data_5OC9
# 
_entry.id   5OC9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5OC9         
WWPDB D_1200005562 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5OC9 
_pdbx_database_status.recvd_initial_deposition_date   2017-06-29 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bushell, S.R.'                        1  ?                   
'Pike, A.C.W.'                         2  0000-0001-9661-2607 
'Chu, A.'                              3  ?                   
'Tessitore, A.'                        4  ?                   
'Rotty, B.'                            5  ?                   
'Mukhopadhyay, S.'                     6  ?                   
'Kupinska, K.'                         7  ?                   
'Shrestha, L.'                         8  ?                   
'Borkowska, O.'                        9  ?                   
'Chalk, R.'                            10 ?                   
'Burgess-Brown, N.A.'                  11 ?                   
'Love, J.'                             12 ?                   
'Edwards, A.M.'                        13 ?                   
'Arrowsmith, C.H.'                     14 ?                   
'Bountra, C.'                          15 ?                   
'Carpenter, E.P.'                      16 0000-0001-9138-2937 
'Structural Genomics Consortium (SGC)' 17 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                3956 
_citation.page_last                 3956 
_citation.title                     
'The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-11753-1 
_citation.pdbx_database_id_PubMed   31477691 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bushell, S.R.'        1  0000-0001-5477-6777 
primary 'Pike, A.C.W.'         2  0000-0001-9661-2607 
primary 'Falzone, M.E.'        3  ?                   
primary 'Rorsman, N.J.G.'      4  ?                   
primary 'Ta, C.M.'             5  ?                   
primary 'Corey, R.A.'          6  ?                   
primary 'Newport, T.D.'        7  ?                   
primary 'Christianson, J.C.'   8  0000-0002-0474-1207 
primary 'Scofano, L.F.'        9  0000-0002-5670-7983 
primary 'Shintre, C.A.'        10 0000-0001-7225-7970 
primary 'Tessitore, A.'        11 ?                   
primary 'Chu, A.'              12 ?                   
primary 'Wang, Q.'             13 ?                   
primary 'Shrestha, L.'         14 ?                   
primary 'Mukhopadhyay, S.M.M.' 15 0000-0003-1430-5529 
primary 'Love, J.D.'           16 ?                   
primary 'Burgess-Brown, N.A.'  17 ?                   
primary 'Sitsapesan, R.'       18 ?                   
primary 'Stansfeld, P.J.'      19 0000-0001-8800-7669 
primary 'Huiskonen, J.T.'      20 0000-0002-0348-7323 
primary 'Tammaro, P.'          21 ?                   
primary 'Accardi, A.'          22 0000-0002-6584-0102 
primary 'Carpenter, E.P.'      23 0000-0001-9138-2937 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5OC9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     59.150 
_cell.length_a_esd                 ? 
_cell.length_b                     153.590 
_cell.length_b_esd                 ? 
_cell.length_c                     218.780 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5OC9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Anoctamin-10                                     77276.016 2  ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                                    40.078    7  ? ? ? ? 
3 non-polymer syn '(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate' 328.487   18 ? ? ? ? 
4 water       nat water                                            18.015    56 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Transmembrane protein 16K' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKATAENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKATAENLYFQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   THR n 
1 5   LEU n 
1 6   SER n 
1 7   ALA n 
1 8   LEU n 
1 9   ASP n 
1 10  THR n 
1 11  SER n 
1 12  GLU n 
1 13  SER n 
1 14  SER n 
1 15  PHE n 
1 16  THR n 
1 17  PRO n 
1 18  LEU n 
1 19  VAL n 
1 20  VAL n 
1 21  ILE n 
1 22  GLU n 
1 23  LEU n 
1 24  ALA n 
1 25  GLN n 
1 26  ASP n 
1 27  VAL n 
1 28  LYS n 
1 29  GLU n 
1 30  GLU n 
1 31  THR n 
1 32  LYS n 
1 33  GLU n 
1 34  TRP n 
1 35  LEU n 
1 36  LYS n 
1 37  ASN n 
1 38  ARG n 
1 39  ILE n 
1 40  ILE n 
1 41  ALA n 
1 42  LYS n 
1 43  LYS n 
1 44  LYS n 
1 45  ASP n 
1 46  GLY n 
1 47  GLY n 
1 48  ALA n 
1 49  GLN n 
1 50  LEU n 
1 51  LEU n 
1 52  PHE n 
1 53  ARG n 
1 54  PRO n 
1 55  LEU n 
1 56  LEU n 
1 57  ASN n 
1 58  LYS n 
1 59  TYR n 
1 60  GLU n 
1 61  GLN n 
1 62  GLU n 
1 63  THR n 
1 64  LEU n 
1 65  GLU n 
1 66  ASN n 
1 67  GLN n 
1 68  ASN n 
1 69  LEU n 
1 70  TYR n 
1 71  LEU n 
1 72  VAL n 
1 73  GLY n 
1 74  ALA n 
1 75  SER n 
1 76  LYS n 
1 77  ILE n 
1 78  ARG n 
1 79  MET n 
1 80  LEU n 
1 81  LEU n 
1 82  GLY n 
1 83  ALA n 
1 84  GLU n 
1 85  ALA n 
1 86  VAL n 
1 87  GLY n 
1 88  LEU n 
1 89  VAL n 
1 90  LYS n 
1 91  GLU n 
1 92  CYS n 
1 93  ASN n 
1 94  ASP n 
1 95  ASN n 
1 96  THR n 
1 97  MET n 
1 98  ARG n 
1 99  ALA n 
1 100 PHE n 
1 101 THR n 
1 102 TYR n 
1 103 ARG n 
1 104 THR n 
1 105 ARG n 
1 106 GLN n 
1 107 ASN n 
1 108 PHE n 
1 109 LYS n 
1 110 GLY n 
1 111 PHE n 
1 112 ASP n 
1 113 ASP n 
1 114 ASN n 
1 115 ASN n 
1 116 ASP n 
1 117 ASP n 
1 118 PHE n 
1 119 LEU n 
1 120 THR n 
1 121 MET n 
1 122 ALA n 
1 123 GLU n 
1 124 CYS n 
1 125 GLN n 
1 126 PHE n 
1 127 ILE n 
1 128 ILE n 
1 129 LYS n 
1 130 HIS n 
1 131 GLU n 
1 132 LEU n 
1 133 GLU n 
1 134 ASN n 
1 135 LEU n 
1 136 ARG n 
1 137 ALA n 
1 138 LYS n 
1 139 ASP n 
1 140 GLU n 
1 141 LYS n 
1 142 MET n 
1 143 ILE n 
1 144 PRO n 
1 145 GLY n 
1 146 TYR n 
1 147 PRO n 
1 148 GLN n 
1 149 ALA n 
1 150 LYS n 
1 151 LEU n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 LYS n 
1 156 SER n 
1 157 LEU n 
1 158 LEU n 
1 159 ARG n 
1 160 ARG n 
1 161 LEU n 
1 162 LEU n 
1 163 THR n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 ILE n 
1 169 GLN n 
1 170 VAL n 
1 171 PHE n 
1 172 PRO n 
1 173 LEU n 
1 174 HIS n 
1 175 ASP n 
1 176 SER n 
1 177 GLU n 
1 178 ALA n 
1 179 LEU n 
1 180 LYS n 
1 181 LYS n 
1 182 LEU n 
1 183 GLU n 
1 184 ASP n 
1 185 THR n 
1 186 TRP n 
1 187 TYR n 
1 188 THR n 
1 189 ARG n 
1 190 PHE n 
1 191 ALA n 
1 192 LEU n 
1 193 LYS n 
1 194 TYR n 
1 195 GLN n 
1 196 PRO n 
1 197 ILE n 
1 198 ASP n 
1 199 SER n 
1 200 ILE n 
1 201 ARG n 
1 202 GLY n 
1 203 TYR n 
1 204 PHE n 
1 205 GLY n 
1 206 GLU n 
1 207 THR n 
1 208 ILE n 
1 209 ALA n 
1 210 LEU n 
1 211 TYR n 
1 212 PHE n 
1 213 GLY n 
1 214 PHE n 
1 215 LEU n 
1 216 GLU n 
1 217 TYR n 
1 218 PHE n 
1 219 THR n 
1 220 PHE n 
1 221 ALA n 
1 222 LEU n 
1 223 ILE n 
1 224 PRO n 
1 225 MET n 
1 226 ALA n 
1 227 VAL n 
1 228 ILE n 
1 229 GLY n 
1 230 LEU n 
1 231 PRO n 
1 232 TYR n 
1 233 TYR n 
1 234 LEU n 
1 235 PHE n 
1 236 VAL n 
1 237 TRP n 
1 238 GLU n 
1 239 ASP n 
1 240 TYR n 
1 241 ASP n 
1 242 LYS n 
1 243 TYR n 
1 244 VAL n 
1 245 ILE n 
1 246 PHE n 
1 247 ALA n 
1 248 SER n 
1 249 PHE n 
1 250 ASN n 
1 251 LEU n 
1 252 ILE n 
1 253 TRP n 
1 254 SER n 
1 255 THR n 
1 256 VAL n 
1 257 ILE n 
1 258 LEU n 
1 259 GLU n 
1 260 LEU n 
1 261 TRP n 
1 262 LYS n 
1 263 ARG n 
1 264 GLY n 
1 265 CYS n 
1 266 ALA n 
1 267 ASN n 
1 268 MET n 
1 269 THR n 
1 270 TYR n 
1 271 ARG n 
1 272 TRP n 
1 273 GLY n 
1 274 THR n 
1 275 LEU n 
1 276 LEU n 
1 277 MET n 
1 278 LYS n 
1 279 ARG n 
1 280 LYS n 
1 281 PHE n 
1 282 GLU n 
1 283 GLU n 
1 284 PRO n 
1 285 ARG n 
1 286 PRO n 
1 287 GLY n 
1 288 PHE n 
1 289 HIS n 
1 290 GLY n 
1 291 VAL n 
1 292 LEU n 
1 293 GLY n 
1 294 ILE n 
1 295 ASN n 
1 296 SER n 
1 297 ILE n 
1 298 THR n 
1 299 GLY n 
1 300 LYS n 
1 301 GLU n 
1 302 GLU n 
1 303 PRO n 
1 304 LEU n 
1 305 TYR n 
1 306 PRO n 
1 307 SER n 
1 308 TYR n 
1 309 LYS n 
1 310 ARG n 
1 311 GLN n 
1 312 LEU n 
1 313 ARG n 
1 314 ILE n 
1 315 TYR n 
1 316 LEU n 
1 317 VAL n 
1 318 SER n 
1 319 LEU n 
1 320 PRO n 
1 321 PHE n 
1 322 VAL n 
1 323 CYS n 
1 324 LEU n 
1 325 CYS n 
1 326 LEU n 
1 327 TYR n 
1 328 PHE n 
1 329 SER n 
1 330 LEU n 
1 331 TYR n 
1 332 VAL n 
1 333 MET n 
1 334 MET n 
1 335 ILE n 
1 336 TYR n 
1 337 PHE n 
1 338 ASP n 
1 339 MET n 
1 340 GLU n 
1 341 VAL n 
1 342 TRP n 
1 343 ALA n 
1 344 LEU n 
1 345 GLY n 
1 346 LEU n 
1 347 HIS n 
1 348 GLU n 
1 349 ASN n 
1 350 SER n 
1 351 GLY n 
1 352 SER n 
1 353 GLU n 
1 354 TRP n 
1 355 THR n 
1 356 SER n 
1 357 VAL n 
1 358 LEU n 
1 359 LEU n 
1 360 TYR n 
1 361 VAL n 
1 362 PRO n 
1 363 SER n 
1 364 ILE n 
1 365 ILE n 
1 366 TYR n 
1 367 ALA n 
1 368 ILE n 
1 369 VAL n 
1 370 ILE n 
1 371 GLU n 
1 372 ILE n 
1 373 MET n 
1 374 ASN n 
1 375 ARG n 
1 376 LEU n 
1 377 TYR n 
1 378 ARG n 
1 379 TYR n 
1 380 ALA n 
1 381 ALA n 
1 382 GLU n 
1 383 PHE n 
1 384 LEU n 
1 385 THR n 
1 386 SER n 
1 387 TRP n 
1 388 GLU n 
1 389 ASN n 
1 390 HIS n 
1 391 ARG n 
1 392 LEU n 
1 393 GLU n 
1 394 SER n 
1 395 ALA n 
1 396 TYR n 
1 397 GLN n 
1 398 ASN n 
1 399 HIS n 
1 400 LEU n 
1 401 ILE n 
1 402 LEU n 
1 403 LYS n 
1 404 VAL n 
1 405 LEU n 
1 406 VAL n 
1 407 PHE n 
1 408 ASN n 
1 409 PHE n 
1 410 LEU n 
1 411 ASN n 
1 412 CYS n 
1 413 PHE n 
1 414 ALA n 
1 415 SER n 
1 416 LEU n 
1 417 PHE n 
1 418 TYR n 
1 419 ILE n 
1 420 ALA n 
1 421 PHE n 
1 422 VAL n 
1 423 LEU n 
1 424 LYS n 
1 425 ASP n 
1 426 MET n 
1 427 LYS n 
1 428 LEU n 
1 429 LEU n 
1 430 ARG n 
1 431 GLN n 
1 432 SER n 
1 433 LEU n 
1 434 ALA n 
1 435 THR n 
1 436 LEU n 
1 437 LEU n 
1 438 ILE n 
1 439 THR n 
1 440 SER n 
1 441 GLN n 
1 442 ILE n 
1 443 LEU n 
1 444 ASN n 
1 445 GLN n 
1 446 ILE n 
1 447 MET n 
1 448 GLU n 
1 449 SER n 
1 450 PHE n 
1 451 LEU n 
1 452 PRO n 
1 453 TYR n 
1 454 TRP n 
1 455 LEU n 
1 456 GLN n 
1 457 ARG n 
1 458 LYS n 
1 459 HIS n 
1 460 GLY n 
1 461 VAL n 
1 462 ARG n 
1 463 VAL n 
1 464 LYS n 
1 465 ARG n 
1 466 LYS n 
1 467 VAL n 
1 468 GLN n 
1 469 ALA n 
1 470 LEU n 
1 471 LYS n 
1 472 ALA n 
1 473 ASP n 
1 474 ILE n 
1 475 ASP n 
1 476 ALA n 
1 477 THR n 
1 478 LEU n 
1 479 TYR n 
1 480 GLU n 
1 481 GLN n 
1 482 VAL n 
1 483 ILE n 
1 484 LEU n 
1 485 GLU n 
1 486 LYS n 
1 487 GLU n 
1 488 MET n 
1 489 GLY n 
1 490 THR n 
1 491 TYR n 
1 492 LEU n 
1 493 GLY n 
1 494 THR n 
1 495 PHE n 
1 496 ASP n 
1 497 ASP n 
1 498 TYR n 
1 499 LEU n 
1 500 GLU n 
1 501 LEU n 
1 502 PHE n 
1 503 LEU n 
1 504 GLN n 
1 505 PHE n 
1 506 GLY n 
1 507 TYR n 
1 508 VAL n 
1 509 SER n 
1 510 LEU n 
1 511 PHE n 
1 512 SER n 
1 513 CYS n 
1 514 VAL n 
1 515 TYR n 
1 516 PRO n 
1 517 LEU n 
1 518 ALA n 
1 519 ALA n 
1 520 ALA n 
1 521 PHE n 
1 522 ALA n 
1 523 VAL n 
1 524 LEU n 
1 525 ASN n 
1 526 ASN n 
1 527 PHE n 
1 528 THR n 
1 529 GLU n 
1 530 VAL n 
1 531 ASN n 
1 532 SER n 
1 533 ASP n 
1 534 ALA n 
1 535 LEU n 
1 536 LYS n 
1 537 MET n 
1 538 CYS n 
1 539 ARG n 
1 540 VAL n 
1 541 PHE n 
1 542 LYS n 
1 543 ARG n 
1 544 PRO n 
1 545 PHE n 
1 546 SER n 
1 547 GLU n 
1 548 PRO n 
1 549 SER n 
1 550 ALA n 
1 551 ASN n 
1 552 ILE n 
1 553 GLY n 
1 554 VAL n 
1 555 TRP n 
1 556 GLN n 
1 557 LEU n 
1 558 ALA n 
1 559 PHE n 
1 560 GLU n 
1 561 THR n 
1 562 MET n 
1 563 SER n 
1 564 VAL n 
1 565 ILE n 
1 566 SER n 
1 567 VAL n 
1 568 VAL n 
1 569 THR n 
1 570 ASN n 
1 571 CYS n 
1 572 ALA n 
1 573 LEU n 
1 574 ILE n 
1 575 GLY n 
1 576 MET n 
1 577 SER n 
1 578 PRO n 
1 579 GLN n 
1 580 VAL n 
1 581 ASN n 
1 582 ALA n 
1 583 VAL n 
1 584 PHE n 
1 585 PRO n 
1 586 GLU n 
1 587 SER n 
1 588 LYS n 
1 589 ALA n 
1 590 ASP n 
1 591 LEU n 
1 592 ILE n 
1 593 LEU n 
1 594 ILE n 
1 595 VAL n 
1 596 VAL n 
1 597 ALA n 
1 598 VAL n 
1 599 GLU n 
1 600 HIS n 
1 601 ALA n 
1 602 LEU n 
1 603 LEU n 
1 604 ALA n 
1 605 LEU n 
1 606 LYS n 
1 607 PHE n 
1 608 ILE n 
1 609 LEU n 
1 610 ALA n 
1 611 PHE n 
1 612 ALA n 
1 613 ILE n 
1 614 PRO n 
1 615 ASP n 
1 616 LYS n 
1 617 PRO n 
1 618 ARG n 
1 619 HIS n 
1 620 ILE n 
1 621 GLN n 
1 622 MET n 
1 623 LYS n 
1 624 LEU n 
1 625 ALA n 
1 626 ARG n 
1 627 LEU n 
1 628 GLU n 
1 629 PHE n 
1 630 GLU n 
1 631 SER n 
1 632 LEU n 
1 633 GLU n 
1 634 ALA n 
1 635 LEU n 
1 636 LYS n 
1 637 GLN n 
1 638 GLN n 
1 639 GLN n 
1 640 MET n 
1 641 LYS n 
1 642 LEU n 
1 643 VAL n 
1 644 THR n 
1 645 GLU n 
1 646 ASN n 
1 647 LEU n 
1 648 LYS n 
1 649 GLU n 
1 650 GLU n 
1 651 PRO n 
1 652 MET n 
1 653 GLU n 
1 654 SER n 
1 655 GLY n 
1 656 LYS n 
1 657 GLU n 
1 658 LYS n 
1 659 ALA n 
1 660 THR n 
1 661 ALA n 
1 662 GLU n 
1 663 ASN n 
1 664 LEU n 
1 665 TYR n 
1 666 PHE n 
1 667 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   667 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ANO10, TMEM16K' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFB-CT10HF-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANO10_HUMAN 
_struct_ref.pdbx_db_accession          Q9NW15 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKAT
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5OC9 A 1 ? 660 ? Q9NW15 1 ? 660 ? 1 660 
2 1 5OC9 B 1 ? 660 ? Q9NW15 1 ? 660 ? 1 660 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5OC9 ALA A 661 ? UNP Q9NW15 ? ? 'expression tag' 661 1  
1 5OC9 GLU A 662 ? UNP Q9NW15 ? ? 'expression tag' 662 2  
1 5OC9 ASN A 663 ? UNP Q9NW15 ? ? 'expression tag' 663 3  
1 5OC9 LEU A 664 ? UNP Q9NW15 ? ? 'expression tag' 664 4  
1 5OC9 TYR A 665 ? UNP Q9NW15 ? ? 'expression tag' 665 5  
1 5OC9 PHE A 666 ? UNP Q9NW15 ? ? 'expression tag' 666 6  
1 5OC9 GLN A 667 ? UNP Q9NW15 ? ? 'expression tag' 667 7  
2 5OC9 ALA B 661 ? UNP Q9NW15 ? ? 'expression tag' 661 8  
2 5OC9 GLU B 662 ? UNP Q9NW15 ? ? 'expression tag' 662 9  
2 5OC9 ASN B 663 ? UNP Q9NW15 ? ? 'expression tag' 663 10 
2 5OC9 LEU B 664 ? UNP Q9NW15 ? ? 'expression tag' 664 11 
2 5OC9 TYR B 665 ? UNP Q9NW15 ? ? 'expression tag' 665 12 
2 5OC9 PHE B 666 ? UNP Q9NW15 ? ? 'expression tag' 666 13 
2 5OC9 GLN B 667 ? UNP Q9NW15 ? ? 'expression tag' 667 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
79M non-polymer         . '(2R)-2,3-dihydroxypropyl (7Z)-hexadec-7-enoate' '[(2R)-2,3-bis(oxidanyl)propyl] (Z)-hexadec-7-enoate' 
'C19 H36 O4'     328.487 
ALA 'L-peptide linking' y ALANINE                                          ?                                                     
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                         ?                                                     
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                       ?                                                     
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                  ?                                                     
'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                                    ?                                                     
'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                         ?                                                     
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                        ?                                                     
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                  ?                                                     
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                          ?                                                     
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                        ?                                                     
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                            ?                                                     
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                       ?                                                     
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                          ?                                                     
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                           ?                                                     
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                       ?                                                     
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                    ?                                                     
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                          ?                                                     
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                           ?                                                     
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                        ?                                                     
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                       ?                                                     
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                         ?                                                     
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                           ?                                                     
'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5OC9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.81 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M MES pH 6.0 -- 0.1M sodium chloride -- 0.1M calcium chloride -- 30% PEG300' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-07-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9686 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9686 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            43.191 
_reflns.entry_id                         5OC9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.2 
_reflns.d_resolution_low                 76.79 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33892 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.1 
_reflns.pdbx_Rmerge_I_obs                0.285 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.139 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.99 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.2 
_reflns_shell.d_res_low                   3.28 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2488 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.265 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.61 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.535 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -16.5833 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            5.8188 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            10.7645 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               57.98 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.8549 
_refine.correlation_coeff_Fo_to_Fc_free          0.8550 
_refine.details                                  'Refined with BUSTER with single TLS group per chain' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5OC9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.20 
_refine.ls_d_res_low                             76.79 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33824 
_refine.ls_number_reflns_R_free                  1699 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2292 
_refine.ls_R_factor_R_free                       0.2452 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2283 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4WIS 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.420 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5OC9 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.485 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        9806 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         276 
_refine_hist.number_atoms_solvent             56 
_refine_hist.number_atoms_total               10138 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        76.79 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008 ? 10295 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 0.87  ? 13881 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 4785  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 199   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1469  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 10295 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1     ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 1.94  ? ?     ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 3.05  ? ?     ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1311  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?     ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 12150 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.20 
_refine_ls_shell.d_res_low                        3.30 
_refine_ls_shell.number_reflns_all                2902 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             138 
_refine_ls_shell.number_reflns_R_work             2764 
_refine_ls_shell.percent_reflns_obs               99.90 
_refine_ls_shell.percent_reflns_R_free            4.76 
_refine_ls_shell.R_factor_all                     0.2500 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3086 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2470 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   17 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5OC9 
_struct.title                        'Crystal Structure of human TMEM16K / Anoctamin 10' 
_struct.pdbx_descriptor              Anoctamin-10 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5OC9 
_struct_keywords.text            
'MEMBRANE PROTEIN, CALCIUM ACTIVATION, TRANSPORT PROTEIN, LIPID TRANSPORT, Structural Genomics, Structural Genomics Consortium, SGC' 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 28  ? ALA A 41  ? LYS A 28  ALA A 41  1 ? 14 
HELX_P HELX_P2  AA2 LYS A 42  ? GLY A 46  ? LYS A 42  GLY A 46  5 ? 5  
HELX_P HELX_P3  AA3 SER A 75  ? GLY A 87  ? SER A 75  GLY A 87  1 ? 13 
HELX_P HELX_P4  AA4 THR A 104 ? PHE A 108 ? THR A 104 PHE A 108 5 ? 5  
HELX_P HELX_P5  AA5 THR A 120 ? ASN A 134 ? THR A 120 ASN A 134 1 ? 15 
HELX_P HELX_P6  AA6 SER A 156 ? SER A 164 ? SER A 156 SER A 164 1 ? 9  
HELX_P HELX_P7  AA7 ASP A 175 ? TYR A 187 ? ASP A 175 TYR A 187 1 ? 13 
HELX_P HELX_P8  AA8 PRO A 196 ? GLY A 205 ? PRO A 196 GLY A 205 1 ? 10 
HELX_P HELX_P9  AA9 GLY A 205 ? PHE A 235 ? GLY A 205 PHE A 235 1 ? 31 
HELX_P HELX_P10 AB1 ASP A 239 ? GLY A 273 ? ASP A 239 GLY A 273 1 ? 35 
HELX_P HELX_P11 AB2 LYS A 278 ? GLU A 282 ? LYS A 278 GLU A 282 5 ? 5  
HELX_P HELX_P12 AB3 PRO A 306 ? VAL A 317 ? PRO A 306 VAL A 317 1 ? 12 
HELX_P HELX_P13 AB4 VAL A 317 ? ASN A 349 ? VAL A 317 ASN A 349 1 ? 33 
HELX_P HELX_P14 AB5 TRP A 354 ? LEU A 359 ? TRP A 354 LEU A 359 1 ? 6  
HELX_P HELX_P15 AB6 TYR A 360 ? GLU A 388 ? TYR A 360 GLU A 388 1 ? 29 
HELX_P HELX_P16 AB7 LEU A 392 ? VAL A 422 ? LEU A 392 VAL A 422 1 ? 31 
HELX_P HELX_P17 AB8 ASP A 425 ? ILE A 438 ? ASP A 425 ILE A 438 1 ? 14 
HELX_P HELX_P18 AB9 ILE A 438 ? SER A 449 ? ILE A 438 SER A 449 1 ? 12 
HELX_P HELX_P19 AC1 SER A 449 ? ALA A 469 ? SER A 449 ALA A 469 1 ? 21 
HELX_P HELX_P20 AC2 ALA A 476 ? MET A 488 ? ALA A 476 MET A 488 1 ? 13 
HELX_P HELX_P21 AC3 THR A 494 ? SER A 512 ? THR A 494 SER A 512 1 ? 19 
HELX_P HELX_P22 AC4 LEU A 517 ? VAL A 540 ? LEU A 517 VAL A 540 1 ? 24 
HELX_P HELX_P23 AC5 VAL A 554 ? SER A 577 ? VAL A 554 SER A 577 1 ? 24 
HELX_P HELX_P24 AC6 SER A 577 ? ALA A 582 ? SER A 577 ALA A 582 1 ? 6  
HELX_P HELX_P25 AC7 SER A 587 ? ILE A 613 ? SER A 587 ILE A 613 1 ? 27 
HELX_P HELX_P26 AC8 PRO A 617 ? GLN A 639 ? PRO A 617 GLN A 639 1 ? 23 
HELX_P HELX_P27 AC9 LYS B 28  ? ALA B 41  ? LYS B 28  ALA B 41  1 ? 14 
HELX_P HELX_P28 AD1 LYS B 42  ? GLY B 46  ? LYS B 42  GLY B 46  5 ? 5  
HELX_P HELX_P29 AD2 TYR B 59  ? THR B 63  ? TYR B 59  THR B 63  5 ? 5  
HELX_P HELX_P30 AD3 SER B 75  ? GLY B 87  ? SER B 75  GLY B 87  1 ? 13 
HELX_P HELX_P31 AD4 THR B 104 ? PHE B 108 ? THR B 104 PHE B 108 5 ? 5  
HELX_P HELX_P32 AD5 THR B 120 ? ASN B 134 ? THR B 120 ASN B 134 1 ? 15 
HELX_P HELX_P33 AD6 SER B 156 ? GLY B 165 ? SER B 156 GLY B 165 1 ? 10 
HELX_P HELX_P34 AD7 ASP B 175 ? TYR B 187 ? ASP B 175 TYR B 187 1 ? 13 
HELX_P HELX_P35 AD8 PRO B 196 ? GLY B 205 ? PRO B 196 GLY B 205 1 ? 10 
HELX_P HELX_P36 AD9 GLY B 205 ? PHE B 235 ? GLY B 205 PHE B 235 1 ? 31 
HELX_P HELX_P37 AE1 ASP B 239 ? GLY B 273 ? ASP B 239 GLY B 273 1 ? 35 
HELX_P HELX_P38 AE2 LYS B 278 ? GLU B 282 ? LYS B 278 GLU B 282 5 ? 5  
HELX_P HELX_P39 AE3 PRO B 306 ? VAL B 317 ? PRO B 306 VAL B 317 1 ? 12 
HELX_P HELX_P40 AE4 VAL B 317 ? HIS B 347 ? VAL B 317 HIS B 347 1 ? 31 
HELX_P HELX_P41 AE5 THR B 355 ? LEU B 359 ? THR B 355 LEU B 359 1 ? 5  
HELX_P HELX_P42 AE6 TYR B 360 ? GLU B 388 ? TYR B 360 GLU B 388 1 ? 29 
HELX_P HELX_P43 AE7 LEU B 392 ? VAL B 422 ? LEU B 392 VAL B 422 1 ? 31 
HELX_P HELX_P44 AE8 ASP B 425 ? ILE B 438 ? ASP B 425 ILE B 438 1 ? 14 
HELX_P HELX_P45 AE9 ILE B 438 ? SER B 449 ? ILE B 438 SER B 449 1 ? 12 
HELX_P HELX_P46 AF1 SER B 449 ? LYS B 471 ? SER B 449 LYS B 471 1 ? 23 
HELX_P HELX_P47 AF2 ALA B 476 ? MET B 488 ? ALA B 476 MET B 488 1 ? 13 
HELX_P HELX_P48 AF3 THR B 494 ? SER B 512 ? THR B 494 SER B 512 1 ? 19 
HELX_P HELX_P49 AF4 LEU B 517 ? VAL B 540 ? LEU B 517 VAL B 540 1 ? 24 
HELX_P HELX_P50 AF5 VAL B 554 ? SER B 577 ? VAL B 554 SER B 577 1 ? 24 
HELX_P HELX_P51 AF6 SER B 577 ? ALA B 582 ? SER B 577 ALA B 582 1 ? 6  
HELX_P HELX_P52 AF7 SER B 587 ? ILE B 613 ? SER B 587 ILE B 613 1 ? 27 
HELX_P HELX_P53 AF8 PRO B 617 ? GLN B 639 ? PRO B 617 GLN B 639 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 259 OE1 ? ? ? 1_555 E  CA  . CA ? ? A GLU 259 A CA  703 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc2  metalc ? ? A ASN 444 OD1 ? ? ? 1_555 C  CA  . CA ? ? A ASN 444 A CA  701 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc3  metalc ? ? A GLN 445 OE1 ? ? ? 1_555 C  CA  . CA ? ? A GLN 445 A CA  701 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc4  metalc ? ? A GLU 448 OE1 ? ? ? 1_555 C  CA  . CA ? ? A GLU 448 A CA  701 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc5  metalc ? ? A GLU 448 OE2 ? ? ? 1_555 D  CA  . CA ? ? A GLU 448 A CA  702 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc6  metalc ? ? A ASP 497 OD1 ? ? ? 1_555 D  CA  . CA ? ? A ASP 497 A CA  702 1_555 ? ? ? ? ? ? ? 2.750 ? 
metalc7  metalc ? ? A GLU 500 OE1 ? ? ? 1_555 C  CA  . CA ? ? A GLU 500 A CA  701 1_555 ? ? ? ? ? ? ? 3.192 ? 
metalc8  metalc ? ? A GLU 500 OE1 ? ? ? 1_555 D  CA  . CA ? ? A GLU 500 A CA  702 1_555 ? ? ? ? ? ? ? 3.028 ? 
metalc9  metalc ? ? A GLU 500 OE2 ? ? ? 1_555 C  CA  . CA ? ? A GLU 500 A CA  701 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc10 metalc ? ? A GLU 529 OE1 ? ? ? 1_555 C  CA  . CA ? ? A GLU 529 A CA  701 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc11 metalc ? ? A GLU 529 OE2 ? ? ? 1_555 C  CA  . CA ? ? A GLU 529 A CA  701 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc12 metalc ? ? A GLU 529 OE2 ? ? ? 1_555 D  CA  . CA ? ? A GLU 529 A CA  702 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc13 metalc ? ? A ASP 533 OD1 ? ? ? 1_555 D  CA  . CA ? ? A ASP 533 A CA  702 1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc14 metalc ? ? A ASP 533 OD2 ? ? ? 1_555 D  CA  . CA ? ? A ASP 533 A CA  702 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc15 metalc ? ? A ALA 610 O   ? ? ? 1_555 E  CA  . CA ? ? A ALA 610 A CA  703 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc16 metalc ? ? A ILE 613 O   ? ? ? 1_555 E  CA  . CA ? ? A ILE 613 A CA  703 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc17 metalc ? ? A ASP 615 OD1 ? ? ? 1_555 E  CA  . CA ? ? A ASP 615 A CA  703 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc18 metalc ? ? B GLU 259 OE1 ? ? ? 1_555 Q  CA  . CA ? ? B GLU 259 B CA  703 1_555 ? ? ? ? ? ? ? 2.159 ? 
metalc19 metalc ? ? B ASN 444 OD1 ? ? ? 1_555 O  CA  . CA ? ? B ASN 444 B CA  701 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc20 metalc ? ? B GLN 445 OE1 ? ? ? 1_555 O  CA  . CA ? ? B GLN 445 B CA  701 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc21 metalc ? ? B GLU 448 OE1 ? ? ? 1_555 O  CA  . CA ? ? B GLU 448 B CA  701 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc22 metalc ? ? B GLU 448 OE2 ? ? ? 1_555 P  CA  . CA ? ? B GLU 448 B CA  702 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc23 metalc ? ? B ASP 497 OD1 ? ? ? 1_555 P  CA  . CA ? ? B ASP 497 B CA  702 1_555 ? ? ? ? ? ? ? 2.915 ? 
metalc24 metalc ? ? B GLU 500 OE1 ? ? ? 1_555 P  CA  . CA ? ? B GLU 500 B CA  702 1_555 ? ? ? ? ? ? ? 3.082 ? 
metalc25 metalc ? ? B GLU 500 OE2 ? ? ? 1_555 O  CA  . CA ? ? B GLU 500 B CA  701 1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc26 metalc ? ? B GLU 529 OE1 ? ? ? 1_555 O  CA  . CA ? ? B GLU 529 B CA  701 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc27 metalc ? ? B GLU 529 OE2 ? ? ? 1_555 P  CA  . CA ? ? B GLU 529 B CA  702 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc28 metalc ? ? B GLU 529 OE2 ? ? ? 1_555 O  CA  . CA ? ? B GLU 529 B CA  701 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc29 metalc ? ? B ASP 533 OD1 ? ? ? 1_555 P  CA  . CA ? ? B ASP 533 B CA  702 1_555 ? ? ? ? ? ? ? 2.792 ? 
metalc30 metalc ? ? B ASP 533 OD2 ? ? ? 1_555 P  CA  . CA ? ? B ASP 533 B CA  702 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc31 metalc ? ? B ALA 610 O   ? ? ? 1_555 Q  CA  . CA ? ? B ALA 610 B CA  703 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc32 metalc ? ? B ILE 613 O   ? ? ? 1_555 Q  CA  . CA ? ? B ILE 613 B CA  703 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc33 metalc ? ? B ASP 615 OD1 ? ? ? 1_555 Q  CA  . CA ? ? B ASP 615 B CA  703 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc34 metalc ? ? O CA  .   CA  ? ? ? 1_555 CA HOH . O  ? ? B CA  701 B HOH 821 1_555 ? ? ? ? ? ? ? 2.791 ? 
metalc35 metalc ? ? Q CA  .   CA  ? ? ? 1_555 CA HOH . O  ? ? B CA  703 B HOH 805 1_555 ? ? ? ? ? ? ? 2.411 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 51  ? PRO A 54  ? LEU A 51  PRO A 54  
AA1 2 LEU A 69  ? GLY A 73  ? LEU A 69  GLY A 73  
AA1 3 VAL A 19  ? LEU A 23  ? VAL A 19  LEU A 23  
AA1 4 VAL A 167 ? PRO A 172 ? VAL A 167 PRO A 172 
AA2 1 VAL A 89  ? GLU A 91  ? VAL A 89  GLU A 91  
AA2 2 MET A 97  ? ALA A 99  ? MET A 97  ALA A 99  
AA3 1 MET A 142 ? ILE A 143 ? MET A 142 ILE A 143 
AA3 2 TYR A 146 ? LYS A 150 ? TYR A 146 LYS A 150 
AA4 1 VAL A 291 ? ILE A 294 ? VAL A 291 ILE A 294 
AA4 2 GLU A 301 ? LEU A 304 ? GLU A 301 LEU A 304 
AA5 1 LEU B 51  ? PRO B 54  ? LEU B 51  PRO B 54  
AA5 2 LEU B 69  ? GLY B 73  ? LEU B 69  GLY B 73  
AA5 3 VAL B 19  ? LEU B 23  ? VAL B 19  LEU B 23  
AA5 4 VAL B 167 ? PRO B 172 ? VAL B 167 PRO B 172 
AA6 1 VAL B 89  ? GLU B 91  ? VAL B 89  GLU B 91  
AA6 2 MET B 97  ? ALA B 99  ? MET B 97  ALA B 99  
AA7 1 MET B 142 ? ILE B 143 ? MET B 142 ILE B 143 
AA7 2 TYR B 146 ? LYS B 150 ? TYR B 146 LYS B 150 
AA8 1 VAL B 291 ? ILE B 294 ? VAL B 291 ILE B 294 
AA8 2 GLU B 301 ? LEU B 304 ? GLU B 301 LEU B 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 51  ? N LEU A 51  O GLY A 73  ? O GLY A 73  
AA1 2 3 O VAL A 72  ? O VAL A 72  N VAL A 19  ? N VAL A 19  
AA1 3 4 N VAL A 20  ? N VAL A 20  O PHE A 171 ? O PHE A 171 
AA2 1 2 N LYS A 90  ? N LYS A 90  O ARG A 98  ? O ARG A 98  
AA3 1 2 N ILE A 143 ? N ILE A 143 O TYR A 146 ? O TYR A 146 
AA4 1 2 N GLY A 293 ? N GLY A 293 O GLU A 302 ? O GLU A 302 
AA5 1 2 N ARG B 53  ? N ARG B 53  O LEU B 71  ? O LEU B 71  
AA5 2 3 O VAL B 72  ? O VAL B 72  N VAL B 19  ? N VAL B 19  
AA5 3 4 N GLU B 22  ? N GLU B 22  O GLN B 169 ? O GLN B 169 
AA6 1 2 N LYS B 90  ? N LYS B 90  O ARG B 98  ? O ARG B 98  
AA7 1 2 N ILE B 143 ? N ILE B 143 O TYR B 146 ? O TYR B 146 
AA8 1 2 N GLY B 293 ? N GLY B 293 O GLU B 302 ? O GLU B 302 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  701 ? 5  'binding site for residue CA A 701'  
AC2 Software A CA  702 ? 6  'binding site for residue CA A 702'  
AC3 Software A CA  703 ? 4  'binding site for residue CA A 703'  
AC4 Software A 79M 704 ? 8  'binding site for residue 79M A 704' 
AC5 Software A 79M 705 ? 6  'binding site for residue 79M A 705' 
AC6 Software A 79M 706 ? 2  'binding site for residue 79M A 706' 
AC7 Software A 79M 707 ? 1  'binding site for residue 79M A 707' 
AC8 Software A 79M 708 ? 10 'binding site for residue 79M A 708' 
AC9 Software A 79M 709 ? 5  'binding site for residue 79M A 709' 
AD1 Software A 79M 710 ? 6  'binding site for residue 79M A 710' 
AD2 Software A 79M 711 ? 2  'binding site for residue 79M A 711' 
AD3 Software A 79M 712 ? 3  'binding site for residue 79M A 712' 
AD4 Software B CA  701 ? 6  'binding site for residue CA B 701'  
AD5 Software B CA  702 ? 6  'binding site for residue CA B 702'  
AD6 Software B CA  703 ? 5  'binding site for residue CA B 703'  
AD7 Software B 79M 705 ? 8  'binding site for residue 79M B 705' 
AD8 Software B 79M 706 ? 3  'binding site for residue 79M B 706' 
AD9 Software B 79M 707 ? 3  'binding site for residue 79M B 707' 
AE1 Software B 79M 708 ? 8  'binding site for residue 79M B 708' 
AE2 Software B 79M 709 ? 10 'binding site for residue 79M B 709' 
AE3 Software B 79M 710 ? 4  'binding site for residue 79M B 710' 
AE4 Software B 79M 711 ? 4  'binding site for residue 79M B 711' 
AE5 Software B 79M 712 ? 1  'binding site for residue 79M B 712' 
AE6 Software B 79M 713 ? 3  'binding site for residue 79M B 713' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  ASN A  444 ? ASN A 444 . ? 1_555 ? 
2   AC1 5  GLN A  445 ? GLN A 445 . ? 1_555 ? 
3   AC1 5  GLU A  448 ? GLU A 448 . ? 1_555 ? 
4   AC1 5  GLU A  500 ? GLU A 500 . ? 1_555 ? 
5   AC1 5  GLU A  529 ? GLU A 529 . ? 1_555 ? 
6   AC2 6  TYR A  211 ? TYR A 211 . ? 1_555 ? 
7   AC2 6  GLU A  448 ? GLU A 448 . ? 1_555 ? 
8   AC2 6  ASP A  497 ? ASP A 497 . ? 1_555 ? 
9   AC2 6  GLU A  500 ? GLU A 500 . ? 1_555 ? 
10  AC2 6  GLU A  529 ? GLU A 529 . ? 1_555 ? 
11  AC2 6  ASP A  533 ? ASP A 533 . ? 1_555 ? 
12  AC3 4  GLU A  259 ? GLU A 259 . ? 1_555 ? 
13  AC3 4  ALA A  610 ? ALA A 610 . ? 1_555 ? 
14  AC3 4  ILE A  613 ? ILE A 613 . ? 1_555 ? 
15  AC3 4  ASP A  615 ? ASP A 615 . ? 1_555 ? 
16  AC4 8  VAL A  227 ? VAL A 227 . ? 1_555 ? 
17  AC4 8  ASP A  241 ? ASP A 241 . ? 1_555 ? 
18  AC4 8  LYS A  242 ? LYS A 242 . ? 1_555 ? 
19  AC4 8  ILE A  245 ? ILE A 245 . ? 1_555 ? 
20  AC4 8  79M G  .   ? 79M A 705 . ? 1_555 ? 
21  AC4 8  TRP B  237 ? TRP B 237 . ? 1_455 ? 
22  AC4 8  LYS B  242 ? LYS B 242 . ? 1_455 ? 
23  AC4 8  79M S  .   ? 79M B 705 . ? 1_455 ? 
24  AC5 6  ILE A  245 ? ILE A 245 . ? 1_555 ? 
25  AC5 6  79M F  .   ? 79M A 704 . ? 1_555 ? 
26  AC5 6  79M H  .   ? 79M A 706 . ? 1_555 ? 
27  AC5 6  PHE B  235 ? PHE B 235 . ? 1_455 ? 
28  AC5 6  TRP B  237 ? TRP B 237 . ? 1_455 ? 
29  AC5 6  79M S  .   ? 79M B 705 . ? 1_455 ? 
30  AC6 2  TYR A  240 ? TYR A 240 . ? 1_555 ? 
31  AC6 2  79M G  .   ? 79M A 705 . ? 1_555 ? 
32  AC7 1  SER A  248 ? SER A 248 . ? 1_555 ? 
33  AC8 10 THR A  255 ? THR A 255 . ? 1_555 ? 
34  AC8 10 GLU A  560 ? GLU A 560 . ? 1_555 ? 
35  AC8 10 SER A  563 ? SER A 563 . ? 1_555 ? 
36  AC8 10 VAL A  564 ? VAL A 564 . ? 1_555 ? 
37  AC8 10 LEU A  603 ? LEU A 603 . ? 1_555 ? 
38  AC8 10 LYS A  606 ? LYS A 606 . ? 1_555 ? 
39  AC8 10 PHE A  607 ? PHE A 607 . ? 1_555 ? 
40  AC8 10 79M K  .   ? 79M A 709 . ? 1_555 ? 
41  AC8 10 HOH BA .   ? HOH A 817 . ? 1_555 ? 
42  AC8 10 79M W  .   ? 79M B 709 . ? 1_555 ? 
43  AC9 5  LEU A  557 ? LEU A 557 . ? 1_555 ? 
44  AC9 5  GLU A  560 ? GLU A 560 . ? 1_555 ? 
45  AC9 5  THR A  561 ? THR A 561 . ? 1_555 ? 
46  AC9 5  79M J  .   ? 79M A 708 . ? 1_555 ? 
47  AC9 5  PHE B  607 ? PHE B 607 . ? 1_555 ? 
48  AD1 6  CYS A  323 ? CYS A 323 . ? 1_555 ? 
49  AD1 6  TYR A  327 ? TYR A 327 . ? 1_555 ? 
50  AD1 6  GLU A  388 ? GLU A 388 . ? 1_555 ? 
51  AD1 6  HIS A  399 ? HIS A 399 . ? 1_555 ? 
52  AD1 6  LEU A  402 ? LEU A 402 . ? 1_555 ? 
53  AD1 6  LYS A  403 ? LYS A 403 . ? 1_555 ? 
54  AD2 2  PHE A  502 ? PHE A 502 . ? 1_555 ? 
55  AD2 2  PHE B  611 ? PHE B 611 . ? 1_555 ? 
56  AD3 3  PHE A  321 ? PHE A 321 . ? 1_555 ? 
57  AD3 3  PHE A  328 ? PHE A 328 . ? 1_555 ? 
58  AD3 3  TYR A  377 ? TYR A 377 . ? 1_555 ? 
59  AD4 6  ASN B  444 ? ASN B 444 . ? 1_555 ? 
60  AD4 6  GLN B  445 ? GLN B 445 . ? 1_555 ? 
61  AD4 6  GLU B  448 ? GLU B 448 . ? 1_555 ? 
62  AD4 6  GLU B  500 ? GLU B 500 . ? 1_555 ? 
63  AD4 6  GLU B  529 ? GLU B 529 . ? 1_555 ? 
64  AD4 6  HOH CA .   ? HOH B 821 . ? 1_555 ? 
65  AD5 6  TYR B  211 ? TYR B 211 . ? 1_555 ? 
66  AD5 6  GLU B  448 ? GLU B 448 . ? 1_555 ? 
67  AD5 6  ASP B  497 ? ASP B 497 . ? 1_555 ? 
68  AD5 6  GLU B  500 ? GLU B 500 . ? 1_555 ? 
69  AD5 6  GLU B  529 ? GLU B 529 . ? 1_555 ? 
70  AD5 6  ASP B  533 ? ASP B 533 . ? 1_555 ? 
71  AD6 5  GLU B  259 ? GLU B 259 . ? 1_555 ? 
72  AD6 5  ALA B  610 ? ALA B 610 . ? 1_555 ? 
73  AD6 5  ILE B  613 ? ILE B 613 . ? 1_555 ? 
74  AD6 5  ASP B  615 ? ASP B 615 . ? 1_555 ? 
75  AD6 5  HOH CA .   ? HOH B 805 . ? 1_555 ? 
76  AD7 8  LYS A  242 ? LYS A 242 . ? 1_655 ? 
77  AD7 8  79M F  .   ? 79M A 704 . ? 1_655 ? 
78  AD7 8  79M G  .   ? 79M A 705 . ? 1_655 ? 
79  AD7 8  VAL B  227 ? VAL B 227 . ? 1_555 ? 
80  AD7 8  TRP B  237 ? TRP B 237 . ? 1_555 ? 
81  AD7 8  ASP B  241 ? ASP B 241 . ? 1_555 ? 
82  AD7 8  LYS B  242 ? LYS B 242 . ? 1_555 ? 
83  AD7 8  ILE B  245 ? ILE B 245 . ? 1_555 ? 
84  AD8 3  PHE A  235 ? PHE A 235 . ? 1_655 ? 
85  AD8 3  ILE B  245 ? ILE B 245 . ? 1_555 ? 
86  AD8 3  79M U  .   ? 79M B 707 . ? 1_555 ? 
87  AD9 3  TYR B  240 ? TYR B 240 . ? 1_555 ? 
88  AD9 3  79M T  .   ? 79M B 706 . ? 1_555 ? 
89  AD9 3  79M V  .   ? 79M B 708 . ? 1_555 ? 
90  AE1 8  TYR B  240 ? TYR B 240 . ? 1_555 ? 
91  AE1 8  SER B  248 ? SER B 248 . ? 1_555 ? 
92  AE1 8  LEU B  251 ? LEU B 251 . ? 1_555 ? 
93  AE1 8  VAL B  583 ? VAL B 583 . ? 1_555 ? 
94  AE1 8  PHE B  584 ? PHE B 584 . ? 1_555 ? 
95  AE1 8  ILE B  594 ? ILE B 594 . ? 1_555 ? 
96  AE1 8  VAL B  595 ? VAL B 595 . ? 1_555 ? 
97  AE1 8  79M U  .   ? 79M B 707 . ? 1_555 ? 
98  AE2 10 79M J  .   ? 79M A 708 . ? 1_555 ? 
99  AE2 10 THR B  255 ? THR B 255 . ? 1_555 ? 
100 AE2 10 GLU B  560 ? GLU B 560 . ? 1_555 ? 
101 AE2 10 SER B  563 ? SER B 563 . ? 1_555 ? 
102 AE2 10 VAL B  564 ? VAL B 564 . ? 1_555 ? 
103 AE2 10 LEU B  603 ? LEU B 603 . ? 1_555 ? 
104 AE2 10 LYS B  606 ? LYS B 606 . ? 1_555 ? 
105 AE2 10 PHE B  607 ? PHE B 607 . ? 1_555 ? 
106 AE2 10 79M X  .   ? 79M B 710 . ? 1_555 ? 
107 AE2 10 HOH CA .   ? HOH B 809 . ? 1_555 ? 
108 AE3 4  PHE A  607 ? PHE A 607 . ? 1_555 ? 
109 AE3 4  LEU B  557 ? LEU B 557 . ? 1_555 ? 
110 AE3 4  GLU B  560 ? GLU B 560 . ? 1_555 ? 
111 AE3 4  79M W  .   ? 79M B 709 . ? 1_555 ? 
112 AE4 4  GLU B  388 ? GLU B 388 . ? 1_555 ? 
113 AE4 4  HIS B  399 ? HIS B 399 . ? 1_555 ? 
114 AE4 4  LEU B  402 ? LEU B 402 . ? 1_555 ? 
115 AE4 4  LYS B  403 ? LYS B 403 . ? 1_555 ? 
116 AE5 1  PHE B  502 ? PHE B 502 . ? 1_555 ? 
117 AE6 3  PHE B  321 ? PHE B 321 . ? 1_555 ? 
118 AE6 3  PHE B  328 ? PHE B 328 . ? 1_555 ? 
119 AE6 3  PHE B  407 ? PHE B 407 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5OC9 
_atom_sites.fract_transf_matrix[1][1]   0.016906 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006511 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004571 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A  1 14  ? 35.968 49.611  42.203  1.00 73.85  ? 14  SER A N   1 
ATOM   2     C  CA  . SER A  1 14  ? 35.993 51.068  42.294  1.00 72.10  ? 14  SER A CA  1 
ATOM   3     C  C   . SER A  1 14  ? 35.535 51.552  43.678  1.00 74.03  ? 14  SER A C   1 
ATOM   4     O  O   . SER A  1 14  ? 34.874 50.811  44.411  1.00 74.72  ? 14  SER A O   1 
ATOM   5     C  CB  . SER A  1 14  ? 35.128 51.690  41.200  1.00 76.02  ? 14  SER A CB  1 
ATOM   6     O  OG  . SER A  1 14  ? 33.747 51.424  41.388  1.00 85.41  ? 14  SER A OG  1 
ATOM   7     N  N   . PHE A  1 15  ? 35.895 52.803  44.021  1.00 67.85  ? 15  PHE A N   1 
ATOM   8     C  CA  . PHE A  1 15  ? 35.585 53.473  45.291  1.00 65.95  ? 15  PHE A CA  1 
ATOM   9     C  C   . PHE A  1 15  ? 34.713 54.724  45.071  1.00 67.83  ? 15  PHE A C   1 
ATOM   10    O  O   . PHE A  1 15  ? 34.297 55.003  43.940  1.00 67.54  ? 15  PHE A O   1 
ATOM   11    C  CB  . PHE A  1 15  ? 36.896 53.865  46.019  1.00 66.53  ? 15  PHE A CB  1 
ATOM   12    C  CG  . PHE A  1 15  ? 37.908 54.608  45.173  1.00 67.14  ? 15  PHE A CG  1 
ATOM   13    C  CD1 . PHE A  1 15  ? 37.815 55.983  44.991  1.00 69.18  ? 15  PHE A CD1 1 
ATOM   14    C  CD2 . PHE A  1 15  ? 38.955 53.933  44.560  1.00 69.51  ? 15  PHE A CD2 1 
ATOM   15    C  CE1 . PHE A  1 15  ? 38.737 56.663  44.190  1.00 69.58  ? 15  PHE A CE1 1 
ATOM   16    C  CE2 . PHE A  1 15  ? 39.884 54.616  43.772  1.00 71.77  ? 15  PHE A CE2 1 
ATOM   17    C  CZ  . PHE A  1 15  ? 39.769 55.976  43.591  1.00 68.89  ? 15  PHE A CZ  1 
ATOM   18    N  N   . THR A  1 16  ? 34.450 55.476  46.157  1.00 62.69  ? 16  THR A N   1 
ATOM   19    C  CA  . THR A  1 16  ? 33.708 56.732  46.103  1.00 61.49  ? 16  THR A CA  1 
ATOM   20    C  C   . THR A  1 16  ? 34.738 57.850  45.857  1.00 62.79  ? 16  THR A C   1 
ATOM   21    O  O   . THR A  1 16  ? 35.629 58.043  46.696  1.00 61.96  ? 16  THR A O   1 
ATOM   22    C  CB  . THR A  1 16  ? 32.859 56.946  47.369  1.00 71.03  ? 16  THR A CB  1 
ATOM   23    O  OG1 . THR A  1 16  ? 33.656 56.719  48.534  1.00 70.84  ? 16  THR A OG1 1 
ATOM   24    C  CG2 . THR A  1 16  ? 31.621 56.061  47.396  1.00 71.37  ? 16  THR A CG2 1 
ATOM   25    N  N   . PRO A  1 17  ? 34.678 58.551  44.693  1.00 57.63  ? 17  PRO A N   1 
ATOM   26    C  CA  . PRO A  1 17  ? 35.684 59.591  44.405  1.00 56.12  ? 17  PRO A CA  1 
ATOM   27    C  C   . PRO A  1 17  ? 35.463 60.844  45.239  1.00 58.51  ? 17  PRO A C   1 
ATOM   28    O  O   . PRO A  1 17  ? 34.347 61.368  45.261  1.00 58.38  ? 17  PRO A O   1 
ATOM   29    C  CB  . PRO A  1 17  ? 35.493 59.873  42.908  1.00 58.29  ? 17  PRO A CB  1 
ATOM   30    C  CG  . PRO A  1 17  ? 34.512 58.847  42.412  1.00 63.98  ? 17  PRO A CG  1 
ATOM   31    C  CD  . PRO A  1 17  ? 33.709 58.433  43.588  1.00 59.67  ? 17  PRO A CD  1 
ATOM   32    N  N   . LEU A  1 18  ? 36.517 61.315  45.936  1.00 53.76  ? 18  LEU A N   1 
ATOM   33    C  CA  . LEU A  1 18  ? 36.410 62.487  46.801  1.00 52.72  ? 18  LEU A CA  1 
ATOM   34    C  C   . LEU A  1 18  ? 37.289 63.645  46.329  1.00 55.58  ? 18  LEU A C   1 
ATOM   35    O  O   . LEU A  1 18  ? 36.809 64.780  46.294  1.00 55.75  ? 18  LEU A O   1 
ATOM   36    C  CB  . LEU A  1 18  ? 36.749 62.130  48.260  1.00 52.76  ? 18  LEU A CB  1 
ATOM   37    C  CG  . LEU A  1 18  ? 35.811 61.143  48.973  1.00 58.73  ? 18  LEU A CG  1 
ATOM   38    C  CD1 . LEU A  1 18  ? 36.412 60.668  50.267  1.00 59.13  ? 18  LEU A CD1 1 
ATOM   39    C  CD2 . LEU A  1 18  ? 34.458 61.765  49.265  1.00 61.67  ? 18  LEU A CD2 1 
ATOM   40    N  N   . VAL A  1 19  ? 38.569 63.374  45.989  1.00 50.10  ? 19  VAL A N   1 
ATOM   41    C  CA  . VAL A  1 19  ? 39.545 64.388  45.554  1.00 48.01  ? 19  VAL A CA  1 
ATOM   42    C  C   . VAL A  1 19  ? 40.052 64.046  44.135  1.00 50.16  ? 19  VAL A C   1 
ATOM   43    O  O   . VAL A  1 19  ? 40.298 62.878  43.831  1.00 49.81  ? 19  VAL A O   1 
ATOM   44    C  CB  . VAL A  1 19  ? 40.709 64.516  46.587  1.00 50.81  ? 19  VAL A CB  1 
ATOM   45    C  CG1 . VAL A  1 19  ? 41.795 65.477  46.115  1.00 50.10  ? 19  VAL A CG1 1 
ATOM   46    C  CG2 . VAL A  1 19  ? 40.187 64.946  47.952  1.00 50.04  ? 19  VAL A CG2 1 
ATOM   47    N  N   . VAL A  1 20  ? 40.200 65.074  43.279  1.00 45.56  ? 20  VAL A N   1 
ATOM   48    C  CA  . VAL A  1 20  ? 40.680 64.933  41.903  1.00 45.54  ? 20  VAL A CA  1 
ATOM   49    C  C   . VAL A  1 20  ? 42.069 65.578  41.774  1.00 49.28  ? 20  VAL A C   1 
ATOM   50    O  O   . VAL A  1 20  ? 42.306 66.647  42.340  1.00 47.94  ? 20  VAL A O   1 
ATOM   51    C  CB  . VAL A  1 20  ? 39.664 65.525  40.881  1.00 49.35  ? 20  VAL A CB  1 
ATOM   52    C  CG1 . VAL A  1 20  ? 40.241 65.590  39.472  1.00 49.54  ? 20  VAL A CG1 1 
ATOM   53    C  CG2 . VAL A  1 20  ? 38.370 64.725  40.872  1.00 49.78  ? 20  VAL A CG2 1 
ATOM   54    N  N   . ILE A  1 21  ? 42.981 64.908  41.037  1.00 46.78  ? 21  ILE A N   1 
ATOM   55    C  CA  . ILE A  1 21  ? 44.330 65.385  40.713  1.00 46.50  ? 21  ILE A CA  1 
ATOM   56    C  C   . ILE A  1 21  ? 44.423 65.491  39.196  1.00 51.96  ? 21  ILE A C   1 
ATOM   57    O  O   . ILE A  1 21  ? 44.174 64.505  38.498  1.00 52.66  ? 21  ILE A O   1 
ATOM   58    C  CB  . ILE A  1 21  ? 45.475 64.497  41.294  1.00 49.51  ? 21  ILE A CB  1 
ATOM   59    C  CG1 . ILE A  1 21  ? 45.322 64.261  42.814  1.00 49.18  ? 21  ILE A CG1 1 
ATOM   60    C  CG2 . ILE A  1 21  ? 46.861 65.085  40.941  1.00 49.97  ? 21  ILE A CG2 1 
ATOM   61    C  CD1 . ILE A  1 21  ? 46.219 63.166  43.392  1.00 55.38  ? 21  ILE A CD1 1 
ATOM   62    N  N   . GLU A  1 22  ? 44.763 66.677  38.687  1.00 49.14  ? 22  GLU A N   1 
ATOM   63    C  CA  . GLU A  1 22  ? 44.925 66.899  37.255  1.00 50.23  ? 22  GLU A CA  1 
ATOM   64    C  C   . GLU A  1 22  ? 46.402 67.071  36.934  1.00 56.43  ? 22  GLU A C   1 
ATOM   65    O  O   . GLU A  1 22  ? 47.068 67.927  37.515  1.00 55.81  ? 22  GLU A O   1 
ATOM   66    C  CB  . GLU A  1 22  ? 44.115 68.109  36.771  1.00 51.29  ? 22  GLU A CB  1 
ATOM   67    C  CG  . GLU A  1 22  ? 44.060 68.224  35.255  1.00 62.35  ? 22  GLU A CG  1 
ATOM   68    C  CD  . GLU A  1 22  ? 43.616 69.552  34.669  1.00 82.70  ? 22  GLU A CD  1 
ATOM   69    O  OE1 . GLU A  1 22  ? 43.519 70.546  35.423  1.00 70.35  ? 22  GLU A OE1 1 
ATOM   70    O  OE2 . GLU A  1 22  ? 43.389 69.602  33.439  1.00 81.35  ? 22  GLU A OE2 1 
ATOM   71    N  N   . LEU A  1 23  ? 46.910 66.251  36.015  1.00 55.06  ? 23  LEU A N   1 
ATOM   72    C  CA  . LEU A  1 23  ? 48.302 66.302  35.584  1.00 55.90  ? 23  LEU A CA  1 
ATOM   73    C  C   . LEU A  1 23  ? 48.402 67.043  34.252  1.00 61.04  ? 23  LEU A C   1 
ATOM   74    O  O   . LEU A  1 23  ? 47.396 67.171  33.548  1.00 60.57  ? 23  LEU A O   1 
ATOM   75    C  CB  . LEU A  1 23  ? 48.881 64.878  35.474  1.00 56.84  ? 23  LEU A CB  1 
ATOM   76    C  CG  . LEU A  1 23  ? 49.408 64.239  36.769  1.00 61.24  ? 23  LEU A CG  1 
ATOM   77    C  CD1 . LEU A  1 23  ? 48.282 63.692  37.629  1.00 60.98  ? 23  LEU A CD1 1 
ATOM   78    C  CD2 . LEU A  1 23  ? 50.338 63.099  36.459  1.00 64.37  ? 23  LEU A CD2 1 
ATOM   79    N  N   . ALA A  1 24  ? 49.608 67.538  33.912  1.00 59.21  ? 24  ALA A N   1 
ATOM   80    C  CA  . ALA A  1 24  ? 49.882 68.263  32.667  1.00 60.73  ? 24  ALA A CA  1 
ATOM   81    C  C   . ALA A  1 24  ? 49.611 67.377  31.427  1.00 67.75  ? 24  ALA A C   1 
ATOM   82    O  O   . ALA A  1 24  ? 49.656 66.149  31.529  1.00 68.21  ? 24  ALA A O   1 
ATOM   83    C  CB  . ALA A  1 24  ? 51.310 68.778  32.661  1.00 61.79  ? 24  ALA A CB  1 
ATOM   84    N  N   . GLN A  1 25  ? 49.295 68.014  30.278  1.00 65.58  ? 25  GLN A N   1 
ATOM   85    C  CA  . GLN A  1 25  ? 48.885 67.399  29.006  1.00 66.81  ? 25  GLN A CA  1 
ATOM   86    C  C   . GLN A  1 25  ? 49.597 66.080  28.641  1.00 71.16  ? 25  GLN A C   1 
ATOM   87    O  O   . GLN A  1 25  ? 48.903 65.115  28.314  1.00 71.21  ? 25  GLN A O   1 
ATOM   88    C  CB  . GLN A  1 25  ? 49.031 68.385  27.839  1.00 69.26  ? 25  GLN A CB  1 
ATOM   89    C  CG  . GLN A  1 25  ? 47.895 68.265  26.822  1.00 88.36  ? 25  GLN A CG  1 
ATOM   90    C  CD  . GLN A  1 25  ? 48.187 68.984  25.527  1.00 114.72 ? 25  GLN A CD  1 
ATOM   91    O  OE1 . GLN A  1 25  ? 48.341 70.212  25.480  1.00 112.42 ? 25  GLN A OE1 1 
ATOM   92    N  NE2 . GLN A  1 25  ? 48.237 68.233  24.434  1.00 108.26 ? 25  GLN A NE2 1 
ATOM   93    N  N   . ASP A  1 26  ? 50.946 66.030  28.684  1.00 67.71  ? 26  ASP A N   1 
ATOM   94    C  CA  . ASP A  1 26  ? 51.677 64.815  28.299  1.00 68.04  ? 26  ASP A CA  1 
ATOM   95    C  C   . ASP A  1 26  ? 52.716 64.390  29.359  1.00 69.99  ? 26  ASP A C   1 
ATOM   96    O  O   . ASP A  1 26  ? 53.917 64.330  29.069  1.00 70.36  ? 26  ASP A O   1 
ATOM   97    C  CB  . ASP A  1 26  ? 52.345 64.997  26.920  1.00 71.32  ? 26  ASP A CB  1 
ATOM   98    C  CG  . ASP A  1 26  ? 51.371 65.156  25.769  1.00 83.28  ? 26  ASP A CG  1 
ATOM   99    O  OD1 . ASP A  1 26  ? 50.654 64.178  25.456  1.00 84.12  ? 26  ASP A OD1 1 
ATOM   100   O  OD2 . ASP A  1 26  ? 51.354 66.245  25.155  1.00 90.10  ? 26  ASP A OD2 1 
ATOM   101   N  N   . VAL A  1 27  ? 52.240 64.061  30.577  1.00 64.04  ? 27  VAL A N   1 
ATOM   102   C  CA  . VAL A  1 27  ? 53.102 63.601  31.673  1.00 62.76  ? 27  VAL A CA  1 
ATOM   103   C  C   . VAL A  1 27  ? 53.501 62.143  31.393  1.00 65.71  ? 27  VAL A C   1 
ATOM   104   O  O   . VAL A  1 27  ? 52.647 61.343  31.004  1.00 65.77  ? 27  VAL A O   1 
ATOM   105   C  CB  . VAL A  1 27  ? 52.446 63.782  33.075  1.00 65.18  ? 27  VAL A CB  1 
ATOM   106   C  CG1 . VAL A  1 27  ? 53.266 63.107  34.172  1.00 64.77  ? 27  VAL A CG1 1 
ATOM   107   C  CG2 . VAL A  1 27  ? 52.254 65.255  33.403  1.00 64.06  ? 27  VAL A CG2 1 
ATOM   108   N  N   . LYS A  1 28  ? 54.801 61.818  31.573  1.00 60.97  ? 28  LYS A N   1 
ATOM   109   C  CA  . LYS A  1 28  ? 55.378 60.484  31.364  1.00 60.92  ? 28  LYS A CA  1 
ATOM   110   C  C   . LYS A  1 28  ? 54.716 59.444  32.267  1.00 63.64  ? 28  LYS A C   1 
ATOM   111   O  O   . LYS A  1 28  ? 54.344 59.770  33.397  1.00 61.93  ? 28  LYS A O   1 
ATOM   112   C  CB  . LYS A  1 28  ? 56.895 60.501  31.622  1.00 63.24  ? 28  LYS A CB  1 
ATOM   113   C  CG  . LYS A  1 28  ? 57.683 61.384  30.662  1.00 71.35  ? 28  LYS A CG  1 
ATOM   114   C  CD  . LYS A  1 28  ? 59.167 61.384  30.983  1.00 76.31  ? 28  LYS A CD  1 
ATOM   115   C  CE  . LYS A  1 28  ? 59.941 62.235  30.010  1.00 83.02  ? 28  LYS A CE  1 
ATOM   116   N  NZ  . LYS A  1 28  ? 61.407 62.143  30.240  1.00 89.50  ? 28  LYS A NZ  1 
ATOM   117   N  N   . GLU A  1 29  ? 54.569 58.195  31.766  1.00 60.72  ? 29  GLU A N   1 
ATOM   118   C  CA  . GLU A  1 29  ? 53.962 57.075  32.503  1.00 60.25  ? 29  GLU A CA  1 
ATOM   119   C  C   . GLU A  1 29  ? 54.781 56.735  33.748  1.00 63.10  ? 29  GLU A C   1 
ATOM   120   O  O   . GLU A  1 29  ? 54.211 56.347  34.768  1.00 61.90  ? 29  GLU A O   1 
ATOM   121   C  CB  . GLU A  1 29  ? 53.807 55.830  31.610  1.00 63.03  ? 29  GLU A CB  1 
ATOM   122   C  CG  . GLU A  1 29  ? 52.772 55.966  30.499  1.00 76.65  ? 29  GLU A CG  1 
ATOM   123   C  CD  . GLU A  1 29  ? 51.345 56.291  30.909  1.00 100.59 ? 29  GLU A CD  1 
ATOM   124   O  OE1 . GLU A  1 29  ? 50.832 55.658  31.861  1.00 93.28  ? 29  GLU A OE1 1 
ATOM   125   O  OE2 . GLU A  1 29  ? 50.733 57.173  30.264  1.00 96.42  ? 29  GLU A OE2 1 
ATOM   126   N  N   . GLU A  1 30  ? 56.117 56.916  33.657  1.00 59.93  ? 30  GLU A N   1 
ATOM   127   C  CA  . GLU A  1 30  ? 57.115 56.723  34.713  1.00 59.38  ? 30  GLU A CA  1 
ATOM   128   C  C   . GLU A  1 30  ? 56.773 57.599  35.925  1.00 61.05  ? 30  GLU A C   1 
ATOM   129   O  O   . GLU A  1 30  ? 56.862 57.132  37.061  1.00 60.93  ? 30  GLU A O   1 
ATOM   130   C  CB  . GLU A  1 30  ? 58.507 57.079  34.155  1.00 61.68  ? 30  GLU A CB  1 
ATOM   131   C  CG  . GLU A  1 30  ? 59.682 56.825  35.087  1.00 73.14  ? 30  GLU A CG  1 
ATOM   132   C  CD  . GLU A  1 30  ? 61.022 57.378  34.628  1.00 95.99  ? 30  GLU A CD  1 
ATOM   133   O  OE1 . GLU A  1 30  ? 61.087 57.978  33.530  1.00 88.90  ? 30  GLU A OE1 1 
ATOM   134   O  OE2 . GLU A  1 30  ? 62.012 57.212  35.376  1.00 91.79  ? 30  GLU A OE2 1 
ATOM   135   N  N   . THR A  1 31  ? 56.360 58.857  35.667  1.00 55.53  ? 31  THR A N   1 
ATOM   136   C  CA  . THR A  1 31  ? 55.964 59.845  36.675  1.00 53.45  ? 31  THR A CA  1 
ATOM   137   C  C   . THR A  1 31  ? 54.602 59.461  37.286  1.00 55.09  ? 31  THR A C   1 
ATOM   138   O  O   . THR A  1 31  ? 54.474 59.441  38.511  1.00 53.77  ? 31  THR A O   1 
ATOM   139   C  CB  . THR A  1 31  ? 55.919 61.252  36.040  1.00 58.49  ? 31  THR A CB  1 
ATOM   140   O  OG1 . THR A  1 31  ? 57.018 61.425  35.146  1.00 57.89  ? 31  THR A OG1 1 
ATOM   141   C  CG2 . THR A  1 31  ? 55.897 62.364  37.068  1.00 54.37  ? 31  THR A CG2 1 
ATOM   142   N  N   . LYS A  1 32  ? 53.593 59.175  36.423  1.00 50.86  ? 32  LYS A N   1 
ATOM   143   C  CA  . LYS A  1 32  ? 52.215 58.812  36.783  1.00 49.53  ? 32  LYS A CA  1 
ATOM   144   C  C   . LYS A  1 32  ? 52.155 57.591  37.689  1.00 53.11  ? 32  LYS A C   1 
ATOM   145   O  O   . LYS A  1 32  ? 51.384 57.596  38.649  1.00 52.42  ? 32  LYS A O   1 
ATOM   146   C  CB  . LYS A  1 32  ? 51.371 58.543  35.530  1.00 52.36  ? 32  LYS A CB  1 
ATOM   147   C  CG  . LYS A  1 32  ? 51.015 59.779  34.722  1.00 66.27  ? 32  LYS A CG  1 
ATOM   148   C  CD  . LYS A  1 32  ? 50.465 59.375  33.369  1.00 77.64  ? 32  LYS A CD  1 
ATOM   149   C  CE  . LYS A  1 32  ? 49.857 60.527  32.621  1.00 87.72  ? 32  LYS A CE  1 
ATOM   150   N  NZ  . LYS A  1 32  ? 49.253 60.077  31.340  1.00 98.94  ? 32  LYS A NZ  1 
ATOM   151   N  N   . GLU A  1 33  ? 52.953 56.547  37.386  1.00 49.97  ? 33  GLU A N   1 
ATOM   152   C  CA  . GLU A  1 33  ? 52.983 55.317  38.179  1.00 49.81  ? 33  GLU A CA  1 
ATOM   153   C  C   . GLU A  1 33  ? 53.652 55.557  39.531  1.00 53.15  ? 33  GLU A C   1 
ATOM   154   O  O   . GLU A  1 33  ? 53.195 55.011  40.538  1.00 52.91  ? 33  GLU A O   1 
ATOM   155   C  CB  . GLU A  1 33  ? 53.678 54.171  37.426  1.00 52.29  ? 33  GLU A CB  1 
ATOM   156   C  CG  . GLU A  1 33  ? 52.885 53.621  36.247  1.00 62.92  ? 33  GLU A CG  1 
ATOM   157   C  CD  . GLU A  1 33  ? 51.471 53.133  36.513  1.00 85.61  ? 33  GLU A CD  1 
ATOM   158   O  OE1 . GLU A  1 33  ? 51.238 52.488  37.562  1.00 74.37  ? 33  GLU A OE1 1 
ATOM   159   O  OE2 . GLU A  1 33  ? 50.598 53.374  35.648  1.00 84.60  ? 33  GLU A OE2 1 
ATOM   160   N  N   . TRP A  1 34  ? 54.726 56.375  39.550  1.00 48.71  ? 34  TRP A N   1 
ATOM   161   C  CA  . TRP A  1 34  ? 55.471 56.734  40.758  1.00 47.55  ? 34  TRP A CA  1 
ATOM   162   C  C   . TRP A  1 34  ? 54.568 57.509  41.725  1.00 49.55  ? 34  TRP A C   1 
ATOM   163   O  O   . TRP A  1 34  ? 54.600 57.242  42.928  1.00 49.19  ? 34  TRP A O   1 
ATOM   164   C  CB  . TRP A  1 34  ? 56.723 57.545  40.392  1.00 46.30  ? 34  TRP A CB  1 
ATOM   165   C  CG  . TRP A  1 34  ? 57.366 58.249  41.547  1.00 46.47  ? 34  TRP A CG  1 
ATOM   166   C  CD1 . TRP A  1 34  ? 58.187 57.705  42.489  1.00 49.76  ? 34  TRP A CD1 1 
ATOM   167   C  CD2 . TRP A  1 34  ? 57.228 59.634  41.884  1.00 45.24  ? 34  TRP A CD2 1 
ATOM   168   N  NE1 . TRP A  1 34  ? 58.574 58.665  43.392  1.00 48.52  ? 34  TRP A NE1 1 
ATOM   169   C  CE2 . TRP A  1 34  ? 58.005 59.862  43.040  1.00 49.05  ? 34  TRP A CE2 1 
ATOM   170   C  CE3 . TRP A  1 34  ? 56.529 60.711  41.311  1.00 45.60  ? 34  TRP A CE3 1 
ATOM   171   C  CZ2 . TRP A  1 34  ? 58.105 61.122  43.634  1.00 47.55  ? 34  TRP A CZ2 1 
ATOM   172   C  CZ3 . TRP A  1 34  ? 56.627 61.957  41.901  1.00 46.26  ? 34  TRP A CZ3 1 
ATOM   173   C  CH2 . TRP A  1 34  ? 57.409 62.156  43.045  1.00 46.89  ? 34  TRP A CH2 1 
ATOM   174   N  N   . LEU A  1 35  ? 53.760 58.452  41.190  1.00 44.58  ? 35  LEU A N   1 
ATOM   175   C  CA  . LEU A  1 35  ? 52.802 59.253  41.953  1.00 42.81  ? 35  LEU A CA  1 
ATOM   176   C  C   . LEU A  1 35  ? 51.703 58.342  42.514  1.00 46.88  ? 35  LEU A C   1 
ATOM   177   O  O   . LEU A  1 35  ? 51.313 58.509  43.668  1.00 45.56  ? 35  LEU A O   1 
ATOM   178   C  CB  . LEU A  1 35  ? 52.208 60.369  41.063  1.00 42.16  ? 35  LEU A CB  1 
ATOM   179   C  CG  . LEU A  1 35  ? 51.097 61.259  41.652  1.00 45.55  ? 35  LEU A CG  1 
ATOM   180   C  CD1 . LEU A  1 35  ? 51.594 62.088  42.824  1.00 44.77  ? 35  LEU A CD1 1 
ATOM   181   C  CD2 . LEU A  1 35  ? 50.526 62.176  40.597  1.00 47.72  ? 35  LEU A CD2 1 
ATOM   182   N  N   . LYS A  1 36  ? 51.247 57.355  41.705  1.00 44.82  ? 36  LYS A N   1 
ATOM   183   C  CA  . LYS A  1 36  ? 50.231 56.357  42.067  1.00 45.01  ? 36  LYS A CA  1 
ATOM   184   C  C   . LYS A  1 36  ? 50.716 55.507  43.246  1.00 49.63  ? 36  LYS A C   1 
ATOM   185   O  O   . LYS A  1 36  ? 49.937 55.252  44.164  1.00 49.13  ? 36  LYS A O   1 
ATOM   186   C  CB  . LYS A  1 36  ? 49.891 55.466  40.849  1.00 48.31  ? 36  LYS A CB  1 
ATOM   187   C  CG  . LYS A  1 36  ? 48.926 54.315  41.137  1.00 60.76  ? 36  LYS A CG  1 
ATOM   188   C  CD  . LYS A  1 36  ? 48.411 53.653  39.869  1.00 70.55  ? 36  LYS A CD  1 
ATOM   189   C  CE  . LYS A  1 36  ? 47.279 52.700  40.172  1.00 80.72  ? 36  LYS A CE  1 
ATOM   190   N  NZ  . LYS A  1 36  ? 46.681 52.131  38.940  1.00 91.26  ? 36  LYS A NZ  1 
ATOM   191   N  N   . ASN A  1 37  ? 52.003 55.092  43.222  1.00 46.95  ? 37  ASN A N   1 
ATOM   192   C  CA  . ASN A  1 37  ? 52.625 54.268  44.257  1.00 47.25  ? 37  ASN A CA  1 
ATOM   193   C  C   . ASN A  1 37  ? 52.674 54.988  45.612  1.00 50.48  ? 37  ASN A C   1 
ATOM   194   O  O   . ASN A  1 37  ? 52.321 54.378  46.618  1.00 50.98  ? 37  ASN A O   1 
ATOM   195   C  CB  . ASN A  1 37  ? 54.033 53.826  43.849  1.00 48.55  ? 37  ASN A CB  1 
ATOM   196   C  CG  . ASN A  1 37  ? 54.696 52.954  44.896  1.00 68.35  ? 37  ASN A CG  1 
ATOM   197   O  OD1 . ASN A  1 37  ? 54.261 51.830  45.175  1.00 59.71  ? 37  ASN A OD1 1 
ATOM   198   N  ND2 . ASN A  1 37  ? 55.720 53.484  45.549  1.00 61.24  ? 37  ASN A ND2 1 
ATOM   199   N  N   . ARG A  1 38  ? 53.085 56.269  45.641  1.00 45.19  ? 38  ARG A N   1 
ATOM   200   C  CA  . ARG A  1 38  ? 53.181 57.036  46.885  1.00 44.11  ? 38  ARG A CA  1 
ATOM   201   C  C   . ARG A  1 38  ? 51.791 57.309  47.499  1.00 48.54  ? 38  ARG A C   1 
ATOM   202   O  O   . ARG A  1 38  ? 51.684 57.406  48.720  1.00 48.46  ? 38  ARG A O   1 
ATOM   203   C  CB  . ARG A  1 38  ? 53.948 58.354  46.675  1.00 42.96  ? 38  ARG A CB  1 
ATOM   204   C  CG  . ARG A  1 38  ? 55.380 58.229  46.107  1.00 52.71  ? 38  ARG A CG  1 
ATOM   205   C  CD  . ARG A  1 38  ? 56.376 57.424  46.944  1.00 62.86  ? 38  ARG A CD  1 
ATOM   206   N  NE  . ARG A  1 38  ? 56.387 57.810  48.358  1.00 69.32  ? 38  ARG A NE  1 
ATOM   207   C  CZ  . ARG A  1 38  ? 57.227 58.685  48.902  1.00 80.08  ? 38  ARG A CZ  1 
ATOM   208   N  NH1 . ARG A  1 38  ? 57.155 58.965  50.195  1.00 68.31  ? 38  ARG A NH1 1 
ATOM   209   N  NH2 . ARG A  1 38  ? 58.148 59.285  48.158  1.00 63.95  ? 38  ARG A NH2 1 
ATOM   210   N  N   . ILE A  1 39  ? 50.735 57.403  46.667  1.00 45.44  ? 39  ILE A N   1 
ATOM   211   C  CA  . ILE A  1 39  ? 49.353 57.634  47.110  1.00 44.85  ? 39  ILE A CA  1 
ATOM   212   C  C   . ILE A  1 39  ? 48.690 56.298  47.546  1.00 50.95  ? 39  ILE A C   1 
ATOM   213   O  O   . ILE A  1 39  ? 47.754 56.336  48.345  1.00 50.49  ? 39  ILE A O   1 
ATOM   214   C  CB  . ILE A  1 39  ? 48.533 58.376  46.003  1.00 47.23  ? 39  ILE A CB  1 
ATOM   215   C  CG1 . ILE A  1 39  ? 49.103 59.793  45.767  1.00 46.96  ? 39  ILE A CG1 1 
ATOM   216   C  CG2 . ILE A  1 39  ? 47.021 58.441  46.319  1.00 47.35  ? 39  ILE A CG2 1 
ATOM   217   C  CD1 . ILE A  1 39  ? 48.649 60.483  44.500  1.00 53.81  ? 39  ILE A CD1 1 
ATOM   218   N  N   . ILE A  1 40  ? 49.175 55.138  47.046  1.00 49.57  ? 40  ILE A N   1 
ATOM   219   C  CA  . ILE A  1 40  ? 48.594 53.825  47.361  1.00 50.91  ? 40  ILE A CA  1 
ATOM   220   C  C   . ILE A  1 40  ? 49.340 53.109  48.520  1.00 57.52  ? 40  ILE A C   1 
ATOM   221   O  O   . ILE A  1 40  ? 48.671 52.644  49.450  1.00 57.44  ? 40  ILE A O   1 
ATOM   222   C  CB  . ILE A  1 40  ? 48.492 52.943  46.077  1.00 54.81  ? 40  ILE A CB  1 
ATOM   223   C  CG1 . ILE A  1 40  ? 47.195 53.288  45.308  1.00 54.89  ? 40  ILE A CG1 1 
ATOM   224   C  CG2 . ILE A  1 40  ? 48.581 51.432  46.369  1.00 57.22  ? 40  ILE A CG2 1 
ATOM   225   C  CD1 . ILE A  1 40  ? 47.004 52.612  43.943  1.00 64.07  ? 40  ILE A CD1 1 
ATOM   226   N  N   . ALA A  1 41  ? 50.696 53.023  48.462  1.00 55.91  ? 41  ALA A N   1 
ATOM   227   C  CA  . ALA A  1 41  ? 51.565 52.334  49.435  1.00 57.14  ? 41  ALA A CA  1 
ATOM   228   C  C   . ALA A  1 41  ? 51.259 52.701  50.891  1.00 61.63  ? 41  ALA A C   1 
ATOM   229   O  O   . ALA A  1 41  ? 50.966 53.859  51.186  1.00 59.79  ? 41  ALA A O   1 
ATOM   230   C  CB  . ALA A  1 41  ? 53.028 52.620  49.136  1.00 58.26  ? 41  ALA A CB  1 
ATOM   231   N  N   . LYS A  1 42  ? 51.329 51.698  51.793  1.00 60.16  ? 42  LYS A N   1 
ATOM   232   C  CA  . LYS A  1 42  ? 51.053 51.845  53.228  1.00 60.28  ? 42  LYS A CA  1 
ATOM   233   C  C   . LYS A  1 42  ? 52.018 52.838  53.894  1.00 64.64  ? 42  LYS A C   1 
ATOM   234   O  O   . LYS A  1 42  ? 53.166 52.970  53.457  1.00 64.63  ? 42  LYS A O   1 
ATOM   235   C  CB  . LYS A  1 42  ? 51.068 50.483  53.957  1.00 63.83  ? 42  LYS A CB  1 
ATOM   236   C  CG  . LYS A  1 42  ? 52.273 49.598  53.673  1.00 78.70  ? 42  LYS A CG  1 
ATOM   237   N  N   . LYS A  1 43  ? 51.531 53.545  54.941  1.00 60.74  ? 43  LYS A N   1 
ATOM   238   C  CA  . LYS A  1 43  ? 52.284 54.565  55.679  1.00 60.32  ? 43  LYS A CA  1 
ATOM   239   C  C   . LYS A  1 43  ? 53.582 54.016  56.286  1.00 66.44  ? 43  LYS A C   1 
ATOM   240   O  O   . LYS A  1 43  ? 54.540 54.776  56.426  1.00 65.56  ? 43  LYS A O   1 
ATOM   241   C  CB  . LYS A  1 43  ? 51.418 55.225  56.757  1.00 62.06  ? 43  LYS A CB  1 
ATOM   242   C  CG  . LYS A  1 43  ? 50.428 56.235  56.181  1.00 75.13  ? 43  LYS A CG  1 
ATOM   243   C  CD  . LYS A  1 43  ? 49.887 57.201  57.228  1.00 84.46  ? 43  LYS A CD  1 
ATOM   244   C  CE  . LYS A  1 43  ? 50.628 58.518  57.236  1.00 93.52  ? 43  LYS A CE  1 
ATOM   245   N  NZ  . LYS A  1 43  ? 49.917 59.549  58.039  1.00 100.00 ? 43  LYS A NZ  1 
ATOM   246   N  N   . LYS A  1 44  ? 53.627 52.701  56.592  1.00 65.95  ? 44  LYS A N   1 
ATOM   247   C  CA  . LYS A  1 44  ? 54.805 52.003  57.124  1.00 67.87  ? 44  LYS A CA  1 
ATOM   248   C  C   . LYS A  1 44  ? 55.988 52.094  56.143  1.00 74.25  ? 44  LYS A C   1 
ATOM   249   O  O   . LYS A  1 44  ? 57.125 52.305  56.572  1.00 74.82  ? 44  LYS A O   1 
ATOM   250   C  CB  . LYS A  1 44  ? 54.472 50.528  57.417  1.00 71.35  ? 44  LYS A CB  1 
ATOM   251   N  N   . ASP A  1 45  ? 55.703 51.970  54.828  1.00 71.38  ? 45  ASP A N   1 
ATOM   252   C  CA  . ASP A  1 45  ? 56.686 52.035  53.742  1.00 71.79  ? 45  ASP A CA  1 
ATOM   253   C  C   . ASP A  1 45  ? 56.884 53.474  53.222  1.00 74.04  ? 45  ASP A C   1 
ATOM   254   O  O   . ASP A  1 45  ? 57.666 53.688  52.289  1.00 74.24  ? 45  ASP A O   1 
ATOM   255   C  CB  . ASP A  1 45  ? 56.252 51.121  52.575  1.00 74.33  ? 45  ASP A CB  1 
ATOM   256   C  CG  . ASP A  1 45  ? 55.808 49.716  52.951  1.00 87.55  ? 45  ASP A CG  1 
ATOM   257   O  OD1 . ASP A  1 45  ? 56.088 49.286  54.096  1.00 89.00  ? 45  ASP A OD1 1 
ATOM   258   O  OD2 . ASP A  1 45  ? 55.184 49.046  52.100  1.00 94.27  ? 45  ASP A OD2 1 
ATOM   259   N  N   . GLY A  1 46  ? 56.180 54.431  53.825  1.00 68.24  ? 46  GLY A N   1 
ATOM   260   C  CA  . GLY A  1 46  ? 56.242 55.833  53.432  1.00 66.39  ? 46  GLY A CA  1 
ATOM   261   C  C   . GLY A  1 46  ? 55.281 56.124  52.301  1.00 67.62  ? 46  GLY A C   1 
ATOM   262   O  O   . GLY A  1 46  ? 55.377 55.522  51.228  1.00 67.71  ? 46  GLY A O   1 
ATOM   263   N  N   . GLY A  1 47  ? 54.351 57.034  52.558  1.00 61.56  ? 47  GLY A N   1 
ATOM   264   C  CA  . GLY A  1 47  ? 53.317 57.423  51.611  1.00 60.14  ? 47  GLY A CA  1 
ATOM   265   C  C   . GLY A  1 47  ? 51.933 57.106  52.137  1.00 62.52  ? 47  GLY A C   1 
ATOM   266   O  O   . GLY A  1 47  ? 51.758 56.112  52.844  1.00 62.46  ? 47  GLY A O   1 
ATOM   267   N  N   . ALA A  1 48  ? 50.945 57.962  51.801  1.00 57.59  ? 48  ALA A N   1 
ATOM   268   C  CA  . ALA A  1 48  ? 49.540 57.860  52.212  1.00 56.75  ? 48  ALA A CA  1 
ATOM   269   C  C   . ALA A  1 48  ? 48.929 56.545  51.771  1.00 60.96  ? 48  ALA A C   1 
ATOM   270   O  O   . ALA A  1 48  ? 49.203 56.084  50.666  1.00 61.84  ? 48  ALA A O   1 
ATOM   271   C  CB  . ALA A  1 48  ? 48.746 59.015  51.635  1.00 56.59  ? 48  ALA A CB  1 
ATOM   272   N  N   . GLN A  1 49  ? 48.118 55.932  52.645  1.00 56.29  ? 49  GLN A N   1 
ATOM   273   C  CA  . GLN A  1 49  ? 47.470 54.638  52.404  1.00 55.98  ? 49  GLN A CA  1 
ATOM   274   C  C   . GLN A  1 49  ? 46.080 54.862  51.774  1.00 56.84  ? 49  GLN A C   1 
ATOM   275   O  O   . GLN A  1 49  ? 45.081 54.276  52.208  1.00 57.22  ? 49  GLN A O   1 
ATOM   276   C  CB  . GLN A  1 49  ? 47.388 53.876  53.737  1.00 57.95  ? 49  GLN A CB  1 
ATOM   277   C  CG  . GLN A  1 49  ? 47.398 52.365  53.648  1.00 70.49  ? 49  GLN A CG  1 
ATOM   278   C  CD  . GLN A  1 49  ? 47.527 51.779  55.032  1.00 88.16  ? 49  GLN A CD  1 
ATOM   279   O  OE1 . GLN A  1 49  ? 48.555 51.929  55.710  1.00 81.64  ? 49  GLN A OE1 1 
ATOM   280   N  NE2 . GLN A  1 49  ? 46.475 51.124  55.495  1.00 83.09  ? 49  GLN A NE2 1 
ATOM   281   N  N   . LEU A  1 50  ? 46.032 55.724  50.738  1.00 49.68  ? 50  LEU A N   1 
ATOM   282   C  CA  . LEU A  1 50  ? 44.809 56.083  50.019  1.00 47.74  ? 50  LEU A CA  1 
ATOM   283   C  C   . LEU A  1 50  ? 44.589 55.161  48.812  1.00 49.60  ? 50  LEU A C   1 
ATOM   284   O  O   . LEU A  1 50  ? 45.350 54.215  48.603  1.00 49.37  ? 50  LEU A O   1 
ATOM   285   C  CB  . LEU A  1 50  ? 44.861 57.563  49.565  1.00 46.69  ? 50  LEU A CB  1 
ATOM   286   C  CG  . LEU A  1 50  ? 45.071 58.644  50.638  1.00 50.21  ? 50  LEU A CG  1 
ATOM   287   C  CD1 . LEU A  1 50  ? 45.419 59.975  50.000  1.00 49.56  ? 50  LEU A CD1 1 
ATOM   288   C  CD2 . LEU A  1 50  ? 43.849 58.803  51.529  1.00 51.50  ? 50  LEU A CD2 1 
ATOM   289   N  N   . LEU A  1 51  ? 43.531 55.437  48.039  1.00 44.98  ? 51  LEU A N   1 
ATOM   290   C  CA  . LEU A  1 51  ? 43.162 54.705  46.835  1.00 45.14  ? 51  LEU A CA  1 
ATOM   291   C  C   . LEU A  1 51  ? 43.305 55.629  45.627  1.00 49.96  ? 51  LEU A C   1 
ATOM   292   O  O   . LEU A  1 51  ? 42.948 56.804  45.700  1.00 48.58  ? 51  LEU A O   1 
ATOM   293   C  CB  . LEU A  1 51  ? 41.732 54.135  46.942  1.00 45.18  ? 51  LEU A CB  1 
ATOM   294   C  CG  . LEU A  1 51  ? 41.356 53.395  48.239  1.00 49.60  ? 51  LEU A CG  1 
ATOM   295   C  CD1 . LEU A  1 51  ? 39.880 53.094  48.282  1.00 49.92  ? 51  LEU A CD1 1 
ATOM   296   C  CD2 . LEU A  1 51  ? 42.158 52.117  48.425  1.00 52.23  ? 51  LEU A CD2 1 
ATOM   297   N  N   . PHE A  1 52  ? 43.871 55.110  44.533  1.00 48.61  ? 52  PHE A N   1 
ATOM   298   C  CA  . PHE A  1 52  ? 44.118 55.870  43.310  1.00 48.87  ? 52  PHE A CA  1 
ATOM   299   C  C   . PHE A  1 52  ? 43.587 55.117  42.101  1.00 54.15  ? 52  PHE A C   1 
ATOM   300   O  O   . PHE A  1 52  ? 43.836 53.916  41.966  1.00 55.27  ? 52  PHE A O   1 
ATOM   301   C  CB  . PHE A  1 52  ? 45.626 56.117  43.165  1.00 51.06  ? 52  PHE A CB  1 
ATOM   302   C  CG  . PHE A  1 52  ? 46.064 57.140  42.147  1.00 52.74  ? 52  PHE A CG  1 
ATOM   303   C  CD1 . PHE A  1 52  ? 46.241 58.471  42.506  1.00 55.28  ? 52  PHE A CD1 1 
ATOM   304   C  CD2 . PHE A  1 52  ? 46.392 56.759  40.852  1.00 55.81  ? 52  PHE A CD2 1 
ATOM   305   C  CE1 . PHE A  1 52  ? 46.695 59.408  41.574  1.00 56.19  ? 52  PHE A CE1 1 
ATOM   306   C  CE2 . PHE A  1 52  ? 46.859 57.694  39.926  1.00 58.55  ? 52  PHE A CE2 1 
ATOM   307   C  CZ  . PHE A  1 52  ? 47.008 59.010  40.292  1.00 55.85  ? 52  PHE A CZ  1 
ATOM   308   N  N   . ARG A  1 53  ? 42.861 55.827  41.219  1.00 50.39  ? 53  ARG A N   1 
ATOM   309   C  CA  . ARG A  1 53  ? 42.266 55.274  39.997  1.00 50.89  ? 53  ARG A CA  1 
ATOM   310   C  C   . ARG A  1 53  ? 42.041 56.399  38.963  1.00 55.42  ? 53  ARG A C   1 
ATOM   311   O  O   . ARG A  1 53  ? 41.667 57.503  39.362  1.00 54.01  ? 53  ARG A O   1 
ATOM   312   C  CB  . ARG A  1 53  ? 40.959 54.522  40.346  1.00 50.22  ? 53  ARG A CB  1 
ATOM   313   C  CG  . ARG A  1 53  ? 39.743 54.746  39.451  1.00 57.08  ? 53  ARG A CG  1 
ATOM   314   C  CD  . ARG A  1 53  ? 38.480 54.297  40.158  1.00 61.75  ? 53  ARG A CD  1 
ATOM   315   N  NE  . ARG A  1 53  ? 37.321 55.105  39.779  1.00 65.02  ? 53  ARG A NE  1 
ATOM   316   C  CZ  . ARG A  1 53  ? 36.291 55.370  40.580  1.00 75.27  ? 53  ARG A CZ  1 
ATOM   317   N  NH1 . ARG A  1 53  ? 36.273 54.916  41.828  1.00 58.58  ? 53  ARG A NH1 1 
ATOM   318   N  NH2 . ARG A  1 53  ? 35.280 56.107  40.146  1.00 61.80  ? 53  ARG A NH2 1 
ATOM   319   N  N   . PRO A  1 54  ? 42.268 56.155  37.644  1.00 54.35  ? 54  PRO A N   1 
ATOM   320   C  CA  . PRO A  1 54  ? 42.020 57.215  36.647  1.00 54.76  ? 54  PRO A CA  1 
ATOM   321   C  C   . PRO A  1 54  ? 40.528 57.473  36.458  1.00 61.08  ? 54  PRO A C   1 
ATOM   322   O  O   . PRO A  1 54  ? 39.721 56.572  36.722  1.00 61.50  ? 54  PRO A O   1 
ATOM   323   C  CB  . PRO A  1 54  ? 42.648 56.658  35.358  1.00 57.32  ? 54  PRO A CB  1 
ATOM   324   C  CG  . PRO A  1 54  ? 43.392 55.421  35.759  1.00 61.95  ? 54  PRO A CG  1 
ATOM   325   C  CD  . PRO A  1 54  ? 42.715 54.913  36.988  1.00 57.16  ? 54  PRO A CD  1 
ATOM   326   N  N   . LEU A  1 55  ? 40.160 58.691  35.984  1.00 58.36  ? 55  LEU A N   1 
ATOM   327   C  CA  . LEU A  1 55  ? 38.762 59.087  35.753  1.00 58.87  ? 55  LEU A CA  1 
ATOM   328   C  C   . LEU A  1 55  ? 38.036 58.062  34.863  1.00 65.70  ? 55  LEU A C   1 
ATOM   329   O  O   . LEU A  1 55  ? 36.886 57.707  35.152  1.00 66.13  ? 55  LEU A O   1 
ATOM   330   C  CB  . LEU A  1 55  ? 38.671 60.503  35.156  1.00 58.42  ? 55  LEU A CB  1 
ATOM   331   C  CG  . LEU A  1 55  ? 37.271 61.050  34.822  1.00 63.02  ? 55  LEU A CG  1 
ATOM   332   C  CD1 . LEU A  1 55  ? 36.350 61.063  36.041  1.00 62.28  ? 55  LEU A CD1 1 
ATOM   333   C  CD2 . LEU A  1 55  ? 37.368 62.427  34.229  1.00 65.37  ? 55  LEU A CD2 1 
ATOM   334   N  N   . LEU A  1 56  ? 38.729 57.560  33.825  1.00 63.49  ? 56  LEU A N   1 
ATOM   335   C  CA  . LEU A  1 56  ? 38.214 56.531  32.920  1.00 99.77  ? 56  LEU A CA  1 
ATOM   336   C  C   . LEU A  1 56  ? 39.103 55.292  32.986  1.00 132.66 ? 56  LEU A C   1 
ATOM   337   O  O   . LEU A  1 56  ? 40.327 55.410  33.006  1.00 94.11  ? 56  LEU A O   1 
ATOM   338   C  CB  . LEU A  1 56  ? 38.119 57.049  31.481  1.00 100.59 ? 56  LEU A CB  1 
ATOM   339   C  CG  . LEU A  1 56  ? 37.143 58.194  31.257  1.00 105.17 ? 56  LEU A CG  1 
ATOM   340   C  CD1 . LEU A  1 56  ? 37.888 59.472  30.962  1.00 104.58 ? 56  LEU A CD1 1 
ATOM   341   C  CD2 . LEU A  1 56  ? 36.160 57.865  30.150  1.00 109.44 ? 56  LEU A CD2 1 
ATOM   342   N  N   . GLN A  1 67  ? 42.820 62.793  29.522  1.00 77.62  ? 67  GLN A N   1 
ATOM   343   C  CA  . GLN A  1 67  ? 42.983 64.175  29.983  1.00 76.43  ? 67  GLN A CA  1 
ATOM   344   C  C   . GLN A  1 67  ? 43.827 64.259  31.276  1.00 78.12  ? 67  GLN A C   1 
ATOM   345   O  O   . GLN A  1 67  ? 43.965 65.346  31.843  1.00 77.05  ? 67  GLN A O   1 
ATOM   346   C  CB  . GLN A  1 67  ? 41.616 64.857  30.186  1.00 77.48  ? 67  GLN A CB  1 
ATOM   347   C  CG  . GLN A  1 67  ? 40.992 65.351  28.886  1.00 95.76  ? 67  GLN A CG  1 
ATOM   348   N  N   . ASN A  1 68  ? 44.416 63.116  31.709  1.00 72.93  ? 68  ASN A N   1 
ATOM   349   C  CA  . ASN A  1 68  ? 45.273 62.961  32.892  1.00 70.63  ? 68  ASN A CA  1 
ATOM   350   C  C   . ASN A  1 68  ? 44.582 63.475  34.175  1.00 69.98  ? 68  ASN A C   1 
ATOM   351   O  O   . ASN A  1 68  ? 45.168 64.229  34.959  1.00 68.68  ? 68  ASN A O   1 
ATOM   352   C  CB  . ASN A  1 68  ? 46.647 63.619  32.673  1.00 71.09  ? 68  ASN A CB  1 
ATOM   353   C  CG  . ASN A  1 68  ? 47.483 62.959  31.598  1.00 95.29  ? 68  ASN A CG  1 
ATOM   354   O  OD1 . ASN A  1 68  ? 47.136 61.905  31.044  1.00 89.43  ? 68  ASN A OD1 1 
ATOM   355   N  ND2 . ASN A  1 68  ? 48.628 63.550  31.298  1.00 88.51  ? 68  ASN A ND2 1 
ATOM   356   N  N   . LEU A  1 69  ? 43.322 63.040  34.371  1.00 63.77  ? 69  LEU A N   1 
ATOM   357   C  CA  . LEU A  1 69  ? 42.494 63.331  35.543  1.00 61.10  ? 69  LEU A CA  1 
ATOM   358   C  C   . LEU A  1 69  ? 42.394 62.066  36.374  1.00 62.00  ? 69  LEU A C   1 
ATOM   359   O  O   . LEU A  1 69  ? 42.044 61.009  35.840  1.00 62.56  ? 69  LEU A O   1 
ATOM   360   C  CB  . LEU A  1 69  ? 41.104 63.840  35.136  1.00 61.09  ? 69  LEU A CB  1 
ATOM   361   C  CG  . LEU A  1 69  ? 41.029 65.296  34.700  1.00 65.29  ? 69  LEU A CG  1 
ATOM   362   C  CD1 . LEU A  1 69  ? 39.901 65.506  33.723  1.00 66.23  ? 69  LEU A CD1 1 
ATOM   363   C  CD2 . LEU A  1 69  ? 40.880 66.220  35.891  1.00 65.95  ? 69  LEU A CD2 1 
ATOM   364   N  N   . TYR A  1 70  ? 42.747 62.152  37.661  1.00 55.36  ? 70  TYR A N   1 
ATOM   365   C  CA  . TYR A  1 70  ? 42.761 60.979  38.531  1.00 54.34  ? 70  TYR A CA  1 
ATOM   366   C  C   . TYR A  1 70  ? 41.937 61.192  39.796  1.00 54.49  ? 70  TYR A C   1 
ATOM   367   O  O   . TYR A  1 70  ? 41.944 62.283  40.362  1.00 53.10  ? 70  TYR A O   1 
ATOM   368   C  CB  . TYR A  1 70  ? 44.208 60.605  38.874  1.00 55.77  ? 70  TYR A CB  1 
ATOM   369   C  CG  . TYR A  1 70  ? 45.026 60.220  37.657  1.00 58.48  ? 70  TYR A CG  1 
ATOM   370   C  CD1 . TYR A  1 70  ? 45.069 58.904  37.211  1.00 61.49  ? 70  TYR A CD1 1 
ATOM   371   C  CD2 . TYR A  1 70  ? 45.740 61.176  36.941  1.00 59.25  ? 70  TYR A CD2 1 
ATOM   372   C  CE1 . TYR A  1 70  ? 45.796 58.547  36.078  1.00 63.61  ? 70  TYR A CE1 1 
ATOM   373   C  CE2 . TYR A  1 70  ? 46.470 60.832  35.805  1.00 61.24  ? 70  TYR A CE2 1 
ATOM   374   C  CZ  . TYR A  1 70  ? 46.497 59.514  35.377  1.00 70.46  ? 70  TYR A CZ  1 
ATOM   375   O  OH  . TYR A  1 70  ? 47.218 59.161  34.261  1.00 72.98  ? 70  TYR A OH  1 
ATOM   376   N  N   . LEU A  1 71  ? 41.224 60.136  40.225  1.00 49.47  ? 71  LEU A N   1 
ATOM   377   C  CA  . LEU A  1 71  ? 40.336 60.135  41.392  1.00 48.13  ? 71  LEU A CA  1 
ATOM   378   C  C   . LEU A  1 71  ? 41.008 59.486  42.602  1.00 50.07  ? 71  LEU A C   1 
ATOM   379   O  O   . LEU A  1 71  ? 41.656 58.446  42.466  1.00 50.26  ? 71  LEU A O   1 
ATOM   380   C  CB  . LEU A  1 71  ? 39.013 59.411  41.071  1.00 48.96  ? 71  LEU A CB  1 
ATOM   381   C  CG  . LEU A  1 71  ? 38.297 59.807  39.768  1.00 54.24  ? 71  LEU A CG  1 
ATOM   382   C  CD1 . LEU A  1 71  ? 37.449 58.667  39.245  1.00 55.13  ? 71  LEU A CD1 1 
ATOM   383   C  CD2 . LEU A  1 71  ? 37.479 61.085  39.937  1.00 56.56  ? 71  LEU A CD2 1 
ATOM   384   N  N   . VAL A  1 72  ? 40.863 60.120  43.785  1.00 44.56  ? 72  VAL A N   1 
ATOM   385   C  CA  . VAL A  1 72  ? 41.459 59.666  45.045  1.00 43.60  ? 72  VAL A CA  1 
ATOM   386   C  C   . VAL A  1 72  ? 40.361 59.498  46.113  1.00 48.26  ? 72  VAL A C   1 
ATOM   387   O  O   . VAL A  1 72  ? 39.498 60.361  46.271  1.00 47.67  ? 72  VAL A O   1 
ATOM   388   C  CB  . VAL A  1 72  ? 42.607 60.604  45.530  1.00 46.16  ? 72  VAL A CB  1 
ATOM   389   C  CG1 . VAL A  1 72  ? 43.285 60.061  46.784  1.00 45.86  ? 72  VAL A CG1 1 
ATOM   390   C  CG2 . VAL A  1 72  ? 43.645 60.822  44.435  1.00 46.11  ? 72  VAL A CG2 1 
ATOM   391   N  N   . GLY A  1 73  ? 40.405 58.362  46.799  1.00 46.09  ? 73  GLY A N   1 
ATOM   392   C  CA  . GLY A  1 73  ? 39.509 57.987  47.886  1.00 46.57  ? 73  GLY A CA  1 
ATOM   393   C  C   . GLY A  1 73  ? 40.267 57.208  48.944  1.00 52.60  ? 73  GLY A C   1 
ATOM   394   O  O   . GLY A  1 73  ? 41.497 57.135  48.885  1.00 52.15  ? 73  GLY A O   1 
ATOM   395   N  N   . ALA A  1 74  ? 39.552 56.627  49.926  1.00 51.19  ? 74  ALA A N   1 
ATOM   396   C  CA  . ALA A  1 74  ? 40.148 55.830  51.007  1.00 52.31  ? 74  ALA A CA  1 
ATOM   397   C  C   . ALA A  1 74  ? 39.125 54.883  51.638  1.00 59.60  ? 74  ALA A C   1 
ATOM   398   O  O   . ALA A  1 74  ? 37.924 55.012  51.389  1.00 60.31  ? 74  ALA A O   1 
ATOM   399   C  CB  . ALA A  1 74  ? 40.734 56.741  52.080  1.00 52.19  ? 74  ALA A CB  1 
ATOM   400   N  N   . SER A  1 75  ? 39.608 53.935  52.463  1.00 57.20  ? 75  SER A N   1 
ATOM   401   C  CA  . SER A  1 75  ? 38.770 52.985  53.196  1.00 57.94  ? 75  SER A CA  1 
ATOM   402   C  C   . SER A  1 75  ? 38.086 53.702  54.362  1.00 61.85  ? 75  SER A C   1 
ATOM   403   O  O   . SER A  1 75  ? 38.588 54.738  54.813  1.00 60.49  ? 75  SER A O   1 
ATOM   404   C  CB  . SER A  1 75  ? 39.615 51.825  53.715  1.00 62.24  ? 75  SER A CB  1 
ATOM   405   O  OG  . SER A  1 75  ? 40.523 51.345  52.737  1.00 70.83  ? 75  SER A OG  1 
ATOM   406   N  N   . LYS A  1 76  ? 36.955 53.155  54.859  1.00 59.40  ? 76  LYS A N   1 
ATOM   407   C  CA  . LYS A  1 76  ? 36.218 53.716  55.999  1.00 58.96  ? 76  LYS A CA  1 
ATOM   408   C  C   . LYS A  1 76  ? 37.119 53.732  57.239  1.00 61.94  ? 76  LYS A C   1 
ATOM   409   O  O   . LYS A  1 76  ? 37.154 54.736  57.948  1.00 60.76  ? 76  LYS A O   1 
ATOM   410   C  CB  . LYS A  1 76  ? 34.919 52.927  56.263  1.00 62.81  ? 76  LYS A CB  1 
ATOM   411   C  CG  . LYS A  1 76  ? 33.928 53.636  57.191  1.00 76.20  ? 76  LYS A CG  1 
ATOM   412   C  CD  . LYS A  1 76  ? 32.749 52.746  57.566  1.00 86.86  ? 76  LYS A CD  1 
ATOM   413   N  N   . ILE A  1 77  ? 37.878 52.630  57.460  1.00 58.74  ? 77  ILE A N   1 
ATOM   414   C  CA  . ILE A  1 77  ? 38.820 52.459  58.571  1.00 58.54  ? 77  ILE A CA  1 
ATOM   415   C  C   . ILE A  1 77  ? 40.011 53.415  58.393  1.00 61.01  ? 77  ILE A C   1 
ATOM   416   O  O   . ILE A  1 77  ? 40.429 54.045  59.370  1.00 60.87  ? 77  ILE A O   1 
ATOM   417   C  CB  . ILE A  1 77  ? 39.277 50.975  58.714  1.00 62.92  ? 77  ILE A CB  1 
ATOM   418   C  CG1 . ILE A  1 77  ? 38.088 49.954  58.612  1.00 64.39  ? 77  ILE A CG1 1 
ATOM   419   C  CG2 . ILE A  1 77  ? 40.120 50.745  59.981  1.00 63.98  ? 77  ILE A CG2 1 
ATOM   420   C  CD1 . ILE A  1 77  ? 36.814 50.039  59.611  1.00 71.00  ? 77  ILE A CD1 1 
ATOM   421   N  N   . ARG A  1 78  ? 40.530 53.549  57.146  1.00 56.04  ? 78  ARG A N   1 
ATOM   422   C  CA  . ARG A  1 78  ? 41.640 54.450  56.803  1.00 54.45  ? 78  ARG A CA  1 
ATOM   423   C  C   . ARG A  1 78  ? 41.263 55.909  57.095  1.00 57.21  ? 78  ARG A C   1 
ATOM   424   O  O   . ARG A  1 78  ? 42.086 56.653  57.641  1.00 56.01  ? 78  ARG A O   1 
ATOM   425   C  CB  . ARG A  1 78  ? 42.057 54.277  55.323  1.00 53.09  ? 78  ARG A CB  1 
ATOM   426   C  CG  . ARG A  1 78  ? 43.076 55.296  54.779  1.00 58.23  ? 78  ARG A CG  1 
ATOM   427   C  CD  . ARG A  1 78  ? 44.388 55.295  55.542  1.00 65.26  ? 78  ARG A CD  1 
ATOM   428   N  NE  . ARG A  1 78  ? 45.396 56.154  54.923  1.00 68.03  ? 78  ARG A NE  1 
ATOM   429   C  CZ  . ARG A  1 78  ? 45.825 57.307  55.426  1.00 73.45  ? 78  ARG A CZ  1 
ATOM   430   N  NH1 . ARG A  1 78  ? 45.313 57.779  56.557  1.00 54.29  ? 78  ARG A NH1 1 
ATOM   431   N  NH2 . ARG A  1 78  ? 46.765 57.999  54.801  1.00 60.77  ? 78  ARG A NH2 1 
ATOM   432   N  N   . MET A  1 79  ? 40.020 56.300  56.747  1.00 53.84  ? 79  MET A N   1 
ATOM   433   C  CA  . MET A  1 79  ? 39.494 57.646  56.971  1.00 52.81  ? 79  MET A CA  1 
ATOM   434   C  C   . MET A  1 79  ? 39.435 57.987  58.460  1.00 56.63  ? 79  MET A C   1 
ATOM   435   O  O   . MET A  1 79  ? 39.778 59.110  58.838  1.00 55.49  ? 79  MET A O   1 
ATOM   436   C  CB  . MET A  1 79  ? 38.101 57.816  56.341  1.00 55.15  ? 79  MET A CB  1 
ATOM   437   C  CG  . MET A  1 79  ? 38.117 58.089  54.833  1.00 58.60  ? 79  MET A CG  1 
ATOM   438   S  SD  . MET A  1 79  ? 39.237 59.376  54.184  1.00 61.67  ? 79  MET A SD  1 
ATOM   439   C  CE  . MET A  1 79  ? 38.930 60.650  55.266  1.00 57.65  ? 79  MET A CE  1 
ATOM   440   N  N   . LEU A  1 80  ? 39.017 57.013  59.298  1.00 53.57  ? 80  LEU A N   1 
ATOM   441   C  CA  . LEU A  1 80  ? 38.922 57.179  60.747  1.00 53.57  ? 80  LEU A CA  1 
ATOM   442   C  C   . LEU A  1 80  ? 40.313 57.335  61.362  1.00 57.88  ? 80  LEU A C   1 
ATOM   443   O  O   . LEU A  1 80  ? 40.488 58.150  62.273  1.00 57.37  ? 80  LEU A O   1 
ATOM   444   C  CB  . LEU A  1 80  ? 38.168 56.006  61.394  1.00 54.69  ? 80  LEU A CB  1 
ATOM   445   C  CG  . LEU A  1 80  ? 36.688 55.863  61.033  1.00 59.46  ? 80  LEU A CG  1 
ATOM   446   C  CD1 . LEU A  1 80  ? 36.169 54.512  61.434  1.00 61.06  ? 80  LEU A CD1 1 
ATOM   447   C  CD2 . LEU A  1 80  ? 35.841 56.958  61.658  1.00 61.46  ? 80  LEU A CD2 1 
ATOM   448   N  N   . LEU A  1 81  ? 41.308 56.590  60.833  1.00 54.63  ? 81  LEU A N   1 
ATOM   449   C  CA  . LEU A  1 81  ? 42.702 56.667  61.282  1.00 54.53  ? 81  LEU A CA  1 
ATOM   450   C  C   . LEU A  1 81  ? 43.322 58.002  60.866  1.00 58.59  ? 81  LEU A C   1 
ATOM   451   O  O   . LEU A  1 81  ? 44.170 58.539  61.582  1.00 57.90  ? 81  LEU A O   1 
ATOM   452   C  CB  . LEU A  1 81  ? 43.527 55.492  60.736  1.00 55.01  ? 81  LEU A CB  1 
ATOM   453   C  CG  . LEU A  1 81  ? 43.242 54.128  61.356  1.00 60.34  ? 81  LEU A CG  1 
ATOM   454   C  CD1 . LEU A  1 81  ? 43.759 53.026  60.472  1.00 61.20  ? 81  LEU A CD1 1 
ATOM   455   C  CD2 . LEU A  1 81  ? 43.827 54.015  62.756  1.00 62.95  ? 81  LEU A CD2 1 
ATOM   456   N  N   . GLY A  1 82  ? 42.868 58.523  59.726  1.00 55.52  ? 82  GLY A N   1 
ATOM   457   C  CA  . GLY A  1 82  ? 43.281 59.815  59.198  1.00 54.84  ? 82  GLY A CA  1 
ATOM   458   C  C   . GLY A  1 82  ? 42.669 60.961  59.986  1.00 59.06  ? 82  GLY A C   1 
ATOM   459   O  O   . GLY A  1 82  ? 43.291 62.019  60.118  1.00 58.90  ? 82  GLY A O   1 
ATOM   460   N  N   . ALA A  1 83  ? 41.443 60.750  60.526  1.00 55.16  ? 83  ALA A N   1 
ATOM   461   C  CA  . ALA A  1 83  ? 40.706 61.719  61.354  1.00 54.23  ? 83  ALA A CA  1 
ATOM   462   C  C   . ALA A  1 83  ? 41.384 61.903  62.712  1.00 56.85  ? 83  ALA A C   1 
ATOM   463   O  O   . ALA A  1 83  ? 41.346 62.998  63.278  1.00 55.11  ? 83  ALA A O   1 
ATOM   464   C  CB  . ALA A  1 83  ? 39.271 61.259  61.546  1.00 55.53  ? 83  ALA A CB  1 
ATOM   465   N  N   . GLU A  1 84  ? 41.999 60.819  63.229  1.00 54.18  ? 84  GLU A N   1 
ATOM   466   C  CA  . GLU A  1 84  ? 42.757 60.782  64.478  1.00 54.18  ? 84  GLU A CA  1 
ATOM   467   C  C   . GLU A  1 84  ? 44.070 61.554  64.286  1.00 58.91  ? 84  GLU A C   1 
ATOM   468   O  O   . GLU A  1 84  ? 44.473 62.307  65.179  1.00 58.23  ? 84  GLU A O   1 
ATOM   469   C  CB  . GLU A  1 84  ? 43.023 59.315  64.880  1.00 56.36  ? 84  GLU A CB  1 
ATOM   470   C  CG  . GLU A  1 84  ? 43.782 59.135  66.186  1.00 63.34  ? 84  GLU A CG  1 
ATOM   471   C  CD  . GLU A  1 84  ? 44.081 57.710  66.615  1.00 78.35  ? 84  GLU A CD  1 
ATOM   472   O  OE1 . GLU A  1 84  ? 43.283 56.797  66.300  1.00 65.88  ? 84  GLU A OE1 1 
ATOM   473   O  OE2 . GLU A  1 84  ? 45.099 57.517  67.318  1.00 72.67  ? 84  GLU A OE2 1 
ATOM   474   N  N   . ALA A  1 85  ? 44.713 61.365  63.100  1.00 56.09  ? 85  ALA A N   1 
ATOM   475   C  CA  . ALA A  1 85  ? 45.980 61.977  62.678  1.00 55.81  ? 85  ALA A CA  1 
ATOM   476   C  C   . ALA A  1 85  ? 45.898 63.505  62.647  1.00 59.47  ? 85  ALA A C   1 
ATOM   477   O  O   . ALA A  1 85  ? 46.808 64.165  63.153  1.00 59.07  ? 85  ALA A O   1 
ATOM   478   C  CB  . ALA A  1 85  ? 46.385 61.451  61.308  1.00 56.51  ? 85  ALA A CB  1 
ATOM   479   N  N   . VAL A  1 86  ? 44.805 64.060  62.075  1.00 55.67  ? 86  VAL A N   1 
ATOM   480   C  CA  . VAL A  1 86  ? 44.571 65.509  61.986  1.00 54.60  ? 86  VAL A CA  1 
ATOM   481   C  C   . VAL A  1 86  ? 44.070 66.062  63.345  1.00 60.08  ? 86  VAL A C   1 
ATOM   482   O  O   . VAL A  1 86  ? 44.177 67.266  63.596  1.00 59.13  ? 86  VAL A O   1 
ATOM   483   C  CB  . VAL A  1 86  ? 43.625 65.909  60.820  1.00 57.31  ? 86  VAL A CB  1 
ATOM   484   C  CG1 . VAL A  1 86  ? 44.261 65.616  59.472  1.00 56.99  ? 86  VAL A CG1 1 
ATOM   485   C  CG2 . VAL A  1 86  ? 42.265 65.232  60.927  1.00 57.36  ? 86  VAL A CG2 1 
ATOM   486   N  N   . GLY A  1 87  ? 43.542 65.171  64.188  1.00 58.23  ? 87  GLY A N   1 
ATOM   487   C  CA  . GLY A  1 87  ? 43.038 65.494  65.517  1.00 58.59  ? 87  GLY A CA  1 
ATOM   488   C  C   . GLY A  1 87  ? 41.688 66.177  65.519  1.00 62.54  ? 87  GLY A C   1 
ATOM   489   O  O   . GLY A  1 87  ? 41.537 67.247  66.121  1.00 61.30  ? 87  GLY A O   1 
ATOM   490   N  N   . LEU A  1 88  ? 40.692 65.556  64.850  1.00 60.09  ? 88  LEU A N   1 
ATOM   491   C  CA  . LEU A  1 88  ? 39.326 66.085  64.781  1.00 59.73  ? 88  LEU A CA  1 
ATOM   492   C  C   . LEU A  1 88  ? 38.624 65.887  66.116  1.00 64.24  ? 88  LEU A C   1 
ATOM   493   O  O   . LEU A  1 88  ? 38.594 64.773  66.638  1.00 64.43  ? 88  LEU A O   1 
ATOM   494   C  CB  . LEU A  1 88  ? 38.506 65.439  63.647  1.00 59.79  ? 88  LEU A CB  1 
ATOM   495   C  CG  . LEU A  1 88  ? 38.937 65.729  62.209  1.00 63.91  ? 88  LEU A CG  1 
ATOM   496   C  CD1 . LEU A  1 88  ? 38.187 64.859  61.239  1.00 64.41  ? 88  LEU A CD1 1 
ATOM   497   C  CD2 . LEU A  1 88  ? 38.749 67.196  61.840  1.00 65.92  ? 88  LEU A CD2 1 
ATOM   498   N  N   . VAL A  1 89  ? 38.084 66.976  66.674  1.00 60.52  ? 89  VAL A N   1 
ATOM   499   C  CA  . VAL A  1 89  ? 37.396 66.967  67.960  1.00 60.63  ? 89  VAL A CA  1 
ATOM   500   C  C   . VAL A  1 89  ? 35.891 66.777  67.715  1.00 65.30  ? 89  VAL A C   1 
ATOM   501   O  O   . VAL A  1 89  ? 35.265 67.578  67.015  1.00 64.04  ? 89  VAL A O   1 
ATOM   502   C  CB  . VAL A  1 89  ? 37.725 68.245  68.779  1.00 63.65  ? 89  VAL A CB  1 
ATOM   503   C  CG1 . VAL A  1 89  ? 36.861 68.360  70.030  1.00 64.14  ? 89  VAL A CG1 1 
ATOM   504   C  CG2 . VAL A  1 89  ? 39.205 68.300  69.144  1.00 63.35  ? 89  VAL A CG2 1 
ATOM   505   N  N   . LYS A  1 90  ? 35.334 65.693  68.280  1.00 63.79  ? 90  LYS A N   1 
ATOM   506   C  CA  . LYS A  1 90  ? 33.917 65.326  68.180  1.00 64.69  ? 90  LYS A CA  1 
ATOM   507   C  C   . LYS A  1 90  ? 33.303 65.187  69.581  1.00 70.85  ? 90  LYS A C   1 
ATOM   508   O  O   . LYS A  1 90  ? 34.030 64.936  70.546  1.00 70.70  ? 90  LYS A O   1 
ATOM   509   C  CB  . LYS A  1 90  ? 33.739 64.013  67.386  1.00 67.79  ? 90  LYS A CB  1 
ATOM   510   C  CG  . LYS A  1 90  ? 34.261 64.033  65.946  1.00 81.26  ? 90  LYS A CG  1 
ATOM   511   C  CD  . LYS A  1 90  ? 33.243 64.577  64.939  1.00 91.35  ? 90  LYS A CD  1 
ATOM   512   C  CE  . LYS A  1 90  ? 33.775 64.601  63.523  1.00 102.85 ? 90  LYS A CE  1 
ATOM   513   N  NZ  . LYS A  1 90  ? 34.841 65.623  63.348  1.00 111.35 ? 90  LYS A NZ  1 
ATOM   514   N  N   . GLU A  1 91  ? 31.967 65.345  69.690  1.00 69.00  ? 91  GLU A N   1 
ATOM   515   C  CA  . GLU A  1 91  ? 31.253 65.228  70.965  1.00 70.32  ? 91  GLU A CA  1 
ATOM   516   C  C   . GLU A  1 91  ? 31.122 63.766  71.380  1.00 76.58  ? 91  GLU A C   1 
ATOM   517   O  O   . GLU A  1 91  ? 30.775 62.914  70.558  1.00 76.04  ? 91  GLU A O   1 
ATOM   518   C  CB  . GLU A  1 91  ? 29.861 65.885  70.893  1.00 71.79  ? 91  GLU A CB  1 
ATOM   519   C  CG  . GLU A  1 91  ? 29.263 66.198  72.257  1.00 83.03  ? 91  GLU A CG  1 
ATOM   520   C  CD  . GLU A  1 91  ? 27.750 66.270  72.301  1.00 104.74 ? 91  GLU A CD  1 
ATOM   521   O  OE1 . GLU A  1 91  ? 27.179 67.249  71.769  1.00 90.43  ? 91  GLU A OE1 1 
ATOM   522   O  OE2 . GLU A  1 91  ? 27.135 65.355  72.895  1.00 105.25 ? 91  GLU A OE2 1 
ATOM   523   N  N   . CYS A  1 92  ? 31.397 63.489  72.662  1.00 75.66  ? 92  CYS A N   1 
ATOM   524   C  CA  . CYS A  1 92  ? 31.295 62.154  73.251  1.00 77.53  ? 92  CYS A CA  1 
ATOM   525   C  C   . CYS A  1 92  ? 29.891 61.948  73.834  1.00 83.58  ? 92  CYS A C   1 
ATOM   526   O  O   . CYS A  1 92  ? 29.073 62.874  73.819  1.00 83.16  ? 92  CYS A O   1 
ATOM   527   C  CB  . CYS A  1 92  ? 32.375 61.943  74.309  1.00 78.41  ? 92  CYS A CB  1 
ATOM   528   S  SG  . CYS A  1 92  ? 34.068 62.134  73.694  1.00 81.37  ? 92  CYS A SG  1 
ATOM   529   N  N   . ASN A  1 93  ? 29.617 60.737  74.354  1.00 81.89  ? 93  ASN A N   1 
ATOM   530   C  CA  . ASN A  1 93  ? 28.329 60.383  74.954  1.00 83.09  ? 93  ASN A CA  1 
ATOM   531   C  C   . ASN A  1 93  ? 28.099 61.116  76.293  1.00 87.54  ? 93  ASN A C   1 
ATOM   532   O  O   . ASN A  1 93  ? 26.946 61.289  76.695  1.00 87.75  ? 93  ASN A O   1 
ATOM   533   C  CB  . ASN A  1 93  ? 28.216 58.869  75.134  1.00 84.97  ? 93  ASN A CB  1 
ATOM   534   C  CG  . ASN A  1 93  ? 28.136 58.110  73.829  1.00 104.89 ? 93  ASN A CG  1 
ATOM   535   O  OD1 . ASN A  1 93  ? 27.259 58.346  72.985  1.00 96.95  ? 93  ASN A OD1 1 
ATOM   536   N  ND2 . ASN A  1 93  ? 29.041 57.163  73.645  1.00 97.62  ? 93  ASN A ND2 1 
ATOM   537   N  N   . ASP A  1 94  ? 29.187 61.578  76.953  1.00 83.90  ? 94  ASP A N   1 
ATOM   538   C  CA  . ASP A  1 94  ? 29.118 62.324  78.214  1.00 84.19  ? 94  ASP A CA  1 
ATOM   539   C  C   . ASP A  1 94  ? 29.077 63.847  77.942  1.00 87.11  ? 94  ASP A C   1 
ATOM   540   O  O   . ASP A  1 94  ? 29.339 64.647  78.845  1.00 86.77  ? 94  ASP A O   1 
ATOM   541   C  CB  . ASP A  1 94  ? 30.284 61.940  79.156  1.00 86.64  ? 94  ASP A CB  1 
ATOM   542   C  CG  . ASP A  1 94  ? 31.677 62.349  78.703  1.00 96.02  ? 94  ASP A CG  1 
ATOM   543   O  OD1 . ASP A  1 94  ? 31.985 62.187  77.505  1.00 96.74  ? 94  ASP A OD1 1 
ATOM   544   O  OD2 . ASP A  1 94  ? 32.476 62.777  79.560  1.00 100.66 ? 94  ASP A OD2 1 
ATOM   545   N  N   . ASN A  1 95  ? 28.727 64.229  76.686  1.00 82.99  ? 95  ASN A N   1 
ATOM   546   C  CA  . ASN A  1 95  ? 28.567 65.594  76.153  1.00 81.62  ? 95  ASN A CA  1 
ATOM   547   C  C   . ASN A  1 95  ? 29.882 66.428  76.165  1.00 83.70  ? 95  ASN A C   1 
ATOM   548   O  O   . ASN A  1 95  ? 29.839 67.637  75.909  1.00 82.37  ? 95  ASN A O   1 
ATOM   549   C  CB  . ASN A  1 95  ? 27.430 66.348  76.875  1.00 83.77  ? 95  ASN A CB  1 
ATOM   550   C  CG  . ASN A  1 95  ? 26.106 65.621  76.836  1.00 112.34 ? 95  ASN A CG  1 
ATOM   551   O  OD1 . ASN A  1 95  ? 25.515 65.398  75.771  1.00 104.89 ? 95  ASN A OD1 1 
ATOM   552   N  ND2 . ASN A  1 95  ? 25.619 65.217  78.001  1.00 108.67 ? 95  ASN A ND2 1 
ATOM   553   N  N   . THR A  1 96  ? 31.044 65.774  76.399  1.00 79.45  ? 96  THR A N   1 
ATOM   554   C  CA  . THR A  1 96  ? 32.355 66.432  76.388  1.00 77.70  ? 96  THR A CA  1 
ATOM   555   C  C   . THR A  1 96  ? 32.954 66.331  74.991  1.00 79.16  ? 96  THR A C   1 
ATOM   556   O  O   . THR A  1 96  ? 32.768 65.318  74.314  1.00 79.23  ? 96  THR A O   1 
ATOM   557   C  CB  . THR A  1 96  ? 33.310 65.849  77.446  1.00 85.44  ? 96  THR A CB  1 
ATOM   558   O  OG1 . THR A  1 96  ? 33.498 64.451  77.222  1.00 85.27  ? 96  THR A OG1 1 
ATOM   559   C  CG2 . THR A  1 96  ? 32.848 66.113  78.874  1.00 85.11  ? 96  THR A CG2 1 
ATOM   560   N  N   . MET A  1 97  ? 33.666 67.382  74.562  1.00 73.14  ? 97  MET A N   1 
ATOM   561   C  CA  . MET A  1 97  ? 34.306 67.441  73.247  1.00 70.95  ? 97  MET A CA  1 
ATOM   562   C  C   . MET A  1 97  ? 35.749 66.945  73.359  1.00 72.83  ? 97  MET A C   1 
ATOM   563   O  O   . MET A  1 97  ? 36.564 67.572  74.036  1.00 72.53  ? 97  MET A O   1 
ATOM   564   C  CB  . MET A  1 97  ? 34.254 68.871  72.683  1.00 71.95  ? 97  MET A CB  1 
ATOM   565   C  CG  . MET A  1 97  ? 32.863 69.436  72.550  1.00 75.29  ? 97  MET A CG  1 
ATOM   566   S  SD  . MET A  1 97  ? 32.044 68.874  71.051  1.00 79.02  ? 97  MET A SD  1 
ATOM   567   C  CE  . MET A  1 97  ? 30.466 69.665  71.254  1.00 75.88  ? 97  MET A CE  1 
ATOM   568   N  N   . ARG A  1 98  ? 36.051 65.798  72.738  1.00 68.01  ? 98  ARG A N   1 
ATOM   569   C  CA  . ARG A  1 98  ? 37.388 65.200  72.786  1.00 67.55  ? 98  ARG A CA  1 
ATOM   570   C  C   . ARG A  1 98  ? 37.896 64.874  71.380  1.00 68.77  ? 98  ARG A C   1 
ATOM   571   O  O   . ARG A  1 98  ? 37.094 64.664  70.467  1.00 67.89  ? 98  ARG A O   1 
ATOM   572   C  CB  . ARG A  1 98  ? 37.395 63.923  73.658  1.00 70.33  ? 98  ARG A CB  1 
ATOM   573   C  CG  . ARG A  1 98  ? 36.956 64.118  75.113  1.00 83.64  ? 98  ARG A CG  1 
ATOM   574   C  CD  . ARG A  1 98  ? 38.118 64.320  76.074  1.00 93.97  ? 98  ARG A CD  1 
ATOM   575   N  NE  . ARG A  1 98  ? 37.658 64.388  77.464  1.00 101.11 ? 98  ARG A NE  1 
ATOM   576   C  CZ  . ARG A  1 98  ? 37.549 63.339  78.275  1.00 115.19 ? 98  ARG A CZ  1 
ATOM   577   N  NH1 . ARG A  1 98  ? 37.880 62.124  77.851  1.00 102.71 ? 98  ARG A NH1 1 
ATOM   578   N  NH2 . ARG A  1 98  ? 37.111 63.496  79.516  1.00 101.57 ? 98  ARG A NH2 1 
ATOM   579   N  N   . ALA A  1 99  ? 39.231 64.827  71.213  1.00 63.79  ? 99  ALA A N   1 
ATOM   580   C  CA  . ALA A  1 99  ? 39.873 64.490  69.944  1.00 62.59  ? 99  ALA A CA  1 
ATOM   581   C  C   . ALA A  1 99  ? 39.642 63.010  69.632  1.00 66.17  ? 99  ALA A C   1 
ATOM   582   O  O   . ALA A  1 99  ? 39.763 62.169  70.527  1.00 66.98  ? 99  ALA A O   1 
ATOM   583   C  CB  . ALA A  1 99  ? 41.358 64.803  70.007  1.00 63.17  ? 99  ALA A CB  1 
ATOM   584   N  N   . PHE A  1 100 ? 39.266 62.705  68.380  1.00 61.36  ? 100 PHE A N   1 
ATOM   585   C  CA  . PHE A  1 100 ? 38.943 61.353  67.929  1.00 61.62  ? 100 PHE A CA  1 
ATOM   586   C  C   . PHE A  1 100 ? 40.158 60.420  67.922  1.00 66.32  ? 100 PHE A C   1 
ATOM   587   O  O   . PHE A  1 100 ? 41.264 60.832  67.573  1.00 65.86  ? 100 PHE A O   1 
ATOM   588   C  CB  . PHE A  1 100 ? 38.279 61.377  66.541  1.00 62.61  ? 100 PHE A CB  1 
ATOM   589   C  CG  . PHE A  1 100 ? 37.802 60.031  66.050  1.00 64.74  ? 100 PHE A CG  1 
ATOM   590   C  CD1 . PHE A  1 100 ? 36.725 59.393  66.654  1.00 68.47  ? 100 PHE A CD1 1 
ATOM   591   C  CD2 . PHE A  1 100 ? 38.438 59.395  64.991  1.00 66.93  ? 100 PHE A CD2 1 
ATOM   592   C  CE1 . PHE A  1 100 ? 36.297 58.140  66.213  1.00 70.33  ? 100 PHE A CE1 1 
ATOM   593   C  CE2 . PHE A  1 100 ? 38.005 58.144  64.546  1.00 70.75  ? 100 PHE A CE2 1 
ATOM   594   C  CZ  . PHE A  1 100 ? 36.938 57.524  65.162  1.00 69.73  ? 100 PHE A CZ  1 
ATOM   595   N  N   . THR A  1 101 ? 39.921 59.161  68.331  1.00 63.77  ? 101 THR A N   1 
ATOM   596   C  CA  . THR A  1 101 ? 40.865 58.044  68.394  1.00 64.43  ? 101 THR A CA  1 
ATOM   597   C  C   . THR A  1 101 ? 40.099 56.795  67.943  1.00 69.95  ? 101 THR A C   1 
ATOM   598   O  O   . THR A  1 101 ? 38.962 56.598  68.381  1.00 70.41  ? 101 THR A O   1 
ATOM   599   C  CB  . THR A  1 101 ? 41.464 57.931  69.812  1.00 71.23  ? 101 THR A CB  1 
ATOM   600   O  OG1 . THR A  1 101 ? 42.209 59.114  70.092  1.00 70.24  ? 101 THR A OG1 1 
ATOM   601   C  CG2 . THR A  1 101 ? 42.366 56.712  69.991  1.00 70.33  ? 101 THR A CG2 1 
ATOM   602   N  N   . TYR A  1 102 ? 40.703 55.968  67.056  1.00 66.76  ? 102 TYR A N   1 
ATOM   603   C  CA  . TYR A  1 102 ? 40.072 54.748  66.540  1.00 67.30  ? 102 TYR A CA  1 
ATOM   604   C  C   . TYR A  1 102 ? 39.807 53.732  67.666  1.00 71.32  ? 102 TYR A C   1 
ATOM   605   O  O   . TYR A  1 102 ? 38.820 53.003  67.594  1.00 71.37  ? 102 TYR A O   1 
ATOM   606   C  CB  . TYR A  1 102 ? 40.909 54.107  65.413  1.00 68.84  ? 102 TYR A CB  1 
ATOM   607   C  CG  . TYR A  1 102 ? 40.198 52.972  64.703  1.00 71.76  ? 102 TYR A CG  1 
ATOM   608   C  CD1 . TYR A  1 102 ? 39.228 53.226  63.737  1.00 73.31  ? 102 TYR A CD1 1 
ATOM   609   C  CD2 . TYR A  1 102 ? 40.479 51.644  65.012  1.00 74.02  ? 102 TYR A CD2 1 
ATOM   610   C  CE1 . TYR A  1 102 ? 38.554 52.186  63.097  1.00 75.26  ? 102 TYR A CE1 1 
ATOM   611   C  CE2 . TYR A  1 102 ? 39.813 50.596  64.378  1.00 75.85  ? 102 TYR A CE2 1 
ATOM   612   C  CZ  . TYR A  1 102 ? 38.851 50.872  63.419  1.00 83.89  ? 102 TYR A CZ  1 
ATOM   613   O  OH  . TYR A  1 102 ? 38.194 49.846  62.782  1.00 87.27  ? 102 TYR A OH  1 
ATOM   614   N  N   . ARG A  1 103 ? 40.666 53.702  68.702  1.00 67.67  ? 103 ARG A N   1 
ATOM   615   C  CA  . ARG A  1 103 ? 40.505 52.805  69.850  1.00 68.90  ? 103 ARG A CA  1 
ATOM   616   C  C   . ARG A  1 103 ? 39.309 53.215  70.727  1.00 72.69  ? 103 ARG A C   1 
ATOM   617   O  O   . ARG A  1 103 ? 38.671 52.350  71.329  1.00 73.59  ? 103 ARG A O   1 
ATOM   618   C  CB  . ARG A  1 103 ? 41.784 52.776  70.700  1.00 69.84  ? 103 ARG A CB  1 
ATOM   619   C  CG  . ARG A  1 103 ? 42.910 51.949  70.096  1.00 81.86  ? 103 ARG A CG  1 
ATOM   620   N  N   . THR A  1 104 ? 39.015 54.529  70.796  1.00 67.68  ? 104 THR A N   1 
ATOM   621   C  CA  . THR A  1 104 ? 37.936 55.100  71.608  1.00 67.33  ? 104 THR A CA  1 
ATOM   622   C  C   . THR A  1 104 ? 36.756 55.576  70.725  1.00 69.89  ? 104 THR A C   1 
ATOM   623   O  O   . THR A  1 104 ? 36.019 56.477  71.128  1.00 68.80  ? 104 THR A O   1 
ATOM   624   C  CB  . THR A  1 104 ? 38.495 56.260  72.465  1.00 75.33  ? 104 THR A CB  1 
ATOM   625   O  OG1 . THR A  1 104 ? 38.781 57.383  71.629  1.00 72.76  ? 104 THR A OG1 1 
ATOM   626   C  CG2 . THR A  1 104 ? 39.737 55.868  73.265  1.00 75.36  ? 104 THR A CG2 1 
ATOM   627   N  N   . ARG A  1 105 ? 36.570 54.954  69.543  1.00 66.45  ? 105 ARG A N   1 
ATOM   628   C  CA  . ARG A  1 105 ? 35.535 55.311  68.560  1.00 65.64  ? 105 ARG A CA  1 
ATOM   629   C  C   . ARG A  1 105 ? 34.088 55.132  69.084  1.00 71.34  ? 105 ARG A C   1 
ATOM   630   O  O   . ARG A  1 105 ? 33.205 55.883  68.666  1.00 70.61  ? 105 ARG A O   1 
ATOM   631   C  CB  . ARG A  1 105 ? 35.722 54.516  67.245  1.00 64.48  ? 105 ARG A CB  1 
ATOM   632   C  CG  . ARG A  1 105 ? 35.546 53.001  67.371  1.00 71.60  ? 105 ARG A CG  1 
ATOM   633   C  CD  . ARG A  1 105 ? 35.923 52.248  66.113  1.00 75.19  ? 105 ARG A CD  1 
ATOM   634   N  NE  . ARG A  1 105 ? 35.724 50.810  66.289  1.00 81.41  ? 105 ARG A NE  1 
ATOM   635   C  CZ  . ARG A  1 105 ? 36.637 49.977  66.778  1.00 95.15  ? 105 ARG A CZ  1 
ATOM   636   N  NH1 . ARG A  1 105 ? 37.835 50.426  67.131  1.00 79.96  ? 105 ARG A NH1 1 
ATOM   637   N  NH2 . ARG A  1 105 ? 36.360 48.689  66.918  1.00 85.12  ? 105 ARG A NH2 1 
ATOM   638   N  N   . GLN A  1 106 ? 33.855 54.153  69.980  1.00 69.56  ? 106 GLN A N   1 
ATOM   639   C  CA  . GLN A  1 106 ? 32.533 53.823  70.518  1.00 70.43  ? 106 GLN A CA  1 
ATOM   640   C  C   . GLN A  1 106 ? 31.999 54.876  71.500  1.00 74.82  ? 106 GLN A C   1 
ATOM   641   O  O   . GLN A  1 106 ? 30.782 54.992  71.655  1.00 74.90  ? 106 GLN A O   1 
ATOM   642   C  CB  . GLN A  1 106 ? 32.555 52.443  71.197  1.00 73.45  ? 106 GLN A CB  1 
ATOM   643   C  CG  . GLN A  1 106 ? 33.085 51.299  70.314  1.00 85.68  ? 106 GLN A CG  1 
ATOM   644   C  CD  . GLN A  1 106 ? 32.133 50.785  69.248  1.00 102.43 ? 106 GLN A CD  1 
ATOM   645   O  OE1 . GLN A  1 106 ? 31.131 51.411  68.884  1.00 95.95  ? 106 GLN A OE1 1 
ATOM   646   N  NE2 . GLN A  1 106 ? 32.443 49.621  68.705  1.00 95.40  ? 106 GLN A NE2 1 
ATOM   647   N  N   . ASN A  1 107 ? 32.897 55.638  72.149  1.00 71.32  ? 107 ASN A N   1 
ATOM   648   C  CA  . ASN A  1 107 ? 32.543 56.669  73.130  1.00 71.15  ? 107 ASN A CA  1 
ATOM   649   C  C   . ASN A  1 107 ? 32.031 57.968  72.485  1.00 74.22  ? 107 ASN A C   1 
ATOM   650   O  O   . ASN A  1 107 ? 31.453 58.798  73.189  1.00 73.99  ? 107 ASN A O   1 
ATOM   651   C  CB  . ASN A  1 107 ? 33.739 56.972  74.028  1.00 72.38  ? 107 ASN A CB  1 
ATOM   652   C  CG  . ASN A  1 107 ? 34.025 55.863  75.007  1.00 103.78 ? 107 ASN A CG  1 
ATOM   653   O  OD1 . ASN A  1 107 ? 33.492 55.833  76.123  1.00 101.66 ? 107 ASN A OD1 1 
ATOM   654   N  ND2 . ASN A  1 107 ? 34.856 54.911  74.605  1.00 97.20  ? 107 ASN A ND2 1 
ATOM   655   N  N   . PHE A  1 108 ? 32.218 58.132  71.161  1.00 69.99  ? 108 PHE A N   1 
ATOM   656   C  CA  . PHE A  1 108 ? 31.789 59.324  70.430  1.00 68.50  ? 108 PHE A CA  1 
ATOM   657   C  C   . PHE A  1 108 ? 30.325 59.228  70.016  1.00 74.10  ? 108 PHE A C   1 
ATOM   658   O  O   . PHE A  1 108 ? 29.892 58.199  69.488  1.00 74.04  ? 108 PHE A O   1 
ATOM   659   C  CB  . PHE A  1 108 ? 32.697 59.580  69.215  1.00 68.70  ? 108 PHE A CB  1 
ATOM   660   C  CG  . PHE A  1 108 ? 34.054 60.083  69.640  1.00 69.28  ? 108 PHE A CG  1 
ATOM   661   C  CD1 . PHE A  1 108 ? 34.261 61.430  69.906  1.00 71.26  ? 108 PHE A CD1 1 
ATOM   662   C  CD2 . PHE A  1 108 ? 35.106 59.201  69.845  1.00 71.65  ? 108 PHE A CD2 1 
ATOM   663   C  CE1 . PHE A  1 108 ? 35.504 61.888  70.346  1.00 71.69  ? 108 PHE A CE1 1 
ATOM   664   C  CE2 . PHE A  1 108 ? 36.348 59.660  70.289  1.00 74.04  ? 108 PHE A CE2 1 
ATOM   665   C  CZ  . PHE A  1 108 ? 36.536 61.000  70.544  1.00 71.21  ? 108 PHE A CZ  1 
ATOM   666   N  N   . LYS A  1 109 ? 29.563 60.313  70.286  1.00 71.66  ? 109 LYS A N   1 
ATOM   667   C  CA  . LYS A  1 109 ? 28.137 60.434  69.980  1.00 72.42  ? 109 LYS A CA  1 
ATOM   668   C  C   . LYS A  1 109 ? 27.907 60.426  68.467  1.00 77.43  ? 109 LYS A C   1 
ATOM   669   O  O   . LYS A  1 109 ? 28.578 61.154  67.729  1.00 75.64  ? 109 LYS A O   1 
ATOM   670   C  CB  . LYS A  1 109 ? 27.551 61.711  70.610  1.00 74.23  ? 109 LYS A CB  1 
ATOM   671   C  CG  . LYS A  1 109 ? 26.030 61.716  70.695  1.00 88.29  ? 109 LYS A CG  1 
ATOM   672   N  N   . GLY A  1 110 ? 26.966 59.588  68.038  1.00 76.45  ? 110 GLY A N   1 
ATOM   673   C  CA  . GLY A  1 110 ? 26.590 59.434  66.637  1.00 76.64  ? 110 GLY A CA  1 
ATOM   674   C  C   . GLY A  1 110 ? 27.418 58.425  65.871  1.00 82.23  ? 110 GLY A C   1 
ATOM   675   O  O   . GLY A  1 110 ? 27.269 58.308  64.650  1.00 81.78  ? 110 GLY A O   1 
ATOM   676   N  N   . PHE A  1 111 ? 28.301 57.692  66.574  1.00 80.20  ? 111 PHE A N   1 
ATOM   677   C  CA  . PHE A  1 111 ? 29.137 56.687  65.930  1.00 80.81  ? 111 PHE A CA  1 
ATOM   678   C  C   . PHE A  1 111 ? 28.446 55.331  65.920  1.00 88.20  ? 111 PHE A C   1 
ATOM   679   O  O   . PHE A  1 111 ? 27.775 54.951  66.886  1.00 89.04  ? 111 PHE A O   1 
ATOM   680   C  CB  . PHE A  1 111 ? 30.527 56.577  66.585  1.00 82.26  ? 111 PHE A CB  1 
ATOM   681   C  CG  . PHE A  1 111 ? 31.504 55.715  65.810  1.00 83.82  ? 111 PHE A CG  1 
ATOM   682   C  CD1 . PHE A  1 111 ? 32.225 56.238  64.743  1.00 85.67  ? 111 PHE A CD1 1 
ATOM   683   C  CD2 . PHE A  1 111 ? 31.689 54.376  66.139  1.00 87.33  ? 111 PHE A CD2 1 
ATOM   684   C  CE1 . PHE A  1 111 ? 33.113 55.437  64.019  1.00 86.65  ? 111 PHE A CE1 1 
ATOM   685   C  CE2 . PHE A  1 111 ? 32.566 53.573  65.404  1.00 90.13  ? 111 PHE A CE2 1 
ATOM   686   C  CZ  . PHE A  1 111 ? 33.280 54.112  64.357  1.00 87.00  ? 111 PHE A CZ  1 
ATOM   687   N  N   . ASP A  1 112 ? 28.627 54.610  64.804  1.00 86.13  ? 112 ASP A N   1 
ATOM   688   C  CA  . ASP A  1 112 ? 28.136 53.259  64.555  1.00 87.91  ? 112 ASP A CA  1 
ATOM   689   C  C   . ASP A  1 112 ? 29.012 52.604  63.490  1.00 92.85  ? 112 ASP A C   1 
ATOM   690   O  O   . ASP A  1 112 ? 29.325 53.239  62.478  1.00 91.12  ? 112 ASP A O   1 
ATOM   691   C  CB  . ASP A  1 112 ? 26.660 53.271  64.126  1.00 90.33  ? 112 ASP A CB  1 
ATOM   692   N  N   . ASP A  1 113 ? 29.421 51.341  63.722  1.00 91.69  ? 113 ASP A N   1 
ATOM   693   C  CA  . ASP A  1 113 ? 30.249 50.582  62.780  1.00 91.93  ? 113 ASP A CA  1 
ATOM   694   C  C   . ASP A  1 113 ? 29.437 50.192  61.537  1.00 96.77  ? 113 ASP A C   1 
ATOM   695   O  O   . ASP A  1 113 ? 30.016 50.031  60.461  1.00 96.20  ? 113 ASP A O   1 
ATOM   696   C  CB  . ASP A  1 113 ? 30.875 49.352  63.451  1.00 94.98  ? 113 ASP A CB  1 
ATOM   697   C  CG  . ASP A  1 113 ? 32.082 49.682  64.321  1.00 103.79 ? 113 ASP A CG  1 
ATOM   698   O  OD1 . ASP A  1 113 ? 32.896 50.547  63.914  1.00 102.75 ? 113 ASP A OD1 1 
ATOM   699   O  OD2 . ASP A  1 113 ? 32.227 49.060  65.395  1.00 110.69 ? 113 ASP A OD2 1 
ATOM   700   N  N   . ASN A  1 114 ? 28.095 50.099  61.677  1.00 94.30  ? 114 ASN A N   1 
ATOM   701   C  CA  . ASN A  1 114 ? 27.154 49.815  60.590  1.00 94.66  ? 114 ASN A CA  1 
ATOM   702   C  C   . ASN A  1 114 ? 26.990 51.051  59.685  1.00 97.11  ? 114 ASN A C   1 
ATOM   703   O  O   . ASN A  1 114 ? 26.575 50.917  58.530  1.00 96.79  ? 114 ASN A O   1 
ATOM   704   C  CB  . ASN A  1 114 ? 25.802 49.386  61.159  1.00 97.16  ? 114 ASN A CB  1 
ATOM   705   N  N   . ASN A  1 115 ? 27.327 52.247  60.221  1.00 92.28  ? 115 ASN A N   1 
ATOM   706   C  CA  . ASN A  1 115 ? 27.262 53.540  59.537  1.00 90.50  ? 115 ASN A CA  1 
ATOM   707   C  C   . ASN A  1 115 ? 28.600 53.905  58.855  1.00 91.96  ? 115 ASN A C   1 
ATOM   708   O  O   . ASN A  1 115 ? 29.624 53.240  59.054  1.00 91.32  ? 115 ASN A O   1 
ATOM   709   C  CB  . ASN A  1 115 ? 26.881 54.650  60.535  1.00 90.77  ? 115 ASN A CB  1 
ATOM   710   C  CG  . ASN A  1 115 ? 25.407 54.873  60.778  1.00 114.26 ? 115 ASN A CG  1 
ATOM   711   O  OD1 . ASN A  1 115 ? 24.548 54.584  59.939  1.00 107.77 ? 115 ASN A OD1 1 
ATOM   712   N  ND2 . ASN A  1 115 ? 25.086 55.462  61.922  1.00 107.71 ? 115 ASN A ND2 1 
ATOM   713   N  N   . ASP A  1 116 ? 28.561 54.975  58.046  1.00 86.55  ? 116 ASP A N   1 
ATOM   714   C  CA  . ASP A  1 116 ? 29.683 55.558  57.314  1.00 84.61  ? 116 ASP A CA  1 
ATOM   715   C  C   . ASP A  1 116 ? 29.515 57.084  57.270  1.00 86.09  ? 116 ASP A C   1 
ATOM   716   O  O   . ASP A  1 116 ? 30.391 57.791  56.765  1.00 85.08  ? 116 ASP A O   1 
ATOM   717   C  CB  . ASP A  1 116 ? 29.767 54.963  55.900  1.00 86.61  ? 116 ASP A CB  1 
ATOM   718   N  N   . ASP A  1 117 ? 28.393 57.582  57.842  1.00 81.15  ? 117 ASP A N   1 
ATOM   719   C  CA  . ASP A  1 117 ? 28.016 58.996  57.904  1.00 79.22  ? 117 ASP A CA  1 
ATOM   720   C  C   . ASP A  1 117 ? 28.555 59.698  59.180  1.00 79.89  ? 117 ASP A C   1 
ATOM   721   O  O   . ASP A  1 117 ? 28.018 60.739  59.579  1.00 79.29  ? 117 ASP A O   1 
ATOM   722   C  CB  . ASP A  1 117 ? 26.484 59.124  57.824  1.00 81.82  ? 117 ASP A CB  1 
ATOM   723   N  N   . PHE A  1 118 ? 29.629 59.143  59.798  1.00 73.88  ? 118 PHE A N   1 
ATOM   724   C  CA  . PHE A  1 118 ? 30.250 59.715  61.001  1.00 71.90  ? 118 PHE A CA  1 
ATOM   725   C  C   . PHE A  1 118 ? 31.060 60.965  60.632  1.00 71.83  ? 118 PHE A C   1 
ATOM   726   O  O   . PHE A  1 118 ? 30.863 62.022  61.236  1.00 70.69  ? 118 PHE A O   1 
ATOM   727   C  CB  . PHE A  1 118 ? 31.121 58.677  61.742  1.00 73.98  ? 118 PHE A CB  1 
ATOM   728   C  CG  . PHE A  1 118 ? 31.852 59.219  62.949  1.00 74.66  ? 118 PHE A CG  1 
ATOM   729   C  CD1 . PHE A  1 118 ? 31.158 59.585  64.098  1.00 77.85  ? 118 PHE A CD1 1 
ATOM   730   C  CD2 . PHE A  1 118 ? 33.233 59.360  62.939  1.00 75.97  ? 118 PHE A CD2 1 
ATOM   731   C  CE1 . PHE A  1 118 ? 31.833 60.096  65.210  1.00 78.52  ? 118 PHE A CE1 1 
ATOM   732   C  CE2 . PHE A  1 118 ? 33.908 59.866  64.052  1.00 78.71  ? 118 PHE A CE2 1 
ATOM   733   C  CZ  . PHE A  1 118 ? 33.204 60.232  65.180  1.00 77.20  ? 118 PHE A CZ  1 
ATOM   734   N  N   . LEU A  1 119 ? 31.958 60.836  59.637  1.00 66.00  ? 119 LEU A N   1 
ATOM   735   C  CA  . LEU A  1 119 ? 32.767 61.935  59.113  1.00 63.56  ? 119 LEU A CA  1 
ATOM   736   C  C   . LEU A  1 119 ? 32.075 62.511  57.885  1.00 65.25  ? 119 LEU A C   1 
ATOM   737   O  O   . LEU A  1 119 ? 31.603 61.741  57.043  1.00 65.73  ? 119 LEU A O   1 
ATOM   738   C  CB  . LEU A  1 119 ? 34.192 61.462  58.755  1.00 63.17  ? 119 LEU A CB  1 
ATOM   739   C  CG  . LEU A  1 119 ? 35.094 60.997  59.898  1.00 67.65  ? 119 LEU A CG  1 
ATOM   740   C  CD1 . LEU A  1 119 ? 36.262 60.202  59.363  1.00 67.76  ? 119 LEU A CD1 1 
ATOM   741   C  CD2 . LEU A  1 119 ? 35.600 62.167  60.731  1.00 68.81  ? 119 LEU A CD2 1 
ATOM   742   N  N   . THR A  1 120 ? 32.000 63.852  57.775  1.00 58.88  ? 120 THR A N   1 
ATOM   743   C  CA  . THR A  1 120 ? 31.369 64.501  56.618  1.00 57.45  ? 120 THR A CA  1 
ATOM   744   C  C   . THR A  1 120 ? 32.288 64.390  55.398  1.00 58.73  ? 120 THR A C   1 
ATOM   745   O  O   . THR A  1 120 ? 33.467 64.055  55.552  1.00 57.85  ? 120 THR A O   1 
ATOM   746   C  CB  . THR A  1 120 ? 30.997 65.970  56.913  1.00 63.21  ? 120 THR A CB  1 
ATOM   747   O  OG1 . THR A  1 120 ? 32.174 66.743  57.157  1.00 61.31  ? 120 THR A OG1 1 
ATOM   748   C  CG2 . THR A  1 120 ? 29.996 66.115  58.059  1.00 61.04  ? 120 THR A CG2 1 
ATOM   749   N  N   . MET A  1 121 ? 31.752 64.666  54.191  1.00 54.12  ? 121 MET A N   1 
ATOM   750   C  CA  . MET A  1 121 ? 32.533 64.627  52.951  1.00 53.34  ? 121 MET A CA  1 
ATOM   751   C  C   . MET A  1 121 ? 33.645 65.688  52.992  1.00 54.67  ? 121 MET A C   1 
ATOM   752   O  O   . MET A  1 121 ? 34.761 65.410  52.550  1.00 53.93  ? 121 MET A O   1 
ATOM   753   C  CB  . MET A  1 121 ? 31.636 64.822  51.723  1.00 56.04  ? 121 MET A CB  1 
ATOM   754   C  CG  . MET A  1 121 ? 32.338 64.499  50.422  1.00 59.88  ? 121 MET A CG  1 
ATOM   755   S  SD  . MET A  1 121 ? 31.285 64.611  48.968  1.00 64.98  ? 121 MET A SD  1 
ATOM   756   C  CE  . MET A  1 121 ? 30.386 63.068  49.102  1.00 63.11  ? 121 MET A CE  1 
ATOM   757   N  N   . ALA A  1 122 ? 33.339 66.877  53.563  1.00 49.39  ? 122 ALA A N   1 
ATOM   758   C  CA  . ALA A  1 122 ? 34.266 67.997  53.729  1.00 47.72  ? 122 ALA A CA  1 
ATOM   759   C  C   . ALA A  1 122 ? 35.445 67.601  54.621  1.00 50.49  ? 122 ALA A C   1 
ATOM   760   O  O   . ALA A  1 122 ? 36.587 67.942  54.302  1.00 49.50  ? 122 ALA A O   1 
ATOM   761   C  CB  . ALA A  1 122 ? 33.537 69.191  54.317  1.00 48.06  ? 122 ALA A CB  1 
ATOM   762   N  N   . GLU A  1 123 ? 35.166 66.857  55.720  1.00 47.35  ? 123 GLU A N   1 
ATOM   763   C  CA  . GLU A  1 123 ? 36.171 66.344  56.660  1.00 46.81  ? 123 GLU A CA  1 
ATOM   764   C  C   . GLU A  1 123 ? 37.053 65.318  55.946  1.00 50.69  ? 123 GLU A C   1 
ATOM   765   O  O   . GLU A  1 123 ? 38.280 65.411  56.017  1.00 50.50  ? 123 GLU A O   1 
ATOM   766   C  CB  . GLU A  1 123 ? 35.505 65.721  57.908  1.00 48.40  ? 123 GLU A CB  1 
ATOM   767   C  CG  . GLU A  1 123 ? 35.005 66.740  58.923  1.00 57.86  ? 123 GLU A CG  1 
ATOM   768   C  CD  . GLU A  1 123 ? 34.113 66.242  60.052  1.00 73.34  ? 123 GLU A CD  1 
ATOM   769   O  OE1 . GLU A  1 123 ? 33.521 65.146  59.919  1.00 62.32  ? 123 GLU A OE1 1 
ATOM   770   O  OE2 . GLU A  1 123 ? 33.970 66.979  61.055  1.00 59.13  ? 123 GLU A OE2 1 
ATOM   771   N  N   . CYS A  1 124 ? 36.414 64.382  55.207  1.00 46.52  ? 124 CYS A N   1 
ATOM   772   C  CA  . CYS A  1 124 ? 37.061 63.322  54.440  1.00 46.58  ? 124 CYS A CA  1 
ATOM   773   C  C   . CYS A  1 124 ? 38.052 63.888  53.419  1.00 49.54  ? 124 CYS A C   1 
ATOM   774   O  O   . CYS A  1 124 ? 39.198 63.437  53.364  1.00 49.80  ? 124 CYS A O   1 
ATOM   775   C  CB  . CYS A  1 124 ? 36.024 62.428  53.765  1.00 47.64  ? 124 CYS A CB  1 
ATOM   776   S  SG  . CYS A  1 124 ? 35.237 61.236  54.877  1.00 52.43  ? 124 CYS A SG  1 
ATOM   777   N  N   . GLN A  1 125 ? 37.615 64.887  52.634  1.00 44.07  ? 125 GLN A N   1 
ATOM   778   C  CA  . GLN A  1 125 ? 38.425 65.538  51.609  1.00 42.49  ? 125 GLN A CA  1 
ATOM   779   C  C   . GLN A  1 125 ? 39.591 66.313  52.233  1.00 46.07  ? 125 GLN A C   1 
ATOM   780   O  O   . GLN A  1 125 ? 40.664 66.345  51.632  1.00 45.90  ? 125 GLN A O   1 
ATOM   781   C  CB  . GLN A  1 125 ? 37.556 66.445  50.735  1.00 43.06  ? 125 GLN A CB  1 
ATOM   782   C  CG  . GLN A  1 125 ? 36.656 65.646  49.792  1.00 48.87  ? 125 GLN A CG  1 
ATOM   783   C  CD  . GLN A  1 125 ? 35.418 66.380  49.331  1.00 62.47  ? 125 GLN A CD  1 
ATOM   784   O  OE1 . GLN A  1 125 ? 35.034 67.434  49.860  1.00 55.82  ? 125 GLN A OE1 1 
ATOM   785   N  NE2 . GLN A  1 125 ? 34.767 65.835  48.314  1.00 53.18  ? 125 GLN A NE2 1 
ATOM   786   N  N   . PHE A  1 126 ? 39.404 66.891  53.448  1.00 42.34  ? 126 PHE A N   1 
ATOM   787   C  CA  . PHE A  1 126 ? 40.456 67.615  54.174  1.00 41.59  ? 126 PHE A CA  1 
ATOM   788   C  C   . PHE A  1 126 ? 41.570 66.656  54.600  1.00 44.52  ? 126 PHE A C   1 
ATOM   789   O  O   . PHE A  1 126 ? 42.748 67.007  54.488  1.00 43.80  ? 126 PHE A O   1 
ATOM   790   C  CB  . PHE A  1 126 ? 39.888 68.358  55.405  1.00 43.37  ? 126 PHE A CB  1 
ATOM   791   C  CG  . PHE A  1 126 ? 40.922 68.822  56.414  1.00 45.19  ? 126 PHE A CG  1 
ATOM   792   C  CD1 . PHE A  1 126 ? 41.795 69.864  56.116  1.00 48.06  ? 126 PHE A CD1 1 
ATOM   793   C  CD2 . PHE A  1 126 ? 41.032 68.207  57.655  1.00 48.13  ? 126 PHE A CD2 1 
ATOM   794   C  CE1 . PHE A  1 126 ? 42.754 70.283  57.043  1.00 48.98  ? 126 PHE A CE1 1 
ATOM   795   C  CE2 . PHE A  1 126 ? 41.996 68.626  58.580  1.00 50.92  ? 126 PHE A CE2 1 
ATOM   796   C  CZ  . PHE A  1 126 ? 42.849 69.661  58.267  1.00 48.45  ? 126 PHE A CZ  1 
ATOM   797   N  N   . ILE A  1 127 ? 41.187 65.460  55.102  1.00 40.77  ? 127 ILE A N   1 
ATOM   798   C  CA  . ILE A  1 127 ? 42.102 64.410  55.557  1.00 40.97  ? 127 ILE A CA  1 
ATOM   799   C  C   . ILE A  1 127 ? 42.938 63.913  54.359  1.00 46.11  ? 127 ILE A C   1 
ATOM   800   O  O   . ILE A  1 127 ? 44.155 63.781  54.496  1.00 46.23  ? 127 ILE A O   1 
ATOM   801   C  CB  . ILE A  1 127 ? 41.337 63.261  56.283  1.00 44.34  ? 127 ILE A CB  1 
ATOM   802   C  CG1 . ILE A  1 127 ? 40.734 63.749  57.622  1.00 44.30  ? 127 ILE A CG1 1 
ATOM   803   C  CG2 . ILE A  1 127 ? 42.234 62.038  56.516  1.00 45.46  ? 127 ILE A CG2 1 
ATOM   804   C  CD1 . ILE A  1 127 ? 39.450 63.052  58.067  1.00 50.01  ? 127 ILE A CD1 1 
ATOM   805   N  N   . ILE A  1 128 ? 42.296 63.685  53.188  1.00 43.07  ? 128 ILE A N   1 
ATOM   806   C  CA  . ILE A  1 128 ? 42.976 63.240  51.963  1.00 43.28  ? 128 ILE A CA  1 
ATOM   807   C  C   . ILE A  1 128 ? 43.993 64.320  51.537  1.00 47.92  ? 128 ILE A C   1 
ATOM   808   O  O   . ILE A  1 128 ? 45.149 63.978  51.284  1.00 48.25  ? 128 ILE A O   1 
ATOM   809   C  CB  . ILE A  1 128 ? 41.971 62.854  50.838  1.00 46.44  ? 128 ILE A CB  1 
ATOM   810   C  CG1 . ILE A  1 128 ? 41.195 61.571  51.240  1.00 47.49  ? 128 ILE A CG1 1 
ATOM   811   C  CG2 . ILE A  1 128 ? 42.685 62.659  49.487  1.00 47.34  ? 128 ILE A CG2 1 
ATOM   812   C  CD1 . ILE A  1 128 ? 40.022 61.189  50.375  1.00 53.74  ? 128 ILE A CD1 1 
ATOM   813   N  N   . LYS A  1 129 ? 43.587 65.613  51.547  1.00 44.19  ? 129 LYS A N   1 
ATOM   814   C  CA  . LYS A  1 129 ? 44.457 66.754  51.232  1.00 43.63  ? 129 LYS A CA  1 
ATOM   815   C  C   . LYS A  1 129 ? 45.663 66.776  52.169  1.00 48.03  ? 129 LYS A C   1 
ATOM   816   O  O   . LYS A  1 129 ? 46.786 66.927  51.695  1.00 48.60  ? 129 LYS A O   1 
ATOM   817   C  CB  . LYS A  1 129 ? 43.686 68.084  51.329  1.00 45.29  ? 129 LYS A CB  1 
ATOM   818   C  CG  . LYS A  1 129 ? 44.521 69.324  50.975  1.00 50.23  ? 129 LYS A CG  1 
ATOM   819   C  CD  . LYS A  1 129 ? 43.969 70.608  51.593  1.00 57.46  ? 129 LYS A CD  1 
ATOM   820   C  CE  . LYS A  1 129 ? 44.265 70.780  53.067  1.00 66.27  ? 129 LYS A CE  1 
ATOM   821   N  NZ  . LYS A  1 129 ? 43.644 72.021  53.604  1.00 73.09  ? 129 LYS A NZ  1 
ATOM   822   N  N   . HIS A  1 130 ? 45.427 66.593  53.483  1.00 44.31  ? 130 HIS A N   1 
ATOM   823   C  CA  . HIS A  1 130 ? 46.451 66.566  54.529  1.00 44.54  ? 130 HIS A CA  1 
ATOM   824   C  C   . HIS A  1 130 ? 47.483 65.456  54.277  1.00 47.98  ? 130 HIS A C   1 
ATOM   825   O  O   . HIS A  1 130 ? 48.678 65.691  54.462  1.00 47.56  ? 130 HIS A O   1 
ATOM   826   C  CB  . HIS A  1 130 ? 45.791 66.386  55.912  1.00 45.76  ? 130 HIS A CB  1 
ATOM   827   C  CG  . HIS A  1 130 ? 46.760 66.204  57.039  1.00 49.96  ? 130 HIS A CG  1 
ATOM   828   N  ND1 . HIS A  1 130 ? 47.291 67.288  57.716  1.00 51.67  ? 130 HIS A ND1 1 
ATOM   829   C  CD2 . HIS A  1 130 ? 47.246 65.064  57.586  1.00 52.82  ? 130 HIS A CD2 1 
ATOM   830   C  CE1 . HIS A  1 130 ? 48.088 66.777  58.641  1.00 51.88  ? 130 HIS A CE1 1 
ATOM   831   N  NE2 . HIS A  1 130 ? 48.093 65.442  58.601  1.00 52.88  ? 130 HIS A NE2 1 
ATOM   832   N  N   . GLU A  1 131 ? 47.020 64.260  53.859  1.00 44.59  ? 131 GLU A N   1 
ATOM   833   C  CA  . GLU A  1 131 ? 47.885 63.106  53.593  1.00 45.16  ? 131 GLU A CA  1 
ATOM   834   C  C   . GLU A  1 131 ? 48.724 63.322  52.327  1.00 49.05  ? 131 GLU A C   1 
ATOM   835   O  O   . GLU A  1 131 ? 49.901 62.957  52.321  1.00 49.28  ? 131 GLU A O   1 
ATOM   836   C  CB  . GLU A  1 131 ? 47.074 61.801  53.499  1.00 46.97  ? 131 GLU A CB  1 
ATOM   837   C  CG  . GLU A  1 131 ? 46.348 61.398  54.781  1.00 56.98  ? 131 GLU A CG  1 
ATOM   838   C  CD  . GLU A  1 131 ? 47.165 61.270  56.056  1.00 78.08  ? 131 GLU A CD  1 
ATOM   839   O  OE1 . GLU A  1 131 ? 48.189 60.549  56.045  1.00 69.45  ? 131 GLU A OE1 1 
ATOM   840   O  OE2 . GLU A  1 131 ? 46.760 61.871  57.078  1.00 72.79  ? 131 GLU A OE2 1 
ATOM   841   N  N   . LEU A  1 132 ? 48.132 63.938  51.278  1.00 44.81  ? 132 LEU A N   1 
ATOM   842   C  CA  . LEU A  1 132 ? 48.812 64.255  50.015  1.00 44.70  ? 132 LEU A CA  1 
ATOM   843   C  C   . LEU A  1 132 ? 49.866 65.352  50.217  1.00 48.17  ? 132 LEU A C   1 
ATOM   844   O  O   . LEU A  1 132 ? 50.904 65.331  49.556  1.00 48.41  ? 132 LEU A O   1 
ATOM   845   C  CB  . LEU A  1 132 ? 47.806 64.693  48.928  1.00 44.46  ? 132 LEU A CB  1 
ATOM   846   C  CG  . LEU A  1 132 ? 46.798 63.650  48.416  1.00 49.76  ? 132 LEU A CG  1 
ATOM   847   C  CD1 . LEU A  1 132 ? 45.641 64.320  47.713  1.00 49.70  ? 132 LEU A CD1 1 
ATOM   848   C  CD2 . LEU A  1 132 ? 47.441 62.657  47.470  1.00 52.89  ? 132 LEU A CD2 1 
ATOM   849   N  N   . GLU A  1 133 ? 49.591 66.311  51.123  1.00 43.91  ? 133 GLU A N   1 
ATOM   850   C  CA  . GLU A  1 133 ? 50.486 67.421  51.465  1.00 43.40  ? 133 GLU A CA  1 
ATOM   851   C  C   . GLU A  1 133 ? 51.693 66.941  52.265  1.00 47.22  ? 133 GLU A C   1 
ATOM   852   O  O   . GLU A  1 133 ? 52.761 67.554  52.193  1.00 47.41  ? 133 GLU A O   1 
ATOM   853   C  CB  . GLU A  1 133 ? 49.740 68.488  52.280  1.00 44.12  ? 133 GLU A CB  1 
ATOM   854   C  CG  . GLU A  1 133 ? 48.878 69.425  51.452  1.00 54.74  ? 133 GLU A CG  1 
ATOM   855   C  CD  . GLU A  1 133 ? 47.960 70.348  52.234  1.00 80.55  ? 133 GLU A CD  1 
ATOM   856   O  OE1 . GLU A  1 133 ? 47.876 70.216  53.477  1.00 69.91  ? 133 GLU A OE1 1 
ATOM   857   O  OE2 . GLU A  1 133 ? 47.311 71.204  51.591  1.00 83.46  ? 133 GLU A OE2 1 
ATOM   858   N  N   . ASN A  1 134 ? 51.517 65.862  53.048  1.00 42.79  ? 134 ASN A N   1 
ATOM   859   C  CA  . ASN A  1 134 ? 52.576 65.309  53.886  1.00 42.35  ? 134 ASN A CA  1 
ATOM   860   C  C   . ASN A  1 134 ? 53.324 64.152  53.195  1.00 44.25  ? 134 ASN A C   1 
ATOM   861   O  O   . ASN A  1 134 ? 54.083 63.430  53.849  1.00 43.88  ? 134 ASN A O   1 
ATOM   862   C  CB  . ASN A  1 134 ? 52.020 64.902  55.242  1.00 43.28  ? 134 ASN A CB  1 
ATOM   863   C  CG  . ASN A  1 134 ? 51.871 66.099  56.140  1.00 68.19  ? 134 ASN A CG  1 
ATOM   864   O  OD1 . ASN A  1 134 ? 52.831 66.548  56.773  1.00 64.97  ? 134 ASN A OD1 1 
ATOM   865   N  ND2 . ASN A  1 134 ? 50.695 66.705  56.135  1.00 59.54  ? 134 ASN A ND2 1 
ATOM   866   N  N   . LEU A  1 135 ? 53.158 64.027  51.864  1.00 39.68  ? 135 LEU A N   1 
ATOM   867   C  CA  . LEU A  1 135 ? 53.858 63.051  51.029  1.00 39.87  ? 135 LEU A CA  1 
ATOM   868   C  C   . LEU A  1 135 ? 55.252 63.616  50.781  1.00 44.68  ? 135 LEU A C   1 
ATOM   869   O  O   . LEU A  1 135 ? 55.384 64.636  50.102  1.00 44.57  ? 135 LEU A O   1 
