  -19.262 4.674  1.00 36.94 ? 434 GLU A CA  1 
ATOM   1709 C C   . GLU A 1 220 ? -4.233  -19.378 5.298  1.00 37.27 ? 434 GLU A C   1 
ATOM   1710 O O   . GLU A 1 220 ? -5.254  -19.335 4.599  1.00 38.06 ? 434 GLU A O   1 
ATOM   1711 C CB  . GLU A 1 220 ? -2.638  -20.332 3.596  1.00 37.21 ? 434 GLU A CB  1 
ATOM   1712 C CG  . GLU A 1 220 ? -2.581  -21.754 4.145  1.00 40.14 ? 434 GLU A CG  1 
ATOM   1713 C CD  . GLU A 1 220 ? -2.545  -22.810 3.060  1.00 44.24 ? 434 GLU A CD  1 
ATOM   1714 O OE1 . GLU A 1 220 ? -3.357  -23.754 3.142  1.00 46.17 ? 434 GLU A OE1 1 
ATOM   1715 O OE2 . GLU A 1 220 ? -1.711  -22.702 2.128  1.00 46.07 ? 434 GLU A OE2 1 
ATOM   1716 N N   . ASP B 2 1   ? 7.332   10.776  -5.546 1.00 44.14 ? 60  ASP L N   1 
ATOM   1717 C CA  . ASP B 2 1   ? 7.465   10.020  -4.268 1.00 44.43 ? 60  ASP L CA  1 
ATOM   1718 C C   . ASP B 2 1   ? 6.505   10.554  -3.213 1.00 44.01 ? 60  ASP L C   1 
ATOM   1719 O O   . ASP B 2 1   ? 6.226   11.764  -3.165 1.00 44.35 ? 60  ASP L O   1 
ATOM   1720 C CB  . ASP B 2 1   ? 8.898   10.112  -3.725 1.00 44.66 ? 60  ASP L CB  1 
ATOM   1721 C CG  . ASP B 2 1   ? 9.947   9.608   -4.710 1.00 45.83 ? 60  ASP L CG  1 
ATOM   1722 O OD1 . ASP B 2 1   ? 9.606   9.303   -5.879 1.00 47.07 ? 60  ASP L OD1 1 
ATOM   1723 O OD2 . ASP B 2 1   ? 11.127  9.518   -4.304 1.00 46.68 ? 60  ASP L OD2 1 
ATOM   1724 N N   . SER B 2 2   ? 6.011   9.650   -2.366 1.00 43.02 ? 61  SER L N   1 
ATOM   1725 C CA  . SER B 2 2   ? 5.203   10.031  -1.207 1.00 41.96 ? 61  SER L CA  1 
ATOM   1726 C C   . SER B 2 2   ? 6.095   10.180  0.031  1.00 41.65 ? 61  SER L C   1 
ATOM   1727 O O   . SER B 2 2   ? 7.227   9.692   0.043  1.00 41.32 ? 61  SER L O   1 
ATOM   1728 C CB  . SER B 2 2   ? 4.082   9.004   -0.959 1.00 41.86 ? 61  SER L CB  1 
ATOM   1729 O OG  . SER B 2 2   ? 4.593   7.693   -0.748 1.00 39.30 ? 61  SER L OG  1 
ATOM   1730 N N   . GLU B 2 3   ? 5.586   10.870  1.053  1.00 41.32 ? 62  GLU L N   1 
ATOM   1731 C CA  . GLU B 2 3   ? 6.272   10.994  2.350  1.00 41.48 ? 62  GLU L CA  1 
ATOM   1732 C C   . GLU B 2 3   ? 5.627   10.044  3.356  1.00 40.96 ? 62  GLU L C   1 
ATOM   1733 O O   . GLU B 2 3   ? 4.488   9.610   3.148  1.00 41.03 ? 62  GLU L O   1 
ATOM   1734 C CB  . GLU B 2 3   ? 6.232   12.441  2.854  1.00 41.38 ? 62  GLU L CB  1 
ATOM   1735 C CG  . GLU B 2 3   ? 7.292   13.374  2.206  1.00 43.09 ? 62  GLU L CG  1 
ATOM   1736 C CD  . GLU B 2 3   ? 6.788   14.153  0.983  1.00 45.16 ? 62  GLU L CD  1 
ATOM   1737 O OE1 . GLU B 2 3   ? 5.555   14.242  0.775  1.00 45.11 ? 62  GLU L OE1 1 
ATOM   1738 O OE2 . GLU B 2 3   ? 7.637   14.698  0.233  1.00 45.62 ? 62  GLU L OE2 1 
ATOM   1739 N N   . THR B 2 4   ? 6.339   9.710   4.432  1.00 40.30 ? 63  THR L N   1 
ATOM   1740 C CA  . THR B 2 4   ? 5.854   8.700   5.395  1.00 39.50 ? 63  THR L CA  1 
ATOM   1741 C C   . THR B 2 4   ? 6.000   9.124   6.876  1.00 39.22 ? 63  THR L C   1 
ATOM   1742 O O   . THR B 2 4   ? 6.083   8.267   7.776  1.00 38.87 ? 63  THR L O   1 
ATOM   1743 C CB  . THR B 2 4   ? 6.550   7.306   5.184  1.00 39.93 ? 63  THR L CB  1 
ATOM   1744 O OG1 . THR B 2 4   ? 6.543   6.917   3.793  1.00 41.27 ? 63  THR L OG1 1 
ATOM   1745 C CG2 . THR B 2 4   ? 5.854   6.208   6.003  1.00 39.61 ? 63  THR L CG2 1 
ATOM   1746 N N   . ASP B 2 5   ? 6.022   10.435  7.131  1.00 38.55 ? 64  ASP L N   1 
ATOM   1747 C CA  . ASP B 2 5   ? 6.337   10.992  8.469  1.00 37.32 ? 64  ASP L CA  1 
ATOM   1748 C C   . ASP B 2 5   ? 5.112   11.504  9.222  1.00 37.02 ? 64  ASP L C   1 
ATOM   1749 O O   . ASP B 2 5   ? 4.025   11.597  8.653  1.00 37.07 ? 64  ASP L O   1 
ATOM   1750 C CB  . ASP B 2 5   ? 7.342   12.138  8.337  1.00 37.67 ? 64  ASP L CB  1 
ATOM   1751 C CG  . ASP B 2 5   ? 6.826   13.268  7.466  1.00 36.55 ? 64  ASP L CG  1 
ATOM   1752 O OD1 . ASP B 2 5   ? 6.123   14.167  7.973  1.00 34.74 ? 64  ASP L OD1 1 
ATOM   1753 O OD2 . ASP B 2 5   ? 7.147   13.261  6.263  1.00 40.07 ? 64  ASP L OD2 1 
ATOM   1754 N N   . LEU B 2 6   ? 5.317   11.896  10.483 1.00 35.94 ? 65  LEU L N   1 
ATOM   1755 C CA  . LEU B 2 6   ? 4.234   12.155  11.432 1.00 35.26 ? 65  LEU L CA  1 
ATOM   1756 C C   . LEU B 2 6   ? 3.285   13.301  11.043 1.00 35.31 ? 65  LEU L C   1 
ATOM   1757 O O   . LEU B 2 6   ? 2.067   13.148  11.133 1.00 35.34 ? 65  LEU L O   1 
ATOM   1758 C CB  . LEU B 2 6   ? 4.799   12.368  12.840 1.00 35.25 ? 65  LEU L CB  1 
ATOM   1759 C CG  . LEU B 2 6   ? 3.854   12.406  14.042 1.00 34.59 ? 65  LEU L CG  1 
ATOM   1760 C CD1 . LEU B 2 6   ? 3.087   11.096  14.249 1.00 31.99 ? 65  LEU L CD1 1 
ATOM   1761 C CD2 . LEU B 2 6   ? 4.642   12.766  15.294 1.00 34.79 ? 65  LEU L CD2 1 
ATOM   1762 N N   . GLU B 2 7   ? 3.832   14.439  10.621 1.00 34.40 ? 66  GLU L N   1 
ATOM   1763 C CA  . GLU B 2 7   ? 2.991   15.505  10.070 1.00 33.99 ? 66  GLU L CA  1 
ATOM   1764 C C   . GLU B 2 7   ? 2.257   15.042  8.814  1.00 32.71 ? 66  GLU L C   1 
ATOM   1765 O O   . GLU B 2 7   ? 1.062   15.278  8.682  1.00 32.51 ? 66  GLU L O   1 
ATOM   1766 C CB  . GLU B 2 7   ? 3.797   16.765  9.765  1.00 34.36 ? 66  GLU L CB  1 
ATOM   1767 C CG  . GLU B 2 7   ? 4.183   17.563  10.997 1.00 37.67 ? 66  GLU L CG  1 
ATOM   1768 C CD  . GLU B 2 7   ? 3.063   17.674  12.021 1.00 40.66 ? 66  GLU L CD  1 
ATOM   1769 O OE1 . GLU B 2 7   ? 1.937   18.081  11.654 1.00 42.84 ? 66  GLU L OE1 1 
ATOM   1770 O OE2 . GLU B 2 7   ? 3.322   17.368  13.204 1.00 42.05 ? 66  GLU L OE2 1 
ATOM   1771 N N   . ALA B 2 8   ? 2.980   14.373  7.915  1.00 31.59 ? 67  ALA L N   1 
ATOM   1772 C CA  . ALA B 2 8   ? 2.398   13.850  6.676  1.00 30.92 ? 67  ALA L CA  1 
ATOM   1773 C C   . ALA B 2 8   ? 1.188   12.930  6.942  1.00 30.22 ? 67  ALA L C   1 
ATOM   1774 O O   . ALA B 2 8   ? 0.162   13.035  6.249  1.00 30.21 ? 67  ALA L O   1 
ATOM   1775 C CB  . ALA B 2 8   ? 3.455   13.140  5.846  1.00 30.88 ? 67  ALA L CB  1 
ATOM   1776 N N   . LEU B 2 9   ? 1.314   12.063  7.955  1.00 29.22 ? 68  LEU L N   1 
ATOM   1777 C CA  A LEU B 2 9   ? 0.267   11.103  8.309  0.50 28.63 ? 68  LEU L CA  1 
ATOM   1778 C CA  B LEU B 2 9   ? 0.259   11.104  8.341  0.50 28.41 ? 68  LEU L CA  1 
ATOM   1779 C C   . LEU B 2 9   ? -1.045  11.800  8.666  1.00 28.45 ? 68  LEU L C   1 
ATOM   1780 O O   . LEU B 2 9   ? -2.105  11.464  8.121  1.00 27.97 ? 68  LEU L O   1 
ATOM   1781 C CB  A LEU B 2 9   ? 0.746   10.235  9.478  0.50 28.71 ? 68  LEU L CB  1 
ATOM   1782 C CB  B LEU B 2 9   ? 0.666   10.307  9.585  0.50 28.34 ? 68  LEU L CB  1 
ATOM   1783 C CG  A LEU B 2 9   ? -0.092  9.063   9.970  0.50 28.56 ? 68  LEU L CG  1 
ATOM   1784 C CG  B LEU B 2 9   ? 1.883   9.395   9.558  0.50 27.17 ? 68  LEU L CG  1 
ATOM   1785 C CD1 A LEU B 2 9   ? -0.030  7.923   8.979  0.50 28.15 ? 68  LEU L CD1 1 
ATOM   1786 C CD1 B LEU B 2 9   ? 2.049   8.719   10.917 0.50 26.64 ? 68  LEU L CD1 1 
ATOM   1787 C CD2 A LEU B 2 9   ? 0.448   8.623   11.310 0.50 28.12 ? 68  LEU L CD2 1 
ATOM   1788 C CD2 B LEU B 2 9   ? 1.711   8.382   8.465  0.50 26.22 ? 68  LEU L CD2 1 
ATOM   1789 N N   . PHE B 2 10  ? -0.964  12.756  9.584  1.00 28.30 ? 69  PHE L N   1 
ATOM   1790 C CA  . PHE B 2 10  ? -2.129  13.508  10.023 1.00 29.20 ? 69  PHE L CA  1 
ATOM   1791 C C   . PHE B 2 10  ? -2.593  14.508  8.959  1.00 29.83 ? 69  PHE L C   1 