ATOM   870   C  CB  . LEU A  1 135 ? 53.078 62.828  49.716  1.00 39.44  ? 135 LEU A CB  1 
ATOM   871   C  CG  . LEU A  1 135 ? 52.798 61.393  49.275  1.00 44.16  ? 135 LEU A CG  1 
ATOM   872   C  CD1 . LEU A  1 135 ? 51.865 60.697  50.227  1.00 43.86  ? 135 LEU A CD1 1 
ATOM   873   C  CD2 . LEU A  1 135 ? 52.145 61.384  47.912  1.00 46.16  ? 135 LEU A CD2 1 
ATOM   874   N  N   . ARG A  1 136 ? 56.279 63.033  51.417  1.00 41.61  ? 136 ARG A N   1 
ATOM   875   C  CA  . ARG A  1 136 ? 57.638 63.569  51.318  1.00 41.78  ? 136 ARG A CA  1 
ATOM   876   C  C   . ARG A  1 136 ? 58.595 62.595  50.629  1.00 48.49  ? 136 ARG A C   1 
ATOM   877   O  O   . ARG A  1 136 ? 58.465 61.378  50.780  1.00 49.41  ? 136 ARG A O   1 
ATOM   878   C  CB  . ARG A  1 136 ? 58.174 63.967  52.709  1.00 39.87  ? 136 ARG A CB  1 
ATOM   879   C  CG  . ARG A  1 136 ? 57.175 64.807  53.502  1.00 43.04  ? 136 ARG A CG  1 
ATOM   880   C  CD  . ARG A  1 136 ? 57.722 65.497  54.736  1.00 41.16  ? 136 ARG A CD  1 
ATOM   881   N  NE  . ARG A  1 136 ? 56.721 66.417  55.280  1.00 42.88  ? 136 ARG A NE  1 
ATOM   882   C  CZ  . ARG A  1 136 ? 56.524 67.661  54.847  1.00 60.89  ? 136 ARG A CZ  1 
ATOM   883   N  NH1 . ARG A  1 136 ? 57.279 68.162  53.876  1.00 50.22  ? 136 ARG A NH1 1 
ATOM   884   N  NH2 . ARG A  1 136 ? 55.574 68.413  55.383  1.00 51.29  ? 136 ARG A NH2 1 
ATOM   885   N  N   . ALA A  1 137 ? 59.555 63.155  49.861  1.00 45.42  ? 137 ALA A N   1 
ATOM   886   C  CA  . ALA A  1 137 ? 60.589 62.426  49.126  1.00 46.14  ? 137 ALA A CA  1 
ATOM   887   C  C   . ALA A  1 137 ? 61.510 61.660  50.080  1.00 51.07  ? 137 ALA A C   1 
ATOM   888   O  O   . ALA A  1 137 ? 61.911 62.196  51.119  1.00 50.33  ? 137 ALA A O   1 
ATOM   889   C  CB  . ALA A  1 137 ? 61.402 63.395  48.282  1.00 47.00  ? 137 ALA A CB  1 
ATOM   890   N  N   . LYS A  1 138 ? 61.820 60.398  49.737  1.00 48.96  ? 138 LYS A N   1 
ATOM   891   C  CA  . LYS A  1 138 ? 62.689 59.555  50.555  1.00 49.97  ? 138 LYS A CA  1 
ATOM   892   C  C   . LYS A  1 138 ? 64.118 59.574  49.994  1.00 56.39  ? 138 LYS A C   1 
ATOM   893   O  O   . LYS A  1 138 ? 64.915 60.424  50.400  1.00 56.36  ? 138 LYS A O   1 
ATOM   894   C  CB  . LYS A  1 138 ? 62.143 58.117  50.666  1.00 52.27  ? 138 LYS A CB  1 
ATOM   895   C  CG  . LYS A  1 138 ? 60.867 57.981  51.497  1.00 61.78  ? 138 LYS A CG  1 
ATOM   896   C  CD  . LYS A  1 138 ? 60.592 56.536  51.908  1.00 72.91  ? 138 LYS A CD  1 
ATOM   897   C  CE  . LYS A  1 138 ? 60.008 55.674  50.808  1.00 84.96  ? 138 LYS A CE  1 
ATOM   898   N  NZ  . LYS A  1 138 ? 60.164 54.224  51.106  1.00 94.14  ? 138 LYS A NZ  1 
ATOM   899   N  N   . ASP A  1 139 ? 64.429 58.667  49.048  1.00 54.62  ? 139 ASP A N   1 
ATOM   900   C  CA  . ASP A  1 139 ? 65.753 58.543  48.437  1.00 56.20  ? 139 ASP A CA  1 
ATOM   901   C  C   . ASP A  1 139 ? 65.811 59.174  47.036  1.00 59.26  ? 139 ASP A C   1 
ATOM   902   O  O   . ASP A  1 139 ? 66.910 59.316  46.488  1.00 59.77  ? 139 ASP A O   1 
ATOM   903   C  CB  . ASP A  1 139 ? 66.172 57.058  48.369  1.00 60.02  ? 139 ASP A CB  1 
ATOM   904   C  CG  . ASP A  1 139 ? 66.263 56.351  49.713  1.00 76.73  ? 139 ASP A CG  1 
ATOM   905   O  OD1 . ASP A  1 139 ? 66.767 56.970  50.684  1.00 78.39  ? 139 ASP A OD1 1 
ATOM   906   O  OD2 . ASP A  1 139 ? 65.866 55.165  49.789  1.00 84.24  ? 139 ASP A OD2 1 
ATOM   907   N  N   . GLU A  1 140 ? 64.640 59.559  46.466  1.00 54.05  ? 140 GLU A N   1 
ATOM   908   C  CA  . GLU A  1 140 ? 64.533 60.165  45.130  1.00 53.18  ? 140 GLU A CA  1 
ATOM   909   C  C   . GLU A  1 140 ? 65.213 61.540  45.090  1.00 56.66  ? 140 GLU A C   1 
ATOM   910   O  O   . GLU A  1 140 ? 64.934 62.411  45.926  1.00 55.18  ? 140 GLU A O   1 
ATOM   911   C  CB  . GLU A  1 140 ? 63.072 60.252  44.632  1.00 53.14  ? 140 GLU A CB  1 
ATOM   912   C  CG  . GLU A  1 140 ? 62.043 60.675  45.668  1.00 58.08  ? 140 GLU A CG  1 
ATOM   913   C  CD  . GLU A  1 140 ? 61.237 59.523  46.228  1.00 63.25  ? 140 GLU A CD  1 
ATOM   914   O  OE1 . GLU A  1 140 ? 60.233 59.137  45.588  1.00 38.33  ? 140 GLU A OE1 1 
ATOM   915   O  OE2 . GLU A  1 140 ? 61.609 59.003  47.304  1.00 57.13  ? 140 GLU A OE2 1 
ATOM   916   N  N   . LYS A  1 141 ? 66.142 61.698  44.131  1.00 53.76  ? 141 LYS A N   1 
ATOM   917   C  CA  . LYS A  1 141 ? 66.945 62.905  43.928  1.00 53.85  ? 141 LYS A CA  1 
ATOM   918   C  C   . LYS A  1 141 ? 66.293 63.865  42.911  1.00 58.67  ? 141 LYS A C   1 
ATOM   919   O  O   . LYS A  1 141 ? 66.797 64.973  42.704  1.00 58.54  ? 141 LYS A O   1 
ATOM   920   C  CB  . LYS A  1 141 ? 68.368 62.518  43.492  1.00 57.22  ? 141 LYS A CB  1 
ATOM   921   C  CG  . LYS A  1 141 ? 69.173 61.874  44.622  1.00 66.28  ? 141 LYS A CG  1 
ATOM   922   C  CD  . LYS A  1 141 ? 70.438 61.199  44.140  1.00 77.17  ? 141 LYS A CD  1 
ATOM   923   C  CE  . LYS A  1 141 ? 71.115 60.444  45.257  1.00 88.44  ? 141 LYS A CE  1 
ATOM   924   N  NZ  . LYS A  1 141 ? 72.284 59.664  44.770  1.00 98.85  ? 141 LYS A NZ  1 
ATOM   925   N  N   . MET A  1 142 ? 65.159 63.445  42.307  1.00 55.53  ? 142 MET A N   1 
ATOM   926   C  CA  . MET A  1 142 ? 64.361 64.191  41.321  1.00 55.00  ? 142 MET A CA  1 
ATOM   927   C  C   . MET A  1 142 ? 62.993 63.517  41.130  1.00 58.12  ? 142 MET A C   1 
ATOM   928   O  O   . MET A  1 142 ? 62.812 62.377  41.568  1.00 58.18  ? 142 MET A O   1 
ATOM   929   C  CB  . MET A  1 142 ? 65.108 64.287  39.962  1.00 58.53  ? 142 MET A CB  1 
ATOM   930   C  CG  . MET A  1 142 ? 65.038 63.015  39.125  1.00 63.18  ? 142 MET A CG  1 
ATOM   931   S  SD  . MET A  1 142 ? 66.476 62.758  38.065  1.00 69.55  ? 142 MET A SD  1 
ATOM   932   C  CE  . MET A  1 142 ? 67.632 62.048  39.247  1.00 67.14  ? 142 MET A CE  1 
ATOM   933   N  N   . ILE A  1 143 ? 62.046 64.203  40.456  1.00 53.59  ? 143 ILE A N   1 
ATOM   934   C  CA  . ILE A  1 143 ? 60.749 63.608  40.124  1.00 52.76  ? 143 ILE A CA  1 
ATOM   935   C  C   . ILE A  1 143 ? 61.018 62.657  38.934  1.00 58.49  ? 143 ILE A C   1 
ATOM   936   O  O   . ILE A  1 143 ? 61.520 63.129  37.910  1.00 59.25  ? 143 ILE A O   1 
ATOM   937   C  CB  . ILE A  1 143 ? 59.626 64.658  39.837  1.00 54.56  ? 143 ILE A CB  1 
ATOM   938   C  CG1 . ILE A  1 143 ? 59.353 65.554  41.068  1.00 53.40  ? 143 ILE A CG1 1 
ATOM   939   C  CG2 . ILE A  1 143 ? 58.343 63.959  39.366  1.00 55.05  ? 143 ILE A CG2 1 
ATOM   940   C  CD1 . ILE A  1 143 ? 58.301 66.661  40.890  1.00 55.57  ? 143 ILE A CD1 1 
ATOM   941   N  N   . PRO A  1 144 ? 60.769 61.326  39.069  1.00 55.26  ? 144 PRO A N   1 
ATOM   942   C  CA  . PRO A  1 144 ? 61.071 60.391  37.967  1.00 56.15  ? 144 PRO A CA  1 
ATOM   943   C  C   . PRO A  1 144 ? 60.532 60.840  36.607  1.00 60.61  ? 144 PRO A C   1 
ATOM   944   O  O   . PRO A  1 144 ? 59.351 61.170  36.482  1.00 59.26  ? 144 PRO A O   1 
ATOM   945   C  CB  . PRO A  1 144 ? 60.405 59.094  38.421  1.00 57.82  ? 144 PRO A CB  1 
ATOM   946   C  CG  . PRO A  1 144 ? 60.444 59.164  39.890  1.00 61.63  ? 144 PRO A CG  1 
ATOM   947   C  CD  . PRO A  1 144 ? 60.219 60.605  40.233  1.00 56.29  ? 144 PRO A CD  1 
ATOM   948   N  N   . GLY A  1 145 ? 61.434 60.899  35.627  1.00 58.66  ? 145 GLY A N   1 
ATOM   949   C  CA  . GLY A  1 145 ? 61.133 61.328  34.265  1.00 59.16  ? 145 GLY A CA  1 
ATOM   950   C  C   . GLY A  1 145 ? 61.407 62.795  33.996  1.00 63.68  ? 145 GLY A C   1 
ATOM   951   O  O   . GLY A  1 145 ? 61.516 63.197  32.835  1.00 64.12  ? 145 GLY A O   1 
ATOM   952   N  N   . TYR A  1 146 ? 61.518 63.611  35.064  1.00 59.93  ? 146 TYR A N   1 
ATOM   953   C  CA  . TYR A  1 146 ? 61.769 65.049  34.957  1.00 59.67  ? 146 TYR A CA  1 
ATOM   954   C  C   . TYR A  1 146 ? 62.998 65.423  35.816  1.00 63.01  ? 146 TYR A C   1 
ATOM   955   O  O   . TYR A  1 146 ? 62.856 65.742  37.003  1.00 61.54  ? 146 TYR A O   1 
ATOM   956   C  CB  . TYR A  1 146 ? 60.509 65.859  35.326  1.00 59.84  ? 146 TYR A CB  1 
ATOM   957   C  CG  . TYR A  1 146 ? 59.353 65.584  34.387  1.00 62.17  ? 146 TYR A CG  1 
ATOM   958   C  CD1 . TYR A  1 146 ? 59.234 66.266  33.179  1.00 64.74  ? 146 TYR A CD1 1 
ATOM   959   C  CD2 . TYR A  1 146 ? 58.410 64.602  34.677  1.00 62.70  ? 146 TYR A CD2 1 
ATOM   960   C  CE1 . TYR A  1 146 ? 58.192 65.992  32.293  1.00 65.85  ? 146 TYR A CE1 1 
ATOM   961   C  CE2 . TYR A  1 146 ? 57.364 64.320  33.799  1.00 63.70  ? 146 TYR A CE2 1 
ATOM   962   C  CZ  . TYR A  1 146 ? 57.259 65.018  32.608  1.00 71.86  ? 146 TYR A CZ  1 
ATOM   963   O  OH  . TYR A  1 146 ? 56.232 64.746  31.738  1.00 73.57  ? 146 TYR A OH  1 
ATOM   964   N  N   . PRO A  1 147 ? 64.219 65.346  35.220  1.00 60.26  ? 147 PRO A N   1 
ATOM   965   C  CA  . PRO A  1 147 ? 65.446 65.649  35.979  1.00 60.43  ? 147 PRO A CA  1 
ATOM   966   C  C   . PRO A  1 147 ? 65.540 67.087  36.481  1.00 64.34  ? 147 PRO A C   1 
ATOM   967   O  O   . PRO A  1 147 ? 66.195 67.313  37.497  1.00 64.31  ? 147 PRO A O   1 
ATOM   968   C  CB  . PRO A  1 147 ? 66.560 65.364  34.971  1.00 63.67  ? 147 PRO A CB  1 
ATOM   969   C  CG  . PRO A  1 147 ? 65.947 64.463  33.954  1.00 68.40  ? 147 PRO A CG  1 
ATOM   970   C  CD  . PRO A  1 147 ? 64.542 64.963  33.833  1.00 62.78  ? 147 PRO A CD  1 
ATOM   971   N  N   . GLN A  1 148 ? 64.897 68.046  35.788  1.00 60.58  ? 148 GLN A N   1 
ATOM   972   C  CA  . GLN A  1 148 ? 64.874 69.468  36.158  1.00 59.81  ? 148 GLN A CA  1 
ATOM   973   C  C   . GLN A  1 148 ? 64.160 69.679  37.514  1.00 61.04  ? 148 GLN A C   1 
ATOM   974   O  O   . GLN A  1 148 ? 64.593 70.516  38.305  1.00 60.73  ? 148 GLN A O   1 
ATOM   975   C  CB  . GLN A  1 148 ? 64.236 70.343  35.061  1.00 61.47  ? 148 GLN A CB  1 
ATOM   976   C  CG  . GLN A  1 148 ? 62.930 69.789  34.471  1.00 81.42  ? 148 GLN A CG  1 
ATOM   977   C  CD  . GLN A  1 148 ? 63.117 68.938  33.237  1.00 103.29 ? 148 GLN A CD  1 
ATOM   978   O  OE1 . GLN A  1 148 ? 64.118 68.234  33.061  1.00 100.15 ? 148 GLN A OE1 1 
ATOM   979   N  NE2 . GLN A  1 148 ? 62.115 68.934  32.374  1.00 95.60  ? 148 GLN A NE2 1 
ATOM   980   N  N   . ALA A  1 149 ? 63.082 68.903  37.770  1.00 55.03  ? 149 ALA A N   1 
ATOM   981   C  CA  . ALA A  1 149 ? 62.305 68.948  39.007  1.00 52.53  ? 149 ALA A CA  1 
ATOM   982   C  C   . ALA A  1 149 ? 62.998 68.101  40.079  1.00 53.80  ? 149 ALA A C   1 
ATOM   983   O  O   . ALA A  1 149 ? 62.558 66.994  40.407  1.00 52.90  ? 149 ALA A O   1 
ATOM   984   C  CB  . ALA A  1 149 ? 60.882 68.464  38.755  1.00 52.52  ? 149 ALA A CB  1 
ATOM   985   N  N   . LYS A  1 150 ? 64.114 68.642  40.599  1.00 49.03  ? 150 LYS A N   1 
ATOM   986   C  CA  . LYS A  1 150 ? 64.973 68.027  41.607  1.00 48.46  ? 150 LYS A CA  1 
ATOM   987   C  C   . LYS A  1 150 ? 64.250 67.850  42.940  1.00 50.49  ? 150 LYS A C   1 
ATOM   988   O  O   . LYS A  1 150 ? 63.310 68.585  43.238  1.00 48.34  ? 150 LYS A O   1 
ATOM   989   C  CB  . LYS A  1 150 ? 66.239 68.871  41.801  1.00 51.32  ? 150 LYS A CB  1 
ATOM   990   N  N   . LEU A  1 151 ? 64.691 66.862  43.733  1.00 47.95  ? 151 LEU A N   1 
ATOM   991   C  CA  . LEU A  1 151 ? 64.131 66.539  45.047  1.00 47.24  ? 151 LEU A CA  1 
ATOM   992   C  C   . LEU A  1 151 ? 65.237 66.263  46.069  1.00 51.96  ? 151 LEU A C   1 
ATOM   993   O  O   . LEU A  1 151 ? 66.392 66.048  45.690  1.00 52.70  ? 151 LEU A O   1 
ATOM   994   C  CB  . LEU A  1 151 ? 63.195 65.316  44.948  1.00 47.10  ? 151 LEU A CB  1 
ATOM   995   C  CG  . LEU A  1 151 ? 61.772 65.542  44.427  1.00 50.62  ? 151 LEU A CG  1 
ATOM   996   C  CD1 . LEU A  1 151 ? 61.119 64.223  44.080  1.00 50.75  ? 151 LEU A CD1 1 
ATOM   997   C  CD2 . LEU A  1 151 ? 60.910 66.251  45.456  1.00 51.77  ? 151 LEU A CD2 1 
ATOM   998   N  N   . TYR A  1 152 ? 64.878 66.272  47.364  1.00 48.12  ? 152 TYR A N   1 
ATOM   999   C  CA  . TYR A  1 152 ? 65.790 65.993  48.476  1.00 49.00  ? 152 TYR A CA  1 
ATOM   1000  C  C   . TYR A  1 152 ? 64.998 65.329  49.625  1.00 53.11  ? 152 TYR A C   1 
ATOM   1001  O  O   . TYR A  1 152 ? 63.773 65.499  49.668  1.00 51.43  ? 152 TYR A O   1 
ATOM   1002  C  CB  . TYR A  1 152 ? 66.532 67.272  48.938  1.00 50.40  ? 152 TYR A CB  1 
ATOM   1003  C  CG  . TYR A  1 152 ? 65.645 68.377  49.472  1.00 51.36  ? 152 TYR A CG  1 
ATOM   1004  C  CD1 . TYR A  1 152 ? 65.347 68.463  50.829  1.00 53.25  ? 152 TYR A CD1 1 
ATOM   1005  C  CD2 . TYR A  1 152 ? 65.155 69.373  48.631  1.00 51.41  ? 152 TYR A CD2 1 
ATOM   1006  C  CE1 . TYR A  1 152 ? 64.541 69.485  51.330  1.00 53.14  ? 152 TYR A CE1 1 
ATOM   1007  C  CE2 . TYR A  1 152 ? 64.353 70.402  49.120  1.00 51.31  ? 152 TYR A CE2 1 
ATOM   1008  C  CZ  . TYR A  1 152 ? 64.046 70.453  50.471  1.00 58.49  ? 152 TYR A CZ  1 
ATOM   1009  O  OH  . TYR A  1 152 ? 63.250 71.459  50.961  1.00 57.84  ? 152 TYR A OH  1 
ATOM   1010  N  N   . PRO A  1 153 ? 65.640 64.563  50.551  1.00 51.04  ? 153 PRO A N   1 
ATOM   1011  C  CA  . PRO A  1 153 ? 64.865 63.917  51.625  1.00 50.60  ? 153 PRO A CA  1 
ATOM   1012  C  C   . PRO A  1 153 ? 64.135 64.929  52.511  1.00 54.15  ? 153 PRO A C   1 
ATOM   1013  O  O   . PRO A  1 153 ? 64.741 65.870  53.039  1.00 54.21  ? 153 PRO A O   1 
ATOM   1014  C  CB  . PRO A  1 153 ? 65.919 63.122  52.405  1.00 53.60  ? 153 PRO A CB  1 
ATOM   1015  C  CG  . PRO A  1 153 ? 67.214 63.760  52.064  1.00 58.91  ? 153 PRO A CG  1 
ATOM   1016  C  CD  . PRO A  1 153 ? 67.072 64.215  50.650  1.00 54.12  ? 153 PRO A CD  1 
ATOM   1017  N  N   . GLY A  1 154 ? 62.821 64.746  52.602  1.00 49.88  ? 154 GLY A N   1 
ATOM   1018  C  CA  . GLY A  1 154 ? 61.935 65.598  53.384  1.00 48.78  ? 154 GLY A CA  1 
ATOM   1019  C  C   . GLY A  1 154 ? 61.074 66.547  52.576  1.00 51.90  ? 154 GLY A C   1 
ATOM   1020  O  O   . GLY A  1 154 ? 60.093 67.072  53.107  1.00 51.18  ? 154 GLY A O   1 
ATOM   1021  N  N   . LYS A  1 155 ? 61.431 66.789  51.296  1.00 48.12  ? 155 LYS A N   1 
ATOM   1022  C  CA  . LYS A  1 155 ? 60.702 67.710  50.417  1.00 46.93  ? 155 LYS A CA  1 
ATOM   1023  C  C   . LYS A  1 155 ? 59.312 67.172  50.065  1.00 50.20  ? 155 LYS A C   1 
ATOM   1024  O  O   . LYS A  1 155 ? 59.181 66.015  49.658  1.00 50.31  ? 155 LYS A O   1 
ATOM   1025  C  CB  . LYS A  1 155 ? 61.511 68.010  49.129  1.00 49.67  ? 155 LYS A CB  1 
ATOM   1026  C  CG  . LYS A  1 155 ? 60.834 68.950  48.107  1.00 57.69  ? 155 LYS A CG  1 
ATOM   1027  C  CD  . LYS A  1 155 ? 60.719 70.400  48.579  1.00 66.16  ? 155 LYS A CD  1 
ATOM   1028  C  CE  . LYS A  1 155 ? 59.843 71.233  47.680  1.00 73.86  ? 155 LYS A CE  1 
ATOM   1029  N  NZ  . LYS A  1 155 ? 59.625 72.592  48.236  1.00 81.56  ? 155 LYS A NZ  1 
ATOM   1030  N  N   . SER A  1 156 ? 58.284 68.038  50.221  1.00 45.52  ? 156 SER A N   1 
ATOM   1031  C  CA  . SER A  1 156 ? 56.881 67.761  49.896  1.00 44.22  ? 156 SER A CA  1 
ATOM   1032  C  C   . SER A  1 156 ? 56.748 67.492  48.393  1.00 47.51  ? 156 SER A C   1 
ATOM   1033  O  O   . SER A  1 156 ? 57.140 68.336  47.580  1.00 48.12  ? 156 SER A O   1 
ATOM   1034  C  CB  . SER A  1 156 ? 55.999 68.934  50.320  1.00 46.27  ? 156 SER A CB  1 
ATOM   1035  O  OG  . SER A  1 156 ? 54.699 68.869  49.756  1.00 52.99  ? 156 SER A OG  1 
ATOM   1036  N  N   . LEU A  1 157 ? 56.243 66.301  48.034  1.00 41.97  ? 157 LEU A N   1 
ATOM   1037  C  CA  . LEU A  1 157 ? 56.077 65.873  46.649  1.00 41.26  ? 157 LEU A CA  1 
ATOM   1038  C  C   . LEU A  1 157 ? 55.031 66.729  45.929  1.00 43.20  ? 157 LEU A C   1 
ATOM   1039  O  O   . LEU A  1 157 ? 55.313 67.233  44.841  1.00 42.00  ? 157 LEU A O   1 
ATOM   1040  C  CB  . LEU A  1 157 ? 55.706 64.380  46.579  1.00 41.80  ? 157 LEU A CB  1 
ATOM   1041  C  CG  . LEU A  1 157 ? 56.695 63.386  47.208  1.00 47.61  ? 157 LEU A CG  1 
ATOM   1042  C  CD1 . LEU A  1 157 ? 56.110 61.993  47.250  1.00 48.16  ? 157 LEU A CD1 1 
ATOM   1043  C  CD2 . LEU A  1 157 ? 58.029 63.376  46.475  1.00 51.41  ? 157 LEU A CD2 1 
ATOM   1044  N  N   . LEU A  1 158 ? 53.856 66.944  46.568  1.00 39.35  ? 158 LEU A N   1 
ATOM   1045  C  CA  . LEU A  1 158 ? 52.748 67.748  46.040  1.00 38.73  ? 158 LEU A CA  1 
ATOM   1046  C  C   . LEU A  1 158 ? 53.200 69.167  45.692  1.00 41.62  ? 158 LEU A C   1 
ATOM   1047  O  O   . LEU A  1 158 ? 52.780 69.693  44.668  1.00 41.33  ? 158 LEU A O   1 
ATOM   1048  C  CB  . LEU A  1 158 ? 51.584 67.798  47.047  1.00 38.38  ? 158 LEU A CB  1 
ATOM   1049  C  CG  . LEU A  1 158 ? 50.258 68.351  46.529  1.00 43.19  ? 158 LEU A CG  1 
ATOM   1050  C  CD1 . LEU A  1 158 ? 49.438 67.262  45.849  1.00 44.13  ? 158 LEU A CD1 1 
ATOM   1051  C  CD2 . LEU A  1 158 ? 49.460 68.974  47.651  1.00 45.11  ? 158 LEU A CD2 1 
ATOM   1052  N  N   . ARG A  1 159 ? 54.066 69.769  46.531  1.00 37.53  ? 159 ARG A N   1 
ATOM   1053  C  CA  . ARG A  1 159 ? 54.608 71.112  46.312  1.00 37.05  ? 159 ARG A CA  1 
ATOM   1054  C  C   . ARG A  1 159 ? 55.510 71.130  45.071  1.00 41.13  ? 159 ARG A C   1 
ATOM   1055  O  O   . ARG A  1 159 ? 55.292 71.959  44.187  1.00 40.85  ? 159 ARG A O   1 
ATOM   1056  C  CB  . ARG A  1 159 ? 55.365 71.605  47.562  1.00 37.62  ? 159 ARG A CB  1 
ATOM   1057  C  CG  . ARG A  1 159 ? 56.126 72.928  47.405  1.00 47.08  ? 159 ARG A CG  1 
ATOM   1058  C  CD  . ARG A  1 159 ? 55.229 74.141  47.208  1.00 55.56  ? 159 ARG A CD  1 
ATOM   1059  N  NE  . ARG A  1 159 ? 56.022 75.366  47.104  1.00 66.19  ? 159 ARG A NE  1 
ATOM   1060  C  CZ  . ARG A  1 159 ? 55.643 76.459  46.451  1.00 78.98  ? 159 ARG A CZ  1 
ATOM   1061  N  NH1 . ARG A  1 159 ? 54.471 76.496  45.829  1.00 65.26  ? 159 ARG A NH1 1 
ATOM   1062  N  NH2 . ARG A  1 159 ? 56.439 77.518  46.401  1.00 64.96  ? 159 ARG A NH2 1 
ATOM   1063  N  N   . ARG A  1 160 ? 56.485 70.196  44.989  1.00 37.90  ? 160 ARG A N   1 
ATOM   1064  C  CA  . ARG A  1 160 ? 57.415 70.083  43.863  1.00 38.26  ? 160 ARG A CA  1 
ATOM   1065  C  C   . ARG A  1 160 ? 56.667 69.787  42.556  1.00 42.63  ? 160 ARG A C   1 
ATOM   1066  O  O   . ARG A  1 160 ? 57.037 70.334  41.517  1.00 43.04  ? 160 ARG A O   1 
ATOM   1067  C  CB  . ARG A  1 160 ? 58.491 69.016  44.135  1.00 37.54  ? 160 ARG A CB  1 
ATOM   1068  C  CG  . ARG A  1 160 ? 59.741 69.145  43.255  1.00 45.99  ? 160 ARG A CG  1 
ATOM   1069  C  CD  . ARG A  1 160 ? 60.546 70.404  43.534  1.00 54.06  ? 160 ARG A CD  1 
ATOM   1070  N  NE  . ARG A  1 160 ? 61.381 70.797  42.396  1.00 61.12  ? 160 ARG A NE  1 
ATOM   1071  C  CZ  . ARG A  1 160 ? 60.982 71.594  41.408  1.00 76.61  ? 160 ARG A CZ  1 
ATOM   1072  N  NH1 . ARG A  1 160 ? 59.746 72.077  41.392  1.00 63.58  ? 160 ARG A NH1 1 
ATOM   1073  N  NH2 . ARG A  1 160 ? 61.815 71.911  40.426  1.00 67.60  ? 160 ARG A NH2 1 
ATOM   1074  N  N   . LEU A  1 161 ? 55.604 68.959  42.616  1.00 38.40  ? 161 LEU A N   1 
ATOM   1075  C  CA  . LEU A  1 161 ? 54.776 68.625  41.456  1.00 38.05  ? 161 LEU A CA  1 
ATOM   1076  C  C   . LEU A  1 161 ? 54.026 69.866  40.952  1.00 41.88  ? 161 LEU A C   1 
ATOM   1077  O  O   . LEU A  1 161 ? 53.949 70.078  39.742  1.00 41.71  ? 161 LEU A O   1 
ATOM   1078  C  CB  . LEU A  1 161 ? 53.784 67.499  41.800  1.00 37.54  ? 161 LEU A CB  1 
ATOM   1079  C  CG  . LEU A  1 161 ? 54.347 66.076  41.843  1.00 42.07  ? 161 LEU A CG  1 
ATOM   1080  C  CD1 . LEU A  1 161 ? 53.590 65.226  42.825  1.00 41.47  ? 161 LEU A CD1 1 
ATOM   1081  C  CD2 . LEU A  1 161 ? 54.318 65.429  40.482  1.00 44.07  ? 161 LEU A CD2 1 
ATOM   1082  N  N   . LEU A  1 162 ? 53.513 70.700  41.881  1.00 38.42  ? 162 LEU A N   1 
ATOM   1083  C  CA  . LEU A  1 162 ? 52.780 71.927  41.558  1.00 38.45  ? 162 LEU A CA  1 
ATOM   1084  C  C   . LEU A  1 162 ? 53.712 73.033  41.063  1.00 44.22  ? 162 LEU A C   1 
ATOM   1085  O  O   . LEU A  1 162 ? 53.330 73.766  40.150  1.00 44.48  ? 162 LEU A O   1 
ATOM   1086  C  CB  . LEU A  1 162 ? 51.966 72.437  42.761  1.00 37.56  ? 162 LEU A CB  1 
ATOM   1087  C  CG  . LEU A  1 162 ? 50.672 71.681  43.109  1.00 41.80  ? 162 LEU A CG  1 
ATOM   1088  C  CD1 . LEU A  1 162 ? 50.187 72.056  44.489  1.00 40.81  ? 162 LEU A CD1 1 
ATOM   1089  C  CD2 . LEU A  1 162 ? 49.571 71.934  42.088  1.00 44.90  ? 162 LEU A CD2 1 
ATOM   1090  N  N   . THR A  1 163 ? 54.923 73.153  41.660  1.00 41.28  ? 163 THR A N   1 
ATOM   1091  C  CA  . THR A  1 163 ? 55.937 74.157  41.300  1.00 41.56  ? 163 THR A CA  1 
ATOM   1092  C  C   . THR A  1 163 ? 56.448 73.920  39.868  1.00 45.53  ? 163 THR A C   1 
ATOM   1093  O  O   . THR A  1 163 ? 56.456 74.854  39.066  1.00 45.08  ? 163 THR A O   1 
ATOM   1094  C  CB  . THR A  1 163 ? 57.088 74.147  42.318  1.00 52.31  ? 163 THR A CB  1 
ATOM   1095  O  OG1 . THR A  1 163 ? 56.558 74.332  43.628  1.00 52.45  ? 163 THR A OG1 1 
ATOM   1096  C  CG2 . THR A  1 163 ? 58.138 75.217  42.034  1.00 53.82  ? 163 THR A CG2 1 
ATOM   1097  N  N   . SER A  1 164 ? 56.857 72.673  39.560  1.00 42.66  ? 164 SER A N   1 
ATOM   1098  C  CA  . SER A  1 164 ? 57.365 72.246  38.254  1.00 43.67  ? 164 SER A CA  1 
ATOM   1099  C  C   . SER A  1 164 ? 56.297 72.346  37.162  1.00 47.66  ? 164 SER A C   1 
ATOM   1100  O  O   . SER A  1 164 ? 56.629 72.620  36.007  1.00 48.34  ? 164 SER A O   1 
ATOM   1101  C  CB  . SER A  1 164 ? 57.879 70.811  38.328  1.00 47.78  ? 164 SER A CB  1 
ATOM   1102  O  OG  . SER A  1 164 ? 56.862 69.930  38.778  1.00 55.09  ? 164 SER A OG  1 
ATOM   1103  N  N   . GLY A  1 165 ? 55.042 72.107  37.541  1.00 43.22  ? 165 GLY A N   1 
ATOM   1104  C  CA  . GLY A  1 165 ? 53.899 72.152  36.638  1.00 43.01  ? 165 GLY A CA  1 
ATOM   1105  C  C   . GLY A  1 165 ? 53.432 70.793  36.160  1.00 47.63  ? 165 GLY A C   1 
ATOM   1106  O  O   . GLY A  1 165 ? 52.609 70.726  35.243  1.00 48.19  ? 165 GLY A O   1 
ATOM   1107  N  N   . ILE A  1 166 ? 53.958 69.698  36.770  1.00 43.80  ? 166 ILE A N   1 
ATOM   1108  C  CA  . ILE A  1 166 ? 53.597 68.308  36.444  1.00 43.74  ? 166 ILE A CA  1 
ATOM   1109  C  C   . ILE A  1 166 ? 52.138 68.088  36.886  1.00 47.48  ? 166 ILE A C   1 
ATOM   1110  O  O   . ILE A  1 166 ? 51.347 67.537  36.122  1.00 48.03  ? 166 ILE A O   1 
ATOM   1111  C  CB  . ILE A  1 166 ? 54.600 67.274  37.051  1.00 46.89  ? 166 ILE A CB  1 
ATOM   1112  C  CG1 . ILE A  1 166 ? 56.024 67.505  36.487  1.00 48.03  ? 166 ILE A CG1 1 
ATOM   1113  C  CG2 . ILE A  1 166 ? 54.147 65.828  36.782  1.00 48.02  ? 166 ILE A CG2 1 
ATOM   1114  C  CD1 . ILE A  1 166 ? 57.174 66.922  37.284  1.00 54.77  ? 166 ILE A CD1 1 
ATOM   1115  N  N   . VAL A  1 167 ? 51.782 68.577  38.087  1.00 42.67  ? 167 VAL A N   1 
ATOM   1116  C  CA  . VAL A  1 167 ? 50.419 68.539  38.612  1.00 41.80  ? 167 VAL A CA  1 
ATOM   1117  C  C   . VAL A  1 167 ? 49.863 69.956  38.439  1.00 45.71  ? 167 VAL A C   1 
ATOM   1118  O  O   . VAL A  1 167 ? 50.433 70.903  38.990  1.00 45.52  ? 167 VAL A O   1 
ATOM   1119  C  CB  . VAL A  1 167 ? 50.356 68.014  40.081  1.00 45.13  ? 167 VAL A CB  1 
ATOM   1120  C  CG1 . VAL A  1 167 ? 49.025 68.357  40.754  1.00 44.10  ? 167 VAL A CG1 1 
ATOM   1121  C  CG2 . VAL A  1 167 ? 50.601 66.509  40.134  1.00 45.63  ? 167 VAL A CG2 1 
ATOM   1122  N  N   . ILE A  1 168 ? 48.797 70.108  37.629  1.00 41.88  ? 168 ILE A N   1 
ATOM   1123  C  CA  . ILE A  1 168 ? 48.163 71.406  37.377  1.00 41.26  ? 168 ILE A CA  1 
ATOM   1124  C  C   . ILE A  1 168 ? 47.388 71.844  38.627  1.00 44.13  ? 168 ILE A C   1 
ATOM   1125  O  O   . ILE A  1 168 ? 47.578 72.971  39.088  1.00 43.32  ? 168 ILE A O   1 
ATOM   1126  C  CB  . ILE A  1 168 ? 47.252 71.407  36.113  1.00 45.10  ? 168 ILE A CB  1 
ATOM   1127  C  CG1 . ILE A  1 168 ? 48.015 70.947  34.847  1.00 46.80  ? 168 ILE A CG1 1 
ATOM   1128  C  CG2 . ILE A  1 168 ? 46.605 72.789  35.902  1.00 45.68  ? 168 ILE A CG2 1 
ATOM   1129  C  CD1 . ILE A  1 168 ? 47.102 70.542  33.651  1.00 57.61  ? 168 ILE A CD1 1 
ATOM   1130  N  N   . GLN A  1 169 ? 46.522 70.959  39.170  1.00 40.51  ? 169 GLN A N   1 
ATOM   1131  C  CA  . GLN A  1 169 ? 45.692 71.262  40.342  1.00 39.42  ? 169 GLN A CA  1 
ATOM   1132  C  C   . GLN A  1 169 ? 45.203 70.012  41.092  1.00 42.64  ? 169 GLN A C   1 
ATOM   1133  O  O   . GLN A  1 169 ? 45.116 68.924  40.519  1.00 43.23  ? 169 GLN A O   1 
ATOM   1134  C  CB  . GLN A  1 169 ? 44.464 72.104  39.931  1.00 40.64  ? 169 GLN A CB  1 
ATOM   1135  C  CG  . GLN A  1 169 ? 43.551 71.439  38.888  1.00 54.30  ? 169 GLN A CG  1 
ATOM   1136  C  CD  . GLN A  1 169 ? 42.207 72.103  38.762  1.00 72.30  ? 169 GLN A CD  1 
ATOM   1137  O  OE1 . GLN A  1 169 ? 41.772 72.854  39.632  1.00 67.70  ? 169 GLN A OE1 1 
ATOM   1138  N  NE2 . GLN A  1 169 ? 41.503 71.820  37.680  1.00 64.19  ? 169 GLN A NE2 1 
ATOM   1139  N  N   . VAL A  1 170 ? 44.849 70.205  42.373  1.00 37.38  ? 170 VAL A N   1 
ATOM   1140  C  CA  . VAL A  1 170 ? 44.275 69.201  43.274  1.00 36.48  ? 170 VAL A CA  1 
ATOM   1141  C  C   . VAL A  1 170 ? 43.042 69.869  43.916  1.00 39.93  ? 170 VAL A C   1 
ATOM   1142  O  O   . VAL A  1 170 ? 43.166 70.968  44.471  1.00 39.17  ? 170 VAL A O   1 
ATOM   1143  C  CB  . VAL A  1 170 ? 45.306 68.655  44.307  1.00 39.43  ? 170 VAL A CB  1 
ATOM   1144  C  CG1 . VAL A  1 170 ? 44.631 67.829  45.400  1.00 38.82  ? 170 VAL A CG1 1 
ATOM   1145  C  CG2 . VAL A  1 170 ? 46.397 67.839  43.618  1.00 39.68  ? 170 VAL A CG2 1 
ATOM   1146  N  N   . PHE A  1 171 ? 41.850 69.250  43.781  1.00 36.23  ? 171 PHE A N   1 
ATOM   1147  C  CA  . PHE A  1 171 ? 40.621 69.855  44.299  1.00 35.67  ? 171 PHE A CA  1 
ATOM   1148  C  C   . PHE A  1 171 ? 39.583 68.824  44.787  1.00 39.84  ? 171 PHE A C   1 
ATOM   1149  O  O   . PHE A  1 171 ? 39.482 67.744  44.201  1.00 40.19  ? 171 PHE A O   1 
ATOM   1150  C  CB  . PHE A  1 171 ? 39.981 70.766  43.224  1.00 37.70  ? 171 PHE A CB  1 
ATOM   1151  C  CG  . PHE A  1 171 ? 39.450 70.076  41.988  1.00 40.01  ? 171 PHE A CG  1 
ATOM   1152  C  CD1 . PHE A  1 171 ? 40.268 69.866  40.883  1.00 43.73  ? 171 PHE A CD1 1 
ATOM   1153  C  CD2 . PHE A  1 171 ? 38.120 69.676  41.911  1.00 42.74  ? 171 PHE A CD2 1 
ATOM   1154  C  CE1 . PHE A  1 171 ? 39.774 69.234  39.736  1.00 45.68  ? 171 PHE A CE1 1 
ATOM   1155  C  CE2 . PHE A  1 171 ? 37.628 69.038  40.769  1.00 46.65  ? 171 PHE A CE2 1 
ATOM   1156  C  CZ  . PHE A  1 171 ? 38.457 68.827  39.686  1.00 45.25  ? 171 PHE A CZ  1 
ATOM   1157  N  N   . PRO A  1 172 ? 38.757 69.165  45.810  1.00 35.92  ? 172 PRO A N   1 
ATOM   1158  C  CA  . PRO A  1 172 ? 37.718 68.223  46.255  1.00 36.22  ? 172 PRO A CA  1 
ATOM   1159  C  C   . PRO A  1 172 ? 36.467 68.286  45.376  1.00 41.58  ? 172 PRO A C   1 
ATOM   1160  O  O   . PRO A  1 172 ? 36.146 69.345  44.836  1.00 41.11  ? 172 PRO A O   1 
ATOM   1161  C  CB  . PRO A  1 172 ? 37.418 68.681  47.681  1.00 37.42  ? 172 PRO A CB  1 
ATOM   1162  C  CG  . PRO A  1 172 ? 37.758 70.117  47.714  1.00 41.00  ? 172 PRO A CG  1 
ATOM   1163  C  CD  . PRO A  1 172 ? 38.734 70.409  46.610  1.00 36.64  ? 172 PRO A CD  1 
ATOM   1164  N  N   . LEU A  1 173 ? 35.758 67.153  45.245  1.00 39.55  ? 173 LEU A N   1 
ATOM   1165  C  CA  . LEU A  1 173 ? 34.544 67.037  44.433  1.00 40.46  ? 173 LEU A CA  1 
ATOM   1166  C  C   . LEU A  1 173 ? 33.285 67.475  45.182  1.00 46.35  ? 173 LEU A C   1 
ATOM   1167  O  O   . LEU A  1 173 ? 33.126 67.171  46.365  1.00 46.45  ? 173 LEU A O   1 
ATOM   1168  C  CB  . LEU A  1 173 ? 34.354 65.594  43.953  1.00 41.26  ? 173 LEU A CB  1 
ATOM   1169  C  CG  . LEU A  1 173 ? 35.002 65.217  42.630  1.00 46.53  ? 173 LEU A CG  1 
ATOM   1170  C  CD1 . LEU A  1 173 ? 35.181 63.723  42.532  1.00 47.50  ? 173 LEU A CD1 1 
ATOM   1171  C  CD2 . LEU A  1 173 ? 34.178 65.704  41.454  1.00 49.68  ? 173 LEU A CD2 1 
ATOM   1172  N  N   . HIS A  1 174 ? 32.376 68.160  44.467  1.00 43.88  ? 174 HIS A N   1 
ATOM   1173  C  CA  . HIS A  1 174 ? 31.088 68.630  44.983  1.00 43.96  ? 174 HIS A CA  1 
ATOM   1174  C  C   . HIS A  1 174 ? 30.094 67.477  45.114  1.00 50.14  ? 174 HIS A C   1 
ATOM   1175  O  O   . HIS A  1 174 ? 30.090 66.573  44.272  1.00 50.70  ? 174 HIS A O   1 
ATOM   1176  C  CB  . HIS A  1 174 ? 30.480 69.684  44.031  1.00 44.74  ? 174 HIS A CB  1 
ATOM   1177  C  CG  . HIS A  1 174 ? 30.839 71.111  44.316  1.00 47.31  ? 174 HIS A CG  1 
ATOM   1178  N  ND1 . HIS A  1 174 ? 30.419 71.745  45.470  1.00 48.67  ? 174 HIS A ND1 1 
ATOM   1179  C  CD2 . HIS A  1 174 ? 31.478 72.012  43.533  1.00 48.84  ? 174 HIS A CD2 1 
ATOM   1180  C  CE1 . HIS A  1 174 ? 30.849 72.994  45.372  1.00 47.56  ? 174 HIS A CE1 1 
ATOM   1181  N  NE2 . HIS A  1 174 ? 31.492 73.201  44.223  1.00 47.99  ? 174 HIS A NE2 1 
ATOM   1182  N  N   . ASP A  1 175 ? 29.229 67.528  46.141  1.00 47.57  ? 175 ASP A N   1 
ATOM   1183  C  CA  . ASP A  1 175 ? 28.139 66.571  46.317  1.00 48.93  ? 175 ASP A CA  1 
ATOM   1184  C  C   . ASP A  1 175 ? 26.862 67.305  45.912  1.00 55.69  ? 175 ASP A C   1 
ATOM   1185  O  O   . ASP A  1 175 ? 26.230 67.972  46.735  1.00 55.46  ? 175 ASP A O   1 
ATOM   1186  C  CB  . ASP A  1 175 ? 28.075 65.998  47.748  1.00 50.41  ? 175 ASP A CB  1 
ATOM   1187  C  CG  . ASP A  1 175 ? 27.019 64.918  47.978  1.00 60.96  ? 175 ASP A CG  1 
ATOM   1188  O  OD1 . ASP A  1 175 ? 26.393 64.470  46.989  1.00 62.72  ? 175 ASP A OD1 1 
ATOM   1189  O  OD2 . ASP A  1 175 ? 26.829 64.515  49.143  1.00 67.35  ? 175 ASP A OD2 1 
ATOM   1190  N  N   . SER A  1 176 ? 26.542 67.225  44.604  1.00 54.39  ? 176 SER A N   1 
ATOM   1191  C  CA  . SER A  1 176 ? 25.424 67.873  43.911  1.00 55.63  ? 176 SER A CA  1 
ATOM   1192  C  C   . SER A  1 176 ? 24.121 67.862  44.718  1.00 61.30  ? 176 SER A C   1 
ATOM   1193  O  O   . SER A  1 176 ? 23.543 68.930  44.937  1.00 60.94  ? 176 SER A O   1 
ATOM   1194  C  CB  . SER A  1 176 ? 25.190 67.210  42.556  1.00 61.10  ? 176 SER A CB  1 
ATOM   1195  O  OG  . SER A  1 176 ? 26.394 67.064  41.820  1.00 71.21  ? 176 SER A OG  1 
ATOM   1196  N  N   . GLU A  1 177 ? 23.683 66.666  45.181  1.00 59.05  ? 177 GLU A N   1 
ATOM   1197  C  CA  . GLU A  1 177 ? 22.454 66.475  45.961  1.00 59.63  ? 177 GLU A CA  1 
ATOM   1198  C  C   . GLU A  1 177 ? 22.500 67.215  47.306  1.00 61.76  ? 177 GLU A C   1 
ATOM   1199  O  O   . GLU A  1 177 ? 21.514 67.860  47.673  1.00 61.46  ? 177 GLU A O   1 
ATOM   1200  C  CB  . GLU A  1 177 ? 22.176 64.983  46.188  1.00 62.06  ? 177 GLU A CB  1 
ATOM   1201  C  CG  . GLU A  1 177 ? 21.271 64.375  45.130  1.00 77.26  ? 177 GLU A CG  1 
ATOM   1202  C  CD  . GLU A  1 177 ? 20.681 63.010  45.443  1.00 108.11 ? 177 GLU A CD  1 
ATOM   1203  O  OE1 . GLU A  1 177 ? 20.373 62.743  46.629  1.00 101.86 ? 177 GLU A OE1 1 
ATOM   1204  O  OE2 . GLU A  1 177 ? 20.474 62.226  44.487  1.00 107.46 ? 177 GLU A OE2 1 
ATOM   1205  N  N   . ALA A  1 178 ? 23.645 67.140  48.022  1.00 56.71  ? 178 ALA A N   1 
ATOM   1206  C  CA  . ALA A  1 178 ? 23.848 67.806  49.311  1.00 55.46  ? 178 ALA A CA  1 
ATOM   1207  C  C   . ALA A  1 178 ? 23.899 69.327  49.151  1.00 57.16  ? 178 ALA A C   1 
ATOM   1208  O  O   . ALA A  1 178 ? 23.327 70.043  49.976  1.00 56.28  ? 178 ALA A O   1 
ATOM   1209  C  CB  . ALA A  1 178 ? 25.127 67.308  49.962  1.00 55.55  ? 178 ALA A CB  1 
ATOM   1210  N  N   . LEU A  1 179 ? 24.571 69.811  48.081  1.00 52.66  ? 179 LEU A N   1 
ATOM   1211  C  CA  . LEU A  1 179 ? 24.721 71.231  47.756  1.00 51.56  ? 179 LEU A CA  1 
ATOM   1212  C  C   . LEU A  1 179 ? 23.365 71.862  47.436  1.00 56.65  ? 179 LEU A C   1 
ATOM   1213  O  O   . LEU A  1 179 ? 23.118 72.988  47.865  1.00 55.97  ? 179 LEU A O   1 
ATOM   1214  C  CB  . LEU A  1 179 ? 25.700 71.419  46.578  1.00 51.06  ? 179 LEU A CB  1 
ATOM   1215  C  CG  . LEU A  1 179 ? 25.978 72.854  46.101  1.00 54.77  ? 179 LEU A CG  1 
ATOM   1216  C  CD1 . LEU A  1 179 ? 26.905 73.601  47.056  1.00 53.32  ? 179 LEU A CD1 1 
ATOM   1217  C  CD2 . LEU A  1 179 ? 26.550 72.857  44.698  1.00 57.37  ? 179 LEU A CD2 1 
ATOM   1218  N  N   . LYS A  1 180 ? 22.492 71.133  46.703  1.00 54.64  ? 180 LYS A N   1 
ATOM   1219  C  CA  . LYS A  1 180 ? 21.147 71.585  46.327  1.00 55.56  ? 180 LYS A CA  1 
ATOM   1220  C  C   . LYS A  1 180 ? 20.240 71.710  47.560  1.00 60.34  ? 180 LYS A C   1 
ATOM   1221  O  O   . LYS A  1 180 ? 19.427 72.635  47.619  1.00 60.30  ? 180 LYS A O   1 
ATOM   1222  C  CB  . LYS A  1 180 ? 20.517 70.635  45.298  1.00 58.95  ? 180 LYS A CB  1 
ATOM   1223  N  N   . LYS A  1 181 ? 20.395 70.792  48.546  1.00 56.91  ? 181 LYS A N   1 
ATOM   1224  C  CA  . LYS A  1 181 ? 19.626 70.787  49.793  1.00 56.78  ? 181 LYS A CA  1 
ATOM   1225  C  C   . LYS A  1 181 ? 19.998 71.997  50.656  1.00 59.89  ? 181 LYS A C   1 
ATOM   1226  O  O   . LYS A  1 181 ? 19.109 72.623  51.235  1.00 60.37  ? 181 LYS A O   1 
ATOM   1227  C  CB  . LYS A  1 181 ? 19.844 69.480  50.569  1.00 59.19  ? 181 LYS A CB  1 
ATOM   1228  N  N   . LEU A  1 182 ? 21.307 72.336  50.715  1.00 54.58  ? 182 LEU A N   1 
ATOM   1229  C  CA  . LEU A  1 182 ? 21.838 73.484  51.456  1.00 53.12  ? 182 LEU A CA  1 
ATOM   1230  C  C   . LEU A  1 182 ? 21.374 74.795  50.798  1.00 57.70  ? 182 LEU A C   1 
ATOM   1231  O  O   . LEU A  1 182 ? 20.952 75.706  51.508  1.00 57.66  ? 182 LEU A O   1 
ATOM   1232  C  CB  . LEU A  1 182 ? 23.387 73.409  51.537  1.00 51.85  ? 182 LEU A CB  1 
ATOM   1233  C  CG  . LEU A  1 182 ? 24.182 74.655  52.002  1.00 55.15  ? 182 LEU A CG  1 
ATOM   1234  C  CD1 . LEU A  1 182 ? 23.888 75.017  53.449  1.00 54.92  ? 182 LEU A CD1 1 
ATOM   1235  C  CD2 . LEU A  1 182 ? 25.668 74.438  51.838  1.00 56.43  ? 182 LEU A CD2 1 
ATOM   1236  N  N   . GLU A  1 183 ? 21.435 74.865  49.450  1.00 54.39  ? 183 GLU A N   1 
ATOM   1237  C  CA  . GLU A  1 183 ? 21.042 76.003  48.610  1.00 54.45  ? 183 GLU A CA  1 
ATOM   1238  C  C   . GLU A  1 183 ? 19.653 76.536  48.933  1.00 59.24  ? 183 GLU A C   1 
ATOM   1239  O  O   . GLU A  1 183 ? 19.467 77.750  48.997  1.00 58.51  ? 183 GLU A O   1 
ATOM   1240  C  CB  . GLU A  1 183 ? 21.054 75.584  47.133  1.00 56.58  ? 183 GLU A CB  1 
ATOM   1241  C  CG  . GLU A  1 183 ? 22.303 75.970  46.369  1.00 66.85  ? 183 GLU A CG  1 
ATOM   1242  C  CD  . GLU A  1 183 ? 22.325 75.518  44.921  1.00 91.27  ? 183 GLU A CD  1 
ATOM   1243  O  OE1 . GLU A  1 183 ? 21.267 75.098  44.397  1.00 84.14  ? 183 GLU A OE1 1 
ATOM   1244  O  OE2 . GLU A  1 183 ? 23.411 75.594  44.304  1.00 91.79  ? 183 GLU A OE2 1 
ATOM   1245  N  N   . ASP A  1 184 ? 18.677 75.627  49.103  1.00 57.18  ? 184 ASP A N   1 
ATOM   1246  C  CA  . ASP A  1 184 ? 17.285 75.976  49.375  1.00 58.27  ? 184 ASP A CA  1 
ATOM   1247  C  C   . ASP A  1 184 ? 17.095 76.515  50.799  1.00 62.22  ? 184 ASP A C   1 
ATOM   1248  O  O   . ASP A  1 184 ? 16.172 77.301  51.021  1.00 62.52  ? 184 ASP A O   1 
ATOM   1249  C  CB  . ASP A  1 184 ? 16.374 74.766  49.119  1.00 61.51  ? 184 ASP A CB  1 
ATOM   1250  C  CG  . ASP A  1 184 ? 16.427 74.220  47.696  1.00 73.41  ? 184 ASP A CG  1 
ATOM   1251  O  OD1 . ASP A  1 184 ? 16.955 74.927  46.803  1.00 73.43  ? 184 ASP A OD1 1 
ATOM   1252  O  OD2 . ASP A  1 184 ? 15.937 73.090  47.474  1.00 81.25  ? 184 ASP A OD2 1 
ATOM   1253  N  N   . THR A  1 185 ? 17.976 76.120  51.746  1.00 58.05  ? 185 THR A N   1 
ATOM   1254  C  CA  . THR A  1 185 ? 17.935 76.583  53.142  1.00 57.42  ? 185 THR A CA  1 
ATOM   1255  C  C   . THR A  1 185 ? 18.806 77.847  53.325  1.00 60.28  ? 185 THR A C   1 
ATOM   1256  O  O   . THR A  1 185 ? 18.665 78.543  54.332  1.00 60.52  ? 185 THR A O   1 
ATOM   1257  C  CB  . THR A  1 185 ? 18.355 75.463  54.121  1.00 64.10  ? 185 THR A CB  1 
ATOM   1258  O  OG1 . THR A  1 185 ? 19.677 75.018  53.816  1.00 62.15  ? 185 THR A OG1 1 
ATOM   1259  C  CG2 . THR A  1 185 ? 17.391 74.282  54.122  1.00 64.22  ? 185 THR A CG2 1 
ATOM   1260  N  N   . TRP A  1 186 ? 19.679 78.147  52.341  1.00 55.25  ? 186 TRP A N   1 
ATOM   1261  C  CA  . TRP A  1 186 ? 20.603 79.286  52.333  1.00 53.85  ? 186 TRP A CA  1 
ATOM   1262  C  C   . TRP A  1 186 ? 20.021 80.497  51.576  1.00 57.91  ? 186 TRP A C   1 
ATOM   1263  O  O   . TRP A  1 186 ? 20.110 81.624  52.064  1.00 57.08  ? 186 TRP A O   1 
ATOM   1264  C  CB  . TRP A  1 186 ? 21.921 78.848  51.678  1.00 51.92  ? 186 TRP A CB  1 
ATOM   1265  C  CG  . TRP A  1 186 ? 23.163 79.549  52.140  1.00 51.80  ? 186 TRP A CG  1 
ATOM   1266  C  CD1 . TRP A  1 186 ? 23.254 80.588  53.021  1.00 54.26  ? 186 TRP A CD1 1 
ATOM   1267  C  CD2 . TRP A  1 186 ? 24.504 79.245  51.737  1.00 50.92  ? 186 TRP A CD2 1 
ATOM   1268  N  NE1 . TRP A  1 186 ? 24.568 80.956  53.184  1.00 52.77  ? 186 TRP A NE1 1 
ATOM   1269  C  CE2 . TRP A  1 186 ? 25.358 80.145  52.410  1.00 54.02  ? 186 TRP A CE2 1 
ATOM   1270  C  CE3 . TRP A  1 186 ? 25.069 78.297  50.867  1.00 52.23  ? 186 TRP A CE3 1 
ATOM   1271  C  CZ2 . TRP A  1 186 ? 26.747 80.126  52.240  1.00 52.61  ? 186 TRP A CZ2 1 
ATOM   1272  C  CZ3 . TRP A  1 186 ? 26.445 78.280  50.699  1.00 52.95  ? 186 TRP A CZ3 1 
ATOM   1273  C  CH2 . TRP A  1 186 ? 27.268 79.191  51.373  1.00 52.76  ? 186 TRP A CH2 1 
ATOM   1274  N  N   . TYR A  1 187 ? 19.456 80.255  50.373  1.00 55.30  ? 187 TYR A N   1 
ATOM   1275  C  CA  . TYR A  1 187 ? 18.831 81.242  49.483  1.00 79.24  ? 187 TYR A CA  1 
ATOM   1276  C  C   . TYR A  1 187 ? 17.918 80.499  48.489  1.00 117.36 ? 187 TYR A C   1 
ATOM   1277  O  O   . TYR A  1 187 ? 17.362 81.088  47.563  1.00 83.40  ? 187 TYR A O   1 
ATOM   1278  C  CB  . TYR A  1 187 ? 19.896 82.110  48.763  1.00 79.47  ? 187 TYR A CB  1 
ATOM   1279  C  CG  . TYR A  1 187 ? 20.738 81.379  47.735  1.00 80.81  ? 187 TYR A CG  1 
ATOM   1280  C  CD1 . TYR A  1 187 ? 21.831 80.607  48.120  1.00 81.84  ? 187 TYR A CD1 1 
ATOM   1281  C  CD2 . TYR A  1 187 ? 20.473 81.500  46.375  1.00 82.22  ? 187 TYR A CD2 1 
ATOM   1282  C  CE1 . TYR A  1 187 ? 22.617 79.943  47.179  1.00 82.01  ? 187 TYR A CE1 1 
ATOM   1283  C  CE2 . TYR A  1 187 ? 21.251 80.840  45.425  1.00 82.95  ? 187 TYR A CE2 1 
ATOM   1284  C  CZ  . TYR A  1 187 ? 22.323 80.062  45.831  1.00 88.31  ? 187 TYR A CZ  1 
ATOM   1285  O  OH  . TYR A  1 187 ? 23.094 79.409  44.898  1.00 88.08  ? 187 TYR A OH  1 
ATOM   1286  N  N   . LEU A  1 192 ? 13.118 86.338  55.164  1.00 69.23  ? 192 LEU A N   1 
ATOM   1287  C  CA  . LEU A  1 192 ? 13.933 86.710  56.317  1.00 68.01  ? 192 LEU A CA  1 
ATOM   1288  C  C   . LEU A  1 192 ? 14.012 85.545  57.317  1.00 71.93  ? 192 LEU A C   1 
ATOM   1289  O  O   . LEU A  1 192 ? 12.979 84.994  57.710  1.00 72.54  ? 192 LEU A O   1 
ATOM   1290  C  CB  . LEU A  1 192 ? 13.383 87.989  56.988  1.00 68.34  ? 192 LEU A CB  1 
ATOM   1291  C  CG  . LEU A  1 192 ? 14.166 88.564  58.185  1.00 72.03  ? 192 LEU A CG  1 
ATOM   1292  C  CD1 . LEU A  1 192 ? 15.539 89.074  57.773  1.00 71.02  ? 192 LEU A CD1 1 
ATOM   1293  C  CD2 . LEU A  1 192 ? 13.392 89.681  58.852  1.00 74.69  ? 192 LEU A CD2 1 
ATOM   1294  N  N   . LYS A  1 193 ? 15.254 85.167  57.704  1.00 67.05  ? 193 LYS A N   1 
ATOM   1295  C  CA  . LYS A  1 193 ? 15.568 84.062  58.623  1.00 66.45  ? 193 LYS A CA  1 
ATOM   1296  C  C   . LYS A  1 193 ? 17.036 84.095  59.083  1.00 68.29  ? 193 LYS A C   1 
ATOM   1297  O  O   . LYS A  1 193 ? 17.838 84.868  58.553  1.00 66.63  ? 193 LYS A O   1 
ATOM   1298  C  CB  . LYS A  1 193 ? 15.281 82.705  57.944  1.00 69.56  ? 193 LYS A CB  1 
ATOM   1299  N  N   . TYR A  1 194 ? 17.383 83.240  60.066  1.00 64.50  ? 194 TYR A N   1 
ATOM   1300  C  CA  . TYR A  1 194 ? 18.753 83.094  60.556  1.00 62.93  ? 194 TYR A CA  1 
ATOM   1301  C  C   . TYR A  1 194 ? 19.492 82.133  59.628  1.00 63.87  ? 194 TYR A C   1 
ATOM   1302  O  O   . TYR A  1 194 ? 18.956 81.070  59.304  1.00 64.18  ? 194 TYR A O   1 
ATOM   1303  C  CB  . TYR A  1 194 ? 18.785 82.597  62.014  1.00 64.92  ? 194 TYR A CB  1 
ATOM   1304  C  CG  . TYR A  1 194 ? 18.437 83.653  63.042  1.00 67.73  ? 194 TYR A CG  1 
ATOM   1305  C  CD1 . TYR A  1 194 ? 19.402 84.534  63.521  1.00 69.15  ? 194 TYR A CD1 1 
ATOM   1306  C  CD2 . TYR A  1 194 ? 17.153 83.742  63.573  1.00 69.74  ? 194 TYR A CD2 1 
ATOM   1307  C  CE1 . TYR A  1 194 ? 19.091 85.503  64.476  1.00 70.57  ? 194 TYR A CE1 1 
ATOM   1308  C  CE2 . TYR A  1 194 ? 16.831 84.702  64.534  1.00 70.93  ? 194 TYR A CE2 1 
ATOM   1309  C  CZ  . TYR A  1 194 ? 17.805 85.580  64.985  1.00 77.83  ? 194 TYR A CZ  1 
ATOM   1310  O  OH  . TYR A  1 194 ? 17.503 86.528  65.936  1.00 78.56  ? 194 TYR A OH  1 
ATOM   1311  N  N   . GLN A  1 195 ? 20.698 82.523  59.172  1.00 57.32  ? 195 GLN A N   1 
ATOM   1312  C  CA  . GLN A  1 195 ? 21.536 81.744  58.254  1.00 55.51  ? 195 GLN A CA  1 
ATOM   1313  C  C   . GLN A  1 195 ? 21.894 80.350  58.815  1.00 57.23  ? 195 GLN A C   1 
ATOM   1314  O  O   . GLN A  1 195 ? 22.155 80.241  60.017  1.00 56.88  ? 195 GLN A O   1 
ATOM   1315  C  CB  . GLN A  1 195 ? 22.817 82.513  57.935  1.00 55.67  ? 195 GLN A CB  1 
ATOM   1316  C  CG  . GLN A  1 195 ? 22.797 83.219  56.597  1.00 70.60  ? 195 GLN A CG  1 
ATOM   1317  C  CD  . GLN A  1 195 ? 24.207 83.482  56.137  1.00 93.75  ? 195 GLN A CD  1 
ATOM   1318  O  OE1 . GLN A  1 195 ? 24.797 82.688  55.400  1.00 89.92  ? 195 GLN A OE1 1 
ATOM   1319  N  NE2 . GLN A  1 195 ? 24.777 84.614  56.545  1.00 86.19  ? 195 GLN A NE2 1 
ATOM   1320  N  N   . PRO A  1 196 ? 21.912 79.277  57.977  1.00 51.87  ? 196 PRO A N   1 
ATOM   1321  C  CA  . PRO A  1 196 ? 22.250 77.941  58.500  1.00 51.14  ? 196 PRO A CA  1 
ATOM   1322  C  C   . PRO A  1 196 ? 23.765 77.699  58.523  1.00 52.10  ? 196 PRO A C   1 
ATOM   1323  O  O   . PRO A  1 196 ? 24.288 76.917  57.723  1.00 51.35  ? 196 PRO A O   1 
ATOM   1324  C  CB  . PRO A  1 196 ? 21.518 76.997  57.540  1.00 53.82  ? 196 PRO A CB  1 
ATOM   1325  C  CG  . PRO A  1 196 ? 21.381 77.765  56.263  1.00 58.17  ? 196 PRO A CG  1 
ATOM   1326  C  CD  . PRO A  1 196 ? 21.627 79.225  56.528  1.00 53.31  ? 196 PRO A CD  1 
ATOM   1327  N  N   . ILE A  1 197 ? 24.462 78.363  59.473  1.00 46.76  ? 197 ILE A N   1 
ATOM   1328  C  CA  . ILE A  1 197 ? 25.920 78.331  59.670  1.00 45.05  ? 197 ILE A CA  1 
ATOM   1329  C  C   . ILE A  1 197 ? 26.421 76.897  59.944  1.00 49.95  ? 197 ILE A C   1 
ATOM   1330  O  O   . ILE A  1 197 ? 27.476 76.528  59.424  1.00 49.25  ? 197 ILE A O   1 
ATOM   1331  C  CB  . ILE A  1 197 ? 26.369 79.334  60.777  1.00 46.97  ? 197 ILE A CB  1 
ATOM   1332  C  CG1 . ILE A  1 197 ? 25.775 80.756  60.559  1.00 46.89  ? 197 ILE A CG1 1 
ATOM   1333  C  CG2 . ILE A  1 197 ? 27.899 79.391  60.937  1.00 46.32  ? 197 ILE A CG2 1 
ATOM   1334  C  CD1 . ILE A  1 197 ? 26.086 81.466  59.187  1.00 51.16  ? 197 ILE A CD1 1 
ATOM   1335  N  N   . ASP A  1 198 ? 25.660 76.088  60.708  1.00 47.81  ? 198 ASP A N   1 
ATOM   1336  C  CA  . ASP A  1 198 ? 26.023 74.698  60.999  1.00 48.17  ? 198 ASP A CA  1 
ATOM   1337  C  C   . ASP A  1 198 ? 25.951 73.825  59.732  1.00 51.05  ? 198 ASP A C   1 
ATOM   1338  O  O   . ASP A  1 198 ? 26.748 72.893  59.594  1.00 50.37  ? 198 ASP A O   1 
ATOM   1339  C  CB  . ASP A  1 198 ? 25.143 74.124  62.117  1.00 51.47  ? 198 ASP A CB  1 
ATOM   1340  C  CG  . ASP A  1 198 ? 25.434 74.734  63.477  1.00 68.73  ? 198 ASP A CG  1 
ATOM   1341  O  OD1 . ASP A  1 198 ? 26.557 74.524  63.998  1.00 69.59  ? 198 ASP A OD1 1 
ATOM   1342  O  OD2 . ASP A  1 198 ? 24.537 75.408  64.029  1.00 78.84  ? 198 ASP A OD2 1 
ATOM   1343  N  N   . SER A  1 199 ? 25.029 74.152  58.801  1.00 47.31  ? 199 SER A N   1 
ATOM   1344  C  CA  . SER A  1 199 ? 24.875 73.452  57.523  1.00 47.34  ? 199 SER A CA  1 
ATOM   1345  C  C   . SER A  1 199 ? 26.005 73.844  56.561  1.00 49.90  ? 199 SER A C   1 
ATOM   1346  O  O   . SER A  1 199 ? 26.519 72.975  55.852  1.00 50.27  ? 199 SER A O   1 
ATOM   1347  C  CB  . SER A  1 199 ? 23.516 73.748  56.901  1.00 52.20  ? 199 SER A CB  1 
ATOM   1348  O  OG  . SER A  1 199 ? 22.458 73.319  57.741  1.00 64.50  ? 199 SER A OG  1 
ATOM   1349  N  N   . ILE A  1 200 ? 26.406 75.145  56.555  1.00 44.06  ? 200 ILE A N   1 
ATOM   1350  C  CA  . ILE A  1 200 ? 27.506 75.678  55.731  1.00 42.27  ? 200 ILE A CA  1 
ATOM   1351  C  C   . ILE A  1 200 ? 28.823 75.022  56.185  1.00 45.99  ? 200 ILE A C   1 
ATOM   1352  O  O   . ILE A  1 200 ? 29.648 74.666  55.341  1.00 45.43  ? 200 ILE A O   1 
ATOM   1353  C  CB  . ILE A  1 200 ? 27.578 77.236  55.774  1.00 44.20  ? 200 ILE A CB  1 
ATOM   1354  C  CG1 . ILE A  1 200 ? 26.253 77.874  55.307  1.00 44.55  ? 200 ILE A CG1 1 
ATOM   1355  C  CG2 . ILE A  1 200 ? 28.755 77.771  54.936  1.00 44.32  ? 200 ILE A CG2 1 
ATOM   1356  C  CD1 . ILE A  1 200 ? 25.943 79.237  55.927  1.00 47.69  ? 200 ILE A CD1 1 
ATOM   1357  N  N   . ARG A  1 201 ? 28.986 74.841  57.517  1.00 42.51  ? 201 ARG A N   1 
ATOM   1358  C  CA  . ARG A  1 201 ? 30.128 74.200  58.181  1.00 41.65  ? 201 ARG A CA  1 
ATOM   1359  C  C   . ARG A  1 201 ? 30.296 72.756  57.692  1.00 45.56  ? 201 ARG A C   1 
ATOM   1360  O  O   . ARG A  1 201 ? 31.395 72.375  57.291  1.00 45.10  ? 201 ARG A O   1 
ATOM   1361  C  CB  . ARG A  1 201 ? 29.935 74.242  59.710  1.00 41.38  ? 201 ARG A CB  1 
ATOM   1362  C  CG  . ARG A  1 201 ? 31.075 73.644  60.510  1.00 51.73  ? 201 ARG A CG  1 
ATOM   1363  C  CD  . ARG A  1 201 ? 30.581 72.499  61.366  1.00 63.77  ? 201 ARG A CD  1 
ATOM   1364  N  NE  . ARG A  1 201 ? 31.694 71.765  61.965  1.00 73.51  ? 201 ARG A NE  1 
ATOM   1365  C  CZ  . ARG A  1 201 ? 31.569 70.871  62.940  1.00 90.83  ? 201 ARG A CZ  1 
ATOM   1366  N  NH1 . ARG A  1 201 ? 30.373 70.594  63.447  1.00 79.36  ? 201 ARG A NH1 1 
ATOM   1367  N  NH2 . ARG A  1 201 ? 32.638 70.255  63.423  1.00 81.12  ? 201 ARG A NH2 1 
ATOM   1368  N  N   . GLY A  1 202 ? 29.196 72.000  57.692  1.00 41.99  ? 202 GLY A N   1 
ATOM   1369  C  CA  . GLY A  1 202 ? 29.156 70.604  57.269  1.00 41.92  ? 202 GLY A CA  1 
ATOM   1370  C  C   . GLY A  1 202 ? 29.542 70.357  55.824  1.00 44.79  ? 202 GLY A C   1 
ATOM   1371  O  O   . GLY A  1 202 ? 30.084 69.295  55.509  1.00 44.31  ? 202 GLY A O   1 
ATOM   1372  N  N   . TYR A  1 203 ? 29.285 71.340  54.938  1.00 40.95  ? 203 TYR A N   1 
ATOM   1373  C  CA  . TYR A  1 203 ? 29.580 71.215  53.510  1.00 40.59  ? 203 TYR A CA  1 
ATOM   1374  C  C   . TYR A  1 203 ? 30.897 71.897  53.089  1.00 43.81  ? 203 TYR A C   1 
ATOM   1375  O  O   . TYR A  1 203 ? 31.657 71.295  52.327  1.00 43.12  ? 203 TYR A O   1 
ATOM   1376  C  CB  . TYR A  1 203 ? 28.417 71.769  52.660  1.00 41.62  ? 203 TYR A CB  1 
ATOM   1377  C  CG  . TYR A  1 203 ? 28.466 71.310  51.219  1.00 43.23  ? 203 TYR A CG  1 
ATOM   1378  C  CD1 . TYR A  1 203 ? 27.852 70.124  50.823  1.00 46.15  ? 203 TYR A CD1 1 
ATOM   1379  C  CD2 . TYR A  1 203 ? 29.148 72.046  50.255  1.00 43.32  ? 203 TYR A CD2 1 
ATOM   1380  C  CE1 . TYR A  1 203 ? 27.914 69.684  49.502  1.00 47.02  ? 203 TYR A CE1 1 
ATOM   1381  C  CE2 . TYR A  1 203 ? 29.229 71.609  48.935  1.00 44.60  ? 203 TYR A CE2 1 
ATOM   1382  C  CZ  . TYR A  1 203 ? 28.599 70.434  48.560  1.00 52.94  ? 203 TYR A CZ  1 
ATOM   1383  O  OH  . TYR A  1 203 ? 28.666 70.011  47.258  1.00 55.01  ? 203 TYR A OH  1 
ATOM   1384  N  N   . PHE A  1 204 ? 31.143 73.150  53.535  1.00 39.93  ? 204 PHE A N   1 
ATOM   1385  C  CA  . PHE A  1 204 ? 32.311 73.927  53.123  1.00 39.27  ? 204 PHE A CA  1 
ATOM   1386  C  C   . PHE A  1 204 ? 33.452 73.969  54.143  1.00 45.38  ? 204 PHE A C   1 
ATOM   1387  O  O   . PHE A  1 204 ? 34.601 74.172  53.742  1.00 45.37  ? 204 PHE A O   1 
ATOM   1388  C  CB  . PHE A  1 204 ? 31.895 75.357  52.774  1.00 40.35  ? 204 PHE A CB  1 
ATOM   1389  C  CG  . PHE A  1 204 ? 31.056 75.456  51.524  1.00 41.86  ? 204 PHE A CG  1 
ATOM   1390  C  CD1 . PHE A  1 204 ? 31.648 75.455  50.267  1.00 44.53  ? 204 PHE A CD1 1 
ATOM   1391  C  CD2 . PHE A  1 204 ? 29.672 75.558  51.604  1.00 44.24  ? 204 PHE A CD2 1 
ATOM   1392  C  CE1 . PHE A  1 204 ? 30.870 75.530  49.110  1.00 46.04  ? 204 PHE A CE1 1 
ATOM   1393  C  CE2 . PHE A  1 204 ? 28.895 75.641  50.448  1.00 47.58  ? 204 PHE A CE2 1 
ATOM   1394  C  CZ  . PHE A  1 204 ? 29.498 75.622  49.209  1.00 45.85  ? 204 PHE A CZ  1 
ATOM   1395  N  N   . GLY A  1 205 ? 33.146 73.800  55.425  1.00 43.10  ? 205 GLY A N   1 
ATOM   1396  C  CA  . GLY A  1 205 ? 34.166 73.827  56.468  1.00 43.32  ? 205 GLY A CA  1 
ATOM   1397  C  C   . GLY A  1 205 ? 34.047 74.969  57.455  1.00 48.58  ? 205 GLY A C   1 
ATOM   1398  O  O   . GLY A  1 205 ? 33.183 75.838  57.314  1.00 48.55  ? 205 GLY A O   1 
ATOM   1399  N  N   . GLU A  1 206 ? 34.936 74.973  58.457  1.00 45.52  ? 206 GLU A N   1 
ATOM   1400  C  CA  . GLU A  1 206 ? 34.958 75.960  59.534  1.00 45.49  ? 206 GLU A CA  1 
ATOM   1401  C  C   . GLU A  1 206 ? 35.298 77.371  59.059  1.00 48.90  ? 206 GLU A C   1 
ATOM   1402  O  O   . GLU A  1 206 ? 34.703 78.311  59.573  1.00 48.44  ? 206 GLU A O   1 
ATOM   1403  C  CB  . GLU A  1 206 ? 35.947 75.547  60.632  1.00 47.09  ? 206 GLU A CB  1 
ATOM   1404  C  CG  . GLU A  1 206 ? 35.431 74.481  61.585  1.00 58.06  ? 206 GLU A CG  1 
ATOM   1405  C  CD  . GLU A  1 206 ? 35.337 73.062  61.059  1.00 77.29  ? 206 GLU A CD  1 
ATOM   1406  O  OE1 . GLU A  1 206 ? 36.221 72.645  60.276  1.00 70.65  ? 206 GLU A OE1 1 
ATOM   1407  O  OE2 . GLU A  1 206 ? 34.388 72.353  61.464  1.00 73.33  ? 206 GLU A OE2 1 
ATOM   1408  N  N   . THR A  1 207 ? 36.242 77.526  58.104  1.00 45.35  ? 207 THR A N   1 
ATOM   1409  C  CA  . THR A  1 207 ? 36.690 78.830  57.595  1.00 44.82  ? 207 THR A CA  1 
ATOM   1410  C  C   . THR A  1 207 ? 35.577 79.556  56.811  1.00 50.67  ? 207 THR A C   1 
ATOM   1411  O  O   . THR A  1 207 ? 35.351 80.743  57.063  1.00 50.73  ? 207 THR A O   1 
ATOM   1412  C  CB  . THR A  1 207 ? 37.961 78.678  56.751  1.00 47.67  ? 207 THR A CB  1 
ATOM   1413  O  OG1 . THR A  1 207 ? 38.952 78.020  57.532  1.00 44.59  ? 207 THR A OG1 1 
ATOM   1414  C  CG2 . THR A  1 207 ? 38.521 80.018  56.277  1.00 45.66  ? 207 THR A CG2 1 
ATOM   1415  N  N   . ILE A  1 208 ? 34.893 78.860  55.874  1.00 48.31  ? 208 ILE A N   1 
ATOM   1416  C  CA  . ILE A  1 208 ? 33.822 79.461  55.064  1.00 48.53  ? 208 ILE A CA  1 
ATOM   1417  C  C   . ILE A  1 208 ? 32.604 79.759  55.956  1.00 53.31  ? 208 ILE A C   1 
ATOM   1418  O  O   . ILE A  1 208 ? 32.060 80.864  55.873  1.00 53.97  ? 208 ILE A O   1 
ATOM   1419  C  CB  . ILE A  1 208 ? 33.456 78.603  53.816  1.00 51.92  ? 208 ILE A CB  1 
ATOM   1420  C  CG1 . ILE A  1 208 ? 34.597 78.617  52.776  1.00 52.32  ? 208 ILE A CG1 1 
ATOM   1421  C  CG2 . ILE A  1 208 ? 32.153 79.074  53.160  1.00 53.01  ? 208 ILE A CG2 1 
ATOM   1422  C  CD1 . ILE A  1 208 ? 35.482 77.395  52.798  1.00 62.47  ? 208 ILE A CD1 1 
ATOM   1423  N  N   . ALA A  1 209 ? 32.211 78.807  56.833  1.00 49.07  ? 209 ALA A N   1 
ATOM   1424  C  CA  . ALA A  1 209 ? 31.082 78.986  57.751  1.00 48.44  ? 209 ALA A CA  1 
ATOM   1425  C  C   . ALA A  1 209 ? 31.327 80.140  58.718  1.00 50.09  ? 209 ALA A C   1 
ATOM   1426  O  O   . ALA A  1 209 ? 30.383 80.857  59.048  1.00 49.61  ? 209 ALA A O   1 
ATOM   1427  C  CB  . ALA A  1 209 ? 30.818 77.712  58.521  1.00 49.52  ? 209 ALA A CB  1 
ATOM   1428  N  N   . LEU A  1 210 ? 32.597 80.342  59.139  1.00 45.29  ? 210 LEU A N   1 
ATOM   1429  C  CA  . LEU A  1 210 ? 32.978 81.441  60.025  1.00 44.38  ? 210 LEU A CA  1 
ATOM   1430  C  C   . LEU A  1 210 ? 32.806 82.771  59.317  1.00 46.83  ? 210 LEU A C   1 
ATOM   1431  O  O   . LEU A  1 210 ? 32.403 83.740  59.963  1.00 46.54  ? 210 LEU A O   1 
ATOM   1432  C  CB  . LEU A  1 210 ? 34.413 81.302  60.549  1.00 44.04  ? 210 LEU A CB  1 
ATOM   1433  C  CG  . LEU A  1 210 ? 34.542 80.943  62.025  1.00 48.68  ? 210 LEU A CG  1 
ATOM   1434  C  CD1 . LEU A  1 210 ? 35.896 80.349  62.320  1.00 48.95  ? 210 LEU A CD1 1 
ATOM   1435  C  CD2 . LEU A  1 210 ? 34.324 82.148  62.900  1.00 50.81  ? 210 LEU A CD2 1 
ATOM   1436  N  N   . TYR A  1 211 ? 33.078 82.817  57.991  1.00 42.13  ? 211 TYR A N   1 
ATOM   1437  C  CA  . TYR A  1 211 ? 32.885 84.042  57.222  1.00 41.73  ? 211 TYR A CA  1 
ATOM   1438  C  C   . TYR A  1 211 ? 31.396 84.399  57.163  1.00 46.05  ? 211 TYR A C   1 
ATOM   1439  O  O   . TYR A  1 211 ? 31.043 85.554  57.413  1.00 46.00  ? 211 TYR A O   1 
ATOM   1440  C  CB  . TYR A  1 211 ? 33.484 83.967  55.804  1.00 42.63  ? 211 TYR A CB  1 
ATOM   1441  C  CG  . TYR A  1 211 ? 32.976 85.093  54.930  1.00 44.79  ? 211 TYR A CG  1 
ATOM   1442  C  CD1 . TYR A  1 211 ? 33.338 86.414  55.184  1.00 46.50  ? 211 TYR A CD1 1 
ATOM   1443  C  CD2 . TYR A  1 211 ? 32.036 84.856  53.931  1.00 46.46  ? 211 TYR A CD2 1 
ATOM   1444  C  CE1 . TYR A  1 211 ? 32.796 87.466  54.451  1.00 48.05  ? 211 TYR A CE1 1 
ATOM   1445  C  CE2 . TYR A  1 211 ? 31.501 85.899  53.177  1.00 48.05  ? 211 TYR A CE2 1 
ATOM   1446  C  CZ  . TYR A  1 211 ? 31.883 87.205  53.442  1.00 56.18  ? 211 TYR A CZ  1 
ATOM   1447  O  OH  . TYR A  1 211 ? 31.388 88.238  52.683  1.00 58.22  ? 211 TYR A OH  1 
ATOM   1448  N  N   . PHE A  1 212 ? 30.534 83.417  56.829  1.00 42.27  ? 212 PHE A N   1 
ATOM   1449  C  CA  . PHE A  1 212 ? 29.091 83.630  56.734  1.00 42.26  ? 212 PHE A CA  1 
ATOM   1450  C  C   . PHE A  1 212 ? 28.482 83.849  58.126  1.00 45.98  ? 212 PHE A C   1 
ATOM   1451  O  O   . PHE A  1 212 ? 27.423 84.469  58.236  1.00 46.43  ? 212 PHE A O   1 
ATOM   1452  C  CB  . PHE A  1 212 ? 28.408 82.482  55.977  1.00 44.32  ? 212 PHE A CB  1 
ATOM   1453  C  CG  . PHE A  1 212 ? 28.616 82.567  54.481  1.00 45.69  ? 212 PHE A CG  1 
ATOM   1454  C  CD1 . PHE A  1 212 ? 27.820 83.396  53.696  1.00 49.10  ? 212 PHE A CD1 1 
ATOM   1455  C  CD2 . PHE A  1 212 ? 29.612 81.827  53.858  1.00 47.56  ? 212 PHE A CD2 1 
ATOM   1456  C  CE1 . PHE A  1 212 ? 28.021 83.487  52.315  1.00 50.17  ? 212 PHE A CE1 1 
ATOM   1457  C  CE2 . PHE A  1 212 ? 29.813 81.918  52.475  1.00 50.80  ? 212 PHE A CE2 1 
ATOM   1458  C  CZ  . PHE A  1 212 ? 29.016 82.748  51.714  1.00 49.27  ? 212 PHE A CZ  1 
ATOM   1459  N  N   . GLY A  1 213 ? 29.183 83.384  59.161  1.00 41.35  ? 213 GLY A N   1 
ATOM   1460  C  CA  . GLY A  1 213 ? 28.817 83.588  60.558  1.00 41.17  ? 213 GLY A CA  1 
ATOM   1461  C  C   . GLY A  1 213 ? 29.115 85.013  60.993  1.00 44.02  ? 213 GLY A C   1 
ATOM   1462  O  O   . GLY A  1 213 ? 28.314 85.632  61.704  1.00 43.83  ? 213 GLY A O   1 
ATOM   1463  N  N   . PHE A  1 214 ? 30.275 85.547  60.542  1.00 38.95  ? 214 PHE A N   1 
ATOM   1464  C  CA  . PHE A  1 214 ? 30.705 86.917  60.815  1.00 37.54  ? 214 PHE A CA  1 
ATOM   1465  C  C   . PHE A  1 214 ? 29.886 87.899  59.990  1.00 40.80  ? 214 PHE A C   1 
ATOM   1466  O  O   . PHE A  1 214 ? 29.559 88.967  60.501  1.00 41.31  ? 214 PHE A O   1 
ATOM   1467  C  CB  . PHE A  1 214 ? 32.210 87.111  60.551  1.00 38.44  ? 214 PHE A CB  1 
ATOM   1468  C  CG  . PHE A  1 214 ? 32.704 88.500  60.888  1.00 39.29  ? 214 PHE A CG  1 
ATOM   1469  C  CD1 . PHE A  1 214 ? 32.917 88.879  62.209  1.00 41.70  ? 214 PHE A CD1 1 
ATOM   1470  C  CD2 . PHE A  1 214 ? 32.932 89.435  59.888  1.00 41.10  ? 214 PHE A CD2 1 
ATOM   1471  C  CE1 . PHE A  1 214 ? 33.351 90.167  62.522  1.00 42.31  ? 214 PHE A CE1 1 
ATOM   1472  C  CE2 . PHE A  1 214 ? 33.366 90.723  60.202  1.00 43.85  ? 214 PHE A CE2 1 
ATOM   1473  C  CZ  . PHE A  1 214 ? 33.575 91.080  61.517  1.00 41.71  ? 214 PHE A CZ  1 
ATOM   1474  N  N   . LEU A  1 215 ? 29.567 87.547  58.723  1.00 35.92  ? 215 LEU A N   1 
ATOM   1475  C  CA  . LEU A  1 215 ? 28.766 88.376  57.820  1.00 35.65  ? 215 LEU A CA  1 
ATOM   1476  C  C   . LEU A  1 215 ? 27.382 88.615  58.430  1.00 39.60  ? 215 LEU A C   1 
ATOM   1477  O  O   . LEU A  1 215 ? 26.970 89.770  58.544  1.00 39.16  ? 215 LEU A O   1 
ATOM   1478  C  CB  . LEU A  1 215 ? 28.661 87.720  56.424  1.00 35.71  ? 215 LEU A CB  1 
ATOM   1479  C  CG  . LEU A  1 215 ? 27.677 88.321  55.402  1.00 40.41  ? 215 LEU A CG  1 
ATOM   1480  C  CD1 . LEU A  1 215 ? 28.100 89.705  54.950  1.00 40.00  ? 215 LEU A CD1 1 
ATOM   1481  C  CD2 . LEU A  1 215 ? 27.541 87.423  54.204  1.00 43.28  ? 215 LEU A CD2 1 
ATOM   1482  N  N   . GLU A  1 216 ? 26.706 87.527  58.874  1.00 36.05  ? 216 GLU A N   1 
ATOM   1483  C  CA  . GLU A  1 216 ? 25.385 87.563  59.509  1.00 36.06  ? 216 GLU A CA  1 
ATOM   1484  C  C   . GLU A  1 216 ? 25.419 88.421  60.781  1.00 39.95  ? 216 GLU A C   1 
ATOM   1485  O  O   . GLU A  1 216 ? 24.504 89.219  60.995  1.00 39.78  ? 216 GLU A O   1 
ATOM   1486  C  CB  . GLU A  1 216 ? 24.903 86.137  59.832  1.00 37.52  ? 216 GLU A CB  1 
ATOM   1487  C  CG  . GLU A  1 216 ? 23.434 86.063  60.220  1.00 47.32  ? 216 GLU A CG  1 
ATOM   1488  C  CD  . GLU A  1 216 ? 22.955 84.803  60.916  1.00 65.03  ? 216 GLU A CD  1 
ATOM   1489  O  OE1 . GLU A  1 216 ? 23.797 83.993  61.365  1.00 59.88  ? 216 GLU A OE1 1 
ATOM   1490  O  OE2 . GLU A  1 216 ? 21.720 84.646  61.045  1.00 59.10  ? 216 GLU A OE2 1 
ATOM   1491  N  N   . TYR A  1 217 ? 26.487 88.269  61.600  1.00 36.46  ? 217 TYR A N   1 
ATOM   1492  C  CA  . TYR A  1 217 ? 26.683 89.008  62.847  1.00 36.20  ? 217 TYR A CA  1 
ATOM   1493  C  C   . TYR A  1 217 ? 26.896 90.502  62.588  1.00 41.63  ? 217 TYR A C   1 
ATOM   1494  O  O   . TYR A  1 217 ? 26.218 91.323  63.202  1.00 41.98  ? 217 TYR A O   1 
ATOM   1495  C  CB  . TYR A  1 217 ? 27.864 88.437  63.656  1.00 36.48  ? 217 TYR A CB  1 
ATOM   1496  C  CG  . TYR A  1 217 ? 28.165 89.259  64.888  1.00 38.35  ? 217 TYR A CG  1 
ATOM   1497  C  CD1 . TYR A  1 217 ? 27.355 89.179  66.018  1.00 41.18  ? 217 TYR A CD1 1 
ATOM   1498  C  CD2 . TYR A  1 217 ? 29.219 90.167  64.904  1.00 38.73  ? 217 TYR A CD2 1 
ATOM   1499  C  CE1 . TYR A  1 217 ? 27.593 89.973  67.137  1.00 42.19  ? 217 TYR A CE1 1 
ATOM   1500  C  CE2 . TYR A  1 217 ? 29.465 90.968  66.016  1.00 39.97  ? 217 TYR A CE2 1 
ATOM   1501  C  CZ  . TYR A  1 217 ? 28.655 90.858  67.135  1.00 48.96  ? 217 TYR A CZ  1 
ATOM   1502  O  OH  . TYR A  1 217 ? 28.885 91.635  68.239  1.00 51.50  ? 217 TYR A OH  1 
ATOM   1503  N  N   . PHE A  1 218 ? 27.853 90.843  61.705  1.00 38.70  ? 218 PHE A N   1 
ATOM   1504  C  CA  . PHE A  1 218 ? 28.213 92.214  61.344  1.00 38.85  ? 218 PHE A CA  1 
ATOM   1505  C  C   . PHE A  1 218 ? 27.017 92.978  60.763  1.00 43.55  ? 218 PHE A C   1 
ATOM   1506  O  O   . PHE A  1 218 ? 26.862 94.159  61.077  1.00 44.03  ? 218 PHE A O   1 
ATOM   1507  C  CB  . PHE A  1 218 ? 29.391 92.212  60.356  1.00 40.44  ? 218 PHE A CB  1 
ATOM   1508  C  CG  . PHE A  1 218 ? 29.974 93.562  60.015  1.00 42.27  ? 218 PHE A CG  1 
ATOM   1509  C  CD1 . PHE A  1 218 ? 30.506 94.381  61.006  1.00 44.97  ? 218 PHE A CD1 1 
ATOM   1510  C  CD2 . PHE A  1 218 ? 30.048 93.990  58.695  1.00 44.90  ? 218 PHE A CD2 1 
ATOM   1511  C  CE1 . PHE A  1 218 ? 31.061 95.622  60.687  1.00 45.87  ? 218 PHE A CE1 1 
ATOM   1512  C  CE2 . PHE A  1 218 ? 30.615 95.227  58.376  1.00 47.91  ? 218 PHE A CE2 1 
ATOM   1513  C  CZ  . PHE A  1 218 ? 31.103 96.041  59.376  1.00 45.61  ? 218 PHE A CZ  1 
ATOM   1514  N  N   . THR A  1 219 ? 26.158 92.303  59.956  1.00 39.45  ? 219 THR A N   1 
ATOM   1515  C  CA  . THR A  1 219 ? 24.952 92.902  59.371  1.00 39.69  ? 219 THR A CA  1 
ATOM   1516  C  C   . THR A  1 219 ? 23.998 93.317  60.499  1.00 44.69  ? 219 THR A C   1 
ATOM   1517  O  O   . THR A  1 219 ? 23.496 94.443  60.479  1.00 44.59  ? 219 THR A O   1 
ATOM   1518  C  CB  . THR A  1 219 ? 24.283 91.949  58.365  1.00 45.82  ? 219 THR A CB  1 
ATOM   1519  O  OG1 . THR A  1 219 ? 25.249 91.501  57.417  1.00 43.07  ? 219 THR A OG1 1 
ATOM   1520  C  CG2 . THR A  1 219 ? 23.122 92.604  57.620  1.00 45.12  ? 219 THR A CG2 1 
ATOM   1521  N  N   . PHE A  1 220 ? 23.785 92.423  61.496  1.00 42.04  ? 220 PHE A N   1 
ATOM   1522  C  CA  . PHE A  1 220 ? 22.935 92.695  62.660  1.00 42.47  ? 220 PHE A CA  1 
ATOM   1523  C  C   . PHE A  1 220 ? 23.554 93.782  63.535  1.00 45.29  ? 220 PHE A C   1 
ATOM   1524  O  O   . PHE A  1 220 ? 22.834 94.661  64.009  1.00 45.79  ? 220 PHE A O   1 
ATOM   1525  C  CB  . PHE A  1 220 ? 22.682 91.423  63.487  1.00 44.66  ? 220 PHE A CB  1 
ATOM   1526  C  CG  . PHE A  1 220 ? 21.870 90.335  62.822  1.00 47.31  ? 220 PHE A CG  1 
ATOM   1527  C  CD1 . PHE A  1 220 ? 20.885 90.646  61.889  1.00 51.25  ? 220 PHE A CD1 1 
ATOM   1528  C  CD2 . PHE A  1 220 ? 22.049 89.003  63.171  1.00 50.37  ? 220 PHE A CD2 1 
ATOM   1529  C  CE1 . PHE A  1 220 ? 20.127 89.638  61.287  1.00 52.99  ? 220 PHE A CE1 1 
ATOM   1530  C  CE2 . PHE A  1 220 ? 21.289 87.996  62.570  1.00 53.90  ? 220 PHE A CE2 1 
ATOM   1531  C  CZ  . PHE A  1 220 ? 20.332 88.320  61.635  1.00 52.51  ? 220 PHE A CZ  1 
ATOM   1532  N  N   . ALA A  1 221 ? 24.891 93.738  63.709  1.00 39.88  ? 221 ALA A N   1 
ATOM   1533  C  CA  . ALA A  1 221 ? 25.665 94.702  64.490  1.00 39.08  ? 221 ALA A CA  1 
ATOM   1534  C  C   . ALA A  1 221 ? 25.544 96.116  63.920  1.00 41.44  ? 221 ALA A C   1 
ATOM   1535  O  O   . ALA A  1 221 ? 25.455 97.062  64.691  1.00 41.60  ? 221 ALA A O   1 
ATOM   1536  C  CB  . ALA A  1 221 ? 27.125 94.283  64.538  1.00 39.20  ? 221 ALA A CB  1 
ATOM   1537  N  N   . LEU A  1 222 ? 25.517 96.254  62.584  1.00 36.36  ? 222 LEU A N   1 
ATOM   1538  C  CA  . LEU A  1 222 ? 25.404 97.541  61.902  1.00 36.22  ? 222 LEU A CA  1 
ATOM   1539  C  C   . LEU A  1 222 ? 23.998 98.166  62.010  1.00 42.21  ? 222 LEU A C   1 
ATOM   1540  O  O   . LEU A  1 222 ? 23.880 99.389  61.864  1.00 42.10  ? 222 LEU A O   1 
ATOM   1541  C  CB  . LEU A  1 222 ? 25.764 97.388  60.418  1.00 35.88  ? 222 LEU A CB  1 
ATOM   1542  C  CG  . LEU A  1 222 ? 27.234 97.342  60.038  1.00 39.76  ? 222 LEU A CG  1 
ATOM   1543  C  CD1 . LEU A  1 222 ? 27.402 96.736  58.667  1.00 39.89  ? 222 LEU A CD1 1 
ATOM   1544  C  CD2 . LEU A  1 222 ? 27.863 98.727  60.072  1.00 41.60  ? 222 LEU A CD2 1 
ATOM   1545  N  N   . ILE A  1 223 ? 22.940 97.336  62.240  1.00 39.34  ? 223 ILE A N   1 
ATOM   1546  C  CA  . ILE A  1 223 ? 21.531 97.763  62.317  1.00 39.51  ? 223 ILE A CA  1 
ATOM   1547  C  C   . ILE A  1 223 ? 21.342 98.923  63.337  1.00 43.58  ? 223 ILE A C   1 
ATOM   1548  O  O   . ILE A  1 223 ? 20.773 99.925  62.907  1.00 43.68  ? 223 ILE A O   1 
ATOM   1549  C  CB  . ILE A  1 223 ? 20.541 96.583  62.555  1.00 42.53  ? 223 ILE A CB  1 
ATOM   1550  C  CG1 . ILE A  1 223 ? 20.423 95.719  61.271  1.00 42.29  ? 223 ILE A CG1 1 
ATOM   1551  C  CG2 . ILE A  1 223 ? 19.157 97.086  63.005  1.00 44.11  ? 223 ILE A CG2 1 
ATOM   1552  C  CD1 . ILE A  1 223 ? 19.799 94.347  61.439  1.00 46.09  ? 223 ILE A CD1 1 
ATOM   1553  N  N   . PRO A  1 224 ? 21.828 98.888  64.614  1.00 40.30  ? 224 PRO A N   1 
ATOM   1554  C  CA  . PRO A  1 224 ? 21.633 100.058 65.497  1.00 40.51  ? 224 PRO A CA  1 
ATOM   1555  C  C   . PRO A  1 224 ? 22.181 101.348 64.887  1.00 45.09  ? 224 PRO A C   1 
ATOM   1556  O  O   . PRO A  1 224 ? 21.453 102.338 64.855  1.00 45.80  ? 224 PRO A O   1 
ATOM   1557  C  CB  . PRO A  1 224 ? 22.395 99.683  66.771  1.00 41.73  ? 224 PRO A CB  1 
ATOM   1558  C  CG  . PRO A  1 224 ? 22.437 98.217  66.767  1.00 46.08  ? 224 PRO A CG  1 
ATOM   1559  C  CD  . PRO A  1 224 ? 22.530 97.804  65.330  1.00 41.38  ? 224 PRO A CD  1 
ATOM   1560  N  N   . MET A  1 225 ? 23.421 101.304 64.329  1.00 41.10  ? 225 MET A N   1 
ATOM   1561  C  CA  . MET A  1 225 ? 24.107 102.433 63.674  1.00 40.77  ? 225 MET A CA  1 
ATOM   1562  C  C   . MET A  1 225 ? 23.346 102.946 62.436  1.00 45.84  ? 225 MET A C   1 
ATOM   1563  O  O   . MET A  1 225 ? 23.426 104.136 62.120  1.00 45.71  ? 225 MET A O   1 
ATOM   1564  C  CB  . MET A  1 225 ? 25.540 102.049 63.277  1.00 41.85  ? 225 MET A CB  1 
ATOM   1565  C  CG  . MET A  1 225 ? 26.533 102.152 64.412  1.00 44.54  ? 225 MET A CG  1 
ATOM   1566  S  SD  . MET A  1 225 ? 26.905 103.833 64.975  1.00 48.71  ? 225 MET A SD  1 
ATOM   1567  C  CE  . MET A  1 225 ? 27.875 104.432 63.608  1.00 45.20  ? 225 MET A CE  1 
ATOM   1568  N  N   . ALA A  1 226 ? 22.622 102.049 61.743  1.00 42.59  ? 226 ALA A N   1 
ATOM   1569  C  CA  . ALA A  1 226 ? 21.810 102.400 60.582  1.00 42.99  ? 226 ALA A CA  1 
ATOM   1570  C  C   . ALA A  1 226 ? 20.544 103.148 61.017  1.00 47.08  ? 226 ALA A C   1 
ATOM   1571  O  O   . ALA A  1 226 ? 20.160 104.118 60.362  1.00 47.90  ? 226 ALA A O   1 
ATOM   1572  C  CB  . ALA A  1 226 ? 21.445 101.148 59.801  1.00 43.75  ? 226 ALA A CB  1 
ATOM   1573  N  N   . VAL A  1 227 ? 19.916 102.712 62.134  1.00 42.52  ? 227 VAL A N   1 
ATOM   1574  C  CA  . VAL A  1 227 ? 18.693 103.311 62.678  1.00 42.89  ? 227 VAL A CA  1 
ATOM   1575  C  C   . VAL A  1 227 ? 19.017 104.652 63.365  1.00 47.80  ? 227 VAL A C   1 
ATOM   1576  O  O   . VAL A  1 227 ? 18.262 105.605 63.170  1.00 48.64  ? 227 VAL A O   1 
ATOM   1577  C  CB  . VAL A  1 227 ? 17.908 102.357 63.620  1.00 46.20  ? 227 VAL A CB  1 
ATOM   1578  C  CG1 . VAL A  1 227 ? 16.568 102.965 64.022  1.00 47.16  ? 227 VAL A CG1 1 
ATOM   1579  C  CG2 . VAL A  1 227 ? 17.678 101.001 62.965  1.00 45.61  ? 227 VAL A CG2 1 
ATOM   1580  N  N   . ILE A  1 228 ? 20.119 104.729 64.158  1.00 43.67  ? 228 ILE A N   1 
ATOM   1581  C  CA  . ILE A  1 228 ? 20.534 105.960 64.858  1.00 43.82  ? 228 ILE A CA  1 
ATOM   1582  C  C   . ILE A  1 228 ? 20.922 107.044 63.825  1.00 48.52  ? 228 ILE A C   1 
ATOM   1583  O  O   . ILE A  1 228 ? 20.517 108.196 63.975  1.00 48.77  ? 228 ILE A O   1 
ATOM   1584  C  CB  . ILE A  1 228 ? 21.682 105.719 65.901  1.00 46.08  ? 228 ILE A CB  1 
ATOM   1585  C  CG1 . ILE A  1 228 ? 21.327 104.635 66.961  1.00 46.53  ? 228 ILE A CG1 1 
ATOM   1586  C  CG2 . ILE A  1 228 ? 22.143 107.022 66.576  1.00 46.98  ? 228 ILE A CG2 1 
ATOM   1587  C  CD1 . ILE A  1 228 ? 20.226 104.959 68.023  1.00 57.05  ? 228 ILE A CD1 1 
ATOM   1588  N  N   . GLY A  1 229 ? 21.674 106.652 62.796  1.00 44.89  ? 229 GLY A N   1 
ATOM   1589  C  CA  . GLY A  1 229 ? 22.145 107.543 61.739  1.00 45.04  ? 229 GLY A CA  1 
ATOM   1590  C  C   . GLY A  1 229 ? 21.099 108.036 60.756  1.00 49.87  ? 229 GLY A C   1 
ATOM   1591  O  O   . GLY A  1 229 ? 21.304 109.071 60.118  1.00 50.17  ? 229 GLY A O   1 
ATOM   1592  N  N   . LEU A  1 230 ? 19.977 107.303 60.612  1.00 46.39  ? 230 LEU A N   1 
ATOM   1593  C  CA  . LEU A  1 230 ? 18.894 107.635 59.682  1.00 46.92  ? 230 LEU A CA  1 
ATOM   1594  C  C   . LEU A  1 230 ? 18.277 109.043 59.941  1.00 51.85  ? 230 LEU A C   1 
ATOM   1595  O  O   . LEU A  1 230 ? 18.273 109.818 58.982  1.00 51.98  ? 230 LEU A O   1 
ATOM   1596  C  CB  . LEU A  1 230 ? 17.809 106.549 59.701  1.00 47.24  ? 230 LEU A CB  1 
ATOM   1597  C  CG  . LEU A  1 230 ? 17.036 106.342 58.404  1.00 53.02  ? 230 LEU A CG  1 
ATOM   1598  C  CD1 . LEU A  1 230 ? 17.856 105.561 57.387  1.00 52.49  ? 230 LEU A CD1 1 
ATOM   1599  C  CD2 . LEU A  1 230 ? 15.742 105.608 58.668  1.00 56.64  ? 230 LEU A CD2 1 
ATOM   1600  N  N   . PRO A  1 231 ? 17.822 109.445 61.175  1.00 48.68  ? 231 PRO A N   1 
ATOM   1601  C  CA  . PRO A  1 231 ? 17.257 110.802 61.343  1.00 49.47  ? 231 PRO A CA  1 
ATOM   1602  C  C   . PRO A  1 231 ? 18.283 111.945 61.236  1.00 53.43  ? 231 PRO A C   1 
ATOM   1603  O  O   . PRO A  1 231 ? 17.879 113.099 61.086  1.00 54.18  ? 231 PRO A O   1 
ATOM   1604  C  CB  . PRO A  1 231 ? 16.642 110.755 62.744  1.00 51.25  ? 231 PRO A CB  1 
ATOM   1605  C  CG  . PRO A  1 231 ? 17.427 109.737 63.464  1.00 54.38  ? 231 PRO A CG  1 
ATOM   1606  C  CD  . PRO A  1 231 ? 17.723 108.687 62.442  1.00 49.43  ? 231 PRO A CD  1 
ATOM   1607  N  N   . TYR A  1 232 ? 19.596 111.634 61.307  1.00 48.69  ? 232 TYR A N   1 
ATOM   1608  C  CA  . TYR A  1 232 ? 20.676 112.622 61.186  1.00 48.26  ? 232 TYR A CA  1 
ATOM   1609  C  C   . TYR A  1 232 ? 20.759 113.159 59.750  1.00 53.49  ? 232 TYR A C   1 
ATOM   1610  O  O   . TYR A  1 232 ? 21.136 114.315 59.545  1.00 53.73  ? 232 TYR A O   1 
ATOM   1611  C  CB  . TYR A  1 232 ? 22.011 112.004 61.620  1.00 47.67  ? 232 TYR A CB  1 
ATOM   1612  C  CG  . TYR A  1 232 ? 22.217 112.024 63.117  1.00 48.15  ? 232 TYR A CG  1 
ATOM   1613  C  CD1 . TYR A  1 232 ? 21.604 111.085 63.941  1.00 50.02  ? 232 TYR A CD1 1 
ATOM   1614  C  CD2 . TYR A  1 232 ? 23.033 112.976 63.710  1.00 48.38  ? 232 TYR A CD2 1 
ATOM   1615  C  CE1 . TYR A  1 232 ? 21.777 111.110 65.323  1.00 50.48  ? 232 TYR A CE1 1 
ATOM   1616  C  CE2 . TYR A  1 232 ? 23.211 113.015 65.089  1.00 48.84  ? 232 TYR A CE2 1 
ATOM   1617  C  CZ  . TYR A  1 232 ? 22.581 112.078 65.893  1.00 55.61  ? 232 TYR A CZ  1 
ATOM   1618  O  OH  . TYR A  1 232 ? 22.741 112.076 67.254  1.00 55.95  ? 232 TYR A OH  1 
ATOM   1619  N  N   . TYR A  1 233 ? 20.392 112.320 58.769  1.00 50.12  ? 233 TYR A N   1 
ATOM   1620  C  CA  . TYR A  1 233 ? 20.364 112.666 57.354  1.00 50.43  ? 233 TYR A CA  1 
ATOM   1621  C  C   . TYR A  1 233 ? 19.015 113.305 56.999  1.00 55.09  ? 233 TYR A C   1 
ATOM   1622  O  O   . TYR A  1 233 ? 18.989 114.379 56.394  1.00 56.12  ? 233 TYR A O   1 
ATOM   1623  C  CB  . TYR A  1 233 ? 20.632 111.409 56.496  1.00 51.09  ? 233 TYR A CB  1 
ATOM   1624  C  CG  . TYR A  1 233 ? 20.238 111.541 55.037  1.00 54.14  ? 233 TYR A CG  1 
ATOM   1625  C  CD1 . TYR A  1 233 ? 21.091 112.142 54.113  1.00 56.49  ? 233 TYR A CD1 1 
ATOM   1626  C  CD2 . TYR A  1 233 ? 19.026 111.035 54.572  1.00 55.55  ? 233 TYR A CD2 1 
ATOM   1627  C  CE1 . TYR A  1 233 ? 20.739 112.252 52.767  1.00 58.19  ? 233 TYR A CE1 1 
ATOM   1628  C  CE2 . TYR A  1 233 ? 18.660 111.147 53.231  1.00 57.33  ? 233 TYR A CE2 1 
ATOM   1629  C  CZ  . TYR A  1 233 ? 19.522 111.752 52.332  1.00 64.84  ? 233 TYR A CZ  1 
ATOM   1630  O  OH  . TYR A  1 233 ? 19.164 111.853 51.010  1.00 67.19  ? 233 TYR A OH  1 
ATOM   1631  N  N   . LEU A  1 234 ? 17.904 112.629 57.369  1.00 50.64  ? 234 LEU A N   1 
ATOM   1632  C  CA  . LEU A  1 234 ? 16.522 113.015 57.077  1.00 51.29  ? 234 LEU A CA  1 
ATOM   1633  C  C   . LEU A  1 234 ? 16.153 114.410 57.577  1.00 56.68  ? 234 LEU A C   1 
ATOM   1634  O  O   . LEU A  1 234 ? 15.549 115.170 56.823  1.00 56.99  ? 234 LEU A O   1 
ATOM   1635  C  CB  . LEU A  1 234 ? 15.539 111.990 57.669  1.00 50.89  ? 234 LEU A CB  1 
ATOM   1636  C  CG  . LEU A  1 234 ? 15.510 110.611 57.016  1.00 54.32  ? 234 LEU A CG  1 
ATOM   1637  C  CD1 . LEU A  1 234 ? 14.983 109.570 57.977  1.00 53.77  ? 234 LEU A CD1 1 
ATOM   1638  C  CD2 . LEU A  1 234 ? 14.683 110.617 55.747  1.00 57.61  ? 234 LEU A CD2 1 
ATOM   1639  N  N   . PHE A  1 235 ? 16.504 114.745 58.832  1.00 54.16  ? 235 PHE A N   1 
ATOM   1640  C  CA  . PHE A  1 235 ? 16.160 116.035 59.434  1.00 55.47  ? 235 PHE A CA  1 
ATOM   1641  C  C   . PHE A  1 235 ? 17.339 117.022 59.434  1.00 61.50  ? 235 PHE A C   1 
ATOM   1642  O  O   . PHE A  1 235 ? 17.177 118.160 59.886  1.00 61.56  ? 235 PHE A O   1 
ATOM   1643  C  CB  . PHE A  1 235 ? 15.617 115.831 60.860  1.00 56.82  ? 235 PHE A CB  1 
ATOM   1644  C  CG  . PHE A  1 235 ? 14.497 114.818 60.939  1.00 58.31  ? 235 PHE A CG  1 
ATOM   1645  C  CD1 . PHE A  1 235 ? 13.255 115.083 60.373  1.00 62.69  ? 235 PHE A CD1 1 
ATOM   1646  C  CD2 . PHE A  1 235 ? 14.689 113.594 61.562  1.00 59.27  ? 235 PHE A CD2 1 
ATOM   1647  C  CE1 . PHE A  1 235 ? 12.229 114.137 60.426  1.00 63.90  ? 235 PHE A CE1 1 
ATOM   1648  C  CE2 . PHE A  1 235 ? 13.660 112.650 61.620  1.00 62.32  ? 235 PHE A CE2 1 
ATOM   1649  C  CZ  . PHE A  1 235 ? 12.437 112.928 61.051  1.00 61.79  ? 235 PHE A CZ  1 
ATOM   1650  N  N   . VAL A  1 236 ? 18.501 116.599 58.878  1.00 59.42  ? 236 VAL A N   1 
ATOM   1651  C  CA  . VAL A  1 236 ? 19.756 117.362 58.759  1.00 60.06  ? 236 VAL A CA  1 
ATOM   1652  C  C   . VAL A  1 236 ? 20.142 117.907 60.160  1.00 66.24  ? 236 VAL A C   1 
ATOM   1653  O  O   . VAL A  1 236 ? 20.002 119.103 60.450  1.00 66.84  ? 236 VAL A O   1 
ATOM   1654  C  CB  . VAL A  1 236 ? 19.728 118.466 57.654  1.00 65.17  ? 236 VAL A CB  1 
ATOM   1655  C  CG1 . VAL A  1 236 ? 21.133 118.997 57.367  1.00 64.60  ? 236 VAL A CG1 1 
ATOM   1656  C  CG2 . VAL A  1 236 ? 19.093 117.947 56.366  1.00 65.48  ? 236 VAL A CG2 1 
ATOM   1657  N  N   . TRP A  1 237 ? 20.568 116.983 61.036  1.00 63.14  ? 237 TRP A N   1 
ATOM   1658  C  CA  . TRP A  1 237 ? 20.978 117.277 62.404  1.00 63.30  ? 237 TRP A CA  1 
ATOM   1659  C  C   . TRP A  1 237 ? 22.464 117.642 62.416  1.00 68.66  ? 237 TRP A C   1 
ATOM   1660  O  O   . TRP A  1 237 ? 23.324 116.760 62.318  1.00 67.57  ? 237 TRP A O   1 
ATOM   1661  C  CB  . TRP A  1 237 ? 20.685 116.076 63.326  1.00 61.11  ? 237 TRP A CB  1 
ATOM   1662  C  CG  . TRP A  1 237 ? 19.241 115.868 63.704  1.00 62.64  ? 237 TRP A CG  1 
ATOM   1663  C  CD1 . TRP A  1 237 ? 18.200 116.731 63.513  1.00 66.84  ? 237 TRP A CD1 1 
ATOM   1664  C  CD2 . TRP A  1 237 ? 18.705 114.742 64.409  1.00 62.00  ? 237 TRP A CD2 1 
ATOM   1665  N  NE1 . TRP A  1 237 ? 17.043 116.197 64.031  1.00 66.58  ? 237 TRP A NE1 1 
ATOM   1666  C  CE2 . TRP A  1 237 ? 17.327 114.981 64.597  1.00 66.94  ? 237 TRP A CE2 1 
ATOM   1667  C  CE3 . TRP A  1 237 ? 19.265 113.565 64.925  1.00 62.09  ? 237 TRP A CE3 1 
ATOM   1668  C  CZ2 . TRP A  1 237 ? 16.495 114.067 65.252  1.00 66.35  ? 237 TRP A CZ2 1 
ATOM   1669  C  CZ3 . TRP A  1 237 ? 18.438 112.651 65.557  1.00 63.64  ? 237 TRP A CZ3 1 
ATOM   1670  C  CH2 . TRP A  1 237 ? 17.072 112.910 65.725  1.00 65.47  ? 237 TRP A CH2 1 
ATOM   1671  N  N   . GLU A  1 238 ? 22.758 118.952 62.492  1.00 67.16  ? 238 GLU A N   1 
ATOM   1672  C  CA  . GLU A  1 238 ? 24.129 119.469 62.474  1.00 67.16  ? 238 GLU A CA  1 
ATOM   1673  C  C   . GLU A  1 238 ? 24.437 120.274 63.759  1.00 71.66  ? 238 GLU A C   1 
ATOM   1674  O  O   . GLU A  1 238 ? 24.913 121.412 63.688  1.00 72.68  ? 238 GLU A O   1 
ATOM   1675  C  CB  . GLU A  1 238 ? 24.378 120.315 61.204  1.00 69.47  ? 238 GLU A CB  1 
ATOM   1676  C  CG  . GLU A  1 238 ? 24.303 119.531 59.899  1.00 80.90  ? 238 GLU A CG  1 
ATOM   1677  C  CD  . GLU A  1 238 ? 25.609 119.191 59.200  1.00 104.70 ? 238 GLU A CD  1 
ATOM   1678  O  OE1 . GLU A  1 238 ? 26.694 119.486 59.752  1.00 99.13  ? 238 GLU A OE1 1 
ATOM   1679  O  OE2 . GLU A  1 238 ? 25.540 118.602 58.096  1.00 101.92 ? 238 GLU A OE2 1 
ATOM   1680  N  N   . ASP A  1 239 ? 24.182 119.659 64.933  1.00 66.54  ? 239 ASP A N   1 
ATOM   1681  C  CA  . ASP A  1 239 ? 24.437 120.262 66.244  1.00 65.72  ? 239 ASP A CA  1 
ATOM   1682  C  C   . ASP A  1 239 ? 25.628 119.599 66.927  1.00 66.57  ? 239 ASP A C   1 
ATOM   1683  O  O   . ASP A  1 239 ? 25.929 118.436 66.638  1.00 65.08  ? 239 ASP A O   1 
ATOM   1684  C  CB  . ASP A  1 239 ? 23.196 120.158 67.138  1.00 67.99  ? 239 ASP A CB  1 
ATOM   1685  C  CG  . ASP A  1 239 ? 22.080 121.087 66.727  1.00 80.68  ? 239 ASP A CG  1 
ATOM   1686  O  OD1 . ASP A  1 239 ? 21.370 120.765 65.747  1.00 81.03  ? 239 ASP A OD1 1 
ATOM   1687  O  OD2 . ASP A  1 239 ? 21.906 122.133 67.389  1.00 88.84  ? 239 ASP A OD2 1 
ATOM   1688  N  N   . TYR A  1 240 ? 26.302 120.338 67.837  1.00 61.77  ? 240 TYR A N   1 
ATOM   1689  C  CA  . TYR A  1 240 ? 27.448 119.836 68.597  1.00 59.99  ? 240 TYR A CA  1 
ATOM   1690  C  C   . TYR A  1 240 ? 27.009 118.659 69.472  1.00 62.03  ? 240 TYR A C   1 
ATOM   1691  O  O   . TYR A  1 240 ? 27.567 117.570 69.339  1.00 60.65  ? 240 TYR A O   1 
ATOM   1692  C  CB  . TYR A  1 240 ? 28.101 120.953 69.446  1.00 61.52  ? 240 TYR A CB  1 
ATOM   1693  C  CG  . TYR A  1 240 ? 29.131 120.449 70.438  1.00 62.19  ? 240 TYR A CG  1 
ATOM   1694  C  CD1 . TYR A  1 240 ? 30.371 119.986 70.012  1.00 63.25  ? 240 TYR A CD1 1 
ATOM   1695  C  CD2 . TYR A  1 240 ? 28.856 120.413 71.802  1.00 63.17  ? 240 TYR A CD2 1 
ATOM   1696  C  CE1 . TYR A  1 240 ? 31.325 119.526 70.919  1.00 63.52  ? 240 TYR A CE1 1 
ATOM   1697  C  CE2 . TYR A  1 240 ? 29.794 119.933 72.717  1.00 63.74  ? 240 TYR A CE2 1 
ATOM   1698  C  CZ  . TYR A  1 240 ? 31.027 119.488 72.270  1.00 70.87  ? 240 TYR A CZ  1 
ATOM   1699  O  OH  . TYR A  1 240 ? 31.959 119.010 73.160  1.00 72.38  ? 240 TYR A OH  1 
ATOM   1700  N  N   . ASP A  1 241 ? 25.987 118.876 70.329  1.00 58.20  ? 241 ASP A N   1 
ATOM   1701  C  CA  . ASP A  1 241 ? 25.426 117.871 71.236  1.00 57.21  ? 241 ASP A CA  1 
ATOM   1702  C  C   . ASP A  1 241 ? 24.977 116.621 70.469  1.00 58.37  ? 241 ASP A C   1 
ATOM   1703  O  O   . ASP A  1 241 ? 25.345 115.515 70.866  1.00 57.08  ? 241 ASP A O   1 
ATOM   1704  C  CB  . ASP A  1 241 ? 24.261 118.451 72.065  1.00 60.40  ? 241 ASP A CB  1 
ATOM   1705  C  CG  . ASP A  1 241 ? 23.315 119.355 71.293  1.00 75.78  ? 241 ASP A CG  1 
ATOM   1706  O  OD1 . ASP A  1 241 ? 22.575 118.841 70.426  1.00 76.46  ? 241 ASP A OD1 1 
ATOM   1707  O  OD2 . ASP A  1 241 ? 23.312 120.577 71.561  1.00 84.98  ? 241 ASP A OD2 1 
ATOM   1708  N  N   . LYS A  1 242 ? 24.251 116.803 69.342  1.00 53.70  ? 242 LYS A N   1 
ATOM   1709  C  CA  . LYS A  1 242 ? 23.756 115.713 68.497  1.00 52.27  ? 242 LYS A CA  1 
ATOM   1710  C  C   . LYS A  1 242 ? 24.899 114.915 67.857  1.00 56.39  ? 242 LYS A C   1 
ATOM   1711  O  O   . LYS A  1 242 ? 24.800 113.692 67.778  1.00 55.33  ? 242 LYS A O   1 
ATOM   1712  C  CB  . LYS A  1 242 ? 22.798 116.239 67.423  1.00 53.97  ? 242 LYS A CB  1 
ATOM   1713  C  CG  . LYS A  1 242 ? 21.337 116.032 67.797  1.00 55.49  ? 242 LYS A CG  1 
ATOM   1714  C  CD  . LYS A  1 242 ? 20.383 116.855 66.953  1.00 63.86  ? 242 LYS A CD  1 
ATOM   1715  C  CE  . LYS A  1 242 ? 20.002 118.175 67.579  1.00 79.13  ? 242 LYS A CE  1 
ATOM   1716  N  NZ  . LYS A  1 242 ? 18.983 118.012 68.647  1.00 92.65  ? 242 LYS A NZ  1 
ATOM   1717  N  N   . TYR A  1 243 ? 25.993 115.584 67.447  1.00 53.77  ? 243 TYR A N   1 
ATOM   1718  C  CA  . TYR A  1 243 ? 27.131 114.880 66.854  1.00 53.06  ? 243 TYR A CA  1 
ATOM   1719  C  C   . TYR A  1 243 ? 27.956 114.141 67.911  1.00 55.30  ? 243 TYR A C   1 
ATOM   1720  O  O   . TYR A  1 243 ? 28.432 113.041 67.629  1.00 53.94  ? 243 TYR A O   1 
ATOM   1721  C  CB  . TYR A  1 243 ? 28.016 115.817 66.025  1.00 55.40  ? 243 TYR A CB  1 
ATOM   1722  C  CG  . TYR A  1 243 ? 27.525 115.996 64.602  1.00 58.86  ? 243 TYR A CG  1 
ATOM   1723  C  CD1 . TYR A  1 243 ? 27.053 114.911 63.864  1.00 60.45  ? 243 TYR A CD1 1 
ATOM   1724  C  CD2 . TYR A  1 243 ? 27.576 117.238 63.976  1.00 60.98  ? 243 TYR A CD2 1 
ATOM   1725  C  CE1 . TYR A  1 243 ? 26.594 115.068 62.559  1.00 62.19  ? 243 TYR A CE1 1 
ATOM   1726  C  CE2 . TYR A  1 243 ? 27.145 117.403 62.660  1.00 62.69  ? 243 TYR A CE2 1 
ATOM   1727  C  CZ  . TYR A  1 243 ? 26.648 116.315 61.957  1.00 71.82  ? 243 TYR A CZ  1 
ATOM   1728  O  OH  . TYR A  1 243 ? 26.218 116.463 60.658  1.00 74.84  ? 243 TYR A OH  1 
ATOM   1729  N  N   . VAL A  1 244 ? 28.092 114.721 69.127  1.00 51.59  ? 244 VAL A N   1 
ATOM   1730  C  CA  . VAL A  1 244 ? 28.823 114.119 70.249  1.00 50.47  ? 244 VAL A CA  1 
ATOM   1731  C  C   . VAL A  1 244 ? 28.094 112.841 70.691  1.00 53.64  ? 244 VAL A C   1 
ATOM   1732  O  O   . VAL A  1 244 ? 28.758 111.830 70.888  1.00 53.00  ? 244 VAL A O   1 
ATOM   1733  C  CB  . VAL A  1 244 ? 29.058 115.111 71.428  1.00 54.94  ? 244 VAL A CB  1 
ATOM   1734  C  CG1 . VAL A  1 244 ? 29.591 114.403 72.673  1.00 54.30  ? 244 VAL A CG1 1 
ATOM   1735  C  CG2 . VAL A  1 244 ? 30.018 116.219 71.019  1.00 55.20  ? 244 VAL A CG2 1 
ATOM   1736  N  N   . ILE A  1 245 ? 26.743 112.873 70.794  1.00 50.33  ? 245 ILE A N   1 
ATOM   1737  C  CA  . ILE A  1 245 ? 25.916 111.718 71.186  1.00 49.69  ? 245 ILE A CA  1 
ATOM   1738  C  C   . ILE A  1 245 ? 26.137 110.551 70.196  1.00 53.38  ? 245 ILE A C   1 
ATOM   1739  O  O   . ILE A  1 245 ? 26.416 109.431 70.634  1.00 52.57  ? 245 ILE A O   1 
ATOM   1740  C  CB  . ILE A  1 245 ? 24.412 112.115 71.317  1.00 53.30  ? 245 ILE A CB  1 
ATOM   1741  C  CG1 . ILE A  1 245 ? 24.173 112.914 72.615  1.00 54.34  ? 245 ILE A CG1 1 
ATOM   1742  C  CG2 . ILE A  1 245 ? 23.483 110.889 71.265  1.00 53.21  ? 245 ILE A CG2 1 
ATOM   1743  C  CD1 . ILE A  1 245 ? 23.043 113.905 72.559  1.00 59.22  ? 245 ILE A CD1 1 
ATOM   1744  N  N   . PHE A  1 246 ? 26.056 110.834 68.877  1.00 50.02  ? 246 PHE A N   1 
ATOM   1745  C  CA  . PHE A  1 246 ? 26.239 109.851 67.806  1.00 48.95  ? 246 PHE A CA  1 
ATOM   1746  C  C   . PHE A  1 246 ? 27.654 109.260 67.818  1.00 51.14  ? 246 PHE A C   1 
ATOM   1747  O  O   . PHE A  1 246 ? 27.791 108.036 67.761  1.00 50.36  ? 246 PHE A O   1 
ATOM   1748  C  CB  . PHE A  1 246 ? 25.921 110.472 66.433  1.00 51.23  ? 246 PHE A CB  1 
ATOM   1749  C  CG  . PHE A  1 246 ? 25.821 109.517 65.265  1.00 52.67  ? 246 PHE A CG  1 
ATOM   1750  C  CD1 . PHE A  1 246 ? 25.304 108.235 65.434  1.00 55.77  ? 246 PHE A CD1 1 
ATOM   1751  C  CD2 . PHE A  1 246 ? 26.167 109.922 63.984  1.00 55.24  ? 246 PHE A CD2 1 
ATOM   1752  C  CE1 . PHE A  1 246 ? 25.182 107.362 64.351  1.00 56.38  ? 246 PHE A CE1 1 
ATOM   1753  C  CE2 . PHE A  1 246 ? 26.048 109.050 62.900  1.00 57.87  ? 246 PHE A CE2 1 
ATOM   1754  C  CZ  . PHE A  1 246 ? 25.556 107.774 63.091  1.00 55.51  ? 246 PHE A CZ  1 
ATOM   1755  N  N   . ALA A  1 247 ? 28.692 110.120 67.918  1.00 46.48  ? 247 ALA A N   1 
ATOM   1756  C  CA  . ALA A  1 247 ? 30.096 109.706 67.954  1.00 44.81  ? 247 ALA A CA  1 
ATOM   1757  C  C   . ALA A  1 247 ? 30.421 108.915 69.224  1.00 46.21  ? 247 ALA A C   1 
ATOM   1758  O  O   . ALA A  1 247 ? 31.208 107.976 69.151  1.00 45.15  ? 247 ALA A O   1 
ATOM   1759  C  CB  . ALA A  1 247 ? 31.005 110.914 67.845  1.00 45.94  ? 247 ALA A CB  1 
ATOM   1760  N  N   . SER A  1 248 ? 29.815 109.281 70.377  1.00 41.94  ? 248 SER A N   1 
ATOM   1761  C  CA  . SER A  1 248 ? 30.004 108.577 71.652  1.00 40.92  ? 248 SER A CA  1 
ATOM   1762  C  C   . SER A  1 248 ? 29.427 107.172 71.544  1.00 44.91  ? 248 SER A C   1 
ATOM   1763  O  O   . SER A  1 248 ? 30.078 106.210 71.954  1.00 43.30  ? 248 SER A O   1 
ATOM   1764  C  CB  . SER A  1 248 ? 29.351 109.336 72.804  1.00 43.05  ? 248 SER A CB  1 
ATOM   1765  O  OG  . SER A  1 248 ? 29.965 110.598 72.999  1.00 47.72  ? 248 SER A OG  1 
ATOM   1766  N  N   . PHE A  1 249 ? 28.223 107.057 70.938  1.00 42.80  ? 249 PHE A N   1 
ATOM   1767  C  CA  . PHE A  1 249 ? 27.548 105.785 70.704  1.00 42.62  ? 249 PHE A CA  1 
ATOM   1768  C  C   . PHE A  1 249 ? 28.369 104.938 69.736  1.00 46.01  ? 249 PHE A C   1 
ATOM   1769  O  O   . PHE A  1 249 ? 28.512 103.742 69.967  1.00 45.76  ? 249 PHE A O   1 
ATOM   1770  C  CB  . PHE A  1 249 ? 26.120 106.003 70.174  1.00 45.20  ? 249 PHE A CB  1 
ATOM   1771  C  CG  . PHE A  1 249 ? 25.407 104.729 69.782  1.00 46.92  ? 249 PHE A CG  1 
ATOM   1772  C  CD1 . PHE A  1 249 ? 24.935 103.849 70.750  1.00 49.93  ? 249 PHE A CD1 1 
ATOM   1773  C  CD2 . PHE A  1 249 ? 25.212 104.407 68.443  1.00 50.01  ? 249 PHE A CD2 1 
ATOM   1774  C  CE1 . PHE A  1 249 ? 24.284 102.667 70.385  1.00 51.07  ? 249 PHE A CE1 1 
ATOM   1775  C  CE2 . PHE A  1 249 ? 24.564 103.222 68.079  1.00 52.94  ? 249 PHE A CE2 1 
ATOM   1776  C  CZ  . PHE A  1 249 ? 24.098 102.364 69.052  1.00 50.90  ? 249 PHE A CZ  1 
ATOM   1777  N  N   . ASN A  1 250 ? 28.930 105.575 68.680  1.00 42.29  ? 250 ASN A N   1 
ATOM   1778  C  CA  . ASN A  1 250 ? 29.776 104.969 67.646  1.00 41.42  ? 250 ASN A CA  1 
ATOM   1779  C  C   . ASN A  1 250 ? 31.008 104.288 68.266  1.00 45.25  ? 250 ASN A C   1 
ATOM   1780  O  O   . ASN A  1 250 ? 31.280 103.126 67.952  1.00 44.62  ? 250 ASN A O   1 
ATOM   1781  C  CB  . ASN A  1 250 ? 30.212 106.050 66.632  1.00 41.44  ? 250 ASN A CB  1 
ATOM   1782  C  CG  . ASN A  1 250 ? 30.877 105.575 65.355  1.00 57.96  ? 250 ASN A CG  1 
ATOM   1783  O  OD1 . ASN A  1 250 ? 31.358 104.443 65.229  1.00 50.39  ? 250 ASN A OD1 1 
ATOM   1784  N  ND2 . ASN A  1 250 ? 30.934 106.458 64.370  1.00 47.95  ? 250 ASN A ND2 1 
ATOM   1785  N  N   . LEU A  1 251 ? 31.724 105.003 69.159  1.00 42.00  ? 251 LEU A N   1 
ATOM   1786  C  CA  . LEU A  1 251 ? 32.935 104.517 69.823  1.00 41.50  ? 251 LEU A CA  1 
ATOM   1787  C  C   . LEU A  1 251 ? 32.643 103.381 70.808  1.00 46.37  ? 251 LEU A C   1 
ATOM   1788  O  O   . LEU A  1 251 ? 33.481 102.487 70.946  1.00 45.97  ? 251 LEU A O   1 
ATOM   1789  C  CB  . LEU A  1 251 ? 33.675 105.660 70.533  1.00 41.92  ? 251 LEU A CB  1 
ATOM   1790  C  CG  . LEU A  1 251 ? 34.188 106.811 69.651  1.00 46.88  ? 251 LEU A CG  1 
ATOM   1791  C  CD1 . LEU A  1 251 ? 34.820 107.889 70.490  1.00 47.64  ? 251 LEU A CD1 1 
ATOM   1792  C  CD2 . LEU A  1 251 ? 35.168 106.329 68.595  1.00 48.66  ? 251 LEU A CD2 1 
ATOM   1793  N  N   . ILE A  1 252 ? 31.470 103.406 71.484  1.00 43.61  ? 252 ILE A N   1 
ATOM   1794  C  CA  . ILE A  1 252 ? 31.050 102.346 72.414  1.00 43.49  ? 252 ILE A CA  1 
ATOM   1795  C  C   . ILE A  1 252 ? 30.670 101.109 71.579  1.00 47.05  ? 252 ILE A C   1 
ATOM   1796  O  O   . ILE A  1 252 ? 31.117 100.002 71.888  1.00 47.00  ? 252 ILE A O   1 
ATOM   1797  C  CB  . ILE A  1 252 ? 29.898 102.807 73.357  1.00 47.42  ? 252 ILE A CB  1 
ATOM   1798  C  CG1 . ILE A  1 252 ? 30.370 103.919 74.319  1.00 48.66  ? 252 ILE A CG1 1 
ATOM   1799  C  CG2 . ILE A  1 252 ? 29.301 101.625 74.143  1.00 48.33  ? 252 ILE A CG2 1 
ATOM   1800  C  CD1 . ILE A  1 252 ? 29.248 104.817 74.889  1.00 56.75  ? 252 ILE A CD1 1 
ATOM   1801  N  N   . TRP A  1 253 ? 29.876 101.322 70.504  1.00 42.79  ? 253 TRP A N   1 
ATOM   1802  C  CA  . TRP A  1 253 ? 29.403 100.303 69.563  1.00 42.33  ? 253 TRP A CA  1 
ATOM   1803  C  C   . TRP A  1 253 ? 30.577 99.506  68.973  1.00 45.23  ? 253 TRP A C   1 
ATOM   1804  O  O   . TRP A  1 253 ? 30.555 98.275  69.021  1.00 44.54  ? 253 TRP A O   1 
ATOM   1805  C  CB  . TRP A  1 253 ? 28.573 100.968 68.449  1.00 41.56  ? 253 TRP A CB  1 
ATOM   1806  C  CG  . TRP A  1 253 ? 28.285 100.100 67.263  1.00 42.46  ? 253 TRP A CG  1 
ATOM   1807  C  CD1 . TRP A  1 253 ? 27.329 99.136  67.168  1.00 45.49  ? 253 TRP A CD1 1 
ATOM   1808  C  CD2 . TRP A  1 253 ? 28.934 100.151 65.984  1.00 41.95  ? 253 TRP A CD2 1 
ATOM   1809  N  NE1 . TRP A  1 253 ? 27.358 98.562  65.920  1.00 44.83  ? 253 TRP A NE1 1 
ATOM   1810  C  CE2 . TRP A  1 253 ? 28.325 99.174  65.166  1.00 45.93  ? 253 TRP A CE2 1 
ATOM   1811  C  CE3 . TRP A  1 253 ? 29.959 100.945 65.439  1.00 42.89  ? 253 TRP A CE3 1 
ATOM   1812  C  CZ2 . TRP A  1 253 ? 28.710 98.962  63.836  1.00 44.80  ? 253 TRP A CZ2 1 
ATOM   1813  C  CZ3 . TRP A  1 253 ? 30.345 100.729 64.122  1.00 43.93  ? 253 TRP A CZ3 1 
ATOM   1814  C  CH2 . TRP A  1 253 ? 29.725 99.748  63.337  1.00 44.41  ? 253 TRP A CH2 1 
ATOM   1815  N  N   . SER A  1 254 ? 31.605 100.214 68.460  1.00 41.10  ? 254 SER A N   1 
ATOM   1816  C  CA  . SER A  1 254 ? 32.817 99.649  67.865  1.00 40.10  ? 254 SER A CA  1 
ATOM   1817  C  C   . SER A  1 254 ? 33.488 98.613  68.769  1.00 43.31  ? 254 SER A C   1 
ATOM   1818  O  O   . SER A  1 254 ? 33.829 97.530  68.292  1.00 42.94  ? 254 SER A O   1 
ATOM   1819  C  CB  . SER A  1 254 ? 33.814 100.757 67.544  1.00 43.52  ? 254 SER A CB  1 
ATOM   1820  O  OG  . SER A  1 254 ? 33.406 101.491 66.404  1.00 53.34  ? 254 SER A OG  1 
ATOM   1821  N  N   . THR A  1 255 ? 33.655 98.937  70.070  1.00 39.07  ? 255 THR A N   1 
ATOM   1822  C  CA  . THR A  1 255 ? 34.301 98.069  71.057  1.00 38.40  ? 255 THR A CA  1 
ATOM   1823  C  C   . THR A  1 255 ? 33.415 96.867  71.404  1.00 41.59  ? 255 THR A C   1 
ATOM   1824  O  O   . THR A  1 255 ? 33.874 95.725  71.299  1.00 40.61  ? 255 THR A O   1 
ATOM   1825  C  CB  . THR A  1 255 ? 34.665 98.879  72.312  1.00 44.54  ? 255 THR A CB  1 
ATOM   1826  O  OG1 . THR A  1 255 ? 35.482 99.974  71.917  1.00 42.36  ? 255 THR A OG1 1 
ATOM   1827  C  CG2 . THR A  1 255 ? 35.397 98.049  73.368  1.00 43.01  ? 255 THR A CG2 1 
ATOM   1828  N  N   . VAL A  1 256 ? 32.160 97.133  71.814  1.00 38.02  ? 256 VAL A N   1 
ATOM   1829  C  CA  . VAL A  1 256 ? 31.178 96.139  72.253  1.00 37.73  ? 256 VAL A CA  1 
ATOM   1830  C  C   . VAL A  1 256 ? 30.886 95.098  71.143  1.00 41.52  ? 256 VAL A C   1 
ATOM   1831  O  O   . VAL A  1 256 ? 30.862 93.911  71.461  1.00 41.39  ? 256 VAL A O   1 
ATOM   1832  C  CB  . VAL A  1 256 ? 29.890 96.827  72.790  1.00 41.66  ? 256 VAL A CB  1 
ATOM   1833  C  CG1 . VAL A  1 256 ? 28.782 95.818  73.084  1.00 41.61  ? 256 VAL A CG1 1 
ATOM   1834  C  CG2 . VAL A  1 256 ? 30.198 97.647  74.042  1.00 41.77  ? 256 VAL A CG2 1 
ATOM   1835  N  N   . ILE A  1 257 ? 30.727 95.510  69.866  1.00 38.03  ? 257 ILE A N   1 
ATOM   1836  C  CA  . ILE A  1 257 ? 30.440 94.542  68.792  1.00 37.86  ? 257 ILE A CA  1 
ATOM   1837  C  C   . ILE A  1 257 ? 31.649 93.622  68.508  1.00 42.21  ? 257 ILE A C   1 
ATOM   1838  O  O   . ILE A  1 257 ? 31.447 92.432  68.265  1.00 41.52  ? 257 ILE A O   1 
ATOM   1839  C  CB  . ILE A  1 257 ? 29.879 95.155  67.478  1.00 40.92  ? 257 ILE A CB  1 
ATOM   1840  C  CG1 . ILE A  1 257 ? 30.882 96.102  66.769  1.00 40.80  ? 257 ILE A CG1 1 
ATOM   1841  C  CG2 . ILE A  1 257 ? 28.537 95.832  67.731  1.00 42.72  ? 257 ILE A CG2 1 
ATOM   1842  C  CD1 . ILE A  1 257 ? 30.763 96.139  65.257  1.00 45.27  ? 257 ILE A CD1 1 
ATOM   1843  N  N   . LEU A  1 258 ? 32.885 94.152  68.563  1.00 39.41  ? 258 LEU A N   1 
ATOM   1844  C  CA  . LEU A  1 258 ? 34.086 93.349  68.308  1.00 39.11  ? 258 LEU A CA  1 
ATOM   1845  C  C   . LEU A  1 258 ? 34.387 92.419  69.484  1.00 43.25  ? 258 LEU A C   1 
ATOM   1846  O  O   . LEU A  1 258 ? 34.964 91.348  69.280  1.00 42.85  ? 258 LEU A O   1 
ATOM   1847  C  CB  . LEU A  1 258 ? 35.301 94.230  67.980  1.00 39.08  ? 258 LEU A CB  1 
ATOM   1848  C  CG  . LEU A  1 258 ? 35.208 95.044  66.682  1.00 43.62  ? 258 LEU A CG  1 
ATOM   1849  C  CD1 . LEU A  1 258 ? 36.363 96.007  66.567  1.00 43.99  ? 258 LEU A CD1 1 
ATOM   1850  C  CD2 . LEU A  1 258 ? 35.118 94.150  65.454  1.00 45.09  ? 258 LEU A CD2 1 
ATOM   1851  N  N   . GLU A  1 259 ? 33.968 92.815  70.703  1.00 39.84  ? 259 GLU A N   1 
ATOM   1852  C  CA  . GLU A  1 259 ? 34.127 92.017  71.916  1.00 39.39  ? 259 GLU A CA  1 
ATOM   1853  C  C   . GLU A  1 259 ? 33.058 90.923  71.964  1.00 42.25  ? 259 GLU A C   1 
ATOM   1854  O  O   . GLU A  1 259 ? 33.391 89.780  72.280  1.00 42.23  ? 259 GLU A O   1 
ATOM   1855  C  CB  . GLU A  1 259 ? 34.076 92.896  73.177  1.00 41.19  ? 259 GLU A CB  1 
ATOM   1856  C  CG  . GLU A  1 259 ? 35.366 93.648  73.467  1.00 50.58  ? 259 GLU A CG  1 
ATOM   1857  C  CD  . GLU A  1 259 ? 36.602 92.798  73.703  1.00 70.28  ? 259 GLU A CD  1 
ATOM   1858  O  OE1 . GLU A  1 259 ? 36.575 91.936  74.612  1.00 68.78  ? 259 GLU A OE1 1 
ATOM   1859  O  OE2 . GLU A  1 259 ? 37.607 93.011  72.988  1.00 62.49  ? 259 GLU A OE2 1 
ATOM   1860  N  N   . LEU A  1 260 ? 31.785 91.264  71.620  1.00 37.65  ? 260 LEU A N   1 
ATOM   1861  C  CA  . LEU A  1 260 ? 30.668 90.312  71.587  1.00 37.47  ? 260 LEU A CA  1 
ATOM   1862  C  C   . LEU A  1 260 ? 30.860 89.258  70.492  1.00 42.25  ? 260 LEU A C   1 
ATOM   1863  O  O   . LEU A  1 260 ? 30.352 88.141  70.635  1.00 41.86  ? 260 LEU A O   1 
ATOM   1864  C  CB  . LEU A  1 260 ? 29.314 91.009  71.397  1.00 37.53  ? 260 LEU A CB  1 
ATOM   1865  C  CG  . LEU A  1 260 ? 28.698 91.722  72.596  1.00 42.78  ? 260 LEU A CG  1 
ATOM   1866  C  CD1 . LEU A  1 260 ? 27.423 92.421  72.186  1.00 43.46  ? 260 LEU A CD1 1 
ATOM   1867  C  CD2 . LEU A  1 260 ? 28.406 90.761  73.746  1.00 45.45  ? 260 LEU A CD2 1 
ATOM   1868  N  N   . TRP A  1 261 ? 31.585 89.614  69.400  1.00 39.18  ? 261 TRP A N   1 
ATOM   1869  C  CA  . TRP A  1 261 ? 31.886 88.679  68.317  1.00 38.83  ? 261 TRP A CA  1 
ATOM   1870  C  C   . TRP A  1 261 ? 32.799 87.571  68.838  1.00 42.98  ? 261 TRP A C   1 
ATOM   1871  O  O   . TRP A  1 261 ? 32.549 86.404  68.539  1.00 43.52  ? 261 TRP A O   1 
ATOM   1872  C  CB  . TRP A  1 261 ? 32.518 89.366  67.087  1.00 37.09  ? 261 TRP A CB  1 
ATOM   1873  C  CG  . TRP A  1 261 ? 33.208 88.392  66.178  1.00 37.67  ? 261 TRP A CG  1 
ATOM   1874  C  CD1 . TRP A  1 261 ? 34.552 88.188  66.077  1.00 40.47  ? 261 TRP A CD1 1 
ATOM   1875  C  CD2 . TRP A  1 261 ? 32.585 87.349  65.412  1.00 37.60  ? 261 TRP A CD2 1 
ATOM   1876  N  NE1 . TRP A  1 261 ? 34.808 87.117  65.250  1.00 39.99  ? 261 TRP A NE1 1 
ATOM   1877  C  CE2 . TRP A  1 261 ? 33.618 86.584  64.827  1.00 41.36  ? 261 TRP A CE2 1 
ATOM   1878  C  CE3 . TRP A  1 261 ? 31.251 86.997  65.145  1.00 39.15  ? 261 TRP A CE3 1 
ATOM   1879  C  CZ2 . TRP A  1 261 ? 33.359 85.503  63.977  1.00 40.34  ? 261 TRP A CZ2 1 
ATOM   1880  C  CZ3 . TRP A  1 261 ? 30.998 85.920  64.309  1.00 40.43  ? 261 TRP A CZ3 1 
ATOM   1881  C  CH2 . TRP A  1 261 ? 32.044 85.187  63.734  1.00 40.64  ? 261 TRP A CH2 1 
ATOM   1882  N  N   . LYS A  1 262 ? 33.851 87.942  69.609  1.00 38.53  ? 262 LYS A N   1 
ATOM   1883  C  CA  . LYS A  1 262 ? 34.814 87.017  70.223  1.00 37.95  ? 262 LYS A CA  1 
ATOM   1884  C  C   . LYS A  1 262 ? 34.089 85.951  71.054  1.00 42.94  ? 262 LYS A C   1 
ATOM   1885  O  O   . LYS A  1 262 ? 34.380 84.763  70.907  1.00 42.47  ? 262 LYS A O   1 
ATOM   1886  C  CB  . LYS A  1 262 ? 35.816 87.774  71.117  1.00 39.42  ? 262 LYS A CB  1 
ATOM   1887  C  CG  . LYS A  1 262 ? 36.842 88.623  70.385  1.00 41.52  ? 262 LYS A CG  1 
ATOM   1888  C  CD  . LYS A  1 262 ? 37.446 89.631  71.348  1.00 48.06  ? 262 LYS A CD  1 
ATOM   1889  C  CE  . LYS A  1 262 ? 38.894 89.932  71.059  1.00 57.85  ? 262 LYS A CE  1 
ATOM   1890  N  NZ  . LYS A  1 262 ? 39.474 90.861  72.067  1.00 68.52  ? 262 LYS A NZ  1 
ATOM   1891  N  N   . ARG A  1 263 ? 33.121 86.386  71.896  1.00 40.44  ? 263 ARG A N   1 
ATOM   1892  C  CA  . ARG A  1 263 ? 32.316 85.537  72.787  1.00 40.94  ? 263 ARG A CA  1 
ATOM   1893  C  C   . ARG A  1 263 ? 31.404 84.600  71.993  1.00 45.68  ? 263 ARG A C   1 
ATOM   1894  O  O   . ARG A  1 263 ? 31.286 83.427  72.354  1.00 45.75  ? 263 ARG A O   1 
ATOM   1895  C  CB  . ARG A  1 263 ? 31.473 86.385  73.762  1.00 40.08  ? 263 ARG A CB  1 
ATOM   1896  C  CG  . ARG A  1 263 ? 32.229 87.531  74.407  1.00 44.57  ? 263 ARG A CG  1 
ATOM   1897  C  CD  . ARG A  1 263 ? 31.384 88.260  75.419  1.00 50.78  ? 263 ARG A CD  1 
ATOM   1898  N  NE  . ARG A  1 263 ? 31.692 87.813  76.775  1.00 53.88  ? 263 ARG A NE  1 
ATOM   1899  C  CZ  . ARG A  1 263 ? 30.957 86.952  77.467  1.00 64.41  ? 263 ARG A CZ  1 
ATOM   1900  N  NH1 . ARG A  1 263 ? 29.843 86.450  76.946  1.00 48.32  ? 263 ARG A NH1 1 
ATOM   1901  N  NH2 . ARG A  1 263 ? 31.317 86.599  78.693  1.00 52.96  ? 263 ARG A NH2 1 
ATOM   1902  N  N   . GLY A  1 264 ? 30.769 85.133  70.941  1.00 42.52  ? 264 GLY A N   1 
ATOM   1903  C  CA  . GLY A  1 264 ? 29.870 84.391  70.060  1.00 42.56  ? 264 GLY A CA  1 
ATOM   1904  C  C   . GLY A  1 264 ? 30.591 83.342  69.239  1.00 46.36  ? 264 GLY A C   1 
ATOM   1905  O  O   . GLY A  1 264 ? 30.097 82.221  69.087  1.00 45.95  ? 264 GLY A O   1 
ATOM   1906  N  N   . CYS A  1 265 ? 31.781 83.707  68.719  1.00 43.24  ? 265 CYS A N   1 
ATOM   1907  C  CA  . CYS A  1 265 ? 32.666 82.845  67.938  1.00 43.18  ? 265 CYS A CA  1 
ATOM   1908  C  C   . CYS A  1 265 ? 33.174 81.693  68.812  1.00 49.03  ? 265 CYS A C   1 
ATOM   1909  O  O   . CYS A  1 265 ? 33.233 80.560  68.338  1.00 48.83  ? 265 CYS A O   1 
ATOM   1910  C  CB  . CYS A  1 265 ? 33.820 83.653  67.352  1.00 42.78  ? 265 CYS A CB  1 
ATOM   1911  S  SG  . CYS A  1 265 ? 35.016 82.674  66.413  1.00 46.32  ? 265 CYS A SG  1 
ATOM   1912  N  N   . ALA A  1 266 ? 33.510 81.982  70.088  1.00 47.26  ? 266 ALA A N   1 
ATOM   1913  C  CA  . ALA A  1 266 ? 33.985 81.004  71.073  1.00 48.23  ? 266 ALA A CA  1 
ATOM   1914  C  C   . ALA A  1 266 ? 32.924 79.933  71.350  1.00 54.93  ? 266 ALA A C   1 
ATOM   1915  O  O   . ALA A  1 266 ? 33.283 78.767  71.514  1.00 55.74  ? 266 ALA A O   1 
ATOM   1916  C  CB  . ALA A  1 266 ? 34.370 81.702  72.367  1.00 49.24  ? 266 ALA A CB  1 
ATOM   1917  N  N   . ASN A  1 267 ? 31.626 80.329  71.391  1.00 52.12  ? 267 ASN A N   1 
ATOM   1918  C  CA  . ASN A  1 267 ? 30.466 79.449  71.595  1.00 52.66  ? 267 ASN A CA  1 
ATOM   1919  C  C   . ASN A  1 267 ? 30.308 78.472  70.429  1.00 56.17  ? 267 ASN A C   1 
ATOM   1920  O  O   . ASN A  1 267 ? 30.147 77.267  70.634  1.00 56.28  ? 267 ASN A O   1 
ATOM   1921  C  CB  . ASN A  1 267 ? 29.179 80.287  71.730  1.00 54.59  ? 267 ASN A CB  1 
ATOM   1922  C  CG  . ASN A  1 267 ? 28.704 80.560  73.135  1.00 82.04  ? 267 ASN A CG  1 
ATOM   1923  O  OD1 . ASN A  1 267 ? 29.316 80.159  74.127  1.00 76.35  ? 267 ASN A OD1 1 
ATOM   1924  N  ND2 . ASN A  1 267 ? 27.581 81.254  73.245  1.00 76.53  ? 267 ASN A ND2 1 
ATOM   1925  N  N   . MET A  1 268 ? 30.344 79.020  69.208  1.00 52.18  ? 268 MET A N   1 
ATOM   1926  C  CA  . MET A  1 268 ? 30.179 78.330  67.937  1.00 51.97  ? 268 MET A CA  1 
ATOM   1927  C  C   . MET A  1 268 ? 31.303 77.314  67.689  1.00 56.54  ? 268 MET A C   1 
ATOM   1928  O  O   . MET A  1 268 ? 31.009 76.153  67.400  1.00 57.23  ? 268 MET A O   1 
ATOM   1929  C  CB  . MET A  1 268 ? 30.130 79.378  66.818  1.00 53.58  ? 268 MET A CB  1 
ATOM   1930  C  CG  . MET A  1 268 ? 29.633 78.855  65.502  1.00 57.21  ? 268 MET A CG  1 
ATOM   1931  S  SD  . MET A  1 268 ? 29.257 80.188  64.339  1.00 61.25  ? 268 MET A SD  1 
ATOM   1932  C  CE  . MET A  1 268 ? 30.896 80.870  64.042  1.00 57.19  ? 268 MET A CE  1 
ATOM   1933  N  N   . THR A  1 269 ? 32.577 77.748  67.809  1.00 52.17  ? 269 THR A N   1 
ATOM   1934  C  CA  . THR A  1 269 ? 33.764 76.916  67.583  1.00 51.44  ? 269 THR A CA  1 
ATOM   1935  C  C   . THR A  1 269 ? 33.889 75.818  68.645  1.00 55.04  ? 269 THR A C   1 
ATOM   1936  O  O   . THR A  1 269 ? 34.423 74.752  68.331  1.00 54.75  ? 269 THR A O   1 
ATOM   1937  C  CB  . THR A  1 269 ? 35.033 77.765  67.491  1.00 59.31  ? 269 THR A CB  1 
ATOM   1938  O  OG1 . THR A  1 269 ? 35.144 78.607  68.641  1.00 58.76  ? 269 THR A OG1 1 
ATOM   1939  C  CG2 . THR A  1 269 ? 35.078 78.594  66.214  1.00 58.00  ? 269 THR A CG2 1 
ATOM   1940  N  N   . TYR A  1 270 ? 33.386 76.056  69.881  1.00 51.44  ? 270 TYR A N   1 
ATOM   1941  C  CA  . TYR A  1 270 ? 33.390 75.028  70.923  1.00 51.85  ? 270 TYR A CA  1 
ATOM   1942  C  C   . TYR A  1 270 ? 32.414 73.924  70.510  1.00 56.66  ? 270 TYR A C   1 
ATOM   1943  O  O   . TYR A  1 270 ? 32.768 72.746  70.560  1.00 57.40  ? 270 TYR A O   1 
ATOM   1944  C  CB  . TYR A  1 270 ? 33.040 75.599  72.316  1.00 52.97  ? 270 TYR A CB  1 
ATOM   1945  C  CG  . TYR A  1 270 ? 32.930 74.532  73.388  1.00 55.14  ? 270 TYR A CG  1 
ATOM   1946  C  CD1 . TYR A  1 270 ? 34.060 74.060  74.049  1.00 57.11  ? 270 TYR A CD1 1 
ATOM   1947  C  CD2 . TYR A  1 270 ? 31.700 73.970  73.715  1.00 56.83  ? 270 TYR A CD2 1 
ATOM   1948  C  CE1 . TYR A  1 270 ? 33.968 73.055  75.012  1.00 59.20  ? 270 TYR A CE1 1 
ATOM   1949  C  CE2 . TYR A  1 270 ? 31.596 72.958  74.669  1.00 58.82  ? 270 TYR A CE2 1 
ATOM   1950  C  CZ  . TYR A  1 270 ? 32.733 72.504  75.319  1.00 66.49  ? 270 TYR A CZ  1 
ATOM   1951  O  OH  . TYR A  1 270 ? 32.637 71.510  76.265  1.00 68.27  ? 270 TYR A OH  1 
ATOM   1952  N  N   . ARG A  1 271 ? 31.197 74.323  70.076  1.00 52.55  ? 271 ARG A N   1 
ATOM   1953  C  CA  . ARG A  1 271 ? 30.121 73.448  69.602  1.00 52.61  ? 271 ARG A CA  1 
ATOM   1954  C  C   . ARG A  1 271 ? 30.615 72.610  68.406  1.00 55.70  ? 271 ARG A C   1 
ATOM   1955  O  O   . ARG A  1 271 ? 30.296 71.425  68.311  1.00 55.69  ? 271 ARG A O   1 
ATOM   1956  C  CB  . ARG A  1 271 ? 28.896 74.303  69.222  1.00 52.70  ? 271 ARG A CB  1 
ATOM   1957  C  CG  . ARG A  1 271 ? 27.603 73.520  69.005  1.00 63.60  ? 271 ARG A CG  1 
ATOM   1958  C  CD  . ARG A  1 271 ? 26.427 74.416  68.644  1.00 73.82  ? 271 ARG A CD  1 
ATOM   1959  N  NE  . ARG A  1 271 ? 26.556 75.019  67.314  1.00 83.15  ? 271 ARG A NE  1 
ATOM   1960  C  CZ  . ARG A  1 271 ? 26.799 76.308  67.094  1.00 96.46  ? 271 ARG A CZ  1 
ATOM   1961  N  NH1 . ARG A  1 271 ? 26.931 77.150  68.113  1.00 83.88  ? 271 ARG A NH1 1 
ATOM   1962  N  NH2 . ARG A  1 271 ? 26.904 76.767  65.854  1.00 80.72  ? 271 ARG A NH2 1 
ATOM   1963  N  N   . TRP A  1 272 ? 31.429 73.226  67.529  1.00 51.27  ? 272 TRP A N   1 
ATOM   1964  C  CA  . TRP A  1 272 ? 32.026 72.583  66.363  1.00 50.90  ? 272 TRP A CA  1 
ATOM   1965  C  C   . TRP A  1 272 ? 33.159 71.639  66.778  1.00 55.43  ? 272 TRP A C   1 
ATOM   1966  O  O   . TRP A  1 272 ? 33.331 70.581  66.166  1.00 55.83  ? 272 TRP A O   1 
ATOM   1967  C  CB  . TRP A  1 272 ? 32.555 73.643  65.380  1.00 48.75  ? 272 TRP A CB  1 
ATOM   1968  C  CG  . TRP A  1 272 ? 31.505 74.472  64.696  1.00 49.62  ? 272 TRP A CG  1 
ATOM   1969  C  CD1 . TRP A  1 272 ? 30.152 74.298  64.744  1.00 53.17  ? 272 TRP A CD1 1 
ATOM   1970  C  CD2 . TRP A  1 272 ? 31.736 75.581  63.818  1.00 48.94  ? 272 TRP A CD2 1 
ATOM   1971  N  NE1 . TRP A  1 272 ? 29.525 75.242  63.964  1.00 52.54  ? 272 TRP A NE1 1 
ATOM   1972  C  CE2 . TRP A  1 272 ? 30.475 76.040  63.379  1.00 53.18  ? 272 TRP A CE2 1 
ATOM   1973  C  CE3 . TRP A  1 272 ? 32.891 76.243  63.366  1.00 49.64  ? 272 TRP A CE3 1 
ATOM   1974  C  CZ2 . TRP A  1 272 ? 30.336 77.118  62.498  1.00 52.00  ? 272 TRP A CZ2 1 
ATOM   1975  C  CZ3 . TRP A  1 272 ? 32.752 77.318  62.502  1.00 50.68  ? 272 TRP A CZ3 1 
ATOM   1976  C  CH2 . TRP A  1 272 ? 31.486 77.755  62.089  1.00 51.52  ? 272 TRP A CH2 1 
ATOM   1977  N  N   . GLY A  1 273 ? 33.913 72.038  67.804  1.00 51.27  ? 273 GLY A N   1 
ATOM   1978  C  CA  . GLY A  1 273 ? 35.041 71.278  68.333  1.00 51.01  ? 273 GLY A CA  1 
ATOM   1979  C  C   . GLY A  1 273 ? 36.397 71.811  67.916  1.00 53.26  ? 273 GLY A C   1 
ATOM   1980  O  O   . GLY A  1 273 ? 37.415 71.414  68.483  1.00 53.36  ? 273 GLY A O   1 
ATOM   1981  N  N   . THR A  1 274 ? 36.420 72.733  66.937  1.00 48.30  ? 274 THR A N   1 
ATOM   1982  C  CA  . THR A  1 274 ? 37.633 73.348  66.384  1.00 47.56  ? 274 THR A CA  1 
ATOM   1983  C  C   . THR A  1 274 ? 38.350 74.269  67.411  1.00 51.15  ? 274 THR A C   1 
ATOM   1984  O  O   . THR A  1 274 ? 39.542 74.545  67.239  1.00 50.53  ? 274 THR A O   1 
ATOM   1985  C  CB  . THR A  1 274 ? 37.305 74.077  65.068  1.00 57.02  ? 274 THR A CB  1 
ATOM   1986  O  OG1 . THR A  1 274 ? 38.476 74.714  64.554  1.00 57.56  ? 274 THR A OG1 1 
ATOM   1987  C  CG2 . THR A  1 274 ? 36.170 75.080  65.210  1.00 56.01  ? 274 THR A CG2 1 
ATOM   1988  N  N   . LEU A  1 275 ? 37.639 74.722  68.471  1.00 47.66  ? 275 LEU A N   1 
ATOM   1989  C  CA  . LEU A  1 275 ? 38.199 75.564  69.538  1.00 47.01  ? 275 LEU A CA  1 
ATOM   1990  C  C   . LEU A  1 275 ? 39.110 74.733  70.450  1.00 52.47  ? 275 LEU A C   1 
ATOM   1991  O  O   . LEU A  1 275 ? 40.099 75.254  70.968  1.00 53.09  ? 275 LEU A O   1 
ATOM   1992  C  CB  . LEU A  1 275 ? 37.069 76.226  70.356  1.00 46.72  ? 275 LEU A CB  1 
ATOM   1993  C  CG  . LEU A  1 275 ? 37.473 77.221  71.457  1.00 50.63  ? 275 LEU A CG  1 
ATOM   1994  C  CD1 . LEU A  1 275 ? 37.924 78.544  70.874  1.00 49.96  ? 275 LEU A CD1 1 
ATOM   1995  C  CD2 . LEU A  1 275 ? 36.333 77.456  72.415  1.00 52.47  ? 275 LEU A CD2 1 
ATOM   1996  N  N   . LEU A  1 276 ? 38.774 73.439  70.625  1.00 49.06  ? 276 LEU A N   1 
ATOM   1997  C  CA  . LEU A  1 276 ? 39.494 72.473  71.462  1.00 49.67  ? 276 LEU A CA  1 
ATOM   1998  C  C   . LEU A  1 276 ? 40.686 71.841  70.718  1.00 54.98  ? 276 LEU A C   1 
ATOM   1999  O  O   . LEU A  1 276 ? 41.431 71.051  71.306  1.00 55.05  ? 276 LEU A O   1 
ATOM   2000  C  CB  . LEU A  1 276 ? 38.530 71.378  71.941  1.00 50.31  ? 276 LEU A CB  1 
ATOM   2001  C  CG  . LEU A  1 276 ? 37.351 71.854  72.778  1.00 54.99  ? 276 LEU A CG  1 
ATOM   2002  C  CD1 . LEU A  1 276 ? 36.092 71.934  71.946  1.00 54.67  ? 276 LEU A CD1 1 
ATOM   2003  C  CD2 . LEU A  1 276 ? 37.134 70.953  73.964  1.00 58.37  ? 276 LEU A CD2 1 
ATOM   2004  N  N   . MET A  1 277 ? 40.866 72.197  69.436  1.00 52.44  ? 277 MET A N   1 
ATOM   2005  C  CA  . MET A  1 277 ? 41.952 71.706  68.597  1.00 52.89  ? 277 MET A CA  1 
ATOM   2006  C  C   . MET A  1 277 ? 43.233 72.481  68.854  1.00 58.21  ? 277 MET A C   1 
ATOM   2007  O  O   . MET A  1 277 ? 43.235 73.715  68.823  1.00 57.48  ? 277 MET A O   1 
ATOM   2008  C  CB  . MET A  1 277 ? 41.577 71.806  67.116  1.00 54.55  ? 277 MET A CB  1 
ATOM   2009  C  CG  . MET A  1 277 ? 40.863 70.596  66.598  1.00 58.60  ? 277 MET A CG  1 
ATOM   2010  S  SD  . MET A  1 277 ? 40.475 70.787  64.849  1.00 62.27  ? 277 MET A SD  1 
ATOM   2011  C  CE  . MET A  1 277 ? 42.086 70.449  64.112  1.00 59.00  ? 277 MET A CE  1 
ATOM   2012  N  N   . LYS A  1 278 ? 44.325 71.750  69.100  1.00 56.25  ? 278 LYS A N   1 
ATOM   2013  C  CA  . LYS A  1 278 ? 45.647 72.324  69.330  1.00 56.37  ? 278 LYS A CA  1 
ATOM   2014  C  C   . LYS A  1 278 ? 46.372 72.289  67.981  1.00 60.28  ? 278 LYS A C   1 
ATOM   2015  O  O   . LYS A  1 278 ? 47.090 71.335  67.664  1.00 60.04  ? 278 LYS A O   1 
ATOM   2016  C  CB  . LYS A  1 278 ? 46.393 71.570  70.455  1.00 59.83  ? 278 LYS A CB  1 
ATOM   2017  C  CG  . LYS A  1 278 ? 45.606 71.423  71.769  1.00 71.96  ? 278 LYS A CG  1 
ATOM   2018  C  CD  . LYS A  1 278 ? 45.827 72.584  72.738  1.00 81.66  ? 278 LYS A CD  1 
ATOM   2019  C  CE  . LYS A  1 278 ? 45.083 72.410  74.040  1.00 91.75  ? 278 LYS A CE  1 
ATOM   2020  N  NZ  . LYS A  1 278 ? 43.633 72.702  73.895  1.00 101.21 ? 278 LYS A NZ  1 
ATOM   2021  N  N   . ARG A  1 279 ? 46.094 73.319  67.156  1.00 56.50  ? 279 ARG A N   1 
ATOM   2022  C  CA  . ARG A  1 279 ? 46.585 73.492  65.783  1.00 55.92  ? 279 ARG A CA  1 
ATOM   2023  C  C   . ARG A  1 279 ? 48.100 73.750  65.702  1.00 58.76  ? 279 ARG A C   1 
ATOM   2024  O  O   . ARG A  1 279 ? 48.683 73.561  64.635  1.00 57.85  ? 279 ARG A O   1 
ATOM   2025  C  CB  . ARG A  1 279 ? 45.829 74.645  65.085  1.00 56.88  ? 279 ARG A CB  1 
ATOM   2026  C  CG  . ARG A  1 279 ? 44.312 74.445  64.964  1.00 70.21  ? 279 ARG A CG  1 
ATOM   2027  C  CD  . ARG A  1 279 ? 43.897 73.807  63.647  1.00 82.17  ? 279 ARG A CD  1 
ATOM   2028  N  NE  . ARG A  1 279 ? 43.908 74.765  62.540  1.00 92.72  ? 279 ARG A NE  1 
ATOM   2029  C  CZ  . ARG A  1 279 ? 43.916 74.430  61.253  1.00 107.92 ? 279 ARG A CZ  1 
ATOM   2030  N  NH1 . ARG A  1 279 ? 43.931 73.153  60.892  1.00 93.58  ? 279 ARG A NH1 1 
ATOM   2031  N  NH2 . ARG A  1 279 ? 43.923 75.370  60.317  1.00 96.81  ? 279 ARG A NH2 1 
ATOM   2032  N  N   . LYS A  1 280 ? 48.729 74.184  66.812  1.00 55.23  ? 280 LYS A N   1 
ATOM   2033  C  CA  . LYS A  1 280 ? 50.165 74.484  66.876  1.00 55.20  ? 280 LYS A CA  1 
ATOM   2034  C  C   . LYS A  1 280 ? 51.047 73.224  66.683  1.00 60.10  ? 280 LYS A C   1 
ATOM   2035  O  O   . LYS A  1 280 ? 52.169 73.343  66.183  1.00 60.34  ? 280 LYS A O   1 
ATOM   2036  C  CB  . LYS A  1 280 ? 50.531 75.206  68.191  1.00 57.50  ? 280 LYS A CB  1 
ATOM   2037  C  CG  . LYS A  1 280 ? 50.099 74.499  69.475  1.00 65.63  ? 280 LYS A CG  1 
ATOM   2038  C  CD  . LYS A  1 280 ? 50.698 75.149  70.707  1.00 71.79  ? 280 LYS A CD  1 
ATOM   2039  C  CE  . LYS A  1 280 ? 49.657 75.853  71.535  1.00 79.73  ? 280 LYS A CE  1 
ATOM   2040  N  NZ  . LYS A  1 280 ? 50.259 76.516  72.720  1.00 90.52  ? 280 LYS A NZ  1 
ATOM   2041  N  N   . PHE A  1 281 ? 50.537 72.033  67.059  1.00 56.58  ? 281 PHE A N   1 
ATOM   2042  C  CA  . PHE A  1 281 ? 51.268 70.766  66.943  1.00 56.81  ? 281 PHE A CA  1 
ATOM   2043  C  C   . PHE A  1 281 ? 51.002 70.061  65.593  1.00 61.84  ? 281 PHE A C   1 
ATOM   2044  O  O   . PHE A  1 281 ? 51.535 68.970  65.365  1.00 62.16  ? 281 PHE A O   1 
ATOM   2045  C  CB  . PHE A  1 281 ? 50.922 69.828  68.118  1.00 58.70  ? 281 PHE A CB  1 
ATOM   2046  C  CG  . PHE A  1 281 ? 51.044 70.450  69.489  1.00 59.73  ? 281 PHE A CG  1 
ATOM   2047  C  CD1 . PHE A  1 281 ? 52.288 70.650  70.072  1.00 62.69  ? 281 PHE A CD1 1 
ATOM   2048  C  CD2 . PHE A  1 281 ? 49.915 70.823  70.204  1.00 60.86  ? 281 PHE A CD2 1 
ATOM   2049  C  CE1 . PHE A  1 281 ? 52.399 71.235  71.334  1.00 63.71  ? 281 PHE A CE1 1 
ATOM   2050  C  CE2 . PHE A  1 281 ? 50.028 71.401  71.469  1.00 63.84  ? 281 PHE A CE2 1 
ATOM   2051  C  CZ  . PHE A  1 281 ? 51.268 71.599  72.027  1.00 62.55  ? 281 PHE A CZ  1 
ATOM   2052  N  N   . GLU A  1 282 ? 50.208 70.694  64.694  1.00 58.26  ? 282 GLU A N   1 
ATOM   2053  C  CA  . GLU A  1 282 ? 49.877 70.151  63.369  1.00 57.99  ? 282 GLU A CA  1 
ATOM   2054  C  C   . GLU A  1 282 ? 51.099 70.090  62.459  1.00 61.27  ? 282 GLU A C   1 
ATOM   2055  O  O   . GLU A  1 282 ? 52.050 70.855  62.640  1.00 60.91  ? 282 GLU A O   1 
ATOM   2056  C  CB  . GLU A  1 282 ? 48.776 70.973  62.686  1.00 58.70  ? 282 GLU A CB  1 
ATOM   2057  C  CG  . GLU A  1 282 ? 47.385 70.728  63.243  1.00 72.47  ? 282 GLU A CG  1 
ATOM   2058  C  CD  . GLU A  1 282 ? 46.244 71.376  62.480  1.00 96.71  ? 282 GLU A CD  1 
ATOM   2059  O  OE1 . GLU A  1 282 ? 46.455 72.455  61.877  1.00 89.66  ? 282 GLU A OE1 1 
ATOM   2060  O  OE2 . GLU A  1 282 ? 45.122 70.820  62.517  1.00 91.61  ? 282 GLU A OE2 1 
ATOM   2061  N  N   . GLU A  1 283 ? 51.059 69.181  61.472  1.00 57.40  ? 283 GLU A N   1 
ATOM   2062  C  CA  . GLU A  1 283 ? 52.126 68.971  60.495  1.00 57.23  ? 283 GLU A CA  1 
ATOM   2063  C  C   . GLU A  1 283 ? 52.302 70.215  59.581  1.00 60.21  ? 283 GLU A C   1 
ATOM   2064  O  O   . GLU A  1 283 ? 51.326 70.952  59.381  1.00 59.72  ? 283 GLU A O   1 
ATOM   2065  C  CB  . GLU A  1 283 ? 51.843 67.703  59.684  1.00 58.76  ? 283 GLU A CB  1 
ATOM   2066  C  CG  . GLU A  1 283 ? 52.260 66.444  60.426  1.00 70.15  ? 283 GLU A CG  1 
ATOM   2067  C  CD  . GLU A  1 283 ? 51.405 65.220  60.167  1.00 95.14  ? 283 GLU A CD  1 
ATOM   2068  O  OE1 . GLU A  1 283 ? 51.928 64.241  59.588  1.00 93.72  ? 283 GLU A OE1 1 
ATOM   2069  O  OE2 . GLU A  1 283 ? 50.217 65.231  60.563  1.00 90.95  ? 283 GLU A OE2 1 
ATOM   2070  N  N   . PRO A  1 284 ? 53.535 70.505  59.070  1.00 55.65  ? 284 PRO A N   1 
ATOM   2071  C  CA  . PRO A  1 284 ? 53.730 71.729  58.270  1.00 54.25  ? 284 PRO A CA  1 
ATOM   2072  C  C   . PRO A  1 284 ? 53.056 71.730  56.899  1.00 56.49  ? 284 PRO A C   1 
ATOM   2073  O  O   . PRO A  1 284 ? 52.754 70.671  56.345  1.00 56.21  ? 284 PRO A O   1 
ATOM   2074  C  CB  . PRO A  1 284 ? 55.250 71.808  58.110  1.00 56.60  ? 284 PRO A CB  1 
ATOM   2075  C  CG  . PRO A  1 284 ? 55.722 70.421  58.248  1.00 61.97  ? 284 PRO A CG  1 
ATOM   2076  C  CD  . PRO A  1 284 ? 54.812 69.780  59.250  1.00 57.71  ? 284 PRO A CD  1 
ATOM   2077  N  N   . ARG A  1 285 ? 52.849 72.948  56.352  1.00 52.06  ? 285 ARG A N   1 
ATOM   2078  C  CA  . ARG A  1 285 ? 52.262 73.210  55.031  1.00 51.48  ? 285 ARG A CA  1 
ATOM   2079  C  C   . ARG A  1 285 ? 53.192 72.681  53.917  1.00 57.26  ? 285 ARG A C   1 
ATOM   2080  O  O   . ARG A  1 285 ? 54.402 72.621  54.148  1.00 58.12  ? 285 ARG A O   1 
ATOM   2081  C  CB  . ARG A  1 285 ? 51.976 74.718  54.844  1.00 49.48  ? 285 ARG A CB  1 
ATOM   2082  C  CG  . ARG A  1 285 ? 53.151 75.651  55.146  1.00 55.66  ? 285 ARG A CG  1 
ATOM   2083  C  CD  . ARG A  1 285 ? 52.802 77.113  54.950  1.00 59.21  ? 285 ARG A CD  1 
ATOM   2084  N  NE  . ARG A  1 285 ? 53.151 77.574  53.605  1.00 60.19  ? 285 ARG A NE  1 
ATOM   2085  C  CZ  . ARG A  1 285 ? 52.273 78.015  52.710  1.00 69.33  ? 285 ARG A CZ  1 
ATOM   2086  N  NH1 . ARG A  1 285 ? 50.984 78.093  53.017  1.00 57.25  ? 285 ARG A NH1 1 
ATOM   2087  N  NH2 . ARG A  1 285 ? 52.678 78.396  51.507  1.00 50.70  ? 285 ARG A NH2 1 
ATOM   2088  N  N   . PRO A  1 286 ? 52.681 72.289  52.718  1.00 53.93  ? 286 PRO A N   1 
ATOM   2089  C  CA  . PRO A  1 286 ? 53.582 71.755  51.672  1.00 54.15  ? 286 PRO A CA  1 
ATOM   2090  C  C   . PRO A  1 286 ? 54.667 72.734  51.204  1.00 56.74  ? 286 PRO A C   1 
ATOM   2091  O  O   . PRO A  1 286 ? 55.729 72.294  50.763  1.00 57.07  ? 286 PRO A O   1 
ATOM   2092  C  CB  . PRO A  1 286 ? 52.632 71.405  50.521  1.00 55.87  ? 286 PRO A CB  1 
ATOM   2093  C  CG  . PRO A  1 286 ? 51.398 72.185  50.780  1.00 59.92  ? 286 PRO A CG  1 
ATOM   2094  C  CD  . PRO A  1 286 ? 51.275 72.262  52.269  1.00 55.16  ? 286 PRO A CD  1 
ATOM   2095  N  N   . GLY A  1 287 ? 54.408 74.034  51.343  1.00 51.41  ? 287 GLY A N   1 
ATOM   2096  C  CA  . GLY A  1 287 ? 55.342 75.091  50.966  1.00 50.95  ? 287 GLY A CA  1 
ATOM   2097  C  C   . GLY A  1 287 ? 56.500 75.304  51.923  1.00 53.51  ? 287 GLY A C   1 
ATOM   2098  O  O   . GLY A  1 287 ? 57.395 76.102  51.635  1.00 53.09  ? 287 GLY A O   1 
ATOM   2099  N  N   . PHE A  1 288 ? 56.495 74.600  53.067  1.00 49.47  ? 288 PHE A N   1 
ATOM   2100  C  CA  . PHE A  1 288 ? 57.544 74.714  54.071  1.00 49.53  ? 288 PHE A CA  1 
ATOM   2101  C  C   . PHE A  1 288 ? 58.711 73.783  53.750  1.00 54.57  ? 288 PHE A C   1 
ATOM   2102  O  O   . PHE A  1 288 ? 58.537 72.566  53.647  1.00 54.31  ? 288 PHE A O   1 
ATOM   2103  C  CB  . PHE A  1 288 ? 56.996 74.445  55.482  1.00 50.84  ? 288 PHE A CB  1 
ATOM   2104  C  CG  . PHE A  1 288 ? 58.029 74.462  56.586  1.00 52.88  ? 288 PHE A CG  1 
ATOM   2105  C  CD1 . PHE A  1 288 ? 58.620 75.655  56.991  1.00 55.80  ? 288 PHE A CD1 1 
ATOM   2106  C  CD2 . PHE A  1 288 ? 58.399 73.290  57.232  1.00 55.46  ? 288 PHE A CD2 1 
ATOM   2107  C  CE1 . PHE A  1 288 ? 59.556 75.672  58.025  1.00 57.28  ? 288 PHE A CE1 1 
ATOM   2108  C  CE2 . PHE A  1 288 ? 59.340 73.307  58.262  1.00 58.83  ? 288 PHE A CE2 1 
ATOM   2109  C  CZ  . PHE A  1 288 ? 59.910 74.498  58.654  1.00 56.99  ? 288 PHE A CZ  1 
ATOM   2110  N  N   . HIS A  1 289 ? 59.904 74.380  53.602  1.00 52.30  ? 289 HIS A N   1 
ATOM   2111  C  CA  . HIS A  1 289 ? 61.157 73.690  53.306  1.00 53.33  ? 289 HIS A CA  1 
ATOM   2112  C  C   . HIS A  1 289 ? 62.108 73.757  54.507  1.00 55.56  ? 289 HIS A C   1 
ATOM   2113  O  O   . HIS A  1 289 ? 61.995 74.648  55.350  1.00 54.99  ? 289 HIS A O   1 
ATOM   2114  C  CB  . HIS A  1 289 ? 61.824 74.265  52.035  1.00 55.24  ? 289 HIS A CB  1 
ATOM   2115  C  CG  . HIS A  1 289 ? 62.158 75.724  52.104  1.00 59.21  ? 289 HIS A CG  1 
ATOM   2116  N  ND1 . HIS A  1 289 ? 63.336 76.168  52.676  1.00 62.16  ? 289 HIS A ND1 1 
ATOM   2117  C  CD2 . HIS A  1 289 ? 61.467 76.792  51.643  1.00 60.85  ? 289 HIS A CD2 1 
ATOM   2118  C  CE1 . HIS A  1 289 ? 63.314 77.486  52.565  1.00 61.69  ? 289 HIS A CE1 1 
ATOM   2119  N  NE2 . HIS A  1 289 ? 62.208 77.908  51.951  1.00 61.17  ? 289 HIS A NE2 1 
ATOM   2120  N  N   . GLY A  1 290 ? 63.029 72.805  54.563  1.00 51.57  ? 290 GLY A N   1 
ATOM   2121  C  CA  . GLY A  1 290 ? 64.024 72.691  55.620  1.00 51.64  ? 290 GLY A CA  1 
ATOM   2122  C  C   . GLY A  1 290 ? 64.716 71.346  55.614  1.00 55.10  ? 290 GLY A C   1 
ATOM   2123  O  O   . GLY A  1 290 ? 64.308 70.437  54.881  1.00 54.64  ? 290 GLY A O   1 
ATOM   2124  N  N   . VAL A  1 291 ? 65.773 71.215  56.431  1.00 51.65  ? 291 VAL A N   1 
ATOM   2125  C  CA  . VAL A  1 291 ? 66.545 69.977  56.555  1.00 52.29  ? 291 VAL A CA  1 
ATOM   2126  C  C   . VAL A  1 291 ? 65.695 68.957  57.319  1.00 56.05  ? 291 VAL A C   1 
ATOM   2127  O  O   . VAL A  1 291 ? 65.195 69.275  58.402  1.00 54.99  ? 291 VAL A O   1 
ATOM   2128  C  CB  . VAL A  1 291 ? 67.929 70.205  57.224  1.00 57.22  ? 291 VAL A CB  1 
ATOM   2129  C  CG1 . VAL A  1 291 ? 68.749 68.916  57.255  1.00 58.23  ? 291 VAL A CG1 1 
ATOM   2130  C  CG2 . VAL A  1 291 ? 68.707 71.311  56.519  1.00 57.41  ? 291 VAL A CG2 1 
ATOM   2131  N  N   . LEU A  1 292 ? 65.506 67.750  56.737  1.00 53.19  ? 292 LEU A N   1 
ATOM   2132  C  CA  . LEU A  1 292 ? 64.719 66.681  57.355  1.00 52.70  ? 292 LEU A CA  1 
ATOM   2133  C  C   . LEU A  1 292 ? 65.377 66.234  58.661  1.00 58.91  ? 292 LEU A C   1 
ATOM   2134  O  O   . LEU A  1 292 ? 66.564 65.900  58.683  1.00 59.82  ? 292 LEU A O   1 
ATOM   2135  C  CB  . LEU A  1 292 ? 64.526 65.488  56.396  1.00 52.55  ? 292 LEU A CB  1 
ATOM   2136  C  CG  . LEU A  1 292 ? 63.714 64.291  56.923  1.00 56.41  ? 292 LEU A CG  1 
ATOM   2137  C  CD1 . LEU A  1 292 ? 62.225 64.605  56.991  1.00 55.09  ? 292 LEU A CD1 1 
ATOM   2138  C  CD2 . LEU A  1 292 ? 63.942 63.068  56.074  1.00 58.60  ? 292 LEU A CD2 1 
ATOM   2139  N  N   . GLY A  1 293 ? 64.595 66.281  59.732  1.00 55.75  ? 293 GLY A N   1 
ATOM   2140  C  CA  . GLY A  1 293 ? 65.025 65.897  61.069  1.00 56.97  ? 293 GLY A CA  1 
ATOM   2141  C  C   . GLY A  1 293 ? 63.863 65.563  61.979  1.00 61.26  ? 293 GLY A C   1 
ATOM   2142  O  O   . GLY A  1 293 ? 62.710 65.537  61.538  1.00 59.50  ? 293 GLY A O   1 
ATOM   2143  N  N   . ILE A  1 294 ? 64.164 65.302  63.259  1.00 59.57  ? 294 ILE A N   1 
ATOM   2144  C  CA  . ILE A  1 294 ? 63.147 64.959  64.250  1.00 59.34  ? 294 ILE A CA  1 
ATOM   2145  C  C   . ILE A  1 294 ? 62.726 66.222  64.996  1.00 63.22  ? 294 ILE A C   1 
ATOM   2146  O  O   . ILE A  1 294 ? 63.573 66.946  65.527  1.00 63.42  ? 294 ILE A O   1 
ATOM   2147  C  CB  . ILE A  1 294 ? 63.629 63.831  65.216  1.00 63.83  ? 294 ILE A CB  1 
ATOM   2148  C  CG1 . ILE A  1 294 ? 63.984 62.516  64.456  1.00 64.89  ? 294 ILE A CG1 1 
ATOM   2149  C  CG2 . ILE A  1 294 ? 62.640 63.576  66.375  1.00 64.58  ? 294 ILE A CG2 1 
ATOM   2150  C  CD1 . ILE A  1 294 ? 62.825 61.770  63.673  1.00 70.79  ? 294 ILE A CD1 1 
ATOM   2151  N  N   . ASN A  1 295 ? 61.407 66.474  65.022  1.00 59.05  ? 295 ASN A N   1 
ATOM   2152  C  CA  . ASN A  1 295 ? 60.795 67.593  65.729  1.00 58.32  ? 295 ASN A CA  1 
ATOM   2153  C  C   . ASN A  1 295 ? 61.021 67.403  67.235  1.00 64.63  ? 295 ASN A C   1 
ATOM   2154  O  O   . ASN A  1 295 ? 60.910 66.283  67.737  1.00 64.68  ? 295 ASN A O   1 
ATOM   2155  C  CB  . ASN A  1 295 ? 59.306 67.673  65.393  1.00 55.32  ? 295 ASN A CB  1 
ATOM   2156  C  CG  . ASN A  1 295 ? 58.658 68.986  65.746  1.00 69.05  ? 295 ASN A CG  1 
ATOM   2157  O  OD1 . ASN A  1 295 ? 58.530 69.361  66.916  1.00 60.81  ? 295 ASN A OD1 1 
ATOM   2158  N  ND2 . ASN A  1 295 ? 58.186 69.694  64.737  1.00 59.86  ? 295 ASN A ND2 1 
ATOM   2159  N  N   . SER A  1 296 ? 61.394 68.483  67.937  1.00 62.41  ? 296 SER A N   1 
ATOM   2160  C  CA  . SER A  1 296 ? 61.675 68.453  69.373  1.00 63.49  ? 296 SER A CA  1 
ATOM   2161  C  C   . SER A  1 296 ? 60.402 68.277  70.208  1.00 66.49  ? 296 SER A C   1 
ATOM   2162  O  O   . SER A  1 296 ? 60.456 67.657  71.271  1.00 67.57  ? 296 SER A O   1 
ATOM   2163  C  CB  . SER A  1 296 ? 62.389 69.733  69.799  1.00 68.01  ? 296 SER A CB  1 
ATOM   2164  O  OG  . SER A  1 296 ? 63.533 69.991  68.999  1.00 79.00  ? 296 SER A OG  1 
ATOM   2165  N  N   . ILE A  1 297 ? 59.267 68.822  69.726  1.00 60.34  ? 297 ILE A N   1 
ATOM   2166  C  CA  . ILE A  1 297 ? 57.979 68.814  70.423  1.00 58.81  ? 297 ILE A CA  1 
ATOM   2167  C  C   . ILE A  1 297 ? 57.158 67.549  70.098  1.00 61.07  ? 297 ILE A C   1 
ATOM   2168  O  O   . ILE A  1 297 ? 56.832 66.802  71.020  1.00 61.53  ? 297 ILE A O   1 
ATOM   2169  C  CB  . ILE A  1 297 ? 57.171 70.112  70.108  1.00 60.44  ? 297 ILE A CB  1 
ATOM   2170  C  CG1 . ILE A  1 297 ? 57.978 71.391  70.397  1.00 60.94  ? 297 ILE A CG1 1 
ATOM   2171  C  CG2 . ILE A  1 297 ? 55.838 70.145  70.837  1.00 60.50  ? 297 ILE A CG2 1 
ATOM   2172  C  CD1 . ILE A  1 297 ? 58.360 72.130  69.164  1.00 67.05  ? 297 ILE A CD1 1 
ATOM   2173  N  N   . THR A  1 298 ? 56.796 67.339  68.812  1.00 55.65  ? 298 THR A N   1 
ATOM   2174  C  CA  . THR A  1 298 ? 55.945 66.228  68.358  1.00 54.71  ? 298 THR A CA  1 
ATOM   2175  C  C   . THR A  1 298 ? 56.712 64.914  68.108  1.00 58.33  ? 298 THR A C   1 
ATOM   2176  O  O   . THR A  1 298 ? 56.109 63.841  68.181  1.00 58.01  ? 298 THR A O   1 
ATOM   2177  C  CB  . THR A  1 298 ? 55.161 66.624  67.093  1.00 61.12  ? 298 THR A CB  1 
ATOM   2178  O  OG1 . THR A  1 298 ? 56.062 67.067  66.078  1.00 61.56  ? 298 THR A OG1 1 
ATOM   2179  C  CG2 . THR A  1 298 ? 54.106 67.690  67.364  1.00 56.86  ? 298 THR A CG2 1 
ATOM   2180  N  N   . GLY A  1 299 ? 58.005 65.007  67.806  1.00 54.92  ? 299 GLY A N   1 
ATOM   2181  C  CA  . GLY A  1 299 ? 58.847 63.842  67.542  1.00 55.65  ? 299 GLY A CA  1 
ATOM   2182  C  C   . GLY A  1 299 ? 58.702 63.262  66.149  1.00 58.22  ? 299 GLY A C   1 
ATOM   2183  O  O   . GLY A  1 299 ? 59.217 62.173  65.877  1.00 58.19  ? 299 GLY A O   1 
ATOM   2184  N  N   . LYS A  1 300 ? 58.009 63.994  65.253  1.00 53.24  ? 300 LYS A N   1 
ATOM   2185  C  CA  . LYS A  1 300 ? 57.759 63.592  63.866  1.00 52.48  ? 300 LYS A CA  1 
ATOM   2186  C  C   . LYS A  1 300 ? 58.955 63.917  62.967  1.00 55.68  ? 300 LYS A C   1 
ATOM   2187  O  O   . LYS A  1 300 ? 59.602 64.952  63.155  1.00 55.06  ? 300 LYS A O   1 
ATOM   2188  C  CB  . LYS A  1 300 ? 56.496 64.290  63.307  1.00 53.96  ? 300 LYS A CB  1 
ATOM   2189  C  CG  . LYS A  1 300 ? 55.225 64.147  64.150  1.00 71.25  ? 300 LYS A CG  1 
ATOM   2190  C  CD  . LYS A  1 300 ? 54.416 62.896  63.812  1.00 83.96  ? 300 LYS A CD  1 
ATOM   2191  C  CE  . LYS A  1 300 ? 53.120 62.818  64.590  1.00 98.65  ? 300 LYS A CE  1 
ATOM   2192  N  NZ  . LYS A  1 300 ? 53.335 62.535  66.040  1.00 109.96 ? 300 LYS A NZ  1 
ATOM   2193  N  N   . GLU A  1 301 ? 59.234 63.043  61.978  1.00 51.81  ? 301 GLU A N   1 
ATOM   2194  C  CA  . GLU A  1 301 ? 60.308 63.259  61.011  1.00 51.55  ? 301 GLU A CA  1 
ATOM   2195  C  C   . GLU A  1 301 ? 59.771 64.184  59.923  1.00 53.66  ? 301 GLU A C   1 
ATOM   2196  O  O   . GLU A  1 301 ? 59.031 63.750  59.037  1.00 53.07  ? 301 GLU A O   1 
ATOM   2197  C  CB  . GLU A  1 301 ? 60.839 61.935  60.442  1.00 53.98  ? 301 GLU A CB  1 
ATOM   2198  C  CG  . GLU A  1 301 ? 62.224 62.071  59.835  1.00 66.66  ? 301 GLU A CG  1 
ATOM   2199  C  CD  . GLU A  1 301 ? 62.804 60.791  59.273  1.00 96.89  ? 301 GLU A CD  1 
ATOM   2200  O  OE1 . GLU A  1 301 ? 62.269 60.290  58.258  1.00 97.61  ? 301 GLU A OE1 1 
ATOM   2201  O  OE2 . GLU A  1 301 ? 63.810 60.302  59.835  1.00 97.27  ? 301 GLU A OE2 1 
ATOM   2202  N  N   . GLU A  1 302 ? 60.102 65.476  60.037  1.00 49.36  ? 302 GLU A N   1 
ATOM   2203  C  CA  . GLU A  1 302 ? 59.629 66.535  59.143  1.00 47.72  ? 302 GLU A CA  1 
ATOM   2204  C  C   . GLU A  1 302 ? 60.737 67.584  58.878  1.00 50.79  ? 302 GLU A C   1 
ATOM   2205  O  O   . GLU A  1 302 ? 61.740 67.580  59.600  1.00 50.97  ? 302 GLU A O   1 
ATOM   2206  C  CB  . GLU A  1 302 ? 58.373 67.205  59.758  1.00 48.07  ? 302 GLU A CB  1 
ATOM   2207  C  CG  . GLU A  1 302 ? 58.585 67.844  61.125  1.00 59.07  ? 302 GLU A CG  1 
ATOM   2208  C  CD  . GLU A  1 302 ? 57.391 68.593  61.682  1.00 78.12  ? 302 GLU A CD  1 
ATOM   2209  O  OE1 . GLU A  1 302 ? 56.309 67.976  61.821  1.00 78.14  ? 302 GLU A OE1 1 
ATOM   2210  O  OE2 . GLU A  1 302 ? 57.548 69.792  62.010  1.00 64.69  ? 302 GLU A OE2 1 
ATOM   2211  N  N   . PRO A  1 303 ? 60.585 68.501  57.882  1.00 46.32  ? 303 PRO A N   1 
ATOM   2212  C  CA  . PRO A  1 303 ? 61.634 69.517  57.664  1.00 46.36  ? 303 PRO A CA  1 
ATOM   2213  C  C   . PRO A  1 303 ? 61.800 70.452  58.864  1.00 49.49  ? 303 PRO A C   1 
ATOM   2214  O  O   . PRO A  1 303 ? 60.830 70.750  59.565  1.00 48.08  ? 303 PRO A O   1 
ATOM   2215  C  CB  . PRO A  1 303 ? 61.141 70.286  56.433  1.00 47.29  ? 303 PRO A CB  1 
ATOM   2216  C  CG  . PRO A  1 303 ? 60.124 69.405  55.794  1.00 51.19  ? 303 PRO A CG  1 
ATOM   2217  C  CD  . PRO A  1 303 ? 59.480 68.670  56.915  1.00 46.69  ? 303 PRO A CD  1 
ATOM   2218  N  N   . LEU A  1 304 ? 63.041 70.888  59.111  1.00 46.66  ? 304 LEU A N   1 
ATOM   2219  C  CA  . LEU A  1 304 ? 63.379 71.794  60.209  1.00 46.30  ? 304 LEU A CA  1 
ATOM   2220  C  C   . LEU A  1 304 ? 64.021 73.066  59.658  1.00 49.71  ? 304 LEU A C   1 
ATOM   2221  O  O   . LEU A  1 304 ? 64.969 72.987  58.872  1.00 49.98  ? 304 LEU A O   1 
ATOM   2222  C  CB  . LEU A  1 304 ? 64.318 71.117  61.232  1.00 47.46  ? 304 LEU A CB  1 
ATOM   2223  C  CG  . LEU A  1 304 ? 63.942 69.731  61.780  1.00 52.17  ? 304 LEU A CG  1 
ATOM   2224  C  CD1 . LEU A  1 304 ? 65.036 69.203  62.681  1.00 53.52  ? 304 LEU A CD1 1 
ATOM   2225  C  CD2 . LEU A  1 304 ? 62.623 69.761  62.543  1.00 54.16  ? 304 LEU A CD2 1 
ATOM   2226  N  N   . TYR A  1 305 ? 63.494 74.232  60.053  1.00 45.08  ? 305 TYR A N   1 
ATOM   2227  C  CA  . TYR A  1 305 ? 64.013 75.522  59.603  1.00 44.86  ? 305 TYR A CA  1 
ATOM   2228  C  C   . TYR A  1 305 ? 64.220 76.468  60.794  1.00 48.94  ? 305 TYR A C   1 
ATOM   2229  O  O   . TYR A  1 305 ? 63.317 76.600  61.632  1.00 47.69  ? 305 TYR A O   1 
ATOM   2230  C  CB  . TYR A  1 305 ? 63.090 76.153  58.548  1.00 44.70  ? 305 TYR A CB  1 
ATOM   2231  C  CG  . TYR A  1 305 ? 63.725 77.283  57.768  1.00 46.16  ? 305 TYR A CG  1 
ATOM   2232  C  CD1 . TYR A  1 305 ? 64.671 77.029  56.780  1.00 48.82  ? 305 TYR A CD1 1 
ATOM   2233  C  CD2 . TYR A  1 305 ? 63.353 78.606  57.992  1.00 46.26  ? 305 TYR A CD2 1 
ATOM   2234  C  CE1 . TYR A  1 305 ? 65.259 78.066  56.058  1.00 49.97  ? 305 TYR A CE1 1 
ATOM   2235  C  CE2 . TYR A  1 305 ? 63.927 79.651  57.269  1.00 47.46  ? 305 TYR A CE2 1 
ATOM   2236  C  CZ  . TYR A  1 305 ? 64.884 79.376  56.306  1.00 55.58  ? 305 TYR A CZ  1 
ATOM   2237  O  OH  . TYR A  1 305 ? 65.461 80.396  55.590  1.00 57.29  ? 305 TYR A OH  1 
ATOM   2238  N  N   . PRO A  1 306 ? 65.411 77.116  60.897  1.00 46.49  ? 306 PRO A N   1 
ATOM   2239  C  CA  . PRO A  1 306 ? 65.664 78.018  62.034  1.00 46.69  ? 306 PRO A CA  1 
ATOM   2240  C  C   . PRO A  1 306 ? 64.814 79.280  61.969  1.00 50.50  ? 306 PRO A C   1 
ATOM   2241  O  O   . PRO A  1 306 ? 64.775 79.948  60.931  1.00 49.90  ? 306 PRO A O   1 
ATOM   2242  C  CB  . PRO A  1 306 ? 67.157 78.348  61.914  1.00 49.68  ? 306 PRO A CB  1 
ATOM   2243  C  CG  . PRO A  1 306 ? 67.706 77.435  60.878  1.00 54.56  ? 306 PRO A CG  1 
ATOM   2244  C  CD  . PRO A  1 306 ? 66.576 77.061  59.992  1.00 48.84  ? 306 PRO A CD  1 
ATOM   2245  N  N   . SER A  1 307 ? 64.127 79.596  63.087  1.00 46.91  ? 307 SER A N   1 
ATOM   2246  C  CA  . SER A  1 307 ? 63.243 80.756  63.228  1.00 45.72  ? 307 SER A CA  1 
ATOM   2247  C  C   . SER A  1 307 ? 63.955 82.082  62.931  1.00 50.32  ? 307 SER A C   1 
ATOM   2248  O  O   . SER A  1 307 ? 63.343 82.954  62.316  1.00 49.47  ? 307 SER A O   1 
ATOM   2249  C  CB  . SER A  1 307 ? 62.636 80.801  64.626  1.00 48.78  ? 307 SER A CB  1 
ATOM   2250  N  N   . TYR A  1 308 ? 65.245 82.218  63.325  1.00 48.23  ? 308 TYR A N   1 
ATOM   2251  C  CA  . TYR A  1 308 ? 66.037 83.433  63.111  1.00 49.02  ? 308 TYR A CA  1 
ATOM   2252  C  C   . TYR A  1 308 ? 66.141 83.801  61.614  1.00 52.48  ? 308 TYR A C   1 
ATOM   2253  O  O   . TYR A  1 308 ? 66.076 84.987  61.291  1.00 51.94  ? 308 TYR A O   1 
ATOM   2254  C  CB  . TYR A  1 308 ? 67.432 83.333  63.767  1.00 52.21  ? 308 TYR A CB  1 
ATOM   2255  C  CG  . TYR A  1 308 ? 68.509 82.643  62.956  1.00 55.62  ? 308 TYR A CG  1 
ATOM   2256  C  CD1 . TYR A  1 308 ? 69.275 83.351  62.032  1.00 58.50  ? 308 TYR A CD1 1 
ATOM   2257  C  CD2 . TYR A  1 308 ? 68.824 81.306  63.173  1.00 57.10  ? 308 TYR A CD2 1 
ATOM   2258  C  CE1 . TYR A  1 308 ? 70.270 82.725  61.284  1.00 60.95  ? 308 TYR A CE1 1 
ATOM   2259  C  CE2 . TYR A  1 308 ? 69.834 80.673  62.447  1.00 59.34  ? 308 TYR A CE2 1 
ATOM   2260  C  CZ  . TYR A  1 308 ? 70.552 81.387  61.500  1.00 68.57  ? 308 TYR A CZ  1 
ATOM   2261  O  OH  . TYR A  1 308 ? 71.551 80.776  60.777  1.00 71.65  ? 308 TYR A OH  1 
ATOM   2262  N  N   . LYS A  1 309 ? 66.280 82.797  60.715  1.00 48.83  ? 309 LYS A N   1 
ATOM   2263  C  CA  . LYS A  1 309 ? 66.368 83.004  59.261  1.00 48.17  ? 309 LYS A CA  1 
ATOM   2264  C  C   . LYS A  1 309 ? 65.059 83.609  58.727  1.00 49.60  ? 309 LYS A C   1 
ATOM   2265  O  O   . LYS A  1 309 ? 65.101 84.522  57.904  1.00 48.98  ? 309 LYS A O   1 
ATOM   2266  C  CB  . LYS A  1 309 ? 66.694 81.688  58.529  1.00 50.68  ? 309 LYS A CB  1 
ATOM   2267  C  CG  . LYS A  1 309 ? 68.138 81.224  58.669  1.00 64.09  ? 309 LYS A CG  1 
ATOM   2268  C  CD  . LYS A  1 309 ? 68.354 79.884  57.975  1.00 72.69  ? 309 LYS A CD  1 
ATOM   2269  C  CE  . LYS A  1 309 ? 69.732 79.320  58.221  1.00 80.36  ? 309 LYS A CE  1 
ATOM   2270  N  NZ  . LYS A  1 309 ? 69.866 77.934  57.700  1.00 82.85  ? 309 LYS A NZ  1 
ATOM   2271  N  N   . ARG A  1 310 ? 63.908 83.115  59.232  1.00 44.16  ? 310 ARG A N   1 
ATOM   2272  C  CA  . ARG A  1 310 ? 62.562 83.578  58.892  1.00 42.16  ? 310 ARG A CA  1 
ATOM   2273  C  C   . ARG A  1 310 ? 62.356 85.013  59.410  1.00 45.53  ? 310 ARG A C   1 
ATOM   2274  O  O   . ARG A  1 310 ? 61.826 85.846  58.676  1.00 44.64  ? 310 ARG A O   1 
ATOM   2275  C  CB  . ARG A  1 310 ? 61.515 82.601  59.474  1.00 40.29  ? 310 ARG A CB  1 
ATOM   2276  C  CG  . ARG A  1 310 ? 60.055 83.064  59.443  1.00 44.23  ? 310 ARG A CG  1 
ATOM   2277  C  CD  . ARG A  1 310 ? 59.062 81.912  59.483  1.00 51.81  ? 310 ARG A CD  1 
ATOM   2278  N  NE  . ARG A  1 310 ? 59.143 81.105  60.706  1.00 59.66  ? 310 ARG A NE  1 
ATOM   2279  C  CZ  . ARG A  1 310 ? 59.686 79.891  60.779  1.00 72.71  ? 310 ARG A CZ  1 
ATOM   2280  N  NH1 . ARG A  1 310 ? 60.220 79.328  59.703  1.00 58.81  ? 310 ARG A NH1 1 
ATOM   2281  N  NH2 . ARG A  1 310 ? 59.712 79.238  61.932  1.00 61.56  ? 310 ARG A NH2 1 
ATOM   2282  N  N   . GLN A  1 311 ? 62.806 85.299  60.653  1.00 42.36  ? 311 GLN A N   1 
ATOM   2283  C  CA  . GLN A  1 311 ? 62.683 86.610  61.302  1.00 42.27  ? 311 GLN A CA  1 
ATOM   2284  C  C   . GLN A  1 311 ? 63.484 87.694  60.569  1.00 47.42  ? 311 GLN A C   1 
ATOM   2285  O  O   . GLN A  1 311 ? 62.979 88.808  60.410  1.00 47.21  ? 311 GLN A O   1 
ATOM   2286  C  CB  . GLN A  1 311 ? 63.114 86.544  62.779  1.00 44.22  ? 311 GLN A CB  1 
ATOM   2287  C  CG  . GLN A  1 311 ? 62.160 85.770  63.697  1.00 57.84  ? 311 GLN A CG  1 
ATOM   2288  C  CD  . GLN A  1 311 ? 60.745 86.301  63.682  1.00 78.93  ? 311 GLN A CD  1 
ATOM   2289  O  OE1 . GLN A  1 311 ? 60.465 87.422  64.123  1.00 74.80  ? 311 GLN A OE1 1 
ATOM   2290  N  NE2 . GLN A  1 311 ? 59.822 85.499  63.171  1.00 71.96  ? 311 GLN A NE2 1 
ATOM   2291  N  N   . LEU A  1 312 ? 64.713 87.369  60.112  1.00 44.71  ? 312 LEU A N   1 
ATOM   2292  C  CA  . LEU A  1 312 ? 65.565 88.306  59.370  1.00 45.22  ? 312 LEU A CA  1 
ATOM   2293  C  C   . LEU A  1 312 ? 64.904 88.691  58.038  1.00 48.90  ? 312 LEU A C   1 
ATOM   2294  O  O   . LEU A  1 312 ? 64.881 89.872  57.694  1.00 49.01  ? 312 LEU A O   1 
ATOM   2295  C  CB  . LEU A  1 312 ? 66.972 87.723  59.129  1.00 46.43  ? 312 LEU A CB  1 
ATOM   2296  C  CG  . LEU A  1 312 ? 67.882 87.583  60.354  1.00 51.74  ? 312 LEU A CG  1 
ATOM   2297  C  CD1 . LEU A  1 312 ? 68.909 86.502  60.136  1.00 52.86  ? 312 LEU A CD1 1 
ATOM   2298  C  CD2 . LEU A  1 312 ? 68.567 88.892  60.699  1.00 53.95  ? 312 LEU A CD2 1 
ATOM   2299  N  N   . ARG A  1 313 ? 64.310 87.701  57.328  1.00 44.34  ? 313 ARG A N   1 
ATOM   2300  C  CA  . ARG A  1 313 ? 63.595 87.900  56.061  1.00 43.08  ? 313 ARG A CA  1 
ATOM   2301  C  C   . ARG A  1 313 ? 62.354 88.795  56.262  1.00 46.35  ? 313 ARG A C   1 
ATOM   2302  O  O   . ARG A  1 313 ? 62.016 89.580  55.372  1.00 45.93  ? 313 ARG A O   1 
ATOM   2303  C  CB  . ARG A  1 313 ? 63.189 86.550  55.448  1.00 40.78  ? 313 ARG A CB  1 
ATOM   2304  C  CG  . ARG A  1 313 ? 64.364 85.728  54.929  1.00 48.93  ? 313 ARG A CG  1 
ATOM   2305  C  CD  . ARG A  1 313 ? 63.932 84.362  54.425  1.00 55.28  ? 313 ARG A CD  1 
ATOM   2306  N  NE  . ARG A  1 313 ? 65.003 83.689  53.685  1.00 61.22  ? 313 ARG A NE  1 
ATOM   2307  C  CZ  . ARG A  1 313 ? 64.917 82.462  53.178  1.00 76.54  ? 313 ARG A CZ  1 
ATOM   2308  N  NH1 . ARG A  1 313 ? 63.810 81.745  53.336  1.00 63.19  ? 313 ARG A NH1 1 
ATOM   2309  N  NH2 . ARG A  1 313 ? 65.941 81.937  52.518  1.00 66.13  ? 313 ARG A NH2 1 
ATOM   2310  N  N   . ILE A  1 314 ? 61.711 88.696  57.446  1.00 42.22  ? 314 ILE A N   1 
ATOM   2311  C  CA  . ILE A  1 314 ? 60.521 89.468  57.816  1.00 41.12  ? 314 ILE A CA  1 
ATOM   2312  C  C   . ILE A  1 314 ? 60.882 90.946  58.062  1.00 44.79  ? 314 ILE A C   1 
ATOM   2313  O  O   . ILE A  1 314 ? 60.311 91.817  57.408  1.00 44.41  ? 314 ILE A O   1 
ATOM   2314  C  CB  . ILE A  1 314 ? 59.790 88.828  59.050  1.00 43.53  ? 314 ILE A CB  1 
ATOM   2315  C  CG1 . ILE A  1 314 ? 59.020 87.558  58.637  1.00 43.34  ? 314 ILE A CG1 1 
ATOM   2316  C  CG2 . ILE A  1 314 ? 58.844 89.821  59.755  1.00 42.86  ? 314 ILE A CG2 1 
ATOM   2317  C  CD1 . ILE A  1 314 ? 58.670 86.604  59.784  1.00 51.93  ? 314 ILE A CD1 1 
ATOM   2318  N  N   . TYR A  1 315 ? 61.813 91.219  58.993  1.00 41.87  ? 315 TYR A N   1 
ATOM   2319  C  CA  . TYR A  1 315 ? 62.164 92.574  59.418  1.00 42.51  ? 315 TYR A CA  1 
ATOM   2320  C  C   . TYR A  1 315 ? 63.185 93.304  58.535  1.00 47.59  ? 315 TYR A C   1 
ATOM   2321  O  O   . TYR A  1 315 ? 63.188 94.533  58.551  1.00 47.42  ? 315 TYR A O   1 
ATOM   2322  C  CB  . TYR A  1 315 ? 62.674 92.556  60.868  1.00 44.39  ? 315 TYR A CB  1 
ATOM   2323  C  CG  . TYR A  1 315 ? 61.593 92.221  61.873  1.00 45.32  ? 315 TYR A CG  1 
ATOM   2324  C  CD1 . TYR A  1 315 ? 60.762 93.212  62.391  1.00 46.90  ? 315 TYR A CD1 1 
ATOM   2325  C  CD2 . TYR A  1 315 ? 61.389 90.911  62.297  1.00 45.85  ? 315 TYR A CD2 1 
ATOM   2326  C  CE1 . TYR A  1 315 ? 59.750 92.905  63.302  1.00 47.02  ? 315 TYR A CE1 1 
ATOM   2327  C  CE2 . TYR A  1 315 ? 60.381 90.593  63.206  1.00 46.18  ? 315 TYR A CE2 1 
ATOM   2328  C  CZ  . TYR A  1 315 ? 59.566 91.594  63.709  1.00 53.26  ? 315 TYR A CZ  1 
ATOM   2329  O  OH  . TYR A  1 315 ? 58.571 91.279  64.600  1.00 54.10  ? 315 TYR A OH  1 
ATOM   2330  N  N   . LEU A  1 316 ? 64.037 92.590  57.781  1.00 45.57  ? 316 LEU A N   1 
ATOM   2331  C  CA  . LEU A  1 316 ? 65.055 93.255  56.957  1.00 46.88  ? 316 LEU A CA  1 
ATOM   2332  C  C   . LEU A  1 316 ? 64.698 93.344  55.468  1.00 50.84  ? 316 LEU A C   1 
ATOM   2333  O  O   . LEU A  1 316 ? 65.218 94.232  54.791  1.00 50.80  ? 316 LEU A O   1 
ATOM   2334  C  CB  . LEU A  1 316 ? 66.420 92.566  57.104  1.00 48.16  ? 316 LEU A CB  1 
ATOM   2335  C  CG  . LEU A  1 316 ? 67.260 92.982  58.304  1.00 54.03  ? 316 LEU A CG  1 
ATOM   2336  C  CD1 . LEU A  1 316 ? 66.932 92.146  59.527  1.00 53.92  ? 316 LEU A CD1 1 
ATOM   2337  C  CD2 . LEU A  1 316 ? 68.730 92.842  57.996  1.00 58.54  ? 316 LEU A CD2 1 
ATOM   2338  N  N   . VAL A  1 317 ? 63.847 92.438  54.949  1.00 47.12  ? 317 VAL A N   1 
ATOM   2339  C  CA  . VAL A  1 317 ? 63.506 92.448  53.521  1.00 47.02  ? 317 VAL A CA  1 
ATOM   2340  C  C   . VAL A  1 317 ? 62.026 92.793  53.300  1.00 50.60  ? 317 VAL A C   1 
ATOM   2341  O  O   . VAL A  1 317 ? 61.727 93.735  52.561  1.00 50.31  ? 317 VAL A O   1 
ATOM   2342  C  CB  . VAL A  1 317 ? 63.883 91.117  52.810  1.00 50.61  ? 317 VAL A CB  1 
ATOM   2343  C  CG1 . VAL A  1 317 ? 63.583 91.185  51.315  1.00 50.30  ? 317 VAL A CG1 1 
ATOM   2344  C  CG2 . VAL A  1 317 ? 65.349 90.758  53.041  1.00 51.65  ? 317 VAL A CG2 1 
ATOM   2345  N  N   . SER A  1 318 ? 61.115 92.029  53.922  1.00 46.70  ? 318 SER A N   1 
ATOM   2346  C  CA  . SER A  1 318 ? 59.673 92.189  53.760  1.00 45.73  ? 318 SER A CA  1 
ATOM   2347  C  C   . SER A  1 318 ? 59.130 93.499  54.343  1.00 49.38  ? 318 SER A C   1 
ATOM   2348  O  O   . SER A  1 318 ? 58.437 94.220  53.626  1.00 49.09  ? 318 SER A O   1 
ATOM   2349  C  CB  . SER A  1 318 ? 58.942 91.005  54.373  1.00 48.64  ? 318 SER A CB  1 
ATOM   2350  O  OG  . SER A  1 318 ? 59.122 89.856  53.562  1.00 58.53  ? 318 SER A OG  1 
ATOM   2351  N  N   . LEU A  1 319 ? 59.437 93.803  55.621  1.00 45.51  ? 319 LEU A N   1 
ATOM   2352  C  CA  . LEU A  1 319 ? 58.975 95.017  56.297  1.00 45.32  ? 319 LEU A CA  1 
ATOM   2353  C  C   . LEU A  1 319 ? 59.411 96.300  55.541  1.00 49.87  ? 319 LEU A C   1 
ATOM   2354  O  O   . LEU A  1 319 ? 58.522 97.118  55.279  1.00 49.17  ? 319 LEU A O   1 
ATOM   2355  C  CB  . LEU A  1 319 ? 59.440 95.056  57.761  1.00 45.76  ? 319 LEU A CB  1 
ATOM   2356  C  CG  . LEU A  1 319 ? 58.805 96.131  58.633  1.00 50.69  ? 319 LEU A CG  1 
ATOM   2357  C  CD1 . LEU A  1 319 ? 57.588 95.592  59.374  1.00 50.12  ? 319 LEU A CD1 1 
ATOM   2358  C  CD2 . LEU A  1 319 ? 59.811 96.682  59.608  1.00 54.64  ? 319 LEU A CD2 1 
ATOM   2359  N  N   . PRO A  1 320 ? 60.698 96.499  55.122  1.00 47.04  ? 320 PRO A N   1 
ATOM   2360  C  CA  . PRO A  1 320 ? 61.038 97.731  54.382  1.00 47.54  ? 320 PRO A CA  1 
ATOM   2361  C  C   . PRO A  1 320 ? 60.331 97.828  53.027  1.00 51.73  ? 320 PRO A C   1 
ATOM   2362  O  O   . PRO A  1 320 ? 59.998 98.937  52.609  1.00 51.57  ? 320 PRO A O   1 
ATOM   2363  C  CB  . PRO A  1 320 ? 62.557 97.634  54.206  1.00 50.48  ? 320 PRO A CB  1 
ATOM   2364  C  CG  . PRO A  1 320 ? 63.007 96.670  55.241  1.00 54.70  ? 320 PRO A CG  1 
ATOM   2365  C  CD  . PRO A  1 320 ? 61.906 95.671  55.322  1.00 49.00  ? 320 PRO A CD  1 
ATOM   2366  N  N   . PHE A  1 321 ? 60.073 96.677  52.362  1.00 48.43  ? 321 PHE A N   1 
ATOM   2367  C  CA  . PHE A  1 321 ? 59.375 96.626  51.075  1.00 48.40  ? 321 PHE A CA  1 
ATOM   2368  C  C   . PHE A  1 321 ? 57.923 97.112  51.215  1.00 50.99  ? 321 PHE A C   1 
ATOM   2369  O  O   . PHE A  1 321 ? 57.463 97.890  50.376  1.00 50.71  ? 321 PHE A O   1 
ATOM   2370  C  CB  . PHE A  1 321 ? 59.409 95.210  50.479  1.00 50.28  ? 321 PHE A CB  1 
ATOM   2371  C  CG  . PHE A  1 321 ? 58.633 95.067  49.186  1.00 52.23  ? 321 PHE A CG  1 
ATOM   2372  C  CD1 . PHE A  1 321 ? 59.192 95.454  47.973  1.00 56.21  ? 321 PHE A CD1 1 
ATOM   2373  C  CD2 . PHE A  1 321 ? 57.338 94.553  49.184  1.00 53.81  ? 321 PHE A CD2 1 
ATOM   2374  C  CE1 . PHE A  1 321 ? 58.474 95.326  46.782  1.00 57.12  ? 321 PHE A CE1 1 
ATOM   2375  C  CE2 . PHE A  1 321 ? 56.622 94.421  47.992  1.00 56.60  ? 321 PHE A CE2 1 
ATOM   2376  C  CZ  . PHE A  1 321 ? 57.197 94.807  46.799  1.00 55.57  ? 321 PHE A CZ  1 
ATOM   2377  N  N   . VAL A  1 322 ? 57.209 96.640  52.261  1.00 46.28  ? 322 VAL A N   1 
ATOM   2378  C  CA  . VAL A  1 322 ? 55.819 97.012  52.547  1.00 45.22  ? 322 VAL A CA  1 
ATOM   2379  C  C   . VAL A  1 322 ? 55.758 98.535  52.796  1.00 49.81  ? 322 VAL A C   1 
ATOM   2380  O  O   . VAL A  1 322 ? 54.862 99.200  52.271  1.00 48.95  ? 322 VAL A O   1 
ATOM   2381  C  CB  . VAL A  1 322 ? 55.233 96.176  53.725  1.00 48.22  ? 322 VAL A CB  1 
ATOM   2382  C  CG1 . VAL A  1 322 ? 53.851 96.674  54.150  1.00 47.36  ? 322 VAL A CG1 1 
ATOM   2383  C  CG2 . VAL A  1 322 ? 55.168 94.695  53.366  1.00 47.58  ? 322 VAL A CG2 1 
ATOM   2384  N  N   . CYS A  1 323 ? 56.755 99.082  53.525  1.00 47.58  ? 323 CYS A N   1 
ATOM   2385  C  CA  . CYS A  1 323 ? 56.871 100.509 53.834  1.00 48.27  ? 323 CYS A CA  1 
ATOM   2386  C  C   . CYS A  1 323 ? 57.154 101.333 52.577  1.00 54.01  ? 323 CYS A C   1 
ATOM   2387  O  O   . CYS A  1 323 ? 56.695 102.475 52.495  1.00 54.25  ? 323 CYS A O   1 
ATOM   2388  C  CB  . CYS A  1 323 ? 57.934 100.747 54.899  1.00 49.05  ? 323 CYS A CB  1 
ATOM   2389  S  SG  . CYS A  1 323 ? 57.500 100.086 56.528  1.00 51.94  ? 323 CYS A SG  1 
ATOM   2390  N  N   . LEU A  1 324 ? 57.898 100.766 51.608  1.00 51.39  ? 324 LEU A N   1 
ATOM   2391  C  CA  . LEU A  1 324 ? 58.202 101.449 50.349  1.00 52.70  ? 324 LEU A CA  1 
ATOM   2392  C  C   . LEU A  1 324 ? 56.947 101.554 49.479  1.00 57.21  ? 324 LEU A C   1 
ATOM   2393  O  O   . LEU A  1 324 ? 56.704 102.612 48.894  1.00 57.47  ? 324 LEU A O   1 
ATOM   2394  C  CB  . LEU A  1 324 ? 59.332 100.741 49.581  1.00 53.59  ? 324 LEU A CB  1 
ATOM   2395  C  CG  . LEU A  1 324 ? 60.757 100.981 50.081  1.00 59.56  ? 324 LEU A CG  1 
ATOM   2396  C  CD1 . LEU A  1 324 ? 61.681 99.877  49.625  1.00 60.07  ? 324 LEU A CD1 1 
ATOM   2397  C  CD2 . LEU A  1 324 ? 61.291 102.335 49.632  1.00 63.88  ? 324 LEU A CD2 1 
ATOM   2398  N  N   . CYS A  1 325 ? 56.141 100.468 49.421  1.00 53.53  ? 325 CYS A N   1 
ATOM   2399  C  CA  . CYS A  1 325 ? 54.889 100.397 48.660  1.00 53.20  ? 325 CYS A CA  1 
ATOM   2400  C  C   . CYS A  1 325 ? 53.838 101.312 49.274  1.00 57.50  ? 325 CYS A C   1 
ATOM   2401  O  O   . CYS A  1 325 ? 53.033 101.888 48.543  1.00 57.76  ? 325 CYS A O   1 
ATOM   2402  C  CB  . CYS A  1 325 ? 54.385 98.964  48.576  1.00 52.60  ? 325 CYS A CB  1 
ATOM   2403  S  SG  . CYS A  1 325 ? 55.434 97.868  47.587  1.00 57.08  ? 325 CYS A SG  1 
ATOM   2404  N  N   . LEU A  1 326 ? 53.848 101.440 50.615  1.00 53.64  ? 326 LEU A N   1 
ATOM   2405  C  CA  . LEU A  1 326 ? 52.946 102.305 51.375  1.00 53.04  ? 326 LEU A CA  1 
ATOM   2406  C  C   . LEU A  1 326 ? 53.291 103.776 51.113  1.00 57.82  ? 326 LEU A C   1 
ATOM   2407  O  O   . LEU A  1 326 ? 52.379 104.595 50.987  1.00 57.68  ? 326 LEU A O   1 
ATOM   2408  C  CB  . LEU A  1 326 ? 53.025 101.969 52.876  1.00 52.39  ? 326 LEU A CB  1 
ATOM   2409  C  CG  . LEU A  1 326 ? 51.862 101.163 53.487  1.00 55.77  ? 326 LEU A CG  1 
ATOM   2410  C  CD1 . LEU A  1 326 ? 51.562 99.880  52.711  1.00 55.55  ? 326 LEU A CD1 1 
ATOM   2411  C  CD2 . LEU A  1 326 ? 52.145 100.825 54.930  1.00 57.55  ? 326 LEU A CD2 1 
ATOM   2412  N  N   . TYR A  1 327 ? 54.601 104.098 50.983  1.00 54.92  ? 327 TYR A N   1 
ATOM   2413  C  CA  . TYR A  1 327 ? 55.081 105.447 50.665  1.00 55.79  ? 327 TYR A CA  1 
ATOM   2414  C  C   . TYR A  1 327 ? 54.747 105.789 49.209  1.00 59.21  ? 327 TYR A C   1 
ATOM   2415  O  O   . TYR A  1 327 ? 54.352 106.922 48.924  1.00 59.21  ? 327 TYR A O   1 
ATOM   2416  C  CB  . TYR A  1 327 ? 56.595 105.584 50.924  1.00 58.16  ? 327 TYR A CB  1 
ATOM   2417  C  CG  . TYR A  1 327 ? 57.156 106.943 50.551  1.00 61.70  ? 327 TYR A CG  1 
ATOM   2418  C  CD1 . TYR A  1 327 ? 57.009 108.037 51.400  1.00 64.09  ? 327 TYR A CD1 1 
ATOM   2419  C  CD2 . TYR A  1 327 ? 57.827 107.137 49.347  1.00 63.70  ? 327 TYR A CD2 1 
ATOM   2420  C  CE1 . TYR A  1 327 ? 57.510 109.292 51.057  1.00 66.51  ? 327 TYR A CE1 1 
ATOM   2421  C  CE2 . TYR A  1 327 ? 58.328 108.389 48.991  1.00 66.18  ? 327 TYR A CE2 1 
ATOM   2422  C  CZ  . TYR A  1 327 ? 58.169 109.464 49.850  1.00 74.62  ? 327 TYR A CZ  1 
ATOM   2423  O  OH  . TYR A  1 327 ? 58.667 110.700 49.508  1.00 77.70  ? 327 TYR A OH  1 
ATOM   2424  N  N   . PHE A  1 328 ? 54.911 104.811 48.295  1.00 55.10  ? 328 PHE A N   1 
ATOM   2425  C  CA  . PHE A  1 328 ? 54.614 104.968 46.872  1.00 55.40  ? 328 PHE A CA  1 
ATOM   2426  C  C   . PHE A  1 328 ? 53.114 105.191 46.657  1.00 58.29  ? 328 PHE A C   1 
ATOM   2427  O  O   . PHE A  1 328 ? 52.744 105.957 45.767  1.00 59.24  ? 328 PHE A O   1 
ATOM   2428  C  CB  . PHE A  1 328 ? 55.105 103.752 46.073  1.00 57.27  ? 328 PHE A CB  1 
ATOM   2429  C  CG  . PHE A  1 328 ? 54.825 103.801 44.589  1.00 59.82  ? 328 PHE A CG  1 
ATOM   2430  C  CD1 . PHE A  1 328 ? 55.524 104.672 43.760  1.00 64.68  ? 328 PHE A CD1 1 
ATOM   2431  C  CD2 . PHE A  1 328 ? 53.876 102.962 44.018  1.00 61.40  ? 328 PHE A CD2 1 
ATOM   2432  C  CE1 . PHE A  1 328 ? 55.266 104.712 42.386  1.00 66.48  ? 328 PHE A CE1 1 
ATOM   2433  C  CE2 . PHE A  1 328 ? 53.628 102.994 42.643  1.00 65.18  ? 328 PHE A CE2 1 
ATOM   2434  C  CZ  . PHE A  1 328 ? 54.327 103.866 41.835  1.00 64.86  ? 328 PHE A CZ  1 
ATOM   2435  N  N   . SER A  1 329 ? 52.262 104.548 47.490  1.00 52.56  ? 329 SER A N   1 
ATOM   2436  C  CA  . SER A  1 329 ? 50.802 104.689 47.459  1.00 51.10  ? 329 SER A CA  1 
ATOM   2437  C  C   . SER A  1 329 ? 50.408 106.132 47.739  1.00 54.55  ? 329 SER A C   1 
ATOM   2438  O  O   . SER A  1 329 ? 49.550 106.678 47.042  1.00 53.96  ? 329 SER A O   1 
ATOM   2439  C  CB  . SER A  1 329 ? 50.151 103.760 48.479  1.00 52.39  ? 329 SER A CB  1 
ATOM   2440  O  OG  . SER A  1 329 ? 50.372 102.400 48.149  1.00 59.24  ? 329 SER A OG  1 
ATOM   2441  N  N   . LEU A  1 330 ? 51.070 106.753 48.740  1.00 51.06  ? 330 LEU A N   1 
ATOM   2442  C  CA  . LEU A  1 330 ? 50.864 108.145 49.134  1.00 51.33  ? 330 LEU A CA  1 
ATOM   2443  C  C   . LEU A  1 330 ? 51.401 109.088 48.060  1.00 57.72  ? 330 LEU A C   1 
ATOM   2444  O  O   . LEU A  1 330 ? 50.803 110.136 47.822  1.00 58.28  ? 330 LEU A O   1 
ATOM   2445  C  CB  . LEU A  1 330 ? 51.537 108.437 50.484  1.00 50.88  ? 330 LEU A CB  1 
ATOM   2446  C  CG  . LEU A  1 330 ? 50.925 107.770 51.713  1.00 53.64  ? 330 LEU A CG  1 
ATOM   2447  C  CD1 . LEU A  1 330 ? 51.944 107.638 52.823  1.00 53.66  ? 330 LEU A CD1 1 
ATOM   2448  C  CD2 . LEU A  1 330 ? 49.694 108.514 52.199  1.00 55.12  ? 330 LEU A CD2 1 
ATOM   2449  N  N   . TYR A  1 331 ? 52.514 108.703 47.402  1.00 55.21  ? 331 TYR A N   1 
ATOM   2450  C  CA  . TYR A  1 331 ? 53.146 109.479 46.334  1.00 56.75  ? 331 TYR A CA  1 
ATOM   2451  C  C   . TYR A  1 331 ? 52.232 109.550 45.105  1.00 60.69  ? 331 TYR A C   1 
ATOM   2452  O  O   . TYR A  1 331 ? 52.067 110.632 44.543  1.00 61.99  ? 331 TYR A O   1 
ATOM   2453  C  CB  . TYR A  1 331 ? 54.520 108.885 45.969  1.00 58.91  ? 331 TYR A CB  1 
ATOM   2454  C  CG  . TYR A  1 331 ? 55.238 109.614 44.852  1.00 63.07  ? 331 TYR A CG  1 
ATOM   2455  C  CD1 . TYR A  1 331 ? 55.817 110.862 45.067  1.00 66.32  ? 331 TYR A CD1 1 
ATOM   2456  C  CD2 . TYR A  1 331 ? 55.370 109.042 43.590  1.00 64.58  ? 331 TYR A CD2 1 
ATOM   2457  C  CE1 . TYR A  1 331 ? 56.484 111.537 44.045  1.00 68.96  ? 331 TYR A CE1 1 
ATOM   2458  C  CE2 . TYR A  1 331 ? 56.043 109.703 42.562  1.00 67.26  ? 331 TYR A CE2 1 
ATOM   2459  C  CZ  . TYR A  1 331 ? 56.593 110.954 42.793  1.00 76.55  ? 331 TYR A CZ  1 
ATOM   2460  O  OH  . TYR A  1 331 ? 57.247 111.620 41.782  1.00 80.54  ? 331 TYR A OH  1 
ATOM   2461  N  N   . VAL A  1 332 ? 51.630 108.406 44.710  1.00 55.42  ? 332 VAL A N   1 
ATOM   2462  C  CA  . VAL A  1 332 ? 50.705 108.273 43.576  1.00 55.13  ? 332 VAL A CA  1 
ATOM   2463  C  C   . VAL A  1 332 ? 49.412 109.057 43.874  1.00 58.76  ? 332 VAL A C   1 
ATOM   2464  O  O   . VAL A  1 332 ? 48.901 109.748 42.990  1.00 58.89  ? 332 VAL A O   1 
ATOM   2465  C  CB  . VAL A  1 332 ? 50.438 106.773 43.267  1.00 57.98  ? 332 VAL A CB  1 
ATOM   2466  C  CG1 . VAL A  1 332 ? 49.201 106.568 42.394  1.00 57.71  ? 332 VAL A CG1 1 
ATOM   2467  C  CG2 . VAL A  1 332 ? 51.656 106.132 42.616  1.00 58.35  ? 332 VAL A CG2 1 
ATOM   2468  N  N   . MET A  1 333 ? 48.901 108.955 45.122  1.00 54.98  ? 333 MET A N   1 
ATOM   2469  C  CA  . MET A  1 333 ? 47.695 109.650 45.590  1.00 54.83  ? 333 MET A CA  1 
ATOM   2470  C  C   . MET A  1 333 ? 47.864 111.164 45.440  1.00 61.13  ? 333 MET A C   1 
ATOM   2471  O  O   . MET A  1 333 ? 46.949 111.832 44.954  1.00 61.61  ? 333 MET A O   1 
ATOM   2472  C  CB  . MET A  1 333 ? 47.387 109.285 47.052  1.00 55.65  ? 333 MET A CB  1 
ATOM   2473  C  CG  . MET A  1 333 ? 46.070 109.845 47.545  1.00 58.56  ? 333 MET A CG  1 
ATOM   2474  S  SD  . MET A  1 333 ? 46.151 110.516 49.215  1.00 61.98  ? 333 MET A SD  1 
ATOM   2475  C  CE  . MET A  1 333 ? 47.160 111.958 48.953  1.00 60.11  ? 333 MET A CE  1 
ATOM   2476  N  N   . MET A  1 334 ? 49.049 111.687 45.829  1.00 58.61  ? 334 MET A N   1 
ATOM   2477  C  CA  . MET A  1 334 ? 49.406 113.100 45.725  1.00 60.13  ? 334 MET A CA  1 
ATOM   2478  C  C   . MET A  1 334 ? 49.401 113.564 44.265  1.00 65.66  ? 334 MET A C   1 
ATOM   2479  O  O   . MET A  1 334 ? 49.044 114.712 44.009  1.00 66.38  ? 334 MET A O   1 
ATOM   2480  C  CB  . MET A  1 334 ? 50.775 113.374 46.367  1.00 63.08  ? 334 MET A CB  1 
ATOM   2481  C  CG  . MET A  1 334 ? 50.746 113.452 47.891  1.00 66.14  ? 334 MET A CG  1 
ATOM   2482  S  SD  . MET A  1 334 ? 49.624 114.691 48.603  1.00 70.89  ? 334 MET A SD  1 
ATOM   2483  C  CE  . MET A  1 334 ? 50.447 116.213 48.120  1.00 69.73  ? 334 MET A CE  1 
ATOM   2484  N  N   . ILE A  1 335 ? 49.765 112.670 43.317  1.00 62.57  ? 335 ILE A N   1 
ATOM   2485  C  CA  . ILE A  1 335 ? 49.772 112.952 41.877  1.00 64.05  ? 335 ILE A CA  1 
ATOM   2486  C  C   . ILE A  1 335 ? 48.320 113.156 41.403  1.00 69.86  ? 335 ILE A C   1 
ATOM   2487  O  O   . ILE A  1 335 ? 48.072 114.085 40.633  1.00 71.14  ? 335 ILE A O   1 
ATOM   2488  C  CB  . ILE A  1 335 ? 50.525 111.852 41.064  1.00 66.88  ? 335 ILE A CB  1 
ATOM   2489  C  CG1 . ILE A  1 335 ? 52.030 111.849 41.406  1.00 67.69  ? 335 ILE A CG1 1 
ATOM   2490  C  CG2 . ILE A  1 335 ? 50.316 112.005 39.547  1.00 68.71  ? 335 ILE A CG2 1 
ATOM   2491  C  CD1 . ILE A  1 335 ? 52.748 110.513 41.172  1.00 75.48  ? 335 ILE A CD1 1 
ATOM   2492  N  N   . TYR A  1 336 ? 47.369 112.322 41.893  1.00 65.96  ? 336 TYR A N   1 
ATOM   2493  C  CA  . TYR A  1 336 ? 45.943 112.423 41.551  1.00 66.22  ? 336 TYR A CA  1 
ATOM   2494  C  C   . TYR A  1 336 ? 45.357 113.747 42.049  1.00 71.14  ? 336 TYR A C   1 
ATOM   2495  O  O   . TYR A  1 336 ? 44.622 114.401 41.307  1.00 71.82  ? 336 TYR A O   1 
ATOM   2496  C  CB  . TYR A  1 336 ? 45.143 111.227 42.113  1.00 66.03  ? 336 TYR A CB  1 
ATOM   2497  C  CG  . TYR A  1 336 ? 43.658 111.486 42.302  1.00 67.57  ? 336 TYR A CG  1 
ATOM   2498  C  CD1 . TYR A  1 336 ? 42.790 111.516 41.213  1.00 70.22  ? 336 TYR A CD1 1 
ATOM   2499  C  CD2 . TYR A  1 336 ? 43.120 111.687 43.571  1.00 67.35  ? 336 TYR A CD2 1 
ATOM   2500  C  CE1 . TYR A  1 336 ? 41.425 111.745 41.382  1.00 70.70  ? 336 TYR A CE1 1 
ATOM   2501  C  CE2 . TYR A  1 336 ? 41.759 111.926 43.750  1.00 68.06  ? 336 TYR A CE2 1 
ATOM   2502  C  CZ  . TYR A  1 336 ? 40.914 111.954 42.652  1.00 75.87  ? 336 TYR A CZ  1 
ATOM   2503  O  OH  . TYR A  1 336 ? 39.570 112.184 42.823  1.00 76.24  ? 336 TYR A OH  1 
ATOM   2504  N  N   . PHE A  1 337 ? 45.676 114.135 43.302  1.00 67.31  ? 337 PHE A N   1 
ATOM   2505  C  CA  . PHE A  1 337 ? 45.184 115.379 43.893  1.00 67.72  ? 337 PHE A CA  1 
ATOM   2506  C  C   . PHE A  1 337 ? 45.851 116.604 43.237  1.00 76.26  ? 337 PHE A C   1 
ATOM   2507  O  O   . PHE A  1 337 ? 45.322 117.712 43.347  1.00 76.94  ? 337 PHE A O   1 
ATOM   2508  C  CB  . PHE A  1 337 ? 45.355 115.381 45.420  1.00 67.68  ? 337 PHE A CB  1 
ATOM   2509  C  CG  . PHE A  1 337 ? 44.316 114.558 46.149  1.00 66.74  ? 337 PHE A CG  1 
ATOM   2510  C  CD1 . PHE A  1 337 ? 42.994 114.981 46.223  1.00 69.11  ? 337 PHE A CD1 1 
ATOM   2511  C  CD2 . PHE A  1 337 ? 44.663 113.373 46.781  1.00 66.79  ? 337 PHE A CD2 1 
ATOM   2512  C  CE1 . PHE A  1 337 ? 42.036 114.222 46.899  1.00 68.36  ? 337 PHE A CE1 1 
ATOM   2513  C  CE2 . PHE A  1 337 ? 43.705 112.622 47.468  1.00 68.11  ? 337 PHE A CE2 1 
ATOM   2514  C  CZ  . PHE A  1 337 ? 42.399 113.050 47.519  1.00 66.04  ? 337 PHE A CZ  1 
ATOM   2515  N  N   . ASP A  1 338 ? 46.982 116.389 42.526  1.00 75.19  ? 338 ASP A N   1 
ATOM   2516  C  CA  . ASP A  1 338 ? 47.686 117.412 41.752  1.00 77.60  ? 338 ASP A CA  1 
ATOM   2517  C  C   . ASP A  1 338 ? 47.090 117.462 40.347  1.00 84.25  ? 338 ASP A C   1 
ATOM   2518  O  O   . ASP A  1 338 ? 47.105 118.516 39.711  1.00 85.74  ? 338 ASP A O   1 
ATOM   2519  C  CB  . ASP A  1 338 ? 49.202 117.134 41.692  1.00 79.90  ? 338 ASP A CB  1 
ATOM   2520  C  CG  . ASP A  1 338 ? 49.997 117.529 42.928  1.00 92.48  ? 338 ASP A CG  1 
ATOM   2521  O  OD1 . ASP A  1 338 ? 49.449 118.261 43.787  1.00 93.67  ? 338 ASP A OD1 1 
ATOM   2522  O  OD2 . ASP A  1 338 ? 51.172 117.116 43.033  1.00 99.06  ? 338 ASP A OD2 1 
ATOM   2523  N  N   . MET A  1 339 ? 46.560 116.314 39.874  1.00 81.08  ? 339 MET A N   1 
ATOM   2524  C  CA  . MET A  1 339 ? 45.918 116.146 38.569  1.00 82.21  ? 339 MET A CA  1 
ATOM   2525  C  C   . MET A  1 339 ? 44.516 116.765 38.583  1.00 86.67  ? 339 MET A C   1 
ATOM   2526  O  O   . MET A  1 339 ? 44.079 117.305 37.566  1.00 87.78  ? 339 MET A O   1 
ATOM   2527  C  CB  . MET A  1 339 ? 45.847 114.657 38.198  1.00 83.56  ? 339 MET A CB  1 
ATOM   2528  C  CG  . MET A  1 339 ? 45.875 114.399 36.713  1.00 88.49  ? 339 MET A CG  1 
ATOM   2529  S  SD  . MET A  1 339 ? 45.932 112.629 36.349  1.00 91.54  ? 339 MET A SD  1 
ATOM   2530  C  CE  . MET A  1 339 ? 47.676 112.318 36.510  1.00 88.34  ? 339 MET A CE  1 
ATOM   2531  N  N   . GLU A  1 340 ? 43.824 116.696 39.744  1.00 81.90  ? 340 GLU A N   1 
ATOM   2532  C  CA  . GLU A  1 340 ? 42.489 117.270 39.950  1.00 81.85  ? 340 GLU A CA  1 
ATOM   2533  C  C   . GLU A  1 340 ? 42.561 118.800 39.936  1.00 87.87  ? 340 GLU A C   1 
ATOM   2534  O  O   . GLU A  1 340 ? 41.581 119.454 39.576  1.00 88.07  ? 340 GLU A O   1 
ATOM   2535  C  CB  . GLU A  1 340 ? 41.880 116.772 41.268  1.00 81.40  ? 340 GLU A CB  1 
ATOM   2536  C  CG  . GLU A  1 340 ? 41.345 115.354 41.199  1.00 89.13  ? 340 GLU A CG  1 
ATOM   2537  C  CD  . GLU A  1 340 ? 39.846 115.248 41.003  1.00 107.52 ? 340 GLU A CD  1 
ATOM   2538  O  OE1 . GLU A  1 340 ? 39.103 115.445 41.992  1.00 102.59 ? 340 GLU A OE1 1 
ATOM   2539  O  OE2 . GLU A  1 340 ? 39.414 114.941 39.869  1.00 99.18  ? 340 GLU A OE2 1 
ATOM   2540  N  N   . VAL A  1 341 ? 43.732 119.357 40.316  1.00 85.77  ? 341 VAL A N   1 
ATOM   2541  C  CA  . VAL A  1 341 ? 44.033 120.792 40.338  1.00 87.58  ? 341 VAL A CA  1 
ATOM   2542  C  C   . VAL A  1 341 ? 44.213 121.272 38.883  1.00 95.31  ? 341 VAL A C   1 
ATOM   2543  O  O   . VAL A  1 341 ? 43.635 122.295 38.508  1.00 96.42  ? 341 VAL A O   1 
ATOM   2544  C  CB  . VAL A  1 341 ? 45.269 121.094 41.239  1.00 91.07  ? 341 VAL A CB  1 
ATOM   2545  C  CG1 . VAL A  1 341 ? 45.840 122.488 40.991  1.00 92.76  ? 341 VAL A CG1 1 
ATOM   2546  C  CG2 . VAL A  1 341 ? 44.925 120.916 42.714  1.00 89.35  ? 341 VAL A CG2 1 
ATOM   2547  N  N   . TRP A  1 342 ? 44.987 120.516 38.069  1.00 93.53  ? 342 TRP A N   1 
ATOM   2548  C  CA  . TRP A  1 342 ? 45.243 120.810 36.654  1.00 96.03  ? 342 TRP A CA  1 
ATOM   2549  C  C   . TRP A  1 342 ? 43.965 120.677 35.818  1.00 103.15 ? 342 TRP A C   1 
ATOM   2550  O  O   . TRP A  1 342 ? 43.783 121.443 34.870  1.00 104.69 ? 342 TRP A O   1 
ATOM   2551  C  CB  . TRP A  1 342 ? 46.339 119.896 36.094  1.00 94.57  ? 342 TRP A CB  1 
ATOM   2552  N  N   . ALA A  1 343 ? 43.078 119.722 36.178  1.00 100.23 ? 343 ALA A N   1 
ATOM   2553  C  CA  . ALA A  1 343 ? 41.795 119.493 35.503  1.00 101.36 ? 343 ALA A CA  1 
ATOM   2554  C  C   . ALA A  1 343 ? 40.782 120.604 35.832  1.00 108.40 ? 343 ALA A C   1 
ATOM   2555  O  O   . ALA A  1 343 ? 39.919 120.904 35.002  1.00 109.21 ? 343 ALA A O   1 
ATOM   2556  C  CB  . ALA A  1 343 ? 41.228 118.137 35.892  1.00 100.21 ? 343 ALA A CB  1 
ATOM   2557  N  N   . LEU A  1 344 ? 40.888 121.206 37.040  1.00 106.01 ? 344 LEU A N   1 
ATOM   2558  C  CA  . LEU A  1 344 ? 40.025 122.300 37.499  1.00 107.23 ? 344 LEU A CA  1 
ATOM   2559  C  C   . LEU A  1 344 ? 40.370 123.600 36.768  1.00 115.33 ? 344 LEU A C   1 
ATOM   2560  O  O   . LEU A  1 344 ? 39.462 124.324 36.354  1.00 116.29 ? 344 LEU A O   1 
ATOM   2561  C  CB  . LEU A  1 344 ? 40.148 122.494 39.017  1.00 105.95 ? 344 LEU A CB  1 
ATOM   2562  N  N   . GLY A  1 345 ? 41.672 123.866 36.612  1.00 113.85 ? 345 GLY A N   1 
ATOM   2563  C  CA  . GLY A  1 345 ? 42.202 125.040 35.925  1.00 116.56 ? 345 GLY A CA  1 
ATOM   2564  C  C   . GLY A  1 345 ? 41.872 125.072 34.445  1.00 123.60 ? 345 GLY A C   1 
ATOM   2565  O  O   . GLY A  1 345 ? 41.620 126.147 33.892  1.00 125.14 ? 345 GLY A O   1 
ATOM   2566  N  N   . LEU A  1 346 ? 41.864 123.887 33.797  1.00 120.64 ? 346 LEU A N   1 
ATOM   2567  C  CA  . LEU A  1 346 ? 41.542 123.714 32.377  1.00 122.42 ? 346 LEU A CA  1 
ATOM   2568  C  C   . LEU A  1 346 ? 40.052 123.973 32.109  1.00 128.15 ? 346 LEU A C   1 
ATOM   2569  O  O   . LEU A  1 346 ? 39.714 124.515 31.054  1.00 129.71 ? 346 LEU A O   1 
ATOM   2570  C  CB  . LEU A  1 346 ? 41.924 122.306 31.909  1.00 121.40 ? 346 LEU A CB  1 
ATOM   2571  N  N   . HIS A  1 347 ? 39.171 123.589 33.062  1.00 123.95 ? 347 HIS A N   1 
ATOM   2572  C  CA  . HIS A  1 347 ? 37.722 123.803 32.978  1.00 124.47 ? 347 HIS A CA  1 
ATOM   2573  C  C   . HIS A  1 347 ? 37.397 125.287 33.184  1.00 130.68 ? 347 HIS A C   1 
ATOM   2574  O  O   . HIS A  1 347 ? 36.472 125.804 32.555  1.00 131.91 ? 347 HIS A O   1 
ATOM   2575  C  CB  . HIS A  1 347 ? 36.981 122.936 34.008  1.00 122.99 ? 347 HIS A CB  1 
ATOM   2576  C  CG  . HIS A  1 347 ? 35.489 122.989 33.882  1.00 126.70 ? 347 HIS A CG  1 
ATOM   2577  N  ND1 . HIS A  1 347 ? 34.819 122.235 32.936  1.00 128.78 ? 347 HIS A ND1 1 
ATOM   2578  C  CD2 . HIS A  1 347 ? 34.585 123.707 34.589  1.00 128.53 ? 347 HIS A CD2 1 
ATOM   2579  C  CE1 . HIS A  1 347 ? 33.535 122.514 33.097  1.00 128.55 ? 347 HIS A CE1 1 
ATOM   2580  N  NE2 . HIS A  1 347 ? 33.345 123.394 34.079  1.00 128.74 ? 347 HIS A NE2 1 
ATOM   2581  N  N   . GLU A  1 348 ? 38.175 125.965 34.055  1.00 127.32 ? 348 GLU A N   1 
ATOM   2582  C  CA  . GLU A  1 348 ? 38.050 127.395 34.345  1.00 128.64 ? 348 GLU A CA  1 
ATOM   2583  C  C   . GLU A  1 348 ? 38.456 128.226 33.114  1.00 134.90 ? 348 GLU A C   1 
ATOM   2584  O  O   . GLU A  1 348 ? 37.920 129.316 32.913  1.00 136.32 ? 348 GLU A O   1 
ATOM   2585  C  CB  . GLU A  1 348 ? 38.902 127.774 35.566  1.00 129.08 ? 348 GLU A CB  1 
ATOM   2586  N  N   . ASN A  1 349 ? 39.383 127.691 32.286  1.00 131.46 ? 349 ASN A N   1 
ATOM   2587  C  CA  . ASN A  1 349 ? 39.860 128.314 31.050  1.00 160.62 ? 349 ASN A CA  1 
ATOM   2588  C  C   . ASN A  1 349 ? 39.005 127.863 29.870  1.00 187.87 ? 349 ASN A C   1 
ATOM   2589  O  O   . ASN A  1 349 ? 38.381 128.686 29.206  1.00 150.55 ? 349 ASN A O   1 
ATOM   2590  C  CB  . ASN A  1 349 ? 41.334 127.969 30.796  1.00 160.96 ? 349 ASN A CB  1 
ATOM   2591  C  CG  . ASN A  1 349 ? 42.310 128.509 31.816  1.00 181.22 ? 349 ASN A CG  1 
ATOM   2592  O  OD1 . ASN A  1 349 ? 42.213 129.652 32.281  1.00 176.35 ? 349 ASN A OD1 1 
ATOM   2593  N  ND2 . ASN A  1 349 ? 43.310 127.708 32.148  1.00 170.99 ? 349 ASN A ND2 1 
ATOM   2594  N  N   . SER A  1 352 ? 33.126 124.189 26.659  1.00 136.86 ? 352 SER A N   1 
ATOM   2595  C  CA  . SER A  1 352 ? 32.605 123.662 27.918  1.00 134.46 ? 352 SER A CA  1 
ATOM   2596  C  C   . SER A  1 352 ? 32.148 122.197 27.780  1.00 137.50 ? 352 SER A C   1 
ATOM   2597  O  O   . SER A  1 352 ? 31.896 121.540 28.794  1.00 134.96 ? 352 SER A O   1 
ATOM   2598  C  CB  . SER A  1 352 ? 31.456 124.528 28.424  1.00 138.40 ? 352 SER A CB  1 
ATOM   2599  O  OG  . SER A  1 352 ? 31.093 124.181 29.750  1.00 144.13 ? 352 SER A OG  1 
ATOM   2600  N  N   . GLU A  1 353 ? 32.051 121.691 26.533  1.00 135.75 ? 353 GLU A N   1 
ATOM   2601  C  CA  . GLU A  1 353 ? 31.635 120.319 26.238  1.00 134.72 ? 353 GLU A CA  1 
ATOM   2602  C  C   . GLU A  1 353 ? 32.786 119.333 26.454  1.00 137.19 ? 353 GLU A C   1 
ATOM   2603  O  O   . GLU A  1 353 ? 32.585 118.299 27.095  1.00 134.92 ? 353 GLU A O   1 
ATOM   2604  C  CB  . GLU A  1 353 ? 31.105 120.210 24.799  1.00 138.25 ? 353 GLU A CB  1 
ATOM   2605  N  N   . TRP A  1 354 ? 33.986 119.658 25.922  1.00 134.64 ? 354 TRP A N   1 
ATOM   2606  C  CA  . TRP A  1 354 ? 35.192 118.830 26.013  1.00 133.14 ? 354 TRP A CA  1 
ATOM   2607  C  C   . TRP A  1 354 ? 35.806 118.843 27.420  1.00 134.60 ? 354 TRP A C   1 
ATOM   2608  O  O   . TRP A  1 354 ? 36.370 117.831 27.842  1.00 132.51 ? 354 TRP A O   1 
ATOM   2609  C  CB  . TRP A  1 354 ? 36.238 119.290 24.989  1.00 133.69 ? 354 TRP A CB  1 
ATOM   2610  N  N   . THR A  1 355 ? 35.697 119.983 28.135  1.00 130.89 ? 355 THR A N   1 
ATOM   2611  C  CA  . THR A  1 355 ? 36.245 120.177 29.485  1.00 128.67 ? 355 THR A CA  1 
ATOM   2612  C  C   . THR A  1 355 ? 35.484 119.363 30.549  1.00 129.21 ? 355 THR A C   1 
ATOM   2613  O  O   . THR A  1 355 ? 36.110 118.899 31.504  1.00 127.20 ? 355 THR A O   1 
ATOM   2614  C  CB  . THR A  1 355 ? 36.260 121.663 29.865  1.00 138.08 ? 355 THR A CB  1 
ATOM   2615  O  OG1 . THR A  1 355 ? 34.927 122.174 29.830  1.00 139.50 ? 355 THR A OG1 1 
ATOM   2616  C  CG2 . THR A  1 355 ? 37.176 122.497 28.973  1.00 138.41 ? 355 THR A CG2 1 
ATOM   2617  N  N   . SER A  1 356 ? 34.150 119.193 30.387  1.00 124.69 ? 356 SER A N   1 
ATOM   2618  C  CA  . SER A  1 356 ? 33.292 118.433 31.309  1.00 121.98 ? 356 SER A CA  1 
ATOM   2619  C  C   . SER A  1 356 ? 33.660 116.940 31.338  1.00 122.22 ? 356 SER A C   1 
ATOM   2620  O  O   . SER A  1 356 ? 33.425 116.271 32.347  1.00 119.89 ? 356 SER A O   1 
ATOM   2621  C  CB  . SER A  1 356 ? 31.823 118.600 30.938  1.00 126.62 ? 356 SER A CB  1 
ATOM   2622  O  OG  . SER A  1 356 ? 31.344 119.875 31.332  1.00 136.33 ? 356 SER A OG  1 
ATOM   2623  N  N   . VAL A  1 357 ? 34.242 116.432 30.233  1.00 117.95 ? 357 VAL A N   1 
ATOM   2624  C  CA  . VAL A  1 357 ? 34.705 115.048 30.086  1.00 115.67 ? 357 VAL A CA  1 
ATOM   2625  C  C   . VAL A  1 357 ? 36.082 114.920 30.767  1.00 116.22 ? 357 VAL A C   1 
ATOM   2626  O  O   . VAL A  1 357 ? 36.325 113.944 31.480  1.00 114.03 ? 357 VAL A O   1 
ATOM   2627  C  CB  . VAL A  1 357 ? 34.752 114.602 28.594  1.00 121.00 ? 357 VAL A CB  1 
ATOM   2628  C  CG1 . VAL A  1 357 ? 35.045 113.107 28.467  1.00 119.49 ? 357 VAL A CG1 1 
ATOM   2629  C  CG2 . VAL A  1 357 ? 33.458 114.953 27.863  1.00 122.39 ? 357 VAL A CG2 1 
ATOM   2630  N  N   . LEU A  1 358 ? 36.959 115.932 30.564  1.00 112.09 ? 358 LEU A N   1 
ATOM   2631  C  CA  . LEU A  1 358 ? 38.323 116.024 31.100  1.00 110.37 ? 358 LEU A CA  1 
ATOM   2632  C  C   . LEU A  1 358 ? 38.363 116.061 32.643  1.00 110.85 ? 358 LEU A C   1 
ATOM   2633  O  O   . LEU A  1 358 ? 39.399 115.730 33.223  1.00 109.49 ? 358 LEU A O   1 
ATOM   2634  C  CB  . LEU A  1 358 ? 39.023 117.272 30.531  1.00 112.25 ? 358 LEU A CB  1 
ATOM   2635  C  CG  . LEU A  1 358 ? 40.551 117.241 30.459  1.00 116.87 ? 358 LEU A CG  1 
ATOM   2636  C  CD1 . LEU A  1 358 ? 41.032 116.691 29.122  1.00 118.14 ? 358 LEU A CD1 1 
ATOM   2637  C  CD2 . LEU A  1 358 ? 41.124 118.624 30.673  1.00 120.40 ? 358 LEU A CD2 1 
ATOM   2638  N  N   . LEU A  1 359 ? 37.252 116.456 33.299  1.00 105.71 ? 359 LEU A N   1 
ATOM   2639  C  CA  . LEU A  1 359 ? 37.147 116.526 34.762  1.00 103.21 ? 359 LEU A CA  1 
ATOM   2640  C  C   . LEU A  1 359 ? 37.079 115.133 35.399  1.00 103.75 ? 359 LEU A C   1 
ATOM   2641  O  O   . LEU A  1 359 ? 37.561 114.954 36.519  1.00 101.82 ? 359 LEU A O   1 
ATOM   2642  C  CB  . LEU A  1 359 ? 35.917 117.343 35.183  1.00 103.61 ? 359 LEU A CB  1 
ATOM   2643  C  CG  . LEU A  1 359 ? 35.948 118.844 34.887  1.00 109.98 ? 359 LEU A CG  1 
ATOM   2644  C  CD1 . LEU A  1 359 ? 34.550 119.406 34.845  1.00 111.01 ? 359 LEU A CD1 1 
ATOM   2645  C  CD2 . LEU A  1 359 ? 36.809 119.606 35.895  1.00 111.79 ? 359 LEU A CD2 1 
ATOM   2646  N  N   . TYR A  1 360 ? 36.467 114.160 34.696  1.00 99.36  ? 360 TYR A N   1 
ATOM   2647  C  CA  . TYR A  1 360 ? 36.322 112.777 35.159  1.00 97.03  ? 360 TYR A CA  1 
ATOM   2648  C  C   . TYR A  1 360 ? 37.601 111.959 34.941  1.00 98.73  ? 360 TYR A C   1 
ATOM   2649  O  O   . TYR A  1 360 ? 37.857 111.022 35.699  1.00 96.95  ? 360 TYR A O   1 
ATOM   2650  C  CB  . TYR A  1 360 ? 35.148 112.095 34.440  1.00 98.70  ? 360 TYR A CB  1 
ATOM   2651  C  CG  . TYR A  1 360 ? 33.786 112.549 34.913  1.00 100.76 ? 360 TYR A CG  1 
ATOM   2652  C  CD1 . TYR A  1 360 ? 33.159 111.930 35.989  1.00 101.27 ? 360 TYR A CD1 1 
ATOM   2653  C  CD2 . TYR A  1 360 ? 33.104 113.570 34.259  1.00 103.39 ? 360 TYR A CD2 1 
ATOM   2654  C  CE1 . TYR A  1 360 ? 31.894 112.328 36.417  1.00 102.58 ? 360 TYR A CE1 1 
ATOM   2655  C  CE2 . TYR A  1 360 ? 31.841 113.983 34.680  1.00 104.65 ? 360 TYR A CE2 1 
ATOM   2656  C  CZ  . TYR A  1 360 ? 31.238 113.356 35.759  1.00 111.08 ? 360 TYR A CZ  1 
ATOM   2657  O  OH  . TYR A  1 360 ? 29.992 113.752 36.182  1.00 112.85 ? 360 TYR A OH  1 
ATOM   2658  N  N   . VAL A  1 361 ? 38.392 112.323 33.909  1.00 95.05  ? 361 VAL A N   1 
ATOM   2659  C  CA  . VAL A  1 361 ? 39.643 111.692 33.464  1.00 94.00  ? 361 VAL A CA  1 
ATOM   2660  C  C   . VAL A  1 361 ? 40.648 111.418 34.647  1.00 95.34  ? 361 VAL A C   1 
ATOM   2661  O  O   . VAL A  1 361 ? 41.082 110.266 34.721  1.00 93.74  ? 361 VAL A O   1 
ATOM   2662  C  CB  . VAL A  1 361 ? 40.289 112.513 32.306  1.00 99.69  ? 361 VAL A CB  1 
ATOM   2663  C  CG1 . VAL A  1 361 ? 41.731 112.103 32.032  1.00 99.43  ? 361 VAL A CG1 1 
ATOM   2664  C  CG2 . VAL A  1 361 ? 39.458 112.399 31.031  1.00 100.89 ? 361 VAL A CG2 1 
ATOM   2665  N  N   . PRO A  1 362 ? 41.014 112.354 35.582  1.00 91.08  ? 362 PRO A N   1 
ATOM   2666  C  CA  . PRO A  1 362 ? 41.974 111.977 36.647  1.00 89.07  ? 362 PRO A CA  1 
ATOM   2667  C  C   . PRO A  1 362 ? 41.433 110.926 37.624  1.00 89.55  ? 362 PRO A C   1 
ATOM   2668  O  O   . PRO A  1 362 ? 42.205 110.089 38.095  1.00 87.96  ? 362 PRO A O   1 
ATOM   2669  C  CB  . PRO A  1 362 ? 42.265 113.302 37.363  1.00 91.31  ? 362 PRO A CB  1 
ATOM   2670  C  CG  . PRO A  1 362 ? 41.110 114.162 37.066  1.00 96.95  ? 362 PRO A CG  1 
ATOM   2671  C  CD  . PRO A  1 362 ? 40.639 113.780 35.695  1.00 93.70  ? 362 PRO A CD  1 
ATOM   2672  N  N   . SER A  1 363 ? 40.114 110.955 37.907  1.00 84.63  ? 363 SER A N   1 
ATOM   2673  C  CA  . SER A  1 363 ? 39.443 110.002 38.795  1.00 82.22  ? 363 SER A CA  1 
ATOM   2674  C  C   . SER A  1 363 ? 39.427 108.603 38.173  1.00 84.82  ? 363 SER A C   1 
ATOM   2675  O  O   . SER A  1 363 ? 39.528 107.614 38.899  1.00 83.07  ? 363 SER A O   1 
ATOM   2676  C  CB  . SER A  1 363 ? 38.023 110.464 39.100  1.00 85.40  ? 363 SER A CB  1 
ATOM   2677  O  OG  . SER A  1 363 ? 38.021 111.762 39.671  1.00 94.39  ? 363 SER A OG  1 
ATOM   2678  N  N   . ILE A  1 364 ? 39.326 108.531 36.829  1.00 81.79  ? 364 ILE A N   1 
ATOM   2679  C  CA  . ILE A  1 364 ? 39.321 107.288 36.052  1.00 80.94  ? 364 ILE A CA  1 
ATOM   2680  C  C   . ILE A  1 364 ? 40.749 106.702 36.024  1.00 82.26  ? 364 ILE A C   1 
ATOM   2681  O  O   . ILE A  1 364 ? 40.911 105.507 36.282  1.00 80.61  ? 364 ILE A O   1 
ATOM   2682  C  CB  . ILE A  1 364 ? 38.737 107.529 34.623  1.00 85.94  ? 364 ILE A CB  1 
ATOM   2683  C  CG1 . ILE A  1 364 ? 37.238 107.915 34.690  1.00 86.87  ? 364 ILE A CG1 1 
ATOM   2684  C  CG2 . ILE A  1 364 ? 38.942 106.311 33.702  1.00 86.83  ? 364 ILE A CG2 1 
ATOM   2685  C  CD1 . ILE A  1 364 ? 36.712 108.720 33.474  1.00 96.95  ? 364 ILE A CD1 1 
ATOM   2686  N  N   . ILE A  1 365 ? 41.772 107.550 35.743  1.00 78.07  ? 365 ILE A N   1 
ATOM   2687  C  CA  . ILE A  1 365 ? 43.188 107.165 35.673  1.00 77.04  ? 365 ILE A CA  1 
ATOM   2688  C  C   . ILE A  1 365 ? 43.664 106.600 37.027  1.00 77.97  ? 365 ILE A C   1 
ATOM   2689  O  O   . ILE A  1 365 ? 44.205 105.494 37.049  1.00 76.80  ? 365 ILE A O   1 
ATOM   2690  C  CB  . ILE A  1 365 ? 44.093 108.341 35.184  1.00 81.41  ? 365 ILE A CB  1 
ATOM   2691  C  CG1 . ILE A  1 365 ? 43.836 108.651 33.693  1.00 83.20  ? 365 ILE A CG1 1 
ATOM   2692  C  CG2 . ILE A  1 365 ? 45.592 108.060 35.430  1.00 82.13  ? 365 ILE A CG2 1 
ATOM   2693  C  CD1 . ILE A  1 365 ? 44.455 109.955 33.177  1.00 89.83  ? 365 ILE A CD1 1 
ATOM   2694  N  N   . TYR A  1 366 ? 43.449 107.345 38.136  1.00 72.72  ? 366 TYR A N   1 
ATOM   2695  C  CA  . TYR A  1 366 ? 43.874 106.959 39.486  1.00 70.53  ? 366 TYR A CA  1 
ATOM   2696  C  C   . TYR A  1 366 ? 43.266 105.619 39.919  1.00 72.48  ? 366 TYR A C   1 
ATOM   2697  O  O   . TYR A  1 366 ? 44.004 104.773 40.424  1.00 70.95  ? 366 TYR A O   1 
ATOM   2698  C  CB  . TYR A  1 366 ? 43.548 108.067 40.509  1.00 71.14  ? 366 TYR A CB  1 
ATOM   2699  C  CG  . TYR A  1 366 ? 43.994 107.792 41.934  1.00 70.58  ? 366 TYR A CG  1 
ATOM   2700  C  CD1 . TYR A  1 366 ? 45.290 107.365 42.212  1.00 72.11  ? 366 TYR A CD1 1 
ATOM   2701  C  CD2 . TYR A  1 366 ? 43.145 108.036 43.009  1.00 70.22  ? 366 TYR A CD2 1 
ATOM   2702  C  CE1 . TYR A  1 366 ? 45.709 107.128 43.520  1.00 71.55  ? 366 TYR A CE1 1 
ATOM   2703  C  CE2 . TYR A  1 366 ? 43.558 107.814 44.323  1.00 69.96  ? 366 TYR A CE2 1 
ATOM   2704  C  CZ  . TYR A  1 366 ? 44.840 107.355 44.572  1.00 76.11  ? 366 TYR A CZ  1 
ATOM   2705  O  OH  . TYR A  1 366 ? 45.246 107.109 45.860  1.00 74.72  ? 366 TYR A OH  1 
ATOM   2706  N  N   . ALA A  1 367 ? 41.950 105.413 39.685  1.00 68.87  ? 367 ALA A N   1 
ATOM   2707  C  CA  . ALA A  1 367 ? 41.237 104.176 40.031  1.00 67.42  ? 367 ALA A CA  1 
ATOM   2708  C  C   . ALA A  1 367 ? 41.788 102.964 39.261  1.00 70.43  ? 367 ALA A C   1 
ATOM   2709  O  O   . ALA A  1 367 ? 41.813 101.859 39.804  1.00 68.80  ? 367 ALA A O   1 
ATOM   2710  C  CB  . ALA A  1 367 ? 39.750 104.334 39.760  1.00 68.50  ? 367 ALA A CB  1 
ATOM   2711  N  N   . ILE A  1 368 ? 42.243 103.183 38.009  1.00 67.75  ? 368 ILE A N   1 
ATOM   2712  C  CA  . ILE A  1 368 ? 42.836 102.158 37.147  1.00 67.38  ? 368 ILE A CA  1 
ATOM   2713  C  C   . ILE A  1 368 ? 44.248 101.820 37.679  1.00 69.80  ? 368 ILE A C   1 
ATOM   2714  O  O   . ILE A  1 368 ? 44.567 100.639 37.823  1.00 68.24  ? 368 ILE A O   1 
ATOM   2715  C  CB  . ILE A  1 368 ? 42.818 102.615 35.654  1.00 72.03  ? 368 ILE A CB  1 
ATOM   2716  C  CG1 . ILE A  1 368 ? 41.396 102.435 35.063  1.00 72.97  ? 368 ILE A CG1 1 
ATOM   2717  C  CG2 . ILE A  1 368 ? 43.865 101.878 34.797  1.00 72.81  ? 368 ILE A CG2 1 
ATOM   2718  C  CD1 . ILE A  1 368 ? 41.082 103.230 33.790  1.00 83.88  ? 368 ILE A CD1 1 
ATOM   2719  N  N   . VAL A  1 369 ? 45.060 102.853 38.011  1.00 66.46  ? 369 VAL A N   1 
ATOM   2720  C  CA  . VAL A  1 369 ? 46.417 102.721 38.563  1.00 65.72  ? 369 VAL A CA  1 
ATOM   2721  C  C   . VAL A  1 369 ? 46.359 101.921 39.887  1.00 68.29  ? 369 VAL A C   1 
ATOM   2722  O  O   . VAL A  1 369 ? 47.215 101.059 40.096  1.00 67.52  ? 369 VAL A O   1 
ATOM   2723  C  CB  . VAL A  1 369 ? 47.105 104.106 38.731  1.00 70.26  ? 369 VAL A CB  1 
ATOM   2724  C  CG1 . VAL A  1 369 ? 48.391 104.016 39.551  1.00 69.75  ? 369 VAL A CG1 1 
ATOM   2725  C  CG2 . VAL A  1 369 ? 47.394 104.737 37.375  1.00 71.62  ? 369 VAL A CG2 1 
ATOM   2726  N  N   . ILE A  1 370 ? 45.331 102.168 40.740  1.00 64.02  ? 370 ILE A N   1 
ATOM   2727  C  CA  . ILE A  1 370 ? 45.110 101.461 42.014  1.00 62.13  ? 370 ILE A CA  1 
ATOM   2728  C  C   . ILE A  1 370 ? 44.918 99.953  41.745  1.00 65.26  ? 370 ILE A C   1 
ATOM   2729  O  O   . ILE A  1 370 ? 45.515 99.145  42.450  1.00 63.67  ? 370 ILE A O   1 
ATOM   2730  C  CB  . ILE A  1 370 ? 43.922 102.087 42.814  1.00 64.63  ? 370 ILE A CB  1 
ATOM   2731  C  CG1 . ILE A  1 370 ? 44.289 103.474 43.422  1.00 65.52  ? 370 ILE A CG1 1 
ATOM   2732  C  CG2 . ILE A  1 370 ? 43.329 101.143 43.879  1.00 63.93  ? 370 ILE A CG2 1 
ATOM   2733  C  CD1 . ILE A  1 370 ? 45.534 103.558 44.389  1.00 72.54  ? 370 ILE A CD1 1 
ATOM   2734  N  N   . GLU A  1 371 ? 44.130 99.589  40.707  1.00 62.99  ? 371 GLU A N   1 
ATOM   2735  C  CA  . GLU A  1 371 ? 43.886 98.197  40.312  1.00 62.64  ? 371 GLU A CA  1 
ATOM   2736  C  C   . GLU A  1 371 ? 45.183 97.529  39.818  1.00 66.33  ? 371 GLU A C   1 
ATOM   2737  O  O   . GLU A  1 371 ? 45.420 96.363  40.145  1.00 65.63  ? 371 GLU A O   1 
ATOM   2738  C  CB  . GLU A  1 371 ? 42.784 98.111  39.239  1.00 64.88  ? 371 GLU A CB  1 
ATOM   2739  C  CG  . GLU A  1 371 ? 42.185 96.721  39.055  1.00 77.88  ? 371 GLU A CG  1 
ATOM   2740  C  CD  . GLU A  1 371 ? 41.544 96.099  40.282  1.00 106.02 ? 371 GLU A CD  1 
ATOM   2741  O  OE1 . GLU A  1 371 ? 40.616 96.720  40.852  1.00 105.65 ? 371 GLU A OE1 1 
ATOM   2742  O  OE2 . GLU A  1 371 ? 41.967 94.986  40.671  1.00 101.92 ? 371 GLU A OE2 1 
ATOM   2743  N  N   . ILE A  1 372 ? 46.022 98.272  39.057  1.00 62.96  ? 372 ILE A N   1 
ATOM   2744  C  CA  . ILE A  1 372 ? 47.324 97.808  38.554  1.00 62.75  ? 372 ILE A CA  1 
ATOM   2745  C  C   . ILE A  1 372 ? 48.260 97.589  39.758  1.00 65.56  ? 372 ILE A C   1 
ATOM   2746  O  O   . ILE A  1 372 ? 48.981 96.592  39.800  1.00 65.06  ? 372 ILE A O   1 
ATOM   2747  C  CB  . ILE A  1 372 ? 47.926 98.802  37.511  1.00 67.07  ? 372 ILE A CB  1 
ATOM   2748  C  CG1 . ILE A  1 372 ? 47.011 98.940  36.274  1.00 68.43  ? 372 ILE A CG1 1 
ATOM   2749  C  CG2 . ILE A  1 372 ? 49.350 98.397  37.088  1.00 67.72  ? 372 ILE A CG2 1 
ATOM   2750  C  CD1 . ILE A  1 372 ? 47.172 100.247 35.495  1.00 77.25  ? 372 ILE A CD1 1 
ATOM   2751  N  N   . MET A  1 373 ? 48.210 98.505  40.742  1.00 61.29  ? 373 MET A N   1 
ATOM   2752  C  CA  . MET A  1 373 ? 49.013 98.449  41.962  1.00 60.23  ? 373 MET A CA  1 
ATOM   2753  C  C   . MET A  1 373 ? 48.584 97.307  42.874  1.00 61.26  ? 373 MET A C   1 
ATOM   2754  O  O   . MET A  1 373 ? 49.451 96.643  43.434  1.00 60.56  ? 373 MET A O   1 
ATOM   2755  C  CB  . MET A  1 373 ? 48.932 99.771  42.728  1.00 62.84  ? 373 MET A CB  1 
ATOM   2756  C  CG  . MET A  1 373 ? 49.870 100.827 42.209  1.00 67.81  ? 373 MET A CG  1 
ATOM   2757  S  SD  . MET A  1 373 ? 49.486 102.441 42.917  1.00 72.37  ? 373 MET A SD  1 
ATOM   2758  C  CE  . MET A  1 373 ? 50.236 102.278 44.526  1.00 68.31  ? 373 MET A CE  1 
ATOM   2759  N  N   . ASN A  1 374 ? 47.262 97.081  43.034  1.00 56.34  ? 374 ASN A N   1 
ATOM   2760  C  CA  . ASN A  1 374 ? 46.717 96.027  43.894  1.00 54.75  ? 374 ASN A CA  1 
ATOM   2761  C  C   . ASN A  1 374 ? 47.055 94.637  43.361  1.00 58.12  ? 374 ASN A C   1 
ATOM   2762  O  O   . ASN A  1 374 ? 47.395 93.767  44.162  1.00 57.02  ? 374 ASN A O   1 
ATOM   2763  C  CB  . ASN A  1 374 ? 45.198 96.168  44.081  1.00 53.97  ? 374 ASN A CB  1 
ATOM   2764  C  CG  . ASN A  1 374 ? 44.760 97.273  45.024  1.00 73.66  ? 374 ASN A CG  1 
ATOM   2765  O  OD1 . ASN A  1 374 ? 45.457 97.653  45.972  1.00 66.25  ? 374 ASN A OD1 1 
ATOM   2766  N  ND2 . ASN A  1 374 ? 43.559 97.786  44.813  1.00 66.03  ? 374 ASN A ND2 1 
ATOM   2767  N  N   . ARG A  1 375 ? 47.001 94.430  42.022  1.00 54.91  ? 375 ARG A N   1 
ATOM   2768  C  CA  . ARG A  1 375 ? 47.317 93.122  41.439  1.00 54.29  ? 375 ARG A CA  1 
ATOM   2769  C  C   . ARG A  1 375 ? 48.838 92.850  41.479  1.00 57.05  ? 375 ARG A C   1 
ATOM   2770  O  O   . ARG A  1 375 ? 49.228 91.704  41.699  1.00 56.82  ? 375 ARG A O   1 
ATOM   2771  C  CB  . ARG A  1 375 ? 46.736 92.949  40.016  1.00 55.50  ? 375 ARG A CB  1 
ATOM   2772  C  CG  . ARG A  1 375 ? 47.401 93.758  38.907  1.00 68.66  ? 375 ARG A CG  1 
ATOM   2773  C  CD  . ARG A  1 375 ? 47.386 93.011  37.586  1.00 82.75  ? 375 ARG A CD  1 
ATOM   2774  N  NE  . ARG A  1 375 ? 48.214 93.670  36.573  1.00 93.52  ? 375 ARG A NE  1 
ATOM   2775  C  CZ  . ARG A  1 375 ? 49.440 93.285  36.231  1.00 108.04 ? 375 ARG A CZ  1 
ATOM   2776  N  NH1 . ARG A  1 375 ? 49.998 92.226  36.808  1.00 96.71  ? 375 ARG A NH1 1 
ATOM   2777  N  NH2 . ARG A  1 375 ? 50.115 93.949  35.303  1.00 94.10  ? 375 ARG A NH2 1 
ATOM   2778  N  N   . LEU A  1 376 ? 49.682 93.895  41.311  1.00 52.39  ? 376 LEU A N   1 
ATOM   2779  C  CA  . LEU A  1 376 ? 51.143 93.772  41.340  1.00 51.78  ? 376 LEU A CA  1 
ATOM   2780  C  C   . LEU A  1 376 ? 51.667 93.546  42.759  1.00 53.48  ? 376 LEU A C   1 
ATOM   2781  O  O   . LEU A  1 376 ? 52.543 92.701  42.942  1.00 52.95  ? 376 LEU A O   1 
ATOM   2782  C  CB  . LEU A  1 376 ? 51.821 95.007  40.729  1.00 52.85  ? 376 LEU A CB  1 
ATOM   2783  C  CG  . LEU A  1 376 ? 52.016 95.000  39.214  1.00 58.35  ? 376 LEU A CG  1 
ATOM   2784  C  CD1 . LEU A  1 376 ? 52.202 96.401  38.695  1.00 59.55  ? 376 LEU A CD1 1 
ATOM   2785  C  CD2 . LEU A  1 376 ? 53.209 94.147  38.808  1.00 60.61  ? 376 LEU A CD2 1 
ATOM   2786  N  N   . TYR A  1 377 ? 51.139 94.299  43.755  1.00 48.43  ? 377 TYR A N   1 
ATOM   2787  C  CA  . TYR A  1 377 ? 51.533 94.183  45.163  1.00 47.01  ? 377 TYR A CA  1 
ATOM   2788  C  C   . TYR A  1 377 ? 51.140 92.822  45.728  1.00 49.74  ? 377 TYR A C   1 
ATOM   2789  O  O   . TYR A  1 377 ? 51.889 92.283  46.539  1.00 49.09  ? 377 TYR A O   1 
ATOM   2790  C  CB  . TYR A  1 377 ? 50.926 95.314  46.011  1.00 47.51  ? 377 TYR A CB  1 
ATOM   2791  C  CG  . TYR A  1 377 ? 51.271 95.261  47.488  1.00 48.25  ? 377 TYR A CG  1 
ATOM   2792  C  CD1 . TYR A  1 377 ? 52.432 95.851  47.976  1.00 50.66  ? 377 TYR A CD1 1 
ATOM   2793  C  CD2 . TYR A  1 377 ? 50.418 94.649  48.404  1.00 47.78  ? 377 TYR A CD2 1 
ATOM   2794  C  CE1 . TYR A  1 377 ? 52.750 95.810  49.334  1.00 50.74  ? 377 TYR A CE1 1 
ATOM   2795  C  CE2 . TYR A  1 377 ? 50.735 94.585  49.758  1.00 48.09  ? 377 TYR A CE2 1 
ATOM   2796  C  CZ  . TYR A  1 377 ? 51.890 95.189  50.224  1.00 56.05  ? 377 TYR A CZ  1 
ATOM   2797  O  OH  . TYR A  1 377 ? 52.195 95.146  51.566  1.00 56.73  ? 377 TYR A OH  1 
ATOM   2798  N  N   . ARG A  1 378 ? 49.975 92.274  45.317  1.00 45.69  ? 378 ARG A N   1 
ATOM   2799  C  CA  . ARG A  1 378 ? 49.501 90.970  45.784  1.00 44.76  ? 378 ARG A CA  1 
ATOM   2800  C  C   . ARG A  1 378 ? 50.428 89.843  45.308  1.00 49.83  ? 378 ARG A C   1 
ATOM   2801  O  O   . ARG A  1 378 ? 50.658 88.911  46.075  1.00 49.22  ? 378 ARG A O   1 
ATOM   2802  C  CB  . ARG A  1 378 ? 48.053 90.708  45.364  1.00 43.64  ? 378 ARG A CB  1 
ATOM   2803  C  CG  . ARG A  1 378 ? 47.061 91.335  46.330  1.00 49.31  ? 378 ARG A CG  1 
ATOM   2804  C  CD  . ARG A  1 378 ? 45.624 91.273  45.856  1.00 58.44  ? 378 ARG A CD  1 
ATOM   2805  N  NE  . ARG A  1 378 ? 45.030 89.960  46.095  1.00 67.71  ? 378 ARG A NE  1 
ATOM   2806  C  CZ  . ARG A  1 378 ? 43.806 89.763  46.574  1.00 79.78  ? 378 ARG A CZ  1 
ATOM   2807  N  NH1 . ARG A  1 378 ? 43.028 90.797  46.875  1.00 65.62  ? 378 ARG A NH1 1 
ATOM   2808  N  NH2 . ARG A  1 378 ? 43.353 88.533  46.762  1.00 64.43  ? 378 ARG A NH2 1 
ATOM   2809  N  N   . TYR A  1 379 ? 51.001 89.951  44.081  1.00 47.25  ? 379 TYR A N   1 
ATOM   2810  C  CA  . TYR A  1 379 ? 51.962 88.969  43.551  1.00 47.54  ? 379 TYR A CA  1 
ATOM   2811  C  C   . TYR A  1 379 ? 53.261 89.017  44.361  1.00 50.63  ? 379 TYR A C   1 
ATOM   2812  O  O   . TYR A  1 379 ? 53.807 87.968  44.704  1.00 49.69  ? 379 TYR A O   1 
ATOM   2813  C  CB  . TYR A  1 379 ? 52.268 89.210  42.058  1.00 49.86  ? 379 TYR A CB  1 
ATOM   2814  C  CG  . TYR A  1 379 ? 51.077 89.062  41.135  1.00 51.61  ? 379 TYR A CG  1 
ATOM   2815  N  N   . ALA A  1 380 ? 53.741 90.243  44.666  1.00 47.35  ? 380 ALA A N   1 
ATOM   2816  C  CA  . ALA A  1 380 ? 54.955 90.505  45.441  1.00 47.38  ? 380 ALA A CA  1 
ATOM   2817  C  C   . ALA A  1 380 ? 54.786 90.065  46.899  1.00 51.02  ? 380 ALA A C   1 
ATOM   2818  O  O   . ALA A  1 380 ? 55.732 89.533  47.480  1.00 50.93  ? 380 ALA A O   1 
ATOM   2819  C  CB  . ALA A  1 380 ? 55.307 91.981  45.373  1.00 48.58  ? 380 ALA A CB  1 
ATOM   2820  N  N   . ALA A  1 381 ? 53.579 90.272  47.479  1.00 46.87  ? 381 ALA A N   1 
ATOM   2821  C  CA  . ALA A  1 381 ? 53.238 89.887  48.850  1.00 45.85  ? 381 ALA A CA  1 
ATOM   2822  C  C   . ALA A  1 381 ? 53.161 88.367  48.976  1.00 50.42  ? 381 ALA A C   1 
ATOM   2823  O  O   . ALA A  1 381 ? 53.717 87.820  49.927  1.00 49.79  ? 381 ALA A O   1 
ATOM   2824  C  CB  . ALA A  1 381 ? 51.919 90.518  49.267  1.00 45.78  ? 381 ALA A CB  1 
ATOM   2825  N  N   . GLU A  1 382 ? 52.500 87.686  48.001  1.00 47.41  ? 382 GLU A N   1 
ATOM   2826  C  CA  . GLU A  1 382 ? 52.357 86.225  47.945  1.00 47.16  ? 382 GLU A CA  1 
ATOM   2827  C  C   . GLU A  1 382 ? 53.726 85.563  47.817  1.00 51.30  ? 382 GLU A C   1 
ATOM   2828  O  O   . GLU A  1 382 ? 53.937 84.495  48.388  1.00 51.10  ? 382 GLU A O   1 
ATOM   2829  C  CB  . GLU A  1 382 ? 51.447 85.804  46.778  1.00 48.67  ? 382 GLU A CB  1 
ATOM   2830  C  CG  . GLU A  1 382 ? 50.952 84.369  46.841  1.00 58.55  ? 382 GLU A CG  1 
ATOM   2831  N  N   . PHE A  1 383 ? 54.652 86.206  47.084  1.00 48.01  ? 383 PHE A N   1 
ATOM   2832  C  CA  . PHE A  1 383 ? 56.014 85.727  46.882  1.00 48.49  ? 383 PHE A CA  1 
ATOM   2833  C  C   . PHE A  1 383 ? 56.821 85.825  48.181  1.00 50.45  ? 383 PHE A C   1 
ATOM   2834  O  O   . PHE A  1 383 ? 57.436 84.837  48.578  1.00 50.48  ? 383 PHE A O   1 
ATOM   2835  C  CB  . PHE A  1 383 ? 56.710 86.508  45.746  1.00 51.72  ? 383 PHE A CB  1 
ATOM   2836  C  CG  . PHE A  1 383 ? 58.210 86.323  45.672  1.00 54.80  ? 383 PHE A CG  1 
ATOM   2837  C  CD1 . PHE A  1 383 ? 58.759 85.171  45.119  1.00 58.34  ? 383 PHE A CD1 1 
ATOM   2838  C  CD2 . PHE A  1 383 ? 59.073 87.299  46.162  1.00 58.18  ? 383 PHE A CD2 1 
ATOM   2839  C  CE1 . PHE A  1 383 ? 60.144 84.995  45.062  1.00 60.34  ? 383 PHE A CE1 1 
ATOM   2840  C  CE2 . PHE A  1 383 ? 60.459 87.123  46.102  1.00 62.13  ? 383 PHE A CE2 1 
ATOM   2841  C  CZ  . PHE A  1 383 ? 60.984 85.973  45.550  1.00 60.47  ? 383 PHE A CZ  1 
ATOM   2842  N  N   . LEU A  1 384 ? 56.828 87.013  48.821  1.00 45.08  ? 384 LEU A N   1 
ATOM   2843  C  CA  . LEU A  1 384 ? 57.582 87.283  50.046  1.00 43.86  ? 384 LEU A CA  1 
ATOM   2844  C  C   . LEU A  1 384 ? 57.101 86.453  51.231  1.00 45.33  ? 384 LEU A C   1 
ATOM   2845  O  O   . LEU A  1 384 ? 57.946 86.008  52.000  1.00 44.81  ? 384 LEU A O   1 
ATOM   2846  C  CB  . LEU A  1 384 ? 57.551 88.774  50.414  1.00 43.75  ? 384 LEU A CB  1 
ATOM   2847  C  CG  . LEU A  1 384 ? 58.401 89.715  49.558  1.00 48.94  ? 384 LEU A CG  1 
ATOM   2848  C  CD1 . LEU A  1 384 ? 57.951 91.129  49.738  1.00 48.89  ? 384 LEU A CD1 1 
ATOM   2849  C  CD2 . LEU A  1 384 ? 59.882 89.609  49.895  1.00 52.07  ? 384 LEU A CD2 1 
ATOM   2850  N  N   . THR A  1 385 ? 55.771 86.234  51.381  1.00 40.52  ? 385 THR A N   1 
ATOM   2851  C  CA  . THR A  1 385 ? 55.224 85.438  52.494  1.00 39.21  ? 385 THR A CA  1 
ATOM   2852  C  C   . THR A  1 385 ? 55.601 83.958  52.299  1.00 43.37  ? 385 THR A C   1 
ATOM   2853  O  O   . THR A  1 385 ? 55.852 83.257  53.284  1.00 42.86  ? 385 THR A O   1 
ATOM   2854  C  CB  . THR A  1 385 ? 53.710 85.646  52.675  1.00 39.81  ? 385 THR A CB  1 
ATOM   2855  O  OG1 . THR A  1 385 ? 53.386 87.022  52.492  1.00 37.19  ? 385 THR A OG1 1 
ATOM   2856  C  CG2 . THR A  1 385 ? 53.231 85.225  54.052  1.00 35.01  ? 385 THR A CG2 1 
ATOM   2857  N  N   . SER A  1 386 ? 55.674 83.502  51.035  1.00 40.46  ? 386 SER A N   1 
ATOM   2858  C  CA  . SER A  1 386 ? 56.101 82.142  50.707  1.00 40.81  ? 386 SER A CA  1 
ATOM   2859  C  C   . SER A  1 386 ? 57.607 82.010  50.948  1.00 46.09  ? 386 SER A C   1 
ATOM   2860  O  O   . SER A  1 386 ? 58.054 81.004  51.497  1.00 46.35  ? 386 SER A O   1 
ATOM   2861  C  CB  . SER A  1 386 ? 55.759 81.796  49.260  1.00 43.94  ? 386 SER A CB  1 
ATOM   2862  O  OG  . SER A  1 386 ? 54.359 81.676  49.071  1.00 51.88  ? 386 SER A OG  1 
ATOM   2863  N  N   . TRP A  1 387 ? 58.377 83.051  50.568  1.00 42.97  ? 387 TRP A N   1 
ATOM   2864  C  CA  . TRP A  1 387 ? 59.830 83.109  50.712  1.00 43.86  ? 387 TRP A CA  1 
ATOM   2865  C  C   . TRP A  1 387 ? 60.239 83.184  52.190  1.00 50.04  ? 387 TRP A C   1 
ATOM   2866  O  O   . TRP A  1 387 ? 61.252 82.581  52.551  1.00 51.28  ? 387 TRP A O   1 
ATOM   2867  C  CB  . TRP A  1 387 ? 60.406 84.284  49.914  1.00 42.82  ? 387 TRP A CB  1 
ATOM   2868  C  CG  . TRP A  1 387 ? 61.871 84.515  50.120  1.00 44.67  ? 387 TRP A CG  1 
ATOM   2869  C  CD1 . TRP A  1 387 ? 62.896 83.703  49.734  1.00 48.33  ? 387 TRP A CD1 1 
ATOM   2870  C  CD2 . TRP A  1 387 ? 62.470 85.638  50.771  1.00 44.90  ? 387 TRP A CD2 1 
ATOM   2871  N  NE1 . TRP A  1 387 ? 64.100 84.250  50.109  1.00 48.65  ? 387 TRP A NE1 1 
ATOM   2872  C  CE2 . TRP A  1 387 ? 63.869 85.442  50.744  1.00 49.86  ? 387 TRP A CE2 1 
ATOM   2873  C  CE3 . TRP A  1 387 ? 61.958 86.799  51.376  1.00 45.86  ? 387 TRP A CE3 1 
ATOM   2874  C  CZ2 . TRP A  1 387 ? 64.764 86.365  51.296  1.00 50.01  ? 387 TRP A CZ2 1 
ATOM   2875  C  CZ3 . TRP A  1 387 ? 62.845 87.707  51.931  1.00 48.12  ? 387 TRP A CZ3 1 
ATOM   2876  C  CH2 . TRP A  1 387 ? 64.230 87.497  51.872  1.00 49.94  ? 387 TRP A CH2 1 
ATOM   2877  N  N   . GLU A  1 388 ? 59.434 83.874  53.045  1.00 46.25  ? 388 GLU A N   1 
ATOM   2878  C  CA  . GLU A  1 388 ? 59.638 83.991  54.502  1.00 45.88  ? 388 GLU A CA  1 
ATOM   2879  C  C   . GLU A  1 388 ? 59.756 82.602  55.146  1.00 49.39  ? 388 GLU A C   1 
ATOM   2880  O  O   . GLU A  1 388 ? 60.428 82.449  56.166  1.00 48.83  ? 388 GLU A O   1 
ATOM   2881  C  CB  . GLU A  1 388 ? 58.472 84.758  55.151  1.00 46.37  ? 388 GLU A CB  1 
ATOM   2882  C  CG  . GLU A  1 388 ? 58.602 86.271  55.110  1.00 55.85  ? 388 GLU A CG  1 
ATOM   2883  C  CD  . GLU A  1 388 ? 57.298 87.048  55.163  1.00 73.33  ? 388 GLU A CD  1 
ATOM   2884  O  OE1 . GLU A  1 388 ? 56.262 86.477  55.572  1.00 74.76  ? 388 GLU A OE1 1 
ATOM   2885  O  OE2 . GLU A  1 388 ? 57.317 88.247  54.809  1.00 62.50  ? 388 GLU A OE2 1 
ATOM   2886  N  N   . ASN A  1 389 ? 59.091 81.602  54.520  1.00 45.75  ? 389 ASN A N   1 
ATOM   2887  C  CA  . ASN A  1 389 ? 59.053 80.179  54.847  1.00 45.58  ? 389 ASN A CA  1 
ATOM   2888  C  C   . ASN A  1 389 ? 58.381 79.930  56.204  1.00 49.09  ? 389 ASN A C   1 
ATOM   2889  O  O   . ASN A  1 389 ? 59.042 79.570  57.179  1.00 49.02  ? 389 ASN A O   1 
ATOM   2890  C  CB  . ASN A  1 389 ? 60.460 79.547  54.774  1.00 46.97  ? 389 ASN A CB  1 
ATOM   2891  C  CG  . ASN A  1 389 ? 60.478 78.041  54.770  1.00 63.71  ? 389 ASN A CG  1 
ATOM   2892  O  OD1 . ASN A  1 389 ? 59.603 77.380  54.204  1.00 58.85  ? 389 ASN A OD1 1 
ATOM   2893  N  ND2 . ASN A  1 389 ? 61.504 77.465  55.369  1.00 52.75  ? 389 ASN A ND2 1 
ATOM   2894  N  N   . HIS A  1 390 ? 57.048 80.100  56.246  1.00 45.01  ? 390 HIS A N   1 
ATOM   2895  C  CA  . HIS A  1 390 ? 56.235 79.856  57.440  1.00 44.30  ? 390 HIS A CA  1 
ATOM   2896  C  C   . HIS A  1 390 ? 55.939 78.361  57.555  1.00 46.66  ? 390 HIS A C   1 
ATOM   2897  O  O   . HIS A  1 390 ? 55.708 77.707  56.536  1.00 46.39  ? 390 HIS A O   1 
ATOM   2898  C  CB  . HIS A  1 390 ? 54.941 80.682  57.396  1.00 44.58  ? 390 HIS A CB  1 
ATOM   2899  C  CG  . HIS A  1 390 ? 55.191 82.154  57.477  1.00 48.37  ? 390 HIS A CG  1 
ATOM   2900  N  ND1 . HIS A  1 390 ? 55.258 82.807  58.697  1.00 50.32  ? 390 HIS A ND1 1 
ATOM   2901  C  CD2 . HIS A  1 390 ? 55.430 83.047  56.490  1.00 50.25  ? 390 HIS A CD2 1 
ATOM   2902  C  CE1 . HIS A  1 390 ? 55.521 84.073  58.411  1.00 49.70  ? 390 HIS A CE1 1 
ATOM   2903  N  NE2 . HIS A  1 390 ? 55.627 84.265  57.097  1.00 50.03  ? 390 HIS A NE2 1 
ATOM   2904  N  N   . ARG A  1 391 ? 55.977 77.815  58.782  1.00 42.23  ? 391 ARG A N   1 
ATOM   2905  C  CA  . ARG A  1 391 ? 55.759 76.387  59.010  1.00 41.95  ? 391 ARG A CA  1 
ATOM   2906  C  C   . ARG A  1 391 ? 54.285 75.997  58.903  1.00 46.60  ? 391 ARG A C   1 
ATOM   2907  O  O   . ARG A  1 391 ? 53.988 74.985  58.272  1.00 47.26  ? 391 ARG A O   1 
ATOM   2908  C  CB  . ARG A  1 391 ? 56.333 75.935  60.359  1.00 41.05  ? 391 ARG A CB  1 
ATOM   2909  C  CG  . ARG A  1 391 ? 56.599 74.438  60.416  1.00 45.09  ? 391 ARG A CG  1 
ATOM   2910  C  CD  . ARG A  1 391 ? 56.891 73.961  61.817  1.00 51.00  ? 391 ARG A CD  1 
ATOM   2911  N  NE  . ARG A  1 391 ? 56.412 72.595  62.027  1.00 58.95  ? 391 ARG A NE  1 
ATOM   2912  C  CZ  . ARG A  1 391 ? 55.207 72.289  62.497  1.00 75.28  ? 391 ARG A CZ  1 
ATOM   2913  N  NH1 . ARG A  1 391 ? 54.346 73.247  62.813  1.00 63.40  ? 391 ARG A NH1 1 
ATOM   2914  N  NH2 . ARG A  1 391 ? 54.853 71.020  62.654  1.00 64.45  ? 391 ARG A NH2 1 
ATOM   2915  N  N   . LEU A  1 392 ? 53.372 76.762  59.521  1.00 42.80  ? 392 LEU A N   1 
ATOM   2916  C  CA  . LEU A  1 392 ? 51.944 76.446  59.483  1.00 42.12  ? 392 LEU A CA  1 
ATOM   2917  C  C   . LEU A  1 392 ? 51.199 77.329  58.488  1.00 45.94  ? 392 LEU A C   1 
ATOM   2918  O  O   . LEU A  1 392 ? 51.591 78.478  58.281  1.00 46.44  ? 392 LEU A O   1 
ATOM   2919  C  CB  . LEU A  1 392 ? 51.328 76.577  60.881  1.00 42.04  ? 392 LEU A CB  1 
ATOM   2920  C  CG  . LEU A  1 392 ? 51.573 75.388  61.799  1.00 47.32  ? 392 LEU A CG  1 
ATOM   2921  C  CD1 . LEU A  1 392 ? 51.847 75.842  63.211  1.00 48.02  ? 392 LEU A CD1 1 
ATOM   2922  C  CD2 . LEU A  1 392 ? 50.414 74.404  61.748  1.00 49.88  ? 392 LEU A CD2 1 
ATOM   2923  N  N   . GLU A  1 393 ? 50.126 76.785  57.869  1.00 41.54  ? 393 GLU A N   1 
ATOM   2924  C  CA  . GLU A  1 393 ? 49.287 77.486  56.887  1.00 40.82  ? 393 GLU A CA  1 
ATOM   2925  C  C   . GLU A  1 393 ? 48.647 78.743  57.510  1.00 44.39  ? 393 GLU A C   1 
ATOM   2926  O  O   . GLU A  1 393 ? 48.577 79.778  56.841  1.00 43.84  ? 393 GLU A O   1 
ATOM   2927  C  CB  . GLU A  1 393 ? 48.213 76.535  56.322  1.00 41.90  ? 393 GLU A CB  1 
ATOM   2928  C  CG  . GLU A  1 393 ? 47.254 77.145  55.304  1.00 50.68  ? 393 GLU A CG  1 
ATOM   2929  C  CD  . GLU A  1 393 ? 47.826 77.585  53.971  1.00 65.01  ? 393 GLU A CD  1 
ATOM   2930  O  OE1 . GLU A  1 393 ? 47.516 78.718  53.541  1.00 51.16  ? 393 GLU A OE1 1 
ATOM   2931  O  OE2 . GLU A  1 393 ? 48.544 76.782  53.333  1.00 62.03  ? 393 GLU A OE2 1 
ATOM   2932  N  N   . SER A  1 394 ? 48.222 78.651  58.794  1.00 40.45  ? 394 SER A N   1 
ATOM   2933  C  CA  . SER A  1 394 ? 47.620 79.745  59.560  1.00 39.53  ? 394 SER A CA  1 
ATOM   2934  C  C   . SER A  1 394 ? 48.575 80.941  59.654  1.00 43.71  ? 394 SER A C   1 
ATOM   2935  O  O   . SER A  1 394 ? 48.139 82.073  59.448  1.00 43.91  ? 394 SER A O   1 
ATOM   2936  C  CB  . SER A  1 394 ? 47.222 79.270  60.953  1.00 42.54  ? 394 SER A CB  1 
ATOM   2937  O  OG  . SER A  1 394 ? 48.338 78.797  61.688  1.00 50.92  ? 394 SER A OG  1 
ATOM   2938  N  N   . ALA A  1 395 ? 49.877 80.681  59.916  1.00 39.73  ? 395 ALA A N   1 
ATOM   2939  C  CA  . ALA A  1 395 ? 50.928 81.698  59.993  1.00 39.33  ? 395 ALA A CA  1 
ATOM   2940  C  C   . ALA A  1 395 ? 51.110 82.387  58.636  1.00 41.81  ? 395 ALA A C   1 
ATOM   2941  O  O   . ALA A  1 395 ? 51.102 83.614  58.579  1.00 40.69  ? 395 ALA A O   1 
ATOM   2942  C  CB  . ALA A  1 395 ? 52.237 81.070  60.447  1.00 40.83  ? 395 ALA A CB  1 
ATOM   2943  N  N   . TYR A  1 396 ? 51.212 81.594  57.542  1.00 38.51  ? 396 TYR A N   1 
ATOM   2944  C  CA  . TYR A  1 396 ? 51.342 82.092  56.168  1.00 38.22  ? 396 TYR A CA  1 
ATOM   2945  C  C   . TYR A  1 396 ? 50.176 83.032  55.841  1.00 41.90  ? 396 TYR A C   1 
ATOM   2946  O  O   . TYR A  1 396 ? 50.400 84.108  55.291  1.00 41.35  ? 396 TYR A O   1 
ATOM   2947  C  CB  . TYR A  1 396 ? 51.406 80.923  55.151  1.00 39.07  ? 396 TYR A CB  1 
ATOM   2948  C  CG  . TYR A  1 396 ? 51.267 81.356  53.702  1.00 40.51  ? 396 TYR A CG  1 
ATOM   2949  C  CD1 . TYR A  1 396 ? 52.366 81.801  52.977  1.00 43.29  ? 396 TYR A CD1 1 
ATOM   2950  C  CD2 . TYR A  1 396 ? 50.030 81.328  53.060  1.00 40.44  ? 396 TYR A CD2 1 
ATOM   2951  C  CE1 . TYR A  1 396 ? 52.239 82.223  51.653  1.00 44.18  ? 396 TYR A CE1 1 
ATOM   2952  C  CE2 . TYR A  1 396 ? 49.889 81.753  51.740  1.00 41.17  ? 396 TYR A CE2 1 
ATOM   2953  C  CZ  . TYR A  1 396 ? 50.998 82.197  51.039  1.00 48.44  ? 396 TYR A CZ  1 
ATOM   2954  O  OH  . TYR A  1 396 ? 50.866 82.608  49.735  1.00 48.33  ? 396 TYR A OH  1 
ATOM   2955  N  N   . GLN A  1 397 ? 48.942 82.622  56.194  1.00 38.43  ? 397 GLN A N   1 
ATOM   2956  C  CA  . GLN A  1 397 ? 47.724 83.382  55.940  1.00 38.03  ? 397 GLN A CA  1 
ATOM   2957  C  C   . GLN A  1 397 ? 47.720 84.705  56.702  1.00 43.34  ? 397 GLN A C   1 
ATOM   2958  O  O   . GLN A  1 397 ? 47.537 85.743  56.072  1.00 43.26  ? 397 GLN A O   1 
ATOM   2959  C  CB  . GLN A  1 397 ? 46.470 82.555  56.276  1.00 38.85  ? 397 GLN A CB  1 
ATOM   2960  C  CG  . GLN A  1 397 ? 46.130 81.480  55.237  1.00 47.89  ? 397 GLN A CG  1 
ATOM   2961  C  CD  . GLN A  1 397 ? 45.850 82.022  53.850  1.00 67.18  ? 397 GLN A CD  1 
ATOM   2962  O  OE1 . GLN A  1 397 ? 45.168 83.039  53.663  1.00 61.81  ? 397 GLN A OE1 1 
ATOM   2963  N  NE2 . GLN A  1 397 ? 46.356 81.335  52.840  1.00 62.10  ? 397 GLN A NE2 1 
ATOM   2964  N  N   . ASN A  1 398 ? 47.974 84.678  58.029  1.00 40.79  ? 398 ASN A N   1 
ATOM   2965  C  CA  . ASN A  1 398 ? 47.992 85.871  58.890  1.00 40.71  ? 398 ASN A CA  1 
ATOM   2966  C  C   . ASN A  1 398 ? 48.999 86.928  58.414  1.00 45.42  ? 398 ASN A C   1 
ATOM   2967  O  O   . ASN A  1 398 ? 48.667 88.115  58.415  1.00 45.42  ? 398 ASN A O   1 
ATOM   2968  C  CB  . ASN A  1 398 ? 48.278 85.496  60.345  1.00 39.18  ? 398 ASN A CB  1 
ATOM   2969  C  CG  . ASN A  1 398 ? 47.187 84.688  61.002  1.00 55.42  ? 398 ASN A CG  1 
ATOM   2970  O  OD1 . ASN A  1 398 ? 45.987 84.915  60.799  1.00 49.48  ? 398 ASN A OD1 1 
ATOM   2971  N  ND2 . ASN A  1 398 ? 47.585 83.732  61.827  1.00 46.75  ? 398 ASN A ND2 1 
ATOM   2972  N  N   . HIS A  1 399 ? 50.207 86.498  57.994  1.00 41.98  ? 399 HIS A N   1 
ATOM   2973  C  CA  . HIS A  1 399 ? 51.253 87.397  57.503  1.00 42.13  ? 399 HIS A CA  1 
ATOM   2974  C  C   . HIS A  1 399 ? 50.889 87.963  56.129  1.00 45.80  ? 399 HIS A C   1 
ATOM   2975  O  O   . HIS A  1 399 ? 51.084 89.158  55.907  1.00 45.44  ? 399 HIS A O   1 
ATOM   2976  C  CB  . HIS A  1 399 ? 52.611 86.691  57.464  1.00 43.41  ? 399 HIS A CB  1 
ATOM   2977  C  CG  . HIS A  1 399 ? 53.243 86.550  58.811  1.00 47.19  ? 399 HIS A CG  1 
ATOM   2978  N  ND1 . HIS A  1 399 ? 54.373 87.265  59.151  1.00 49.83  ? 399 HIS A ND1 1 
ATOM   2979  C  CD2 . HIS A  1 399 ? 52.869 85.793  59.870  1.00 48.92  ? 399 HIS A CD2 1 
ATOM   2980  C  CE1 . HIS A  1 399 ? 54.656 86.918  60.398  1.00 49.56  ? 399 HIS A CE1 1 
ATOM   2981  N  NE2 . HIS A  1 399 ? 53.778 86.034  60.872  1.00 49.31  ? 399 HIS A NE2 1 
ATOM   2982  N  N   . LEU A  1 400 ? 50.331 87.122  55.227  1.00 42.38  ? 400 LEU A N   1 
ATOM   2983  C  CA  . LEU A  1 400 ? 49.913 87.535  53.883  1.00 42.29  ? 400 LEU A CA  1 
ATOM   2984  C  C   . LEU A  1 400 ? 48.742 88.520  53.958  1.00 45.12  ? 400 LEU A C   1 
ATOM   2985  O  O   . LEU A  1 400 ? 48.777 89.534  53.258  1.00 44.78  ? 400 LEU A O   1 
ATOM   2986  C  CB  . LEU A  1 400 ? 49.553 86.323  52.996  1.00 42.37  ? 400 LEU A CB  1 
ATOM   2987  C  CG  . LEU A  1 400 ? 49.087 86.599  51.548  1.00 47.44  ? 400 LEU A CG  1 
ATOM   2988  C  CD1 . LEU A  1 400 ? 50.140 87.348  50.742  1.00 48.21  ? 400 LEU A CD1 1 
ATOM   2989  C  CD2 . LEU A  1 400 ? 48.730 85.314  50.839  1.00 50.29  ? 400 LEU A CD2 1 
ATOM   2990  N  N   . ILE A  1 401 ? 47.727 88.234  54.815  1.00 40.61  ? 401 ILE A N   1 
ATOM   2991  C  CA  . ILE A  1 401 ? 46.559 89.103  55.010  1.00 39.82  ? 401 ILE A CA  1 
ATOM   2992  C  C   . ILE A  1 401 ? 47.049 90.481  55.478  1.00 44.23  ? 401 ILE A C   1 
ATOM   2993  O  O   . ILE A  1 401 ? 46.708 91.478  54.848  1.00 44.65  ? 401 ILE A O   1 
ATOM   2994  C  CB  . ILE A  1 401 ? 45.490 88.497  55.976  1.00 42.10  ? 401 ILE A CB  1 
ATOM   2995  C  CG1 . ILE A  1 401 ? 44.833 87.238  55.369  1.00 42.04  ? 401 ILE A CG1 1 
ATOM   2996  C  CG2 . ILE A  1 401 ? 44.408 89.536  56.328  1.00 42.63  ? 401 ILE A CG2 1 
ATOM   2997  C  CD1 . ILE A  1 401 ? 44.178 86.289  56.387  1.00 45.82  ? 401 ILE A CD1 1 
ATOM   2998  N  N   . LEU A  1 402 ? 47.909 90.516  56.513  1.00 40.09  ? 402 LEU A N   1 
ATOM   2999  C  CA  . LEU A  1 402 ? 48.467 91.736  57.096  1.00 39.88  ? 402 LEU A CA  1 
ATOM   3000  C  C   . LEU A  1 402 ? 49.189 92.621  56.064  1.00 43.82  ? 402 LEU A C   1 
ATOM   3001  O  O   . LEU A  1 402 ? 49.016 93.838  56.112  1.00 43.99  ? 402 LEU A O   1 
ATOM   3002  C  CB  . LEU A  1 402 ? 49.418 91.386  58.256  1.00 40.08  ? 402 LEU A CB  1 
ATOM   3003  C  CG  . LEU A  1 402 ? 49.775 92.512  59.234  1.00 45.04  ? 402 LEU A CG  1 
ATOM   3004  C  CD1 . LEU A  1 402 ? 48.569 92.949  60.058  1.00 44.71  ? 402 LEU A CD1 1 
ATOM   3005  C  CD2 . LEU A  1 402 ? 50.871 92.076  60.169  1.00 47.95  ? 402 LEU A CD2 1 
ATOM   3006  N  N   . LYS A  1 403 ? 49.968 92.024  55.137  1.00 40.20  ? 403 LYS A N   1 
ATOM   3007  C  CA  . LYS A  1 403 ? 50.706 92.763  54.102  1.00 40.56  ? 403 LYS A CA  1 
ATOM   3008  C  C   . LYS A  1 403 ? 49.760 93.422  53.095  1.00 44.62  ? 403 LYS A C   1 
ATOM   3009  O  O   . LYS A  1 403 ? 49.837 94.634  52.885  1.00 44.74  ? 403 LYS A O   1 
ATOM   3010  C  CB  . LYS A  1 403 ? 51.687 91.846  53.355  1.00 43.19  ? 403 LYS A CB  1 
ATOM   3011  C  CG  . LYS A  1 403 ? 52.902 91.423  54.162  1.00 57.05  ? 403 LYS A CG  1 
ATOM   3012  C  CD  . LYS A  1 403 ? 53.402 90.059  53.710  1.00 64.98  ? 403 LYS A CD  1 
ATOM   3013  C  CE  . LYS A  1 403 ? 54.573 90.131  52.768  1.00 74.88  ? 403 LYS A CE  1 
ATOM   3014  N  NZ  . LYS A  1 403 ? 55.845 90.250  53.510  1.00 84.84  ? 403 LYS A NZ  1 
ATOM   3015  N  N   . VAL A  1 404 ? 48.869 92.618  52.483  1.00 40.67  ? 404 VAL A N   1 
ATOM   3016  C  CA  . VAL A  1 404 ? 47.905 93.043  51.465  1.00 40.55  ? 404 VAL A CA  1 
ATOM   3017  C  C   . VAL A  1 404 ? 46.882 94.038  52.061  1.00 44.38  ? 404 VAL A C   1 
ATOM   3018  O  O   . VAL A  1 404 ? 46.511 95.006  51.388  1.00 45.19  ? 404 VAL A O   1 
ATOM   3019  C  CB  . VAL A  1 404 ? 47.202 91.821  50.806  1.00 43.96  ? 404 VAL A CB  1 
ATOM   3020  C  CG1 . VAL A  1 404 ? 46.262 92.257  49.690  1.00 43.87  ? 404 VAL A CG1 1 
ATOM   3021  C  CG2 . VAL A  1 404 ? 48.221 90.818  50.268  1.00 44.02  ? 404 VAL A CG2 1 
ATOM   3022  N  N   . LEU A  1 405 ? 46.461 93.812  53.320  1.00 39.01  ? 405 LEU A N   1 
ATOM   3023  C  CA  . LEU A  1 405 ? 45.470 94.632  54.015  1.00 38.18  ? 405 LEU A CA  1 
ATOM   3024  C  C   . LEU A  1 405 ? 45.927 96.075  54.243  1.00 42.65  ? 405 LEU A C   1 
ATOM   3025  O  O   . LEU A  1 405 ? 45.156 96.981  53.924  1.00 42.14  ? 405 LEU A O   1 
ATOM   3026  C  CB  . LEU A  1 405 ? 45.085 93.994  55.355  1.00 37.44  ? 405 LEU A CB  1 
ATOM   3027  C  CG  . LEU A  1 405 ? 44.067 94.720  56.221  1.00 41.33  ? 405 LEU A CG  1 
ATOM   3028  C  CD1 . LEU A  1 405 ? 42.722 94.817  55.535  1.00 41.46  ? 405 LEU A CD1 1 
ATOM   3029  C  CD2 . LEU A  1 405 ? 43.927 94.033  57.527  1.00 42.11  ? 405 LEU A CD2 1 
ATOM   3030  N  N   . VAL A  1 406 ? 47.147 96.296  54.802  1.00 39.65  ? 406 VAL A N   1 
ATOM   3031  C  CA  . VAL A  1 406 ? 47.673 97.648  55.081  1.00 39.91  ? 406 VAL A CA  1 
ATOM   3032  C  C   . VAL A  1 406 ? 47.774 98.462  53.770  1.00 46.09  ? 406 VAL A C   1 
ATOM   3033  O  O   . VAL A  1 406 ? 47.533 99.670  53.785  1.00 46.63  ? 406 VAL A O   1 
ATOM   3034  C  CB  . VAL A  1 406 ? 49.000 97.691  55.899  1.00 43.29  ? 406 VAL A CB  1 
ATOM   3035  C  CG1 . VAL A  1 406 ? 48.782 97.174  57.312  1.00 42.56  ? 406 VAL A CG1 1 
ATOM   3036  C  CG2 . VAL A  1 406 ? 50.136 96.944  55.207  1.00 43.33  ? 406 VAL A CG2 1 
ATOM   3037  N  N   . PHE A  1 407 ? 48.051 97.778  52.642  1.00 42.78  ? 407 PHE A N   1 
ATOM   3038  C  CA  . PHE A  1 407 ? 48.139 98.365  51.310  1.00 43.30  ? 407 PHE A CA  1 
ATOM   3039  C  C   . PHE A  1 407 ? 46.749 98.743  50.801  1.00 48.84  ? 407 PHE A C   1 
ATOM   3040  O  O   . PHE A  1 407 ? 46.553 99.884  50.376  1.00 49.66  ? 407 PHE A O   1 
ATOM   3041  C  CB  . PHE A  1 407 ? 48.813 97.376  50.348  1.00 44.92  ? 407 PHE A CB  1 
ATOM   3042  C  CG  . PHE A  1 407 ? 49.107 97.906  48.966  1.00 46.82  ? 407 PHE A CG  1 
ATOM   3043  C  CD1 . PHE A  1 407 ? 50.194 98.743  48.741  1.00 50.55  ? 407 PHE A CD1 1 
ATOM   3044  C  CD2 . PHE A  1 407 ? 48.322 97.538  47.883  1.00 48.34  ? 407 PHE A CD2 1 
ATOM   3045  C  CE1 . PHE A  1 407 ? 50.474 99.224  47.461  1.00 52.02  ? 407 PHE A CE1 1 
ATOM   3046  C  CE2 . PHE A  1 407 ? 48.604 98.019  46.602  1.00 52.05  ? 407 PHE A CE2 1 
ATOM   3047  C  CZ  . PHE A  1 407 ? 49.673 98.864  46.402  1.00 50.97  ? 407 PHE A CZ  1 
ATOM   3048  N  N   . ASN A  1 408 ? 45.784 97.788  50.856  1.00 44.86  ? 408 ASN A N   1 
ATOM   3049  C  CA  . ASN A  1 408 ? 44.399 97.986  50.415  1.00 44.14  ? 408 ASN A CA  1 
ATOM   3050  C  C   . ASN A  1 408 ? 43.704 99.068  51.244  1.00 47.30  ? 408 ASN A C   1 
ATOM   3051  O  O   . ASN A  1 408 ? 42.969 99.881  50.683  1.00 46.91  ? 408 ASN A O   1 
ATOM   3052  C  CB  . ASN A  1 408 ? 43.612 96.672  50.471  1.00 42.70  ? 408 ASN A CB  1 
ATOM   3053  C  CG  . ASN A  1 408 ? 43.956 95.689  49.369  1.00 64.06  ? 408 ASN A CG  1 
ATOM   3054  O  OD1 . ASN A  1 408 ? 44.530 96.036  48.331  1.00 60.37  ? 408 ASN A OD1 1 
ATOM   3055  N  ND2 . ASN A  1 408 ? 43.591 94.432  49.558  1.00 54.74  ? 408 ASN A ND2 1 
ATOM   3056  N  N   . PHE A  1 409 ? 43.984 99.110  52.561  1.00 43.59  ? 409 PHE A N   1 
ATOM   3057  C  CA  . PHE A  1 409 ? 43.415 100.097 53.473  1.00 43.45  ? 409 PHE A CA  1 
ATOM   3058  C  C   . PHE A  1 409 ? 43.921 101.498 53.122  1.00 47.51  ? 409 PHE A C   1 
ATOM   3059  O  O   . PHE A  1 409 ? 43.111 102.420 53.011  1.00 47.79  ? 409 PHE A O   1 
ATOM   3060  C  CB  . PHE A  1 409 ? 43.727 99.737  54.942  1.00 45.01  ? 409 PHE A CB  1 
ATOM   3061  C  CG  . PHE A  1 409 ? 43.711 100.892 55.920  1.00 47.24  ? 409 PHE A CG  1 
ATOM   3062  C  CD1 . PHE A  1 409 ? 42.509 101.441 56.356  1.00 50.45  ? 409 PHE A CD1 1 
ATOM   3063  C  CD2 . PHE A  1 409 ? 44.896 101.421 56.417  1.00 49.93  ? 409 PHE A CD2 1 
ATOM   3064  C  CE1 . PHE A  1 409 ? 42.496 102.516 57.245  1.00 51.62  ? 409 PHE A CE1 1 
ATOM   3065  C  CE2 . PHE A  1 409 ? 44.881 102.494 57.311  1.00 53.00  ? 409 PHE A CE2 1 
ATOM   3066  C  CZ  . PHE A  1 409 ? 43.682 103.032 57.720  1.00 51.00  ? 409 PHE A CZ  1 
ATOM   3067  N  N   . LEU A  1 410 ? 45.246 101.646 52.918  1.00 43.56  ? 410 LEU A N   1 
ATOM   3068  C  CA  . LEU A  1 410 ? 45.872 102.926 52.594  1.00 43.74  ? 410 LEU A CA  1 
ATOM   3069  C  C   . LEU A  1 410 ? 45.375 103.482 51.257  1.00 48.11  ? 410 LEU A C   1 
ATOM   3070  O  O   . LEU A  1 410 ? 44.983 104.640 51.219  1.00 48.23  ? 410 LEU A O   1 
ATOM   3071  C  CB  . LEU A  1 410 ? 47.397 102.813 52.590  1.00 43.99  ? 410 LEU A CB  1 
ATOM   3072  C  CG  . LEU A  1 410 ? 48.136 104.082 52.971  1.00 49.26  ? 410 LEU A CG  1 
ATOM   3073  C  CD1 . LEU A  1 410 ? 49.325 103.770 53.836  1.00 49.39  ? 410 LEU A CD1 1 
ATOM   3074  C  CD2 . LEU A  1 410 ? 48.558 104.858 51.744  1.00 52.99  ? 410 LEU A CD2 1 
ATOM   3075  N  N   . ASN A  1 411 ? 45.351 102.667 50.183  1.00 44.64  ? 411 ASN A N   1 
ATOM   3076  C  CA  . ASN A  1 411 ? 44.887 103.105 48.858  1.00 45.08  ? 411 ASN A CA  1 
ATOM   3077  C  C   . ASN A  1 411 ? 43.413 103.523 48.855  1.00 49.65  ? 411 ASN A C   1 
ATOM   3078  O  O   . ASN A  1 411 ? 43.017 104.357 48.036  1.00 50.40  ? 411 ASN A O   1 
ATOM   3079  C  CB  . ASN A  1 411 ? 45.097 102.012 47.825  1.00 44.07  ? 411 ASN A CB  1 
ATOM   3080  C  CG  . ASN A  1 411 ? 46.540 101.760 47.509  1.00 62.06  ? 411 ASN A CG  1 
ATOM   3081  O  OD1 . ASN A  1 411 ? 47.284 102.655 47.099  1.00 56.96  ? 411 ASN A OD1 1 
ATOM   3082  N  ND2 . ASN A  1 411 ? 46.959 100.527 47.678  1.00 52.74  ? 411 ASN A ND2 1 
ATOM   3083  N  N   . CYS A  1 412 ? 42.614 102.954 49.773  1.00 45.37  ? 412 CYS A N   1 
ATOM   3084  C  CA  . CYS A  1 412 ? 41.191 103.237 49.892  1.00 45.32  ? 412 CYS A CA  1 
ATOM   3085  C  C   . CYS A  1 412 ? 40.914 104.443 50.804  1.00 48.02  ? 412 CYS A C   1 
ATOM   3086  O  O   . CYS A  1 412 ? 40.053 105.256 50.464  1.00 48.42  ? 412 CYS A O   1 
ATOM   3087  C  CB  . CYS A  1 412 ? 40.446 101.998 50.381  1.00 45.33  ? 412 CYS A CB  1 
ATOM   3088  S  SG  . CYS A  1 412 ? 38.646 102.191 50.459  1.00 49.61  ? 412 CYS A SG  1 
ATOM   3089  N  N   . PHE A  1 413 ? 41.614 104.552 51.955  1.00 42.75  ? 413 PHE A N   1 
ATOM   3090  C  CA  . PHE A  1 413 ? 41.342 105.594 52.940  1.00 42.18  ? 413 PHE A CA  1 
ATOM   3091  C  C   . PHE A  1 413 ? 42.271 106.816 52.888  1.00 46.09  ? 413 PHE A C   1 
ATOM   3092  O  O   . PHE A  1 413 ? 41.834 107.871 53.334  1.00 45.97  ? 413 PHE A O   1 
ATOM   3093  C  CB  . PHE A  1 413 ? 41.342 105.002 54.354  1.00 43.32  ? 413 PHE A CB  1 
ATOM   3094  C  CG  . PHE A  1 413 ? 40.074 104.237 54.666  1.00 44.58  ? 413 PHE A CG  1 
ATOM   3095  C  CD1 . PHE A  1 413 ? 38.973 104.878 55.224  1.00 47.90  ? 413 PHE A CD1 1 
ATOM   3096  C  CD2 . PHE A  1 413 ? 39.968 102.882 54.370  1.00 46.07  ? 413 PHE A CD2 1 
ATOM   3097  C  CE1 . PHE A  1 413 ? 37.796 104.172 55.495  1.00 48.21  ? 413 PHE A CE1 1 
ATOM   3098  C  CE2 . PHE A  1 413 ? 38.790 102.179 54.641  1.00 48.19  ? 413 PHE A CE2 1 
ATOM   3099  C  CZ  . PHE A  1 413 ? 37.711 102.830 55.194  1.00 46.41  ? 413 PHE A CZ  1 
ATOM   3100  N  N   . ALA A  1 414 ? 43.502 106.713 52.344  1.00 42.75  ? 414 ALA A N   1 
ATOM   3101  C  CA  . ALA A  1 414 ? 44.428 107.861 52.263  1.00 43.31  ? 414 ALA A CA  1 
ATOM   3102  C  C   . ALA A  1 414 ? 43.802 109.054 51.539  1.00 48.43  ? 414 ALA A C   1 
ATOM   3103  O  O   . ALA A  1 414 ? 43.953 110.180 52.012  1.00 49.30  ? 414 ALA A O   1 
ATOM   3104  C  CB  . ALA A  1 414 ? 45.730 107.473 51.579  1.00 44.27  ? 414 ALA A CB  1 
ATOM   3105  N  N   . SER A  1 415 ? 43.083 108.811 50.417  1.00 44.47  ? 415 SER A N   1 
ATOM   3106  C  CA  . SER A  1 415 ? 42.402 109.871 49.663  1.00 44.89  ? 415 SER A CA  1 
ATOM   3107  C  C   . SER A  1 415 ? 41.252 110.446 50.495  1.00 48.40  ? 415 SER A C   1 
ATOM   3108  O  O   . SER A  1 415 ? 41.085 111.667 50.540  1.00 49.07  ? 415 SER A O   1 
ATOM   3109  C  CB  . SER A  1 415 ? 41.894 109.351 48.322  1.00 48.21  ? 415 SER A CB  1 
ATOM   3110  O  OG  . SER A  1 415 ? 41.128 108.168 48.483  1.00 56.52  ? 415 SER A OG  1 
ATOM   3111  N  N   . LEU A  1 416 ? 40.502 109.561 51.198  1.00 43.00  ? 416 LEU A N   1 
ATOM   3112  C  CA  . LEU A  1 416 ? 39.372 109.901 52.069  1.00 41.97  ? 416 LEU A CA  1 
ATOM   3113  C  C   . LEU A  1 416 ? 39.827 110.767 53.247  1.00 45.05  ? 416 LEU A C   1 
ATOM   3114  O  O   . LEU A  1 416 ? 39.145 111.730 53.586  1.00 45.52  ? 416 LEU A O   1 
ATOM   3115  C  CB  . LEU A  1 416 ? 38.691 108.618 52.568  1.00 40.86  ? 416 LEU A CB  1 
ATOM   3116  C  CG  . LEU A  1 416 ? 37.329 108.259 51.970  1.00 45.50  ? 416 LEU A CG  1 
ATOM   3117  C  CD1 . LEU A  1 416 ? 37.358 108.230 50.446  1.00 46.18  ? 416 LEU A CD1 1 
ATOM   3118  C  CD2 . LEU A  1 416 ? 36.857 106.918 52.495  1.00 46.99  ? 416 LEU A CD2 1 
ATOM   3119  N  N   . PHE A  1 417 ? 40.993 110.452 53.835  1.00 40.16  ? 417 PHE A N   1 
ATOM   3120  C  CA  . PHE A  1 417 ? 41.595 111.223 54.921  1.00 39.83  ? 417 PHE A CA  1 
ATOM   3121  C  C   . PHE A  1 417 ? 42.094 112.583 54.400  1.00 44.16  ? 417 PHE A C   1 
ATOM   3122  O  O   . PHE A  1 417 ? 41.981 113.581 55.113  1.00 43.83  ? 417 PHE A O   1 
ATOM   3123  C  CB  . PHE A  1 417 ? 42.756 110.445 55.562  1.00 40.99  ? 417 PHE A CB  1 
ATOM   3124  C  CG  . PHE A  1 417 ? 42.384 109.445 56.634  1.00 41.40  ? 417 PHE A CG  1 
ATOM   3125  C  CD1 . PHE A  1 417 ? 42.110 108.123 56.311  1.00 43.32  ? 417 PHE A CD1 1 
ATOM   3126  C  CD2 . PHE A  1 417 ? 42.391 109.805 57.977  1.00 43.35  ? 417 PHE A CD2 1 
ATOM   3127  C  CE1 . PHE A  1 417 ? 41.799 107.192 57.305  1.00 42.99  ? 417 PHE A CE1 1 
ATOM   3128  C  CE2 . PHE A  1 417 ? 42.075 108.872 58.972  1.00 45.10  ? 417 PHE A CE2 1 
ATOM   3129  C  CZ  . PHE A  1 417 ? 41.783 107.572 58.630  1.00 42.08  ? 417 PHE A CZ  1 
ATOM   3130  N  N   . TYR A  1 418 ? 42.632 112.617 53.151  1.00 40.93  ? 418 TYR A N   1 
ATOM   3131  C  CA  . TYR A  1 418 ? 43.165 113.820 52.499  1.00 41.87  ? 418 TYR A CA  1 
ATOM   3132  C  C   . TYR A  1 418 ? 42.064 114.845 52.231  1.00 46.49  ? 418 TYR A C   1 
ATOM   3133  O  O   . TYR A  1 418 ? 42.284 116.040 52.421  1.00 46.78  ? 418 TYR A O   1 
ATOM   3134  C  CB  . TYR A  1 418 ? 43.893 113.473 51.183  1.00 43.45  ? 418 TYR A CB  1 
ATOM   3135  C  CG  . TYR A  1 418 ? 44.640 114.649 50.588  1.00 46.82  ? 418 TYR A CG  1 
ATOM   3136  C  CD1 . TYR A  1 418 ? 45.950 114.929 50.961  1.00 49.53  ? 418 TYR A CD1 1 
ATOM   3137  C  CD2 . TYR A  1 418 ? 44.028 115.497 49.670  1.00 48.56  ? 418 TYR A CD2 1 
ATOM   3138  C  CE1 . TYR A  1 418 ? 46.634 116.027 50.437  1.00 52.12  ? 418 TYR A CE1 1 
ATOM   3139  C  CE2 . TYR A  1 418 ? 44.697 116.603 49.148  1.00 50.84  ? 418 TYR A CE2 1 
ATOM   3140  C  CZ  . TYR A  1 418 ? 45.998 116.868 49.538  1.00 59.12  ? 418 TYR A CZ  1 
ATOM   3141  O  OH  . TYR A  1 418 ? 46.659 117.952 49.012  1.00 61.95  ? 418 TYR A OH  1 
ATOM   3142  N  N   . ILE A  1 419 ? 40.901 114.383 51.755  1.00 42.96  ? 419 ILE A N   1 
ATOM   3143  C  CA  . ILE A  1 419 ? 39.746 115.234 51.461  1.00 43.34  ? 419 ILE A CA  1 
ATOM   3144  C  C   . ILE A  1 419 ? 39.180 115.790 52.780  1.00 47.40  ? 419 ILE A C   1 
ATOM   3145  O  O   . ILE A  1 419 ? 38.879 116.982 52.864  1.00 47.68  ? 419 ILE A O   1 
ATOM   3146  C  CB  . ILE A  1 419 ? 38.679 114.430 50.654  1.00 45.76  ? 419 ILE A CB  1 
ATOM   3147  C  CG1 . ILE A  1 419 ? 39.187 114.075 49.241  1.00 46.02  ? 419 ILE A CG1 1 
ATOM   3148  C  CG2 . ILE A  1 419 ? 37.350 115.178 50.579  1.00 47.33  ? 419 ILE A CG2 1 
ATOM   3149  C  CD1 . ILE A  1 419 ? 38.489 112.890 48.583  1.00 47.53  ? 419 ILE A CD1 1 
ATOM   3150  N  N   . ALA A  1 420 ? 39.074 114.919 53.806  1.00 43.09  ? 420 ALA A N   1 
ATOM   3151  C  CA  . ALA A  1 420 ? 38.512 115.227 55.119  1.00 42.62  ? 420 ALA A CA  1 
ATOM   3152  C  C   . ALA A  1 420 ? 39.377 116.145 55.986  1.00 47.22  ? 420 ALA A C   1 
ATOM   3153  O  O   . ALA A  1 420 ? 38.826 117.055 56.607  1.00 47.90  ? 420 ALA A O   1 
ATOM   3154  C  CB  . ALA A  1 420 ? 38.246 113.940 55.881  1.00 42.00  ? 420 ALA A CB  1 
ATOM   3155  N  N   . PHE A  1 421 ? 40.701 115.893 56.082  1.00 42.80  ? 421 PHE A N   1 
ATOM   3156  C  CA  . PHE A  1 421 ? 41.540 116.653 57.010  1.00 42.45  ? 421 PHE A CA  1 
ATOM   3157  C  C   . PHE A  1 421 ? 42.558 117.605 56.348  1.00 47.20  ? 421 PHE A C   1 
ATOM   3158  O  O   . PHE A  1 421 ? 42.982 118.554 57.013  1.00 47.59  ? 421 PHE A O   1 
ATOM   3159  C  CB  . PHE A  1 421 ? 42.253 115.697 57.984  1.00 43.00  ? 421 PHE A CB  1 
ATOM   3160  C  CG  . PHE A  1 421 ? 41.296 114.743 58.668  1.00 43.22  ? 421 PHE A CG  1 
ATOM   3161  C  CD1 . PHE A  1 421 ? 40.426 115.190 59.656  1.00 46.10  ? 421 PHE A CD1 1 
ATOM   3162  C  CD2 . PHE A  1 421 ? 41.238 113.406 58.296  1.00 44.34  ? 421 PHE A CD2 1 
ATOM   3163  C  CE1 . PHE A  1 421 ? 39.514 114.317 60.255  1.00 46.14  ? 421 PHE A CE1 1 
ATOM   3164  C  CE2 . PHE A  1 421 ? 40.333 112.532 58.903  1.00 46.14  ? 421 PHE A CE2 1 
ATOM   3165  C  CZ  . PHE A  1 421 ? 39.481 112.992 59.883  1.00 44.22  ? 421 PHE A CZ  1 
ATOM   3166  N  N   . VAL A  1 422 ? 42.937 117.390 55.075  1.00 43.78  ? 422 VAL A N   1 
ATOM   3167  C  CA  . VAL A  1 422 ? 43.867 118.304 54.400  1.00 44.82  ? 422 VAL A CA  1 
ATOM   3168  C  C   . VAL A  1 422 ? 43.036 119.320 53.607  1.00 50.64  ? 422 VAL A C   1 
ATOM   3169  O  O   . VAL A  1 422 ? 43.162 120.523 53.847  1.00 51.52  ? 422 VAL A O   1 
ATOM   3170  C  CB  . VAL A  1 422 ? 44.938 117.597 53.523  1.00 48.53  ? 422 VAL A CB  1 
ATOM   3171  C  CG1 . VAL A  1 422 ? 45.870 118.613 52.862  1.00 49.79  ? 422 VAL A CG1 1 
ATOM   3172  C  CG2 . VAL A  1 422 ? 45.741 116.588 54.337  1.00 47.31  ? 422 VAL A CG2 1 
ATOM   3173  N  N   . LEU A  1 423 ? 42.172 118.836 52.690  1.00 47.44  ? 423 LEU A N   1 
ATOM   3174  C  CA  . LEU A  1 423 ? 41.300 119.685 51.874  1.00 48.54  ? 423 LEU A CA  1 
ATOM   3175  C  C   . LEU A  1 423 ? 40.137 120.254 52.697  1.00 53.47  ? 423 LEU A C   1 
ATOM   3176  O  O   . LEU A  1 423 ? 39.629 121.329 52.362  1.00 53.99  ? 423 LEU A O   1 
ATOM   3177  C  CB  . LEU A  1 423 ? 40.748 118.912 50.664  1.00 48.31  ? 423 LEU A CB  1 
ATOM   3178  C  CG  . LEU A  1 423 ? 41.739 118.489 49.580  1.00 53.01  ? 423 LEU A CG  1 
ATOM   3179  C  CD1 . LEU A  1 423 ? 41.101 117.507 48.622  1.00 52.74  ? 423 LEU A CD1 1 
ATOM   3180  C  CD2 . LEU A  1 423 ? 42.281 119.682 48.812  1.00 56.31  ? 423 LEU A CD2 1 
ATOM   3181  N  N   . LYS A  1 424 ? 39.708 119.514 53.758  1.00 49.43  ? 424 LYS A N   1 
ATOM   3182  C  CA  . LYS A  1 424 ? 38.609 119.844 54.687  1.00 49.12  ? 424 LYS A CA  1 
ATOM   3183  C  C   . LYS A  1 424 ? 37.292 120.137 53.917  1.00 53.37  ? 424 LYS A C   1 
ATOM   3184  O  O   . LYS A  1 424 ? 36.497 120.989 54.321  1.00 53.78  ? 424 LYS A O   1 
ATOM   3185  C  CB  . LYS A  1 424 ? 38.999 121.011 55.625  1.00 52.38  ? 424 LYS A CB  1 
ATOM   3186  C  CG  . LYS A  1 424 ? 40.030 120.638 56.688  1.00 63.97  ? 424 LYS A CG  1 
ATOM   3187  C  CD  . LYS A  1 424 ? 40.426 121.836 57.543  1.00 73.61  ? 424 LYS A CD  1 
ATOM   3188  C  CE  . LYS A  1 424 ? 41.865 122.253 57.346  1.00 84.95  ? 424 LYS A CE  1 
ATOM   3189  N  NZ  . LYS A  1 424 ? 42.807 121.413 58.135  1.00 93.22  ? 424 LYS A NZ  1 
ATOM   3190  N  N   . ASP A  1 425 ? 37.077 119.398 52.811  1.00 49.31  ? 425 ASP A N   1 
ATOM   3191  C  CA  . ASP A  1 425 ? 35.920 119.503 51.924  1.00 49.49  ? 425 ASP A CA  1 
ATOM   3192  C  C   . ASP A  1 425 ? 34.937 118.357 52.226  1.00 52.77  ? 425 ASP A C   1 
ATOM   3193  O  O   . ASP A  1 425 ? 35.058 117.268 51.661  1.00 51.47  ? 425 ASP A O   1 
ATOM   3194  C  CB  . ASP A  1 425 ? 36.401 119.474 50.458  1.00 51.72  ? 425 ASP A CB  1 
ATOM   3195  C  CG  . ASP A  1 425 ? 35.384 119.843 49.396  1.00 59.41  ? 425 ASP A CG  1 
ATOM   3196  O  OD1 . ASP A  1 425 ? 34.171 119.848 49.704  1.00 60.42  ? 425 ASP A OD1 1 
ATOM   3197  O  OD2 . ASP A  1 425 ? 35.796 120.065 48.240  1.00 63.39  ? 425 ASP A OD2 1 
ATOM   3198  N  N   . MET A  1 426 ? 33.966 118.611 53.126  1.00 49.91  ? 426 MET A N   1 
ATOM   3199  C  CA  . MET A  1 426 ? 32.973 117.616 53.557  1.00 48.94  ? 426 MET A CA  1 
ATOM   3200  C  C   . MET A  1 426 ? 31.975 117.269 52.447  1.00 52.49  ? 426 MET A C   1 
ATOM   3201  O  O   . MET A  1 426 ? 31.440 116.159 52.452  1.00 51.14  ? 426 MET A O   1 
ATOM   3202  C  CB  . MET A  1 426 ? 32.230 118.069 54.824  1.00 51.43  ? 426 MET A CB  1 
ATOM   3203  C  CG  . MET A  1 426 ? 33.143 118.300 56.021  1.00 54.90  ? 426 MET A CG  1 
ATOM   3204  S  SD  . MET A  1 426 ? 34.235 116.908 56.411  1.00 57.87  ? 426 MET A SD  1 
ATOM   3205  C  CE  . MET A  1 426 ? 35.591 117.784 57.154  1.00 55.05  ? 426 MET A CE  1 
ATOM   3206  N  N   . LYS A  1 427 ? 31.746 118.197 51.492  1.00 49.79  ? 427 LYS A N   1 
ATOM   3207  C  CA  . LYS A  1 427 ? 30.867 117.982 50.340  1.00 49.87  ? 427 LYS A CA  1 
ATOM   3208  C  C   . LYS A  1 427 ? 31.480 116.920 49.421  1.00 52.67  ? 427 LYS A C   1 
ATOM   3209  O  O   . LYS A  1 427 ? 30.775 116.004 48.990  1.00 51.98  ? 427 LYS A O   1 
ATOM   3210  C  CB  . LYS A  1 427 ? 30.626 119.297 49.579  1.00 53.76  ? 427 LYS A CB  1 
ATOM   3211  N  N   . LEU A  1 428 ? 32.807 117.022 49.171  1.00 48.55  ? 428 LEU A N   1 
ATOM   3212  C  CA  . LEU A  1 428 ? 33.571 116.084 48.347  1.00 47.61  ? 428 LEU A CA  1 
ATOM   3213  C  C   . LEU A  1 428 ? 33.709 114.739 49.061  1.00 50.50  ? 428 LEU A C   1 
ATOM   3214  O  O   . LEU A  1 428 ? 33.631 113.703 48.399  1.00 50.19  ? 428 LEU A O   1 
ATOM   3215  C  CB  . LEU A  1 428 ? 34.955 116.667 47.993  1.00 47.95  ? 428 LEU A CB  1 
ATOM   3216  C  CG  . LEU A  1 428 ? 35.921 115.816 47.145  1.00 52.02  ? 428 LEU A CG  1 
ATOM   3217  C  CD1 . LEU A  1 428 ? 35.352 115.510 45.765  1.00 52.85  ? 428 LEU A CD1 1 
ATOM   3218  C  CD2 . LEU A  1 428 ? 37.265 116.499 47.015  1.00 54.43  ? 428 LEU A CD2 1 
ATOM   3219  N  N   . LEU A  1 429 ? 33.893 114.752 50.401  1.00 46.19  ? 429 LEU A N   1 
ATOM   3220  C  CA  . LEU A  1 429 ? 34.014 113.537 51.210  1.00 44.76  ? 429 LEU A CA  1 
ATOM   3221  C  C   . LEU A  1 429 ? 32.710 112.740 51.163  1.00 49.54  ? 429 LEU A C   1 
ATOM   3222  O  O   . LEU A  1 429 ? 32.763 111.525 50.967  1.00 48.71  ? 429 LEU A O   1 
ATOM   3223  C  CB  . LEU A  1 429 ? 34.412 113.863 52.664  1.00 44.22  ? 429 LEU A CB  1 
ATOM   3224  C  CG  . LEU A  1 429 ? 34.596 112.675 53.625  1.00 47.35  ? 429 LEU A CG  1 
ATOM   3225  C  CD1 . LEU A  1 429 ? 35.780 111.801 53.230  1.00 46.89  ? 429 LEU A CD1 1 
ATOM   3226  C  CD2 . LEU A  1 429 ? 34.756 113.150 55.046  1.00 49.06  ? 429 LEU A CD2 1 
ATOM   3227  N  N   . ARG A  1 430 ? 31.549 113.425 51.301  1.00 47.33  ? 430 ARG A N   1 
ATOM   3228  C  CA  . ARG A  1 430 ? 30.221 112.806 51.232  1.00 47.12  ? 430 ARG A CA  1 
ATOM   3229  C  C   . ARG A  1 430 ? 30.022 112.138 49.869  1.00 51.74  ? 430 ARG A C   1 
ATOM   3230  O  O   . ARG A  1 430 ? 29.651 110.966 49.828  1.00 50.59  ? 430 ARG A O   1 
ATOM   3231  C  CB  . ARG A  1 430 ? 29.116 113.833 51.501  1.00 47.57  ? 430 ARG A CB  1 
ATOM   3232  C  CG  . ARG A  1 430 ? 28.838 114.041 52.974  1.00 55.84  ? 430 ARG A CG  1 
ATOM   3233  C  CD  . ARG A  1 430 ? 28.226 115.400 53.221  1.00 65.01  ? 430 ARG A CD  1 
ATOM   3234  N  NE  . ARG A  1 430 ? 28.055 115.660 54.648  1.00 70.99  ? 430 ARG A NE  1 
ATOM   3235  C  CZ  . ARG A  1 430 ? 28.006 116.872 55.187  1.00 87.95  ? 430 ARG A CZ  1 
ATOM   3236  N  NH1 . ARG A  1 430 ? 28.128 117.951 54.424  1.00 75.81  ? 430 ARG A NH1 1 
ATOM   3237  N  NH2 . ARG A  1 430 ? 27.844 117.016 56.495  1.00 78.87  ? 430 ARG A NH2 1 
ATOM   3238  N  N   . GLN A  1 431 ? 30.338 112.862 48.767  1.00 49.67  ? 431 GLN A N   1 
ATOM   3239  C  CA  . GLN A  1 431 ? 30.243 112.369 47.389  1.00 50.09  ? 431 GLN A CA  1 
ATOM   3240  C  C   . GLN A  1 431 ? 31.201 111.190 47.158  1.00 52.72  ? 431 GLN A C   1 
ATOM   3241  O  O   . GLN A  1 431 ? 30.848 110.269 46.417  1.00 52.53  ? 431 GLN A O   1 
ATOM   3242  C  CB  . GLN A  1 431 ? 30.525 113.493 46.381  1.00 52.86  ? 431 GLN A CB  1 
ATOM   3243  N  N   . SER A  1 432 ? 32.392 111.207 47.810  1.00 47.56  ? 432 SER A N   1 
ATOM   3244  C  CA  . SER A  1 432 ? 33.388 110.133 47.716  1.00 45.93  ? 432 SER A CA  1 
ATOM   3245  C  C   . SER A  1 432 ? 32.860 108.865 48.375  1.00 48.25  ? 432 SER A C   1 
ATOM   3246  O  O   . SER A  1 432 ? 32.947 107.792 47.778  1.00 47.53  ? 432 SER A O   1 
ATOM   3247  C  CB  . SER A  1 432 ? 34.709 110.551 48.355  1.00 48.38  ? 432 SER A CB  1 
ATOM   3248  O  OG  . SER A  1 432 ? 35.291 111.653 47.678  1.00 56.97  ? 432 SER A OG  1 
ATOM   3249  N  N   . LEU A  1 433 ? 32.278 108.999 49.586  1.00 43.95  ? 433 LEU A N   1 
ATOM   3250  C  CA  . LEU A  1 433 ? 31.702 107.893 50.356  1.00 42.59  ? 433 LEU A CA  1 
ATOM   3251  C  C   . LEU A  1 433 ? 30.441 107.343 49.676  1.00 47.04  ? 433 LEU A C   1 
ATOM   3252  O  O   . LEU A  1 433 ? 30.230 106.128 49.695  1.00 46.03  ? 433 LEU A O   1 
ATOM   3253  C  CB  . LEU A  1 433 ? 31.386 108.326 51.799  1.00 41.97  ? 433 LEU A CB  1 
ATOM   3254  C  CG  . LEU A  1 433 ? 32.592 108.574 52.708  1.00 45.37  ? 433 LEU A CG  1 
ATOM   3255  C  CD1 . LEU A  1 433 ? 32.266 109.594 53.776  1.00 45.43  ? 433 LEU A CD1 1 
ATOM   3256  C  CD2 . LEU A  1 433 ? 33.102 107.280 53.325  1.00 46.10  ? 433 LEU A CD2 1 
ATOM   3257  N  N   . ALA A  1 434 ? 29.627 108.231 49.055  1.00 44.52  ? 434 ALA A N   1 
ATOM   3258  C  CA  . ALA A  1 434 ? 28.400 107.866 48.339  1.00 44.84  ? 434 ALA A CA  1 
ATOM   3259  C  C   . ALA A  1 434 ? 28.707 106.956 47.146  1.00 49.25  ? 434 ALA A C   1 
ATOM   3260  O  O   . ALA A  1 434 ? 27.969 105.998 46.913  1.00 48.76  ? 434 ALA A O   1 
ATOM   3261  C  CB  . ALA A  1 434 ? 27.669 109.113 47.873  1.00 46.84  ? 434 ALA A CB  1 
ATOM   3262  N  N   . THR A  1 435 ? 29.812 107.232 46.417  1.00 46.04  ? 435 THR A N   1 
ATOM   3263  C  CA  . THR A  1 435 ? 30.244 106.424 45.274  1.00 45.78  ? 435 THR A CA  1 
ATOM   3264  C  C   . THR A  1 435 ? 30.703 105.052 45.788  1.00 48.43  ? 435 THR A C   1 
ATOM   3265  O  O   . THR A  1 435 ? 30.291 104.038 45.229  1.00 48.13  ? 435 THR A O   1 
ATOM   3266  C  CB  . THR A  1 435 ? 31.333 107.152 44.463  1.00 52.32  ? 435 THR A CB  1 
ATOM   3267  O  OG1 . THR A  1 435 ? 30.860 108.446 44.099  1.00 51.05  ? 435 THR A OG1 1 
ATOM   3268  C  CG2 . THR A  1 435 ? 31.723 106.405 43.200  1.00 52.10  ? 435 THR A CG2 1 
ATOM   3269  N  N   . LEU A  1 436 ? 31.510 105.033 46.874  1.00 43.59  ? 436 LEU A N   1 
ATOM   3270  C  CA  . LEU A  1 436 ? 32.046 103.823 47.503  1.00 41.95  ? 436 LEU A CA  1 
ATOM   3271  C  C   . LEU A  1 436 ? 30.953 102.914 48.061  1.00 46.30  ? 436 LEU A C   1 
ATOM   3272  O  O   . LEU A  1 436 ? 31.049 101.695 47.909  1.00 45.56  ? 436 LEU A O   1 
ATOM   3273  C  CB  . LEU A  1 436 ? 33.010 104.181 48.646  1.00 41.11  ? 436 LEU A CB  1 
ATOM   3274  C  CG  . LEU A  1 436 ? 34.385 104.716 48.281  1.00 45.81  ? 436 LEU A CG  1 
ATOM   3275  C  CD1 . LEU A  1 436 ? 34.983 105.466 49.448  1.00 45.70  ? 436 LEU A CD1 1 
ATOM   3276  C  CD2 . LEU A  1 436 ? 35.327 103.599 47.876  1.00 47.32  ? 436 LEU A CD2 1 
ATOM   3277  N  N   . LEU A  1 437 ? 29.932 103.501 48.719  1.00 43.36  ? 437 LEU A N   1 
ATOM   3278  C  CA  . LEU A  1 437 ? 28.856 102.759 49.378  1.00 42.95  ? 437 LEU A CA  1 
ATOM   3279  C  C   . LEU A  1 437 ? 27.680 102.398 48.455  1.00 47.54  ? 437 LEU A C   1 
ATOM   3280  O  O   . LEU A  1 437 ? 26.956 101.451 48.773  1.00 47.26  ? 437 LEU A O   1 
ATOM   3281  C  CB  . LEU A  1 437 ? 28.334 103.535 50.601  1.00 43.01  ? 437 LEU A CB  1 
ATOM   3282  C  CG  . LEU A  1 437 ? 29.283 103.605 51.807  1.00 46.91  ? 437 LEU A CG  1 
ATOM   3283  C  CD1 . LEU A  1 437 ? 29.025 104.840 52.630  1.00 47.50  ? 437 LEU A CD1 1 
ATOM   3284  C  CD2 . LEU A  1 437 ? 29.187 102.356 52.674  1.00 48.42  ? 437 LEU A CD2 1 
ATOM   3285  N  N   . ILE A  1 438 ? 27.473 103.125 47.338  1.00 44.50  ? 438 ILE A N   1 
ATOM   3286  C  CA  . ILE A  1 438 ? 26.346 102.812 46.453  1.00 44.93  ? 438 ILE A CA  1 
ATOM   3287  C  C   . ILE A  1 438 ? 26.863 102.206 45.124  1.00 50.37  ? 438 ILE A C   1 
ATOM   3288  O  O   . ILE A  1 438 ? 26.862 100.979 44.994  1.00 49.45  ? 438 ILE A O   1 
ATOM   3289  C  CB  . ILE A  1 438 ? 25.379 104.023 46.241  1.00 48.59  ? 438 ILE A CB  1 
ATOM   3290  C  CG1 . ILE A  1 438 ? 24.933 104.621 47.598  1.00 48.42  ? 438 ILE A CG1 1 
ATOM   3291  C  CG2 . ILE A  1 438 ? 24.154 103.621 45.405  1.00 49.37  ? 438 ILE A CG2 1 
ATOM   3292  C  CD1 . ILE A  1 438 ? 24.647 106.103 47.595  1.00 53.93  ? 438 ILE A CD1 1 
ATOM   3293  N  N   . THR A  1 439 ? 27.312 103.051 44.166  1.00 48.43  ? 439 THR A N   1 
ATOM   3294  C  CA  . THR A  1 439 ? 27.773 102.664 42.824  1.00 49.00  ? 439 THR A CA  1 
ATOM   3295  C  C   . THR A  1 439 ? 28.877 101.583 42.853  1.00 53.04  ? 439 THR A C   1 
ATOM   3296  O  O   . THR A  1 439 ? 28.763 100.599 42.118  1.00 52.76  ? 439 THR A O   1 
ATOM   3297  C  CB  . THR A  1 439 ? 28.238 103.902 42.040  1.00 54.92  ? 439 THR A CB  1 
ATOM   3298  O  OG1 . THR A  1 439 ? 27.258 104.935 42.171  1.00 55.27  ? 439 THR A OG1 1 
ATOM   3299  C  CG2 . THR A  1 439 ? 28.475 103.607 40.560  1.00 52.64  ? 439 THR A CG2 1 
ATOM   3300  N  N   . SER A  1 440 ? 29.922 101.758 43.685  1.00 49.34  ? 440 SER A N   1 
ATOM   3301  C  CA  . SER A  1 440 ? 31.037 100.811 43.781  1.00 48.42  ? 440 SER A CA  1 
ATOM   3302  C  C   . SER A  1 440 ? 30.587 99.437  44.294  1.00 50.58  ? 440 SER A C   1 
ATOM   3303  O  O   . SER A  1 440 ? 31.071 98.428  43.780  1.00 50.15  ? 440 SER A O   1 
ATOM   3304  C  CB  . SER A  1 440 ? 32.144 101.364 44.668  1.00 52.59  ? 440 SER A CB  1 
ATOM   3305  O  OG  . SER A  1 440 ? 33.303 100.548 44.620  1.00 64.45  ? 440 SER A OG  1 
ATOM   3306  N  N   . GLN A  1 441 ? 29.649 99.395  45.271  1.00 45.51  ? 441 GLN A N   1 
ATOM   3307  C  CA  . GLN A  1 441 ? 29.133 98.144  45.840  1.00 44.01  ? 441 GLN A CA  1 
ATOM   3308  C  C   . GLN A  1 441 ? 28.206 97.404  44.858  1.00 47.90  ? 441 GLN A C   1 
ATOM   3309  O  O   . GLN A  1 441 ? 28.194 96.170  44.875  1.00 47.22  ? 441 GLN A O   1 
ATOM   3310  C  CB  . GLN A  1 441 ? 28.420 98.381  47.174  1.00 44.74  ? 441 GLN A CB  1 
ATOM   3311  C  CG  . GLN A  1 441 ? 29.385 98.718  48.307  1.00 54.30  ? 441 GLN A CG  1 
ATOM   3312  C  CD  . GLN A  1 441 ? 28.837 98.393  49.673  1.00 64.76  ? 441 GLN A CD  1 
ATOM   3313  O  OE1 . GLN A  1 441 ? 29.297 97.463  50.342  1.00 58.02  ? 441 GLN A OE1 1 
ATOM   3314  N  NE2 . GLN A  1 441 ? 27.875 99.177  50.140  1.00 53.35  ? 441 GLN A NE2 1 
ATOM   3315  N  N   . ILE A  1 442 ? 27.449 98.144  44.000  1.00 44.18  ? 442 ILE A N   1 
ATOM   3316  C  CA  . ILE A  1 442 ? 26.564 97.561  42.975  1.00 43.70  ? 442 ILE A CA  1 
ATOM   3317  C  C   . ILE A  1 442 ? 27.442 96.890  41.913  1.00 49.27  ? 442 ILE A C   1 
ATOM   3318  O  O   . ILE A  1 442 ? 27.203 95.730  41.576  1.00 48.99  ? 442 ILE A O   1 
ATOM   3319  C  CB  . ILE A  1 442 ? 25.583 98.600  42.357  1.00 46.96  ? 442 ILE A CB  1 
ATOM   3320  C  CG1 . ILE A  1 442 ? 24.605 99.149  43.417  1.00 46.54  ? 442 ILE A CG1 1 
ATOM   3321  C  CG2 . ILE A  1 442 ? 24.808 97.995  41.176  1.00 48.22  ? 442 ILE A CG2 1 
ATOM   3322  C  CD1 . ILE A  1 442 ? 24.044 100.541 43.133  1.00 49.47  ? 442 ILE A CD1 1 
ATOM   3323  N  N   . LEU A  1 443 ? 28.477 97.611  41.424  1.00 47.34  ? 443 LEU A N   1 
ATOM   3324  C  CA  . LEU A  1 443 ? 29.439 97.125  40.430  1.00 47.87  ? 443 LEU A CA  1 
ATOM   3325  C  C   . LEU A  1 443 ? 30.243 95.951  40.972  1.00 51.15  ? 443 LEU A C   1 
ATOM   3326  O  O   . LEU A  1 443 ? 30.515 95.019  40.218  1.00 51.33  ? 443 LEU A O   1 
ATOM   3327  C  CB  . LEU A  1 443 ? 30.387 98.245  39.984  1.00 48.61  ? 443 LEU A CB  1 
ATOM   3328  C  CG  . LEU A  1 443 ? 29.790 99.282  39.038  1.00 55.64  ? 443 LEU A CG  1 
ATOM   3329  C  CD1 . LEU A  1 443 ? 30.486 100.617 39.186  1.00 56.26  ? 443 LEU A CD1 1 
ATOM   3330  C  CD2 . LEU A  1 443 ? 29.852 98.814  37.595  1.00 60.20  ? 443 LEU A CD2 1 
ATOM   3331  N  N   . ASN A  1 444 ? 30.597 95.983  42.279  1.00 46.52  ? 444 ASN A N   1 
ATOM   3332  C  CA  . ASN A  1 444 ? 31.337 94.913  42.948  1.00 45.21  ? 444 ASN A CA  1 
ATOM   3333  C  C   . ASN A  1 444 ? 30.555 93.604  42.899  1.00 49.90  ? 444 ASN A C   1 
ATOM   3334  O  O   . ASN A  1 444 ? 31.153 92.585  42.581  1.00 49.91  ? 444 ASN A O   1 
ATOM   3335  C  CB  . ASN A  1 444 ? 31.672 95.277  44.399  1.00 44.16  ? 444 ASN A CB  1 
ATOM   3336  C  CG  . ASN A  1 444 ? 32.268 94.136  45.194  1.00 61.84  ? 444 ASN A CG  1 
ATOM   3337  O  OD1 . ASN A  1 444 ? 31.570 93.426  45.927  1.00 56.51  ? 444 ASN A OD1 1 
ATOM   3338  N  ND2 . ASN A  1 444 ? 33.558 93.905  45.027  1.00 51.75  ? 444 ASN A ND2 1 
ATOM   3339  N  N   . GLN A  1 445 ? 29.233 93.632  43.194  1.00 46.63  ? 445 GLN A N   1 
ATOM   3340  C  CA  . GLN A  1 445 ? 28.348 92.454  43.188  1.00 46.11  ? 445 GLN A CA  1 
ATOM   3341  C  C   . GLN A  1 445 ? 28.241 91.825  41.790  1.00 49.39  ? 445 GLN A C   1 
ATOM   3342  O  O   . GLN A  1 445 ? 28.177 90.598  41.677  1.00 47.91  ? 445 GLN A O   1 
ATOM   3343  C  CB  . GLN A  1 445 ? 26.946 92.816  43.709  1.00 47.83  ? 445 GLN A CB  1 
ATOM   3344  C  CG  . GLN A  1 445 ? 26.884 93.090  45.207  1.00 62.63  ? 445 GLN A CG  1 
ATOM   3345  C  CD  . GLN A  1 445 ? 26.826 91.826  46.023  1.00 81.07  ? 445 GLN A CD  1 
ATOM   3346  O  OE1 . GLN A  1 445 ? 27.819 91.107  46.175  1.00 75.53  ? 445 GLN A OE1 1 
ATOM   3347  N  NE2 . GLN A  1 445 ? 25.664 91.550  46.595  1.00 73.63  ? 445 GLN A NE2 1 
ATOM   3348  N  N   . ILE A  1 446 ? 28.239 92.666  40.736  1.00 46.80  ? 446 ILE A N   1 
ATOM   3349  C  CA  . ILE A  1 446 ? 28.178 92.222  39.342  1.00 47.68  ? 446 ILE A CA  1 
ATOM   3350  C  C   . ILE A  1 446 ? 29.483 91.477  39.004  1.00 52.09  ? 446 ILE A C   1 
ATOM   3351  O  O   . ILE A  1 446 ? 29.422 90.357  38.513  1.00 51.75  ? 446 ILE A O   1 
ATOM   3352  C  CB  . ILE A  1 446 ? 27.892 93.408  38.373  1.00 51.75  ? 446 ILE A CB  1 
ATOM   3353  C  CG1 . ILE A  1 446 ? 26.512 94.045  38.670  1.00 52.64  ? 446 ILE A CG1 1 
ATOM   3354  C  CG2 . ILE A  1 446 ? 27.986 92.973  36.901  1.00 53.18  ? 446 ILE A CG2 1 
ATOM   3355  C  CD1 . ILE A  1 446 ? 26.368 95.517  38.278  1.00 58.81  ? 446 ILE A CD1 1 
ATOM   3356  N  N   . MET A  1 447 ? 30.645 92.071  39.327  1.00 48.99  ? 447 MET A N   1 
ATOM   3357  C  CA  . MET A  1 447 ? 31.964 91.480  39.074  1.00 48.82  ? 447 MET A CA  1 
ATOM   3358  C  C   . MET A  1 447 ? 32.255 90.251  39.950  1.00 51.93  ? 447 MET A C   1 
ATOM   3359  O  O   . MET A  1 447 ? 32.924 89.326  39.485  1.00 51.59  ? 447 MET A O   1 
ATOM   3360  C  CB  . MET A  1 447 ? 33.080 92.520  39.298  1.00 51.05  ? 447 MET A CB  1 
ATOM   3361  C  CG  . MET A  1 447 ? 33.034 93.710  38.356  1.00 56.03  ? 447 MET A CG  1 
ATOM   3362  S  SD  . MET A  1 447 ? 32.827 93.283  36.609  1.00 62.14  ? 447 MET A SD  1 
ATOM   3363  C  CE  . MET A  1 447 ? 34.418 92.522  36.254  1.00 58.56  ? 447 MET A CE  1 
ATOM   3364  N  N   . GLU A  1 448 ? 31.780 90.262  41.214  1.00 47.64  ? 448 GLU A N   1 
ATOM   3365  C  CA  . GLU A  1 448 ? 32.010 89.226  42.223  1.00 46.46  ? 448 GLU A CA  1 
ATOM   3366  C  C   . GLU A  1 448 ? 31.252 87.923  41.950  1.00 50.43  ? 448 GLU A C   1 
ATOM   3367  O  O   . GLU A  1 448 ? 31.868 86.861  42.043  1.00 49.90  ? 448 GLU A O   1 
ATOM   3368  C  CB  . GLU A  1 448 ? 31.636 89.745  43.626  1.00 47.14  ? 448 GLU A CB  1 
ATOM   3369  C  CG  . GLU A  1 448 ? 32.329 89.039  44.783  1.00 56.47  ? 448 GLU A CG  1 
ATOM   3370  C  CD  . GLU A  1 448 ? 31.823 89.373  46.177  1.00 76.72  ? 448 GLU A CD  1 
ATOM   3371  O  OE1 . GLU A  1 448 ? 30.917 90.229  46.307  1.00 73.91  ? 448 GLU A OE1 1 
ATOM   3372  O  OE2 . GLU A  1 448 ? 32.349 88.783  47.148  1.00 67.55  ? 448 GLU A OE2 1 
ATOM   3373  N  N   . SER A  1 449 ? 29.933 87.981  41.669  1.00 47.34  ? 449 SER A N   1 
ATOM   3374  C  CA  . SER A  1 449 ? 29.170 86.748  41.495  1.00 47.58  ? 449 SER A CA  1 
ATOM   3375  C  C   . SER A  1 449 ? 28.189 86.734  40.317  1.00 52.23  ? 449 SER A C   1 
ATOM   3376  O  O   . SER A  1 449 ? 28.101 85.703  39.656  1.00 52.58  ? 449 SER A O   1 
ATOM   3377  C  CB  . SER A  1 449 ? 28.399 86.423  42.770  1.00 51.47  ? 449 SER A CB  1 
ATOM   3378  O  OG  . SER A  1 449 ? 27.436 87.420  43.069  1.00 62.75  ? 449 SER A OG  1 
ATOM   3379  N  N   . PHE A  1 450 ? 27.449 87.829  40.063  1.00 48.60  ? 450 PHE A N   1 
ATOM   3380  C  CA  . PHE A  1 450 ? 26.426 87.876  39.012  1.00 49.56  ? 450 PHE A CA  1 
ATOM   3381  C  C   . PHE A  1 450 ? 26.986 87.637  37.605  1.00 53.27  ? 450 PHE A C   1 
ATOM   3382  O  O   . PHE A  1 450 ? 26.417 86.816  36.879  1.00 54.19  ? 450 PHE A O   1 
ATOM   3383  C  CB  . PHE A  1 450 ? 25.622 89.184  39.067  1.00 52.25  ? 450 PHE A CB  1 
ATOM   3384  C  CG  . PHE A  1 450 ? 24.905 89.405  40.384  1.00 53.50  ? 450 PHE A CG  1 
ATOM   3385  C  CD1 . PHE A  1 450 ? 24.218 88.365  41.008  1.00 56.02  ? 450 PHE A CD1 1 
ATOM   3386  C  CD2 . PHE A  1 450 ? 24.909 90.654  40.995  1.00 55.71  ? 450 PHE A CD2 1 
ATOM   3387  C  CE1 . PHE A  1 450 ? 23.573 88.565  42.229  1.00 56.58  ? 450 PHE A CE1 1 
ATOM   3388  C  CE2 . PHE A  1 450 ? 24.252 90.855  42.212  1.00 58.06  ? 450 PHE A CE2 1 
ATOM   3389  C  CZ  . PHE A  1 450 ? 23.591 89.809  42.821  1.00 55.86  ? 450 PHE A CZ  1 
ATOM   3390  N  N   . LEU A  1 451 ? 28.093 88.307  37.229  1.00 48.32  ? 451 LEU A N   1 
ATOM   3391  C  CA  . LEU A  1 451 ? 28.731 88.102  35.924  1.00 48.39  ? 451 LEU A CA  1 
ATOM   3392  C  C   . LEU A  1 451 ? 29.429 86.720  35.897  1.00 50.84  ? 451 LEU A C   1 
ATOM   3393  O  O   . LEU A  1 451 ? 29.119 85.959  34.978  1.00 51.05  ? 451 LEU A O   1 
ATOM   3394  C  CB  . LEU A  1 451 ? 29.699 89.245  35.556  1.00 48.44  ? 451 LEU A CB  1 
ATOM   3395  C  CG  . LEU A  1 451 ? 30.511 89.107  34.268  1.00 53.63  ? 451 LEU A CG  1 
ATOM   3396  C  CD1 . LEU A  1 451 ? 29.658 89.384  33.042  1.00 55.37  ? 451 LEU A CD1 1 
ATOM   3397  C  CD2 . LEU A  1 451 ? 31.706 90.038  34.290  1.00 55.84  ? 451 LEU A CD2 1 
ATOM   3398  N  N   . PRO A  1 452 ? 30.277 86.320  36.893  1.00 45.97  ? 452 PRO A N   1 
ATOM   3399  C  CA  . PRO A  1 452 ? 30.885 84.977  36.843  1.00 45.37  ? 452 PRO A CA  1 
ATOM   3400  C  C   . PRO A  1 452 ? 29.869 83.831  36.841  1.00 49.97  ? 452 PRO A C   1 
ATOM   3401  O  O   . PRO A  1 452 ? 30.163 82.803  36.239  1.00 50.17  ? 452 PRO A O   1 
ATOM   3402  C  CB  . PRO A  1 452 ? 31.745 84.929  38.106  1.00 45.73  ? 452 PRO A CB  1 
ATOM   3403  C  CG  . PRO A  1 452 ? 32.030 86.332  38.422  1.00 50.05  ? 452 PRO A CG  1 
ATOM   3404  C  CD  . PRO A  1 452 ? 30.785 87.068  38.063  1.00 46.50  ? 452 PRO A CD  1 
ATOM   3405  N  N   . TYR A  1 453 ? 28.685 84.003  37.485  1.00 46.52  ? 453 TYR A N   1 
ATOM   3406  C  CA  . TYR A  1 453 ? 27.628 82.982  37.493  1.00 46.98  ? 453 TYR A CA  1 
ATOM   3407  C  C   . TYR A  1 453 ? 27.037 82.820  36.091  1.00 53.57  ? 453 TYR A C   1 
ATOM   3408  O  O   . TYR A  1 453 ? 26.846 81.688  35.641  1.00 53.72  ? 453 TYR A O   1 
ATOM   3409  C  CB  . TYR A  1 453 ? 26.521 83.300  38.514  1.00 47.88  ? 453 TYR A CB  1 
ATOM   3410  C  CG  . TYR A  1 453 ? 25.293 82.430  38.375  1.00 50.56  ? 453 TYR A CG  1 
ATOM   3411  C  CD1 . TYR A  1 453 ? 25.305 81.102  38.792  1.00 52.11  ? 453 TYR A CD1 1 
ATOM   3412  C  CD2 . TYR A  1 453 ? 24.124 82.927  37.809  1.00 52.68  ? 453 TYR A CD2 1 
ATOM   3413  C  CE1 . TYR A  1 453 ? 24.184 80.288  38.646  1.00 53.67  ? 453 TYR A CE1 1 
ATOM   3414  C  CE2 . TYR A  1 453 ? 22.996 82.123  37.658  1.00 54.51  ? 453 TYR A CE2 1 
ATOM   3415  C  CZ  . TYR A  1 453 ? 23.028 80.806  38.087  1.00 61.02  ? 453 TYR A CZ  1 
ATOM   3416  O  OH  . TYR A  1 453 ? 21.918 80.006  37.952  1.00 62.10  ? 453 TYR A OH  1 
ATOM   3417  N  N   . TRP A  1 454 ? 26.762 83.954  35.404  1.00 51.50  ? 454 TRP A N   1 
ATOM   3418  C  CA  . TRP A  1 454 ? 26.222 83.979  34.045  1.00 52.99  ? 454 TRP A CA  1 
ATOM   3419  C  C   . TRP A  1 454 ? 27.170 83.261  33.092  1.00 55.75  ? 454 TRP A C   1 
ATOM   3420  O  O   . TRP A  1 454 ? 26.717 82.458  32.278  1.00 56.62  ? 454 TRP A O   1 
ATOM   3421  C  CB  . TRP A  1 454 ? 25.973 85.427  33.578  1.00 52.98  ? 454 TRP A CB  1 
ATOM   3422  C  CG  . TRP A  1 454 ? 25.366 85.548  32.204  1.00 56.12  ? 454 TRP A CG  1 
ATOM   3423  C  CD1 . TRP A  1 454 ? 24.325 84.823  31.699  1.00 60.26  ? 454 TRP A CD1 1 
ATOM   3424  C  CD2 . TRP A  1 454 ? 25.723 86.498  31.189  1.00 57.05  ? 454 TRP A CD2 1 
ATOM   3425  N  NE1 . TRP A  1 454 ? 24.034 85.239  30.418  1.00 61.48  ? 454 TRP A NE1 1 
ATOM   3426  C  CE2 . TRP A  1 454 ? 24.867 86.275  30.085  1.00 62.79  ? 454 TRP A CE2 1 
ATOM   3427  C  CE3 . TRP A  1 454 ? 26.694 87.511  31.099  1.00 58.03  ? 454 TRP A CE3 1 
ATOM   3428  C  CZ2 . TRP A  1 454 ? 24.951 87.028  28.907  1.00 63.35  ? 454 TRP A CZ2 1 
ATOM   3429  C  CZ3 . TRP A  1 454 ? 26.775 88.256  29.931  1.00 60.86  ? 454 TRP A CZ3 1 
ATOM   3430  C  CH2 . TRP A  1 454 ? 25.911 88.013  28.853  1.00 63.14  ? 454 TRP A CH2 1 
ATOM   3431  N  N   . LEU A  1 455 ? 28.483 83.518  33.232  1.00 50.18  ? 455 LEU A N   1 
ATOM   3432  C  CA  . LEU A  1 455 ? 29.524 82.907  32.411  1.00 49.86  ? 455 LEU A CA  1 
ATOM   3433  C  C   . LEU A  1 455 ? 29.718 81.426  32.751  1.00 52.95  ? 455 LEU A C   1 
ATOM   3434  O  O   . LEU A  1 455 ? 30.020 80.648  31.842  1.00 53.63  ? 455 LEU A O   1 
ATOM   3435  C  CB  . LEU A  1 455 ? 30.856 83.666  32.546  1.00 49.11  ? 455 LEU A CB  1 
ATOM   3436  C  CG  . LEU A  1 455 ? 30.895 85.083  31.958  1.00 54.36  ? 455 LEU A CG  1 
ATOM   3437  C  CD1 . LEU A  1 455 ? 31.979 85.916  32.611  1.00 53.78  ? 455 LEU A CD1 1 
ATOM   3438  C  CD2 . LEU A  1 455 ? 31.076 85.063  30.449  1.00 57.41  ? 455 LEU A CD2 1 
ATOM   3439  N  N   . GLN A  1 456 ? 29.540 81.030  34.037  1.00 47.28  ? 456 GLN A N   1 
ATOM   3440  C  CA  . GLN A  1 456 ? 29.681 79.630  34.462  1.00 46.30  ? 456 GLN A CA  1 
ATOM   3441  C  C   . GLN A  1 456 ? 28.491 78.792  33.959  1.00 51.74  ? 456 GLN A C   1 
ATOM   3442  O  O   . GLN A  1 456 ? 28.684 77.619  33.625  1.00 51.78  ? 456 GLN A O   1 
ATOM   3443  C  CB  . GLN A  1 456 ? 29.853 79.507  35.988  1.00 46.04  ? 456 GLN A CB  1 
ATOM   3444  C  CG  . GLN A  1 456 ? 30.120 78.092  36.522  1.00 56.13  ? 456 GLN A CG  1 
ATOM   3445  C  CD  . GLN A  1 456 ? 31.267 77.367  35.857  1.00 67.71  ? 456 GLN A CD  1 
ATOM   3446  O  OE1 . GLN A  1 456 ? 32.412 77.829  35.817  1.00 62.84  ? 456 GLN A OE1 1 
ATOM   3447  N  NE2 . GLN A  1 456 ? 30.981 76.188  35.352  1.00 56.20  ? 456 GLN A NE2 1 
ATOM   3448  N  N   . ARG A  1 457 ? 27.287 79.403  33.839  1.00 48.76  ? 457 ARG A N   1 
ATOM   3449  C  CA  . ARG A  1 457 ? 26.101 78.736  33.289  1.00 49.50  ? 457 ARG A CA  1 
ATOM   3450  C  C   . ARG A  1 457 ? 26.367 78.357  31.834  1.00 54.54  ? 457 ARG A C   1 
ATOM   3451  O  O   . ARG A  1 457 ? 25.990 77.265  31.398  1.00 55.20  ? 457 ARG A O   1 
ATOM   3452  C  CB  . ARG A  1 457 ? 24.865 79.641  33.382  1.00 50.56  ? 457 ARG A CB  1 
ATOM   3453  C  CG  . ARG A  1 457 ? 24.172 79.627  34.729  1.00 61.06  ? 457 ARG A CG  1 
ATOM   3454  C  CD  . ARG A  1 457 ? 22.766 80.182  34.607  1.00 77.88  ? 457 ARG A CD  1 
ATOM   3455  N  NE  . ARG A  1 457 ? 21.777 79.135  34.340  1.00 91.77  ? 457 ARG A NE  1 
ATOM   3456  C  CZ  . ARG A  1 457 ? 20.468 79.271  34.534  1.00 109.82 ? 457 ARG A CZ  1 
ATOM   3457  N  NH1 . ARG A  1 457 ? 19.972 80.411  35.002  1.00 98.34  ? 457 ARG A NH1 1 
ATOM   3458  N  NH2 . ARG A  1 457 ? 19.645 78.265  34.272  1.00 98.36  ? 457 ARG A NH2 1 
ATOM   3459  N  N   . LYS A  1 458 ? 27.053 79.265  31.101  1.00 50.73  ? 458 LYS A N   1 
ATOM   3460  C  CA  . LYS A  1 458 ? 27.460 79.114  29.701  1.00 51.19  ? 458 LYS A CA  1 
ATOM   3461  C  C   . LYS A  1 458 ? 28.474 77.976  29.562  1.00 53.09  ? 458 LYS A C   1 
ATOM   3462  O  O   . LYS A  1 458 ? 28.366 77.177  28.629  1.00 53.68  ? 458 LYS A O   1 
ATOM   3463  C  CB  . LYS A  1 458 ? 28.053 80.429  29.166  1.00 53.54  ? 458 LYS A CB  1 
ATOM   3464  C  CG  . LYS A  1 458 ? 27.047 81.566  29.035  1.00 59.64  ? 458 LYS A CG  1 
ATOM   3465  C  CD  . LYS A  1 458 ? 27.753 82.905  28.875  1.00 61.31  ? 458 LYS A CD  1 
ATOM   3466  C  CE  . LYS A  1 458 ? 26.894 83.930  28.185  1.00 63.78  ? 458 LYS A CE  1 