ATOM   1792 O O   . PHE B 2 10  ? -3.793  14.674  8.761  1.00 30.24 ? 69  PHE L O   1 
ATOM   1793 C CB  . PHE B 2 10  ? -1.867  14.154  11.394 1.00 28.96 ? 69  PHE L CB  1 
ATOM   1794 C CG  . PHE B 2 10  ? -1.879  13.150  12.523 1.00 28.38 ? 69  PHE L CG  1 
ATOM   1795 C CD1 . PHE B 2 10  ? -3.034  12.939  13.271 1.00 26.31 ? 69  PHE L CD1 1 
ATOM   1796 C CD2 . PHE B 2 10  ? -0.754  12.374  12.793 1.00 27.20 ? 69  PHE L CD2 1 
ATOM   1797 C CE1 . PHE B 2 10  ? -3.065  11.986  14.293 1.00 26.21 ? 69  PHE L CE1 1 
ATOM   1798 C CE2 . PHE B 2 10  ? -0.776  11.413  13.829 1.00 27.43 ? 69  PHE L CE2 1 
ATOM   1799 C CZ  . PHE B 2 10  ? -1.932  11.222  14.567 1.00 25.13 ? 69  PHE L CZ  1 
ATOM   1800 N N   . ASN B 2 11  ? -1.641  15.120  8.256  1.00 31.16 ? 70  ASN L N   1 
ATOM   1801 C CA  . ASN B 2 11  ? -1.929  16.048  7.143  1.00 32.89 ? 70  ASN L CA  1 
ATOM   1802 C C   . ASN B 2 11  ? -2.796  15.381  6.075  1.00 33.00 ? 70  ASN L C   1 
ATOM   1803 O O   . ASN B 2 11  ? -3.740  15.987  5.551  1.00 33.13 ? 70  ASN L O   1 
ATOM   1804 C CB  . ASN B 2 11  ? -0.619  16.553  6.512  1.00 33.13 ? 70  ASN L CB  1 
ATOM   1805 C CG  . ASN B 2 11  ? -0.850  17.421  5.258  1.00 35.53 ? 70  ASN L CG  1 
ATOM   1806 O OD1 . ASN B 2 11  ? -1.369  18.539  5.347  1.00 37.97 ? 70  ASN L OD1 1 
ATOM   1807 N ND2 . ASN B 2 11  ? -0.448  16.908  4.096  1.00 34.40 ? 70  ASN L ND2 1 
ATOM   1808 N N   . ALA B 2 12  ? -2.461  14.127  5.775  1.00 33.25 ? 71  ALA L N   1 
ATOM   1809 C CA  . ALA B 2 12  ? -3.160  13.322  4.785  1.00 33.72 ? 71  ALA L CA  1 
ATOM   1810 C C   . ALA B 2 12  ? -4.645  13.191  5.095  1.00 34.24 ? 71  ALA L C   1 
ATOM   1811 O O   . ALA B 2 12  ? -5.481  13.200  4.190  1.00 34.05 ? 71  ALA L O   1 
ATOM   1812 C CB  . ALA B 2 12  ? -2.522  11.947  4.684  1.00 33.39 ? 71  ALA L CB  1 
ATOM   1813 N N   . VAL B 2 13  ? -4.964  13.061  6.379  1.00 34.61 ? 72  VAL L N   1 
ATOM   1814 C CA  . VAL B 2 13  ? -6.344  12.920  6.808  1.00 35.51 ? 72  VAL L CA  1 
ATOM   1815 C C   . VAL B 2 13  ? -7.003  14.281  7.050  1.00 36.30 ? 72  VAL L C   1 
ATOM   1816 O O   . VAL B 2 13  ? -8.154  14.471  6.689  1.00 36.93 ? 72  VAL L O   1 
ATOM   1817 C CB  . VAL B 2 13  ? -6.464  11.982  8.042  1.00 35.52 ? 72  VAL L CB  1 
ATOM   1818 C CG1 . VAL B 2 13  ? -7.905  11.808  8.432  1.00 35.45 ? 72  VAL L CG1 1 
ATOM   1819 C CG2 . VAL B 2 13  ? -5.858  10.619  7.727  1.00 34.86 ? 72  VAL L CG2 1 
ATOM   1820 N N   . MET B 2 14  ? -6.270  15.229  7.638  1.00 37.23 ? 73  MET L N   1 
ATOM   1821 C CA  . MET B 2 14  ? -6.825  16.556  7.951  1.00 38.26 ? 73  MET L CA  1 
ATOM   1822 C C   . MET B 2 14  ? -7.071  17.382  6.700  1.00 38.40 ? 73  MET L C   1 
ATOM   1823 O O   . MET B 2 14  ? -8.041  18.136  6.627  1.00 38.40 ? 73  MET L O   1 
ATOM   1824 C CB  . MET B 2 14  ? -5.901  17.346  8.879  1.00 38.55 ? 73  MET L CB  1 
ATOM   1825 C CG  . MET B 2 14  ? -5.856  16.839  10.303 1.00 41.58 ? 73  MET L CG  1 
ATOM   1826 S SD  . MET B 2 14  ? -4.905  17.878  11.440 1.00 48.08 ? 73  MET L SD  1 
ATOM   1827 C CE  . MET B 2 14  ? -3.247  17.741  10.767 1.00 46.41 ? 73  MET L CE  1 
ATOM   1828 N N   . ASN B 2 15  ? -6.168  17.258  5.733  1.00 38.56 ? 74  ASN L N   1 
ATOM   1829 C CA  . ASN B 2 15  ? -6.236  18.035  4.494  1.00 39.05 ? 74  ASN L CA  1 
ATOM   1830 C C   . ASN B 2 15  ? -5.961  17.111  3.314  1.00 38.50 ? 74  ASN L C   1 
ATOM   1831 O O   . ASN B 2 15  ? -4.852  17.099  2.779  1.00 38.68 ? 74  ASN L O   1 
ATOM   1832 C CB  . ASN B 2 15  ? -5.222  19.187  4.521  1.00 39.36 ? 74  ASN L CB  1 
ATOM   1833 C CG  . ASN B 2 15  ? -5.234  19.952  5.831  1.00 41.20 ? 74  ASN L CG  1 
ATOM   1834 O OD1 . ASN B 2 15  ? -4.208  20.058  6.511  1.00 44.01 ? 74  ASN L OD1 1 
ATOM   1835 N ND2 . ASN B 2 15  ? -6.396  20.487  6.197  1.00 43.03 ? 74  ASN L ND2 1 
ATOM   1836 N N   . PRO B 2 16  ? -6.963  16.305  2.925  1.00 38.62 ? 75  PRO L N   1 
ATOM   1837 C CA  . PRO B 2 16  ? -6.760  15.267  1.903  1.00 38.76 ? 75  PRO L CA  1 
ATOM   1838 C C   . PRO B 2 16  ? -6.290  15.775  0.538  1.00 39.16 ? 75  PRO L C   1 
ATOM   1839 O O   . PRO B 2 16  ? -5.704  15.007  -0.218 1.00 39.49 ? 75  PRO L O   1 
ATOM   1840 C CB  . PRO B 2 16  ? -8.129  14.588  1.795  1.00 38.71 ? 75  PRO L CB  1 
ATOM   1841 C CG  . PRO B 2 16  ? -9.084  15.463  2.529  1.00 38.66 ? 75  PRO L CG  1 
ATOM   1842 C CD  . PRO B 2 16  ? -8.307  16.240  3.524  1.00 38.75 ? 75  PRO L CD  1 
ATOM   1843 N N   . LYS B 2 17  ? -6.536  17.052  0.232  1.00 39.40 ? 76  LYS L N   1 
ATOM   1844 C CA  . LYS B 2 17  ? -6.057  17.663  -1.020 1.00 39.40 ? 76  LYS L CA  1 
ATOM   1845 C C   . LYS B 2 17  ? -4.534  17.684  -1.140 1.00 38.93 ? 76  LYS L C   1 
ATOM   1846 O O   . LYS B 2 17  ? -3.990  17.596  -2.241 1.00 39.23 ? 76  LYS L O   1 
ATOM   1847 C CB  . LYS B 2 17  ? -6.595  19.090  -1.178 1.00 39.64 ? 76  LYS L CB  1 
ATOM   1848 C CG  . LYS B 2 17  ? -8.104  19.187  -1.233 1.00 40.54 ? 76  LYS L CG  1 
ATOM   1849 C CD  . LYS B 2 17  ? -8.555  20.644  -1.258 1.00 42.96 ? 76  LYS L CD  1 
ATOM   1850 C CE  . LYS B 2 17  ? -10.074 20.734  -1.320 1.00 43.96 ? 76  LYS L CE  1 
ATOM   1851 N NZ  . LYS B 2 17  ? -10.553 22.105  -0.982 1.00 45.08 ? 76  LYS L NZ  1 
ATOM   1852 N N   . THR B 2 18  ? -3.846  17.820  -0.013 1.00 38.09 ? 77  THR L N   1 
ATOM   1853 C CA  . THR B 2 18  ? -2.388  17.891  -0.028 1.00 37.34 ? 77  THR L CA  1 
ATOM   1854 C C   . THR B 2 18  ? -1.711  16.583  0.418  1.00 36.35 ? 77  THR L C   1 
ATOM   1855 O O   . THR B 2 18  ? -0.508  16.563  0.663  1.00 36.17 ? 77  THR L O   1 
ATOM   1856 C CB  . THR B 2 18  ? -1.876  19.085  0.824  1.00 37.24 ? 77  THR L CB  1 
ATOM   1857 O OG1 . THR B 2 18  ? -2.284  18.913  2.186  1.00 38.43 ? 77  THR L OG1 1 
ATOM   1858 C CG2 . THR B 2 18  ? -2.448  20.400  0.305  1.00 37.88 ? 77  THR L CG2 1 
ATOM   1859 N N   . ALA B 2 19  ? -2.483  15.497  0.487  1.00 35.61 ? 78  ALA L N   1 
ATOM   1860 C CA  . ALA B 2 19  ? -1.979  14.193  0.942  1.00 34.77 ? 78  ALA L CA  1 
ATOM   1861 C C   . ALA B 2 19  ? -0.901  13.625  0.023  1.00 34.11 ? 78  ALA L C   1 
ATOM   1862 O O   . ALA B 2 19  ? -1.040  13.652  -1.198 1.00 34.35 ? 78  ALA L O   1 
ATOM   1863 C CB  . ALA B 2 19  ? -3.125  13.200  1.090  1.00 34.80 ? 78  ALA L CB  1 
ATOM   1864 N N   . ASN B 2 20  ? 0.176   13.119  0.616  1.00 32.79 ? 79  ASN L N   1 
ATOM   1865 C CA  . ASN B 2 20  ? 1.248   12.493  -0.146 1.00 32.36 ? 79  ASN L CA  1 
ATOM   1866 C C   . ASN B 2 20  ? 1.830   11.299  0.600  1.00 31.51 ? 79  ASN L C   1 
ATOM   1867 O O   . ASN B 2 20  ? 3.030   11.179  0.751  1.00 32.52 ? 79  ASN L O   1 
ATOM   1868 C CB  . ASN B 2 20  ? 2.349   13.506  -0.493 1.00 32.80 ? 79  ASN L CB  1 
ATOM   1869 C CG  . ASN B 2 20  ? 3.238   13.045  -1.650 1.00 34.06 ? 79  ASN L CG  1 
ATOM   1870 O OD1 . ASN B 2 20  ? 2.827   12.237  -2.494 1.00 36.66 ? 79  ASN L OD1 1 
ATOM   1871 N ND2 . ASN B 2 20  ? 4.459   13.568  -1.698 1.00 34.14 ? 79  ASN L ND2 1 
ATOM   1872 N N   . VAL B 2 21  ? 0.964   10.416  1.075  1.00 29.76 ? 80  VAL L N   1 
ATOM   1873 C CA  . VAL B 2 21  ? 1.399   9.228   1.796  1.00 27.82 ? 80  VAL L CA  1 
ATOM   1874 C C   . VAL B 2 21  ? 1.070   8.012   0.912  1.00 26.55 ? 80  VAL L C   1 
ATOM   1875 O O   . VAL B 2 21  ? 0.271   8.144   -0.031 1.00 26.08 ? 80  VAL L O   1 
ATOM   1876 C CB  . VAL B 2 21  ? 0.737   9.150   3.193  1.00 28.06 ? 80  VAL L CB  1 
ATOM   1877 C CG1 . VAL B 2 21  ? 1.214   10.326  4.066  1.00 28.09 ? 80  VAL L CG1 1 
ATOM   1878 C CG2 . VAL B 2 21  ? -0.807  9.122   3.091  1.00 26.87 ? 80  VAL L CG2 1 
ATOM   1879 N N   . PRO B 2 22  ? 1.700   6.845   1.181  1.00 25.38 ? 81  PRO L N   1 
ATOM   1880 C CA  . PRO B 2 22  ? 1.392   5.653   0.378  1.00 24.51 ? 81  PRO L CA  1 
ATOM   1881 C C   . PRO B 2 22  ? -0.090  5.350   0.385  1.00 23.67 ? 81  PRO L C   1 
ATOM   1882 O O   . PRO B 2 22  ? -0.777  5.638   1.361  1.00 22.99 ? 81  PRO L O   1 
ATOM   1883 C CB  . PRO B 2 22  ? 2.155   4.537   1.101  1.00 24.35 ? 81  PRO L CB  1 
ATOM   1884 C CG  . PRO B 2 22  ? 3.331   5.245   1.718  1.00 24.72 ? 81  PRO L CG  1 
ATOM   1885 C CD  . PRO B 2 22  ? 2.802   6.593   2.135  1.00 25.25 ? 81  PRO L CD  1 
ATOM   1886 N N   . GLN B 2 23  ? -0.572  4.775   -0.715 1.00 23.81 ? 82  GLN L N   1 
ATOM   1887 C CA  . GLN B 2 23  ? -1.980  4.441   -0.854 1.00 23.63 ? 82  GLN L CA  1 
ATOM   1888 C C   . GLN B 2 23  ? -2.122  2.962   -0.516 1.00 22.99 ? 82  GLN L C   1 
ATOM   1889 O O   . GLN B 2 23  ? -1.244  2.169   -0.819 1.00 21.98 ? 82  GLN L O   1 
ATOM   1890 C CB  . GLN B 2 23  ? -2.450  4.745   -2.291 1.00 24.25 ? 82  GLN L CB  1 
ATOM   1891 C CG  . GLN B 2 23  ? -2.268  6.241   -2.659 1.00 25.86 ? 82  GLN L CG  1 
ATOM   1892 C CD  . GLN B 2 23  ? -2.685  6.612   -4.075 1.00 28.20 ? 82  GLN L CD  1 
ATOM   1893 O OE1 . GLN B 2 23  ? -3.217  5.791   -4.836 1.00 28.39 ? 82  GLN L OE1 1 
ATOM   1894 N NE2 . GLN B 2 23  ? -2.438  7.868   -4.437 1.00 28.11 ? 82  GLN L NE2 1 
ATOM   1895 N N   . THR B 2 24  ? -3.210  2.590   0.142  1.00 22.54 ? 83  THR L N   1 
ATOM   1896 C CA  . THR B 2 24  ? -3.326  1.221   0.598  1.00 23.34 ? 83  THR L CA  1 
ATOM   1897 C C   . THR B 2 24  ? -4.744  0.667   0.523  1.00 23.04 ? 83  THR L C   1 
ATOM   1898 O O   . THR B 2 24  ? -5.712  1.429   0.432  1.00 22.14 ? 83  THR L O   1 
ATOM   1899 C CB  . THR B 2 24  ? -2.785  1.063   2.036  1.00 23.14 ? 83  THR L CB  1 
ATOM   1900 O OG1 . THR B 2 24  ? -2.659  -0.328  2.330  1.00 27.01 ? 83  THR L OG1 1 
ATOM   1901 C CG2 . THR B 2 24  ? -3.706  1.722   3.056  1.00 22.58 ? 83  THR L CG2 1 
ATOM   1902 N N   . VAL B 2 25  ? -4.845  -0.660  0.583  1.00 22.85 ? 84  VAL L N   1 
ATOM   1903 C CA  . VAL B 2 25  ? -6.149  -1.318  0.699  1.00 22.92 ? 84  VAL L CA  1 
ATOM   1904 C C   . VAL B 2 25  ? -6.709  -1.154  2.118  1.00 23.12 ? 84  VAL L C   1 
ATOM   1905 O O   . VAL B 2 25  ? -6.067  -1.590  3.094  1.00 23.18 ? 84  VAL L O   1 
ATOM   1906 C CB  . VAL B 2 25  ? -6.081  -2.810  0.305  1.00 22.52 ? 84  VAL L CB  1 
ATOM   1907 C CG1 . VAL B 2 25  ? -7.474  -3.466  0.424  1.00 22.90 ? 84  VAL L CG1 1 
ATOM   1908 C CG2 . VAL B 2 25  ? -5.551  -2.956  -1.124 1.00 22.93 ? 84  VAL L CG2 1 
ATOM   1909 N N   . PRO B 2 26  ? -7.908  -0.540  2.245  1.00 23.52 ? 85  PRO L N   1 
ATOM   1910 C CA  . PRO B 2 26  ? -8.525  -0.396  3.570  1.00 24.04 ? 85  PRO L CA  1 
ATOM   1911 C C   . PRO B 2 26  ? -8.791  -1.749  4.212  1.00 24.14 ? 85  PRO L C   1 
ATOM   1912 O O   . PRO B 2 26  ? -9.149  -2.714  3.522  1.00 23.10 ? 85  PRO L O   1 
ATOM   1913 C CB  . PRO B 2 26  ? -9.843  0.335   3.266  1.00 24.33 ? 85  PRO L CB  1 
ATOM   1914 C CG  . PRO B 2 26  ? -9.579  1.044   1.982  1.00 24.85 ? 85  PRO L CG  1 
ATOM   1915 C CD  . PRO B 2 26  ? -8.765  0.053   1.201  1.00 23.28 ? 85  PRO L CD  1 
ATOM   1916 N N   . MET B 2 27  ? -8.581  -1.825  5.526  1.00 24.67 ? 86  MET L N   1 
ATOM   1917 C CA  . MET B 2 27  ? -8.696  -3.084  6.251  1.00 25.66 ? 86  MET L CA  1 
ATOM   1918 C C   . MET B 2 27  ? -10.056 -3.749  6.025  1.00 26.02 ? 86  MET L C   1 
ATOM   1919 O O   . MET B 2 27  ? -10.139 -4.953  5.854  1.00 24.90 ? 86  MET L O   1 
ATOM   1920 C CB  . MET B 2 27  ? -8.432  -2.876  7.749  1.00 26.04 ? 86  MET L CB  1 
ATOM   1921 C CG  . MET B 2 27  ? -6.976  -2.544  8.068  1.00 26.95 ? 86  MET L CG  1 
ATOM   1922 S SD  . MET B 2 27  ? -5.864  -3.912  7.701  1.00 31.81 ? 86  MET L SD  1 
ATOM   1923 C CE  . MET B 2 27  ? -6.076  -4.939  9.147  1.00 29.82 ? 86  MET L CE  1 
ATOM   1924 N N   . ARG B 2 28  ? -11.117 -2.947  5.983  1.00 27.95 ? 87  ARG L N   1 
ATOM   1925 C CA  . ARG B 2 28  ? -12.462 -3.483  5.735  1.00 28.95 ? 87  ARG L CA  1 
ATOM   1926 C C   . ARG B 2 28  ? -12.593 -4.281  4.438  1.00 29.28 ? 87  ARG L C   1 
ATOM   1927 O O   . ARG B 2 28  ? -13.442 -5.181  4.331  1.00 28.77 ? 87  ARG L O   1 
ATOM   1928 C CB  . ARG B 2 28  ? -13.511 -2.385  5.814  1.00 29.93 ? 87  ARG L CB  1 
ATOM   1929 C CG  . ARG B 2 28  ? -13.750 -2.009  7.248  1.00 33.16 ? 87  ARG L CG  1 
ATOM   1930 C CD  . ARG B 2 28  ? -15.170 -1.586  7.562  1.00 37.38 ? 87  ARG L CD  1 
ATOM   1931 N NE  . ARG B 2 28  ? -15.357 -1.632  9.010  1.00 39.73 ? 87  ARG L NE  1 
ATOM   1932 C CZ  . ARG B 2 28  ? -14.915 -0.710  9.865  1.00 42.71 ? 87  ARG L CZ  1 
ATOM   1933 N NH1 . ARG B 2 28  ? -14.279 0.375   9.429  1.00 43.64 ? 87  ARG L NH1 1 
ATOM   1934 N NH2 . ARG B 2 28  ? -15.124 -0.869  11.168 1.00 44.04 ? 87  ARG L NH2 1 
ATOM   1935 N N   . LEU B 2 29  ? -11.734 -3.983  3.469  1.00 28.39 ? 88  LEU L N   1 
ATOM   1936 C CA  . LEU B 2 29  ? -11.858 -4.607  2.163  1.00 28.48 ? 88  LEU L CA  1 
ATOM   1937 C C   . LEU B 2 29  ? -10.947 -5.811  1.989  1.00 28.22 ? 88  LEU L C   1 
ATOM   1938 O O   . LEU B 2 29  ? -10.905 -6.403  0.919  1.00 28.39 ? 88  LEU L O   1 
ATOM   1939 C CB  . LEU B 2 29  ? -11.664 -3.571  1.040  1.00 29.18 ? 88  LEU L CB  1 
ATOM   1940 C CG  . LEU B 2 29  ? -12.401 -2.229  1.171  1.00 30.36 ? 88  LEU L CG  1 
ATOM   1941 C CD1 . LEU B 2 29  ? -12.171 -1.412  -0.082 1.00 32.82 ? 88  LEU L CD1 1 
ATOM   1942 C CD2 . LEU B 2 29  ? -13.913 -2.346  1.456  1.00 34.58 ? 88  LEU L CD2 1 
ATOM   1943 N N   . ARG B 2 30  ? -10.229 -6.181  3.052  1.00 27.52 ? 89  ARG L N   1 
ATOM   1944 C CA  . ARG B 2 30  ? -9.339  -7.328  3.021  1.00 27.45 ? 89  ARG L CA  1 
ATOM   1945 C C   . ARG B 2 30  ? -10.055 -8.609  3.450  1.00 28.03 ? 89  ARG L C   1 
ATOM   1946 O O   . ARG B 2 30  ? -11.138 -8.546  4.034  1.00 28.14 ? 89  ARG L O   1 
ATOM   1947 C CB  . ARG B 2 30  ? -8.120  -7.071  3.919  1.00 26.72 ? 89  ARG L CB  1 
ATOM   1948 C CG  . ARG B 2 30  ? -7.325  -5.843  3.504  1.00 25.00 ? 89  ARG L CG  1 
ATOM   1949 C CD  . ARG B 2 30  ? -6.125  -5.599  4.384  1.00 23.26 ? 89  ARG L CD  1 
ATOM   1950 N NE  . ARG B 2 30  ? -5.452  -4.363  4.002  1.00 21.26 ? 89  ARG L NE  1 
ATOM   1951 C CZ  . ARG B 2 30  ? -4.144  -4.156  4.104  1.00 20.90 ? 89  ARG L CZ  1 
ATOM   1952 N NH1 . ARG B 2 30  ? -3.344  -5.120  4.536  1.00 20.68 ? 89  ARG L NH1 1 
ATOM   1953 N NH2 . ARG B 2 30  ? -3.634  -2.998  3.743  1.00 19.48 ? 89  ARG L NH2 1 
ATOM   1954 N N   . LYS B 2 31  ? -9.439  -9.755  3.157  1.00 28.65 ? 90  LYS L N   1 
ATOM   1955 C CA  . LYS B 2 31  ? -9.909  -11.070 3.611  1.00 29.70 ? 90  LYS L CA  1 
ATOM   1956 C C   . LYS B 2 31  ? -9.620  -11.295 5.099  1.00 29.93 ? 90  LYS L C   1 
ATOM   1957 O O   . LYS B 2 31  ? -8.628  -11.951 5.476  1.00 29.69 ? 90  LYS L O   1 