ATOM   3467  N  NZ  . LYS A  1 458 ? 26.658 83.575  26.762  1.00 70.97  ? 458 LYS A NZ  1 
ATOM   3468  N  N   . HIS A  1 459 ? 29.435 77.887  30.510  1.00 46.91  ? 459 HIS A N   1 
ATOM   3469  C  CA  . HIS A  1 459 ? 30.457 76.840  30.546  1.00 46.03  ? 459 HIS A CA  1 
ATOM   3470  C  C   . HIS A  1 459 ? 29.832 75.476  30.847  1.00 50.61  ? 459 HIS A C   1 
ATOM   3471  O  O   . HIS A  1 459 ? 30.391 74.451  30.457  1.00 50.70  ? 459 HIS A O   1 
ATOM   3472  C  CB  . HIS A  1 459 ? 31.552 77.165  31.572  1.00 45.21  ? 459 HIS A CB  1 
ATOM   3473  C  CG  . HIS A  1 459 ? 32.286 78.447  31.310  1.00 48.57  ? 459 HIS A CG  1 
ATOM   3474  N  ND1 . HIS A  1 459 ? 32.891 79.149  32.337  1.00 49.13  ? 459 HIS A ND1 1 
ATOM   3475  C  CD2 . HIS A  1 459 ? 32.481 79.119  30.150  1.00 51.31  ? 459 HIS A CD2 1 
ATOM   3476  C  CE1 . HIS A  1 459 ? 33.435 80.214  31.773  1.00 48.82  ? 459 HIS A CE1 1 
ATOM   3477  N  NE2 . HIS A  1 459 ? 33.217 80.238  30.459  1.00 50.47  ? 459 HIS A NE2 1 
ATOM   3478  N  N   . GLY A  1 460 ? 28.669 75.487  31.505  1.00 47.20  ? 460 GLY A N   1 
ATOM   3479  C  CA  . GLY A  1 460 ? 27.894 74.293  31.827  1.00 47.23  ? 460 GLY A CA  1 
ATOM   3480  C  C   . GLY A  1 460 ? 27.404 73.574  30.587  1.00 52.13  ? 460 GLY A C   1 
ATOM   3481  O  O   . GLY A  1 460 ? 27.341 72.342  30.565  1.00 52.24  ? 460 GLY A O   1 
ATOM   3482  N  N   . VAL A  1 461 ? 27.072 74.354  29.541  1.00 49.09  ? 461 VAL A N   1 
ATOM   3483  C  CA  . VAL A  1 461 ? 26.627 73.882  28.227  1.00 50.26  ? 461 VAL A CA  1 
ATOM   3484  C  C   . VAL A  1 461 ? 27.854 73.346  27.468  1.00 54.29  ? 461 VAL A C   1 
ATOM   3485  O  O   . VAL A  1 461 ? 27.792 72.264  26.877  1.00 54.35  ? 461 VAL A O   1 
ATOM   3486  C  CB  . VAL A  1 461 ? 25.903 75.014  27.438  1.00 55.04  ? 461 VAL A CB  1 
ATOM   3487  C  CG1 . VAL A  1 461 ? 25.397 74.522  26.088  1.00 56.62  ? 461 VAL A CG1 1 
ATOM   3488  C  CG2 . VAL A  1 461 ? 24.757 75.614  28.247  1.00 54.77  ? 461 VAL A CG2 1 
ATOM   3489  N  N   . ARG A  1 462 ? 28.969 74.114  27.505  1.00 50.37  ? 462 ARG A N   1 
ATOM   3490  C  CA  . ARG A  1 462 ? 30.249 73.826  26.849  1.00 50.31  ? 462 ARG A CA  1 
ATOM   3491  C  C   . ARG A  1 462 ? 30.784 72.448  27.259  1.00 53.92  ? 462 ARG A C   1 
ATOM   3492  O  O   . ARG A  1 462 ? 31.134 71.647  26.388  1.00 54.89  ? 462 ARG A O   1 
ATOM   3493  C  CB  . ARG A  1 462 ? 31.262 74.936  27.180  1.00 48.62  ? 462 ARG A CB  1 
ATOM   3494  C  CG  . ARG A  1 462 ? 32.357 75.112  26.138  1.00 56.87  ? 462 ARG A CG  1 
ATOM   3495  C  CD  . ARG A  1 462 ? 33.116 76.410  26.333  1.00 63.70  ? 462 ARG A CD  1 
ATOM   3496  N  NE  . ARG A  1 462 ? 33.901 76.421  27.570  1.00 69.98  ? 462 ARG A NE  1 
ATOM   3497  C  CZ  . ARG A  1 462 ? 34.608 77.460  28.002  1.00 82.99  ? 462 ARG A CZ  1 
ATOM   3498  N  NH1 . ARG A  1 462 ? 34.640 78.588  27.302  1.00 72.15  ? 462 ARG A NH1 1 
ATOM   3499  N  NH2 . ARG A  1 462 ? 35.284 77.383  29.140  1.00 66.53  ? 462 ARG A NH2 1 
ATOM   3500  N  N   . VAL A  1 463 ? 30.800 72.173  28.578  1.00 48.28  ? 463 VAL A N   1 
ATOM   3501  C  CA  . VAL A  1 463 ? 31.216 70.917  29.198  1.00 47.12  ? 463 VAL A CA  1 
ATOM   3502  C  C   . VAL A  1 463 ? 30.237 69.806  28.796  1.00 51.10  ? 463 VAL A C   1 
ATOM   3503  O  O   . VAL A  1 463 ? 30.688 68.727  28.421  1.00 51.25  ? 463 VAL A O   1 
ATOM   3504  C  CB  . VAL A  1 463 ? 31.348 71.053  30.736  1.00 49.71  ? 463 VAL A CB  1 
ATOM   3505  C  CG1 . VAL A  1 463 ? 31.441 69.691  31.420  1.00 49.08  ? 463 VAL A CG1 1 
ATOM   3506  C  CG2 . VAL A  1 463 ? 32.538 71.934  31.116  1.00 48.67  ? 463 VAL A CG2 1 
ATOM   3507  N  N   . LYS A  1 464 ? 28.910 70.079  28.840  1.00 47.65  ? 464 LYS A N   1 
ATOM   3508  C  CA  . LYS A  1 464 ? 27.859 69.122  28.468  1.00 48.39  ? 464 LYS A CA  1 
ATOM   3509  C  C   . LYS A  1 464 ? 28.049 68.624  27.015  1.00 53.59  ? 464 LYS A C   1 
ATOM   3510  O  O   . LYS A  1 464 ? 27.858 67.432  26.762  1.00 53.61  ? 464 LYS A O   1 
ATOM   3511  C  CB  . LYS A  1 464 ? 26.459 69.733  28.668  1.00 51.22  ? 464 LYS A CB  1 
ATOM   3512  C  CG  . LYS A  1 464 ? 25.323 68.715  28.582  1.00 66.49  ? 464 LYS A CG  1 
ATOM   3513  C  CD  . LYS A  1 464 ? 24.000 69.246  29.127  1.00 73.02  ? 464 LYS A CD  1 
ATOM   3514  C  CE  . LYS A  1 464 ? 23.549 68.508  30.369  1.00 78.96  ? 464 LYS A CE  1 
ATOM   3515  N  NZ  . LYS A  1 464 ? 23.060 67.133  30.070  1.00 85.94  ? 464 LYS A NZ  1 
ATOM   3516  N  N   . ARG A  1 465 ? 28.477 69.519  26.093  1.00 50.94  ? 465 ARG A N   1 
ATOM   3517  C  CA  . ARG A  1 465 ? 28.748 69.203  24.686  1.00 52.42  ? 465 ARG A CA  1 
ATOM   3518  C  C   . ARG A  1 465 ? 30.007 68.318  24.541  1.00 57.20  ? 465 ARG A C   1 
ATOM   3519  O  O   . ARG A  1 465 ? 29.970 67.372  23.755  1.00 58.65  ? 465 ARG A O   1 
ATOM   3520  C  CB  . ARG A  1 465 ? 28.880 70.490  23.847  1.00 52.55  ? 465 ARG A CB  1 
ATOM   3521  C  CG  . ARG A  1 465 ? 29.034 70.283  22.334  1.00 60.90  ? 465 ARG A CG  1 
ATOM   3522  C  CD  . ARG A  1 465 ? 27.830 69.621  21.697  1.00 70.08  ? 465 ARG A CD  1 
ATOM   3523  N  NE  . ARG A  1 465 ? 28.072 69.282  20.297  1.00 82.48  ? 465 ARG A NE  1 
ATOM   3524  C  CZ  . ARG A  1 465 ? 27.300 68.474  19.578  1.00 101.28 ? 465 ARG A CZ  1 
ATOM   3525  N  NH1 . ARG A  1 465 ? 26.231 67.907  20.123  1.00 90.16  ? 465 ARG A NH1 1 
ATOM   3526  N  NH2 . ARG A  1 465 ? 27.595 68.219  18.311  1.00 91.70  ? 465 ARG A NH2 1 
ATOM   3527  N  N   . LYS A  1 466 ? 31.103 68.624  25.285  1.00 52.74  ? 466 LYS A N   1 
ATOM   3528  C  CA  . LYS A  1 466 ? 32.357 67.853  25.305  1.00 52.52  ? 466 LYS A CA  1 
ATOM   3529  C  C   . LYS A  1 466 ? 32.098 66.384  25.668  1.00 58.51  ? 466 LYS A C   1 
ATOM   3530  O  O   . LYS A  1 466 ? 32.684 65.484  25.066  1.00 59.05  ? 466 LYS A O   1 
ATOM   3531  C  CB  . LYS A  1 466 ? 33.331 68.452  26.336  1.00 52.90  ? 466 LYS A CB  1 
ATOM   3532  C  CG  . LYS A  1 466 ? 34.247 69.562  25.843  1.00 65.82  ? 466 LYS A CG  1 
ATOM   3533  C  CD  . LYS A  1 466 ? 35.220 69.924  26.968  1.00 74.83  ? 466 LYS A CD  1 
ATOM   3534  C  CE  . LYS A  1 466 ? 36.107 71.103  26.687  1.00 88.76  ? 466 LYS A CE  1 
ATOM   3535  N  NZ  . LYS A  1 466 ? 35.406 72.397  26.911  1.00 99.11  ? 466 LYS A NZ  1 
ATOM   3536  N  N   . VAL A  1 467 ? 31.206 66.156  26.648  1.00 55.47  ? 467 VAL A N   1 
ATOM   3537  C  CA  . VAL A  1 467 ? 30.826 64.841  27.166  1.00 55.66  ? 467 VAL A CA  1 
ATOM   3538  C  C   . VAL A  1 467 ? 29.949 64.103  26.143  1.00 62.18  ? 467 VAL A C   1 
ATOM   3539  O  O   . VAL A  1 467 ? 30.132 62.899  25.958  1.00 62.51  ? 467 VAL A O   1 
ATOM   3540  C  CB  . VAL A  1 467 ? 30.144 64.991  28.545  1.00 58.26  ? 467 VAL A CB  1 
ATOM   3541  C  CG1 . VAL A  1 467 ? 29.645 63.651  29.086  1.00 58.29  ? 467 VAL A CG1 1 
ATOM   3542  C  CG2 . VAL A  1 467 ? 31.106 65.642  29.532  1.00 56.37  ? 467 VAL A CG2 1 
ATOM   3543  N  N   . GLN A  1 468 ? 29.035 64.819  25.458  1.00 59.98  ? 468 GLN A N   1 
ATOM   3544  C  CA  . GLN A  1 468 ? 28.168 64.236  24.419  1.00 61.87  ? 468 GLN A CA  1 
ATOM   3545  C  C   . GLN A  1 468 ? 28.991 63.608  23.301  1.00 69.05  ? 468 GLN A C   1 
ATOM   3546  O  O   . GLN A  1 468 ? 28.563 62.623  22.703  1.00 69.75  ? 468 GLN A O   1 
ATOM   3547  C  CB  . GLN A  1 468 ? 27.229 65.286  23.820  1.00 63.77  ? 468 GLN A CB  1 
ATOM   3548  C  CG  . GLN A  1 468 ? 25.981 65.528  24.634  1.00 71.67  ? 468 GLN A CG  1 
ATOM   3549  C  CD  . GLN A  1 468 ? 25.122 66.619  24.044  1.00 84.68  ? 468 GLN A CD  1 
ATOM   3550  O  OE1 . GLN A  1 468 ? 25.592 67.519  23.334  1.00 78.00  ? 468 GLN A OE1 1 
ATOM   3551  N  NE2 . GLN A  1 468 ? 23.836 66.572  24.342  1.00 77.08  ? 468 GLN A NE2 1 
ATOM   3552  N  N   . ALA A  1 469 ? 30.185 64.171  23.043  1.00 67.42  ? 469 ALA A N   1 
ATOM   3553  C  CA  . ALA A  1 469 ? 31.133 63.713  22.033  1.00 69.27  ? 469 ALA A CA  1 
ATOM   3554  C  C   . ALA A  1 469 ? 31.802 62.380  22.434  1.00 75.21  ? 469 ALA A C   1 
ATOM   3555  O  O   . ALA A  1 469 ? 32.236 61.632  21.554  1.00 76.06  ? 469 ALA A O   1 
ATOM   3556  C  CB  . ALA A  1 469 ? 32.191 64.784  21.803  1.00 69.48  ? 469 ALA A CB  1 
ATOM   3557  N  N   . LEU A  1 470 ? 31.871 62.085  23.749  1.00 72.01  ? 470 LEU A N   1 
ATOM   3558  C  CA  . LEU A  1 470 ? 32.486 60.869  24.298  1.00 72.26  ? 470 LEU A CA  1 
ATOM   3559  C  C   . LEU A  1 470 ? 31.656 59.610  23.979  1.00 78.95  ? 470 LEU A C   1 
ATOM   3560  O  O   . LEU A  1 470 ? 32.243 58.580  23.631  1.00 79.67  ? 470 LEU A O   1 
ATOM   3561  C  CB  . LEU A  1 470 ? 32.679 61.013  25.823  1.00 70.61  ? 470 LEU A CB  1 
ATOM   3562  C  CG  . LEU A  1 470 ? 33.577 59.995  26.517  1.00 74.68  ? 470 LEU A CG  1 
ATOM   3563  C  CD1 . LEU A  1 470 ? 35.037 60.419  26.461  1.00 74.15  ? 470 LEU A CD1 1 
ATOM   3564  C  CD2 . LEU A  1 470 ? 33.157 59.814  27.956  1.00 75.97  ? 470 LEU A CD2 1 
ATOM   3565  N  N   . LYS A  1 471 ? 30.304 59.702  24.102  1.00 76.23  ? 471 LYS A N   1 
ATOM   3566  C  CA  . LYS A  1 471 ? 29.314 58.635  23.856  1.00 107.69 ? 471 LYS A CA  1 
ATOM   3567  C  C   . LYS A  1 471 ? 29.570 57.392  24.743  1.00 135.65 ? 471 LYS A C   1 
ATOM   3568  O  O   . LYS A  1 471 ? 30.189 56.409  24.327  1.00 95.52  ? 471 LYS A O   1 
ATOM   3569  C  CB  . LYS A  1 471 ? 29.247 58.250  22.363  1.00 112.01 ? 471 LYS A CB  1 
ATOM   3570  N  N   . ASP A  1 475 ? 28.775 55.050  31.099  1.00 86.45  ? 475 ASP A N   1 
ATOM   3571  C  CA  . ASP A  1 475 ? 28.144 56.055  31.950  1.00 85.23  ? 475 ASP A CA  1 
ATOM   3572  C  C   . ASP A  1 475 ? 29.146 57.186  32.249  1.00 85.88  ? 475 ASP A C   1 
ATOM   3573  O  O   . ASP A  1 475 ? 30.065 57.019  33.058  1.00 84.37  ? 475 ASP A O   1 
ATOM   3574  C  CB  . ASP A  1 475 ? 27.602 55.412  33.240  1.00 87.28  ? 475 ASP A CB  1 
ATOM   3575  C  CG  . ASP A  1 475 ? 26.820 56.366  34.120  1.00 100.05 ? 475 ASP A CG  1 
ATOM   3576  O  OD1 . ASP A  1 475 ? 25.615 56.566  33.852  1.00 101.52 ? 475 ASP A OD1 1 
ATOM   3577  O  OD2 . ASP A  1 475 ? 27.417 56.921  35.071  1.00 106.33 ? 475 ASP A OD2 1 
ATOM   3578  N  N   . ALA A  1 476 ? 28.973 58.327  31.562  1.00 81.00  ? 476 ALA A N   1 
ATOM   3579  C  CA  . ALA A  1 476 ? 29.843 59.495  31.689  1.00 78.81  ? 476 ALA A CA  1 
ATOM   3580  C  C   . ALA A  1 476 ? 29.223 60.579  32.602  1.00 79.51  ? 476 ALA A C   1 
ATOM   3581  O  O   . ALA A  1 476 ? 29.377 61.780  32.347  1.00 78.79  ? 476 ALA A O   1 
ATOM   3582  C  CB  . ALA A  1 476 ? 30.144 60.062  30.306  1.00 80.23  ? 476 ALA A CB  1 
ATOM   3583  N  N   . THR A  1 477 ? 28.550 60.145  33.687  1.00 73.82  ? 477 THR A N   1 
ATOM   3584  C  CA  . THR A  1 477 ? 27.923 61.044  34.660  1.00 71.90  ? 477 THR A CA  1 
ATOM   3585  C  C   . THR A  1 477 ? 29.020 61.704  35.502  1.00 72.25  ? 477 THR A C   1 
ATOM   3586  O  O   . THR A  1 477 ? 29.047 62.931  35.603  1.00 70.53  ? 477 THR A O   1 
ATOM   3587  C  CB  . THR A  1 477 ? 26.886 60.300  35.514  1.00 79.89  ? 477 THR A CB  1 
ATOM   3588  O  OG1 . THR A  1 477 ? 26.120 59.433  34.677  1.00 81.85  ? 477 THR A OG1 1 
ATOM   3589  C  CG2 . THR A  1 477 ? 25.950 61.249  36.255  1.00 77.37  ? 477 THR A CG2 1 
ATOM   3590  N  N   . LEU A  1 478 ? 29.937 60.886  36.070  1.00 67.69  ? 478 LEU A N   1 
ATOM   3591  C  CA  . LEU A  1 478 ? 31.082 61.334  36.871  1.00 65.63  ? 478 LEU A CA  1 
ATOM   3592  C  C   . LEU A  1 478 ? 32.086 62.084  35.990  1.00 68.46  ? 478 LEU A C   1 
ATOM   3593  O  O   . LEU A  1 478 ? 32.691 63.051  36.454  1.00 66.71  ? 478 LEU A O   1 
ATOM   3594  C  CB  . LEU A  1 478 ? 31.757 60.136  37.568  1.00 65.41  ? 478 LEU A CB  1 
ATOM   3595  C  CG  . LEU A  1 478 ? 32.946 60.426  38.491  1.00 68.59  ? 478 LEU A CG  1 
ATOM   3596  C  CD1 . LEU A  1 478 ? 32.490 60.979  39.839  1.00 67.87  ? 478 LEU A CD1 1 
ATOM   3597  C  CD2 . LEU A  1 478 ? 33.779 59.183  38.683  1.00 71.16  ? 478 LEU A CD2 1 
ATOM   3598  N  N   . TYR A  1 479 ? 32.242 61.642  34.719  1.00 65.81  ? 479 TYR A N   1 
ATOM   3599  C  CA  . TYR A  1 479 ? 33.122 62.264  33.732  1.00 65.52  ? 479 TYR A CA  1 
ATOM   3600  C  C   . TYR A  1 479 ? 32.715 63.726  33.539  1.00 65.26  ? 479 TYR A C   1 
ATOM   3601  O  O   . TYR A  1 479 ? 33.562 64.605  33.680  1.00 63.51  ? 479 TYR A O   1 
ATOM   3602  C  CB  . TYR A  1 479 ? 33.092 61.481  32.402  1.00 69.52  ? 479 TYR A CB  1 
ATOM   3603  C  CG  . TYR A  1 479 ? 33.896 62.118  31.284  1.00 74.11  ? 479 TYR A CG  1 
ATOM   3604  C  CD1 . TYR A  1 479 ? 35.284 62.022  31.252  1.00 76.21  ? 479 TYR A CD1 1 
ATOM   3605  C  CD2 . TYR A  1 479 ? 33.267 62.793  30.242  1.00 76.61  ? 479 TYR A CD2 1 
ATOM   3606  C  CE1 . TYR A  1 479 ? 36.029 62.608  30.226  1.00 78.62  ? 479 TYR A CE1 1 
ATOM   3607  C  CE2 . TYR A  1 479 ? 34.000 63.377  29.206  1.00 78.51  ? 479 TYR A CE2 1 
ATOM   3608  C  CZ  . TYR A  1 479 ? 35.383 63.279  29.200  1.00 87.62  ? 479 TYR A CZ  1 
ATOM   3609  O  OH  . TYR A  1 479 ? 36.111 63.852  28.180  1.00 90.85  ? 479 TYR A OH  1 
ATOM   3610  N  N   . GLU A  1 480 ? 31.414 63.980  33.299  1.00 60.24  ? 480 GLU A N   1 
ATOM   3611  C  CA  . GLU A  1 480 ? 30.845 65.319  33.124  1.00 59.01  ? 480 GLU A CA  1 
ATOM   3612  C  C   . GLU A  1 480 ? 31.012 66.171  34.391  1.00 60.51  ? 480 GLU A C   1 
ATOM   3613  O  O   . GLU A  1 480 ? 31.335 67.352  34.280  1.00 59.78  ? 480 GLU A O   1 
ATOM   3614  C  CB  . GLU A  1 480 ? 29.357 65.231  32.724  1.00 61.30  ? 480 GLU A CB  1 
ATOM   3615  C  CG  . GLU A  1 480 ? 28.774 66.572  32.317  1.00 68.92  ? 480 GLU A CG  1 
ATOM   3616  C  CD  . GLU A  1 480 ? 27.539 66.579  31.453  1.00 83.89  ? 480 GLU A CD  1 
ATOM   3617  O  OE1 . GLU A  1 480 ? 27.299 65.605  30.702  1.00 80.83  ? 480 GLU A OE1 1 
ATOM   3618  O  OE2 . GLU A  1 480 ? 26.853 67.625  31.462  1.00 74.95  ? 480 GLU A OE2 1 
ATOM   3619  N  N   . GLN A  1 481 ? 30.817 65.567  35.586  1.00 55.32  ? 481 GLN A N   1 
ATOM   3620  C  CA  . GLN A  1 481 ? 30.960 66.231  36.888  1.00 53.17  ? 481 GLN A CA  1 
ATOM   3621  C  C   . GLN A  1 481 ? 32.406 66.688  37.133  1.00 54.40  ? 481 GLN A C   1 
ATOM   3622  O  O   . GLN A  1 481 ? 32.613 67.772  37.681  1.00 53.05  ? 481 GLN A O   1 
ATOM   3623  C  CB  . GLN A  1 481 ? 30.506 65.305  38.026  1.00 54.46  ? 481 GLN A CB  1 
ATOM   3624  C  CG  . GLN A  1 481 ? 30.140 66.058  39.308  1.00 71.08  ? 481 GLN A CG  1 
ATOM   3625  C  CD  . GLN A  1 481 ? 30.237 65.237  40.576  1.00 95.12  ? 481 GLN A CD  1 
ATOM   3626  O  OE1 . GLN A  1 481 ? 30.916 64.201  40.650  1.00 94.67  ? 481 GLN A OE1 1 
ATOM   3627  N  NE2 . GLN A  1 481 ? 29.592 65.722  41.629  1.00 84.24  ? 481 GLN A NE2 1 
ATOM   3628  N  N   . VAL A  1 482 ? 33.398 65.867  36.724  1.00 49.80  ? 482 VAL A N   1 
ATOM   3629  C  CA  . VAL A  1 482 ? 34.821 66.178  36.890  1.00 47.93  ? 482 VAL A CA  1 
ATOM   3630  C  C   . VAL A  1 482 ? 35.239 67.255  35.863  1.00 50.52  ? 482 VAL A C   1 
ATOM   3631  O  O   . VAL A  1 482 ? 35.802 68.261  36.279  1.00 48.69  ? 482 VAL A O   1 
ATOM   3632  C  CB  . VAL A  1 482 ? 35.720 64.911  36.851  1.00 51.58  ? 482 VAL A CB  1 
ATOM   3633  C  CG1 . VAL A  1 482 ? 37.203 65.275  36.788  1.00 50.82  ? 482 VAL A CG1 1 
ATOM   3634  C  CG2 . VAL A  1 482 ? 35.451 64.026  38.065  1.00 50.94  ? 482 VAL A CG2 1 
ATOM   3635  N  N   . ILE A  1 483 ? 34.916 67.079  34.557  1.00 48.30  ? 483 ILE A N   1 
ATOM   3636  C  CA  . ILE A  1 483 ? 35.233 68.038  33.475  1.00 48.58  ? 483 ILE A CA  1 
ATOM   3637  C  C   . ILE A  1 483 ? 34.680 69.445  33.821  1.00 52.54  ? 483 ILE A C   1 
ATOM   3638  O  O   . ILE A  1 483 ? 35.374 70.440  33.600  1.00 51.95  ? 483 ILE A O   1 
ATOM   3639  C  CB  . ILE A  1 483 ? 34.714 67.543  32.075  1.00 52.92  ? 483 ILE A CB  1 
ATOM   3640  C  CG1 . ILE A  1 483 ? 35.312 66.162  31.653  1.00 54.10  ? 483 ILE A CG1 1 
ATOM   3641  C  CG2 . ILE A  1 483 ? 34.901 68.585  30.957  1.00 53.23  ? 483 ILE A CG2 1 
ATOM   3642  C  CD1 . ILE A  1 483 ? 36.862 66.028  31.518  1.00 61.58  ? 483 ILE A CD1 1 
ATOM   3643  N  N   . LEU A  1 484 ? 33.452 69.515  34.386  1.00 49.45  ? 484 LEU A N   1 
ATOM   3644  C  CA  . LEU A  1 484 ? 32.784 70.760  34.778  1.00 48.92  ? 484 LEU A CA  1 
ATOM   3645  C  C   . LEU A  1 484 ? 33.531 71.442  35.929  1.00 51.63  ? 484 LEU A C   1 
ATOM   3646  O  O   . LEU A  1 484 ? 33.944 72.590  35.776  1.00 50.76  ? 484 LEU A O   1 
ATOM   3647  C  CB  . LEU A  1 484 ? 31.314 70.482  35.174  1.00 49.26  ? 484 LEU A CB  1 
ATOM   3648  C  CG  . LEU A  1 484 ? 30.355 71.673  35.268  1.00 53.83  ? 484 LEU A CG  1 
ATOM   3649  C  CD1 . LEU A  1 484 ? 29.640 71.887  33.975  1.00 55.87  ? 484 LEU A CD1 1 
ATOM   3650  C  CD2 . LEU A  1 484 ? 29.289 71.437  36.308  1.00 54.83  ? 484 LEU A CD2 1 
ATOM   3651  N  N   . GLU A  1 485 ? 33.723 70.729  37.057  1.00 47.92  ? 485 GLU A N   1 
ATOM   3652  C  CA  . GLU A  1 485 ? 34.376 71.234  38.270  1.00 46.92  ? 485 GLU A CA  1 
ATOM   3653  C  C   . GLU A  1 485 ? 35.869 71.529  38.069  1.00 51.44  ? 485 GLU A C   1 
ATOM   3654  O  O   . GLU A  1 485 ? 36.401 72.404  38.753  1.00 50.47  ? 485 GLU A O   1 
ATOM   3655  C  CB  . GLU A  1 485 ? 34.182 70.254  39.431  1.00 47.69  ? 485 GLU A CB  1 
ATOM   3656  C  CG  . GLU A  1 485 ? 32.783 70.315  40.018  1.00 54.20  ? 485 GLU A CG  1 
ATOM   3657  C  CD  . GLU A  1 485 ? 32.431 69.226  41.006  1.00 68.21  ? 485 GLU A CD  1 
ATOM   3658  O  OE1 . GLU A  1 485 ? 33.254 68.949  41.907  1.00 64.77  ? 485 GLU A OE1 1 
ATOM   3659  O  OE2 . GLU A  1 485 ? 31.306 68.684  40.912  1.00 58.96  ? 485 GLU A OE2 1 
ATOM   3660  N  N   . LYS A  1 486 ? 36.537 70.812  37.145  1.00 48.74  ? 486 LYS A N   1 
ATOM   3661  C  CA  . LYS A  1 486 ? 37.951 71.002  36.811  1.00 48.43  ? 486 LYS A CA  1 
ATOM   3662  C  C   . LYS A  1 486 ? 38.150 72.392  36.201  1.00 53.26  ? 486 LYS A C   1 
ATOM   3663  O  O   . LYS A  1 486 ? 39.013 73.139  36.670  1.00 52.58  ? 486 LYS A O   1 
ATOM   3664  C  CB  . LYS A  1 486 ? 38.418 69.897  35.844  1.00 51.45  ? 486 LYS A CB  1 
ATOM   3665  C  CG  . LYS A  1 486 ? 39.827 70.064  35.287  1.00 61.28  ? 486 LYS A CG  1 
ATOM   3666  C  CD  . LYS A  1 486 ? 40.029 69.276  34.007  1.00 69.71  ? 486 LYS A CD  1 
ATOM   3667  C  CE  . LYS A  1 486 ? 39.860 70.119  32.772  1.00 75.90  ? 486 LYS A CE  1 
ATOM   3668  N  NZ  . LYS A  1 486 ? 40.589 69.535  31.623  1.00 85.84  ? 486 LYS A NZ  1 
ATOM   3669  N  N   . GLU A  1 487 ? 37.321 72.744  35.188  1.00 50.63  ? 487 GLU A N   1 
ATOM   3670  C  CA  . GLU A  1 487 ? 37.379 74.027  34.482  1.00 50.66  ? 487 GLU A CA  1 
ATOM   3671  C  C   . GLU A  1 487 ? 36.721 75.178  35.260  1.00 53.33  ? 487 GLU A C   1 
ATOM   3672  O  O   . GLU A  1 487 ? 36.862 76.334  34.849  1.00 53.35  ? 487 GLU A O   1 
ATOM   3673  C  CB  . GLU A  1 487 ? 36.747 73.903  33.099  1.00 53.35  ? 487 GLU A CB  1 
ATOM   3674  C  CG  . GLU A  1 487 ? 37.633 73.177  32.105  1.00 64.55  ? 487 GLU A CG  1 
ATOM   3675  C  CD  . GLU A  1 487 ? 36.863 72.333  31.114  1.00 82.47  ? 487 GLU A CD  1 
ATOM   3676  O  OE1 . GLU A  1 487 ? 35.894 72.849  30.512  1.00 78.35  ? 487 GLU A OE1 1 
ATOM   3677  O  OE2 . GLU A  1 487 ? 37.274 71.174  30.883  1.00 73.30  ? 487 GLU A OE2 1 
ATOM   3678  N  N   . MET A  1 488 ? 36.036 74.877  36.386  1.00 48.49  ? 488 MET A N   1 
ATOM   3679  C  CA  . MET A  1 488 ? 35.406 75.879  37.254  1.00 47.31  ? 488 MET A CA  1 
ATOM   3680  C  C   . MET A  1 488 ? 36.462 76.775  37.899  1.00 50.39  ? 488 MET A C   1 
ATOM   3681  O  O   . MET A  1 488 ? 37.624 76.374  38.017  1.00 49.41  ? 488 MET A O   1 
ATOM   3682  C  CB  . MET A  1 488 ? 34.582 75.197  38.354  1.00 49.01  ? 488 MET A CB  1 
ATOM   3683  C  CG  . MET A  1 488 ? 33.142 74.990  38.012  1.00 53.34  ? 488 MET A CG  1 
ATOM   3684  S  SD  . MET A  1 488 ? 32.265 74.445  39.490  1.00 57.11  ? 488 MET A SD  1 
ATOM   3685  C  CE  . MET A  1 488 ? 30.752 73.892  38.796  1.00 55.01  ? 488 MET A CE  1 
ATOM   3686  N  N   . GLY A  1 489 ? 36.051 77.969  38.314  1.00 47.32  ? 489 GLY A N   1 
ATOM   3687  C  CA  . GLY A  1 489 ? 36.933 78.918  38.982  1.00 46.74  ? 489 GLY A CA  1 
ATOM   3688  C  C   . GLY A  1 489 ? 37.383 78.420  40.341  1.00 49.62  ? 489 GLY A C   1 
ATOM   3689  O  O   . GLY A  1 489 ? 36.648 77.681  41.001  1.00 49.09  ? 489 GLY A O   1 
ATOM   3690  N  N   . THR A  1 490 ? 38.602 78.790  40.756  1.00 45.83  ? 490 THR A N   1 
ATOM   3691  C  CA  . THR A  1 490 ? 39.140 78.378  42.054  1.00 44.99  ? 490 THR A CA  1 
ATOM   3692  C  C   . THR A  1 490 ? 38.911 79.498  43.051  1.00 48.01  ? 490 THR A C   1 
ATOM   3693  O  O   . THR A  1 490 ? 39.237 80.653  42.759  1.00 47.40  ? 490 THR A O   1 
ATOM   3694  C  CB  . THR A  1 490 ? 40.632 77.995  41.952  1.00 55.15  ? 490 THR A CB  1 
ATOM   3695  O  OG1 . THR A  1 490 ? 40.865 77.226  40.771  1.00 59.33  ? 490 THR A OG1 1 
ATOM   3696  C  CG2 . THR A  1 490 ? 41.121 77.226  43.167  1.00 51.63  ? 490 THR A CG2 1 
ATOM   3697  N  N   . TYR A  1 491 ? 38.334 79.163  44.219  1.00 44.51  ? 491 TYR A N   1 
ATOM   3698  C  CA  . TYR A  1 491 ? 38.086 80.139  45.275  1.00 44.21  ? 491 TYR A CA  1 
ATOM   3699  C  C   . TYR A  1 491 ? 39.423 80.500  45.906  1.00 48.50  ? 491 TYR A C   1 
ATOM   3700  O  O   . TYR A  1 491 ? 40.096 79.632  46.473  1.00 48.48  ? 491 TYR A O   1 
ATOM   3701  C  CB  . TYR A  1 491 ? 37.082 79.602  46.306  1.00 45.15  ? 491 TYR A CB  1 
ATOM   3702  C  CG  . TYR A  1 491 ? 36.701 80.603  47.372  1.00 46.65  ? 491 TYR A CG  1 
ATOM   3703  C  CD1 . TYR A  1 491 ? 35.954 81.733  47.059  1.00 48.88  ? 491 TYR A CD1 1 
ATOM   3704  C  CD2 . TYR A  1 491 ? 37.047 80.399  48.703  1.00 47.14  ? 491 TYR A CD2 1 
ATOM   3705  C  CE1 . TYR A  1 491 ? 35.583 82.649  48.040  1.00 49.21  ? 491 TYR A CE1 1 
ATOM   3706  C  CE2 . TYR A  1 491 ? 36.677 81.306  49.695  1.00 47.78  ? 491 TYR A CE2 1 
ATOM   3707  C  CZ  . TYR A  1 491 ? 35.943 82.429  49.357  1.00 53.85  ? 491 TYR A CZ  1 
ATOM   3708  O  OH  . TYR A  1 491 ? 35.575 83.327  50.325  1.00 52.61  ? 491 TYR A OH  1 
ATOM   3709  N  N   . LEU A  1 492 ? 39.834 81.767  45.738  1.00 44.72  ? 492 LEU A N   1 
ATOM   3710  C  CA  . LEU A  1 492 ? 41.121 82.296  46.196  1.00 44.38  ? 492 LEU A CA  1 
ATOM   3711  C  C   . LEU A  1 492 ? 41.276 82.338  47.725  1.00 46.04  ? 492 LEU A C   1 
ATOM   3712  O  O   . LEU A  1 492 ? 42.399 82.215  48.222  1.00 44.66  ? 492 LEU A O   1 
ATOM   3713  C  CB  . LEU A  1 492 ? 41.338 83.700  45.624  1.00 45.11  ? 492 LEU A CB  1 
ATOM   3714  C  CG  . LEU A  1 492 ? 41.627 83.772  44.124  1.00 50.99  ? 492 LEU A CG  1 
ATOM   3715  C  CD1 . LEU A  1 492 ? 40.948 84.969  43.494  1.00 51.81  ? 492 LEU A CD1 1 
ATOM   3716  C  CD2 . LEU A  1 492 ? 43.121 83.787  43.846  1.00 54.12  ? 492 LEU A CD2 1 
ATOM   3717  N  N   . GLY A  1 493 ? 40.170 82.520  48.440  1.00 42.34  ? 493 GLY A N   1 
ATOM   3718  C  CA  . GLY A  1 493 ? 40.161 82.597  49.897  1.00 42.07  ? 493 GLY A CA  1 
ATOM   3719  C  C   . GLY A  1 493 ? 39.199 83.639  50.426  1.00 47.07  ? 493 GLY A C   1 
ATOM   3720  O  O   . GLY A  1 493 ? 38.680 84.454  49.657  1.00 47.45  ? 493 GLY A O   1 
ATOM   3721  N  N   . THR A  1 494 ? 38.982 83.645  51.753  1.00 43.09  ? 494 THR A N   1 
ATOM   3722  C  CA  . THR A  1 494 ? 38.049 84.562  52.410  1.00 42.88  ? 494 THR A CA  1 
ATOM   3723  C  C   . THR A  1 494 ? 38.548 86.031  52.492  1.00 47.86  ? 494 THR A C   1 
ATOM   3724  O  O   . THR A  1 494 ? 37.764 86.883  52.912  1.00 48.03  ? 494 THR A O   1 
ATOM   3725  C  CB  . THR A  1 494 ? 37.689 84.056  53.814  1.00 49.58  ? 494 THR A CB  1 
ATOM   3726  O  OG1 . THR A  1 494 ? 38.844 84.059  54.656  1.00 49.28  ? 494 THR A OG1 1 
ATOM   3727  C  CG2 . THR A  1 494 ? 37.022 82.690  53.800  1.00 48.38  ? 494 THR A CG2 1 
ATOM   3728  N  N   . PHE A  1 495 ? 39.804 86.338  52.073  1.00 44.71  ? 495 PHE A N   1 
ATOM   3729  C  CA  . PHE A  1 495 ? 40.373 87.694  52.148  1.00 44.77  ? 495 PHE A CA  1 
ATOM   3730  C  C   . PHE A  1 495 ? 39.488 88.770  51.484  1.00 49.62  ? 495 PHE A C   1 
ATOM   3731  O  O   . PHE A  1 495 ? 39.093 89.710  52.175  1.00 50.33  ? 495 PHE A O   1 
ATOM   3732  C  CB  . PHE A  1 495 ? 41.803 87.774  51.571  1.00 46.65  ? 495 PHE A CB  1 
ATOM   3733  C  CG  . PHE A  1 495 ? 42.394 89.167  51.642  1.00 48.20  ? 495 PHE A CG  1 
ATOM   3734  C  CD1 . PHE A  1 495 ? 42.998 89.625  52.806  1.00 51.16  ? 495 PHE A CD1 1 
ATOM   3735  C  CD2 . PHE A  1 495 ? 42.316 90.032  50.556  1.00 50.69  ? 495 PHE A CD2 1 
ATOM   3736  C  CE1 . PHE A  1 495 ? 43.508 90.924  52.885  1.00 52.32  ? 495 PHE A CE1 1 
ATOM   3737  C  CE2 . PHE A  1 495 ? 42.818 91.333  50.639  1.00 53.76  ? 495 PHE A CE2 1 
ATOM   3738  C  CZ  . PHE A  1 495 ? 43.414 91.769  51.801  1.00 51.70  ? 495 PHE A CZ  1 
ATOM   3739  N  N   . ASP A  1 496 ? 39.213 88.660  50.166  1.00 45.19  ? 496 ASP A N   1 
ATOM   3740  C  CA  . ASP A  1 496 ? 38.422 89.644  49.414  1.00 45.00  ? 496 ASP A CA  1 
ATOM   3741  C  C   . ASP A  1 496 ? 37.027 89.851  50.023  1.00 46.98  ? 496 ASP A C   1 
ATOM   3742  O  O   . ASP A  1 496 ? 36.506 90.969  49.990  1.00 47.17  ? 496 ASP A O   1 
ATOM   3743  C  CB  . ASP A  1 496 ? 38.285 89.234  47.938  1.00 47.80  ? 496 ASP A CB  1 
ATOM   3744  C  CG  . ASP A  1 496 ? 39.600 88.971  47.237  1.00 60.02  ? 496 ASP A CG  1 
ATOM   3745  O  OD1 . ASP A  1 496 ? 40.242 89.947  46.800  1.00 60.73  ? 496 ASP A OD1 1 
ATOM   3746  O  OD2 . ASP A  1 496 ? 39.983 87.792  47.124  1.00 67.26  ? 496 ASP A OD2 1 
ATOM   3747  N  N   . ASP A  1 497 ? 36.443 88.774  50.588  1.00 41.36  ? 497 ASP A N   1 
ATOM   3748  C  CA  . ASP A  1 497 ? 35.121 88.755  51.214  1.00 40.22  ? 497 ASP A CA  1 
ATOM   3749  C  C   . ASP A  1 497 ? 35.118 89.529  52.532  1.00 41.35  ? 497 ASP A C   1 
ATOM   3750  O  O   . ASP A  1 497 ? 34.227 90.355  52.736  1.00 40.90  ? 497 ASP A O   1 
ATOM   3751  C  CB  . ASP A  1 497 ? 34.663 87.311  51.435  1.00 41.80  ? 497 ASP A CB  1 
ATOM   3752  C  CG  . ASP A  1 497 ? 34.440 86.556  50.148  1.00 50.16  ? 497 ASP A CG  1 
ATOM   3753  O  OD1 . ASP A  1 497 ? 33.313 86.612  49.618  1.00 51.54  ? 497 ASP A OD1 1 
ATOM   3754  O  OD2 . ASP A  1 497 ? 35.401 85.939  49.653  1.00 53.88  ? 497 ASP A OD2 1 
ATOM   3755  N  N   . TYR A  1 498 ? 36.112 89.269  53.415  1.00 36.03  ? 498 TYR A N   1 
ATOM   3756  C  CA  . TYR A  1 498 ? 36.270 89.944  54.709  1.00 35.02  ? 498 TYR A CA  1 
ATOM   3757  C  C   . TYR A  1 498 ? 36.653 91.413  54.524  1.00 39.17  ? 498 TYR A C   1 
ATOM   3758  O  O   . TYR A  1 498 ? 36.161 92.256  55.275  1.00 38.88  ? 498 TYR A O   1 
ATOM   3759  C  CB  . TYR A  1 498 ? 37.334 89.255  55.579  1.00 35.35  ? 498 TYR A CB  1 
ATOM   3760  C  CG  . TYR A  1 498 ? 36.865 88.063  56.389  1.00 36.58  ? 498 TYR A CG  1 
ATOM   3761  C  CD1 . TYR A  1 498 ? 35.951 88.216  57.429  1.00 38.26  ? 498 TYR A CD1 1 
ATOM   3762  C  CD2 . TYR A  1 498 ? 37.432 86.806  56.204  1.00 37.16  ? 498 TYR A CD2 1 
ATOM   3763  C  CE1 . TYR A  1 498 ? 35.550 87.130  58.207  1.00 38.31  ? 498 TYR A CE1 1 
ATOM   3764  C  CE2 . TYR A  1 498 ? 37.042 85.713  56.977  1.00 37.82  ? 498 TYR A CE2 1 
ATOM   3765  C  CZ  . TYR A  1 498 ? 36.101 85.880  57.977  1.00 44.47  ? 498 TYR A CZ  1 
ATOM   3766  O  OH  . TYR A  1 498 ? 35.726 84.799  58.736  1.00 45.75  ? 498 TYR A OH  1 
ATOM   3767  N  N   . LEU A  1 499 ? 37.537 91.714  53.531  1.00 35.51  ? 499 LEU A N   1 
ATOM   3768  C  CA  . LEU A  1 499 ? 38.013 93.064  53.201  1.00 35.49  ? 499 LEU A CA  1 
ATOM   3769  C  C   . LEU A  1 499 ? 36.831 93.996  52.898  1.00 40.54  ? 499 LEU A C   1 
ATOM   3770  O  O   . LEU A  1 499 ? 36.847 95.144  53.340  1.00 40.73  ? 499 LEU A O   1 
ATOM   3771  C  CB  . LEU A  1 499 ? 39.010 93.031  52.021  1.00 35.64  ? 499 LEU A CB  1 
ATOM   3772  C  CG  . LEU A  1 499 ? 39.507 94.369  51.438  1.00 40.42  ? 499 LEU A CG  1 
ATOM   3773  C  CD1 . LEU A  1 499 ? 40.420 95.109  52.404  1.00 40.22  ? 499 LEU A CD1 1 
ATOM   3774  C  CD2 . LEU A  1 499 ? 40.222 94.150  50.133  1.00 43.15  ? 499 LEU A CD2 1 
ATOM   3775  N  N   . GLU A  1 500 ? 35.797 93.486  52.193  1.00 37.32  ? 500 GLU A N   1 
ATOM   3776  C  CA  . GLU A  1 500 ? 34.566 94.218  51.877  1.00 37.81  ? 500 GLU A CA  1 
ATOM   3777  C  C   . GLU A  1 500 ? 33.913 94.741  53.162  1.00 41.70  ? 500 GLU A C   1 
ATOM   3778  O  O   . GLU A  1 500 ? 33.560 95.919  53.236  1.00 41.86  ? 500 GLU A O   1 
ATOM   3779  C  CB  . GLU A  1 500 ? 33.576 93.311  51.123  1.00 39.40  ? 500 GLU A CB  1 
ATOM   3780  C  CG  . GLU A  1 500 ? 33.849 93.160  49.639  1.00 49.48  ? 500 GLU A CG  1 
ATOM   3781  C  CD  . GLU A  1 500 ? 32.721 92.526  48.848  1.00 68.92  ? 500 GLU A CD  1 
ATOM   3782  O  OE1 . GLU A  1 500 ? 33.001 91.576  48.084  1.00 64.16  ? 500 GLU A OE1 1 
ATOM   3783  O  OE2 . GLU A  1 500 ? 31.563 92.989  48.969  1.00 60.83  ? 500 GLU A OE2 1 
ATOM   3784  N  N   . LEU A  1 501 ? 33.794 93.859  54.177  1.00 37.28  ? 501 LEU A N   1 
ATOM   3785  C  CA  . LEU A  1 501 ? 33.204 94.154  55.482  1.00 36.89  ? 501 LEU A CA  1 
ATOM   3786  C  C   . LEU A  1 501 ? 34.136 95.027  56.324  1.00 40.07  ? 501 LEU A C   1 
ATOM   3787  O  O   . LEU A  1 501 ? 33.647 95.835  57.117  1.00 40.36  ? 501 LEU A O   1 
ATOM   3788  C  CB  . LEU A  1 501 ? 32.850 92.857  56.243  1.00 36.60  ? 501 LEU A CB  1 
ATOM   3789  C  CG  . LEU A  1 501 ? 32.047 91.779  55.484  1.00 40.99  ? 501 LEU A CG  1 
ATOM   3790  C  CD1 . LEU A  1 501 ? 31.803 90.564  56.360  1.00 40.62  ? 501 LEU A CD1 1 
ATOM   3791  C  CD2 . LEU A  1 501 ? 30.723 92.322  54.957  1.00 43.38  ? 501 LEU A CD2 1 
ATOM   3792  N  N   . PHE A  1 502 ? 35.468 94.871  56.152  1.00 35.06  ? 502 PHE A N   1 
ATOM   3793  C  CA  . PHE A  1 502 ? 36.476 95.667  56.859  1.00 34.01  ? 502 PHE A CA  1 
ATOM   3794  C  C   . PHE A  1 502 ? 36.396 97.117  56.405  1.00 38.55  ? 502 PHE A C   1 
ATOM   3795  O  O   . PHE A  1 502 ? 36.393 98.013  57.251  1.00 38.63  ? 502 PHE A O   1 
ATOM   3796  C  CB  . PHE A  1 502 ? 37.890 95.105  56.641  1.00 35.01  ? 502 PHE A CB  1 
ATOM   3797  C  CG  . PHE A  1 502 ? 39.004 95.976  57.176  1.00 35.78  ? 502 PHE A CG  1 
ATOM   3798  C  CD1 . PHE A  1 502 ? 39.346 95.947  58.521  1.00 37.53  ? 502 PHE A CD1 1 
ATOM   3799  C  CD2 . PHE A  1 502 ? 39.717 96.818  56.330  1.00 37.81  ? 502 PHE A CD2 1 
ATOM   3800  C  CE1 . PHE A  1 502 ? 40.375 96.750  59.013  1.00 38.06  ? 502 PHE A CE1 1 
ATOM   3801  C  CE2 . PHE A  1 502 ? 40.747 97.620  56.824  1.00 40.42  ? 502 PHE A CE2 1 
ATOM   3802  C  CZ  . PHE A  1 502 ? 41.077 97.569  58.160  1.00 37.92  ? 502 PHE A CZ  1 
ATOM   3803  N  N   . LEU A  1 503 ? 36.329 97.340  55.069  1.00 34.85  ? 503 LEU A N   1 
ATOM   3804  C  CA  . LEU A  1 503 ? 36.217 98.667  54.459  1.00 34.67  ? 503 LEU A CA  1 
ATOM   3805  C  C   . LEU A  1 503 ? 34.869 99.284  54.820  1.00 37.09  ? 503 LEU A C   1 
ATOM   3806  O  O   . LEU A  1 503 ? 34.814 100.484 55.073  1.00 37.08  ? 503 LEU A O   1 
ATOM   3807  C  CB  . LEU A  1 503 ? 36.407 98.613  52.935  1.00 35.20  ? 503 LEU A CB  1 
ATOM   3808  C  CG  . LEU A  1 503 ? 37.759 98.101  52.412  1.00 39.94  ? 503 LEU A CG  1 
ATOM   3809  C  CD1 . LEU A  1 503 ? 37.676 97.784  50.946  1.00 40.76  ? 503 LEU A CD1 1 
ATOM   3810  C  CD2 . LEU A  1 503 ? 38.879 99.090  52.659  1.00 42.72  ? 503 LEU A CD2 1 
ATOM   3811  N  N   . GLN A  1 504 ? 33.800 98.452  54.898  1.00 32.51  ? 504 GLN A N   1 
ATOM   3812  C  CA  . GLN A  1 504 ? 32.456 98.858  55.319  1.00 32.12  ? 504 GLN A CA  1 
ATOM   3813  C  C   . GLN A  1 504 ? 32.532 99.423  56.731  1.00 37.03  ? 504 GLN A C   1 
ATOM   3814  O  O   . GLN A  1 504 ? 32.114 100.561 56.950  1.00 37.07  ? 504 GLN A O   1 
ATOM   3815  C  CB  . GLN A  1 504 ? 31.485 97.671  55.273  1.00 32.76  ? 504 GLN A CB  1 
ATOM   3816  C  CG  . GLN A  1 504 ? 30.669 97.583  54.000  1.00 37.47  ? 504 GLN A CG  1 
ATOM   3817  C  CD  . GLN A  1 504 ? 29.592 96.527  54.077  1.00 51.71  ? 504 GLN A CD  1 
ATOM   3818  O  OE1 . GLN A  1 504 ? 29.201 96.055  55.152  1.00 41.09  ? 504 GLN A OE1 1 
ATOM   3819  N  NE2 . GLN A  1 504 ? 29.062 96.154  52.926  1.00 50.41  ? 504 GLN A NE2 1 
ATOM   3820  N  N   . PHE A  1 505 ? 33.150 98.651  57.667  1.00 33.42  ? 505 PHE A N   1 
ATOM   3821  C  CA  . PHE A  1 505 ? 33.381 99.030  59.065  1.00 33.07  ? 505 PHE A CA  1 
ATOM   3822  C  C   . PHE A  1 505 ? 34.218 100.304 59.143  1.00 38.79  ? 505 PHE A C   1 
ATOM   3823  O  O   . PHE A  1 505 ? 34.048 101.086 60.077  1.00 39.33  ? 505 PHE A O   1 
ATOM   3824  C  CB  . PHE A  1 505 ? 34.078 97.891  59.829  1.00 34.01  ? 505 PHE A CB  1 
ATOM   3825  C  CG  . PHE A  1 505 ? 34.249 98.109  61.316  1.00 35.34  ? 505 PHE A CG  1 
ATOM   3826  C  CD1 . PHE A  1 505 ? 33.144 98.204  62.154  1.00 38.23  ? 505 PHE A CD1 1 
ATOM   3827  C  CD2 . PHE A  1 505 ? 35.513 98.174  61.884  1.00 37.32  ? 505 PHE A CD2 1 
ATOM   3828  C  CE1 . PHE A  1 505 ? 33.302 98.402  63.527  1.00 38.77  ? 505 PHE A CE1 1 
ATOM   3829  C  CE2 . PHE A  1 505 ? 35.669 98.366  63.261  1.00 39.93  ? 505 PHE A CE2 1 
ATOM   3830  C  CZ  . PHE A  1 505 ? 34.563 98.477  64.072  1.00 37.80  ? 505 PHE A CZ  1 
ATOM   3831  N  N   . GLY A  1 506 ? 35.091 100.496 58.151  1.00 35.29  ? 506 GLY A N   1 
ATOM   3832  C  CA  . GLY A  1 506 ? 35.947 101.665 58.020  1.00 35.01  ? 506 GLY A CA  1 
ATOM   3833  C  C   . GLY A  1 506 ? 35.163 102.934 57.768  1.00 38.66  ? 506 GLY A C   1 
ATOM   3834  O  O   . GLY A  1 506 ? 35.324 103.899 58.513  1.00 38.70  ? 506 GLY A O   1 
ATOM   3835  N  N   . TYR A  1 507 ? 34.274 102.927 56.744  1.00 34.68  ? 507 TYR A N   1 
ATOM   3836  C  CA  . TYR A  1 507 ? 33.426 104.077 56.388  1.00 34.97  ? 507 TYR A CA  1 
ATOM   3837  C  C   . TYR A  1 507 ? 32.419 104.421 57.491  1.00 39.49  ? 507 TYR A C   1 
ATOM   3838  O  O   . TYR A  1 507 ? 32.113 105.598 57.688  1.00 39.16  ? 507 TYR A O   1 
ATOM   3839  C  CB  . TYR A  1 507 ? 32.642 103.837 55.080  1.00 36.08  ? 507 TYR A CB  1 
ATOM   3840  C  CG  . TYR A  1 507 ? 33.402 103.206 53.930  1.00 36.97  ? 507 TYR A CG  1 
ATOM   3841  C  CD1 . TYR A  1 507 ? 34.574 103.780 53.443  1.00 38.78  ? 507 TYR A CD1 1 
ATOM   3842  C  CD2 . TYR A  1 507 ? 32.880 102.115 53.242  1.00 37.39  ? 507 TYR A CD2 1 
ATOM   3843  C  CE1 . TYR A  1 507 ? 35.256 103.224 52.362  1.00 39.05  ? 507 TYR A CE1 1 
ATOM   3844  C  CE2 . TYR A  1 507 ? 33.553 101.550 52.161  1.00 38.10  ? 507 TYR A CE2 1 
ATOM   3845  C  CZ  . TYR A  1 507 ? 34.739 102.110 51.721  1.00 44.66  ? 507 TYR A CZ  1 
ATOM   3846  O  OH  . TYR A  1 507 ? 35.398 101.550 50.653  1.00 45.46  ? 507 TYR A OH  1 
ATOM   3847  N  N   . VAL A  1 508 ? 31.889 103.390 58.185  1.00 36.73  ? 508 VAL A N   1 
ATOM   3848  C  CA  . VAL A  1 508 ? 30.876 103.521 59.238  1.00 37.05  ? 508 VAL A CA  1 
ATOM   3849  C  C   . VAL A  1 508 ? 31.500 104.077 60.529  1.00 41.34  ? 508 VAL A C   1 
ATOM   3850  O  O   . VAL A  1 508 ? 31.033 105.106 61.005  1.00 41.91  ? 508 VAL A O   1 
ATOM   3851  C  CB  . VAL A  1 508 ? 30.110 102.190 59.488  1.00 40.60  ? 508 VAL A CB  1 
ATOM   3852  C  CG1 . VAL A  1 508 ? 29.143 102.305 60.666  1.00 40.47  ? 508 VAL A CG1 1 
ATOM   3853  C  CG2 . VAL A  1 508 ? 29.360 101.750 58.236  1.00 40.72  ? 508 VAL A CG2 1 
ATOM   3854  N  N   . SER A  1 509 ? 32.542 103.429 61.081  1.00 37.31  ? 509 SER A N   1 
ATOM   3855  C  CA  . SER A  1 509 ? 33.161 103.885 62.331  1.00 37.31  ? 509 SER A CA  1 
ATOM   3856  C  C   . SER A  1 509 ? 33.915 105.229 62.191  1.00 42.23  ? 509 SER A C   1 
ATOM   3857  O  O   . SER A  1 509 ? 33.910 106.022 63.136  1.00 41.93  ? 509 SER A O   1 
ATOM   3858  C  CB  . SER A  1 509 ? 34.102 102.824 62.894  1.00 39.50  ? 509 SER A CB  1 
ATOM   3859  O  OG  . SER A  1 509 ? 35.214 102.594 62.044  1.00 46.81  ? 509 SER A OG  1 
ATOM   3860  N  N   . LEU A  1 510 ? 34.535 105.489 61.025  1.00 39.09  ? 510 LEU A N   1 
ATOM   3861  C  CA  . LEU A  1 510 ? 35.332 106.698 60.811  1.00 39.43  ? 510 LEU A CA  1 
ATOM   3862  C  C   . LEU A  1 510 ? 34.501 107.935 60.463  1.00 45.01  ? 510 LEU A C   1 
ATOM   3863  O  O   . LEU A  1 510 ? 34.604 108.935 61.173  1.00 44.84  ? 510 LEU A O   1 
ATOM   3864  C  CB  . LEU A  1 510 ? 36.381 106.461 59.708  1.00 39.18  ? 510 LEU A CB  1 
ATOM   3865  C  CG  . LEU A  1 510 ? 37.828 106.135 60.112  1.00 43.21  ? 510 LEU A CG  1 
ATOM   3866  C  CD1 . LEU A  1 510 ? 37.913 104.972 61.080  1.00 42.54  ? 510 LEU A CD1 1 
ATOM   3867  C  CD2 . LEU A  1 510 ? 38.645 105.792 58.894  1.00 45.45  ? 510 LEU A CD2 1 
ATOM   3868  N  N   . PHE A  1 511 ? 33.705 107.888 59.377  1.00 43.06  ? 511 PHE A N   1 
ATOM   3869  C  CA  . PHE A  1 511 ? 32.972 109.063 58.898  1.00 44.25  ? 511 PHE A CA  1 
ATOM   3870  C  C   . PHE A  1 511 ? 31.431 108.946 58.990  1.00 50.66  ? 511 PHE A C   1 
ATOM   3871  O  O   . PHE A  1 511 ? 30.739 109.363 58.059  1.00 50.82  ? 511 PHE A O   1 
ATOM   3872  C  CB  . PHE A  1 511 ? 33.383 109.388 57.442  1.00 46.17  ? 511 PHE A CB  1 
ATOM   3873  C  CG  . PHE A  1 511 ? 34.862 109.314 57.135  1.00 47.24  ? 511 PHE A CG  1 
ATOM   3874  C  CD1 . PHE A  1 511 ? 35.709 110.371 57.448  1.00 50.41  ? 511 PHE A CD1 1 
ATOM   3875  C  CD2 . PHE A  1 511 ? 35.403 108.197 56.505  1.00 48.63  ? 511 PHE A CD2 1 
ATOM   3876  C  CE1 . PHE A  1 511 ? 37.076 110.302 57.159  1.00 51.22  ? 511 PHE A CE1 1 
ATOM   3877  C  CE2 . PHE A  1 511 ? 36.769 108.129 56.213  1.00 51.16  ? 511 PHE A CE2 1 
ATOM   3878  C  CZ  . PHE A  1 511 ? 37.596 109.183 56.541  1.00 49.75  ? 511 PHE A CZ  1 
ATOM   3879  N  N   . SER A  1 512 ? 30.889 108.460 60.124  1.00 48.88  ? 512 SER A N   1 
ATOM   3880  C  CA  . SER A  1 512 ? 29.430 108.404 60.292  1.00 49.92  ? 512 SER A CA  1 
ATOM   3881  C  C   . SER A  1 512 ? 28.861 109.794 60.594  1.00 57.57  ? 512 SER A C   1 
ATOM   3882  O  O   . SER A  1 512 ? 27.702 110.058 60.279  1.00 58.10  ? 512 SER A O   1 
ATOM   3883  C  CB  . SER A  1 512 ? 29.026 107.421 61.383  1.00 52.18  ? 512 SER A CB  1 
ATOM   3884  O  OG  . SER A  1 512 ? 28.565 106.221 60.785  1.00 58.90  ? 512 SER A OG  1 
ATOM   3885  N  N   . CYS A  1 513 ? 29.679 110.688 61.179  1.00 56.05  ? 513 CYS A N   1 
ATOM   3886  C  CA  . CYS A  1 513 ? 29.268 112.059 61.476  1.00 57.65  ? 513 CYS A CA  1 
ATOM   3887  C  C   . CYS A  1 513 ? 29.156 112.886 60.184  1.00 60.60  ? 513 CYS A C   1 
ATOM   3888  O  O   . CYS A  1 513 ? 28.328 113.795 60.118  1.00 61.15  ? 513 CYS A O   1 
ATOM   3889  C  CB  . CYS A  1 513 ? 30.223 112.705 62.472  1.00 58.81  ? 513 CYS A CB  1 
ATOM   3890  S  SG  . CYS A  1 513 ? 30.090 112.039 64.151  1.00 62.78  ? 513 CYS A SG  1 
ATOM   3891  N  N   . VAL A  1 514 ? 29.963 112.552 59.156  1.00 55.04  ? 514 VAL A N   1 
ATOM   3892  C  CA  . VAL A  1 514 ? 29.941 113.234 57.859  1.00 54.84  ? 514 VAL A CA  1 
ATOM   3893  C  C   . VAL A  1 514 ? 28.840 112.606 56.976  1.00 58.13  ? 514 VAL A C   1 
ATOM   3894  O  O   . VAL A  1 514 ? 28.007 113.334 56.434  1.00 59.46  ? 514 VAL A O   1 
ATOM   3895  C  CB  . VAL A  1 514 ? 31.326 113.226 57.157  1.00 58.11  ? 514 VAL A CB  1 
ATOM   3896  C  CG1 . VAL A  1 514 ? 31.296 114.050 55.871  1.00 58.85  ? 514 VAL A CG1 1 
ATOM   3897  C  CG2 . VAL A  1 514 ? 32.422 113.735 58.088  1.00 57.71  ? 514 VAL A CG2 1 
ATOM   3898  N  N   . TYR A  1 515 ? 28.844 111.266 56.838  1.00 52.06  ? 515 TYR A N   1 
ATOM   3899  C  CA  . TYR A  1 515 ? 27.880 110.503 56.044  1.00 51.03  ? 515 TYR A CA  1 
ATOM   3900  C  C   . TYR A  1 515 ? 27.043 109.626 56.999  1.00 52.63  ? 515 TYR A C   1 
ATOM   3901  O  O   . TYR A  1 515 ? 27.457 108.515 57.333  1.00 51.26  ? 515 TYR A O   1 
ATOM   3902  C  CB  . TYR A  1 515 ? 28.630 109.670 54.991  1.00 51.90  ? 515 TYR A CB  1 
ATOM   3903  C  CG  . TYR A  1 515 ? 27.793 109.235 53.810  1.00 54.74  ? 515 TYR A CG  1 
ATOM   3904  C  CD1 . TYR A  1 515 ? 27.611 110.073 52.714  1.00 57.62  ? 515 TYR A CD1 1 
ATOM   3905  C  CD2 . TYR A  1 515 ? 27.258 107.952 53.744  1.00 55.34  ? 515 TYR A CD2 1 
ATOM   3906  C  CE1 . TYR A  1 515 ? 26.872 109.664 51.605  1.00 58.91  ? 515 TYR A CE1 1 
ATOM   3907  C  CE2 . TYR A  1 515 ? 26.515 107.532 52.641  1.00 56.81  ? 515 TYR A CE2 1 
ATOM   3908  C  CZ  . TYR A  1 515 ? 26.329 108.391 51.571  1.00 65.11  ? 515 TYR A CZ  1 
ATOM   3909  O  OH  . TYR A  1 515 ? 25.602 107.980 50.480  1.00 67.28  ? 515 TYR A OH  1 
ATOM   3910  N  N   . PRO A  1 516 ? 25.886 110.131 57.497  1.00 48.81  ? 516 PRO A N   1 
ATOM   3911  C  CA  . PRO A  1 516 ? 25.091 109.358 58.471  1.00 47.81  ? 516 PRO A CA  1 
ATOM   3912  C  C   . PRO A  1 516 ? 24.440 108.088 57.917  1.00 51.44  ? 516 PRO A C   1 
ATOM   3913  O  O   . PRO A  1 516 ? 24.097 107.207 58.704  1.00 50.52  ? 516 PRO A O   1 
ATOM   3914  C  CB  . PRO A  1 516 ? 24.022 110.354 58.928  1.00 50.46  ? 516 PRO A CB  1 
ATOM   3915  C  CG  . PRO A  1 516 ? 24.521 111.695 58.516  1.00 55.79  ? 516 PRO A CG  1 
ATOM   3916  C  CD  . PRO A  1 516 ? 25.273 111.450 57.254  1.00 51.51  ? 516 PRO A CD  1 
ATOM   3917  N  N   . LEU A  1 517 ? 24.276 107.985 56.585  1.00 48.46  ? 517 LEU A N   1 
ATOM   3918  C  CA  . LEU A  1 517 ? 23.666 106.824 55.931  1.00 48.05  ? 517 LEU A CA  1 
ATOM   3919  C  C   . LEU A  1 517 ? 24.690 105.712 55.621  1.00 50.77  ? 517 LEU A C   1 
ATOM   3920  O  O   . LEU A  1 517 ? 24.340 104.734 54.950  1.00 50.17  ? 517 LEU A O   1 
ATOM   3921  C  CB  . LEU A  1 517 ? 22.973 107.251 54.625  1.00 49.22  ? 517 LEU A CB  1 
ATOM   3922  C  CG  . LEU A  1 517 ? 21.809 108.232 54.689  1.00 54.95  ? 517 LEU A CG  1 
ATOM   3923  C  CD1 . LEU A  1 517 ? 21.330 108.552 53.293  1.00 56.00  ? 517 LEU A CD1 1 
ATOM   3924  C  CD2 . LEU A  1 517 ? 20.650 107.677 55.510  1.00 58.01  ? 517 LEU A CD2 1 
ATOM   3925  N  N   . ALA A  1 518 ? 25.947 105.863 56.103  1.00 46.46  ? 518 ALA A N   1 
ATOM   3926  C  CA  . ALA A  1 518 ? 27.040 104.910 55.895  1.00 45.12  ? 518 ALA A CA  1 
ATOM   3927  C  C   . ALA A  1 518 ? 26.636 103.499 56.310  1.00 47.45  ? 518 ALA A C   1 
ATOM   3928  O  O   . ALA A  1 518 ? 26.776 102.578 55.508  1.00 46.67  ? 518 ALA A O   1 
ATOM   3929  C  CB  . ALA A  1 518 ? 28.274 105.350 56.666  1.00 45.48  ? 518 ALA A CB  1 
ATOM   3930  N  N   . ALA A  1 519 ? 26.086 103.343 57.532  1.00 43.78  ? 519 ALA A N   1 
ATOM   3931  C  CA  . ALA A  1 519 ? 25.631 102.057 58.062  1.00 43.06  ? 519 ALA A CA  1 
ATOM   3932  C  C   . ALA A  1 519 ? 24.351 101.574 57.371  1.00 47.26  ? 519 ALA A C   1 
ATOM   3933  O  O   . ALA A  1 519 ? 24.176 100.367 57.229  1.00 46.43  ? 519 ALA A O   1 
ATOM   3934  C  CB  . ALA A  1 519 ? 25.416 102.147 59.559  1.00 43.59  ? 519 ALA A CB  1 
ATOM   3935  N  N   . ALA A  1 520 ? 23.478 102.504 56.920  1.00 44.58  ? 520 ALA A N   1 
ATOM   3936  C  CA  . ALA A  1 520 ? 22.233 102.173 56.221  1.00 44.78  ? 520 ALA A CA  1 
ATOM   3937  C  C   . ALA A  1 520 ? 22.520 101.468 54.895  1.00 47.69  ? 520 ALA A C   1 
ATOM   3938  O  O   . ALA A  1 520 ? 21.908 100.434 54.628  1.00 47.94  ? 520 ALA A O   1 
ATOM   3939  C  CB  . ALA A  1 520 ? 21.400 103.424 55.985  1.00 46.60  ? 520 ALA A CB  1 
ATOM   3940  N  N   . PHE A  1 521 ? 23.478 101.985 54.094  1.00 42.81  ? 521 PHE A N   1 
ATOM   3941  C  CA  . PHE A  1 521 ? 23.851 101.379 52.813  1.00 42.09  ? 521 PHE A CA  1 
ATOM   3942  C  C   . PHE A  1 521 ? 24.710 100.132 53.011  1.00 44.05  ? 521 PHE A C   1 
ATOM   3943  O  O   . PHE A  1 521 ? 24.690 99.246  52.156  1.00 43.72  ? 521 PHE A O   1 
ATOM   3944  C  CB  . PHE A  1 521 ? 24.559 102.385 51.898  1.00 44.22  ? 521 PHE A CB  1 
ATOM   3945  C  CG  . PHE A  1 521 ? 23.665 103.513 51.436  1.00 47.04  ? 521 PHE A CG  1 
ATOM   3946  C  CD1 . PHE A  1 521 ? 22.474 103.251 50.766  1.00 50.89  ? 521 PHE A CD1 1 
ATOM   3947  C  CD2 . PHE A  1 521 ? 24.024 104.838 51.652  1.00 49.42  ? 521 PHE A CD2 1 
ATOM   3948  C  CE1 . PHE A  1 521 ? 21.646 104.294 50.347  1.00 53.04  ? 521 PHE A CE1 1 
ATOM   3949  C  CE2 . PHE A  1 521 ? 23.200 105.881 51.223  1.00 53.24  ? 521 PHE A CE2 1 
ATOM   3950  C  CZ  . PHE A  1 521 ? 22.017 105.602 50.576  1.00 52.34  ? 521 PHE A CZ  1 
ATOM   3951  N  N   . ALA A  1 522 ? 25.440 100.052 54.140  1.00 39.52  ? 522 ALA A N   1 
ATOM   3952  C  CA  . ALA A  1 522 ? 26.259 98.890  54.484  1.00 38.28  ? 522 ALA A CA  1 
ATOM   3953  C  C   . ALA A  1 522 ? 25.358 97.675  54.744  1.00 42.41  ? 522 ALA A C   1 
ATOM   3954  O  O   . ALA A  1 522 ? 25.617 96.609  54.186  1.00 41.80  ? 522 ALA A O   1 
ATOM   3955  C  CB  . ALA A  1 522 ? 27.125 99.190  55.698  1.00 38.16  ? 522 ALA A CB  1 
ATOM   3956  N  N   . VAL A  1 523 ? 24.262 97.861  55.523  1.00 39.19  ? 523 VAL A N   1 
ATOM   3957  C  CA  . VAL A  1 523 ? 23.275 96.821  55.849  1.00 39.03  ? 523 VAL A CA  1 
ATOM   3958  C  C   . VAL A  1 523 ? 22.530 96.393  54.570  1.00 44.07  ? 523 VAL A C   1 
ATOM   3959  O  O   . VAL A  1 523 ? 22.308 95.196  54.375  1.00 43.81  ? 523 VAL A O   1 
ATOM   3960  C  CB  . VAL A  1 523 ? 22.280 97.261  56.964  1.00 43.09  ? 523 VAL A CB  1 
ATOM   3961  C  CG1 . VAL A  1 523 ? 21.320 96.139  57.329  1.00 43.05  ? 523 VAL A CG1 1 
ATOM   3962  C  CG2 . VAL A  1 523 ? 23.009 97.725  58.213  1.00 42.30  ? 523 VAL A CG2 1 
ATOM   3963  N  N   . LEU A  1 524 ? 22.165 97.362  53.702  1.00 41.38  ? 524 LEU A N   1 
ATOM   3964  C  CA  . LEU A  1 524 ? 21.451 97.089  52.451  1.00 42.09  ? 524 LEU A CA  1 
ATOM   3965  C  C   . LEU A  1 524 ? 22.285 96.220  51.509  1.00 45.53  ? 524 LEU A C   1 
ATOM   3966  O  O   . LEU A  1 524 ? 21.739 95.282  50.929  1.00 45.38  ? 524 LEU A O   1 
ATOM   3967  C  CB  . LEU A  1 524 ? 21.021 98.383  51.744  1.00 43.12  ? 524 LEU A CB  1 
ATOM   3968  C  CG  . LEU A  1 524 ? 19.842 99.129  52.368  1.00 48.68  ? 524 LEU A CG  1 
ATOM   3969  C  CD1 . LEU A  1 524 ? 19.803 100.570 51.901  1.00 49.74  ? 524 LEU A CD1 1 
ATOM   3970  C  CD2 . LEU A  1 524 ? 18.521 98.430  52.081  1.00 51.60  ? 524 LEU A CD2 1 
ATOM   3971  N  N   . ASN A  1 525 ? 23.602 96.498  51.391  1.00 41.59  ? 525 ASN A N   1 
ATOM   3972  C  CA  . ASN A  1 525 ? 24.506 95.703  50.552  1.00 41.04  ? 525 ASN A CA  1 
ATOM   3973  C  C   . ASN A  1 525 ? 24.676 94.309  51.135  1.00 43.05  ? 525 ASN A C   1 
ATOM   3974  O  O   . ASN A  1 525 ? 24.651 93.336  50.387  1.00 42.58  ? 525 ASN A O   1 
ATOM   3975  C  CB  . ASN A  1 525 ? 25.873 96.377  50.397  1.00 42.70  ? 525 ASN A CB  1 
ATOM   3976  C  CG  . ASN A  1 525 ? 26.881 95.515  49.670  1.00 67.88  ? 525 ASN A CG  1 
ATOM   3977  O  OD1 . ASN A  1 525 ? 26.890 95.423  48.438  1.00 65.91  ? 525 ASN A OD1 1 
ATOM   3978  N  ND2 . ASN A  1 525 ? 27.729 94.830  50.422  1.00 57.80  ? 525 ASN A ND2 1 
ATOM   3979  N  N   . ASN A  1 526 ? 24.843 94.224  52.471  1.00 38.25  ? 526 ASN A N   1 
ATOM   3980  C  CA  . ASN A  1 526 ? 25.023 92.978  53.213  1.00 36.82  ? 526 ASN A CA  1 
ATOM   3981  C  C   . ASN A  1 526 ? 23.773 92.084  53.153  1.00 41.16  ? 526 ASN A C   1 
ATOM   3982  O  O   . ASN A  1 526 ? 23.898 90.867  53.295  1.00 40.34  ? 526 ASN A O   1 
ATOM   3983  C  CB  . ASN A  1 526 ? 25.421 93.265  54.658  1.00 33.43  ? 526 ASN A CB  1 
ATOM   3984  C  CG  . ASN A  1 526 ? 26.841 93.765  54.823  1.00 49.17  ? 526 ASN A CG  1 
ATOM   3985  O  OD1 . ASN A  1 526 ? 27.697 93.651  53.935  1.00 38.40  ? 526 ASN A OD1 1 
ATOM   3986  N  ND2 . ASN A  1 526 ? 27.127 94.335  55.979  1.00 44.41  ? 526 ASN A ND2 1 
ATOM   3987  N  N   . PHE A  1 527 ? 22.584 92.679  52.902  1.00 38.61  ? 527 PHE A N   1 
ATOM   3988  C  CA  . PHE A  1 527 ? 21.322 91.948  52.759  1.00 39.24  ? 527 PHE A CA  1 
ATOM   3989  C  C   . PHE A  1 527 ? 21.316 91.105  51.482  1.00 43.37  ? 527 PHE A C   1 
ATOM   3990  O  O   . PHE A  1 527 ? 20.651 90.066  51.435  1.00 43.43  ? 527 PHE A O   1 
ATOM   3991  C  CB  . PHE A  1 527 ? 20.127 92.911  52.749  1.00 41.97  ? 527 PHE A CB  1 
ATOM   3992  C  CG  . PHE A  1 527 ? 19.599 93.344  54.097  1.00 43.34  ? 527 PHE A CG  1 
ATOM   3993  C  CD1 . PHE A  1 527 ? 19.687 92.503  55.202  1.00 45.79  ? 527 PHE A CD1 1 
ATOM   3994  C  CD2 . PHE A  1 527 ? 18.946 94.560  54.246  1.00 46.20  ? 527 PHE A CD2 1 
ATOM   3995  C  CE1 . PHE A  1 527 ? 19.183 92.899  56.444  1.00 46.86  ? 527 PHE A CE1 1 
ATOM   3996  C  CE2 . PHE A  1 527 ? 18.420 94.945  55.483  1.00 49.03  ? 527 PHE A CE2 1 
ATOM   3997  C  CZ  . PHE A  1 527 ? 18.538 94.110  56.572  1.00 46.59  ? 527 PHE A CZ  1 
ATOM   3998  N  N   . THR A  1 528 ? 22.049 91.565  50.449  1.00 39.30  ? 528 THR A N   1 
ATOM   3999  C  CA  . THR A  1 528 ? 22.199 90.873  49.170  1.00 39.26  ? 528 THR A CA  1 
ATOM   4000  C  C   . THR A  1 528 ? 23.551 90.137  49.118  1.00 41.79  ? 528 THR A C   1 
ATOM   4001  O  O   . THR A  1 528 ? 23.670 89.165  48.377  1.00 42.48  ? 528 THR A O   1 
ATOM   4002  C  CB  . THR A  1 528 ? 22.038 91.839  47.982  1.00 46.14  ? 528 THR A CB  1 
ATOM   4003  O  OG1 . THR A  1 528 ? 23.003 92.886  48.074  1.00 42.92  ? 528 THR A OG1 1 
ATOM   4004  C  CG2 . THR A  1 528 ? 20.634 92.420  47.881  1.00 46.63  ? 528 THR A CG2 1 
ATOM   4005  N  N   . GLU A  1 529 ? 24.555 90.588  49.915  1.00 35.85  ? 529 GLU A N   1 
ATOM   4006  C  CA  . GLU A  1 529 ? 25.902 90.007  49.980  1.00 34.23  ? 529 GLU A CA  1 
ATOM   4007  C  C   . GLU A  1 529 ? 25.836 88.545  50.399  1.00 39.11  ? 529 GLU A C   1 
ATOM   4008  O  O   . GLU A  1 529 ? 26.568 87.730  49.847  1.00 38.76  ? 529 GLU A O   1 
ATOM   4009  C  CB  . GLU A  1 529 ? 26.803 90.807  50.939  1.00 34.49  ? 529 GLU A CB  1 
ATOM   4010  C  CG  . GLU A  1 529 ? 28.297 90.542  50.796  1.00 40.11  ? 529 GLU A CG  1 
ATOM   4011  C  CD  . GLU A  1 529 ? 28.993 91.051  49.544  1.00 54.80  ? 529 GLU A CD  1 
ATOM   4012  O  OE1 . GLU A  1 529 ? 28.570 92.095  48.995  1.00 56.85  ? 529 GLU A OE1 1 
ATOM   4013  O  OE2 . GLU A  1 529 ? 29.999 90.426  49.139  1.00 39.09  ? 529 GLU A OE2 1 
ATOM   4014  N  N   . VAL A  1 530 ? 24.926 88.214  51.333  1.00 36.88  ? 530 VAL A N   1 
ATOM   4015  C  CA  . VAL A  1 530 ? 24.688 86.857  51.831  1.00 37.04  ? 530 VAL A CA  1 
ATOM   4016  C  C   . VAL A  1 530 ? 24.188 85.966  50.674  1.00 41.95  ? 530 VAL A C   1 
ATOM   4017  O  O   . VAL A  1 530 ? 24.709 84.866  50.494  1.00 41.70  ? 530 VAL A O   1 
ATOM   4018  C  CB  . VAL A  1 530 ? 23.734 86.833  53.067  1.00 41.60  ? 530 VAL A CB  1 
ATOM   4019  C  CG1 . VAL A  1 530 ? 22.464 87.658  52.845  1.00 42.45  ? 530 VAL A CG1 1 
ATOM   4020  C  CG2 . VAL A  1 530 ? 23.387 85.411  53.486  1.00 41.63  ? 530 VAL A CG2 1 
ATOM   4021  N  N   . ASN A  1 531 ? 23.228 86.467  49.874  1.00 38.99  ? 531 ASN A N   1 
ATOM   4022  C  CA  . ASN A  1 531 ? 22.657 85.753  48.732  1.00 39.47  ? 531 ASN A CA  1 
ATOM   4023  C  C   . ASN A  1 531 ? 23.682 85.609  47.592  1.00 42.85  ? 531 ASN A C   1 
ATOM   4024  O  O   . ASN A  1 531 ? 23.830 84.511  47.048  1.00 43.10  ? 531 ASN A O   1 
ATOM   4025  C  CB  . ASN A  1 531 ? 21.395 86.468  48.224  1.00 41.34  ? 531 ASN A CB  1 
ATOM   4026  C  CG  . ASN A  1 531 ? 20.322 86.702  49.264  1.00 62.89  ? 531 ASN A CG  1 
ATOM   4027  O  OD1 . ASN A  1 531 ? 19.836 85.775  49.925  1.00 56.07  ? 531 ASN A OD1 1 
ATOM   4028  N  ND2 . ASN A  1 531 ? 19.891 87.949  49.391  1.00 55.38  ? 531 ASN A ND2 1 
ATOM   4029  N  N   . SER A  1 532 ? 24.392 86.713  47.252  1.00 38.06  ? 532 SER A N   1 
ATOM   4030  C  CA  . SER A  1 532 ? 25.387 86.787  46.181  1.00 37.36  ? 532 SER A CA  1 
ATOM   4031  C  C   . SER A  1 532 ? 26.607 85.905  46.468  1.00 40.74  ? 532 SER A C   1 
ATOM   4032  O  O   . SER A  1 532 ? 27.013 85.158  45.575  1.00 41.04  ? 532 SER A O   1 
ATOM   4033  C  CB  . SER A  1 532 ? 25.817 88.232  45.937  1.00 40.06  ? 532 SER A CB  1 
ATOM   4034  O  OG  . SER A  1 532 ? 27.169 88.481  46.290  1.00 46.24  ? 532 SER A OG  1 
ATOM   4035  N  N   . ASP A  1 533 ? 27.189 85.994  47.692  1.00 36.02  ? 533 ASP A N   1 
ATOM   4036  C  CA  . ASP A  1 533 ? 28.361 85.201  48.098  1.00 35.03  ? 533 ASP A CA  1 
ATOM   4037  C  C   . ASP A  1 533 ? 28.043 83.708  48.181  1.00 39.64  ? 533 ASP A C   1 
ATOM   4038  O  O   . ASP A  1 533 ? 28.923 82.896  47.890  1.00 38.61  ? 533 ASP A O   1 
ATOM   4039  C  CB  . ASP A  1 533 ? 28.938 85.685  49.433  1.00 35.79  ? 533 ASP A CB  1 
ATOM   4040  C  CG  . ASP A  1 533 ? 29.745 86.963  49.341  1.00 44.00  ? 533 ASP A CG  1 
ATOM   4041  O  OD1 . ASP A  1 533 ? 29.947 87.464  48.208  1.00 44.79  ? 533 ASP A OD1 1 
ATOM   4042  O  OD2 . ASP A  1 533 ? 30.193 87.454  50.395  1.00 48.23  ? 533 ASP A OD2 1 
ATOM   4043  N  N   . ALA A  1 534 ? 26.792 83.353  48.559  1.00 37.16  ? 534 ALA A N   1 
ATOM   4044  C  CA  . ALA A  1 534 ? 26.309 81.972  48.626  1.00 37.62  ? 534 ALA A CA  1 
ATOM   4045  C  C   . ALA A  1 534 ? 26.237 81.375  47.218  1.00 43.00  ? 534 ALA A C   1 
ATOM   4046  O  O   . ALA A  1 534 ? 26.685 80.248  47.010  1.00 42.21  ? 534 ALA A O   1 
ATOM   4047  C  CB  . ALA A  1 534 ? 24.947 81.928  49.292  1.00 38.95  ? 534 ALA A CB  1 
ATOM   4048  N  N   . LEU A  1 535 ? 25.715 82.166  46.246  1.00 41.36  ? 535 LEU A N   1 
ATOM   4049  C  CA  . LEU A  1 535 ? 25.614 81.834  44.818  1.00 42.28  ? 535 LEU A CA  1 
ATOM   4050  C  C   . LEU A  1 535 ? 27.016 81.607  44.243  1.00 46.39  ? 535 LEU A C   1 
ATOM   4051  O  O   . LEU A  1 535 ? 27.233 80.674  43.466  1.00 46.33  ? 535 LEU A O   1 
ATOM   4052  C  CB  . LEU A  1 535 ? 24.899 82.984  44.075  1.00 42.97  ? 535 LEU A CB  1 
ATOM   4053  C  CG  . LEU A  1 535 ? 24.852 82.902  42.551  1.00 48.31  ? 535 LEU A CG  1 
ATOM   4054  C  CD1 . LEU A  1 535 ? 23.528 82.343  42.072  1.00 49.49  ? 535 LEU A CD1 1 
ATOM   4055  C  CD2 . LEU A  1 535 ? 25.109 84.251  41.937  1.00 51.09  ? 535 LEU A CD2 1 
ATOM   4056  N  N   . LYS A  1 536 ? 27.962 82.467  44.659  1.00 42.47  ? 536 LYS A N   1 
ATOM   4057  C  CA  . LYS A  1 536 ? 29.370 82.451  44.288  1.00 41.64  ? 536 LYS A CA  1 
ATOM   4058  C  C   . LYS A  1 536 ? 30.035 81.154  44.810  1.00 46.21  ? 536 LYS A C   1 
ATOM   4059  O  O   . LYS A  1 536 ? 30.840 80.562  44.091  1.00 45.84  ? 536 LYS A O   1 
ATOM   4060  C  CB  . LYS A  1 536 ? 30.039 83.745  44.802  1.00 42.50  ? 536 LYS A CB  1 
ATOM   4061  C  CG  . LYS A  1 536 ? 31.388 83.638  45.484  1.00 47.62  ? 536 LYS A CG  1 
ATOM   4062  C  CD  . LYS A  1 536 ? 31.828 85.009  45.949  1.00 50.84  ? 536 LYS A CD  1 
ATOM   4063  C  CE  . LYS A  1 536 ? 33.161 84.973  46.634  1.00 53.41  ? 536 LYS A CE  1 
ATOM   4064  N  NZ  . LYS A  1 536 ? 33.686 86.338  46.863  1.00 60.07  ? 536 LYS A NZ  1 
ATOM   4065  N  N   . MET A  1 537 ? 29.643 80.684  46.015  1.00 43.00  ? 537 MET A N   1 
ATOM   4066  C  CA  . MET A  1 537 ? 30.189 79.461  46.616  1.00 42.50  ? 537 MET A CA  1 
ATOM   4067  C  C   . MET A  1 537 ? 29.604 78.190  45.991  1.00 45.80  ? 537 MET A C   1 
ATOM   4068  O  O   . MET A  1 537 ? 30.334 77.217  45.776  1.00 45.06  ? 537 MET A O   1 
ATOM   4069  C  CB  . MET A  1 537 ? 29.947 79.429  48.140  1.00 44.62  ? 537 MET A CB  1 
ATOM   4070  C  CG  . MET A  1 537 ? 30.691 80.504  48.934  1.00 48.08  ? 537 MET A CG  1 
ATOM   4071  S  SD  . MET A  1 537 ? 32.444 80.729  48.540  1.00 52.31  ? 537 MET A SD  1 
ATOM   4072  C  CE  . MET A  1 537 ? 33.121 79.201  49.179  1.00 48.86  ? 537 MET A CE  1 
ATOM   4073  N  N   . CYS A  1 538 ? 28.288 78.200  45.721  1.00 42.49  ? 538 CYS A N   1 
ATOM   4074  C  CA  . CYS A  1 538 ? 27.538 77.055  45.211  1.00 43.01  ? 538 CYS A CA  1 
ATOM   4075  C  C   . CYS A  1 538 ? 27.706 76.823  43.697  1.00 47.24  ? 538 CYS A C   1 
ATOM   4076  O  O   . CYS A  1 538 ? 28.163 75.751  43.295  1.00 46.63  ? 538 CYS A O   1 
ATOM   4077  C  CB  . CYS A  1 538 ? 26.060 77.193  45.572  1.00 43.86  ? 538 CYS A CB  1 
ATOM   4078  S  SG  . CYS A  1 538 ? 25.717 77.174  47.350  1.00 47.14  ? 538 CYS A SG  1 
ATOM   4079  N  N   . ARG A  1 539 ? 27.296 77.802  42.869  1.00 44.15  ? 539 ARG A N   1 
ATOM   4080  C  CA  . ARG A  1 539 ? 27.236 77.669  41.416  1.00 44.54  ? 539 ARG A CA  1 
ATOM   4081  C  C   . ARG A  1 539 ? 28.339 78.413  40.606  1.00 48.15  ? 539 ARG A C   1 
ATOM   4082  O  O   . ARG A  1 539 ? 28.273 78.390  39.373  1.00 48.19  ? 539 ARG A O   1 
ATOM   4083  C  CB  . ARG A  1 539 ? 25.850 78.136  40.935  1.00 45.40  ? 539 ARG A CB  1 
ATOM   4084  C  CG  . ARG A  1 539 ? 24.671 77.367  41.537  1.00 57.01  ? 539 ARG A CG  1 
ATOM   4085  C  CD  . ARG A  1 539 ? 24.370 76.083  40.785  1.00 75.01  ? 539 ARG A CD  1 
ATOM   4086  N  NE  . ARG A  1 539 ? 23.419 75.239  41.508  1.00 89.43  ? 539 ARG A NE  1 
ATOM   4087  C  CZ  . ARG A  1 539 ? 23.503 73.915  41.594  1.00 106.79 ? 539 ARG A CZ  1 
ATOM   4088  N  NH1 . ARG A  1 539 ? 24.500 73.265  41.005  1.00 94.79  ? 539 ARG A NH1 1 
ATOM   4089  N  NH2 . ARG A  1 539 ? 22.596 73.230  42.278  1.00 95.93  ? 539 ARG A NH2 1 
ATOM   4090  N  N   . VAL A  1 540 ? 29.353 79.022  41.258  1.00 44.02  ? 540 VAL A N   1 
ATOM   4091  C  CA  . VAL A  1 540 ? 30.421 79.708  40.510  1.00 43.52  ? 540 VAL A CA  1 
ATOM   4092  C  C   . VAL A  1 540 ? 31.739 78.930  40.656  1.00 46.95  ? 540 VAL A C   1 
ATOM   4093  O  O   . VAL A  1 540 ? 32.220 78.366  39.672  1.00 47.23  ? 540 VAL A O   1 
ATOM   4094  C  CB  . VAL A  1 540 ? 30.593 81.208  40.886  1.00 46.64  ? 540 VAL A CB  1 
ATOM   4095  C  CG1 . VAL A  1 540 ? 31.743 81.846  40.116  1.00 46.31  ? 540 VAL A CG1 1 
ATOM   4096  C  CG2 . VAL A  1 540 ? 29.306 81.988  40.658  1.00 47.18  ? 540 VAL A CG2 1 
ATOM   4097  N  N   . PHE A  1 541 ? 32.315 78.913  41.871  1.00 42.61  ? 541 PHE A N   1 
ATOM   4098  C  CA  . PHE A  1 541 ? 33.581 78.249  42.167  1.00 42.00  ? 541 PHE A CA  1 
ATOM   4099  C  C   . PHE A  1 541 ? 33.427 76.761  42.435  1.00 46.54  ? 541 PHE A C   1 
ATOM   4100  O  O   . PHE A  1 541 ? 32.363 76.303  42.858  1.00 46.85  ? 541 PHE A O   1 
ATOM   4101  C  CB  . PHE A  1 541 ? 34.261 78.894  43.389  1.00 42.92  ? 541 PHE A CB  1 
ATOM   4102  C  CG  . PHE A  1 541 ? 34.674 80.333  43.221  1.00 44.61  ? 541 PHE A CG  1 
ATOM   4103  C  CD1 . PHE A  1 541 ? 35.659 80.690  42.308  1.00 48.44  ? 541 PHE A CD1 1 
ATOM   4104  C  CD2 . PHE A  1 541 ? 34.112 81.329  44.008  1.00 46.84  ? 541 PHE A CD2 1 
ATOM   4105  C  CE1 . PHE A  1 541 ? 36.044 82.024  42.156  1.00 49.77  ? 541 PHE A CE1 1 
ATOM   4106  C  CE2 . PHE A  1 541 ? 34.507 82.663  43.865  1.00 49.99  ? 541 PHE A CE2 1 
ATOM   4107  C  CZ  . PHE A  1 541 ? 35.468 83.002  42.937  1.00 48.58  ? 541 PHE A CZ  1 
ATOM   4108  N  N   . LYS A  1 542 ? 34.521 76.014  42.227  1.00 43.00  ? 542 LYS A N   1 
ATOM   4109  C  CA  . LYS A  1 542 ? 34.581 74.589  42.542  1.00 43.12  ? 542 LYS A CA  1 
ATOM   4110  C  C   . LYS A  1 542 ? 34.776 74.455  44.050  1.00 48.16  ? 542 LYS A C   1 
ATOM   4111  O  O   . LYS A  1 542 ? 35.302 75.387  44.669  1.00 47.69  ? 542 LYS A O   1 
ATOM   4112  C  CB  . LYS A  1 542 ? 35.686 73.872  41.743  1.00 45.09  ? 542 LYS A CB  1 
ATOM   4113  C  CG  . LYS A  1 542 ? 37.071 74.482  41.853  1.00 49.29  ? 542 LYS A CG  1 
ATOM   4114  C  CD  . LYS A  1 542 ? 38.123 73.518  41.388  1.00 56.44  ? 542 LYS A CD  1 
ATOM   4115  C  CE  . LYS A  1 542 ? 39.289 74.255  40.801  1.00 64.46  ? 542 LYS A CE  1 
ATOM   4116  N  NZ  . LYS A  1 542 ? 39.148 74.427  39.330  1.00 68.23  ? 542 LYS A NZ  1 
ATOM   4117  N  N   . ARG A  1 543 ? 34.335 73.325  44.641  1.00 45.51  ? 543 ARG A N   1 
ATOM   4118  C  CA  . ARG A  1 543 ? 34.389 73.066  46.085  1.00 45.18  ? 543 ARG A CA  1 
ATOM   4119  C  C   . ARG A  1 543 ? 35.766 73.409  46.697  1.00 49.93  ? 543 ARG A C   1 
ATOM   4120  O  O   . ARG A  1 543 ? 36.771 72.832  46.285  1.00 49.97  ? 543 ARG A O   1 
ATOM   4121  C  CB  . ARG A  1 543 ? 34.011 71.607  46.400  1.00 44.66  ? 543 ARG A CB  1 
ATOM   4122  C  CG  . ARG A  1 543 ? 33.581 71.396  47.848  1.00 49.27  ? 543 ARG A CG  1 
ATOM   4123  C  CD  . ARG A  1 543 ? 32.947 70.042  48.058  1.00 50.61  ? 543 ARG A CD  1 
ATOM   4124  N  NE  . ARG A  1 543 ? 32.471 69.880  49.430  1.00 53.43  ? 543 ARG A NE  1 
ATOM   4125  C  CZ  . ARG A  1 543 ? 31.781 68.831  49.865  1.00 69.06  ? 543 ARG A CZ  1 
ATOM   4126  N  NH1 . ARG A  1 543 ? 31.482 67.837  49.039  1.00 61.37  ? 543 ARG A NH1 1 
ATOM   4127  N  NH2 . ARG A  1 543 ? 31.383 68.769  51.127  1.00 55.23  ? 543 ARG A NH2 1 
ATOM   4128  N  N   . PRO A  1 544 ? 35.839 74.385  47.633  1.00 46.34  ? 544 PRO A N   1 
ATOM   4129  C  CA  . PRO A  1 544 ? 37.142 74.708  48.240  1.00 45.89  ? 544 PRO A CA  1 
ATOM   4130  C  C   . PRO A  1 544 ? 37.470 73.775  49.412  1.00 51.12  ? 544 PRO A C   1 
ATOM   4131  O  O   . PRO A  1 544 ? 36.561 73.383  50.156  1.00 51.61  ? 544 PRO A O   1 
ATOM   4132  C  CB  . PRO A  1 544 ? 36.960 76.151  48.698  1.00 47.00  ? 544 PRO A CB  1 
ATOM   4133  C  CG  . PRO A  1 544 ? 35.481 76.309  48.925  1.00 51.31  ? 544 PRO A CG  1 
ATOM   4134  C  CD  . PRO A  1 544 ? 34.753 75.203  48.216  1.00 47.59  ? 544 PRO A CD  1 
ATOM   4135  N  N   . PHE A  1 545 ? 38.764 73.411  49.576  1.00 47.34  ? 545 PHE A N   1 
ATOM   4136  C  CA  . PHE A  1 545 ? 39.207 72.536  50.671  1.00 46.74  ? 545 PHE A CA  1 
ATOM   4137  C  C   . PHE A  1 545 ? 38.938 73.200  52.025  1.00 50.88  ? 545 PHE A C   1 
ATOM   4138  O  O   . PHE A  1 545 ? 39.257 74.379  52.212  1.00 49.91  ? 545 PHE A O   1 
ATOM   4139  C  CB  . PHE A  1 545 ? 40.693 72.161  50.537  1.00 48.07  ? 545 PHE A CB  1 
ATOM   4140  C  CG  . PHE A  1 545 ? 40.990 70.953  49.680  1.00 49.78  ? 545 PHE A CG  1 
ATOM   4141  C  CD1 . PHE A  1 545 ? 40.523 69.690  50.039  1.00 53.02  ? 545 PHE A CD1 1 
ATOM   4142  C  CD2 . PHE A  1 545 ? 41.812 71.058  48.566  1.00 52.06  ? 545 PHE A CD2 1 
ATOM   4143  C  CE1 . PHE A  1 545 ? 40.805 68.570  49.248  1.00 54.23  ? 545 PHE A CE1 1 
ATOM   4144  C  CE2 . PHE A  1 545 ? 42.114 69.932  47.790  1.00 55.46  ? 545 PHE A CE2 1 
ATOM   4145  C  CZ  . PHE A  1 545 ? 41.611 68.695  48.138  1.00 53.76  ? 545 PHE A CZ  1 
ATOM   4146  N  N   . SER A  1 546 ? 38.303 72.455  52.943  1.00 48.21  ? 546 SER A N   1 
ATOM   4147  C  CA  . SER A  1 546 ? 37.949 72.954  54.271  1.00 48.08  ? 546 SER A CA  1 
ATOM   4148  C  C   . SER A  1 546 ? 39.180 73.140  55.149  1.00 51.17  ? 546 SER A C   1 
ATOM   4149  O  O   . SER A  1 546 ? 40.132 72.368  55.055  1.00 50.63  ? 546 SER A O   1 
ATOM   4150  C  CB  . SER A  1 546 ? 36.962 72.016  54.955  1.00 53.09  ? 546 SER A CB  1 
ATOM   4151  O  OG  . SER A  1 546 ? 37.537 70.749  55.227  1.00 66.51  ? 546 SER A OG  1 
ATOM   4152  N  N   . GLU A  1 547 ? 39.158 74.179  55.990  1.00 47.47  ? 547 GLU A N   1 
ATOM   4153  C  CA  . GLU A  1 547 ? 40.237 74.476  56.923  1.00 46.97  ? 547 GLU A CA  1 
ATOM   4154  C  C   . GLU A  1 547 ? 39.630 74.642  58.322  1.00 50.19  ? 547 GLU A C   1 
ATOM   4155  O  O   . GLU A  1 547 ? 38.758 75.494  58.497  1.00 49.64  ? 547 GLU A O   1 
ATOM   4156  C  CB  . GLU A  1 547 ? 41.036 75.714  56.474  1.00 48.05  ? 547 GLU A CB  1 
ATOM   4157  C  CG  . GLU A  1 547 ? 42.445 75.800  57.052  1.00 60.74  ? 547 GLU A CG  1 
ATOM   4158  C  CD  . GLU A  1 547 ? 43.434 74.722  56.640  1.00 85.62  ? 547 GLU A CD  1 
ATOM   4159  O  OE1 . GLU A  1 547 ? 43.395 74.279  55.468  1.00 81.64  ? 547 GLU A OE1 1 
ATOM   4160  O  OE2 . GLU A  1 547 ? 44.269 74.338  57.490  1.00 81.39  ? 547 GLU A OE2 1 
ATOM   4161  N  N   . PRO A  1 548 ? 40.016 73.800  59.311  1.00 46.83  ? 548 PRO A N   1 
ATOM   4162  C  CA  . PRO A  1 548 ? 39.410 73.909  60.650  1.00 46.83  ? 548 PRO A CA  1 
ATOM   4163  C  C   . PRO A  1 548 ? 39.879 75.159  61.409  1.00 50.69  ? 548 PRO A C   1 
ATOM   4164  O  O   . PRO A  1 548 ? 40.834 75.108  62.187  1.00 50.84  ? 548 PRO A O   1 
ATOM   4165  C  CB  . PRO A  1 548 ? 39.839 72.606  61.348  1.00 49.04  ? 548 PRO A CB  1 
ATOM   4166  C  CG  . PRO A  1 548 ? 40.442 71.743  60.270  1.00 53.45  ? 548 PRO A CG  1 
ATOM   4167  C  CD  . PRO A  1 548 ? 40.989 72.695  59.265  1.00 48.62  ? 548 PRO A CD  1 
ATOM   4168  N  N   . SER A  1 549 ? 39.197 76.292  61.162  1.00 46.65  ? 549 SER A N   1 
ATOM   4169  C  CA  . SER A  1 549 ? 39.473 77.578  61.799  1.00 46.24  ? 549 SER A CA  1 
ATOM   4170  C  C   . SER A  1 549 ? 38.704 77.699  63.103  1.00 48.95  ? 549 SER A C   1 
ATOM   4171  O  O   . SER A  1 549 ? 37.550 77.270  63.180  1.00 48.38  ? 549 SER A O   1 
ATOM   4172  C  CB  . SER A  1 549 ? 39.110 78.734  60.871  1.00 50.78  ? 549 SER A CB  1 
ATOM   4173  O  OG  . SER A  1 549 ? 40.072 78.898  59.842  1.00 62.16  ? 549 SER A OG  1 
ATOM   4174  N  N   . ALA A  1 550 ? 39.344 78.296  64.123  1.00 44.90  ? 550 ALA A N   1 
ATOM   4175  C  CA  . ALA A  1 550 ? 38.772 78.498  65.455  1.00 44.45  ? 550 ALA A CA  1 
ATOM   4176  C  C   . ALA A  1 550 ? 38.425 79.984  65.724  1.00 46.89  ? 550 ALA A C   1 
ATOM   4177  O  O   . ALA A  1 550 ? 37.913 80.301  66.801  1.00 46.85  ? 550 ALA A O   1 
ATOM   4178  C  CB  . ALA A  1 550 ? 39.739 77.981  66.511  1.00 45.56  ? 550 ALA A CB  1 
ATOM   4179  N  N   . ASN A  1 551 ? 38.687 80.880  64.735  1.00 42.03  ? 551 ASN A N   1 
ATOM   4180  C  CA  . ASN A  1 551 ? 38.450 82.335  64.783  1.00 40.87  ? 551 ASN A CA  1 
ATOM   4181  C  C   . ASN A  1 551 ? 38.607 82.992  63.391  1.00 43.15  ? 551 ASN A C   1 
ATOM   4182  O  O   . ASN A  1 551 ? 38.888 82.299  62.409  1.00 42.58  ? 551 ASN A O   1 
ATOM   4183  C  CB  . ASN A  1 551 ? 39.410 83.007  65.780  1.00 41.86  ? 551 ASN A CB  1 
ATOM   4184  C  CG  . ASN A  1 551 ? 40.850 82.578  65.648  1.00 67.43  ? 551 ASN A CG  1 
ATOM   4185  O  OD1 . ASN A  1 551 ? 41.483 82.716  64.595  1.00 61.66  ? 551 ASN A OD1 1 
ATOM   4186  N  ND2 . ASN A  1 551 ? 41.402 82.051  66.730  1.00 61.85  ? 551 ASN A ND2 1 
ATOM   4187  N  N   . ILE A  1 552 ? 38.453 84.337  63.323  1.00 38.87  ? 552 ILE A N   1 
ATOM   4188  C  CA  . ILE A  1 552 ? 38.597 85.130  62.091  1.00 38.08  ? 552 ILE A CA  1 
ATOM   4189  C  C   . ILE A  1 552 ? 40.086 85.493  61.847  1.00 42.03  ? 552 ILE A C   1 
ATOM   4190  O  O   . ILE A  1 552 ? 40.395 86.195  60.879  1.00 42.43  ? 552 ILE A O   1 
ATOM   4191  C  CB  . ILE A  1 552 ? 37.676 86.395  62.038  1.00 40.94  ? 552 ILE A CB  1 
ATOM   4192  C  CG1 . ILE A  1 552 ? 37.851 87.317  63.281  1.00 41.18  ? 552 ILE A CG1 1 
ATOM   4193  C  CG2 . ILE A  1 552 ? 36.213 85.999  61.811  1.00 41.47  ? 552 ILE A CG2 1 
ATOM   4194  C  CD1 . ILE A  1 552 ? 37.410 88.766  63.098  1.00 45.00  ? 552 ILE A CD1 1 
ATOM   4195  N  N   . GLY A  1 553 ? 40.977 84.988  62.701  1.00 37.54  ? 553 GLY A N   1 
ATOM   4196  C  CA  . GLY A  1 553 ? 42.416 85.186  62.579  1.00 37.49  ? 553 GLY A CA  1 
ATOM   4197  C  C   . GLY A  1 553 ? 42.891 86.591  62.863  1.00 42.55  ? 553 GLY A C   1 
ATOM   4198  O  O   . GLY A  1 553 ? 42.465 87.212  63.844  1.00 43.13  ? 553 GLY A O   1 
ATOM   4199  N  N   . VAL A  1 554 ? 43.777 87.103  61.985  1.00 38.71  ? 554 VAL A N   1 
ATOM   4200  C  CA  . VAL A  1 554 ? 44.391 88.427  62.110  1.00 38.76  ? 554 VAL A CA  1 
ATOM   4201  C  C   . VAL A  1 554 ? 43.360 89.559  61.839  1.00 42.20  ? 554 VAL A C   1 
ATOM   4202  O  O   . VAL A  1 554 ? 43.645 90.721  62.140  1.00 42.12  ? 554 VAL A O   1 
ATOM   4203  C  CB  . VAL A  1 554 ? 45.658 88.536  61.214  1.00 43.03  ? 554 VAL A CB  1 
ATOM   4204  C  CG1 . VAL A  1 554 ? 45.313 88.851  59.765  1.00 42.80  ? 554 VAL A CG1 1 
ATOM   4205  C  CG2 . VAL A  1 554 ? 46.658 89.546  61.769  1.00 43.23  ? 554 VAL A CG2 1 
ATOM   4206  N  N   . TRP A  1 555 ? 42.160 89.212  61.323  1.00 37.99  ? 555 TRP A N   1 
ATOM   4207  C  CA  . TRP A  1 555 ? 41.087 90.170  61.045  1.00 37.70  ? 555 TRP A CA  1 
ATOM   4208  C  C   . TRP A  1 555 ? 40.582 90.848  62.316  1.00 42.80  ? 555 TRP A C   1 
ATOM   4209  O  O   . TRP A  1 555 ? 40.135 91.993  62.242  1.00 43.06  ? 555 TRP A O   1 
ATOM   4210  C  CB  . TRP A  1 555 ? 39.924 89.504  60.307  1.00 36.04  ? 555 TRP A CB  1 
ATOM   4211  C  CG  . TRP A  1 555 ? 40.211 89.286  58.853  1.00 36.79  ? 555 TRP A CG  1 
ATOM   4212  C  CD1 . TRP A  1 555 ? 40.468 88.098  58.236  1.00 39.52  ? 555 TRP A CD1 1 
ATOM   4213  C  CD2 . TRP A  1 555 ? 40.346 90.298  57.849  1.00 36.67  ? 555 TRP A CD2 1 
ATOM   4214  N  NE1 . TRP A  1 555 ? 40.728 88.305  56.903  1.00 38.87  ? 555 TRP A NE1 1 
ATOM   4215  C  CE2 . TRP A  1 555 ? 40.669 89.648  56.639  1.00 40.38  ? 555 TRP A CE2 1 
ATOM   4216  C  CE3 . TRP A  1 555 ? 40.221 91.697  57.853  1.00 38.17  ? 555 TRP A CE3 1 
ATOM   4217  C  CZ2 . TRP A  1 555 ? 40.842 90.343  55.441  1.00 40.08  ? 555 TRP A CZ2 1 
ATOM   4218  C  CZ3 . TRP A  1 555 ? 40.400 92.385  56.666  1.00 40.05  ? 555 TRP A CZ3 1 
ATOM   4219  C  CH2 . TRP A  1 555 ? 40.710 91.712  55.478  1.00 40.82  ? 555 TRP A CH2 1 
ATOM   4220  N  N   . GLN A  1 556 ? 40.681 90.160  63.478  1.00 39.28  ? 556 GLN A N   1 
ATOM   4221  C  CA  . GLN A  1 556 ? 40.282 90.691  64.784  1.00 38.94  ? 556 GLN A CA  1 
ATOM   4222  C  C   . GLN A  1 556 ? 41.131 91.922  65.127  1.00 43.31  ? 556 GLN A C   1 
ATOM   4223  O  O   . GLN A  1 556 ? 40.576 92.939  65.537  1.00 43.44  ? 556 GLN A O   1 
ATOM   4224  C  CB  . GLN A  1 556 ? 40.400 89.610  65.876  1.00 40.00  ? 556 GLN A CB  1 
ATOM   4225  C  CG  . GLN A  1 556 ? 39.767 89.991  67.223  1.00 41.43  ? 556 GLN A CG  1 
ATOM   4226  C  CD  . GLN A  1 556 ? 38.257 90.108  67.196  1.00 50.02  ? 556 GLN A CD  1 
ATOM   4227  O  OE1 . GLN A  1 556 ? 37.551 89.320  66.556  1.00 41.24  ? 556 GLN A OE1 1 
ATOM   4228  N  NE2 . GLN A  1 556 ? 37.728 91.087  67.921  1.00 42.13  ? 556 GLN A NE2 1 
ATOM   4229  N  N   . LEU A  1 557 ? 42.462 91.837  64.911  1.00 39.65  ? 557 LEU A N   1 
ATOM   4230  C  CA  . LEU A  1 557 ? 43.418 92.923  65.143  1.00 39.63  ? 557 LEU A CA  1 
ATOM   4231  C  C   . LEU A  1 557 ? 43.146 94.079  64.177  1.00 44.39  ? 557 LEU A C   1 
ATOM   4232  O  O   . LEU A  1 557 ? 43.175 95.240  64.589  1.00 45.25  ? 557 LEU A O   1 
ATOM   4233  C  CB  . LEU A  1 557 ? 44.862 92.403  64.973  1.00 39.58  ? 557 LEU A CB  1 
ATOM   4234  C  CG  . LEU A  1 557 ? 45.993 93.422  65.118  1.00 44.22  ? 557 LEU A CG  1 
ATOM   4235  C  CD1 . LEU A  1 557 ? 46.522 93.452  66.532  1.00 44.74  ? 557 LEU A CD1 1 
ATOM   4236  C  CD2 . LEU A  1 557 ? 47.116 93.122  64.154  1.00 45.88  ? 557 LEU A CD2 1 
ATOM   4237  N  N   . ALA A  1 558 ? 42.876 93.749  62.902  1.00 39.96  ? 558 ALA A N   1 
ATOM   4238  C  CA  . ALA A  1 558 ? 42.585 94.697  61.832  1.00 39.62  ? 558 ALA A CA  1 
ATOM   4239  C  C   . ALA A  1 558 ? 41.358 95.543  62.160  1.00 42.96  ? 558 ALA A C   1 
ATOM   4240  O  O   . ALA A  1 558 ? 41.432 96.771  62.088  1.00 43.70  ? 558 ALA A O   1 
ATOM   4241  C  CB  . ALA A  1 558 ? 42.367 93.948  60.534  1.00 40.20  ? 558 ALA A CB  1 
ATOM   4242  N  N   . PHE A  1 559 ? 40.244 94.885  62.545  1.00 38.01  ? 559 PHE A N   1 
ATOM   4243  C  CA  . PHE A  1 559 ? 38.977 95.521  62.910  1.00 37.47  ? 559 PHE A CA  1 
ATOM   4244  C  C   . PHE A  1 559 ? 39.115 96.347  64.196  1.00 41.17  ? 559 PHE A C   1 
ATOM   4245  O  O   . PHE A  1 559 ? 38.513 97.418  64.288  1.00 41.29  ? 559 PHE A O   1 
ATOM   4246  C  CB  . PHE A  1 559 ? 37.879 94.461  63.070  1.00 38.90  ? 559 PHE A CB  1 
ATOM   4247  C  CG  . PHE A  1 559 ? 37.090 94.142  61.822  1.00 40.21  ? 559 PHE A CG  1 
ATOM   4248  C  CD1 . PHE A  1 559 ? 37.642 93.368  60.806  1.00 42.92  ? 559 PHE A CD1 1 
ATOM   4249  C  CD2 . PHE A  1 559 ? 35.775 94.569  61.683  1.00 42.64  ? 559 PHE A CD2 1 
ATOM   4250  C  CE1 . PHE A  1 559 ? 36.905 93.060  59.659  1.00 43.69  ? 559 PHE A CE1 1 
ATOM   4251  C  CE2 . PHE A  1 559 ? 35.036 94.251  60.538  1.00 45.45  ? 559 PHE A CE2 1 
ATOM   4252  C  CZ  . PHE A  1 559 ? 35.604 93.493  59.537  1.00 43.02  ? 559 PHE A CZ  1 
ATOM   4253  N  N   . GLU A  1 560 ? 39.919 95.864  65.173  1.00 37.07  ? 560 GLU A N   1 
ATOM   4254  C  CA  . GLU A  1 560 ? 40.160 96.560  66.441  1.00 36.85  ? 560 GLU A CA  1 
ATOM   4255  C  C   . GLU A  1 560 ? 41.024 97.810  66.228  1.00 40.71  ? 560 GLU A C   1 
ATOM   4256  O  O   . GLU A  1 560 ? 40.815 98.805  66.918  1.00 40.65  ? 560 GLU A O   1 
ATOM   4257  C  CB  . GLU A  1 560 ? 40.793 95.628  67.483  1.00 38.26  ? 560 GLU A CB  1 
ATOM   4258  C  CG  . GLU A  1 560 ? 39.766 94.767  68.201  1.00 50.69  ? 560 GLU A CG  1 
ATOM   4259  C  CD  . GLU A  1 560 ? 40.299 93.744  69.187  1.00 77.10  ? 560 GLU A CD  1 
ATOM   4260  O  OE1 . GLU A  1 560 ? 41.307 93.069  68.875  1.00 78.22  ? 560 GLU A OE1 1 
ATOM   4261  O  OE2 . GLU A  1 560 ? 39.667 93.576  70.255  1.00 70.64  ? 560 GLU A OE2 1 
ATOM   4262  N  N   . THR A  1 561 ? 41.964 97.772  65.263  1.00 37.33  ? 561 THR A N   1 
ATOM   4263  C  CA  . THR A  1 561 ? 42.824 98.909  64.921  1.00 38.11  ? 561 THR A CA  1 
ATOM   4264  C  C   . THR A  1 561 ? 41.956 99.999  64.262  1.00 43.18  ? 561 THR A C   1 
ATOM   4265  O  O   . THR A  1 561 ? 42.149 101.185 64.544  1.00 43.31  ? 561 THR A O   1 
ATOM   4266  C  CB  . THR A  1 561 ? 43.992 98.435  64.040  1.00 48.64  ? 561 THR A CB  1 
ATOM   4267  O  OG1 . THR A  1 561 ? 44.788 97.520  64.799  1.00 50.55  ? 561 THR A OG1 1 
ATOM   4268  C  CG2 . THR A  1 561 ? 44.865 99.580  63.530  1.00 47.28  ? 561 THR A CG2 1 
ATOM   4269  N  N   . MET A  1 562 ? 40.973 99.582  63.428  1.00 39.85  ? 562 MET A N   1 
ATOM   4270  C  CA  . MET A  1 562 ? 40.015 100.463 62.757  1.00 39.88  ? 562 MET A CA  1 
ATOM   4271  C  C   . MET A  1 562 ? 39.155 101.198 63.798  1.00 44.52  ? 562 MET A C   1 
ATOM   4272  O  O   . MET A  1 562 ? 38.892 102.389 63.631  1.00 45.47  ? 562 MET A O   1 
ATOM   4273  C  CB  . MET A  1 562 ? 39.136 99.658  61.781  1.00 42.00  ? 562 MET A CB  1 
ATOM   4274  C  CG  . MET A  1 562 ? 38.224 100.514 60.903  1.00 46.39  ? 562 MET A CG  1 
ATOM   4275  S  SD  . MET A  1 562 ? 39.094 101.728 59.883  1.00 51.61  ? 562 MET A SD  1 
ATOM   4276  C  CE  . MET A  1 562 ? 39.537 100.730 58.507  1.00 48.20  ? 562 MET A CE  1 
ATOM   4277  N  N   . SER A  1 563 ? 38.758 100.499 64.885  1.00 40.33  ? 563 SER A N   1 
ATOM   4278  C  CA  . SER A  1 563 ? 37.968 101.080 65.974  1.00 40.16  ? 563 SER A CA  1 
ATOM   4279  C  C   . SER A  1 563 ? 38.826 102.038 66.835  1.00 42.98  ? 563 SER A C   1 
ATOM   4280  O  O   . SER A  1 563 ? 38.275 102.917 67.499  1.00 43.07  ? 563 SER A O   1 
ATOM   4281  C  CB  . SER A  1 563 ? 37.336 99.988  66.833  1.00 43.88  ? 563 SER A CB  1 
ATOM   4282  O  OG  . SER A  1 563 ? 38.274 99.326  67.664  1.00 54.06  ? 563 SER A OG  1 
ATOM   4283  N  N   . VAL A  1 564 ? 40.166 101.871 66.814  1.00 38.00  ? 564 VAL A N   1 
ATOM   4284  C  CA  . VAL A  1 564 ? 41.101 102.735 67.543  1.00 37.28  ? 564 VAL A CA  1 
ATOM   4285  C  C   . VAL A  1 564 ? 41.288 104.024 66.717  1.00 40.22  ? 564 VAL A C   1 
ATOM   4286  O  O   . VAL A  1 564 ? 41.253 105.121 67.285  1.00 40.30  ? 564 VAL A O   1 
ATOM   4287  C  CB  . VAL A  1 564 ? 42.435 102.002 67.878  1.00 40.22  ? 564 VAL A CB  1 
ATOM   4288  C  CG1 . VAL A  1 564 ? 43.567 102.976 68.194  1.00 40.51  ? 564 VAL A CG1 1 
ATOM   4289  C  CG2 . VAL A  1 564 ? 42.238 101.030 69.035  1.00 39.59  ? 564 VAL A CG2 1 
ATOM   4290  N  N   . ILE A  1 565 ? 41.426 103.885 65.377  1.00 35.51  ? 565 ILE A N   1 
ATOM   4291  C  CA  . ILE A  1 565 ? 41.573 105.003 64.433  1.00 35.41  ? 565 ILE A CA  1 
ATOM   4292  C  C   . ILE A  1 565 ? 40.293 105.864 64.457  1.00 40.49  ? 565 ILE A C   1 
ATOM   4293  O  O   . ILE A  1 565 ? 40.398 107.089 64.378  1.00 41.16  ? 565 ILE A O   1 
ATOM   4294  C  CB  . ILE A  1 565 ? 41.932 104.503 62.996  1.00 37.79  ? 565 ILE A CB  1 
ATOM   4295  C  CG1 . ILE A  1 565 ? 43.377 103.956 62.950  1.00 37.86  ? 565 ILE A CG1 1 
ATOM   4296  C  CG2 . ILE A  1 565 ? 41.737 105.594 61.925  1.00 38.44  ? 565 ILE A CG2 1 
ATOM   4297  C  CD1 . ILE A  1 565 ? 43.621 102.868 61.924  1.00 41.69  ? 565 ILE A CD1 1 
ATOM   4298  N  N   . SER A  1 566 ? 39.106 105.232 64.634  1.00 37.10  ? 566 SER A N   1 
ATOM   4299  C  CA  . SER A  1 566 ? 37.807 105.918 64.673  1.00 37.41  ? 566 SER A CA  1 
ATOM   4300  C  C   . SER A  1 566 ? 37.692 106.945 65.835  1.00 42.24  ? 566 SER A C   1 
ATOM   4301  O  O   . SER A  1 566 ? 36.907 107.885 65.720  1.00 41.84  ? 566 SER A O   1 
ATOM   4302  C  CB  . SER A  1 566 ? 36.662 104.914 64.728  1.00 40.17  ? 566 SER A CB  1 
ATOM   4303  O  OG  . SER A  1 566 ? 36.534 104.298 65.997  1.00 49.55  ? 566 SER A OG  1 
ATOM   4304  N  N   . VAL A  1 567 ? 38.493 106.790 66.917  1.00 39.39  ? 567 VAL A N   1 
ATOM   4305  C  CA  . VAL A  1 567 ? 38.525 107.728 68.054  1.00 39.63  ? 567 VAL A CA  1 
ATOM   4306  C  C   . VAL A  1 567 ? 39.180 109.029 67.582  1.00 43.85  ? 567 VAL A C   1 
ATOM   4307  O  O   . VAL A  1 567 ? 38.658 110.112 67.842  1.00 43.78  ? 567 VAL A O   1 
ATOM   4308  C  CB  . VAL A  1 567 ? 39.242 107.156 69.313  1.00 43.23  ? 567 VAL A CB  1 
ATOM   4309  C  CG1 . VAL A  1 567 ? 39.028 108.054 70.531  1.00 43.51  ? 567 VAL A CG1 1 
ATOM   4310  C  CG2 . VAL A  1 567 ? 38.792 105.735 69.615  1.00 42.40  ? 567 VAL A CG2 1 
ATOM   4311  N  N   . VAL A  1 568 ? 40.312 108.901 66.868  1.00 40.13  ? 568 VAL A N   1 
ATOM   4312  C  CA  . VAL A  1 568 ? 41.093 110.006 66.315  1.00 40.48  ? 568 VAL A CA  1 
ATOM   4313  C  C   . VAL A  1 568 ? 40.235 110.770 65.290  1.00 44.48  ? 568 VAL A C   1 
ATOM   4314  O  O   . VAL A  1 568 ? 40.136 111.996 65.373  1.00 44.52  ? 568 VAL A O   1 
ATOM   4315  C  CB  . VAL A  1 568 ? 42.430 109.504 65.688  1.00 44.00  ? 568 VAL A CB  1 
ATOM   4316  C  CG1 . VAL A  1 568 ? 43.362 110.668 65.370  1.00 44.77  ? 568 VAL A CG1 1 
ATOM   4317  C  CG2 . VAL A  1 568 ? 43.130 108.484 66.588  1.00 43.26  ? 568 VAL A CG2 1 
ATOM   4318  N  N   . THR A  1 569 ? 39.584 110.027 64.365  1.00 40.28  ? 569 THR A N   1 
ATOM   4319  C  CA  . THR A  1 569 ? 38.743 110.544 63.280  1.00 40.25  ? 569 THR A CA  1 
ATOM   4320  C  C   . THR A  1 569 ? 37.552 111.348 63.821  1.00 44.63  ? 569 THR A C   1 
ATOM   4321  O  O   . THR A  1 569 ? 37.416 112.518 63.463  1.00 45.05  ? 569 THR A O   1 
ATOM   4322  C  CB  . THR A  1 569 ? 38.265 109.395 62.372  1.00 47.03  ? 569 THR A CB  1 
ATOM   4323  O  OG1 . THR A  1 569 ? 39.334 108.476 62.151  1.00 48.99  ? 569 THR A OG1 1 
ATOM   4324  C  CG2 . THR A  1 569 ? 37.758 109.886 61.036  1.00 45.38  ? 569 THR A CG2 1 
ATOM   4325  N  N   . ASN A  1 570 ? 36.704 110.730 64.675  1.00 40.64  ? 570 ASN A N   1 
ATOM   4326  C  CA  . ASN A  1 570 ? 35.507 111.357 65.244  1.00 40.70  ? 570 ASN A CA  1 
ATOM   4327  C  C   . ASN A  1 570 ? 35.836 112.595 66.087  1.00 46.92  ? 570 ASN A C   1 
ATOM   4328  O  O   . ASN A  1 570 ? 35.088 113.575 66.024  1.00 47.37  ? 570 ASN A O   1 
ATOM   4329  C  CB  . ASN A  1 570 ? 34.697 110.358 66.069  1.00 37.92  ? 570 ASN A CB  1 
ATOM   4330  C  CG  . ASN A  1 570 ? 33.837 109.439 65.238  1.00 52.20  ? 570 ASN A CG  1 
ATOM   4331  O  OD1 . ASN A  1 570 ? 32.813 109.837 64.675  1.00 40.45  ? 570 ASN A OD1 1 
ATOM   4332  N  ND2 . ASN A  1 570 ? 34.216 108.178 65.165  1.00 47.02  ? 570 ASN A ND2 1 
ATOM   4333  N  N   . CYS A  1 571 ? 36.952 112.562 66.852  1.00 44.42  ? 571 CYS A N   1 
ATOM   4334  C  CA  . CYS A  1 571 ? 37.381 113.692 67.689  1.00 45.09  ? 571 CYS A CA  1 
ATOM   4335  C  C   . CYS A  1 571 ? 37.855 114.858 66.820  1.00 49.63  ? 571 CYS A C   1 
ATOM   4336  O  O   . CYS A  1 571 ? 37.577 116.013 67.150  1.00 50.00  ? 571 CYS A O   1 
ATOM   4337  C  CB  . CYS A  1 571 ? 38.457 113.268 68.683  1.00 45.07  ? 571 CYS A CB  1 
ATOM   4338  S  SG  . CYS A  1 571 ? 37.826 112.344 70.110  1.00 48.44  ? 571 CYS A SG  1 
ATOM   4339  N  N   . ALA A  1 572 ? 38.548 114.552 65.706  1.00 45.84  ? 572 ALA A N   1 
ATOM   4340  C  CA  . ALA A  1 572 ? 39.060 115.553 64.774  1.00 46.44  ? 572 ALA A CA  1 
ATOM   4341  C  C   . ALA A  1 572 ? 37.920 116.239 64.017  1.00 50.49  ? 572 ALA A C   1 
ATOM   4342  O  O   . ALA A  1 572 ? 37.876 117.465 64.002  1.00 51.36  ? 572 ALA A O   1 
ATOM   4343  C  CB  . ALA A  1 572 ? 40.038 114.918 63.798  1.00 46.89  ? 572 ALA A CB  1 
ATOM   4344  N  N   . LEU A  1 573 ? 36.981 115.458 63.442  1.00 45.81  ? 573 LEU A N   1 
ATOM   4345  C  CA  . LEU A  1 573 ? 35.830 115.964 62.685  1.00 45.56  ? 573 LEU A CA  1 
ATOM   4346  C  C   . LEU A  1 573 ? 34.916 116.853 63.538  1.00 49.57  ? 573 LEU A C   1 
ATOM   4347  O  O   . LEU A  1 573 ? 34.380 117.832 63.013  1.00 50.14  ? 573 LEU A O   1 
ATOM   4348  C  CB  . LEU A  1 573 ? 35.014 114.812 62.073  1.00 44.62  ? 573 LEU A CB  1 
ATOM   4349  C  CG  . LEU A  1 573 ? 35.691 114.002 60.967  1.00 48.31  ? 573 LEU A CG  1 
ATOM   4350  C  CD1 . LEU A  1 573 ? 35.003 112.667 60.780  1.00 47.45  ? 573 LEU A CD1 1 
ATOM   4351  C  CD2 . LEU A  1 573 ? 35.741 114.774 59.654  1.00 51.37  ? 573 LEU A CD2 1 
ATOM   4352  N  N   . ILE A  1 574 ? 34.747 116.530 64.839  1.00 45.45  ? 574 ILE A N   1 
ATOM   4353  C  CA  . ILE A  1 574 ? 33.925 117.336 65.747  1.00 46.05  ? 574 ILE A CA  1 
ATOM   4354  C  C   . ILE A  1 574 ? 34.699 118.628 66.082  1.00 51.56  ? 574 ILE A C   1 
ATOM   4355  O  O   . ILE A  1 574 ? 34.128 119.711 65.978  1.00 52.16  ? 574 ILE A O   1 
ATOM   4356  C  CB  . ILE A  1 574 ? 33.462 116.542 67.006  1.00 48.52  ? 574 ILE A CB  1 
ATOM   4357  C  CG1 . ILE A  1 574 ? 32.372 115.521 66.623  1.00 48.26  ? 574 ILE A CG1 1 
ATOM   4358  C  CG2 . ILE A  1 574 ? 32.940 117.479 68.113  1.00 50.14  ? 574 ILE A CG2 1 
ATOM   4359  C  CD1 . ILE A  1 574 ? 32.160 114.409 67.614  1.00 56.79  ? 574 ILE A CD1 1 
ATOM   4360  N  N   . GLY A  1 575 ? 35.989 118.500 66.404  1.00 48.35  ? 575 GLY A N   1 
ATOM   4361  C  CA  . GLY A  1 575 ? 36.866 119.629 66.704  1.00 49.45  ? 575 GLY A CA  1 
ATOM   4362  C  C   . GLY A  1 575 ? 37.005 120.610 65.553  1.00 55.47  ? 575 GLY A C   1 
ATOM   4363  O  O   . GLY A  1 575 ? 37.198 121.810 65.771  1.00 55.89  ? 575 GLY A O   1 
ATOM   4364  N  N   . MET A  1 576 ? 36.872 120.098 64.318  1.00 53.26  ? 576 MET A N   1 
ATOM   4365  C  CA  . MET A  1 576 ? 36.944 120.853 63.069  1.00 54.74  ? 576 MET A CA  1 
ATOM   4366  C  C   . MET A  1 576 ? 35.669 121.630 62.769  1.00 60.18  ? 576 MET A C   1 
ATOM   4367  O  O   . MET A  1 576 ? 35.744 122.639 62.064  1.00 61.13  ? 576 MET A O   1 
ATOM   4368  C  CB  . MET A  1 576 ? 37.209 119.903 61.896  1.00 56.83  ? 576 MET A CB  1 
ATOM   4369  C  CG  . MET A  1 576 ? 38.658 119.626 61.669  1.00 61.00  ? 576 MET A CG  1 
ATOM   4370  S  SD  . MET A  1 576 ? 38.897 118.456 60.318  1.00 65.11  ? 576 MET A SD  1 
ATOM   4371  C  CE  . MET A  1 576 ? 40.593 118.790 59.948  1.00 62.49  ? 576 MET A CE  1 
ATOM   4372  N  N   . SER A  1 577 ? 34.499 121.136 63.246  1.00 56.54  ? 577 SER A N   1 
ATOM   4373  C  CA  . SER A  1 577 ? 33.185 121.733 62.983  1.00 57.32  ? 577 SER A CA  1 
ATOM   4374  C  C   . SER A  1 577 ? 33.130 123.220 63.389  1.00 63.47  ? 577 SER A C   1 
ATOM   4375  O  O   . SER A  1 577 ? 33.689 123.585 64.427  1.00 63.15  ? 577 SER A O   1 
ATOM   4376  C  CB  . SER A  1 577 ? 32.072 120.944 63.668  1.00 60.13  ? 577 SER A CB  1 
ATOM   4377  O  OG  . SER A  1 577 ? 32.006 121.165 65.066  1.00 68.16  ? 577 SER A OG  1 
ATOM   4378  N  N   . PRO A  1 578 ? 32.483 124.089 62.565  1.00 61.82  ? 578 PRO A N   1 
ATOM   4379  C  CA  . PRO A  1 578 ? 32.440 125.529 62.891  1.00 62.99  ? 578 PRO A CA  1 
ATOM   4380  C  C   . PRO A  1 578 ? 31.673 125.862 64.173  1.00 66.63  ? 578 PRO A C   1 
ATOM   4381  O  O   . PRO A  1 578 ? 31.871 126.952 64.709  1.00 67.41  ? 578 PRO A O   1 
ATOM   4382  C  CB  . PRO A  1 578 ? 31.756 126.152 61.671  1.00 65.82  ? 578 PRO A CB  1 
ATOM   4383  C  CG  . PRO A  1 578 ? 30.978 125.045 61.062  1.00 69.55  ? 578 PRO A CG  1 
ATOM   4384  C  CD  . PRO A  1 578 ? 31.800 123.816 61.283  1.00 63.59  ? 578 PRO A CD  1 
ATOM   4385  N  N   . GLN A  1 579 ? 30.820 124.938 64.669  1.00 61.97  ? 579 GLN A N   1 
ATOM   4386  C  CA  . GLN A  1 579 ? 30.062 125.134 65.906  1.00 61.94  ? 579 GLN A CA  1 
ATOM   4387  C  C   . GLN A  1 579 ? 31.016 125.155 67.104  1.00 64.59  ? 579 GLN A C   1 
ATOM   4388  O  O   . GLN A  1 579 ? 30.856 125.993 67.994  1.00 64.98  ? 579 GLN A O   1 
ATOM   4389  C  CB  . GLN A  1 579 ? 28.985 124.050 66.078  1.00 62.72  ? 579 GLN A CB  1 
ATOM   4390  C  CG  . GLN A  1 579 ? 27.845 124.480 67.013  1.00 81.91  ? 579 GLN A CG  1 
ATOM   4391  C  CD  . GLN A  1 579 ? 26.628 123.588 66.952  1.00 105.77 ? 579 GLN A CD  1 
ATOM   4392  O  OE1 . GLN A  1 579 ? 26.228 123.102 65.889  1.00 101.87 ? 579 GLN A OE1 1 
ATOM   4393  N  NE2 . GLN A  1 579 ? 25.969 123.411 68.091  1.00 100.13 ? 579 GLN A NE2 1 
ATOM   4394  N  N   . VAL A  1 580 ? 32.027 124.259 67.097  1.00 59.21  ? 580 VAL A N   1 
ATOM   4395  C  CA  . VAL A  1 580 ? 33.049 124.145 68.144  1.00 58.40  ? 580 VAL A CA  1 
ATOM   4396  C  C   . VAL A  1 580 ? 34.052 125.297 67.998  1.00 64.04  ? 580 VAL A C   1 
ATOM   4397  O  O   . VAL A  1 580 ? 34.450 125.891 69.002  1.00 64.22  ? 580 VAL A O   1 
ATOM   4398  C  CB  . VAL A  1 580 ? 33.747 122.761 68.123  1.00 60.43  ? 580 VAL A CB  1 
ATOM   4399  C  CG1 . VAL A  1 580 ? 34.713 122.614 69.285  1.00 59.98  ? 580 VAL A CG1 1 
ATOM   4400  C  CG2 . VAL A  1 580 ? 32.724 121.641 68.168  1.00 59.35  ? 580 VAL A CG2 1 
ATOM   4401  N  N   . ASN A  1 581 ? 34.428 125.633 66.749  1.00 61.48  ? 581 ASN A N   1 
ATOM   4402  C  CA  . ASN A  1 581 ? 35.362 126.714 66.436  1.00 62.56  ? 581 ASN A CA  1 
ATOM   4403  C  C   . ASN A  1 581 ? 34.765 128.100 66.744  1.00 68.84  ? 581 ASN A C   1 
ATOM   4404  O  O   . ASN A  1 581 ? 35.515 129.070 66.844  1.00 69.70  ? 581 ASN A O   1 
ATOM   4405  C  CB  . ASN A  1 581 ? 35.810 126.629 64.982  1.00 62.59  ? 581 ASN A CB  1 
ATOM   4406  C  CG  . ASN A  1 581 ? 36.910 125.621 64.779  1.00 80.05  ? 581 ASN A CG  1 
ATOM   4407  O  OD1 . ASN A  1 581 ? 38.090 125.901 65.014  1.00 70.10  ? 581 ASN A OD1 1 
ATOM   4408  N  ND2 . ASN A  1 581 ? 36.546 124.414 64.369  1.00 72.55  ? 581 ASN A ND2 1 
ATOM   4409  N  N   . ALA A  1 582 ? 33.433 128.189 66.918  1.00 66.09  ? 582 ALA A N   1 
ATOM   4410  C  CA  . ALA A  1 582 ? 32.743 129.432 67.271  1.00 67.69  ? 582 ALA A CA  1 
ATOM   4411  C  C   . ALA A  1 582 ? 33.030 129.802 68.729  1.00 73.16  ? 582 ALA A C   1 
ATOM   4412  O  O   . ALA A  1 582 ? 33.074 130.986 69.068  1.00 74.06  ? 582 ALA A O   1 
ATOM   4413  C  CB  . ALA A  1 582 ? 31.248 129.279 67.054  1.00 68.48  ? 582 ALA A CB  1 
ATOM   4414  N  N   . VAL A  1 583 ? 33.234 128.774 69.581  1.00 69.20  ? 583 VAL A N   1 
ATOM   4415  C  CA  . VAL A  1 583 ? 33.533 128.884 71.013  1.00 69.20  ? 583 VAL A CA  1 
ATOM   4416  C  C   . VAL A  1 583 ? 35.007 129.305 71.197  1.00 73.97  ? 583 VAL A C   1 
ATOM   4417  O  O   . VAL A  1 583 ? 35.328 130.016 72.155  1.00 74.29  ? 583 VAL A O   1 
ATOM   4418  C  CB  . VAL A  1 583 ? 33.200 127.546 71.736  1.00 71.55  ? 583 VAL A CB  1 
ATOM   4419  C  CG1 . VAL A  1 583 ? 33.548 127.593 73.223  1.00 71.58  ? 583 VAL A CG1 1 
ATOM   4420  C  CG2 . VAL A  1 583 ? 31.731 127.177 71.548  1.00 71.05  ? 583 VAL A CG2 1 
ATOM   4421  N  N   . PHE A  1 584 ? 35.884 128.890 70.261  1.00 70.46  ? 584 PHE A N   1 
ATOM   4422  C  CA  . PHE A  1 584 ? 37.314 129.196 70.275  1.00 70.86  ? 584 PHE A CA  1 
ATOM   4423  C  C   . PHE A  1 584 ? 37.674 130.048 69.036  1.00 76.79  ? 584 PHE A C   1 
ATOM   4424  O  O   . PHE A  1 584 ? 38.148 129.505 68.034  1.00 75.76  ? 584 PHE A O   1 
ATOM   4425  C  CB  . PHE A  1 584 ? 38.138 127.895 70.340  1.00 71.22  ? 584 PHE A CB  1 
ATOM   4426  C  CG  . PHE A  1 584 ? 37.875 127.064 71.576  1.00 71.84  ? 584 PHE A CG  1 
ATOM   4427  C  CD1 . PHE A  1 584 ? 36.862 126.112 71.594  1.00 73.71  ? 584 PHE A CD1 1 
ATOM   4428  C  CD2 . PHE A  1 584 ? 38.648 127.225 72.717  1.00 74.27  ? 584 PHE A CD2 1 
ATOM   4429  C  CE1 . PHE A  1 584 ? 36.623 125.342 72.736  1.00 73.85  ? 584 PHE A CE1 1 
ATOM   4430  C  CE2 . PHE A  1 584 ? 38.399 126.464 73.862  1.00 76.36  ? 584 PHE A CE2 1 
ATOM   4431  C  CZ  . PHE A  1 584 ? 37.393 125.523 73.860  1.00 73.31  ? 584 PHE A CZ  1 
ATOM   4432  N  N   . PRO A  1 585 ? 37.434 131.385 69.069  1.00 75.70  ? 585 PRO A N   1 
ATOM   4433  C  CA  . PRO A  1 585 ? 37.718 132.207 67.880  1.00 76.75  ? 585 PRO A CA  1 
ATOM   4434  C  C   . PRO A  1 585 ? 39.209 132.476 67.672  1.00 81.55  ? 585 PRO A C   1 
ATOM   4435  O  O   . PRO A  1 585 ? 39.682 132.371 66.537  1.00 81.33  ? 585 PRO A O   1 
ATOM   4436  C  CB  . PRO A  1 585 ? 36.947 133.510 68.147  1.00 79.94  ? 585 PRO A CB  1 
ATOM   4437  C  CG  . PRO A  1 585 ? 36.146 133.273 69.403  1.00 83.83  ? 585 PRO A CG  1 
ATOM   4438  C  CD  . PRO A  1 585 ? 36.863 132.209 70.152  1.00 78.13  ? 585 PRO A CD  1 
ATOM   4439  N  N   . GLU A  1 586 ? 39.944 132.821 68.755  1.00 78.43  ? 586 GLU A N   1 
ATOM   4440  C  CA  . GLU A  1 586 ? 41.377 133.118 68.705  1.00 78.69  ? 586 GLU A CA  1 
ATOM   4441  C  C   . GLU A  1 586 ? 42.215 131.956 69.258  1.00 79.97  ? 586 GLU A C   1 
ATOM   4442  O  O   . GLU A  1 586 ? 43.168 131.530 68.599  1.00 79.46  ? 586 GLU A O   1 
ATOM   4443  C  CB  . GLU A  1 586 ? 41.693 134.418 69.467  1.00 81.73  ? 586 GLU A CB  1 
ATOM   4444  N  N   . SER A  1 587 ? 41.859 131.447 70.459  1.00 74.20  ? 587 SER A N   1 
ATOM   4445  C  CA  . SER A  1 587 ? 42.574 130.357 71.124  1.00 72.00  ? 587 SER A CA  1 
ATOM   4446  C  C   . SER A  1 587 ? 42.290 129.007 70.444  1.00 71.32  ? 587 SER A C   1 
ATOM   4447  O  O   . SER A  1 587 ? 41.468 128.223 70.928  1.00 69.88  ? 587 SER A O   1 
ATOM   4448  C  CB  . SER A  1 587 ? 42.218 130.309 72.609  1.00 75.51  ? 587 SER A CB  1 
ATOM   4449  N  N   . LYS A  1 588 ? 42.969 128.748 69.312  1.00 65.57  ? 588 LYS A N   1 
ATOM   4450  C  CA  . LYS A  1 588 ? 42.823 127.494 68.567  1.00 63.15  ? 588 LYS A CA  1 
ATOM   4451  C  C   . LYS A  1 588 ? 43.684 126.409 69.207  1.00 64.41  ? 588 LYS A C   1 
ATOM   4452  O  O   . LYS A  1 588 ? 43.389 125.220 69.065  1.00 62.62  ? 588 LYS A O   1 
ATOM   4453  C  CB  . LYS A  1 588 ? 43.183 127.671 67.078  1.00 65.76  ? 588 LYS A CB  1 
ATOM   4454  C  CG  . LYS A  1 588 ? 42.253 128.602 66.296  1.00 79.69  ? 588 LYS A CG  1 
ATOM   4455  C  CD  . LYS A  1 588 ? 40.867 128.012 66.016  1.00 86.59  ? 588 LYS A CD  1 
ATOM   4456  C  CE  . LYS A  1 588 ? 40.011 129.000 65.264  1.00 96.98  ? 588 LYS A CE  1 
ATOM   4457  N  NZ  . LYS A  1 588 ? 38.570 128.660 65.349  1.00 103.78 ? 588 LYS A NZ  1 
ATOM   4458  N  N   . ALA A  1 589 ? 44.743 126.831 69.919  1.00 60.51  ? 589 ALA A N   1 
ATOM   4459  C  CA  . ALA A  1 589 ? 45.668 125.960 70.639  1.00 59.26  ? 589 ALA A CA  1 
ATOM   4460  C  C   . ALA A  1 589 ? 44.944 125.261 71.792  1.00 60.91  ? 589 ALA A C   1 
ATOM   4461  O  O   . ALA A  1 589 ? 45.120 124.055 71.980  1.00 59.36  ? 589 ALA A O   1 
ATOM   4462  C  CB  . ALA A  1 589 ? 46.841 126.775 71.163  1.00 61.37  ? 589 ALA A CB  1 
ATOM   4463  N  N   . ASP A  1 590 ? 44.100 126.023 72.532  1.00 57.10  ? 590 ASP A N   1 
ATOM   4464  C  CA  . ASP A  1 590 ? 43.295 125.549 73.659  1.00 55.92  ? 590 ASP A CA  1 
ATOM   4465  C  C   . ASP A  1 590 ? 42.310 124.487 73.202  1.00 56.21  ? 590 ASP A C   1 
ATOM   4466  O  O   . ASP A  1 590 ? 42.249 123.420 73.809  1.00 54.82  ? 590 ASP A O   1 
ATOM   4467  C  CB  . ASP A  1 590 ? 42.547 126.717 74.328  1.00 59.09  ? 590 ASP A CB  1 
ATOM   4468  C  CG  . ASP A  1 590 ? 43.398 127.625 75.199  1.00 75.66  ? 590 ASP A CG  1 
ATOM   4469  O  OD1 . ASP A  1 590 ? 44.626 127.390 75.290  1.00 77.08  ? 590 ASP A OD1 1 
ATOM   4470  O  OD2 . ASP A  1 590 ? 42.835 128.565 75.800  1.00 85.52  ? 590 ASP A OD2 1 
ATOM   4471  N  N   . LEU A  1 591 ? 41.573 124.769 72.111  1.00 51.10  ? 591 LEU A N   1 
ATOM   4472  C  CA  . LEU A  1 591 ? 40.592 123.872 71.505  1.00 49.26  ? 591 LEU A CA  1 
ATOM   4473  C  C   . LEU A  1 591 ? 41.216 122.505 71.188  1.00 50.52  ? 591 LEU A C   1 
ATOM   4474  O  O   . LEU A  1 591 ? 40.633 121.492 71.567  1.00 49.40  ? 591 LEU A O   1 
ATOM   4475  C  CB  . LEU A  1 591 ? 40.000 124.520 70.233  1.00 49.82  ? 591 LEU A CB  1 
ATOM   4476  C  CG  . LEU A  1 591 ? 39.200 123.634 69.264  1.00 53.81  ? 591 LEU A CG  1 
ATOM   4477  C  CD1 . LEU A  1 591 ? 37.999 123.017 69.938  1.00 53.41  ? 591 LEU A CD1 1 
ATOM   4478  C  CD2 . LEU A  1 591 ? 38.754 124.423 68.057  1.00 57.54  ? 591 LEU A CD2 1 
ATOM   4479  N  N   . ILE A  1 592 ? 42.396 122.481 70.518  1.00 45.93  ? 592 ILE A N   1 
ATOM   4480  C  CA  . ILE A  1 592 ? 43.111 121.247 70.164  1.00 43.98  ? 592 ILE A CA  1 
ATOM   4481  C  C   . ILE A  1 592 ? 43.484 120.494 71.448  1.00 47.51  ? 592 ILE A C   1 
ATOM   4482  O  O   . ILE A  1 592 ? 43.229 119.294 71.522  1.00 46.20  ? 592 ILE A O   1 
ATOM   4483  C  CB  . ILE A  1 592 ? 44.338 121.516 69.248  1.00 47.10  ? 592 ILE A CB  1 
ATOM   4484  C  CG1 . ILE A  1 592 ? 43.871 122.075 67.888  1.00 47.54  ? 592 ILE A CG1 1 
ATOM   4485  C  CG2 . ILE A  1 592 ? 45.189 120.243 69.049  1.00 46.68  ? 592 ILE A CG2 1 
ATOM   4486  C  CD1 . ILE A  1 592 ? 44.896 122.829 67.126  1.00 55.98  ? 592 ILE A CD1 1 
ATOM   4487  N  N   . LEU A  1 593 ? 44.005 121.203 72.472  1.00 44.91  ? 593 LEU A N   1 
ATOM   4488  C  CA  . LEU A  1 593 ? 44.362 120.595 73.756  1.00 44.63  ? 593 LEU A CA  1 
ATOM   4489  C  C   . LEU A  1 593 ? 43.150 119.928 74.429  1.00 48.29  ? 593 LEU A C   1 
ATOM   4490  O  O   . LEU A  1 593 ? 43.316 118.849 74.998  1.00 47.56  ? 593 LEU A O   1 
ATOM   4491  C  CB  . LEU A  1 593 ? 45.004 121.613 74.703  1.00 45.93  ? 593 LEU A CB  1 
ATOM   4492  C  CG  . LEU A  1 593 ? 46.464 121.959 74.417  1.00 51.17  ? 593 LEU A CG  1 
ATOM   4493  C  CD1 . LEU A  1 593 ? 46.865 123.224 75.136  1.00 52.81  ? 593 LEU A CD1 1 
ATOM   4494  C  CD2 . LEU A  1 593 ? 47.397 120.820 74.813  1.00 52.25  ? 593 LEU A CD2 1 
ATOM   4495  N  N   . ILE A  1 594 ? 41.935 120.537 74.322  1.00 44.47  ? 594 ILE A N   1 
ATOM   4496  C  CA  . ILE A  1 594 ? 40.681 119.976 74.854  1.00 43.29  ? 594 ILE A CA  1 
ATOM   4497  C  C   . ILE A  1 594 ? 40.334 118.686 74.070  1.00 46.04  ? 594 ILE A C   1 
ATOM   4498  O  O   . ILE A  1 594 ? 40.083 117.648 74.686  1.00 44.97  ? 594 ILE A O   1 
ATOM   4499  C  CB  . ILE A  1 594 ? 39.494 120.998 74.820  1.00 46.68  ? 594 ILE A CB  1 
ATOM   4500  C  CG1 . ILE A  1 594 ? 39.835 122.369 75.473  1.00 48.36  ? 594 ILE A CG1 1 
ATOM   4501  C  CG2 . ILE A  1 594 ? 38.208 120.406 75.410  1.00 46.90  ? 594 ILE A CG2 1 
ATOM   4502  C  CD1 . ILE A  1 594 ? 40.210 122.418 76.986  1.00 57.99  ? 594 ILE A CD1 1 
ATOM   4503  N  N   . VAL A  1 595 ? 40.340 118.767 72.717  1.00 42.24  ? 595 VAL A N   1 
ATOM   4504  C  CA  . VAL A  1 595 ? 40.037 117.667 71.792  1.00 41.19  ? 595 VAL A CA  1 
ATOM   4505  C  C   . VAL A  1 595 ? 40.972 116.471 72.076  1.00 46.63  ? 595 VAL A C   1 
ATOM   4506  O  O   . VAL A  1 595 ? 40.482 115.354 72.270  1.00 45.62  ? 595 VAL A O   1 
ATOM   4507  C  CB  . VAL A  1 595 ? 40.109 118.134 70.306  1.00 44.54  ? 595 VAL A CB  1 
ATOM   4508  C  CG1 . VAL A  1 595 ? 40.058 116.954 69.335  1.00 43.40  ? 595 VAL A CG1 1 
ATOM   4509  C  CG2 . VAL A  1 595 ? 38.996 119.127 69.985  1.00 44.72  ? 595 VAL A CG2 1 
ATOM   4510  N  N   . VAL A  1 596 ? 42.299 116.723 72.136  1.00 44.82  ? 596 VAL A N   1 
ATOM   4511  C  CA  . VAL A  1 596 ? 43.343 115.718 72.381  1.00 44.87  ? 596 VAL A CA  1 
ATOM   4512  C  C   . VAL A  1 596 ? 43.138 115.080 73.773  1.00 50.38  ? 596 VAL A C   1 
ATOM   4513  O  O   . VAL A  1 596 ? 43.264 113.858 73.894  1.00 49.76  ? 596 VAL A O   1 
ATOM   4514  C  CB  . VAL A  1 596 ? 44.767 116.319 72.189  1.00 49.43  ? 596 VAL A CB  1 
ATOM   4515  C  CG1 . VAL A  1 596 ? 45.866 115.361 72.644  1.00 49.01  ? 596 VAL A CG1 1 
ATOM   4516  C  CG2 . VAL A  1 596 ? 44.993 116.717 70.734  1.00 49.29  ? 596 VAL A CG2 1 
ATOM   4517  N  N   . ALA A  1 597 ? 42.769 115.890 74.793  1.00 47.79  ? 597 ALA A N   1 
ATOM   4518  C  CA  . ALA A  1 597 ? 42.501 115.395 76.146  1.00 47.67  ? 597 ALA A CA  1 
ATOM   4519  C  C   . ALA A  1 597 ? 41.318 114.431 76.137  1.00 50.98  ? 597 ALA A C   1 
ATOM   4520  O  O   . ALA A  1 597 ? 41.425 113.341 76.702  1.00 50.92  ? 597 ALA A O   1 
ATOM   4521  C  CB  . ALA A  1 597 ? 42.232 116.551 77.093  1.00 49.41  ? 597 ALA A CB  1 
ATOM   4522  N  N   . VAL A  1 598 ? 40.215 114.813 75.446  1.00 46.46  ? 598 VAL A N   1 
ATOM   4523  C  CA  . VAL A  1 598 ? 38.989 114.017 75.302  1.00 45.03  ? 598 VAL A CA  1 
ATOM   4524  C  C   . VAL A  1 598 ? 39.332 112.711 74.570  1.00 46.53  ? 598 VAL A C   1 
ATOM   4525  O  O   . VAL A  1 598 ? 38.929 111.642 75.026  1.00 45.81  ? 598 VAL A O   1 
ATOM   4526  C  CB  . VAL A  1 598 ? 37.861 114.827 74.597  1.00 49.07  ? 598 VAL A CB  1 
ATOM   4527  C  CG1 . VAL A  1 598 ? 36.725 113.929 74.117  1.00 48.14  ? 598 VAL A CG1 1 
ATOM   4528  C  CG2 . VAL A  1 598 ? 37.318 115.915 75.517  1.00 49.79  ? 598 VAL A CG2 1 
ATOM   4529  N  N   . GLU A  1 599 ? 40.125 112.803 73.486  1.00 41.91  ? 599 GLU A N   1 
ATOM   4530  C  CA  . GLU A  1 599 ? 40.578 111.670 72.677  1.00 40.52  ? 599 GLU A CA  1 
ATOM   4531  C  C   . GLU A  1 599 ? 41.378 110.658 73.522  1.00 43.93  ? 599 GLU A C   1 
ATOM   4532  O  O   . GLU A  1 599 ? 41.176 109.452 73.376  1.00 42.95  ? 599 GLU A O   1 
ATOM   4533  C  CB  . GLU A  1 599 ? 41.424 112.178 71.497  1.00 41.82  ? 599 GLU A CB  1 
ATOM   4534  C  CG  . GLU A  1 599 ? 41.880 111.087 70.543  1.00 48.43  ? 599 GLU A CG  1 
ATOM   4535  C  CD  . GLU A  1 599 ? 43.359 111.100 70.217  1.00 61.93  ? 599 GLU A CD  1 
ATOM   4536  O  OE1 . GLU A  1 599 ? 44.173 111.524 71.070  1.00 46.18  ? 599 GLU A OE1 1 
ATOM   4537  O  OE2 . GLU A  1 599 ? 43.702 110.671 69.093  1.00 55.71  ? 599 GLU A OE2 1 
ATOM   4538  N  N   . HIS A  1 600 ? 42.270 111.156 74.400  1.00 40.88  ? 600 HIS A N   1 
ATOM   4539  C  CA  . HIS A  1 600 ? 43.104 110.338 75.279  1.00 40.81  ? 600 HIS A CA  1 
ATOM   4540  C  C   . HIS A  1 600 ? 42.260 109.635 76.337  1.00 44.53  ? 600 HIS A C   1 
ATOM   4541  O  O   . HIS A  1 600 ? 42.503 108.459 76.620  1.00 43.46  ? 600 HIS A O   1 
ATOM   4542  C  CB  . HIS A  1 600 ? 44.194 111.193 75.934  1.00 42.58  ? 600 HIS A CB  1 
ATOM   4543  C  CG  . HIS A  1 600 ? 45.422 111.317 75.091  1.00 45.99  ? 600 HIS A CG  1 
ATOM   4544  N  ND1 . HIS A  1 600 ? 45.478 112.188 74.020  1.00 47.72  ? 600 HIS A ND1 1 
ATOM   4545  C  CD2 . HIS A  1 600 ? 46.594 110.650 75.175  1.00 47.84  ? 600 HIS A CD2 1 
ATOM   4546  C  CE1 . HIS A  1 600 ? 46.679 112.029 73.492  1.00 47.36  ? 600 HIS A CE1 1 
ATOM   4547  N  NE2 . HIS A  1 600 ? 47.387 111.116 74.155  1.00 47.76  ? 600 HIS A NE2 1 
ATOM   4548  N  N   . ALA A  1 601 ? 41.255 110.347 76.897  1.00 41.77  ? 601 ALA A N   1 
ATOM   4549  C  CA  . ALA A  1 601 ? 40.326 109.818 77.899  1.00 41.46  ? 601 ALA A CA  1 
ATOM   4550  C  C   . ALA A  1 601 ? 39.459 108.709 77.295  1.00 44.88  ? 601 ALA A C   1 
ATOM   4551  O  O   . ALA A  1 601 ? 39.266 107.673 77.932  1.00 44.30  ? 601 ALA A O   1 
ATOM   4552  C  CB  . ALA A  1 601 ? 39.454 110.935 78.448  1.00 42.64  ? 601 ALA A CB  1 
ATOM   4553  N  N   . LEU A  1 602 ? 38.978 108.916 76.048  1.00 41.35  ? 602 LEU A N   1 
ATOM   4554  C  CA  . LEU A  1 602 ? 38.153 107.953 75.320  1.00 40.39  ? 602 LEU A CA  1 
ATOM   4555  C  C   . LEU A  1 602 ? 38.958 106.705 74.974  1.00 46.96  ? 602 LEU A C   1 
ATOM   4556  O  O   . LEU A  1 602 ? 38.435 105.604 75.143  1.00 46.98  ? 602 LEU A O   1 
ATOM   4557  C  CB  . LEU A  1 602 ? 37.548 108.566 74.045  1.00 39.60  ? 602 LEU A CB  1 
ATOM   4558  C  CG  . LEU A  1 602 ? 36.432 109.591 74.228  1.00 44.27  ? 602 LEU A CG  1 
ATOM   4559  C  CD1 . LEU A  1 602 ? 36.251 110.410 72.979  1.00 44.40  ? 602 LEU A CD1 1 
ATOM   4560  C  CD2 . LEU A  1 602 ? 35.118 108.935 74.610  1.00 46.24  ? 602 LEU A CD2 1 
ATOM   4561  N  N   . LEU A  1 603 ? 40.233 106.866 74.528  1.00 44.69  ? 603 LEU A N   1 
ATOM   4562  C  CA  . LEU A  1 603 ? 41.121 105.748 74.180  1.00 44.54  ? 603 LEU A CA  1 
ATOM   4563  C  C   . LEU A  1 603 ? 41.419 104.874 75.400  1.00 50.49  ? 603 LEU A C   1 
ATOM   4564  O  O   . LEU A  1 603 ? 41.548 103.656 75.257  1.00 50.28  ? 603 LEU A O   1 
ATOM   4565  C  CB  . LEU A  1 603 ? 42.436 106.235 73.555  1.00 44.66  ? 603 LEU A CB  1 
ATOM   4566  C  CG  . LEU A  1 603 ? 42.405 106.588 72.067  1.00 48.65  ? 603 LEU A CG  1 
ATOM   4567  C  CD1 . LEU A  1 603 ? 43.639 107.371 71.682  1.00 49.37  ? 603 LEU A CD1 1 
ATOM   4568  C  CD2 . LEU A  1 603 ? 42.291 105.341 71.190  1.00 49.51  ? 603 LEU A CD2 1 
ATOM   4569  N  N   . ALA A  1 604 ? 41.510 105.494 76.595  1.00 48.19  ? 604 ALA A N   1 
ATOM   4570  C  CA  . ALA A  1 604 ? 41.734 104.789 77.856  1.00 48.33  ? 604 ALA A CA  1 
ATOM   4571  C  C   . ALA A  1 604 ? 40.480 104.003 78.236  1.00 51.51  ? 604 ALA A C   1 
ATOM   4572  O  O   . ALA A  1 604 ? 40.585 102.825 78.573  1.00 51.29  ? 604 ALA A O   1 
ATOM   4573  C  CB  . ALA A  1 604 ? 42.105 105.774 78.955  1.00 50.07  ? 604 ALA A CB  1 
ATOM   4574  N  N   . LEU A  1 605 ? 39.292 104.640 78.117  1.00 47.38  ? 605 LEU A N   1 
ATOM   4575  C  CA  . LEU A  1 605 ? 37.995 104.032 78.413  1.00 46.78  ? 605 LEU A CA  1 
ATOM   4576  C  C   . LEU A  1 605 ? 37.678 102.901 77.444  1.00 49.56  ? 605 LEU A C   1 
ATOM   4577  O  O   . LEU A  1 605 ? 37.078 101.910 77.852  1.00 48.62  ? 605 LEU A O   1 
ATOM   4578  C  CB  . LEU A  1 605 ? 36.877 105.080 78.384  1.00 47.13  ? 605 LEU A CB  1 
ATOM   4579  C  CG  . LEU A  1 605 ? 36.758 105.948 79.634  1.00 53.10  ? 605 LEU A CG  1 
ATOM   4580  C  CD1 . LEU A  1 605 ? 36.139 107.292 79.308  1.00 53.94  ? 605 LEU A CD1 1 
ATOM   4581  C  CD2 . LEU A  1 605 ? 35.965 105.245 80.730  1.00 55.57  ? 605 LEU A CD2 1 
ATOM   4582  N  N   . LYS A  1 606 ? 38.100 103.042 76.174  1.00 46.32  ? 606 LYS A N   1 
ATOM   4583  C  CA  . LYS A  1 606 ? 37.920 102.044 75.115  1.00 45.70  ? 606 LYS A CA  1 
ATOM   4584  C  C   . LYS A  1 606 ? 38.740 100.779 75.437  1.00 49.30  ? 606 LYS A C   1 
ATOM   4585  O  O   . LYS A  1 606 ? 38.251 99.667  75.223  1.00 47.76  ? 606 LYS A O   1 
ATOM   4586  C  CB  . LYS A  1 606 ? 38.320 102.634 73.748  1.00 47.92  ? 606 LYS A CB  1 
ATOM   4587  C  CG  . LYS A  1 606 ? 37.960 101.757 72.566  1.00 62.45  ? 606 LYS A CG  1 
ATOM   4588  C  CD  . LYS A  1 606 ? 38.143 102.462 71.241  1.00 73.23  ? 606 LYS A CD  1 
ATOM   4589  C  CE  . LYS A  1 606 ? 36.828 102.716 70.543  1.00 82.25  ? 606 LYS A CE  1 
ATOM   4590  N  NZ  . LYS A  1 606 ? 36.372 101.536 69.764  1.00 88.16  ? 606 LYS A NZ  1 
ATOM   4591  N  N   . PHE A  1 607 ? 39.969 100.962 75.971  1.00 46.95  ? 607 PHE A N   1 
ATOM   4592  C  CA  . PHE A  1 607 ? 40.868 99.881  76.377  1.00 47.04  ? 607 PHE A CA  1 
ATOM   4593  C  C   . PHE A  1 607 ? 40.279 99.147  77.588  1.00 49.52  ? 607 PHE A C   1 
ATOM   4594  O  O   . PHE A  1 607 ? 40.251 97.914  77.592  1.00 48.92  ? 607 PHE A O   1 
ATOM   4595  C  CB  . PHE A  1 607 ? 42.280 100.433 76.689  1.00 50.07  ? 607 PHE A CB  1 
ATOM   4596  C  CG  . PHE A  1 607 ? 43.253 99.450  77.310  1.00 52.90  ? 607 PHE A CG  1 
ATOM   4597  C  CD1 . PHE A  1 607 ? 43.335 99.304  78.694  1.00 57.19  ? 607 PHE A CD1 1 
ATOM   4598  C  CD2 . PHE A  1 607 ? 44.107 98.694  76.514  1.00 55.48  ? 607 PHE A CD2 1 
ATOM   4599  C  CE1 . PHE A  1 607 ? 44.226 98.388  79.269  1.00 58.58  ? 607 PHE A CE1 1 
ATOM   4600  C  CE2 . PHE A  1 607 ? 45.007 97.786  77.091  1.00 59.02  ? 607 PHE A CE2 1 
ATOM   4601  C  CZ  . PHE A  1 607 ? 45.061 97.642  78.465  1.00 57.76  ? 607 PHE A CZ  1 
ATOM   4602  N  N   . ILE A  1 608 ? 39.824 99.911  78.611  1.00 45.45  ? 608 ILE A N   1 
ATOM   4603  C  CA  . ILE A  1 608 ? 39.234 99.403  79.857  1.00 45.41  ? 608 ILE A CA  1 
ATOM   4604  C  C   . ILE A  1 608 ? 37.991 98.550  79.537  1.00 49.56  ? 608 ILE A C   1 
ATOM   4605  O  O   . ILE A  1 608 ? 37.886 97.442  80.058  1.00 49.21  ? 608 ILE A O   1 
ATOM   4606  C  CB  . ILE A  1 608 ? 38.927 100.569 80.851  1.00 48.79  ? 608 ILE A CB  1 
ATOM   4607  C  CG1 . ILE A  1 608 ? 40.227 101.109 81.477  1.00 49.31  ? 608 ILE A CG1 1 
ATOM   4608  C  CG2 . ILE A  1 608 ? 37.928 100.160 81.949  1.00 49.99  ? 608 ILE A CG2 1 
ATOM   4609  C  CD1 . ILE A  1 608 ? 40.161 102.559 81.932  1.00 55.03  ? 608 ILE A CD1 1 
ATOM   4610  N  N   . LEU A  1 609 ? 37.083 99.050  78.668  1.00 46.33  ? 609 LEU A N   1 
ATOM   4611  C  CA  . LEU A  1 609 ? 35.853 98.363  78.251  1.00 45.87  ? 609 LEU A CA  1 
ATOM   4612  C  C   . LEU A  1 609 ? 36.173 97.026  77.565  1.00 49.77  ? 609 LEU A C   1 
ATOM   4613  O  O   . LEU A  1 609 ? 35.516 96.029  77.862  1.00 49.65  ? 609 LEU A O   1 
ATOM   4614  C  CB  . LEU A  1 609 ? 35.017 99.271  77.323  1.00 45.51  ? 609 LEU A CB  1 
ATOM   4615  C  CG  . LEU A  1 609 ? 33.657 98.758  76.833  1.00 49.69  ? 609 LEU A CG  1 
ATOM   4616  C  CD1 . LEU A  1 609 ? 32.681 98.548  77.987  1.00 50.18  ? 609 LEU A CD1 1 
ATOM   4617  C  CD2 . LEU A  1 609 ? 33.052 99.720  75.829  1.00 52.04  ? 609 LEU A CD2 1 
ATOM   4618  N  N   . ALA A  1 610 ? 37.197 97.003  76.685  1.00 45.92  ? 610 ALA A N   1 
ATOM   4619  C  CA  . ALA A  1 610 ? 37.646 95.800  75.981  1.00 45.23  ? 610 ALA A CA  1 
ATOM   4620  C  C   . ALA A  1 610 ? 38.280 94.805  76.952  1.00 50.38  ? 610 ALA A C   1 
ATOM   4621  O  O   . ALA A  1 610 ? 38.116 93.598  76.782  1.00 50.13  ? 610 ALA A O   1 
ATOM   4622  C  CB  . ALA A  1 610 ? 38.635 96.170  74.893  1.00 45.48  ? 610 ALA A CB  1 
ATOM   4623  N  N   . PHE A  1 611 ? 38.994 95.315  77.972  1.00 48.22  ? 611 PHE A N   1 
ATOM   4624  C  CA  . PHE A  1 611 ? 39.640 94.511  79.009  1.00 49.13  ? 611 PHE A CA  1 
ATOM   4625  C  C   . PHE A  1 611 ? 38.594 93.911  79.956  1.00 52.66  ? 611 PHE A C   1 
ATOM   4626  O  O   . PHE A  1 611 ? 38.756 92.771  80.390  1.00 52.79  ? 611 PHE A O   1 
ATOM   4627  C  CB  . PHE A  1 611 ? 40.649 95.367  79.798  1.00 52.24  ? 611 PHE A CB  1 
ATOM   4628  C  CG  . PHE A  1 611 ? 41.488 94.613  80.805  1.00 55.47  ? 611 PHE A CG  1 
ATOM   4629  C  CD1 . PHE A  1 611 ? 41.057 94.459  82.119  1.00 60.12  ? 611 PHE A CD1 1 
ATOM   4630  C  CD2 . PHE A  1 611 ? 42.723 94.083  80.448  1.00 58.30  ? 611 PHE A CD2 1 
ATOM   4631  C  CE1 . PHE A  1 611 ? 41.834 93.762  83.050  1.00 62.20  ? 611 PHE A CE1 1 
ATOM   4632  C  CE2 . PHE A  1 611 ? 43.504 93.391  81.382  1.00 62.09  ? 611 PHE A CE2 1 
ATOM   4633  C  CZ  . PHE A  1 611 ? 43.054 93.234  82.676  1.00 61.21  ? 611 PHE A CZ  1 
ATOM   4634  N  N   . ALA A  1 612 ? 37.547 94.692  80.295  1.00 48.26  ? 612 ALA A N   1 
ATOM   4635  C  CA  . ALA A  1 612 ? 36.467 94.294  81.196  1.00 48.04  ? 612 ALA A CA  1 
ATOM   4636  C  C   . ALA A  1 612 ? 35.592 93.207  80.583  1.00 50.25  ? 612 ALA A C   1 
ATOM   4637  O  O   . ALA A  1 612 ? 35.166 92.311  81.313  1.00 51.22  ? 612 ALA A O   1 
ATOM   4638  C  CB  . ALA A  1 612 ? 35.618 95.496  81.567  1.00 49.11  ? 612 ALA A CB  1 
ATOM   4639  N  N   . ILE A  1 613 ? 35.325 93.271  79.260  1.00 43.67  ? 613 ILE A N   1 
ATOM   4640  C  CA  . ILE A  1 613 ? 34.513 92.259  78.580  1.00 42.24  ? 613 ILE A CA  1 
ATOM   4641  C  C   . ILE A  1 613 ? 35.388 91.016  78.317  1.00 46.02  ? 613 ILE A C   1 
ATOM   4642  O  O   . ILE A  1 613 ? 36.367 91.122  77.572  1.00 44.71  ? 613 ILE A O   1 
ATOM   4643  C  CB  . ILE A  1 613 ? 33.840 92.793  77.283  1.00 44.13  ? 613 ILE A CB  1 
ATOM   4644  C  CG1 . ILE A  1 613 ? 32.886 93.974  77.593  1.00 44.61  ? 613 ILE A CG1 1 
ATOM   4645  C  CG2 . ILE A  1 613 ? 33.094 91.661  76.550  1.00 44.03  ? 613 ILE A CG2 1 
ATOM   4646  C  CD1 . ILE A  1 613 ? 32.634 94.950  76.418  1.00 49.63  ? 613 ILE A CD1 1 
ATOM   4647  N  N   . PRO A  1 614 ? 35.058 89.840  78.918  1.00 43.65  ? 614 PRO A N   1 
ATOM   4648  C  CA  . PRO A  1 614 ? 35.870 88.630  78.671  1.00 43.30  ? 614 PRO A CA  1 
ATOM   4649  C  C   . PRO A  1 614 ? 35.645 88.085  77.263  1.00 46.12  ? 614 PRO A C   1 
ATOM   4650  O  O   . PRO A  1 614 ? 34.502 87.980  76.819  1.00 45.62  ? 614 PRO A O   1 
ATOM   4651  C  CB  . PRO A  1 614 ? 35.392 87.638  79.745  1.00 45.82  ? 614 PRO A CB  1 
ATOM   4652  C  CG  . PRO A  1 614 ? 34.454 88.403  80.626  1.00 50.99  ? 614 PRO A CG  1 
ATOM   4653  C  CD  . PRO A  1 614 ? 33.932 89.541  79.822  1.00 45.93  ? 614 PRO A CD  1 
ATOM   4654  N  N   . ASP A  1 615 ? 36.744 87.741  76.566  1.00 41.97  ? 615 ASP A N   1 
ATOM   4655  C  CA  . ASP A  1 615 ? 36.748 87.241  75.187  1.00 41.21  ? 615 ASP A CA  1 
ATOM   4656  C  C   . ASP A  1 615 ? 36.017 85.887  75.020  1.00 46.34  ? 615 ASP A C   1 
ATOM   4657  O  O   . ASP A  1 615 ? 35.667 85.525  73.895  1.00 45.86  ? 615 ASP A O   1 
ATOM   4658  C  CB  . ASP A  1 615 ? 38.194 87.130  74.668  1.00 42.34  ? 615 ASP A CB  1 
ATOM   4659  C  CG  . ASP A  1 615 ? 38.980 88.436  74.653  1.00 47.87  ? 615 ASP A CG  1 
ATOM   4660  O  OD1 . ASP A  1 615 ? 38.347 89.515  74.635  1.00 48.59  ? 615 ASP A OD1 1 
ATOM   4661  O  OD2 . ASP A  1 615 ? 40.224 88.376  74.633  1.00 50.40  ? 615 ASP A OD2 1 
ATOM   4662  N  N   . LYS A  1 616 ? 35.782 85.158  76.129  1.00 43.73  ? 616 LYS A N   1 
ATOM   4663  C  CA  . LYS A  1 616 ? 35.081 83.871  76.139  1.00 43.88  ? 616 LYS A CA  1 
ATOM   4664  C  C   . LYS A  1 616 ? 33.974 83.863  77.205  1.00 49.20  ? 616 LYS A C   1 
ATOM   4665  O  O   . LYS A  1 616 ? 34.196 84.408  78.291  1.00 49.92  ? 616 LYS A O   1 
ATOM   4666  C  CB  . LYS A  1 616 ? 36.068 82.720  76.399  1.00 46.47  ? 616 LYS A CB  1 
ATOM   4667  C  CG  . LYS A  1 616 ? 36.921 82.351  75.198  1.00 58.88  ? 616 LYS A CG  1 
ATOM   4668  C  CD  . LYS A  1 616 ? 38.148 81.551  75.610  1.00 66.41  ? 616 LYS A CD  1 
ATOM   4669  C  CE  . LYS A  1 616 ? 39.100 81.312  74.459  1.00 74.35  ? 616 LYS A CE  1 
ATOM   4670  N  NZ  . LYS A  1 616 ? 39.726 82.572  73.965  1.00 83.33  ? 616 LYS A NZ  1 
ATOM   4671  N  N   . PRO A  1 617 ? 32.794 83.242  76.950  1.00 45.69  ? 617 PRO A N   1 
ATOM   4672  C  CA  . PRO A  1 617 ? 31.741 83.211  77.983  1.00 46.58  ? 617 PRO A CA  1 
ATOM   4673  C  C   . PRO A  1 617 ? 32.109 82.280  79.140  1.00 53.11  ? 617 PRO A C   1 
ATOM   4674  O  O   . PRO A  1 617 ? 32.920 81.367  78.953  1.00 53.19  ? 617 PRO A O   1 
ATOM   4675  C  CB  . PRO A  1 617 ? 30.505 82.709  77.228  1.00 48.11  ? 617 PRO A CB  1 
ATOM   4676  C  CG  . PRO A  1 617 ? 30.871 82.747  75.778  1.00 51.75  ? 617 PRO A CG  1 
ATOM   4677  C  CD  . PRO A  1 617 ? 32.346 82.551  75.729  1.00 46.92  ? 617 PRO A CD  1 
ATOM   4678  N  N   . ARG A  1 618 ? 31.518 82.517  80.334  1.00 50.75  ? 618 ARG A N   1 
ATOM   4679  C  CA  . ARG A  1 618 ? 31.783 81.754  81.558  1.00 51.73  ? 618 ARG A CA  1 
ATOM   4680  C  C   . ARG A  1 618 ? 31.679 80.238  81.346  1.00 57.16  ? 618 ARG A C   1 
ATOM   4681  O  O   . ARG A  1 618 ? 32.627 79.537  81.695  1.00 56.85  ? 618 ARG A O   1 
ATOM   4682  C  CB  . ARG A  1 618 ? 30.850 82.189  82.701  1.00 52.29  ? 618 ARG A CB  1 
ATOM   4683  C  CG  . ARG A  1 618 ? 31.293 81.713  84.084  1.00 59.67  ? 618 ARG A CG  1 
ATOM   4684  N  N   . HIS A  1 619 ? 30.568 79.743  80.753  1.00 55.13  ? 619 HIS A N   1 
ATOM   4685  C  CA  . HIS A  1 619 ? 30.347 78.310  80.553  1.00 56.35  ? 619 HIS A CA  1 
ATOM   4686  C  C   . HIS A  1 619 ? 31.429 77.674  79.658  1.00 58.22  ? 619 HIS A C   1 
ATOM   4687  O  O   . HIS A  1 619 ? 31.833 76.548  79.940  1.00 58.32  ? 619 HIS A O   1 
ATOM   4688  C  CB  . HIS A  1 619 ? 28.929 78.016  80.023  1.00 58.38  ? 619 HIS A CB  1 
ATOM   4689  C  CG  . HIS A  1 619 ? 28.658 78.497  78.631  1.00 61.67  ? 619 HIS A CG  1 
ATOM   4690  N  ND1 . HIS A  1 619 ? 28.420 79.835  78.369  1.00 63.29  ? 619 HIS A ND1 1 
ATOM   4691  C  CD2 . HIS A  1 619 ? 28.553 77.799  77.472  1.00 63.46  ? 619 HIS A CD2 1 
ATOM   4692  C  CE1 . HIS A  1 619 ? 28.199 79.910  77.064  1.00 62.05  ? 619 HIS A CE1 1 
ATOM   4693  N  NE2 . HIS A  1 619 ? 28.274 78.709  76.483  1.00 62.42  ? 619 HIS A NE2 1 
ATOM   4694  N  N   . ILE A  1 620 ? 31.930 78.402  78.634  1.00 52.67  ? 620 ILE A N   1 
ATOM   4695  C  CA  . ILE A  1 620 ? 32.987 77.922  77.727  1.00 51.12  ? 620 ILE A CA  1 
ATOM   4696  C  C   . ILE A  1 620 ? 34.313 77.877  78.491  1.00 54.67  ? 620 ILE A C   1 
ATOM   4697  O  O   . ILE A  1 620 ? 35.060 76.907  78.357  1.00 53.91  ? 620 ILE A O   1 
ATOM   4698  C  CB  . ILE A  1 620 ? 33.079 78.785  76.430  1.00 52.70  ? 620 ILE A CB  1 
ATOM   4699  C  CG1 . ILE A  1 620 ? 31.753 78.782  75.627  1.00 52.90  ? 620 ILE A CG1 1 
ATOM   4700  C  CG2 . ILE A  1 620 ? 34.277 78.407  75.542  1.00 52.49  ? 620 ILE A CG2 1 
ATOM   4701  C  CD1 . ILE A  1 620 ? 31.225 77.400  75.046  1.00 61.01  ? 620 ILE A CD1 1 
ATOM   4702  N  N   . GLN A  1 621 ? 34.576 78.912  79.317  1.00 51.57  ? 621 GLN A N   1 
ATOM   4703  C  CA  . GLN A  1 621 ? 35.782 79.026  80.138  1.00 51.78  ? 621 GLN A CA  1 
ATOM   4704  C  C   . GLN A  1 621 ? 35.881 77.862  81.129  1.00 57.47  ? 621 GLN A C   1 
ATOM   4705  O  O   . GLN A  1 621 ? 36.971 77.316  81.293  1.00 56.95  ? 621 GLN A O   1 
ATOM   4706  C  CB  . GLN A  1 621 ? 35.821 80.371  80.874  1.00 53.13  ? 621 GLN A CB  1 
ATOM   4707  C  CG  . GLN A  1 621 ? 36.261 81.530  79.985  1.00 68.71  ? 621 GLN A CG  1 
ATOM   4708  C  CD  . GLN A  1 621 ? 35.962 82.903  80.552  1.00 89.35  ? 621 GLN A CD  1 
ATOM   4709  O  OE1 . GLN A  1 621 ? 34.912 83.151  81.162  1.00 84.68  ? 621 GLN A OE1 1 
ATOM   4710  N  NE2 . GLN A  1 621 ? 36.846 83.855  80.285  1.00 81.62  ? 621 GLN A NE2 1 
ATOM   4711  N  N   . MET A  1 622 ? 34.741 77.456  81.743  1.00 55.66  ? 622 MET A N   1 
ATOM   4712  C  CA  . MET A  1 622 ? 34.661 76.340  82.695  1.00 57.35  ? 622 MET A CA  1 
ATOM   4713  C  C   . MET A  1 622 ? 34.864 74.998  81.982  1.00 60.60  ? 622 MET A C   1 
ATOM   4714  O  O   . MET A  1 622 ? 35.566 74.131  82.507  1.00 60.84  ? 622 MET A O   1 
ATOM   4715  C  CB  . MET A  1 622 ? 33.317 76.333  83.453  1.00 61.18  ? 622 MET A CB  1 
ATOM   4716  C  CG  . MET A  1 622 ? 33.031 77.603  84.241  1.00 66.19  ? 622 MET A CG  1 
ATOM   4717  S  SD  . MET A  1 622 ? 34.151 77.907  85.632  1.00 72.45  ? 622 MET A SD  1 
ATOM   4718  C  CE  . MET A  1 622 ? 34.073 79.698  85.719  1.00 68.64  ? 622 MET A CE  1 
ATOM   4719  N  N   . LYS A  1 623 ? 34.251 74.834  80.785  1.00 55.79  ? 623 LYS A N   1 
ATOM   4720  C  CA  . LYS A  1 623 ? 34.347 73.626  79.956  1.00 55.19  ? 623 LYS A CA  1 
ATOM   4721  C  C   . LYS A  1 623 ? 35.780 73.424  79.470  1.00 58.60  ? 623 LYS A C   1 
ATOM   4722  O  O   . LYS A  1 623 ? 36.255 72.288  79.434  1.00 58.94  ? 623 LYS A O   1 
ATOM   4723  C  CB  . LYS A  1 623 ? 33.370 73.694  78.773  1.00 56.62  ? 623 LYS A CB  1 
ATOM   4724  C  CG  . LYS A  1 623 ? 31.923 73.394  79.171  1.00 69.92  ? 623 LYS A CG  1 
ATOM   4725  C  CD  . LYS A  1 623 ? 30.932 73.825  78.099  1.00 79.31  ? 623 LYS A CD  1 
ATOM   4726  C  CE  . LYS A  1 623 ? 29.482 73.723  78.526  1.00 88.68  ? 623 LYS A CE  1 
ATOM   4727  N  NZ  . LYS A  1 623 ? 28.968 75.008  79.050  1.00 93.39  ? 623 LYS A NZ  1 
ATOM   4728  N  N   . LEU A  1 624 ? 36.475 74.531  79.146  1.00 53.89  ? 624 LEU A N   1 
ATOM   4729  C  CA  . LEU A  1 624 ? 37.872 74.539  78.718  1.00 53.10  ? 624 LEU A CA  1 
ATOM   4730  C  C   . LEU A  1 624 ? 38.807 74.290  79.912  1.00 59.54  ? 624 LEU A C   1 
ATOM   4731  O  O   . LEU A  1 624 ? 39.876 73.708  79.733  1.00 58.81  ? 624 LEU A O   1 
ATOM   4732  C  CB  . LEU A  1 624 ? 38.200 75.884  78.050  1.00 51.58  ? 624 LEU A CB  1 
ATOM   4733  C  CG  . LEU A  1 624 ? 38.304 75.912  76.524  1.00 54.14  ? 624 LEU A CG  1 
ATOM   4734  C  CD1 . LEU A  1 624 ? 36.971 75.627  75.848  1.00 53.96  ? 624 LEU A CD1 1 
ATOM   4735  C  CD2 . LEU A  1 624 ? 38.816 77.248  76.055  1.00 54.75  ? 624 LEU A CD2 1 
ATOM   4736  N  N   . ALA A  1 625 ? 38.396 74.724  81.124  1.00 58.70  ? 625 ALA A N   1 
ATOM   4737  C  CA  . ALA A  1 625 ? 39.159 74.562  82.364  1.00 60.41  ? 625 ALA A CA  1 
ATOM   4738  C  C   . ALA A  1 625 ? 39.153 73.117  82.850  1.00 67.30  ? 625 ALA A C   1 
ATOM   4739  O  O   . ALA A  1 625 ? 40.223 72.605  83.178  1.00 67.89  ? 625 ALA A O   1 
ATOM   4740  C  CB  . ALA A  1 625 ? 38.612 75.473  83.452  1.00 61.64  ? 625 ALA A CB  1 
ATOM   4741  N  N   . ARG A  1 626 ? 37.965 72.456  82.901  1.00 65.17  ? 626 ARG A N   1 
ATOM   4742  C  CA  . ARG A  1 626 ? 37.846 71.067  83.371  1.00 66.69  ? 626 ARG A CA  1 
ATOM   4743  C  C   . ARG A  1 626 ? 38.597 70.105  82.446  1.00 69.95  ? 626 ARG A C   1 
ATOM   4744  O  O   . ARG A  1 626 ? 39.119 69.097  82.920  1.00 70.21  ? 626 ARG A O   1 
ATOM   4745  C  CB  . ARG A  1 626 ? 36.377 70.626  83.572  1.00 68.79  ? 626 ARG A CB  1 
ATOM   4746  C  CG  . ARG A  1 626 ? 35.528 70.477  82.304  1.00 80.38  ? 626 ARG A CG  1 
ATOM   4747  C  CD  . ARG A  1 626 ? 34.080 70.168  82.638  1.00 88.47  ? 626 ARG A CD  1 
ATOM   4748  N  NE  . ARG A  1 626 ? 33.355 71.374  83.049  1.00 91.44  ? 626 ARG A NE  1 
ATOM   4749  C  CZ  . ARG A  1 626 ? 32.194 71.371  83.695  1.00 104.36 ? 626 ARG A CZ  1 
ATOM   4750  N  NH1 . ARG A  1 626 ? 31.609 70.226  84.022  1.00 94.18  ? 626 ARG A NH1 1 
ATOM   4751  N  NH2 . ARG A  1 626 ? 31.609 72.515  84.021  1.00 89.14  ? 626 ARG A NH2 1 
ATOM   4752  N  N   . LEU A  1 627 ? 38.680 70.436  81.145  1.00 65.49  ? 627 LEU A N   1 
ATOM   4753  C  CA  . LEU A  1 627 ? 39.410 69.626  80.181  1.00 65.25  ? 627 LEU A CA  1 
ATOM   4754  C  C   . LEU A  1 627 ? 40.916 69.867  80.331  1.00 69.33  ? 627 LEU A C   1 
ATOM   4755  O  O   . LEU A  1 627 ? 41.693 68.928  80.136  1.00 69.88  ? 627 LEU A O   1 
ATOM   4756  C  CB  . LEU A  1 627 ? 38.927 69.889  78.752  1.00 64.04  ? 627 LEU A CB  1 
ATOM   4757  C  CG  . LEU A  1 627 ? 37.962 68.825  78.215  1.00 69.28  ? 627 LEU A CG  1 
ATOM   4758  C  CD1 . LEU A  1 627 ? 36.507 69.172  78.517  1.00 69.74  ? 627 LEU A CD1 1 
ATOM   4759  C  CD2 . LEU A  1 627 ? 38.151 68.622  76.741  1.00 70.87  ? 627 LEU A CD2 1 
ATOM   4760  N  N   . GLU A  1 628 ? 41.322 71.098  80.736  1.00 64.82  ? 628 GLU A N   1 
ATOM   4761  C  CA  . GLU A  1 628 ? 42.723 71.448  80.997  1.00 64.35  ? 628 GLU A CA  1 
ATOM   4762  C  C   . GLU A  1 628 ? 43.206 70.686  82.233  1.00 68.77  ? 628 GLU A C   1 
ATOM   4763  O  O   . GLU A  1 628 ? 44.318 70.160  82.229  1.00 68.36  ? 628 GLU A O   1 
ATOM   4764  C  CB  . GLU A  1 628 ? 42.894 72.968  81.186  1.00 65.09  ? 628 GLU A CB  1 
ATOM   4765  C  CG  . GLU A  1 628 ? 44.346 73.427  81.197  1.00 75.02  ? 628 GLU A CG  1 