ATOM   1958 C CB  . LYS B 2 31  ? -9.276  -12.193 2.778  1.00 29.81 ? 90  LYS L CB  1 
ATOM   1959 C CG  . LYS B 2 31  ? -9.575  -12.125 1.269  1.00 31.89 ? 90  LYS L CG  1 
ATOM   1960 C CD  . LYS B 2 31  ? -8.854  -13.265 0.545  1.00 33.54 ? 90  LYS L CD  1 
ATOM   1961 C CE  . LYS B 2 31  ? -9.031  -13.214 -0.965 1.00 34.89 ? 90  LYS L CE  1 
ATOM   1962 N NZ  . LYS B 2 31  ? -8.067  -14.188 -1.606 1.00 35.59 ? 90  LYS L NZ  1 
ATOM   1963 N N   . LEU B 2 32  ? -10.502 -10.756 5.938  1.00 30.08 ? 91  LEU L N   1 
ATOM   1964 C CA  . LEU B 2 32  ? -10.334 -10.796 7.395  1.00 30.73 ? 91  LEU L CA  1 
ATOM   1965 C C   . LEU B 2 32  ? -11.628 -11.249 8.046  1.00 31.11 ? 91  LEU L C   1 
ATOM   1966 O O   . LEU B 2 32  ? -12.690 -11.024 7.478  1.00 31.01 ? 91  LEU L O   1 
ATOM   1967 C CB  . LEU B 2 32  ? -9.969  -9.400  7.919  1.00 30.46 ? 91  LEU L CB  1 
ATOM   1968 C CG  . LEU B 2 32  ? -8.580  -8.859  7.605  1.00 30.08 ? 91  LEU L CG  1 
ATOM   1969 C CD1 . LEU B 2 32  ? -8.465  -7.402  8.054  1.00 29.28 ? 91  LEU L CD1 1 
ATOM   1970 C CD2 . LEU B 2 32  ? -7.478  -9.719  8.224  1.00 29.86 ? 91  LEU L CD2 1 
ATOM   1971 N N   . PRO B 2 33  ? -11.556 -11.861 9.250  1.00 31.56 ? 92  PRO L N   1 
ATOM   1972 C CA  . PRO B 2 33  ? -12.791 -12.344 9.873  1.00 31.71 ? 92  PRO L CA  1 
ATOM   1973 C C   . PRO B 2 33  ? -13.762 -11.214 10.173 1.00 31.95 ? 92  PRO L C   1 
ATOM   1974 O O   . PRO B 2 33  ? -13.338 -10.086 10.432 1.00 32.24 ? 92  PRO L O   1 
ATOM   1975 C CB  . PRO B 2 33  ? -12.309 -12.983 11.189 1.00 31.54 ? 92  PRO L CB  1 
ATOM   1976 C CG  . PRO B 2 33  ? -10.843 -13.220 10.994 1.00 31.39 ? 92  PRO L CG  1 
ATOM   1977 C CD  . PRO B 2 33  ? -10.386 -12.101 10.113 1.00 31.66 ? 92  PRO L CD  1 
ATOM   1978 N N   . ASP B 2 34  ? -15.057 -11.518 10.132 1.00 32.38 ? 93  ASP L N   1 
ATOM   1979 C CA  . ASP B 2 34  ? -16.100 -10.534 10.415 1.00 32.75 ? 93  ASP L CA  1 
ATOM   1980 C C   . ASP B 2 34  ? -15.938 -9.909  11.797 1.00 31.96 ? 93  ASP L C   1 
ATOM   1981 O O   . ASP B 2 34  ? -16.231 -8.724  11.989 1.00 31.72 ? 93  ASP L O   1 
ATOM   1982 C CB  . ASP B 2 34  ? -17.489 -11.174 10.296 1.00 34.12 ? 93  ASP L CB  1 
ATOM   1983 C CG  . ASP B 2 34  ? -17.893 -11.450 8.854  1.00 36.98 ? 93  ASP L CG  1 
ATOM   1984 O OD1 . ASP B 2 34  ? -17.332 -10.823 7.920  1.00 41.08 ? 93  ASP L OD1 1 
ATOM   1985 O OD2 . ASP B 2 34  ? -18.787 -12.299 8.657  1.00 40.99 ? 93  ASP L OD2 1 
ATOM   1986 N N   . SER B 2 35  ? -15.450 -10.698 12.757 1.00 31.12 ? 94  SER L N   1 
ATOM   1987 C CA  . SER B 2 35  ? -15.278 -10.214 14.128 1.00 30.03 ? 94  SER L CA  1 
ATOM   1988 C C   . SER B 2 35  ? -14.261 -9.089  14.198 1.00 29.74 ? 94  SER L C   1 
ATOM   1989 O O   . SER B 2 35  ? -14.243 -8.333  15.166 1.00 28.90 ? 94  SER L O   1 
ATOM   1990 C CB  . SER B 2 35  ? -14.831 -11.339 15.057 1.00 30.30 ? 94  SER L CB  1 
ATOM   1991 O OG  . SER B 2 35  ? -13.534 -11.786 14.690 1.00 28.96 ? 94  SER L OG  1 
ATOM   1992 N N   . PHE B 2 36  ? -13.416 -8.989  13.169 1.00 29.31 ? 95  PHE L N   1 
ATOM   1993 C CA  . PHE B 2 36  ? -12.354 -7.988  13.132 1.00 29.23 ? 95  PHE L CA  1 
ATOM   1994 C C   . PHE B 2 36  ? -12.906 -6.573  13.235 1.00 29.48 ? 95  PHE L C   1 
ATOM   1995 O O   . PHE B 2 36  ? -12.234 -5.674  13.748 1.00 28.56 ? 95  PHE L O   1 
ATOM   1996 C CB  . PHE B 2 36  ? -11.521 -8.142  11.854 1.00 29.25 ? 95  PHE L CB  1 
ATOM   1997 C CG  . PHE B 2 36  ? -10.094 -7.729  12.015 1.00 30.22 ? 95  PHE L CG  1 
ATOM   1998 C CD1 . PHE B 2 36  ? -9.130  -8.663  12.392 1.00 30.71 ? 95  PHE L CD1 1 
ATOM   1999 C CD2 . PHE B 2 36  ? -9.708  -6.410  11.800 1.00 27.82 ? 95  PHE L CD2 1 
ATOM   2000 C CE1 . PHE B 2 36  ? -7.801  -8.294  12.555 1.00 30.47 ? 95  PHE L CE1 1 
ATOM   2001 C CE2 . PHE B 2 36  ? -8.389  -6.030  11.960 1.00 29.57 ? 95  PHE L CE2 1 
ATOM   2002 C CZ  . PHE B 2 36  ? -7.429  -6.976  12.343 1.00 29.21 ? 95  PHE L CZ  1 
ATOM   2003 N N   . PHE B 2 37  ? -14.135 -6.376  12.759 1.00 30.69 ? 96  PHE L N   1 
ATOM   2004 C CA  . PHE B 2 37  ? -14.750 -5.051  12.766 1.00 31.60 ? 96  PHE L CA  1 
ATOM   2005 C C   . PHE B 2 37  ? -15.992 -4.965  13.660 1.00 33.12 ? 96  PHE L C   1 
ATOM   2006 O O   . PHE B 2 37  ? -16.697 -3.949  13.670 1.00 33.75 ? 96  PHE L O   1 
ATOM   2007 C CB  . PHE B 2 37  ? -15.039 -4.605  11.335 1.00 31.40 ? 96  PHE L CB  1 
ATOM   2008 C CG  . PHE B 2 37  ? -13.868 -4.790  10.409 1.00 30.96 ? 96  PHE L CG  1 
ATOM   2009 C CD1 . PHE B 2 37  ? -12.823 -3.869  10.400 1.00 30.61 ? 96  PHE L CD1 1 
ATOM   2010 C CD2 . PHE B 2 37  ? -13.793 -5.910  9.575  1.00 30.10 ? 96  PHE L CD2 1 
ATOM   2011 C CE1 . PHE B 2 37  ? -11.720 -4.045  9.543  1.00 29.30 ? 96  PHE L CE1 1 
ATOM   2012 C CE2 . PHE B 2 37  ? -12.692 -6.100  8.719  1.00 30.21 ? 96  PHE L CE2 1 
ATOM   2013 C CZ  . PHE B 2 37  ? -11.661 -5.166  8.710  1.00 28.39 ? 96  PHE L CZ  1 
ATOM   2014 N N   . LYS B 2 38  ? -16.237 -6.023  14.424 1.00 34.09 ? 97  LYS L N   1 
ATOM   2015 C CA  . LYS B 2 38  ? -17.312 -6.039  15.413 1.00 35.15 ? 97  LYS L CA  1 
ATOM   2016 C C   . LYS B 2 38  ? -16.735 -6.286  16.812 1.00 35.30 ? 97  LYS L C   1 
ATOM   2017 O O   . LYS B 2 38  ? -16.427 -7.423  17.163 1.00 35.09 ? 97  LYS L O   1 
ATOM   2018 C CB  . LYS B 2 38  ? -18.366 -7.088  15.043 1.00 35.32 ? 97  LYS L CB  1 
ATOM   2019 C CG  . LYS B 2 38  ? -19.237 -6.644  13.873 1.00 37.64 ? 97  LYS L CG  1 
ATOM   2020 C CD  . LYS B 2 38  ? -20.015 -7.787  13.263 1.00 39.17 ? 97  LYS L CD  1 
ATOM   2021 C CE  . LYS B 2 38  ? -20.521 -7.400  11.882 1.00 41.43 ? 97  LYS L CE  1 
ATOM   2022 N NZ  . LYS B 2 38  ? -20.909 -8.608  11.103 1.00 42.28 ? 97  LYS L NZ  1 
ATOM   2023 N N   . PRO B 2 39  ? -16.567 -5.209  17.606 1.00 35.91 ? 98  PRO L N   1 
ATOM   2024 C CA  . PRO B 2 39  ? -15.996 -5.336  18.956 1.00 36.59 ? 98  PRO L CA  1 
ATOM   2025 C C   . PRO B 2 39  ? -16.947 -6.069  19.907 1.00 37.61 ? 98  PRO L C   1 
ATOM   2026 O O   . PRO B 2 39  ? -18.173 -5.998  19.720 1.00 37.41 ? 98  PRO L O   1 
ATOM   2027 C CB  . PRO B 2 39  ? -15.797 -3.881  19.395 1.00 36.40 ? 98  PRO L CB  1 
ATOM   2028 C CG  . PRO B 2 39  ? -16.766 -3.101  18.581 1.00 36.56 ? 98  PRO L CG  1 
ATOM   2029 C CD  . PRO B 2 39  ? -16.878 -3.809  17.267 1.00 35.67 ? 98  PRO L CD  1 
ATOM   2030 N N   . PRO B 2 40  ? -16.392 -6.800  20.900 1.00 38.41 ? 99  PRO L N   1 
ATOM   2031 C CA  . PRO B 2 40  ? -17.254 -7.449  21.889 1.00 38.85 ? 99  PRO L CA  1 
ATOM   2032 C C   . PRO B 2 40  ? -17.692 -6.462  22.963 1.00 39.34 ? 99  PRO L C   1 
ATOM   2033 O O   . PRO B 2 40  ? -18.560 -5.628  22.710 1.00 39.85 ? 99  PRO L O   1 
ATOM   2034 C CB  . PRO B 2 40  ? -16.355 -8.540  22.485 1.00 38.77 ? 99  PRO L CB  1 
ATOM   2035 C CG  . PRO B 2 40  ? -14.952 -8.039  22.295 1.00 38.81 ? 99  PRO L CG  1 
ATOM   2036 C CD  . PRO B 2 40  ? -14.957 -7.081  21.130 1.00 38.32 ? 99  PRO L CD  1 
HETATM 2037 C C1  . GOL C 3 .   ? 2.100   1.226   2.887  1.00 39.57 ? 501 GOL A C1  1 
HETATM 2038 O O1  . GOL C 3 .   ? 3.470   0.979   2.614  1.00 41.38 ? 501 GOL A O1  1 
HETATM 2039 C C2  . GOL C 3 .   ? 1.426   0.078   3.646  1.00 41.20 ? 501 GOL A C2  1 
HETATM 2040 O O2  . GOL C 3 .   ? 2.040   -0.244  4.869  1.00 40.77 ? 501 GOL A O2  1 