ATOM   4766  C  CD  . GLU A  1 628 ? 44.611 74.869  81.590  1.00 90.31  ? 628 GLU A CD  1 
ATOM   4767  O  OE1 . GLU A  1 628 ? 43.770 75.748  81.291  1.00 83.23  ? 628 GLU A OE1 1 
ATOM   4768  O  OE2 . GLU A  1 628 ? 45.697 75.126  82.158  1.00 79.60  ? 628 GLU A OE2 1 
ATOM   4769  N  N   . PHE A  1 629 ? 42.341 70.606  83.270  1.00 66.17  ? 629 PHE A N   1 
ATOM   4770  C  CA  . PHE A  1 629 ? 42.589 69.903  84.528  1.00 67.59  ? 629 PHE A CA  1 
ATOM   4771  C  C   . PHE A  1 629 ? 42.718 68.401  84.288  1.00 72.72  ? 629 PHE A C   1 
ATOM   4772  O  O   . PHE A  1 629 ? 43.591 67.771  84.885  1.00 73.51  ? 629 PHE A O   1 
ATOM   4773  C  CB  . PHE A  1 629 ? 41.467 70.192  85.545  1.00 69.96  ? 629 PHE A CB  1 
ATOM   4774  C  CG  . PHE A  1 629 ? 41.611 69.466  86.864  1.00 73.42  ? 629 PHE A CG  1 
ATOM   4775  C  CD1 . PHE A  1 629 ? 42.533 69.892  87.817  1.00 77.40  ? 629 PHE A CD1 1 
ATOM   4776  C  CD2 . PHE A  1 629 ? 40.821 68.359  87.157  1.00 76.40  ? 629 PHE A CD2 1 
ATOM   4777  C  CE1 . PHE A  1 629 ? 42.672 69.213  89.032  1.00 79.98  ? 629 PHE A CE1 1 
ATOM   4778  C  CE2 . PHE A  1 629 ? 40.957 67.686  88.377  1.00 80.91  ? 629 PHE A CE2 1 
ATOM   4779  C  CZ  . PHE A  1 629 ? 41.882 68.117  89.304  1.00 79.90  ? 629 PHE A CZ  1 
ATOM   4780  N  N   . GLU A  1 630 ? 41.849 67.838  83.417  1.00 69.10  ? 630 GLU A N   1 
ATOM   4781  C  CA  . GLU A  1 630 ? 41.823 66.419  83.056  1.00 69.60  ? 630 GLU A CA  1 
ATOM   4782  C  C   . GLU A  1 630 ? 43.131 65.985  82.396  1.00 72.70  ? 630 GLU A C   1 
ATOM   4783  O  O   . GLU A  1 630 ? 43.620 64.897  82.697  1.00 73.10  ? 630 GLU A O   1 
ATOM   4784  C  CB  . GLU A  1 630 ? 40.638 66.117  82.129  1.00 70.36  ? 630 GLU A CB  1 
ATOM   4785  C  CG  . GLU A  1 630 ? 39.361 65.770  82.873  1.00 84.82  ? 630 GLU A CG  1 
ATOM   4786  C  CD  . GLU A  1 630 ? 38.078 65.752  82.059  1.00 113.57 ? 630 GLU A CD  1 
ATOM   4787  O  OE1 . GLU A  1 630 ? 38.144 65.775  80.807  1.00 107.80 ? 630 GLU A OE1 1 
ATOM   4788  O  OE2 . GLU A  1 630 ? 36.995 65.703  82.686  1.00 114.45 ? 630 GLU A OE2 1 
ATOM   4789  N  N   . SER A  1 631 ? 43.702 66.845  81.522  1.00 67.94  ? 631 SER A N   1 
ATOM   4790  C  CA  . SER A  1 631 ? 44.961 66.605  80.811  1.00 67.68  ? 631 SER A CA  1 
ATOM   4791  C  C   . SER A  1 631 ? 46.144 66.505  81.779  1.00 73.55  ? 631 SER A C   1 
ATOM   4792  O  O   . SER A  1 631 ? 47.044 65.691  81.560  1.00 73.70  ? 631 SER A O   1 
ATOM   4793  C  CB  . SER A  1 631 ? 45.215 67.710  79.792  1.00 69.64  ? 631 SER A CB  1 
ATOM   4794  O  OG  . SER A  1 631 ? 44.179 67.752  78.824  1.00 78.05  ? 631 SER A OG  1 
ATOM   4795  N  N   . LEU A  1 632 ? 46.131 67.322  82.852  1.00 71.30  ? 632 LEU A N   1 
ATOM   4796  C  CA  . LEU A  1 632 ? 47.174 67.335  83.882  1.00 72.66  ? 632 LEU A CA  1 
ATOM   4797  C  C   . LEU A  1 632 ? 47.075 66.091  84.758  1.00 77.09  ? 632 LEU A C   1 
ATOM   4798  O  O   . LEU A  1 632 ? 48.106 65.510  85.103  1.00 77.83  ? 632 LEU A O   1 
ATOM   4799  C  CB  . LEU A  1 632 ? 47.093 68.602  84.751  1.00 73.09  ? 632 LEU A CB  1 
ATOM   4800  C  CG  . LEU A  1 632 ? 47.108 69.947  84.020  1.00 76.92  ? 632 LEU A CG  1 
ATOM   4801  C  CD1 . LEU A  1 632 ? 46.486 71.017  84.873  1.00 77.50  ? 632 LEU A CD1 1 
ATOM   4802  C  CD2 . LEU A  1 632 ? 48.515 70.340  83.570  1.00 79.72  ? 632 LEU A CD2 1 
ATOM   4803  N  N   . GLU A  1 633 ? 45.836 65.677  85.108  1.00 72.96  ? 633 GLU A N   1 
ATOM   4804  C  CA  . GLU A  1 633 ? 45.571 64.479  85.911  1.00 74.10  ? 633 GLU A CA  1 
ATOM   4805  C  C   . GLU A  1 633 ? 45.930 63.223  85.115  1.00 77.84  ? 633 GLU A C   1 
ATOM   4806  O  O   . GLU A  1 633 ? 46.358 62.234  85.706  1.00 78.69  ? 633 GLU A O   1 
ATOM   4807  C  CB  . GLU A  1 633 ? 44.107 64.428  86.380  1.00 75.66  ? 633 GLU A CB  1 
ATOM   4808  C  CG  . GLU A  1 633 ? 43.731 65.499  87.396  1.00 85.97  ? 633 GLU A CG  1 
ATOM   4809  C  CD  . GLU A  1 633 ? 44.527 65.534  88.688  1.00 105.58 ? 633 GLU A CD  1 
ATOM   4810  O  OE1 . GLU A  1 633 ? 44.588 64.495  89.384  1.00 102.03 ? 633 GLU A OE1 1 
ATOM   4811  O  OE2 . GLU A  1 633 ? 45.070 66.613  89.018  1.00 95.80  ? 633 GLU A OE2 1 
ATOM   4812  N  N   . ALA A  1 634 ? 45.783 63.285  83.771  1.00 73.07  ? 634 ALA A N   1 
ATOM   4813  C  CA  . ALA A  1 634 ? 46.137 62.217  82.837  1.00 72.90  ? 634 ALA A CA  1 
ATOM   4814  C  C   . ALA A  1 634 ? 47.658 62.046  82.772  1.00 77.45  ? 634 ALA A C   1 
ATOM   4815  O  O   . ALA A  1 634 ? 48.138 60.911  82.772  1.00 78.27  ? 634 ALA A O   1 
ATOM   4816  C  CB  . ALA A  1 634 ? 45.585 62.527  81.454  1.00 71.87  ? 634 ALA A CB  1 
ATOM   4817  N  N   . LEU A  1 635 ? 48.410 63.176  82.744  1.00 73.05  ? 635 LEU A N   1 
ATOM   4818  C  CA  . LEU A  1 635 ? 49.876 63.206  82.696  1.00 73.05  ? 635 LEU A CA  1 
ATOM   4819  C  C   . LEU A  1 635 ? 50.483 62.646  83.988  1.00 78.24  ? 635 LEU A C   1 
ATOM   4820  O  O   . LEU A  1 635 ? 51.528 62.001  83.927  1.00 78.88  ? 635 LEU A O   1 
ATOM   4821  C  CB  . LEU A  1 635 ? 50.391 64.633  82.429  1.00 71.98  ? 635 LEU A CB  1 
ATOM   4822  C  CG  . LEU A  1 635 ? 51.868 64.775  82.014  1.00 76.76  ? 635 LEU A CG  1 
ATOM   4823  C  CD1 . LEU A  1 635 ? 52.098 64.317  80.581  1.00 75.70  ? 635 LEU A CD1 1 
ATOM   4824  C  CD2 . LEU A  1 635 ? 52.337 66.204  82.168  1.00 78.98  ? 635 LEU A CD2 1 
ATOM   4825  N  N   . LYS A  1 636 ? 49.823 62.876  85.140  1.00 74.94  ? 636 LYS A N   1 
ATOM   4826  C  CA  . LYS A  1 636 ? 50.259 62.371  86.445  1.00 76.57  ? 636 LYS A CA  1 
ATOM   4827  C  C   . LYS A  1 636 ? 50.080 60.849  86.514  1.00 81.50  ? 636 LYS A C   1 
ATOM   4828  O  O   . LYS A  1 636 ? 50.947 60.158  87.051  1.00 82.14  ? 636 LYS A O   1 
ATOM   4829  C  CB  . LYS A  1 636 ? 49.491 63.060  87.590  1.00 79.38  ? 636 LYS A CB  1 
ATOM   4830  C  CG  . LYS A  1 636 ? 49.963 64.480  87.895  1.00 88.64  ? 636 LYS A CG  1 
ATOM   4831  C  CD  . LYS A  1 636 ? 49.195 65.099  89.071  1.00 97.25  ? 636 LYS A CD  1 
ATOM   4832  C  CE  . LYS A  1 636 ? 49.888 64.956  90.404  1.00 111.67 ? 636 LYS A CE  1 
ATOM   4833  N  NZ  . LYS A  1 636 ? 49.100 65.581  91.500  1.00 121.57 ? 636 LYS A NZ  1 
ATOM   4834  N  N   . GLN A  1 637 ? 48.969 60.336  85.942  1.00 78.29  ? 637 GLN A N   1 
ATOM   4835  C  CA  . GLN A  1 637 ? 48.641 58.907  85.888  1.00 79.78  ? 637 GLN A CA  1 
ATOM   4836  C  C   . GLN A  1 637 ? 49.580 58.160  84.929  1.00 85.08  ? 637 GLN A C   1 
ATOM   4837  O  O   . GLN A  1 637 ? 50.016 57.050  85.247  1.00 86.72  ? 637 GLN A O   1 
ATOM   4838  C  CB  . GLN A  1 637 ? 47.173 58.692  85.461  1.00 80.36  ? 637 GLN A CB  1 
ATOM   4839  C  CG  . GLN A  1 637 ? 46.131 59.008  86.540  1.00 98.72  ? 637 GLN A CG  1 
ATOM   4840  C  CD  . GLN A  1 637 ? 46.011 57.941  87.602  1.00 124.62 ? 637 GLN A CD  1 
ATOM   4841  O  OE1 . GLN A  1 637 ? 45.736 56.766  87.321  1.00 121.05 ? 637 GLN A OE1 1 
ATOM   4842  N  NE2 . GLN A  1 637 ? 46.166 58.341  88.856  1.00 120.63 ? 637 GLN A NE2 1 
ATOM   4843  N  N   . GLN A  1 638 ? 49.889 58.774  83.764  1.00 80.15  ? 638 GLN A N   1 
ATOM   4844  C  CA  . GLN A  1 638 ? 50.756 58.204  82.727  1.00 79.61  ? 638 GLN A CA  1 
ATOM   4845  C  C   . GLN A  1 638 ? 52.229 58.134  83.163  1.00 84.64  ? 638 GLN A C   1 
ATOM   4846  O  O   . GLN A  1 638 ? 52.893 57.141  82.853  1.00 85.30  ? 638 GLN A O   1 
ATOM   4847  C  CB  . GLN A  1 638 ? 50.634 58.993  81.415  1.00 78.70  ? 638 GLN A CB  1 
ATOM   4848  C  CG  . GLN A  1 638 ? 49.357 58.694  80.628  1.00 90.81  ? 638 GLN A CG  1 
ATOM   4849  C  CD  . GLN A  1 638 ? 49.357 57.352  79.941  1.00 111.22 ? 638 GLN A CD  1 
ATOM   4850  O  OE1 . GLN A  1 638 ? 48.619 56.437  80.320  1.00 107.42 ? 638 GLN A OE1 1 
ATOM   4851  N  NE2 . GLN A  1 638 ? 50.159 57.214  78.893  1.00 103.71 ? 638 GLN A NE2 1 
ATOM   4852  N  N   . GLN A  1 639 ? 52.738 59.171  83.869  1.00 80.73  ? 639 GLN A N   1 
ATOM   4853  C  CA  . GLN A  1 639 ? 54.128 59.207  84.336  1.00 102.81 ? 639 GLN A CA  1 
ATOM   4854  C  C   . GLN A  1 639 ? 54.310 58.274  85.540  1.00 125.53 ? 639 GLN A C   1 
ATOM   4855  O  O   . GLN A  1 639 ? 54.471 57.067  85.374  1.00 82.73  ? 639 GLN A O   1 
ATOM   4856  C  CB  . GLN A  1 639 ? 54.582 60.648  84.670  1.00 103.47 ? 639 GLN A CB  1 
ATOM   4857  C  CG  . GLN A  1 639 ? 53.987 61.255  85.952  1.00 117.74 ? 639 GLN A CG  1 
ATOM   4858  C  CD  . GLN A  1 639 ? 54.521 62.634  86.262  1.00 133.49 ? 639 GLN A CD  1 
ATOM   4859  O  OE1 . GLN A  1 639 ? 54.435 63.567  85.453  1.00 127.81 ? 639 GLN A OE1 1 
ATOM   4860  N  NE2 . GLN A  1 639 ? 55.044 62.806  87.468  1.00 124.09 ? 639 GLN A NE2 1 
ATOM   4861  N  N   . SER B  1 14  ? 58.899 64.938  119.493 1.00 63.95  ? 14  SER B N   1 
ATOM   4862  C  CA  . SER B  1 14  ? 58.909 63.675  118.753 1.00 64.58  ? 14  SER B CA  1 
ATOM   4863  C  C   . SER B  1 14  ? 59.334 63.863  117.282 1.00 68.21  ? 14  SER B C   1 
ATOM   4864  O  O   . SER B  1 14  ? 59.780 62.905  116.646 1.00 69.00  ? 14  SER B O   1 
ATOM   4865  C  CB  . SER B  1 14  ? 57.531 63.019  118.810 1.00 68.02  ? 14  SER B CB  1 
ATOM   4866  N  N   . PHE B  1 15  ? 59.197 65.096  116.757 1.00 62.81  ? 15  PHE B N   1 
ATOM   4867  C  CA  . PHE B  1 15  ? 59.486 65.486  115.374 1.00 61.60  ? 15  PHE B CA  1 
ATOM   4868  C  C   . PHE B  1 15  ? 60.383 66.745  115.316 1.00 65.09  ? 15  PHE B C   1 
ATOM   4869  O  O   . PHE B  1 15  ? 61.038 67.082  116.309 1.00 65.50  ? 15  PHE B O   1 
ATOM   4870  C  CB  . PHE B  1 15  ? 58.152 65.738  114.625 1.00 62.58  ? 15  PHE B CB  1 
ATOM   4871  C  CG  . PHE B  1 15  ? 57.218 66.750  115.262 1.00 63.19  ? 15  PHE B CG  1 
ATOM   4872  C  CD1 . PHE B  1 15  ? 57.251 68.087  114.883 1.00 64.69  ? 15  PHE B CD1 1 
ATOM   4873  C  CD2 . PHE B  1 15  ? 56.288 66.360  116.220 1.00 65.72  ? 15  PHE B CD2 1 
ATOM   4874  C  CE1 . PHE B  1 15  ? 56.398 69.021  115.479 1.00 64.96  ? 15  PHE B CE1 1 
ATOM   4875  C  CE2 . PHE B  1 15  ? 55.432 67.295  116.811 1.00 67.74  ? 15  PHE B CE2 1 
ATOM   4876  C  CZ  . PHE B  1 15  ? 55.490 68.617  116.433 1.00 64.63  ? 15  PHE B CZ  1 
ATOM   4877  N  N   . THR B  1 16  ? 60.411 67.426  114.145 1.00 59.86  ? 16  THR B N   1 
ATOM   4878  C  CA  . THR B  1 16  ? 61.146 68.673  113.903 1.00 58.40  ? 16  THR B CA  1 
ATOM   4879  C  C   . THR B  1 16  ? 60.122 69.814  113.811 1.00 59.61  ? 16  THR B C   1 
ATOM   4880  O  O   . THR B  1 16  ? 59.241 69.761  112.951 1.00 59.33  ? 16  THR B O   1 
ATOM   4881  C  CB  . THR B  1 16  ? 62.043 68.580  112.657 1.00 67.17  ? 16  THR B CB  1 
ATOM   4882  O  OG1 . THR B  1 16  ? 61.303 67.992  111.588 1.00 69.80  ? 16  THR B OG1 1 
ATOM   4883  C  CG2 . THR B  1 16  ? 63.314 67.788  112.908 1.00 66.10  ? 16  THR B CG2 1 
ATOM   4884  N  N   . PRO B  1 17  ? 60.148 70.807  114.725 1.00 53.89  ? 17  PRO B N   1 
ATOM   4885  C  CA  . PRO B  1 17  ? 59.147 71.882  114.641 1.00 52.09  ? 17  PRO B CA  1 
ATOM   4886  C  C   . PRO B  1 17  ? 59.406 72.778  113.434 1.00 53.17  ? 17  PRO B C   1 
ATOM   4887  O  O   . PRO B  1 17  ? 60.564 73.080  113.134 1.00 53.26  ? 17  PRO B O   1 
ATOM   4888  C  CB  . PRO B  1 17  ? 59.296 72.626  115.970 1.00 54.00  ? 17  PRO B CB  1 
ATOM   4889  C  CG  . PRO B  1 17  ? 60.657 72.310  116.453 1.00 59.38  ? 17  PRO B CG  1 
ATOM   4890  C  CD  . PRO B  1 17  ? 61.103 71.022  115.833 1.00 55.75  ? 17  PRO B CD  1 
ATOM   4891  N  N   . LEU B  1 18  ? 58.334 73.154  112.714 1.00 46.79  ? 18  LEU B N   1 
ATOM   4892  C  CA  . LEU B  1 18  ? 58.429 73.984  111.509 1.00 44.66  ? 18  LEU B CA  1 
ATOM   4893  C  C   . LEU B  1 18  ? 57.551 75.235  111.586 1.00 46.79  ? 18  LEU B C   1 
ATOM   4894  O  O   . LEU B  1 18  ? 58.016 76.320  111.234 1.00 46.11  ? 18  LEU B O   1 
ATOM   4895  C  CB  . LEU B  1 18  ? 58.062 73.170  110.248 1.00 44.44  ? 18  LEU B CB  1 
ATOM   4896  C  CG  . LEU B  1 18  ? 58.997 72.018  109.873 1.00 49.14  ? 18  LEU B CG  1 
ATOM   4897  C  CD1 . LEU B  1 18  ? 58.374 71.134  108.833 1.00 49.34  ? 18  LEU B CD1 1 
ATOM   4898  C  CD2 . LEU B  1 18  ? 60.338 72.520  109.384 1.00 50.44  ? 18  LEU B CD2 1 
ATOM   4899  N  N   . VAL B  1 19  ? 56.286 75.081  112.015 1.00 42.18  ? 19  VAL B N   1 
ATOM   4900  C  CA  . VAL B  1 19  ? 55.311 76.169  112.120 1.00 40.77  ? 19  VAL B CA  1 
ATOM   4901  C  C   . VAL B  1 19  ? 54.883 76.315  113.593 1.00 43.78  ? 19  VAL B C   1 
ATOM   4902  O  O   . VAL B  1 19  ? 54.831 75.321  114.323 1.00 43.42  ? 19  VAL B O   1 
ATOM   4903  C  CB  . VAL B  1 19  ? 54.113 75.916  111.150 1.00 44.47  ? 19  VAL B CB  1 
ATOM   4904  C  CG1 . VAL B  1 19  ? 52.930 76.845  111.417 1.00 43.80  ? 19  VAL B CG1 1 
ATOM   4905  C  CG2 . VAL B  1 19  ? 54.557 76.034  109.695 1.00 43.90  ? 19  VAL B CG2 1 
ATOM   4906  N  N   . VAL B  1 20  ? 54.620 77.563  114.026 1.00 40.10  ? 20  VAL B N   1 
ATOM   4907  C  CA  . VAL B  1 20  ? 54.189 77.895  115.388 1.00 40.49  ? 20  VAL B CA  1 
ATOM   4908  C  C   . VAL B  1 20  ? 52.771 78.471  115.343 1.00 45.14  ? 20  VAL B C   1 
ATOM   4909  O  O   . VAL B  1 20  ? 52.477 79.312  114.492 1.00 44.32  ? 20  VAL B O   1 
ATOM   4910  C  CB  . VAL B  1 20  ? 55.180 78.869  116.096 1.00 43.89  ? 20  VAL B CB  1 
ATOM   4911  C  CG1 . VAL B  1 20  ? 54.661 79.319  117.460 1.00 43.82  ? 20  VAL B CG1 1 
ATOM   4912  C  CG2 . VAL B  1 20  ? 56.560 78.244  116.242 1.00 44.11  ? 20  VAL B CG2 1 
ATOM   4913  N  N   . ILE B  1 21  ? 51.903 78.011  116.264 1.00 42.66  ? 21  ILE B N   1 
ATOM   4914  C  CA  . ILE B  1 21  ? 50.531 78.493  116.420 1.00 42.79  ? 21  ILE B CA  1 
ATOM   4915  C  C   . ILE B  1 21  ? 50.421 79.130  117.811 1.00 47.22  ? 21  ILE B C   1 
ATOM   4916  O  O   . ILE B  1 21  ? 50.606 78.440  118.816 1.00 47.59  ? 21  ILE B O   1 
ATOM   4917  C  CB  . ILE B  1 21  ? 49.467 77.371  116.187 1.00 46.54  ? 21  ILE B CB  1 
ATOM   4918  C  CG1 . ILE B  1 21  ? 49.527 76.832  114.739 1.00 46.60  ? 21  ILE B CG1 1 
ATOM   4919  C  CG2 . ILE B  1 21  ? 48.048 77.867  116.533 1.00 47.59  ? 21  ILE B CG2 1 
ATOM   4920  C  CD1 . ILE B  1 21  ? 48.615 75.633  114.438 1.00 52.93  ? 21  ILE B CD1 1 
ATOM   4921  N  N   . GLU B  1 22  ? 50.144 80.442  117.870 1.00 43.38  ? 22  GLU B N   1 
ATOM   4922  C  CA  . GLU B  1 22  ? 49.996 81.124  119.154 1.00 43.64  ? 22  GLU B CA  1 
ATOM   4923  C  C   . GLU B  1 22  ? 48.516 81.375  119.433 1.00 48.03  ? 22  GLU B C   1 
ATOM   4924  O  O   . GLU B  1 22  ? 47.831 81.995  118.617 1.00 47.34  ? 22  GLU B O   1 
ATOM   4925  C  CB  . GLU B  1 22  ? 50.803 82.433  119.199 1.00 44.48  ? 22  GLU B CB  1 
ATOM   4926  C  CG  . GLU B  1 22  ? 50.888 83.026  120.596 1.00 52.87  ? 22  GLU B CG  1 
ATOM   4927  C  CD  . GLU B  1 22  ? 51.302 84.478  120.707 1.00 70.28  ? 22  GLU B CD  1 
ATOM   4928  O  OE1 . GLU B  1 22  ? 51.371 85.178  119.670 1.00 72.11  ? 22  GLU B OE1 1 
ATOM   4929  O  OE2 . GLU B  1 22  ? 51.544 84.923  121.851 1.00 62.99  ? 22  GLU B OE2 1 
ATOM   4930  N  N   . LEU B  1 23  ? 48.033 80.877  120.586 1.00 45.18  ? 23  LEU B N   1 
ATOM   4931  C  CA  . LEU B  1 23  ? 46.648 81.016  121.044 1.00 45.36  ? 23  LEU B CA  1 
ATOM   4932  C  C   . LEU B  1 23  ? 46.535 82.132  122.087 1.00 49.84  ? 23  LEU B C   1 
ATOM   4933  O  O   . LEU B  1 23  ? 47.509 82.393  122.796 1.00 49.09  ? 23  LEU B O   1 
ATOM   4934  C  CB  . LEU B  1 23  ? 46.152 79.684  121.629 1.00 46.15  ? 23  LEU B CB  1 
ATOM   4935  C  CG  . LEU B  1 23  ? 45.470 78.702  120.673 1.00 50.66  ? 23  LEU B CG  1 
ATOM   4936  C  CD1 . LEU B  1 23  ? 46.476 77.977  119.809 1.00 50.75  ? 23  LEU B CD1 1 
ATOM   4937  C  CD2 . LEU B  1 23  ? 44.718 77.654  121.446 1.00 53.45  ? 23  LEU B CD2 1 
ATOM   4938  N  N   . ALA B  1 24  ? 45.348 82.781  122.188 1.00 47.62  ? 24  ALA B N   1 
ATOM   4939  C  CA  . ALA B  1 24  ? 45.083 83.881  123.128 1.00 48.47  ? 24  ALA B CA  1 
ATOM   4940  C  C   . ALA B  1 24  ? 45.373 83.466  124.591 1.00 54.83  ? 24  ALA B C   1 
ATOM   4941  O  O   . ALA B  1 24  ? 45.333 82.276  124.911 1.00 54.65  ? 24  ALA B O   1 
ATOM   4942  C  CB  . ALA B  1 24  ? 43.653 84.376  122.977 1.00 49.45  ? 24  ALA B CB  1 
ATOM   4943  N  N   . GLN B  1 25  ? 45.706 84.454  125.450 1.00 52.88  ? 25  GLN B N   1 
ATOM   4944  C  CA  . GLN B  1 25  ? 46.124 84.308  126.851 1.00 54.07  ? 25  GLN B CA  1 
ATOM   4945  C  C   . GLN B  1 25  ? 45.401 83.205  127.655 1.00 60.15  ? 25  GLN B C   1 
ATOM   4946  O  O   . GLN B  1 25  ? 46.091 82.410  128.302 1.00 60.86  ? 25  GLN B O   1 
ATOM   4947  C  CB  . GLN B  1 25  ? 46.001 85.637  127.607 1.00 55.81  ? 25  GLN B CB  1 
ATOM   4948  C  CG  . GLN B  1 25  ? 47.142 85.857  128.601 1.00 75.54  ? 25  GLN B CG  1 
ATOM   4949  C  CD  . GLN B  1 25  ? 46.877 86.987  129.564 1.00 99.69  ? 25  GLN B CD  1 
ATOM   4950  O  OE1 . GLN B  1 25  ? 46.767 88.155  129.179 1.00 97.02  ? 25  GLN B OE1 1 
ATOM   4951  N  NE2 . GLN B  1 25  ? 46.809 86.668  130.850 1.00 92.28  ? 25  GLN B NE2 1 
ATOM   4952  N  N   . ASP B  1 26  ? 44.051 83.149  127.634 1.00 57.11  ? 26  ASP B N   1 
ATOM   4953  C  CA  . ASP B  1 26  ? 43.323 82.143  128.418 1.00 57.96  ? 26  ASP B CA  1 
ATOM   4954  C  C   . ASP B  1 26  ? 42.288 81.368  127.578 1.00 61.25  ? 26  ASP B C   1 
ATOM   4955  O  O   . ASP B  1 26  ? 41.092 81.393  127.890 1.00 61.35  ? 26  ASP B O   1 
ATOM   4956  C  CB  . ASP B  1 26  ? 42.651 82.803  129.638 1.00 60.95  ? 26  ASP B CB  1 
ATOM   4957  C  CG  . ASP B  1 26  ? 43.625 83.360  130.663 1.00 75.26  ? 26  ASP B CG  1 
ATOM   4958  O  OD1 . ASP B  1 26  ? 44.335 82.554  131.308 1.00 77.30  ? 26  ASP B OD1 1 
ATOM   4959  O  OD2 . ASP B  1 26  ? 43.649 84.600  130.848 1.00 80.51  ? 26  ASP B OD2 1 
ATOM   4960  N  N   . VAL B  1 27  ? 42.757 80.648  126.537 1.00 56.70  ? 27  VAL B N   1 
ATOM   4961  C  CA  . VAL B  1 27  ? 41.892 79.840  125.664 1.00 56.11  ? 27  VAL B CA  1 
ATOM   4962  C  C   . VAL B  1 27  ? 41.509 78.560  126.418 1.00 60.97  ? 27  VAL B C   1 
ATOM   4963  O  O   . VAL B  1 27  ? 42.371 77.938  127.045 1.00 61.02  ? 27  VAL B O   1 
ATOM   4964  C  CB  . VAL B  1 27  ? 42.531 79.544  124.274 1.00 58.77  ? 27  VAL B CB  1 
ATOM   4965  C  CG1 . VAL B  1 27  ? 41.705 78.546  123.473 1.00 58.76  ? 27  VAL B CG1 1 
ATOM   4966  C  CG2 . VAL B  1 27  ? 42.706 80.823  123.467 1.00 57.65  ? 27  VAL B CG2 1 
ATOM   4967  N  N   . LYS B  1 28  ? 40.210 78.192  126.370 1.00 57.82  ? 28  LYS B N   1 
ATOM   4968  C  CA  . LYS B  1 28  ? 39.640 77.004  127.020 1.00 58.51  ? 28  LYS B CA  1 
ATOM   4969  C  C   . LYS B  1 28  ? 40.299 75.724  126.509 1.00 62.46  ? 28  LYS B C   1 
ATOM   4970  O  O   . LYS B  1 28  ? 40.660 75.654  125.332 1.00 61.14  ? 28  LYS B O   1 
ATOM   4971  C  CB  . LYS B  1 28  ? 38.120 76.936  126.787 1.00 61.25  ? 28  LYS B CB  1 
ATOM   4972  C  CG  . LYS B  1 28  ? 37.338 78.089  127.408 1.00 71.02  ? 28  LYS B CG  1 
ATOM   4973  C  CD  . LYS B  1 28  ? 35.854 77.989  127.117 1.00 80.75  ? 28  LYS B CD  1 
ATOM   4974  C  CE  . LYS B  1 28  ? 35.089 79.115  127.761 1.00 92.21  ? 28  LYS B CE  1 
ATOM   4975  N  NZ  . LYS B  1 28  ? 33.623 78.952  127.592 1.00 103.53 ? 28  LYS B NZ  1 
ATOM   4976  N  N   . GLU B  1 29  ? 40.455 74.714  127.395 1.00 60.31  ? 29  GLU B N   1 
ATOM   4977  C  CA  . GLU B  1 29  ? 41.058 73.411  127.066 1.00 60.52  ? 29  GLU B CA  1 
ATOM   4978  C  C   . GLU B  1 29  ? 40.229 72.677  126.012 1.00 64.67  ? 29  GLU B C   1 
ATOM   4979  O  O   . GLU B  1 29  ? 40.793 71.974  125.173 1.00 63.73  ? 29  GLU B O   1 
ATOM   4980  C  CB  . GLU B  1 29  ? 41.219 72.530  128.320 1.00 63.04  ? 29  GLU B CB  1 
ATOM   4981  C  CG  . GLU B  1 29  ? 42.246 73.031  129.328 1.00 73.64  ? 29  GLU B CG  1 
ATOM   4982  C  CD  . GLU B  1 29  ? 43.670 73.198  128.833 1.00 94.64  ? 29  GLU B CD  1 
ATOM   4983  O  OE1 . GLU B  1 29  ? 44.181 72.283  128.146 1.00 91.94  ? 29  GLU B OE1 1 
ATOM   4984  O  OE2 . GLU B  1 29  ? 44.283 74.243  129.151 1.00 87.57  ? 29  GLU B OE2 1 
ATOM   4985  N  N   . GLU B  1 30  ? 38.893 72.874  126.056 1.00 62.18  ? 30  GLU B N   1 
ATOM   4986  C  CA  . GLU B  1 30  ? 37.885 72.342  125.134 1.00 62.55  ? 30  GLU B CA  1 
ATOM   4987  C  C   . GLU B  1 30  ? 38.212 72.767  123.692 1.00 66.51  ? 30  GLU B C   1 
ATOM   4988  O  O   . GLU B  1 30  ? 38.114 71.950  122.776 1.00 66.78  ? 30  GLU B O   1 
ATOM   4989  C  CB  . GLU B  1 30  ? 36.496 72.864  125.558 1.00 64.42  ? 30  GLU B CB  1 
ATOM   4990  C  CG  . GLU B  1 30  ? 35.313 72.315  124.775 1.00 73.36  ? 30  GLU B CG  1 
ATOM   4991  C  CD  . GLU B  1 30  ? 33.979 72.992  125.037 1.00 91.25  ? 30  GLU B CD  1 
ATOM   4992  O  OE1 . GLU B  1 30  ? 33.923 73.926  125.872 1.00 80.50  ? 30  GLU B OE1 1 
ATOM   4993  O  OE2 . GLU B  1 30  ? 32.982 72.585  124.398 1.00 85.92  ? 30  GLU B OE2 1 
ATOM   4994  N  N   . THR B  1 31  ? 38.621 74.041  123.512 1.00 61.87  ? 31  THR B N   1 
ATOM   4995  C  CA  . THR B  1 31  ? 38.999 74.639  122.231 1.00 60.34  ? 31  THR B CA  1 
ATOM   4996  C  C   . THR B  1 31  ? 40.348 74.071  121.774 1.00 63.86  ? 31  THR B C   1 
ATOM   4997  O  O   . THR B  1 31  ? 40.473 73.655  120.621 1.00 63.22  ? 31  THR B O   1 
ATOM   4998  C  CB  . THR B  1 31  ? 39.045 76.175  122.362 1.00 65.19  ? 31  THR B CB  1 
ATOM   4999  O  OG1 . THR B  1 31  ? 37.955 76.635  123.161 1.00 63.10  ? 31  THR B OG1 1 
ATOM   5000  C  CG2 . THR B  1 31  ? 39.055 76.888  121.016 1.00 62.24  ? 31  THR B CG2 1 
ATOM   5001  N  N   . LYS B  1 32  ? 41.340 74.042  122.697 1.00 60.53  ? 32  LYS B N   1 
ATOM   5002  C  CA  . LYS B  1 32  ? 42.709 73.559  122.486 1.00 60.09  ? 32  LYS B CA  1 
ATOM   5003  C  C   . LYS B  1 32  ? 42.746 72.116  121.976 1.00 66.05  ? 32  LYS B C   1 
ATOM   5004  O  O   . LYS B  1 32  ? 43.423 71.846  120.983 1.00 65.27  ? 32  LYS B O   1 
ATOM   5005  C  CB  . LYS B  1 32  ? 43.525 73.658  123.783 1.00 62.24  ? 32  LYS B CB  1 
ATOM   5006  C  CG  . LYS B  1 32  ? 43.898 75.068  124.195 1.00 68.28  ? 32  LYS B CG  1 
ATOM   5007  C  CD  . LYS B  1 32  ? 44.629 75.042  125.517 1.00 75.58  ? 32  LYS B CD  1 
ATOM   5008  C  CE  . LYS B  1 32  ? 45.158 76.394  125.891 1.00 85.39  ? 32  LYS B CE  1 
ATOM   5009  N  NZ  . LYS B  1 32  ? 45.923 76.344  127.162 1.00 95.76  ? 32  LYS B NZ  1 
ATOM   5010  N  N   . GLU B  1 33  ? 42.015 71.198  122.646 1.00 64.75  ? 33  GLU B N   1 
ATOM   5011  C  CA  . GLU B  1 33  ? 41.962 69.780  122.283 1.00 65.78  ? 33  GLU B CA  1 
ATOM   5012  C  C   . GLU B  1 33  ? 41.246 69.571  120.954 1.00 70.16  ? 33  GLU B C   1 
ATOM   5013  O  O   . GLU B  1 33  ? 41.617 68.667  120.203 1.00 70.36  ? 33  GLU B O   1 
ATOM   5014  C  CB  . GLU B  1 33  ? 41.297 68.940  123.387 1.00 68.61  ? 33  GLU B CB  1 
ATOM   5015  C  CG  . GLU B  1 33  ? 42.100 68.850  124.680 1.00 83.27  ? 33  GLU B CG  1 
ATOM   5016  C  CD  . GLU B  1 33  ? 43.559 68.447  124.553 1.00 112.60 ? 33  GLU B CD  1 
ATOM   5017  O  OE1 . GLU B  1 33  ? 43.833 67.331  124.055 1.00 109.77 ? 33  GLU B OE1 1 
ATOM   5018  O  OE2 . GLU B  1 33  ? 44.431 69.251  124.957 1.00 109.85 ? 33  GLU B OE2 1 
ATOM   5019  N  N   . TRP B  1 34  ? 40.240 70.416  120.655 1.00 66.34  ? 34  TRP B N   1 
ATOM   5020  C  CA  . TRP B  1 34  ? 39.480 70.356  119.406 1.00 66.01  ? 34  TRP B CA  1 
ATOM   5021  C  C   . TRP B  1 34  ? 40.370 70.769  118.234 1.00 67.46  ? 34  TRP B C   1 
ATOM   5022  O  O   . TRP B  1 34  ? 40.330 70.115  117.190 1.00 67.38  ? 34  TRP B O   1 
ATOM   5023  C  CB  . TRP B  1 34  ? 38.219 71.234  119.494 1.00 65.10  ? 34  TRP B CB  1 
ATOM   5024  C  CG  . TRP B  1 34  ? 37.563 71.515  118.174 1.00 65.89  ? 34  TRP B CG  1 
ATOM   5025  C  CD1 . TRP B  1 34  ? 36.738 70.687  117.472 1.00 69.51  ? 34  TRP B CD1 1 
ATOM   5026  C  CD2 . TRP B  1 34  ? 37.689 72.711  117.396 1.00 64.70  ? 34  TRP B CD2 1 
ATOM   5027  N  NE1 . TRP B  1 34  ? 36.337 71.294  116.306 1.00 68.45  ? 34  TRP B NE1 1 
ATOM   5028  C  CE2 . TRP B  1 34  ? 36.902 72.541  116.235 1.00 68.84  ? 34  TRP B CE2 1 
ATOM   5029  C  CE3 . TRP B  1 34  ? 38.382 73.921  117.573 1.00 64.99  ? 34  TRP B CE3 1 
ATOM   5030  C  CZ2 . TRP B  1 34  ? 36.788 73.534  115.255 1.00 67.35  ? 34  TRP B CZ2 1 
ATOM   5031  C  CZ3 . TRP B  1 34  ? 38.274 74.901  116.597 1.00 65.71  ? 34  TRP B CZ3 1 
ATOM   5032  C  CH2 . TRP B  1 34  ? 37.481 74.707  115.459 1.00 66.49  ? 34  TRP B CH2 1 
ATOM   5033  N  N   . LEU B  1 35  ? 41.173 71.841  118.417 1.00 61.58  ? 35  LEU B N   1 
ATOM   5034  C  CA  . LEU B  1 35  ? 42.113 72.355  117.418 1.00 59.61  ? 35  LEU B CA  1 
ATOM   5035  C  C   . LEU B  1 35  ? 43.217 71.321  117.168 1.00 61.88  ? 35  LEU B C   1 
ATOM   5036  O  O   . LEU B  1 35  ? 43.585 71.098  116.012 1.00 60.19  ? 35  LEU B O   1 
ATOM   5037  C  CB  . LEU B  1 35  ? 42.700 73.710  117.876 1.00 58.77  ? 35  LEU B CB  1 
ATOM   5038  C  CG  . LEU B  1 35  ? 43.789 74.364  117.005 1.00 62.28  ? 35  LEU B CG  1 
ATOM   5039  C  CD1 . LEU B  1 35  ? 43.263 74.746  115.629 1.00 61.84  ? 35  LEU B CD1 1 
ATOM   5040  C  CD2 . LEU B  1 35  ? 44.359 75.584  117.686 1.00 64.08  ? 35  LEU B CD2 1 
ATOM   5041  N  N   . LYS B  1 36  ? 43.706 70.668  118.253 1.00 58.44  ? 36  LYS B N   1 
ATOM   5042  C  CA  . LYS B  1 36  ? 44.735 69.625  118.223 1.00 58.29  ? 36  LYS B CA  1 
ATOM   5043  C  C   . LYS B  1 36  ? 44.250 68.424  117.405 1.00 62.89  ? 36  LYS B C   1 
ATOM   5044  O  O   . LYS B  1 36  ? 45.019 67.886  116.605 1.00 62.38  ? 36  LYS B O   1 
ATOM   5045  C  CB  . LYS B  1 36  ? 45.112 69.197  119.659 1.00 61.34  ? 36  LYS B CB  1 
ATOM   5046  C  CG  . LYS B  1 36  ? 46.102 68.032  119.749 1.00 75.85  ? 36  LYS B CG  1 
ATOM   5047  C  CD  . LYS B  1 36  ? 46.656 67.840  121.151 1.00 87.79  ? 36  LYS B CD  1 
ATOM   5048  C  CE  . LYS B  1 36  ? 47.799 66.854  121.162 1.00 98.54  ? 36  LYS B CE  1 
ATOM   5049  N  NZ  . LYS B  1 36  ? 48.434 66.757  122.502 1.00 106.95 ? 36  LYS B NZ  1 
ATOM   5050  N  N   . ASN B  1 37  ? 42.971 68.021  117.601 1.00 60.10  ? 37  ASN B N   1 
ATOM   5051  C  CA  . ASN B  1 37  ? 42.343 66.885  116.922 1.00 60.47  ? 37  ASN B CA  1 
ATOM   5052  C  C   . ASN B  1 37  ? 42.257 67.101  115.413 1.00 63.00  ? 37  ASN B C   1 
ATOM   5053  O  O   . ASN B  1 37  ? 42.624 66.199  114.667 1.00 63.06  ? 37  ASN B O   1 
ATOM   5054  C  CB  . ASN B  1 37  ? 40.956 66.597  117.494 1.00 62.43  ? 37  ASN B CB  1 
ATOM   5055  N  N   . ARG B  1 38  ? 41.800 68.285  114.962 1.00 58.02  ? 38  ARG B N   1 
ATOM   5056  C  CA  . ARG B  1 38  ? 41.689 68.595  113.534 1.00 56.74  ? 38  ARG B CA  1 
ATOM   5057  C  C   . ARG B  1 38  ? 43.069 68.584  112.845 1.00 59.86  ? 38  ARG B C   1 
ATOM   5058  O  O   . ARG B  1 38  ? 43.178 68.076  111.727 1.00 59.82  ? 38  ARG B O   1 
ATOM   5059  C  CB  . ARG B  1 38  ? 40.979 69.946  113.304 1.00 54.65  ? 38  ARG B CB  1 
ATOM   5060  C  CG  . ARG B  1 38  ? 39.505 70.018  113.752 1.00 62.39  ? 38  ARG B CG  1 
ATOM   5061  C  CD  . ARG B  1 38  ? 38.589 68.932  113.183 1.00 72.26  ? 38  ARG B CD  1 
ATOM   5062  N  NE  . ARG B  1 38  ? 38.595 68.884  111.718 1.00 77.90  ? 38  ARG B NE  1 
ATOM   5063  C  CZ  . ARG B  1 38  ? 37.706 69.490  110.936 1.00 87.49  ? 38  ARG B CZ  1 
ATOM   5064  N  NH1 . ARG B  1 38  ? 36.720 70.204  111.468 1.00 70.60  ? 38  ARG B NH1 1 
ATOM   5065  N  NH2 . ARG B  1 38  ? 37.796 69.388  109.617 1.00 73.56  ? 38  ARG B NH2 1 
ATOM   5066  N  N   . ILE B  1 39  ? 44.118 69.084  113.535 1.00 55.27  ? 39  ILE B N   1 
ATOM   5067  C  CA  . ILE B  1 39  ? 45.493 69.158  113.019 1.00 54.18  ? 39  ILE B CA  1 
ATOM   5068  C  C   . ILE B  1 39  ? 46.169 67.762  113.035 1.00 59.80  ? 39  ILE B C   1 
ATOM   5069  O  O   . ILE B  1 39  ? 47.099 67.550  112.255 1.00 59.18  ? 39  ILE B O   1 
ATOM   5070  C  CB  . ILE B  1 39  ? 46.324 70.236  113.797 1.00 56.14  ? 39  ILE B CB  1 
ATOM   5071  C  CG1 . ILE B  1 39  ? 45.739 71.644  113.558 1.00 55.45  ? 39  ILE B CG1 1 
ATOM   5072  C  CG2 . ILE B  1 39  ? 47.832 70.214  113.442 1.00 55.99  ? 39  ILE B CG2 1 
ATOM   5073  C  CD1 . ILE B  1 39  ? 46.198 72.720  114.517 1.00 60.98  ? 39  ILE B CD1 1 
ATOM   5074  N  N   . ILE B  1 40  ? 45.696 66.810  113.869 1.00 58.09  ? 40  ILE B N   1 
ATOM   5075  C  CA  . ILE B  1 40  ? 46.324 65.485  113.933 1.00 59.12  ? 40  ILE B CA  1 
ATOM   5076  C  C   . ILE B  1 40  ? 45.534 64.440  113.111 1.00 64.25  ? 40  ILE B C   1 
ATOM   5077  O  O   . ILE B  1 40  ? 46.161 63.726  112.323 1.00 63.86  ? 40  ILE B O   1 
ATOM   5078  C  CB  . ILE B  1 40  ? 46.576 65.033  115.399 1.00 63.08  ? 40  ILE B CB  1 
ATOM   5079  C  CG1 . ILE B  1 40  ? 47.741 65.848  116.009 1.00 63.01  ? 40  ILE B CG1 1 
ATOM   5080  C  CG2 . ILE B  1 40  ? 46.863 63.521  115.499 1.00 65.35  ? 40  ILE B CG2 1 
ATOM   5081  C  CD1 . ILE B  1 40  ? 47.999 65.636  117.526 1.00 75.37  ? 40  ILE B CD1 1 
ATOM   5082  N  N   . ALA B  1 41  ? 44.189 64.355  113.287 1.00 61.94  ? 41  ALA B N   1 
ATOM   5083  C  CA  . ALA B  1 41  ? 43.298 63.392  112.610 1.00 63.18  ? 41  ALA B CA  1 
ATOM   5084  C  C   . ALA B  1 41  ? 43.580 63.261  111.111 1.00 68.11  ? 41  ALA B C   1 
ATOM   5085  O  O   . ALA B  1 41  ? 43.864 64.258  110.447 1.00 66.52  ? 41  ALA B O   1 
ATOM   5086  C  CB  . ALA B  1 41  ? 41.841 63.770  112.820 1.00 64.11  ? 41  ALA B CB  1 
ATOM   5087  N  N   . LYS B  1 42  ? 43.506 62.019  110.592 1.00 66.80  ? 42  LYS B N   1 
ATOM   5088  C  CA  . LYS B  1 42  ? 43.763 61.681  109.186 1.00 66.99  ? 42  LYS B CA  1 
ATOM   5089  C  C   . LYS B  1 42  ? 42.787 62.395  108.243 1.00 71.14  ? 42  LYS B C   1 
ATOM   5090  O  O   . LYS B  1 42  ? 41.642 62.662  108.624 1.00 71.09  ? 42  LYS B O   1 
ATOM   5091  C  CB  . LYS B  1 42  ? 43.744 60.156  108.955 1.00 70.87  ? 42  LYS B CB  1 
ATOM   5092  C  CG  . LYS B  1 42  ? 42.546 59.416  109.534 1.00 85.89  ? 42  LYS B CG  1 
ATOM   5093  C  CD  . LYS B  1 42  ? 42.891 57.969  109.843 1.00 97.33  ? 42  LYS B CD  1 
ATOM   5094  N  N   . LYS B  1 43  ? 43.259 62.715  107.018 1.00 67.42  ? 43  LYS B N   1 
ATOM   5095  C  CA  . LYS B  1 43  ? 42.494 63.431  105.992 1.00 67.13  ? 43  LYS B CA  1 
ATOM   5096  C  C   . LYS B  1 43  ? 41.193 62.709  105.615 1.00 74.11  ? 43  LYS B C   1 
ATOM   5097  O  O   . LYS B  1 43  ? 40.229 63.378  105.238 1.00 73.59  ? 43  LYS B O   1 
ATOM   5098  C  CB  . LYS B  1 43  ? 43.347 63.696  104.746 1.00 68.60  ? 43  LYS B CB  1 
ATOM   5099  C  CG  . LYS B  1 43  ? 44.333 64.846  104.942 1.00 76.96  ? 43  LYS B CG  1 
ATOM   5100  C  CD  . LYS B  1 43  ? 44.858 65.409  103.630 1.00 83.95  ? 43  LYS B CD  1 
ATOM   5101  C  CE  . LYS B  1 43  ? 44.109 66.646  103.195 1.00 90.71  ? 43  LYS B CE  1 
ATOM   5102  N  NZ  . LYS B  1 43  ? 44.804 67.344  102.083 1.00 98.02  ? 43  LYS B NZ  1 
ATOM   5103  N  N   . LYS B  1 44  ? 41.151 61.364  105.763 1.00 73.30  ? 44  LYS B N   1 
ATOM   5104  C  CA  . LYS B  1 44  ? 39.970 60.529  105.506 1.00 74.96  ? 44  LYS B CA  1 
ATOM   5105  C  C   . LYS B  1 44  ? 38.796 60.946  106.408 1.00 80.13  ? 44  LYS B C   1 
ATOM   5106  O  O   . LYS B  1 44  ? 37.655 61.003  105.941 1.00 80.58  ? 44  LYS B O   1 
ATOM   5107  C  CB  . LYS B  1 44  ? 40.298 59.039  105.725 1.00 78.90  ? 44  LYS B CB  1 
ATOM   5108  C  CG  . LYS B  1 44  ? 41.025 58.382  104.562 1.00 94.47  ? 44  LYS B CG  1 
ATOM   5109  N  N   . ASP B  1 45  ? 39.094 61.266  107.689 1.00 76.28  ? 45  ASP B N   1 
ATOM   5110  C  CA  . ASP B  1 45  ? 38.120 61.688  108.702 1.00 76.02  ? 45  ASP B CA  1 
ATOM   5111  C  C   . ASP B  1 45  ? 37.918 63.219  108.709 1.00 77.45  ? 45  ASP B C   1 
ATOM   5112  O  O   . ASP B  1 45  ? 37.139 63.733  109.517 1.00 76.97  ? 45  ASP B O   1 
ATOM   5113  C  CB  . ASP B  1 45  ? 38.569 61.218  110.104 1.00 78.23  ? 45  ASP B CB  1 
ATOM   5114  C  CG  . ASP B  1 45  ? 39.013 59.770  110.213 1.00 89.31  ? 45  ASP B CG  1 
ATOM   5115  O  OD1 . ASP B  1 45  ? 38.720 58.982  109.283 1.00 90.42  ? 45  ASP B OD1 1 
ATOM   5116  O  OD2 . ASP B  1 45  ? 39.649 59.424  111.230 1.00 96.17  ? 45  ASP B OD2 1 
ATOM   5117  N  N   . GLY B  1 46  ? 38.614 63.920  107.818 1.00 72.08  ? 46  GLY B N   1 
ATOM   5118  C  CA  . GLY B  1 46  ? 38.548 65.372  107.728 1.00 70.55  ? 46  GLY B CA  1 
ATOM   5119  C  C   . GLY B  1 46  ? 39.521 66.019  108.689 1.00 73.71  ? 46  GLY B C   1 
ATOM   5120  O  O   . GLY B  1 46  ? 39.442 65.803  109.903 1.00 74.17  ? 46  GLY B O   1 
ATOM   5121  N  N   . GLY B  1 47  ? 40.445 66.795  108.136 1.00 68.55  ? 47  GLY B N   1 
ATOM   5122  C  CA  . GLY B  1 47  ? 41.488 67.472  108.896 1.00 67.22  ? 47  GLY B CA  1 
ATOM   5123  C  C   . GLY B  1 47  ? 42.868 67.001  108.489 1.00 69.97  ? 47  GLY B C   1 
ATOM   5124  O  O   . GLY B  1 47  ? 43.041 65.829  108.148 1.00 70.60  ? 47  GLY B O   1 
ATOM   5125  N  N   . ALA B  1 48  ? 43.856 67.923  108.506 1.00 64.31  ? 48  ALA B N   1 
ATOM   5126  C  CA  . ALA B  1 48  ? 45.256 67.694  108.132 1.00 62.97  ? 48  ALA B CA  1 
ATOM   5127  C  C   . ALA B  1 48  ? 45.883 66.597  108.979 1.00 66.01  ? 48  ALA B C   1 
ATOM   5128  O  O   . ALA B  1 48  ? 45.624 66.527  110.178 1.00 66.31  ? 48  ALA B O   1 
ATOM   5129  C  CB  . ALA B  1 48  ? 46.049 68.978  108.280 1.00 62.47  ? 48  ALA B CB  1 
ATOM   5130  N  N   . GLN B  1 49  ? 46.688 65.730  108.348 1.00 60.88  ? 49  GLN B N   1 
ATOM   5131  C  CA  . GLN B  1 49  ? 47.349 64.594  108.996 1.00 60.29  ? 49  GLN B CA  1 
ATOM   5132  C  C   . GLN B  1 49  ? 48.748 65.022  109.500 1.00 61.20  ? 49  GLN B C   1 
ATOM   5133  O  O   . GLN B  1 49  ? 49.746 64.330  109.274 1.00 60.68  ? 49  GLN B O   1 
ATOM   5134  C  CB  . GLN B  1 49  ? 47.420 63.437  107.988 1.00 62.26  ? 49  GLN B CB  1 
ATOM   5135  C  CG  . GLN B  1 49  ? 47.418 62.041  108.574 1.00 74.56  ? 49  GLN B CG  1 
ATOM   5136  C  CD  . GLN B  1 49  ? 47.275 61.027  107.468 1.00 88.83  ? 49  GLN B CD  1 
ATOM   5137  O  OE1 . GLN B  1 49  ? 46.239 60.939  106.796 1.00 82.32  ? 49  GLN B OE1 1 
ATOM   5138  N  NE2 . GLN B  1 49  ? 48.329 60.265  107.227 1.00 81.46  ? 49  GLN B NE2 1 
ATOM   5139  N  N   . LEU B  1 50  ? 48.800 66.179  110.186 1.00 55.69  ? 50  LEU B N   1 
ATOM   5140  C  CA  . LEU B  1 50  ? 50.028 66.765  110.725 1.00 54.56  ? 50  LEU B CA  1 
ATOM   5141  C  C   . LEU B  1 50  ? 50.279 66.297  112.170 1.00 58.75  ? 50  LEU B C   1 
ATOM   5142  O  O   . LEU B  1 50  ? 49.509 65.490  112.701 1.00 59.94  ? 50  LEU B O   1 
ATOM   5143  C  CB  . LEU B  1 50  ? 49.965 68.310  110.660 1.00 53.37  ? 50  LEU B CB  1 
ATOM   5144  C  CG  . LEU B  1 50  ? 49.734 68.973  109.290 1.00 57.37  ? 50  LEU B CG  1 
ATOM   5145  C  CD1 . LEU B  1 50  ? 49.382 70.439  109.452 1.00 56.50  ? 50  LEU B CD1 1 
ATOM   5146  C  CD2 . LEU B  1 50  ? 50.943 68.840  108.387 1.00 59.76  ? 50  LEU B CD2 1 
ATOM   5147  N  N   . LEU B  1 51  ? 51.380 66.780  112.789 1.00 53.53  ? 51  LEU B N   1 
ATOM   5148  C  CA  . LEU B  1 51  ? 51.781 66.461  114.167 1.00 53.14  ? 51  LEU B CA  1 
ATOM   5149  C  C   . LEU B  1 51  ? 51.736 67.737  115.007 1.00 56.41  ? 51  LEU B C   1 
ATOM   5150  O  O   . LEU B  1 51  ? 52.303 68.754  114.606 1.00 55.19  ? 51  LEU B O   1 
ATOM   5151  C  CB  . LEU B  1 51  ? 53.187 65.821  114.220 1.00 53.23  ? 51  LEU B CB  1 
ATOM   5152  C  CG  . LEU B  1 51  ? 53.476 64.618  113.308 1.00 57.94  ? 51  LEU B CG  1 
ATOM   5153  C  CD1 . LEU B  1 51  ? 54.961 64.403  113.154 1.00 57.81  ? 51  LEU B CD1 1 
ATOM   5154  C  CD2 . LEU B  1 51  ? 52.830 63.349  113.831 1.00 61.71  ? 51  LEU B CD2 1 
ATOM   5155  N  N   . PHE B  1 52  ? 51.043 67.686  116.156 1.00 53.16  ? 52  PHE B N   1 
ATOM   5156  C  CA  . PHE B  1 52  ? 50.831 68.818  117.063 1.00 51.83  ? 52  PHE B CA  1 
ATOM   5157  C  C   . PHE B  1 52  ? 51.409 68.514  118.428 1.00 54.81  ? 52  PHE B C   1 
ATOM   5158  O  O   . PHE B  1 52  ? 51.187 67.423  118.963 1.00 55.30  ? 52  PHE B O   1 
ATOM   5159  C  CB  . PHE B  1 52  ? 49.327 69.091  117.161 1.00 53.72  ? 52  PHE B CB  1 
ATOM   5160  C  CG  . PHE B  1 52  ? 48.894 70.386  117.793 1.00 54.74  ? 52  PHE B CG  1 
ATOM   5161  C  CD1 . PHE B  1 52  ? 48.674 71.515  117.016 1.00 56.93  ? 52  PHE B CD1 1 
ATOM   5162  C  CD2 . PHE B  1 52  ? 48.610 70.453  119.151 1.00 57.45  ? 52  PHE B CD2 1 
ATOM   5163  C  CE1 . PHE B  1 52  ? 48.221 72.702  117.594 1.00 57.44  ? 52  PHE B CE1 1 
ATOM   5164  C  CE2 . PHE B  1 52  ? 48.152 71.637  119.728 1.00 59.76  ? 52  PHE B CE2 1 
ATOM   5165  C  CZ  . PHE B  1 52  ? 47.946 72.749  118.943 1.00 56.93  ? 52  PHE B CZ  1 
ATOM   5166  N  N   . ARG B  1 53  ? 52.152 69.483  118.991 1.00 50.11  ? 53  ARG B N   1 
ATOM   5167  C  CA  . ARG B  1 53  ? 52.817 69.360  120.291 1.00 50.19  ? 53  ARG B CA  1 
ATOM   5168  C  C   . ARG B  1 53  ? 53.037 70.760  120.914 1.00 53.85  ? 53  ARG B C   1 
ATOM   5169  O  O   . ARG B  1 53  ? 53.350 71.694  120.177 1.00 53.26  ? 53  ARG B O   1 
ATOM   5170  C  CB  . ARG B  1 53  ? 54.148 68.576  120.117 1.00 49.55  ? 53  ARG B CB  1 
ATOM   5171  C  CG  . ARG B  1 53  ? 55.383 69.089  120.845 1.00 57.10  ? 53  ARG B CG  1 
ATOM   5172  C  CD  . ARG B  1 53  ? 56.639 68.475  120.271 1.00 67.87  ? 53  ARG B CD  1 
ATOM   5173  N  NE  . ARG B  1 53  ? 57.761 69.414  120.290 1.00 76.02  ? 53  ARG B NE  1 
ATOM   5174  C  CZ  . ARG B  1 53  ? 58.813 69.332  119.485 1.00 87.90  ? 53  ARG B CZ  1 
ATOM   5175  N  NH1 . ARG B  1 53  ? 58.899 68.352  118.593 1.00 68.52  ? 53  ARG B NH1 1 
ATOM   5176  N  NH2 . ARG B  1 53  ? 59.790 70.226  119.565 1.00 77.16  ? 53  ARG B NH2 1 
ATOM   5177  N  N   . PRO B  1 54  ? 52.884 70.933  122.252 1.00 50.31  ? 54  PRO B N   1 
ATOM   5178  C  CA  . PRO B  1 54  ? 53.142 72.256  122.856 1.00 49.19  ? 54  PRO B CA  1 
ATOM   5179  C  C   . PRO B  1 54  ? 54.630 72.603  122.867 1.00 51.20  ? 54  PRO B C   1 
ATOM   5180  O  O   . PRO B  1 54  ? 55.458 71.690  122.850 1.00 51.48  ? 54  PRO B O   1 
ATOM   5181  C  CB  . PRO B  1 54  ? 52.604 72.110  124.291 1.00 51.86  ? 54  PRO B CB  1 
ATOM   5182  C  CG  . PRO B  1 54  ? 51.902 70.779  124.344 1.00 57.27  ? 54  PRO B CG  1 
ATOM   5183  C  CD  . PRO B  1 54  ? 52.529 69.941  123.286 1.00 52.93  ? 54  PRO B CD  1 
ATOM   5184  N  N   . LEU B  1 55  ? 54.972 73.914  122.917 1.00 45.36  ? 55  LEU B N   1 
ATOM   5185  C  CA  . LEU B  1 55  ? 56.360 74.405  122.955 1.00 44.14  ? 55  LEU B CA  1 
ATOM   5186  C  C   . LEU B  1 55  ? 57.161 73.720  124.086 1.00 49.27  ? 55  LEU B C   1 
ATOM   5187  O  O   . LEU B  1 55  ? 58.311 73.333  123.871 1.00 49.42  ? 55  LEU B O   1 
ATOM   5188  C  CB  . LEU B  1 55  ? 56.399 75.943  123.103 1.00 42.97  ? 55  LEU B CB  1 
ATOM   5189  C  CG  . LEU B  1 55  ? 57.775 76.620  123.228 1.00 46.68  ? 55  LEU B CG  1 
ATOM   5190  C  CD1 . LEU B  1 55  ? 58.680 76.280  122.062 1.00 46.29  ? 55  LEU B CD1 1 
ATOM   5191  C  CD2 . LEU B  1 55  ? 57.639 78.111  123.360 1.00 48.02  ? 55  LEU B CD2 1 
ATOM   5192  N  N   . LEU B  1 56  ? 56.533 73.532  125.259 1.00 45.76  ? 56  LEU B N   1 
ATOM   5193  C  CA  . LEU B  1 56  ? 57.135 72.847  126.399 1.00 46.18  ? 56  LEU B CA  1 
ATOM   5194  C  C   . LEU B  1 56  ? 56.307 71.614  126.742 1.00 50.05  ? 56  LEU B C   1 
ATOM   5195  O  O   . LEU B  1 56  ? 55.074 71.697  126.769 1.00 49.58  ? 56  LEU B O   1 
ATOM   5196  C  CB  . LEU B  1 56  ? 57.233 73.787  127.614 1.00 46.37  ? 56  LEU B CB  1 
ATOM   5197  C  CG  . LEU B  1 56  ? 58.137 74.996  127.455 1.00 50.32  ? 56  LEU B CG  1 
ATOM   5198  C  CD1 . LEU B  1 56  ? 57.332 76.262  127.391 1.00 50.04  ? 56  LEU B CD1 1 
ATOM   5199  C  CD2 . LEU B  1 56  ? 59.100 75.087  128.594 1.00 53.37  ? 56  LEU B CD2 1 
ATOM   5200  N  N   . ASN B  1 57  ? 56.966 70.466  126.986 1.00 46.81  ? 57  ASN B N   1 
ATOM   5201  C  CA  . ASN B  1 57  ? 56.249 69.245  127.366 1.00 47.35  ? 57  ASN B CA  1 
ATOM   5202  C  C   . ASN B  1 57  ? 55.806 69.368  128.827 1.00 51.35  ? 57  ASN B C   1 
ATOM   5203  O  O   . ASN B  1 57  ? 56.237 70.302  129.502 1.00 50.81  ? 57  ASN B O   1 
ATOM   5204  C  CB  . ASN B  1 57  ? 57.088 67.987  127.119 1.00 48.86  ? 57  ASN B CB  1 
ATOM   5205  C  CG  . ASN B  1 57  ? 58.360 67.899  127.914 1.00 69.75  ? 57  ASN B CG  1 
ATOM   5206  O  OD1 . ASN B  1 57  ? 58.357 67.550  129.094 1.00 64.48  ? 57  ASN B OD1 1 
ATOM   5207  N  ND2 . ASN B  1 57  ? 59.482 68.140  127.260 1.00 60.89  ? 57  ASN B ND2 1 
ATOM   5208  N  N   . LYS B  1 58  ? 54.956 68.442  129.314 1.00 48.51  ? 58  LYS B N   1 
ATOM   5209  C  CA  . LYS B  1 58  ? 54.406 68.459  130.679 1.00 48.84  ? 58  LYS B CA  1 
ATOM   5210  C  C   . LYS B  1 58  ? 55.491 68.549  131.776 1.00 53.23  ? 58  LYS B C   1 
ATOM   5211  O  O   . LYS B  1 58  ? 55.252 69.207  132.793 1.00 53.26  ? 58  LYS B O   1 
ATOM   5212  C  CB  . LYS B  1 58  ? 53.484 67.255  130.928 1.00 52.05  ? 58  LYS B CB  1 
ATOM   5213  C  CG  . LYS B  1 58  ? 52.199 67.263  130.085 1.00 64.68  ? 58  LYS B CG  1 
ATOM   5214  C  CD  . LYS B  1 58  ? 51.166 68.298  130.547 1.00 73.22  ? 58  LYS B CD  1 
ATOM   5215  C  CE  . LYS B  1 58  ? 50.018 68.413  129.573 1.00 82.66  ? 58  LYS B CE  1 
ATOM   5216  N  NZ  . LYS B  1 58  ? 48.980 69.363  130.054 1.00 90.47  ? 58  LYS B NZ  1 
ATOM   5217  N  N   . TYR B  1 59  ? 56.681 67.942  131.554 1.00 49.68  ? 59  TYR B N   1 
ATOM   5218  C  CA  . TYR B  1 59  ? 57.802 68.017  132.502 1.00 50.02  ? 59  TYR B CA  1 
ATOM   5219  C  C   . TYR B  1 59  ? 58.456 69.405  132.422 1.00 52.26  ? 59  TYR B C   1 
ATOM   5220  O  O   . TYR B  1 59  ? 58.776 69.991  133.460 1.00 51.99  ? 59  TYR B O   1 
ATOM   5221  C  CB  . TYR B  1 59  ? 58.838 66.891  132.251 1.00 51.95  ? 59  TYR B CB  1 
ATOM   5222  C  CG  . TYR B  1 59  ? 60.171 67.098  132.945 1.00 53.96  ? 59  TYR B CG  1 
ATOM   5223  C  CD1 . TYR B  1 59  ? 60.370 66.677  134.256 1.00 57.12  ? 59  TYR B CD1 1 
ATOM   5224  C  CD2 . TYR B  1 59  ? 61.232 67.718  132.290 1.00 53.88  ? 59  TYR B CD2 1 
ATOM   5225  C  CE1 . TYR B  1 59  ? 61.588 66.883  134.906 1.00 58.14  ? 59  TYR B CE1 1 
ATOM   5226  C  CE2 . TYR B  1 59  ? 62.448 67.942  132.933 1.00 55.23  ? 59  TYR B CE2 1 
ATOM   5227  C  CZ  . TYR B  1 59  ? 62.627 67.508  134.236 1.00 63.13  ? 59  TYR B CZ  1 
ATOM   5228  O  OH  . TYR B  1 59  ? 63.830 67.717  134.865 1.00 64.30  ? 59  TYR B OH  1 
ATOM   5229  N  N   . GLU B  1 60  ? 58.670 69.911  131.187 1.00 47.45  ? 60  GLU B N   1 
ATOM   5230  C  CA  . GLU B  1 60  ? 59.284 71.216  130.915 1.00 46.21  ? 60  GLU B CA  1 
ATOM   5231  C  C   . GLU B  1 60  ? 58.383 72.367  131.356 1.00 49.45  ? 60  GLU B C   1 
ATOM   5232  O  O   . GLU B  1 60  ? 58.890 73.453  131.641 1.00 49.31  ? 60  GLU B O   1 
ATOM   5233  C  CB  . GLU B  1 60  ? 59.626 71.365  129.421 1.00 46.46  ? 60  GLU B CB  1 
ATOM   5234  C  CG  . GLU B  1 60  ? 60.955 70.731  129.043 1.00 55.93  ? 60  GLU B CG  1 
ATOM   5235  C  CD  . GLU B  1 60  ? 61.369 70.788  127.584 1.00 68.25  ? 60  GLU B CD  1 
ATOM   5236  O  OE1 . GLU B  1 60  ? 60.483 70.711  126.701 1.00 59.24  ? 60  GLU B OE1 1 
ATOM   5237  O  OE2 . GLU B  1 60  ? 62.594 70.832  127.324 1.00 57.53  ? 60  GLU B OE2 1 
ATOM   5238  N  N   . GLN B  1 61  ? 57.057 72.125  131.436 1.00 45.10  ? 61  GLN B N   1 
ATOM   5239  C  CA  . GLN B  1 61  ? 56.061 73.125  131.815 1.00 44.25  ? 61  GLN B CA  1 
ATOM   5240  C  C   . GLN B  1 61  ? 56.118 73.469  133.315 1.00 48.61  ? 61  GLN B C   1 
ATOM   5241  O  O   . GLN B  1 61  ? 55.537 74.480  133.721 1.00 47.40  ? 61  GLN B O   1 
ATOM   5242  C  CB  . GLN B  1 61  ? 54.653 72.687  131.390 1.00 45.36  ? 61  GLN B CB  1 
ATOM   5243  C  CG  . GLN B  1 61  ? 54.362 73.047  129.934 1.00 52.52  ? 61  GLN B CG  1 
ATOM   5244  C  CD  . GLN B  1 61  ? 53.036 72.529  129.452 1.00 66.40  ? 61  GLN B CD  1 
ATOM   5245  O  OE1 . GLN B  1 61  ? 51.983 73.120  129.702 1.00 62.89  ? 61  GLN B OE1 1 
ATOM   5246  N  NE2 . GLN B  1 61  ? 53.061 71.438  128.709 1.00 54.85  ? 61  GLN B NE2 1 
ATOM   5247  N  N   . GLU B  1 62  ? 56.858 72.663  134.116 1.00 46.73  ? 62  GLU B N   1 
ATOM   5248  C  CA  . GLU B  1 62  ? 57.077 72.873  135.556 1.00 47.46  ? 62  GLU B CA  1 
ATOM   5249  C  C   . GLU B  1 62  ? 58.147 73.942  135.788 1.00 52.49  ? 62  GLU B C   1 
ATOM   5250  O  O   . GLU B  1 62  ? 58.150 74.576  136.841 1.00 52.50  ? 62  GLU B O   1 
ATOM   5251  C  CB  . GLU B  1 62  ? 57.491 71.566  136.263 1.00 49.75  ? 62  GLU B CB  1 
ATOM   5252  C  CG  . GLU B  1 62  ? 56.452 70.455  136.233 1.00 58.44  ? 62  GLU B CG  1 
ATOM   5253  C  CD  . GLU B  1 62  ? 55.133 70.734  136.927 1.00 75.97  ? 62  GLU B CD  1 
ATOM   5254  O  OE1 . GLU B  1 62  ? 55.149 71.156  138.106 1.00 65.28  ? 62  GLU B OE1 1 
ATOM   5255  O  OE2 . GLU B  1 62  ? 54.078 70.498  136.297 1.00 73.55  ? 62  GLU B OE2 1 
ATOM   5256  N  N   . THR B  1 63  ? 59.054 74.130  134.802 1.00 49.76  ? 63  THR B N   1 
ATOM   5257  C  CA  . THR B  1 63  ? 60.150 75.106  134.838 1.00 49.91  ? 63  THR B CA  1 
ATOM   5258  C  C   . THR B  1 63  ? 59.725 76.433  134.185 1.00 53.37  ? 63  THR B C   1 
ATOM   5259  O  O   . THR B  1 63  ? 60.081 77.489  134.704 1.00 53.04  ? 63  THR B O   1 
ATOM   5260  C  CB  . THR B  1 63  ? 61.417 74.539  134.161 1.00 58.50  ? 63  THR B CB  1 
ATOM   5261  O  OG1 . THR B  1 63  ? 61.652 73.205  134.615 1.00 61.35  ? 63  THR B OG1 1 
ATOM   5262  C  CG2 . THR B  1 63  ? 62.657 75.393  134.418 1.00 55.36  ? 63  THR B CG2 1 
ATOM   5263  N  N   . LEU B  1 64  ? 59.016 76.382  133.036 1.00 49.45  ? 64  LEU B N   1 
ATOM   5264  C  CA  . LEU B  1 64  ? 58.561 77.576  132.307 1.00 48.65  ? 64  LEU B CA  1 
ATOM   5265  C  C   . LEU B  1 64  ? 57.150 77.395  131.759 1.00 54.11  ? 64  LEU B C   1 
ATOM   5266  O  O   . LEU B  1 64  ? 56.802 76.297  131.328 1.00 53.94  ? 64  LEU B O   1 
ATOM   5267  C  CB  . LEU B  1 64  ? 59.512 77.922  131.136 1.00 47.65  ? 64  LEU B CB  1 
ATOM   5268  C  CG  . LEU B  1 64  ? 60.956 78.325  131.455 1.00 52.00  ? 64  LEU B CG  1 
ATOM   5269  C  CD1 . LEU B  1 64  ? 61.834 78.171  130.238 1.00 51.43  ? 64  LEU B CD1 1 
ATOM   5270  C  CD2 . LEU B  1 64  ? 61.041 79.744  131.978 1.00 53.29  ? 64  LEU B CD2 1 
ATOM   5271  N  N   . GLU B  1 65  ? 56.357 78.487  131.732 1.00 51.68  ? 65  GLU B N   1 
ATOM   5272  C  CA  . GLU B  1 65  ? 54.988 78.497  131.201 1.00 51.83  ? 65  GLU B CA  1 
ATOM   5273  C  C   . GLU B  1 65  ? 54.973 78.314  129.681 1.00 56.44  ? 65  GLU B C   1 
ATOM   5274  O  O   . GLU B  1 65  ? 55.860 78.818  128.987 1.00 55.58  ? 65  GLU B O   1 
ATOM   5275  C  CB  . GLU B  1 65  ? 54.265 79.797  131.566 1.00 53.06  ? 65  GLU B CB  1 
ATOM   5276  C  CG  . GLU B  1 65  ? 53.689 79.806  132.970 1.00 65.27  ? 65  GLU B CG  1 
ATOM   5277  C  CD  . GLU B  1 65  ? 52.463 80.680  133.147 1.00 85.20  ? 65  GLU B CD  1 
ATOM   5278  O  OE1 . GLU B  1 65  ? 52.494 81.856  132.716 1.00 73.99  ? 65  GLU B OE1 1 
ATOM   5279  O  OE2 . GLU B  1 65  ? 51.492 80.209  133.783 1.00 82.82  ? 65  GLU B OE2 1 
ATOM   5280  N  N   . ASN B  1 66  ? 53.947 77.610  129.174 1.00 53.84  ? 66  ASN B N   1 
ATOM   5281  C  CA  . ASN B  1 66  ? 53.770 77.306  127.754 1.00 53.35  ? 66  ASN B CA  1 
ATOM   5282  C  C   . ASN B  1 66  ? 53.355 78.539  126.914 1.00 56.45  ? 66  ASN B C   1 
ATOM   5283  O  O   . ASN B  1 66  ? 53.605 78.537  125.703 1.00 55.27  ? 66  ASN B O   1 
ATOM   5284  C  CB  . ASN B  1 66  ? 52.745 76.176  127.583 1.00 55.55  ? 66  ASN B CB  1 
ATOM   5285  C  CG  . ASN B  1 66  ? 52.673 75.585  126.193 1.00 77.53  ? 66  ASN B CG  1 
ATOM   5286  O  OD1 . ASN B  1 66  ? 53.689 75.263  125.560 1.00 67.30  ? 66  ASN B OD1 1 
ATOM   5287  N  ND2 . ASN B  1 66  ? 51.456 75.415  125.696 1.00 71.20  ? 66  ASN B ND2 1 
ATOM   5288  N  N   . GLN B  1 67  ? 52.717 79.571  127.542 1.00 53.17  ? 67  GLN B N   1 
ATOM   5289  C  CA  . GLN B  1 67  ? 52.231 80.815  126.904 1.00 52.52  ? 67  GLN B CA  1 
ATOM   5290  C  C   . GLN B  1 67  ? 51.292 80.519  125.691 1.00 56.56  ? 67  GLN B C   1 
ATOM   5291  O  O   . GLN B  1 67  ? 51.181 81.338  124.759 1.00 55.96  ? 67  GLN B O   1 
ATOM   5292  C  CB  . GLN B  1 67  ? 53.414 81.717  126.479 1.00 53.24  ? 67  GLN B CB  1 
ATOM   5293  C  CG  . GLN B  1 67  ? 53.968 82.585  127.590 1.00 65.04  ? 67  GLN B CG  1 
ATOM   5294  C  CD  . GLN B  1 67  ? 55.244 83.285  127.199 1.00 81.48  ? 67  GLN B CD  1 
ATOM   5295  O  OE1 . GLN B  1 67  ? 56.341 82.877  127.588 1.00 78.65  ? 67  GLN B OE1 1 
ATOM   5296  N  NE2 . GLN B  1 67  ? 55.130 84.384  126.464 1.00 70.18  ? 67  GLN B NE2 1 
ATOM   5297  N  N   . ASN B  1 68  ? 50.618 79.335  125.733 1.00 52.90  ? 68  ASN B N   1 
ATOM   5298  C  CA  . ASN B  1 68  ? 49.704 78.777  124.724 1.00 52.11  ? 68  ASN B CA  1 
ATOM   5299  C  C   . ASN B  1 68  ? 50.378 78.727  123.335 1.00 53.34  ? 68  ASN B C   1 
ATOM   5300  O  O   . ASN B  1 68  ? 49.753 79.035  122.314 1.00 52.21  ? 68  ASN B O   1 
ATOM   5301  C  CB  . ASN B  1 68  ? 48.363 79.536  124.687 1.00 54.10  ? 68  ASN B CB  1 
ATOM   5302  C  CG  . ASN B  1 68  ? 47.398 79.187  125.801 1.00 80.22  ? 68  ASN B CG  1 
ATOM   5303  O  OD1 . ASN B  1 68  ? 47.716 78.461  126.754 1.00 78.83  ? 68  ASN B OD1 1 
ATOM   5304  N  ND2 . ASN B  1 68  ? 46.181 79.701  125.703 1.00 70.56  ? 68  ASN B ND2 1 
ATOM   5305  N  N   . LEU B  1 69  ? 51.663 78.323  123.319 1.00 48.59  ? 69  LEU B N   1 
ATOM   5306  C  CA  . LEU B  1 69  ? 52.468 78.197  122.107 1.00 47.40  ? 69  LEU B CA  1 
ATOM   5307  C  C   . LEU B  1 69  ? 52.545 76.737  121.704 1.00 50.91  ? 69  LEU B C   1 
ATOM   5308  O  O   . LEU B  1 69  ? 52.865 75.887  122.538 1.00 51.40  ? 69  LEU B O   1 
ATOM   5309  C  CB  . LEU B  1 69  ? 53.872 78.793  122.313 1.00 47.25  ? 69  LEU B CB  1 
ATOM   5310  C  CG  . LEU B  1 69  ? 53.948 80.321  122.330 1.00 51.08  ? 69  LEU B CG  1 
ATOM   5311  C  CD1 . LEU B  1 69  ? 55.068 80.797  123.216 1.00 51.16  ? 69  LEU B CD1 1 
ATOM   5312  C  CD2 . LEU B  1 69  ? 54.083 80.891  120.923 1.00 52.24  ? 69  LEU B CD2 1 
ATOM   5313  N  N   . TYR B  1 70  ? 52.216 76.439  120.435 1.00 46.86  ? 70  TYR B N   1 
ATOM   5314  C  CA  . TYR B  1 70  ? 52.187 75.070  119.918 1.00 47.12  ? 70  TYR B CA  1 
ATOM   5315  C  C   . TYR B  1 70  ? 52.947 74.934  118.602 1.00 50.45  ? 70  TYR B C   1 
ATOM   5316  O  O   . TYR B  1 70  ? 52.792 75.756  117.697 1.00 49.11  ? 70  TYR B O   1 
ATOM   5317  C  CB  . TYR B  1 70  ? 50.738 74.591  119.752 1.00 48.55  ? 70  TYR B CB  1 
ATOM   5318  C  CG  . TYR B  1 70  ? 49.967 74.580  121.055 1.00 51.15  ? 70  TYR B CG  1 
ATOM   5319  C  CD1 . TYR B  1 70  ? 50.069 73.511  121.939 1.00 54.10  ? 70  TYR B CD1 1 
ATOM   5320  C  CD2 . TYR B  1 70  ? 49.160 75.653  121.420 1.00 51.57  ? 70  TYR B CD2 1 
ATOM   5321  C  CE1 . TYR B  1 70  ? 49.390 73.509  123.156 1.00 55.32  ? 70  TYR B CE1 1 
ATOM   5322  C  CE2 . TYR B  1 70  ? 48.474 75.662  122.634 1.00 53.23  ? 70  TYR B CE2 1 
ATOM   5323  C  CZ  . TYR B  1 70  ? 48.592 74.586  123.499 1.00 62.54  ? 70  TYR B CZ  1 
ATOM   5324  O  OH  . TYR B  1 70  ? 47.918 74.575  124.696 1.00 66.72  ? 70  TYR B OH  1 
ATOM   5325  N  N   . LEU B  1 71  ? 53.776 73.883  118.517 1.00 47.85  ? 71  LEU B N   1 
ATOM   5326  C  CA  . LEU B  1 71  ? 54.615 73.562  117.361 1.00 47.35  ? 71  LEU B CA  1 
ATOM   5327  C  C   . LEU B  1 71  ? 53.944 72.527  116.474 1.00 50.91  ? 71  LEU B C   1 
ATOM   5328  O  O   . LEU B  1 71  ? 53.397 71.538  116.971 1.00 51.10  ? 71  LEU B O   1 
ATOM   5329  C  CB  . LEU B  1 71  ? 55.996 73.046  117.805 1.00 47.82  ? 71  LEU B CB  1 
ATOM   5330  C  CG  . LEU B  1 71  ? 56.748 73.878  118.836 1.00 52.47  ? 71  LEU B CG  1 
ATOM   5331  C  CD1 . LEU B  1 71  ? 57.693 73.018  119.614 1.00 53.76  ? 71  LEU B CD1 1 
ATOM   5332  C  CD2 . LEU B  1 71  ? 57.472 75.053  118.197 1.00 53.84  ? 71  LEU B CD2 1 
ATOM   5333  N  N   . VAL B  1 72  ? 53.995 72.759  115.153 1.00 46.43  ? 72  VAL B N   1 
ATOM   5334  C  CA  . VAL B  1 72  ? 53.401 71.878  114.152 1.00 46.35  ? 72  VAL B CA  1 
ATOM   5335  C  C   . VAL B  1 72  ? 54.494 71.379  113.185 1.00 51.71  ? 72  VAL B C   1 
ATOM   5336  O  O   . VAL B  1 72  ? 55.357 72.146  112.752 1.00 50.40  ? 72  VAL B O   1 
ATOM   5337  C  CB  . VAL B  1 72  ? 52.226 72.569  113.401 1.00 49.09  ? 72  VAL B CB  1 
ATOM   5338  C  CG1 . VAL B  1 72  ? 51.547 71.619  112.417 1.00 49.25  ? 72  VAL B CG1 1 
ATOM   5339  C  CG2 . VAL B  1 72  ? 51.199 73.126  114.378 1.00 48.72  ? 72  VAL B CG2 1 
ATOM   5340  N  N   . GLY B  1 73  ? 54.423 70.088  112.880 1.00 50.59  ? 73  GLY B N   1 
ATOM   5341  C  CA  . GLY B  1 73  ? 55.305 69.384  111.957 1.00 51.30  ? 73  GLY B CA  1 
ATOM   5342  C  C   . GLY B  1 73  ? 54.544 68.293  111.230 1.00 57.07  ? 73  GLY B C   1 
ATOM   5343  O  O   . GLY B  1 73  ? 53.309 68.278  111.256 1.00 56.89  ? 73  GLY B O   1 
ATOM   5344  N  N   . ALA B  1 74  ? 55.270 67.373  110.573 1.00 54.92  ? 74  ALA B N   1 
ATOM   5345  C  CA  . ALA B  1 74  ? 54.678 66.251  109.833 1.00 55.79  ? 74  ALA B CA  1 
ATOM   5346  C  C   . ALA B  1 74  ? 55.707 65.156  109.552 1.00 62.39  ? 74  ALA B C   1 
ATOM   5347  O  O   . ALA B  1 74  ? 56.912 65.369  109.732 1.00 62.14  ? 74  ALA B O   1 
ATOM   5348  C  CB  . ALA B  1 74  ? 54.073 66.738  108.521 1.00 55.68  ? 74  ALA B CB  1 
ATOM   5349  N  N   . SER B  1 75  ? 55.223 63.982  109.105 1.00 60.69  ? 75  SER B N   1 
ATOM   5350  C  CA  . SER B  1 75  ? 56.062 62.845  108.726 1.00 61.86  ? 75  SER B CA  1 
ATOM   5351  C  C   . SER B  1 75  ? 56.733 63.130  107.380 1.00 65.59  ? 75  SER B C   1 
ATOM   5352  O  O   . SER B  1 75  ? 56.223 63.953  106.614 1.00 64.52  ? 75  SER B O   1 
ATOM   5353  C  CB  . SER B  1 75  ? 55.223 61.573  108.634 1.00 67.05  ? 75  SER B CB  1 
ATOM   5354  O  OG  . SER B  1 75  ? 54.340 61.444  109.735 1.00 77.28  ? 75  SER B OG  1 
ATOM   5355  N  N   . LYS B  1 76  ? 57.865 62.454  107.087 1.00 62.64  ? 76  LYS B N   1 
ATOM   5356  C  CA  . LYS B  1 76  ? 58.596 62.607  105.821 1.00 62.01  ? 76  LYS B CA  1 
ATOM   5357  C  C   . LYS B  1 76  ? 57.688 62.200  104.654 1.00 65.77  ? 76  LYS B C   1 
ATOM   5358  O  O   . LYS B  1 76  ? 57.642 62.909  103.649 1.00 64.99  ? 76  LYS B O   1 
ATOM   5359  C  CB  . LYS B  1 76  ? 59.889 61.763  105.829 1.00 65.34  ? 76  LYS B CB  1 
ATOM   5360  C  CG  . LYS B  1 76  ? 60.876 62.119  104.718 1.00 75.72  ? 76  LYS B CG  1 
ATOM   5361  C  CD  . LYS B  1 76  ? 62.069 61.172  104.683 1.00 83.97  ? 76  LYS B CD  1 
ATOM   5362  N  N   . ILE B  1 77  ? 56.934 61.095  104.823 1.00 62.70  ? 77  ILE B N   1 
ATOM   5363  C  CA  . ILE B  1 77  ? 55.989 60.542  103.844 1.00 62.69  ? 77  ILE B CA  1 
ATOM   5364  C  C   . ILE B  1 77  ? 54.790 61.502  103.699 1.00 65.63  ? 77  ILE B C   1 
ATOM   5365  O  O   . ILE B  1 77  ? 54.362 61.761  102.574 1.00 64.72  ? 77  ILE B O   1 
ATOM   5366  C  CB  . ILE B  1 77  ? 55.542 59.093  104.218 1.00 67.02  ? 77  ILE B CB  1 
ATOM   5367  C  CG1 . ILE B  1 77  ? 56.734 58.190  104.600 1.00 68.45  ? 77  ILE B CG1 1 
ATOM   5368  C  CG2 . ILE B  1 77  ? 54.720 58.445  103.114 1.00 67.78  ? 77  ILE B CG2 1 
ATOM   5369  C  CD1 . ILE B  1 77  ? 56.829 57.947  105.998 1.00 76.33  ? 77  ILE B CD1 1 
ATOM   5370  N  N   . ARG B  1 78  ? 54.276 62.040  104.834 1.00 61.87  ? 78  ARG B N   1 
ATOM   5371  C  CA  . ARG B  1 78  ? 53.159 62.993  104.864 1.00 60.76  ? 78  ARG B CA  1 
ATOM   5372  C  C   . ARG B  1 78  ? 53.523 64.276  104.100 1.00 64.10  ? 78  ARG B C   1 
ATOM   5373  O  O   . ARG B  1 78  ? 52.691 64.789  103.347 1.00 63.50  ? 78  ARG B O   1 
ATOM   5374  C  CB  . ARG B  1 78  ? 52.747 63.315  106.317 1.00 60.21  ? 78  ARG B CB  1 
ATOM   5375  C  CG  . ARG B  1 78  ? 51.719 64.448  106.493 1.00 67.76  ? 78  ARG B CG  1 
ATOM   5376  C  CD  . ARG B  1 78  ? 50.399 64.182  105.786 1.00 71.95  ? 78  ARG B CD  1 
ATOM   5377  N  NE  . ARG B  1 78  ? 49.386 65.193  106.091 1.00 72.73  ? 78  ARG B NE  1 
ATOM   5378  C  CZ  . ARG B  1 78  ? 48.946 66.113  105.240 1.00 76.70  ? 78  ARG B CZ  1 
ATOM   5379  N  NH1 . ARG B  1 78  ? 49.444 66.183  104.011 1.00 55.85  ? 78  ARG B NH1 1 
ATOM   5380  N  NH2 . ARG B  1 78  ? 48.007 66.971  105.610 1.00 61.18  ? 78  ARG B NH2 1 
ATOM   5381  N  N   . MET B  1 79  ? 54.767 64.772  104.284 1.00 60.17  ? 79  MET B N   1 
ATOM   5382  C  CA  . MET B  1 79  ? 55.278 65.968  103.618 1.00 58.92  ? 79  MET B CA  1 
ATOM   5383  C  C   . MET B  1 79  ? 55.321 65.792  102.102 1.00 63.03  ? 79  MET B C   1 
ATOM   5384  O  O   . MET B  1 79  ? 54.960 66.719  101.372 1.00 62.01  ? 79  MET B O   1 
ATOM   5385  C  CB  . MET B  1 79  ? 56.676 66.347  104.138 1.00 61.14  ? 79  MET B CB  1 
ATOM   5386  C  CG  . MET B  1 79  ? 56.678 67.113  105.464 1.00 64.63  ? 79  MET B CG  1 
ATOM   5387  S  SD  . MET B  1 79  ? 55.556 68.538  105.658 1.00 67.88  ? 79  MET B SD  1 
ATOM   5388  C  CE  . MET B  1 79  ? 55.831 69.385  104.192 1.00 63.89  ? 79  MET B CE  1 
ATOM   5389  N  N   . LEU B  1 80  ? 55.743 64.600  101.634 1.00 60.33  ? 80  LEU B N   1 
ATOM   5390  C  CA  . LEU B  1 80  ? 55.825 64.272  100.211 1.00 60.27  ? 80  LEU B CA  1 
ATOM   5391  C  C   . LEU B  1 80  ? 54.426 64.200  99.597  1.00 63.89  ? 80  LEU B C   1 
ATOM   5392  O  O   . LEU B  1 80  ? 54.234 64.657  98.468  1.00 62.73  ? 80  LEU B O   1 
ATOM   5393  C  CB  . LEU B  1 80  ? 56.589 62.954  99.985  1.00 61.51  ? 80  LEU B CB  1 
ATOM   5394  C  CG  . LEU B  1 80  ? 58.075 62.953  100.360 1.00 66.07  ? 80  LEU B CG  1 
ATOM   5395  C  CD1 . LEU B  1 80  ? 58.610 61.548  100.436 1.00 67.45  ? 80  LEU B CD1 1 
ATOM   5396  C  CD2 . LEU B  1 80  ? 58.904 63.791  99.395  1.00 68.11  ? 80  LEU B CD2 1 
ATOM   5397  N  N   . LEU B  1 81  ? 53.443 63.666  100.357 1.00 60.91  ? 81  LEU B N   1 
ATOM   5398  C  CA  . LEU B  1 81  ? 52.045 63.575  99.925  1.00 60.72  ? 81  LEU B CA  1 
ATOM   5399  C  C   . LEU B  1 81  ? 51.412 64.966  99.880  1.00 62.94  ? 81  LEU B C   1 
ATOM   5400  O  O   . LEU B  1 81  ? 50.548 65.222  99.038  1.00 62.12  ? 81  LEU B O   1 
ATOM   5401  C  CB  . LEU B  1 81  ? 51.236 62.642  100.837 1.00 61.61  ? 81  LEU B CB  1 
ATOM   5402  C  CG  . LEU B  1 81  ? 51.532 61.152  100.706 1.00 67.50  ? 81  LEU B CG  1 
ATOM   5403  C  CD1 . LEU B  1 81  ? 51.037 60.398  101.910 1.00 68.48  ? 81  LEU B CD1 1 
ATOM   5404  C  CD2 . LEU B  1 81  ? 50.928 60.575  99.439  1.00 70.34  ? 81  LEU B CD2 1 
ATOM   5405  N  N   . GLY B  1 82  ? 51.872 65.846  100.771 1.00 58.47  ? 82  GLY B N   1 
ATOM   5406  C  CA  . GLY B  1 82  ? 51.448 67.237  100.839 1.00 57.05  ? 82  GLY B CA  1 
ATOM   5407  C  C   . GLY B  1 82  ? 52.037 68.056  99.706  1.00 60.37  ? 82  GLY B C   1 
ATOM   5408  O  O   . GLY B  1 82  ? 51.398 68.999  99.233  1.00 59.55  ? 82  GLY B O   1 
ATOM   5409  N  N   . ALA B  1 83  ? 53.264 67.686  99.253  1.00 56.83  ? 83  ALA B N   1 
ATOM   5410  C  CA  . ALA B  1 83  ? 53.981 68.321  98.138  1.00 55.71  ? 83  ALA B CA  1 
ATOM   5411  C  C   . ALA B  1 83  ? 53.286 68.028  96.808  1.00 59.35  ? 83  ALA B C   1 
ATOM   5412  O  O   . ALA B  1 83  ? 53.302 68.867  95.912  1.00 58.53  ? 83  ALA B O   1 
ATOM   5413  C  CB  . ALA B  1 83  ? 55.421 67.836  98.094  1.00 56.81  ? 83  ALA B CB  1 
ATOM   5414  N  N   . GLU B  1 84  ? 52.680 66.829  96.692  1.00 56.62  ? 84  GLU B N   1 
ATOM   5415  C  CA  . GLU B  1 84  ? 51.906 66.368  95.539  1.00 56.59  ? 84  GLU B CA  1 
ATOM   5416  C  C   . GLU B  1 84  ? 50.587 67.146  95.478  1.00 59.35  ? 84  GLU B C   1 
ATOM   5417  O  O   . GLU B  1 84  ? 50.165 67.548  94.390  1.00 58.60  ? 84  GLU B O   1 
ATOM   5418  C  CB  . GLU B  1 84  ? 51.653 64.850  95.658  1.00 59.31  ? 84  GLU B CB  1 
ATOM   5419  C  CG  . GLU B  1 84  ? 50.880 64.232  94.500  1.00 70.66  ? 84  GLU B CG  1 
ATOM   5420  C  CD  . GLU B  1 84  ? 50.593 62.743  94.580  1.00 90.01  ? 84  GLU B CD  1 
ATOM   5421  O  OE1 . GLU B  1 84  ? 51.410 61.996  95.168  1.00 82.61  ? 84  GLU B OE1 1 
ATOM   5422  O  OE2 . GLU B  1 84  ? 49.559 62.317  94.019  1.00 85.35  ? 84  GLU B OE2 1 
ATOM   5423  N  N   . ALA B  1 85  ? 49.957 67.365  96.663  1.00 55.51  ? 85  ALA B N   1 
ATOM   5424  C  CA  . ALA B  1 85  ? 48.688 68.071  96.872  1.00 54.71  ? 85  ALA B CA  1 
ATOM   5425  C  C   . ALA B  1 85  ? 48.749 69.518  96.386  1.00 56.28  ? 85  ALA B C   1 
ATOM   5426  O  O   . ALA B  1 85  ? 47.823 69.961  95.706  1.00 55.47  ? 85  ALA B O   1 
ATOM   5427  C  CB  . ALA B  1 85  ? 48.302 68.035  98.345  1.00 55.56  ? 85  ALA B CB  1 
ATOM   5428  N  N   . VAL B  1 86  ? 49.839 70.242  96.722  1.00 51.75  ? 86  VAL B N   1 
ATOM   5429  C  CA  . VAL B  1 86  ? 50.056 71.638  96.312  1.00 50.52  ? 86  VAL B CA  1 
ATOM   5430  C  C   . VAL B  1 86  ? 50.537 71.701  94.842  1.00 55.19  ? 86  VAL B C   1 
ATOM   5431  O  O   . VAL B  1 86  ? 50.403 72.745  94.196  1.00 54.71  ? 86  VAL B O   1 
ATOM   5432  C  CB  . VAL B  1 86  ? 51.006 72.421  97.259  1.00 53.30  ? 86  VAL B CB  1 
ATOM   5433  C  CG1 . VAL B  1 86  ? 50.385 72.598  98.633  1.00 53.04  ? 86  VAL B CG1 1 
ATOM   5434  C  CG2 . VAL B  1 86  ? 52.372 71.760  97.375  1.00 53.37  ? 86  VAL B CG2 1 
ATOM   5435  N  N   . GLY B  1 87  ? 51.073 70.585  94.345  1.00 52.24  ? 87  GLY B N   1 
ATOM   5436  C  CA  . GLY B  1 87  ? 51.563 70.443  92.980  1.00 52.14  ? 87  GLY B CA  1 
ATOM   5437  C  C   . GLY B  1 87  ? 52.908 71.095  92.741  1.00 55.51  ? 87  GLY B C   1 
ATOM   5438  O  O   . GLY B  1 87  ? 53.043 71.897  91.811  1.00 54.92  ? 87  GLY B O   1 
ATOM   5439  N  N   . LEU B  1 88  ? 53.915 70.753  93.576  1.00 51.60  ? 88  LEU B N   1 
ATOM   5440  C  CA  . LEU B  1 88  ? 55.273 71.290  93.451  1.00 50.72  ? 88  LEU B CA  1 
ATOM   5441  C  C   . LEU B  1 88  ? 55.971 70.657  92.266  1.00 54.75  ? 88  LEU B C   1 
ATOM   5442  O  O   . LEU B  1 88  ? 56.015 69.432  92.158  1.00 54.95  ? 88  LEU B O   1 
ATOM   5443  C  CB  . LEU B  1 88  ? 56.109 71.086  94.728  1.00 50.72  ? 88  LEU B CB  1 
ATOM   5444  C  CG  . LEU B  1 88  ? 55.687 71.837  95.981  1.00 54.49  ? 88  LEU B CG  1 
ATOM   5445  C  CD1 . LEU B  1 88  ? 56.462 71.352  97.173  1.00 54.91  ? 88  LEU B CD1 1 
ATOM   5446  C  CD2 . LEU B  1 88  ? 55.859 73.337  95.832  1.00 56.17  ? 88  LEU B CD2 1 
ATOM   5447  N  N   . VAL B  1 89  ? 56.493 71.494  91.367  1.00 51.15  ? 89  VAL B N   1 
ATOM   5448  C  CA  . VAL B  1 89  ? 57.179 71.051  90.158  1.00 51.31  ? 89  VAL B CA  1 
ATOM   5449  C  C   . VAL B  1 89  ? 58.687 70.978  90.442  1.00 55.48  ? 89  VAL B C   1 
ATOM   5450  O  O   . VAL B  1 89  ? 59.303 71.980  90.821  1.00 54.55  ? 89  VAL B O   1 
ATOM   5451  C  CB  . VAL B  1 89  ? 56.828 71.967  88.955  1.00 54.45  ? 89  VAL B CB  1 
ATOM   5452  C  CG1 . VAL B  1 89  ? 57.688 71.654  87.735  1.00 54.89  ? 89  VAL B CG1 1 
ATOM   5453  C  CG2 . VAL B  1 89  ? 55.344 71.873  88.604  1.00 54.21  ? 89  VAL B CG2 1 
ATOM   5454  N  N   . LYS B  1 90  ? 59.258 69.773  90.284  1.00 53.21  ? 90  LYS B N   1 
ATOM   5455  C  CA  . LYS B  1 90  ? 60.680 69.487  90.501  1.00 53.90  ? 90  LYS B CA  1 
ATOM   5456  C  C   . LYS B  1 90  ? 61.300 68.888  89.240  1.00 60.64  ? 90  LYS B C   1 
ATOM   5457  O  O   . LYS B  1 90  ? 60.578 68.308  88.426  1.00 60.98  ? 90  LYS B O   1 
ATOM   5458  C  CB  . LYS B  1 90  ? 60.872 68.522  91.693  1.00 56.79  ? 90  LYS B CB  1 
ATOM   5459  C  CG  . LYS B  1 90  ? 60.363 69.032  93.041  1.00 66.04  ? 90  LYS B CG  1 
ATOM   5460  C  CD  . LYS B  1 90  ? 61.390 69.893  93.771  1.00 73.87  ? 90  LYS B CD  1 
ATOM   5461  C  CE  . LYS B  1 90  ? 60.870 70.407  95.088  1.00 83.72  ? 90  LYS B CE  1 
ATOM   5462  N  NZ  . LYS B  1 90  ? 59.777 71.403  94.914  1.00 92.59  ? 90  LYS B NZ  1 
ATOM   5463  N  N   . GLU B  1 91  ? 62.635 69.018  89.080  1.00 58.89  ? 91  GLU B N   1 
ATOM   5464  C  CA  . GLU B  1 91  ? 63.357 68.471  87.928  1.00 60.25  ? 91  GLU B CA  1 
ATOM   5465  C  C   . GLU B  1 91  ? 63.506 66.956  88.051  1.00 67.52  ? 91  GLU B C   1 
ATOM   5466  O  O   . GLU B  1 91  ? 63.863 66.448  89.119  1.00 67.42  ? 91  GLU B O   1 
ATOM   5467  C  CB  . GLU B  1 91  ? 64.739 69.128  87.769  1.00 61.43  ? 91  GLU B CB  1 
ATOM   5468  C  CG  . GLU B  1 91  ? 65.337 68.951  86.383  1.00 72.57  ? 91  GLU B CG  1 
ATOM   5469  C  CD  . GLU B  1 91  ? 66.851 69.012  86.319  1.00 94.05  ? 91  GLU B CD  1 
ATOM   5470  O  OE1 . GLU B  1 91  ? 67.410 70.121  86.475  1.00 87.17  ? 91  GLU B OE1 1 
ATOM   5471  O  OE2 . GLU B  1 91  ? 67.478 67.954  86.080  1.00 89.53  ? 91  GLU B OE2 1 
ATOM   5472  N  N   . CYS B  1 92  ? 63.232 66.246  86.950  1.00 66.80  ? 92  CYS B N   1 
ATOM   5473  C  CA  . CYS B  1 92  ? 63.350 64.793  86.867  1.00 69.13  ? 92  CYS B CA  1 
ATOM   5474  C  C   . CYS B  1 92  ? 64.758 64.408  86.391  1.00 75.46  ? 92  CYS B C   1 
ATOM   5475  O  O   . CYS B  1 92  ? 65.568 65.288  86.081  1.00 74.96  ? 92  CYS B O   1 
ATOM   5476  C  CB  . CYS B  1 92  ? 62.275 64.219  85.950  1.00 70.24  ? 92  CYS B CB  1 
ATOM   5477  S  SG  . CYS B  1 92  ? 60.583 64.594  86.465  1.00 73.55  ? 92  CYS B SG  1 
ATOM   5478  N  N   . ASN B  1 93  ? 65.044 63.093  86.328  1.00 73.86  ? 93  ASN B N   1 
ATOM   5479  C  CA  . ASN B  1 93  ? 66.334 62.562  85.888  1.00 74.88  ? 93  ASN B CA  1 
ATOM   5480  C  C   . ASN B  1 93  ? 66.558 62.784  84.377  1.00 79.06  ? 93  ASN B C   1 
ATOM   5481  O  O   . ASN B  1 93  ? 67.709 62.813  83.936  1.00 78.99  ? 93  ASN B O   1 
ATOM   5482  C  CB  . ASN B  1 93  ? 66.455 61.079  86.246  1.00 77.26  ? 93  ASN B CB  1 
ATOM   5483  C  CG  . ASN B  1 93  ? 66.538 60.821  87.734  1.00 99.28  ? 93  ASN B CG  1 
ATOM   5484  O  OD1 . ASN B  1 93  ? 67.412 61.341  88.440  1.00 94.24  ? 93  ASN B OD1 1 
ATOM   5485  N  ND2 . ASN B  1 93  ? 65.644 59.989  88.244  1.00 90.18  ? 93  ASN B ND2 1 
ATOM   5486  N  N   . ASP B  1 94  ? 65.467 62.979  83.601  1.00 75.63  ? 94  ASP B N   1 
ATOM   5487  C  CA  . ASP B  1 94  ? 65.531 63.240  82.159  1.00 75.89  ? 94  ASP B CA  1 
ATOM   5488  C  C   . ASP B  1 94  ? 65.557 64.765  81.881  1.00 78.63  ? 94  ASP B C   1 
ATOM   5489  O  O   . ASP B  1 94  ? 65.288 65.198  80.757  1.00 77.74  ? 94  ASP B O   1 
ATOM   5490  C  CB  . ASP B  1 94  ? 64.370 62.538  81.412  1.00 78.25  ? 94  ASP B CB  1 
ATOM   5491  C  CG  . ASP B  1 94  ? 62.975 63.066  81.693  1.00 85.94  ? 94  ASP B CG  1 
ATOM   5492  O  OD1 . ASP B  1 94  ? 62.665 63.331  82.872  1.00 86.12  ? 94  ASP B OD1 1 
ATOM   5493  O  OD2 . ASP B  1 94  ? 62.177 63.158  80.741  1.00 90.78  ? 94  ASP B OD2 1 
ATOM   5494  N  N   . ASN B  1 95  ? 65.903 65.563  82.923  1.00 74.89  ? 95  ASN B N   1 
ATOM   5495  C  CA  . ASN B  1 95  ? 66.049 67.029  82.945  1.00 73.69  ? 95  ASN B CA  1 
ATOM   5496  C  C   . ASN B  1 95  ? 64.724 67.795  82.645  1.00 76.46  ? 95  ASN B C   1 
ATOM   5497  O  O   . ASN B  1 95  ? 64.754 69.020  82.467  1.00 75.11  ? 95  ASN B O   1 
ATOM   5498  C  CB  . ASN B  1 95  ? 67.179 67.492  82.003  1.00 75.48  ? 95  ASN B CB  1 
ATOM   5499  C  CG  . ASN B  1 95  ? 68.510 66.835  82.292  1.00 103.63 ? 95  ASN B CG  1 
ATOM   5500  O  OD1 . ASN B  1 95  ? 69.101 67.001  83.368  1.00 100.56 ? 95  ASN B OD1 1 
ATOM   5501  N  ND2 . ASN B  1 95  ? 69.002 66.056  81.340  1.00 96.18  ? 95  ASN B ND2 1 
ATOM   5502  N  N   . THR B  1 96  ? 63.570 67.090  82.653  1.00 72.75  ? 96  THR B N   1 
ATOM   5503  C  CA  . THR B  1 96  ? 62.250 67.698  82.436  1.00 71.04  ? 96  THR B CA  1 
ATOM   5504  C  C   . THR B  1 96  ? 61.647 68.084  83.782  1.00 72.05  ? 96  THR B C   1 
ATOM   5505  O  O   . THR B  1 96  ? 61.843 67.373  84.769  1.00 71.93  ? 96  THR B O   1 
ATOM   5506  C  CB  . THR B  1 96  ? 61.302 66.769  81.648  1.00 78.41  ? 96  THR B CB  1 
ATOM   5507  O  OG1 . THR B  1 96  ? 61.132 65.535  82.345  1.00 78.66  ? 96  THR B OG1 1 
ATOM   5508  C  CG2 . THR B  1 96  ? 61.765 66.520  80.220  1.00 76.90  ? 96  THR B CG2 1 
ATOM   5509  N  N   . MET B  1 97  ? 60.919 69.208  83.818  1.00 66.20  ? 97  MET B N   1 
ATOM   5510  C  CA  . MET B  1 97  ? 60.270 69.712  85.029  1.00 64.59  ? 97  MET B CA  1 
ATOM   5511  C  C   . MET B  1 97  ? 58.836 69.191  85.096  1.00 66.79  ? 97  MET B C   1 
ATOM   5512  O  O   . MET B  1 97  ? 58.015 69.532  84.246  1.00 66.20  ? 97  MET B O   1 
ATOM   5513  C  CB  . MET B  1 97  ? 60.295 71.250  85.070  1.00 65.85  ? 97  MET B CB  1 
ATOM   5514  C  CG  . MET B  1 97  ? 61.676 71.845  84.993  1.00 69.64  ? 97  MET B CG  1 
ATOM   5515  S  SD  . MET B  1 97  ? 62.507 71.846  86.587  1.00 74.10  ? 97  MET B SD  1 
ATOM   5516  C  CE  . MET B  1 97  ? 64.084 72.545  86.121  1.00 70.98  ? 97  MET B CE  1 
ATOM   5517  N  N   . ARG B  1 98  ? 58.546 68.328  86.077  1.00 62.61  ? 98  ARG B N   1 
ATOM   5518  C  CA  . ARG B  1 98  ? 57.215 67.733  86.244  1.00 62.16  ? 98  ARG B CA  1 
ATOM   5519  C  C   . ARG B  1 98  ? 56.708 67.907  87.675  1.00 63.30  ? 98  ARG B C   1 
ATOM   5520  O  O   . ARG B  1 98  ? 57.511 68.037  88.602  1.00 62.26  ? 98  ARG B O   1 
ATOM   5521  C  CB  . ARG B  1 98  ? 57.232 66.231  85.877  1.00 64.29  ? 98  ARG B CB  1 
ATOM   5522  C  CG  . ARG B  1 98  ? 57.678 65.908  84.450  1.00 77.35  ? 98  ARG B CG  1 
ATOM   5523  C  CD  . ARG B  1 98  ? 56.520 65.730  83.490  1.00 89.32  ? 98  ARG B CD  1 
ATOM   5524  N  NE  . ARG B  1 98  ? 56.984 65.309  82.167  1.00 97.12  ? 98  ARG B NE  1 
ATOM   5525  C  CZ  . ARG B  1 98  ? 57.115 64.043  81.780  1.00 111.02 ? 98  ARG B CZ  1 
ATOM   5526  N  NH1 . ARG B  1 98  ? 56.817 63.052  82.613  1.00 99.58  ? 98  ARG B NH1 1 
ATOM   5527  N  NH2 . ARG B  1 98  ? 57.543 63.759  80.558  1.00 98.20  ? 98  ARG B NH2 1 
ATOM   5528  N  N   . ALA B  1 99  ? 55.374 67.899  87.851  1.00 58.56  ? 99  ALA B N   1 
ATOM   5529  C  CA  . ALA B  1 99  ? 54.736 68.010  89.162  1.00 57.66  ? 99  ALA B CA  1 
ATOM   5530  C  C   . ALA B  1 99  ? 54.985 66.734  89.972  1.00 61.69  ? 99  ALA B C   1 
ATOM   5531  O  O   . ALA B  1 99  ? 54.886 65.629  89.427  1.00 62.51  ? 99  ALA B O   1 
ATOM   5532  C  CB  . ALA B  1 99  ? 53.246 68.263  89.004  1.00 58.22  ? 99  ALA B CB  1 
ATOM   5533  N  N   . PHE B  1 100 ? 55.345 66.893  91.257  1.00 57.01  ? 100 PHE B N   1 
ATOM   5534  C  CA  . PHE B  1 100 ? 55.663 65.782  92.148  1.00 57.45  ? 100 PHE B CA  1 
ATOM   5535  C  C   . PHE B  1 100 ? 54.457 64.896  92.426  1.00 62.48  ? 100 PHE B C   1 
ATOM   5536  O  O   . PHE B  1 100 ? 53.339 65.385  92.575  1.00 61.75  ? 100 PHE B O   1 
ATOM   5537  C  CB  . PHE B  1 100 ? 56.273 66.271  93.473  1.00 58.51  ? 100 PHE B CB  1 
ATOM   5538  C  CG  . PHE B  1 100 ? 56.770 65.154  94.366  1.00 60.81  ? 100 PHE B CG  1 
ATOM   5539  C  CD1 . PHE B  1 100 ? 57.923 64.446  94.046  1.00 64.53  ? 100 PHE B CD1 1 
ATOM   5540  C  CD2 . PHE B  1 100 ? 56.070 64.792  95.510  1.00 63.05  ? 100 PHE B CD2 1 
ATOM   5541  C  CE1 . PHE B  1 100 ? 58.367 63.397  94.856  1.00 66.26  ? 100 PHE B CE1 1 
ATOM   5542  C  CE2 . PHE B  1 100 ? 56.518 63.745  96.320  1.00 66.67  ? 100 PHE B CE2 1 
ATOM   5543  C  CZ  . PHE B  1 100 ? 57.663 63.056  95.988  1.00 65.44  ? 100 PHE B CZ  1 
ATOM   5544  N  N   . THR B  1 101 ? 54.716 63.580  92.465  1.00 60.54  ? 101 THR B N   1 
ATOM   5545  C  CA  . THR B  1 101 ? 53.791 62.487  92.758  1.00 61.63  ? 101 THR B CA  1 
ATOM   5546  C  C   . THR B  1 101 ? 54.576 61.465  93.592  1.00 67.18  ? 101 THR B C   1 
ATOM   5547  O  O   . THR B  1 101 ? 55.710 61.135  93.232  1.00 67.14  ? 101 THR B O   1 
ATOM   5548  C  CB  . THR B  1 101 ? 53.203 61.899  91.455  1.00 71.73  ? 101 THR B CB  1 
ATOM   5549  O  OG1 . THR B  1 101 ? 52.676 62.952  90.648  1.00 71.75  ? 101 THR B OG1 1 
ATOM   5550  C  CG2 . THR B  1 101 ? 52.116 60.857  91.708  1.00 71.79  ? 101 THR B CG2 1 
ATOM   5551  N  N   . TYR B  1 102 ? 53.990 60.982  94.708  1.00 64.58  ? 102 TYR B N   1 
ATOM   5552  C  CA  . TYR B  1 102 ? 54.640 60.013  95.594  1.00 65.63  ? 102 TYR B CA  1 
ATOM   5553  C  C   . TYR B  1 102 ? 54.902 58.677  94.875  1.00 72.00  ? 102 TYR B C   1 
ATOM   5554  O  O   . TYR B  1 102 ? 55.894 58.019  95.177  1.00 72.64  ? 102 TYR B O   1 
ATOM   5555  C  CB  . TYR B  1 102 ? 53.825 59.788  96.881  1.00 67.14  ? 102 TYR B CB  1 
ATOM   5556  C  CG  . TYR B  1 102 ? 54.559 58.965  97.923  1.00 70.01  ? 102 TYR B CG  1 
ATOM   5557  C  CD1 . TYR B  1 102 ? 55.539 59.538  98.730  1.00 71.28  ? 102 TYR B CD1 1 
ATOM   5558  C  CD2 . TYR B  1 102 ? 54.289 57.609  98.088  1.00 72.25  ? 102 TYR B CD2 1 
ATOM   5559  C  CE1 . TYR B  1 102 ? 56.236 58.780  99.671  1.00 72.55  ? 102 TYR B CE1 1 
ATOM   5560  C  CE2 . TYR B  1 102 ? 54.979 56.842  99.027  1.00 73.86  ? 102 TYR B CE2 1 
ATOM   5561  C  CZ  . TYR B  1 102 ? 55.953 57.432  99.815  1.00 79.37  ? 102 TYR B CZ  1 
ATOM   5562  O  OH  . TYR B  1 102 ? 56.633 56.684  100.744 1.00 80.03  ? 102 TYR B OH  1 
ATOM   5563  N  N   . ARG B  1 103 ? 54.032 58.287  93.925  1.00 69.45  ? 103 ARG B N   1 
ATOM   5564  C  CA  . ARG B  1 103 ? 54.192 57.053  93.154  1.00 70.92  ? 103 ARG B CA  1 
ATOM   5565  C  C   . ARG B  1 103 ? 55.384 57.151  92.183  1.00 75.97  ? 103 ARG B C   1 
ATOM   5566  O  O   . ARG B  1 103 ? 56.016 56.133  91.890  1.00 76.72  ? 103 ARG B O   1 
ATOM   5567  C  CB  . ARG B  1 103 ? 52.904 56.733  92.381  1.00 71.35  ? 103 ARG B CB  1 
ATOM   5568  N  N   . THR B  1 104 ? 55.697 58.385  91.716  1.00 71.96  ? 104 THR B N   1 
ATOM   5569  C  CA  . THR B  1 104 ? 56.769 58.682  90.753  1.00 71.79  ? 104 THR B CA  1 
ATOM   5570  C  C   . THR B  1 104 ? 57.961 59.406  91.420  1.00 75.70  ? 104 THR B C   1 
ATOM   5571  O  O   . THR B  1 104 ? 58.757 60.038  90.718  1.00 74.67  ? 104 THR B O   1 
ATOM   5572  C  CB  . THR B  1 104 ? 56.208 59.532  89.584  1.00 76.80  ? 104 THR B CB  1 
ATOM   5573  O  OG1 . THR B  1 104 ? 56.034 60.885  90.011  1.00 74.42  ? 104 THR B OG1 1 
ATOM   5574  C  CG2 . THR B  1 104 ? 54.902 58.986  89.015  1.00 75.63  ? 104 THR B CG2 1 
ATOM   5575  N  N   . ARG B  1 105 ? 58.091 59.296  92.759  1.00 73.06  ? 105 ARG B N   1 
ATOM   5576  C  CA  . ARG B  1 105 ? 59.127 59.967  93.555  1.00 72.61  ? 105 ARG B CA  1 
ATOM   5577  C  C   . ARG B  1 105 ? 60.570 59.609  93.136  1.00 78.37  ? 105 ARG B C   1 
ATOM   5578  O  O   . ARG B  1 105 ? 61.449 60.473  93.213  1.00 77.76  ? 105 ARG B O   1 
ATOM   5579  C  CB  . ARG B  1 105 ? 58.931 59.704  95.064  1.00 71.97  ? 105 ARG B CB  1 
ATOM   5580  C  CG  . ARG B  1 105 ? 59.092 58.254  95.518  1.00 80.51  ? 105 ARG B CG  1 
ATOM   5581  C  CD  . ARG B  1 105 ? 58.651 58.082  96.958  1.00 85.36  ? 105 ARG B CD  1 
ATOM   5582  N  NE  . ARG B  1 105 ? 59.064 56.793  97.508  1.00 90.61  ? 105 ARG B NE  1 
ATOM   5583  C  CZ  . ARG B  1 105 ? 58.366 55.669  97.394  1.00 104.14 ? 105 ARG B CZ  1 
ATOM   5584  N  NH1 . ARG B  1 105 ? 57.212 55.660  96.736  1.00 85.31  ? 105 ARG B NH1 1 
ATOM   5585  N  NH2 . ARG B  1 105 ? 58.818 54.544  97.928  1.00 97.24  ? 105 ARG B NH2 1 
ATOM   5586  N  N   . GLN B  1 106 ? 60.799 58.364  92.680  1.00 76.46  ? 106 GLN B N   1 
ATOM   5587  C  CA  . GLN B  1 106 ? 62.117 57.852  92.292  1.00 77.35  ? 106 GLN B CA  1 
ATOM   5588  C  C   . GLN B  1 106 ? 62.673 58.525  91.025  1.00 81.75  ? 106 GLN B C   1 
ATOM   5589  O  O   . GLN B  1 106 ? 63.893 58.584  90.858  1.00 81.69  ? 106 GLN B O   1 
ATOM   5590  C  CB  . GLN B  1 106 ? 62.070 56.323  92.090  1.00 80.30  ? 106 GLN B CB  1 
ATOM   5591  C  CG  . GLN B  1 106 ? 61.460 55.529  93.256  1.00 89.46  ? 106 GLN B CG  1 
ATOM   5592  C  CD  . GLN B  1 106 ? 62.355 55.345  94.464  1.00 101.30 ? 106 GLN B CD  1 
ATOM   5593  O  OE1 . GLN B  1 106 ? 63.385 56.013  94.646  1.00 94.91  ? 106 GLN B OE1 1 
ATOM   5594  N  NE2 . GLN B  1 106 ? 61.954 54.433  95.341  1.00 91.00  ? 106 GLN B NE2 1 
ATOM   5595  N  N   . ASN B  1 107 ? 61.785 59.034  90.149  1.00 78.39  ? 107 ASN B N   1 
ATOM   5596  C  CA  . ASN B  1 107 ? 62.146 59.679  88.884  1.00 78.27  ? 107 ASN B CA  1 
ATOM   5597  C  C   . ASN B  1 107 ? 62.648 61.126  89.052  1.00 81.04  ? 107 ASN B C   1 
ATOM   5598  O  O   . ASN B  1 107 ? 63.226 61.665  88.106  1.00 80.14  ? 107 ASN B O   1 
ATOM   5599  C  CB  . ASN B  1 107 ? 60.959 59.653  87.920  1.00 80.31  ? 107 ASN B CB  1 
ATOM   5600  C  CG  . ASN B  1 107 ? 60.674 58.281  87.370  1.00 112.81 ? 107 ASN B CG  1 
ATOM   5601  O  OD1 . ASN B  1 107 ? 61.221 57.871  86.340  1.00 112.22 ? 107 ASN B OD1 1 
ATOM   5602  N  ND2 . ASN B  1 107 ? 59.832 57.526  88.062  1.00 105.76 ? 107 ASN B ND2 1 
ATOM   5603  N  N   . PHE B  1 108 ? 62.445 61.749  90.231  1.00 77.30  ? 108 PHE B N   1 
ATOM   5604  C  CA  . PHE B  1 108 ? 62.870 63.132  90.477  1.00 75.85  ? 108 PHE B CA  1 
ATOM   5605  C  C   . PHE B  1 108 ? 64.331 63.199  90.907  1.00 81.13  ? 108 PHE B C   1 
ATOM   5606  O  O   . PHE B  1 108 ? 64.764 62.428  91.765  1.00 81.35  ? 108 PHE B O   1 
ATOM   5607  C  CB  . PHE B  1 108 ? 61.956 63.824  91.505  1.00 76.22  ? 108 PHE B CB  1 
ATOM   5608  C  CG  . PHE B  1 108 ? 60.572 64.068  90.955  1.00 76.97  ? 108 PHE B CG  1 
ATOM   5609  C  CD1 . PHE B  1 108 ? 60.292 65.209  90.214  1.00 78.82  ? 108 PHE B CD1 1 
ATOM   5610  C  CD2 . PHE B  1 108 ? 59.562 63.129  91.126  1.00 79.50  ? 108 PHE B CD2 1 
ATOM   5611  C  CE1 . PHE B  1 108 ? 59.022 65.416  89.674  1.00 79.35  ? 108 PHE B CE1 1 
ATOM   5612  C  CE2 . PHE B  1 108 ? 58.294 63.332  90.574  1.00 81.93  ? 108 PHE B CE2 1 
ATOM   5613  C  CZ  . PHE B  1 108 ? 58.034 64.471  89.847  1.00 79.03  ? 108 PHE B CZ  1 
ATOM   5614  N  N   . LYS B  1 109 ? 65.090 64.120  90.281  1.00 78.28  ? 109 LYS B N   1 
ATOM   5615  C  CA  . LYS B  1 109 ? 66.516 64.346  90.526  1.00 78.73  ? 109 LYS B CA  1 
ATOM   5616  C  C   . LYS B  1 109 ? 66.745 64.856  91.948  1.00 82.68  ? 109 LYS B C   1 
ATOM   5617  O  O   . LYS B  1 109 ? 66.063 65.780  92.395  1.00 81.29  ? 109 LYS B O   1 
ATOM   5618  C  CB  . LYS B  1 109 ? 67.096 65.333  89.494  1.00 80.84  ? 109 LYS B CB  1 
ATOM   5619  C  CG  . LYS B  1 109 ? 68.618 65.303  89.418  1.00 95.02  ? 109 LYS B CG  1 
ATOM   5620  C  CD  . LYS B  1 109 ? 69.193 66.474  88.640  1.00 103.75 ? 109 LYS B CD  1 
ATOM   5621  C  CE  . LYS B  1 109 ? 70.671 66.657  88.900  1.00 115.34 ? 109 LYS B CE  1 
ATOM   5622  N  NZ  . LYS B  1 109 ? 71.495 65.573  88.295  1.00 125.89 ? 109 LYS B NZ  1 
ATOM   5623  N  N   . GLY B  1 110 ? 67.688 64.223  92.638  1.00 80.65  ? 110 GLY B N   1 
ATOM   5624  C  CA  . GLY B  1 110 ? 68.051 64.557  94.009  1.00 80.48  ? 110 GLY B CA  1 
ATOM   5625  C  C   . GLY B  1 110 ? 67.228 63.858  95.073  1.00 84.97  ? 110 GLY B C   1 
ATOM   5626  O  O   . GLY B  1 110 ? 67.401 64.141  96.261  1.00 84.41  ? 110 GLY B O   1 
ATOM   5627  N  N   . PHE B  1 111 ? 66.328 62.942  94.668  1.00 82.19  ? 111 PHE B N   1 
ATOM   5628  C  CA  . PHE B  1 111 ? 65.486 62.204  95.605  1.00 82.58  ? 111 PHE B CA  1 
ATOM   5629  C  C   . PHE B  1 111 ? 66.173 60.913  96.053  1.00 90.18  ? 111 PHE B C   1 
ATOM   5630  O  O   . PHE B  1 111 ? 66.775 60.217  95.235  1.00 91.17  ? 111 PHE B O   1 
ATOM   5631  C  CB  . PHE B  1 111 ? 64.105 61.895  94.995  1.00 83.98  ? 111 PHE B CB  1 
ATOM   5632  C  CG  . PHE B  1 111 ? 63.116 61.326  95.986  1.00 85.45  ? 111 PHE B CG  1 
ATOM   5633  C  CD1 . PHE B  1 111 ? 62.344 62.165  96.781  1.00 87.29  ? 111 PHE B CD1 1 
ATOM   5634  C  CD2 . PHE B  1 111 ? 62.971 59.952  96.141  1.00 88.61  ? 111 PHE B CD2 1 
ATOM   5635  C  CE1 . PHE B  1 111 ? 61.451 61.639  97.719  1.00 88.34  ? 111 PHE B CE1 1 
ATOM   5636  C  CE2 . PHE B  1 111 ? 62.089 59.429  97.088  1.00 91.56  ? 111 PHE B CE2 1 
ATOM   5637  C  CZ  . PHE B  1 111 ? 61.330 60.275  97.865  1.00 88.58  ? 111 PHE B CZ  1 
ATOM   5638  N  N   . ASP B  1 112 ? 66.053 60.591  97.353  1.00 88.29  ? 112 ASP B N   1 
ATOM   5639  C  CA  . ASP B  1 112 ? 66.590 59.384  97.992  1.00 90.11  ? 112 ASP B CA  1 
ATOM   5640  C  C   . ASP B  1 112 ? 65.771 59.071  99.239  1.00 95.17  ? 112 ASP B C   1 
ATOM   5641  O  O   . ASP B  1 112 ? 65.447 59.994  99.992  1.00 93.64  ? 112 ASP B O   1 
ATOM   5642  C  CB  . ASP B  1 112 ? 68.080 59.552  98.344  1.00 92.35  ? 112 ASP B CB  1 
ATOM   5643  N  N   . ASP B  1 113 ? 65.418 57.785  99.448  1.00 93.91  ? 113 ASP B N   1 
ATOM   5644  C  CA  . ASP B  1 113 ? 64.637 57.352  100.615 1.00 94.54  ? 113 ASP B CA  1 
ATOM   5645  C  C   . ASP B  1 113 ? 65.471 57.460  101.904 1.00 99.88  ? 113 ASP B C   1 
ATOM   5646  O  O   . ASP B  1 113 ? 64.907 57.655  102.984 1.00 98.88  ? 113 ASP B O   1 
ATOM   5647  C  CB  . ASP B  1 113 ? 64.109 55.922  100.427 1.00 97.90  ? 113 ASP B CB  1 
ATOM   5648  N  N   . ASN B  1 114 ? 66.815 57.365  101.773 1.00 98.21  ? 114 ASN B N   1 
ATOM   5649  C  CA  . ASN B  1 114 ? 67.780 57.501  102.867 1.00 98.66  ? 114 ASN B CA  1 
ATOM   5650  C  C   . ASN B  1 114 ? 67.907 58.975  103.291 1.00 101.65 ? 114 ASN B C   1 
ATOM   5651  O  O   . ASN B  1 114 ? 68.333 59.260  104.413 1.00 101.55 ? 114 ASN B O   1 
ATOM   5652  C  CB  . ASN B  1 114 ? 69.144 56.944  102.447 1.00 100.79 ? 114 ASN B CB  1 
ATOM   5653  N  N   . ASN B  1 115 ? 67.522 59.903  102.388 1.00 96.75  ? 115 ASN B N   1 
ATOM   5654  C  CA  . ASN B  1 115 ? 67.559 61.351  102.591 1.00 94.87  ? 115 ASN B CA  1 
ATOM   5655  C  C   . ASN B  1 115 ? 66.218 61.905  103.110 1.00 96.60  ? 115 ASN B C   1 
ATOM   5656  O  O   . ASN B  1 115 ? 65.216 61.187  103.176 1.00 96.67  ? 115 ASN B O   1 
ATOM   5657  C  CB  . ASN B  1 115 ? 67.933 62.051  101.274 1.00 95.28  ? 115 ASN B CB  1 
ATOM   5658  N  N   . ASP B  1 116 ? 66.224 63.199  103.475 1.00 90.60  ? 116 ASP B N   1 
ATOM   5659  C  CA  . ASP B  1 116 ? 65.075 63.979  103.937 1.00 88.52  ? 116 ASP B CA  1 
ATOM   5660  C  C   . ASP B  1 116 ? 65.213 65.424  103.432 1.00 88.87  ? 116 ASP B C   1 
ATOM   5661  O  O   . ASP B  1 116 ? 64.310 66.241  103.633 1.00 87.76  ? 116 ASP B O   1 
ATOM   5662  C  CB  . ASP B  1 116 ? 64.967 63.931  105.472 1.00 90.45  ? 116 ASP B CB  1 
ATOM   5663  N  N   . ASP B  1 117 ? 66.342 65.714  102.744 1.00 83.15  ? 117 ASP B N   1 
ATOM   5664  C  CA  . ASP B  1 117 ? 66.716 67.025  102.207 1.00 80.78  ? 117 ASP B CA  1 
ATOM   5665  C  C   . ASP B  1 117 ? 66.193 67.280  100.764 1.00 81.03  ? 117 ASP B C   1 
ATOM   5666  O  O   . ASP B  1 117 ? 66.732 68.148  100.065 1.00 80.22  ? 117 ASP B O   1 
ATOM   5667  C  CB  . ASP B  1 117 ? 68.248 67.175  102.249 1.00 83.07  ? 117 ASP B CB  1 
ATOM   5668  N  N   . PHE B  1 118 ? 65.126 66.570  100.339 1.00 74.81  ? 118 PHE B N   1 
ATOM   5669  C  CA  . PHE B  1 118 ? 64.519 66.743  99.013  1.00 72.54  ? 118 PHE B CA  1 
ATOM   5670  C  C   . PHE B  1 118 ? 63.712 68.042  98.989  1.00 72.12  ? 118 PHE B C   1 
ATOM   5671  O  O   . PHE B  1 118 ? 63.963 68.907  98.148  1.00 71.29  ? 118 PHE B O   1 
ATOM   5672  C  CB  . PHE B  1 118 ? 63.645 65.527  98.651  1.00 74.81  ? 118 PHE B CB  1 
ATOM   5673  C  CG  . PHE B  1 118 ? 62.920 65.602  97.326  1.00 75.74  ? 118 PHE B CG  1 
ATOM   5674  C  CD1 . PHE B  1 118 ? 63.614 65.493  96.125  1.00 78.97  ? 118 PHE B CD1 1 
ATOM   5675  C  CD2 . PHE B  1 118 ? 61.537 65.721  97.280  1.00 76.96  ? 118 PHE B CD2 1 
ATOM   5676  C  CE1 . PHE B  1 118 ? 62.941 65.542  94.901  1.00 79.43  ? 118 PHE B CE1 1 
ATOM   5677  C  CE2 . PHE B  1 118 ? 60.865 65.764  96.055  1.00 79.58  ? 118 PHE B CE2 1 
ATOM   5678  C  CZ  . PHE B  1 118 ? 61.572 65.677  94.875  1.00 77.95  ? 118 PHE B CZ  1 
ATOM   5679  N  N   . LEU B  1 119 ? 62.772 68.187  99.935  1.00 65.72  ? 119 LEU B N   1 
ATOM   5680  C  CA  . LEU B  1 119 ? 61.953 69.387  100.079 1.00 63.13  ? 119 LEU B CA  1 
ATOM   5681  C  C   . LEU B  1 119 ? 62.646 70.351  101.032 1.00 64.13  ? 119 LEU B C   1 
ATOM   5682  O  O   . LEU B  1 119 ? 63.136 69.916  102.077 1.00 64.44  ? 119 LEU B O   1 
ATOM   5683  C  CB  . LEU B  1 119 ? 60.540 69.037  100.597 1.00 63.01  ? 119 LEU B CB  1 
ATOM   5684  C  CG  . LEU B  1 119 ? 59.628 68.200  99.690  1.00 67.89  ? 119 LEU B CG  1 
ATOM   5685  C  CD1 . LEU B  1 119 ? 58.476 67.606  100.476 1.00 68.20  ? 119 LEU B CD1 1 
ATOM   5686  C  CD2 . LEU B  1 119 ? 59.089 69.024  98.535  1.00 69.46  ? 119 LEU B CD2 1 
ATOM   5687  N  N   . THR B  1 120 ? 62.697 71.650  100.687 1.00 57.86  ? 120 THR B N   1 
ATOM   5688  C  CA  . THR B  1 120 ? 63.326 72.662  101.549 1.00 56.31  ? 120 THR B CA  1 
ATOM   5689  C  C   . THR B  1 120 ? 62.416 72.954  102.742 1.00 58.00  ? 120 THR B C   1 
ATOM   5690  O  O   . THR B  1 120 ? 61.242 72.571  102.724 1.00 57.35  ? 120 THR B O   1 
ATOM   5691  C  CB  . THR B  1 120 ? 63.673 73.957  100.773 1.00 62.89  ? 120 THR B CB  1 
ATOM   5692  O  OG1 . THR B  1 120 ? 62.486 74.591  100.295 1.00 58.98  ? 120 THR B OG1 1 
ATOM   5693  C  CG2 . THR B  1 120 ? 64.662 73.727  99.636  1.00 63.11  ? 120 THR B CG2 1 
ATOM   5694  N  N   . MET B  1 121 ? 62.953 73.627  103.779 1.00 53.24  ? 121 MET B N   1 
ATOM   5695  C  CA  . MET B  1 121 ? 62.184 74.000  104.969 1.00 51.94  ? 121 MET B CA  1 
ATOM   5696  C  C   . MET B  1 121 ? 61.057 74.973  104.585 1.00 52.36  ? 121 MET B C   1 
ATOM   5697  O  O   . MET B  1 121 ? 59.949 74.849  105.105 1.00 51.66  ? 121 MET B O   1 
ATOM   5698  C  CB  . MET B  1 121 ? 63.096 74.608  106.044 1.00 54.37  ? 121 MET B CB  1 
ATOM   5699  C  CG  . MET B  1 121 ? 62.421 74.733  107.387 1.00 58.09  ? 121 MET B CG  1 
ATOM   5700  S  SD  . MET B  1 121 ? 63.494 75.340  108.700 1.00 62.57  ? 121 MET B SD  1 
ATOM   5701  C  CE  . MET B  1 121 ? 64.409 73.860  109.079 1.00 60.65  ? 121 MET B CE  1 
ATOM   5702  N  N   . ALA B  1 122 ? 61.342 75.904  103.646 1.00 46.63  ? 122 ALA B N   1 
ATOM   5703  C  CA  . ALA B  1 122 ? 60.399 76.891  103.124 1.00 45.10  ? 122 ALA B CA  1 
ATOM   5704  C  C   . ALA B  1 122 ? 59.217 76.204  102.431 1.00 48.25  ? 122 ALA B C   1 
ATOM   5705  O  O   . ALA B  1 122 ? 58.072 76.616  102.627 1.00 47.46  ? 122 ALA B O   1 
ATOM   5706  C  CB  . ALA B  1 122 ? 61.109 77.824  102.156 1.00 45.42  ? 122 ALA B CB  1 
ATOM   5707  N  N   . GLU B  1 123 ? 59.498 75.141  101.645 1.00 45.19  ? 123 GLU B N   1 
ATOM   5708  C  CA  . GLU B  1 123 ? 58.494 74.329  100.944 1.00 45.04  ? 123 GLU B CA  1 
ATOM   5709  C  C   . GLU B  1 123 ? 57.633 73.590  101.968 1.00 49.61  ? 123 GLU B C   1 
ATOM   5710  O  O   . GLU B  1 123 ? 56.406 73.638  101.881 1.00 49.52  ? 123 GLU B O   1 
ATOM   5711  C  CB  . GLU B  1 123 ? 59.162 73.329  99.973  1.00 46.83  ? 123 GLU B CB  1 
ATOM   5712  C  CG  . GLU B  1 123 ? 59.637 73.957  98.670  1.00 54.18  ? 123 GLU B CG  1 
ATOM   5713  C  CD  . GLU B  1 123 ? 60.524 73.116  97.770  1.00 65.63  ? 123 GLU B CD  1 
ATOM   5714  O  OE1 . GLU B  1 123 ? 61.132 72.134  98.257  1.00 60.81  ? 123 GLU B OE1 1 
ATOM   5715  O  OE2 . GLU B  1 123 ? 60.645 73.473  96.576  1.00 49.92  ? 123 GLU B OE2 1 
ATOM   5716  N  N   . CYS B  1 124 ? 58.290 72.960  102.969 1.00 46.02  ? 124 CYS B N   1 
ATOM   5717  C  CA  . CYS B  1 124 ? 57.662 72.209  104.049 1.00 46.04  ? 124 CYS B CA  1 
ATOM   5718  C  C   . CYS B  1 124 ? 56.673 73.071  104.831 1.00 48.25  ? 124 CYS B C   1 
ATOM   5719  O  O   . CYS B  1 124 ? 55.536 72.653  105.047 1.00 48.13  ? 124 CYS B O   1 
ATOM   5720  C  CB  . CYS B  1 124 ? 58.718 71.608  104.972 1.00 47.32  ? 124 CYS B CB  1 
ATOM   5721  S  SG  . CYS B  1 124 ? 59.511 70.115  104.320 1.00 52.49  ? 124 CYS B SG  1 
ATOM   5722  N  N   . GLN B  1 125 ? 57.098 74.282  105.217 1.00 43.64  ? 125 GLN B N   1 
ATOM   5723  C  CA  . GLN B  1 125 ? 56.296 75.236  105.978 1.00 42.83  ? 125 GLN B CA  1 
ATOM   5724  C  C   . GLN B  1 125 ? 55.117 75.763  105.151 1.00 47.43  ? 125 GLN B C   1 
ATOM   5725  O  O   . GLN B  1 125 ? 54.063 76.030  105.728 1.00 47.02  ? 125 GLN B O   1 
ATOM   5726  C  CB  . GLN B  1 125 ? 57.173 76.384  106.489 1.00 43.39  ? 125 GLN B CB  1 
ATOM   5727  C  CG  . GLN B  1 125 ? 58.114 75.944  107.615 1.00 52.57  ? 125 GLN B CG  1 
ATOM   5728  C  CD  . GLN B  1 125 ? 59.270 76.884  107.862 1.00 68.93  ? 125 GLN B CD  1 
ATOM   5729  O  OE1 . GLN B  1 125 ? 59.696 77.657  106.991 1.00 64.72  ? 125 GLN B OE1 1 
ATOM   5730  N  NE2 . GLN B  1 125 ? 59.793 76.851  109.078 1.00 58.32  ? 125 GLN B NE2 1 
ATOM   5731  N  N   . PHE B  1 126 ? 55.277 75.870  103.806 1.00 44.44  ? 126 PHE B N   1 
ATOM   5732  C  CA  . PHE B  1 126 ? 54.213 76.300  102.892 1.00 44.17  ? 126 PHE B CA  1 
ATOM   5733  C  C   . PHE B  1 126 ? 53.109 75.240  102.824 1.00 47.92  ? 126 PHE B C   1 
ATOM   5734  O  O   . PHE B  1 126 ? 51.928 75.594  102.828 1.00 47.40  ? 126 PHE B O   1 
ATOM   5735  C  CB  . PHE B  1 126 ? 54.762 76.597  101.480 1.00 46.07  ? 126 PHE B CB  1 
ATOM   5736  C  CG  . PHE B  1 126 ? 53.715 76.682  100.385 1.00 47.99  ? 126 PHE B CG  1 
ATOM   5737  C  CD1 . PHE B  1 126 ? 52.830 77.755  100.325 1.00 50.75  ? 126 PHE B CD1 1 
ATOM   5738  C  CD2 . PHE B  1 126 ? 53.606 75.683  99.423  1.00 50.81  ? 126 PHE B CD2 1 
ATOM   5739  C  CE1 . PHE B  1 126 ? 51.858 77.827  99.323  1.00 51.68  ? 126 PHE B CE1 1 
ATOM   5740  C  CE2 . PHE B  1 126 ? 52.631 75.756  98.422  1.00 53.67  ? 126 PHE B CE2 1 
ATOM   5741  C  CZ  . PHE B  1 126 ? 51.764 76.828  98.380  1.00 51.24  ? 126 PHE B CZ  1 
ATOM   5742  N  N   . ILE B  1 127 ? 53.504 73.950  102.750 1.00 44.73  ? 127 ILE B N   1 
ATOM   5743  C  CA  . ILE B  1 127 ? 52.598 72.798  102.687 1.00 45.33  ? 127 ILE B CA  1 
ATOM   5744  C  C   . ILE B  1 127 ? 51.779 72.722  103.992 1.00 50.50  ? 127 ILE B C   1 
ATOM   5745  O  O   . ILE B  1 127 ? 50.562 72.541  103.924 1.00 50.70  ? 127 ILE B O   1 
ATOM   5746  C  CB  . ILE B  1 127 ? 53.375 71.481  102.387 1.00 48.86  ? 127 ILE B CB  1 
ATOM   5747  C  CG1 . ILE B  1 127 ? 53.960 71.496  100.956 1.00 48.78  ? 127 ILE B CG1 1 
ATOM   5748  C  CG2 . ILE B  1 127 ? 52.494 70.241  102.597 1.00 50.22  ? 127 ILE B CG2 1 
ATOM   5749  C  CD1 . ILE B  1 127 ? 55.253 70.700  100.762 1.00 52.73  ? 127 ILE B CD1 1 
ATOM   5750  N  N   . ILE B  1 128 ? 52.434 72.903  105.164 1.00 47.09  ? 128 ILE B N   1 
ATOM   5751  C  CA  . ILE B  1 128 ? 51.770 72.885  106.475 1.00 46.91  ? 128 ILE B CA  1 
ATOM   5752  C  C   . ILE B  1 128 ? 50.745 74.038  106.526 1.00 50.45  ? 128 ILE B C   1 
ATOM   5753  O  O   . ILE B  1 128 ? 49.595 73.791  106.895 1.00 50.50  ? 128 ILE B O   1 
ATOM   5754  C  CB  . ILE B  1 128 ? 52.789 72.906  107.651 1.00 49.70  ? 128 ILE B CB  1 
ATOM   5755  C  CG1 . ILE B  1 128 ? 53.572 71.567  107.696 1.00 50.54  ? 128 ILE B CG1 1 
ATOM   5756  C  CG2 . ILE B  1 128 ? 52.090 73.177  108.996 1.00 50.32  ? 128 ILE B CG2 1 
ATOM   5757  C  CD1 . ILE B  1 128 ? 54.766 71.515  108.628 1.00 56.06  ? 128 ILE B CD1 1 
ATOM   5758  N  N   . LYS B  1 129 ? 51.137 75.256  106.079 1.00 46.30  ? 129 LYS B N   1 
ATOM   5759  C  CA  . LYS B  1 129 ? 50.261 76.431  106.008 1.00 45.75  ? 129 LYS B CA  1 
ATOM   5760  C  C   . LYS B  1 129 ? 49.043 76.128  105.134 1.00 51.39  ? 129 LYS B C   1 
ATOM   5761  O  O   . LYS B  1 129 ? 47.923 76.422  105.546 1.00 51.91  ? 129 LYS B O   1 
ATOM   5762  C  CB  . LYS B  1 129 ? 51.017 77.656  105.460 1.00 46.91  ? 129 LYS B CB  1 
ATOM   5763  C  CG  . LYS B  1 129 ? 50.171 78.935  105.387 1.00 53.76  ? 129 LYS B CG  1 
ATOM   5764  C  CD  . LYS B  1 129 ? 50.698 79.944  104.370 1.00 60.25  ? 129 LYS B CD  1 
ATOM   5765  C  CE  . LYS B  1 129 ? 50.382 79.613  102.928 1.00 69.88  ? 129 LYS B CE  1 
ATOM   5766  N  NZ  . LYS B  1 129 ? 50.977 80.608  101.993 1.00 77.86  ? 129 LYS B NZ  1 
ATOM   5767  N  N   . HIS B  1 130 ? 49.267 75.519  103.950 1.00 48.15  ? 130 HIS B N   1 
ATOM   5768  C  CA  . HIS B  1 130 ? 48.232 75.138  102.987 1.00 48.37  ? 130 HIS B CA  1 
ATOM   5769  C  C   . HIS B  1 130 ? 47.215 74.167  103.609 1.00 51.22  ? 130 HIS B C   1 
ATOM   5770  O  O   . HIS B  1 130 ? 46.015 74.318  103.371 1.00 50.57  ? 130 HIS B O   1 
ATOM   5771  C  CB  . HIS B  1 130 ? 48.879 74.513  101.735 1.00 49.83  ? 130 HIS B CB  1 
ATOM   5772  C  CG  . HIS B  1 130 ? 47.901 73.953  100.747 1.00 54.09  ? 130 HIS B CG  1 
ATOM   5773  N  ND1 . HIS B  1 130 ? 47.352 74.742  99.748  1.00 55.58  ? 130 HIS B ND1 1 
ATOM   5774  C  CD2 . HIS B  1 130 ? 47.419 72.693  100.625 1.00 56.98  ? 130 HIS B CD2 1 
ATOM   5775  C  CE1 . HIS B  1 130 ? 46.551 73.943  99.060  1.00 55.77  ? 130 HIS B CE1 1 
ATOM   5776  N  NE2 . HIS B  1 130 ? 46.558 72.700  99.550  1.00 56.98  ? 130 HIS B NE2 1 
ATOM   5777  N  N   . GLU B  1 131 ? 47.695 73.181  104.395 1.00 47.43  ? 131 GLU B N   1 
ATOM   5778  C  CA  . GLU B  1 131 ? 46.845 72.177  105.043 1.00 47.63  ? 131 GLU B CA  1 
ATOM   5779  C  C   . GLU B  1 131 ? 46.016 72.798  106.175 1.00 50.27  ? 131 GLU B C   1 
ATOM   5780  O  O   . GLU B  1 131 ? 44.842 72.449  106.317 1.00 50.22  ? 131 GLU B O   1 
ATOM   5781  C  CB  . GLU B  1 131 ? 47.672 70.986  105.560 1.00 49.59  ? 131 GLU B CB  1 
ATOM   5782  C  CG  . GLU B  1 131 ? 48.396 70.184  104.483 1.00 59.19  ? 131 GLU B CG  1 
ATOM   5783  C  CD  . GLU B  1 131 ? 47.569 69.632  103.337 1.00 79.05  ? 131 GLU B CD  1 
ATOM   5784  O  OE1 . GLU B  1 131 ? 46.554 68.948  103.603 1.00 71.77  ? 131 GLU B OE1 1 
ATOM   5785  O  OE2 . GLU B  1 131 ? 47.957 69.859  102.168 1.00 75.94  ? 131 GLU B OE2 1 
ATOM   5786  N  N   . LEU B  1 132 ? 46.614 73.731  106.952 1.00 45.46  ? 132 LEU B N   1 
ATOM   5787  C  CA  . LEU B  1 132 ? 45.946 74.442  108.047 1.00 45.17  ? 132 LEU B CA  1 
ATOM   5788  C  C   . LEU B  1 132 ? 44.879 75.404  107.506 1.00 49.57  ? 132 LEU B C   1 
ATOM   5789  O  O   . LEU B  1 132 ? 43.851 75.597  108.154 1.00 49.26  ? 132 LEU B O   1 
ATOM   5790  C  CB  . LEU B  1 132 ? 46.958 75.219  108.913 1.00 44.64  ? 132 LEU B CB  1 
ATOM   5791  C  CG  . LEU B  1 132 ? 47.979 74.416  109.731 1.00 49.55  ? 132 LEU B CG  1 
ATOM   5792  C  CD1 . LEU B  1 132 ? 49.132 75.295  110.151 1.00 49.15  ? 132 LEU B CD1 1 
ATOM   5793  C  CD2 . LEU B  1 132 ? 47.354 73.790  110.963 1.00 52.54  ? 132 LEU B CD2 1 
ATOM   5794  N  N   . GLU B  1 133 ? 45.135 76.011  106.327 1.00 46.42  ? 133 GLU B N   1 
ATOM   5795  C  CA  . GLU B  1 133 ? 44.226 76.941  105.647 1.00 46.30  ? 133 GLU B CA  1 
ATOM   5796  C  C   . GLU B  1 133 ? 43.015 76.216  105.072 1.00 50.78  ? 133 GLU B C   1 
ATOM   5797  O  O   . GLU B  1 133 ? 41.943 76.814  104.948 1.00 50.86  ? 133 GLU B O   1 
ATOM   5798  C  CB  . GLU B  1 133 ? 44.951 77.679  104.511 1.00 47.11  ? 133 GLU B CB  1 
ATOM   5799  C  CG  . GLU B  1 133 ? 45.812 78.843  104.967 1.00 59.74  ? 133 GLU B CG  1 
ATOM   5800  C  CD  . GLU B  1 133 ? 46.713 79.457  103.908 1.00 86.94  ? 133 GLU B CD  1 
ATOM   5801  O  OE1 . GLU B  1 133 ? 46.785 78.919  102.778 1.00 79.34  ? 133 GLU B OE1 1 
ATOM   5802  O  OE2 . GLU B  1 133 ? 47.360 80.482  104.222 1.00 85.05  ? 133 GLU B OE2 1 
ATOM   5803  N  N   . ASN B  1 134 ? 43.190 74.938  104.695 1.00 47.22  ? 134 ASN B N   1 
ATOM   5804  C  CA  . ASN B  1 134 ? 42.128 74.132  104.105 1.00 47.34  ? 134 ASN B CA  1 
ATOM   5805  C  C   . ASN B  1 134 ? 41.400 73.267  105.152 1.00 49.69  ? 134 ASN B C   1 
ATOM   5806  O  O   . ASN B  1 134 ? 40.640 72.366  104.787 1.00 49.94  ? 134 ASN B O   1 
ATOM   5807  C  CB  . ASN B  1 134 ? 42.672 73.299  102.952 1.00 49.17  ? 134 ASN B CB  1 
ATOM   5808  C  CG  . ASN B  1 134 ? 42.800 74.129  101.705 1.00 70.74  ? 134 ASN B CG  1 
ATOM   5809  O  OD1 . ASN B  1 134 ? 41.826 74.335  100.974 1.00 66.13  ? 134 ASN B OD1 1 
ATOM   5810  N  ND2 . ASN B  1 134 ? 43.971 74.707  101.490 1.00 61.52  ? 134 ASN B ND2 1 
ATOM   5811  N  N   . LEU B  1 135 ? 41.584 73.595  106.444 1.00 44.73  ? 135 LEU B N   1 
ATOM   5812  C  CA  . LEU B  1 135 ? 40.902 72.952  107.570 1.00 44.84  ? 135 LEU B CA  1 
ATOM   5813  C  C   . LEU B  1 135 ? 39.506 73.562  107.634 1.00 48.34  ? 135 LEU B C   1 
ATOM   5814  O  O   . LEU B  1 135 ? 39.374 74.749  107.935 1.00 47.63  ? 135 LEU B O   1 
ATOM   5815  C  CB  . LEU B  1 135 ? 41.701 73.183  108.874 1.00 44.31  ? 135 LEU B CB  1 
ATOM   5816  C  CG  . LEU B  1 135 ? 41.996 71.979  109.767 1.00 48.78  ? 135 LEU B CG  1 
ATOM   5817  C  CD1 . LEU B  1 135 ? 42.930 71.016  109.095 1.00 48.62  ? 135 LEU B CD1 1 
ATOM   5818  C  CD2 . LEU B  1 135 ? 42.659 72.422  111.046 1.00 50.69  ? 135 LEU B CD2 1 
ATOM   5819  N  N   . ARG B  1 136 ? 38.477 72.796  107.247 1.00 44.87  ? 136 ARG B N   1 
ATOM   5820  C  CA  . ARG B  1 136 ? 37.114 73.329  107.181 1.00 44.49  ? 136 ARG B CA  1 
ATOM   5821  C  C   . ARG B  1 136 ? 36.172 72.637  108.165 1.00 48.18  ? 136 ARG B C   1 
ATOM   5822  O  O   . ARG B  1 136 ? 36.304 71.439  108.413 1.00 48.25  ? 136 ARG B O   1 
ATOM   5823  C  CB  . ARG B  1 136 ? 36.558 73.242  105.743 1.00 43.82  ? 136 ARG B CB  1 
ATOM   5824  C  CG  . ARG B  1 136 ? 37.541 73.773  104.704 1.00 46.39  ? 136 ARG B CG  1 
ATOM   5825  C  CD  . ARG B  1 136 ? 36.975 74.010  103.324 1.00 47.36  ? 136 ARG B CD  1 
ATOM   5826  N  NE  . ARG B  1 136 ? 37.960 74.699  102.489 1.00 51.54  ? 136 ARG B NE  1 
ATOM   5827  C  CZ  . ARG B  1 136 ? 38.150 76.017  102.477 1.00 69.46  ? 136 ARG B CZ  1 
ATOM   5828  N  NH1 . ARG B  1 136 ? 37.405 76.810  103.236 1.00 59.73  ? 136 ARG B NH1 1 
ATOM   5829  N  NH2 . ARG B  1 136 ? 39.087 76.550  101.704 1.00 59.22  ? 136 ARG B NH2 1 
ATOM   5830  N  N   . ALA B  1 137 ? 35.221 73.416  108.717 1.00 44.32  ? 137 ALA B N   1 
ATOM   5831  C  CA  . ALA B  1 137 ? 34.206 72.971  109.669 1.00 45.37  ? 137 ALA B CA  1 
ATOM   5832  C  C   . ALA B  1 137 ? 33.277 71.934  109.041 1.00 52.05  ? 137 ALA B C   1 
ATOM   5833  O  O   . ALA B  1 137 ? 32.859 72.099  107.892 1.00 51.84  ? 137 ALA B O   1 
ATOM   5834  C  CB  . ALA B  1 137 ? 33.399 74.164  110.157 1.00 45.85  ? 137 ALA B CB  1 
ATOM   5835  N  N   . LYS B  1 138 ? 32.976 70.855  109.784 1.00 50.39  ? 138 LYS B N   1 
ATOM   5836  C  CA  . LYS B  1 138 ? 32.099 69.786  109.303 1.00 51.54  ? 138 LYS B CA  1 
ATOM   5837  C  C   . LYS B  1 138 ? 30.681 69.988  109.853 1.00 58.31  ? 138 LYS B C   1 
ATOM   5838  O  O   . LYS B  1 138 ? 29.873 70.660  109.210 1.00 57.82  ? 138 LYS B O   1 
ATOM   5839  C  CB  . LYS B  1 138 ? 32.652 68.387  109.659 1.00 53.69  ? 138 LYS B CB  1 
ATOM   5840  C  CG  . LYS B  1 138 ? 33.901 67.991  108.882 1.00 58.51  ? 138 LYS B CG  1 
ATOM   5841  C  CD  . LYS B  1 138 ? 34.206 66.506  109.011 1.00 66.56  ? 138 LYS B CD  1 
ATOM   5842  N  N   . ASP B  1 139 ? 30.395 69.439  111.048 1.00 57.23  ? 139 ASP B N   1 
ATOM   5843  C  CA  . ASP B  1 139 ? 29.084 69.518  111.692 1.00 58.70  ? 139 ASP B CA  1 
ATOM   5844  C  C   . ASP B  1 139 ? 29.046 70.570  112.815 1.00 62.71  ? 139 ASP B C   1 
ATOM   5845  O  O   . ASP B  1 139 ? 27.960 70.870  113.323 1.00 63.10  ? 139 ASP B O   1 
ATOM   5846  C  CB  . ASP B  1 139 ? 28.675 68.134  112.241 1.00 62.05  ? 139 ASP B CB  1 
ATOM   5847  C  CG  . ASP B  1 139 ? 28.550 67.036  111.193 1.00 71.86  ? 139 ASP B CG  1 
ATOM   5848  O  OD1 . ASP B  1 139 ? 28.027 67.319  110.084 1.00 71.88  ? 139 ASP B OD1 1 
ATOM   5849  O  OD2 . ASP B  1 139 ? 28.938 65.885  111.492 1.00 77.84  ? 139 ASP B OD2 1 
ATOM   5850  N  N   . GLU B  1 140 ? 30.220 71.134  113.189 1.00 58.42  ? 140 GLU B N   1 
ATOM   5851  C  CA  . GLU B  1 140 ? 30.345 72.145  114.247 1.00 57.88  ? 140 GLU B CA  1 
ATOM   5852  C  C   . GLU B  1 140 ? 29.644 73.451  113.849 1.00 62.98  ? 140 GLU B C   1 
ATOM   5853  O  O   . GLU B  1 140 ? 29.893 73.998  112.772 1.00 61.44  ? 140 GLU B O   1 
ATOM   5854  C  CB  . GLU B  1 140 ? 31.812 72.402  114.661 1.00 57.82  ? 140 GLU B CB  1 
ATOM   5855  C  CG  . GLU B  1 140 ? 32.824 72.457  113.532 1.00 63.51  ? 140 GLU B CG  1 
ATOM   5856  C  CD  . GLU B  1 140 ? 33.629 71.184  113.371 1.00 75.86  ? 140 GLU B CD  1 
ATOM   5857  O  OE1 . GLU B  1 140 ? 34.645 71.028  114.085 1.00 58.91  ? 140 GLU B OE1 1 
ATOM   5858  O  OE2 . GLU B  1 140 ? 33.241 70.338  112.536 1.00 72.90  ? 140 GLU B OE2 1 
ATOM   5859  N  N   . LYS B  1 141 ? 28.728 73.907  114.723 1.00 61.70  ? 141 LYS B N   1 
ATOM   5860  C  CA  . LYS B  1 141 ? 27.907 75.105  114.544 1.00 61.93  ? 141 LYS B CA  1 
ATOM   5861  C  C   . LYS B  1 141 ? 28.570 76.350  115.174 1.00 66.90  ? 141 LYS B C   1 
ATOM   5862  O  O   . LYS B  1 141 ? 28.057 77.463  115.017 1.00 66.53  ? 141 LYS B O   1 
ATOM   5863  C  CB  . LYS B  1 141 ? 26.504 74.874  115.130 1.00 65.41  ? 141 LYS B CB  1 
ATOM   5864  C  CG  . LYS B  1 141 ? 25.680 73.856  114.351 1.00 77.06  ? 141 LYS B CG  1 
ATOM   5865  N  N   . MET B  1 142 ? 29.719 76.153  115.862 1.00 64.03  ? 142 MET B N   1 
ATOM   5866  C  CA  . MET B  1 142 ? 30.529 77.187  116.522 1.00 63.44  ? 142 MET B CA  1 
ATOM   5867  C  C   . MET B  1 142 ? 31.906 76.620  116.899 1.00 66.80  ? 142 MET B C   1 
ATOM   5868  O  O   . MET B  1 142 ? 32.090 75.401  116.860 1.00 67.16  ? 142 MET B O   1 
ATOM   5869  C  CB  . MET B  1 142 ? 29.807 77.727  117.780 1.00 66.82  ? 142 MET B CB  1 
ATOM   5870  C  CG  . MET B  1 142 ? 29.901 76.803  118.993 1.00 71.88  ? 142 MET B CG  1 
ATOM   5871  S  SD  . MET B  1 142 ? 28.503 76.883  120.128 1.00 78.19  ? 142 MET B SD  1 
ATOM   5872  C  CE  . MET B  1 142 ? 27.343 75.808  119.277 1.00 76.09  ? 142 MET B CE  1 
ATOM   5873  N  N   . ILE B  1 143 ? 32.860 77.493  117.286 1.00 62.17  ? 143 ILE B N   1 
ATOM   5874  C  CA  . ILE B  1 143 ? 34.166 77.042  117.776 1.00 61.40  ? 143 ILE B CA  1 
ATOM   5875  C  C   . ILE B  1 143 ? 33.919 76.541  119.219 1.00 66.32  ? 143 ILE B C   1 
ATOM   5876  O  O   . ILE B  1 143 ? 33.428 77.328  120.035 1.00 66.45  ? 143 ILE B O   1 
ATOM   5877  C  CB  . ILE B  1 143 ? 35.283 78.128  117.681 1.00 63.08  ? 143 ILE B CB  1 
ATOM   5878  C  CG1 . ILE B  1 143 ? 35.531 78.566  116.210 1.00 62.45  ? 143 ILE B CG1 1 
ATOM   5879  C  CG2 . ILE B  1 143 ? 36.575 77.625  118.343 1.00 63.18  ? 143 ILE B CG2 1 
ATOM   5880  C  CD1 . ILE B  1 143 ? 36.574 79.679  115.984 1.00 65.78  ? 143 ILE B CD1 1 
ATOM   5881  N  N   . PRO B  1 144 ? 34.170 75.238  119.530 1.00 63.08  ? 144 PRO B N   1 
ATOM   5882  C  CA  . PRO B  1 144 ? 33.883 74.722  120.885 1.00 63.91  ? 144 PRO B CA  1 
ATOM   5883  C  C   . PRO B  1 144 ? 34.430 75.599  122.012 1.00 68.20  ? 144 PRO B C   1 
ATOM   5884  O  O   . PRO B  1 144 ? 35.611 75.952  122.010 1.00 67.30  ? 144 PRO B O   1 
ATOM   5885  C  CB  . PRO B  1 144 ? 34.548 73.347  120.880 1.00 65.87  ? 144 PRO B CB  1 
ATOM   5886  C  CG  . PRO B  1 144 ? 34.499 72.928  119.468 1.00 69.81  ? 144 PRO B CG  1 
ATOM   5887  C  CD  . PRO B  1 144 ? 34.709 74.172  118.662 1.00 64.23  ? 144 PRO B CD  1 
ATOM   5888  N  N   . GLY B  1 145 ? 33.539 75.982  122.927 1.00 65.52  ? 145 GLY B N   1 
ATOM   5889  C  CA  . GLY B  1 145 ? 33.849 76.841  124.066 1.00 65.09  ? 145 GLY B CA  1 
ATOM   5890  C  C   . GLY B  1 145 ? 33.572 78.316  123.832 1.00 67.50  ? 145 GLY B C   1 
ATOM   5891  O  O   . GLY B  1 145 ? 33.477 79.081  124.795 1.00 67.15  ? 145 GLY B O   1 
ATOM   5892  N  N   . TYR B  1 146 ? 33.449 78.731  122.554 1.00 62.88  ? 146 TYR B N   1 
ATOM   5893  C  CA  . TYR B  1 146 ? 33.193 80.124  122.179 1.00 62.15  ? 146 TYR B CA  1 
ATOM   5894  C  C   . TYR B  1 146 ? 31.956 80.196  121.260 1.00 67.23  ? 146 TYR B C   1 
ATOM   5895  O  O   . TYR B  1 146 ? 32.079 80.098  120.034 1.00 66.00  ? 146 TYR B O   1 
ATOM   5896  C  CB  . TYR B  1 146 ? 34.447 80.762  121.545 1.00 61.68  ? 146 TYR B CB  1 
ATOM   5897  C  CG  . TYR B  1 146 ? 35.616 80.815  122.507 1.00 62.84  ? 146 TYR B CG  1 
ATOM   5898  C  CD1 . TYR B  1 146 ? 35.748 81.860  123.417 1.00 64.97  ? 146 TYR B CD1 1 
ATOM   5899  C  CD2 . TYR B  1 146 ? 36.555 79.789  122.553 1.00 63.24  ? 146 TYR B CD2 1 
ATOM   5900  C  CE1 . TYR B  1 146 ? 36.796 81.893  124.334 1.00 65.80  ? 146 TYR B CE1 1 
ATOM   5901  C  CE2 . TYR B  1 146 ? 37.610 79.813  123.464 1.00 63.92  ? 146 TYR B CE2 1 
ATOM   5902  C  CZ  . TYR B  1 146 ? 37.726 80.867  124.353 1.00 71.11  ? 146 TYR B CZ  1 
ATOM   5903  O  OH  . TYR B  1 146 ? 38.762 80.900  125.253 1.00 71.25  ? 146 TYR B OH  1 
ATOM   5904  N  N   . PRO B  1 147 ? 30.746 80.342  121.864 1.00 65.64  ? 147 PRO B N   1 
ATOM   5905  C  CA  . PRO B  1 147 ? 29.507 80.345  121.062 1.00 66.08  ? 147 PRO B CA  1 
ATOM   5906  C  C   . PRO B  1 147 ? 29.389 81.518  120.094 1.00 69.07  ? 147 PRO B C   1 
ATOM   5907  O  O   . PRO B  1 147 ? 28.718 81.377  119.071 1.00 68.83  ? 147 PRO B O   1 
ATOM   5908  C  CB  . PRO B  1 147 ? 28.395 80.394  122.113 1.00 69.21  ? 147 PRO B CB  1 
ATOM   5909  C  CG  . PRO B  1 147 ? 29.031 79.949  123.377 1.00 74.02  ? 147 PRO B CG  1 
ATOM   5910  C  CD  . PRO B  1 147 ? 30.442 80.417  123.306 1.00 68.25  ? 147 PRO B CD  1 
ATOM   5911  N  N   . GLN B  1 148 ? 30.032 82.665  120.413 1.00 64.71  ? 148 GLN B N   1 
ATOM   5912  C  CA  . GLN B  1 148 ? 30.020 83.871  119.573 1.00 63.67  ? 148 GLN B CA  1 
ATOM   5913  C  C   . GLN B  1 148 ? 30.727 83.623  118.235 1.00 65.07  ? 148 GLN B C   1 
ATOM   5914  O  O   . GLN B  1 148 ? 30.275 84.128  117.200 1.00 64.53  ? 148 GLN B O   1 
ATOM   5915  C  CB  . GLN B  1 148 ? 30.660 85.087  120.293 1.00 64.86  ? 148 GLN B CB  1 
ATOM   5916  C  CG  . GLN B  1 148 ? 30.460 85.215  121.818 1.00 86.62  ? 148 GLN B CG  1 
ATOM   5917  C  CD  . GLN B  1 148 ? 29.023 85.257  122.305 1.00 111.93 ? 148 GLN B CD  1 
ATOM   5918  O  OE1 . GLN B  1 148 ? 28.092 85.664  121.593 1.00 109.31 ? 148 GLN B OE1 1 
ATOM   5919  N  NE2 . GLN B  1 148 ? 28.817 84.866  123.555 1.00 104.51 ? 148 GLN B NE2 1 
ATOM   5920  N  N   . ALA B  1 149 ? 31.818 82.821  118.250 1.00 59.64  ? 149 ALA B N   1 
ATOM   5921  C  CA  . ALA B  1 149 ? 32.586 82.447  117.058 1.00 57.68  ? 149 ALA B CA  1 
ATOM   5922  C  C   . ALA B  1 149 ? 31.889 81.282  116.338 1.00 59.73  ? 149 ALA B C   1 
ATOM   5923  O  O   . ALA B  1 149 ? 32.343 80.135  116.403 1.00 59.33  ? 149 ALA B O   1 
ATOM   5924  C  CB  . ALA B  1 149 ? 34.014 82.084  117.443 1.00 57.75  ? 149 ALA B CB  1 
ATOM   5925  N  N   . LYS B  1 150 ? 30.762 81.588  115.673 1.00 55.00  ? 150 LYS B N   1 
ATOM   5926  C  CA  . LYS B  1 150 ? 29.926 80.608  114.979 1.00 55.00  ? 150 LYS B CA  1 
ATOM   5927  C  C   . LYS B  1 150 ? 30.604 80.034  113.730 1.00 57.00  ? 150 LYS B C   1 
ATOM   5928  O  O   . LYS B  1 150 ? 31.414 80.708  113.093 1.00 55.81  ? 150 LYS B O   1 
ATOM   5929  C  CB  . LYS B  1 150 ? 28.567 81.221  114.616 1.00 58.21  ? 150 LYS B CB  1 
ATOM   5930  C  CG  . LYS B  1 150 ? 27.614 81.321  115.801 1.00 72.35  ? 150 LYS B CG  1 
ATOM   5931  C  CD  . LYS B  1 150 ? 26.459 82.261  115.512 1.00 82.95  ? 150 LYS B CD  1 
ATOM   5932  C  CE  . LYS B  1 150 ? 25.426 82.272  116.611 1.00 96.63  ? 150 LYS B CE  1 
ATOM   5933  N  NZ  . LYS B  1 150 ? 24.515 81.098  116.533 1.00 108.85 ? 150 LYS B NZ  1 
ATOM   5934  N  N   . LEU B  1 151 ? 30.279 78.771  113.407 1.00 53.23  ? 151 LEU B N   1 
ATOM   5935  C  CA  . LEU B  1 151 ? 30.801 78.039  112.250 1.00 52.38  ? 151 LEU B CA  1 
ATOM   5936  C  C   . LEU B  1 151 ? 29.669 77.416  111.433 1.00 57.03  ? 151 LEU B C   1 
ATOM   5937  O  O   . LEU B  1 151 ? 28.597 77.136  111.968 1.00 58.05  ? 151 LEU B O   1 
ATOM   5938  C  CB  . LEU B  1 151 ? 31.779 76.926  112.683 1.00 52.32  ? 151 LEU B CB  1 
ATOM   5939  C  CG  . LEU B  1 151 ? 33.181 77.315  113.154 1.00 55.73  ? 151 LEU B CG  1 
ATOM   5940  C  CD1 . LEU B  1 151 ? 33.826 76.158  113.898 1.00 56.17  ? 151 LEU B CD1 1 
ATOM   5941  C  CD2 . LEU B  1 151 ? 34.071 77.732  111.987 1.00 56.43  ? 151 LEU B CD2 1 
ATOM   5942  N  N   . TYR B  1 152 ? 29.926 77.181  110.141 1.00 52.79  ? 152 TYR B N   1 
ATOM   5943  C  CA  . TYR B  1 152 ? 28.995 76.549  109.203 1.00 53.02  ? 152 TYR B CA  1 
ATOM   5944  C  C   . TYR B  1 152 ? 29.770 75.540  108.323 1.00 55.59  ? 152 TYR B C   1 
ATOM   5945  O  O   . TYR B  1 152 ? 30.992 75.685  108.200 1.00 53.59  ? 152 TYR B O   1 
ATOM   5946  C  CB  . TYR B  1 152 ? 28.238 77.604  108.359 1.00 54.00  ? 152 TYR B CB  1 
ATOM   5947  C  CG  . TYR B  1 152 ? 29.104 78.466  107.464 1.00 54.24  ? 152 TYR B CG  1 
ATOM   5948  C  CD1 . TYR B  1 152 ? 29.373 78.092  106.150 1.00 56.01  ? 152 TYR B CD1 1 
ATOM   5949  C  CD2 . TYR B  1 152 ? 29.598 79.688  107.907 1.00 53.85  ? 152 TYR B CD2 1 
ATOM   5950  C  CE1 . TYR B  1 152 ? 30.156 78.888  105.317 1.00 55.37  ? 152 TYR B CE1 1 
ATOM   5951  C  CE2 . TYR B  1 152 ? 30.379 80.496  107.081 1.00 53.45  ? 152 TYR B CE2 1 
ATOM   5952  C  CZ  . TYR B  1 152 ? 30.660 80.089  105.787 1.00 59.28  ? 152 TYR B CZ  1 
ATOM   5953  O  OH  . TYR B  1 152 ? 31.435 80.874  104.969 1.00 57.96  ? 152 TYR B OH  1 
ATOM   5954  N  N   . PRO B  1 153 ? 29.117 74.513  107.717 1.00 53.06  ? 153 PRO B N   1 
ATOM   5955  C  CA  . PRO B  1 153 ? 29.878 73.548  106.902 1.00 52.90  ? 153 PRO B CA  1 
ATOM   5956  C  C   . PRO B  1 153 ? 30.587 74.206  105.715 1.00 56.01  ? 153 PRO B C   1 
ATOM   5957  O  O   . PRO B  1 153 ? 29.968 74.910  104.914 1.00 55.58  ? 153 PRO B O   1 
ATOM   5958  C  CB  . PRO B  1 153 ? 28.815 72.540  106.450 1.00 55.98  ? 153 PRO B CB  1 
ATOM   5959  C  CG  . PRO B  1 153 ? 27.522 73.250  106.588 1.00 60.87  ? 153 PRO B CG  1 
ATOM   5960  C  CD  . PRO B  1 153 ? 27.686 74.151  107.766 1.00 55.88  ? 153 PRO B CD  1 
ATOM   5961  N  N   . GLY B  1 154 ? 31.901 74.007  105.667 1.00 51.81  ? 154 GLY B N   1 
ATOM   5962  C  CA  . GLY B  1 154 ? 32.769 74.550  104.631 1.00 50.54  ? 154 GLY B CA  1 
ATOM   5963  C  C   . GLY B  1 154 ? 33.638 75.713  105.061 1.00 52.93  ? 154 GLY B C   1 
ATOM   5964  O  O   . GLY B  1 154 ? 34.608 76.031  104.371 1.00 51.94  ? 154 GLY B O   1 
ATOM   5965  N  N   . LYS B  1 155 ? 33.298 76.368  106.190 1.00 49.01  ? 155 LYS B N   1 
ATOM   5966  C  CA  . LYS B  1 155 ? 34.032 77.530  106.701 1.00 47.51  ? 155 LYS B CA  1 
ATOM   5967  C  C   . LYS B  1 155 ? 35.432 77.144  107.188 1.00 50.10  ? 155 LYS B C   1 
ATOM   5968  O  O   . LYS B  1 155 ? 35.579 76.191  107.952 1.00 50.09  ? 155 LYS B O   1 
ATOM   5969  C  CB  . LYS B  1 155 ? 33.240 78.241  107.829 1.00 50.09  ? 155 LYS B CB  1 
ATOM   5970  C  CG  . LYS B  1 155 ? 33.925 79.470  108.462 1.00 60.77  ? 155 LYS B CG  1 
ATOM   5971  C  CD  . LYS B  1 155 ? 34.023 80.681  107.524 1.00 68.28  ? 155 LYS B CD  1 
ATOM   5972  C  CE  . LYS B  1 155 ? 34.905 81.766  108.084 1.00 74.96  ? 155 LYS B CE  1 
ATOM   5973  N  NZ  . LYS B  1 155 ? 35.100 82.864  107.103 1.00 84.27  ? 155 LYS B NZ  1 
ATOM   5974  N  N   . SER B  1 156 ? 36.451 77.909  106.737 1.00 45.72  ? 156 SER B N   1 
ATOM   5975  C  CA  . SER B  1 156 ? 37.860 77.762  107.109 1.00 44.91  ? 156 SER B CA  1 
ATOM   5976  C  C   . SER B  1 156 ? 38.015 78.008  108.610 1.00 49.53  ? 156 SER B C   1 
ATOM   5977  O  O   . SER B  1 156 ? 37.632 79.075  109.101 1.00 49.56  ? 156 SER B O   1 
ATOM   5978  C  CB  . SER B  1 156 ? 38.727 78.732  106.304 1.00 46.75  ? 156 SER B CB  1 
ATOM   5979  O  OG  . SER B  1 156 ? 40.036 78.866  106.835 1.00 52.49  ? 156 SER B OG  1 
ATOM   5980  N  N   . LEU B  1 157 ? 38.531 77.003  109.337 1.00 46.04  ? 157 LEU B N   1 
ATOM   5981  C  CA  . LEU B  1 157 ? 38.723 77.058  110.785 1.00 45.91  ? 157 LEU B CA  1 
ATOM   5982  C  C   . LEU B  1 157 ? 39.779 78.103  111.160 1.00 49.37  ? 157 LEU B C   1 
ATOM   5983  O  O   . LEU B  1 157 ? 39.512 78.937  112.024 1.00 48.70  ? 157 LEU B O   1 
ATOM   5984  C  CB  . LEU B  1 157 ? 39.098 75.675  111.349 1.00 46.43  ? 157 LEU B CB  1 
ATOM   5985  C  CG  . LEU B  1 157 ? 38.108 74.529  111.101 1.00 51.72  ? 157 LEU B CG  1 
ATOM   5986  C  CD1 . LEU B  1 157 ? 38.701 73.206  111.517 1.00 52.55  ? 157 LEU B CD1 1 
ATOM   5987  C  CD2 . LEU B  1 157 ? 36.794 74.756  111.820 1.00 54.20  ? 157 LEU B CD2 1 
ATOM   5988  N  N   . LEU B  1 158 ? 40.939 78.097  110.468 1.00 45.97  ? 158 LEU B N   1 
ATOM   5989  C  CA  . LEU B  1 158 ? 42.046 79.036  110.684 1.00 45.38  ? 158 LEU B CA  1 
ATOM   5990  C  C   . LEU B  1 158 ? 41.588 80.488  110.549 1.00 50.13  ? 158 LEU B C   1 
ATOM   5991  O  O   . LEU B  1 158 ? 42.020 81.325  111.340 1.00 50.05  ? 158 LEU B O   1 
ATOM   5992  C  CB  . LEU B  1 158 ? 43.197 78.759  109.703 1.00 44.76  ? 158 LEU B CB  1 
ATOM   5993  C  CG  . LEU B  1 158 ? 44.526 79.453  109.994 1.00 48.40  ? 158 LEU B CG  1 
ATOM   5994  C  CD1 . LEU B  1 158 ? 45.356 78.654  110.987 1.00 48.55  ? 158 LEU B CD1 1 
ATOM   5995  C  CD2 . LEU B  1 158 ? 45.301 79.678  108.712 1.00 50.65  ? 158 LEU B CD2 1 
ATOM   5996  N  N   . ARG B  1 159 ? 40.709 80.780  109.570 1.00 47.18  ? 159 ARG B N   1 
ATOM   5997  C  CA  . ARG B  1 159 ? 40.164 82.117  109.340 1.00 47.10  ? 159 ARG B CA  1 
ATOM   5998  C  C   . ARG B  1 159 ? 39.282 82.541  110.521 1.00 52.02  ? 159 ARG B C   1 
ATOM   5999  O  O   . ARG B  1 159 ? 39.509 83.614  111.081 1.00 51.78  ? 159 ARG B O   1 
ATOM   6000  C  CB  . ARG B  1 159 ? 39.384 82.166  108.007 1.00 48.25  ? 159 ARG B CB  1 
ATOM   6001  C  CG  . ARG B  1 159 ? 38.613 83.467  107.724 1.00 59.49  ? 159 ARG B CG  1 
ATOM   6002  C  CD  . ARG B  1 159 ? 39.500 84.674  107.488 1.00 67.44  ? 159 ARG B CD  1 
ATOM   6003  N  NE  . ARG B  1 159 ? 38.708 85.866  107.189 1.00 79.30  ? 159 ARG B NE  1 
ATOM   6004  C  CZ  . ARG B  1 159 ? 39.102 87.112  107.435 1.00 96.82  ? 159 ARG B CZ  1 
ATOM   6005  N  NH1 . ARG B  1 159 ? 40.279 87.344  108.006 1.00 85.25  ? 159 ARG B NH1 1 
ATOM   6006  N  NH2 . ARG B  1 159 ? 38.321 88.137  107.120 1.00 85.32  ? 159 ARG B NH2 1 
ATOM   6007  N  N   . ARG B  1 160 ? 38.313 81.686  110.920 1.00 49.19  ? 160 ARG B N   1 
ATOM   6008  C  CA  . ARG B  1 160 ? 37.399 81.946  112.035 1.00 49.52  ? 160 ARG B CA  1 
ATOM   6009  C  C   . ARG B  1 160 ? 38.165 82.096  113.357 1.00 53.27  ? 160 ARG B C   1 
ATOM   6010  O  O   . ARG B  1 160 ? 37.804 82.953  114.161 1.00 53.40  ? 160 ARG B O   1 
ATOM   6011  C  CB  . ARG B  1 160 ? 36.326 80.844  112.147 1.00 50.24  ? 160 ARG B CB  1 
ATOM   6012  C  CG  . ARG B  1 160 ? 35.088 81.248  112.953 1.00 59.36  ? 160 ARG B CG  1 
ATOM   6013  C  CD  . ARG B  1 160 ? 34.272 82.342  112.283 1.00 66.21  ? 160 ARG B CD  1 
ATOM   6014  N  NE  . ARG B  1 160 ? 33.451 83.090  113.237 1.00 71.98  ? 160 ARG B NE  1 
ATOM   6015  C  CZ  . ARG B  1 160 ? 33.858 84.168  113.902 1.00 84.60  ? 160 ARG B CZ  1 
ATOM   6016  N  NH1 . ARG B  1 160 ? 35.091 84.633  113.738 1.00 68.46  ? 160 ARG B NH1 1 
ATOM   6017  N  NH2 . ARG B  1 160 ? 33.036 84.789  114.734 1.00 74.29  ? 160 ARG B NH2 1 
ATOM   6018  N  N   . LEU B  1 161 ? 39.231 81.295  113.561 1.00 49.09  ? 161 LEU B N   1 
ATOM   6019  C  CA  . LEU B  1 161 ? 40.075 81.358  114.757 1.00 48.58  ? 161 LEU B CA  1 
ATOM   6020  C  C   . LEU B  1 161 ? 40.822 82.695  114.819 1.00 51.85  ? 161 LEU B C   1 
ATOM   6021  O  O   . LEU B  1 161 ? 40.909 83.291  115.893 1.00 51.26  ? 161 LEU B O   1 
ATOM   6022  C  CB  . LEU B  1 161 ? 41.069 80.184  114.788 1.00 48.49  ? 161 LEU B CB  1 
ATOM   6023  C  CG  . LEU B  1 161 ? 40.513 78.826  115.223 1.00 53.99  ? 161 LEU B CG  1 
ATOM   6024  C  CD1 . LEU B  1 161 ? 41.266 77.701  114.569 1.00 53.98  ? 161 LEU B CD1 1 
ATOM   6025  C  CD2 . LEU B  1 161 ? 40.557 78.661  116.726 1.00 57.34  ? 161 LEU B CD2 1 
ATOM   6026  N  N   . LEU B  1 162 ? 41.322 83.176  113.661 1.00 48.50  ? 162 LEU B N   1 
ATOM   6027  C  CA  . LEU B  1 162 ? 42.053 84.442  113.557 1.00 48.07  ? 162 LEU B CA  1 
ATOM   6028  C  C   . LEU B  1 162 ? 41.120 85.652  113.673 1.00 54.39  ? 162 LEU B C   1 
ATOM   6029  O  O   . LEU B  1 162 ? 41.508 86.646  114.292 1.00 54.33  ? 162 LEU B O   1 
ATOM   6030  C  CB  . LEU B  1 162 ? 42.853 84.528  112.244 1.00 46.99  ? 162 LEU B CB  1 
ATOM   6031  C  CG  . LEU B  1 162 ? 44.139 83.706  112.151 1.00 50.76  ? 162 LEU B CG  1 
ATOM   6032  C  CD1 . LEU B  1 162 ? 44.606 83.615  110.720 1.00 50.28  ? 162 LEU B CD1 1 
ATOM   6033  C  CD2 . LEU B  1 162 ? 45.243 84.285  113.019 1.00 52.39  ? 162 LEU B CD2 1 
ATOM   6034  N  N   . THR B  1 163 ? 39.904 85.570  113.079 1.00 52.10  ? 163 THR B N   1 
ATOM   6035  C  CA  . THR B  1 163 ? 38.892 86.636  113.096 1.00 52.50  ? 163 THR B CA  1 
ATOM   6036  C  C   . THR B  1 163 ? 38.396 86.879  114.533 1.00 57.50  ? 163 THR B C   1 
ATOM   6037  O  O   . THR B  1 163 ? 38.392 88.027  114.983 1.00 57.53  ? 163 THR B O   1 
ATOM   6038  C  CB  . THR B  1 163 ? 37.735 86.291  112.142 1.00 63.84  ? 163 THR B CB  1 
ATOM   6039  O  OG1 . THR B  1 163 ? 38.264 86.047  110.838 1.00 64.81  ? 163 THR B OG1 1 
ATOM   6040  C  CG2 . THR B  1 163 ? 36.679 87.389  112.068 1.00 63.71  ? 163 THR B CG2 1 
ATOM   6041  N  N   . SER B  1 164 ? 37.995 85.799  115.241 1.00 54.03  ? 164 SER B N   1 
ATOM   6042  C  CA  . SER B  1 164 ? 37.501 85.826  116.622 1.00 53.90  ? 164 SER B CA  1 
ATOM   6043  C  C   . SER B  1 164 ? 38.579 86.282  117.608 1.00 56.83  ? 164 SER B C   1 
ATOM   6044  O  O   . SER B  1 164 ? 38.257 86.928  118.608 1.00 56.96  ? 164 SER B O   1 
ATOM   6045  C  CB  . SER B  1 164 ? 36.995 84.447  117.029 1.00 57.45  ? 164 SER B CB  1 
ATOM   6046  O  OG  . SER B  1 164 ? 38.013 83.470  116.886 1.00 64.13  ? 164 SER B OG  1 
ATOM   6047  N  N   . GLY B  1 165 ? 39.832 85.928  117.317 1.00 51.92  ? 165 GLY B N   1 
ATOM   6048  C  CA  . GLY B  1 165 ? 40.986 86.266  118.142 1.00 50.99  ? 165 GLY B CA  1 
ATOM   6049  C  C   . GLY B  1 165 ? 41.464 85.141  119.038 1.00 53.63  ? 165 GLY B C   1 
ATOM   6050  O  O   . GLY B  1 165 ? 42.300 85.378  119.918 1.00 53.30  ? 165 GLY B O   1 
ATOM   6051  N  N   . ILE B  1 166 ? 40.937 83.905  118.827 1.00 49.29  ? 166 ILE B N   1 
ATOM   6052  C  CA  . ILE B  1 166 ? 41.308 82.701  119.589 1.00 48.98  ? 166 ILE B CA  1 
ATOM   6053  C  C   . ILE B  1 166 ? 42.762 82.348  119.228 1.00 53.08  ? 166 ILE B C   1 
ATOM   6054  O  O   . ILE B  1 166 ? 43.566 82.082  120.124 1.00 53.70  ? 166 ILE B O   1 
ATOM   6055  C  CB  . ILE B  1 166 ? 40.307 81.525  119.369 1.00 52.00  ? 166 ILE B CB  1 
ATOM   6056  C  CG1 . ILE B  1 166 ? 38.891 81.931  119.842 1.00 52.69  ? 166 ILE B CG1 1 
ATOM   6057  C  CG2 . ILE B  1 166 ? 40.772 80.249  120.097 1.00 52.87  ? 166 ILE B CG2 1 
ATOM   6058  C  CD1 . ILE B  1 166 ? 37.738 81.118  119.295 1.00 58.27  ? 166 ILE B CD1 1 
ATOM   6059  N  N   . VAL B  1 167 ? 43.101 82.412  117.929 1.00 48.49  ? 167 VAL B N   1 
ATOM   6060  C  CA  . VAL B  1 167 ? 44.459 82.207  117.428 1.00 47.69  ? 167 VAL B CA  1 
ATOM   6061  C  C   . VAL B  1 167 ? 45.007 83.601  117.121 1.00 50.66  ? 167 VAL B C   1 
ATOM   6062  O  O   . VAL B  1 167 ? 44.426 84.316  116.298 1.00 50.55  ? 167 VAL B O   1 
ATOM   6063  C  CB  . VAL B  1 167 ? 44.511 81.232  116.212 1.00 51.49  ? 167 VAL B CB  1 
ATOM   6064  C  CG1 . VAL B  1 167 ? 45.831 81.338  115.449 1.00 50.44  ? 167 VAL B CG1 1 
ATOM   6065  C  CG2 . VAL B  1 167 ? 44.273 79.796  116.661 1.00 52.21  ? 167 VAL B CG2 1 
ATOM   6066  N  N   . ILE B  1 168 ? 46.081 84.010  117.827 1.00 46.25  ? 168 ILE B N   1 
ATOM   6067  C  CA  . ILE B  1 168 ? 46.705 85.324  117.638 1.00 45.24  ? 168 ILE B CA  1 
ATOM   6068  C  C   . ILE B  1 168 ? 47.451 85.341  116.302 1.00 47.45  ? 168 ILE B C   1 
ATOM   6069  O  O   . ILE B  1 168 ? 47.235 86.258  115.506 1.00 47.28  ? 168 ILE B O   1 
ATOM   6070  C  CB  . ILE B  1 168 ? 47.633 85.741  118.818 1.00 48.62  ? 168 ILE B CB  1 
ATOM   6071  C  CG1 . ILE B  1 168 ? 46.896 85.709  120.175 1.00 49.78  ? 168 ILE B CG1 1 
ATOM   6072  C  CG2 . ILE B  1 168 ? 48.250 87.126  118.566 1.00 49.31  ? 168 ILE B CG2 1 
ATOM   6073  C  CD1 . ILE B  1 168 ? 47.832 85.716  121.418 1.00 58.39  ? 168 ILE B CD1 1 
ATOM   6074  N  N   . GLN B  1 169 ? 48.319 84.333  116.059 1.00 42.56  ? 169 GLN B N   1 
ATOM   6075  C  CA  . GLN B  1 169 ? 49.121 84.245  114.835 1.00 41.29  ? 169 GLN B CA  1 
ATOM   6076  C  C   . GLN B  1 169 ? 49.625 82.831  114.526 1.00 44.92  ? 169 GLN B C   1 
ATOM   6077  O  O   . GLN B  1 169 ? 49.742 81.989  115.420 1.00 45.33  ? 169 GLN B O   1 
ATOM   6078  C  CB  . GLN B  1 169 ? 50.331 85.194  114.919 1.00 42.01  ? 169 GLN B CB  1 
ATOM   6079  C  CG  . GLN B  1 169 ? 51.272 84.925  116.099 1.00 46.62  ? 169 GLN B CG  1 
ATOM   6080  C  CD  . GLN B  1 169 ? 52.592 85.635  115.959 1.00 59.53  ? 169 GLN B CD  1 
ATOM   6081  O  OE1 . GLN B  1 169 ? 52.990 86.079  114.875 1.00 52.63  ? 169 GLN B OE1 1 
ATOM   6082  N  NE2 . GLN B  1 169 ? 53.310 85.741  117.058 1.00 52.51  ? 169 GLN B NE2 1 
ATOM   6083  N  N   . VAL B  1 170 ? 49.952 82.601  113.244 1.00 40.57  ? 170 VAL B N   1 
ATOM   6084  C  CA  . VAL B  1 170 ? 50.530 81.366  112.707 1.00 40.85  ? 170 VAL B CA  1 
ATOM   6085  C  C   . VAL B  1 170 ? 51.739 81.803  111.859 1.00 45.15  ? 170 VAL B C   1 
ATOM   6086  O  O   . VAL B  1 170 ? 51.584 82.649  110.973 1.00 44.95  ? 170 VAL B O   1 
ATOM   6087  C  CB  . VAL B  1 170 ? 49.493 80.501  111.928 1.00 44.68  ? 170 VAL B CB  1 
ATOM   6088  C  CG1 . VAL B  1 170 ? 50.167 79.368  111.160 1.00 44.55  ? 170 VAL B CG1 1 
ATOM   6089  C  CG2 . VAL B  1 170 ? 48.424 79.943  112.864 1.00 45.05  ? 170 VAL B CG2 1 
ATOM   6090  N  N   . PHE B  1 171 ? 52.947 81.290  112.170 1.00 41.62  ? 171 PHE B N   1 
ATOM   6091  C  CA  . PHE B  1 171 ? 54.151 81.713  111.453 1.00 41.15  ? 171 PHE B CA  1 
ATOM   6092  C  C   . PHE B  1 171 ? 55.201 80.597  111.317 1.00 46.11  ? 171 PHE B C   1 
ATOM   6093  O  O   . PHE B  1 171 ? 55.331 79.779  112.232 1.00 46.85  ? 171 PHE B O   1 
ATOM   6094  C  CB  . PHE B  1 171 ? 54.783 82.939  112.149 1.00 42.69  ? 171 PHE B CB  1 
ATOM   6095  C  CG  . PHE B  1 171 ? 55.349 82.713  113.536 1.00 44.55  ? 171 PHE B CG  1 
ATOM   6096  C  CD1 . PHE B  1 171 ? 54.554 82.867  114.662 1.00 47.89  ? 171 PHE B CD1 1 
ATOM   6097  C  CD2 . PHE B  1 171 ? 56.689 82.392  113.715 1.00 46.84  ? 171 PHE B CD2 1 
ATOM   6098  C  CE1 . PHE B  1 171 ? 55.082 82.667  115.942 1.00 49.38  ? 171 PHE B CE1 1 
ATOM   6099  C  CE2 . PHE B  1 171 ? 57.213 82.188  114.994 1.00 50.16  ? 171 PHE B CE2 1 
ATOM   6100  C  CZ  . PHE B  1 171 ? 56.407 82.331  116.098 1.00 48.52  ? 171 PHE B CZ  1 
ATOM   6101  N  N   . PRO B  1 172 ? 56.006 80.584  110.223 1.00 42.23  ? 172 PRO B N   1 
ATOM   6102  C  CA  . PRO B  1 172 ? 57.055 79.561  110.101 1.00 42.53  ? 172 PRO B CA  1 
ATOM   6103  C  C   . PRO B  1 172 ? 58.312 79.932  110.895 1.00 46.53  ? 172 PRO B C   1 
ATOM   6104  O  O   . PRO B  1 172 ? 58.614 81.118  111.055 1.00 45.34  ? 172 PRO B O   1 
ATOM   6105  C  CB  . PRO B  1 172 ? 57.331 79.519  108.599 1.00 44.03  ? 172 PRO B CB  1 
ATOM   6106  C  CG  . PRO B  1 172 ? 56.963 80.848  108.090 1.00 47.77  ? 172 PRO B CG  1 
ATOM   6107  C  CD  . PRO B  1 172 ? 55.993 81.482  109.049 1.00 43.21  ? 172 PRO B CD  1 
ATOM   6108  N  N   . LEU B  1 173 ? 59.047 78.917  111.384 1.00 44.30  ? 173 LEU B N   1 
ATOM   6109  C  CA  . LEU B  1 173 ? 60.264 79.104  112.178 1.00 44.75  ? 173 LEU B CA  1 
ATOM   6110  C  C   . LEU B  1 173 ? 61.501 79.295  111.310 1.00 50.73  ? 173 LEU B C   1 
ATOM   6111  O  O   . LEU B  1 173 ? 61.655 78.613  110.296 1.00 50.91  ? 173 LEU B O   1 
ATOM   6112  C  CB  . LEU B  1 173 ? 60.489 77.907  113.111 1.00 45.36  ? 173 LEU B CB  1 
ATOM   6113  C  CG  . LEU B  1 173 ? 59.870 77.979  114.495 1.00 49.79  ? 173 LEU B CG  1 
ATOM   6114  C  CD1 . LEU B  1 173 ? 59.740 76.593  115.087 1.00 50.45  ? 173 LEU B CD1 1 
ATOM   6115  C  CD2 . LEU B  1 173 ? 60.692 78.861  115.429 1.00 52.28  ? 173 LEU B CD2 1 
ATOM   6116  N  N   . HIS B  1 174 ? 62.401 80.195  111.741 1.00 48.34  ? 174 HIS B N   1 
ATOM   6117  C  CA  . HIS B  1 174 ? 63.673 80.480  111.075 1.00 48.80  ? 174 HIS B CA  1 
ATOM   6118  C  C   . HIS B  1 174 ? 64.687 79.365  111.323 1.00 54.37  ? 174 HIS B C   1 
ATOM   6119  O  O   . HIS B  1 174 ? 64.722 78.803  112.423 1.00 54.71  ? 174 HIS B O   1 
ATOM   6120  C  CB  . HIS B  1 174 ? 64.272 81.801  111.607 1.00 49.57  ? 174 HIS B CB  1 
ATOM   6121  C  CG  . HIS B  1 174 ? 63.888 83.043  110.864 1.00 52.48  ? 174 HIS B CG  1 
ATOM   6122  N  ND1 . HIS B  1 174 ? 64.274 83.252  109.548 1.00 54.02  ? 174 HIS B ND1 1 
ATOM   6123  C  CD2 . HIS B  1 174 ? 63.251 84.149  111.310 1.00 53.95  ? 174 HIS B CD2 1 
ATOM   6124  C  CE1 . HIS B  1 174 ? 63.825 84.453  109.227 1.00 52.84  ? 174 HIS B CE1 1 
ATOM   6125  N  NE2 . HIS B  1 174 ? 63.205 85.034  110.255 1.00 53.16  ? 174 HIS B NE2 1 
ATOM   6126  N  N   . ASP B  1 175 ? 65.539 79.076  110.323 1.00 51.22  ? 175 ASP B N   1 
ATOM   6127  C  CA  . ASP B  1 175 ? 66.643 78.131  110.474 1.00 52.14  ? 175 ASP B CA  1 
ATOM   6128  C  C   . ASP B  1 175 ? 67.909 78.978  110.580 1.00 57.42  ? 175 ASP B C   1 
ATOM   6129  O  O   . ASP B  1 175 ? 68.517 79.329  109.565 1.00 56.91  ? 175 ASP B O   1 
ATOM   6130  C  CB  . ASP B  1 175 ? 66.699 77.093  109.336 1.00 54.08  ? 175 ASP B CB  1 
ATOM   6131  C  CG  . ASP B  1 175 ? 67.773 76.017  109.479 1.00 63.50  ? 175 ASP B CG  1 
ATOM   6132  O  OD1 . ASP B  1 175 ? 68.419 75.948  110.552 1.00 62.71  ? 175 ASP B OD1 1 
ATOM   6133  O  OD2 . ASP B  1 175 ? 67.955 75.235  108.524 1.00 71.88  ? 175 ASP B OD2 1 
ATOM   6134  N  N   . SER B  1 176 ? 68.244 79.363  111.829 1.00 55.07  ? 176 SER B N   1 
ATOM   6135  C  CA  . SER B  1 176 ? 69.358 80.223  112.246 1.00 55.21  ? 176 SER B CA  1 
ATOM   6136  C  C   . SER B  1 176 ? 70.650 79.957  111.464 1.00 58.83  ? 176 SER B C   1 
ATOM   6137  O  O   . SER B  1 176 ? 71.203 80.894  110.884 1.00 57.62  ? 176 SER B O   1 
ATOM   6138  C  CB  . SER B  1 176 ? 69.621 80.058  113.740 1.00 60.21  ? 176 SER B CB  1 
ATOM   6139  O  OG  . SER B  1 176 ? 68.428 80.175  114.500 1.00 70.86  ? 176 SER B OG  1 
ATOM   6140  N  N   . GLU B  1 177 ? 71.105 78.681  111.430 1.00 56.24  ? 177 GLU B N   1 
ATOM   6141  C  CA  . GLU B  1 177 ? 72.329 78.247  110.748 1.00 56.60  ? 177 GLU B CA  1 
ATOM   6142  C  C   . GLU B  1 177 ? 72.249 78.479  109.232 1.00 59.15  ? 177 GLU B C   1 
ATOM   6143  O  O   . GLU B  1 177 ? 73.217 78.972  108.653 1.00 58.94  ? 177 GLU B O   1 
ATOM   6144  C  CB  . GLU B  1 177 ? 72.625 76.769  111.050 1.00 58.92  ? 177 GLU B CB  1 
ATOM   6145  N  N   . ALA B  1 178 ? 71.098 78.146  108.604 1.00 54.04  ? 178 ALA B N   1 
ATOM   6146  C  CA  . ALA B  1 178 ? 70.866 78.324  107.167 1.00 52.65  ? 178 ALA B CA  1 
ATOM   6147  C  C   . ALA B  1 178 ? 70.789 79.805  106.794 1.00 54.54  ? 178 ALA B C   1 
ATOM   6148  O  O   . ALA B  1 178 ? 71.343 80.200  105.766 1.00 53.74  ? 178 ALA B O   1 
ATOM   6149  C  CB  . ALA B  1 178 ? 69.589 77.616  106.750 1.00 53.01  ? 178 ALA B CB  1 
ATOM   6150  N  N   . LEU B  1 179 ? 70.115 80.620  107.640 1.00 50.24  ? 179 LEU B N   1 
ATOM   6151  C  CA  . LEU B  1 179 ? 69.943 82.066  107.462 1.00 48.98  ? 179 LEU B CA  1 
ATOM   6152  C  C   . LEU B  1 179 ? 71.293 82.785  107.520 1.00 53.08  ? 179 LEU B C   1 
ATOM   6153  O  O   . LEU B  1 179 ? 71.519 83.697  106.723 1.00 52.58  ? 179 LEU B O   1 
ATOM   6154  C  CB  . LEU B  1 179 ? 68.977 82.633  108.525 1.00 48.37  ? 179 LEU B CB  1 
ATOM   6155  C  CG  . LEU B  1 179 ? 68.683 84.144  108.490 1.00 52.05  ? 179 LEU B CG  1 
ATOM   6156  C  CD1 . LEU B  1 179 ? 67.736 84.519  107.351 1.00 51.04  ? 179 LEU B CD1 1 
ATOM   6157  C  CD2 . LEU B  1 179 ? 68.133 84.618  109.823 1.00 54.28  ? 179 LEU B CD2 1 
ATOM   6158  N  N   . LYS B  1 180 ? 72.184 82.367  108.448 1.00 49.85  ? 180 LYS B N   1 
ATOM   6159  C  CA  . LYS B  1 180 ? 73.521 82.942  108.618 1.00 50.02  ? 180 LYS B CA  1 
ATOM   6160  C  C   . LYS B  1 180 ? 74.415 82.640  107.413 1.00 53.48  ? 180 LYS B C   1 
ATOM   6161  O  O   . LYS B  1 180 ? 75.217 83.494  107.032 1.00 53.66  ? 180 LYS B O   1 
ATOM   6162  C  CB  . LYS B  1 180 ? 74.178 82.428  109.905 1.00 53.68  ? 180 LYS B CB  1 
ATOM   6163  N  N   . LYS B  1 181 ? 74.268 81.437  106.811 1.00 49.17  ? 181 LYS B N   1 
ATOM   6164  C  CA  . LYS B  1 181 ? 75.036 81.007  105.638 1.00 49.09  ? 181 LYS B CA  1 
ATOM   6165  C  C   . LYS B  1 181 ? 74.648 81.834  104.415 1.00 51.90  ? 181 LYS B C   1 
ATOM   6166  O  O   . LYS B  1 181 ? 75.529 82.230  103.649 1.00 51.94  ? 181 LYS B O   1 
ATOM   6167  C  CB  . LYS B  1 181 ? 74.841 79.506  105.364 1.00 52.03  ? 181 LYS B CB  1 
ATOM   6168  C  CG  . LYS B  1 181 ? 75.589 78.590  106.336 1.00 68.57  ? 181 LYS B CG  1 
ATOM   6169  C  CD  . LYS B  1 181 ? 77.041 78.329  105.930 1.00 79.51  ? 181 LYS B CD  1 
ATOM   6170  N  N   . LEU B  1 182 ? 73.334 82.122  104.260 1.00 47.07  ? 182 LEU B N   1 
ATOM   6171  C  CA  . LEU B  1 182 ? 72.771 82.934  103.176 1.00 45.67  ? 182 LEU B CA  1 
ATOM   6172  C  C   . LEU B  1 182 ? 73.185 84.406  103.342 1.00 50.44  ? 182 LEU B C   1 
ATOM   6173  O  O   . LEU B  1 182 ? 73.493 85.063  102.348 1.00 49.78  ? 182 LEU B O   1 
ATOM   6174  C  CB  . LEU B  1 182 ? 71.229 82.783  103.146 1.00 44.33  ? 182 LEU B CB  1 
ATOM   6175  C  CG  . LEU B  1 182 ? 70.379 83.807  102.363 1.00 47.04  ? 182 LEU B CG  1 
ATOM   6176  C  CD1 . LEU B  1 182 ? 70.655 83.765  100.875 1.00 46.71  ? 182 LEU B CD1 1 
ATOM   6177  C  CD2 . LEU B  1 182 ? 68.909 83.576  102.598 1.00 48.30  ? 182 LEU B CD2 1 
ATOM   6178  N  N   . GLU B  1 183 ? 73.197 84.904  104.594 1.00 47.89  ? 183 GLU B N   1 
ATOM   6179  C  CA  . GLU B  1 183 ? 73.550 86.272  104.973 1.00 48.02  ? 183 GLU B CA  1 
ATOM   6180  C  C   . GLU B  1 183 ? 74.933 86.683  104.478 1.00 53.97  ? 183 GLU B C   1 
ATOM   6181  O  O   . GLU B  1 183 ? 75.088 87.801  103.990 1.00 53.61  ? 183 GLU B O   1 
ATOM   6182  C  CB  . GLU B  1 183 ? 73.509 86.418  106.499 1.00 49.66  ? 183 GLU B CB  1 
ATOM   6183  C  CG  . GLU B  1 183 ? 72.276 87.120  107.032 1.00 59.67  ? 183 GLU B CG  1 
ATOM   6184  C  CD  . GLU B  1 183 ? 72.209 87.247  108.542 1.00 84.82  ? 183 GLU B CD  1 
ATOM   6185  O  OE1 . GLU B  1 183 ? 73.261 87.133  109.213 1.00 73.36  ? 183 GLU B OE1 1 
ATOM   6186  O  OE2 . GLU B  1 183 ? 71.093 87.481  109.056 1.00 87.24  ? 183 GLU B OE2 1 
ATOM   6187  N  N   . ASP B  1 184 ? 75.931 85.788  104.615 1.00 52.18  ? 184 ASP B N   1 
ATOM   6188  C  CA  . ASP B  1 184 ? 77.323 86.033  104.231 1.00 53.17  ? 184 ASP B CA  1 
ATOM   6189  C  C   . ASP B  1 184 ? 77.506 86.043  102.709 1.00 57.24  ? 184 ASP B C   1 
ATOM   6190  O  O   . ASP B  1 184 ? 78.421 86.707  102.218 1.00 57.36  ? 184 ASP B O   1 
ATOM   6191  C  CB  . ASP B  1 184 ? 78.250 84.995  104.884 1.00 56.25  ? 184 ASP B CB  1 
ATOM   6192  C  CG  . ASP B  1 184 ? 78.204 84.974  106.409 1.00 68.72  ? 184 ASP B CG  1 
ATOM   6193  O  OD1 . ASP B  1 184 ? 77.676 85.944  107.007 1.00 69.00  ? 184 ASP B OD1 1 
ATOM   6194  O  OD2 . ASP B  1 184 ? 78.705 83.994  107.005 1.00 75.75  ? 184 ASP B OD2 1 
ATOM   6195  N  N   . THR B  1 185 ? 76.633 85.333  101.968 1.00 53.42  ? 185 THR B N   1 
ATOM   6196  C  CA  . THR B  1 185 ? 76.684 85.280  100.502 1.00 53.02  ? 185 THR B CA  1 
ATOM   6197  C  C   . THR B  1 185 ? 75.782 86.378  99.897  1.00 55.51  ? 185 THR B C   1 
ATOM   6198  O  O   . THR B  1 185 ? 75.897 86.671  98.708  1.00 55.04  ? 185 THR B O   1 
ATOM   6199  C  CB  . THR B  1 185 ? 76.326 83.872  99.975  1.00 60.52  ? 185 THR B CB  1 
ATOM   6200  O  OG1 . THR B  1 185 ? 74.946 83.592  100.210 1.00 60.30  ? 185 THR B OG1 1 
ATOM   6201  C  CG2 . THR B  1 185 ? 77.204 82.772  100.572 1.00 59.38  ? 185 THR B CG2 1 
ATOM   6202  N  N   . TRP B  1 186 ? 74.910 86.989  100.725 1.00 51.21  ? 186 TRP B N   1 
ATOM   6203  C  CA  . TRP B  1 186 ? 73.973 88.052  100.344 1.00 50.05  ? 186 TRP B CA  1 
ATOM   6204  C  C   . TRP B  1 186 ? 74.586 89.440  100.587 1.00 55.33  ? 186 TRP B C   1 
ATOM   6205  O  O   . TRP B  1 186 ? 74.587 90.276  99.682  1.00 54.79  ? 186 TRP B O   1 
ATOM   6206  C  CB  . TRP B  1 186 ? 72.662 87.902  101.145 1.00 47.69  ? 186 TRP B CB  1 
ATOM   6207  C  CG  . TRP B  1 186 ? 71.414 88.402  100.474 1.00 47.61  ? 186 TRP B CG  1 
ATOM   6208  C  CD1 . TRP B  1 186 ? 71.328 89.146  99.335  1.00 50.00  ? 186 TRP B CD1 1 
ATOM   6209  C  CD2 . TRP B  1 186 ? 70.069 88.212  100.931 1.00 46.59  ? 186 TRP B CD2 1 
ATOM   6210  N  NE1 . TRP B  1 186 ? 70.012 89.420  99.046  1.00 48.67  ? 186 TRP B NE1 1 
ATOM   6211  C  CE2 . TRP B  1 186 ? 69.218 88.866  100.015 1.00 49.81  ? 186 TRP B CE2 1 
ATOM   6212  C  CE3 . TRP B  1 186 ? 69.498 87.560  102.038 1.00 47.87  ? 186 TRP B CE3 1 
ATOM   6213  C  CZ2 . TRP B  1 186 ? 67.827 88.879  100.163 1.00 48.55  ? 186 TRP B CZ2 1 
ATOM   6214  C  CZ3 . TRP B  1 186 ? 68.119 87.575  102.183 1.00 48.74  ? 186 TRP B CZ3 1 
ATOM   6215  C  CH2 . TRP B  1 186 ? 67.299 88.229  101.255 1.00 48.81  ? 186 TRP B CH2 1 
ATOM   6216  N  N   . TYR B  1 187 ? 75.092 89.674  101.824 1.00 52.76  ? 187 TYR B N   1 
ATOM   6217  C  CA  . TYR B  1 187 ? 75.717 90.912  102.311 1.00 68.03  ? 187 TYR B CA  1 
ATOM   6218  C  C   . TYR B  1 187 ? 76.659 90.564  103.485 1.00 100.96 ? 187 TYR B C   1 
ATOM   6219  O  O   . TYR B  1 187 ? 77.217 91.430  104.160 1.00 59.76  ? 187 TYR B O   1 
ATOM   6220  C  CB  . TYR B  1 187 ? 74.641 91.955  102.715 1.00 68.01  ? 187 TYR B CB  1 
ATOM   6221  C  CG  . TYR B  1 187 ? 73.830 91.603  103.948 1.00 69.19  ? 187 TYR B CG  1 
ATOM   6222  C  CD1 . TYR B  1 187 ? 72.747 90.733  103.872 1.00 70.41  ? 187 TYR B CD1 1 
ATOM   6223  C  CD2 . TYR B  1 187 ? 74.116 92.180  105.184 1.00 70.32  ? 187 TYR B CD2 1 
ATOM   6224  C  CE1 . TYR B  1 187 ? 71.988 90.419  104.999 1.00 70.86  ? 187 TYR B CE1 1 
ATOM   6225  C  CE2 . TYR B  1 187 ? 73.368 91.869  106.320 1.00 70.80  ? 187 TYR B CE2 1 
ATOM   6226  C  CZ  . TYR B  1 187 ? 72.304 90.988  106.223 1.00 76.18  ? 187 TYR B CZ  1 
ATOM   6227  O  OH  . TYR B  1 187 ? 71.567 90.678  107.339 1.00 74.87  ? 187 TYR B OH  1 
ATOM   6228  N  N   . LEU B  1 192 ? 81.335 94.047  95.058  1.00 65.78  ? 192 LEU B N   1 
ATOM   6229  C  CA  . LEU B  1 192 ? 80.523 93.913  93.850  1.00 65.03  ? 192 LEU B CA  1 
ATOM   6230  C  C   . LEU B  1 192 ? 80.388 92.435  93.465  1.00 68.80  ? 192 LEU B C   1 
ATOM   6231  O  O   . LEU B  1 192 ? 81.393 91.726  93.392  1.00 69.14  ? 192 LEU B O   1 
ATOM   6232  C  CB  . LEU B  1 192 ? 81.128 94.744  92.695  1.00 65.52  ? 192 LEU B CB  1 
ATOM   6233  C  CG  . LEU B  1 192 ? 80.357 94.779  91.360  1.00 69.70  ? 192 LEU B CG  1 
ATOM   6234  C  CD1 . LEU B  1 192 ? 78.992 95.483  91.497  1.00 68.89  ? 192 LEU B CD1 1 
ATOM   6235  C  CD2 . LEU B  1 192 ? 81.191 95.438  90.274  1.00 72.43  ? 192 LEU B CD2 1 
ATOM   6236  N  N   . LYS B  1 193 ? 79.137 91.978  93.236  1.00 64.54  ? 193 LYS B N   1 
ATOM   6237  C  CA  . LYS B  1 193 ? 78.786 90.590  92.890  1.00 64.35  ? 193 LYS B CA  1 
ATOM   6238  C  C   . LYS B  1 193 ? 77.330 90.459  92.406  1.00 68.13  ? 193 LYS B C   1 
ATOM   6239  O  O   . LYS B  1 193 ? 76.527 91.377  92.597  1.00 67.56  ? 193 LYS B O   1 
ATOM   6240  C  CB  . LYS B  1 193 ? 78.989 89.659  94.111  1.00 66.49  ? 193 LYS B CB  1 
ATOM   6241  C  CG  . LYS B  1 193 ? 78.314 90.158  95.393  1.00 70.28  ? 193 LYS B CG  1 
ATOM   6242  C  CD  . LYS B  1 193 ? 77.715 89.038  96.216  1.00 74.89  ? 193 LYS B CD  1 
ATOM   6243  C  CE  . LYS B  1 193 ? 77.010 89.573  97.437  1.00 81.43  ? 193 LYS B CE  1 
ATOM   6244  N  NZ  . LYS B  1 193 ? 75.707 90.208  97.102  1.00 87.54  ? 193 LYS B NZ  1 
ATOM   6245  N  N   . TYR B  1 194 ? 76.994 89.300  91.808  1.00 64.62  ? 194 TYR B N   1 
ATOM   6246  C  CA  . TYR B  1 194 ? 75.631 88.976  91.390  1.00 63.61  ? 194 TYR B CA  1 
ATOM   6247  C  C   . TYR B  1 194 ? 74.900 88.392  92.591  1.00 67.38  ? 194 TYR B C   1 
ATOM   6248  O  O   . TYR B  1 194 ? 75.450 87.518  93.268  1.00 68.26  ? 194 TYR B O   1 
ATOM   6249  C  CB  . TYR B  1 194 ? 75.621 87.992  90.203  1.00 64.98  ? 194 TYR B CB  1 
ATOM   6250  C  CG  . TYR B  1 194 ? 75.963 88.618  88.869  1.00 66.85  ? 194 TYR B CG  1 
ATOM   6251  C  CD1 . TYR B  1 194 ? 74.989 89.258  88.107  1.00 68.19  ? 194 TYR B CD1 1 
ATOM   6252  C  CD2 . TYR B  1 194 ? 77.248 88.531  88.344  1.00 68.64  ? 194 TYR B CD2 1 
ATOM   6253  C  CE1 . TYR B  1 194 ? 75.297 89.832  86.874  1.00 69.52  ? 194 TYR B CE1 1 
ATOM   6254  C  CE2 . TYR B  1 194 ? 77.567 89.096  87.110  1.00 69.86  ? 194 TYR B CE2 1 
ATOM   6255  C  CZ  . TYR B  1 194 ? 76.589 89.748  86.379  1.00 77.25  ? 194 TYR B CZ  1 
ATOM   6256  O  OH  . TYR B  1 194 ? 76.900 90.305  85.162  1.00 79.77  ? 194 TYR B OH  1 
ATOM   6257  N  N   . GLN B  1 195 ? 73.686 88.894  92.882  1.00 62.31  ? 195 GLN B N   1 
ATOM   6258  C  CA  . GLN B  1 195 ? 72.860 88.466  94.018  1.00 61.27  ? 195 GLN B CA  1 
ATOM   6259  C  C   . GLN B  1 195 ? 72.525 86.955  93.979  1.00 63.51  ? 195 GLN B C   1 
ATOM   6260  O  O   . GLN B  1 195 ? 72.264 86.430  92.893  1.00 63.63  ? 195 GLN B O   1 
ATOM   6261  C  CB  . GLN B  1 195 ? 71.564 89.274  94.054  1.00 61.82  ? 195 GLN B CB  1 
ATOM   6262  C  CG  . GLN B  1 195 ? 71.567 90.396  95.066  1.00 79.70  ? 195 GLN B CG  1 
ATOM   6263  C  CD  . GLN B  1 195 ? 70.153 90.783  95.404  1.00 103.97 ? 195 GLN B CD  1 
ATOM   6264  O  OE1 . GLN B  1 195 ? 69.569 90.290  96.374  1.00 97.86  ? 195 GLN B OE1 1 
ATOM   6265  N  NE2 . GLN B  1 195 ? 69.577 91.689  94.624  1.00 101.32 ? 195 GLN B NE2 1 
ATOM   6266  N  N   . PRO B  1 196 ? 72.527 86.242  95.135  1.00 58.01  ? 196 PRO B N   1 
ATOM   6267  C  CA  . PRO B  1 196 ? 72.215 84.801  95.108  1.00 57.44  ? 196 PRO B CA  1 
ATOM   6268  C  C   . PRO B  1 196 ? 70.702 84.541  95.188  1.00 58.65  ? 196 PRO B C   1 
ATOM   6269  O  O   . PRO B  1 196 ? 70.197 84.082  96.218  1.00 58.11  ? 196 PRO B O   1 
ATOM   6270  C  CB  . PRO B  1 196 ? 72.970 84.261  96.328  1.00 59.92  ? 196 PRO B CB  1 
ATOM   6271  C  CG  . PRO B  1 196 ? 73.084 85.430  97.268  1.00 64.20  ? 196 PRO B CG  1 
ATOM   6272  C  CD  . PRO B  1 196 ? 72.816 86.703  96.510  1.00 59.30  ? 196 PRO B CD  1 
ATOM   6273  N  N   . ILE B  1 197 ? 69.989 84.823  94.074  1.00 52.90  ? 197 ILE B N   1 
ATOM   6274  C  CA  . ILE B  1 197 ? 68.529 84.709  93.922  1.00 51.11  ? 197 ILE B CA  1 
ATOM   6275  C  C   . ILE B  1 197 ? 68.044 83.266  94.176  1.00 55.43  ? 197 ILE B C   1 
ATOM   6276  O  O   . ILE B  1 197 ? 67.001 83.087  94.808  1.00 54.65  ? 197 ILE B O   1 
ATOM   6277  C  CB  . ILE B  1 197 ? 68.060 85.255  92.535  1.00 53.16  ? 197 ILE B CB  1 
ATOM   6278  C  CG1 . ILE B  1 197 ? 68.636 86.668  92.231  1.00 52.90  ? 197 ILE B CG1 1 
ATOM   6279  C  CG2 . ILE B  1 197 ? 66.533 85.240  92.381  1.00 53.15  ? 197 ILE B CG2 1 
ATOM   6280  C  CD1 . ILE B  1 197 ? 68.319 87.808  93.260  1.00 56.67  ? 197 ILE B CD1 1 
ATOM   6281  N  N   . ASP B  1 198 ? 68.807 82.253  93.729  1.00 53.10  ? 198 ASP B N   1 
ATOM   6282  C  CA  . ASP B  1 198 ? 68.461 80.844  93.943  1.00 53.40  ? 198 ASP B CA  1 
ATOM   6283  C  C   . ASP B  1 198 ? 68.575 80.462  95.428  1.00 56.44  ? 198 ASP B C   1 
ATOM   6284  O  O   . ASP B  1 198 ? 67.808 79.618  95.892  1.00 56.07  ? 198 ASP B O   1 
ATOM   6285  C  CB  . ASP B  1 198 ? 69.331 79.924  93.076  1.00 56.40  ? 198 ASP B CB  1 
ATOM   6286  C  CG  . ASP B  1 198 ? 69.024 80.025  91.595  1.00 68.38  ? 198 ASP B CG  1 
ATOM   6287  O  OD1 . ASP B  1 198 ? 67.898 79.650  91.193  1.00 68.38  ? 198 ASP B OD1 1 
ATOM   6288  O  OD2 . ASP B  1 198 ? 69.911 80.466  90.836  1.00 76.75  ? 198 ASP B OD2 1 
ATOM   6289  N  N   . SER B  1 199 ? 69.503 81.103  96.171  1.00 52.45  ? 199 SER B N   1 
ATOM   6290  C  CA  . SER B  1 199 ? 69.688 80.888  97.609  1.00 52.10  ? 199 SER B CA  1 
ATOM   6291  C  C   . SER B  1 199 ? 68.560 81.569  98.400  1.00 53.78  ? 199 SER B C   1 
ATOM   6292  O  O   . SER B  1 199 ? 68.074 80.989  99.376  1.00 53.12  ? 199 SER B O   1 
ATOM   6293  C  CB  . SER B  1 199 ? 71.049 81.401  98.065  1.00 56.59  ? 199 SER B CB  1 
ATOM   6294  O  OG  . SER B  1 199 ? 72.108 80.732  97.401  1.00 68.18  ? 199 SER B OG  1 
ATOM   6295  N  N   . ILE B  1 200 ? 68.130 82.786  97.962  1.00 48.48  ? 200 ILE B N   1 
ATOM   6296  C  CA  . ILE B  1 200 ? 67.026 83.551  98.566  1.00 46.78  ? 200 ILE B CA  1 
ATOM   6297  C  C   . ILE B  1 200 ? 65.719 82.753  98.380  1.00 51.03  ? 200 ILE B C   1 
ATOM   6298  O  O   . ILE B  1 200 ? 64.908 82.697  99.306  1.00 51.28  ? 200 ILE B O   1 
ATOM   6299  C  CB  . ILE B  1 200 ? 66.920 84.996  97.990  1.00 48.64  ? 200 ILE B CB  1 
ATOM   6300  C  CG1 . ILE B  1 200 ? 68.237 85.779  98.175  1.00 48.86  ? 200 ILE B CG1 1 
ATOM   6301  C  CG2 . ILE B  1 200 ? 65.746 85.767  98.620  1.00 48.54  ? 200 ILE B CG2 1 
ATOM   6302  C  CD1 . ILE B  1 200 ? 68.512 86.853  97.115  1.00 52.96  ? 200 ILE B CD1 1 
ATOM   6303  N  N   . ARG B  1 201 ? 65.548 82.105  97.199  1.00 46.79  ? 201 ARG B N   1 
ATOM   6304  C  CA  . ARG B  1 201 ? 64.388 81.274  96.852  1.00 45.98  ? 201 ARG B CA  1 
ATOM   6305  C  C   . ARG B  1 201 ? 64.275 80.057  97.783  1.00 51.01  ? 201 ARG B C   1 
ATOM   6306  O  O   . ARG B  1 201 ? 63.180 79.752  98.257  1.00 50.53  ? 201 ARG B O   1 
ATOM   6307  C  CB  . ARG B  1 201 ? 64.470 80.822  95.385  1.00 44.04  ? 201 ARG B CB  1 
ATOM   6308  C  CG  . ARG B  1 201 ? 63.220 80.113  94.892  1.00 50.25  ? 201 ARG B CG  1 
ATOM   6309  C  CD  . ARG B  1 201 ? 63.576 78.827  94.186  1.00 61.45  ? 201 ARG B CD  1 
ATOM   6310  N  NE  . ARG B  1 201 ? 62.499 77.843  94.281  1.00 71.20  ? 201 ARG B NE  1 
ATOM   6311  C  CZ  . ARG B  1 201 ? 62.513 76.653  93.691  1.00 88.25  ? 201 ARG B CZ  1 
ATOM   6312  N  NH1 . ARG B  1 201 ? 63.551 76.285  92.947  1.00 73.78  ? 201 ARG B NH1 1 
ATOM   6313  N  NH2 . ARG B  1 201 ? 61.492 75.821  93.836  1.00 80.07  ? 201 ARG B NH2 1 
ATOM   6314  N  N   . GLY B  1 202 ? 65.404 79.395  98.036  1.00 48.45  ? 202 GLY B N   1 
ATOM   6315  C  CA  . GLY B  1 202 ? 65.484 78.222  98.898  1.00 48.83  ? 202 GLY B CA  1 
ATOM   6316  C  C   . GLY B  1 202 ? 65.095 78.480  100.338 1.00 52.61  ? 202 GLY B C   1 
ATOM   6317  O  O   . GLY B  1 202 ? 64.576 77.578  101.003 1.00 53.54  ? 202 GLY B O   1 
ATOM   6318  N  N   . TYR B  1 203 ? 65.323 79.719  100.827 1.00 47.54  ? 203 TYR B N   1 
ATOM   6319  C  CA  . TYR B  1 203 ? 65.008 80.093  102.205 1.00 46.76  ? 203 TYR B CA  1 
ATOM   6320  C  C   . TYR B  1 203 ? 63.665 80.818  102.343 1.00 49.75  ? 203 TYR B C   1 
ATOM   6321  O  O   . TYR B  1 203 ? 62.873 80.465  103.222 1.00 49.44  ? 203 TYR B O   1 
ATOM   6322  C  CB  . TYR B  1 203 ? 66.120 80.977  102.814 1.00 47.44  ? 203 TYR B CB  1 
ATOM   6323  C  CG  . TYR B  1 203 ? 66.054 81.057  104.325 1.00 48.54  ? 203 TYR B CG  1 
ATOM   6324  C  CD1 . TYR B  1 203 ? 65.291 82.033  104.961 1.00 49.58  ? 203 TYR B CD1 1 
ATOM   6325  C  CD2 . TYR B  1 203 ? 66.724 80.132  105.121 1.00 50.03  ? 203 TYR B CD2 1 
ATOM   6326  C  CE1 . TYR B  1 203 ? 65.189 82.081  106.350 1.00 49.87  ? 203 TYR B CE1 1 
ATOM   6327  C  CE2 . TYR B  1 203 ? 66.646 80.183  106.510 1.00 51.03  ? 203 TYR B CE2 1 
ATOM   6328  C  CZ  . TYR B  1 203 ? 65.879 81.161  107.120 1.00 56.82  ? 203 TYR B CZ  1 
ATOM   6329  O  OH  . TYR B  1 203 ? 65.805 81.201  108.488 1.00 58.04  ? 203 TYR B OH  1 
ATOM   6330  N  N   . PHE B  1 204 ? 63.444 81.869  101.536 1.00 45.13  ? 204 PHE B N   1 
ATOM   6331  C  CA  . PHE B  1 204 ? 62.265 82.719  101.662 1.00 44.00  ? 204 PHE B CA  1 
ATOM   6332  C  C   . PHE B  1 204 ? 61.125 82.387  100.702 1.00 47.61  ? 204 PHE B C   1 
ATOM   6333  O  O   . PHE B  1 204 ? 59.977 82.684  101.032 1.00 47.66  ? 204 PHE B O   1 
ATOM   6334  C  CB  . PHE B  1 204 ? 62.657 84.190  101.502 1.00 45.12  ? 204 PHE B CB  1 
ATOM   6335  C  CG  . PHE B  1 204 ? 63.505 84.719  102.635 1.00 46.61  ? 204 PHE B CG  1 
ATOM   6336  C  CD1 . PHE B  1 204 ? 62.923 85.124  103.831 1.00 49.10  ? 204 PHE B CD1 1 
ATOM   6337  C  CD2 . PHE B  1 204 ? 64.884 84.816  102.506 1.00 48.85  ? 204 PHE B CD2 1 
ATOM   6338  C  CE1 . PHE B  1 204 ? 63.705 85.614  104.877 1.00 50.03  ? 204 PHE B CE1 1 
ATOM   6339  C  CE2 . PHE B  1 204 ? 65.666 85.308  103.552 1.00 51.72  ? 204 PHE B CE2 1 
ATOM   6340  C  CZ  . PHE B  1 204 ? 65.071 85.699  104.730 1.00 49.63  ? 204 PHE B CZ  1 
ATOM   6341  N  N   . GLY B  1 205 ? 61.428 81.799  99.547  1.00 43.37  ? 205 GLY B N   1 
ATOM   6342  C  CA  . GLY B  1 205 ? 60.402 81.459  98.566  1.00 42.91  ? 205 GLY B CA  1 
ATOM   6343  C  C   . GLY B  1 205 ? 60.490 82.217  97.256  1.00 46.23  ? 205 GLY B C   1 
ATOM   6344  O  O   . GLY B  1 205 ? 61.334 83.101  97.093  1.00 45.62  ? 205 GLY B O   1 
ATOM   6345  N  N   . GLU B  1 206 ? 59.601 81.870  96.315  1.00 42.66  ? 206 GLU B N   1 
ATOM   6346  C  CA  . GLU B  1 206 ? 59.563 82.422  94.963  1.00 42.33  ? 206 GLU B CA  1 
ATOM   6347  C  C   . GLU B  1 206 ? 59.184 83.912  94.924  1.00 45.94  ? 206 GLU B C   1 
ATOM   6348  O  O   . GLU B  1 206 ? 59.751 84.638  94.110  1.00 44.81  ? 206 GLU B O   1 
ATOM   6349  C  CB  . GLU B  1 206 ? 58.605 81.614  94.068  1.00 43.86  ? 206 GLU B CB  1 
ATOM   6350  C  CG  . GLU B  1 206 ? 59.106 80.227  93.681  1.00 54.78  ? 206 GLU B CG  1 
ATOM   6351  C  CD  . GLU B  1 206 ? 59.033 79.131  94.732  1.00 85.03  ? 206 GLU B CD  1 
ATOM   6352  O  OE1 . GLU B  1 206 ? 58.272 79.277  95.717  1.00 84.88  ? 206 GLU B OE1 1 
ATOM   6353  O  OE2 . GLU B  1 206 ? 59.732 78.109  94.555  1.00 84.49  ? 206 GLU B OE2 1 
ATOM   6354  N  N   . THR B  1 207 ? 58.247 84.365  95.788  1.00 42.96  ? 207 THR B N   1 
ATOM   6355  C  CA  . THR B  1 207 ? 57.778 85.759  95.819  1.00 42.56  ? 207 THR B CA  1 
ATOM   6356  C  C   . THR B  1 207 ? 58.875 86.728  96.296  1.00 47.03  ? 207 THR B C   1 
ATOM   6357  O  O   . THR B  1 207 ? 59.094 87.759  95.647  1.00 47.03  ? 207 THR B O   1 
ATOM   6358  C  CB  . THR B  1 207 ? 56.515 85.888  96.691  1.00 48.74  ? 207 THR B CB  1 
ATOM   6359  O  OG1 . THR B  1 207 ? 55.529 84.986  96.199  1.00 45.46  ? 207 THR B OG1 1 
ATOM   6360  C  CG2 . THR B  1 207 ? 55.936 87.310  96.700  1.00 47.41  ? 207 THR B CG2 1 
ATOM   6361  N  N   . ILE B  1 208 ? 59.533 86.408  97.426  1.00 43.01  ? 208 ILE B N   1 
ATOM   6362  C  CA  . ILE B  1 208 ? 60.575 87.237  98.030  1.00 42.46  ? 208 ILE B CA  1 
ATOM   6363  C  C   . ILE B  1 208 ? 61.817 87.238  97.113  1.00 45.96  ? 208 ILE B C   1 
ATOM   6364  O  O   . ILE B  1 208 ? 62.357 88.311  96.849  1.00 45.70  ? 208 ILE B O   1 
ATOM   6365  C  CB  . ILE B  1 208 ? 60.881 86.803  99.495  1.00 45.79  ? 208 ILE B CB  1 
ATOM   6366  C  CG1 . ILE B  1 208 ? 59.615 86.882  100.389 1.00 46.37  ? 208 ILE B CG1 1 
ATOM   6367  C  CG2 . ILE B  1 208 ? 61.996 87.649  100.116 1.00 45.94  ? 208 ILE B CG2 1 
ATOM   6368  C  CD1 . ILE B  1 208 ? 58.705 85.616  100.432 1.00 55.23  ? 208 ILE B CD1 1 
ATOM   6369  N  N   . ALA B  1 209 ? 62.213 86.067  96.570  1.00 42.22  ? 209 ALA B N   1 
ATOM   6370  C  CA  . ALA B  1 209 ? 63.353 85.968  95.645  1.00 41.98  ? 209 ALA B CA  1 
ATOM   6371  C  C   . ALA B  1 209 ? 63.078 86.684  94.319  1.00 43.38  ? 209 ALA B C   1 
ATOM   6372  O  O   . ALA B  1 209 ? 64.014 87.211  93.713  1.00 43.06  ? 209 ALA B O   1 
ATOM   6373  C  CB  . ALA B  1 209 ? 63.701 84.517  95.378  1.00 43.34  ? 209 ALA B CB  1 
ATOM   6374  N  N   . LEU B  1 210 ? 61.800 86.707  93.874  1.00 37.77  ? 210 LEU B N   1 
ATOM   6375  C  CA  . LEU B  1 210 ? 61.408 87.394  92.644  1.00 36.43  ? 210 LEU B CA  1 
ATOM   6376  C  C   . LEU B  1 210 ? 61.590 88.895  92.794  1.00 37.76  ? 210 LEU B C   1 
ATOM   6377  O  O   . LEU B  1 210 ? 61.994 89.540  91.825  1.00 37.57  ? 210 LEU B O   1 
ATOM   6378  C  CB  . LEU B  1 210 ? 59.963 87.079  92.236  1.00 36.17  ? 210 LEU B CB  1 
ATOM   6379  C  CG  . LEU B  1 210 ? 59.795 86.331  90.920  1.00 40.62  ? 210 LEU B CG  1 
ATOM   6380  C  CD1 . LEU B  1 210 ? 58.441 85.672  90.850  1.00 40.92  ? 210 LEU B CD1 1 
ATOM   6381  C  CD2 . LEU B  1 210 ? 59.974 87.255  89.736  1.00 41.91  ? 210 LEU B CD2 1 
ATOM   6382  N  N   . TYR B  1 211 ? 61.315 89.449  94.006  1.00 31.77  ? 211 TYR B N   1 
ATOM   6383  C  CA  . TYR B  1 211 ? 61.503 90.873  94.265  1.00 30.58  ? 211 TYR B CA  1 
ATOM   6384  C  C   . TYR B  1 211 ? 62.985 91.228  94.163  1.00 35.75  ? 211 TYR B C   1 
ATOM   6385  O  O   . TYR B  1 211 ? 63.320 92.184  93.466  1.00 35.33  ? 211 TYR B O   1 
ATOM   6386  C  CB  . TYR B  1 211 ? 60.918 91.334  95.618  1.00 30.70  ? 211 TYR B CB  1 
ATOM   6387  C  CG  . TYR B  1 211 ? 61.503 92.659  96.064  1.00 31.35  ? 211 TYR B CG  1 
ATOM   6388  C  CD1 . TYR B  1 211 ? 61.229 93.834  95.366  1.00 32.67  ? 211 TYR B CD1 1 
ATOM   6389  C  CD2 . TYR B  1 211 ? 62.415 92.722  97.113  1.00 32.30  ? 211 TYR B CD2 1 
ATOM   6390  C  CE1 . TYR B  1 211 ? 61.846 95.036  95.703  1.00 32.92  ? 211 TYR B CE1 1 
ATOM   6391  C  CE2 . TYR B  1 211 ? 63.023 93.923  97.472  1.00 33.35  ? 211 TYR B CE2 1 
ATOM   6392  C  CZ  . TYR B  1 211 ? 62.735 95.078  96.764  1.00 40.50  ? 211 TYR B CZ  1 
ATOM   6393  O  OH  . TYR B  1 211 ? 63.308 96.272  97.125  1.00 42.77  ? 211 TYR B OH  1 
ATOM   6394  N  N   . PHE B  1 212 ? 63.862 90.467  94.848  1.00 33.71  ? 212 PHE B N   1 
ATOM   6395  C  CA  . PHE B  1 212 ? 65.308 90.695  94.817  1.00 34.59  ? 212 PHE B CA  1 
ATOM   6396  C  C   . PHE B  1 212 ? 65.876 90.449  93.406  1.00 39.88  ? 212 PHE B C   1 
ATOM   6397  O  O   . PHE B  1 212 ? 66.866 91.083  93.028  1.00 39.83  ? 212 PHE B O   1 
ATOM   6398  C  CB  . PHE B  1 212 ? 66.022 89.840  95.873  1.00 36.86  ? 212 PHE B CB  1 
ATOM   6399  C  CG  . PHE B  1 212 ? 65.773 90.348  97.273  1.00 38.52  ? 212 PHE B CG  1 
ATOM   6400  C  CD1 . PHE B  1 212 ? 66.479 91.436  97.772  1.00 42.05  ? 212 PHE B CD1 1 
ATOM   6401  C  CD2 . PHE B  1 212 ? 64.810 89.759  98.082  1.00 40.60  ? 212 PHE B CD2 1 
ATOM   6402  C  CE1 . PHE B  1 212 ? 66.230 91.921  99.060  1.00 43.05  ? 212 PHE B CE1 1 
ATOM   6403  C  CE2 . PHE B  1 212 ? 64.561 90.244  99.369  1.00 43.52  ? 212 PHE B CE2 1 
ATOM   6404  C  CZ  . PHE B  1 212 ? 65.274 91.321  99.851  1.00 41.82  ? 212 PHE B CZ  1 
ATOM   6405  N  N   . GLY B  1 213 ? 65.208 89.580  92.640  1.00 36.72  ? 213 GLY B N   1 
ATOM   6406  C  CA  . GLY B  1 213 ? 65.550 89.288  91.253  1.00 36.88  ? 213 GLY B CA  1 
ATOM   6407  C  C   . GLY B  1 213 ? 65.231 90.470  90.359  1.00 40.74  ? 213 GLY B C   1 
ATOM   6408  O  O   . GLY B  1 213 ? 66.018 90.809  89.467  1.00 41.01  ? 213 GLY B O   1 
ATOM   6409  N  N   . PHE B  1 214 ? 64.067 91.119  90.612  1.00 36.09  ? 214 PHE B N   1 
ATOM   6410  C  CA  . PHE B  1 214 ? 63.613 92.302  89.882  1.00 35.15  ? 214 PHE B CA  1 
ATOM   6411  C  C   . PHE B  1 214 ? 64.428 93.520  90.294  1.00 39.86  ? 214 PHE B C   1 
ATOM   6412  O  O   . PHE B  1 214 ? 64.737 94.343  89.435  1.00 40.46  ? 214 PHE B O   1 
ATOM   6413  C  CB  . PHE B  1 214 ? 62.109 92.561  90.085  1.00 35.98  ? 214 PHE B CB  1 
ATOM   6414  C  CG  . PHE B  1 214 ? 61.592 93.741  89.291  1.00 36.92  ? 214 PHE B CG  1 
ATOM   6415  C  CD1 . PHE B  1 214 ? 61.362 93.634  87.924  1.00 39.74  ? 214 PHE B CD1 1 
ATOM   6416  C  CD2 . PHE B  1 214 ? 61.362 94.966  89.904  1.00 38.40  ? 214 PHE B CD2 1 
ATOM   6417  C  CE1 . PHE B  1 214 ? 60.907 94.730  87.187  1.00 40.20  ? 214 PHE B CE1 1 
ATOM   6418  C  CE2 . PHE B  1 214 ? 60.907 96.061  89.165  1.00 40.82  ? 214 PHE B CE2 1 
ATOM   6419  C  CZ  . PHE B  1 214 ? 60.680 95.935  87.813  1.00 38.71  ? 214 PHE B CZ  1 
ATOM   6420  N  N   . LEU B  1 215 ? 64.764 93.641  91.598  1.00 35.24  ? 215 LEU B N   1 
ATOM   6421  C  CA  . LEU B  1 215 ? 65.563 94.740  92.141  1.00 34.62  ? 215 LEU B CA  1 
ATOM   6422  C  C   . LEU B  1 215 ? 66.938 94.758  91.469  1.00 38.53  ? 215 LEU B C   1 
ATOM   6423  O  O   . LEU B  1 215 ? 67.337 95.798  90.950  1.00 38.05  ? 215 LEU B O   1 
ATOM   6424  C  CB  . LEU B  1 215 ? 65.685 94.613  93.675  1.00 34.67  ? 215 LEU B CB  1 
ATOM   6425  C  CG  . LEU B  1 215 ? 66.671 95.534  94.412  1.00 39.68  ? 215 LEU B CG  1 
ATOM   6426  C  CD1 . LEU B  1 215 ? 66.250 96.995  94.346  1.00 39.27  ? 215 LEU B CD1 1 
ATOM   6427  C  CD2 . LEU B  1 215 ? 66.800 95.120  95.850  1.00 42.68  ? 215 LEU B CD2 1 
ATOM   6428  N  N   . GLU B  1 216 ? 67.621 93.590  91.428  1.00 35.46  ? 216 GLU B N   1 
ATOM   6429  C  CA  . GLU B  1 216 ? 68.935 93.414  90.807  1.00 35.76  ? 216 GLU B CA  1 
ATOM   6430  C  C   . GLU B  1 216 ? 68.880 93.766  89.312  1.00 40.82  ? 216 GLU B C   1 
ATOM   6431  O  O   . GLU B  1 216 ? 69.781 94.447  88.816  1.00 40.88  ? 216 GLU B O   1 
ATOM   6432  C  CB  . GLU B  1 216 ? 69.438 91.975  91.009  1.00 37.23  ? 216 GLU B CB  1 
ATOM   6433  C  CG  . GLU B  1 216 ? 70.909 91.792  90.669  1.00 46.08  ? 216 GLU B CG  1 
ATOM   6434  C  CD  . GLU B  1 216 ? 71.405 90.374  90.458  1.00 68.67  ? 216 GLU B CD  1 
ATOM   6435  O  OE1 . GLU B  1 216 ? 70.574 89.445  90.323  1.00 59.57  ? 216 GLU B OE1 1 
ATOM   6436  O  OE2 . GLU B  1 216 ? 72.643 90.200  90.390  1.00 69.74  ? 216 GLU B OE2 1 
ATOM   6437  N  N   . TYR B  1 217 ? 67.807 93.325  88.613  1.00 37.78  ? 217 TYR B N   1 
ATOM   6438  C  CA  . TYR B  1 217 ? 67.591 93.577  87.187  1.00 37.79  ? 217 TYR B CA  1 
ATOM   6439  C  C   . TYR B  1 217 ? 67.359 95.067  86.907  1.00 42.30  ? 217 TYR B C   1 
ATOM   6440  O  O   . TYR B  1 217 ? 68.018 95.624  86.031  1.00 42.09  ? 217 TYR B O   1 
ATOM   6441  C  CB  . TYR B  1 217 ? 66.411 92.749  86.643  1.00 38.57  ? 217 TYR B CB  1 
ATOM   6442  C  CG  . TYR B  1 217 ? 66.083 93.089  85.205  1.00 40.58  ? 217 TYR B CG  1 
ATOM   6443  C  CD1 . TYR B  1 217 ? 66.879 92.628  84.161  1.00 43.31  ? 217 TYR B CD1 1 
ATOM   6444  C  CD2 . TYR B  1 217 ? 65.014 93.926  84.891  1.00 40.78  ? 217 TYR B CD2 1 
ATOM   6445  C  CE1 . TYR B  1 217 ? 66.617 92.983  82.840  1.00 44.13  ? 217 TYR B CE1 1 
ATOM   6446  C  CE2 . TYR B  1 217 ? 64.745 94.291  83.573  1.00 41.64  ? 217 TYR B CE2 1 
ATOM   6447  C  CZ  . TYR B  1 217 ? 65.542 93.805  82.550  1.00 48.01  ? 217 TYR B CZ  1 
ATOM   6448  O  OH  . TYR B  1 217 ? 65.286 94.145  81.249  1.00 46.68  ? 217 TYR B OH  1 
ATOM   6449  N  N   . PHE B  1 218 ? 66.406 95.690  87.628  1.00 39.10  ? 218 PHE B N   1 
ATOM   6450  C  CA  . PHE B  1 218 ? 66.032 97.096  87.490  1.00 39.08  ? 218 PHE B CA  1 
ATOM   6451  C  C   . PHE B  1 218 ? 67.225 98.025  87.745  1.00 44.35  ? 218 PHE B C   1 
ATOM   6452  O  O   . PHE B  1 218 ? 67.361 99.020  87.034  1.00 44.48  ? 218 PHE B O   1 
ATOM   6453  C  CB  . PHE B  1 218 ? 64.868 97.431  88.435  1.00 40.40  ? 218 PHE B CB  1 
ATOM   6454  C  CG  . PHE B  1 218 ? 64.270 98.809  88.292  1.00 41.94  ? 218 PHE B CG  1 
ATOM   6455  C  CD1 . PHE B  1 218 ? 63.712 99.224  87.086  1.00 44.77  ? 218 PHE B CD1 1 
ATOM   6456  C  CD2 . PHE B  1 218 ? 64.205 99.670  89.380  1.00 44.26  ? 218 PHE B CD2 1 
ATOM   6457  C  CE1 . PHE B  1 218 ? 63.144 100.495 86.959  1.00 45.61  ? 218 PHE B CE1 1 
ATOM   6458  C  CE2 . PHE B  1 218 ? 63.623 100.935 89.257  1.00 47.15  ? 218 PHE B CE2 1 
ATOM   6459  C  CZ  . PHE B  1 218 ? 63.114 101.344 88.044  1.00 44.99  ? 218 PHE B CZ  1 
ATOM   6460  N  N   . THR B  1 219 ? 68.101 97.683  88.722  1.00 41.34  ? 219 THR B N   1 
ATOM   6461  C  CA  . THR B  1 219 ? 69.306 98.459  89.042  1.00 41.57  ? 219 THR B CA  1 
ATOM   6462  C  C   . THR B  1 219 ? 70.240 98.457  87.825  1.00 46.38  ? 219 THR B C   1 
ATOM   6463  O  O   . THR B  1 219 ? 70.728 99.520  87.440  1.00 46.54  ? 219 THR B O   1 
ATOM   6464  C  CB  . THR B  1 219 ? 69.999 97.927  90.308  1.00 48.26  ? 219 THR B CB  1 
ATOM   6465  O  OG1 . THR B  1 219 ? 69.050 97.831  91.369  1.00 45.05  ? 219 THR B OG1 1 
ATOM   6466  C  CG2 . THR B  1 219 ? 71.158 98.809  90.756  1.00 48.22  ? 219 THR B CG2 1 
ATOM   6467  N  N   . PHE B  1 220 ? 70.451 97.272  87.202  1.00 43.32  ? 220 PHE B N   1 
ATOM   6468  C  CA  . PHE B  1 220 ? 71.287 97.121  86.004  1.00 43.66  ? 220 PHE B CA  1 
ATOM   6469  C  C   . PHE B  1 220 ? 70.646 97.827  84.811  1.00 47.60  ? 220 PHE B C   1 
ATOM   6470  O  O   . PHE B  1 220 ? 71.349 98.490  84.047  1.00 47.77  ? 220 PHE B O   1 
ATOM   6471  C  CB  . PHE B  1 220 ? 71.548 95.638  85.676  1.00 45.53  ? 220 PHE B CB  1 
ATOM   6472  C  CG  . PHE B  1 220 ? 72.383 94.866  86.677  1.00 47.56  ? 220 PHE B CG  1 
ATOM   6473  C  CD1 . PHE B  1 220 ? 73.372 95.500  87.424  1.00 51.37  ? 220 PHE B CD1 1 
ATOM   6474  C  CD2 . PHE B  1 220 ? 72.222 93.495  86.830  1.00 50.01  ? 220 PHE B CD2 1 
ATOM   6475  C  CE1 . PHE B  1 220 ? 74.144 94.787  88.344  1.00 52.78  ? 220 PHE B CE1 1 
ATOM   6476  C  CE2 . PHE B  1 220 ? 73.003 92.779  87.744  1.00 53.43  ? 220 PHE B CE2 1 
ATOM   6477  C  CZ  . PHE B  1 220 ? 73.957 93.431  88.495  1.00 51.97  ? 220 PHE B CZ  1 
ATOM   6478  N  N   . ALA B  1 221 ? 69.306 97.718  84.684  1.00 43.22  ? 221 ALA B N   1 
ATOM   6479  C  CA  . ALA B  1 221 ? 68.511 98.340  83.626  1.00 42.39  ? 221 ALA B CA  1 
ATOM   6480  C  C   . ALA B  1 221 ? 68.620 99.864  83.662  1.00 45.49  ? 221 ALA B C   1 
ATOM   6481  O  O   . ALA B  1 221 ? 68.686 100.482 82.607  1.00 45.05  ? 221 ALA B O   1 
ATOM   6482  C  CB  . ALA B  1 221 ? 67.056 97.923  83.752  1.00 42.50  ? 221 ALA B CB  1 
ATOM   6483  N  N   . LEU B  1 222 ? 68.664 100.461 84.869  1.00 41.62  ? 222 LEU B N   1 
ATOM   6484  C  CA  . LEU B  1 222 ? 68.767 101.908 85.053  1.00 41.52  ? 222 LEU B CA  1 
ATOM   6485  C  C   . LEU B  1 222 ? 70.161 102.466 84.712  1.00 46.39  ? 222 LEU B C   1 
ATOM   6486  O  O   . LEU B  1 222 ? 70.263 103.662 84.420  1.00 46.70  ? 222 LEU B O   1 
ATOM   6487  C  CB  . LEU B  1 222 ? 68.423 102.282 86.501  1.00 41.19  ? 222 LEU B CB  1 
ATOM   6488  C  CG  . LEU B  1 222 ? 66.955 102.357 86.897  1.00 45.13  ? 222 LEU B CG  1 
ATOM   6489  C  CD1 . LEU B  1 222 ? 66.813 102.274 88.398  1.00 44.85  ? 222 LEU B CD1 1 
ATOM   6490  C  CD2 . LEU B  1 222 ? 66.307 103.634 86.389  1.00 48.12  ? 222 LEU B CD2 1 
ATOM   6491  N  N   . ILE B  1 223 ? 71.226 101.617 84.772  1.00 42.68  ? 223 ILE B N   1 
ATOM   6492  C  CA  . ILE B  1 223 ? 72.630 102.001 84.529  1.00 42.79  ? 223 ILE B CA  1 
ATOM   6493  C  C   . ILE B  1 223 ? 72.793 102.733 83.164  1.00 47.56  ? 223 ILE B C   1 
ATOM   6494  O  O   . ILE B  1 223 ? 73.354 103.828 83.207  1.00 47.89  ? 223 ILE B O   1 
ATOM   6495  C  CB  . ILE B  1 223 ? 73.634 100.820 84.705  1.00 45.59  ? 223 ILE B CB  1 
ATOM   6496  C  CG1 . ILE B  1 223 ? 73.777 100.463 86.207  1.00 45.03  ? 223 ILE B CG1 1 
ATOM   6497  C  CG2 . ILE B  1 223 ? 75.007 101.140 84.083  1.00 46.97  ? 223 ILE B CG2 1 
ATOM   6498  C  CD1 . ILE B  1 223 ? 74.411 99.128  86.519  1.00 48.84  ? 223 ILE B CD1 1 
ATOM   6499  N  N   . PRO B  1 224 ? 72.296 102.248 81.988  1.00 44.42  ? 224 PRO B N   1 
ATOM   6500  C  CA  . PRO B  1 224 ? 72.460 103.038 80.749  1.00 44.88  ? 224 PRO B CA  1 
ATOM   6501  C  C   . PRO B  1 224 ? 71.901 104.456 80.878  1.00 49.79  ? 224 PRO B C   1 
ATOM   6502  O  O   . PRO B  1 224 ? 72.616 105.402 80.551  1.00 50.08  ? 224 PRO B O   1 
ATOM   6503  C  CB  . PRO B  1 224 ? 71.684 102.234 79.701  1.00 46.19  ? 224 PRO B CB  1 
ATOM   6504  C  CG  . PRO B  1 224 ? 71.667 100.861 80.215  1.00 50.36  ? 224 PRO B CG  1 
ATOM   6505  C  CD  . PRO B  1 224 ? 71.598 100.977 81.707  1.00 45.64  ? 224 PRO B CD  1 
ATOM   6506  N  N   . MET B  1 225 ? 70.666 104.601 81.434  1.00 46.13  ? 225 MET B N   1 
ATOM   6507  C  CA  . MET B  1 225 ? 69.974 105.882 81.663  1.00 45.80  ? 225 MET B CA  1 
ATOM   6508  C  C   . MET B  1 225 ? 70.741 106.798 82.631  1.00 49.07  ? 225 MET B C   1 
ATOM   6509  O  O   . MET B  1 225 ? 70.651 108.020 82.512  1.00 48.94  ? 225 MET B O   1 
ATOM   6510  C  CB  . MET B  1 225 ? 68.551 105.649 82.191  1.00 47.48  ? 225 MET B CB  1 
ATOM   6511  C  CG  . MET B  1 225 ? 67.542 105.337 81.108  1.00 51.21  ? 225 MET B CG  1 
ATOM   6512  S  SD  . MET B  1 225 ? 67.136 106.710 79.995  1.00 56.23  ? 225 MET B SD  1 
ATOM   6513  C  CE  . MET B  1 225 ? 66.178 107.742 81.081  1.00 52.64  ? 225 MET B CE  1 
ATOM   6514  N  N   . ALA B  1 226 ? 71.486 106.210 83.581  1.00 45.30  ? 226 ALA B N   1 
ATOM   6515  C  CA  . ALA B  1 226 ? 72.308 106.951 84.534  1.00 45.78  ? 226 ALA B CA  1 
ATOM   6516  C  C   . ALA B  1 226 ? 73.560 107.516 83.843  1.00 51.37  ? 226 ALA B C   1 
ATOM   6517  O  O   . ALA B  1 226 ? 73.940 108.661 84.108  1.00 51.52  ? 226 ALA B O   1 
ATOM   6518  C  CB  . ALA B  1 226 ? 72.701 106.052 85.697  1.00 46.31  ? 226 ALA B CB  1 
ATOM   6519  N  N   . VAL B  1 227 ? 74.179 106.722 82.938  1.00 48.36  ? 227 VAL B N   1 
ATOM   6520  C  CA  . VAL B  1 227 ? 75.387 107.105 82.199  1.00 48.99  ? 227 VAL B CA  1 
ATOM   6521  C  C   . VAL B  1 227 ? 75.035 108.114 81.091  1.00 52.48  ? 227 VAL B C   1 
ATOM   6522  O  O   . VAL B  1 227 ? 75.778 109.079 80.926  1.00 52.55  ? 227 VAL B O   1 
ATOM   6523  C  CB  . VAL B  1 227 ? 76.171 105.884 81.640  1.00 53.42  ? 227 VAL B CB  1 
ATOM   6524  C  CG1 . VAL B  1 227 ? 77.491 106.318 81.003  1.00 54.42  ? 227 VAL B CG1 1 
ATOM   6525  C  CG2 . VAL B  1 227 ? 76.433 104.846 82.731  1.00 52.96  ? 227 VAL B CG2 1 
ATOM   6526  N  N   . ILE B  1 228 ? 73.923 107.897 80.341  1.00 48.48  ? 228 ILE B N   1 
ATOM   6527  C  CA  . ILE B  1 228 ? 73.479 108.799 79.258  1.00 48.50  ? 228 ILE B CA  1 
ATOM   6528  C  C   . ILE B  1 228 ? 73.087 110.173 79.848  1.00 52.72  ? 228 ILE B C   1 
ATOM   6529  O  O   . ILE B  1 228 ? 73.473 111.202 79.294  1.00 52.43  ? 228 ILE B O   1 
ATOM   6530  C  CB  . ILE B  1 228 ? 72.323 108.199 78.384  1.00 50.77  ? 228 ILE B CB  1 
ATOM   6531  C  CG1 . ILE B  1 228 ? 72.680 106.815 77.767  1.00 51.49  ? 228 ILE B CG1 1 
ATOM   6532  C  CG2 . ILE B  1 228 ? 71.839 109.178 77.300  1.00 51.03  ? 228 ILE B CG2 1 
ATOM   6533  C  CD1 . ILE B  1 228 ? 73.781 106.752 76.639  1.00 61.65  ? 228 ILE B CD1 1 
ATOM   6534  N  N   . GLY B  1 229 ? 72.355 110.160 80.963  1.00 49.22  ? 229 GLY B N   1 
ATOM   6535  C  CA  . GLY B  1 229 ? 71.884 111.361 81.645  1.00 49.27  ? 229 GLY B CA  1 
ATOM   6536  C  C   . GLY B  1 229 ? 72.934 112.179 82.372  1.00 54.16  ? 229 GLY B C   1 
ATOM   6537  O  O   . GLY B  1 229 ? 72.721 113.370 82.605  1.00 54.55  ? 229 GLY B O   1 
ATOM   6538  N  N   . LEU B  1 230 ? 74.069 111.556 82.745  1.00 50.70  ? 230 LEU B N   1 
ATOM   6539  C  CA  . LEU B  1 230 ? 75.161 112.206 83.476  1.00 51.14  ? 230 LEU B CA  1 
ATOM   6540  C  C   . LEU B  1 230 ? 75.753 113.438 82.724  1.00 55.89  ? 230 LEU B C   1 
ATOM   6541  O  O   . LEU B  1 230 ? 75.760 114.502 83.344  1.00 55.71  ? 230 LEU B O   1 
ATOM   6542  C  CB  . LEU B  1 230 ? 76.265 111.194 83.822  1.00 51.38  ? 230 LEU B CB  1 
ATOM   6543  C  CG  . LEU B  1 230 ? 77.057 111.466 85.095  1.00 56.38  ? 230 LEU B CG  1 
ATOM   6544  C  CD1 . LEU B  1 230 ? 76.258 111.080 86.336  1.00 55.89  ? 230 LEU B CD1 1 
ATOM   6545  C  CD2 . LEU B  1 230 ? 78.362 110.708 85.081  1.00 58.99  ? 230 LEU B CD2 1 
ATOM   6546  N  N   . PRO B  1 231 ? 76.183 113.382 81.424  1.00 53.46  ? 231 PRO B N   1 
ATOM   6547  C  CA  . PRO B  1 231 ? 76.725 114.597 80.779  1.00 54.57  ? 231 PRO B CA  1 
ATOM   6548  C  C   . PRO B  1 231 ? 75.681 115.694 80.490  1.00 59.43  ? 231 PRO B C   1 
ATOM   6549  O  O   . PRO B  1 231 ? 76.069 116.829 80.210  1.00 59.92  ? 231 PRO B O   1 
ATOM   6550  C  CB  . PRO B  1 231 ? 77.326 114.060 79.474  1.00 56.46  ? 231 PRO B CB  1 
ATOM   6551  C  CG  . PRO B  1 231 ? 76.551 112.847 79.175  1.00 59.75  ? 231 PRO B CG  1 
ATOM   6552  C  CD  . PRO B  1 231 ? 76.279 112.226 80.507  1.00 54.66  ? 231 PRO B CD  1 
ATOM   6553  N  N   . TYR B  1 232 ? 74.373 115.368 80.559  1.00 55.71  ? 232 TYR B N   1 
ATOM   6554  C  CA  . TYR B  1 232 ? 73.282 116.322 80.338  1.00 55.88  ? 232 TYR B CA  1 
ATOM   6555  C  C   . TYR B  1 232 ? 73.206 117.331 81.489  1.00 61.24  ? 232 TYR B C   1 
ATOM   6556  O  O   . TYR B  1 232 ? 72.815 118.482 81.278  1.00 61.65  ? 232 TYR B O   1 
ATOM   6557  C  CB  . TYR B  1 232 ? 71.947 115.578 80.172  1.00 56.02  ? 232 TYR B CB  1 
ATOM   6558  C  CG  . TYR B  1 232 ? 71.722 115.069 78.765  1.00 58.10  ? 232 TYR B CG  1 
ATOM   6559  C  CD1 . TYR B  1 232 ? 71.082 115.851 77.815  1.00 60.14  ? 232 TYR B CD1 1 
ATOM   6560  C  CD2 . TYR B  1 232 ? 72.175 113.811 78.376  1.00 58.91  ? 232 TYR B CD2 1 
ATOM   6561  C  CE1 . TYR B  1 232 ? 70.892 115.395 76.511  1.00 60.49  ? 232 TYR B CE1 1 
ATOM   6562  C  CE2 . TYR B  1 232 ? 71.977 113.337 77.079  1.00 59.77  ? 232 TYR B CE2 1 
ATOM   6563  C  CZ  . TYR B  1 232 ? 71.335 114.132 76.148  1.00 66.22  ? 232 TYR B CZ  1 
ATOM   6564  O  OH  . TYR B  1 232 ? 71.163 113.655 74.872  1.00 67.01  ? 232 TYR B OH  1 
ATOM   6565  N  N   . TYR B  1 233 ? 73.600 116.897 82.698  1.00 58.17  ? 233 TYR B N   1 
ATOM   6566  C  CA  . TYR B  1 233 ? 73.639 117.717 83.903  1.00 58.54  ? 233 TYR B CA  1 
ATOM   6567  C  C   . TYR B  1 233 ? 74.981 118.460 83.984  1.00 63.97  ? 233 TYR B C   1 
ATOM   6568  O  O   . TYR B  1 233 ? 74.996 119.678 84.170  1.00 64.64  ? 233 TYR B O   1 
ATOM   6569  C  CB  . TYR B  1 233 ? 73.407 116.835 85.154  1.00 58.95  ? 233 TYR B CB  1 
ATOM   6570  C  CG  . TYR B  1 233 ? 73.813 117.474 86.467  1.00 61.71  ? 233 TYR B CG  1 
ATOM   6571  C  CD1 . TYR B  1 233 ? 72.962 118.354 87.130  1.00 63.77  ? 233 TYR B CD1 1 
ATOM   6572  C  CD2 . TYR B  1 233 ? 75.038 117.180 87.059  1.00 63.10  ? 233 TYR B CD2 1 
ATOM   6573  C  CE1 . TYR B  1 233 ? 73.327 118.938 88.344  1.00 64.95  ? 233 TYR B CE1 1 
ATOM   6574  C  CE2 . TYR B  1 233 ? 75.416 117.761 88.270  1.00 64.52  ? 233 TYR B CE2 1 
ATOM   6575  C  CZ  . TYR B  1 233 ? 74.555 118.637 88.911  1.00 71.93  ? 233 TYR B CZ  1 
ATOM   6576  O  OH  . TYR B  1 233 ? 74.922 119.207 90.108  1.00 73.64  ? 233 TYR B OH  1 
ATOM   6577  N  N   . LEU B  1 234 ? 76.097 117.709 83.858  1.00 60.55  ? 234 LEU B N   1 
ATOM   6578  C  CA  . LEU B  1 234 ? 77.478 118.189 83.968  1.00 61.43  ? 234 LEU B CA  1 
ATOM   6579  C  C   . LEU B  1 234 ? 77.820 119.317 82.996  1.00 66.43  ? 234 LEU B C   1 
ATOM   6580  O  O   . LEU B  1 234 ? 78.426 120.299 83.418  1.00 67.33  ? 234 LEU B O   1 
ATOM   6581  C  CB  . LEU B  1 234 ? 78.469 117.031 83.761  1.00 61.48  ? 234 LEU B CB  1 
ATOM   6582  C  CG  . LEU B  1 234 ? 78.528 115.973 84.862  1.00 65.34  ? 234 LEU B CG  1 
ATOM   6583  C  CD1 . LEU B  1 234 ? 79.056 114.663 84.322  1.00 65.42  ? 234 LEU B CD1 1 
ATOM   6584  C  CD2 . LEU B  1 234 ? 79.367 116.445 86.041  1.00 67.84  ? 234 LEU B CD2 1 
ATOM   6585  N  N   . PHE B  1 235 ? 77.448 119.181 81.712  1.00 62.70  ? 235 PHE B N   1 
ATOM   6586  C  CA  . PHE B  1 235 ? 77.764 120.176 80.686  1.00 63.47  ? 235 PHE B CA  1 
ATOM   6587  C  C   . PHE B  1 235 ? 76.571 121.084 80.357  1.00 67.40  ? 235 PHE B C   1 
ATOM   6588  O  O   . PHE B  1 235 ? 76.711 121.984 79.526  1.00 67.94  ? 235 PHE B O   1 
ATOM   6589  C  CB  . PHE B  1 235 ? 78.291 119.484 79.415  1.00 65.51  ? 235 PHE B CB  1 
ATOM   6590  C  CG  . PHE B  1 235 ? 79.426 118.522 79.679  1.00 67.50  ? 235 PHE B CG  1 
ATOM   6591  C  CD1 . PHE B  1 235 ? 80.671 118.983 80.088  1.00 72.13  ? 235 PHE B CD1 1 
ATOM   6592  C  CD2 . PHE B  1 235 ? 79.245 117.154 79.535  1.00 68.95  ? 235 PHE B CD2 1 
ATOM   6593  C  CE1 . PHE B  1 235 ? 81.713 118.091 80.350  1.00 73.48  ? 235 PHE B CE1 1 
ATOM   6594  C  CE2 . PHE B  1 235 ? 80.288 116.262 79.797  1.00 72.20  ? 235 PHE B CE2 1 
ATOM   6595  C  CZ  . PHE B  1 235 ? 81.515 116.737 80.201  1.00 71.57  ? 235 PHE B CZ  1 
ATOM   6596  N  N   . VAL B  1 236 ? 75.425 120.879 81.046  1.00 63.63  ? 236 VAL B N   1 
ATOM   6597  C  CA  . VAL B  1 236 ? 74.160 121.625 80.903  1.00 63.46  ? 236 VAL B CA  1 
ATOM   6598  C  C   . VAL B  1 236 ? 73.746 121.631 79.406  1.00 68.70  ? 236 VAL B C   1 
ATOM   6599  O  O   . VAL B  1 236 ? 73.867 122.645 78.708  1.00 69.14  ? 236 VAL B O   1 
ATOM   6600  C  CB  . VAL B  1 236 ? 74.190 123.052 81.539  1.00 67.71  ? 236 VAL B CB  1 
ATOM   6601  C  CG1 . VAL B  1 236 ? 72.785 123.643 81.638  1.00 66.99  ? 236 VAL B CG1 1 
ATOM   6602  C  CG2 . VAL B  1 236 ? 74.851 123.032 82.916  1.00 67.63  ? 236 VAL B CG2 1 
ATOM   6603  N  N   . TRP B  1 237 ? 73.321 120.453 78.921  1.00 65.40  ? 237 TRP B N   1 
ATOM   6604  C  CA  . TRP B  1 237 ? 72.894 120.239 77.542  1.00 65.77  ? 237 TRP B CA  1 
ATOM   6605  C  C   . TRP B  1 237 ? 71.407 120.568 77.420  1.00 70.07  ? 237 TRP B C   1 
ATOM   6606  O  O   . TRP B  1 237 ? 70.559 119.772 77.838  1.00 68.81  ? 237 TRP B O   1 
ATOM   6607  C  CB  . TRP B  1 237 ? 73.192 118.792 77.104  1.00 64.06  ? 237 TRP B CB  1 
ATOM   6608  C  CG  . TRP B  1 237 ? 74.633 118.474 76.803  1.00 65.91  ? 237 TRP B CG  1 
ATOM   6609  C  CD1 . TRP B  1 237 ? 75.666 119.356 76.658  1.00 70.05  ? 237 TRP B CD1 1 
ATOM   6610  C  CD2 . TRP B  1 237 ? 75.175 117.176 76.536  1.00 65.43  ? 237 TRP B CD2 1 
ATOM   6611  N  NE1 . TRP B  1 237 ? 76.824 118.683 76.343  1.00 69.95  ? 237 TRP B NE1 1 
ATOM   6612  C  CE2 . TRP B  1 237 ? 76.550 117.344 76.252  1.00 70.49  ? 237 TRP B CE2 1 
ATOM   6613  C  CE3 . TRP B  1 237 ? 74.626 115.887 76.484  1.00 65.67  ? 237 TRP B CE3 1 
ATOM   6614  C  CZ2 . TRP B  1 237 ? 77.390 116.265 75.950  1.00 69.93  ? 237 TRP B CZ2 1 
ATOM   6615  C  CZ3 . TRP B  1 237 ? 75.463 114.816 76.206  1.00 67.22  ? 237 TRP B CZ3 1 
ATOM   6616  C  CH2 . TRP B  1 237 ? 76.824 115.009 75.929  1.00 68.93  ? 237 TRP B CH2 1 
ATOM   6617  N  N   . GLU B  1 238 ? 71.096 121.763 76.881  1.00 67.83  ? 238 GLU B N   1 
ATOM   6618  C  CA  . GLU B  1 238 ? 69.718 122.242 76.734  1.00 67.51  ? 238 GLU B CA  1 
ATOM   6619  C  C   . GLU B  1 238 ? 69.383 122.534 75.250  1.00 71.15  ? 238 GLU B C   1 
ATOM   6620  O  O   . GLU B  1 238 ? 68.889 123.617 74.916  1.00 71.70  ? 238 GLU B O   1 
ATOM   6621  C  CB  . GLU B  1 238 ? 69.473 123.482 77.626  1.00 69.69  ? 238 GLU B CB  1 
ATOM   6622  C  CG  . GLU B  1 238 ? 69.573 123.217 79.125  1.00 82.62  ? 238 GLU B CG  1 
ATOM   6623  C  CD  . GLU B  1 238 ? 68.283 123.134 79.923  1.00 108.51 ? 238 GLU B CD  1 
ATOM   6624  O  OE1 . GLU B  1 238 ? 67.185 123.205 79.322  1.00 108.84 ? 238 GLU B OE1 1 
ATOM   6625  O  OE2 . GLU B  1 238 ? 68.374 122.978 81.163  1.00 102.00 ? 238 GLU B OE2 1 
ATOM   6626  N  N   . ASP B  1 239 ? 69.634 121.546 74.370  1.00 66.23  ? 239 ASP B N   1 
ATOM   6627  C  CA  . ASP B  1 239 ? 69.356 121.641 72.934  1.00 65.77  ? 239 ASP B CA  1 
ATOM   6628  C  C   . ASP B  1 239 ? 68.167 120.769 72.547  1.00 67.37  ? 239 ASP B C   1 
ATOM   6629  O  O   . ASP B  1 239 ? 67.887 119.783 73.234  1.00 65.95  ? 239 ASP B O   1 
ATOM   6630  C  CB  . ASP B  1 239 ? 70.588 121.237 72.116  1.00 68.16  ? 239 ASP B CB  1 
ATOM   6631  C  CG  . ASP B  1 239 ? 71.698 122.260 72.153  1.00 79.03  ? 239 ASP B CG  1 
ATOM   6632  O  OD1 . ASP B  1 239 ? 72.423 122.315 73.174  1.00 79.61  ? 239 ASP B OD1 1 
ATOM   6633  O  OD2 . ASP B  1 239 ? 71.850 123.001 71.160  1.00 85.70  ? 239 ASP B OD2 1 
ATOM   6634  N  N   . TYR B  1 240 ? 67.474 121.128 71.443  1.00 63.46  ? 240 TYR B N   1 
ATOM   6635  C  CA  . TYR B  1 240 ? 66.326 120.377 70.929  1.00 62.21  ? 240 TYR B CA  1 
ATOM   6636  C  C   . TYR B  1 240 ? 66.771 118.972 70.524  1.00 65.03  ? 240 TYR B C   1 
ATOM   6637  O  O   . TYR B  1 240 ? 66.231 117.999 71.047  1.00 63.82  ? 240 TYR B O   1 
ATOM   6638  C  CB  . TYR B  1 240 ? 65.645 121.110 69.748  1.00 63.94  ? 240 TYR B CB  1 
ATOM   6639  C  CG  . TYR B  1 240 ? 64.612 120.274 69.016  1.00 64.86  ? 240 TYR B CG  1 
ATOM   6640  C  CD1 . TYR B  1 240 ? 63.378 119.991 69.595  1.00 66.01  ? 240 TYR B CD1 1 
ATOM   6641  C  CD2 . TYR B  1 240 ? 64.873 119.756 67.751  1.00 65.84  ? 240 TYR B CD2 1 
ATOM   6642  C  CE1 . TYR B  1 240 ? 62.423 119.226 68.926  1.00 66.41  ? 240 TYR B CE1 1 
ATOM   6643  C  CE2 . TYR B  1 240 ? 63.932 118.976 67.079  1.00 66.32  ? 240 TYR B CE2 1 
ATOM   6644  C  CZ  . TYR B  1 240 ? 62.709 118.708 67.673  1.00 72.75  ? 240 TYR B CZ  1 
ATOM   6645  O  OH  . TYR B  1 240 ? 61.779 117.934 67.019  1.00 72.07  ? 240 TYR B OH  1 
ATOM   6646  N  N   . ASP B  1 241 ? 67.781 118.878 69.630  1.00 61.68  ? 241 ASP B N   1 
ATOM   6647  C  CA  . ASP B  1 241 ? 68.348 117.623 69.131  1.00 60.94  ? 241 ASP B CA  1 
ATOM   6648  C  C   . ASP B  1 241 ? 68.822 116.735 70.285  1.00 62.72  ? 241 ASP B C   1 
ATOM   6649  O  O   . ASP B  1 241 ? 68.463 115.558 70.312  1.00 61.83  ? 241 ASP B O   1 
ATOM   6650  C  CB  . ASP B  1 241 ? 69.498 117.882 68.133  1.00 64.11  ? 241 ASP B CB  1 
ATOM   6651  C  CG  . ASP B  1 241 ? 70.439 119.010 68.519  1.00 78.82  ? 241 ASP B CG  1 
ATOM   6652  O  OD1 . ASP B  1 241 ? 71.193 118.847 69.504  1.00 79.29  ? 241 ASP B OD1 1 
ATOM   6653  O  OD2 . ASP B  1 241 ? 70.423 120.056 67.832  1.00 88.03  ? 241 ASP B OD2 1 
ATOM   6654  N  N   . LYS B  1 242 ? 69.557 117.310 71.263  1.00 58.16  ? 242 LYS B N   1 
ATOM   6655  C  CA  . LYS B  1 242 ? 70.078 116.594 72.432  1.00 56.86  ? 242 LYS B CA  1 
ATOM   6656  C  C   . LYS B  1 242 ? 68.952 116.068 73.333  1.00 60.40  ? 242 LYS B C   1 
ATOM   6657  O  O   . LYS B  1 242 ? 69.070 114.956 73.844  1.00 59.53  ? 242 LYS B O   1 
ATOM   6658  C  CB  . LYS B  1 242 ? 71.042 117.475 73.235  1.00 58.90  ? 242 LYS B CB  1 
ATOM   6659  C  CG  . LYS B  1 242 ? 72.501 117.159 72.938  1.00 60.61  ? 242 LYS B CG  1 
ATOM   6660  C  CD  . LYS B  1 242 ? 73.448 118.238 73.430  1.00 67.95  ? 242 LYS B CD  1 
ATOM   6661  C  CE  . LYS B  1 242 ? 73.807 119.252 72.369  1.00 83.32  ? 242 LYS B CE  1 
ATOM   6662  N  NZ  . LYS B  1 242 ? 74.813 118.725 71.412  1.00 95.48  ? 242 LYS B NZ  1 
ATOM   6663  N  N   . TYR B  1 243 ? 67.852 116.828 73.496  1.00 57.09  ? 243 TYR B N   1 
ATOM   6664  C  CA  . TYR B  1 243 ? 66.733 116.373 74.318  1.00 56.10  ? 243 TYR B CA  1 
ATOM   6665  C  C   . TYR B  1 243 ? 65.907 115.302 73.605  1.00 57.67  ? 243 TYR B C   1 
ATOM   6666  O  O   . TYR B  1 243 ? 65.454 114.369 74.268  1.00 56.74  ? 243 TYR B O   1 
ATOM   6667  C  CB  . TYR B  1 243 ? 65.844 117.537 74.772  1.00 58.40  ? 243 TYR B CB  1 
ATOM   6668  C  CG  . TYR B  1 243 ? 66.347 118.211 76.032  1.00 62.16  ? 243 TYR B CG  1 
ATOM   6669  C  CD1 . TYR B  1 243 ? 66.847 117.462 77.097  1.00 64.13  ? 243 TYR B CD1 1 
ATOM   6670  C  CD2 . TYR B  1 243 ? 66.285 119.594 76.180  1.00 64.09  ? 243 TYR B CD2 1 
ATOM   6671  C  CE1 . TYR B  1 243 ? 67.318 118.076 78.256  1.00 66.24  ? 243 TYR B CE1 1 
ATOM   6672  C  CE2 . TYR B  1 243 ? 66.730 120.218 77.346  1.00 65.67  ? 243 TYR B CE2 1 
ATOM   6673  C  CZ  . TYR B  1 243 ? 67.250 119.454 78.380  1.00 75.60  ? 243 TYR B CZ  1 
ATOM   6674  O  OH  . TYR B  1 243 ? 67.695 120.051 79.537  1.00 79.95  ? 243 TYR B OH  1 
ATOM   6675  N  N   . VAL B  1 244 ? 65.745 115.411 72.264  1.00 53.07  ? 244 VAL B N   1 
ATOM   6676  C  CA  . VAL B  1 244 ? 65.011 114.441 71.439  1.00 51.76  ? 244 VAL B CA  1 
ATOM   6677  C  C   . VAL B  1 244 ? 65.757 113.096 71.469  1.00 54.55  ? 244 VAL B C   1 
ATOM   6678  O  O   . VAL B  1 244 ? 65.105 112.075 71.655  1.00 54.23  ? 244 VAL B O   1 
ATOM   6679  C  CB  . VAL B  1 244 ? 64.749 114.945 69.987  1.00 56.00  ? 244 VAL B CB  1 
ATOM   6680  C  CG1 . VAL B  1 244 ? 64.216 113.835 69.082  1.00 55.35  ? 244 VAL B CG1 1 
ATOM   6681  C  CG2 . VAL B  1 244 ? 63.776 116.114 69.991  1.00 56.03  ? 244 VAL B CG2 1 
ATOM   6682  N  N   . ILE B  1 245 ? 67.106 113.100 71.341  1.00 50.12  ? 245 ILE B N   1 
ATOM   6683  C  CA  . ILE B  1 245 ? 67.945 111.892 71.373  1.00 49.07  ? 245 ILE B CA  1 
ATOM   6684  C  C   . ILE B  1 245 ? 67.751 111.155 72.717  1.00 52.13  ? 245 ILE B C   1 
ATOM   6685  O  O   . ILE B  1 245 ? 67.479 109.951 72.707  1.00 51.20  ? 245 ILE B O   1 
ATOM   6686  C  CB  . ILE B  1 245 ? 69.440 112.232 71.087  1.00 52.57  ? 245 ILE B CB  1 
ATOM   6687  C  CG1 . ILE B  1 245 ? 69.654 112.518 69.587  1.00 53.25  ? 245 ILE B CG1 1 
ATOM   6688  C  CG2 . ILE B  1 245 ? 70.388 111.115 71.558  1.00 53.34  ? 245 ILE B CG2 1 
ATOM   6689  C  CD1 . ILE B  1 245 ? 70.778 113.468 69.271  1.00 58.63  ? 245 ILE B CD1 1 
ATOM   6690  N  N   . PHE B  1 246 ? 67.847 111.886 73.852  1.00 48.68  ? 246 PHE B N   1 
ATOM   6691  C  CA  . PHE B  1 246 ? 67.687 111.347 75.205  1.00 47.88  ? 246 PHE B CA  1 
ATOM   6692  C  C   . PHE B  1 246 ? 66.278 110.779 75.426  1.00 50.49  ? 246 PHE B C   1 
ATOM   6693  O  O   . PHE B  1 246 ? 66.160 109.653 75.915  1.00 49.57  ? 246 PHE B O   1 
ATOM   6694  C  CB  . PHE B  1 246 ? 68.012 112.414 76.265  1.00 50.07  ? 246 PHE B CB  1 
ATOM   6695  C  CG  . PHE B  1 246 ? 68.136 111.929 77.694  1.00 51.42  ? 246 PHE B CG  1 
ATOM   6696  C  CD1 . PHE B  1 246 ? 68.673 110.678 77.981  1.00 54.09  ? 246 PHE B CD1 1 
ATOM   6697  C  CD2 . PHE B  1 246 ? 67.804 112.759 78.758  1.00 54.08  ? 246 PHE B CD2 1 
ATOM   6698  C  CE1 . PHE B  1 246 ? 68.820 110.244 79.304  1.00 54.60  ? 246 PHE B CE1 1 
ATOM   6699  C  CE2 . PHE B  1 246 ? 67.953 112.326 80.081  1.00 56.51  ? 246 PHE B CE2 1 
ATOM   6700  C  CZ  . PHE B  1 246 ? 68.458 111.070 80.345  1.00 54.01  ? 246 PHE B CZ  1 
ATOM   6701  N  N   . ALA B  1 247 ? 65.227 111.536 75.037  1.00 46.31  ? 247 ALA B N   1 
ATOM   6702  C  CA  . ALA B  1 247 ? 63.829 111.125 75.172  1.00 45.07  ? 247 ALA B CA  1 
ATOM   6703  C  C   . ALA B  1 247 ? 63.499 109.933 74.273  1.00 48.08  ? 247 ALA B C   1 
ATOM   6704  O  O   . ALA B  1 247 ? 62.726 109.074 74.688  1.00 46.93  ? 247 ALA B O   1 
ATOM   6705  C  CB  . ALA B  1 247 ? 62.906 112.285 74.858  1.00 46.06  ? 247 ALA B CB  1 
ATOM   6706  N  N   . SER B  1 248 ? 64.087 109.873 73.057  1.00 45.12  ? 248 SER B N   1 
ATOM   6707  C  CA  . SER B  1 248 ? 63.891 108.762 72.118  1.00 44.93  ? 248 SER B CA  1 
ATOM   6708  C  C   . SER B  1 248 ? 64.488 107.496 72.706  1.00 48.86  ? 248 SER B C   1 
ATOM   6709  O  O   . SER B  1 248 ? 63.842 106.449 72.671  1.00 48.25  ? 248 SER B O   1 
ATOM   6710  C  CB  . SER B  1 248 ? 64.518 109.065 70.760  1.00 49.24  ? 248 SER B CB  1 
ATOM   6711  O  OG  . SER B  1 248 ? 63.889 110.168 70.130  1.00 58.28  ? 248 SER B OG  1 
ATOM   6712  N  N   . PHE B  1 249 ? 65.702 107.611 73.295  1.00 45.41  ? 249 PHE B N   1 
ATOM   6713  C  CA  . PHE B  1 249 ? 66.401 106.512 73.953  1.00 44.78  ? 249 PHE B CA  1 
ATOM   6714  C  C   . PHE B  1 249 ? 65.598 106.051 75.168  1.00 46.58  ? 249 PHE B C   1 
ATOM   6715  O  O   . PHE B  1 249 ? 65.466 104.847 75.374  1.00 45.70  ? 249 PHE B O   1 
ATOM   6716  C  CB  . PHE B  1 249 ? 67.832 106.923 74.352  1.00 47.37  ? 249 PHE B CB  1 
ATOM   6717  C  CG  . PHE B  1 249 ? 68.572 105.882 75.157  1.00 49.47  ? 249 PHE B CG  1 
ATOM   6718  C  CD1 . PHE B  1 249 ? 69.048 104.722 74.555  1.00 53.43  ? 249 PHE B CD1 1 
ATOM   6719  C  CD2 . PHE B  1 249 ? 68.781 106.052 76.521  1.00 51.96  ? 249 PHE B CD2 1 
ATOM   6720  C  CE1 . PHE B  1 249 ? 69.714 103.748 75.306  1.00 54.49  ? 249 PHE B CE1 1 
ATOM   6721  C  CE2 . PHE B  1 249 ? 69.448 105.077 77.270  1.00 54.95  ? 249 PHE B CE2 1 
ATOM   6722  C  CZ  . PHE B  1 249 ? 69.915 103.935 76.657  1.00 53.35  ? 249 PHE B CZ  1 
ATOM   6723  N  N   . ASN B  1 250 ? 65.042 107.017 75.942  1.00 41.56  ? 250 ASN B N   1 
ATOM   6724  C  CA  . ASN B  1 250 ? 64.217 106.808 77.137  1.00 39.68  ? 250 ASN B CA  1 
ATOM   6725  C  C   . ASN B  1 250 ? 62.984 105.943 76.813  1.00 41.27  ? 250 ASN B C   1 
ATOM   6726  O  O   . ASN B  1 250 ? 62.728 104.966 77.519  1.00 40.07  ? 250 ASN B O   1 
ATOM   6727  C  CB  . ASN B  1 250 ? 63.781 108.171 77.710  1.00 38.49  ? 250 ASN B CB  1 
ATOM   6728  C  CG  . ASN B  1 250 ? 63.143 108.171 79.083  1.00 55.05  ? 250 ASN B CG  1 
ATOM   6729  O  OD1 . ASN B  1 250 ? 62.676 107.153 79.606  1.00 48.21  ? 250 ASN B OD1 1 
ATOM   6730  N  ND2 . ASN B  1 250 ? 63.085 109.345 79.693  1.00 46.37  ? 250 ASN B ND2 1 
ATOM   6731  N  N   . LEU B  1 251 ? 62.245 106.293 75.740  1.00 36.79  ? 251 LEU B N   1 
ATOM   6732  C  CA  . LEU B  1 251 ? 61.031 105.596 75.309  1.00 35.77  ? 251 LEU B CA  1 
ATOM   6733  C  C   . LEU B  1 251 ? 61.326 104.189 74.778  1.00 39.95  ? 251 LEU B C   1 
ATOM   6734  O  O   . LEU B  1 251 ? 60.498 103.298 74.975  1.00 39.40  ? 251 LEU B O   1 
ATOM   6735  C  CB  . LEU B  1 251 ? 60.268 106.409 74.254  1.00 35.89  ? 251 LEU B CB  1 
ATOM   6736  C  CG  . LEU B  1 251 ? 59.750 107.788 74.671  1.00 40.22  ? 251 LEU B CG  1 
ATOM   6737  C  CD1 . LEU B  1 251 ? 59.083 108.483 73.515  1.00 40.74  ? 251 LEU B CD1 1 
ATOM   6738  C  CD2 . LEU B  1 251 ? 58.790 107.700 75.842  1.00 42.14  ? 251 LEU B CD2 1 
ATOM   6739  N  N   . ILE B  1 252 ? 62.489 103.984 74.115  1.00 36.65  ? 252 ILE B N   1 
ATOM   6740  C  CA  . ILE B  1 252 ? 62.910 102.669 73.610  1.00 36.25  ? 252 ILE B CA  1 
ATOM   6741  C  C   . ILE B  1 252 ? 63.317 101.810 74.820  1.00 42.70  ? 252 ILE B C   1 
ATOM   6742  O  O   . ILE B  1 252 ? 62.877 100.665 74.926  1.00 42.65  ? 252 ILE B O   1 
ATOM   6743  C  CB  . ILE B  1 252 ? 64.043 102.775 72.545  1.00 38.90  ? 252 ILE B CB  1 
ATOM   6744  C  CG1 . ILE B  1 252 ? 63.551 103.480 71.263  1.00 38.64  ? 252 ILE B CG1 1 
ATOM   6745  C  CG2 . ILE B  1 252 ? 64.644 101.394 72.220  1.00 38.89  ? 252 ILE B CG2 1 
ATOM   6746  C  CD1 . ILE B  1 252 ? 64.666 104.114 70.405  1.00 38.33  ? 252 ILE B CD1 1 
ATOM   6747  N  N   . TRP B  1 253 ? 64.126 102.393 75.741  1.00 40.35  ? 253 TRP B N   1 
ATOM   6748  C  CA  . TRP B  1 253 ? 64.624 101.773 76.974  1.00 40.25  ? 253 TRP B CA  1 
ATOM   6749  C  C   . TRP B  1 253 ? 63.468 101.229 77.826  1.00 43.16  ? 253 TRP B C   1 
ATOM   6750  O  O   . TRP B  1 253 ? 63.506 100.062 78.206  1.00 42.11  ? 253 TRP B O   1 
ATOM   6751  C  CB  . TRP B  1 253 ? 65.462 102.794 77.770  1.00 39.34  ? 253 TRP B CB  1 
ATOM   6752  C  CG  . TRP B  1 253 ? 65.779 102.401 79.181  1.00 39.98  ? 253 TRP B CG  1 
ATOM   6753  C  CD1 . TRP B  1 253 ? 66.751 101.541 79.591  1.00 42.94  ? 253 TRP B CD1 1 
ATOM   6754  C  CD2 . TRP B  1 253 ? 65.146 102.892 80.371  1.00 39.53  ? 253 TRP B CD2 1 
ATOM   6755  N  NE1 . TRP B  1 253 ? 66.748 101.441 80.960  1.00 42.07  ? 253 TRP B NE1 1 
ATOM   6756  C  CE2 . TRP B  1 253 ? 65.781 102.269 81.468  1.00 43.32  ? 253 TRP B CE2 1 
ATOM   6757  C  CE3 . TRP B  1 253 ? 64.117 103.818 80.621  1.00 40.64  ? 253 TRP B CE3 1 
ATOM   6758  C  CZ2 . TRP B  1 253 ? 65.416 102.533 82.796  1.00 42.37  ? 253 TRP B CZ2 1 
ATOM   6759  C  CZ3 . TRP B  1 253 ? 63.752 104.076 81.935  1.00 41.83  ? 253 TRP B CZ3 1 
ATOM   6760  C  CH2 . TRP B  1 253 ? 64.395 103.435 83.005  1.00 42.33  ? 253 TRP B CH2 1 
ATOM   6761  N  N   . SER B  1 254 ? 62.436 102.063 78.076  1.00 39.83  ? 254 SER B N   1 
ATOM   6762  C  CA  . SER B  1 254 ? 61.240 101.733 78.852  1.00 39.54  ? 254 SER B CA  1 
ATOM   6763  C  C   . SER B  1 254 ? 60.569 100.443 78.379  1.00 44.71  ? 254 SER B C   1 
ATOM   6764  O  O   . SER B  1 254 ? 60.253 99.594  79.211  1.00 44.29  ? 254 SER B O   1 
ATOM   6765  C  CB  . SER B  1 254 ? 60.233 102.874 78.779  1.00 43.22  ? 254 SER B CB  1 
ATOM   6766  O  OG  . SER B  1 254 ? 60.648 103.964 79.581  1.00 54.43  ? 254 SER B OG  1 
ATOM   6767  N  N   . THR B  1 255 ? 60.377 100.288 77.050  1.00 41.91  ? 255 THR B N   1 
ATOM   6768  C  CA  . THR B  1 255 ? 59.731 99.122  76.437  1.00 41.65  ? 255 THR B CA  1 
ATOM   6769  C  C   . THR B  1 255 ? 60.631 97.883  76.516  1.00 45.26  ? 255 THR B C   1 
ATOM   6770  O  O   . THR B  1 255 ? 60.191 96.850  77.023  1.00 45.16  ? 255 THR B O   1 
ATOM   6771  C  CB  . THR B  1 255 ? 59.341 99.437  74.984  1.00 49.22  ? 255 THR B CB  1 
ATOM   6772  O  OG1 . THR B  1 255 ? 58.514 100.591 74.984  1.00 48.13  ? 255 THR B OG1 1 
ATOM   6773  C  CG2 . THR B  1 255 ? 58.608 98.287  74.299  1.00 48.30  ? 255 THR B CG2 1 
ATOM   6774  N  N   . VAL B  1 256 ? 61.877 97.997  76.013  1.00 40.71  ? 256 VAL B N   1 
ATOM   6775  C  CA  . VAL B  1 256 ? 62.869 96.924  75.937  1.00 40.02  ? 256 VAL B CA  1 
ATOM   6776  C  C   . VAL B  1 256 ? 63.193 96.343  77.340  1.00 41.89  ? 256 VAL B C   1 
ATOM   6777  O  O   . VAL B  1 256 ? 63.233 95.120  77.457  1.00 41.06  ? 256 VAL B O   1 
ATOM   6778  C  CB  . VAL B  1 256 ? 64.138 97.393  75.173  1.00 44.38  ? 256 VAL B CB  1 
ATOM   6779  C  CG1 . VAL B  1 256 ? 65.260 96.360  75.235  1.00 44.54  ? 256 VAL B CG1 1 
ATOM   6780  C  CG2 . VAL B  1 256 ? 63.802 97.714  73.718  1.00 44.60  ? 256 VAL B CG2 1 
ATOM   6781  N  N   . ILE B  1 257 ? 63.362 97.179  78.390  1.00 37.42  ? 257 ILE B N   1 
ATOM   6782  C  CA  . ILE B  1 257 ? 63.675 96.653  79.729  1.00 37.05  ? 257 ILE B CA  1 
ATOM   6783  C  C   . ILE B  1 257 ? 62.486 95.883  80.338  1.00 41.60  ? 257 ILE B C   1 
ATOM   6784  O  O   . ILE B  1 257 ? 62.708 94.858  80.984  1.00 41.20  ? 257 ILE B O   1 
ATOM   6785  C  CB  . ILE B  1 257 ? 64.246 97.688  80.738  1.00 39.79  ? 257 ILE B CB  1 
ATOM   6786  C  CG1 . ILE B  1 257 ? 63.238 98.815  81.086  1.00 39.56  ? 257 ILE B CG1 1 
ATOM   6787  C  CG2 . ILE B  1 257 ? 65.582 98.238  80.240  1.00 41.16  ? 257 ILE B CG2 1 
ATOM   6788  C  CD1 . ILE B  1 257 ? 63.376 99.391  82.483  1.00 43.11  ? 257 ILE B CD1 1 
ATOM   6789  N  N   . LEU B  1 258 ? 61.243 96.348  80.120  1.00 38.59  ? 258 LEU B N   1 
ATOM   6790  C  CA  . LEU B  1 258 ? 60.059 95.675  80.660  1.00 38.31  ? 258 LEU B CA  1 
ATOM   6791  C  C   . LEU B  1 258 ? 59.756 94.387  79.886  1.00 42.19  ? 258 LEU B C   1 
ATOM   6792  O  O   . LEU B  1 258 ? 59.202 93.448  80.462  1.00 41.71  ? 258 LEU B O   1 
ATOM   6793  C  CB  . LEU B  1 258 ? 58.835 96.605  80.682  1.00 38.10  ? 258 LEU B CB  1 
ATOM   6794  C  CG  . LEU B  1 258 ? 58.929 97.820  81.613  1.00 42.22  ? 258 LEU B CG  1 
ATOM   6795  C  CD1 . LEU B  1 258 ? 57.761 98.751  81.403  1.00 42.41  ? 258 LEU B CD1 1 
ATOM   6796  C  CD2 . LEU B  1 258 ? 59.047 97.414  83.073  1.00 43.29  ? 258 LEU B CD2 1 
ATOM   6797  N  N   . GLU B  1 259 ? 60.154 94.334  78.602  1.00 38.78  ? 259 GLU B N   1 
ATOM   6798  C  CA  . GLU B  1 259 ? 59.996 93.159  77.746  1.00 38.62  ? 259 GLU B CA  1 
ATOM   6799  C  C   . GLU B  1 259 ? 61.083 92.132  78.067  1.00 41.47  ? 259 GLU B C   1 
ATOM   6800  O  O   . GLU B  1 259 ? 60.765 90.951  78.181  1.00 40.75  ? 259 GLU B O   1 
ATOM   6801  C  CB  . GLU B  1 259 ? 60.020 93.539  76.254  1.00 40.48  ? 259 GLU B CB  1 
ATOM   6802  C  CG  . GLU B  1 259 ? 58.715 94.131  75.740  1.00 51.96  ? 259 GLU B CG  1 
ATOM   6803  C  CD  . GLU B  1 259 ? 57.488 93.245  75.837  1.00 72.48  ? 259 GLU B CD  1 
ATOM   6804  O  OE1 . GLU B  1 259 ? 57.519 92.122  75.284  1.00 73.55  ? 259 GLU B OE1 1 
ATOM   6805  O  OE2 . GLU B  1 259 ? 56.487 93.682  76.451  1.00 60.65  ? 259 GLU B OE2 1 
ATOM   6806  N  N   . LEU B  1 260 ? 62.354 92.583  78.248  1.00 37.63  ? 260 LEU B N   1 
ATOM   6807  C  CA  . LEU B  1 260 ? 63.488 91.716  78.600  1.00 37.23  ? 260 LEU B CA  1 
ATOM   6808  C  C   . LEU B  1 260 ? 63.325 91.119  79.999  1.00 41.60  ? 260 LEU B C   1 
ATOM   6809  O  O   . LEU B  1 260 ? 63.853 90.031  80.250  1.00 41.14  ? 260 LEU B O   1 
ATOM   6810  C  CB  . LEU B  1 260 ? 64.835 92.452  78.515  1.00 37.02  ? 260 LEU B CB  1 
ATOM   6811  C  CG  . LEU B  1 260 ? 65.432 92.705  77.138  1.00 41.50  ? 260 LEU B CG  1 
ATOM   6812  C  CD1 . LEU B  1 260 ? 66.694 93.520  77.255  1.00 41.26  ? 260 LEU B CD1 1 
ATOM   6813  C  CD2 . LEU B  1 260 ? 65.744 91.408  76.413  1.00 45.09  ? 260 LEU B CD2 1 
ATOM   6814  N  N   . TRP B  1 261 ? 62.604 91.827  80.910  1.00 38.42  ? 261 TRP B N   1 
ATOM   6815  C  CA  . TRP B  1 261 ? 62.329 91.330  82.257  1.00 38.36  ? 261 TRP B CA  1 
ATOM   6816  C  C   . TRP B  1 261 ? 61.431 90.101  82.171  1.00 43.03  ? 261 TRP B C   1 
ATOM   6817  O  O   . TRP B  1 261 ? 61.705 89.115  82.854  1.00 43.33  ? 261 TRP B O   1 
ATOM   6818  C  CB  . TRP B  1 261 ? 61.701 92.396  83.177  1.00 36.80  ? 261 TRP B CB  1 
ATOM   6819  C  CG  . TRP B  1 261 ? 61.036 91.788  84.381  1.00 37.60  ? 261 TRP B CG  1 
ATOM   6820  C  CD1 . TRP B  1 261 ? 59.696 91.618  84.569  1.00 40.43  ? 261 TRP B CD1 1 
ATOM   6821  C  CD2 . TRP B  1 261 ? 61.682 91.084  85.453  1.00 37.49  ? 261 TRP B CD2 1 
ATOM   6822  N  NE1 . TRP B  1 261 ? 59.466 90.898  85.718  1.00 39.76  ? 261 TRP B NE1 1 
ATOM   6823  C  CE2 . TRP B  1 261 ? 60.668 90.559  86.282  1.00 41.14  ? 261 TRP B CE2 1 
ATOM   6824  C  CE3 . TRP B  1 261 ? 63.024 90.863  85.806  1.00 38.94  ? 261 TRP B CE3 1 
ATOM   6825  C  CZ2 . TRP B  1 261 ? 60.951 89.847  87.451  1.00 40.38  ? 261 TRP B CZ2 1 
ATOM   6826  C  CZ3 . TRP B  1 261 ? 63.303 90.148  86.961  1.00 40.34  ? 261 TRP B CZ3 1 
ATOM   6827  C  CH2 . TRP B  1 261 ? 62.274 89.650  87.768  1.00 40.69  ? 261 TRP B CH2 1 
ATOM   6828  N  N   . LYS B  1 262 ? 60.361 90.165  81.339  1.00 39.25  ? 262 LYS B N   1 
ATOM   6829  C  CA  . LYS B  1 262 ? 59.408 89.070  81.106  1.00 38.69  ? 262 LYS B CA  1 
ATOM   6830  C  C   . LYS B  1 262 ? 60.146 87.797  80.687  1.00 42.41  ? 262 LYS B C   1 
ATOM   6831  O  O   . LYS B  1 262 ? 59.882 86.729  81.237  1.00 42.11  ? 262 LYS B O   1 
ATOM   6832  C  CB  . LYS B  1 262 ? 58.385 89.456  80.019  1.00 40.72  ? 262 LYS B CB  1 
ATOM   6833  C  CG  . LYS B  1 262 ? 57.354 90.498  80.420  1.00 47.21  ? 262 LYS B CG  1 
ATOM   6834  C  CD  . LYS B  1 262 ? 56.721 91.098  79.170  1.00 54.98  ? 262 LYS B CD  1 
ATOM   6835  C  CE  . LYS B  1 262 ? 55.272 91.467  79.356  1.00 63.86  ? 262 LYS B CE  1 
ATOM   6836  N  NZ  . LYS B  1 262 ? 54.670 91.975  78.094  1.00 68.58  ? 262 LYS B NZ  1 
ATOM   6837  N  N   . ARG B  1 263 ? 61.103 87.940  79.743  1.00 38.87  ? 263 ARG B N   1 
ATOM   6838  C  CA  . ARG B  1 263 ? 61.929 86.870  79.181  1.00 39.39  ? 263 ARG B CA  1 
ATOM   6839  C  C   . ARG B  1 263 ? 62.841 86.263  80.250  1.00 44.28  ? 263 ARG B C   1 
ATOM   6840  O  O   . ARG B  1 263 ? 62.925 85.037  80.351  1.00 44.65  ? 263 ARG B O   1 
ATOM   6841  C  CB  . ARG B  1 263 ? 62.768 87.388  77.991  1.00 38.87  ? 263 ARG B CB  1 
ATOM   6842  C  CG  . ARG B  1 263 ? 61.973 88.194  76.964  1.00 43.54  ? 263 ARG B CG  1 
ATOM   6843  C  CD  . ARG B  1 263 ? 62.787 88.579  75.747  1.00 43.79  ? 263 ARG B CD  1 
ATOM   6844  N  NE  . ARG B  1 263 ? 62.421 87.745  74.605  1.00 46.97  ? 263 ARG B NE  1 
ATOM   6845  C  CZ  . ARG B  1 263 ? 63.136 86.719  74.160  1.00 61.46  ? 263 ARG B CZ  1 
ATOM   6846  N  NH1 . ARG B  1 263 ? 64.302 86.420  74.721  1.00 47.80  ? 263 ARG B NH1 1 
ATOM   6847  N  NH2 . ARG B  1 263 ? 62.704 85.998  73.134  1.00 50.97  ? 263 ARG B NH2 1 
ATOM   6848  N  N   . GLY B  1 264 ? 63.499 87.125  81.031  1.00 40.69  ? 264 GLY B N   1 
ATOM   6849  C  CA  . GLY B  1 264 ? 64.413 86.746  82.106  1.00 40.76  ? 264 GLY B CA  1 
ATOM   6850  C  C   . GLY B  1 264 ? 63.715 86.038  83.247  1.00 45.27  ? 264 GLY B C   1 
ATOM   6851  O  O   . GLY B  1 264 ? 64.231 85.047  83.774  1.00 45.17  ? 264 GLY B O   1 
ATOM   6852  N  N   . CYS B  1 265 ? 62.519 86.538  83.612  1.00 41.85  ? 265 CYS B N   1 
ATOM   6853  C  CA  . CYS B  1 265 ? 61.658 85.984  84.654  1.00 41.88  ? 265 CYS B CA  1 
ATOM   6854  C  C   . CYS B  1 265 ? 61.163 84.596  84.234  1.00 48.53  ? 265 CYS B C   1 
ATOM   6855  O  O   . CYS B  1 265 ? 61.122 83.698  85.074  1.00 48.92  ? 265 CYS B O   1 
ATOM   6856  C  CB  . CYS B  1 265 ? 60.496 86.929  84.944  1.00 41.47  ? 265 CYS B CB  1 
ATOM   6857  S  SG  . CYS B  1 265 ? 59.333 86.317  86.188  1.00 45.18  ? 265 CYS B SG  1 
ATOM   6858  N  N   . ALA B  1 266 ? 60.821 84.418  82.932  1.00 46.16  ? 266 ALA B N   1 
ATOM   6859  C  CA  . ALA B  1 266 ? 60.362 83.149  82.358  1.00 46.68  ? 266 ALA B CA  1 
ATOM   6860  C  C   . ALA B  1 266 ? 61.446 82.075  82.471  1.00 52.27  ? 266 ALA B C   1 
ATOM   6861  O  O   . ALA B  1 266 ? 61.120 80.933  82.783  1.00 52.75  ? 266 ALA B O   1 
ATOM   6862  C  CB  . ALA B  1 266 ? 59.957 83.338  80.906  1.00 47.62  ? 266 ALA B CB  1 
ATOM   6863  N  N   . ASN B  1 267 ? 62.731 82.452  82.256  1.00 49.30  ? 267 ASN B N   1 
ATOM   6864  C  CA  . ASN B  1 267 ? 63.901 81.571  82.369  1.00 50.05  ? 267 ASN B CA  1 
ATOM   6865  C  C   . ASN B  1 267 ? 64.067 81.077  83.804  1.00 54.68  ? 267 ASN B C   1 
ATOM   6866  O  O   . ASN B  1 267 ? 64.257 79.882  84.044  1.00 55.01  ? 267 ASN B O   1 
ATOM   6867  C  CB  . ASN B  1 267 ? 65.173 82.325  81.952  1.00 51.44  ? 267 ASN B CB  1 
ATOM   6868  C  CG  . ASN B  1 267 ? 65.658 82.111  80.542  1.00 82.30  ? 267 ASN B CG  1 
ATOM   6869  O  OD1 . ASN B  1 267 ? 65.067 81.392  79.744  1.00 77.68  ? 267 ASN B OD1 1 
ATOM   6870  N  ND2 . ASN B  1 267 ? 66.769 82.742  80.199  1.00 78.19  ? 267 ASN B ND2 1 
ATOM   6871  N  N   . MET B  1 268 ? 63.979 82.025  84.752  1.00 50.57  ? 268 MET B N   1 
ATOM   6872  C  CA  . MET B  1 268 ? 64.140 81.838  86.186  1.00 50.17  ? 268 MET B CA  1 
ATOM   6873  C  C   . MET B  1 268 ? 63.008 80.998  86.785  1.00 55.59  ? 268 MET B C   1 
ATOM   6874  O  O   . MET B  1 268 ? 63.293 80.059  87.530  1.00 56.13  ? 268 MET B O   1 
ATOM   6875  C  CB  . MET B  1 268 ? 64.204 83.214  86.850  1.00 51.56  ? 268 MET B CB  1 
ATOM   6876  C  CG  . MET B  1 268 ? 64.702 83.195  88.268  1.00 54.79  ? 268 MET B CG  1 
ATOM   6877  S  SD  . MET B  1 268 ? 64.945 84.863  88.927  1.00 57.91  ? 268 MET B SD  1 
ATOM   6878  C  CE  . MET B  1 268 ? 63.266 85.522  88.846  1.00 53.76  ? 268 MET B CE  1 
ATOM   6879  N  N   . THR B  1 269 ? 61.736 81.326  86.466  1.00 52.06  ? 269 THR B N   1 
ATOM   6880  C  CA  . THR B  1 269 ? 60.570 80.614  87.002  1.00 51.77  ? 269 THR B CA  1 
ATOM   6881  C  C   . THR B  1 269 ? 60.441 79.214  86.390  1.00 56.88  ? 269 THR B C   1 
ATOM   6882  O  O   . THR B  1 269 ? 59.825 78.347  87.014  1.00 57.15  ? 269 THR B O   1 
ATOM   6883  C  CB  . THR B  1 269 ? 59.287 81.431  86.857  1.00 57.81  ? 269 THR B CB  1 
ATOM   6884  O  OG1 . THR B  1 269 ? 59.101 81.813  85.496  1.00 57.39  ? 269 THR B OG1 1 
ATOM   6885  C  CG2 . THR B  1 269 ? 59.283 82.649  87.762  1.00 55.68  ? 269 THR B CG2 1 
ATOM   6886  N  N   . TYR B  1 270 ? 61.032 78.977  85.202  1.00 53.67  ? 270 TYR B N   1 
ATOM   6887  C  CA  . TYR B  1 270 ? 61.039 77.647  84.589  1.00 54.36  ? 270 TYR B CA  1 
ATOM   6888  C  C   . TYR B  1 270 ? 62.033 76.773  85.357  1.00 57.89  ? 270 TYR B C   1 
ATOM   6889  O  O   . TYR B  1 270 ? 61.700 75.645  85.719  1.00 57.96  ? 270 TYR B O   1 
ATOM   6890  C  CB  . TYR B  1 270 ? 61.382 77.700  83.084  1.00 56.29  ? 270 TYR B CB  1 
ATOM   6891  C  CG  . TYR B  1 270 ? 61.517 76.333  82.453  1.00 59.64  ? 270 TYR B CG  1 
ATOM   6892  C  CD1 . TYR B  1 270 ? 60.400 75.642  81.997  1.00 62.26  ? 270 TYR B CD1 1 
ATOM   6893  C  CD2 . TYR B  1 270 ? 62.759 75.714  82.341  1.00 61.26  ? 270 TYR B CD2 1 
ATOM   6894  C  CE1 . TYR B  1 270 ? 60.513 74.365  81.451  1.00 64.99  ? 270 TYR B CE1 1 
ATOM   6895  C  CE2 . TYR B  1 270 ? 62.884 74.435  81.805  1.00 63.44  ? 270 TYR B CE2 1 
ATOM   6896  C  CZ  . TYR B  1 270 ? 61.758 73.766  81.351  1.00 72.55  ? 270 TYR B CZ  1 
ATOM   6897  O  OH  . TYR B  1 270 ? 61.885 72.508  80.806  1.00 75.18  ? 270 TYR B OH  1 
ATOM   6898  N  N   . ARG B  1 271 ? 63.245 77.320  85.619  1.00 53.64  ? 271 ARG B N   1 
ATOM   6899  C  CA  . ARG B  1 271 ? 64.339 76.684  86.359  1.00 53.53  ? 271 ARG B CA  1 
ATOM   6900  C  C   . ARG B  1 271 ? 63.865 76.300  87.768  1.00 56.59  ? 271 ARG B C   1 
ATOM   6901  O  O   . ARG B  1 271 ? 64.206 75.225  88.261  1.00 56.18  ? 271 ARG B O   1 
ATOM   6902  C  CB  . ARG B  1 271 ? 65.545 77.639  86.412  1.00 53.27  ? 271 ARG B CB  1 
ATOM   6903  C  CG  . ARG B  1 271 ? 66.855 76.999  86.863  1.00 65.37  ? 271 ARG B CG  1 
ATOM   6904  C  CD  . ARG B  1 271 ? 68.013 77.983  86.866  1.00 75.91  ? 271 ARG B CD  1 
ATOM   6905  N  NE  . ARG B  1 271 ? 67.881 79.004  87.910  1.00 86.81  ? 271 ARG B NE  1 
ATOM   6906  C  CZ  . ARG B  1 271 ? 67.613 80.287  87.681  1.00 103.38 ? 271 ARG B CZ  1 
ATOM   6907  N  NH1 . ARG B  1 271 ? 67.455 80.729  86.439  1.00 94.58  ? 271 ARG B NH1 1 
ATOM   6908  N  NH2 . ARG B  1 271 ? 67.510 81.140  88.691  1.00 87.43  ? 271 ARG B NH2 1 
ATOM   6909  N  N   . TRP B  1 272 ? 63.042 77.166  88.382  1.00 53.22  ? 272 TRP B N   1 
ATOM   6910  C  CA  . TRP B  1 272 ? 62.455 76.956  89.704  1.00 53.51  ? 272 TRP B CA  1 
ATOM   6911  C  C   . TRP B  1 272 ? 61.339 75.907  89.649  1.00 59.44  ? 272 TRP B C   1 
ATOM   6912  O  O   . TRP B  1 272 ? 61.188 75.121  90.585  1.00 59.65  ? 272 TRP B O   1 
ATOM   6913  C  CB  . TRP B  1 272 ? 61.910 78.283  90.267  1.00 51.34  ? 272 TRP B CB  1 
ATOM   6914  C  CG  . TRP B  1 272 ? 62.952 79.313  90.617  1.00 51.94  ? 272 TRP B CG  1 
ATOM   6915  C  CD1 . TRP B  1 272 ? 64.308 79.150  90.620  1.00 55.34  ? 272 TRP B CD1 1 
ATOM   6916  C  CD2 . TRP B  1 272 ? 62.709 80.659  91.048  1.00 50.94  ? 272 TRP B CD2 1 
ATOM   6917  N  NE1 . TRP B  1 272 ? 64.924 80.311  91.020  1.00 54.32  ? 272 TRP B NE1 1 
ATOM   6918  C  CE2 . TRP B  1 272 ? 63.967 81.253  91.296  1.00 54.83  ? 272 TRP B CE2 1 
ATOM   6919  C  CE3 . TRP B  1 272 ? 61.549 81.426  91.248  1.00 51.54  ? 272 TRP B CE3 1 
ATOM   6920  C  CZ2 . TRP B  1 272 ? 64.098 82.572  91.746  1.00 53.47  ? 272 TRP B CZ2 1 
ATOM   6921  C  CZ3 . TRP B  1 272 ? 61.680 82.735  91.687  1.00 52.40  ? 272 TRP B CZ3 1 
ATOM   6922  C  CH2 . TRP B  1 272 ? 62.942 83.298  91.923  1.00 53.05  ? 272 TRP B CH2 1 
ATOM   6923  N  N   . GLY B  1 273 ? 60.578 75.914  88.553  1.00 57.04  ? 273 GLY B N   1 
ATOM   6924  C  CA  . GLY B  1 273 ? 59.461 75.003  88.323  1.00 57.52  ? 273 GLY B CA  1 
ATOM   6925  C  C   . GLY B  1 273 ? 58.094 75.627  88.541  1.00 60.84  ? 273 GLY B C   1 
ATOM   6926  O  O   . GLY B  1 273 ? 57.081 75.043  88.152  1.00 61.25  ? 273 GLY B O   1 
ATOM   6927  N  N   . THR B  1 274 ? 58.058 76.828  89.145  1.00 55.87  ? 274 THR B N   1 
ATOM   6928  C  CA  . THR B  1 274 ? 56.839 77.579  89.463  1.00 54.79  ? 274 THR B CA  1 
ATOM   6929  C  C   . THR B  1 274 ? 56.107 78.082  88.186  1.00 56.83  ? 274 THR B C   1 
ATOM   6930  O  O   . THR B  1 274 ? 54.915 78.387  88.262  1.00 55.91  ? 274 THR B O   1 
ATOM   6931  C  CB  . THR B  1 274 ? 57.166 78.718  90.448  1.00 67.00  ? 274 THR B CB  1 
ATOM   6932  O  OG1 . THR B  1 274 ? 55.991 79.479  90.725  1.00 69.97  ? 274 THR B OG1 1 
ATOM   6933  C  CG2 . THR B  1 274 ? 58.284 79.630  89.961  1.00 66.79  ? 274 THR B CG2 1 
ATOM   6934  N  N   . LEU B  1 275 ? 56.806 78.148  87.030  1.00 53.03  ? 275 LEU B N   1 
ATOM   6935  C  CA  . LEU B  1 275 ? 56.228 78.562  85.740  1.00 52.35  ? 275 LEU B CA  1 
ATOM   6936  C  C   . LEU B  1 275 ? 55.326 77.455  85.175  1.00 56.61  ? 275 LEU B C   1 
ATOM   6937  O  O   . LEU B  1 275 ? 54.330 77.750  84.512  1.00 56.33  ? 275 LEU B O   1 
ATOM   6938  C  CB  . LEU B  1 275 ? 57.345 78.912  84.729  1.00 52.13  ? 275 LEU B CB  1 
ATOM   6939  C  CG  . LEU B  1 275 ? 56.925 79.463  83.362  1.00 56.23  ? 275 LEU B CG  1 
ATOM   6940  C  CD1 . LEU B  1 275 ? 56.451 80.901  83.461  1.00 55.95  ? 275 LEU B CD1 1 
ATOM   6941  C  CD2 . LEU B  1 275 ? 58.060 79.370  82.374  1.00 58.02  ? 275 LEU B CD2 1 
ATOM   6942  N  N   . LEU B  1 276 ? 55.679 76.187  85.457  1.00 53.42  ? 276 LEU B N   1 
ATOM   6943  C  CA  . LEU B  1 276 ? 54.971 74.983  85.013  1.00 54.16  ? 276 LEU B CA  1 
ATOM   6944  C  C   . LEU B  1 276 ? 53.790 74.636  85.940  1.00 59.12  ? 276 LEU B C   1 
ATOM   6945  O  O   . LEU B  1 276 ? 53.050 73.688  85.669  1.00 59.62  ? 276 LEU B O   1 
ATOM   6946  C  CB  . LEU B  1 276 ? 55.953 73.798  84.929  1.00 54.94  ? 276 LEU B CB  1 
ATOM   6947  C  CG  . LEU B  1 276 ? 57.130 73.972  83.969  1.00 59.86  ? 276 LEU B CG  1 
ATOM   6948  C  CD1 . LEU B  1 276 ? 58.388 74.353  84.717  1.00 60.09  ? 276 LEU B CD1 1 
ATOM   6949  C  CD2 . LEU B  1 276 ? 57.367 72.724  83.175  1.00 62.70  ? 276 LEU B CD2 1 
ATOM   6950  N  N   . MET B  1 277 ? 53.610 75.414  87.019  1.00 55.96  ? 277 MET B N   1 
ATOM   6951  C  CA  . MET B  1 277 ? 52.533 75.234  87.987  1.00 56.43  ? 277 MET B CA  1 
ATOM   6952  C  C   . MET B  1 277 ? 51.240 75.863  87.498  1.00 61.70  ? 277 MET B C   1 
ATOM   6953  O  O   . MET B  1 277 ? 51.226 77.033  87.105  1.00 61.48  ? 277 MET B O   1 
ATOM   6954  C  CB  . MET B  1 277 ? 52.916 75.839  89.339  1.00 58.22  ? 277 MET B CB  1 
ATOM   6955  C  CG  . MET B  1 277 ? 53.651 74.887  90.234  1.00 62.57  ? 277 MET B CG  1 
ATOM   6956  S  SD  . MET B  1 277 ? 54.052 75.661  91.808  1.00 66.48  ? 277 MET B SD  1 
ATOM   6957  C  CE  . MET B  1 277 ? 52.452 75.590  92.635  1.00 63.11  ? 277 MET B CE  1 
ATOM   6958  N  N   . LYS B  1 278 ? 50.153 75.084  87.534  1.00 59.12  ? 278 LYS B N   1 
ATOM   6959  C  CA  . LYS B  1 278 ? 48.821 75.536  87.138  1.00 59.06  ? 278 LYS B CA  1 
ATOM   6960  C  C   . LYS B  1 278 ? 48.106 75.962  88.423  1.00 62.63  ? 278 LYS B C   1 
ATOM   6961  O  O   . LYS B  1 278 ? 47.398 75.170  89.056  1.00 62.60  ? 278 LYS B O   1 
ATOM   6962  C  CB  . LYS B  1 278 ? 48.070 74.439  86.350  1.00 62.90  ? 278 LYS B CB  1 
ATOM   6963  C  CG  . LYS B  1 278 ? 48.850 73.856  85.161  1.00 79.68  ? 278 LYS B CG  1 
ATOM   6964  C  CD  . LYS B  1 278 ? 48.607 74.603  83.851  1.00 90.33  ? 278 LYS B CD  1 
ATOM   6965  C  CE  . LYS B  1 278 ? 49.343 73.982  82.686  1.00 103.62 ? 278 LYS B CE  1 
ATOM   6966  N  NZ  . LYS B  1 278 ? 50.798 74.299  82.708  1.00 114.82 ? 278 LYS B NZ  1 
ATOM   6967  N  N   . ARG B  1 279 ? 48.380 77.215  88.842  1.00 58.46  ? 279 ARG B N   1 
ATOM   6968  C  CA  . ARG B  1 279 ? 47.899 77.846  90.079  1.00 57.73  ? 279 ARG B CA  1 
ATOM   6969  C  C   . ARG B  1 279 ? 46.383 78.109  90.084  1.00 61.56  ? 279 ARG B C   1 
ATOM   6970  O  O   . ARG B  1 279 ? 45.811 78.295  91.158  1.00 60.81  ? 279 ARG B O   1 
ATOM   6971  C  CB  . ARG B  1 279 ? 48.649 79.170  90.333  1.00 57.43  ? 279 ARG B CB  1 
ATOM   6972  C  CG  . ARG B  1 279 ? 50.169 79.031  90.498  1.00 68.91  ? 279 ARG B CG  1 
ATOM   6973  C  CD  . ARG B  1 279 ? 50.599 78.891  91.947  1.00 79.15  ? 279 ARG B CD  1 
ATOM   6974  N  NE  . ARG B  1 279 ? 50.581 80.171  92.661  1.00 88.64  ? 279 ARG B NE  1 
ATOM   6975  C  CZ  . ARG B  1 279 ? 50.589 80.296  93.986  1.00 101.96 ? 279 ARG B CZ  1 
ATOM   6976  N  NH1 . ARG B  1 279 ? 50.596 79.219  94.762  1.00 88.20  ? 279 ARG B NH1 1 
ATOM   6977  N  NH2 . ARG B  1 279 ? 50.578 81.499  94.545  1.00 88.25  ? 279 ARG B NH2 1 
ATOM   6978  N  N   . LYS B  1 280 ? 45.739 78.131  88.901  1.00 58.61  ? 280 LYS B N   1 
ATOM   6979  C  CA  . LYS B  1 280 ? 44.299 78.382  88.756  1.00 58.70  ? 280 LYS B CA  1 
ATOM   6980  C  C   . LYS B  1 280 ? 43.430 77.260  89.382  1.00 63.28  ? 280 LYS B C   1 
ATOM   6981  O  O   . LYS B  1 280 ? 42.312 77.539  89.825  1.00 63.00  ? 280 LYS B O   1 
ATOM   6982  C  CB  . LYS B  1 280 ? 43.913 78.605  87.276  1.00 61.11  ? 280 LYS B CB  1 
ATOM   6983  C  CG  . LYS B  1 280 ? 44.336 77.502  86.306  1.00 70.65  ? 280 LYS B CG  1 
ATOM   6984  C  CD  . LYS B  1 280 ? 43.706 77.687  84.937  1.00 78.48  ? 280 LYS B CD  1 
ATOM   6985  C  CE  . LYS B  1 280 ? 44.727 78.062  83.896  1.00 91.26  ? 280 LYS B CE  1 
ATOM   6986  N  NZ  . LYS B  1 280 ? 44.098 78.264  82.565  1.00 104.58 ? 280 LYS B NZ  1 
ATOM   6987  N  N   . PHE B  1 281 ? 43.948 76.014  89.428  1.00 60.05  ? 281 PHE B N   1 
ATOM   6988  C  CA  . PHE B  1 281 ? 43.232 74.858  89.980  1.00 60.40  ? 281 PHE B CA  1 
ATOM   6989  C  C   . PHE B  1 281 ? 43.520 74.656  91.484  1.00 63.90  ? 281 PHE B C   1 
ATOM   6990  O  O   . PHE B  1 281 ? 43.001 73.704  92.079  1.00 63.93  ? 281 PHE B O   1 
ATOM   6991  C  CB  . PHE B  1 281 ? 43.572 73.578  89.193  1.00 62.82  ? 281 PHE B CB  1 
ATOM   6992  C  CG  . PHE B  1 281 ? 43.428 73.694  87.694  1.00 64.21  ? 281 PHE B CG  1 
ATOM   6993  C  CD1 . PHE B  1 281 ? 42.175 73.675  87.094  1.00 67.55  ? 281 PHE B CD1 1 
ATOM   6994  C  CD2 . PHE B  1 281 ? 44.548 73.804  86.880  1.00 65.78  ? 281 PHE B CD2 1 
ATOM   6995  C  CE1 . PHE B  1 281 ? 42.045 73.787  85.709  1.00 68.69  ? 281 PHE B CE1 1 
ATOM   6996  C  CE2 . PHE B  1 281 ? 44.417 73.910  85.495  1.00 68.80  ? 281 PHE B CE2 1 
ATOM   6997  C  CZ  . PHE B  1 281 ? 43.167 73.895  84.918  1.00 67.47  ? 281 PHE B CZ  1 
ATOM   6998  N  N   . GLU B  1 282 ? 44.316 75.563  92.101  1.00 59.63  ? 282 GLU B N   1 
ATOM   6999  C  CA  . GLU B  1 282 ? 44.667 75.509  93.528  1.00 58.99  ? 282 GLU B CA  1 
ATOM   7000  C  C   . GLU B  1 282 ? 43.455 75.759  94.418  1.00 62.20  ? 282 GLU B C   1 
ATOM   7001  O  O   . GLU B  1 282 ? 42.498 76.414  94.001  1.00 61.59  ? 282 GLU B O   1 
ATOM   7002  C  CB  . GLU B  1 282 ? 45.768 76.519  93.878  1.00 59.45  ? 282 GLU B CB  1 
ATOM   7003  C  CG  . GLU B  1 282 ? 47.154 76.103  93.420  1.00 71.34  ? 282 GLU B CG  1 
ATOM   7004  C  CD  . GLU B  1 282 ? 48.295 76.980  93.900  1.00 94.08  ? 282 GLU B CD  1 
ATOM   7005  O  OE1 . GLU B  1 282 ? 48.078 78.196  94.105  1.00 85.67  ? 282 GLU B OE1 1 
ATOM   7006  O  OE2 . GLU B  1 282 ? 49.423 76.452  94.035  1.00 91.97  ? 282 GLU B OE2 1 
ATOM   7007  N  N   . GLU B  1 283 ? 43.515 75.242  95.650  1.00 58.77  ? 283 GLU B N   1 
ATOM   7008  C  CA  . GLU B  1 283 ? 42.460 75.366  96.653  1.00 58.93  ? 283 GLU B CA  1 
ATOM   7009  C  C   . GLU B  1 283 ? 42.282 76.847  97.095  1.00 61.17  ? 283 GLU B C   1 
ATOM   7010  O  O   . GLU B  1 283 ? 43.248 77.614  97.019  1.00 60.28  ? 283 GLU B O   1 
ATOM   7011  C  CB  . GLU B  1 283 ? 42.763 74.444  97.839  1.00 60.90  ? 283 GLU B CB  1 
ATOM   7012  C  CG  . GLU B  1 283 ? 42.359 73.004  97.564  1.00 74.43  ? 283 GLU B CG  1 
ATOM   7013  C  CD  . GLU B  1 283 ? 43.233 71.946  98.206  1.00 102.11 ? 283 GLU B CD  1 
ATOM   7014  O  OE1 . GLU B  1 283 ? 42.727 71.218  99.092  1.00 101.90 ? 283 GLU B OE1 1 
ATOM   7015  O  OE2 . GLU B  1 283 ? 44.416 71.828  97.812  1.00 96.94  ? 283 GLU B OE2 1 
ATOM   7016  N  N   . PRO B  1 284 ? 41.055 77.283  97.499  1.00 56.66  ? 284 PRO B N   1 
ATOM   7017  C  CA  . PRO B  1 284 ? 40.856 78.705  97.840  1.00 55.32  ? 284 PRO B CA  1 
ATOM   7018  C  C   . PRO B  1 284 ? 41.549 79.177  99.120  1.00 58.35  ? 284 PRO B C   1 
ATOM   7019  O  O   . PRO B  1 284 ? 41.881 78.368  99.990  1.00 58.57  ? 284 PRO B O   1 
ATOM   7020  C  CB  . PRO B  1 284 ? 39.341 78.823  97.993  1.00 57.47  ? 284 PRO B CB  1 
ATOM   7021  C  CG  . PRO B  1 284 ? 38.880 77.469  98.331  1.00 62.92  ? 284 PRO B CG  1 
ATOM   7022  C  CD  . PRO B  1 284 ? 39.784 76.533  97.596  1.00 58.81  ? 284 PRO B CD  1 
ATOM   7023  N  N   . ARG B  1 285 ? 41.753 80.514  99.219  1.00 53.25  ? 285 ARG B N   1 
ATOM   7024  C  CA  . ARG B  1 285 ? 42.354 81.216  100.362 1.00 52.11  ? 285 ARG B CA  1 
ATOM   7025  C  C   . ARG B  1 285 ? 41.444 81.080  101.603 1.00 56.58  ? 285 ARG B C   1 
ATOM   7026  O  O   . ARG B  1 285 ? 40.231 80.944  101.422 1.00 57.45  ? 285 ARG B O   1 
ATOM   7027  C  CB  . ARG B  1 285 ? 42.621 82.703  100.025 1.00 50.89  ? 285 ARG B CB  1 
ATOM   7028  C  CG  . ARG B  1 285 ? 41.429 83.467  99.443  1.00 58.85  ? 285 ARG B CG  1 
ATOM   7029  C  CD  . ARG B  1 285 ? 41.758 84.914  99.118  1.00 62.78  ? 285 ARG B CD  1 
ATOM   7030  N  NE  . ARG B  1 285 ? 41.412 85.805  100.227 1.00 68.70  ? 285 ARG B NE  1 
ATOM   7031  C  CZ  . ARG B  1 285 ? 42.286 86.548  100.896 1.00 77.17  ? 285 ARG B CZ  1 
ATOM   7032  N  NH1 . ARG B  1 285 ? 43.571 86.536  100.563 1.00 60.82  ? 285 ARG B NH1 1 
ATOM   7033  N  NH2 . ARG B  1 285 ? 41.881 87.324  101.893 1.00 60.23  ? 285 ARG B NH2 1 
ATOM   7034  N  N   . PRO B  1 286 ? 41.974 81.111  102.859 1.00 52.19  ? 286 PRO B N   1 
ATOM   7035  C  CA  . PRO B  1 286 ? 41.092 80.954  104.038 1.00 52.21  ? 286 PRO B CA  1 
ATOM   7036  C  C   . PRO B  1 286 ? 40.005 82.034  104.169 1.00 54.91  ? 286 PRO B C   1 
ATOM   7037  O  O   . PRO B  1 286 ? 38.953 81.763  104.752 1.00 55.30  ? 286 PRO B O   1 
ATOM   7038  C  CB  . PRO B  1 286 ? 42.061 81.005  105.224 1.00 53.65  ? 286 PRO B CB  1 
ATOM   7039  C  CG  . PRO B  1 286 ? 43.282 81.659  104.697 1.00 57.41  ? 286 PRO B CG  1 
ATOM   7040  C  CD  . PRO B  1 286 ? 43.385 81.239  103.271 1.00 52.99  ? 286 PRO B CD  1 
ATOM   7041  N  N   . GLY B  1 287 ? 40.249 83.215  103.595 1.00 49.38  ? 287 GLY B N   1 
ATOM   7042  C  CA  . GLY B  1 287 ? 39.308 84.330  103.613 1.00 48.76  ? 287 GLY B CA  1 
ATOM   7043  C  C   . GLY B  1 287 ? 38.131 84.203  102.659 1.00 51.85  ? 287 GLY B C   1 
ATOM   7044  O  O   . GLY B  1 287 ? 37.230 85.049  102.675 1.00 51.42  ? 287 GLY B O   1 
ATOM   7045  N  N   . PHE B  1 288 ? 38.130 83.158  101.815 1.00 48.28  ? 288 PHE B N   1 
ATOM   7046  C  CA  . PHE B  1 288 ? 37.064 82.918  100.847 1.00 48.68  ? 288 PHE B CA  1 
ATOM   7047  C  C   . PHE B  1 288 ? 35.908 82.146  101.484 1.00 53.60  ? 288 PHE B C   1 
ATOM   7048  O  O   . PHE B  1 288 ? 36.094 81.036  101.993 1.00 53.27  ? 288 PHE B O   1 
ATOM   7049  C  CB  . PHE B  1 288 ? 37.597 82.187  99.601  1.00 50.28  ? 288 PHE B CB  1 
ATOM   7050  C  CG  . PHE B  1 288 ? 36.550 81.819  98.572  1.00 52.27  ? 288 PHE B CG  1 
ATOM   7051  C  CD1 . PHE B  1 288 ? 35.941 82.796  97.793  1.00 55.03  ? 288 PHE B CD1 1 
ATOM   7052  C  CD2 . PHE B  1 288 ? 36.187 80.493  98.371  1.00 54.85  ? 288 PHE B CD2 1 
ATOM   7053  C  CE1 . PHE B  1 288 ? 34.992 82.450  96.829  1.00 56.42  ? 288 PHE B CE1 1 
ATOM   7054  C  CE2 . PHE B  1 288 ? 35.235 80.150  97.409  1.00 58.05  ? 288 PHE B CE2 1 
ATOM   7055  C  CZ  . PHE B  1 288 ? 34.646 81.129  96.644  1.00 56.02  ? 288 PHE B CZ  1 
ATOM   7056  N  N   . HIS B  1 289 ? 34.713 82.752  101.436 1.00 51.31  ? 289 HIS B N   1 
ATOM   7057  C  CA  . HIS B  1 289 ? 33.472 82.193  101.969 1.00 52.73  ? 289 HIS B CA  1 
ATOM   7058  C  C   . HIS B  1 289 ? 32.503 81.835  100.827 1.00 56.59  ? 289 HIS B C   1 
ATOM   7059  O  O   . HIS B  1 289 ? 32.594 82.386  99.726  1.00 55.98  ? 289 HIS B O   1 
ATOM   7060  C  CB  . HIS B  1 289 ? 32.813 83.164  102.974 1.00 54.26  ? 289 HIS B CB  1 
ATOM   7061  C  CG  . HIS B  1 289 ? 32.456 84.509  102.407 1.00 57.91  ? 289 HIS B CG  1 
ATOM   7062  N  ND1 . HIS B  1 289 ? 31.262 84.718  101.732 1.00 60.60  ? 289 HIS B ND1 1 
ATOM   7063  C  CD2 . HIS B  1 289 ? 33.138 85.678  102.458 1.00 59.21  ? 289 HIS B CD2 1 
ATOM   7064  C  CE1 . HIS B  1 289 ? 31.266 85.996  101.381 1.00 59.71  ? 289 HIS B CE1 1 
ATOM   7065  N  NE2 . HIS B  1 289 ? 32.373 86.615  101.795 1.00 59.16  ? 289 HIS B NE2 1 
ATOM   7066  N  N   . GLY B  1 290 ? 31.595 80.910  101.115 1.00 52.94  ? 290 GLY B N   1 
ATOM   7067  C  CA  . GLY B  1 290 ? 30.591 80.432  100.176 1.00 52.77  ? 290 GLY B CA  1 
ATOM   7068  C  C   . GLY B  1 290 ? 29.919 79.165  100.650 1.00 55.82  ? 290 GLY B C   1 
ATOM   7069  O  O   . GLY B  1 290 ? 30.348 78.562  101.639 1.00 55.10  ? 290 GLY B O   1 
ATOM   7070  N  N   . VAL B  1 291 ? 28.853 78.754  99.944  1.00 52.51  ? 291 VAL B N   1 
ATOM   7071  C  CA  . VAL B  1 291 ? 28.091 77.541  100.257 1.00 53.20  ? 291 VAL B CA  1 
ATOM   7072  C  C   . VAL B  1 291 ? 28.942 76.330  99.864  1.00 57.03  ? 291 VAL B C   1 
ATOM   7073  O  O   . VAL B  1 291 ? 29.427 76.267  98.732  1.00 56.20  ? 291 VAL B O   1 
ATOM   7074  C  CB  . VAL B  1 291 ? 26.694 77.525  99.571  1.00 57.73  ? 291 VAL B CB  1 
ATOM   7075  C  CG1 . VAL B  1 291 ? 25.891 76.292  99.968  1.00 58.70  ? 291 VAL B CG1 1 
ATOM   7076  C  CG2 . VAL B  1 291 ? 25.909 78.793  99.892  1.00 57.56  ? 291 VAL B CG2 1 
ATOM   7077  N  N   . LEU B  1 292 ? 29.148 75.394  100.810 1.00 54.00  ? 292 LEU B N   1 
ATOM   7078  C  CA  . LEU B  1 292 ? 29.940 74.185  100.577 1.00 53.99  ? 292 LEU B CA  1 
ATOM   7079  C  C   . LEU B  1 292 ? 29.274 73.317  99.513  1.00 58.54  ? 292 LEU B C   1 
ATOM   7080  O  O   . LEU B  1 292 ? 28.090 72.987  99.623  1.00 59.08  ? 292 LEU B O   1 
ATOM   7081  C  CB  . LEU B  1 292 ? 30.155 73.389  101.884 1.00 54.47  ? 292 LEU B CB  1 
ATOM   7082  C  CG  . LEU B  1 292 ? 30.979 72.092  101.785 1.00 59.06  ? 292 LEU B CG  1 
ATOM   7083  C  CD1 . LEU B  1 292 ? 32.466 72.375  101.592 1.00 57.88  ? 292 LEU B CD1 1 
ATOM   7084  C  CD2 . LEU B  1 292 ? 30.768 71.232  103.001 1.00 62.08  ? 292 LEU B CD2 1 
ATOM   7085  N  N   . GLY B  1 293 ? 30.044 73.002  98.479  1.00 54.67  ? 293 GLY B N   1 
ATOM   7086  C  CA  . GLY B  1 293 ? 29.604 72.187  97.357  1.00 55.45  ? 293 GLY B CA  1 
ATOM   7087  C  C   . GLY B  1 293 ? 30.756 71.571  96.598  1.00 59.23  ? 293 GLY B C   1 
ATOM   7088  O  O   . GLY B  1 293 ? 31.913 71.700  97.006  1.00 57.29  ? 293 GLY B O   1 
ATOM   7089  N  N   . ILE B  1 294 ? 30.443 70.890  95.488  1.00 57.70  ? 294 ILE B N   1 
ATOM   7090  C  CA  . ILE B  1 294 ? 31.451 70.237  94.655  1.00 57.72  ? 294 ILE B CA  1 
ATOM   7091  C  C   . ILE B  1 294 ? 31.851 71.175  93.516  1.00 61.66  ? 294 ILE B C   1 
ATOM   7092  O  O   . ILE B  1 294 ? 30.991 71.675  92.784  1.00 61.69  ? 294 ILE B O   1 
ATOM   7093  C  CB  . ILE B  1 294 ? 30.968 68.846  94.137  1.00 62.13  ? 294 ILE B CB  1 
ATOM   7094  C  CG1 . ILE B  1 294 ? 30.638 67.866  95.303  1.00 63.67  ? 294 ILE B CG1 1 
ATOM   7095  C  CG2 . ILE B  1 294 ? 31.943 68.219  93.117  1.00 62.33  ? 294 ILE B CG2 1 
ATOM   7096  C  CD1 . ILE B  1 294 ? 31.818 67.436  96.281  1.00 71.41  ? 294 ILE B CD1 1 
ATOM   7097  N  N   . ASN B  1 295 ? 33.167 71.409  93.385  1.00 57.62  ? 295 ASN B N   1 
ATOM   7098  C  CA  . ASN B  1 295 ? 33.757 72.220  92.328  1.00 56.98  ? 295 ASN B CA  1 
ATOM   7099  C  C   . ASN B  1 295 ? 33.515 71.526  90.983  1.00 63.55  ? 295 ASN B C   1 
ATOM   7100  O  O   . ASN B  1 295 ? 33.631 70.301  90.897  1.00 64.12  ? 295 ASN B O   1 
ATOM   7101  C  CB  . ASN B  1 295 ? 35.251 72.416  92.594  1.00 56.15  ? 295 ASN B CB  1 
ATOM   7102  C  CG  . ASN B  1 295 ? 35.884 73.531  91.803  1.00 81.38  ? 295 ASN B CG  1 
ATOM   7103  O  OD1 . ASN B  1 295 ? 35.987 73.481  90.572  1.00 78.41  ? 295 ASN B OD1 1 
ATOM   7104  N  ND2 . ASN B  1 295 ? 36.367 74.547  92.500  1.00 72.43  ? 295 ASN B ND2 1 
ATOM   7105  N  N   . SER B  1 296 ? 33.121 72.295  89.956  1.00 60.88  ? 296 SER B N   1 
ATOM   7106  C  CA  . SER B  1 296 ? 32.824 71.761  88.623  1.00 61.52  ? 296 SER B CA  1 
ATOM   7107  C  C   . SER B  1 296 ? 34.088 71.321  87.879  1.00 64.95  ? 296 SER B C   1 
ATOM   7108  O  O   . SER B  1 296 ? 34.033 70.369  87.097  1.00 65.73  ? 296 SER B O   1 
ATOM   7109  C  CB  . SER B  1 296 ? 32.081 72.799  87.788  1.00 64.95  ? 296 SER B CB  1 
ATOM   7110  O  OG  . SER B  1 296 ? 30.920 73.267  88.454  1.00 74.90  ? 296 SER B OG  1 
ATOM   7111  N  N   . ILE B  1 297 ? 35.220 72.011  88.128  1.00 59.65  ? 297 ILE B N   1 
ATOM   7112  C  CA  . ILE B  1 297 ? 36.500 71.772  87.459  1.00 58.79  ? 297 ILE B CA  1 
ATOM   7113  C  C   . ILE B  1 297 ? 37.341 70.698  88.185  1.00 62.58  ? 297 ILE B C   1 
ATOM   7114  O  O   . ILE B  1 297 ? 37.662 69.678  87.571  1.00 63.31  ? 297 ILE B O   1 
ATOM   7115  C  CB  . ILE B  1 297 ? 37.297 73.104  87.298  1.00 60.32  ? 297 ILE B CB  1 
ATOM   7116  C  CG1 . ILE B  1 297 ? 36.466 74.195  86.594  1.00 60.22  ? 297 ILE B CG1 1 
ATOM   7117  C  CG2 . ILE B  1 297 ? 38.625 72.888  86.581  1.00 60.94  ? 297 ILE B CG2 1 
ATOM   7118  C  CD1 . ILE B  1 297 ? 36.084 75.308  87.488  1.00 67.00  ? 297 ILE B CD1 1 
ATOM   7119  N  N   . THR B  1 298 ? 37.723 70.945  89.460  1.00 57.48  ? 298 THR B N   1 
ATOM   7120  C  CA  . THR B  1 298 ? 38.590 70.059  90.254  1.00 56.92  ? 298 THR B CA  1 
ATOM   7121  C  C   . THR B  1 298 ? 37.836 68.904  90.949  1.00 60.92  ? 298 THR B C   1 
ATOM   7122  O  O   . THR B  1 298 ? 38.446 67.873  91.239  1.00 60.48  ? 298 THR B O   1 
ATOM   7123  C  CB  . THR B  1 298 ? 39.386 70.864  91.296  1.00 64.90  ? 298 THR B CB  1 
ATOM   7124  O  OG1 . THR B  1 298 ? 38.494 71.626  92.111  1.00 65.50  ? 298 THR B OG1 1 
ATOM   7125  C  CG2 . THR B  1 298 ? 40.429 71.776  90.663  1.00 63.20  ? 298 THR B CG2 1 
ATOM   7126  N  N   . GLY B  1 299 ? 36.546 69.089  91.221  1.00 57.97  ? 299 GLY B N   1 
ATOM   7127  C  CA  . GLY B  1 299 ? 35.717 68.082  91.878  1.00 59.04  ? 299 GLY B CA  1 
ATOM   7128  C  C   . GLY B  1 299 ? 35.886 68.015  93.383  1.00 63.79  ? 299 GLY B C   1 
ATOM   7129  O  O   . GLY B  1 299 ? 35.385 67.082  94.017  1.00 64.32  ? 299 GLY B O   1 
ATOM   7130  N  N   . LYS B  1 300 ? 36.582 69.012  93.966  1.00 60.21  ? 300 LYS B N   1 
ATOM   7131  C  CA  . LYS B  1 300 ? 36.856 69.114  95.403  1.00 59.90  ? 300 LYS B CA  1 
ATOM   7132  C  C   . LYS B  1 300 ? 35.668 69.719  96.153  1.00 64.06  ? 300 LYS B C   1 
ATOM   7133  O  O   . LYS B  1 300 ? 35.009 70.625  95.634  1.00 62.93  ? 300 LYS B O   1 
ATOM   7134  C  CB  . LYS B  1 300 ? 38.118 69.968  95.668  1.00 61.22  ? 300 LYS B CB  1 
ATOM   7135  C  CG  . LYS B  1 300 ? 39.379 69.545  94.909  1.00 78.86  ? 300 LYS B CG  1 
ATOM   7136  C  CD  . LYS B  1 300 ? 40.202 68.482  95.640  1.00 91.30  ? 300 LYS B CD  1 
ATOM   7137  C  CE  . LYS B  1 300 ? 41.489 68.145  94.916  1.00 103.14 ? 300 LYS B CE  1 
ATOM   7138  N  NZ  . LYS B  1 300 ? 41.259 67.386  93.653  1.00 110.94 ? 300 LYS B NZ  1 
ATOM   7139  N  N   . GLU B  1 301 ? 35.408 69.228  97.382  1.00 61.65  ? 301 GLU B N   1 
ATOM   7140  C  CA  . GLU B  1 301 ? 34.346 69.757  98.238  1.00 61.75  ? 301 GLU B CA  1 
ATOM   7141  C  C   . GLU B  1 301 ? 34.889 71.002  98.940  1.00 63.78  ? 301 GLU B C   1 
ATOM   7142  O  O   . GLU B  1 301 ? 35.646 70.900  99.908  1.00 62.83  ? 301 GLU B O   1 
ATOM   7143  C  CB  . GLU B  1 301 ? 33.838 68.703  99.235  1.00 64.32  ? 301 GLU B CB  1 
ATOM   7144  C  CG  . GLU B  1 301 ? 32.460 69.029  99.780  1.00 76.06  ? 301 GLU B CG  1 
ATOM   7145  C  CD  . GLU B  1 301 ? 31.902 68.012  100.754 1.00 102.94 ? 301 GLU B CD  1 
ATOM   7146  O  OE1 . GLU B  1 301 ? 32.451 67.896  101.874 1.00 102.06 ? 301 GLU B OE1 1 
ATOM   7147  O  OE2 . GLU B  1 301 ? 30.899 67.349  100.407 1.00 100.76 ? 301 GLU B OE2 1 
ATOM   7148  N  N   . GLU B  1 302 ? 34.544 72.175  98.396  1.00 59.35  ? 302 GLU B N   1 
ATOM   7149  C  CA  . GLU B  1 302 ? 35.015 73.478  98.866  1.00 57.68  ? 302 GLU B CA  1 
ATOM   7150  C  C   . GLU B  1 302 ? 33.897 74.546  98.784  1.00 61.76  ? 302 GLU B C   1 
ATOM   7151  O  O   . GLU B  1 302 ? 32.885 74.291  98.125  1.00 61.90  ? 302 GLU B O   1 
ATOM   7152  C  CB  . GLU B  1 302 ? 36.251 73.908  98.038  1.00 57.81  ? 302 GLU B CB  1 
ATOM   7153  C  CG  . GLU B  1 302 ? 36.013 74.039  96.540  1.00 64.50  ? 302 GLU B CG  1 
ATOM   7154  C  CD  . GLU B  1 302 ? 37.193 74.561  95.743  1.00 76.29  ? 302 GLU B CD  1 
ATOM   7155  O  OE1 . GLU B  1 302 ? 38.280 73.942  95.805  1.00 64.32  ? 302 GLU B OE1 1 
ATOM   7156  O  OE2 . GLU B  1 302 ? 37.018 75.574  95.029  1.00 67.96  ? 302 GLU B OE2 1 
ATOM   7157  N  N   . PRO B  1 303 ? 34.049 75.747  99.408  1.00 58.03  ? 303 PRO B N   1 
ATOM   7158  C  CA  . PRO B  1 303 ? 32.992 76.768  99.289  1.00 58.07  ? 303 PRO B CA  1 
ATOM   7159  C  C   . PRO B  1 303 ? 32.800 77.241  97.848  1.00 61.65  ? 303 PRO B C   1 
ATOM   7160  O  O   . PRO B  1 303 ? 33.758 77.292  97.073  1.00 60.76  ? 303 PRO B O   1 
ATOM   7161  C  CB  . PRO B  1 303 ? 33.492 77.917  100.177 1.00 58.92  ? 303 PRO B CB  1 
ATOM   7162  C  CG  . PRO B  1 303 ? 34.533 77.317  101.053 1.00 63.00  ? 303 PRO B CG  1 
ATOM   7163  C  CD  . PRO B  1 303 ? 35.167 76.243  100.238 1.00 58.64  ? 303 PRO B CD  1 
ATOM   7164  N  N   . LEU B  1 304 ? 31.551 77.556  97.489  1.00 58.61  ? 304 LEU B N   1 
ATOM   7165  C  CA  . LEU B  1 304 ? 31.191 78.028  96.155  1.00 58.31  ? 304 LEU B CA  1 
ATOM   7166  C  C   . LEU B  1 304 ? 30.543 79.400  96.252  1.00 61.44  ? 304 LEU B C   1 
ATOM   7167  O  O   . LEU B  1 304 ? 29.600 79.585  97.029  1.00 61.52  ? 304 LEU B O   1 
ATOM   7168  C  CB  . LEU B  1 304 ? 30.249 77.039  95.434  1.00 59.61  ? 304 LEU B CB  1 
ATOM   7169  C  CG  . LEU B  1 304 ? 30.639 75.556  95.374  1.00 64.89  ? 304 LEU B CG  1 
ATOM   7170  C  CD1 . LEU B  1 304 ? 29.541 74.748  94.724  1.00 66.47  ? 304 LEU B CD1 1 
ATOM   7171  C  CD2 . LEU B  1 304 ? 31.953 75.338  94.621  1.00 66.45  ? 304 LEU B CD2 1 
ATOM   7172  N  N   . TYR B  1 305 ? 31.057 80.364  95.476  1.00 56.96  ? 305 TYR B N   1 
ATOM   7173  C  CA  . TYR B  1 305 ? 30.525 81.721  95.463  1.00 56.67  ? 305 TYR B CA  1 
ATOM   7174  C  C   . TYR B  1 305 ? 30.291 82.190  94.022  1.00 61.02  ? 305 TYR B C   1 
ATOM   7175  O  O   . TYR B  1 305 ? 31.182 82.032  93.180  1.00 60.27  ? 305 TYR B O   1 
ATOM   7176  C  CB  . TYR B  1 305 ? 31.448 82.685  96.222  1.00 56.66  ? 305 TYR B CB  1 
ATOM   7177  C  CG  . TYR B  1 305 ? 30.803 84.006  96.571  1.00 57.99  ? 305 TYR B CG  1 
ATOM   7178  C  CD1 . TYR B  1 305 ? 29.871 84.099  97.600  1.00 60.63  ? 305 TYR B CD1 1 
ATOM   7179  C  CD2 . TYR B  1 305 ? 31.150 85.172  95.898  1.00 57.99  ? 305 TYR B CD2 1 
ATOM   7180  C  CE1 . TYR B  1 305 ? 29.272 85.314  97.925  1.00 61.72  ? 305 TYR B CE1 1 
ATOM   7181  C  CE2 . TYR B  1 305 ? 30.567 86.395  96.221  1.00 58.93  ? 305 TYR B CE2 1 
ATOM   7182  C  CZ  . TYR B  1 305 ? 29.624 86.460  97.234  1.00 67.26  ? 305 TYR B CZ  1 
ATOM   7183  O  OH  . TYR B  1 305 ? 29.037 87.657  97.558  1.00 68.87  ? 305 TYR B OH  1 
ATOM   7184  N  N   . PRO B  1 306 ? 29.088 82.741  93.715  1.00 58.31  ? 306 PRO B N   1 
ATOM   7185  C  CA  . PRO B  1 306 ? 28.812 83.181  92.338  1.00 58.25  ? 306 PRO B CA  1 
ATOM   7186  C  C   . PRO B  1 306 ? 29.643 84.395  91.948  1.00 61.51  ? 306 PRO B C   1 
ATOM   7187  O  O   . PRO B  1 306 ? 29.683 85.382  92.689  1.00 61.13  ? 306 PRO B O   1 
ATOM   7188  C  CB  . PRO B  1 306 ? 27.315 83.512  92.354  1.00 61.03  ? 306 PRO B CB  1 
ATOM   7189  C  CG  . PRO B  1 306 ? 26.788 83.017  93.656  1.00 65.95  ? 306 PRO B CG  1 
ATOM   7190  C  CD  . PRO B  1 306 ? 27.932 82.995  94.599  1.00 60.56  ? 306 PRO B CD  1 
ATOM   7191  N  N   . SER B  1 307 ? 30.314 84.309  90.782  1.00 57.37  ? 307 SER B N   1 
ATOM   7192  C  CA  . SER B  1 307 ? 31.182 85.357  90.236  1.00 55.87  ? 307 SER B CA  1 
ATOM   7193  C  C   . SER B  1 307 ? 30.451 86.693  90.066  1.00 58.47  ? 307 SER B C   1 
ATOM   7194  O  O   . SER B  1 307 ? 31.055 87.731  90.335  1.00 56.93  ? 307 SER B O   1 
ATOM   7195  C  CB  . SER B  1 307 ? 31.778 84.921  88.900  1.00 59.39  ? 307 SER B CB  1 
ATOM   7196  O  OG  . SER B  1 307 ? 32.711 83.866  89.063  1.00 68.42  ? 307 SER B OG  1 
ATOM   7197  N  N   . TYR B  1 308 ? 29.156 86.669  89.663  1.00 55.52  ? 308 TYR B N   1 
ATOM   7198  C  CA  . TYR B  1 308 ? 28.346 87.871  89.449  1.00 55.48  ? 308 TYR B CA  1 
ATOM   7199  C  C   . TYR B  1 308 ? 28.249 88.735  90.727  1.00 58.68  ? 308 TYR B C   1 
ATOM   7200  O  O   . TYR B  1 308 ? 28.298 89.959  90.616  1.00 58.27  ? 308 TYR B O   1 
ATOM   7201  C  CB  . TYR B  1 308 ? 26.948 87.531  88.882  1.00 58.17  ? 308 TYR B CB  1 
ATOM   7202  C  CG  . TYR B  1 308 ? 25.886 87.155  89.896  1.00 61.70  ? 308 TYR B CG  1 
ATOM   7203  C  CD1 . TYR B  1 308 ? 25.115 88.131  90.524  1.00 64.50  ? 308 TYR B CD1 1 
ATOM   7204  C  CD2 . TYR B  1 308 ? 25.592 85.823  90.165  1.00 63.18  ? 308 TYR B CD2 1 
ATOM   7205  C  CE1 . TYR B  1 308 ? 24.133 87.793  91.453  1.00 66.79  ? 308 TYR B CE1 1 
ATOM   7206  C  CE2 . TYR B  1 308 ? 24.596 85.471  91.077  1.00 65.13  ? 308 TYR B CE2 1 
ATOM   7207  C  CZ  . TYR B  1 308 ? 23.872 86.460  91.723  1.00 74.51  ? 308 TYR B CZ  1 
ATOM   7208  O  OH  . TYR B  1 308 ? 22.889 86.120  92.623  1.00 78.32  ? 308 TYR B OH  1 
ATOM   7209  N  N   . LYS B  1 309 ? 28.133 88.105  91.921  1.00 54.69  ? 309 LYS B N   1 
ATOM   7210  C  CA  . LYS B  1 309 ? 28.052 88.806  93.211  1.00 54.10  ? 309 LYS B CA  1 
ATOM   7211  C  C   . LYS B  1 309 ? 29.358 89.573  93.489  1.00 56.38  ? 309 LYS B C   1 
ATOM   7212  O  O   . LYS B  1 309 ? 29.312 90.715  93.946  1.00 56.23  ? 309 LYS B O   1 
ATOM   7213  C  CB  . LYS B  1 309 ? 27.750 87.827  94.359  1.00 56.92  ? 309 LYS B CB  1 
ATOM   7214  C  CG  . LYS B  1 309 ? 26.313 87.327  94.409  1.00 67.78  ? 309 LYS B CG  1 
ATOM   7215  C  CD  . LYS B  1 309 ? 26.128 86.311  95.527  1.00 74.20  ? 309 LYS B CD  1 
ATOM   7216  C  CE  . LYS B  1 309 ? 24.757 85.685  95.510  1.00 82.92  ? 309 LYS B CE  1 
ATOM   7217  N  NZ  . LYS B  1 309 ? 24.654 84.567  96.484  1.00 91.22  ? 309 LYS B NZ  1 
ATOM   7218  N  N   . ARG B  1 310 ? 30.513 88.949  93.172  1.00 51.00  ? 310 ARG B N   1 
ATOM   7219  C  CA  . ARG B  1 310 ? 31.854 89.518  93.315  1.00 48.96  ? 310 ARG B CA  1 
ATOM   7220  C  C   . ARG B  1 310 ? 32.035 90.682  92.326  1.00 51.90  ? 310 ARG B C   1 
ATOM   7221  O  O   . ARG B  1 310 ? 32.559 91.724  92.717  1.00 51.14  ? 310 ARG B O   1 
ATOM   7222  C  CB  . ARG B  1 310 ? 32.912 88.412  93.099  1.00 47.40  ? 310 ARG B CB  1 
ATOM   7223  C  CG  . ARG B  1 310 ? 34.366 88.873  92.948  1.00 51.93  ? 310 ARG B CG  1 
ATOM   7224  C  CD  . ARG B  1 310 ? 35.377 87.791  93.299  1.00 58.16  ? 310 ARG B CD  1 
ATOM   7225  N  NE  . ARG B  1 310 ? 35.301 86.613  92.431  1.00 67.36  ? 310 ARG B NE  1 
ATOM   7226  C  CZ  . ARG B  1 310 ? 34.774 85.445  92.789  1.00 84.78  ? 310 ARG B CZ  1 
ATOM   7227  N  NH1 . ARG B  1 310 ? 34.259 85.286  94.002  1.00 69.62  ? 310 ARG B NH1 1 
ATOM   7228  N  NH2 . ARG B  1 310 ? 34.747 84.432  91.934  1.00 77.50  ? 310 ARG B NH2 1 
ATOM   7229  N  N   . GLN B  1 311 ? 31.571 90.511  91.068  1.00 48.38  ? 311 GLN B N   1 
ATOM   7230  C  CA  . GLN B  1 311 ? 31.666 91.512  90.000  1.00 47.89  ? 311 GLN B CA  1 
ATOM   7231  C  C   . GLN B  1 311 ? 30.855 92.774  90.321  1.00 52.64  ? 311 GLN B C   1 
ATOM   7232  O  O   . GLN B  1 311 ? 31.343 93.880  90.074  1.00 51.80  ? 311 GLN B O   1 
ATOM   7233  C  CB  . GLN B  1 311 ? 31.224 90.931  88.643  1.00 49.56  ? 311 GLN B CB  1 
ATOM   7234  C  CG  . GLN B  1 311 ? 32.185 89.897  88.043  1.00 61.73  ? 311 GLN B CG  1 
ATOM   7235  C  CD  . GLN B  1 311 ? 33.593 90.416  87.853  1.00 79.69  ? 311 GLN B CD  1 
ATOM   7236  O  OE1 . GLN B  1 311 ? 33.853 91.313  87.041  1.00 75.48  ? 311 GLN B OE1 1 
ATOM   7237  N  NE2 . GLN B  1 311 ? 34.533 89.854  88.601  1.00 68.84  ? 311 GLN B NE2 1 
ATOM   7238  N  N   . LEU B  1 312 ? 29.635 92.616  90.880  1.00 50.16  ? 312 LEU B N   1 
ATOM   7239  C  CA  . LEU B  1 312 ? 28.773 93.742  91.262  1.00 50.26  ? 312 LEU B CA  1 
ATOM   7240  C  C   . LEU B  1 312 ? 29.441 94.576  92.367  1.00 53.68  ? 312 LEU B C   1 
ATOM   7241  O  O   . LEU B  1 312 ? 29.450 95.801  92.276  1.00 52.85  ? 312 LEU B O   1 
ATOM   7242  C  CB  . LEU B  1 312 ? 27.377 93.264  91.705  1.00 51.11  ? 312 LEU B CB  1 
ATOM   7243  C  CG  . LEU B  1 312 ? 26.463 92.692  90.613  1.00 55.81  ? 312 LEU B CG  1 
ATOM   7244  C  CD1 . LEU B  1 312 ? 25.454 91.747  91.202  1.00 56.50  ? 312 LEU B CD1 1 
ATOM   7245  C  CD2 . LEU B  1 312 ? 25.763 93.786  89.830  1.00 58.30  ? 312 LEU B CD2 1 
ATOM   7246  N  N   . ARG B  1 313 ? 30.056 93.905  93.366  1.00 50.25  ? 313 ARG B N   1 
ATOM   7247  C  CA  . ARG B  1 313 ? 30.783 94.543  94.471  1.00 49.67  ? 313 ARG B CA  1 
ATOM   7248  C  C   . ARG B  1 313 ? 32.009 95.325  93.949  1.00 53.92  ? 313 ARG B C   1 
ATOM   7249  O  O   . ARG B  1 313 ? 32.345 96.375  94.502  1.00 53.61  ? 313 ARG B O   1 
ATOM   7250  C  CB  . ARG B  1 313 ? 31.220 93.495  95.511  1.00 48.42  ? 313 ARG B CB  1 
ATOM   7251  C  CG  . ARG B  1 313 ? 30.063 92.891  96.302  1.00 56.65  ? 313 ARG B CG  1 
ATOM   7252  C  CD  . ARG B  1 313 ? 30.525 91.794  97.244  1.00 63.32  ? 313 ARG B CD  1 
ATOM   7253  N  NE  . ARG B  1 313 ? 29.473 91.409  98.190  1.00 67.31  ? 313 ARG B NE  1 
ATOM   7254  C  CZ  . ARG B  1 313 ? 29.586 90.439  99.094  1.00 77.75  ? 313 ARG B CZ  1 
ATOM   7255  N  NH1 . ARG B  1 313 ? 30.702 89.725  99.179  1.00 58.15  ? 313 ARG B NH1 1 
ATOM   7256  N  NH2 . ARG B  1 313 ? 28.579 90.168  99.912  1.00 69.15  ? 313 ARG B NH2 1 
ATOM   7257  N  N   . ILE B  1 314 ? 32.642 94.827  92.863  1.00 50.30  ? 314 ILE B N   1 
ATOM   7258  C  CA  . ILE B  1 314 ? 33.814 95.433  92.229  1.00 49.46  ? 314 ILE B CA  1 
ATOM   7259  C  C   . ILE B  1 314 ? 33.423 96.725  91.487  1.00 54.62  ? 314 ILE B C   1 
ATOM   7260  O  O   . ILE B  1 314 ? 33.984 97.775  91.788  1.00 54.04  ? 314 ILE B O   1 
ATOM   7261  C  CB  . ILE B  1 314 ? 34.541 94.412  91.286  1.00 52.05  ? 314 ILE B CB  1 
ATOM   7262  C  CG1 . ILE B  1 314 ? 35.338 93.377  92.110  1.00 52.14  ? 314 ILE B CG1 1 
ATOM   7263  C  CG2 . ILE B  1 314 ? 35.460 95.104  90.247  1.00 51.97  ? 314 ILE B CG2 1 
ATOM   7264  C  CD1 . ILE B  1 314 ? 35.692 92.083  91.370  1.00 60.73  ? 314 ILE B CD1 1 
ATOM   7265  N  N   . TYR B  1 315 ? 32.477 96.645  90.531  1.00 52.17  ? 315 TYR B N   1 
ATOM   7266  C  CA  . TYR B  1 315 ? 32.094 97.760  89.665  1.00 52.13  ? 315 TYR B CA  1 
ATOM   7267  C  C   . TYR B  1 315 ? 31.073 98.740  90.257  1.00 55.81  ? 315 TYR B C   1 
ATOM   7268  O  O   . TYR B  1 315 ? 31.048 99.886  89.810  1.00 56.12  ? 315 TYR B O   1 
ATOM   7269  C  CB  . TYR B  1 315 ? 31.563 97.226  88.327  1.00 54.05  ? 315 TYR B CB  1 
ATOM   7270  C  CG  . TYR B  1 315 ? 32.634 96.577  87.479  1.00 55.59  ? 315 TYR B CG  1 
ATOM   7271  C  CD1 . TYR B  1 315 ? 33.420 97.332  86.615  1.00 57.15  ? 315 TYR B CD1 1 
ATOM   7272  C  CD2 . TYR B  1 315 ? 32.865 95.207  87.542  1.00 56.48  ? 315 TYR B CD2 1 
ATOM   7273  C  CE1 . TYR B  1 315 ? 34.413 96.740  85.837  1.00 57.38  ? 315 TYR B CE1 1 
ATOM   7274  C  CE2 . TYR B  1 315 ? 33.862 94.605  86.777  1.00 57.15  ? 315 TYR B CE2 1 
ATOM   7275  C  CZ  . TYR B  1 315 ? 34.633 95.376  85.923  1.00 64.95  ? 315 TYR B CZ  1 
ATOM   7276  O  OH  . TYR B  1 315 ? 35.609 94.783  85.157  1.00 66.91  ? 315 TYR B OH  1 
ATOM   7277  N  N   . LEU B  1 316 ? 30.243 98.326  91.232  1.00 51.48  ? 316 LEU B N   1 
ATOM   7278  C  CA  . LEU B  1 316 ? 29.224 99.224  91.788  1.00 51.31  ? 316 LEU B CA  1 
ATOM   7279  C  C   . LEU B  1 316 ? 29.597 99.831  93.145  1.00 53.11  ? 316 LEU B C   1 
ATOM   7280  O  O   . LEU B  1 316 ? 29.067 100.889 93.481  1.00 52.88  ? 316 LEU B O   1 
ATOM   7281  C  CB  . LEU B  1 316 ? 27.870 98.513  91.913  1.00 52.37  ? 316 LEU B CB  1 
ATOM   7282  C  CG  . LEU B  1 316 ? 27.006 98.471  90.659  1.00 57.95  ? 316 LEU B CG  1 
ATOM   7283  C  CD1 . LEU B  1 316 ? 27.337 97.267  89.798  1.00 58.03  ? 316 LEU B CD1 1 
ATOM   7284  C  CD2 . LEU B  1 316 ? 25.546 98.413  91.026  1.00 61.91  ? 316 LEU B CD2 1 
ATOM   7285  N  N   . VAL B  1 317 ? 30.472 99.180  93.930  1.00 48.39  ? 317 VAL B N   1 
ATOM   7286  C  CA  . VAL B  1 317 ? 30.827 99.695  95.259  1.00 47.79  ? 317 VAL B CA  1 
ATOM   7287  C  C   . VAL B  1 317 ? 32.303 100.110 95.319  1.00 50.55  ? 317 VAL B C   1 
ATOM   7288  O  O   . VAL B  1 317 ? 32.592 101.253 95.675  1.00 50.46  ? 317 VAL B O   1 
ATOM   7289  C  CB  . VAL B  1 317 ? 30.482 98.693  96.399  1.00 51.76  ? 317 VAL B CB  1 
ATOM   7290  C  CG1 . VAL B  1 317 ? 30.800 99.282  97.773  1.00 51.30  ? 317 VAL B CG1 1 
ATOM   7291  C  CG2 . VAL B  1 317 ? 29.019 98.253  96.333  1.00 52.63  ? 317 VAL B CG2 1 
ATOM   7292  N  N   . SER B  1 318 ? 33.220 99.188  94.987  1.00 46.18  ? 318 SER B N   1 
ATOM   7293  C  CA  . SER B  1 318 ? 34.662 99.411  95.058  1.00 45.31  ? 318 SER B CA  1 
ATOM   7294  C  C   . SER B  1 318 ? 35.176 100.437 94.041  1.00 48.81  ? 318 SER B C   1 
ATOM   7295  O  O   . SER B  1 318 ? 35.865 101.375 94.443  1.00 48.21  ? 318 SER B O   1 
ATOM   7296  C  CB  . SER B  1 318 ? 35.405 98.097  94.890  1.00 48.81  ? 318 SER B CB  1 
ATOM   7297  O  OG  . SER B  1 318 ? 35.253 97.305  96.056  1.00 58.14  ? 318 SER B OG  1 
ATOM   7298  N  N   . LEU B  1 319 ? 34.850 100.269 92.747  1.00 45.64  ? 319 LEU B N   1 
ATOM   7299  C  CA  . LEU B  1 319 ? 35.281 101.171 91.676  1.00 45.48  ? 319 LEU B CA  1 
ATOM   7300  C  C   . LEU B  1 319 ? 34.829 102.631 91.938  1.00 50.15  ? 319 LEU B C   1 
ATOM   7301  O  O   . LEU B  1 319 ? 35.703 103.497 91.877  1.00 49.69  ? 319 LEU B O   1 
ATOM   7302  C  CB  . LEU B  1 319 ? 34.799 100.688 90.298  1.00 45.77  ? 319 LEU B CB  1 
ATOM   7303  C  CG  . LEU B  1 319 ? 35.408 101.383 89.093  1.00 50.07  ? 319 LEU B CG  1 
ATOM   7304  C  CD1 . LEU B  1 319 ? 36.602 100.611 88.568  1.00 49.43  ? 319 LEU B CD1 1 
ATOM   7305  C  CD2 . LEU B  1 319 ? 34.374 101.556 88.003  1.00 53.56  ? 319 LEU B CD2 1 
ATOM   7306  N  N   . PRO B  1 320 ? 33.545 102.949 92.283  1.00 47.51  ? 320 PRO B N   1 
ATOM   7307  C  CA  . PRO B  1 320 ? 33.192 104.357 92.547  1.00 47.94  ? 320 PRO B CA  1 
ATOM   7308  C  C   . PRO B  1 320 ? 33.914 104.937 93.767  1.00 51.23  ? 320 PRO B C   1 
ATOM   7309  O  O   . PRO B  1 320 ? 34.231 106.127 93.761  1.00 51.24  ? 320 PRO B O   1 
ATOM   7310  C  CB  . PRO B  1 320 ? 31.677 104.311 92.775  1.00 50.72  ? 320 PRO B CB  1 
ATOM   7311  C  CG  . PRO B  1 320 ? 31.234 103.043 92.147  1.00 55.20  ? 320 PRO B CG  1 
ATOM   7312  C  CD  . PRO B  1 320 ? 32.351 102.092 92.408  1.00 49.71  ? 320 PRO B CD  1 
ATOM   7313  N  N   . PHE B  1 321 ? 34.201 104.100 94.789  1.00 46.60  ? 321 PHE B N   1 
ATOM   7314  C  CA  . PHE B  1 321 ? 34.915 104.518 95.997  1.00 45.94  ? 321 PHE B CA  1 
ATOM   7315  C  C   . PHE B  1 321 ? 36.354 104.942 95.668  1.00 51.10  ? 321 PHE B C   1 
ATOM   7316  O  O   . PHE B  1 321 ? 36.809 105.977 96.167  1.00 51.17  ? 321 PHE B O   1 
ATOM   7317  C  CB  . PHE B  1 321 ? 34.915 103.403 97.056  1.00 46.83  ? 321 PHE B CB  1 
ATOM   7318  C  CG  . PHE B  1 321 ? 35.709 103.734 98.300  1.00 47.49  ? 321 PHE B CG  1 
ATOM   7319  C  CD1 . PHE B  1 321 ? 35.160 104.524 99.305  1.00 50.72  ? 321 PHE B CD1 1 
ATOM   7320  C  CD2 . PHE B  1 321 ? 37.010 103.270 98.460  1.00 48.43  ? 321 PHE B CD2 1 
ATOM   7321  C  CE1 . PHE B  1 321 ? 35.894 104.833 100.451 1.00 51.32  ? 321 PHE B CE1 1 
ATOM   7322  C  CE2 . PHE B  1 321 ? 37.741 103.576 99.609  1.00 50.95  ? 321 PHE B CE2 1 
ATOM   7323  C  CZ  . PHE B  1 321 ? 37.178 104.355 100.597 1.00 49.67  ? 321 PHE B CZ  1 
ATOM   7324  N  N   . VAL B  1 322 ? 37.065 104.135 94.846  1.00 47.49  ? 322 VAL B N   1 
ATOM   7325  C  CA  . VAL B  1 322 ? 38.445 104.397 94.420  1.00 47.02  ? 322 VAL B CA  1 
ATOM   7326  C  C   . VAL B  1 322 ? 38.477 105.734 93.645  1.00 52.88  ? 322 VAL B C   1 
ATOM   7327  O  O   . VAL B  1 322 ? 39.366 106.553 93.887  1.00 52.55  ? 322 VAL B O   1 
ATOM   7328  C  CB  . VAL B  1 322 ? 39.034 103.205 93.607  1.00 50.10  ? 322 VAL B CB  1 
ATOM   7329  C  CG1 . VAL B  1 322 ? 40.405 103.534 93.023  1.00 49.32  ? 322 VAL B CG1 1 
ATOM   7330  C  CG2 . VAL B  1 322 ? 39.126 101.948 94.467  1.00 49.63  ? 322 VAL B CG2 1 
ATOM   7331  N  N   . CYS B  1 323 ? 37.464 105.973 92.784  1.00 50.82  ? 323 CYS B N   1 
ATOM   7332  C  CA  . CYS B  1 323 ? 37.318 107.196 91.991  1.00 51.52  ? 323 CYS B CA  1 
ATOM   7333  C  C   . CYS B  1 323 ? 37.039 108.405 92.875  1.00 55.16  ? 323 CYS B C   1 
ATOM   7334  O  O   . CYS B  1 323 ? 37.480 109.501 92.535  1.00 55.11  ? 323 CYS B O   1 
ATOM   7335  C  CB  . CYS B  1 323 ? 36.232 107.030 90.936  1.00 52.89  ? 323 CYS B CB  1 
ATOM   7336  S  SG  . CYS B  1 323 ? 36.639 105.830 89.647  1.00 56.65  ? 323 CYS B SG  1 
ATOM   7337  N  N   . LEU B  1 324 ? 36.309 108.218 93.991  1.00 51.60  ? 324 LEU B N   1 
ATOM   7338  C  CA  . LEU B  1 324 ? 36.009 109.303 94.926  1.00 52.16  ? 324 LEU B CA  1 
ATOM   7339  C  C   . LEU B  1 324 ? 37.272 109.728 95.680  1.00 54.79  ? 324 LEU B C   1 
ATOM   7340  O  O   . LEU B  1 324 ? 37.503 110.928 95.836  1.00 54.92  ? 324 LEU B O   1 
ATOM   7341  C  CB  . LEU B  1 324 ? 34.903 108.905 95.917  1.00 53.05  ? 324 LEU B CB  1 
ATOM   7342  C  CG  . LEU B  1 324 ? 33.466 108.933 95.391  1.00 59.12  ? 324 LEU B CG  1 
ATOM   7343  C  CD1 . LEU B  1 324 ? 32.565 108.051 96.235  1.00 59.90  ? 324 LEU B CD1 1 
ATOM   7344  C  CD2 . LEU B  1 324 ? 32.915 110.358 95.323  1.00 62.34  ? 324 LEU B CD2 1 
ATOM   7345  N  N   . CYS B  1 325 ? 38.096 108.745 96.115  1.00 49.59  ? 325 CYS B N   1 
ATOM   7346  C  CA  . CYS B  1 325 ? 39.355 108.967 96.831  1.00 48.55  ? 325 CYS B CA  1 
ATOM   7347  C  C   . CYS B  1 325 ? 40.382 109.620 95.913  1.00 51.94  ? 325 CYS B C   1 
ATOM   7348  O  O   . CYS B  1 325 ? 41.181 110.436 96.373  1.00 51.89  ? 325 CYS B O   1 
ATOM   7349  C  CB  . CYS B  1 325 ? 39.885 107.660 97.409  1.00 48.13  ? 325 CYS B CB  1 
ATOM   7350  S  SG  . CYS B  1 325 ? 38.872 106.972 98.740  1.00 52.30  ? 325 CYS B SG  1 
ATOM   7351  N  N   . LEU B  1 326 ? 40.362 109.252 94.619  1.00 48.06  ? 326 LEU B N   1 
ATOM   7352  C  CA  . LEU B  1 326 ? 41.243 109.795 93.588  1.00 47.71  ? 326 LEU B CA  1 
ATOM   7353  C  C   . LEU B  1 326 ? 40.877 111.256 93.301  1.00 53.45  ? 326 LEU B C   1 
ATOM   7354  O  O   . LEU B  1 326 ? 41.775 112.078 93.109  1.00 53.44  ? 326 LEU B O   1 
ATOM   7355  C  CB  . LEU B  1 326 ? 41.158 108.936 92.314  1.00 47.24  ? 326 LEU B CB  1 
ATOM   7356  C  CG  . LEU B  1 326 ? 42.328 107.979 92.021  1.00 50.72  ? 326 LEU B CG  1 
ATOM   7357  C  CD1 . LEU B  1 326 ? 42.650 107.065 93.197  1.00 50.41  ? 326 LEU B CD1 1 
ATOM   7358  C  CD2 . LEU B  1 326 ? 42.041 107.143 90.802  1.00 52.14  ? 326 LEU B CD2 1 
ATOM   7359  N  N   . TYR B  1 327 ? 39.563 111.585 93.320  1.00 51.11  ? 327 TYR B N   1 
ATOM   7360  C  CA  . TYR B  1 327 ? 39.063 112.948 93.128  1.00 52.07  ? 327 TYR B CA  1 
ATOM   7361  C  C   . TYR B  1 327 ? 39.399 113.802 94.356  1.00 57.61  ? 327 TYR B C   1 
ATOM   7362  O  O   . TYR B  1 327 ? 39.773 114.968 94.206  1.00 58.45  ? 327 TYR B O   1 
ATOM   7363  C  CB  . TYR B  1 327 ? 37.546 112.962 92.850  1.00 53.94  ? 327 TYR B CB  1 