HETATM 2041 C C3  . GOL C 3 .   ? -0.014  0.421   3.992  1.00 41.59 ? 501 GOL A C3  1 
HETATM 2042 O O3  . GOL C 3 .   ? -0.689  -0.787  4.292  1.00 42.67 ? 501 GOL A O3  1 
HETATM 2043 C C1  . MYR D 4 .   ? 7.740   3.807   22.887 1.00 41.51 ? 502 MYR A C1  1 
HETATM 2044 O O1  . MYR D 4 .   ? 8.767   3.552   23.481 1.00 44.43 ? 502 MYR A O1  1 
HETATM 2045 C C2  . MYR D 4 .   ? 6.569   2.880   23.038 1.00 42.43 ? 502 MYR A C2  1 
HETATM 2046 C C3  . MYR D 4 .   ? 6.673   1.583   22.234 1.00 43.26 ? 502 MYR A C3  1 
HETATM 2047 C C4  . MYR D 4 .   ? 5.238   1.082   22.025 1.00 44.22 ? 502 MYR A C4  1 
HETATM 2048 C C5  . MYR D 4 .   ? 4.551   0.730   23.354 1.00 43.88 ? 502 MYR A C5  1 
HETATM 2049 C C6  . MYR D 4 .   ? 3.250   -0.026  23.064 1.00 44.74 ? 502 MYR A C6  1 
HETATM 2050 C C7  . MYR D 4 .   ? 2.062   0.673   23.734 1.00 44.38 ? 502 MYR A C7  1 
HETATM 2051 C C8  . MYR D 4 .   ? 0.745   0.413   23.002 1.00 43.97 ? 502 MYR A C8  1 
HETATM 2052 C C9  . MYR D 4 .   ? 0.147   1.768   22.617 1.00 43.72 ? 502 MYR A C9  1 
HETATM 2053 C C10 . MYR D 4 .   ? -1.371  1.785   22.762 1.00 44.39 ? 502 MYR A C10 1 
HETATM 2054 C C11 . MYR D 4 .   ? -1.815  3.233   22.996 1.00 44.90 ? 502 MYR A C11 1 
HETATM 2055 C C12 . MYR D 4 .   ? -3.058  3.568   22.164 1.00 45.68 ? 502 MYR A C12 1 
HETATM 2056 C C13 . MYR D 4 .   ? -2.669  4.392   20.933 1.00 46.17 ? 502 MYR A C13 1 
HETATM 2057 C C14 . MYR D 4 .   ? -3.729  4.219   19.842 1.00 45.80 ? 502 MYR A C14 1 
HETATM 2058 O O   . HOH E 5 .   ? 22.291  -13.905 26.130 1.00 34.07 ? 601 HOH A O   1 
HETATM 2059 O O   . HOH E 5 .   ? 4.796   -7.344  2.953  1.00 42.92 ? 602 HOH A O   1 
HETATM 2060 O O   . HOH E 5 .   ? -11.206 0.082   6.870  1.00 35.08 ? 603 HOH A O   1 
HETATM 2061 O O   . HOH E 5 .   ? 15.107  -21.242 23.266 1.00 42.23 ? 604 HOH A O   1 
HETATM 2062 O O   . HOH E 5 .   ? 5.386   8.632   12.006 1.00 28.63 ? 605 HOH A O   1 
HETATM 2063 O O   . HOH E 5 .   ? -7.331  -8.556  0.924  1.00 33.95 ? 606 HOH A O   1 
HETATM 2064 O O   . HOH E 5 .   ? 4.521   -16.388 4.855  1.00 34.48 ? 607 HOH A O   1 
HETATM 2065 O O   . HOH E 5 .   ? -5.317  -0.365  5.485  1.00 24.64 ? 608 HOH A O   1 
HETATM 2066 O O   . HOH E 5 .   ? 22.613  -14.280 29.079 1.00 25.62 ? 609 HOH A O   1 
HETATM 2067 O O   . HOH E 5 .   ? 14.488  -23.327 33.267 1.00 32.88 ? 610 HOH A O   1 
HETATM 2068 O O   . HOH E 5 .   ? 8.612   -20.532 21.392 1.00 21.32 ? 611 HOH A O   1 
HETATM 2069 O O   . HOH E 5 .   ? 10.384  -10.175 6.725  1.00 25.65 ? 612 HOH A O   1 
HETATM 2070 O O   . HOH E 5 .   ? -3.809  -0.265  12.996 1.00 27.19 ? 613 HOH A O   1 
HETATM 2071 O O   . HOH E 5 .   ? 20.024  -7.746  27.152 1.00 38.83 ? 614 HOH A O   1 
HETATM 2072 O O   . HOH E 5 .   ? 6.076   8.088   29.685 1.00 42.88 ? 615 HOH A O   1 
HETATM 2073 O O   . HOH E 5 .   ? 7.161   -8.207  40.191 0.50 27.11 ? 616 HOH A O   1 
HETATM 2074 O O   . HOH E 5 .   ? -9.839  -5.088  26.362 1.00 36.77 ? 617 HOH A O   1 
HETATM 2075 O O   . HOH E 5 .   ? 11.255  -4.249  2.029  1.00 38.83 ? 618 HOH A O   1 
HETATM 2076 O O   . HOH E 5 .   ? -0.712  14.515  29.053 1.00 37.77 ? 619 HOH A O   1 
HETATM 2077 O O   . HOH E 5 .   ? 17.739  -4.563  26.705 1.00 44.92 ? 620 HOH A O   1 
HETATM 2078 O O   . HOH E 5 .   ? 13.700  -9.254  14.219 1.00 36.72 ? 621 HOH A O   1 
HETATM 2079 O O   . HOH E 5 .   ? -3.180  6.522   7.404  1.00 36.93 ? 622 HOH A O   1 
HETATM 2080 O O   . HOH E 5 .   ? 10.786  -16.787 14.513 1.00 22.36 ? 623 HOH A O   1 
HETATM 2081 O O   . HOH E 5 .   ? -9.254  9.642   32.801 1.00 46.89 ? 624 HOH A O   1 
HETATM 2082 O O   . HOH E 5 .   ? 7.459   -24.684 20.618 1.00 36.68 ? 625 HOH A O   1 
HETATM 2083 O O   . HOH E 5 .   ? -10.310 -15.196 18.231 1.00 27.67 ? 626 HOH A O   1 
HETATM 2084 O O   . HOH E 5 .   ? -10.549 7.377   32.298 1.00 42.93 ? 627 HOH A O   1 
HETATM 2085 O O   . HOH E 5 .   ? -0.347  -18.810 16.837 1.00 37.49 ? 628 HOH A O   1 
HETATM 2086 O O   . HOH E 5 .   ? -14.306 2.765   15.734 1.00 41.96 ? 629 HOH A O   1 
HETATM 2087 O O   . HOH E 5 .   ? 13.006  -9.622  21.069 1.00 23.50 ? 630 HOH A O   1 
HETATM 2088 O O   . HOH E 5 .   ? 22.756  -11.329 31.901 1.00 40.84 ? 631 HOH A O   1 
HETATM 2089 O O   . HOH E 5 .   ? -12.909 -1.821  28.758 1.00 32.85 ? 632 HOH A O   1 
HETATM 2090 O O   . HOH E 5 .   ? -12.562 -6.889  24.879 1.00 25.89 ? 633 HOH A O   1 
HETATM 2091 O O   . HOH E 5 .   ? 9.804   -3.547  24.419 1.00 25.26 ? 634 HOH A O   1 
HETATM 2092 O O   . HOH E 5 .   ? 5.897   -7.949  6.973  1.00 26.90 ? 635 HOH A O   1 
HETATM 2093 O O   . HOH E 5 .   ? 5.380   -4.327  24.182 1.00 35.68 ? 636 HOH A O   1 
HETATM 2094 O O   . HOH E 5 .   ? 17.690  -10.781 21.989 1.00 30.87 ? 637 HOH A O   1 
HETATM 2095 O O   . HOH E 5 .   ? 6.380   -22.344 21.013 1.00 31.61 ? 638 HOH A O   1 
HETATM 2096 O O   . HOH E 5 .   ? -4.512  -1.208  10.538 1.00 31.44 ? 639 HOH A O   1 
HETATM 2097 O O   . HOH E 5 .   ? 16.352  -13.555 38.053 1.00 18.07 ? 640 HOH A O   1 
HETATM 2098 O O   . HOH E 5 .   ? 12.192  -19.279 16.951 1.00 22.66 ? 641 HOH A O   1 
HETATM 2099 O O   . HOH E 5 .   ? 9.940   -3.784  35.023 1.00 40.91 ? 642 HOH A O   1 
HETATM 2100 O O   . HOH E 5 .   ? 2.192   0.198   9.737  1.00 24.37 ? 643 HOH A O   1 
HETATM 2101 O O   . HOH E 5 .   ? 6.862   -2.529  27.237 1.00 42.51 ? 644 HOH A O   1 
HETATM 2102 O O   . HOH E 5 .   ? -4.124  13.615  26.726 1.00 48.12 ? 645 HOH A O   1 
HETATM 2103 O O   . HOH E 5 .   ? -3.945  16.458  15.001 1.00 35.87 ? 646 HOH A O   1 
HETATM 2104 O O   . HOH E 5 .   ? -16.323 0.320   19.792 1.00 32.20 ? 647 HOH A O   1 
HETATM 2105 O O   . HOH E 5 .   ? -3.275  -14.047 26.994 1.00 29.20 ? 648 HOH A O   1 
HETATM 2106 O O   . HOH E 5 .   ? -10.128 -12.572 21.730 1.00 39.01 ? 649 HOH A O   1 
HETATM 2107 O O   . HOH E 5 .   ? 16.149  -15.068 34.246 1.00 26.08 ? 650 HOH A O   1 
HETATM 2108 O O   . HOH E 5 .   ? 1.511   -10.703 1.637  1.00 20.87 ? 651 HOH A O   1 
HETATM 2109 O O   . HOH E 5 .   ? -0.215  -7.760  2.649  1.00 29.85 ? 652 HOH A O   1 
HETATM 2110 O O   . HOH E 5 .   ? -11.950 5.873   8.720  1.00 41.51 ? 653 HOH A O   1 
HETATM 2111 O O   . HOH E 5 .   ? 17.036  -19.286 17.168 1.00 30.10 ? 654 HOH A O   1 
HETATM 2112 O O   . HOH E 5 .   ? 1.085   -0.932  36.081 1.00 37.71 ? 655 HOH A O   1 
HETATM 2113 O O   . HOH E 5 .   ? 10.855  -0.846  8.525  1.00 39.53 ? 656 HOH A O   1 
HETATM 2114 O O   . HOH E 5 .   ? 13.851  5.811   15.793 1.00 32.17 ? 657 HOH A O   1 
HETATM 2115 O O   . HOH E 5 .   ? 11.860  7.632   13.100 1.00 33.15 ? 658 HOH A O   1 
HETATM 2116 O O   . HOH E 5 .   ? 13.637  -16.195 14.113 1.00 34.52 ? 659 HOH A O   1 
HETATM 2117 O O   . HOH E 5 .   ? -12.143 6.331   22.624 1.00 29.32 ? 660 HOH A O   1 
HETATM 2118 O O   . HOH E 5 .   ? -5.559  9.570   34.159 1.00 34.85 ? 661 HOH A O   1 
HETATM 2119 O O   . HOH E 5 .   ? 15.111  0.651   24.012 1.00 37.02 ? 662 HOH A O   1 
HETATM 2120 O O   . HOH E 5 .   ? -8.545  -8.995  29.001 1.00 43.33 ? 663 HOH A O   1 
HETATM 2121 O O   . HOH E 5 .   ? 19.575  -21.201 18.993 1.00 21.59 ? 664 HOH A O   1 
HETATM 2122 O O   . HOH E 5 .   ? 10.919  8.526   24.033 1.00 27.39 ? 665 HOH A O   1 
HETATM 2123 O O   . HOH E 5 .   ? 5.505   -3.558  29.186 1.00 33.09 ? 666 HOH A O   1 
HETATM 2124 O O   . HOH E 5 .   ? -15.554 -13.631 12.530 1.00 33.77 ? 667 HOH A O   1 
HETATM 2125 O O   . HOH E 5 .   ? -8.463  1.600   11.956 1.00 35.82 ? 668 HOH A O   1 
HETATM 2126 O O   . HOH E 5 .   ? 4.959   10.184  30.762 1.00 34.41 ? 669 HOH A O   1 
HETATM 2127 O O   . HOH E 5 .   ? 8.299   -3.552  -0.389 1.00 38.44 ? 670 HOH A O   1 
HETATM 2128 O O   . HOH E 5 .   ? 9.507   -5.956  17.461 1.00 28.52 ? 671 HOH A O   1 
HETATM 2129 O O   . HOH E 5 .   ? 10.916  -9.541  34.539 1.00 25.86 ? 672 HOH A O   1 
HETATM 2130 O O   . HOH E 5 .   ? -9.243  -2.460  11.457 1.00 27.18 ? 673 HOH A O   1 
HETATM 2131 O O   . HOH E 5 .   ? 3.890   -20.565 29.940 1.00 41.85 ? 674 HOH A O   1 
HETATM 2132 O O   . HOH E 5 .   ? 13.204  -20.665 25.125 1.00 40.32 ? 675 HOH A O   1 
HETATM 2133 O O   . HOH E 5 .   ? 7.704   -9.174  6.256  1.00 37.51 ? 676 HOH A O   1 
HETATM 2134 O O   . HOH E 5 .   ? -8.435  -3.551  25.218 1.00 27.23 ? 677 HOH A O   1 
HETATM 2135 O O   . HOH E 5 .   ? 0.307   -21.513 10.044 1.00 32.14 ? 678 HOH A O   1 
HETATM 2136 O O   . HOH E 5 .   ? -10.090 -20.000 12.619 1.00 42.16 ? 679 HOH A O   1 
HETATM 2137 O O   . HOH E 5 .   ? 14.256  3.755   17.738 1.00 34.47 ? 680 HOH A O   1 
HETATM 2138 O O   . HOH E 5 .   ? 10.940  -7.158  15.705 1.00 38.63 ? 681 HOH A O   1 
HETATM 2139 O O   . HOH E 5 .   ? 1.652   5.405   41.402 1.00 50.95 ? 682 HOH A O   1 
HETATM 2140 O O   . HOH E 5 .   ? -7.371  16.480  26.994 1.00 42.62 ? 683 HOH A O   1 
HETATM 2141 O O   . HOH E 5 .   ? -4.225  4.832   39.935 0.50 30.46 ? 684 HOH A O   1 
HETATM 2142 O O   . HOH E 5 .   ? -14.132 4.270   24.911 1.00 44.84 ? 685 HOH A O   1 
HETATM 2143 O O   . HOH E 5 .   ? 3.334   3.372   41.100 1.00 51.08 ? 686 HOH A O   1 
HETATM 2144 O O   . HOH E 5 .   ? 12.418  -2.333  9.864  1.00 37.38 ? 687 HOH A O   1 
HETATM 2145 O O   . HOH E 5 .   ? 8.170   -23.266 10.983 1.00 50.05 ? 688 HOH A O   1 
HETATM 2146 O O   . HOH E 5 .   ? 12.805  -8.425  16.870 1.00 35.28 ? 689 HOH A O   1 
HETATM 2147 O O   . HOH E 5 .   ? -1.693  -20.534 18.720 1.00 41.87 ? 690 HOH A O   1 
HETATM 2148 O O   . HOH E 5 .   ? 6.520   -9.477  3.483  1.00 35.47 ? 691 HOH A O   1 
HETATM 2149 O O   . HOH E 5 .   ? -5.759  -13.240 27.935 1.00 44.68 ? 692 HOH A O   1 
HETATM 2150 O O   . HOH E 5 .   ? 11.655  6.215   21.804 1.00 35.81 ? 693 HOH A O   1 
HETATM 2151 O O   . HOH E 5 .   ? 2.719   -12.738 0.588  1.00 38.11 ? 694 HOH A O   1 
HETATM 2152 O O   . HOH F 5 .   ? -2.128  -2.236  1.154  1.00 38.24 ? 201 HOH L O   1 
HETATM 2153 O O   . HOH F 5 .   ? -9.575  12.870  5.621  1.00 39.59 ? 202 HOH L O   1 
HETATM 2154 O O   . HOH F 5 .   ? -5.918  12.494  -0.735 1.00 33.89 ? 203 HOH L O   1 
HETATM 2155 O O   . HOH F 5 .   ? 6.882   7.232   0.801  0.50 37.18 ? 204 HOH L O   1 
HETATM 2156 O O   . HOH F 5 .   ? -13.043 2.386   10.553 1.00 41.81 ? 205 HOH L O   1 
HETATM 2157 O O   . HOH F 5 .   ? -0.405  -0.304  -0.373 0.50 30.01 ? 206 HOH L O   1 
HETATM 2158 O O   . HOH F 5 .   ? -3.355  6.041   1.969  1.00 32.64 ? 207 HOH L O   1 
HETATM 2159 O O   . HOH F 5 .   ? 3.822   6.385   -2.963 1.00 30.31 ? 208 HOH L O   1 
HETATM 2160 O O   . HOH F 5 .   ? 3.781   11.567  -4.918 1.00 39.21 ? 209 HOH L O   1 
HETATM 2161 O O   . HOH F 5 .   ? -7.145  3.679   0.909  1.00 41.70 ? 210 HOH L O   1 
HETATM 2162 O O   . HOH F 5 .   ? -7.661  -13.777 7.230  1.00 28.54 ? 211 HOH L O   1 
HETATM 2163 O O   . HOH F 5 .   ? -2.479  8.961   7.076  1.00 39.68 ? 212 HOH L O   1 
HETATM 2164 O O   . HOH F 5 .   ? -2.545  9.873   -6.312 1.00 31.05 ? 213 HOH L O   1 
HETATM 2165 O O   . HOH F 5 .   ? -1.690  10.169  -0.211 1.00 34.47 ? 214 HOH L O   1 
HETATM 2166 O O   . HOH F 5 .   ? -5.043  4.786   0.266  1.00 39.73 ? 215 HOH L O   1 
HETATM 2167 O O   . HOH F 5 .   ? 0.433   13.976  3.454  1.00 31.87 ? 216 HOH L O   1 
HETATM 2168 O O   . HOH F 5 .   ? -7.876  2.434   -1.577 1.00 33.31 ? 217 HOH L O   1 
HETATM 2169 O O   . HOH F 5 .   ? -6.754  2.661   3.188  1.00 36.79 ? 218 HOH L O   1 
HETATM 2170 O O   . HOH F 5 .   ? 2.081   18.335  5.979  1.00 44.57 ? 219 HOH L O   1 
HETATM 2171 O O   . HOH F 5 .   ? 9.094   7.193   9.361  1.00 43.50 ? 220 HOH L O   1 
HETATM 2172 O O   . HOH F 5 .   ? 14.608  11.225  -4.110 1.00 44.66 ? 221 HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   215 ?   ?   ?   A . n 
A 1 2   PRO 2   216 ?   ?   ?   A . n 
A 1 3   ARG 3   217 217 ARG ARG A . n 
A 1 4   SER 4   218 218 SER SER A . n 
A 1 5   VAL 5   219 219 VAL VAL A . n 
A 1 6   ALA 6   220 220 ALA ALA A . n 
A 1 7   SER 7   221 221 SER SER A . n 
A 1 8   SER 8   222 222 SER SER A . n 
A 1 9   LYS 9   223 223 LYS LYS A . n 
A 1 10  LEU 10  224 224 LEU LEU A . n 
A 1 11  TRP 11  225 225 TRP TRP A . n 
A 1 12  MET 12  226 226 MET MET A . n 
A 1 13  LEU 13  227 227 LEU LEU A . n 
A 1 14  GLU 14  228 228 GLU GLU A . n 
A 1 15  PHE 15  229 229 PHE PHE A . n 
A 1 16  SER 16  230 230 SER SER A . n 
A 1 17  ALA 17  231 231 ALA ALA A . n 
A 1 18  PHE 18  232 232 PHE PHE A . n 
A 1 19  LEU 19  233 233 LEU LEU A . n 
A 1 20  GLU 20  234 234 GLU GLU A . n 
A 1 21  GLN 21  235 235 GLN GLN A . n 
A 1 22  GLN 22  236 236 GLN GLN A . n 
A 1 23  GLN 23  237 237 GLN GLN A . n 
A 1 24  ASP 24  238 238 ASP ASP A . n 
A 1 25  PRO 25  239 239 PRO PRO A . n 
A 1 26  ASP 26  240 240 ASP ASP A . n 
A 1 27  THR 27  241 241 THR THR A . n 
A 1 28  TYR 28  242 242 TYR TYR A . n 
A 1 29  ASN 29  243 243 ASN ASN A . n 
A 1 30  LYS 30  244 244 LYS LYS A . n 
A 1 31  HIS 31  245 245 HIS HIS A . n 
A 1 32  LEU 32  246 246 LEU LEU A . n 
A 1 33  PHE 33  247 247 PHE PHE A . n 
A 1 34  VAL 34  248 248 VAL VAL A . n 
A 1 35  HIS 35  249 249 HIS HIS A . n 
A 1 36  ILE 36  250 250 ILE ILE A . n 
A 1 37  GLY 37  251 251 GLY GLY A . n 
A 1 38  GLN 38  252 ?   ?   ?   A . n 
A 1 39  SER 39  253 ?   ?   ?   A . n 
A 1 40  SER 40  254 ?   ?   ?   A . n 
A 1 41  PRO 41  255 ?   ?   ?   A . n 
A 1 42  SER 42  256 ?   ?   ?   A . n 
A 1 43  TYR 43  257 ?   ?   ?   A . n 
A 1 44  SER 44  258 ?   ?   ?   A . n 
A 1 45  ASP 45  259 ?   ?   ?   A . n 
A 1 46  PRO 46  260 ?   ?   ?   A . n 
A 1 47  TYR 47  261 ?   ?   ?   A . n 
A 1 48  LEU 48  262 262 LEU LEU A . n 
A 1 49  GLU 49  263 263 GLU GLU A . n 
A 1 50  ALA 50  264 264 ALA ALA A . n 
A 1 51  VAL 51  265 265 VAL VAL A . n 
A 1 52  ASP 52  266 266 ASP ASP A . n 
A 1 53  ILE 53  267 267 ILE ILE A . n 
A 1 54  ARG 54  268 268 ARG ARG A . n 
A 1 55  GLN 55  269 269 GLN GLN A . n 
A 1 56  ILE 56  270 270 ILE ILE A . n 
A 1 57  TYR 57  271 271 TYR TYR A . n 
A 1 58  ASP 58  272 272 ASP ASP A . n 
A 1 59  LYS 59  273 273 LYS LYS A . n 
A 1 60  PHE 60  274 274 PHE PHE A . n 
A 1 61  PRO 61  275 275 PRO PRO A . n 
A 1 62  GLU 62  276 276 GLU GLU A . n 
A 1 63  LYS 63  277 277 LYS LYS A . n 
A 1 64  LYS 64  278 278 LYS LYS A . n 
A 1 65  GLY 65  279 279 GLY GLY A . n 
A 1 66  GLY 66  280 280 GLY GLY A . n 
A 1 67  LEU 67  281 281 LEU LEU A . n 
A 1 68  LYS 68  282 282 LYS LYS A . n 
A 1 69  ASP 69  283 283 ASP ASP A . n 
A 1 70  LEU 70  284 284 LEU LEU A . n 
A 1 71  PHE 71  285 285 PHE PHE A . n 
A 1 72  GLU 72  286 286 GLU GLU A . n 
A 1 73  ARG 73  287 287 ARG ARG A . n 
A 1 74  GLY 74  288 288 GLY GLY A . n 
A 1 75  PRO 75  289 289 PRO PRO A . n 
A 1 76  SER 76  290 290 SER SER A . n 
A 1 77  ASN 77  291 291 ASN ASN A . n 