ATOM   7364  C  CG  . TYR B  1 327 ? 36.969 114.356 92.704  1.00 57.19  ? 327 TYR B CG  1 
ATOM   7365  C  CD1 . TYR B  1 327 ? 37.106 115.068 91.515  1.00 59.75  ? 327 TYR B CD1 1 
ATOM   7366  C  CD2 . TYR B  1 327 ? 36.299 114.969 93.759  1.00 58.96  ? 327 TYR B CD2 1 
ATOM   7367  C  CE1 . TYR B  1 327 ? 36.600 116.363 91.383  1.00 61.96  ? 327 TYR B CE1 1 
ATOM   7368  C  CE2 . TYR B  1 327 ? 35.785 116.261 93.637  1.00 61.06  ? 327 TYR B CE2 1 
ATOM   7369  C  CZ  . TYR B  1 327 ? 35.934 116.953 92.444  1.00 68.50  ? 327 TYR B CZ  1 
ATOM   7370  O  OH  . TYR B  1 327 ? 35.424 118.225 92.317  1.00 69.06  ? 327 TYR B OH  1 
ATOM   7371  N  N   . PHE B  1 328 ? 39.257 113.221 95.565  1.00 53.92  ? 328 PHE B N   1 
ATOM   7372  C  CA  . PHE B  1 328 ? 39.557 113.891 96.829  1.00 53.99  ? 328 PHE B CA  1 
ATOM   7373  C  C   . PHE B  1 328 ? 41.054 114.198 96.931  1.00 56.01  ? 328 PHE B C   1 
ATOM   7374  O  O   . PHE B  1 328 ? 41.416 115.241 97.478  1.00 56.44  ? 328 PHE B O   1 
ATOM   7375  C  CB  . PHE B  1 328 ? 39.089 113.041 98.020  1.00 56.05  ? 328 PHE B CB  1 
ATOM   7376  C  CG  . PHE B  1 328 ? 39.375 113.632 99.380  1.00 58.53  ? 328 PHE B CG  1 
ATOM   7377  C  CD1 . PHE B  1 328 ? 38.668 114.738 99.842  1.00 62.95  ? 328 PHE B CD1 1 
ATOM   7378  C  CD2 . PHE B  1 328 ? 40.339 113.072 100.209 1.00 60.62  ? 328 PHE B CD2 1 
ATOM   7379  C  CE1 . PHE B  1 328 ? 38.931 115.282 101.104 1.00 64.37  ? 328 PHE B CE1 1 
ATOM   7380  C  CE2 . PHE B  1 328 ? 40.595 113.609 101.475 1.00 64.09  ? 328 PHE B CE2 1 
ATOM   7381  C  CZ  . PHE B  1 328 ? 39.886 114.707 101.916 1.00 63.12  ? 328 PHE B CZ  1 
ATOM   7382  N  N   . SER B  1 329 ? 41.913 113.308 96.378  1.00 50.00  ? 329 SER B N   1 
ATOM   7383  C  CA  . SER B  1 329 ? 43.370 113.473 96.339  1.00 48.59  ? 329 SER B CA  1 
ATOM   7384  C  C   . SER B  1 329 ? 43.738 114.723 95.545  1.00 51.38  ? 329 SER B C   1 
ATOM   7385  O  O   . SER B  1 329 ? 44.585 115.502 95.984  1.00 50.99  ? 329 SER B O   1 
ATOM   7386  C  CB  . SER B  1 329 ? 44.033 112.247 95.723  1.00 50.77  ? 329 SER B CB  1 
ATOM   7387  O  OG  . SER B  1 329 ? 43.835 111.097 96.524  1.00 58.18  ? 329 SER B OG  1 
ATOM   7388  N  N   . LEU B  1 330 ? 43.062 114.926 94.396  1.00 46.93  ? 330 LEU B N   1 
ATOM   7389  C  CA  . LEU B  1 330 ? 43.239 116.082 93.521  1.00 46.53  ? 330 LEU B CA  1 
ATOM   7390  C  C   . LEU B  1 330 ? 42.693 117.343 94.186  1.00 51.05  ? 330 LEU B C   1 
ATOM   7391  O  O   . LEU B  1 330 ? 43.277 118.415 94.025  1.00 51.16  ? 330 LEU B O   1 
ATOM   7392  C  CB  . LEU B  1 330 ? 42.549 115.853 92.165  1.00 46.27  ? 330 LEU B CB  1 
ATOM   7393  C  CG  . LEU B  1 330 ? 43.164 114.790 91.255  1.00 49.46  ? 330 LEU B CG  1 
ATOM   7394  C  CD1 . LEU B  1 330 ? 42.145 114.249 90.284  1.00 49.41  ? 330 LEU B CD1 1 
ATOM   7395  C  CD2 . LEU B  1 330 ? 44.370 115.327 90.510  1.00 51.42  ? 330 LEU B CD2 1 
ATOM   7396  N  N   . TYR B  1 331 ? 41.589 117.210 94.947  1.00 48.06  ? 331 TYR B N   1 
ATOM   7397  C  CA  . TYR B  1 331 ? 40.950 118.312 95.669  1.00 49.03  ? 331 TYR B CA  1 
ATOM   7398  C  C   . TYR B  1 331 ? 41.869 118.839 96.783  1.00 52.35  ? 331 TYR B C   1 
ATOM   7399  O  O   . TYR B  1 331 ? 42.016 120.054 96.915  1.00 52.86  ? 331 TYR B O   1 
ATOM   7400  C  CB  . TYR B  1 331 ? 39.588 117.871 96.240  1.00 50.84  ? 331 TYR B CB  1 
ATOM   7401  C  CG  . TYR B  1 331 ? 38.864 118.947 97.022  1.00 54.26  ? 331 TYR B CG  1 
ATOM   7402  C  CD1 . TYR B  1 331 ? 38.270 120.028 96.376  1.00 57.12  ? 331 TYR B CD1 1 
ATOM   7403  C  CD2 . TYR B  1 331 ? 38.741 118.866 98.405  1.00 55.71  ? 331 TYR B CD2 1 
ATOM   7404  C  CE1 . TYR B  1 331 ? 37.592 121.014 97.090  1.00 59.37  ? 331 TYR B CE1 1 
ATOM   7405  C  CE2 . TYR B  1 331 ? 38.054 119.839 99.129  1.00 58.09  ? 331 TYR B CE2 1 
ATOM   7406  C  CZ  . TYR B  1 331 ? 37.491 120.919 98.468  1.00 68.30  ? 331 TYR B CZ  1 
ATOM   7407  O  OH  . TYR B  1 331 ? 36.821 121.888 99.180  1.00 73.46  ? 331 TYR B OH  1 
ATOM   7408  N  N   . VAL B  1 332 ? 42.492 117.925 97.558  1.00 47.28  ? 332 VAL B N   1 
ATOM   7409  C  CA  . VAL B  1 332 ? 43.421 118.227 98.655  1.00 46.50  ? 332 VAL B CA  1 
ATOM   7410  C  C   . VAL B  1 332 ? 44.694 118.882 98.077  1.00 50.90  ? 332 VAL B C   1 
ATOM   7411  O  O   . VAL B  1 332 ? 45.201 119.847 98.657  1.00 50.80  ? 332 VAL B O   1 
ATOM   7412  C  CB  . VAL B  1 332 ? 43.720 116.941 99.479  1.00 48.87  ? 332 VAL B CB  1 
ATOM   7413  C  CG1 . VAL B  1 332 ? 44.969 117.080 100.349 1.00 48.35  ? 332 VAL B CG1 1 
ATOM   7414  C  CG2 . VAL B  1 332 ? 42.518 116.562 100.331 1.00 48.89  ? 332 VAL B CG2 1 
ATOM   7415  N  N   . MET B  1 333 ? 45.166 118.388 96.914  1.00 47.47  ? 333 MET B N   1 
ATOM   7416  C  CA  . MET B  1 333 ? 46.340 118.905 96.206  1.00 47.27  ? 333 MET B CA  1 
ATOM   7417  C  C   . MET B  1 333 ? 46.132 120.381 95.839  1.00 53.10  ? 333 MET B C   1 
ATOM   7418  O  O   . MET B  1 333 ? 47.029 121.195 96.059  1.00 53.08  ? 333 MET B O   1 
ATOM   7419  C  CB  . MET B  1 333 ? 46.614 118.061 94.949  1.00 48.63  ? 333 MET B CB  1 
ATOM   7420  C  CG  . MET B  1 333 ? 47.877 118.456 94.209  1.00 51.90  ? 333 MET B CG  1 
ATOM   7421  S  SD  . MET B  1 333 ? 47.798 118.183 92.418  1.00 55.43  ? 333 MET B SD  1 
ATOM   7422  C  CE  . MET B  1 333 ? 46.665 119.440 91.938  1.00 53.00  ? 333 MET B CE  1 
ATOM   7423  N  N   . MET B  1 334 ? 44.933 120.718 95.321  1.00 50.82  ? 334 MET B N   1 
ATOM   7424  C  CA  . MET B  1 334 ? 44.551 122.073 94.922  1.00 52.08  ? 334 MET B CA  1 
ATOM   7425  C  C   . MET B  1 334 ? 44.588 123.047 96.099  1.00 57.63  ? 334 MET B C   1 
ATOM   7426  O  O   . MET B  1 334 ? 45.038 124.180 95.927  1.00 57.99  ? 334 MET B O   1 
ATOM   7427  C  CB  . MET B  1 334 ? 43.163 122.080 94.268  1.00 54.84  ? 334 MET B CB  1 
ATOM   7428  C  CG  . MET B  1 334 ? 43.171 121.620 92.818  1.00 57.96  ? 334 MET B CG  1 
ATOM   7429  S  SD  . MET B  1 334 ? 44.484 122.354 91.804  1.00 62.18  ? 334 MET B SD  1 
ATOM   7430  C  CE  . MET B  1 334 ? 43.983 124.088 91.795  1.00 60.41  ? 334 MET B CE  1 
ATOM   7431  N  N   . ILE B  1 335 ? 44.151 122.594 97.292  1.00 54.83  ? 335 ILE B N   1 
ATOM   7432  C  CA  . ILE B  1 335 ? 44.168 123.373 98.535  1.00 55.62  ? 335 ILE B CA  1 
ATOM   7433  C  C   . ILE B  1 335 ? 45.634 123.673 98.900  1.00 60.92  ? 335 ILE B C   1 
ATOM   7434  O  O   . ILE B  1 335 ? 45.921 124.784 99.354  1.00 61.95  ? 335 ILE B O   1 
ATOM   7435  C  CB  . ILE B  1 335 ? 43.387 122.634 99.665  1.00 58.10  ? 335 ILE B CB  1 
ATOM   7436  C  CG1 . ILE B  1 335 ? 41.867 122.736 99.416  1.00 58.78  ? 335 ILE B CG1 1 
ATOM   7437  C  CG2 . ILE B  1 335 ? 43.744 123.151 101.072 1.00 58.83  ? 335 ILE B CG2 1 
ATOM   7438  C  CD1 . ILE B  1 335 ? 41.076 121.548 99.857  1.00 62.95  ? 335 ILE B CD1 1 
ATOM   7439  N  N   . TYR B  1 336 ? 46.557 122.708 98.647  1.00 56.79  ? 336 TYR B N   1 
ATOM   7440  C  CA  . TYR B  1 336 ? 47.988 122.889 98.904  1.00 56.57  ? 336 TYR B CA  1 
ATOM   7441  C  C   . TYR B  1 336 ? 48.568 123.941 97.945  1.00 62.20  ? 336 TYR B C   1 
ATOM   7442  O  O   . TYR B  1 336 ? 49.358 124.785 98.376  1.00 62.72  ? 336 TYR B O   1 
ATOM   7443  C  CB  . TYR B  1 336 ? 48.768 121.556 98.807  1.00 55.91  ? 336 TYR B CB  1 
ATOM   7444  C  CG  . TYR B  1 336 ? 50.261 121.742 98.624  1.00 56.86  ? 336 TYR B CG  1 
ATOM   7445  C  CD1 . TYR B  1 336 ? 51.054 122.242 99.654  1.00 59.16  ? 336 TYR B CD1 1 
ATOM   7446  C  CD2 . TYR B  1 336 ? 50.872 121.475 97.402  1.00 57.00  ? 336 TYR B CD2 1 
ATOM   7447  C  CE1 . TYR B  1 336 ? 52.422 122.447 99.481  1.00 59.94  ? 336 TYR B CE1 1 
ATOM   7448  C  CE2 . TYR B  1 336 ? 52.236 121.689 97.213  1.00 57.90  ? 336 TYR B CE2 1 
ATOM   7449  C  CZ  . TYR B  1 336 ? 53.008 122.176 98.256  1.00 66.29  ? 336 TYR B CZ  1 
ATOM   7450  O  OH  . TYR B  1 336 ? 54.354 122.390 98.075  1.00 67.97  ? 336 TYR B OH  1 
ATOM   7451  N  N   . PHE B  1 337 ? 48.166 123.899 96.662  1.00 58.95  ? 337 PHE B N   1 
ATOM   7452  C  CA  . PHE B  1 337 ? 48.657 124.846 95.662  1.00 59.46  ? 337 PHE B CA  1 
ATOM   7453  C  C   . PHE B  1 337 ? 47.985 126.222 95.795  1.00 66.21  ? 337 PHE B C   1 
ATOM   7454  O  O   . PHE B  1 337 ? 48.429 127.174 95.152  1.00 66.91  ? 337 PHE B O   1 
ATOM   7455  C  CB  . PHE B  1 337 ? 48.521 124.278 94.242  1.00 60.20  ? 337 PHE B CB  1 
ATOM   7456  C  CG  . PHE B  1 337 ? 49.588 123.254 93.928  1.00 59.99  ? 337 PHE B CG  1 
ATOM   7457  C  CD1 . PHE B  1 337 ? 50.924 123.626 93.818  1.00 62.69  ? 337 PHE B CD1 1 
ATOM   7458  C  CD2 . PHE B  1 337 ? 49.260 121.917 93.754  1.00 60.72  ? 337 PHE B CD2 1 
ATOM   7459  C  CE1 . PHE B  1 337 ? 51.911 122.678 93.543  1.00 62.64  ? 337 PHE B CE1 1 
ATOM   7460  C  CE2 . PHE B  1 337 ? 50.248 120.972 93.466  1.00 62.67  ? 337 PHE B CE2 1 
ATOM   7461  C  CZ  . PHE B  1 337 ? 51.566 121.358 93.364  1.00 60.81  ? 337 PHE B CZ  1 
ATOM   7462  N  N   . ASP B  1 338 ? 46.946 126.327 96.651  1.00 64.01  ? 338 ASP B N   1 
ATOM   7463  C  CA  . ASP B  1 338 ? 46.262 127.576 96.995  1.00 65.59  ? 338 ASP B CA  1 
ATOM   7464  C  C   . ASP B  1 338 ? 46.894 128.129 98.272  1.00 71.53  ? 338 ASP B C   1 
ATOM   7465  O  O   . ASP B  1 338 ? 46.920 129.341 98.477  1.00 72.59  ? 338 ASP B O   1 
ATOM   7466  C  CB  . ASP B  1 338 ? 44.746 127.360 97.171  1.00 67.58  ? 338 ASP B CB  1 
ATOM   7467  C  CG  . ASP B  1 338 ? 43.915 127.374 95.895  1.00 77.38  ? 338 ASP B CG  1 
ATOM   7468  O  OD1 . ASP B  1 338 ? 44.459 127.751 94.827  1.00 77.95  ? 338 ASP B OD1 1 
ATOM   7469  O  OD2 . ASP B  1 338 ? 42.713 127.041 95.968  1.00 82.79  ? 338 ASP B OD2 1 
ATOM   7470  N  N   . MET B  1 339 ? 47.421 127.221 99.115  1.00 68.51  ? 339 MET B N   1 
ATOM   7471  C  CA  . MET B  1 339 ? 48.118 127.516 100.365 1.00 69.43  ? 339 MET B CA  1 
ATOM   7472  C  C   . MET B  1 339 ? 49.515 128.075 100.075 1.00 74.08  ? 339 MET B C   1 
ATOM   7473  O  O   . MET B  1 339 ? 49.979 128.951 100.805 1.00 74.66  ? 339 MET B O   1 
ATOM   7474  C  CB  . MET B  1 339 ? 48.217 126.246 101.221 1.00 71.12  ? 339 MET B CB  1 
ATOM   7475  C  CG  . MET B  1 339 ? 48.278 126.513 102.705 1.00 76.05  ? 339 MET B CG  1 
ATOM   7476  S  SD  . MET B  1 339 ? 48.267 124.987 103.680 1.00 79.94  ? 339 MET B SD  1 
ATOM   7477  C  CE  . MET B  1 339 ? 46.513 124.616 103.685 1.00 76.78  ? 339 MET B CE  1 
ATOM   7478  N  N   . GLU B  1 340 ? 50.180 127.569 99.006  1.00 70.27  ? 340 GLU B N   1 
ATOM   7479  C  CA  . GLU B  1 340 ? 51.513 128.009 98.569  1.00 70.26  ? 340 GLU B CA  1 
ATOM   7480  C  C   . GLU B  1 340 ? 51.450 129.402 97.937  1.00 75.82  ? 340 GLU B C   1 
ATOM   7481  O  O   . GLU B  1 340 ? 52.478 130.071 97.847  1.00 76.08  ? 340 GLU B O   1 
ATOM   7482  C  CB  . GLU B  1 340 ? 52.146 127.006 97.593  1.00 70.32  ? 340 GLU B CB  1 
ATOM   7483  C  CG  . GLU B  1 340 ? 52.681 125.755 98.267  1.00 79.13  ? 340 GLU B CG  1 
ATOM   7484  C  CD  . GLU B  1 340 ? 54.078 125.841 98.852  1.00 95.52  ? 340 GLU B CD  1 
ATOM   7485  O  OE1 . GLU B  1 340 ? 55.051 125.827 98.064  1.00 92.01  ? 340 GLU B OE1 1 
ATOM   7486  O  OE2 . GLU B  1 340 ? 54.204 125.850 100.098 1.00 83.26  ? 340 GLU B OE2 1 
ATOM   7487  N  N   . VAL B  1 341 ? 50.248 129.829 97.501  1.00 73.34  ? 341 VAL B N   1 
ATOM   7488  C  CA  . VAL B  1 341 ? 49.979 131.154 96.939  1.00 74.92  ? 341 VAL B CA  1 
ATOM   7489  C  C   . VAL B  1 341 ? 49.854 132.146 98.122  1.00 82.55  ? 341 VAL B C   1 
ATOM   7490  O  O   . VAL B  1 341 ? 50.449 133.227 98.082  1.00 82.83  ? 341 VAL B O   1 
ATOM   7491  C  CB  . VAL B  1 341 ? 48.726 131.130 96.015  1.00 78.33  ? 341 VAL B CB  1 
ATOM   7492  C  CG1 . VAL B  1 341 ? 48.193 132.532 95.733  1.00 79.61  ? 341 VAL B CG1 1 
ATOM   7493  C  CG2 . VAL B  1 341 ? 49.026 130.406 94.709  1.00 77.00  ? 341 VAL B CG2 1 
ATOM   7494  N  N   . TRP B  1 342 ? 49.119 131.741 99.189  1.00 81.32  ? 342 TRP B N   1 
ATOM   7495  C  CA  . TRP B  1 342 ? 48.903 132.513 100.421 1.00 83.28  ? 342 TRP B CA  1 
ATOM   7496  C  C   . TRP B  1 342 ? 50.206 132.675 101.231 1.00 89.56  ? 342 TRP B C   1 
ATOM   7497  O  O   . TRP B  1 342 ? 50.357 133.667 101.948 1.00 90.20  ? 342 TRP B O   1 
ATOM   7498  C  CB  . TRP B  1 342 ? 47.822 131.848 101.289 1.00 81.71  ? 342 TRP B CB  1 
ATOM   7499  N  N   . ALA B  1 343 ? 51.136 131.700 101.115 1.00 86.76  ? 343 ALA B N   1 
ATOM   7500  C  CA  . ALA B  1 343 ? 52.442 131.704 101.785 1.00 87.43  ? 343 ALA B CA  1 
ATOM   7501  C  C   . ALA B  1 343 ? 53.452 132.577 101.026 1.00 93.39  ? 343 ALA B C   1 
ATOM   7502  O  O   . ALA B  1 343 ? 54.327 133.180 101.650 1.00 93.57  ? 343 ALA B O   1 
ATOM   7503  C  CB  . ALA B  1 343 ? 52.971 130.283 101.914 1.00 86.75  ? 343 ALA B CB  1 
ATOM   7504  N  N   . LEU B  1 344 ? 53.326 132.635 99.680  1.00 91.04  ? 344 LEU B N   1 
ATOM   7505  C  CA  . LEU B  1 344 ? 54.180 133.438 98.799  1.00 92.25  ? 344 LEU B CA  1 
ATOM   7506  C  C   . LEU B  1 344 ? 53.870 134.929 98.949  1.00 99.80  ? 344 LEU B C   1 
ATOM   7507  O  O   . LEU B  1 344 ? 54.761 135.761 98.773  1.00 100.76 ? 344 LEU B O   1 
ATOM   7508  C  CB  . LEU B  1 344 ? 54.005 133.010 97.336  1.00 91.51  ? 344 LEU B CB  1 
ATOM   7509  N  N   . GLY B  1 345 ? 52.614 135.240 99.268  1.00 97.63  ? 345 GLY B N   1 
ATOM   7510  C  CA  . GLY B  1 345 ? 52.136 136.602 99.478  1.00 99.37  ? 345 GLY B CA  1 
ATOM   7511  C  C   . GLY B  1 345 ? 52.511 137.158 100.836 1.00 105.05 ? 345 GLY B C   1 
ATOM   7512  O  O   . GLY B  1 345 ? 52.775 138.358 100.959 1.00 106.08 ? 345 GLY B O   1 
ATOM   7513  N  N   . LEU B  1 346 ? 52.535 136.283 101.868 1.00 101.74 ? 346 LEU B N   1 
ATOM   7514  C  CA  . LEU B  1 346 ? 52.883 136.627 103.251 1.00 102.79 ? 346 LEU B CA  1 
ATOM   7515  C  C   . LEU B  1 346 ? 54.373 136.978 103.381 1.00 107.91 ? 346 LEU B C   1 
ATOM   7516  O  O   . LEU B  1 346 ? 54.723 137.867 104.161 1.00 109.07 ? 346 LEU B O   1 
ATOM   7517  C  CB  . LEU B  1 346 ? 52.524 135.477 104.200 1.00 101.76 ? 346 LEU B CB  1 
ATOM   7518  N  N   . HIS B  1 347 ? 55.241 136.289 102.611 1.00 103.56 ? 347 HIS B N   1 
ATOM   7519  C  CA  . HIS B  1 347 ? 56.687 136.514 102.598 1.00 140.52 ? 347 HIS B CA  1 
ATOM   7520  C  C   . HIS B  1 347 ? 57.010 137.808 101.852 1.00 169.36 ? 347 HIS B C   1 
ATOM   7521  O  O   . HIS B  1 347 ? 57.948 138.512 102.217 1.00 132.27 ? 347 HIS B O   1 
ATOM   7522  C  CB  . HIS B  1 347 ? 57.409 135.322 101.951 1.00 139.84 ? 347 HIS B CB  1 
ATOM   7523  C  CG  . HIS B  1 347 ? 58.902 135.397 102.029 1.00 143.62 ? 347 HIS B CG  1 
ATOM   7524  N  ND1 . HIS B  1 347 ? 59.583 135.038 103.178 1.00 145.45 ? 347 HIS B ND1 1 
ATOM   7525  C  CD2 . HIS B  1 347 ? 59.798 135.782 101.091 1.00 145.69 ? 347 HIS B CD2 1 
ATOM   7526  C  CE1 . HIS B  1 347 ? 60.865 135.213 102.904 1.00 145.19 ? 347 HIS B CE1 1 
ATOM   7527  N  NE2 . HIS B  1 347 ? 61.043 135.662 101.661 1.00 145.72 ? 347 HIS B NE2 1 
ATOM   7528  N  N   . TRP B  1 354 ? 60.547 135.257 110.630 1.00 96.31  ? 354 TRP B N   1 
ATOM   7529  C  CA  . TRP B  1 354 ? 59.331 134.488 110.884 1.00 95.14  ? 354 TRP B CA  1 
ATOM   7530  C  C   . TRP B  1 354 ? 58.692 133.971 109.584 1.00 98.20  ? 354 TRP B C   1 
ATOM   7531  O  O   . TRP B  1 354 ? 58.114 132.881 109.584 1.00 96.55  ? 354 TRP B O   1 
ATOM   7532  C  CB  . TRP B  1 354 ? 58.317 135.337 111.664 1.00 95.02  ? 354 TRP B CB  1 
ATOM   7533  N  N   . THR B  1 355 ? 58.792 134.756 108.488 1.00 95.27  ? 355 THR B N   1 
ATOM   7534  C  CA  . THR B  1 355 ? 58.216 134.440 107.175 1.00 94.08  ? 355 THR B CA  1 
ATOM   7535  C  C   . THR B  1 355 ? 58.941 133.276 106.483 1.00 96.53  ? 355 THR B C   1 
ATOM   7536  O  O   . THR B  1 355 ? 58.286 132.500 105.786 1.00 95.36  ? 355 THR B O   1 
ATOM   7537  C  CB  . THR B  1 355 ? 58.209 135.675 106.263 1.00 104.27 ? 355 THR B CB  1 
ATOM   7538  O  OG1 . THR B  1 355 ? 59.547 136.139 106.082 1.00 105.53 ? 355 THR B OG1 1 
ATOM   7539  C  CG2 . THR B  1 355 ? 57.321 136.801 106.792 1.00 104.71 ? 355 THR B CG2 1 
ATOM   7540  N  N   . SER B  1 356 ? 60.277 133.153 106.671 1.00 92.75  ? 356 SER B N   1 
ATOM   7541  C  CA  . SER B  1 356 ? 61.103 132.088 106.079 1.00 91.12  ? 356 SER B CA  1 
ATOM   7542  C  C   . SER B  1 356 ? 60.718 130.701 106.616 1.00 93.21  ? 356 SER B C   1 
ATOM   7543  O  O   . SER B  1 356 ? 60.918 129.701 105.924 1.00 91.48  ? 356 SER B O   1 
ATOM   7544  C  CB  . SER B  1 356 ? 62.583 132.351 106.334 1.00 95.48  ? 356 SER B CB  1 
ATOM   7545  N  N   . VAL B  1 357 ? 60.163 130.653 107.843 1.00 89.83  ? 357 VAL B N   1 
ATOM   7546  C  CA  . VAL B  1 357 ? 59.692 129.431 108.503 1.00 88.48  ? 357 VAL B CA  1 
ATOM   7547  C  C   . VAL B  1 357 ? 58.297 129.080 107.947 1.00 90.55  ? 357 VAL B C   1 
ATOM   7548  O  O   . VAL B  1 357 ? 58.030 127.913 107.651 1.00 88.61  ? 357 VAL B O   1 
ATOM   7549  C  CB  . VAL B  1 357 ? 59.678 129.575 110.056 1.00 93.40  ? 357 VAL B CB  1 
ATOM   7550  C  CG1 . VAL B  1 357 ? 59.378 128.238 110.737 1.00 92.14  ? 357 VAL B CG1 1 
ATOM   7551  C  CG2 . VAL B  1 357 ? 60.990 130.160 110.580 1.00 94.30  ? 357 VAL B CG2 1 
ATOM   7552  N  N   . LEU B  1 358 ? 57.430 130.112 107.786 1.00 87.26  ? 358 LEU B N   1 
ATOM   7553  C  CA  . LEU B  1 358 ? 56.053 130.023 107.285 1.00 86.20  ? 358 LEU B CA  1 
ATOM   7554  C  C   . LEU B  1 358 ? 55.967 129.489 105.841 1.00 88.42  ? 358 LEU B C   1 
ATOM   7555  O  O   . LEU B  1 358 ? 54.912 128.987 105.451 1.00 87.58  ? 358 LEU B O   1 
ATOM   7556  C  CB  . LEU B  1 358 ? 55.380 131.398 107.365 1.00 87.58  ? 358 LEU B CB  1 
ATOM   7557  N  N   . LEU B  1 359 ? 57.060 129.596 105.058 1.00 84.09  ? 359 LEU B N   1 
ATOM   7558  C  CA  . LEU B  1 359 ? 57.120 129.121 103.672 1.00 82.66  ? 359 LEU B CA  1 
ATOM   7559  C  C   . LEU B  1 359 ? 57.156 127.591 103.591 1.00 84.56  ? 359 LEU B C   1 
ATOM   7560  O  O   . LEU B  1 359 ? 56.637 127.020 102.628 1.00 83.59  ? 359 LEU B O   1 
ATOM   7561  C  CB  . LEU B  1 359 ? 58.346 129.700 102.948 1.00 83.14  ? 359 LEU B CB  1 
ATOM   7562  C  CG  . LEU B  1 359 ? 58.346 131.198 102.667 1.00 89.14  ? 359 LEU B CG  1 
ATOM   7563  C  CD1 . LEU B  1 359 ? 59.758 131.700 102.468 1.00 89.86  ? 359 LEU B CD1 1 
ATOM   7564  C  CD2 . LEU B  1 359 ? 57.485 131.535 101.457 1.00 91.57  ? 359 LEU B CD2 1 
ATOM   7565  N  N   . TYR B  1 360 ? 57.788 126.936 104.587 1.00 80.00  ? 360 TYR B N   1 
ATOM   7566  C  CA  . TYR B  1 360 ? 57.917 125.480 104.661 1.00 78.08  ? 360 TYR B CA  1 
ATOM   7567  C  C   . TYR B  1 360 ? 56.644 124.822 105.197 1.00 79.00  ? 360 TYR B C   1 
ATOM   7568  O  O   . TYR B  1 360 ? 56.363 123.679 104.840 1.00 77.64  ? 360 TYR B O   1 
ATOM   7569  C  CB  . TYR B  1 360 ? 59.115 125.086 105.542 1.00 79.91  ? 360 TYR B CB  1 
ATOM   7570  C  CG  . TYR B  1 360 ? 60.462 125.318 104.889 1.00 82.74  ? 360 TYR B CG  1 
ATOM   7571  C  CD1 . TYR B  1 360 ? 61.041 124.347 104.073 1.00 83.75  ? 360 TYR B CD1 1 
ATOM   7572  C  CD2 . TYR B  1 360 ? 61.170 126.498 105.103 1.00 85.13  ? 360 TYR B CD2 1 
ATOM   7573  C  CE1 . TYR B  1 360 ? 62.280 124.557 103.465 1.00 84.92  ? 360 TYR B CE1 1 
ATOM   7574  C  CE2 . TYR B  1 360 ? 62.413 126.715 104.505 1.00 86.47  ? 360 TYR B CE2 1 
ATOM   7575  C  CZ  . TYR B  1 360 ? 62.963 125.742 103.685 1.00 93.47  ? 360 TYR B CZ  1 
ATOM   7576  O  OH  . TYR B  1 360 ? 64.186 125.952 103.091 1.00 95.40  ? 360 TYR B OH  1 
ATOM   7577  N  N   . VAL B  1 361 ? 55.883 125.549 106.042 1.00 74.37  ? 361 VAL B N   1 
ATOM   7578  C  CA  . VAL B  1 361 ? 54.639 125.141 106.716 1.00 73.14  ? 361 VAL B CA  1 
ATOM   7579  C  C   . VAL B  1 361 ? 53.599 124.474 105.739 1.00 74.38  ? 361 VAL B C   1 
ATOM   7580  O  O   . VAL B  1 361 ? 53.156 123.373 106.082 1.00 73.15  ? 361 VAL B O   1 
ATOM   7581  C  CB  . VAL B  1 361 ? 54.026 126.334 107.510 1.00 78.24  ? 361 VAL B CB  1 
ATOM   7582  C  CG1 . VAL B  1 361 ? 52.593 126.058 107.953 1.00 77.93  ? 361 VAL B CG1 1 
ATOM   7583  C  CG2 . VAL B  1 361 ? 54.894 126.692 108.713 1.00 78.81  ? 361 VAL B CG2 1 
ATOM   7584  N  N   . PRO B  1 362 ? 53.202 125.049 104.561 1.00 69.78  ? 362 PRO B N   1 
ATOM   7585  C  CA  . PRO B  1 362 ? 52.209 124.361 103.709 1.00 68.36  ? 362 PRO B CA  1 
ATOM   7586  C  C   . PRO B  1 362 ? 52.689 123.017 103.156 1.00 70.20  ? 362 PRO B C   1 
ATOM   7587  O  O   . PRO B  1 362 ? 51.870 122.110 102.999 1.00 69.29  ? 362 PRO B O   1 
ATOM   7588  C  CB  . PRO B  1 362 ? 51.960 125.357 102.571 1.00 70.68  ? 362 PRO B CB  1 
ATOM   7589  C  CG  . PRO B  1 362 ? 52.414 126.663 103.092 1.00 76.56  ? 362 PRO B CG  1 
ATOM   7590  C  CD  . PRO B  1 362 ? 53.585 126.340 103.957 1.00 72.14  ? 362 PRO B CD  1 
ATOM   7591  N  N   . SER B  1 363 ? 54.003 122.885 102.873 1.00 65.56  ? 363 SER B N   1 
ATOM   7592  C  CA  . SER B  1 363 ? 54.618 121.648 102.373 1.00 63.49  ? 363 SER B CA  1 
ATOM   7593  C  C   . SER B  1 363 ? 54.615 120.571 103.461 1.00 64.79  ? 363 SER B C   1 
ATOM   7594  O  O   . SER B  1 363 ? 54.363 119.403 103.161 1.00 63.63  ? 363 SER B O   1 
ATOM   7595  C  CB  . SER B  1 363 ? 56.043 121.910 101.895 1.00 67.35  ? 363 SER B CB  1 
ATOM   7596  O  OG  . SER B  1 363 ? 56.081 122.925 100.907 1.00 78.10  ? 363 SER B OG  1 
ATOM   7597  N  N   . ILE B  1 364 ? 54.873 120.976 104.724 1.00 60.18  ? 364 ILE B N   1 
ATOM   7598  C  CA  . ILE B  1 364 ? 54.890 120.106 105.905 1.00 58.85  ? 364 ILE B CA  1 
ATOM   7599  C  C   . ILE B  1 364 ? 53.463 119.576 106.159 1.00 61.22  ? 364 ILE B C   1 
ATOM   7600  O  O   . ILE B  1 364 ? 53.302 118.370 106.353 1.00 59.80  ? 364 ILE B O   1 
ATOM   7601  C  CB  . ILE B  1 364 ? 55.495 120.846 107.144 1.00 62.55  ? 364 ILE B CB  1 
ATOM   7602  C  CG1 . ILE B  1 364 ? 56.997 121.157 106.923 1.00 62.88  ? 364 ILE B CG1 1 
ATOM   7603  C  CG2 . ILE B  1 364 ? 55.298 120.051 108.446 1.00 62.77  ? 364 ILE B CG2 1 
ATOM   7604  C  CD1 . ILE B  1 364 ? 57.562 122.336 107.724 1.00 68.74  ? 364 ILE B CD1 1 
ATOM   7605  N  N   . ILE B  1 365 ? 52.441 120.466 106.114 1.00 57.56  ? 365 ILE B N   1 
ATOM   7606  C  CA  . ILE B  1 365 ? 51.025 120.131 106.334 1.00 56.82  ? 365 ILE B CA  1 
ATOM   7607  C  C   . ILE B  1 365 ? 50.540 119.106 105.286 1.00 59.40  ? 365 ILE B C   1 
ATOM   7608  O  O   . ILE B  1 365 ? 50.009 118.062 105.671 1.00 58.53  ? 365 ILE B O   1 
ATOM   7609  C  CB  . ILE B  1 365 ? 50.122 121.410 106.358 1.00 60.69  ? 365 ILE B CB  1 
ATOM   7610  C  CG1 . ILE B  1 365 ? 50.400 122.265 107.618 1.00 62.04  ? 365 ILE B CG1 1 
ATOM   7611  C  CG2 . ILE B  1 365 ? 48.621 121.056 106.251 1.00 60.88  ? 365 ILE B CG2 1 
ATOM   7612  C  CD1 . ILE B  1 365 ? 49.800 123.681 107.602 1.00 69.98  ? 365 ILE B CD1 1 
ATOM   7613  N  N   . TYR B  1 366 ? 50.739 119.400 103.981 1.00 55.54  ? 366 TYR B N   1 
ATOM   7614  C  CA  . TYR B  1 366 ? 50.307 118.551 102.866 1.00 54.56  ? 366 TYR B CA  1 
ATOM   7615  C  C   . TYR B  1 366 ? 50.927 117.151 102.937 1.00 58.07  ? 366 TYR B C   1 
ATOM   7616  O  O   . TYR B  1 366 ? 50.192 116.174 102.781 1.00 57.57  ? 366 TYR B O   1 
ATOM   7617  C  CB  . TYR B  1 366 ? 50.616 119.217 101.509 1.00 55.55  ? 366 TYR B CB  1 
ATOM   7618  C  CG  . TYR B  1 366 ? 50.159 118.448 100.283 1.00 56.16  ? 366 TYR B CG  1 
ATOM   7619  C  CD1 . TYR B  1 366 ? 48.863 117.941 100.192 1.00 57.93  ? 366 TYR B CD1 1 
ATOM   7620  C  CD2 . TYR B  1 366 ? 50.996 118.295 99.181  1.00 56.27  ? 366 TYR B CD2 1 
ATOM   7621  C  CE1 . TYR B  1 366 ? 48.435 117.245 99.061  1.00 57.66  ? 366 TYR B CE1 1 
ATOM   7622  C  CE2 . TYR B  1 366 ? 50.575 117.612 98.040  1.00 56.38  ? 366 TYR B CE2 1 
ATOM   7623  C  CZ  . TYR B  1 366 ? 49.294 117.087 97.985  1.00 62.15  ? 366 TYR B CZ  1 
ATOM   7624  O  OH  . TYR B  1 366 ? 48.881 116.413 96.861  1.00 60.08  ? 366 TYR B OH  1 
ATOM   7625  N  N   . ALA B  1 367 ? 52.251 117.054 103.214 1.00 53.90  ? 367 ALA B N   1 
ATOM   7626  C  CA  . ALA B  1 367 ? 52.976 115.782 103.329 1.00 52.63  ? 367 ALA B CA  1 
ATOM   7627  C  C   . ALA B  1 367 ? 52.447 114.924 104.490 1.00 55.96  ? 367 ALA B C   1 
ATOM   7628  O  O   . ALA B  1 367 ? 52.438 113.696 104.380 1.00 54.82  ? 367 ALA B O   1 
ATOM   7629  C  CB  . ALA B  1 367 ? 54.461 116.038 103.507 1.00 53.53  ? 367 ALA B CB  1 
ATOM   7630  N  N   . ILE B  1 368 ? 51.996 115.574 105.585 1.00 52.99  ? 368 ILE B N   1 
ATOM   7631  C  CA  . ILE B  1 368 ? 51.425 114.919 106.763 1.00 52.87  ? 368 ILE B CA  1 
ATOM   7632  C  C   . ILE B  1 368 ? 50.016 114.394 106.402 1.00 56.94  ? 368 ILE B C   1 
ATOM   7633  O  O   . ILE B  1 368 ? 49.716 113.232 106.690 1.00 56.49  ? 368 ILE B O   1 
ATOM   7634  C  CB  . ILE B  1 368 ? 51.443 115.881 107.992 1.00 56.98  ? 368 ILE B CB  1 
ATOM   7635  C  CG1 . ILE B  1 368 ? 52.868 115.942 108.594 1.00 57.80  ? 368 ILE B CG1 1 
ATOM   7636  C  CG2 . ILE B  1 368 ? 50.412 115.487 109.068 1.00 57.48  ? 368 ILE B CG2 1 
ATOM   7637  C  CD1 . ILE B  1 368 ? 53.168 117.152 109.498 1.00 66.77  ? 368 ILE B CD1 1 
ATOM   7638  N  N   . VAL B  1 369 ? 49.186 115.232 105.734 1.00 53.48  ? 369 VAL B N   1 
ATOM   7639  C  CA  . VAL B  1 369 ? 47.827 114.891 105.281 1.00 52.90  ? 369 VAL B CA  1 
ATOM   7640  C  C   . VAL B  1 369 ? 47.895 113.668 104.333 1.00 56.55  ? 369 VAL B C   1 
ATOM   7641  O  O   . VAL B  1 369 ? 47.057 112.768 104.450 1.00 56.14  ? 369 VAL B O   1 
ATOM   7642  C  CB  . VAL B  1 369 ? 47.123 116.118 104.633 1.00 56.90  ? 369 VAL B CB  1 
ATOM   7643  C  CG1 . VAL B  1 369 ? 45.834 115.723 103.910 1.00 56.32  ? 369 VAL B CG1 1 
ATOM   7644  C  CG2 . VAL B  1 369 ? 46.837 117.196 105.677 1.00 57.68  ? 369 VAL B CG2 1 
ATOM   7645  N  N   . ILE B  1 370 ? 48.929 113.627 103.450 1.00 52.92  ? 370 ILE B N   1 
ATOM   7646  C  CA  . ILE B  1 370 ? 49.216 112.538 102.505 1.00 52.32  ? 370 ILE B CA  1 
ATOM   7647  C  C   . ILE B  1 370 ? 49.371 111.216 103.276 1.00 57.33  ? 370 ILE B C   1 
ATOM   7648  O  O   . ILE B  1 370 ? 48.761 110.218 102.888 1.00 56.66  ? 370 ILE B O   1 
ATOM   7649  C  CB  . ILE B  1 370 ? 50.482 112.872 101.645 1.00 55.28  ? 370 ILE B CB  1 
ATOM   7650  C  CG1 . ILE B  1 370 ? 50.192 113.935 100.544 1.00 56.10  ? 370 ILE B CG1 1 
ATOM   7651  C  CG2 . ILE B  1 370 ? 51.171 111.625 101.055 1.00 55.25  ? 370 ILE B CG2 1 
ATOM   7652  C  CD1 . ILE B  1 370 ? 49.142 113.602 99.461  1.00 63.79  ? 370 ILE B CD1 1 
ATOM   7653  N  N   . GLU B  1 371 ? 50.158 111.228 104.379 1.00 55.27  ? 371 GLU B N   1 
ATOM   7654  C  CA  . GLU B  1 371 ? 50.422 110.071 105.242 1.00 55.28  ? 371 GLU B CA  1 
ATOM   7655  C  C   . GLU B  1 371 ? 49.142 109.601 105.952 1.00 59.39  ? 371 GLU B C   1 
ATOM   7656  O  O   . GLU B  1 371 ? 48.924 108.389 106.061 1.00 58.64  ? 371 GLU B O   1 
ATOM   7657  C  CB  . GLU B  1 371 ? 51.532 110.388 106.262 1.00 57.23  ? 371 GLU B CB  1 
ATOM   7658  C  CG  . GLU B  1 371 ? 52.164 109.161 106.911 1.00 72.28  ? 371 GLU B CG  1 
ATOM   7659  C  CD  . GLU B  1 371 ? 52.797 108.144 105.974 1.00 104.73 ? 371 GLU B CD  1 
ATOM   7660  O  OE1 . GLU B  1 371 ? 53.698 108.524 105.191 1.00 106.88 ? 371 GLU B OE1 1 
ATOM   7661  O  OE2 . GLU B  1 371 ? 52.392 106.960 106.032 1.00 101.20 ? 371 GLU B OE2 1 
ATOM   7662  N  N   . ILE B  1 372 ? 48.295 110.555 106.409 1.00 56.38  ? 372 ILE B N   1 
ATOM   7663  C  CA  . ILE B  1 372 ? 47.004 110.280 107.059 1.00 56.43  ? 372 ILE B CA  1 
ATOM   7664  C  C   . ILE B  1 372 ? 46.064 109.624 106.024 1.00 59.86  ? 372 ILE B C   1 
ATOM   7665  O  O   . ILE B  1 372 ? 45.363 108.662 106.346 1.00 59.48  ? 372 ILE B O   1 
ATOM   7666  C  CB  . ILE B  1 372 ? 46.391 111.574 107.682 1.00 60.43  ? 372 ILE B CB  1 
ATOM   7667  C  CG1 . ILE B  1 372 ? 47.311 112.163 108.775 1.00 61.30  ? 372 ILE B CG1 1 
ATOM   7668  C  CG2 . ILE B  1 372 ? 44.976 111.325 108.236 1.00 61.60  ? 372 ILE B CG2 1 
ATOM   7669  C  CD1 . ILE B  1 372 ? 47.131 113.660 109.035 1.00 69.49  ? 372 ILE B CD1 1 
ATOM   7670  N  N   . MET B  1 373 ? 46.089 110.132 104.779 1.00 55.72  ? 373 MET B N   1 
ATOM   7671  C  CA  . MET B  1 373 ? 45.281 109.628 103.673 1.00 55.16  ? 373 MET B CA  1 
ATOM   7672  C  C   . MET B  1 373 ? 45.727 108.236 103.220 1.00 58.43  ? 373 MET B C   1 
ATOM   7673  O  O   . MET B  1 373 ? 44.869 107.398 102.946 1.00 58.31  ? 373 MET B O   1 
ATOM   7674  C  CB  . MET B  1 373 ? 45.331 110.596 102.487 1.00 57.52  ? 373 MET B CB  1 
ATOM   7675  C  CG  . MET B  1 373 ? 44.374 111.754 102.610 1.00 61.68  ? 373 MET B CG  1 
ATOM   7676  S  SD  . MET B  1 373 ? 44.721 113.021 101.374 1.00 65.94  ? 373 MET B SD  1 
ATOM   7677  C  CE  . MET B  1 373 ? 43.980 112.289 99.940  1.00 62.32  ? 373 MET B CE  1 
ATOM   7678  N  N   . ASN B  1 374 ? 47.054 107.990 103.134 1.00 54.19  ? 374 ASN B N   1 
ATOM   7679  C  CA  . ASN B  1 374 ? 47.596 106.703 102.685 1.00 53.36  ? 374 ASN B CA  1 
ATOM   7680  C  C   . ASN B  1 374 ? 47.351 105.583 103.706 1.00 57.11  ? 374 ASN B C   1 
ATOM   7681  O  O   . ASN B  1 374 ? 47.115 104.451 103.288 1.00 56.58  ? 374 ASN B O   1 
ATOM   7682  C  CB  . ASN B  1 374 ? 49.085 106.801 102.337 1.00 54.19  ? 374 ASN B CB  1 
ATOM   7683  C  CG  . ASN B  1 374 ? 49.398 107.489 101.016 1.00 74.45  ? 374 ASN B CG  1 
ATOM   7684  O  OD1 . ASN B  1 374 ? 48.592 107.536 100.078 1.00 61.12  ? 374 ASN B OD1 1 
ATOM   7685  N  ND2 . ASN B  1 374 ? 50.608 108.011 100.899 1.00 69.94  ? 374 ASN B ND2 1 
ATOM   7686  N  N   . ARG B  1 375 ? 47.371 105.882 105.023 1.00 53.63  ? 375 ARG B N   1 
ATOM   7687  C  CA  . ARG B  1 375 ? 47.098 104.859 106.039 1.00 53.14  ? 375 ARG B CA  1 
ATOM   7688  C  C   . ARG B  1 375 ? 45.582 104.557 106.121 1.00 56.01  ? 375 ARG B C   1 
ATOM   7689  O  O   . ARG B  1 375 ? 45.217 103.403 106.336 1.00 55.64  ? 375 ARG B O   1 
ATOM   7690  C  CB  . ARG B  1 375 ? 47.683 105.221 107.427 1.00 54.25  ? 375 ARG B CB  1 
ATOM   7691  C  CG  . ARG B  1 375 ? 47.008 106.366 108.177 1.00 68.02  ? 375 ARG B CG  1 
ATOM   7692  C  CD  . ARG B  1 375 ? 47.042 106.140 109.678 1.00 82.21  ? 375 ARG B CD  1 
ATOM   7693  N  NE  . ARG B  1 375 ? 46.204 107.106 110.394 1.00 93.30  ? 375 ARG B NE  1 
ATOM   7694  C  CZ  . ARG B  1 375 ? 44.987 106.849 110.866 1.00 106.40 ? 375 ARG B CZ  1 
ATOM   7695  N  NH1 . ARG B  1 375 ? 44.448 105.645 110.715 1.00 93.00  ? 375 ARG B NH1 1 
ATOM   7696  N  NH2 . ARG B  1 375 ? 44.303 107.791 111.502 1.00 92.30  ? 375 ARG B NH2 1 
ATOM   7697  N  N   . LEU B  1 376 ? 44.716 105.578 105.912 1.00 51.69  ? 376 LEU B N   1 
ATOM   7698  C  CA  . LEU B  1 376 ? 43.258 105.426 105.949 1.00 51.33  ? 376 LEU B CA  1 
ATOM   7699  C  C   . LEU B  1 376 ? 42.735 104.688 104.718 1.00 53.95  ? 376 LEU B C   1 
ATOM   7700  O  O   . LEU B  1 376 ? 41.878 103.814 104.862 1.00 54.12  ? 376 LEU B O   1 
ATOM   7701  C  CB  . LEU B  1 376 ? 42.556 106.789 106.077 1.00 52.01  ? 376 LEU B CB  1 
ATOM   7702  C  CG  . LEU B  1 376 ? 42.363 107.327 107.495 1.00 56.97  ? 376 LEU B CG  1 
ATOM   7703  C  CD1 . LEU B  1 376 ? 42.153 108.821 107.478 1.00 57.51  ? 376 LEU B CD1 1 
ATOM   7704  C  CD2 . LEU B  1 376 ? 41.188 106.652 108.191 1.00 59.43  ? 376 LEU B CD2 1 
ATOM   7705  N  N   . TYR B  1 377 ? 43.240 105.039 103.518 1.00 49.04  ? 377 TYR B N   1 
ATOM   7706  C  CA  . TYR B  1 377 ? 42.843 104.417 102.252 1.00 48.05  ? 377 TYR B CA  1 
ATOM   7707  C  C   . TYR B  1 377 ? 43.259 102.947 102.208 1.00 52.67  ? 377 TYR B C   1 
ATOM   7708  O  O   . TYR B  1 377 ? 42.513 102.142 101.653 1.00 52.36  ? 377 TYR B O   1 
ATOM   7709  C  CB  . TYR B  1 377 ? 43.433 105.179 101.050 1.00 47.95  ? 377 TYR B CB  1 
ATOM   7710  C  CG  . TYR B  1 377 ? 43.073 104.600 99.699  1.00 47.96  ? 377 TYR B CG  1 
ATOM   7711  C  CD1 . TYR B  1 377 ? 41.900 104.973 99.048  1.00 49.97  ? 377 TYR B CD1 1 
ATOM   7712  C  CD2 . TYR B  1 377 ? 43.920 103.703 99.055  1.00 47.67  ? 377 TYR B CD2 1 
ATOM   7713  C  CE1 . TYR B  1 377 ? 41.567 104.447 97.802  1.00 49.89  ? 377 TYR B CE1 1 
ATOM   7714  C  CE2 . TYR B  1 377 ? 43.588 103.157 97.819  1.00 48.03  ? 377 TYR B CE2 1 
ATOM   7715  C  CZ  . TYR B  1 377 ? 42.422 103.550 97.184  1.00 55.03  ? 377 TYR B CZ  1 
ATOM   7716  O  OH  . TYR B  1 377 ? 42.104 103.029 95.956  1.00 55.87  ? 377 TYR B OH  1 
ATOM   7717  N  N   . ARG B  1 378 ? 44.439 102.601 102.775 1.00 49.38  ? 378 ARG B N   1 
ATOM   7718  C  CA  . ARG B  1 378 ? 44.934 101.222 102.804 1.00 48.97  ? 378 ARG B CA  1 
ATOM   7719  C  C   . ARG B  1 378 ? 44.028 100.325 103.659 1.00 55.36  ? 378 ARG B C   1 
ATOM   7720  O  O   . ARG B  1 378 ? 43.810 99.173  103.279 1.00 55.21  ? 378 ARG B O   1 
ATOM   7721  C  CB  . ARG B  1 378 ? 46.388 101.155 103.279 1.00 47.30  ? 378 ARG B CB  1 
ATOM   7722  C  CG  . ARG B  1 378 ? 47.370 101.395 102.145 1.00 55.15  ? 378 ARG B CG  1 
ATOM   7723  C  CD  . ARG B  1 378 ? 48.812 101.481 102.605 1.00 67.04  ? 378 ARG B CD  1 
ATOM   7724  N  NE  . ARG B  1 378 ? 49.407 100.159 102.837 1.00 79.04  ? 378 ARG B NE  1 
ATOM   7725  C  CZ  . ARG B  1 378 ? 50.631 99.804  102.451 1.00 92.85  ? 378 ARG B CZ  1 
ATOM   7726  N  NH1 . ARG B  1 378 ? 51.405 100.663 101.799 1.00 80.12  ? 378 ARG B NH1 1 
ATOM   7727  N  NH2 . ARG B  1 378 ? 51.090 98.585  102.715 1.00 76.25  ? 378 ARG B NH2 1 
ATOM   7728  N  N   . TYR B  1 379 ? 43.462 100.858 104.771 1.00 53.59  ? 379 TYR B N   1 
ATOM   7729  C  CA  . TYR B  1 379 ? 42.525 100.114 105.622 1.00 54.44  ? 379 TYR B CA  1 
ATOM   7730  C  C   . TYR B  1 379 ? 41.217 99.846  104.869 1.00 55.86  ? 379 TYR B C   1 
ATOM   7731  O  O   . TYR B  1 379 ? 40.687 98.734  104.928 1.00 55.24  ? 379 TYR B O   1 
ATOM   7732  C  CB  . TYR B  1 379 ? 42.219 100.870 106.930 1.00 57.89  ? 379 TYR B CB  1 
ATOM   7733  C  CG  . TYR B  1 379 ? 43.389 101.132 107.853 1.00 62.26  ? 379 TYR B CG  1 
ATOM   7734  C  CD1 . TYR B  1 379 ? 44.354 100.153 108.089 1.00 64.33  ? 379 TYR B CD1 1 
ATOM   7735  C  CD2 . TYR B  1 379 ? 43.456 102.303 108.605 1.00 64.40  ? 379 TYR B CD2 1 
ATOM   7736  C  CE1 . TYR B  1 379 ? 45.407 100.374 108.977 1.00 66.37  ? 379 TYR B CE1 1 
ATOM   7737  C  CE2 . TYR B  1 379 ? 44.506 102.538 109.491 1.00 65.91  ? 379 TYR B CE2 1 
ATOM   7738  C  CZ  . TYR B  1 379 ? 45.477 101.568 109.679 1.00 76.39  ? 379 TYR B CZ  1 
ATOM   7739  O  OH  . TYR B  1 379 ? 46.504 101.801 110.564 1.00 81.39  ? 379 TYR B OH  1 
ATOM   7740  N  N   . ALA B  1 380 ? 40.712 100.875 104.155 1.00 50.94  ? 380 ALA B N   1 
ATOM   7741  C  CA  . ALA B  1 380 ? 39.489 100.828 103.357 1.00 50.47  ? 380 ALA B CA  1 
ATOM   7742  C  C   . ALA B  1 380 ? 39.653 99.899  102.149 1.00 53.00  ? 380 ALA B C   1 
ATOM   7743  O  O   . ALA B  1 380 ? 38.711 99.182  101.810 1.00 52.57  ? 380 ALA B O   1 
ATOM   7744  C  CB  . ALA B  1 380 ? 39.114 102.230 102.898 1.00 51.45  ? 380 ALA B CB  1 
ATOM   7745  N  N   . ALA B  1 381 ? 40.851 99.903  101.518 1.00 48.53  ? 381 ALA B N   1 
ATOM   7746  C  CA  . ALA B  1 381 ? 41.187 99.059  100.370 1.00 47.62  ? 381 ALA B CA  1 
ATOM   7747  C  C   . ALA B  1 381 ? 41.288 97.596  100.785 1.00 51.40  ? 381 ALA B C   1 
ATOM   7748  O  O   . ALA B  1 381 ? 40.731 96.743  100.097 1.00 51.66  ? 381 ALA B O   1 
ATOM   7749  C  CB  . ALA B  1 381 ? 42.491 99.517  99.741  1.00 47.78  ? 381 ALA B CB  1 
ATOM   7750  N  N   . GLU B  1 382 ? 41.969 97.311  101.926 1.00 47.33  ? 382 GLU B N   1 
ATOM   7751  C  CA  . GLU B  1 382 ? 42.133 95.965  102.490 1.00 47.13  ? 382 GLU B CA  1 
ATOM   7752  C  C   . GLU B  1 382 ? 40.777 95.371  102.862 1.00 51.33  ? 382 GLU B C   1 
ATOM   7753  O  O   . GLU B  1 382 ? 40.578 94.167  102.705 1.00 51.33  ? 382 GLU B O   1 
ATOM   7754  C  CB  . GLU B  1 382 ? 43.060 95.997  103.719 1.00 48.60  ? 382 GLU B CB  1 
ATOM   7755  C  CG  . GLU B  1 382 ? 43.584 94.633  104.147 1.00 61.51  ? 382 GLU B CG  1 
ATOM   7756  C  CD  . GLU B  1 382 ? 44.627 94.644  105.251 1.00 85.50  ? 382 GLU B CD  1 
ATOM   7757  O  OE1 . GLU B  1 382 ? 45.570 95.468  105.184 1.00 79.35  ? 382 GLU B OE1 1 
ATOM   7758  O  OE2 . GLU B  1 382 ? 44.523 93.792  106.162 1.00 80.20  ? 382 GLU B OE2 1 
ATOM   7759  N  N   . PHE B  1 383 ? 39.847 96.223  103.336 1.00 48.21  ? 383 PHE B N   1 
ATOM   7760  C  CA  . PHE B  1 383 ? 38.493 95.832  103.715 1.00 48.72  ? 383 PHE B CA  1 
ATOM   7761  C  C   . PHE B  1 383 ? 37.673 95.453  102.477 1.00 53.05  ? 383 PHE B C   1 
ATOM   7762  O  O   . PHE B  1 383 ? 37.068 94.380  102.461 1.00 53.77  ? 383 PHE B O   1 
ATOM   7763  C  CB  . PHE B  1 383 ? 37.796 96.959  104.509 1.00 51.04  ? 383 PHE B CB  1 
ATOM   7764  C  CG  . PHE B  1 383 ? 36.300 96.796  104.665 1.00 53.63  ? 383 PHE B CG  1 
ATOM   7765  C  CD1 . PHE B  1 383 ? 35.772 95.905  105.594 1.00 57.59  ? 383 PHE B CD1 1 
ATOM   7766  C  CD2 . PHE B  1 383 ? 35.418 97.528  103.879 1.00 56.28  ? 383 PHE B CD2 1 
ATOM   7767  C  CE1 . PHE B  1 383 ? 34.388 95.742  105.726 1.00 59.39  ? 383 PHE B CE1 1 
ATOM   7768  C  CE2 . PHE B  1 383 ? 34.034 97.365  104.012 1.00 60.04  ? 383 PHE B CE2 1 
ATOM   7769  C  CZ  . PHE B  1 383 ? 33.529 96.475  104.936 1.00 58.70  ? 383 PHE B CZ  1 
ATOM   7770  N  N   . LEU B  1 384 ? 37.640 96.339  101.460 1.00 48.52  ? 384 LEU B N   1 
ATOM   7771  C  CA  . LEU B  1 384 ? 36.871 96.148  100.230 1.00 48.18  ? 384 LEU B CA  1 
ATOM   7772  C  C   . LEU B  1 384 ? 37.355 94.960  99.404  1.00 51.13  ? 384 LEU B C   1 
ATOM   7773  O  O   . LEU B  1 384 ? 36.511 94.259  98.852  1.00 51.34  ? 384 LEU B O   1 
ATOM   7774  C  CB  . LEU B  1 384 ? 36.876 97.415  99.360  1.00 48.20  ? 384 LEU B CB  1 
ATOM   7775  C  CG  . LEU B  1 384 ? 36.019 98.591  99.840  1.00 53.34  ? 384 LEU B CG  1 
ATOM   7776  C  CD1 . LEU B  1 384 ? 36.443 99.860  99.168  1.00 53.12  ? 384 LEU B CD1 1 
ATOM   7777  C  CD2 . LEU B  1 384 ? 34.537 98.350  99.586  1.00 56.85  ? 384 LEU B CD2 1 
ATOM   7778  N  N   . THR B  1 385 ? 38.684 94.718  99.320  1.00 46.63  ? 385 THR B N   1 
ATOM   7779  C  CA  . THR B  1 385 ? 39.229 93.588  98.551  1.00 46.40  ? 385 THR B CA  1 
ATOM   7780  C  C   . THR B  1 385 ? 38.879 92.267  99.260  1.00 52.19  ? 385 THR B C   1 
ATOM   7781  O  O   . THR B  1 385 ? 38.627 91.261  98.584  1.00 52.47  ? 385 THR B O   1 
ATOM   7782  C  CB  . THR B  1 385 ? 40.737 93.732  98.287  1.00 50.52  ? 385 THR B CB  1 
ATOM   7783  O  OG1 . THR B  1 385 ? 41.039 95.088  97.968  1.00 50.04  ? 385 THR B OG1 1 
ATOM   7784  C  CG2 . THR B  1 385 ? 41.209 92.856  97.141  1.00 46.40  ? 385 THR B CG2 1 
ATOM   7785  N  N   . SER B  1 386 ? 38.826 92.282  100.610 1.00 49.04  ? 386 SER B N   1 
ATOM   7786  C  CA  . SER B  1 386 ? 38.425 91.118  101.400 1.00 49.55  ? 386 SER B CA  1 
ATOM   7787  C  C   . SER B  1 386 ? 36.923 90.886  101.239 1.00 54.85  ? 386 SER B C   1 
ATOM   7788  O  O   . SER B  1 386 ? 36.491 89.739  101.081 1.00 55.51  ? 386 SER B O   1 
ATOM   7789  C  CB  . SER B  1 386 ? 38.782 91.304  102.872 1.00 53.56  ? 386 SER B CB  1 
ATOM   7790  O  OG  . SER B  1 386 ? 40.187 91.273  103.068 1.00 63.82  ? 386 SER B OG  1 
ATOM   7791  N  N   . TRP B  1 387 ? 36.140 91.987  101.243 1.00 51.30  ? 387 TRP B N   1 
ATOM   7792  C  CA  . TRP B  1 387 ? 34.685 91.974  101.106 1.00 51.58  ? 387 TRP B CA  1 
ATOM   7793  C  C   . TRP B  1 387 ? 34.261 91.517  99.703  1.00 55.02  ? 387 TRP B C   1 
ATOM   7794  O  O   . TRP B  1 387 ? 33.255 90.811  99.594  1.00 55.75  ? 387 TRP B O   1 
ATOM   7795  C  CB  . TRP B  1 387 ? 34.098 93.349  101.446 1.00 50.54  ? 387 TRP B CB  1 
ATOM   7796  C  CG  . TRP B  1 387 ? 32.630 93.471  101.192 1.00 52.55  ? 387 TRP B CG  1 
ATOM   7797  C  CD1 . TRP B  1 387 ? 31.622 92.831  101.852 1.00 56.28  ? 387 TRP B CD1 1 
ATOM   7798  C  CD2 . TRP B  1 387 ? 32.007 94.285  100.196 1.00 52.70  ? 387 TRP B CD2 1 
ATOM   7799  N  NE1 . TRP B  1 387 ? 30.405 93.197  101.327 1.00 56.70  ? 387 TRP B NE1 1 
ATOM   7800  C  CE2 . TRP B  1 387 ? 30.612 94.094  100.311 1.00 57.84  ? 387 TRP B CE2 1 
ATOM   7801  C  CE3 . TRP B  1 387 ? 32.493 95.167  99.217  1.00 53.50  ? 387 TRP B CE3 1 
ATOM   7802  C  CZ2 . TRP B  1 387 ? 29.697 94.756  99.486  1.00 57.71  ? 387 TRP B CZ2 1 
ATOM   7803  C  CZ3 . TRP B  1 387 ? 31.588 95.814  98.395  1.00 55.54  ? 387 TRP B CZ3 1 
ATOM   7804  C  CH2 . TRP B  1 387 ? 30.208 95.622  98.545  1.00 57.23  ? 387 TRP B CH2 1 
ATOM   7805  N  N   . GLU B  1 388 ? 35.046 91.872  98.648  1.00 50.08  ? 388 GLU B N   1 
ATOM   7806  C  CA  . GLU B  1 388 ? 34.826 91.469  97.246  1.00 49.43  ? 388 GLU B CA  1 
ATOM   7807  C  C   . GLU B  1 388 ? 34.722 89.941  97.133  1.00 52.69  ? 388 GLU B C   1 
ATOM   7808  O  O   . GLU B  1 388 ? 34.039 89.432  96.244  1.00 53.10  ? 388 GLU B O   1 
ATOM   7809  C  CB  . GLU B  1 388 ? 35.969 91.977  96.352  1.00 49.93  ? 388 GLU B CB  1 
ATOM   7810  C  CG  . GLU B  1 388 ? 35.812 93.405  95.859  1.00 59.63  ? 388 GLU B CG  1 
ATOM   7811  C  CD  . GLU B  1 388 ? 37.102 94.132  95.516  1.00 81.18  ? 388 GLU B CD  1 
ATOM   7812  O  OE1 . GLU B  1 388 ? 38.143 93.466  95.319  1.00 81.99  ? 388 GLU B OE1 1 
ATOM   7813  O  OE2 . GLU B  1 388 ? 37.067 95.379  95.425  1.00 72.62  ? 388 GLU B OE2 1 
ATOM   7814  N  N   . ASN B  1 389 ? 35.408 89.230  98.062  1.00 47.96  ? 389 ASN B N   1 
ATOM   7815  C  CA  . ASN B  1 389 ? 35.465 87.782  98.252  1.00 47.70  ? 389 ASN B CA  1 
ATOM   7816  C  C   . ASN B  1 389 ? 36.126 87.084  97.054  1.00 51.81  ? 389 ASN B C   1 
ATOM   7817  O  O   . ASN B  1 389 ? 35.457 86.402  96.271  1.00 52.66  ? 389 ASN B O   1 
ATOM   7818  C  CB  . ASN B  1 389 ? 34.067 87.197  98.557  1.00 47.01  ? 389 ASN B CB  1 
ATOM   7819  C  CG  . ASN B  1 389 ? 34.073 85.783  99.083  1.00 56.53  ? 389 ASN B CG  1 
ATOM   7820  O  OD1 . ASN B  1 389 ? 34.964 85.365  99.831  1.00 49.28  ? 389 ASN B OD1 1 
ATOM   7821  N  ND2 . ASN B  1 389 ? 33.047 85.027  98.734  1.00 45.52  ? 389 ASN B ND2 1 
ATOM   7822  N  N   . HIS B  1 390 ? 37.457 87.243  96.936  1.00 46.81  ? 390 HIS B N   1 
ATOM   7823  C  CA  . HIS B  1 390 ? 38.257 86.608  95.887  1.00 45.89  ? 390 HIS B CA  1 
ATOM   7824  C  C   . HIS B  1 390 ? 38.575 85.167  96.292  1.00 50.06  ? 390 HIS B C   1 
ATOM   7825  O  O   . HIS B  1 390 ? 38.823 84.904  97.472  1.00 49.59  ? 390 HIS B O   1 
ATOM   7826  C  CB  . HIS B  1 390 ? 39.535 87.411  95.618  1.00 45.56  ? 390 HIS B CB  1 
ATOM   7827  C  CG  . HIS B  1 390 ? 39.262 88.760  95.032  1.00 48.60  ? 390 HIS B CG  1 
ATOM   7828  N  ND1 . HIS B  1 390 ? 39.177 88.947  93.666  1.00 50.34  ? 390 HIS B ND1 1 
ATOM   7829  C  CD2 . HIS B  1 390 ? 39.019 89.939  95.650  1.00 50.08  ? 390 HIS B CD2 1 
ATOM   7830  C  CE1 . HIS B  1 390 ? 38.896 90.228  93.496  1.00 49.45  ? 390 HIS B CE1 1 
ATOM   7831  N  NE2 . HIS B  1 390 ? 38.800 90.866  94.660  1.00 49.66  ? 390 HIS B NE2 1 
ATOM   7832  N  N   . ARG B  1 391 ? 38.535 84.233  95.326  1.00 47.17  ? 391 ARG B N   1 
ATOM   7833  C  CA  . ARG B  1 391 ? 38.768 82.815  95.597  1.00 47.54  ? 391 ARG B CA  1 
ATOM   7834  C  C   . ARG B  1 391 ? 40.246 82.498  95.807  1.00 52.50  ? 391 ARG B C   1 
ATOM   7835  O  O   . ARG B  1 391 ? 40.563 81.765  96.739  1.00 52.60  ? 391 ARG B O   1 
ATOM   7836  C  CB  . ARG B  1 391 ? 38.187 81.927  94.490  1.00 47.49  ? 391 ARG B CB  1 
ATOM   7837  C  CG  . ARG B  1 391 ? 37.931 80.501  94.950  1.00 54.42  ? 391 ARG B CG  1 
ATOM   7838  C  CD  . ARG B  1 391 ? 37.626 79.575  93.797  1.00 61.71  ? 391 ARG B CD  1 
ATOM   7839  N  NE  . ARG B  1 391 ? 38.121 78.224  94.052  1.00 66.71  ? 391 ARG B NE  1 
ATOM   7840  C  CZ  . ARG B  1 391 ? 39.323 77.784  93.692  1.00 78.67  ? 391 ARG B CZ  1 
ATOM   7841  N  NH1 . ARG B  1 391 ? 40.170 78.587  93.055  1.00 60.75  ? 391 ARG B NH1 1 
ATOM   7842  N  NH2 . ARG B  1 391 ? 39.690 76.540  93.966  1.00 68.94  ? 391 ARG B NH2 1 
ATOM   7843  N  N   . LEU B  1 392 ? 41.141 83.015  94.950  1.00 49.45  ? 392 LEU B N   1 
ATOM   7844  C  CA  . LEU B  1 392 ? 42.577 82.745  95.073  1.00 49.08  ? 392 LEU B CA  1 
ATOM   7845  C  C   . LEU B  1 392 ? 43.317 83.926  95.693  1.00 52.55  ? 392 LEU B C   1 
ATOM   7846  O  O   . LEU B  1 392 ? 42.911 85.070  95.498  1.00 51.78  ? 392 LEU B O   1 
ATOM   7847  C  CB  . LEU B  1 392 ? 43.178 82.391  93.708  1.00 49.11  ? 392 LEU B CB  1 
ATOM   7848  C  CG  . LEU B  1 392 ? 42.935 80.961  93.247  1.00 54.61  ? 392 LEU B CG  1 
ATOM   7849  C  CD1 . LEU B  1 392 ? 42.644 80.906  91.767  1.00 55.04  ? 392 LEU B CD1 1 
ATOM   7850  C  CD2 . LEU B  1 392 ? 44.103 80.062  93.610  1.00 57.69  ? 392 LEU B CD2 1 
ATOM   7851  N  N   . GLU B  1 393 ? 44.403 83.644  96.442  1.00 49.59  ? 393 GLU B N   1 
ATOM   7852  C  CA  . GLU B  1 393 ? 45.239 84.651  97.113  1.00 49.10  ? 393 GLU B CA  1 
ATOM   7853  C  C   . GLU B  1 393 ? 45.852 85.620  96.085  1.00 52.78  ? 393 GLU B C   1 
ATOM   7854  O  O   . GLU B  1 393 ? 45.915 86.822  96.353  1.00 52.20  ? 393 GLU B O   1 
ATOM   7855  C  CB  . GLU B  1 393 ? 46.336 83.966  97.959  1.00 50.43  ? 393 GLU B CB  1 
ATOM   7856  C  CG  . GLU B  1 393 ? 47.297 84.898  98.692  1.00 59.41  ? 393 GLU B CG  1 
ATOM   7857  C  CD  . GLU B  1 393 ? 46.726 85.767  99.797  1.00 73.75  ? 393 GLU B CD  1 
ATOM   7858  O  OE1 . GLU B  1 393 ? 47.021 86.985  99.799  1.00 52.67  ? 393 GLU B OE1 1 
ATOM   7859  O  OE2 . GLU B  1 393 ? 46.025 85.227  100.685 1.00 70.14  ? 393 GLU B OE2 1 
ATOM   7860  N  N   . SER B  1 394 ? 46.267 85.093  94.908  1.00 49.49  ? 394 SER B N   1 
ATOM   7861  C  CA  . SER B  1 394 ? 46.847 85.861  93.801  1.00 49.03  ? 394 SER B CA  1 
ATOM   7862  C  C   . SER B  1 394 ? 45.873 86.937  93.311  1.00 52.67  ? 394 SER B C   1 
ATOM   7863  O  O   . SER B  1 394 ? 46.294 88.075  93.106  1.00 52.60  ? 394 SER B O   1 
ATOM   7864  C  CB  . SER B  1 394 ? 47.241 84.938  92.651  1.00 53.20  ? 394 SER B CB  1 
ATOM   7865  O  OG  . SER B  1 394 ? 46.124 84.234  92.135  1.00 64.09  ? 394 SER B OG  1 
ATOM   7866  N  N   . ALA B  1 395 ? 44.570 86.587  93.175  1.00 48.54  ? 395 ALA B N   1 
ATOM   7867  C  CA  . ALA B  1 395 ? 43.501 87.503  92.766  1.00 47.97  ? 395 ALA B CA  1 
ATOM   7868  C  C   . ALA B  1 395 ? 43.322 88.616  93.801  1.00 50.65  ? 395 ALA B C   1 
ATOM   7869  O  O   . ALA B  1 395 ? 43.313 89.787  93.424  1.00 50.26  ? 395 ALA B O   1 
ATOM   7870  C  CB  . ALA B  1 395 ? 42.199 86.744  92.580  1.00 49.41  ? 395 ALA B CB  1 
ATOM   7871  N  N   . TYR B  1 396 ? 43.242 88.253  95.108  1.00 46.25  ? 396 TYR B N   1 
ATOM   7872  C  CA  . TYR B  1 396 ? 43.118 89.196  96.226  1.00 45.25  ? 396 TYR B CA  1 
ATOM   7873  C  C   . TYR B  1 396 ? 44.271 90.205  96.186  1.00 48.72  ? 396 TYR B C   1 
ATOM   7874  O  O   . TYR B  1 396 ? 44.034 91.405  96.328  1.00 48.77  ? 396 TYR B O   1 
ATOM   7875  C  CB  . TYR B  1 396 ? 43.079 88.453  97.586  1.00 46.07  ? 396 TYR B CB  1 
ATOM   7876  C  CG  . TYR B  1 396 ? 43.226 89.361  98.792  1.00 47.29  ? 396 TYR B CG  1 
ATOM   7877  C  CD1 . TYR B  1 396 ? 42.125 90.021  99.331  1.00 49.45  ? 396 TYR B CD1 1 
ATOM   7878  C  CD2 . TYR B  1 396 ? 44.466 89.571  99.387  1.00 47.81  ? 396 TYR B CD2 1 
ATOM   7879  C  CE1 . TYR B  1 396 ? 42.260 90.884  100.422 1.00 50.15  ? 396 TYR B CE1 1 
ATOM   7880  C  CE2 . TYR B  1 396 ? 44.613 90.431  100.476 1.00 48.67  ? 396 TYR B CE2 1 
ATOM   7881  C  CZ  . TYR B  1 396 ? 43.507 91.086  100.992 1.00 55.58  ? 396 TYR B CZ  1 
ATOM   7882  O  OH  . TYR B  1 396 ? 43.649 91.934  102.068 1.00 55.30  ? 396 TYR B OH  1 
ATOM   7883  N  N   . GLN B  1 397 ? 45.508 89.710  95.981  1.00 44.09  ? 397 GLN B N   1 
ATOM   7884  C  CA  . GLN B  1 397 ? 46.716 90.527  95.936  1.00 42.89  ? 397 GLN B CA  1 
ATOM   7885  C  C   . GLN B  1 397 ? 46.693 91.502  94.760  1.00 45.43  ? 397 GLN B C   1 
ATOM   7886  O  O   . GLN B  1 397 ? 46.867 92.697  94.986  1.00 44.55  ? 397 GLN B O   1 
ATOM   7887  C  CB  . GLN B  1 397 ? 47.979 89.650  95.894  1.00 44.03  ? 397 GLN B CB  1 
ATOM   7888  C  CG  . GLN B  1 397 ? 48.343 89.007  97.237  1.00 60.48  ? 397 GLN B CG  1 
ATOM   7889  C  CD  . GLN B  1 397 ? 48.626 90.000  98.347  1.00 84.25  ? 397 GLN B CD  1 
ATOM   7890  O  OE1 . GLN B  1 397 ? 49.291 91.030  98.160  1.00 81.89  ? 397 GLN B OE1 1 
ATOM   7891  N  NE2 . GLN B  1 397 ? 48.141 89.697  99.540  1.00 74.93  ? 397 GLN B NE2 1 
ATOM   7892  N  N   . ASN B  1 398 ? 46.427 91.013  93.529  1.00 41.51  ? 398 ASN B N   1 
ATOM   7893  C  CA  . ASN B  1 398 ? 46.385 91.829  92.307  1.00 41.00  ? 398 ASN B CA  1 
ATOM   7894  C  C   . ASN B  1 398 ? 45.366 92.972  92.395  1.00 44.51  ? 398 ASN B C   1 
ATOM   7895  O  O   . ASN B  1 398 ? 45.680 94.088  91.971  1.00 44.19  ? 398 ASN B O   1 
ATOM   7896  C  CB  . ASN B  1 398 ? 46.091 90.969  91.079  1.00 41.55  ? 398 ASN B CB  1 
ATOM   7897  C  CG  . ASN B  1 398 ? 47.185 89.994  90.727  1.00 65.41  ? 398 ASN B CG  1 
ATOM   7898  O  OD1 . ASN B  1 398 ? 48.384 90.290  90.824  1.00 59.35  ? 398 ASN B OD1 1 
ATOM   7899  N  ND2 . ASN B  1 398 ? 46.790 88.807  90.285  1.00 57.99  ? 398 ASN B ND2 1 
ATOM   7900  N  N   . HIS B  1 399 ? 44.168 92.704  92.956  1.00 40.45  ? 399 HIS B N   1 
ATOM   7901  C  CA  . HIS B  1 399 ? 43.116 93.707  93.112  1.00 40.25  ? 399 HIS B CA  1 
ATOM   7902  C  C   . HIS B  1 399 ? 43.483 94.722  94.194  1.00 43.88  ? 399 HIS B C   1 
ATOM   7903  O  O   . HIS B  1 399 ? 43.274 95.916  93.984  1.00 43.39  ? 399 HIS B O   1 
ATOM   7904  C  CB  . HIS B  1 399 ? 41.768 93.044  93.418  1.00 41.55  ? 399 HIS B CB  1 
ATOM   7905  C  CG  . HIS B  1 399 ? 41.124 92.434  92.216  1.00 45.49  ? 399 HIS B CG  1 
ATOM   7906  N  ND1 . HIS B  1 399 ? 39.978 92.973  91.663  1.00 47.91  ? 399 HIS B ND1 1 
ATOM   7907  C  CD2 . HIS B  1 399 ? 41.497 91.360  91.483  1.00 47.48  ? 399 HIS B CD2 1 
ATOM   7908  C  CE1 . HIS B  1 399 ? 39.687 92.209  90.622  1.00 47.66  ? 399 HIS B CE1 1 
ATOM   7909  N  NE2 . HIS B  1 399 ? 40.574 91.226  90.474  1.00 47.75  ? 399 HIS B NE2 1 
ATOM   7910  N  N   . LEU B  1 400 ? 44.063 94.255  95.327  1.00 40.26  ? 400 LEU B N   1 
ATOM   7911  C  CA  . LEU B  1 400 ? 44.484 95.117  96.437  1.00 39.83  ? 400 LEU B CA  1 
ATOM   7912  C  C   . LEU B  1 400 ? 45.639 96.026  96.005  1.00 43.40  ? 400 LEU B C   1 
ATOM   7913  O  O   . LEU B  1 400 ? 45.595 97.220  96.307  1.00 43.02  ? 400 LEU B O   1 
ATOM   7914  C  CB  . LEU B  1 400 ? 44.868 94.291  97.691  1.00 39.71  ? 400 LEU B CB  1 
ATOM   7915  C  CG  . LEU B  1 400 ? 45.348 95.058  98.945  1.00 43.89  ? 400 LEU B CG  1 
ATOM   7916  C  CD1 . LEU B  1 400 ? 44.300 96.035  99.450  1.00 44.24  ? 400 LEU B CD1 1 
ATOM   7917  C  CD2 . LEU B  1 400 ? 45.724 94.108  100.051 1.00 46.02  ? 400 LEU B CD2 1 
ATOM   7918  N  N   . ILE B  1 401 ? 46.651 95.471  95.289  1.00 39.54  ? 401 ILE B N   1 
ATOM   7919  C  CA  . ILE B  1 401 ? 47.806 96.227  94.790  1.00 38.60  ? 401 ILE B CA  1 
ATOM   7920  C  C   . ILE B  1 401 ? 47.294 97.348  93.878  1.00 42.93  ? 401 ILE B C   1 
ATOM   7921  O  O   . ILE B  1 401 ? 47.630 98.506  94.113  1.00 42.47  ? 401 ILE B O   1 
ATOM   7922  C  CB  . ILE B  1 401 ? 48.876 95.331  94.086  1.00 40.90  ? 401 ILE B CB  1 
ATOM   7923  C  CG1 . ILE B  1 401 ? 49.552 94.372  95.087  1.00 40.69  ? 401 ILE B CG1 1 
ATOM   7924  C  CG2 . ILE B  1 401 ? 49.941 96.191  93.384  1.00 41.38  ? 401 ILE B CG2 1 
ATOM   7925  C  CD1 . ILE B  1 401 ? 50.210 93.134  94.460  1.00 45.29  ? 401 ILE B CD1 1 
ATOM   7926  N  N   . LEU B  1 402 ? 46.425 97.009  92.907  1.00 40.18  ? 402 LEU B N   1 
ATOM   7927  C  CA  . LEU B  1 402 ? 45.844 97.943  91.938  1.00 40.58  ? 402 LEU B CA  1 
ATOM   7928  C  C   . LEU B  1 402 ? 45.115 99.127  92.604  1.00 44.13  ? 402 LEU B C   1 
ATOM   7929  O  O   . LEU B  1 402 ? 45.265 100.254 92.131  1.00 43.74  ? 402 LEU B O   1 
ATOM   7930  C  CB  . LEU B  1 402 ? 44.891 97.202  90.985  1.00 41.07  ? 402 LEU B CB  1 
ATOM   7931  C  CG  . LEU B  1 402 ? 44.510 97.914  89.682  1.00 46.23  ? 402 LEU B CG  1 
ATOM   7932  C  CD1 . LEU B  1 402 ? 45.709 98.055  88.745  1.00 46.09  ? 402 LEU B CD1 1 
ATOM   7933  C  CD2 . LEU B  1 402 ? 43.408 97.160  88.970  1.00 50.02  ? 402 LEU B CD2 1 
ATOM   7934  N  N   . LYS B  1 403 ? 44.355 98.881  93.693  1.00 40.34  ? 403 LYS B N   1 
ATOM   7935  C  CA  . LYS B  1 403 ? 43.615 99.927  94.410  1.00 40.34  ? 403 LYS B CA  1 
ATOM   7936  C  C   . LYS B  1 403 ? 44.561 100.905 95.112  1.00 44.32  ? 403 LYS B C   1 
ATOM   7937  O  O   . LYS B  1 403 ? 44.467 102.113 94.885  1.00 44.81  ? 403 LYS B O   1 
ATOM   7938  C  CB  . LYS B  1 403 ? 42.652 99.320  95.443  1.00 42.78  ? 403 LYS B CB  1 
ATOM   7939  C  CG  . LYS B  1 403 ? 41.434 98.632  94.850  1.00 56.03  ? 403 LYS B CG  1 
ATOM   7940  C  CD  . LYS B  1 403 ? 40.962 97.508  95.760  1.00 66.44  ? 403 LYS B CD  1 
ATOM   7941  C  CE  . LYS B  1 403 ? 39.802 97.893  96.634  1.00 76.82  ? 403 LYS B CE  1 
ATOM   7942  N  NZ  . LYS B  1 403 ? 38.520 97.728  95.915  1.00 85.79  ? 403 LYS B NZ  1 
ATOM   7943  N  N   . VAL B  1 404 ? 45.470 100.377 95.959  1.00 39.46  ? 404 VAL B N   1 
ATOM   7944  C  CA  . VAL B  1 404 ? 46.440 101.143 96.753  1.00 38.26  ? 404 VAL B CA  1 
ATOM   7945  C  C   . VAL B  1 404 ? 47.443 101.880 95.838  1.00 41.04  ? 404 VAL B C   1 
ATOM   7946  O  O   . VAL B  1 404 ? 47.803 103.022 96.126  1.00 40.39  ? 404 VAL B O   1 
ATOM   7947  C  CB  . VAL B  1 404 ? 47.167 100.233 97.788  1.00 41.10  ? 404 VAL B CB  1 
ATOM   7948  C  CG1 . VAL B  1 404 ? 48.112 101.038 98.670  1.00 40.85  ? 404 VAL B CG1 1 
ATOM   7949  C  CG2 . VAL B  1 404 ? 46.169 99.476  98.656  1.00 40.88  ? 404 VAL B CG2 1 
ATOM   7950  N  N   . LEU B  1 405 ? 47.864 101.238 94.742  1.00 37.20  ? 405 LEU B N   1 
ATOM   7951  C  CA  . LEU B  1 405 ? 48.840 101.779 93.799  1.00 36.73  ? 405 LEU B CA  1 
ATOM   7952  C  C   . LEU B  1 405 ? 48.347 103.040 93.053  1.00 39.28  ? 405 LEU B C   1 
ATOM   7953  O  O   . LEU B  1 405 ? 49.107 104.006 92.990  1.00 38.25  ? 405 LEU B O   1 
ATOM   7954  C  CB  . LEU B  1 405 ? 49.253 100.694 92.799  1.00 36.67  ? 405 LEU B CB  1 
ATOM   7955  C  CG  . LEU B  1 405 ? 50.303 101.040 91.772  1.00 41.64  ? 405 LEU B CG  1 
ATOM   7956  C  CD1 . LEU B  1 405 ? 51.589 101.485 92.427  1.00 41.96  ? 405 LEU B CD1 1 
ATOM   7957  C  CD2 . LEU B  1 405 ? 50.556 99.873  90.897  1.00 44.48  ? 405 LEU B CD2 1 
ATOM   7958  N  N   . VAL B  1 406 ? 47.110 103.035 92.491  1.00 35.39  ? 406 VAL B N   1 
ATOM   7959  C  CA  . VAL B  1 406 ? 46.571 104.191 91.754  1.00 35.29  ? 406 VAL B CA  1 
ATOM   7960  C  C   . VAL B  1 406 ? 46.453 105.414 92.685  1.00 41.27  ? 406 VAL B C   1 
ATOM   7961  O  O   . VAL B  1 406 ? 46.685 106.537 92.240  1.00 42.09  ? 406 VAL B O   1 
ATOM   7962  C  CB  . VAL B  1 406 ? 45.239 103.932 90.988  1.00 38.61  ? 406 VAL B CB  1 
ATOM   7963  C  CG1 . VAL B  1 406 ? 45.427 102.962 89.831  1.00 37.95  ? 406 VAL B CG1 1 
ATOM   7964  C  CG2 . VAL B  1 406 ? 44.117 103.460 91.904  1.00 38.67  ? 406 VAL B CG2 1 
ATOM   7965  N  N   . PHE B  1 407 ? 46.121 105.191 93.966  1.00 37.98  ? 407 PHE B N   1 
ATOM   7966  C  CA  . PHE B  1 407 ? 46.008 106.248 94.964  1.00 38.27  ? 407 PHE B CA  1 
ATOM   7967  C  C   . PHE B  1 407 ? 47.403 106.799 95.304  1.00 43.72  ? 407 PHE B C   1 
ATOM   7968  O  O   . PHE B  1 407 ? 47.611 108.010 95.210  1.00 43.83  ? 407 PHE B O   1 
ATOM   7969  C  CB  . PHE B  1 407 ? 45.291 105.713 96.211  1.00 39.83  ? 407 PHE B CB  1 
ATOM   7970  C  CG  . PHE B  1 407 ? 44.989 106.727 97.285  1.00 41.39  ? 407 PHE B CG  1 
ATOM   7971  C  CD1 . PHE B  1 407 ? 43.906 107.590 97.164  1.00 44.51  ? 407 PHE B CD1 1 
ATOM   7972  C  CD2 . PHE B  1 407 ? 45.750 106.782 98.443  1.00 43.53  ? 407 PHE B CD2 1 
ATOM   7973  C  CE1 . PHE B  1 407 ? 43.612 108.512 98.170  1.00 45.93  ? 407 PHE B CE1 1 
ATOM   7974  C  CE2 . PHE B  1 407 ? 45.454 107.706 99.450  1.00 47.01  ? 407 PHE B CE2 1 
ATOM   7975  C  CZ  . PHE B  1 407 ? 44.394 108.571 99.301  1.00 45.43  ? 407 PHE B CZ  1 
ATOM   7976  N  N   . ASN B  1 408 ? 48.363 105.903 95.648  1.00 40.87  ? 408 ASN B N   1 
ATOM   7977  C  CA  . ASN B  1 408 ? 49.752 106.237 95.991  1.00 40.82  ? 408 ASN B CA  1 
ATOM   7978  C  C   . ASN B  1 408 ? 50.478 106.936 94.839  1.00 44.80  ? 408 ASN B C   1 
ATOM   7979  O  O   . ASN B  1 408 ? 51.256 107.853 95.096  1.00 45.00  ? 408 ASN B O   1 
ATOM   7980  C  CB  . ASN B  1 408 ? 50.528 104.985 96.408  1.00 41.58  ? 408 ASN B CB  1 
ATOM   7981  C  CG  . ASN B  1 408 ? 50.206 104.469 97.790  1.00 65.86  ? 408 ASN B CG  1 
ATOM   7982  O  OD1 . ASN B  1 408 ? 49.555 105.127 98.609  1.00 62.57  ? 408 ASN B OD1 1 
ATOM   7983  N  ND2 . ASN B  1 408 ? 50.695 103.279 98.094  1.00 58.57  ? 408 ASN B ND2 1 
ATOM   7984  N  N   . PHE B  1 409 ? 50.222 106.508 93.582  1.00 40.88  ? 409 PHE B N   1 
ATOM   7985  C  CA  . PHE B  1 409 ? 50.797 107.105 92.376  1.00 40.71  ? 409 PHE B CA  1 
ATOM   7986  C  C   . PHE B  1 409 ? 50.277 108.527 92.207  1.00 44.54  ? 409 PHE B C   1 
ATOM   7987  O  O   . PHE B  1 409 ? 51.084 109.434 92.011  1.00 44.52  ? 409 PHE B O   1 
ATOM   7988  C  CB  . PHE B  1 409 ? 50.491 106.252 91.119  1.00 42.43  ? 409 PHE B CB  1 
ATOM   7989  C  CG  . PHE B  1 409 ? 50.486 106.995 89.799  1.00 44.37  ? 409 PHE B CG  1 
ATOM   7990  C  CD1 . PHE B  1 409 ? 51.678 107.371 89.188  1.00 47.43  ? 409 PHE B CD1 1 
ATOM   7991  C  CD2 . PHE B  1 409 ? 49.291 107.308 89.163  1.00 46.94  ? 409 PHE B CD2 1 
ATOM   7992  C  CE1 . PHE B  1 409 ? 51.672 108.074 87.979  1.00 48.56  ? 409 PHE B CE1 1 
ATOM   7993  C  CE2 . PHE B  1 409 ? 49.287 108.003 87.948  1.00 50.01  ? 409 PHE B CE2 1 
ATOM   7994  C  CZ  . PHE B  1 409 ? 50.478 108.381 87.364  1.00 47.97  ? 409 PHE B CZ  1 
ATOM   7995  N  N   . LEU B  1 410 ? 48.934 108.713 92.267  1.00 40.89  ? 410 LEU B N   1 
ATOM   7996  C  CA  . LEU B  1 410 ? 48.281 110.013 92.098  1.00 41.11  ? 410 LEU B CA  1 
ATOM   7997  C  C   . LEU B  1 410 ? 48.774 111.022 93.134  1.00 45.93  ? 410 LEU B C   1 
ATOM   7998  O  O   . LEU B  1 410 ? 49.199 112.089 92.733  1.00 45.83  ? 410 LEU B O   1 
ATOM   7999  C  CB  . LEU B  1 410 ? 46.745 109.910 92.132  1.00 41.12  ? 410 LEU B CB  1 
ATOM   8000  C  CG  . LEU B  1 410 ? 45.989 111.027 91.401  1.00 45.76  ? 410 LEU B CG  1 
ATOM   8001  C  CD1 . LEU B  1 410 ? 44.790 110.489 90.686  1.00 45.87  ? 410 LEU B CD1 1 
ATOM   8002  C  CD2 . LEU B  1 410 ? 45.556 112.125 92.350  1.00 48.59  ? 410 LEU B CD2 1 
ATOM   8003  N  N   . ASN B  1 411 ? 48.773 110.688 94.435  1.00 43.31  ? 411 ASN B N   1 
ATOM   8004  C  CA  . ASN B  1 411 ? 49.249 111.606 95.479  1.00 44.39  ? 411 ASN B CA  1 
ATOM   8005  C  C   . ASN B  1 411 ? 50.715 112.035 95.272  1.00 50.23  ? 411 ASN B C   1 
ATOM   8006  O  O   . ASN B  1 411 ? 51.073 113.188 95.548  1.00 50.80  ? 411 ASN B O   1 
ATOM   8007  C  CB  . ASN B  1 411 ? 49.091 110.977 96.853  1.00 45.25  ? 411 ASN B CB  1 
ATOM   8008  C  CG  . ASN B  1 411 ? 47.660 110.885 97.301  1.00 76.08  ? 411 ASN B CG  1 
ATOM   8009  O  OD1 . ASN B  1 411 ? 46.974 111.892 97.512  1.00 73.39  ? 411 ASN B OD1 1 
ATOM   8010  N  ND2 . ASN B  1 411 ? 47.181 109.671 97.463  1.00 70.42  ? 411 ASN B ND2 1 
ATOM   8011  N  N   . CYS B  1 412 ? 51.543 111.111 94.757  1.00 46.84  ? 412 CYS B N   1 
ATOM   8012  C  CA  . CYS B  1 412 ? 52.964 111.322 94.525  1.00 46.83  ? 412 CYS B CA  1 
ATOM   8013  C  C   . CYS B  1 412 ? 53.233 112.141 93.259  1.00 48.66  ? 412 CYS B C   1 
ATOM   8014  O  O   . CYS B  1 412 ? 54.066 113.050 93.300  1.00 48.27  ? 412 CYS B O   1 
ATOM   8015  C  CB  . CYS B  1 412 ? 53.692 109.982 94.471  1.00 47.20  ? 412 CYS B CB  1 
ATOM   8016  S  SG  . CYS B  1 412 ? 55.472 110.111 94.169  1.00 51.64  ? 412 CYS B SG  1 
ATOM   8017  N  N   . PHE B  1 413 ? 52.551 111.810 92.142  1.00 43.65  ? 413 PHE B N   1 
ATOM   8018  C  CA  . PHE B  1 413 ? 52.796 112.419 90.837  1.00 42.88  ? 413 PHE B CA  1 
ATOM   8019  C  C   . PHE B  1 413 ? 51.851 113.580 90.453  1.00 46.97  ? 413 PHE B C   1 
ATOM   8020  O  O   . PHE B  1 413 ? 52.299 114.434 89.694  1.00 46.75  ? 413 PHE B O   1 
ATOM   8021  C  CB  . PHE B  1 413 ? 52.782 111.341 89.741  1.00 43.81  ? 413 PHE B CB  1 
ATOM   8022  C  CG  . PHE B  1 413 ? 54.065 110.539 89.721  1.00 44.58  ? 413 PHE B CG  1 
ATOM   8023  C  CD1 . PHE B  1 413 ? 55.130 110.919 88.913  1.00 47.56  ? 413 PHE B CD1 1 
ATOM   8024  C  CD2 . PHE B  1 413 ? 54.233 109.440 90.557  1.00 45.92  ? 413 PHE B CD2 1 
ATOM   8025  C  CE1 . PHE B  1 413 ? 56.330 110.202 88.926  1.00 48.02  ? 413 PHE B CE1 1 
ATOM   8026  C  CE2 . PHE B  1 413 ? 55.433 108.725 90.569  1.00 48.16  ? 413 PHE B CE2 1 
ATOM   8027  C  CZ  . PHE B  1 413 ? 56.474 109.114 89.758  1.00 46.44  ? 413 PHE B CZ  1 
ATOM   8028  N  N   . ALA B  1 414 ? 50.596 113.656 90.975  1.00 43.58  ? 414 ALA B N   1 
ATOM   8029  C  CA  . ALA B  1 414 ? 49.663 114.757 90.647  1.00 43.83  ? 414 ALA B CA  1 
ATOM   8030  C  C   . ALA B  1 414 ? 50.273 116.134 90.941  1.00 48.37  ? 414 ALA B C   1 
ATOM   8031  O  O   . ALA B  1 414 ? 50.136 117.037 90.113  1.00 48.99  ? 414 ALA B O   1 
ATOM   8032  C  CB  . ALA B  1 414 ? 48.349 114.608 91.394  1.00 44.62  ? 414 ALA B CB  1 
ATOM   8033  N  N   . SER B  1 415 ? 50.959 116.284 92.099  1.00 44.05  ? 415 SER B N   1 
ATOM   8034  C  CA  . SER B  1 415 ? 51.639 117.523 92.489  1.00 44.03  ? 415 SER B CA  1 
ATOM   8035  C  C   . SER B  1 415 ? 52.813 117.816 91.537  1.00 46.48  ? 415 SER B C   1 
ATOM   8036  O  O   . SER B  1 415 ? 53.000 118.969 91.148  1.00 46.96  ? 415 SER B O   1 
ATOM   8037  C  CB  . SER B  1 415 ? 52.116 117.457 93.938  1.00 47.61  ? 415 SER B CB  1 
ATOM   8038  O  OG  . SER B  1 415 ? 52.587 116.171 94.310  1.00 56.79  ? 415 SER B OG  1 
ATOM   8039  N  N   . LEU B  1 416 ? 53.553 116.762 91.120  1.00 40.85  ? 416 LEU B N   1 
ATOM   8040  C  CA  . LEU B  1 416 ? 54.685 116.842 90.188  1.00 40.01  ? 416 LEU B CA  1 
ATOM   8041  C  C   . LEU B  1 416 ? 54.218 117.274 88.792  1.00 43.73  ? 416 LEU B C   1 
ATOM   8042  O  O   . LEU B  1 416 ? 54.860 118.126 88.180  1.00 44.34  ? 416 LEU B O   1 
ATOM   8043  C  CB  . LEU B  1 416 ? 55.415 115.487 90.117  1.00 39.10  ? 416 LEU B CB  1 
ATOM   8044  C  CG  . LEU B  1 416 ? 56.768 115.364 90.833  1.00 43.57  ? 416 LEU B CG  1 
ATOM   8045  C  CD1 . LEU B  1 416 ? 56.686 115.780 92.297  1.00 43.81  ? 416 LEU B CD1 1 
ATOM   8046  C  CD2 . LEU B  1 416 ? 57.289 113.943 90.749  1.00 45.25  ? 416 LEU B CD2 1 
ATOM   8047  N  N   . PHE B  1 417 ? 53.090 116.710 88.309  1.00 39.08  ? 417 PHE B N   1 
ATOM   8048  C  CA  . PHE B  1 417 ? 52.481 117.041 87.019  1.00 38.78  ? 417 PHE B CA  1 
ATOM   8049  C  C   . PHE B  1 417 ? 51.957 118.487 87.025  1.00 43.49  ? 417 PHE B C   1 
ATOM   8050  O  O   . PHE B  1 417 ? 52.050 119.173 86.007  1.00 43.63  ? 417 PHE B O   1 
ATOM   8051  C  CB  . PHE B  1 417 ? 51.338 116.066 86.700  1.00 40.11  ? 417 PHE B CB  1 
ATOM   8052  C  CG  . PHE B  1 417 ? 51.727 114.758 86.048  1.00 41.19  ? 417 PHE B CG  1 
ATOM   8053  C  CD1 . PHE B  1 417 ? 52.047 113.645 86.816  1.00 43.62  ? 417 PHE B CD1 1 
ATOM   8054  C  CD2 . PHE B  1 417 ? 51.692 114.616 84.669  1.00 43.80  ? 417 PHE B CD2 1 
ATOM   8055  C  CE1 . PHE B  1 417 ? 52.382 112.428 86.216  1.00 43.97  ? 417 PHE B CE1 1 
ATOM   8056  C  CE2 . PHE B  1 417 ? 52.026 113.399 84.069  1.00 46.13  ? 417 PHE B CE2 1 
ATOM   8057  C  CZ  . PHE B  1 417 ? 52.363 112.313 84.849  1.00 43.46  ? 417 PHE B CZ  1 
ATOM   8058  N  N   . TYR B  1 418 ? 51.424 118.947 88.178  1.00 40.35  ? 418 TYR B N   1 
ATOM   8059  C  CA  . TYR B  1 418 ? 50.886 120.299 88.350  1.00 41.10  ? 418 TYR B CA  1 
ATOM   8060  C  C   . TYR B  1 418 ? 51.994 121.350 88.223  1.00 46.38  ? 418 TYR B C   1 
ATOM   8061  O  O   . TYR B  1 418 ? 51.782 122.366 87.566  1.00 46.78  ? 418 TYR B O   1 
ATOM   8062  C  CB  . TYR B  1 418 ? 50.162 120.439 89.703  1.00 42.14  ? 418 TYR B CB  1 
ATOM   8063  C  CG  . TYR B  1 418 ? 49.352 121.713 89.829  1.00 44.58  ? 418 TYR B CG  1 
ATOM   8064  C  CD1 . TYR B  1 418 ? 48.028 121.766 89.405  1.00 46.67  ? 418 TYR B CD1 1 
ATOM   8065  C  CD2 . TYR B  1 418 ? 49.909 122.867 90.373  1.00 45.96  ? 418 TYR B CD2 1 
ATOM   8066  C  CE1 . TYR B  1 418 ? 47.277 122.936 89.520  1.00 47.98  ? 418 TYR B CE1 1 
ATOM   8067  C  CE2 . TYR B  1 418 ? 49.172 124.046 90.483  1.00 47.64  ? 418 TYR B CE2 1 
ATOM   8068  C  CZ  . TYR B  1 418 ? 47.855 124.075 90.056  1.00 53.69  ? 418 TYR B CZ  1 
ATOM   8069  O  OH  . TYR B  1 418 ? 47.126 125.235 90.168  1.00 54.06  ? 418 TYR B OH  1 
ATOM   8070  N  N   . ILE B  1 419 ? 53.160 121.111 88.858  1.00 42.88  ? 419 ILE B N   1 
ATOM   8071  C  CA  . ILE B  1 419 ? 54.317 122.015 88.816  1.00 43.16  ? 419 ILE B CA  1 
ATOM   8072  C  C   . ILE B  1 419 ? 54.863 122.077 87.378  1.00 47.38  ? 419 ILE B C   1 
ATOM   8073  O  O   . ILE B  1 419 ? 55.155 123.165 86.876  1.00 47.94  ? 419 ILE B O   1 
ATOM   8074  C  CB  . ILE B  1 419 ? 55.406 121.553 89.835  1.00 45.71  ? 419 ILE B CB  1 
ATOM   8075  C  CG1 . ILE B  1 419 ? 54.917 121.708 91.289  1.00 46.22  ? 419 ILE B CG1 1 
ATOM   8076  C  CG2 . ILE B  1 419 ? 56.729 122.290 89.624  1.00 46.56  ? 419 ILE B CG2 1 
ATOM   8077  C  CD1 . ILE B  1 419 ? 55.644 120.831 92.305  1.00 53.73  ? 419 ILE B CD1 1 
ATOM   8078  N  N   . ALA B  1 420 ? 54.962 120.904 86.723  1.00 42.92  ? 420 ALA B N   1 
ATOM   8079  C  CA  . ALA B  1 420 ? 55.507 120.735 85.380  1.00 42.66  ? 420 ALA B CA  1 
ATOM   8080  C  C   . ALA B  1 420 ? 54.623 121.286 84.257  1.00 46.44  ? 420 ALA B C   1 
ATOM   8081  O  O   . ALA B  1 420 ? 55.159 121.926 83.351  1.00 47.38  ? 420 ALA B O   1 
ATOM   8082  C  CB  . ALA B  1 420 ? 55.781 119.262 85.114  1.00 42.40  ? 420 ALA B CB  1 
ATOM   8083  N  N   . PHE B  1 421 ? 53.303 121.011 84.274  1.00 41.14  ? 421 PHE B N   1 
ATOM   8084  C  CA  . PHE B  1 421 ? 52.448 121.392 83.149  1.00 40.57  ? 421 PHE B CA  1 
ATOM   8085  C  C   . PHE B  1 421 ? 51.427 122.511 83.449  1.00 46.12  ? 421 PHE B C   1 
ATOM   8086  O  O   . PHE B  1 421 ? 50.991 123.167 82.501  1.00 46.62  ? 421 PHE B O   1 
ATOM   8087  C  CB  . PHE B  1 421 ? 51.734 120.150 82.583  1.00 40.85  ? 421 PHE B CB  1 
ATOM   8088  C  CG  . PHE B  1 421 ? 52.693 119.021 82.266  1.00 40.62  ? 421 PHE B CG  1 
ATOM   8089  C  CD1 . PHE B  1 421 ? 53.552 119.100 81.176  1.00 43.41  ? 421 PHE B CD1 1 
ATOM   8090  C  CD2 . PHE B  1 421 ? 52.767 117.900 83.081  1.00 41.01  ? 421 PHE B CD2 1 
ATOM   8091  C  CE1 . PHE B  1 421 ? 54.468 118.081 80.911  1.00 43.54  ? 421 PHE B CE1 1 
ATOM   8092  C  CE2 . PHE B  1 421 ? 53.678 116.877 82.808  1.00 43.06  ? 421 PHE B CE2 1 
ATOM   8093  C  CZ  . PHE B  1 421 ? 54.517 116.970 81.722  1.00 41.44  ? 421 PHE B CZ  1 
ATOM   8094  N  N   . VAL B  1 422 ? 51.062 122.754 84.722  1.00 43.14  ? 422 VAL B N   1 
ATOM   8095  C  CA  . VAL B  1 422 ? 50.130 123.843 85.046  1.00 43.92  ? 422 VAL B CA  1 
ATOM   8096  C  C   . VAL B  1 422 ? 50.961 125.075 85.424  1.00 48.78  ? 422 VAL B C   1 
ATOM   8097  O  O   . VAL B  1 422 ? 50.822 126.117 84.783  1.00 49.70  ? 422 VAL B O   1 
ATOM   8098  C  CB  . VAL B  1 422 ? 49.073 123.485 86.127  1.00 47.76  ? 422 VAL B CB  1 
ATOM   8099  C  CG1 . VAL B  1 422 ? 48.141 124.664 86.400  1.00 48.52  ? 422 VAL B CG1 1 
ATOM   8100  C  CG2 . VAL B  1 422 ? 48.270 122.253 85.726  1.00 46.97  ? 422 VAL B CG2 1 
ATOM   8101  N  N   . LEU B  1 423 ? 51.838 124.946 86.439  1.00 44.76  ? 423 LEU B N   1 
ATOM   8102  C  CA  . LEU B  1 423 ? 52.710 126.031 86.896  1.00 45.35  ? 423 LEU B CA  1 
ATOM   8103  C  C   . LEU B  1 423 ? 53.857 126.283 85.911  1.00 51.14  ? 423 LEU B C   1 
ATOM   8104  O  O   . LEU B  1 423 ? 54.356 127.410 85.845  1.00 51.45  ? 423 LEU B O   1 
ATOM   8105  C  CB  . LEU B  1 423 ? 53.283 125.729 88.294  1.00 44.71  ? 423 LEU B CB  1 
ATOM   8106  C  CG  . LEU B  1 423 ? 52.302 125.695 89.472  1.00 48.25  ? 423 LEU B CG  1 
ATOM   8107  C  CD1 . LEU B  1 423 ? 52.961 125.118 90.698  1.00 47.51  ? 423 LEU B CD1 1 
ATOM   8108  C  CD2 . LEU B  1 423 ? 51.751 127.070 89.788  1.00 50.68  ? 423 LEU B CD2 1 
ATOM   8109  N  N   . LYS B  1 424 ? 54.283 125.224 85.166  1.00 48.47  ? 424 LYS B N   1 
ATOM   8110  C  CA  . LYS B  1 424 ? 55.366 125.213 84.164  1.00 48.77  ? 424 LYS B CA  1 
ATOM   8111  C  C   . LYS B  1 424 ? 56.687 125.765 84.761  1.00 53.82  ? 424 LYS B C   1 
ATOM   8112  O  O   . LYS B  1 424 ? 57.468 126.430 84.071  1.00 54.11  ? 424 LYS B O   1 
ATOM   8113  C  CB  . LYS B  1 424 ? 54.953 125.977 82.886  1.00 52.15  ? 424 LYS B CB  1 
ATOM   8114  C  CG  . LYS B  1 424 ? 53.914 125.246 82.035  1.00 63.98  ? 424 LYS B CG  1 
ATOM   8115  C  CD  . LYS B  1 424 ? 53.493 126.066 80.817  1.00 71.90  ? 424 LYS B CD  1 
ATOM   8116  C  CE  . LYS B  1 424 ? 52.053 126.520 80.880  1.00 78.81  ? 424 LYS B CE  1 
ATOM   8117  N  NZ  . LYS B  1 424 ? 51.114 125.452 80.449  1.00 85.48  ? 424 LYS B NZ  1 
ATOM   8118  N  N   . ASP B  1 425 ? 56.926 125.459 86.052  1.00 50.39  ? 425 ASP B N   1 
ATOM   8119  C  CA  . ASP B  1 425 ? 58.091 125.877 86.826  1.00 50.56  ? 425 ASP B CA  1 
ATOM   8120  C  C   . ASP B  1 425 ? 59.084 124.706 86.925  1.00 54.34  ? 425 ASP B C   1 
ATOM   8121  O  O   . ASP B  1 425 ? 58.984 123.880 87.838  1.00 54.23  ? 425 ASP B O   1 
ATOM   8122  C  CB  . ASP B  1 425 ? 57.629 126.360 88.218  1.00 52.42  ? 425 ASP B CB  1 
ATOM   8123  C  CG  . ASP B  1 425 ? 58.659 127.085 89.065  1.00 61.64  ? 425 ASP B CG  1 
ATOM   8124  O  OD1 . ASP B  1 425 ? 59.869 126.988 88.752  1.00 61.73  ? 425 ASP B OD1 1 
ATOM   8125  O  OD2 . ASP B  1 425 ? 58.262 127.699 90.080  1.00 67.23  ? 425 ASP B OD2 1 
ATOM   8126  N  N   . MET B  1 426 ? 60.040 124.638 85.977  1.00 50.04  ? 426 MET B N   1 
ATOM   8127  C  CA  . MET B  1 426 ? 61.040 123.563 85.904  1.00 48.60  ? 426 MET B CA  1 
ATOM   8128  C  C   . MET B  1 426 ? 62.055 123.629 87.050  1.00 51.90  ? 426 MET B C   1 
ATOM   8129  O  O   . MET B  1 426 ? 62.600 122.587 87.425  1.00 50.84  ? 426 MET B O   1 
ATOM   8130  C  CB  . MET B  1 426 ? 61.763 123.554 84.546  1.00 50.94  ? 426 MET B CB  1 
ATOM   8131  C  CG  . MET B  1 426 ? 60.831 123.343 83.359  1.00 54.12  ? 426 MET B CG  1 
ATOM   8132  S  SD  . MET B  1 426 ? 59.748 121.897 83.494  1.00 56.98  ? 426 MET B SD  1 
ATOM   8133  C  CE  . MET B  1 426 ? 58.372 122.446 82.525  1.00 53.91  ? 426 MET B CE  1 
ATOM   8134  N  N   . LYS B  1 427 ? 62.287 124.837 87.616  1.00 48.56  ? 427 LYS B N   1 
ATOM   8135  C  CA  . LYS B  1 427 ? 63.184 125.045 88.756  1.00 48.13  ? 427 LYS B CA  1 
ATOM   8136  C  C   . LYS B  1 427 ? 62.595 124.368 90.001  1.00 50.05  ? 427 LYS B C   1 
ATOM   8137  O  O   . LYS B  1 427 ? 63.317 123.666 90.714  1.00 48.84  ? 427 LYS B O   1 
ATOM   8138  C  CB  . LYS B  1 427 ? 63.419 126.543 89.001  1.00 51.61  ? 427 LYS B CB  1 
ATOM   8139  N  N   . LEU B  1 428 ? 61.269 124.541 90.219  1.00 45.76  ? 428 LEU B N   1 
ATOM   8140  C  CA  . LEU B  1 428 ? 60.527 123.945 91.332  1.00 44.79  ? 428 LEU B CA  1 
ATOM   8141  C  C   . LEU B  1 428 ? 60.397 122.434 91.139  1.00 48.31  ? 428 LEU B C   1 
ATOM   8142  O  O   . LEU B  1 428 ? 60.495 121.698 92.121  1.00 47.30  ? 428 LEU B O   1 
ATOM   8143  C  CB  . LEU B  1 428 ? 59.138 124.604 91.480  1.00 44.84  ? 428 LEU B CB  1 
ATOM   8144  C  CG  . LEU B  1 428 ? 58.193 124.097 92.587  1.00 48.55  ? 428 LEU B CG  1 
ATOM   8145  C  CD1 . LEU B  1 428 ? 58.780 124.299 93.979  1.00 49.07  ? 428 LEU B CD1 1 
ATOM   8146  C  CD2 . LEU B  1 428 ? 56.847 124.775 92.495  1.00 50.86  ? 428 LEU B CD2 1 
ATOM   8147  N  N   . LEU B  1 429 ? 60.197 121.976 89.881  1.00 45.06  ? 429 LEU B N   1 
ATOM   8148  C  CA  . LEU B  1 429 ? 60.082 120.554 89.552  1.00 43.90  ? 429 LEU B CA  1 
ATOM   8149  C  C   . LEU B  1 429 ? 61.397 119.833 89.856  1.00 47.55  ? 429 LEU B C   1 
ATOM   8150  O  O   . LEU B  1 429 ? 61.364 118.764 90.467  1.00 46.68  ? 429 LEU B O   1 
ATOM   8151  C  CB  . LEU B  1 429 ? 59.661 120.349 88.083  1.00 43.82  ? 429 LEU B CB  1 
ATOM   8152  C  CG  . LEU B  1 429 ? 59.477 118.897 87.602  1.00 47.72  ? 429 LEU B CG  1 
ATOM   8153  C  CD1 . LEU B  1 429 ? 58.307 118.210 88.298  1.00 47.22  ? 429 LEU B CD1 1 
ATOM   8154  C  CD2 . LEU B  1 429 ? 59.294 118.841 86.105  1.00 50.10  ? 429 LEU B CD2 1 
ATOM   8155  N  N   . ARG B  1 430 ? 62.547 120.435 89.467  1.00 44.43  ? 430 ARG B N   1 
ATOM   8156  C  CA  . ARG B  1 430 ? 63.883 119.888 89.728  1.00 44.06  ? 430 ARG B CA  1 
ATOM   8157  C  C   . ARG B  1 430 ? 64.110 119.740 91.236  1.00 49.23  ? 430 ARG B C   1 
ATOM   8158  O  O   . ARG B  1 430 ? 64.496 118.657 91.681  1.00 48.33  ? 430 ARG B O   1 
ATOM   8159  C  CB  . ARG B  1 430 ? 64.970 120.764 89.096  1.00 43.16  ? 430 ARG B CB  1 
ATOM   8160  C  CG  . ARG B  1 430 ? 65.223 120.447 87.639  1.00 50.10  ? 430 ARG B CG  1 
ATOM   8161  C  CD  . ARG B  1 430 ? 65.814 121.637 86.920  1.00 65.37  ? 430 ARG B CD  1 
ATOM   8162  N  NE  . ARG B  1 430 ? 65.967 121.383 85.487  1.00 78.09  ? 430 ARG B NE  1 
ATOM   8163  C  CZ  . ARG B  1 430 ? 65.996 122.330 84.555  1.00 94.78  ? 430 ARG B CZ  1 
ATOM   8164  N  NH1 . ARG B  1 430 ? 65.867 123.608 84.892  1.00 82.15  ? 430 ARG B NH1 1 
ATOM   8165  N  NH2 . ARG B  1 430 ? 66.142 122.006 83.277  1.00 83.04  ? 430 ARG B NH2 1 
ATOM   8166  N  N   . GLN B  1 431 ? 63.800 120.805 92.019  1.00 47.09  ? 431 GLN B N   1 
ATOM   8167  C  CA  . GLN B  1 431 ? 63.916 120.828 93.482  1.00 47.12  ? 431 GLN B CA  1 
ATOM   8168  C  C   . GLN B  1 431 ? 62.972 119.799 94.129  1.00 50.27  ? 431 GLN B C   1 
ATOM   8169  O  O   . GLN B  1 431 ? 63.340 119.198 95.140  1.00 49.94  ? 431 GLN B O   1 
ATOM   8170  C  CB  . GLN B  1 431 ? 63.635 122.235 94.033  1.00 49.41  ? 431 GLN B CB  1 
ATOM   8171  N  N   . SER B  1 432 ? 61.776 119.580 93.533  1.00 46.15  ? 432 SER B N   1 
ATOM   8172  C  CA  . SER B  1 432 ? 60.795 118.603 94.014  1.00 45.29  ? 432 SER B CA  1 
ATOM   8173  C  C   . SER B  1 432 ? 61.327 117.186 93.835  1.00 48.56  ? 432 SER B C   1 
ATOM   8174  O  O   . SER B  1 432 ? 61.258 116.390 94.773  1.00 48.15  ? 432 SER B O   1 
ATOM   8175  C  CB  . SER B  1 432 ? 59.462 118.757 93.286  1.00 49.21  ? 432 SER B CB  1 
ATOM   8176  O  OG  . SER B  1 432 ? 58.869 120.019 93.536  1.00 60.48  ? 432 SER B OG  1 
ATOM   8177  N  N   . LEU B  1 433 ? 61.891 116.887 92.645  1.00 44.74  ? 433 LEU B N   1 
ATOM   8178  C  CA  . LEU B  1 433 ? 62.471 115.584 92.308  1.00 43.86  ? 433 LEU B CA  1 
ATOM   8179  C  C   . LEU B  1 433 ? 63.743 115.314 93.122  1.00 48.50  ? 433 LEU B C   1 
ATOM   8180  O  O   . LEU B  1 433 ? 63.964 114.172 93.536  1.00 47.55  ? 433 LEU B O   1 
ATOM   8181  C  CB  . LEU B  1 433 ? 62.768 115.485 90.801  1.00 43.79  ? 433 LEU B CB  1 
ATOM   8182  C  CG  . LEU B  1 433 ? 61.544 115.393 89.878  1.00 48.26  ? 433 LEU B CG  1 
ATOM   8183  C  CD1 . LEU B  1 433 ? 61.840 115.974 88.510  1.00 48.58  ? 433 LEU B CD1 1 
ATOM   8184  C  CD2 . LEU B  1 433 ? 61.031 113.964 89.769  1.00 50.16  ? 433 LEU B CD2 1 
ATOM   8185  N  N   . ALA B  1 434 ? 64.556 116.372 93.379  1.00 45.68  ? 434 ALA B N   1 
ATOM   8186  C  CA  . ALA B  1 434 ? 65.792 116.291 94.163  1.00 45.53  ? 434 ALA B CA  1 
ATOM   8187  C  C   . ALA B  1 434 ? 65.506 115.857 95.606  1.00 49.04  ? 434 ALA B C   1 
ATOM   8188  O  O   . ALA B  1 434 ? 66.256 115.044 96.153  1.00 48.76  ? 434 ALA B O   1 
ATOM   8189  C  CB  . ALA B  1 434 ? 66.514 117.627 94.149  1.00 47.20  ? 434 ALA B CB  1 
ATOM   8190  N  N   . THR B  1 435 ? 64.407 116.365 96.205  1.00 44.69  ? 435 THR B N   1 
ATOM   8191  C  CA  . THR B  1 435 ? 63.998 116.007 97.566  1.00 44.05  ? 435 THR B CA  1 
ATOM   8192  C  C   . THR B  1 435 ? 63.551 114.537 97.578  1.00 46.66  ? 435 THR B C   1 
ATOM   8193  O  O   . THR B  1 435 ? 63.977 113.784 98.454  1.00 46.06  ? 435 THR B O   1 
ATOM   8194  C  CB  . THR B  1 435 ? 62.909 116.967 98.082  1.00 50.52  ? 435 THR B CB  1 
ATOM   8195  O  OG1 . THR B  1 435 ? 63.374 118.309 97.961  1.00 53.92  ? 435 THR B OG1 1 
ATOM   8196  C  CG2 . THR B  1 435 ? 62.538 116.707 99.534  1.00 47.30  ? 435 THR B CG2 1 
ATOM   8197  N  N   . LEU B  1 436 ? 62.736 114.133 96.578  1.00 42.16  ? 436 LEU B N   1 
ATOM   8198  C  CA  . LEU B  1 436 ? 62.205 112.778 96.423  1.00 40.81  ? 436 LEU B CA  1 
ATOM   8199  C  C   . LEU B  1 436 ? 63.299 111.734 96.207  1.00 45.12  ? 436 LEU B C   1 
ATOM   8200  O  O   . LEU B  1 436 ? 63.218 110.644 96.777  1.00 44.23  ? 436 LEU B O   1 
ATOM   8201  C  CB  . LEU B  1 436 ? 61.221 112.710 95.242  1.00 40.14  ? 436 LEU B CB  1 
ATOM   8202  C  CG  . LEU B  1 436 ? 59.844 113.338 95.417  1.00 44.43  ? 436 LEU B CG  1 
ATOM   8203  C  CD1 . LEU B  1 436 ? 59.226 113.627 94.082  1.00 44.49  ? 436 LEU B CD1 1 
ATOM   8204  C  CD2 . LEU B  1 436 ? 58.916 112.433 96.199  1.00 46.83  ? 436 LEU B CD2 1 
ATOM   8205  N  N   . LEU B  1 437 ? 64.305 112.061 95.373  1.00 42.51  ? 437 LEU B N   1 
ATOM   8206  C  CA  . LEU B  1 437 ? 65.382 111.140 95.005  1.00 42.48  ? 437 LEU B CA  1 
ATOM   8207  C  C   . LEU B  1 437 ? 66.574 111.138 95.978  1.00 46.20  ? 437 LEU B C   1 
ATOM   8208  O  O   . LEU B  1 437 ? 67.307 110.147 96.003  1.00 45.76  ? 437 LEU B O   1 
ATOM   8209  C  CB  . LEU B  1 437 ? 65.882 111.439 93.578  1.00 42.90  ? 437 LEU B CB  1 
ATOM   8210  C  CG  . LEU B  1 437 ? 64.921 111.074 92.439  1.00 47.04  ? 437 LEU B CG  1 
ATOM   8211  C  CD1 . LEU B  1 437 ? 65.152 111.947 91.229  1.00 47.40  ? 437 LEU B CD1 1 
ATOM   8212  C  CD2 . LEU B  1 437 ? 65.024 109.605 92.069  1.00 48.87  ? 437 LEU B CD2 1 
ATOM   8213  N  N   . ILE B  1 438 ? 66.785 112.214 96.764  1.00 42.61  ? 438 ILE B N   1 
ATOM   8214  C  CA  . ILE B  1 438 ? 67.924 112.240 97.687  1.00 42.68  ? 438 ILE B CA  1 
ATOM   8215  C  C   . ILE B  1 438 ? 67.430 112.137 99.154  1.00 47.27  ? 438 ILE B C   1 
ATOM   8216  O  O   . ILE B  1 438 ? 67.450 111.036 99.708  1.00 46.62  ? 438 ILE B O   1 
ATOM   8217  C  CB  . ILE B  1 438 ? 68.875 113.454 97.446  1.00 46.33  ? 438 ILE B CB  1 
ATOM   8218  C  CG1 . ILE B  1 438 ? 69.296 113.545 95.959  1.00 46.49  ? 438 ILE B CG1 1 
ATOM   8219  C  CG2 . ILE B  1 438 ? 70.117 113.378 98.355  1.00 47.42  ? 438 ILE B CG2 1 
ATOM   8220  C  CD1 . ILE B  1 438 ? 69.569 114.935 95.446  1.00 52.83  ? 438 ILE B CD1 1 
ATOM   8221  N  N   . THR B  1 439 ? 66.981 113.258 99.759  1.00 44.31  ? 439 THR B N   1 
ATOM   8222  C  CA  . THR B  1 439 ? 66.541 113.359 101.156 1.00 44.44  ? 439 THR B CA  1 
ATOM   8223  C  C   . THR B  1 439 ? 65.452 112.325 101.527 1.00 47.71  ? 439 THR B C   1 
ATOM   8224  O  O   . THR B  1 439 ? 65.588 111.661 102.559 1.00 47.52  ? 439 THR B O   1 
ATOM   8225  C  CB  . THR B  1 439 ? 66.064 114.791 101.461 1.00 54.46  ? 439 THR B CB  1 
ATOM   8226  O  OG1 . THR B  1 439 ? 67.025 115.724 100.959 1.00 57.01  ? 439 THR B OG1 1 
ATOM   8227  C  CG2 . THR B  1 439 ? 65.841 115.035 102.956 1.00 52.48  ? 439 THR B CG2 1 
ATOM   8228  N  N   . SER B  1 440 ? 64.394 112.192 100.701 1.00 43.45  ? 440 SER B N   1 
ATOM   8229  C  CA  . SER B  1 440 ? 63.292 111.265 100.960 1.00 42.81  ? 440 SER B CA  1 
ATOM   8230  C  C   . SER B  1 440 ? 63.759 109.800 100.960 1.00 47.27  ? 440 SER B C   1 
ATOM   8231  O  O   . SER B  1 440 ? 63.300 109.031 101.805 1.00 47.02  ? 440 SER B O   1 
ATOM   8232  C  CB  . SER B  1 440 ? 62.168 111.463 99.948  1.00 45.83  ? 440 SER B CB  1 
ATOM   8233  O  OG  . SER B  1 440 ? 61.018 110.700 100.278 1.00 53.17  ? 440 SER B OG  1 
ATOM   8234  N  N   . GLN B  1 441 ? 64.682 109.427 100.045 1.00 43.84  ? 441 GLN B N   1 
ATOM   8235  C  CA  . GLN B  1 441 ? 65.210 108.061 99.943  1.00 43.29  ? 441 GLN B CA  1 
ATOM   8236  C  C   . GLN B  1 441 ? 66.161 107.720 101.105 1.00 48.41  ? 441 GLN B C   1 
ATOM   8237  O  O   . GLN B  1 441 ? 66.195 106.559 101.518 1.00 47.97  ? 441 GLN B O   1 
ATOM   8238  C  CB  . GLN B  1 441 ? 65.903 107.820 98.596  1.00 44.36  ? 441 GLN B CB  1 
ATOM   8239  C  CG  . GLN B  1 441 ? 64.924 107.733 97.434  1.00 52.63  ? 441 GLN B CG  1 
ATOM   8240  C  CD  . GLN B  1 441 ? 65.466 106.953 96.267  1.00 67.71  ? 441 GLN B CD  1 
ATOM   8241  O  OE1 . GLN B  1 441 ? 65.011 105.842 95.977  1.00 58.69  ? 441 GLN B OE1 1 
ATOM   8242  N  NE2 . GLN B  1 441 ? 66.414 107.533 95.540  1.00 64.56  ? 441 GLN B NE2 1 
ATOM   8243  N  N   . ILE B  1 442 ? 66.918 108.716 101.633 1.00 46.02  ? 442 ILE B N   1 
ATOM   8244  C  CA  . ILE B  1 442 ? 67.822 108.529 102.781 1.00 46.65  ? 442 ILE B CA  1 
ATOM   8245  C  C   . ILE B  1 442 ? 66.967 108.258 104.029 1.00 51.83  ? 442 ILE B C   1 
ATOM   8246  O  O   . ILE B  1 442 ? 67.224 107.285 104.743 1.00 51.60  ? 442 ILE B O   1 
ATOM   8247  C  CB  . ILE B  1 442 ? 68.795 109.731 102.986 1.00 50.44  ? 442 ILE B CB  1 
ATOM   8248  C  CG1 . ILE B  1 442 ? 69.755 109.884 101.785 1.00 51.04  ? 442 ILE B CG1 1 
ATOM   8249  C  CG2 . ILE B  1 442 ? 69.584 109.596 104.306 1.00 50.98  ? 442 ILE B CG2 1 
ATOM   8250  C  CD1 . ILE B  1 442 ? 70.298 111.299 101.559 1.00 57.99  ? 442 ILE B CD1 1 
ATOM   8251  N  N   . LEU B  1 443 ? 65.930 109.098 104.254 1.00 49.09  ? 443 LEU B N   1 
ATOM   8252  C  CA  . LEU B  1 443 ? 64.991 108.980 105.373 1.00 49.13  ? 443 LEU B CA  1 
ATOM   8253  C  C   . LEU B  1 443 ? 64.196 107.685 105.287 1.00 52.73  ? 443 LEU B C   1 
ATOM   8254  O  O   . LEU B  1 443 ? 63.950 107.065 106.322 1.00 52.23  ? 443 LEU B O   1 
ATOM   8255  C  CB  . LEU B  1 443 ? 64.038 110.181 105.417 1.00 49.57  ? 443 LEU B CB  1 
ATOM   8256  C  CG  . LEU B  1 443 ? 64.642 111.487 105.928 1.00 55.80  ? 443 LEU B CG  1 
ATOM   8257  C  CD1 . LEU B  1 443 ? 63.926 112.682 105.339 1.00 56.56  ? 443 LEU B CD1 1 
ATOM   8258  C  CD2 . LEU B  1 443 ? 64.636 111.549 107.451 1.00 58.75  ? 443 LEU B CD2 1 
ATOM   8259  N  N   . ASN B  1 444 ? 63.820 107.265 104.058 1.00 49.48  ? 444 ASN B N   1 
ATOM   8260  C  CA  . ASN B  1 444 ? 63.085 106.024 103.812 1.00 49.12  ? 444 ASN B CA  1 
ATOM   8261  C  C   . ASN B  1 444 ? 63.886 104.814 104.292 1.00 54.08  ? 444 ASN B C   1 
ATOM   8262  O  O   . ASN B  1 444 ? 63.307 103.958 104.949 1.00 54.23  ? 444 ASN B O   1 
ATOM   8263  C  CB  . ASN B  1 444 ? 62.719 105.861 102.330 1.00 49.57  ? 444 ASN B CB  1 
ATOM   8264  C  CG  . ASN B  1 444 ? 62.130 104.510 101.992 1.00 67.08  ? 444 ASN B CG  1 
ATOM   8265  O  OD1 . ASN B  1 444 ? 62.831 103.599 101.540 1.00 60.75  ? 444 ASN B OD1 1 
ATOM   8266  N  ND2 . ASN B  1 444 ? 60.844 104.329 102.259 1.00 56.85  ? 444 ASN B ND2 1 
ATOM   8267  N  N   . GLN B  1 445 ? 65.203 104.751 103.981 1.00 50.58  ? 445 GLN B N   1 
ATOM   8268  C  CA  . GLN B  1 445 ? 66.095 103.650 104.368 1.00 50.24  ? 445 GLN B CA  1 
ATOM   8269  C  C   . GLN B  1 445 ? 66.236 103.534 105.886 1.00 53.76  ? 445 GLN B C   1 
ATOM   8270  O  O   . GLN B  1 445 ? 66.320 102.417 106.399 1.00 53.08  ? 445 GLN B O   1 
ATOM   8271  C  CB  . GLN B  1 445 ? 67.480 103.807 103.723 1.00 52.09  ? 445 GLN B CB  1 
ATOM   8272  C  CG  . GLN B  1 445 ? 67.498 103.556 102.218 1.00 69.13  ? 445 GLN B CG  1 
ATOM   8273  C  CD  . GLN B  1 445 ? 67.536 102.091 101.865 1.00 87.36  ? 445 GLN B CD  1 
ATOM   8274  O  OE1 . GLN B  1 445 ? 66.555 101.354 102.028 1.00 81.61  ? 445 GLN B OE1 1 
ATOM   8275  N  NE2 . GLN B  1 445 ? 68.663 101.651 101.327 1.00 79.78  ? 445 GLN B NE2 1 
ATOM   8276  N  N   . ILE B  1 446 ? 66.235 104.680 106.601 1.00 50.40  ? 446 ILE B N   1 
ATOM   8277  C  CA  . ILE B  1 446 ? 66.320 104.735 108.063 1.00 50.48  ? 446 ILE B CA  1 
ATOM   8278  C  C   . ILE B  1 446 ? 65.022 104.148 108.659 1.00 54.94  ? 446 ILE B C   1 
ATOM   8279  O  O   . ILE B  1 446 ? 65.094 103.262 109.507 1.00 54.90  ? 446 ILE B O   1 
ATOM   8280  C  CB  . ILE B  1 446 ? 66.614 106.181 108.560 1.00 53.80  ? 446 ILE B CB  1 
ATOM   8281  C  CG1 . ILE B  1 446 ? 67.977 106.684 108.030 1.00 54.37  ? 446 ILE B CG1 1 
ATOM   8282  C  CG2 . ILE B  1 446 ? 66.556 106.267 110.095 1.00 54.82  ? 446 ILE B CG2 1 
ATOM   8283  C  CD1 . ILE B  1 446 ? 68.106 108.208 107.898 1.00 61.13  ? 446 ILE B CD1 1 
ATOM   8284  N  N   . MET B  1 447 ? 63.854 104.598 108.172 1.00 51.55  ? 447 MET B N   1 
ATOM   8285  C  CA  . MET B  1 447 ? 62.546 104.128 108.635 1.00 51.71  ? 447 MET B CA  1 
ATOM   8286  C  C   . MET B  1 447 ? 62.246 102.670 108.240 1.00 54.59  ? 447 MET B C   1 
ATOM   8287  O  O   . MET B  1 447 ? 61.584 101.966 109.005 1.00 54.35  ? 447 MET B O   1 
ATOM   8288  C  CB  . MET B  1 447 ? 61.419 105.027 108.090 1.00 54.43  ? 447 MET B CB  1 
ATOM   8289  C  CG  . MET B  1 447 ? 61.473 106.468 108.565 1.00 59.69  ? 447 MET B CG  1 
ATOM   8290  S  SD  . MET B  1 447 ? 61.713 106.682 110.347 1.00 66.10  ? 447 MET B SD  1 
ATOM   8291  C  CE  . MET B  1 447 ? 60.136 106.067 110.979 1.00 62.90  ? 447 MET B CE  1 
ATOM   8292  N  N   . GLU B  1 448 ? 62.705 102.235 107.043 1.00 49.79  ? 448 GLU B N   1 
ATOM   8293  C  CA  . GLU B  1 448 ? 62.447 100.910 106.469 1.00 48.42  ? 448 GLU B CA  1 
ATOM   8294  C  C   . GLU B  1 448 ? 63.220 99.788  107.163 1.00 51.55  ? 448 GLU B C   1 
ATOM   8295  O  O   . GLU B  1 448 ? 62.608 98.758  107.458 1.00 50.71  ? 448 GLU B O   1 
ATOM   8296  C  CB  . GLU B  1 448 ? 62.766 100.891 104.958 1.00 49.26  ? 448 GLU B CB  1 
ATOM   8297  C  CG  . GLU B  1 448 ? 62.144 99.736  104.182 1.00 57.57  ? 448 GLU B CG  1 
ATOM   8298  C  CD  . GLU B  1 448 ? 62.682 99.466  102.784 1.00 71.55  ? 448 GLU B CD  1 
ATOM   8299  O  OE1 . GLU B  1 448 ? 63.849 99.823  102.503 1.00 67.00  ? 448 GLU B OE1 1 
ATOM   8300  O  OE2 . GLU B  1 448 ? 61.949 98.838  101.985 1.00 53.86  ? 448 GLU B OE2 1 
ATOM   8301  N  N   . SER B  1 449 ? 64.547 99.942  107.376 1.00 48.03  ? 449 SER B N   1 
ATOM   8302  C  CA  . SER B  1 449 ? 65.322 98.843  107.950 1.00 48.07  ? 449 SER B CA  1 
ATOM   8303  C  C   . SER B  1 449 ? 66.319 99.232  109.048 1.00 53.54  ? 449 SER B C   1 
ATOM   8304  O  O   . SER B  1 449 ? 66.426 98.487  110.021 1.00 53.16  ? 449 SER B O   1 
ATOM   8305  C  CB  . SER B  1 449 ? 66.075 98.101  106.852 1.00 50.70  ? 449 SER B CB  1 
ATOM   8306  O  OG  . SER B  1 449 ? 67.024 98.937  106.212 1.00 58.17  ? 449 SER B OG  1 
ATOM   8307  N  N   . PHE B  1 450 ? 67.055 100.352 108.899 1.00 51.26  ? 450 PHE B N   1 
ATOM   8308  C  CA  . PHE B  1 450 ? 68.093 100.761 109.853 1.00 52.00  ? 450 PHE B CA  1 
ATOM   8309  C  C   . PHE B  1 450 ? 67.549 101.019 111.265 1.00 55.49  ? 450 PHE B C   1 
ATOM   8310  O  O   . PHE B  1 450 ? 68.128 100.502 112.222 1.00 55.57  ? 450 PHE B O   1 
ATOM   8311  C  CB  . PHE B  1 450 ? 68.887 101.971 109.334 1.00 54.60  ? 450 PHE B CB  1 
ATOM   8312  C  CG  . PHE B  1 450 ? 69.581 101.728 108.007 1.00 56.49  ? 450 PHE B CG  1 
ATOM   8313  C  CD1 . PHE B  1 450 ? 70.263 100.537 107.764 1.00 59.73  ? 450 PHE B CD1 1 
ATOM   8314  C  CD2 . PHE B  1 450 ? 69.561 102.691 107.005 1.00 58.75  ? 450 PHE B CD2 1 
ATOM   8315  C  CE1 . PHE B  1 450 ? 70.888 100.308 106.534 1.00 60.54  ? 450 PHE B CE1 1 
ATOM   8316  C  CE2 . PHE B  1 450 ? 70.198 102.464 105.780 1.00 61.43  ? 450 PHE B CE2 1 
ATOM   8317  C  CZ  . PHE B  1 450 ? 70.856 101.274 105.553 1.00 59.52  ? 450 PHE B CZ  1 
ATOM   8318  N  N   . LEU B  1 451 ? 66.447 101.774 111.402 1.00 51.74  ? 451 LEU B N   1 
ATOM   8319  C  CA  . LEU B  1 451 ? 65.831 102.029 112.707 1.00 52.12  ? 451 LEU B CA  1 
ATOM   8320  C  C   . LEU B  1 451 ? 65.138 100.737 113.220 1.00 56.25  ? 451 LEU B C   1 
ATOM   8321  O  O   . LEU B  1 451 ? 65.462 100.338 114.341 1.00 56.20  ? 451 LEU B O   1 
ATOM   8322  C  CB  . LEU B  1 451 ? 64.864 103.233 112.671 1.00 52.21  ? 451 LEU B CB  1 
ATOM   8323  C  CG  . LEU B  1 451 ? 64.063 103.543 113.938 1.00 57.56  ? 451 LEU B CG  1 
ATOM   8324  C  CD1 . LEU B  1 451 ? 64.919 104.224 114.985 1.00 58.72  ? 451 LEU B CD1 1 
ATOM   8325  C  CD2 . LEU B  1 451 ? 62.875 104.416 113.617 1.00 60.07  ? 451 LEU B CD2 1 
ATOM   8326  N  N   . PRO B  1 452 ? 64.275 100.021 112.432 1.00 52.40  ? 452 PRO B N   1 
ATOM   8327  C  CA  . PRO B  1 452 ? 63.673 98.773  112.946 1.00 52.08  ? 452 PRO B CA  1 
ATOM   8328  C  C   . PRO B  1 452 ? 64.690 97.688  113.328 1.00 56.83  ? 452 PRO B C   1 
ATOM   8329  O  O   . PRO B  1 452 ? 64.400 96.914  114.245 1.00 57.15  ? 452 PRO B O   1 
ATOM   8330  C  CB  . PRO B  1 452 ? 62.800 98.299  111.787 1.00 52.94  ? 452 PRO B CB  1 
ATOM   8331  C  CG  . PRO B  1 452 ? 62.504 99.513  111.020 1.00 57.25  ? 452 PRO B CG  1 
ATOM   8332  C  CD  . PRO B  1 452 ? 63.751 100.324 111.085 1.00 53.30  ? 452 PRO B CD  1 
ATOM   8333  N  N   . TYR B  1 453 ? 65.869 97.631  112.649 1.00 53.06  ? 453 TYR B N   1 
ATOM   8334  C  CA  . TYR B  1 453 ? 66.931 96.670  112.974 1.00 53.12  ? 453 TYR B CA  1 
ATOM   8335  C  C   . TYR B  1 453 ? 67.518 96.998  114.335 1.00 59.19  ? 453 TYR B C   1 
ATOM   8336  O  O   . TYR B  1 453 ? 67.712 96.090  115.142 1.00 59.16  ? 453 TYR B O   1 
ATOM   8337  C  CB  . TYR B  1 453 ? 68.045 96.633  111.901 1.00 53.82  ? 453 TYR B CB  1 
ATOM   8338  C  CG  . TYR B  1 453 ? 69.296 95.898  112.345 1.00 55.55  ? 453 TYR B CG  1 
ATOM   8339  C  CD1 . TYR B  1 453 ? 69.323 94.509  112.424 1.00 57.51  ? 453 TYR B CD1 1 
ATOM   8340  C  CD2 . TYR B  1 453 ? 70.442 96.594  112.723 1.00 56.79  ? 453 TYR B CD2 1 
ATOM   8341  C  CE1 . TYR B  1 453 ? 70.460 93.829  112.867 1.00 58.91  ? 453 TYR B CE1 1 
ATOM   8342  C  CE2 . TYR B  1 453 ? 71.581 95.926  113.173 1.00 58.26  ? 453 TYR B CE2 1 
ATOM   8343  C  CZ  . TYR B  1 453 ? 71.589 94.543  113.239 1.00 64.54  ? 453 TYR B CZ  1 
ATOM   8344  O  OH  . TYR B  1 453 ? 72.712 93.884  113.679 1.00 64.50  ? 453 TYR B OH  1 
ATOM   8345  N  N   . TRP B  1 454 ? 67.827 98.290  114.569 1.00 57.48  ? 454 TRP B N   1 
ATOM   8346  C  CA  . TRP B  1 454 ? 68.378 98.808  115.821 1.00 58.85  ? 454 TRP B CA  1 
ATOM   8347  C  C   . TRP B  1 454 ? 67.454 98.414  116.982 1.00 62.07  ? 454 TRP B C   1 
ATOM   8348  O  O   . TRP B  1 454 ? 67.933 97.875  117.981 1.00 62.38  ? 454 TRP B O   1 
ATOM   8349  C  CB  . TRP B  1 454 ? 68.544 100.341 115.725 1.00 58.53  ? 454 TRP B CB  1 
ATOM   8350  C  CG  . TRP B  1 454 ? 69.230 100.993 116.894 1.00 61.03  ? 454 TRP B CG  1 
ATOM   8351  C  CD1 . TRP B  1 454 ? 68.723 101.172 118.149 1.00 64.52  ? 454 TRP B CD1 1 
ATOM   8352  C  CD2 . TRP B  1 454 ? 70.500 101.664 116.878 1.00 61.83  ? 454 TRP B CD2 1 
ATOM   8353  N  NE1 . TRP B  1 454 ? 69.626 101.849 118.934 1.00 65.18  ? 454 TRP B NE1 1 
ATOM   8354  C  CE2 . TRP B  1 454 ? 70.723 102.172 118.177 1.00 66.80  ? 454 TRP B CE2 1 
ATOM   8355  C  CE3 . TRP B  1 454 ? 71.486 101.865 115.894 1.00 63.24  ? 454 TRP B CE3 1 
ATOM   8356  C  CZ2 . TRP B  1 454 ? 71.891 102.866 118.521 1.00 67.09  ? 454 TRP B CZ2 1 
ATOM   8357  C  CZ3 . TRP B  1 454 ? 72.645 102.549 116.237 1.00 65.63  ? 454 TRP B CZ3 1 
ATOM   8358  C  CH2 . TRP B  1 454 ? 72.839 103.038 117.536 1.00 67.16  ? 454 TRP B CH2 1 
ATOM   8359  N  N   . LEU B  1 455 ? 66.130 98.627  116.809 1.00 57.25  ? 455 LEU B N   1 
ATOM   8360  C  CA  . LEU B  1 455 ? 65.097 98.329  117.801 1.00 56.70  ? 455 LEU B CA  1 
ATOM   8361  C  C   . LEU B  1 455 ? 64.900 96.819  117.991 1.00 60.22  ? 455 LEU B C   1 
ATOM   8362  O  O   . LEU B  1 455 ? 64.627 96.405  119.119 1.00 60.54  ? 455 LEU B O   1 
ATOM   8363  C  CB  . LEU B  1 455 ? 63.767 99.003  117.430 1.00 56.19  ? 455 LEU B CB  1 
ATOM   8364  C  CG  . LEU B  1 455 ? 63.741 100.538 117.497 1.00 61.00  ? 455 LEU B CG  1 
ATOM   8365  C  CD1 . LEU B  1 455 ? 62.648 101.104 116.613 1.00 60.75  ? 455 LEU B CD1 1 
ATOM   8366  C  CD2 . LEU B  1 455 ? 63.573 101.034 118.924 1.00 63.76  ? 455 LEU B CD2 1 
ATOM   8367  N  N   . GLN B  1 456 ? 65.055 96.001  116.919 1.00 55.88  ? 456 GLN B N   1 
ATOM   8368  C  CA  . GLN B  1 456 ? 64.933 94.540  117.016 1.00 55.58  ? 456 GLN B CA  1 
ATOM   8369  C  C   . GLN B  1 456 ? 66.177 93.941  117.700 1.00 62.07  ? 456 GLN B C   1 
ATOM   8370  O  O   . GLN B  1 456 ? 66.044 92.985  118.472 1.00 62.53  ? 456 GLN B O   1 
ATOM   8371  C  CB  . GLN B  1 456 ? 64.697 93.889  115.641 1.00 55.67  ? 456 GLN B CB  1 
ATOM   8372  C  CG  . GLN B  1 456 ? 64.491 92.352  115.669 1.00 55.76  ? 456 GLN B CG  1 
ATOM   8373  C  CD  . GLN B  1 456 ? 63.415 91.854  116.620 1.00 59.63  ? 456 GLN B CD  1 
ATOM   8374  O  OE1 . GLN B  1 456 ? 62.253 92.265  116.552 1.00 51.57  ? 456 GLN B OE1 1 
ATOM   8375  N  NE2 . GLN B  1 456 ? 63.772 90.918  117.496 1.00 48.00  ? 456 GLN B NE2 1 
ATOM   8376  N  N   . ARG B  1 457 ? 67.378 94.493  117.400 1.00 59.50  ? 457 ARG B N   1 
ATOM   8377  C  CA  . ARG B  1 457 ? 68.644 94.053  117.990 1.00 60.40  ? 457 ARG B CA  1 
ATOM   8378  C  C   . ARG B  1 457 ? 68.621 94.301  119.504 1.00 66.27  ? 457 ARG B C   1 
ATOM   8379  O  O   . ARG B  1 457 ? 68.983 93.400  120.263 1.00 66.78  ? 457 ARG B O   1 
ATOM   8380  C  CB  . ARG B  1 457 ? 69.850 94.747  117.331 1.00 60.81  ? 457 ARG B CB  1 
ATOM   8381  C  CG  . ARG B  1 457 ? 71.194 94.190  117.797 1.00 74.46  ? 457 ARG B CG  1 
ATOM   8382  C  CD  . ARG B  1 457 ? 72.374 94.746  117.026 1.00 90.73  ? 457 ARG B CD  1 
ATOM   8383  N  NE  . ARG B  1 457 ? 73.642 94.184  117.502 1.00 103.53 ? 457 ARG B NE  1 
ATOM   8384  C  CZ  . ARG B  1 457 ? 74.192 93.062  117.043 1.00 118.09 ? 457 ARG B CZ  1 
ATOM   8385  N  NH1 . ARG B  1 457 ? 73.593 92.362  116.086 1.00 104.04 ? 457 ARG B NH1 1 
ATOM   8386  N  NH2 . ARG B  1 457 ? 75.343 92.629  117.539 1.00 105.42 ? 457 ARG B NH2 1 
ATOM   8387  N  N   . LYS B  1 458 ? 68.149 95.497  119.936 1.00 63.09  ? 458 LYS B N   1 
ATOM   8388  C  CA  . LYS B  1 458 ? 68.039 95.885  121.347 1.00 63.62  ? 458 LYS B CA  1 
ATOM   8389  C  C   . LYS B  1 458 ? 67.127 94.924  122.115 1.00 67.26  ? 458 LYS B C   1 
ATOM   8390  O  O   . LYS B  1 458 ? 67.460 94.541  123.239 1.00 67.75  ? 458 LYS B O   1 
ATOM   8391  C  CB  . LYS B  1 458 ? 67.537 97.329  121.487 1.00 66.25  ? 458 LYS B CB  1 
ATOM   8392  C  CG  . LYS B  1 458 ? 68.649 98.361  121.381 1.00 80.92  ? 458 LYS B CG  1 
ATOM   8393  C  CD  . LYS B  1 458 ? 68.173 99.741  121.807 1.00 91.18  ? 458 LYS B CD  1 
ATOM   8394  C  CE  . LYS B  1 458 ? 69.318 100.645 122.201 1.00 102.81 ? 458 LYS B CE  1 
ATOM   8395  N  NZ  . LYS B  1 458 ? 69.893 100.276 123.524 1.00 111.66 ? 458 LYS B NZ  1 
ATOM   8396  N  N   . HIS B  1 459 ? 66.005 94.508  121.491 1.00 62.51  ? 459 HIS B N   1 
ATOM   8397  C  CA  . HIS B  1 459 ? 65.055 93.559  122.069 1.00 62.11  ? 459 HIS B CA  1 
ATOM   8398  C  C   . HIS B  1 459 ? 65.680 92.154  122.128 1.00 65.15  ? 459 HIS B C   1 
ATOM   8399  O  O   . HIS B  1 459 ? 65.502 91.453  123.124 1.00 65.10  ? 459 HIS B O   1 
ATOM   8400  C  CB  . HIS B  1 459 ? 63.740 93.555  121.267 1.00 62.22  ? 459 HIS B CB  1 
ATOM   8401  C  CG  . HIS B  1 459 ? 62.761 92.503  121.692 1.00 65.77  ? 459 HIS B CG  1 
ATOM   8402  N  ND1 . HIS B  1 459 ? 62.495 91.401  120.894 1.00 67.29  ? 459 HIS B ND1 1 
ATOM   8403  C  CD2 . HIS B  1 459 ? 62.028 92.410  122.825 1.00 68.09  ? 459 HIS B CD2 1 
ATOM   8404  C  CE1 . HIS B  1 459 ? 61.608 90.682  121.561 1.00 66.97  ? 459 HIS B CE1 1 
ATOM   8405  N  NE2 . HIS B  1 459 ? 61.298 91.248  122.730 1.00 67.80  ? 459 HIS B NE2 1 
ATOM   8406  N  N   . GLY B  1 460 ? 66.418 91.785  121.076 1.00 60.80  ? 460 GLY B N   1 
ATOM   8407  C  CA  . GLY B  1 460 ? 67.101 90.501  120.945 1.00 60.61  ? 460 GLY B CA  1 
ATOM   8408  C  C   . GLY B  1 460 ? 68.116 90.232  122.038 1.00 64.85  ? 460 GLY B C   1 
ATOM   8409  O  O   . GLY B  1 460 ? 68.118 89.145  122.628 1.00 64.60  ? 460 GLY B O   1 
ATOM   8410  N  N   . VAL B  1 461 ? 68.975 91.236  122.323 1.00 61.43  ? 461 VAL B N   1 
ATOM   8411  C  CA  . VAL B  1 461 ? 70.005 91.185  123.369 1.00 61.94  ? 461 VAL B CA  1 
ATOM   8412  C  C   . VAL B  1 461 ? 69.305 91.042  124.732 1.00 65.56  ? 461 VAL B C   1 
ATOM   8413  O  O   . VAL B  1 461 ? 69.721 90.221  125.551 1.00 66.25  ? 461 VAL B O   1 
ATOM   8414  C  CB  . VAL B  1 461 ? 70.954 92.422  123.321 1.00 66.14  ? 461 VAL B CB  1 
ATOM   8415  C  CG1 . VAL B  1 461 ? 72.007 92.363  124.423 1.00 67.14  ? 461 VAL B CG1 1 
ATOM   8416  C  CG2 . VAL B  1 461 ? 71.632 92.550  121.961 1.00 65.57  ? 461 VAL B CG2 1 
ATOM   8417  N  N   . ARG B  1 462 ? 68.212 91.805  124.935 1.00 60.61  ? 462 ARG B N   1 
ATOM   8418  C  CA  . ARG B  1 462 ? 67.406 91.803  126.152 1.00 60.38  ? 462 ARG B CA  1 
ATOM   8419  C  C   . ARG B  1 462 ? 66.731 90.449  126.397 1.00 63.16  ? 462 ARG B C   1 
ATOM   8420  O  O   . ARG B  1 462 ? 66.663 90.042  127.553 1.00 63.70  ? 462 ARG B O   1 
ATOM   8421  C  CB  . ARG B  1 462 ? 66.346 92.911  126.096 1.00 60.98  ? 462 ARG B CB  1 
ATOM   8422  C  CG  . ARG B  1 462 ? 65.904 93.416  127.469 1.00 73.57  ? 462 ARG B CG  1 
ATOM   8423  C  CD  . ARG B  1 462 ? 64.997 94.633  127.386 1.00 86.83  ? 462 ARG B CD  1 
ATOM   8424  N  NE  . ARG B  1 462 ? 65.707 95.828  126.921 1.00 101.11 ? 462 ARG B NE  1 
ATOM   8425  C  CZ  . ARG B  1 462 ? 65.556 96.378  125.718 1.00 117.86 ? 462 ARG B CZ  1 
ATOM   8426  N  NH1 . ARG B  1 462 ? 64.707 95.853  124.841 1.00 104.17 ? 462 ARG B NH1 1 
ATOM   8427  N  NH2 . ARG B  1 462 ? 66.248 97.459  125.384 1.00 106.08 ? 462 ARG B NH2 1 
ATOM   8428  N  N   . VAL B  1 463 ? 66.247 89.750  125.336 1.00 58.03  ? 463 VAL B N   1 
ATOM   8429  C  CA  . VAL B  1 463 ? 65.573 88.447  125.494 1.00 57.38  ? 463 VAL B CA  1 
ATOM   8430  C  C   . VAL B  1 463 ? 66.595 87.370  125.910 1.00 62.00  ? 463 VAL B C   1 
ATOM   8431  O  O   . VAL B  1 463 ? 66.335 86.647  126.875 1.00 62.48  ? 463 VAL B O   1 
ATOM   8432  C  CB  . VAL B  1 463 ? 64.772 88.046  124.221 1.00 60.00  ? 463 VAL B CB  1 
ATOM   8433  C  CG1 . VAL B  1 463 ? 64.414 86.558  124.202 1.00 59.80  ? 463 VAL B CG1 1 
ATOM   8434  C  CG2 . VAL B  1 463 ? 63.515 88.896  124.089 1.00 59.18  ? 463 VAL B CG2 1 
ATOM   8435  N  N   . LYS B  1 464 ? 67.754 87.295  125.215 1.00 58.16  ? 464 LYS B N   1 
ATOM   8436  C  CA  . LYS B  1 464 ? 68.835 86.337  125.490 1.00 58.43  ? 464 LYS B CA  1 
ATOM   8437  C  C   . LYS B  1 464 ? 69.387 86.492  126.918 1.00 62.56  ? 464 LYS B C   1 
ATOM   8438  O  O   . LYS B  1 464 ? 69.661 85.487  127.578 1.00 63.07  ? 464 LYS B O   1 
ATOM   8439  C  CB  . LYS B  1 464 ? 69.969 86.494  124.467 1.00 60.88  ? 464 LYS B CB  1 
ATOM   8440  N  N   . ARG B  1 465 ? 69.526 87.744  127.392 1.00 58.40  ? 465 ARG B N   1 
ATOM   8441  C  CA  . ARG B  1 465 ? 70.026 88.051  128.733 1.00 59.21  ? 465 ARG B CA  1 
ATOM   8442  C  C   . ARG B  1 465 ? 69.006 87.678  129.816 1.00 62.61  ? 465 ARG B C   1 
ATOM   8443  O  O   . ARG B  1 465 ? 69.401 87.291  130.921 1.00 63.34  ? 465 ARG B O   1 
ATOM   8444  C  CB  . ARG B  1 465 ? 70.402 89.533  128.847 1.00 59.70  ? 465 ARG B CB  1 
ATOM   8445  C  CG  . ARG B  1 465 ? 71.740 89.855  128.198 1.00 71.07  ? 465 ARG B CG  1 
ATOM   8446  C  CD  . ARG B  1 465 ? 72.057 91.332  128.273 1.00 83.57  ? 465 ARG B CD  1 
ATOM   8447  N  NE  . ARG B  1 465 ? 73.309 91.649  127.585 1.00 93.80  ? 465 ARG B NE  1 
ATOM   8448  C  CZ  . ARG B  1 465 ? 73.857 92.859  127.539 1.00 111.53 ? 465 ARG B CZ  1 
ATOM   8449  N  NH1 . ARG B  1 465 ? 73.271 93.886  128.146 1.00 98.97  ? 465 ARG B NH1 1 
ATOM   8450  N  NH2 . ARG B  1 465 ? 74.996 93.054  126.887 1.00 100.94 ? 465 ARG B NH2 1 
ATOM   8451  N  N   . LYS B  1 466 ? 67.702 87.787  129.491 1.00 56.85  ? 466 LYS B N   1 
ATOM   8452  C  CA  . LYS B  1 466 ? 66.600 87.464  130.402 1.00 55.97  ? 466 LYS B CA  1 
ATOM   8453  C  C   . LYS B  1 466 ? 66.541 85.966  130.691 1.00 60.16  ? 466 LYS B C   1 
ATOM   8454  O  O   . LYS B  1 466 ? 66.364 85.577  131.847 1.00 60.44  ? 466 LYS B O   1 
ATOM   8455  C  CB  . LYS B  1 466 ? 65.254 87.932  129.827 1.00 56.49  ? 466 LYS B CB  1 
ATOM   8456  C  CG  . LYS B  1 466 ? 64.878 89.349  130.202 1.00 57.92  ? 466 LYS B CG  1 
ATOM   8457  C  CD  . LYS B  1 466 ? 63.567 89.767  129.549 1.00 61.57  ? 466 LYS B CD  1 
ATOM   8458  C  CE  . LYS B  1 466 ? 62.884 90.933  130.244 1.00 65.10  ? 466 LYS B CE  1 
ATOM   8459  N  NZ  . LYS B  1 466 ? 63.637 92.212  130.129 1.00 71.92  ? 466 LYS B NZ  1 
ATOM   8460  N  N   . VAL B  1 467 ? 66.691 85.133  129.636 1.00 56.32  ? 467 VAL B N   1 
ATOM   8461  C  CA  . VAL B  1 467 ? 66.634 83.666  129.693 1.00 56.72  ? 467 VAL B CA  1 
ATOM   8462  C  C   . VAL B  1 467 ? 67.881 83.101  130.419 1.00 63.35  ? 467 VAL B C   1 
ATOM   8463  O  O   . VAL B  1 467 ? 67.740 82.145  131.189 1.00 63.90  ? 467 VAL B O   1 
ATOM   8464  C  CB  . VAL B  1 467 ? 66.434 83.039  128.281 1.00 59.33  ? 467 VAL B CB  1 
ATOM   8465  C  CG1 . VAL B  1 467 ? 66.363 81.515  128.342 1.00 59.42  ? 467 VAL B CG1 1 
ATOM   8466  C  CG2 . VAL B  1 467 ? 65.177 83.585  127.614 1.00 58.09  ? 467 VAL B CG2 1 
ATOM   8467  N  N   . GLN B  1 468 ? 69.078 83.704  130.201 1.00 60.78  ? 468 GLN B N   1 
ATOM   8468  C  CA  . GLN B  1 468 ? 70.332 83.285  130.838 1.00 61.90  ? 468 GLN B CA  1 
ATOM   8469  C  C   . GLN B  1 468 ? 70.283 83.483  132.359 1.00 66.55  ? 468 GLN B C   1 
ATOM   8470  O  O   . GLN B  1 468 ? 70.901 82.717  133.100 1.00 67.04  ? 468 GLN B O   1 
ATOM   8471  C  CB  . GLN B  1 468 ? 71.516 84.056  130.245 1.00 63.34  ? 468 GLN B CB  1 
ATOM   8472  C  CG  . GLN B  1 468 ? 72.442 83.184  129.397 1.00 78.16  ? 468 GLN B CG  1 
ATOM   8473  N  N   . ALA B  1 469 ? 69.532 84.505  132.808 1.00 62.77  ? 469 ALA B N   1 
ATOM   8474  C  CA  . ALA B  1 469 ? 69.340 84.861  134.212 1.00 63.35  ? 469 ALA B CA  1 
ATOM   8475  C  C   . ALA B  1 469 ? 68.486 83.834  134.958 1.00 66.61  ? 469 ALA B C   1 
ATOM   8476  O  O   . ALA B  1 469 ? 68.621 83.709  136.180 1.00 67.64  ? 469 ALA B O   1 
ATOM   8477  C  CB  . ALA B  1 469 ? 68.691 86.229  134.310 1.00 63.73  ? 469 ALA B CB  1 
ATOM   8478  N  N   . LEU B  1 470 ? 67.600 83.118  134.230 1.00 61.05  ? 470 LEU B N   1 
ATOM   8479  C  CA  . LEU B  1 470 ? 66.705 82.105  134.796 1.00 60.47  ? 470 LEU B CA  1 
ATOM   8480  C  C   . LEU B  1 470 ? 67.472 80.886  135.298 1.00 65.75  ? 470 LEU B C   1 
ATOM   8481  O  O   . LEU B  1 470 ? 67.200 80.424  136.410 1.00 66.63  ? 470 LEU B O   1 
ATOM   8482  C  CB  . LEU B  1 470 ? 65.645 81.654  133.777 1.00 59.04  ? 470 LEU B CB  1 
ATOM   8483  C  CG  . LEU B  1 470 ? 64.650 82.697  133.283 1.00 62.11  ? 470 LEU B CG  1 
ATOM   8484  C  CD1 . LEU B  1 470 ? 64.008 82.241  132.002 1.00 60.98  ? 470 LEU B CD1 1 
ATOM   8485  C  CD2 . LEU B  1 470 ? 63.579 82.993  134.328 1.00 64.49  ? 470 LEU B CD2 1 
ATOM   8486  N  N   . LYS B  1 471 ? 68.434 80.379  134.487 1.00 61.99  ? 471 LYS B N   1 
ATOM   8487  C  CA  . LYS B  1 471 ? 69.254 79.193  134.767 1.00 62.62  ? 471 LYS B CA  1 
ATOM   8488  C  C   . LYS B  1 471 ? 68.317 77.990  134.958 1.00 66.48  ? 471 LYS B C   1 
ATOM   8489  O  O   . LYS B  1 471 ? 68.283 77.368  136.021 1.00 67.11  ? 471 LYS B O   1 
ATOM   8490  C  CB  . LYS B  1 471 ? 70.205 79.414  135.967 1.00 66.08  ? 471 LYS B CB  1 
ATOM   8491  C  CG  . LYS B  1 471 ? 71.411 80.263  135.611 1.00 79.86  ? 471 LYS B CG  1 
ATOM   8492  C  CD  . LYS B  1 471 ? 72.106 80.818  136.840 1.00 90.41  ? 471 LYS B CD  1 
ATOM   8493  C  CE  . LYS B  1 471 ? 73.353 81.595  136.483 1.00 103.14 ? 471 LYS B CE  1 
ATOM   8494  N  NZ  . LYS B  1 471 ? 73.045 82.862  135.761 1.00 111.35 ? 471 LYS B NZ  1 
ATOM   8495  N  N   . ALA B  1 472 ? 67.510 77.722  133.916 1.00 61.70  ? 472 ALA B N   1 
ATOM   8496  C  CA  . ALA B  1 472 ? 66.518 76.652  133.870 1.00 61.34  ? 472 ALA B CA  1 
ATOM   8497  C  C   . ALA B  1 472 ? 67.175 75.276  133.892 1.00 66.24  ? 472 ALA B C   1 
ATOM   8498  O  O   . ALA B  1 472 ? 68.253 75.100  133.318 1.00 66.16  ? 472 ALA B O   1 
ATOM   8499  C  CB  . ALA B  1 472 ? 65.667 76.799  132.617 1.00 60.74  ? 472 ALA B CB  1 
ATOM   8500  N  N   . ASP B  1 473 ? 66.509 74.293  134.540 1.00 63.09  ? 473 ASP B N   1 
ATOM   8501  C  CA  . ASP B  1 473 ? 66.976 72.903  134.623 1.00 63.46  ? 473 ASP B CA  1 
ATOM   8502  C  C   . ASP B  1 473 ? 66.528 72.104  133.369 1.00 65.68  ? 473 ASP B C   1 
ATOM   8503  O  O   . ASP B  1 473 ? 66.644 70.874  133.333 1.00 65.96  ? 473 ASP B O   1 
ATOM   8504  C  CB  . ASP B  1 473 ? 66.485 72.241  135.930 1.00 66.50  ? 473 ASP B CB  1 
ATOM   8505  C  CG  . ASP B  1 473 ? 65.028 71.799  135.971 1.00 75.92  ? 473 ASP B CG  1 
ATOM   8506  O  OD1 . ASP B  1 473 ? 64.156 72.575  135.519 1.00 74.50  ? 473 ASP B OD1 1 
ATOM   8507  O  OD2 . ASP B  1 473 ? 64.757 70.704  136.508 1.00 83.85  ? 473 ASP B OD2 1 
ATOM   8508  N  N   . ILE B  1 474 ? 66.025 72.829  132.346 1.00 59.98  ? 474 ILE B N   1 
ATOM   8509  C  CA  . ILE B  1 474 ? 65.551 72.310  131.061 1.00 58.70  ? 474 ILE B CA  1 
ATOM   8510  C  C   . ILE B  1 474 ? 66.248 73.064  129.913 1.00 62.41  ? 474 ILE B C   1 
ATOM   8511  O  O   . ILE B  1 474 ? 66.675 74.208  130.104 1.00 61.86  ? 474 ILE B O   1 
ATOM   8512  C  CB  . ILE B  1 474 ? 63.996 72.387  130.942 1.00 60.67  ? 474 ILE B CB  1 
ATOM   8513  C  CG1 . ILE B  1 474 ? 63.466 73.835  131.044 1.00 59.61  ? 474 ILE B CG1 1 
ATOM   8514  C  CG2 . ILE B  1 474 ? 63.297 71.454  131.942 1.00 62.16  ? 474 ILE B CG2 1 
ATOM   8515  C  CD1 . ILE B  1 474 ? 62.511 74.207  129.964 1.00 60.94  ? 474 ILE B CD1 1 
ATOM   8516  N  N   . ASP B  1 475 ? 66.362 72.428  128.726 1.00 58.56  ? 475 ASP B N   1 
ATOM   8517  C  CA  . ASP B  1 475 ? 66.974 73.063  127.558 1.00 57.46  ? 475 ASP B CA  1 
ATOM   8518  C  C   . ASP B  1 475 ? 65.958 74.025  126.920 1.00 59.43  ? 475 ASP B C   1 
ATOM   8519  O  O   . ASP B  1 475 ? 65.021 73.587  126.242 1.00 59.06  ? 475 ASP B O   1 
ATOM   8520  C  CB  . ASP B  1 475 ? 67.479 72.012  126.552 1.00 59.72  ? 475 ASP B CB  1 
ATOM   8521  C  CG  . ASP B  1 475 ? 68.232 72.605  125.378 1.00 69.97  ? 475 ASP B CG  1 
ATOM   8522  O  OD1 . ASP B  1 475 ? 69.443 72.876  125.525 1.00 71.06  ? 475 ASP B OD1 1 
ATOM   8523  O  OD2 . ASP B  1 475 ? 67.607 72.807  124.312 1.00 74.88  ? 475 ASP B OD2 1 
ATOM   8524  N  N   . ALA B  1 476 ? 66.130 75.334  127.173 1.00 54.27  ? 476 ALA B N   1 
ATOM   8525  C  CA  . ALA B  1 476 ? 65.233 76.375  126.666 1.00 52.38  ? 476 ALA B CA  1 
ATOM   8526  C  C   . ALA B  1 476 ? 65.820 77.083  125.422 1.00 53.98  ? 476 ALA B C   1 
ATOM   8527  O  O   . ALA B  1 476 ? 65.645 78.293  125.253 1.00 52.60  ? 476 ALA B O   1 
ATOM   8528  C  CB  . ALA B  1 476 ? 64.937 77.380  127.772 1.00 53.12  ? 476 ALA B CB  1 
ATOM   8529  N  N   . THR B  1 477 ? 66.488 76.312  124.539 1.00 49.65  ? 477 THR B N   1 
ATOM   8530  C  CA  . THR B  1 477 ? 67.091 76.833  123.312 1.00 48.49  ? 477 THR B CA  1 
ATOM   8531  C  C   . THR B  1 477 ? 65.978 77.162  122.314 1.00 50.94  ? 477 THR B C   1 
ATOM   8532  O  O   . THR B  1 477 ? 65.934 78.284  121.801 1.00 50.02  ? 477 THR B O   1 
ATOM   8533  C  CB  . THR B  1 477 ? 68.120 75.842  122.742 1.00 57.86  ? 477 THR B CB  1 
ATOM   8534  O  OG1 . THR B  1 477 ? 68.903 75.305  123.806 1.00 60.45  ? 477 THR B OG1 1 
ATOM   8535  C  CG2 . THR B  1 477 ? 69.040 76.485  121.710 1.00 56.07  ? 477 THR B CG2 1 
ATOM   8536  N  N   . LEU B  1 478 ? 65.065 76.187  122.070 1.00 46.64  ? 478 LEU B N   1 
ATOM   8537  C  CA  . LEU B  1 478 ? 63.911 76.327  121.173 1.00 44.78  ? 478 LEU B CA  1 
ATOM   8538  C  C   . LEU B  1 478 ? 62.907 77.318  121.759 1.00 46.89  ? 478 LEU B C   1 
ATOM   8539  O  O   . LEU B  1 478 ? 62.286 78.070  121.007 1.00 45.86  ? 478 LEU B O   1 
ATOM   8540  C  CB  . LEU B  1 478 ? 63.249 74.957  120.924 1.00 44.91  ? 478 LEU B CB  1 
ATOM   8541  C  CG  . LEU B  1 478 ? 62.064 74.905  119.949 1.00 48.52  ? 478 LEU B CG  1 
ATOM   8542  C  CD1 . LEU B  1 478 ? 62.523 74.984  118.502 1.00 48.17  ? 478 LEU B CD1 1 
ATOM   8543  C  CD2 . LEU B  1 478 ? 61.287 73.644  120.132 1.00 51.35  ? 478 LEU B CD2 1 
ATOM   8544  N  N   . TYR B  1 479 ? 62.769 77.326  123.101 1.00 43.04  ? 479 TYR B N   1 
ATOM   8545  C  CA  . TYR B  1 479 ? 61.890 78.235  123.832 1.00 42.44  ? 479 TYR B CA  1 
ATOM   8546  C  C   . TYR B  1 479 ? 62.274 79.681  123.525 1.00 45.90  ? 479 TYR B C   1 
ATOM   8547  O  O   . TYR B  1 479 ? 61.409 80.448  123.111 1.00 45.03  ? 479 TYR B O   1 
ATOM   8548  C  CB  . TYR B  1 479 ? 61.954 77.953  125.342 1.00 44.30  ? 479 TYR B CB  1 
ATOM   8549  C  CG  . TYR B  1 479 ? 61.132 78.898  126.191 1.00 45.35  ? 479 TYR B CG  1 
ATOM   8550  C  CD1 . TYR B  1 479 ? 59.749 78.770  126.269 1.00 47.23  ? 479 TYR B CD1 1 
ATOM   8551  C  CD2 . TYR B  1 479 ? 61.741 79.894  126.948 1.00 45.77  ? 479 TYR B CD2 1 
ATOM   8552  C  CE1 . TYR B  1 479 ? 58.988 79.626  127.061 1.00 48.14  ? 479 TYR B CE1 1 
ATOM   8553  C  CE2 . TYR B  1 479 ? 60.991 80.760  127.741 1.00 46.38  ? 479 TYR B CE2 1 
ATOM   8554  C  CZ  . TYR B  1 479 ? 59.614 80.619  127.799 1.00 53.07  ? 479 TYR B CZ  1 
ATOM   8555  O  OH  . TYR B  1 479 ? 58.871 81.459  128.591 1.00 52.08  ? 479 TYR B OH  1 
ATOM   8556  N  N   . GLU B  1 480 ? 63.578 80.025  123.655 1.00 42.72  ? 480 GLU B N   1 
ATOM   8557  C  CA  . GLU B  1 480 ? 64.120 81.358  123.368 1.00 42.17  ? 480 GLU B CA  1 
ATOM   8558  C  C   . GLU B  1 480 ? 63.918 81.728  121.884 1.00 45.23  ? 480 GLU B C   1 
ATOM   8559  O  O   . GLU B  1 480 ? 63.581 82.877  121.598 1.00 43.97  ? 480 GLU B O   1 
ATOM   8560  C  CB  . GLU B  1 480 ? 65.606 81.433  123.753 1.00 44.13  ? 480 GLU B CB  1 
ATOM   8561  C  CG  . GLU B  1 480 ? 66.217 82.830  123.702 1.00 53.99  ? 480 GLU B CG  1 
ATOM   8562  C  CD  . GLU B  1 480 ? 67.688 82.907  124.092 1.00 82.36  ? 480 GLU B CD  1 
ATOM   8563  O  OE1 . GLU B  1 480 ? 68.091 82.177  125.026 1.00 74.48  ? 480 GLU B OE1 1 
ATOM   8564  O  OE2 . GLU B  1 480 ? 68.441 83.679  123.454 1.00 85.32  ? 480 GLU B OE2 1 
ATOM   8565  N  N   . GLN B  1 481 ? 64.114 80.756  120.957 1.00 41.92  ? 481 GLN B N   1 
ATOM   8566  C  CA  . GLN B  1 481 ? 63.953 80.946  119.513 1.00 41.11  ? 481 GLN B CA  1 
ATOM   8567  C  C   . GLN B  1 481 ? 62.500 81.277  119.148 1.00 44.78  ? 481 GLN B C   1 
ATOM   8568  O  O   . GLN B  1 481 ? 62.274 82.118  118.274 1.00 43.96  ? 481 GLN B O   1 
ATOM   8569  C  CB  . GLN B  1 481 ? 64.410 79.695  118.743 1.00 42.84  ? 481 GLN B CB  1 
ATOM   8570  C  CG  . GLN B  1 481 ? 64.742 79.976  117.273 1.00 57.83  ? 481 GLN B CG  1 
ATOM   8571  C  CD  . GLN B  1 481 ? 64.645 78.780  116.353 1.00 71.86  ? 481 GLN B CD  1 
ATOM   8572  O  OE1 . GLN B  1 481 ? 63.991 77.771  116.645 1.00 65.34  ? 481 GLN B OE1 1 
ATOM   8573  N  NE2 . GLN B  1 481 ? 65.267 78.887  115.188 1.00 62.82  ? 481 GLN B NE2 1 
ATOM   8574  N  N   . VAL B  1 482 ? 61.526 80.625  119.819 1.00 41.83  ? 482 VAL B N   1 
ATOM   8575  C  CA  . VAL B  1 482 ? 60.096 80.840  119.578 1.00 40.89  ? 482 VAL B CA  1 
ATOM   8576  C  C   . VAL B  1 482 ? 59.669 82.191  120.193 1.00 44.33  ? 482 VAL B C   1 
ATOM   8577  O  O   . VAL B  1 482 ? 59.087 82.991  119.469 1.00 43.11  ? 482 VAL B O   1 
ATOM   8578  C  CB  . VAL B  1 482 ? 59.221 79.647  120.048 1.00 44.78  ? 482 VAL B CB  1 
ATOM   8579  C  CG1 . VAL B  1 482 ? 57.733 79.988  120.009 1.00 44.19  ? 482 VAL B CG1 1 
ATOM   8580  C  CG2 . VAL B  1 482 ? 59.496 78.413  119.189 1.00 44.64  ? 482 VAL B CG2 1 
ATOM   8581  N  N   . ILE B  1 483 ? 60.002 82.465  121.480 1.00 41.64  ? 483 ILE B N   1 
ATOM   8582  C  CA  . ILE B  1 483 ? 59.677 83.725  122.185 1.00 41.62  ? 483 ILE B CA  1 
ATOM   8583  C  C   . ILE B  1 483 ? 60.198 84.951  121.381 1.00 47.65  ? 483 ILE B C   1 
ATOM   8584  O  O   . ILE B  1 483 ? 59.483 85.954  121.263 1.00 47.50  ? 483 ILE B O   1 
ATOM   8585  C  CB  . ILE B  1 483 ? 60.214 83.728  123.664 1.00 44.65  ? 483 ILE B CB  1 
ATOM   8586  C  CG1 . ILE B  1 483 ? 59.637 82.558  124.528 1.00 45.14  ? 483 ILE B CG1 1 
ATOM   8587  C  CG2 . ILE B  1 483 ? 60.024 85.082  124.368 1.00 44.78  ? 483 ILE B CG2 1 
ATOM   8588  C  CD1 . ILE B  1 483 ? 58.099 82.446  124.721 1.00 50.99  ? 483 ILE B CD1 1 
ATOM   8589  N  N   . LEU B  1 484 ? 61.414 84.842  120.810 1.00 45.28  ? 484 LEU B N   1 
ATOM   8590  C  CA  . LEU B  1 484 ? 62.048 85.899  120.019 1.00 45.22  ? 484 LEU B CA  1 
ATOM   8591  C  C   . LEU B  1 484 ? 61.289 86.151  118.702 1.00 47.96  ? 484 LEU B C   1 
ATOM   8592  O  O   . LEU B  1 484 ? 60.855 87.283  118.459 1.00 47.70  ? 484 LEU B O   1 
ATOM   8593  C  CB  . LEU B  1 484 ? 63.522 85.539  119.736 1.00 45.90  ? 484 LEU B CB  1 
ATOM   8594  C  CG  . LEU B  1 484 ? 64.440 86.679  119.280 1.00 51.11  ? 484 LEU B CG  1 
ATOM   8595  C  CD1 . LEU B  1 484 ? 65.061 87.409  120.484 1.00 51.79  ? 484 LEU B CD1 1 
ATOM   8596  C  CD2 . LEU B  1 484 ? 65.521 86.146  118.356 1.00 54.43  ? 484 LEU B CD2 1 
ATOM   8597  N  N   . GLU B  1 485 ? 61.112 85.094  117.881 1.00 43.16  ? 485 GLU B N   1 
ATOM   8598  C  CA  . GLU B  1 485 ? 60.441 85.151  116.578 1.00 42.15  ? 485 GLU B CA  1 
ATOM   8599  C  C   . GLU B  1 485 ? 58.942 85.471  116.682 1.00 46.32  ? 485 GLU B C   1 
ATOM   8600  O  O   . GLU B  1 485 ? 58.385 86.051  115.749 1.00 45.81  ? 485 GLU B O   1 
ATOM   8601  C  CB  . GLU B  1 485 ? 60.640 83.840  115.813 1.00 43.53  ? 485 GLU B CB  1 
ATOM   8602  C  CG  . GLU B  1 485 ? 62.032 83.715  115.222 1.00 53.31  ? 485 GLU B CG  1 
ATOM   8603  C  CD  . GLU B  1 485 ? 62.376 82.357  114.645 1.00 70.05  ? 485 GLU B CD  1 
ATOM   8604  O  OE1 . GLU B  1 485 ? 61.544 81.782  113.906 1.00 64.14  ? 485 GLU B OE1 1 
ATOM   8605  O  OE2 . GLU B  1 485 ? 63.508 81.888  114.898 1.00 62.34  ? 485 GLU B OE2 1 
ATOM   8606  N  N   . LYS B  1 486 ? 58.296 85.090  117.800 1.00 43.17  ? 486 LYS B N   1 
ATOM   8607  C  CA  . LYS B  1 486 ? 56.881 85.351  118.070 1.00 42.78  ? 486 LYS B CA  1 
ATOM   8608  C  C   . LYS B  1 486 ? 56.652 86.859  118.173 1.00 46.61  ? 486 LYS B C   1 
ATOM   8609  O  O   . LYS B  1 486 ? 55.769 87.389  117.502 1.00 45.29  ? 486 LYS B O   1 
ATOM   8610  C  CB  . LYS B  1 486 ? 56.454 84.632  119.367 1.00 46.13  ? 486 LYS B CB  1 
ATOM   8611  C  CG  . LYS B  1 486 ? 55.040 84.904  119.847 1.00 60.92  ? 486 LYS B CG  1 
ATOM   8612  C  CD  . LYS B  1 486 ? 54.878 84.602  121.329 1.00 68.74  ? 486 LYS B CD  1 
ATOM   8613  C  CE  . LYS B  1 486 ? 55.025 85.812  122.210 1.00 77.17  ? 486 LYS B CE  1 
ATOM   8614  N  NZ  . LYS B  1 486 ? 54.340 85.610  123.513 1.00 86.63  ? 486 LYS B NZ  1 
ATOM   8615  N  N   . GLU B  1 487 ? 57.480 87.543  118.984 1.00 44.46  ? 487 GLU B N   1 
ATOM   8616  C  CA  . GLU B  1 487 ? 57.387 88.986  119.223 1.00 44.55  ? 487 GLU B CA  1 
ATOM   8617  C  C   . GLU B  1 487 ? 58.021 89.830  118.090 1.00 47.68  ? 487 GLU B C   1 
ATOM   8618  O  O   . GLU B  1 487 ? 57.857 91.052  118.085 1.00 47.15  ? 487 GLU B O   1 
ATOM   8619  C  CB  . GLU B  1 487 ? 58.012 89.350  120.577 1.00 46.70  ? 487 GLU B CB  1 
ATOM   8620  C  CG  . GLU B  1 487 ? 57.137 88.979  121.765 1.00 59.37  ? 487 GLU B CG  1 
ATOM   8621  C  CD  . GLU B  1 487 ? 55.855 89.778  121.941 1.00 85.00  ? 487 GLU B CD  1 
ATOM   8622  O  OE1 . GLU B  1 487 ? 55.924 91.029  121.943 1.00 89.82  ? 487 GLU B OE1 1 
ATOM   8623  O  OE2 . GLU B  1 487 ? 54.778 89.148  122.052 1.00 76.39  ? 487 GLU B OE2 1 
ATOM   8624  N  N   . MET B  1 488 ? 58.712 89.184  117.128 1.00 43.56  ? 488 MET B N   1 
ATOM   8625  C  CA  . MET B  1 488 ? 59.311 89.845  115.963 1.00 42.69  ? 488 MET B CA  1 
ATOM   8626  C  C   . MET B  1 488 ? 58.225 90.450  115.059 1.00 48.02  ? 488 MET B C   1 
ATOM   8627  O  O   . MET B  1 488 ? 57.070 90.012  115.096 1.00 48.19  ? 488 MET B O   1 
ATOM   8628  C  CB  . MET B  1 488 ? 60.143 88.844  115.150 1.00 44.42  ? 488 MET B CB  1 
ATOM   8629  C  CG  . MET B  1 488 ? 61.591 88.791  115.528 1.00 47.75  ? 488 MET B CG  1 
ATOM   8630  S  SD  . MET B  1 488 ? 62.472 87.784  114.316 1.00 51.15  ? 488 MET B SD  1 
ATOM   8631  C  CE  . MET B  1 488 ? 64.003 87.534  115.163 1.00 48.65  ? 488 MET B CE  1 
ATOM   8632  N  N   . GLY B  1 489 ? 58.612 91.433  114.249 1.00 44.62  ? 489 GLY B N   1 
ATOM   8633  C  CA  . GLY B  1 489 ? 57.706 92.089  113.314 1.00 44.17  ? 489 GLY B CA  1 
ATOM   8634  C  C   . GLY B  1 489 ? 57.266 91.158  112.206 1.00 48.53  ? 489 GLY B C   1 
ATOM   8635  O  O   . GLY B  1 489 ? 58.013 90.251  111.834 1.00 48.56  ? 489 GLY B O   1 
ATOM   8636  N  N   . THR B  1 490 ? 56.043 91.349  111.692 1.00 45.09  ? 490 THR B N   1 
ATOM   8637  C  CA  . THR B  1 490 ? 55.521 90.520  110.604 1.00 44.69  ? 490 THR B CA  1 
ATOM   8638  C  C   . THR B  1 490 ? 55.725 91.259  109.281 1.00 47.85  ? 490 THR B C   1 
ATOM   8639  O  O   . THR B  1 490 ? 55.368 92.439  109.180 1.00 47.94  ? 490 THR B O   1 
ATOM   8640  C  CB  . THR B  1 490 ? 54.043 90.152  110.832 1.00 54.87  ? 490 THR B CB  1 
ATOM   8641  O  OG1 . THR B  1 490 ? 53.820 89.813  112.204 1.00 59.50  ? 490 THR B OG1 1 
ATOM   8642  C  CG2 . THR B  1 490 ? 53.587 89.009  109.939 1.00 52.33  ? 490 THR B CG2 1 
ATOM   8643  N  N   . TYR B  1 491 ? 56.317 90.575  108.279 1.00 42.85  ? 491 TYR B N   1 
ATOM   8644  C  CA  . TYR B  1 491 ? 56.533 91.156  106.954 1.00 41.49  ? 491 TYR B CA  1 
ATOM   8645  C  C   . TYR B  1 491 ? 55.186 91.265  106.254 1.00 43.82  ? 491 TYR B C   1 
ATOM   8646  O  O   . TYR B  1 491 ? 54.527 90.250  106.018 1.00 43.85  ? 491 TYR B O   1 
ATOM   8647  C  CB  . TYR B  1 491 ? 57.541 90.330  106.138 1.00 42.80  ? 491 TYR B CB  1 
ATOM   8648  C  CG  . TYR B  1 491 ? 57.887 90.928  104.785 1.00 44.46  ? 491 TYR B CG  1 
ATOM   8649  C  CD1 . TYR B  1 491 ? 58.604 92.120  104.686 1.00 46.08  ? 491 TYR B CD1 1 
ATOM   8650  C  CD2 . TYR B  1 491 ? 57.535 90.280  103.604 1.00 45.12  ? 491 TYR B CD2 1 
ATOM   8651  C  CE1 . TYR B  1 491 ? 58.942 92.662  103.445 1.00 46.50  ? 491 TYR B CE1 1 
ATOM   8652  C  CE2 . TYR B  1 491 ? 57.875 90.808  102.358 1.00 45.65  ? 491 TYR B CE2 1 
ATOM   8653  C  CZ  . TYR B  1 491 ? 58.582 91.998  102.284 1.00 53.46  ? 491 TYR B CZ  1 
ATOM   8654  O  OH  . TYR B  1 491 ? 58.922 92.519  101.058 1.00 55.65  ? 491 TYR B OH  1 
ATOM   8655  N  N   . LEU B  1 492 ? 54.754 92.508  105.994 1.00 39.05  ? 492 LEU B N   1 
ATOM   8656  C  CA  . LEU B  1 492 ? 53.457 92.848  105.394 1.00 38.24  ? 492 LEU B CA  1 
ATOM   8657  C  C   . LEU B  1 492 ? 53.284 92.361  103.940 1.00 40.83  ? 492 LEU B C   1 
ATOM   8658  O  O   . LEU B  1 492 ? 52.162 92.056  103.537 1.00 39.36  ? 492 LEU B O   1 
ATOM   8659  C  CB  . LEU B  1 492 ? 53.236 94.367  105.448 1.00 38.05  ? 492 LEU B CB  1 
ATOM   8660  C  CG  . LEU B  1 492 ? 52.991 94.951  106.830 1.00 42.79  ? 492 LEU B CG  1 
ATOM   8661  C  CD1 . LEU B  1 492 ? 53.671 96.290  106.973 1.00 43.29  ? 492 LEU B CD1 1 
ATOM   8662  C  CD2 . LEU B  1 492 ? 51.502 95.051  107.131 1.00 44.61  ? 492 LEU B CD2 1 