A 1 78  ALA 78  292 292 ALA ALA A . n 
A 1 79  PHE 79  293 293 PHE PHE A . n 
A 1 80  PHE 80  294 294 PHE PHE A . n 
A 1 81  LEU 81  295 295 LEU LEU A . n 
A 1 82  VAL 82  296 296 VAL VAL A . n 
A 1 83  LYS 83  297 297 LYS LYS A . n 
A 1 84  PHE 84  298 298 PHE PHE A . n 
A 1 85  TRP 85  299 299 TRP TRP A . n 
A 1 86  ALA 86  300 300 ALA ALA A . n 
A 1 87  ASP 87  301 301 ASP ASP A . n 
A 1 88  LEU 88  302 302 LEU LEU A . n 
A 1 89  ASN 89  303 303 ASN ASN A . n 
A 1 90  THR 90  304 304 THR THR A . n 
A 1 91  ASN 91  305 305 ASN ASN A . n 
A 1 92  ILE 92  306 ?   ?   ?   A . n 
A 1 93  GLU 93  307 ?   ?   ?   A . n 
A 1 94  ASP 94  308 ?   ?   ?   A . n 
A 1 95  GLU 95  309 ?   ?   ?   A . n 
A 1 96  GLY 96  310 310 GLY GLY A . n 
A 1 97  SER 97  311 311 SER SER A . n 
A 1 98  SER 98  312 312 SER SER A . n 
A 1 99  PHE 99  313 313 PHE PHE A . n 
A 1 100 TYR 100 314 314 TYR TYR A . n 
A 1 101 GLY 101 315 315 GLY GLY A . n 
A 1 102 VAL 102 316 316 VAL VAL A . n 
A 1 103 SER 103 317 317 SER SER A . n 
A 1 104 SER 104 318 318 SER SER A . n 
A 1 105 GLN 105 319 319 GLN GLN A . n 
A 1 106 TYR 106 320 320 TYR TYR A . n 
A 1 107 GLU 107 321 321 GLU GLU A . n 
A 1 108 SER 108 322 322 SER SER A . n 
A 1 109 PRO 109 323 323 PRO PRO A . n 
A 1 110 GLU 110 324 324 GLU GLU A . n 
A 1 111 ASN 111 325 325 ASN ASN A . n 
A 1 112 MET 112 326 326 MET MET A . n 
A 1 113 ILE 113 327 327 ILE ILE A . n 
A 1 114 ILE 114 328 328 ILE ILE A . n 
A 1 115 THR 115 329 329 THR THR A . n 
A 1 116 CYS 116 330 330 CYS CYS A . n 
A 1 117 SER 117 331 331 SER SER A . n 
A 1 118 THR 118 332 332 THR THR A . n 
A 1 119 LYS 119 333 333 LYS LYS A . n 
A 1 120 VAL 120 334 334 VAL VAL A . n 
A 1 121 CYS 121 335 335 CYS CYS A . n 
A 1 122 SER 122 336 336 SER SER A . n 
A 1 123 PHE 123 337 337 PHE PHE A . n 
A 1 124 GLY 124 338 338 GLY GLY A . n 
A 1 125 LYS 125 339 339 LYS LYS A . n 
A 1 126 GLN 126 340 340 GLN GLN A . n 
A 1 127 VAL 127 341 341 VAL VAL A . n 
A 1 128 VAL 128 342 342 VAL VAL A . n 
A 1 129 GLU 129 343 343 GLU GLU A . n 
A 1 130 LYS 130 344 344 LYS LYS A . n 
A 1 131 VAL 131 345 345 VAL VAL A . n 
A 1 132 GLU 132 346 346 GLU GLU A . n 
A 1 133 THR 133 347 347 THR THR A . n 
A 1 134 GLU 134 348 348 GLU GLU A . n 
A 1 135 TYR 135 349 349 TYR TYR A . n 
A 1 136 ALA 136 350 350 ALA ALA A . n 
A 1 137 ARG 137 351 351 ARG ARG A . n 
A 1 138 TYR 138 352 352 TYR TYR A . n 
A 1 139 GLU 139 353 353 GLU GLU A . n 
A 1 140 ASN 140 354 354 ASN ASN A . n 
A 1 141 GLY 141 355 355 GLY GLY A . n 
A 1 142 HIS 142 356 356 HIS HIS A . n 
A 1 143 TYR 143 357 357 TYR TYR A . n 
A 1 144 SER 144 358 358 SER SER A . n 
A 1 145 TYR 145 359 359 TYR TYR A . n 
A 1 146 ARG 146 360 360 ARG ARG A . n 
A 1 147 ILE 147 361 361 ILE ILE A . n 
A 1 148 HIS 148 362 362 HIS HIS A . n 
A 1 149 ARG 149 363 363 ARG ARG A . n 
A 1 150 SER 150 364 364 SER SER A . n 
A 1 151 PRO 151 365 365 PRO PRO A . n 
A 1 152 LEU 152 366 366 LEU LEU A . n 
A 1 153 CYS 153 367 367 CYS CYS A . n 
A 1 154 GLU 154 368 368 GLU GLU A . n 
A 1 155 TYR 155 369 369 TYR TYR A . n 
A 1 156 MET 156 370 370 MET MET A . n 
A 1 157 ILE 157 371 371 ILE ILE A . n 
A 1 158 ASN 158 372 372 ASN ASN A . n 
A 1 159 PHE 159 373 373 PHE PHE A . n 
A 1 160 ILE 160 374 374 ILE ILE A . n 
A 1 161 HIS 161 375 375 HIS HIS A . n 
A 1 162 LYS 162 376 376 LYS LYS A . n 
A 1 163 LEU 163 377 377 LEU LEU A . n 
A 1 164 LYS 164 378 378 LYS LYS A . n 
A 1 165 HIS 165 379 379 HIS HIS A . n 
A 1 166 LEU 166 380 380 LEU LEU A . n 
A 1 167 PRO 167 381 381 PRO PRO A . n 
A 1 168 GLU 168 382 382 GLU GLU A . n 
A 1 169 LYS 169 383 383 LYS LYS A . n 
A 1 170 TYR 170 384 384 TYR TYR A . n 
A 1 171 MET 171 385 385 MET MET A . n 
A 1 172 MET 172 386 386 MET MET A . n 
A 1 173 ASN 173 387 387 ASN ASN A . n 
A 1 174 SER 174 388 388 SER SER A . n 
A 1 175 VAL 175 389 389 VAL VAL A . n 
A 1 176 LEU 176 390 390 LEU LEU A . n 
A 1 177 GLU 177 391 391 GLU GLU A . n 
A 1 178 ASN 178 392 392 ASN ASN A . n 
A 1 179 PHE 179 393 393 PHE PHE A . n 
A 1 180 THR 180 394 394 THR THR A . n 
A 1 181 ILE 181 395 395 ILE ILE A . n 
A 1 182 LEU 182 396 396 LEU LEU A . n 
A 1 183 GLN 183 397 397 GLN GLN A . n 
A 1 184 VAL 184 398 398 VAL VAL A . n 
A 1 185 VAL 185 399 399 VAL VAL A . n 
A 1 186 THR 186 400 400 THR THR A . n 
A 1 187 ASN 187 401 401 ASN ASN A . n 
A 1 188 ARG 188 402 402 ARG ARG A . n 
A 1 189 ASP 189 403 403 ASP ASP A . n 
A 1 190 THR 190 404 404 THR THR A . n 
A 1 191 GLN 191 405 405 GLN GLN A . n 
A 1 192 GLU 192 406 406 GLU GLU A . n 
A 1 193 THR 193 407 407 THR THR A . n 
A 1 194 LEU 194 408 408 LEU LEU A . n 
A 1 195 LEU 195 409 409 LEU LEU A . n 
A 1 196 CYS 196 410 410 CYS CYS A . n 
A 1 197 ILE 197 411 411 ILE ILE A . n 
A 1 198 ALA 198 412 412 ALA ALA A . n 
A 1 199 TYR 199 413 413 TYR TYR A . n 
A 1 200 VAL 200 414 414 VAL VAL A . n 
A 1 201 PHE 201 415 415 PHE PHE A . n 
A 1 202 GLU 202 416 416 GLU GLU A . n 
A 1 203 VAL 203 417 417 VAL VAL A . n 
A 1 204 SER 204 418 418 SER SER A . n 
A 1 205 ALA 205 419 419 ALA ALA A . n 
A 1 206 SER 206 420 420 SER SER A . n 
A 1 207 GLU 207 421 421 GLU GLU A . n 
A 1 208 HIS 208 422 422 HIS HIS A . n 
A 1 209 GLY 209 423 423 GLY GLY A . n 
A 1 210 ALA 210 424 424 ALA ALA A . n 
A 1 211 GLN 211 425 425 GLN GLN A . n 
A 1 212 HIS 212 426 426 HIS HIS A . n 
A 1 213 HIS 213 427 427 HIS HIS A . n 
A 1 214 ILE 214 428 428 ILE ILE A . n 
A 1 215 TYR 215 429 429 TYR TYR A . n 
A 1 216 ARG 216 430 430 ARG ARG A . n 
A 1 217 LEU 217 431 431 LEU LEU A . n 
A 1 218 VAL 218 432 432 VAL VAL A . n 
A 1 219 LYS 219 433 433 LYS LYS A . n 
A 1 220 GLU 220 434 434 GLU GLU A . n 
B 2 1   ASP 1   60  60  ASP ASP L . n 
B 2 2   SER 2   61  61  SER SER L . n 
B 2 3   GLU 3   62  62  GLU GLU L . n 
B 2 4   THR 4   63  63  THR THR L . n 
B 2 5   ASP 5   64  64  ASP ASP L . n 
B 2 6   LEU 6   65  65  LEU LEU L . n 
B 2 7   GLU 7   66  66  GLU GLU L . n 
B 2 8   ALA 8   67  67  ALA ALA L . n 
B 2 9   LEU 9   68  68  LEU LEU L . n 
B 2 10  PHE 10  69  69  PHE PHE L . n 
B 2 11  ASN 11  70  70  ASN ASN L . n 
B 2 12  ALA 12  71  71  ALA ALA L . n 
B 2 13  VAL 13  72  72  VAL VAL L . n 
B 2 14  MET 14  73  73  MET MET L . n 
B 2 15  ASN 15  74  74  ASN ASN L . n 
B 2 16  PRO 16  75  75  PRO PRO L . n 
B 2 17  LYS 17  76  76  LYS LYS L . n 
B 2 18  THR 18  77  77  THR THR L . n 
B 2 19  ALA 19  78  78  ALA ALA L . n 
B 2 20  ASN 20  79  79  ASN ASN L . n 
B 2 21  VAL 21  80  80  VAL VAL L . n 
B 2 22  PRO 22  81  81  PRO PRO L . n 
B 2 23  GLN 23  82  82  GLN GLN L . n 
B 2 24  THR 24  83  83  THR THR L . n 
B 2 25  VAL 25  84  84  VAL VAL L . n 
B 2 26  PRO 26  85  85  PRO PRO L . n 
B 2 27  MET 27  86  86  MET MET L . n 
B 2 28  ARG 28  87  87  ARG ARG L . n 
B 2 29  LEU 29  88  88  LEU LEU L . n 
B 2 30  ARG 30  89  89  ARG ARG L . n 
B 2 31  LYS 31  90  90  LYS LYS L . n 
B 2 32  LEU 32  91  91  LEU LEU L . n 
B 2 33  PRO 33  92  92  PRO PRO L . n 
B 2 34  ASP 34  93  93  ASP ASP L . n 
B 2 35  SER 35  94  94  SER SER L . n 
B 2 36  PHE 36  95  95  PHE PHE L . n 
B 2 37  PHE 37  96  96  PHE PHE L . n 
B 2 38  LYS 38  97  97  LYS LYS L . n 
B 2 39  PRO 39  98  98  PRO PRO L . n 
B 2 40  PRO 40  99  99  PRO PRO L . n 
B 2 41  GLU 41  100 ?   ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GOL 1  501 1   GOL GOL A . 
D 4 MYR 1  502 1   MYR LI1 A . 
E 5 HOH 1  601 47  HOH HOH A . 
E 5 HOH 2  602 104 HOH HOH A . 
E 5 HOH 3  603 67  HOH HOH A . 
E 5 HOH 4  604 97  HOH HOH A . 
E 5 HOH 5  605 22  HOH HOH A . 
E 5 HOH 6  606 51  HOH HOH A . 
E 5 HOH 7  607 62  HOH HOH A . 
E 5 HOH 8  608 9   HOH HOH A . 
E 5 HOH 9  609 15  HOH HOH A . 
E 5 HOH 10 610 34  HOH HOH A . 
E 5 HOH 11 611 3   HOH HOH A . 
E 5 HOH 12 612 12  HOH HOH A . 
E 5 HOH 13 613 10  HOH HOH A . 
E 5 HOH 14 614 79  HOH HOH A . 
E 5 HOH 15 615 106 HOH HOH A . 
E 5 HOH 16 616 24  HOH HOH A . 
E 5 HOH 17 617 72  HOH HOH A . 
E 5 HOH 18 618 80  HOH HOH A . 
E 5 HOH 19 619 78  HOH HOH A . 
E 5 HOH 20 620 105 HOH HOH A . 
E 5 HOH 21 621 81  HOH HOH A . 
E 5 HOH 22 622 68  HOH HOH A . 
E 5 HOH 23 623 6   HOH HOH A . 
E 5 HOH 24 624 111 HOH HOH A . 
E 5 HOH 25 625 71  HOH HOH A . 
E 5 HOH 26 626 21  HOH HOH A . 
E 5 HOH 27 627 103 HOH HOH A . 
E 5 HOH 28 628 63  HOH HOH A . 
E 5 HOH 29 629 101 HOH HOH A . 
E 5 HOH 30 630 4   HOH HOH A . 
E 5 HOH 31 631 85  HOH HOH A . 
E 5 HOH 32 632 46  HOH HOH A . 
E 5 HOH 33 633 16  HOH HOH A . 
E 5 HOH 34 634 8   HOH HOH A . 
E 5 HOH 35 635 20  HOH HOH A . 
E 5 HOH 36 636 56  HOH HOH A . 
E 5 HOH 37 637 40  HOH HOH A . 
E 5 HOH 38 638 33  HOH HOH A . 
E 5 HOH 39 639 42  HOH HOH A . 
E 5 HOH 40 640 1   HOH HOH A . 
E 5 HOH 41 641 7   HOH HOH A . 
E 5 HOH 42 642 89  HOH HOH A . 
E 5 HOH 43 643 13  HOH HOH A . 
E 5 HOH 44 644 96  HOH HOH A . 
E 5 HOH 45 645 113 HOH HOH A . 
E 5 HOH 46 646 60  HOH HOH A . 
E 5 HOH 47 647 45  HOH HOH A . 
E 5 HOH 48 648 28  HOH HOH A . 
E 5 HOH 49 649 95  HOH HOH A . 
E 5 HOH 50 650 11  HOH HOH A . 
E 5 HOH 51 651 5   HOH HOH A . 
E 5 HOH 52 652 25  HOH HOH A . 
E 5 HOH 53 653 87  HOH HOH A . 
E 5 HOH 54 654 29  HOH HOH A . 
E 5 HOH 55 655 90  HOH HOH A . 
E 5 HOH 56 656 69  HOH HOH A . 
E 5 HOH 57 657 43  HOH HOH A . 
E 5 HOH 58 658 50  HOH HOH A . 
E 5 HOH 59 659 53  HOH HOH A . 
E 5 HOH 60 660 27  HOH HOH A . 
E 5 HOH 61 661 55  HOH HOH A . 
E 5 HOH 62 662 65  HOH HOH A . 
E 5 HOH 63 663 102 HOH HOH A . 
E 5 HOH 64 664 2   HOH HOH A . 
E 5 HOH 65 665 19  HOH HOH A . 
E 5 HOH 66 666 49  HOH HOH A . 
E 5 HOH 67 667 44  HOH HOH A . 
E 5 HOH 68 668 57  HOH HOH A . 
E 5 HOH 69 669 39  HOH HOH A . 
E 5 HOH 70 670 73  HOH HOH A . 
E 5 HOH 71 671 23  HOH HOH A . 
E 5 HOH 72 672 14  HOH HOH A . 
E 5 HOH 73 673 18  HOH HOH A . 
E 5 HOH 74 674 110 HOH HOH A . 
E 5 HOH 75 675 91  HOH HOH A . 
E 5 HOH 76 676 58  HOH HOH A . 
E 5 HOH 77 677 17  HOH HOH A . 
E 5 HOH 78 678 36  HOH HOH A . 
E 5 HOH 79 679 93  HOH HOH A . 
E 5 HOH 80 680 54  HOH HOH A . 
E 5 HOH 81 681 77  HOH HOH A . 
E 5 HOH 82 682 115 HOH HOH A . 
E 5 HOH 83 683 107 HOH HOH A . 
E 5 HOH 84 684 38  HOH HOH A . 
E 5 HOH 85 685 92  HOH HOH A . 
E 5 HOH 86 686 112 HOH HOH A . 
E 5 HOH 87 687 74  HOH HOH A . 
E 5 HOH 88 688 114 HOH HOH A . 
E 5 HOH 89 689 75  HOH HOH A . 
E 5 HOH 90 690 100 HOH HOH A . 
E 5 HOH 91 691 59  HOH HOH A . 
E 5 HOH 92 692 98  HOH HOH A . 
E 5 HOH 93 693 61  HOH HOH A . 
E 5 HOH 94 694 64  HOH HOH A . 
F 5 HOH 1  201 70  HOH HOH L . 
F 5 HOH 2  202 84  HOH HOH L . 
F 5 HOH 3  203 52  HOH HOH L . 
F 5 HOH 4  204 83  HOH HOH L . 
F 5 HOH 5  205 88  HOH HOH L . 
F 5 HOH 6  206 31  HOH HOH L . 
F 5 HOH 7  207 37  HOH HOH L . 
F 5 HOH 8  208 30  HOH HOH L . 
F 5 HOH 9  209 76  HOH HOH L . 
F 5 HOH 10 210 94  HOH HOH L . 
F 5 HOH 11 211 26  HOH HOH L . 
F 5 HOH 12 212 86  HOH HOH L . 
F 5 HOH 13 213 32  HOH HOH L . 
F 5 HOH 14 214 48  HOH HOH L . 
F 5 HOH 15 215 82  HOH HOH L . 
F 5 HOH 16 216 35  HOH HOH L . 
F 5 HOH 17 217 41  HOH HOH L . 
F 5 HOH 18 218 66  HOH HOH L . 
F 5 HOH 19 219 99  HOH HOH L . 
F 5 HOH 20 220 109 HOH HOH L . 
F 5 HOH 21 221 108 HOH HOH L . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3470  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  12480 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-10-11 
2 'Structure model' 1 1 2017-11-29 
3 'Structure model' 1 2 2018-10-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation     
2 3 'Structure model' reflns       
3 3 'Structure model' reflns_shell 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
4 3 'Structure model' '_reflns.pdbx_CC_half'     
5 3 'Structure model' '_reflns.pdbx_Rpim_I_all'  
6 3 'Structure model' '_reflns_shell.d_res_high' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .    1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .    5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    403 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    601 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 277 ? ? 69.00   -177.71 
2 1 ASN L 79  ? ? -143.32 49.22   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 215 ? A GLY 1  
2  1 Y 1 A PRO 216 ? A PRO 2  
3  1 Y 1 A GLN 252 ? A GLN 38 
4  1 Y 1 A SER 253 ? A SER 39 
5  1 Y 1 A SER 254 ? A SER 40 
6  1 Y 1 A PRO 255 ? A PRO 41 
7  1 Y 1 A SER 256 ? A SER 42 
8  1 Y 1 A TYR 257 ? A TYR 43 
9  1 Y 1 A SER 258 ? A SER 44 
10 1 Y 1 A ASP 259 ? A ASP 45 
11 1 Y 1 A PRO 260 ? A PRO 46 
12 1 Y 1 A TYR 261 ? A TYR 47 
13 1 Y 1 A ILE 306 ? A ILE 92 
14 1 Y 1 A GLU 307 ? A GLU 93 
15 1 Y 1 A ASP 308 ? A ASP 94 
16 1 Y 1 A GLU 309 ? A GLU 95 
17 1 Y 1 L GLU 100 ? B GLU 41 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 GLYCEROL        GOL 
4 'MYRISTIC ACID' MYR 
5 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#