ATOM   8663  N  N   . GLY B  1 493 ? 54.376 92.320  103.181 1.00 37.64  ? 493 GLY B N   1 
ATOM   8664  C  CA  . GLY B  1 493 ? 54.369 91.915  101.780 1.00 37.60  ? 493 GLY B CA  1 
ATOM   8665  C  C   . GLY B  1 493 ? 55.298 92.742  100.913 1.00 42.28  ? 493 GLY B C   1 
ATOM   8666  O  O   . GLY B  1 493 ? 55.806 93.780  101.350 1.00 42.66  ? 493 GLY B O   1 
ATOM   8667  N  N   . THR B  1 494 ? 55.503 92.300  99.661  1.00 38.29  ? 494 THR B N   1 
ATOM   8668  C  CA  . THR B  1 494 ? 56.413 92.944  98.709  1.00 37.96  ? 494 THR B CA  1 
ATOM   8669  C  C   . THR B  1 494 ? 55.891 94.291  98.131  1.00 42.57  ? 494 THR B C   1 
ATOM   8670  O  O   . THR B  1 494 ? 56.656 94.952  97.426  1.00 42.32  ? 494 THR B O   1 
ATOM   8671  C  CB  . THR B  1 494 ? 56.763 91.984  97.557  1.00 43.60  ? 494 THR B CB  1 
ATOM   8672  O  OG1 . THR B  1 494 ? 55.598 91.684  96.781  1.00 42.47  ? 494 THR B OG1 1 
ATOM   8673  C  CG2 . THR B  1 494 ? 57.451 90.713  98.027  1.00 42.01  ? 494 THR B CG2 1 
ATOM   8674  N  N   . PHE B  1 495 ? 54.636 94.710  98.436  1.00 39.55  ? 495 PHE B N   1 
ATOM   8675  C  CA  . PHE B  1 495 ? 54.048 95.949  97.896  1.00 39.69  ? 495 PHE B CA  1 
ATOM   8676  C  C   . PHE B  1 495 ? 54.924 97.198  98.128  1.00 45.04  ? 495 PHE B C   1 
ATOM   8677  O  O   . PHE B  1 495 ? 55.298 97.847  97.148  1.00 45.25  ? 495 PHE B O   1 
ATOM   8678  C  CB  . PHE B  1 495 ? 52.620 96.212  98.429  1.00 41.53  ? 495 PHE B CB  1 
ATOM   8679  C  CG  . PHE B  1 495 ? 52.005 97.488  97.886  1.00 42.92  ? 495 PHE B CG  1 
ATOM   8680  C  CD1 . PHE B  1 495 ? 51.384 97.507  96.643  1.00 45.81  ? 495 PHE B CD1 1 
ATOM   8681  C  CD2 . PHE B  1 495 ? 52.084 98.680  98.601  1.00 45.16  ? 495 PHE B CD2 1 
ATOM   8682  C  CE1 . PHE B  1 495 ? 50.858 98.696  96.122  1.00 47.03  ? 495 PHE B CE1 1 
ATOM   8683  C  CE2 . PHE B  1 495 ? 51.562 99.869  98.077  1.00 47.85  ? 495 PHE B CE2 1 
ATOM   8684  C  CZ  . PHE B  1 495 ? 50.951 99.867  96.843  1.00 45.96  ? 495 PHE B CZ  1 
ATOM   8685  N  N   . ASP B  1 496 ? 55.214 97.554  99.398  1.00 42.14  ? 496 ASP B N   1 
ATOM   8686  C  CA  . ASP B  1 496 ? 56.000 98.749  99.754  1.00 42.25  ? 496 ASP B CA  1 
ATOM   8687  C  C   . ASP B  1 496 ? 57.387 98.749  99.089  1.00 46.16  ? 496 ASP B C   1 
ATOM   8688  O  O   . ASP B  1 496 ? 57.889 99.815  98.719  1.00 46.21  ? 496 ASP B O   1 
ATOM   8689  C  CB  . ASP B  1 496 ? 56.156 98.868  101.279 1.00 44.39  ? 496 ASP B CB  1 
ATOM   8690  C  CG  . ASP B  1 496 ? 54.846 98.849  102.045 1.00 55.36  ? 496 ASP B CG  1 
ATOM   8691  O  OD1 . ASP B  1 496 ? 54.191 99.909  102.122 1.00 56.71  ? 496 ASP B OD1 1 
ATOM   8692  O  OD2 . ASP B  1 496 ? 54.478 97.770  102.569 1.00 60.61  ? 496 ASP B OD2 1 
ATOM   8693  N  N   . ASP B  1 497 ? 57.982 97.545  98.925  1.00 41.75  ? 497 ASP B N   1 
ATOM   8694  C  CA  . ASP B  1 497 ? 59.297 97.320  98.321  1.00 40.81  ? 497 ASP B CA  1 
ATOM   8695  C  C   . ASP B  1 497 ? 59.273 97.590  96.812  1.00 43.23  ? 497 ASP B C   1 
ATOM   8696  O  O   . ASP B  1 497 ? 60.149 98.300  96.314  1.00 42.79  ? 497 ASP B O   1 
ATOM   8697  C  CB  . ASP B  1 497 ? 59.767 95.888  98.608  1.00 42.45  ? 497 ASP B CB  1 
ATOM   8698  C  CG  . ASP B  1 497 ? 60.016 95.626  100.074 1.00 52.78  ? 497 ASP B CG  1 
ATOM   8699  O  OD1 . ASP B  1 497 ? 61.148 95.869  100.532 1.00 54.46  ? 497 ASP B OD1 1 
ATOM   8700  O  OD2 . ASP B  1 497 ? 59.066 95.210  100.771 1.00 57.65  ? 497 ASP B OD2 1 
ATOM   8701  N  N   . TYR B  1 498 ? 58.269 97.031  96.094  1.00 38.70  ? 498 TYR B N   1 
ATOM   8702  C  CA  . TYR B  1 498 ? 58.086 97.212  94.649  1.00 38.02  ? 498 TYR B CA  1 
ATOM   8703  C  C   . TYR B  1 498 ? 57.687 98.652  94.316  1.00 41.29  ? 498 TYR B C   1 
ATOM   8704  O  O   . TYR B  1 498 ? 58.159 99.187  93.308  1.00 41.44  ? 498 TYR B O   1 
ATOM   8705  C  CB  . TYR B  1 498 ? 57.019 96.252  94.092  1.00 38.85  ? 498 TYR B CB  1 
ATOM   8706  C  CG  . TYR B  1 498 ? 57.496 94.859  93.738  1.00 40.82  ? 498 TYR B CG  1 
ATOM   8707  C  CD1 . TYR B  1 498 ? 58.398 94.651  92.695  1.00 42.74  ? 498 TYR B CD1 1 
ATOM   8708  C  CD2 . TYR B  1 498 ? 56.950 93.739  94.356  1.00 41.83  ? 498 TYR B CD2 1 
ATOM   8709  C  CE1 . TYR B  1 498 ? 58.804 93.366  92.335  1.00 43.78  ? 498 TYR B CE1 1 
ATOM   8710  C  CE2 . TYR B  1 498 ? 57.345 92.450  94.004  1.00 43.02  ? 498 TYR B CE2 1 
ATOM   8711  C  CZ  . TYR B  1 498 ? 58.273 92.267  92.992  1.00 51.35  ? 498 TYR B CZ  1 
ATOM   8712  O  OH  . TYR B  1 498 ? 58.652 90.990  92.648  1.00 53.77  ? 498 TYR B OH  1 
ATOM   8713  N  N   . LEU B  1 499 ? 56.812 99.271  95.158  1.00 36.25  ? 499 LEU B N   1 
ATOM   8714  C  CA  . LEU B  1 499 ? 56.320 100.647 94.999  1.00 35.51  ? 499 LEU B CA  1 
ATOM   8715  C  C   . LEU B  1 499 ? 57.492 101.637 94.934  1.00 39.48  ? 499 LEU B C   1 
ATOM   8716  O  O   . LEU B  1 499 ? 57.455 102.558 94.120  1.00 39.32  ? 499 LEU B O   1 
ATOM   8717  C  CB  . LEU B  1 499 ? 55.338 101.016 96.135  1.00 35.29  ? 499 LEU B CB  1 
ATOM   8718  C  CG  . LEU B  1 499 ? 54.830 102.473 96.224  1.00 39.40  ? 499 LEU B CG  1 
ATOM   8719  C  CD1 . LEU B  1 499 ? 53.898 102.828 95.074  1.00 39.39  ? 499 LEU B CD1 1 
ATOM   8720  C  CD2 . LEU B  1 499 ? 54.126 102.711 97.530  1.00 41.10  ? 499 LEU B CD2 1 
ATOM   8721  N  N   . GLU B  1 500 ? 58.542 101.414 95.754  1.00 35.97  ? 500 GLU B N   1 
ATOM   8722  C  CA  . GLU B  1 500 ? 59.767 102.222 95.772  1.00 35.86  ? 500 GLU B CA  1 
ATOM   8723  C  C   . GLU B  1 500 ? 60.398 102.271 94.374  1.00 39.57  ? 500 GLU B C   1 
ATOM   8724  O  O   . GLU B  1 500 ? 60.735 103.352 93.887  1.00 39.40  ? 500 GLU B O   1 
ATOM   8725  C  CB  . GLU B  1 500 ? 60.778 101.639 96.777  1.00 37.31  ? 500 GLU B CB  1 
ATOM   8726  C  CG  . GLU B  1 500 ? 60.525 102.008 98.223  1.00 46.11  ? 500 GLU B CG  1 
ATOM   8727  C  CD  . GLU B  1 500 ? 61.675 101.703 99.165  1.00 64.35  ? 500 GLU B CD  1 
ATOM   8728  O  OE1 . GLU B  1 500 ? 61.422 101.079 100.220 1.00 57.47  ? 500 GLU B OE1 1 
ATOM   8729  O  OE2 . GLU B  1 500 ? 62.822 102.113 98.868  1.00 56.30  ? 500 GLU B OE2 1 
ATOM   8730  N  N   . LEU B  1 501 ? 60.514 101.090 93.726  1.00 35.68  ? 501 LEU B N   1 
ATOM   8731  C  CA  . LEU B  1 501 ? 61.083 100.917 92.389  1.00 35.42  ? 501 LEU B CA  1 
ATOM   8732  C  C   . LEU B  1 501 ? 60.130 101.432 91.312  1.00 37.96  ? 501 LEU B C   1 
ATOM   8733  O  O   . LEU B  1 501 ? 60.596 101.914 90.277  1.00 37.85  ? 501 LEU B O   1 
ATOM   8734  C  CB  . LEU B  1 501 ? 61.444 99.440  92.122  1.00 35.53  ? 501 LEU B CB  1 
ATOM   8735  C  CG  . LEU B  1 501 ? 62.269 98.706  93.196  1.00 40.57  ? 501 LEU B CG  1 
ATOM   8736  C  CD1 . LEU B  1 501 ? 62.521 97.272  92.791  1.00 40.91  ? 501 LEU B CD1 1 
ATOM   8737  C  CD2 . LEU B  1 501 ? 63.595 99.409  93.475  1.00 43.43  ? 501 LEU B CD2 1 
ATOM   8738  N  N   . PHE B  1 502 ? 58.802 101.334 91.552  1.00 33.14  ? 502 PHE B N   1 
ATOM   8739  C  CA  . PHE B  1 502 ? 57.774 101.827 90.631  1.00 32.18  ? 502 PHE B CA  1 
ATOM   8740  C  C   . PHE B  1 502 ? 57.840 103.346 90.548  1.00 35.73  ? 502 PHE B C   1 
ATOM   8741  O  O   . PHE B  1 502 ? 57.820 103.892 89.444  1.00 36.32  ? 502 PHE B O   1 
ATOM   8742  C  CB  . PHE B  1 502 ? 56.371 101.365 91.056  1.00 33.46  ? 502 PHE B CB  1 
ATOM   8743  C  CG  . PHE B  1 502 ? 55.241 101.989 90.266  1.00 34.85  ? 502 PHE B CG  1 
ATOM   8744  C  CD1 . PHE B  1 502 ? 54.887 101.492 89.016  1.00 37.62  ? 502 PHE B CD1 1 
ATOM   8745  C  CD2 . PHE B  1 502 ? 54.524 103.064 90.778  1.00 37.03  ? 502 PHE B CD2 1 
ATOM   8746  C  CE1 . PHE B  1 502 ? 53.843 102.067 88.286  1.00 38.57  ? 502 PHE B CE1 1 
ATOM   8747  C  CE2 . PHE B  1 502 ? 53.477 103.637 90.048  1.00 40.03  ? 502 PHE B CE2 1 
ATOM   8748  C  CZ  . PHE B  1 502 ? 53.137 103.126 88.812  1.00 38.12  ? 502 PHE B CZ  1 
ATOM   8749  N  N   . LEU B  1 503 ? 57.922 104.021 91.718  1.00 30.94  ? 503 LEU B N   1 
ATOM   8750  C  CA  . LEU B  1 503 ? 58.024 105.475 91.824  1.00 30.57  ? 503 LEU B CA  1 
ATOM   8751  C  C   . LEU B  1 503 ? 59.359 105.940 91.245  1.00 35.10  ? 503 LEU B C   1 
ATOM   8752  O  O   . LEU B  1 503 ? 59.396 106.978 90.585  1.00 35.79  ? 503 LEU B O   1 
ATOM   8753  C  CB  . LEU B  1 503 ? 57.854 105.956 93.276  1.00 30.54  ? 503 LEU B CB  1 
ATOM   8754  C  CG  . LEU B  1 503 ? 56.521 105.647 93.971  1.00 34.67  ? 503 LEU B CG  1 
ATOM   8755  C  CD1 . LEU B  1 503 ? 56.633 105.865 95.446  1.00 35.17  ? 503 LEU B CD1 1 
ATOM   8756  C  CD2 . LEU B  1 503 ? 55.374 106.470 93.412  1.00 37.04  ? 503 LEU B CD2 1 
ATOM   8757  N  N   . GLN B  1 504 ? 60.438 105.143 91.448  1.00 30.93  ? 504 GLN B N   1 
ATOM   8758  C  CA  . GLN B  1 504 ? 61.770 105.388 90.884  1.00 30.79  ? 504 GLN B CA  1 
ATOM   8759  C  C   . GLN B  1 504 ? 61.668 105.422 89.363  1.00 35.62  ? 504 GLN B C   1 
ATOM   8760  O  O   . GLN B  1 504 ? 62.068 106.410 88.750  1.00 35.63  ? 504 GLN B O   1 
ATOM   8761  C  CB  . GLN B  1 504 ? 62.756 104.300 91.326  1.00 31.73  ? 504 GLN B CB  1 
ATOM   8762  C  CG  . GLN B  1 504 ? 63.591 104.668 92.533  1.00 43.28  ? 504 GLN B CG  1 
ATOM   8763  C  CD  . GLN B  1 504 ? 64.682 103.661 92.813  1.00 58.93  ? 504 GLN B CD  1 
ATOM   8764  O  OE1 . GLN B  1 504 ? 65.065 102.844 91.965  1.00 52.99  ? 504 GLN B OE1 1 
ATOM   8765  N  NE2 . GLN B  1 504 ? 65.234 103.720 94.011  1.00 50.77  ? 504 GLN B NE2 1 
ATOM   8766  N  N   . PHE B  1 505 ? 61.046 104.370 88.768  1.00 32.54  ? 505 PHE B N   1 
ATOM   8767  C  CA  . PHE B  1 505 ? 60.794 104.235 87.332  1.00 32.81  ? 505 PHE B CA  1 
ATOM   8768  C  C   . PHE B  1 505 ? 59.939 105.394 86.826  1.00 39.01  ? 505 PHE B C   1 
ATOM   8769  O  O   . PHE B  1 505 ? 60.082 105.803 85.672  1.00 39.58  ? 505 PHE B O   1 
ATOM   8770  C  CB  . PHE B  1 505 ? 60.104 102.895 87.022  1.00 34.09  ? 505 PHE B CB  1 
ATOM   8771  C  CG  . PHE B  1 505 ? 59.914 102.584 85.551  1.00 35.42  ? 505 PHE B CG  1 
ATOM   8772  C  CD1 . PHE B  1 505 ? 61.009 102.395 84.714  1.00 38.38  ? 505 PHE B CD1 1 
ATOM   8773  C  CD2 . PHE B  1 505 ? 58.642 102.436 85.015  1.00 37.06  ? 505 PHE B CD2 1 
ATOM   8774  C  CE1 . PHE B  1 505 ? 60.832 102.095 83.361  1.00 39.34  ? 505 PHE B CE1 1 
ATOM   8775  C  CE2 . PHE B  1 505 ? 58.467 102.132 83.663  1.00 39.97  ? 505 PHE B CE2 1 
ATOM   8776  C  CZ  . PHE B  1 505 ? 59.563 101.962 82.846  1.00 38.31  ? 505 PHE B CZ  1 
ATOM   8777  N  N   . GLY B  1 506 ? 59.076 105.911 87.704  1.00 35.88  ? 506 GLY B N   1 
ATOM   8778  C  CA  . GLY B  1 506 ? 58.206 107.043 87.430  1.00 36.22  ? 506 GLY B CA  1 
ATOM   8779  C  C   . GLY B  1 506 ? 58.980 108.324 87.199  1.00 42.02  ? 506 GLY B C   1 
ATOM   8780  O  O   . GLY B  1 506 ? 58.799 108.965 86.162  1.00 42.40  ? 506 GLY B O   1 
ATOM   8781  N  N   . TYR B  1 507 ? 59.881 108.686 88.144  1.00 38.78  ? 507 TYR B N   1 
ATOM   8782  C  CA  . TYR B  1 507 ? 60.717 109.891 88.058  1.00 39.23  ? 507 TYR B CA  1 
ATOM   8783  C  C   . TYR B  1 507 ? 61.706 109.835 86.886  1.00 43.75  ? 507 TYR B C   1 
ATOM   8784  O  O   . TYR B  1 507 ? 61.992 110.872 86.279  1.00 43.42  ? 507 TYR B O   1 
ATOM   8785  C  CB  . TYR B  1 507 ? 61.521 110.126 89.356  1.00 40.78  ? 507 TYR B CB  1 
ATOM   8786  C  CG  . TYR B  1 507 ? 60.778 109.939 90.664  1.00 42.47  ? 507 TYR B CG  1 
ATOM   8787  C  CD1 . TYR B  1 507 ? 59.606 110.642 90.933  1.00 44.43  ? 507 TYR B CD1 1 
ATOM   8788  C  CD2 . TYR B  1 507 ? 61.317 109.162 91.685  1.00 42.94  ? 507 TYR B CD2 1 
ATOM   8789  C  CE1 . TYR B  1 507 ? 58.935 110.493 92.145  1.00 44.57  ? 507 TYR B CE1 1 
ATOM   8790  C  CE2 . TYR B  1 507 ? 60.657 109.008 92.901  1.00 43.59  ? 507 TYR B CE2 1 
ATOM   8791  C  CZ  . TYR B  1 507 ? 59.468 109.679 93.129  1.00 50.95  ? 507 TYR B CZ  1 
ATOM   8792  O  OH  . TYR B  1 507 ? 58.820 109.534 94.331  1.00 53.68  ? 507 TYR B OH  1 
ATOM   8793  N  N   . VAL B  1 508 ? 62.241 108.629 86.591  1.00 40.65  ? 508 VAL B N   1 
ATOM   8794  C  CA  . VAL B  1 508 ? 63.237 108.389 85.542  1.00 40.61  ? 508 VAL B CA  1 
ATOM   8795  C  C   . VAL B  1 508 ? 62.601 108.446 84.139  1.00 44.34  ? 508 VAL B C   1 
ATOM   8796  O  O   . VAL B  1 508 ? 63.038 109.257 83.331  1.00 44.33  ? 508 VAL B O   1 
ATOM   8797  C  CB  . VAL B  1 508 ? 64.019 107.060 85.767  1.00 43.84  ? 508 VAL B CB  1 
ATOM   8798  C  CG1 . VAL B  1 508 ? 64.967 106.762 84.605  1.00 43.89  ? 508 VAL B CG1 1 
ATOM   8799  C  CG2 . VAL B  1 508 ? 64.792 107.097 87.081  1.00 43.65  ? 508 VAL B CG2 1 
ATOM   8800  N  N   . SER B  1 509 ? 61.622 107.576 83.832  1.00 40.48  ? 509 SER B N   1 
ATOM   8801  C  CA  . SER B  1 509 ? 61.017 107.519 82.496  1.00 40.68  ? 509 SER B CA  1 
ATOM   8802  C  C   . SER B  1 509 ? 60.272 108.805 82.095  1.00 45.38  ? 509 SER B C   1 
ATOM   8803  O  O   . SER B  1 509 ? 60.275 109.160 80.916  1.00 45.48  ? 509 SER B O   1 
ATOM   8804  C  CB  . SER B  1 509 ? 60.070 106.328 82.376  1.00 43.65  ? 509 SER B CB  1 
ATOM   8805  O  OG  . SER B  1 509 ? 58.965 106.436 83.259  1.00 51.25  ? 509 SER B OG  1 
ATOM   8806  N  N   . LEU B  1 510 ? 59.652 109.495 83.069  1.00 41.74  ? 510 LEU B N   1 
ATOM   8807  C  CA  . LEU B  1 510 ? 58.849 110.695 82.832  1.00 41.62  ? 510 LEU B CA  1 
ATOM   8808  C  C   . LEU B  1 510 ? 59.680 111.981 82.743  1.00 46.92  ? 510 LEU B C   1 
ATOM   8809  O  O   . LEU B  1 510 ? 59.691 112.623 81.690  1.00 46.94  ? 510 LEU B O   1 
ATOM   8810  C  CB  . LEU B  1 510 ? 57.795 110.850 83.952  1.00 41.07  ? 510 LEU B CB  1 
ATOM   8811  C  CG  . LEU B  1 510 ? 56.382 110.275 83.759  1.00 44.79  ? 510 LEU B CG  1 
ATOM   8812  C  CD1 . LEU B  1 510 ? 56.402 108.805 83.439  1.00 44.59  ? 510 LEU B CD1 1 
ATOM   8813  C  CD2 . LEU B  1 510 ? 55.559 110.466 85.016  1.00 45.59  ? 510 LEU B CD2 1 
ATOM   8814  N  N   . PHE B  1 511 ? 60.350 112.366 83.848  1.00 44.27  ? 511 PHE B N   1 
ATOM   8815  C  CA  . PHE B  1 511 ? 61.064 113.637 83.957  1.00 44.90  ? 511 PHE B CA  1 
ATOM   8816  C  C   . PHE B  1 511 ? 62.605 113.523 83.885  1.00 50.88  ? 511 PHE B C   1 
ATOM   8817  O  O   . PHE B  1 511 ? 63.292 114.234 84.620  1.00 51.24  ? 511 PHE B O   1 
ATOM   8818  C  CB  . PHE B  1 511 ? 60.648 114.350 85.263  1.00 46.30  ? 511 PHE B CB  1 
ATOM   8819  C  CG  . PHE B  1 511 ? 59.156 114.436 85.502  1.00 47.00  ? 511 PHE B CG  1 
ATOM   8820  C  CD1 . PHE B  1 511 ? 58.379 115.372 84.827  1.00 50.06  ? 511 PHE B CD1 1 
ATOM   8821  C  CD2 . PHE B  1 511 ? 58.533 113.597 86.416  1.00 47.94  ? 511 PHE B CD2 1 
ATOM   8822  C  CE1 . PHE B  1 511 ? 57.000 115.451 85.049  1.00 50.53  ? 511 PHE B CE1 1 
ATOM   8823  C  CE2 . PHE B  1 511 ? 57.154 113.678 86.638  1.00 50.42  ? 511 PHE B CE2 1 
ATOM   8824  C  CZ  . PHE B  1 511 ? 56.397 114.601 85.949  1.00 48.89  ? 511 PHE B CZ  1 
ATOM   8825  N  N   . SER B  1 512 ? 63.149 112.703 82.964  1.00 48.29  ? 512 SER B N   1 
ATOM   8826  C  CA  . SER B  1 512 ? 64.606 112.607 82.808  1.00 49.04  ? 512 SER B CA  1 
ATOM   8827  C  C   . SER B  1 512 ? 65.156 113.802 82.023  1.00 55.76  ? 512 SER B C   1 
ATOM   8828  O  O   . SER B  1 512 ? 66.319 114.165 82.209  1.00 56.30  ? 512 SER B O   1 
ATOM   8829  C  CB  . SER B  1 512 ? 65.014 111.305 82.133  1.00 52.10  ? 512 SER B CB  1 
ATOM   8830  O  OG  . SER B  1 512 ? 65.495 110.396 83.108  1.00 58.45  ? 512 SER B OG  1 
ATOM   8831  N  N   . CYS B  1 513 ? 64.321 114.426 81.166  1.00 53.11  ? 513 CYS B N   1 
ATOM   8832  C  CA  . CYS B  1 513 ? 64.716 115.603 80.392  1.00 54.05  ? 513 CYS B CA  1 
ATOM   8833  C  C   . CYS B  1 513 ? 64.839 116.834 81.303  1.00 57.12  ? 513 CYS B C   1 
ATOM   8834  O  O   . CYS B  1 513 ? 65.662 117.709 81.030  1.00 57.86  ? 513 CYS B O   1 
ATOM   8835  C  CB  . CYS B  1 513 ? 63.740 115.850 79.248  1.00 55.04  ? 513 CYS B CB  1 
ATOM   8836  S  SG  . CYS B  1 513 ? 63.858 114.638 77.908  1.00 59.11  ? 513 CYS B SG  1 
ATOM   8837  N  N   . VAL B  1 514 ? 64.045 116.885 82.391  1.00 51.88  ? 514 VAL B N   1 
ATOM   8838  C  CA  . VAL B  1 514 ? 64.072 117.980 83.365  1.00 51.77  ? 514 VAL B CA  1 
ATOM   8839  C  C   . VAL B  1 514 ? 65.180 117.704 84.401  1.00 54.40  ? 514 VAL B C   1 
ATOM   8840  O  O   . VAL B  1 514 ? 66.010 118.579 84.650  1.00 55.12  ? 514 VAL B O   1 
ATOM   8841  C  CB  . VAL B  1 514 ? 62.693 118.211 84.042  1.00 55.55  ? 514 VAL B CB  1 
ATOM   8842  C  CG1 . VAL B  1 514 ? 62.728 119.428 84.962  1.00 56.05  ? 514 VAL B CG1 1 
ATOM   8843  C  CG2 . VAL B  1 514 ? 61.587 118.363 83.004  1.00 55.30  ? 514 VAL B CG2 1 
ATOM   8844  N  N   . TYR B  1 515 ? 65.182 116.491 84.995  1.00 48.80  ? 515 TYR B N   1 
ATOM   8845  C  CA  . TYR B  1 515 ? 66.147 116.041 86.002  1.00 48.14  ? 515 TYR B CA  1 
ATOM   8846  C  C   . TYR B  1 515 ? 67.009 114.912 85.406  1.00 51.48  ? 515 TYR B C   1 
ATOM   8847  O  O   . TYR B  1 515 ? 66.623 113.744 85.497  1.00 50.67  ? 515 TYR B O   1 
ATOM   8848  C  CB  . TYR B  1 515 ? 65.402 115.578 87.265  1.00 48.46  ? 515 TYR B CB  1 
ATOM   8849  C  CG  . TYR B  1 515 ? 66.227 115.622 88.529  1.00 50.45  ? 515 TYR B CG  1 
ATOM   8850  C  CD1 . TYR B  1 515 ? 66.271 116.769 89.316  1.00 53.20  ? 515 TYR B CD1 1 
ATOM   8851  C  CD2 . TYR B  1 515 ? 66.914 114.499 88.975  1.00 50.84  ? 515 TYR B CD2 1 
ATOM   8852  C  CE1 . TYR B  1 515 ? 67.004 116.806 90.501  1.00 54.50  ? 515 TYR B CE1 1 
ATOM   8853  C  CE2 . TYR B  1 515 ? 67.648 114.522 90.160  1.00 52.02  ? 515 TYR B CE2 1 
ATOM   8854  C  CZ  . TYR B  1 515 ? 67.688 115.677 90.922  1.00 59.95  ? 515 TYR B CZ  1 
ATOM   8855  O  OH  . TYR B  1 515 ? 68.414 115.707 92.086  1.00 60.65  ? 515 TYR B OH  1 
ATOM   8856  N  N   . PRO B  1 516 ? 68.158 115.230 84.761  1.00 47.92  ? 516 PRO B N   1 
ATOM   8857  C  CA  . PRO B  1 516 ? 68.957 114.175 84.114  1.00 47.34  ? 516 PRO B CA  1 
ATOM   8858  C  C   . PRO B  1 516 ? 69.634 113.191 85.072  1.00 50.54  ? 516 PRO B C   1 
ATOM   8859  O  O   . PRO B  1 516 ? 69.983 112.093 84.639  1.00 49.81  ? 516 PRO B O   1 
ATOM   8860  C  CB  . PRO B  1 516 ? 70.006 114.962 83.322  1.00 50.07  ? 516 PRO B CB  1 
ATOM   8861  C  CG  . PRO B  1 516 ? 69.490 116.353 83.237  1.00 55.10  ? 516 PRO B CG  1 
ATOM   8862  C  CD  . PRO B  1 516 ? 68.753 116.557 84.518  1.00 50.37  ? 516 PRO B CD  1 
ATOM   8863  N  N   . LEU B  1 517 ? 69.810 113.566 86.355  1.00 47.02  ? 517 LEU B N   1 
ATOM   8864  C  CA  . LEU B  1 517 ? 70.445 112.716 87.368  1.00 46.72  ? 517 LEU B CA  1 
ATOM   8865  C  C   . LEU B  1 517 ? 69.441 111.770 88.062  1.00 51.57  ? 517 LEU B C   1 
ATOM   8866  O  O   . LEU B  1 517 ? 69.813 111.092 89.028  1.00 51.28  ? 517 LEU B O   1 
ATOM   8867  C  CB  . LEU B  1 517 ? 71.146 113.579 88.430  1.00 47.24  ? 517 LEU B CB  1 
ATOM   8868  C  CG  . LEU B  1 517 ? 72.296 114.485 88.003  1.00 52.99  ? 517 LEU B CG  1 
ATOM   8869  C  CD1 . LEU B  1 517 ? 72.786 115.286 89.189  1.00 53.72  ? 517 LEU B CD1 1 
ATOM   8870  C  CD2 . LEU B  1 517 ? 73.458 113.687 87.403  1.00 55.89  ? 517 LEU B CD2 1 
ATOM   8871  N  N   . ALA B  1 518 ? 68.177 111.727 87.572  1.00 48.14  ? 518 ALA B N   1 
ATOM   8872  C  CA  . ALA B  1 518 ? 67.100 110.897 88.116  1.00 47.29  ? 518 ALA B CA  1 
ATOM   8873  C  C   . ALA B  1 518 ? 67.519 109.436 88.218  1.00 51.28  ? 518 ALA B C   1 
ATOM   8874  O  O   . ALA B  1 518 ? 67.405 108.854 89.297  1.00 50.90  ? 518 ALA B O   1 
ATOM   8875  C  CB  . ALA B  1 518 ? 65.852 111.024 87.260  1.00 47.75  ? 518 ALA B CB  1 
ATOM   8876  N  N   . ALA B  1 519 ? 68.055 108.867 87.120  1.00 48.08  ? 519 ALA B N   1 
ATOM   8877  C  CA  . ALA B  1 519 ? 68.520 107.480 87.073  1.00 47.78  ? 519 ALA B CA  1 
ATOM   8878  C  C   . ALA B  1 519 ? 69.813 107.281 87.868  1.00 51.96  ? 519 ALA B C   1 
ATOM   8879  O  O   . ALA B  1 519 ? 70.006 106.201 88.420  1.00 51.31  ? 519 ALA B O   1 
ATOM   8880  C  CB  . ALA B  1 519 ? 68.716 107.038 85.637  1.00 48.64  ? 519 ALA B CB  1 
ATOM   8881  N  N   . ALA B  1 520 ? 70.681 108.319 87.949  1.00 48.98  ? 520 ALA B N   1 
ATOM   8882  C  CA  . ALA B  1 520 ? 71.940 108.265 88.701  1.00 48.99  ? 520 ALA B CA  1 
ATOM   8883  C  C   . ALA B  1 520 ? 71.679 108.063 90.194  1.00 51.99  ? 520 ALA B C   1 
ATOM   8884  O  O   . ALA B  1 520 ? 72.307 107.193 90.793  1.00 51.58  ? 520 ALA B O   1 
ATOM   8885  C  CB  . ALA B  1 520 ? 72.758 109.529 88.472  1.00 50.57  ? 520 ALA B CB  1 
ATOM   8886  N  N   . PHE B  1 521 ? 70.723 108.821 90.777  1.00 48.13  ? 521 PHE B N   1 
ATOM   8887  C  CA  . PHE B  1 521 ? 70.376 108.699 92.197  1.00 47.75  ? 521 PHE B CA  1 
ATOM   8888  C  C   . PHE B  1 521 ? 69.532 107.452 92.464  1.00 51.35  ? 521 PHE B C   1 
ATOM   8889  O  O   . PHE B  1 521 ? 69.574 106.923 93.578  1.00 51.07  ? 521 PHE B O   1 
ATOM   8890  C  CB  . PHE B  1 521 ? 69.664 109.955 92.714  1.00 49.49  ? 521 PHE B CB  1 
ATOM   8891  C  CG  . PHE B  1 521 ? 70.545 111.181 92.738  1.00 51.61  ? 521 PHE B CG  1 
ATOM   8892  C  CD1 . PHE B  1 521 ? 71.746 111.183 93.438  1.00 54.92  ? 521 PHE B CD1 1 
ATOM   8893  C  CD2 . PHE B  1 521 ? 70.165 112.342 92.077  1.00 53.94  ? 521 PHE B CD2 1 
ATOM   8894  C  CE1 . PHE B  1 521 ? 72.562 112.314 93.452  1.00 56.84  ? 521 PHE B CE1 1 
ATOM   8895  C  CE2 . PHE B  1 521 ? 70.978 113.477 92.101  1.00 57.55  ? 521 PHE B CE2 1 
ATOM   8896  C  CZ  . PHE B  1 521 ? 72.171 113.455 92.787  1.00 56.24  ? 521 PHE B CZ  1 
ATOM   8897  N  N   . ALA B  1 522 ? 68.787 106.974 91.443  1.00 47.01  ? 522 ALA B N   1 
ATOM   8898  C  CA  . ALA B  1 522 ? 67.979 105.761 91.542  1.00 45.73  ? 522 ALA B CA  1 
ATOM   8899  C  C   . ALA B  1 522 ? 68.896 104.542 91.711  1.00 49.51  ? 522 ALA B C   1 
ATOM   8900  O  O   . ALA B  1 522 ? 68.658 103.736 92.610  1.00 49.44  ? 522 ALA B O   1 
ATOM   8901  C  CB  . ALA B  1 522 ? 67.095 105.609 90.314  1.00 45.94  ? 522 ALA B CB  1 
ATOM   8902  N  N   . VAL B  1 523 ? 69.981 104.454 90.900  1.00 45.55  ? 523 VAL B N   1 
ATOM   8903  C  CA  . VAL B  1 523 ? 70.979 103.373 90.942  1.00 45.13  ? 523 VAL B CA  1 
ATOM   8904  C  C   . VAL B  1 523 ? 71.745 103.424 92.277  1.00 48.96  ? 523 VAL B C   1 
ATOM   8905  O  O   . VAL B  1 523 ? 71.986 102.372 92.875  1.00 49.38  ? 523 VAL B O   1 
ATOM   8906  C  CB  . VAL B  1 523 ? 71.954 103.401 89.728  1.00 49.37  ? 523 VAL B CB  1 
ATOM   8907  C  CG1 . VAL B  1 523 ? 72.923 102.228 89.768  1.00 49.51  ? 523 VAL B CG1 1 
ATOM   8908  C  CG2 . VAL B  1 523 ? 71.202 103.393 88.407  1.00 48.87  ? 523 VAL B CG2 1 
ATOM   8909  N  N   . LEU B  1 524 ? 72.106 104.638 92.746  1.00 44.57  ? 524 LEU B N   1 
ATOM   8910  C  CA  . LEU B  1 524 ? 72.840 104.827 94.002  1.00 44.33  ? 524 LEU B CA  1 
ATOM   8911  C  C   . LEU B  1 524 ? 72.034 104.334 95.200  1.00 46.71  ? 524 LEU B C   1 
ATOM   8912  O  O   . LEU B  1 524 ? 72.602 103.661 96.061  1.00 46.16  ? 524 LEU B O   1 
ATOM   8913  C  CB  . LEU B  1 524 ? 73.260 106.292 94.203  1.00 45.00  ? 524 LEU B CB  1 
ATOM   8914  C  CG  . LEU B  1 524 ? 74.419 106.786 93.327  1.00 50.54  ? 524 LEU B CG  1 
ATOM   8915  C  CD1 . LEU B  1 524 ? 74.446 108.297 93.267  1.00 51.36  ? 524 LEU B CD1 1 
ATOM   8916  C  CD2 . LEU B  1 524 ? 75.760 106.237 93.795  1.00 53.75  ? 524 LEU B CD2 1 
ATOM   8917  N  N   . ASN B  1 525 ? 70.714 104.628 95.237  1.00 42.54  ? 525 ASN B N   1 
ATOM   8918  C  CA  . ASN B  1 525 ? 69.830 104.170 96.315  1.00 41.96  ? 525 ASN B CA  1 
ATOM   8919  C  C   . ASN B  1 525 ? 69.672 102.658 96.258  1.00 47.20  ? 525 ASN B C   1 
ATOM   8920  O  O   . ASN B  1 525 ? 69.721 102.007 97.298  1.00 47.10  ? 525 ASN B O   1 
ATOM   8921  C  CB  . ASN B  1 525 ? 68.460 104.845 96.251  1.00 40.07  ? 525 ASN B CB  1 
ATOM   8922  C  CG  . ASN B  1 525 ? 67.471 104.281 97.246  1.00 55.17  ? 525 ASN B CG  1 
ATOM   8923  O  OD1 . ASN B  1 525 ? 67.478 104.625 98.430  1.00 49.36  ? 525 ASN B OD1 1 
ATOM   8924  N  ND2 . ASN B  1 525 ? 66.621 103.369 96.794  1.00 43.66  ? 525 ASN B ND2 1 
ATOM   8925  N  N   . ASN B  1 526 ? 69.488 102.110 95.038  1.00 44.26  ? 526 ASN B N   1 
ATOM   8926  C  CA  . ASN B  1 526 ? 69.313 100.684 94.783  1.00 44.01  ? 526 ASN B CA  1 
ATOM   8927  C  C   . ASN B  1 526 ? 70.571 99.876  95.132  1.00 49.49  ? 526 ASN B C   1 
ATOM   8928  O  O   . ASN B  1 526 ? 70.454 98.684  95.428  1.00 49.13  ? 526 ASN B O   1 
ATOM   8929  C  CB  . ASN B  1 526 ? 68.892 100.445 93.338  1.00 44.36  ? 526 ASN B CB  1 
ATOM   8930  C  CG  . ASN B  1 526 ? 67.464 100.845 93.029  1.00 66.99  ? 526 ASN B CG  1 
ATOM   8931  O  OD1 . ASN B  1 526 ? 66.621 101.043 93.916  1.00 59.58  ? 526 ASN B OD1 1 
ATOM   8932  N  ND2 . ASN B  1 526 ? 67.157 100.972 91.749  1.00 60.17  ? 526 ASN B ND2 1 
ATOM   8933  N  N   . PHE B  1 527 ? 71.756 100.525 95.140  1.00 47.50  ? 527 PHE B N   1 
ATOM   8934  C  CA  . PHE B  1 527 ? 73.028 99.896  95.508  1.00 48.38  ? 527 PHE B CA  1 
ATOM   8935  C  C   . PHE B  1 527 ? 73.056 99.546  96.996  1.00 52.42  ? 527 PHE B C   1 
ATOM   8936  O  O   . PHE B  1 527 ? 73.723 98.586  97.388  1.00 51.62  ? 527 PHE B O   1 
ATOM   8937  C  CB  . PHE B  1 527 ? 74.214 100.808 95.165  1.00 51.26  ? 527 PHE B CB  1 
ATOM   8938  C  CG  . PHE B  1 527 ? 74.722 100.744 93.743  1.00 53.53  ? 527 PHE B CG  1 
ATOM   8939  C  CD1 . PHE B  1 527 ? 74.632 99.567  93.005  1.00 56.51  ? 527 PHE B CD1 1 
ATOM   8940  C  CD2 . PHE B  1 527 ? 75.355 101.839 93.166  1.00 56.86  ? 527 PHE B CD2 1 
ATOM   8941  C  CE1 . PHE B  1 527 ? 75.125 99.501  91.701  1.00 58.02  ? 527 PHE B CE1 1 
ATOM   8942  C  CE2 . PHE B  1 527 ? 75.859 101.770 91.866  1.00 60.18  ? 527 PHE B CE2 1 
ATOM   8943  C  CZ  . PHE B  1 527 ? 75.742 100.600 91.142  1.00 58.06  ? 527 PHE B CZ  1 
ATOM   8944  N  N   . THR B  1 528 ? 72.335 100.337 97.815  1.00 49.72  ? 528 THR B N   1 
ATOM   8945  C  CA  . THR B  1 528 ? 72.211 100.136 99.260  1.00 49.80  ? 528 THR B CA  1 
ATOM   8946  C  C   . THR B  1 528 ? 70.866 99.461  99.589  1.00 52.74  ? 528 THR B C   1 
ATOM   8947  O  O   . THR B  1 528 ? 70.766 98.807  100.626 1.00 52.95  ? 528 THR B O   1 
ATOM   8948  C  CB  . THR B  1 528 ? 72.385 101.458 100.032 1.00 57.06  ? 528 THR B CB  1 
ATOM   8949  O  OG1 . THR B  1 528 ? 71.410 102.404 99.595  1.00 56.92  ? 528 THR B OG1 1 
ATOM   8950  C  CG2 . THR B  1 528 ? 73.786 102.041 99.898  1.00 55.64  ? 528 THR B CG2 1 
ATOM   8951  N  N   . GLU B  1 529 ? 69.849 99.599  98.699  1.00 47.48  ? 529 GLU B N   1 
ATOM   8952  C  CA  . GLU B  1 529 ? 68.506 99.022  98.861  1.00 45.81  ? 529 GLU B CA  1 
ATOM   8953  C  C   . GLU B  1 529 ? 68.573 97.499  98.975  1.00 48.17  ? 529 GLU B C   1 
ATOM   8954  O  O   . GLU B  1 529 ? 67.864 96.931  99.798  1.00 47.34  ? 529 GLU B O   1 
ATOM   8955  C  CB  . GLU B  1 529 ? 67.585 99.434  97.698  1.00 46.47  ? 529 GLU B CB  1 
ATOM   8956  C  CG  . GLU B  1 529 ? 66.098 99.226  97.946  1.00 55.36  ? 529 GLU B CG  1 
ATOM   8957  C  CD  . GLU B  1 529 ? 65.414 100.130 98.958  1.00 77.12  ? 529 GLU B CD  1 
ATOM   8958  O  OE1 . GLU B  1 529 ? 65.826 101.305 99.096  1.00 68.26  ? 529 GLU B OE1 1 
ATOM   8959  O  OE2 . GLU B  1 529 ? 64.424 99.673  99.575  1.00 73.76  ? 529 GLU B OE2 1 
ATOM   8960  N  N   . VAL B  1 530 ? 69.424 96.851  98.159  1.00 44.04  ? 530 VAL B N   1 
ATOM   8961  C  CA  . VAL B  1 530 ? 69.649 95.403  98.146  1.00 43.48  ? 530 VAL B CA  1 
ATOM   8962  C  C   . VAL B  1 530 ? 70.118 94.921  99.542  1.00 47.43  ? 530 VAL B C   1 
ATOM   8963  O  O   . VAL B  1 530 ? 69.563 93.950  100.056 1.00 47.30  ? 530 VAL B O   1 
ATOM   8964  C  CB  . VAL B  1 530 ? 70.627 94.980  97.007  1.00 47.60  ? 530 VAL B CB  1 
ATOM   8965  C  CG1 . VAL B  1 530 ? 71.811 95.938  96.877  1.00 48.03  ? 530 VAL B CG1 1 
ATOM   8966  C  CG2 . VAL B  1 530 ? 71.109 93.544  97.172  1.00 47.66  ? 530 VAL B CG2 1 
ATOM   8967  N  N   . ASN B  1 531 ? 71.096 95.625  100.156 1.00 43.24  ? 531 ASN B N   1 
ATOM   8968  C  CA  . ASN B  1 531 ? 71.652 95.303  101.474 1.00 42.67  ? 531 ASN B CA  1 
ATOM   8969  C  C   . ASN B  1 531 ? 70.690 95.689  102.599 1.00 44.72  ? 531 ASN B C   1 
ATOM   8970  O  O   . ASN B  1 531 ? 70.604 94.964  103.594 1.00 44.42  ? 531 ASN B O   1 
ATOM   8971  C  CB  . ASN B  1 531 ? 72.998 95.996  101.679 1.00 43.87  ? 531 ASN B CB  1 
ATOM   8972  C  CG  . ASN B  1 531 ? 73.946 95.856  100.518 1.00 70.69  ? 531 ASN B CG  1 
ATOM   8973  O  OD1 . ASN B  1 531 ? 74.284 94.749  100.083 1.00 67.12  ? 531 ASN B OD1 1 
ATOM   8974  N  ND2 . ASN B  1 531 ? 74.388 96.985  99.986  1.00 64.65  ? 531 ASN B ND2 1 
ATOM   8975  N  N   . SER B  1 532 ? 69.980 96.831  102.444 1.00 39.74  ? 532 SER B N   1 
ATOM   8976  C  CA  . SER B  1 532 ? 69.001 97.341  103.405 1.00 38.91  ? 532 SER B CA  1 
ATOM   8977  C  C   . SER B  1 532 ? 67.789 96.399  103.498 1.00 41.84  ? 532 SER B C   1 
ATOM   8978  O  O   . SER B  1 532 ? 67.356 96.094  104.607 1.00 41.37  ? 532 SER B O   1 
ATOM   8979  C  CB  . SER B  1 532 ? 68.566 98.755  103.031 1.00 42.05  ? 532 SER B CB  1 
ATOM   8980  O  OG  . SER B  1 532 ? 67.197 99.007  103.304 1.00 52.04  ? 532 SER B OG  1 
ATOM   8981  N  N   . ASP B  1 533 ? 67.262 95.932  102.341 1.00 37.36  ? 533 ASP B N   1 
ATOM   8982  C  CA  . ASP B  1 533 ? 66.133 95.003  102.279 1.00 36.10  ? 533 ASP B CA  1 
ATOM   8983  C  C   . ASP B  1 533 ? 66.557 93.590  102.672 1.00 40.45  ? 533 ASP B C   1 
ATOM   8984  O  O   . ASP B  1 533 ? 65.707 92.822  103.123 1.00 40.54  ? 533 ASP B O   1 
ATOM   8985  C  CB  . ASP B  1 533 ? 65.474 94.995  100.894 1.00 37.04  ? 533 ASP B CB  1 
ATOM   8986  C  CG  . ASP B  1 533 ? 64.656 96.230  100.586 1.00 46.13  ? 533 ASP B CG  1 
ATOM   8987  O  OD1 . ASP B  1 533 ? 63.956 96.725  101.496 1.00 47.17  ? 533 ASP B OD1 1 
ATOM   8988  O  OD2 . ASP B  1 533 ? 64.672 96.672  99.425  1.00 51.50  ? 533 ASP B OD2 1 
ATOM   8989  N  N   . ALA B  1 534 ? 67.854 93.242  102.513 1.00 36.91  ? 534 ALA B N   1 
ATOM   8990  C  CA  . ALA B  1 534 ? 68.362 91.927  102.913 1.00 37.08  ? 534 ALA B CA  1 
ATOM   8991  C  C   . ALA B  1 534 ? 68.436 91.840  104.447 1.00 42.08  ? 534 ALA B C   1 
ATOM   8992  O  O   . ALA B  1 534 ? 67.982 90.849  105.014 1.00 41.91  ? 534 ALA B O   1 
ATOM   8993  C  CB  . ALA B  1 534 ? 69.717 91.662  102.288 1.00 38.17  ? 534 ALA B CB  1 
ATOM   8994  N  N   . LEU B  1 535 ? 68.942 92.909  105.112 1.00 39.14  ? 535 LEU B N   1 
ATOM   8995  C  CA  . LEU B  1 535 ? 69.036 93.048  106.575 1.00 39.26  ? 535 LEU B CA  1 
ATOM   8996  C  C   . LEU B  1 535 ? 67.628 93.031  107.200 1.00 43.34  ? 535 LEU B C   1 
ATOM   8997  O  O   . LEU B  1 535 ? 67.431 92.464  108.273 1.00 43.67  ? 535 LEU B O   1 
ATOM   8998  C  CB  . LEU B  1 535 ? 69.774 94.364  106.919 1.00 39.53  ? 535 LEU B CB  1 
ATOM   8999  C  CG  . LEU B  1 535 ? 69.803 94.809  108.387 1.00 44.39  ? 535 LEU B CG  1 
ATOM   9000  C  CD1 . LEU B  1 535 ? 70.984 94.211  109.121 1.00 45.42  ? 535 LEU B CD1 1 
ATOM   9001  C  CD2 . LEU B  1 535 ? 69.836 96.316  108.494 1.00 46.65  ? 535 LEU B CD2 1 
ATOM   9002  N  N   . LYS B  1 536 ? 66.667 93.663  106.507 1.00 39.40  ? 536 LYS B N   1 
ATOM   9003  C  CA  . LYS B  1 536 ? 65.245 93.789  106.828 1.00 38.59  ? 536 LYS B CA  1 
ATOM   9004  C  C   . LYS B  1 536 ? 64.584 92.392  106.870 1.00 44.19  ? 536 LYS B C   1 
ATOM   9005  O  O   . LYS B  1 536 ? 63.847 92.087  107.808 1.00 43.86  ? 536 LYS B O   1 
ATOM   9006  C  CB  . LYS B  1 536 ? 64.611 94.687  105.746 1.00 39.47  ? 536 LYS B CB  1 
ATOM   9007  C  CG  . LYS B  1 536 ? 63.132 94.975  105.836 1.00 40.65  ? 536 LYS B CG  1 
ATOM   9008  C  CD  . LYS B  1 536 ? 62.629 95.476  104.484 1.00 41.98  ? 536 LYS B CD  1 
ATOM   9009  C  CE  . LYS B  1 536 ? 61.245 96.068  104.557 1.00 45.43  ? 536 LYS B CE  1 
ATOM   9010  N  NZ  . LYS B  1 536 ? 60.767 96.506  103.226 1.00 48.91  ? 536 LYS B NZ  1 
ATOM   9011  N  N   . MET B  1 537 ? 64.886 91.541  105.869 1.00 41.68  ? 537 MET B N   1 
ATOM   9012  C  CA  . MET B  1 537 ? 64.335 90.188  105.747 1.00 41.77  ? 537 MET B CA  1 
ATOM   9013  C  C   . MET B  1 537 ? 65.045 89.168  106.642 1.00 45.86  ? 537 MET B C   1 
ATOM   9014  O  O   . MET B  1 537 ? 64.458 88.135  106.964 1.00 45.42  ? 537 MET B O   1 
ATOM   9015  C  CB  . MET B  1 537 ? 64.404 89.701  104.284 1.00 44.07  ? 537 MET B CB  1 
ATOM   9016  C  CG  . MET B  1 537 ? 63.484 90.446  103.324 1.00 47.37  ? 537 MET B CG  1 
ATOM   9017  S  SD  . MET B  1 537 ? 61.790 90.686  103.916 1.00 51.65  ? 537 MET B SD  1 
ATOM   9018  C  CE  . MET B  1 537 ? 61.182 89.037  103.873 1.00 48.36  ? 537 MET B CE  1 
ATOM   9019  N  N   . CYS B  1 538 ? 66.304 89.434  107.014 1.00 42.76  ? 538 CYS B N   1 
ATOM   9020  C  CA  . CYS B  1 538 ? 67.103 88.508  107.809 1.00 43.38  ? 538 CYS B CA  1 
ATOM   9021  C  C   . CYS B  1 538 ? 67.060 88.802  109.307 1.00 48.81  ? 538 CYS B C   1 
ATOM   9022  O  O   . CYS B  1 538 ? 66.965 87.863  110.101 1.00 49.34  ? 538 CYS B O   1 
ATOM   9023  C  CB  . CYS B  1 538 ? 68.545 88.499  107.314 1.00 43.92  ? 538 CYS B CB  1 
ATOM   9024  S  SG  . CYS B  1 538 ? 68.763 87.777  105.675 1.00 47.57  ? 538 CYS B SG  1 
ATOM   9025  N  N   . ARG B  1 539 ? 67.209 90.074  109.700 1.00 45.37  ? 539 ARG B N   1 
ATOM   9026  C  CA  . ARG B  1 539 ? 67.335 90.413  111.110 1.00 46.12  ? 539 ARG B CA  1 
ATOM   9027  C  C   . ARG B  1 539 ? 66.229 91.364  111.657 1.00 50.58  ? 539 ARG B C   1 
ATOM   9028  O  O   . ARG B  1 539 ? 66.343 91.811  112.804 1.00 50.93  ? 539 ARG B O   1 
ATOM   9029  C  CB  . ARG B  1 539 ? 68.744 91.010  111.362 1.00 47.16  ? 539 ARG B CB  1 
ATOM   9030  C  CG  . ARG B  1 539 ? 69.930 90.059  111.070 1.00 57.00  ? 539 ARG B CG  1 
ATOM   9031  C  CD  . ARG B  1 539 ? 70.134 89.009  112.158 1.00 71.13  ? 539 ARG B CD  1 
ATOM   9032  N  NE  . ARG B  1 539 ? 71.151 88.012  111.811 1.00 80.73  ? 539 ARG B NE  1 
ATOM   9033  C  CZ  . ARG B  1 539 ? 71.048 86.708  112.062 1.00 95.67  ? 539 ARG B CZ  1 
ATOM   9034  N  NH1 . ARG B  1 539 ? 69.957 86.219  112.640 1.00 82.05  ? 539 ARG B NH1 1 
ATOM   9035  N  NH2 . ARG B  1 539 ? 72.023 85.879  111.715 1.00 84.13  ? 539 ARG B NH2 1 
ATOM   9036  N  N   . VAL B  1 540 ? 65.148 91.629  110.893 1.00 46.36  ? 540 VAL B N   1 
ATOM   9037  C  CA  . VAL B  1 540 ? 64.076 92.502  111.401 1.00 45.60  ? 540 VAL B CA  1 
ATOM   9038  C  C   . VAL B  1 540 ? 62.776 91.702  111.542 1.00 47.96  ? 540 VAL B C   1 
ATOM   9039  O  O   . VAL B  1 540 ? 62.264 91.570  112.653 1.00 47.79  ? 540 VAL B O   1 
ATOM   9040  C  CB  . VAL B  1 540 ? 63.858 93.796  110.566 1.00 49.13  ? 540 VAL B CB  1 
ATOM   9041  C  CG1 . VAL B  1 540 ? 62.728 94.643  111.144 1.00 48.70  ? 540 VAL B CG1 1 
ATOM   9042  C  CG2 . VAL B  1 540 ? 65.138 94.615  110.462 1.00 49.40  ? 540 VAL B CG2 1 
ATOM   9043  N  N   . PHE B  1 541 ? 62.240 91.195  110.424 1.00 43.18  ? 541 PHE B N   1 
ATOM   9044  C  CA  . PHE B  1 541 ? 60.991 90.446  110.424 1.00 42.65  ? 541 PHE B CA  1 
ATOM   9045  C  C   . PHE B  1 541 ? 61.193 88.962  110.664 1.00 47.96  ? 541 PHE B C   1 
ATOM   9046  O  O   . PHE B  1 541 ? 62.237 88.411  110.309 1.00 47.89  ? 541 PHE B O   1 
ATOM   9047  C  CB  . PHE B  1 541 ? 60.254 90.624  109.088 1.00 43.62  ? 541 PHE B CB  1 
ATOM   9048  C  CG  . PHE B  1 541 ? 59.875 92.039  108.736 1.00 44.72  ? 541 PHE B CG  1 
ATOM   9049  C  CD1 . PHE B  1 541 ? 58.873 92.702  109.433 1.00 47.99  ? 541 PHE B CD1 1 
ATOM   9050  C  CD2 . PHE B  1 541 ? 60.487 92.695  107.677 1.00 46.35  ? 541 PHE B CD2 1 
ATOM   9051  C  CE1 . PHE B  1 541 ? 58.510 94.009  109.095 1.00 48.74  ? 541 PHE B CE1 1 
ATOM   9052  C  CE2 . PHE B  1 541 ? 60.117 93.997  107.336 1.00 48.94  ? 541 PHE B CE2 1 
ATOM   9053  C  CZ  . PHE B  1 541 ? 59.135 94.648  108.049 1.00 47.22  ? 541 PHE B CZ  1 
ATOM   9054  N  N   . LYS B  1 542 ? 60.158 88.306  111.225 1.00 45.45  ? 542 LYS B N   1 
ATOM   9055  C  CA  . LYS B  1 542 ? 60.121 86.856  111.413 1.00 46.17  ? 542 LYS B CA  1 
ATOM   9056  C  C   . LYS B  1 542 ? 59.899 86.217  110.033 1.00 51.84  ? 542 LYS B C   1 
ATOM   9057  O  O   . LYS B  1 542 ? 59.352 86.884  109.143 1.00 51.34  ? 542 LYS B O   1 
ATOM   9058  C  CB  . LYS B  1 542 ? 59.039 86.436  112.427 1.00 48.52  ? 542 LYS B CB  1 
ATOM   9059  C  CG  . LYS B  1 542 ? 57.638 86.947  112.131 1.00 54.22  ? 542 LYS B CG  1 
ATOM   9060  C  CD  . LYS B  1 542 ? 56.606 86.183  112.918 1.00 58.07  ? 542 LYS B CD  1 
ATOM   9061  C  CE  . LYS B  1 542 ? 55.426 87.052  113.230 1.00 64.30  ? 542 LYS B CE  1 
ATOM   9062  N  NZ  . LYS B  1 542 ? 55.573 87.716  114.547 1.00 72.36  ? 542 LYS B NZ  1 
ATOM   9063  N  N   . ARG B  1 543 ? 60.340 84.950  109.845 1.00 49.54  ? 543 ARG B N   1 
ATOM   9064  C  CA  . ARG B  1 543 ? 60.259 84.230  108.565 1.00 49.25  ? 543 ARG B CA  1 
ATOM   9065  C  C   . ARG B  1 543 ? 58.865 84.343  107.911 1.00 54.03  ? 543 ARG B C   1 
ATOM   9066  O  O   . ARG B  1 543 ? 57.872 83.942  108.517 1.00 53.61  ? 543 ARG B O   1 
ATOM   9067  C  CB  . ARG B  1 543 ? 60.657 82.749  108.724 1.00 47.88  ? 543 ARG B CB  1 
ATOM   9068  C  CG  . ARG B  1 543 ? 61.141 82.113  107.424 1.00 52.78  ? 543 ARG B CG  1 
ATOM   9069  C  CD  . ARG B  1 543 ? 61.633 80.696  107.629 1.00 57.40  ? 543 ARG B CD  1 
ATOM   9070  N  NE  . ARG B  1 543 ? 62.281 80.157  106.431 1.00 57.95  ? 543 ARG B NE  1 
ATOM   9071  C  CZ  . ARG B  1 543 ? 62.920 78.990  106.384 1.00 69.06  ? 543 ARG B CZ  1 
ATOM   9072  N  NH1 . ARG B  1 543 ? 62.999 78.225  107.464 1.00 56.40  ? 543 ARG B NH1 1 
ATOM   9073  N  NH2 . ARG B  1 543 ? 63.487 78.583  105.257 1.00 55.42  ? 543 ARG B NH2 1 
ATOM   9074  N  N   . PRO B  1 544 ? 58.766 84.951  106.705 1.00 51.24  ? 544 PRO B N   1 
ATOM   9075  C  CA  . PRO B  1 544 ? 57.455 85.039  106.043 1.00 51.14  ? 544 PRO B CA  1 
ATOM   9076  C  C   . PRO B  1 544 ? 57.136 83.752  105.265 1.00 55.47  ? 544 PRO B C   1 
ATOM   9077  O  O   . PRO B  1 544 ? 58.045 83.147  104.685 1.00 55.53  ? 544 PRO B O   1 
ATOM   9078  C  CB  . PRO B  1 544 ? 57.614 86.248  105.112 1.00 52.41  ? 544 PRO B CB  1 
ATOM   9079  C  CG  . PRO B  1 544 ? 59.079 86.335  104.831 1.00 56.73  ? 544 PRO B CG  1 
ATOM   9080  C  CD  . PRO B  1 544 ? 59.835 85.526  105.860 1.00 52.71  ? 544 PRO B CD  1 
ATOM   9081  N  N   . PHE B  1 545 ? 55.853 83.326  105.253 1.00 51.83  ? 545 PHE B N   1 
ATOM   9082  C  CA  . PHE B  1 545 ? 55.428 82.125  104.524 1.00 51.76  ? 545 PHE B CA  1 
ATOM   9083  C  C   . PHE B  1 545 ? 55.667 82.300  103.022 1.00 56.21  ? 545 PHE B C   1 
ATOM   9084  O  O   . PHE B  1 545 ? 55.319 83.342  102.457 1.00 55.61  ? 545 PHE B O   1 
ATOM   9085  C  CB  . PHE B  1 545 ? 53.954 81.785  104.797 1.00 53.42  ? 545 PHE B CB  1 
ATOM   9086  C  CG  . PHE B  1 545 ? 53.690 80.930  106.016 1.00 55.35  ? 545 PHE B CG  1 
ATOM   9087  C  CD1 . PHE B  1 545 ? 54.172 79.629  106.093 1.00 58.97  ? 545 PHE B CD1 1 
ATOM   9088  C  CD2 . PHE B  1 545 ? 52.881 81.392  107.048 1.00 57.43  ? 545 PHE B CD2 1 
ATOM   9089  C  CE1 . PHE B  1 545 ? 53.921 78.839  107.218 1.00 60.35  ? 545 PHE B CE1 1 
ATOM   9090  C  CE2 . PHE B  1 545 ? 52.608 80.589  108.161 1.00 60.57  ? 545 PHE B CE2 1 
ATOM   9091  C  CZ  . PHE B  1 545 ? 53.128 79.317  108.237 1.00 59.18  ? 545 PHE B CZ  1 
ATOM   9092  N  N   . SER B  1 546 ? 56.313 81.302  102.395 1.00 53.25  ? 546 SER B N   1 
ATOM   9093  C  CA  . SER B  1 546 ? 56.647 81.331  100.972 1.00 52.73  ? 546 SER B CA  1 
ATOM   9094  C  C   . SER B  1 546 ? 55.407 81.198  100.098 1.00 56.34  ? 546 SER B C   1 
ATOM   9095  O  O   . SER B  1 546 ? 54.467 80.488  100.458 1.00 56.16  ? 546 SER B O   1 
ATOM   9096  C  CB  . SER B  1 546 ? 57.640 80.225  100.632 1.00 56.49  ? 546 SER B CB  1 
ATOM   9097  O  OG  . SER B  1 546 ? 57.082 78.935  100.810 1.00 65.80  ? 546 SER B OG  1 
ATOM   9098  N  N   . GLU B  1 547 ? 55.406 81.895  98.957  1.00 52.62  ? 547 GLU B N   1 
ATOM   9099  C  CA  . GLU B  1 547 ? 54.311 81.847  97.994  1.00 52.54  ? 547 GLU B CA  1 
ATOM   9100  C  C   . GLU B  1 547 ? 54.901 81.540  96.612  1.00 56.59  ? 547 GLU B C   1 
ATOM   9101  O  O   . GLU B  1 547 ? 55.758 82.294  96.146  1.00 55.73  ? 547 GLU B O   1 
ATOM   9102  C  CB  . GLU B  1 547 ? 53.496 83.155  98.008  1.00 53.51  ? 547 GLU B CB  1 
ATOM   9103  C  CG  . GLU B  1 547 ? 52.081 83.024  97.456  1.00 65.18  ? 547 GLU B CG  1 
ATOM   9104  C  CD  . GLU B  1 547 ? 51.112 82.138  98.222  1.00 88.23  ? 547 GLU B CD  1 
ATOM   9105  O  OE1 . GLU B  1 547 ? 51.167 82.114  99.474  1.00 87.27  ? 547 GLU B OE1 1 
ATOM   9106  O  OE2 . GLU B  1 547 ? 50.271 81.487  97.562  1.00 80.63  ? 547 GLU B OE2 1 
ATOM   9107  N  N   . PRO B  1 548 ? 54.516 80.407  95.971  1.00 53.85  ? 548 PRO B N   1 
ATOM   9108  C  CA  . PRO B  1 548 ? 55.108 80.061  94.668  1.00 53.79  ? 548 PRO B CA  1 
ATOM   9109  C  C   . PRO B  1 548 ? 54.612 80.972  93.539  1.00 57.11  ? 548 PRO B C   1 
ATOM   9110  O  O   . PRO B  1 548 ? 53.653 80.644  92.840  1.00 57.40  ? 548 PRO B O   1 
ATOM   9111  C  CB  . PRO B  1 548 ? 54.693 78.593  94.460  1.00 56.22  ? 548 PRO B CB  1 
ATOM   9112  C  CG  . PRO B  1 548 ? 54.112 78.142  95.770  1.00 60.90  ? 548 PRO B CG  1 
ATOM   9113  C  CD  . PRO B  1 548 ? 53.560 79.372  96.401  1.00 55.83  ? 548 PRO B CD  1 
ATOM   9114  N  N   . SER B  1 549 ? 55.279 82.129  93.374  1.00 52.55  ? 549 SER B N   1 
ATOM   9115  C  CA  . SER B  1 549 ? 54.979 83.116  92.338  1.00 51.83  ? 549 SER B CA  1 
ATOM   9116  C  C   . SER B  1 549 ? 55.729 82.784  91.058  1.00 55.26  ? 549 SER B C   1 
ATOM   9117  O  O   . SER B  1 549 ? 56.886 82.368  91.117  1.00 54.26  ? 549 SER B O   1 
ATOM   9118  C  CB  . SER B  1 549 ? 55.337 84.523  92.806  1.00 55.35  ? 549 SER B CB  1 
ATOM   9119  O  OG  . SER B  1 549 ? 54.385 85.018  93.733  1.00 65.24  ? 549 SER B OG  1 
ATOM   9120  N  N   . ALA B  1 550 ? 55.068 82.981  89.904  1.00 52.55  ? 550 ALA B N   1 
ATOM   9121  C  CA  . ALA B  1 550 ? 55.632 82.718  88.578  1.00 52.95  ? 550 ALA B CA  1 
ATOM   9122  C  C   . ALA B  1 550 ? 55.954 84.023  87.805  1.00 56.40  ? 550 ALA B C   1 
ATOM   9123  O  O   . ALA B  1 550 ? 56.449 83.952  86.674  1.00 56.50  ? 550 ALA B O   1 
ATOM   9124  C  CB  . ALA B  1 550 ? 54.671 81.854  87.775  1.00 54.29  ? 550 ALA B CB  1 
ATOM   9125  N  N   . ASN B  1 551 ? 55.693 85.203  88.427  1.00 52.00  ? 551 ASN B N   1 
ATOM   9126  C  CA  . ASN B  1 551 ? 55.908 86.553  87.871  1.00 51.33  ? 551 ASN B CA  1 
ATOM   9127  C  C   . ASN B  1 551 ? 55.758 87.651  88.949  1.00 55.27  ? 551 ASN B C   1 
ATOM   9128  O  O   . ASN B  1 551 ? 55.495 87.338  90.119  1.00 55.19  ? 551 ASN B O   1 
ATOM   9129  C  CB  . ASN B  1 551 ? 54.924 86.828  86.718  1.00 51.24  ? 551 ASN B CB  1 
ATOM   9130  C  CG  . ASN B  1 551 ? 53.489 86.456  87.019  1.00 71.29  ? 551 ASN B CG  1 
ATOM   9131  O  OD1 . ASN B  1 551 ? 52.868 86.946  87.972  1.00 64.71  ? 551 ASN B OD1 1 
ATOM   9132  N  ND2 . ASN B  1 551 ? 52.928 85.575  86.203  1.00 62.14  ? 551 ASN B ND2 1 
ATOM   9133  N  N   . ILE B  1 552 ? 55.893 88.942  88.538  1.00 50.95  ? 552 ILE B N   1 
ATOM   9134  C  CA  . ILE B  1 552 ? 55.749 90.112  89.425  1.00 50.01  ? 552 ILE B CA  1 
ATOM   9135  C  C   . ILE B  1 552 ? 54.255 90.521  89.560  1.00 53.66  ? 552 ILE B C   1 
ATOM   9136  O  O   . ILE B  1 552 ? 53.943 91.509  90.235  1.00 53.04  ? 552 ILE B O   1 
ATOM   9137  C  CB  . ILE B  1 552 ? 56.648 91.327  89.026  1.00 52.52  ? 552 ILE B CB  1 
ATOM   9138  C  CG1 . ILE B  1 552 ? 56.444 91.758  87.548  1.00 52.81  ? 552 ILE B CG1 1 
ATOM   9139  C  CG2 . ILE B  1 552 ? 58.116 91.050  89.351  1.00 52.85  ? 552 ILE B CG2 1 
ATOM   9140  C  CD1 . ILE B  1 552 ? 56.867 93.184  87.204  1.00 56.27  ? 552 ILE B CD1 1 
ATOM   9141  N  N   . GLY B  1 553 ? 53.363 89.742  88.945  1.00 49.91  ? 553 GLY B N   1 
ATOM   9142  C  CA  . GLY B  1 553 ? 51.923 89.956  89.007  1.00 49.29  ? 553 GLY B CA  1 
ATOM   9143  C  C   . GLY B  1 553 ? 51.425 91.170  88.257  1.00 51.75  ? 553 GLY B C   1 
ATOM   9144  O  O   . GLY B  1 553 ? 51.833 91.412  87.115  1.00 52.19  ? 553 GLY B O   1 
ATOM   9145  N  N   . VAL B  1 554 ? 50.541 91.947  88.912  1.00 46.00  ? 554 VAL B N   1 
ATOM   9146  C  CA  . VAL B  1 554 ? 49.909 93.140  88.344  1.00 45.18  ? 554 VAL B CA  1 
ATOM   9147  C  C   . VAL B  1 554 ? 50.926 94.307  88.193  1.00 47.56  ? 554 VAL B C   1 
ATOM   9148  O  O   . VAL B  1 554 ? 50.621 95.291  87.515  1.00 47.63  ? 554 VAL B O   1 
ATOM   9149  C  CB  . VAL B  1 554 ? 48.651 93.539  89.161  1.00 49.13  ? 554 VAL B CB  1 
ATOM   9150  C  CG1 . VAL B  1 554 ? 49.004 94.344  90.405  1.00 48.63  ? 554 VAL B CG1 1 
ATOM   9151  C  CG2 . VAL B  1 554 ? 47.630 94.273  88.295  1.00 49.24  ? 554 VAL B CG2 1 
ATOM   9152  N  N   . TRP B  1 555 ? 52.134 94.173  88.780  1.00 42.49  ? 555 TRP B N   1 
ATOM   9153  C  CA  . TRP B  1 555 ? 53.194 95.179  88.693  1.00 41.66  ? 555 TRP B CA  1 
ATOM   9154  C  C   . TRP B  1 555 ? 53.673 95.378  87.261  1.00 46.04  ? 555 TRP B C   1 
ATOM   9155  O  O   . TRP B  1 555 ? 54.101 96.482  86.926  1.00 45.61  ? 555 TRP B O   1 
ATOM   9156  C  CB  . TRP B  1 555 ? 54.375 94.821  89.601  1.00 40.02  ? 555 TRP B CB  1 
ATOM   9157  C  CG  . TRP B  1 555 ? 54.110 95.119  91.046  1.00 40.59  ? 555 TRP B CG  1 
ATOM   9158  C  CD1 . TRP B  1 555 ? 53.876 94.216  92.041  1.00 43.35  ? 555 TRP B CD1 1 
ATOM   9159  C  CD2 . TRP B  1 555 ? 53.976 96.417  91.639  1.00 40.41  ? 555 TRP B CD2 1 
ATOM   9160  N  NE1 . TRP B  1 555 ? 53.631 94.871  93.225  1.00 42.73  ? 555 TRP B NE1 1 
ATOM   9161  C  CE2 . TRP B  1 555 ? 53.676 96.223  93.005  1.00 44.22  ? 555 TRP B CE2 1 
ATOM   9162  C  CE3 . TRP B  1 555 ? 54.078 97.732  91.147  1.00 41.59  ? 555 TRP B CE3 1 
ATOM   9163  C  CZ2 . TRP B  1 555 ? 53.506 97.294  93.892  1.00 43.56  ? 555 TRP B CZ2 1 
ATOM   9164  C  CZ3 . TRP B  1 555 ? 53.902 98.789  92.024  1.00 42.97  ? 555 TRP B CZ3 1 
ATOM   9165  C  CH2 . TRP B  1 555 ? 53.617 98.567  93.379  1.00 43.60  ? 555 TRP B CH2 1 
ATOM   9166  N  N   . GLN B  1 556 ? 53.574 94.325  86.412  1.00 43.14  ? 556 GLN B N   1 
ATOM   9167  C  CA  . GLN B  1 556 ? 53.951 94.371  84.995  1.00 42.97  ? 556 GLN B CA  1 
ATOM   9168  C  C   . GLN B  1 556 ? 53.080 95.395  84.256  1.00 46.17  ? 556 GLN B C   1 
ATOM   9169  O  O   . GLN B  1 556 ? 53.617 96.210  83.509  1.00 45.22  ? 556 GLN B O   1 
ATOM   9170  C  CB  . GLN B  1 556 ? 53.838 92.976  84.352  1.00 44.53  ? 556 GLN B CB  1 
ATOM   9171  C  CG  . GLN B  1 556 ? 54.446 92.865  82.946  1.00 57.86  ? 556 GLN B CG  1 
ATOM   9172  C  CD  . GLN B  1 556 ? 55.952 92.993  82.906  1.00 75.42  ? 556 GLN B CD  1 
ATOM   9173  O  OE1 . GLN B  1 556 ? 56.676 92.484  83.771  1.00 71.12  ? 556 GLN B OE1 1 
ATOM   9174  N  NE2 . GLN B  1 556 ? 56.456 93.658  81.876  1.00 65.53  ? 556 GLN B NE2 1 
ATOM   9175  N  N   . LEU B  1 557 ? 51.753 95.379  84.508  1.00 42.96  ? 557 LEU B N   1 
ATOM   9176  C  CA  . LEU B  1 557 ? 50.779 96.309  83.927  1.00 43.01  ? 557 LEU B CA  1 
ATOM   9177  C  C   . LEU B  1 557 ? 51.043 97.729  84.425  1.00 47.28  ? 557 LEU B C   1 
ATOM   9178  O  O   . LEU B  1 557 ? 50.994 98.672  83.634  1.00 47.95  ? 557 LEU B O   1 
ATOM   9179  C  CB  . LEU B  1 557 ? 49.347 95.871  84.286  1.00 43.24  ? 557 LEU B CB  1 
ATOM   9180  C  CG  . LEU B  1 557 ? 48.204 96.764  83.803  1.00 48.13  ? 557 LEU B CG  1 
ATOM   9181  C  CD1 . LEU B  1 557 ? 47.673 96.299  82.456  1.00 48.79  ? 557 LEU B CD1 1 
ATOM   9182  C  CD2 . LEU B  1 557 ? 47.092 96.810  84.824  1.00 50.39  ? 557 LEU B CD2 1 
ATOM   9183  N  N   . ALA B  1 558 ? 51.330 97.869  85.733  1.00 42.73  ? 558 ALA B N   1 
ATOM   9184  C  CA  . ALA B  1 558 ? 51.621 99.137  86.401  1.00 41.76  ? 558 ALA B CA  1 
ATOM   9185  C  C   . ALA B  1 558 ? 52.834 99.827  85.777  1.00 43.53  ? 558 ALA B C   1 
ATOM   9186  O  O   . ALA B  1 558 ? 52.745 101.001 85.417  1.00 42.96  ? 558 ALA B O   1 
ATOM   9187  C  CB  . ALA B  1 558 ? 51.865 98.889  87.878  1.00 42.29  ? 558 ALA B CB  1 
ATOM   9188  N  N   . PHE B  1 559 ? 53.951 99.084  85.626  1.00 38.88  ? 559 PHE B N   1 
ATOM   9189  C  CA  . PHE B  1 559 ? 55.203 99.562  85.041  1.00 38.28  ? 559 PHE B CA  1 
ATOM   9190  C  C   . PHE B  1 559 ? 55.037 99.882  83.548  1.00 41.61  ? 559 PHE B C   1 
ATOM   9191  O  O   . PHE B  1 559 ? 55.625 100.856 83.075  1.00 41.07  ? 559 PHE B O   1 
ATOM   9192  C  CB  . PHE B  1 559 ? 56.313 98.523  85.246  1.00 39.88  ? 559 PHE B CB  1 
ATOM   9193  C  CG  . PHE B  1 559 ? 57.121 98.669  86.515  1.00 41.22  ? 559 PHE B CG  1 
ATOM   9194  C  CD1 . PHE B  1 559 ? 56.592 98.294  87.746  1.00 43.74  ? 559 PHE B CD1 1 
ATOM   9195  C  CD2 . PHE B  1 559 ? 58.431 99.129  86.473  1.00 43.63  ? 559 PHE B CD2 1 
ATOM   9196  C  CE1 . PHE B  1 559 ? 57.347 98.409  88.917  1.00 44.42  ? 559 PHE B CE1 1 
ATOM   9197  C  CE2 . PHE B  1 559 ? 59.189 99.238  87.644  1.00 46.29  ? 559 PHE B CE2 1 
ATOM   9198  C  CZ  . PHE B  1 559 ? 58.643 98.869  88.856  1.00 43.90  ? 559 PHE B CZ  1 
ATOM   9199  N  N   . GLU B  1 560 ? 54.227 99.080  82.819  1.00 37.81  ? 560 GLU B N   1 
ATOM   9200  C  CA  . GLU B  1 560 ? 53.959 99.283  81.391  1.00 37.90  ? 560 GLU B CA  1 
ATOM   9201  C  C   . GLU B  1 560 ? 53.081 100.520 81.164  1.00 41.90  ? 560 GLU B C   1 
ATOM   9202  O  O   . GLU B  1 560 ? 53.268 101.210 80.162  1.00 42.29  ? 560 GLU B O   1 
ATOM   9203  C  CB  . GLU B  1 560 ? 53.328 98.038  80.749  1.00 39.31  ? 560 GLU B CB  1 
ATOM   9204  C  CG  . GLU B  1 560 ? 54.361 96.994  80.358  1.00 50.19  ? 560 GLU B CG  1 
ATOM   9205  C  CD  . GLU B  1 560 ? 53.836 95.685  79.800  1.00 73.78  ? 560 GLU B CD  1 
ATOM   9206  O  OE1 . GLU B  1 560 ? 52.841 95.154  80.344  1.00 74.15  ? 560 GLU B OE1 1 
ATOM   9207  O  OE2 . GLU B  1 560 ? 54.458 95.160  78.849  1.00 71.28  ? 560 GLU B OE2 1 
ATOM   9208  N  N   . THR B  1 561 ? 52.153 100.814 82.096  1.00 37.44  ? 561 THR B N   1 
ATOM   9209  C  CA  . THR B  1 561 ? 51.285 101.994 82.032  1.00 37.48  ? 561 THR B CA  1 
ATOM   9210  C  C   . THR B  1 561 ? 52.149 103.253 82.256  1.00 41.82  ? 561 THR B C   1 
ATOM   9211  O  O   . THR B  1 561 ? 51.940 104.264 81.581  1.00 42.49  ? 561 THR B O   1 
ATOM   9212  C  CB  . THR B  1 561 ? 50.136 101.852 83.036  1.00 46.65  ? 561 THR B CB  1 
ATOM   9213  O  OG1 . THR B  1 561 ? 49.347 100.723 82.655  1.00 46.55  ? 561 THR B OG1 1 
ATOM   9214  C  CG2 . THR B  1 561 ? 49.250 103.096 83.119  1.00 45.23  ? 561 THR B CG2 1 
ATOM   9215  N  N   . MET B  1 562 ? 53.146 103.163 83.166  1.00 37.40  ? 562 MET B N   1 
ATOM   9216  C  CA  . MET B  1 562 ? 54.102 104.232 83.468  1.00 36.97  ? 562 MET B CA  1 
ATOM   9217  C  C   . MET B  1 562 ? 54.940 104.563 82.219  1.00 42.61  ? 562 MET B C   1 
ATOM   9218  O  O   . MET B  1 562 ? 55.194 105.741 81.954  1.00 43.03  ? 562 MET B O   1 
ATOM   9219  C  CB  . MET B  1 562 ? 55.005 103.828 84.650  1.00 38.62  ? 562 MET B CB  1 
ATOM   9220  C  CG  . MET B  1 562 ? 55.913 104.947 85.158  1.00 41.76  ? 562 MET B CG  1 
ATOM   9221  S  SD  . MET B  1 562 ? 55.035 106.431 85.711  1.00 45.33  ? 562 MET B SD  1 
ATOM   9222  C  CE  . MET B  1 562 ? 54.626 105.970 87.354  1.00 41.52  ? 562 MET B CE  1 
ATOM   9223  N  N   . SER B  1 563 ? 55.332 103.527 81.438  1.00 39.03  ? 563 SER B N   1 
ATOM   9224  C  CA  . SER B  1 563 ? 56.098 103.695 80.202  1.00 38.99  ? 563 SER B CA  1 
ATOM   9225  C  C   . SER B  1 563 ? 55.214 104.278 79.074  1.00 42.31  ? 563 SER B C   1 
ATOM   9226  O  O   . SER B  1 563 ? 55.745 104.870 78.133  1.00 42.80  ? 563 SER B O   1 
ATOM   9227  C  CB  . SER B  1 563 ? 56.732 102.375 79.774  1.00 43.10  ? 563 SER B CB  1 
ATOM   9228  O  OG  . SER B  1 563 ? 55.791 101.456 79.245  1.00 53.41  ? 563 SER B OG  1 
ATOM   9229  N  N   . VAL B  1 564 ? 53.875 104.120 79.176  1.00 37.05  ? 564 VAL B N   1 
ATOM   9230  C  CA  . VAL B  1 564 ? 52.918 104.668 78.208  1.00 36.18  ? 564 VAL B CA  1 
ATOM   9231  C  C   . VAL B  1 564 ? 52.725 106.164 78.536  1.00 39.56  ? 564 VAL B C   1 
ATOM   9232  O  O   . VAL B  1 564 ? 52.736 106.992 77.620  1.00 39.74  ? 564 VAL B O   1 
ATOM   9233  C  CB  . VAL B  1 564 ? 51.592 103.858 78.176  1.00 39.28  ? 564 VAL B CB  1 
ATOM   9234  C  CG1 . VAL B  1 564 ? 50.443 104.655 77.564  1.00 39.44  ? 564 VAL B CG1 1 
ATOM   9235  C  CG2 . VAL B  1 564 ? 51.783 102.548 77.426  1.00 38.99  ? 564 VAL B CG2 1 
ATOM   9236  N  N   . ILE B  1 565 ? 52.612 106.504 79.842  1.00 34.83  ? 565 ILE B N   1 
ATOM   9237  C  CA  . ILE B  1 565 ? 52.466 107.879 80.332  1.00 34.73  ? 565 ILE B CA  1 
ATOM   9238  C  C   . ILE B  1 565 ? 53.734 108.685 79.980  1.00 40.70  ? 565 ILE B C   1 
ATOM   9239  O  O   . ILE B  1 565 ? 53.616 109.862 79.627  1.00 41.46  ? 565 ILE B O   1 
ATOM   9240  C  CB  . ILE B  1 565 ? 52.137 107.911 81.862  1.00 36.96  ? 565 ILE B CB  1 
ATOM   9241  C  CG1 . ILE B  1 565 ? 50.702 107.410 82.130  1.00 36.37  ? 565 ILE B CG1 1 
ATOM   9242  C  CG2 . ILE B  1 565 ? 52.336 109.316 82.477  1.00 38.08  ? 565 ILE B CG2 1 
ATOM   9243  C  CD1 . ILE B  1 565 ? 50.489 106.757 83.475  1.00 39.14  ? 565 ILE B CD1 1 
ATOM   9244  N  N   . SER B  1 566 ? 54.926 108.037 80.010  1.00 37.43  ? 566 SER B N   1 
ATOM   9245  C  CA  . SER B  1 566 ? 56.215 108.676 79.706  1.00 37.63  ? 566 SER B CA  1 
ATOM   9246  C  C   . SER B  1 566 ? 56.297 109.227 78.259  1.00 40.36  ? 566 SER B C   1 
ATOM   9247  O  O   . SER B  1 566 ? 57.072 110.154 78.022  1.00 40.11  ? 566 SER B O   1 
ATOM   9248  C  CB  . SER B  1 566 ? 57.375 107.726 79.986  1.00 41.38  ? 566 SER B CB  1 
ATOM   9249  O  OG  . SER B  1 566 ? 57.488 106.703 79.014  1.00 51.73  ? 566 SER B OG  1 
ATOM   9250  N  N   . VAL B  1 567 ? 55.478 108.696 77.319  1.00 35.75  ? 567 VAL B N   1 
ATOM   9251  C  CA  . VAL B  1 567 ? 55.414 109.174 75.925  1.00 35.49  ? 567 VAL B CA  1 
ATOM   9252  C  C   . VAL B  1 567 ? 54.750 110.552 75.922  1.00 38.71  ? 567 VAL B C   1 
ATOM   9253  O  O   . VAL B  1 567 ? 55.255 111.477 75.287  1.00 38.90  ? 567 VAL B O   1 
ATOM   9254  C  CB  . VAL B  1 567 ? 54.685 108.193 74.965  1.00 39.00  ? 567 VAL B CB  1 
ATOM   9255  C  CG1 . VAL B  1 567 ? 54.866 108.607 73.507  1.00 39.19  ? 567 VAL B CG1 1 
ATOM   9256  C  CG2 . VAL B  1 567 ? 55.154 106.761 75.170  1.00 38.37  ? 567 VAL B CG2 1 
ATOM   9257  N  N   . VAL B  1 568 ? 53.631 110.678 76.661  1.00 33.79  ? 568 VAL B N   1 
ATOM   9258  C  CA  . VAL B  1 568 ? 52.846 111.905 76.805  1.00 33.39  ? 568 VAL B CA  1 
ATOM   9259  C  C   . VAL B  1 568 ? 53.713 112.983 77.475  1.00 37.15  ? 568 VAL B C   1 
ATOM   9260  O  O   . VAL B  1 568 ? 53.797 114.100 76.963  1.00 37.12  ? 568 VAL B O   1 
ATOM   9261  C  CB  . VAL B  1 568 ? 51.528 111.655 77.594  1.00 36.63  ? 568 VAL B CB  1 
ATOM   9262  C  CG1 . VAL B  1 568 ? 50.585 112.849 77.485  1.00 36.73  ? 568 VAL B CG1 1 
ATOM   9263  C  CG2 . VAL B  1 568 ? 50.827 110.376 77.135  1.00 36.26  ? 568 VAL B CG2 1 
ATOM   9264  N  N   . THR B  1 569 ? 54.390 112.619 78.589  1.00 33.10  ? 569 THR B N   1 
ATOM   9265  C  CA  . THR B  1 569 ? 55.242 113.490 79.402  1.00 32.92  ? 569 THR B CA  1 
ATOM   9266  C  C   . THR B  1 569 ? 56.414 114.061 78.587  1.00 37.76  ? 569 THR B C   1 
ATOM   9267  O  O   . THR B  1 569 ? 56.544 115.282 78.509  1.00 37.70  ? 569 THR B O   1 
ATOM   9268  C  CB  . THR B  1 569 ? 55.757 112.736 80.643  1.00 38.11  ? 569 THR B CB  1 
ATOM   9269  O  OG1 . THR B  1 569 ? 54.712 111.940 81.196  1.00 37.53  ? 569 THR B OG1 1 
ATOM   9270  C  CG2 . THR B  1 569 ? 56.294 113.669 81.708  1.00 37.21  ? 569 THR B CG2 1 
ATOM   9271  N  N   . ASN B  1 570 ? 57.254 113.185 77.987  1.00 34.53  ? 570 ASN B N   1 
ATOM   9272  C  CA  . ASN B  1 570 ? 58.433 113.578 77.209  1.00 34.74  ? 570 ASN B CA  1 
ATOM   9273  C  C   . ASN B  1 570 ? 58.072 114.435 75.989  1.00 39.42  ? 570 ASN B C   1 
ATOM   9274  O  O   . ASN B  1 570 ? 58.807 115.377 75.688  1.00 39.43  ? 570 ASN B O   1 
ATOM   9275  C  CB  . ASN B  1 570 ? 59.242 112.357 76.775  1.00 33.66  ? 570 ASN B CB  1 
ATOM   9276  C  CG  . ASN B  1 570 ? 60.126 111.798 77.864  1.00 47.73  ? 570 ASN B CG  1 
ATOM   9277  O  OD1 . ASN B  1 570 ? 61.152 112.380 78.236  1.00 41.93  ? 570 ASN B OD1 1 
ATOM   9278  N  ND2 . ASN B  1 570 ? 59.765 110.641 78.383  1.00 37.06  ? 570 ASN B ND2 1 
ATOM   9279  N  N   . CYS B  1 571 ? 56.943 114.128 75.309  1.00 36.05  ? 571 CYS B N   1 
ATOM   9280  C  CA  . CYS B  1 571 ? 56.481 114.887 74.140  1.00 36.45  ? 571 CYS B CA  1 
ATOM   9281  C  C   . CYS B  1 571 ? 56.013 116.282 74.551  1.00 39.46  ? 571 CYS B C   1 
ATOM   9282  O  O   . CYS B  1 571 ? 56.268 117.245 73.826  1.00 39.38  ? 571 CYS B O   1 
ATOM   9283  C  CB  . CYS B  1 571 ? 55.384 114.137 73.390  1.00 36.74  ? 571 CYS B CB  1 
ATOM   9284  S  SG  . CYS B  1 571 ? 55.990 112.777 72.361  1.00 40.47  ? 571 CYS B SG  1 
ATOM   9285  N  N   . ALA B  1 572 ? 55.341 116.387 75.715  1.00 35.28  ? 572 ALA B N   1 
ATOM   9286  C  CA  . ALA B  1 572 ? 54.834 117.650 76.242  1.00 35.53  ? 572 ALA B CA  1 
ATOM   9287  C  C   . ALA B  1 572 ? 55.978 118.563 76.686  1.00 40.62  ? 572 ALA B C   1 
ATOM   9288  O  O   . ALA B  1 572 ? 56.010 119.715 76.267  1.00 41.17  ? 572 ALA B O   1 
ATOM   9289  C  CB  . ALA B  1 572 ? 53.878 117.397 77.393  1.00 35.75  ? 572 ALA B CB  1 
ATOM   9290  N  N   . LEU B  1 573 ? 56.936 118.040 77.481  1.00 37.37  ? 573 LEU B N   1 
ATOM   9291  C  CA  . LEU B  1 573 ? 58.095 118.788 77.987  1.00 37.86  ? 573 LEU B CA  1 
ATOM   9292  C  C   . LEU B  1 573 ? 58.987 119.320 76.853  1.00 44.01  ? 573 LEU B C   1 
ATOM   9293  O  O   . LEU B  1 573 ? 59.524 120.420 76.987  1.00 45.16  ? 573 LEU B O   1 
ATOM   9294  C  CB  . LEU B  1 573 ? 58.933 117.935 78.951  1.00 37.10  ? 573 LEU B CB  1 
ATOM   9295  C  CG  . LEU B  1 573 ? 58.281 117.564 80.284  1.00 40.83  ? 573 LEU B CG  1 
ATOM   9296  C  CD1 . LEU B  1 573 ? 58.985 116.387 80.918  1.00 40.05  ? 573 LEU B CD1 1 
ATOM   9297  C  CD2 . LEU B  1 573 ? 58.235 118.751 81.239  1.00 43.72  ? 573 LEU B CD2 1 
ATOM   9298  N  N   . ILE B  1 574 ? 59.136 118.559 75.745  1.00 40.45  ? 574 ILE B N   1 
ATOM   9299  C  CA  . ILE B  1 574 ? 59.930 118.995 74.593  1.00 41.10  ? 574 ILE B CA  1 
ATOM   9300  C  C   . ILE B  1 574 ? 59.133 120.082 73.842  1.00 47.64  ? 574 ILE B C   1 
ATOM   9301  O  O   . ILE B  1 574 ? 59.693 121.136 73.544  1.00 48.38  ? 574 ILE B O   1 
ATOM   9302  C  CB  . ILE B  1 574 ? 60.379 117.812 73.688  1.00 43.51  ? 574 ILE B CB  1 
ATOM   9303  C  CG1 . ILE B  1 574 ? 61.489 117.002 74.389  1.00 43.31  ? 574 ILE B CG1 1 
ATOM   9304  C  CG2 . ILE B  1 574 ? 60.864 118.297 72.305  1.00 45.09  ? 574 ILE B CG2 1 
ATOM   9305  C  CD1 . ILE B  1 574 ? 61.702 115.612 73.850  1.00 51.32  ? 574 ILE B CD1 1 
ATOM   9306  N  N   . GLY B  1 575 ? 57.839 119.843 73.614  1.00 44.96  ? 575 GLY B N   1 
ATOM   9307  C  CA  . GLY B  1 575 ? 56.941 120.791 72.956  1.00 46.03  ? 575 GLY B CA  1 
ATOM   9308  C  C   . GLY B  1 575 ? 56.818 122.112 73.696  1.00 52.39  ? 575 GLY B C   1 
ATOM   9309  O  O   . GLY B  1 575 ? 56.599 123.156 73.078  1.00 53.00  ? 575 GLY B O   1 
ATOM   9310  N  N   . MET B  1 576 ? 56.990 122.069 75.028  1.00 50.07  ? 576 MET B N   1 
ATOM   9311  C  CA  . MET B  1 576 ? 56.936 123.215 75.936  1.00 51.18  ? 576 MET B CA  1 
ATOM   9312  C  C   . MET B  1 576 ? 58.212 124.046 75.920  1.00 55.81  ? 576 MET B C   1 
ATOM   9313  O  O   . MET B  1 576 ? 58.145 125.235 76.240  1.00 56.69  ? 576 MET B O   1 
ATOM   9314  C  CB  . MET B  1 576 ? 56.694 122.740 77.373  1.00 53.22  ? 576 MET B CB  1 
ATOM   9315  C  CG  . MET B  1 576 ? 55.249 122.563 77.706  1.00 57.15  ? 576 MET B CG  1 
ATOM   9316  S  SD  . MET B  1 576 ? 55.040 121.941 79.378  1.00 61.37  ? 576 MET B SD  1 
ATOM   9317  C  CE  . MET B  1 576 ? 53.342 122.373 79.636  1.00 58.84  ? 576 MET B CE  1 
ATOM   9318  N  N   . SER B  1 577 ? 59.372 123.421 75.604  1.00 51.75  ? 577 SER B N   1 
ATOM   9319  C  CA  . SER B  1 577 ? 60.686 124.077 75.603  1.00 52.22  ? 577 SER B CA  1 
ATOM   9320  C  C   . SER B  1 577 ? 60.710 125.330 74.702  1.00 57.14  ? 577 SER B C   1 
ATOM   9321  O  O   . SER B  1 577 ? 60.115 125.305 73.620  1.00 56.89  ? 577 SER B O   1 
ATOM   9322  C  CB  . SER B  1 577 ? 61.793 123.102 75.204  1.00 54.89  ? 577 SER B CB  1 
ATOM   9323  O  OG  . SER B  1 577 ? 61.819 122.820 73.816  1.00 62.23  ? 577 SER B OG  1 
ATOM   9324  N  N   . PRO B  1 578 ? 61.369 126.435 75.147  1.00 54.29  ? 578 PRO B N   1 
ATOM   9325  C  CA  . PRO B  1 578 ? 61.377 127.669 74.339  1.00 55.19  ? 578 PRO B CA  1 
ATOM   9326  C  C   . PRO B  1 578 ? 62.099 127.539 72.997  1.00 59.18  ? 578 PRO B C   1 
ATOM   9327  O  O   . PRO B  1 578 ? 61.867 128.374 72.121  1.00 60.21  ? 578 PRO B O   1 
ATOM   9328  C  CB  . PRO B  1 578 ? 62.082 128.683 75.243  1.00 57.79  ? 578 PRO B CB  1 
ATOM   9329  C  CG  . PRO B  1 578 ? 62.894 127.866 76.173  1.00 61.73  ? 578 PRO B CG  1 
ATOM   9330  C  CD  . PRO B  1 578 ? 62.094 126.630 76.420  1.00 55.96  ? 578 PRO B CD  1 
ATOM   9331  N  N   . GLN B  1 579 ? 62.950 126.506 72.825  1.00 54.23  ? 579 GLN B N   1 
ATOM   9332  C  CA  . GLN B  1 579 ? 63.671 126.261 71.575  1.00 54.02  ? 579 GLN B CA  1 
ATOM   9333  C  C   . GLN B  1 579 ? 62.685 125.855 70.472  1.00 56.15  ? 579 GLN B C   1 
ATOM   9334  O  O   . GLN B  1 579 ? 62.801 126.331 69.341  1.00 56.49  ? 579 GLN B O   1 
ATOM   9335  C  CB  . GLN B  1 579 ? 64.758 125.193 71.770  1.00 55.05  ? 579 GLN B CB  1 
ATOM   9336  C  CG  . GLN B  1 579 ? 65.879 125.270 70.732  1.00 78.08  ? 579 GLN B CG  1 
ATOM   9337  C  CD  . GLN B  1 579 ? 67.112 124.471 71.101  1.00 101.16 ? 579 GLN B CD  1 
ATOM   9338  O  OE1 . GLN B  1 579 ? 67.531 124.403 72.267  1.00 99.30  ? 579 GLN B OE1 1 
ATOM   9339  N  NE2 . GLN B  1 579 ? 67.764 123.904 70.094  1.00 89.83  ? 579 GLN B NE2 1 
ATOM   9340  N  N   . VAL B  1 580 ? 61.693 125.015 70.825  1.00 50.86  ? 580 VAL B N   1 
ATOM   9341  C  CA  . VAL B  1 580 ? 60.645 124.534 69.918  1.00 50.25  ? 580 VAL B CA  1 
ATOM   9342  C  C   . VAL B  1 580 ? 59.620 125.659 69.688  1.00 55.45  ? 580 VAL B C   1 
ATOM   9343  O  O   . VAL B  1 580 ? 59.178 125.865 68.556  1.00 55.48  ? 580 VAL B O   1 
ATOM   9344  C  CB  . VAL B  1 580 ? 59.977 123.235 70.444  1.00 52.66  ? 580 VAL B CB  1 
ATOM   9345  C  CG1 . VAL B  1 580 ? 58.986 122.678 69.435  1.00 52.30  ? 580 VAL B CG1 1 
ATOM   9346  C  CG2 . VAL B  1 580 ? 61.020 122.176 70.767  1.00 51.78  ? 580 VAL B CG2 1 
ATOM   9347  N  N   . ASN B  1 581 ? 59.275 126.403 70.756  1.00 52.80  ? 581 ASN B N   1 
ATOM   9348  C  CA  . ASN B  1 581 ? 58.327 127.520 70.709  1.00 53.51  ? 581 ASN B CA  1 
ATOM   9349  C  C   . ASN B  1 581 ? 58.882 128.716 69.921  1.00 59.56  ? 581 ASN B C   1 
ATOM   9350  O  O   . ASN B  1 581 ? 58.107 129.588 69.525  1.00 60.71  ? 581 ASN B O   1 
ATOM   9351  C  CB  . ASN B  1 581 ? 57.927 127.946 72.114  1.00 53.22  ? 581 ASN B CB  1 
ATOM   9352  C  CG  . ASN B  1 581 ? 56.854 127.068 72.693  1.00 75.86  ? 581 ASN B CG  1 
ATOM   9353  O  OD1 . ASN B  1 581 ? 55.665 127.244 72.421  1.00 71.75  ? 581 ASN B OD1 1 
ATOM   9354  N  ND2 . ASN B  1 581 ? 57.252 126.082 73.478  1.00 66.89  ? 581 ASN B ND2 1 
ATOM   9355  N  N   . ALA B  1 582 ? 60.206 128.749 69.679  1.00 56.26  ? 582 ALA B N   1 
ATOM   9356  C  CA  . ALA B  1 582 ? 60.858 129.801 68.895  1.00 57.24  ? 582 ALA B CA  1 
ATOM   9357  C  C   . ALA B  1 582 ? 60.513 129.647 67.412  1.00 59.91  ? 582 ALA B C   1 
ATOM   9358  O  O   . ALA B  1 582 ? 60.427 130.644 66.691  1.00 60.25  ? 582 ALA B O   1 
ATOM   9359  C  CB  . ALA B  1 582 ? 62.364 129.743 69.093  1.00 58.30  ? 582 ALA B CB  1 
ATOM   9360  N  N   . VAL B  1 583 ? 60.305 128.388 66.975  1.00 54.75  ? 583 VAL B N   1 
ATOM   9361  C  CA  . VAL B  1 583 ? 59.956 127.994 65.606  1.00 54.40  ? 583 VAL B CA  1 
ATOM   9362  C  C   . VAL B  1 583 ? 58.466 128.313 65.344  1.00 59.11  ? 583 VAL B C   1 
ATOM   9363  O  O   . VAL B  1 583 ? 58.098 128.647 64.215  1.00 59.45  ? 583 VAL B O   1 
ATOM   9364  C  CB  . VAL B  1 583 ? 60.297 126.494 65.374  1.00 56.57  ? 583 VAL B CB  1 
ATOM   9365  C  CG1 . VAL B  1 583 ? 59.902 126.026 63.975  1.00 56.42  ? 583 VAL B CG1 1 
ATOM   9366  C  CG2 . VAL B  1 583 ? 61.781 126.231 65.622  1.00 56.26  ? 583 VAL B CG2 1 
ATOM   9367  N  N   . PHE B  1 584 ? 57.631 128.238 66.398  1.00 55.30  ? 584 PHE B N   1 
ATOM   9368  C  CA  . PHE B  1 584 ? 56.194 128.509 66.334  1.00 55.09  ? 584 PHE B CA  1 
ATOM   9369  C  C   . PHE B  1 584 ? 55.856 129.731 67.215  1.00 59.00  ? 584 PHE B C   1 
ATOM   9370  O  O   . PHE B  1 584 ? 55.427 129.563 68.359  1.00 57.69  ? 584 PHE B O   1 
ATOM   9371  C  CB  . PHE B  1 584 ? 55.396 127.258 66.751  1.00 55.65  ? 584 PHE B CB  1 
ATOM   9372  C  CG  . PHE B  1 584 ? 55.641 126.053 65.876  1.00 56.52  ? 584 PHE B CG  1 
ATOM   9373  C  CD1 . PHE B  1 584 ? 54.952 125.890 64.681  1.00 59.79  ? 584 PHE B CD1 1 
ATOM   9374  C  CD2 . PHE B  1 584 ? 56.557 125.076 66.250  1.00 57.71  ? 584 PHE B CD2 1 
ATOM   9375  C  CE1 . PHE B  1 584 ? 55.188 124.781 63.867  1.00 60.40  ? 584 PHE B CE1 1 
ATOM   9376  C  CE2 . PHE B  1 584 ? 56.780 123.959 65.442  1.00 60.10  ? 584 PHE B CE2 1 
ATOM   9377  C  CZ  . PHE B  1 584 ? 56.097 123.820 64.255  1.00 58.72  ? 584 PHE B CZ  1 
ATOM   9378  N  N   . PRO B  1 585 ? 56.061 130.974 66.716  1.00 56.89  ? 585 PRO B N   1 
ATOM   9379  C  CA  . PRO B  1 585 ? 55.800 132.153 67.561  1.00 57.56  ? 585 PRO B CA  1 
ATOM   9380  C  C   . PRO B  1 585 ? 54.312 132.463 67.725  1.00 61.91  ? 585 PRO B C   1 
ATOM   9381  O  O   . PRO B  1 585 ? 53.883 132.748 68.846  1.00 61.58  ? 585 PRO B O   1 
ATOM   9382  C  CB  . PRO B  1 585 ? 56.529 133.292 66.830  1.00 60.67  ? 585 PRO B CB  1 
ATOM   9383  C  CG  . PRO B  1 585 ? 57.290 132.642 65.701  1.00 64.84  ? 585 PRO B CG  1 
ATOM   9384  C  CD  . PRO B  1 585 ? 56.575 131.379 65.395  1.00 59.21  ? 585 PRO B CD  1 
ATOM   9385  N  N   . GLU B  1 586 ? 53.530 132.410 66.623  1.00 58.67  ? 586 GLU B N   1 
ATOM   9386  C  CA  . GLU B  1 586 ? 52.094 132.690 66.637  1.00 58.55  ? 586 GLU B CA  1 
ATOM   9387  C  C   . GLU B  1 586 ? 51.267 131.403 66.535  1.00 61.58  ? 586 GLU B C   1 
ATOM   9388  O  O   . GLU B  1 586 ? 50.342 131.216 67.331  1.00 60.62  ? 586 GLU B O   1 
ATOM   9389  C  CB  . GLU B  1 586 ? 51.711 133.666 65.510  1.00 61.11  ? 586 GLU B CB  1 
ATOM   9390  C  CG  . GLU B  1 586 ? 50.369 134.349 65.727  1.00 71.87  ? 586 GLU B CG  1 
ATOM   9391  C  CD  . GLU B  1 586 ? 50.237 135.112 67.032  1.00 99.33  ? 586 GLU B CD  1 
ATOM   9392  O  OE1 . GLU B  1 586 ? 50.945 136.131 67.205  1.00 102.11 ? 586 GLU B OE1 1 
ATOM   9393  O  OE2 . GLU B  1 586 ? 49.438 134.676 67.892  1.00 94.71  ? 586 GLU B OE2 1 
ATOM   9394  N  N   . SER B  1 587 ? 51.596 130.523 65.562  1.00 57.84  ? 587 SER B N   1 
ATOM   9395  C  CA  . SER B  1 587 ? 50.884 129.266 65.331  1.00 56.62  ? 587 SER B CA  1 
ATOM   9396  C  C   . SER B  1 587 ? 51.222 128.226 66.417  1.00 58.39  ? 587 SER B C   1 
ATOM   9397  O  O   . SER B  1 587 ? 52.045 127.333 66.201  1.00 57.16  ? 587 SER B O   1 
ATOM   9398  C  CB  . SER B  1 587 ? 51.189 128.725 63.935  1.00 60.34  ? 587 SER B CB  1 
ATOM   9399  N  N   . LYS B  1 588 ? 50.582 128.360 67.593  1.00 54.12  ? 588 LYS B N   1 
ATOM   9400  C  CA  . LYS B  1 588 ? 50.775 127.433 68.712  1.00 52.64  ? 588 LYS B CA  1 
ATOM   9401  C  C   . LYS B  1 588 ? 49.908 126.194 68.506  1.00 56.96  ? 588 LYS B C   1 
ATOM   9402  O  O   . LYS B  1 588 ? 50.219 125.127 69.038  1.00 55.60  ? 588 LYS B O   1 
ATOM   9403  C  CB  . LYS B  1 588 ? 50.468 128.096 70.068  1.00 54.54  ? 588 LYS B CB  1 
ATOM   9404  C  CG  . LYS B  1 588 ? 51.398 129.251 70.450  1.00 61.88  ? 588 LYS B CG  1 
ATOM   9405  C  CD  . LYS B  1 588 ? 52.803 128.812 70.863  1.00 64.35  ? 588 LYS B CD  1 
ATOM   9406  C  CE  . LYS B  1 588 ? 53.654 130.012 71.200  1.00 73.23  ? 588 LYS B CE  1 
ATOM   9407  N  NZ  . LYS B  1 588 ? 55.103 129.691 71.180  1.00 81.48  ? 588 LYS B NZ  1 
ATOM   9408  N  N   . ALA B  1 589 ? 48.824 126.342 67.722  1.00 54.81  ? 589 ALA B N   1 
ATOM   9409  C  CA  . ALA B  1 589 ? 47.894 125.274 67.362  1.00 54.29  ? 589 ALA B CA  1 
ATOM   9410  C  C   . ALA B  1 589 ? 48.604 124.228 66.501  1.00 57.45  ? 589 ALA B C   1 
ATOM   9411  O  O   . ALA B  1 589 ? 48.449 123.030 66.747  1.00 56.18  ? 589 ALA B O   1 
ATOM   9412  C  CB  . ALA B  1 589 ? 46.704 125.859 66.616  1.00 56.10  ? 589 ALA B CB  1 
ATOM   9413  N  N   . ASP B  1 590 ? 49.414 124.694 65.518  1.00 54.53  ? 590 ASP B N   1 
ATOM   9414  C  CA  . ASP B  1 590 ? 50.205 123.868 64.601  1.00 53.85  ? 590 ASP B CA  1 
ATOM   9415  C  C   . ASP B  1 590 ? 51.221 123.040 65.371  1.00 55.27  ? 590 ASP B C   1 
ATOM   9416  O  O   . ASP B  1 590 ? 51.295 121.831 65.168  1.00 54.33  ? 590 ASP B O   1 
ATOM   9417  C  CB  . ASP B  1 590 ? 50.914 124.745 63.552  1.00 57.09  ? 590 ASP B CB  1 
ATOM   9418  C  CG  . ASP B  1 590 ? 50.027 125.296 62.449  1.00 70.95  ? 590 ASP B CG  1 
ATOM   9419  O  OD1 . ASP B  1 590 ? 48.801 125.036 62.479  1.00 72.03  ? 590 ASP B OD1 1 
ATOM   9420  O  OD2 . ASP B  1 590 ? 50.558 125.982 61.548  1.00 78.33  ? 590 ASP B OD2 1 
ATOM   9421  N  N   . LEU B  1 591 ? 51.953 123.692 66.294  1.00 50.84  ? 591 LEU B N   1 
ATOM   9422  C  CA  . LEU B  1 591 ? 52.963 123.116 67.185  1.00 49.38  ? 591 LEU B CA  1 
ATOM   9423  C  C   . LEU B  1 591 ? 52.393 121.910 67.955  1.00 50.81  ? 591 LEU B C   1 
ATOM   9424  O  O   . LEU B  1 591 ? 53.005 120.840 67.927  1.00 49.32  ? 591 LEU B O   1 
ATOM   9425  C  CB  . LEU B  1 591 ? 53.459 124.219 68.151  1.00 49.80  ? 591 LEU B CB  1 
ATOM   9426  C  CG  . LEU B  1 591 ? 54.060 123.822 69.499  1.00 53.68  ? 591 LEU B CG  1 
ATOM   9427  C  CD1 . LEU B  1 591 ? 55.473 123.333 69.342  1.00 53.79  ? 591 LEU B CD1 1 
ATOM   9428  C  CD2 . LEU B  1 591 ? 54.040 124.988 70.451  1.00 56.60  ? 591 LEU B CD2 1 
ATOM   9429  N  N   . ILE B  1 592 ? 51.213 122.079 68.595  1.00 46.38  ? 592 ILE B N   1 
ATOM   9430  C  CA  . ILE B  1 592 ? 50.531 121.035 69.362  1.00 45.02  ? 592 ILE B CA  1 
ATOM   9431  C  C   . ILE B  1 592 ? 50.157 119.886 68.423  1.00 48.71  ? 592 ILE B C   1 
ATOM   9432  O  O   . ILE B  1 592 ? 50.429 118.735 68.759  1.00 48.52  ? 592 ILE B O   1 
ATOM   9433  C  CB  . ILE B  1 592 ? 49.310 121.584 70.159  1.00 48.18  ? 592 ILE B CB  1 
ATOM   9434  C  CG1 . ILE B  1 592 ? 49.775 122.582 71.240  1.00 48.73  ? 592 ILE B CG1 1 
ATOM   9435  C  CG2 . ILE B  1 592 ? 48.491 120.446 70.801  1.00 47.64  ? 592 ILE B CG2 1 
ATOM   9436  C  CD1 . ILE B  1 592 ? 48.731 123.545 71.712  1.00 55.50  ? 592 ILE B CD1 1 
ATOM   9437  N  N   . LEU B  1 593 ? 49.608 120.194 67.231  1.00 44.99  ? 593 LEU B N   1 
ATOM   9438  C  CA  . LEU B  1 593 ? 49.235 119.174 66.247  1.00 44.62  ? 593 LEU B CA  1 
ATOM   9439  C  C   . LEU B  1 593 ? 50.442 118.326 65.818  1.00 47.72  ? 593 LEU B C   1 
ATOM   9440  O  O   . LEU B  1 593 ? 50.283 117.116 65.663  1.00 46.58  ? 593 LEU B O   1 
ATOM   9441  C  CB  . LEU B  1 593 ? 48.552 119.793 65.022  1.00 45.68  ? 593 LEU B CB  1 
ATOM   9442  C  CG  . LEU B  1 593 ? 47.094 120.209 65.213  1.00 50.94  ? 593 LEU B CG  1 
ATOM   9443  C  CD1 . LEU B  1 593 ? 46.654 121.146 64.111  1.00 52.61  ? 593 LEU B CD1 1 
ATOM   9444  C  CD2 . LEU B  1 593 ? 46.166 118.998 65.285  1.00 52.90  ? 593 LEU B CD2 1 
ATOM   9445  N  N   . ILE B  1 594 ? 51.644 118.946 65.679  1.00 44.42  ? 594 ILE B N   1 
ATOM   9446  C  CA  . ILE B  1 594 ? 52.896 118.247 65.338  1.00 43.72  ? 594 ILE B CA  1 
ATOM   9447  C  C   . ILE B  1 594 ? 53.287 117.312 66.512  1.00 46.53  ? 594 ILE B C   1 
ATOM   9448  O  O   . ILE B  1 594 ? 53.550 116.128 66.291  1.00 45.49  ? 594 ILE B O   1 
ATOM   9449  C  CB  . ILE B  1 594 ? 54.067 119.225 64.979  1.00 47.10  ? 594 ILE B CB  1 
ATOM   9450  C  CG1 . ILE B  1 594 ? 53.686 120.285 63.901  1.00 48.59  ? 594 ILE B CG1 1 
ATOM   9451  C  CG2 . ILE B  1 594 ? 55.342 118.470 64.586  1.00 47.08  ? 594 ILE B CG2 1 
ATOM   9452  C  CD1 . ILE B  1 594 ? 53.272 119.806 62.477  1.00 57.83  ? 594 ILE B CD1 1 
ATOM   9453  N  N   . VAL B  1 595 ? 53.306 117.859 67.753  1.00 42.15  ? 595 VAL B N   1 
ATOM   9454  C  CA  . VAL B  1 595 ? 53.649 117.153 68.993  1.00 40.55  ? 595 VAL B CA  1 
ATOM   9455  C  C   . VAL B  1 595 ? 52.730 115.925 69.166  1.00 43.47  ? 595 VAL B C   1 
ATOM   9456  O  O   . VAL B  1 595 ? 53.237 114.817 69.359  1.00 43.00  ? 595 VAL B O   1 
ATOM   9457  C  CB  . VAL B  1 595 ? 53.597 118.108 70.226  1.00 44.22  ? 595 VAL B CB  1 
ATOM   9458  C  CG1 . VAL B  1 595 ? 53.697 117.343 71.542  1.00 43.14  ? 595 VAL B CG1 1 
ATOM   9459  C  CG2 . VAL B  1 595 ? 54.687 119.173 70.154  1.00 44.57  ? 595 VAL B CG2 1 
ATOM   9460  N  N   . VAL B  1 596 ? 51.398 116.124 69.052  1.00 39.41  ? 596 VAL B N   1 
ATOM   9461  C  CA  . VAL B  1 596 ? 50.368 115.084 69.197  1.00 38.54  ? 596 VAL B CA  1 
ATOM   9462  C  C   . VAL B  1 596 ? 50.555 114.003 68.110  1.00 41.84  ? 596 VAL B C   1 
ATOM   9463  O  O   . VAL B  1 596 ? 50.449 112.817 68.421  1.00 40.68  ? 596 VAL B O   1 
ATOM   9464  C  CB  . VAL B  1 596 ? 48.936 115.695 69.208  1.00 42.70  ? 596 VAL B CB  1 
ATOM   9465  C  CG1 . VAL B  1 596 ? 47.850 114.624 69.144  1.00 42.02  ? 596 VAL B CG1 1 
ATOM   9466  C  CG2 . VAL B  1 596 ? 48.735 116.571 70.442  1.00 42.46  ? 596 VAL B CG2 1 
ATOM   9467  N  N   . ALA B  1 597 ? 50.893 114.410 66.868  1.00 38.92  ? 597 ALA B N   1 
ATOM   9468  C  CA  . ALA B  1 597 ? 51.144 113.477 65.765  1.00 38.64  ? 597 ALA B CA  1 
ATOM   9469  C  C   . ALA B  1 597 ? 52.347 112.589 66.079  1.00 41.45  ? 597 ALA B C   1 
ATOM   9470  O  O   . ALA B  1 597 ? 52.249 111.370 65.932  1.00 40.67  ? 597 ALA B O   1 
ATOM   9471  C  CB  . ALA B  1 597 ? 51.373 114.235 64.467  1.00 40.29  ? 597 ALA B CB  1 
ATOM   9472  N  N   . VAL B  1 598 ? 53.455 113.201 66.568  1.00 37.67  ? 598 VAL B N   1 
ATOM   9473  C  CA  . VAL B  1 598 ? 54.699 112.521 66.953  1.00 36.65  ? 598 VAL B CA  1 
ATOM   9474  C  C   . VAL B  1 598 ? 54.393 111.550 68.104  1.00 39.97  ? 598 VAL B C   1 
ATOM   9475  O  O   . VAL B  1 598 ? 54.806 110.393 68.046  1.00 39.09  ? 598 VAL B O   1 
ATOM   9476  C  CB  . VAL B  1 598 ? 55.824 113.538 67.303  1.00 40.31  ? 598 VAL B CB  1 
ATOM   9477  C  CG1 . VAL B  1 598 ? 56.987 112.875 68.035  1.00 39.57  ? 598 VAL B CG1 1 
ATOM   9478  C  CG2 . VAL B  1 598 ? 56.327 114.248 66.053  1.00 40.84  ? 598 VAL B CG2 1 
ATOM   9479  N  N   . GLU B  1 599 ? 53.619 112.008 69.102  1.00 36.95  ? 599 GLU B N   1 
ATOM   9480  C  CA  . GLU B  1 599 ? 53.201 111.224 70.269  1.00 36.57  ? 599 GLU B CA  1 
ATOM   9481  C  C   . GLU B  1 599 ? 52.405 109.971 69.852  1.00 41.06  ? 599 GLU B C   1 
ATOM   9482  O  O   . GLU B  1 599 ? 52.634 108.895 70.406  1.00 39.73  ? 599 GLU B O   1 
ATOM   9483  C  CB  . GLU B  1 599 ? 52.365 112.102 71.216  1.00 37.83  ? 599 GLU B CB  1 
ATOM   9484  C  CG  . GLU B  1 599 ? 51.949 111.410 72.501  1.00 45.78  ? 599 GLU B CG  1 
ATOM   9485  C  CD  . GLU B  1 599 ? 50.473 111.509 72.826  1.00 61.96  ? 599 GLU B CD  1 
ATOM   9486  O  OE1 . GLU B  1 599 ? 50.138 111.569 74.030  1.00 65.28  ? 599 GLU B OE1 1 
ATOM   9487  O  OE2 . GLU B  1 599 ? 49.650 111.522 71.882  1.00 48.90  ? 599 GLU B OE2 1 
ATOM   9488  N  N   . HIS B  1 600 ? 51.488 110.118 68.875  1.00 38.99  ? 600 HIS B N   1 
ATOM   9489  C  CA  . HIS B  1 600 ? 50.654 109.035 68.354  1.00 38.73  ? 600 HIS B CA  1 
ATOM   9490  C  C   . HIS B  1 600 ? 51.495 108.017 67.589  1.00 42.51  ? 600 HIS B C   1 
ATOM   9491  O  O   . HIS B  1 600 ? 51.271 106.814 67.737  1.00 41.75  ? 600 HIS B O   1 
ATOM   9492  C  CB  . HIS B  1 600 ? 49.537 109.596 67.469  1.00 40.04  ? 600 HIS B CB  1 
ATOM   9493  C  CG  . HIS B  1 600 ? 48.324 109.989 68.246  1.00 43.38  ? 600 HIS B CG  1 
ATOM   9494  N  ND1 . HIS B  1 600 ? 48.269 111.178 68.942  1.00 45.24  ? 600 HIS B ND1 1 
ATOM   9495  C  CD2 . HIS B  1 600 ? 47.167 109.318 68.437  1.00 45.19  ? 600 HIS B CD2 1 
ATOM   9496  C  CE1 . HIS B  1 600 ? 47.083 111.197 69.526  1.00 44.68  ? 600 HIS B CE1 1 
ATOM   9497  N  NE2 . HIS B  1 600 ? 46.387 110.098 69.252  1.00 44.94  ? 600 HIS B NE2 1 
ATOM   9498  N  N   . ALA B  1 601 ? 52.477 108.500 66.799  1.00 39.43  ? 601 ALA B N   1 
ATOM   9499  C  CA  . ALA B  1 601 ? 53.396 107.662 66.025  1.00 39.40  ? 601 ALA B CA  1 
ATOM   9500  C  C   . ALA B  1 601 ? 54.296 106.848 66.963  1.00 43.42  ? 601 ALA B C   1 
ATOM   9501  O  O   . ALA B  1 601 ? 54.501 105.656 66.727  1.00 42.88  ? 601 ALA B O   1 
ATOM   9502  C  CB  . ALA B  1 601 ? 54.238 108.524 65.094  1.00 40.53  ? 601 ALA B CB  1 
ATOM   9503  N  N   . LEU B  1 602 ? 54.791 107.485 68.046  1.00 39.96  ? 602 LEU B N   1 
ATOM   9504  C  CA  . LEU B  1 602 ? 55.647 106.847 69.044  1.00 39.39  ? 602 LEU B CA  1 
ATOM   9505  C  C   . LEU B  1 602 ? 54.872 105.791 69.825  1.00 44.63  ? 602 LEU B C   1 
ATOM   9506  O  O   . LEU B  1 602 ? 55.413 104.710 70.046  1.00 44.81  ? 602 LEU B O   1 
ATOM   9507  C  CB  . LEU B  1 602 ? 56.266 107.874 70.008  1.00 39.12  ? 602 LEU B CB  1 
ATOM   9508  C  CG  . LEU B  1 602 ? 57.363 108.782 69.451  1.00 44.00  ? 602 LEU B CG  1 
ATOM   9509  C  CD1 . LEU B  1 602 ? 57.551 109.986 70.330  1.00 43.89  ? 602 LEU B CD1 1 
ATOM   9510  C  CD2 . LEU B  1 602 ? 58.679 108.046 69.311  1.00 46.56  ? 602 LEU B CD2 1 
ATOM   9511  N  N   . LEU B  1 603 ? 53.603 106.083 70.213  1.00 41.53  ? 603 LEU B N   1 
ATOM   9512  C  CA  . LEU B  1 603 ? 52.741 105.146 70.950  1.00 40.82  ? 603 LEU B CA  1 
ATOM   9513  C  C   . LEU B  1 603 ? 52.439 103.898 70.121  1.00 44.96  ? 603 LEU B C   1 
ATOM   9514  O  O   . LEU B  1 603 ? 52.338 102.809 70.687  1.00 44.38  ? 603 LEU B O   1 
ATOM   9515  C  CB  . LEU B  1 603 ? 51.428 105.806 71.393  1.00 40.78  ? 603 LEU B CB  1 
ATOM   9516  C  CG  . LEU B  1 603 ? 51.480 106.660 72.658  1.00 44.89  ? 603 LEU B CG  1 
ATOM   9517  C  CD1 . LEU B  1 603 ? 50.239 107.509 72.777  1.00 45.54  ? 603 LEU B CD1 1 
ATOM   9518  C  CD2 . LEU B  1 603 ? 51.629 105.813 73.911  1.00 45.85  ? 603 LEU B CD2 1 
ATOM   9519  N  N   . ALA B  1 604 ? 52.317 104.057 68.785  1.00 41.83  ? 604 ALA B N   1 
ATOM   9520  C  CA  . ALA B  1 604 ? 52.090 102.953 67.853  1.00 41.65  ? 604 ALA B CA  1 
ATOM   9521  C  C   . ALA B  1 604 ? 53.355 102.104 67.745  1.00 44.74  ? 604 ALA B C   1 
ATOM   9522  O  O   . ALA B  1 604 ? 53.267 100.881 67.841  1.00 44.57  ? 604 ALA B O   1 
ATOM   9523  C  CB  . ALA B  1 604 ? 51.683 103.485 66.488  1.00 43.12  ? 604 ALA B CB  1 
ATOM   9524  N  N   . LEU B  1 605 ? 54.533 102.756 67.611  1.00 40.57  ? 605 LEU B N   1 
ATOM   9525  C  CA  . LEU B  1 605 ? 55.837 102.098 67.522  1.00 40.34  ? 605 LEU B CA  1 
ATOM   9526  C  C   . LEU B  1 605 ? 56.186 101.383 68.816  1.00 44.18  ? 605 LEU B C   1 
ATOM   9527  O  O   . LEU B  1 605 ? 56.799 100.319 68.769  1.00 43.95  ? 605 LEU B O   1 
ATOM   9528  C  CB  . LEU B  1 605 ? 56.937 103.102 67.164  1.00 40.80  ? 605 LEU B CB  1 
ATOM   9529  C  CG  . LEU B  1 605 ? 57.023 103.483 65.684  1.00 46.83  ? 605 LEU B CG  1 
ATOM   9530  C  CD1 . LEU B  1 605 ? 57.619 104.864 65.507  1.00 47.37  ? 605 LEU B CD1 1 
ATOM   9531  C  CD2 . LEU B  1 605 ? 57.813 102.452 64.886  1.00 49.93  ? 605 LEU B CD2 1 
ATOM   9532  N  N   . LYS B  1 606 ? 55.778 101.952 69.966  1.00 41.00  ? 606 LYS B N   1 
ATOM   9533  C  CA  . LYS B  1 606 ? 55.993 101.390 71.303  1.00 40.66  ? 606 LYS B CA  1 
ATOM   9534  C  C   . LYS B  1 606 ? 55.191 100.085 71.457  1.00 45.73  ? 606 LYS B C   1 
ATOM   9535  O  O   . LYS B  1 606 ? 55.702 99.124  72.036  1.00 45.05  ? 606 LYS B O   1 
ATOM   9536  C  CB  . LYS B  1 606 ? 55.606 102.415 72.385  1.00 42.41  ? 606 LYS B CB  1 
ATOM   9537  C  CG  . LYS B  1 606 ? 56.004 102.010 73.791  1.00 51.86  ? 606 LYS B CG  1 
ATOM   9538  C  CD  . LYS B  1 606 ? 55.829 103.129 74.789  1.00 61.36  ? 606 LYS B CD  1 
ATOM   9539  C  CE  . LYS B  1 606 ? 57.150 103.625 75.328  1.00 71.58  ? 606 LYS B CE  1 
ATOM   9540  N  NZ  . LYS B  1 606 ? 57.632 102.798 76.466  1.00 79.88  ? 606 LYS B NZ  1 
ATOM   9541  N  N   . PHE B  1 607 ? 53.951 100.055 70.916  1.00 43.56  ? 607 PHE B N   1 
ATOM   9542  C  CA  . PHE B  1 607 ? 53.064 98.889  70.931  1.00 44.07  ? 607 PHE B CA  1 
ATOM   9543  C  C   . PHE B  1 607 ? 53.650 97.784  70.039  1.00 47.36  ? 607 PHE B C   1 
ATOM   9544  O  O   . PHE B  1 607 ? 53.701 96.628  70.466  1.00 47.43  ? 607 PHE B O   1 
ATOM   9545  C  CB  . PHE B  1 607 ? 51.638 99.280  70.474  1.00 46.86  ? 607 PHE B CB  1 
ATOM   9546  C  CG  . PHE B  1 607 ? 50.672 98.132  70.248  1.00 49.63  ? 607 PHE B CG  1 
ATOM   9547  C  CD1 . PHE B  1 607 ? 50.579 97.510  69.002  1.00 53.98  ? 607 PHE B CD1 1 
ATOM   9548  C  CD2 . PHE B  1 607 ? 49.835 97.694  71.267  1.00 51.99  ? 607 PHE B CD2 1 
ATOM   9549  C  CE1 . PHE B  1 607 ? 49.698 96.440  68.797  1.00 55.08  ? 607 PHE B CE1 1 
ATOM   9550  C  CE2 . PHE B  1 607 ? 48.942 96.636  71.056  1.00 55.27  ? 607 PHE B CE2 1 
ATOM   9551  C  CZ  . PHE B  1 607 ? 48.882 96.015  69.823  1.00 53.86  ? 607 PHE B CZ  1 
ATOM   9552  N  N   . ILE B  1 608 ? 54.079 98.148  68.805  1.00 42.47  ? 608 ILE B N   1 
ATOM   9553  C  CA  . ILE B  1 608 ? 54.662 97.244  67.806  1.00 42.00  ? 608 ILE B CA  1 
ATOM   9554  C  C   . ILE B  1 608 ? 55.925 96.574  68.379  1.00 45.56  ? 608 ILE B C   1 
ATOM   9555  O  O   . ILE B  1 608 ? 56.042 95.356  68.276  1.00 45.75  ? 608 ILE B O   1 
ATOM   9556  C  CB  . ILE B  1 608 ? 54.935 97.992  66.461  1.00 45.14  ? 608 ILE B CB  1 
ATOM   9557  C  CG1 . ILE B  1 608 ? 53.615 98.265  65.712  1.00 45.61  ? 608 ILE B CG1 1 
ATOM   9558  C  CG2 . ILE B  1 608 ? 55.924 97.237  65.557  1.00 45.66  ? 608 ILE B CG2 1 
ATOM   9559  C  CD1 . ILE B  1 608 ? 53.648 99.466  64.778  1.00 52.79  ? 608 ILE B CD1 1 
ATOM   9560  N  N   . LEU B  1 609 ? 56.835 97.359  69.004  1.00 41.24  ? 609 LEU B N   1 
ATOM   9561  C  CA  . LEU B  1 609 ? 58.082 96.875  69.613  1.00 40.59  ? 609 LEU B CA  1 
ATOM   9562  C  C   . LEU B  1 609 ? 57.793 95.858  70.731  1.00 44.57  ? 609 LEU B C   1 
ATOM   9563  O  O   . LEU B  1 609 ? 58.463 94.830  70.792  1.00 44.27  ? 609 LEU B O   1 
ATOM   9564  C  CB  . LEU B  1 609 ? 58.915 98.060  70.147  1.00 40.17  ? 609 LEU B CB  1 
ATOM   9565  C  CG  . LEU B  1 609 ? 60.289 97.763  70.771  1.00 44.34  ? 609 LEU B CG  1 
ATOM   9566  C  CD1 . LEU B  1 609 ? 61.254 97.177  69.754  1.00 45.21  ? 609 LEU B CD1 1 
ATOM   9567  C  CD2 . LEU B  1 609 ? 60.890 99.016  71.366  1.00 45.64  ? 609 LEU B CD2 1 
ATOM   9568  N  N   . ALA B  1 610 ? 56.781 96.132  71.580  1.00 41.15  ? 610 ALA B N   1 
ATOM   9569  C  CA  . ALA B  1 610 ? 56.365 95.247  72.667  1.00 41.10  ? 610 ALA B CA  1 
ATOM   9570  C  C   . ALA B  1 610 ? 55.737 93.968  72.119  1.00 47.38  ? 610 ALA B C   1 
ATOM   9571  O  O   . ALA B  1 610 ? 55.925 92.900  72.699  1.00 47.21  ? 610 ALA B O   1 
ATOM   9572  C  CB  . ALA B  1 610 ? 55.381 95.963  73.572  1.00 41.41  ? 610 ALA B CB  1 
ATOM   9573  N  N   . PHE B  1 611 ? 55.003 94.078  70.998  1.00 46.11  ? 611 PHE B N   1 
ATOM   9574  C  CA  . PHE B  1 611 ? 54.356 92.954  70.319  1.00 47.20  ? 611 PHE B CA  1 
ATOM   9575  C  C   . PHE B  1 611 ? 55.400 92.075  69.624  1.00 51.65  ? 611 PHE B C   1 
ATOM   9576  O  O   . PHE B  1 611 ? 55.254 90.855  69.620  1.00 52.15  ? 611 PHE B O   1 
ATOM   9577  C  CB  . PHE B  1 611 ? 53.321 93.466  69.298  1.00 49.93  ? 611 PHE B CB  1 
ATOM   9578  C  CG  . PHE B  1 611 ? 52.483 92.397  68.635  1.00 52.74  ? 611 PHE B CG  1 
ATOM   9579  C  CD1 . PHE B  1 611 ? 52.900 91.796  67.451  1.00 56.77  ? 611 PHE B CD1 1 
ATOM   9580  C  CD2 . PHE B  1 611 ? 51.261 92.013  69.177  1.00 55.37  ? 611 PHE B CD2 1 
ATOM   9581  C  CE1 . PHE B  1 611 ? 52.125 90.807  66.840  1.00 58.35  ? 611 PHE B CE1 1 
ATOM   9582  C  CE2 . PHE B  1 611 ? 50.480 91.030  68.557  1.00 58.78  ? 611 PHE B CE2 1 
ATOM   9583  C  CZ  . PHE B  1 611 ? 50.915 90.438  67.391  1.00 57.48  ? 611 PHE B CZ  1 
ATOM   9584  N  N   . ALA B  1 612 ? 56.428 92.700  69.015  1.00 47.99  ? 612 ALA B N   1 
ATOM   9585  C  CA  . ALA B  1 612 ? 57.504 92.026  68.290  1.00 48.09  ? 612 ALA B CA  1 
ATOM   9586  C  C   . ALA B  1 612 ? 58.406 91.234  69.227  1.00 51.79  ? 612 ALA B C   1 
ATOM   9587  O  O   . ALA B  1 612 ? 58.833 90.146  68.852  1.00 52.53  ? 612 ALA B O   1 
ATOM   9588  C  CB  . ALA B  1 612 ? 58.328 93.036  67.508  1.00 49.06  ? 612 ALA B CB  1 
ATOM   9589  N  N   . ILE B  1 613 ? 58.689 91.760  70.436  1.00 47.40  ? 613 ILE B N   1 
ATOM   9590  C  CA  . ILE B  1 613 ? 59.528 91.060  71.413  1.00 47.01  ? 613 ILE B CA  1 
ATOM   9591  C  C   . ILE B  1 613 ? 58.676 89.977  72.112  1.00 50.18  ? 613 ILE B C   1 
ATOM   9592  O  O   . ILE B  1 613 ? 57.705 90.324  72.792  1.00 49.51  ? 613 ILE B O   1 
ATOM   9593  C  CB  . ILE B  1 613 ? 60.209 92.024  72.430  1.00 49.69  ? 613 ILE B CB  1 
ATOM   9594  C  CG1 . ILE B  1 613 ? 61.138 93.029  71.711  1.00 50.45  ? 613 ILE B CG1 1 
ATOM   9595  C  CG2 . ILE B  1 613 ? 60.982 91.231  73.503  1.00 50.35  ? 613 ILE B CG2 1 
ATOM   9596  C  CD1 . ILE B  1 613 ? 61.382 94.355  72.468  1.00 58.21  ? 613 ILE B CD1 1 
ATOM   9597  N  N   . PRO B  1 614 ? 59.020 88.671  71.955  1.00 46.23  ? 614 PRO B N   1 
ATOM   9598  C  CA  . PRO B  1 614 ? 58.239 87.617  72.628  1.00 45.88  ? 614 PRO B CA  1 
ATOM   9599  C  C   . PRO B  1 614 ? 58.492 87.607  74.136  1.00 49.31  ? 614 PRO B C   1 
ATOM   9600  O  O   . PRO B  1 614 ? 59.643 87.688  74.569  1.00 48.97  ? 614 PRO B O   1 
ATOM   9601  C  CB  . PRO B  1 614 ? 58.731 86.322  71.968  1.00 48.38  ? 614 PRO B CB  1 
ATOM   9602  C  CG  . PRO B  1 614 ? 59.633 86.746  70.846  1.00 53.28  ? 614 PRO B CG  1 
ATOM   9603  C  CD  . PRO B  1 614 ? 60.141 88.093  71.194  1.00 48.11  ? 614 PRO B CD  1 
ATOM   9604  N  N   . ASP B  1 615 ? 57.410 87.511  74.932  1.00 45.15  ? 615 ASP B N   1 
ATOM   9605  C  CA  . ASP B  1 615 ? 57.438 87.531  76.399  1.00 44.22  ? 615 ASP B CA  1 
ATOM   9606  C  C   . ASP B  1 615 ? 58.201 86.335  77.017  1.00 48.93  ? 615 ASP B C   1 
ATOM   9607  O  O   . ASP B  1 615 ? 58.563 86.391  78.193  1.00 47.93  ? 615 ASP B O   1 
ATOM   9608  C  CB  . ASP B  1 615 ? 56.004 87.587  76.954  1.00 45.53  ? 615 ASP B CB  1 
ATOM   9609  C  CG  . ASP B  1 615 ? 55.188 88.798  76.526  1.00 53.42  ? 615 ASP B CG  1 
ATOM   9610  O  OD1 . ASP B  1 615 ? 55.794 89.824  76.149  1.00 53.41  ? 615 ASP B OD1 1 
ATOM   9611  O  OD2 . ASP B  1 615 ? 53.944 88.729  76.598  1.00 59.78  ? 615 ASP B OD2 1 
ATOM   9612  N  N   . LYS B  1 616 ? 58.450 85.273  76.230  1.00 46.85  ? 616 LYS B N   1 
ATOM   9613  C  CA  . LYS B  1 616 ? 59.178 84.079  76.666  1.00 47.05  ? 616 LYS B CA  1 
ATOM   9614  C  C   . LYS B  1 616 ? 60.286 83.724  75.658  1.00 52.35  ? 616 LYS B C   1 
ATOM   9615  O  O   . LYS B  1 616 ? 60.050 83.848  74.451  1.00 52.43  ? 616 LYS B O   1 
ATOM   9616  C  CB  . LYS B  1 616 ? 58.217 82.886  76.842  1.00 49.29  ? 616 LYS B CB  1 
ATOM   9617  C  CG  . LYS B  1 616 ? 57.354 82.955  78.092  1.00 55.49  ? 616 LYS B CG  1 
ATOM   9618  C  CD  . LYS B  1 616 ? 56.126 82.054  77.976  1.00 61.18  ? 616 LYS B CD  1 
ATOM   9619  C  CE  . LYS B  1 616 ? 55.178 82.210  79.140  1.00 70.39  ? 616 LYS B CE  1 
ATOM   9620  N  NZ  . LYS B  1 616 ? 54.538 83.553  79.171  1.00 78.60  ? 616 LYS B NZ  1 
ATOM   9621  N  N   . PRO B  1 617 ? 61.483 83.263  76.115  1.00 49.24  ? 617 PRO B N   1 
ATOM   9622  C  CA  . PRO B  1 617 ? 62.545 82.883  75.161  1.00 49.88  ? 617 PRO B CA  1 
ATOM   9623  C  C   . PRO B  1 617 ? 62.181 81.631  74.353  1.00 54.91  ? 617 PRO B C   1 
ATOM   9624  O  O   . PRO B  1 617 ? 61.305 80.870  74.768  1.00 54.28  ? 617 PRO B O   1 
ATOM   9625  C  CB  . PRO B  1 617 ? 63.760 82.632  76.064  1.00 51.68  ? 617 PRO B CB  1 
ATOM   9626  C  CG  . PRO B  1 617 ? 63.407 83.235  77.394  1.00 55.18  ? 617 PRO B CG  1 
ATOM   9627  C  CD  . PRO B  1 617 ? 61.933 83.060  77.504  1.00 50.46  ? 617 PRO B CD  1 
ATOM   9628  N  N   . ARG B  1 618 ? 62.841 81.429  73.193  1.00 52.99  ? 618 ARG B N   1 
ATOM   9629  C  CA  . ARG B  1 618 ? 62.584 80.318  72.268  1.00 54.15  ? 618 ARG B CA  1 
ATOM   9630  C  C   . ARG B  1 618 ? 62.689 78.947  72.935  1.00 59.84  ? 618 ARG B C   1 
ATOM   9631  O  O   . ARG B  1 618 ? 61.779 78.139  72.770  1.00 60.00  ? 618 ARG B O   1 
ATOM   9632  C  CB  . ARG B  1 618 ? 63.529 80.374  71.060  1.00 55.20  ? 618 ARG B CB  1 
ATOM   9633  N  N   . HIS B  1 619 ? 63.773 78.696  73.701  1.00 57.16  ? 619 HIS B N   1 
ATOM   9634  C  CA  . HIS B  1 619 ? 64.018 77.416  74.379  1.00 57.84  ? 619 HIS B CA  1 
ATOM   9635  C  C   . HIS B  1 619 ? 62.968 77.105  75.462  1.00 58.65  ? 619 HIS B C   1 
ATOM   9636  O  O   . HIS B  1 619 ? 62.589 75.944  75.600  1.00 58.83  ? 619 HIS B O   1 
ATOM   9637  C  CB  . HIS B  1 619 ? 65.441 77.344  74.956  1.00 59.87  ? 619 HIS B CB  1 
ATOM   9638  C  CG  . HIS B  1 619 ? 65.726 78.300  76.075  1.00 63.39  ? 619 HIS B CG  1 
ATOM   9639  N  ND1 . HIS B  1 619 ? 65.931 79.658  75.843  1.00 65.03  ? 619 HIS B ND1 1 
ATOM   9640  C  CD2 . HIS B  1 619 ? 65.877 78.056  77.397  1.00 65.40  ? 619 HIS B CD2 1 
ATOM   9641  C  CE1 . HIS B  1 619 ? 66.179 80.191  77.031  1.00 63.97  ? 619 HIS B CE1 1 
ATOM   9642  N  NE2 . HIS B  1 619 ? 66.152 79.269  77.997  1.00 64.45  ? 619 HIS B NE2 1 
ATOM   9643  N  N   . ILE B  1 620 ? 62.476 78.130  76.191  1.00 52.69  ? 620 ILE B N   1 
ATOM   9644  C  CA  . ILE B  1 620 ? 61.441 77.973  77.222  1.00 51.11  ? 620 ILE B CA  1 
ATOM   9645  C  C   . ILE B  1 620 ? 60.103 77.657  76.539  1.00 55.55  ? 620 ILE B C   1 
ATOM   9646  O  O   . ILE B  1 620 ? 59.377 76.788  77.019  1.00 55.70  ? 620 ILE B O   1 
ATOM   9647  C  CB  . ILE B  1 620 ? 61.348 79.211  78.161  1.00 52.53  ? 620 ILE B CB  1 
ATOM   9648  C  CG1 . ILE B  1 620 ? 62.708 79.546  78.813  1.00 52.66  ? 620 ILE B CG1 1 
ATOM   9649  C  CG2 . ILE B  1 620 ? 60.237 79.066  79.215  1.00 52.34  ? 620 ILE B CG2 1 
ATOM   9650  C  CD1 . ILE B  1 620 ? 63.300 78.513  79.868  1.00 61.78  ? 620 ILE B CD1 1 
ATOM   9651  N  N   . GLN B  1 621 ? 59.804 78.330  75.404  1.00 52.15  ? 621 GLN B N   1 
ATOM   9652  C  CA  . GLN B  1 621 ? 58.584 78.129  74.617  1.00 52.36  ? 621 GLN B CA  1 
ATOM   9653  C  C   . GLN B  1 621 ? 58.497 76.693  74.092  1.00 58.24  ? 621 GLN B C   1 
ATOM   9654  O  O   . GLN B  1 621 ? 57.415 76.110  74.140  1.00 58.06  ? 621 GLN B O   1 
ATOM   9655  C  CB  . GLN B  1 621 ? 58.508 79.130  73.460  1.00 53.52  ? 621 GLN B CB  1 
ATOM   9656  C  CG  . GLN B  1 621 ? 58.052 80.517  73.899  1.00 69.20  ? 621 GLN B CG  1 
ATOM   9657  C  CD  . GLN B  1 621 ? 58.315 81.606  72.882  1.00 88.29  ? 621 GLN B CD  1 
ATOM   9658  O  OE1 . GLN B  1 621 ? 59.355 81.647  72.211  1.00 83.50  ? 621 GLN B OE1 1 
ATOM   9659  N  NE2 . GLN B  1 621 ? 57.403 82.562  72.807  1.00 80.17  ? 621 GLN B NE2 1 
ATOM   9660  N  N   . MET B  1 622 ? 59.638 76.116  73.643  1.00 56.34  ? 622 MET B N   1 
ATOM   9661  C  CA  . MET B  1 622 ? 59.730 74.737  73.135  1.00 57.87  ? 622 MET B CA  1 
ATOM   9662  C  C   . MET B  1 622 ? 59.558 73.725  74.275  1.00 61.09  ? 622 MET B C   1 
ATOM   9663  O  O   . MET B  1 622 ? 58.865 72.720  74.098  1.00 61.28  ? 622 MET B O   1 
ATOM   9664  C  CB  . MET B  1 622 ? 61.068 74.483  72.402  1.00 61.37  ? 622 MET B CB  1 
ATOM   9665  C  CG  . MET B  1 622 ? 61.330 75.410  71.226  1.00 65.64  ? 622 MET B CG  1 
ATOM   9666  S  SD  . MET B  1 622 ? 60.176 75.248  69.845  1.00 71.18  ? 622 MET B SD  1 
ATOM   9667  C  CE  . MET B  1 622 ? 60.296 76.877  69.132  1.00 67.26  ? 622 MET B CE  1 
ATOM   9668  N  N   . LYS B  1 623 ? 60.188 73.998  75.440  1.00 56.48  ? 623 LYS B N   1 
ATOM   9669  C  CA  . LYS B  1 623 ? 60.118 73.160  76.642  1.00 56.33  ? 623 LYS B CA  1 
ATOM   9670  C  C   . LYS B  1 623 ? 58.679 73.121  77.188  1.00 59.01  ? 623 LYS B C   1 
ATOM   9671  O  O   . LYS B  1 623 ? 58.219 72.065  77.627  1.00 58.94  ? 623 LYS B O   1 
ATOM   9672  C  CB  . LYS B  1 623 ? 61.104 73.655  77.713  1.00 58.30  ? 623 LYS B CB  1 
ATOM   9673  C  CG  . LYS B  1 623 ? 62.550 73.255  77.423  1.00 74.99  ? 623 LYS B CG  1 
ATOM   9674  C  CD  . LYS B  1 623 ? 63.552 74.041  78.279  1.00 86.04  ? 623 LYS B CD  1 
ATOM   9675  C  CE  . LYS B  1 623 ? 65.034 73.912  77.936  1.00 103.23 ? 623 LYS B CE  1 
ATOM   9676  N  NZ  . LYS B  1 623 ? 65.575 72.514  77.776  1.00 116.91 ? 623 LYS B NZ  1 
ATOM   9677  N  N   . LEU B  1 624 ? 57.964 74.259  77.112  1.00 53.96  ? 624 LEU B N   1 
ATOM   9678  C  CA  . LEU B  1 624 ? 56.564 74.394  77.522  1.00 53.02  ? 624 LEU B CA  1 
ATOM   9679  C  C   . LEU B  1 624 ? 55.627 73.732  76.501  1.00 57.61  ? 624 LEU B C   1 
ATOM   9680  O  O   . LEU B  1 624 ? 54.563 73.236  76.880  1.00 57.31  ? 624 LEU B O   1 
ATOM   9681  C  CB  . LEU B  1 624 ? 56.212 75.882  77.676  1.00 51.83  ? 624 LEU B CB  1 
ATOM   9682  C  CG  . LEU B  1 624 ? 56.113 76.440  79.099  1.00 55.32  ? 624 LEU B CG  1 
ATOM   9683  C  CD1 . LEU B  1 624 ? 57.463 76.454  79.795  1.00 55.31  ? 624 LEU B CD1 1 
ATOM   9684  C  CD2 . LEU B  1 624 ? 55.574 77.849  79.076  1.00 56.51  ? 624 LEU B CD2 1 
ATOM   9685  N  N   . ALA B  1 625 ? 56.027 73.723  75.211  1.00 54.86  ? 625 ALA B N   1 
ATOM   9686  C  CA  . ALA B  1 625 ? 55.263 73.128  74.114  1.00 55.58  ? 625 ALA B CA  1 
ATOM   9687  C  C   . ALA B  1 625 ? 55.290 71.605  74.168  1.00 61.61  ? 625 ALA B C   1 
ATOM   9688  O  O   . ALA B  1 625 ? 54.228 70.997  74.050  1.00 61.87  ? 625 ALA B O   1 
ATOM   9689  C  CB  . ALA B  1 625 ? 55.794 73.606  72.772  1.00 56.53  ? 625 ALA B CB  1 
ATOM   9690  N  N   . ARG B  1 626 ? 56.486 70.982  74.350  1.00 59.59  ? 626 ARG B N   1 
ATOM   9691  C  CA  . ARG B  1 626 ? 56.621 69.517  74.404  1.00 61.15  ? 626 ARG B CA  1 
ATOM   9692  C  C   . ARG B  1 626 ? 55.881 68.932  75.611  1.00 65.04  ? 626 ARG B C   1 
ATOM   9693  O  O   . ARG B  1 626 ? 55.371 67.817  75.520  1.00 65.54  ? 626 ARG B O   1 
ATOM   9694  C  CB  . ARG B  1 626 ? 58.091 69.049  74.362  1.00 63.56  ? 626 ARG B CB  1 
ATOM   9695  C  CG  . ARG B  1 626 ? 58.950 69.365  75.588  1.00 77.99  ? 626 ARG B CG  1 
ATOM   9696  C  CD  . ARG B  1 626 ? 60.399 68.975  75.351  1.00 91.68  ? 626 ARG B CD  1 
ATOM   9697  N  NE  . ARG B  1 626 ? 61.109 69.968  74.539  1.00 97.86  ? 626 ARG B NE  1 
ATOM   9698  C  CZ  . ARG B  1 626 ? 62.246 69.740  73.889  1.00 106.97 ? 626 ARG B CZ  1 
ATOM   9699  N  NH1 . ARG B  1 626 ? 62.811 68.537  73.926  1.00 92.63  ? 626 ARG B NH1 1 
ATOM   9700  N  NH2 . ARG B  1 626 ? 62.817 70.705  73.182  1.00 90.14  ? 626 ARG B NH2 1 
ATOM   9701  N  N   . LEU B  1 627 ? 55.777 69.706  76.705  1.00 61.23  ? 627 LEU B N   1 
ATOM   9702  C  CA  . LEU B  1 627 ? 55.053 69.304  77.905  1.00 61.35  ? 627 LEU B CA  1 
ATOM   9703  C  C   . LEU B  1 627 ? 53.549 69.449  77.684  1.00 64.88  ? 627 LEU B C   1 
ATOM   9704  O  O   . LEU B  1 627 ? 52.780 68.662  78.239  1.00 65.45  ? 627 LEU B O   1 
ATOM   9705  C  CB  . LEU B  1 627 ? 55.517 70.100  79.130  1.00 60.59  ? 627 LEU B CB  1 
ATOM   9706  C  CG  . LEU B  1 627 ? 56.442 69.317  80.061  1.00 66.41  ? 627 LEU B CG  1 
ATOM   9707  C  CD1 . LEU B  1 627 ? 57.908 69.595  79.763  1.00 66.98  ? 627 LEU B CD1 1 
ATOM   9708  C  CD2 . LEU B  1 627 ? 56.133 69.610  81.499  1.00 68.46  ? 627 LEU B CD2 1 
ATOM   9709  N  N   . GLU B  1 628 ? 53.134 70.426  76.847  1.00 60.02  ? 628 GLU B N   1 
ATOM   9710  C  CA  . GLU B  1 628 ? 51.732 70.641  76.480  1.00 59.46  ? 628 GLU B CA  1 
ATOM   9711  C  C   . GLU B  1 628 ? 51.268 69.485  75.587  1.00 64.21  ? 628 GLU B C   1 
ATOM   9712  O  O   . GLU B  1 628 ? 50.161 68.979  75.770  1.00 64.70  ? 628 GLU B O   1 
ATOM   9713  C  CB  . GLU B  1 628 ? 51.543 71.995  75.771  1.00 60.02  ? 628 GLU B CB  1 
ATOM   9714  C  CG  . GLU B  1 628 ? 50.085 72.395  75.582  1.00 69.89  ? 628 GLU B CG  1 
ATOM   9715  C  CD  . GLU B  1 628 ? 49.816 73.605  74.706  1.00 90.87  ? 628 GLU B CD  1 
ATOM   9716  O  OE1 . GLU B  1 628 ? 50.637 74.552  74.710  1.00 88.88  ? 628 GLU B OE1 1 
ATOM   9717  O  OE2 . GLU B  1 628 ? 48.754 73.623  74.044  1.00 83.50  ? 628 GLU B OE2 1 
ATOM   9718  N  N   . PHE B  1 629 ? 52.142 69.057  74.646  1.00 60.31  ? 629 PHE B N   1 
ATOM   9719  C  CA  . PHE B  1 629 ? 51.908 67.955  73.712  1.00 60.85  ? 629 PHE B CA  1 
ATOM   9720  C  C   . PHE B  1 629 ? 51.792 66.630  74.458  1.00 65.13  ? 629 PHE B C   1 
ATOM   9721  O  O   . PHE B  1 629 ? 50.931 65.819  74.116  1.00 65.62  ? 629 PHE B O   1 
ATOM   9722  C  CB  . PHE B  1 629 ? 53.037 67.887  72.665  1.00 62.94  ? 629 PHE B CB  1 
ATOM   9723  C  CG  . PHE B  1 629 ? 52.925 66.749  71.679  1.00 65.95  ? 629 PHE B CG  1 
ATOM   9724  C  CD1 . PHE B  1 629 ? 52.020 66.806  70.625  1.00 69.64  ? 629 PHE B CD1 1 
ATOM   9725  C  CD2 . PHE B  1 629 ? 53.735 65.627  71.794  1.00 68.69  ? 629 PHE B CD2 1 
ATOM   9726  C  CE1 . PHE B  1 629 ? 51.913 65.749  69.718  1.00 71.80  ? 629 PHE B CE1 1 
ATOM   9727  C  CE2 . PHE B  1 629 ? 53.631 64.574  70.882  1.00 72.87  ? 629 PHE B CE2 1 
ATOM   9728  C  CZ  . PHE B  1 629 ? 52.721 64.642  69.852  1.00 71.56  ? 629 PHE B CZ  1 
ATOM   9729  N  N   . GLU B  1 630 ? 52.657 66.419  75.473  1.00 61.52  ? 630 GLU B N   1 
ATOM   9730  C  CA  . GLU B  1 630 ? 52.694 65.215  76.309  1.00 62.19  ? 630 GLU B CA  1 
ATOM   9731  C  C   . GLU B  1 630 ? 51.387 65.028  77.083  1.00 66.10  ? 630 GLU B C   1 
ATOM   9732  O  O   . GLU B  1 630 ? 50.907 63.899  77.183  1.00 66.58  ? 630 GLU B O   1 
ATOM   9733  C  CB  . GLU B  1 630 ? 53.885 65.264  77.276  1.00 63.10  ? 630 GLU B CB  1 
ATOM   9734  C  CG  . GLU B  1 630 ? 55.156 64.673  76.681  1.00 74.98  ? 630 GLU B CG  1 
ATOM   9735  C  CD  . GLU B  1 630 ? 56.459 64.948  77.410  1.00 97.31  ? 630 GLU B CD  1 
ATOM   9736  O  OE1 . GLU B  1 630 ? 56.417 65.405  78.575  1.00 93.61  ? 630 GLU B OE1 1 
ATOM   9737  O  OE2 . GLU B  1 630 ? 57.529 64.695  76.810  1.00 92.24  ? 630 GLU B OE2 1 
ATOM   9738  N  N   . SER B  1 631 ? 50.804 66.135  77.596  1.00 61.85  ? 631 SER B N   1 
ATOM   9739  C  CA  . SER B  1 631 ? 49.541 66.151  78.342  1.00 61.74  ? 631 SER B CA  1 
ATOM   9740  C  C   . SER B  1 631 ? 48.362 65.707  77.465  1.00 67.68  ? 631 SER B C   1 
ATOM   9741  O  O   . SER B  1 631 ? 47.465 65.015  77.952  1.00 67.99  ? 631 SER B O   1 
ATOM   9742  C  CB  . SER B  1 631 ? 49.272 67.541  78.905  1.00 63.31  ? 631 SER B CB  1 
ATOM   9743  O  OG  . SER B  1 631 ? 50.301 67.927  79.800  1.00 71.12  ? 631 SER B OG  1 
ATOM   9744  N  N   . LEU B  1 632 ? 48.376 66.094  76.176  1.00 64.98  ? 632 LEU B N   1 
ATOM   9745  C  CA  . LEU B  1 632 ? 47.340 65.731  75.206  1.00 66.13  ? 632 LEU B CA  1 
ATOM   9746  C  C   . LEU B  1 632 ? 47.456 64.258  74.830  1.00 72.04  ? 632 LEU B C   1 
ATOM   9747  O  O   . LEU B  1 632 ? 46.432 63.584  74.705  1.00 72.74  ? 632 LEU B O   1 
ATOM   9748  C  CB  . LEU B  1 632 ? 47.419 66.608  73.944  1.00 65.98  ? 632 LEU B CB  1 
ATOM   9749  C  CG  . LEU B  1 632 ? 47.389 68.121  74.145  1.00 69.17  ? 632 LEU B CG  1 
ATOM   9750  C  CD1 . LEU B  1 632 ? 48.011 68.822  72.967  1.00 69.25  ? 632 LEU B CD1 1 
ATOM   9751  C  CD2 . LEU B  1 632 ? 45.977 68.633  74.407  1.00 71.19  ? 632 LEU B CD2 1 
ATOM   9752  N  N   . GLU B  1 633 ? 48.709 63.760  74.675  1.00 69.02  ? 633 GLU B N   1 
ATOM   9753  C  CA  . GLU B  1 633 ? 49.020 62.360  74.361  1.00 70.51  ? 633 GLU B CA  1 
ATOM   9754  C  C   . GLU B  1 633 ? 48.641 61.460  75.534  1.00 74.29  ? 633 GLU B C   1 
ATOM   9755  O  O   . GLU B  1 633 ? 48.244 60.312  75.327  1.00 75.43  ? 633 GLU B O   1 
ATOM   9756  C  CB  . GLU B  1 633 ? 50.510 62.176  74.012  1.00 72.17  ? 633 GLU B CB  1 
ATOM   9757  C  CG  . GLU B  1 633 ? 50.941 62.805  72.695  1.00 84.88  ? 633 GLU B CG  1 
ATOM   9758  C  CD  . GLU B  1 633 ? 50.148 62.419  71.459  1.00 113.23 ? 633 GLU B CD  1 
ATOM   9759  O  OE1 . GLU B  1 633 ? 50.017 61.204  71.182  1.00 111.51 ? 633 GLU B OE1 1 
ATOM   9760  O  OE2 . GLU B  1 633 ? 49.672 63.340  70.757  1.00 109.33 ? 633 GLU B OE2 1 
ATOM   9761  N  N   . ALA B  1 634 ? 48.756 61.999  76.762  1.00 68.84  ? 634 ALA B N   1 
ATOM   9762  C  CA  . ALA B  1 634 ? 48.401 61.325  78.007  1.00 68.35  ? 634 ALA B CA  1 
ATOM   9763  C  C   . ALA B  1 634 ? 46.885 61.171  78.113  1.00 72.02  ? 634 ALA B C   1 
ATOM   9764  O  O   . ALA B  1 634 ? 46.415 60.101  78.499  1.00 72.43  ? 634 ALA B O   1 
ATOM   9765  C  CB  . ALA B  1 634 ? 48.935 62.111  79.194  1.00 67.56  ? 634 ALA B CB  1 
ATOM   9766  N  N   . LEU B  1 635 ? 46.125 62.233  77.744  1.00 67.73  ? 635 LEU B N   1 
ATOM   9767  C  CA  . LEU B  1 635 ? 44.659 62.263  77.775  1.00 67.84  ? 635 LEU B CA  1 
ATOM   9768  C  C   . LEU B  1 635 ? 44.061 61.281  76.760  1.00 73.25  ? 635 LEU B C   1 
ATOM   9769  O  O   . LEU B  1 635 ? 43.021 60.687  77.043  1.00 73.68  ? 635 LEU B O   1 
ATOM   9770  C  CB  . LEU B  1 635 ? 44.132 63.690  77.522  1.00 66.70  ? 635 LEU B CB  1 
ATOM   9771  C  CG  . LEU B  1 635 ? 42.653 63.955  77.856  1.00 71.55  ? 635 LEU B CG  1 
ATOM   9772  C  CD1 . LEU B  1 635 ? 42.423 64.035  79.358  1.00 71.05  ? 635 LEU B CD1 1 
ATOM   9773  C  CD2 . LEU B  1 635 ? 42.170 65.233  77.205  1.00 73.62  ? 635 LEU B CD2 1 
ATOM   9774  N  N   . LYS B  1 636 ? 44.722 61.106  75.598  1.00 70.35  ? 636 LYS B N   1 
ATOM   9775  C  CA  . LYS B  1 636 ? 44.297 60.180  74.544  1.00 71.75  ? 636 LYS B CA  1 
ATOM   9776  C  C   . LYS B  1 636 ? 44.495 58.731  75.004  1.00 77.57  ? 636 LYS B C   1 
ATOM   9777  O  O   . LYS B  1 636 ? 43.639 57.885  74.738  1.00 78.88  ? 636 LYS B O   1 
ATOM   9778  C  CB  . LYS B  1 636 ? 45.052 60.445  73.229  1.00 73.79  ? 636 LYS B CB  1 
ATOM   9779  C  CG  . LYS B  1 636 ? 44.552 61.676  72.470  1.00 78.51  ? 636 LYS B CG  1 
ATOM   9780  C  CD  . LYS B  1 636 ? 45.203 61.825  71.109  1.00 86.51  ? 636 LYS B CD  1 
ATOM   9781  C  CE  . LYS B  1 636 ? 46.373 62.773  71.097  1.00 94.51  ? 636 LYS B CE  1 
ATOM   9782  N  NZ  . LYS B  1 636 ? 46.962 62.893  69.735  1.00 102.08 ? 636 LYS B NZ  1 
ATOM   9783  N  N   . GLN B  1 637 ? 45.612 58.461  75.715  1.00 73.77  ? 637 GLN B N   1 
ATOM   9784  C  CA  . GLN B  1 637 ? 45.956 57.141  76.256  1.00 74.77  ? 637 GLN B CA  1 
ATOM   9785  C  C   . GLN B  1 637 ? 45.022 56.755  77.413  1.00 78.13  ? 637 GLN B C   1 
ATOM   9786  O  O   . GLN B  1 637 ? 44.601 55.600  77.492  1.00 79.06  ? 637 GLN B O   1 
ATOM   9787  C  CB  . GLN B  1 637 ? 47.425 57.105  76.727  1.00 75.72  ? 637 GLN B CB  1 
ATOM   9788  C  CG  . GLN B  1 637 ? 48.466 57.042  75.602  1.00 93.56  ? 637 GLN B CG  1 
ATOM   9789  C  CD  . GLN B  1 637 ? 48.597 55.678  74.960  1.00 117.75 ? 637 GLN B CD  1 
ATOM   9790  O  OE1 . GLN B  1 637 ? 48.877 54.665  75.617  1.00 115.39 ? 637 GLN B OE1 1 
ATOM   9791  N  NE2 . GLN B  1 637 ? 48.444 55.631  73.646  1.00 109.96 ? 637 GLN B NE2 1 
ATOM   9792  N  N   . GLN B  1 638 ? 44.700 57.725  78.296  1.00 73.06  ? 638 GLN B N   1 
ATOM   9793  C  CA  . GLN B  1 638 ? 43.836 57.539  79.466  1.00 72.60  ? 638 GLN B CA  1 
ATOM   9794  C  C   . GLN B  1 638 ? 42.368 57.298  79.076  1.00 77.70  ? 638 GLN B C   1 
ATOM   9795  O  O   . GLN B  1 638 ? 41.719 56.456  79.700  1.00 78.79  ? 638 GLN B O   1 
ATOM   9796  C  CB  . GLN B  1 638 ? 43.937 58.737  80.424  1.00 71.83  ? 638 GLN B CB  1 
ATOM   9797  C  CG  . GLN B  1 638 ? 45.204 58.736  81.273  1.00 82.73  ? 638 GLN B CG  1 
ATOM   9798  N  N   . GLN B  1 639 ? 41.847 58.025  78.060  1.00 73.58  ? 639 GLN B N   1 
ATOM   9799  C  CA  . GLN B  1 639 ? 40.459 57.879  77.609  1.00 97.56  ? 639 GLN B CA  1 
ATOM   9800  C  C   . GLN B  1 639 ? 40.294 56.588  76.796  1.00 103.77 ? 639 GLN B C   1 
ATOM   9801  O  O   . GLN B  1 639 ? 40.146 55.510  77.366  1.00 57.61  ? 639 GLN B O   1 
ATOM   9802  C  CB  . GLN B  1 639 ? 39.986 59.113  76.806  1.00 98.11  ? 639 GLN B CB  1 
ATOM   9803  C  CG  . GLN B  1 639 ? 40.577 59.255  75.395  1.00 116.09 ? 639 GLN B CG  1 
ATOM   9804  C  CD  . GLN B  1 639 ? 40.027 60.439  74.634  1.00 134.11 ? 639 GLN B CD  1 
ATOM   9805  O  OE1 . GLN B  1 639 ? 40.098 61.593  75.078  1.00 128.61 ? 639 GLN B OE1 1 
ATOM   9806  N  NE2 . GLN B  1 639 ? 39.511 60.184  73.439  1.00 124.71 ? 639 GLN B NE2 1 
HETATM 9807  CA CA  . CA  C  2 .   ? 30.044 92.460  47.270  1.00 36.75  2 701 CA  A CA  1 
HETATM 9808  CA CA  . CA  D  2 .   ? 31.988 89.003  49.318  1.00 45.94  2 702 CA  A CA  1 
HETATM 9809  CA CA  . CA  E  2 .   ? 38.122 91.342  76.001  1.00 53.32  2 703 CA  A CA  1 
HETATM 9810  C  C19 . 79M F  3 .   ? 18.547 98.007  66.782  1.00 73.64  ? 704 79M A C19 1 
HETATM 9811  C  C8  . 79M F  3 .   ? 16.878 107.366 67.177  1.00 76.85  ? 704 79M A C8  1 
HETATM 9812  C  C7  . 79M F  3 .   ? 17.861 107.953 67.842  1.00 77.54  ? 704 79M A C7  1 
HETATM 9813  C  C15 . 79M F  3 .   ? 17.711 99.242  66.535  1.00 74.11  ? 704 79M A C15 1 
HETATM 9814  C  C9  . 79M F  3 .   ? 16.007 106.258 67.685  1.00 76.86  ? 704 79M A C9  1 
HETATM 9815  C  C6  . 79M F  3 .   ? 18.753 109.061 67.349  1.00 78.00  ? 704 79M A C6  1 
HETATM 9816  C  C21 . 79M F  3 .   ? 20.060 115.947 71.166  1.00 78.27  ? 704 79M A C21 1 
HETATM 9817  C  C14 . 79M F  3 .   ? 18.089 100.411 67.429  1.00 75.23  ? 704 79M A C14 1 
HETATM 9818  C  C10 . 79M F  3 .   ? 16.575 104.879 67.344  1.00 77.39  ? 704 79M A C10 1 
HETATM 9819  C  C5  . 79M F  3 .   ? 19.444 109.840 68.474  1.00 77.67  ? 704 79M A C5  1 
HETATM 9820  C  C13 . 79M F  3 .   ? 17.093 101.559 67.385  1.00 76.45  ? 704 79M A C13 1 
HETATM 9821  C  C11 . 79M F  3 .   ? 16.337 103.812 68.408  1.00 77.41  ? 704 79M A C11 1 
HETATM 9822  C  C4  . 79M F  3 .   ? 18.552 110.867 69.161  1.00 77.88  ? 704 79M A C4  1 
HETATM 9823  C  C12 . 79M F  3 .   ? 17.342 102.657 68.412  1.00 77.11  ? 704 79M A C12 1 
HETATM 9824  C  C3  . 79M F  3 .   ? 18.959 111.240 70.585  1.00 78.72  ? 704 79M A C3  1 
HETATM 9825  C  C2  . 79M F  3 .   ? 20.041 112.313 70.674  1.00 79.09  ? 704 79M A C2  1 
HETATM 9826  C  C24 . 79M F  3 .   ? 19.728 118.154 72.299  1.00 78.76  ? 704 79M A C24 1 
HETATM 9827  C  C22 . 79M F  3 .   ? 19.573 116.654 72.399  1.00 78.17  ? 704 79M A C22 1 
HETATM 9828  O  O19 . 79M F  3 .   ? 18.884 114.091 69.546  1.00 80.87  ? 704 79M A O19 1 
HETATM 9829  C  C1  . 79M F  3 .   ? 19.554 113.720 70.476  1.00 79.69  ? 704 79M A C1  1 
HETATM 9830  O  O20 . 79M F  3 .   ? 20.003 114.528 71.444  1.00 78.90  ? 704 79M A O20 1 
HETATM 9831  O  O23 . 79M F  3 .   ? 18.199 116.325 72.605  1.00 78.34  ? 704 79M A O23 1 
HETATM 9832  O  O25 . 79M F  3 .   ? 19.457 118.772 73.549  1.00 79.88  ? 704 79M A O25 1 
HETATM 9833  C  C8  . 79M G  3 .   ? 20.419 108.815 73.241  1.00 81.00  ? 705 79M A C8  1 
HETATM 9834  C  C7  . 79M G  3 .   ? 21.049 109.798 73.876  1.00 80.82  ? 705 79M A C7  1 
HETATM 9835  C  C9  . 79M G  3 .   ? 18.967 108.435 73.329  1.00 80.62  ? 705 79M A C9  1 
HETATM 9836  C  C6  . 79M G  3 .   ? 20.466 110.774 74.849  1.00 80.64  ? 705 79M A C6  1 
HETATM 9837  C  C21 . 79M G  3 .   ? 22.779 118.680 75.709  1.00 87.77  ? 705 79M A C21 1 
HETATM 9838  C  C5  . 79M G  3 .   ? 21.459 111.830 75.324  1.00 80.91  ? 705 79M A C5  1 
HETATM 9839  C  C4  . 79M G  3 .   ? 20.872 112.793 76.349  1.00 81.39  ? 705 79M A C4  1 
HETATM 9840  C  C3  . 79M G  3 .   ? 21.767 113.960 76.747  1.00 82.39  ? 705 79M A C3  1 
HETATM 9841  C  C2  . 79M G  3 .   ? 21.738 115.118 75.752  1.00 84.07  ? 705 79M A C2  1 
HETATM 9842  C  C22 . 79M G  3 .   ? 21.652 119.603 76.103  1.00 87.92  ? 705 79M A C22 1 
HETATM 9843  O  O19 . 79M G  3 .   ? 23.310 116.380 77.064  1.00 85.85  ? 705 79M A O19 1 
HETATM 9844  C  C1  . 79M G  3 .   ? 22.494 116.345 76.180  1.00 85.95  ? 705 79M A C1  1 
HETATM 9845  O  O20 . 79M G  3 .   ? 22.140 117.408 75.443  1.00 87.57  ? 705 79M A O20 1 
HETATM 9846  C  C7  . 79M H  3 .   ? 26.774 110.427 75.485  1.00 82.51  ? 706 79M A C7  1 
HETATM 9847  C  C6  . 79M H  3 .   ? 26.353 111.829 75.799  1.00 82.52  ? 706 79M A C6  1 
HETATM 9848  C  C21 . 79M H  3 .   ? 27.222 119.771 75.786  1.00 90.42  ? 706 79M A C21 1 
HETATM 9849  C  C5  . 79M H  3 .   ? 27.515 112.827 75.770  1.00 83.14  ? 706 79M A C5  1 
HETATM 9850  C  C4  . 79M H  3 .   ? 27.108 114.280 75.978  1.00 84.47  ? 706 79M A C4  1 
HETATM 9851  C  C3  . 79M H  3 .   ? 26.542 114.968 74.738  1.00 86.17  ? 706 79M A C3  1 
HETATM 9852  C  C2  . 79M H  3 .   ? 25.978 116.363 75.001  1.00 87.81  ? 706 79M A C2  1 
HETATM 9853  C  C24 . 79M H  3 .   ? 25.643 121.398 74.665  1.00 91.02  ? 706 79M A C24 1 
HETATM 9854  C  C22 . 79M H  3 .   ? 26.279 120.945 75.960  1.00 90.73  ? 706 79M A C22 1 
HETATM 9855  O  O19 . 79M H  3 .   ? 28.181 117.339 75.012  1.00 89.83  ? 706 79M A O19 1 
HETATM 9856  C  C1  . 79M H  3 .   ? 26.993 117.460 75.173  1.00 89.44  ? 706 79M A C1  1 
HETATM 9857  O  O20 . 79M H  3 .   ? 26.398 118.607 75.527  1.00 90.42  ? 706 79M A O20 1 
HETATM 9858  O  O23 . 79M H  3 .   ? 25.262 120.626 76.917  1.00 90.71  ? 706 79M A O23 1 
HETATM 9859  O  O25 . 79M H  3 .   ? 26.587 122.055 73.828  1.00 91.34  ? 706 79M A O25 1 
HETATM 9860  C  C19 . 79M I  3 .   ? 32.886 111.329 71.058  1.00 45.06  ? 707 79M A C19 1 
HETATM 9861  C  C15 . 79M I  3 .   ? 32.707 112.830 71.087  1.00 44.77  ? 707 79M A C15 1 
HETATM 9862  C  C14 . 79M I  3 .   ? 34.016 113.584 70.951  1.00 44.51  ? 707 79M A C14 1 
HETATM 9863  C  C13 . 79M I  3 .   ? 33.913 115.062 71.281  1.00 44.14  ? 707 79M A C13 1 
HETATM 9864  C  C11 . 79M I  3 .   ? 35.144 117.268 71.620  1.00 43.61  ? 707 79M A C11 1 
HETATM 9865  C  C12 . 79M I  3 .   ? 35.226 115.822 71.160  1.00 43.70  ? 707 79M A C12 1 
HETATM 9866  C  C8  . 79M J  3 .   ? 48.032 103.904 70.074  1.00 59.51  ? 708 79M A C8  1 
HETATM 9867  C  C7  . 79M J  3 .   ? 47.929 102.654 70.523  1.00 61.95  ? 708 79M A C7  1 
HETATM 9868  C  C9  . 79M J  3 .   ? 47.046 104.670 69.247  1.00 57.43  ? 708 79M A C9  1 
HETATM 9869  C  C6  . 79M J  3 .   ? 46.808 101.664 70.315  1.00 63.63  ? 708 79M A C6  1 
HETATM 9870  C  C21 . 79M J  3 .   ? 41.168 98.193  72.741  1.00 74.08  ? 708 79M A C21 1 
HETATM 9871  C  C10 . 79M J  3 .   ? 47.636 105.167 67.930  1.00 55.74  ? 708 79M A C10 1 
HETATM 9872  C  C5  . 79M J  3 .   ? 45.937 101.397 71.555  1.00 64.98  ? 708 79M A C5  1 
HETATM 9873  C  C13 . 79M J  3 .   ? 46.068 106.844 64.758  1.00 53.96  ? 708 79M A C13 1 
HETATM 9874  C  C11 . 79M J  3 .   ? 46.601 105.791 67.012  1.00 54.83  ? 708 79M A C11 1 
HETATM 9875  C  C4  . 79M J  3 .   ? 44.844 102.436 71.787  1.00 66.35  ? 708 79M A C4  1 
HETATM 9876  C  C12 . 79M J  3 .   ? 47.131 106.235 65.662  1.00 54.28  ? 708 79M A C12 1 
HETATM 9877  C  C3  . 79M J  3 .   ? 43.997 102.239 73.036  1.00 67.39  ? 708 79M A C3  1 
HETATM 9878  C  C2  . 79M J  3 .   ? 42.639 101.603 72.760  1.00 68.87  ? 708 79M A C2  1 
HETATM 9879  C  C24 . 79M J  3 .   ? 38.811 98.288  71.825  1.00 73.69  ? 708 79M A C24 1 
HETATM 9880  C  C22 . 79M J  3 .   ? 40.216 97.761  71.643  1.00 74.18  ? 708 79M A C22 1 
HETATM 9881  O  O19 . 79M J  3 .   ? 43.594 99.414  73.028  1.00 71.15  ? 708 79M A O19 1 
HETATM 9882  C  C1  . 79M J  3 .   ? 42.627 100.102 72.825  1.00 71.11  ? 708 79M A C1  1 
HETATM 9883  O  O20 . 79M J  3 .   ? 41.389 99.622  72.633  1.00 73.38  ? 708 79M A O20 1 
HETATM 9884  O  O23 . 79M J  3 .   ? 40.723 98.152  70.365  1.00 74.91  ? 708 79M A O23 1 
HETATM 9885  O  O25 . 79M J  3 .   ? 37.955 97.845  70.781  1.00 73.17  ? 708 79M A O25 1 
HETATM 9886  C  C6  . 79M K  3 .   ? 49.969 100.470 64.820  1.00 89.63  ? 709 79M A C6  1 
HETATM 9887  C  C21 . 79M K  3 .   ? 44.911 97.428  69.935  1.00 96.06  ? 709 79M A C21 1 
HETATM 9888  C  C5  . 79M K  3 .   ? 49.761 99.707  66.131  1.00 90.32  ? 709 79M A C5  1 
HETATM 9889  C  C4  . 79M K  3 .   ? 48.555 100.152 66.956  1.00 91.76  ? 709 79M A C4  1 
HETATM 9890  C  C3  . 79M K  3 .   ? 47.204 99.868  66.305  1.00 93.50  ? 709 79M A C3  1 
HETATM 9891  C  C2  . 79M K  3 .   ? 46.035 99.761  67.284  1.00 95.03  ? 709 79M A C2  1 
HETATM 9892  C  C24 . 79M K  3 .   ? 44.627 95.004  69.330  1.00 95.89  ? 709 79M A C24 1 
HETATM 9893  C  C22 . 79M K  3 .   ? 43.981 96.368  69.391  1.00 95.67  ? 709 79M A C22 1 
HETATM 9894  O  O19 . 79M K  3 .   ? 46.746 97.555  67.925  1.00 97.81  ? 709 79M A O19 1 
HETATM 9895  C  C1  . 79M K  3 .   ? 45.984 98.477  68.065  1.00 96.63  ? 709 79M A C1  1 
HETATM 9896  O  O20 . 79M K  3 .   ? 44.970 98.483  68.943  1.00 96.45  ? 709 79M A O20 1 
HETATM 9897  O  O23 . 79M K  3 .   ? 42.805 96.305  70.197  1.00 95.27  ? 709 79M A O23 1 
HETATM 9898  O  O25 . 79M K  3 .   ? 43.835 94.099  68.574  1.00 95.95  ? 709 79M A O25 1 
HETATM 9899  C  C19 . 79M L  3 .   ? 55.802 109.626 54.485  1.00 78.89  ? 710 79M A C19 1 
HETATM 9900  C  C8  . 79M L  3 .   ? 53.474 102.489 58.204  1.00 82.94  ? 710 79M A C8  1 
HETATM 9901  C  C7  . 79M L  3 .   ? 52.638 101.696 58.858  1.00 83.72  ? 710 79M A C7  1 
HETATM 9902  C  C15 . 79M L  3 .   ? 54.974 108.438 54.927  1.00 79.61  ? 710 79M A C15 1 
HETATM 9903  C  C9  . 79M L  3 .   ? 54.971 102.352 58.093  1.00 81.53  ? 710 79M A C9  1 
HETATM 9904  C  C6  . 79M L  3 .   ? 52.988 100.473 59.643  1.00 83.88  ? 710 79M A C6  1 
HETATM 9905  C  C21 . 79M L  3 .   ? 53.729 92.159  57.776  1.00 88.22  ? 710 79M A C21 1 
HETATM 9906  C  C14 . 79M L  3 .   ? 55.582 107.103 54.527  1.00 79.97  ? 710 79M A C14 1 
HETATM 9907  C  C10 . 79M L  3 .   ? 55.621 103.450 57.256  1.00 80.25  ? 710 79M A C10 1 
HETATM 9908  C  C5  . 79M L  3 .   ? 52.548 99.206  58.940  1.00 84.20  ? 710 79M A C5  1 
HETATM 9909  C  C13 . 79M L  3 .   ? 54.931 105.888 55.166  1.00 79.70  ? 710 79M A C13 1 
HETATM 9910  C  C11 . 79M L  3 .   ? 55.248 103.418 55.779  1.00 79.91  ? 710 79M A C11 1 
HETATM 9911  C  C4  . 79M L  3 .   ? 53.071 97.943  59.589  1.00 85.03  ? 710 79M A C4  1 
HETATM 9912  C  C12 . 79M L  3 .   ? 55.733 104.609 54.972  1.00 79.72  ? 710 79M A C12 1 
HETATM 9913  C  C3  . 79M L  3 .   ? 52.575 96.677  58.935  1.00 85.76  ? 710 79M A C3  1 
HETATM 9914  C  C2  . 79M L  3 .   ? 53.707 95.814  58.391  1.00 87.52  ? 710 79M A C2  1 
HETATM 9915  C  C24 . 79M L  3 .   ? 54.793 89.985  57.144  1.00 86.00  ? 710 79M A C24 1 
HETATM 9916  C  C22 . 79M L  3 .   ? 55.018 91.394  57.646  1.00 87.53  ? 710 79M A C22 1 
HETATM 9917  O  O19 . 79M L  3 .   ? 52.227 94.341  57.210  1.00 90.40  ? 710 79M A O19 1 
HETATM 9918  C  C1  . 79M L  3 .   ? 53.239 94.497  57.844  1.00 89.24  ? 710 79M A C1  1 
HETATM 9919  O  O20 . 79M L  3 .   ? 54.090 93.509  58.155  1.00 88.92  ? 710 79M A O20 1 
HETATM 9920  O  O23 . 79M L  3 .   ? 55.906 92.094  56.768  1.00 88.04  ? 710 79M A O23 1 
HETATM 9921  O  O25 . 79M L  3 .   ? 56.023 89.308  56.952  1.00 85.20  ? 710 79M A O25 1 
HETATM 9922  C  C19 . 79M M  3 .   ? 43.569 99.818  59.631  1.00 50.45  ? 711 79M A C19 1 
HETATM 9923  C  C8  . 79M M  3 .   ? 50.587 96.019  63.482  1.00 59.84  ? 711 79M A C8  1 
HETATM 9924  C  C7  . 79M M  3 .   ? 50.493 95.242  64.552  1.00 59.79  ? 711 79M A C7  1 
HETATM 9925  C  C15 . 79M M  3 .   ? 44.650 98.839  59.247  1.00 50.88  ? 711 79M A C15 1 
HETATM 9926  C  C9  . 79M M  3 .   ? 49.530 96.943  62.967  1.00 59.68  ? 711 79M A C9  1 
HETATM 9927  C  C6  . 79M M  3 .   ? 51.544 94.310  65.086  1.00 58.90  ? 711 79M A C6  1 
HETATM 9928  C  C14 . 79M M  3 .   ? 44.804 97.706  60.244  1.00 51.80  ? 711 79M A C14 1 
HETATM 9929  C  C10 . 79M M  3 .   ? 48.663 96.324  61.871  1.00 59.10  ? 711 79M A C10 1 
HETATM 9930  C  C5  . 79M M  3 .   ? 51.820 93.120  64.163  1.00 58.30  ? 711 79M A C5  1 
HETATM 9931  C  C13 . 79M M  3 .   ? 45.954 96.757  59.937  1.00 53.34  ? 711 79M A C13 1 
HETATM 9932  C  C11 . 79M M  3 .   ? 47.169 96.326  62.178  1.00 57.52  ? 711 79M A C11 1 
HETATM 9933  C  C12 . 79M M  3 .   ? 46.279 95.779  61.063  1.00 55.48  ? 711 79M A C12 1 
HETATM 9934  C  C19 . 79M N  3 .   ? 52.864 99.564  44.579  1.00 46.15  ? 712 79M A C19 1 
HETATM 9935  C  C8  . 79M N  3 .   ? 56.726 92.266  40.406  1.00 49.61  ? 712 79M A C8  1 
HETATM 9936  C  C7  . 79M N  3 .   ? 56.160 91.551  39.452  1.00 49.08  ? 712 79M A C7  1 
HETATM 9937  C  C15 . 79M N  3 .   ? 52.927 98.268  43.823  1.00 46.15  ? 712 79M A C15 1 
HETATM 9938  C  C9  . 79M N  3 .   ? 56.134 93.465  41.085  1.00 49.74  ? 712 79M A C9  1 
HETATM 9939  C  C14 . 79M N  3 .   ? 54.203 97.495  44.095  1.00 46.91  ? 712 79M A C14 1 
HETATM 9940  C  C10 . 79M N  3 .   ? 57.122 94.204  41.999  1.00 49.04  ? 712 79M A C10 1 
HETATM 9941  C  C13 . 79M N  3 .   ? 54.245 96.134  43.422  1.00 47.96  ? 712 79M A C13 1 
HETATM 9942  C  C11 . 79M N  3 .   ? 56.591 95.508  42.588  1.00 48.60  ? 712 79M A C11 1 
HETATM 9943  C  C12 . 79M N  3 .   ? 55.522 95.344  43.664  1.00 48.39  ? 712 79M A C12 1 
HETATM 9944  CA CA  . CA  O  2 .   ? 64.470 101.895 100.837 1.00 46.85  2 701 CA  B CA  1 
HETATM 9945  CA CA  . CA  P  2 .   ? 62.546 98.268  99.645  1.00 41.43  2 702 CA  B CA  1 
HETATM 9946  CA CA  . CA  Q  2 .   ? 55.963 91.068  74.222  1.00 33.25  2 703 CA  B CA  1 
HETATM 9947  CA CA  . CA  R  2 .   ? 46.947 129.617 68.496  1.00 43.23  2 704 CA  B CA  1 
HETATM 9948  C  C19 . 79M S  3 .   ? 83.880 113.876 80.242  1.00 69.08  ? 705 79M B C19 1 
HETATM 9949  C  C8  . 79M S  3 .   ? 76.986 108.639 76.842  1.00 72.36  ? 705 79M B C8  1 
HETATM 9950  C  C7  . 79M S  3 .   ? 76.522 109.812 76.431  1.00 71.79  ? 705 79M B C7  1 
HETATM 9951  C  C15 . 79M S  3 .   ? 83.066 112.657 79.866  1.00 70.15  ? 705 79M B C15 1 
HETATM 9952  C  C9  . 79M S  3 .   ? 78.161 108.404 77.766  1.00 72.73  ? 705 79M B C9  1 
HETATM 9953  C  C6  . 79M S  3 .   ? 75.369 110.075 75.511  1.00 70.89  ? 705 79M B C6  1 
HETATM 9954  C  C21 . 79M S  3 .   ? 74.311 114.849 68.665  1.00 71.44  ? 705 79M B C21 1 
HETATM 9955  C  C14 . 79M S  3 .   ? 82.232 112.104 81.019  1.00 71.60  ? 705 79M B C14 1 
HETATM 9956  C  C10 . 79M S  3 .   ? 78.419 109.530 78.784  1.00 72.64  ? 705 79M B C10 1 
HETATM 9957  C  C5  . 79M S  3 .   ? 75.531 111.441 74.842  1.00 70.07  ? 705 79M B C5  1 
HETATM 9958  C  C13 . 79M S  3 .   ? 81.587 110.742 80.754  1.00 72.43  ? 705 79M B C13 1 
HETATM 9959  C  C11 . 79M S  3 .   ? 79.758 109.453 79.504  1.00 72.04  ? 705 79M B C11 1 
HETATM 9960  C  C4  . 79M S  3 .   ? 74.443 111.820 73.850  1.00 69.39  ? 705 79M B C4  1 
HETATM 9961  C  C12 . 79M S  3 .   ? 80.197 110.775 80.123  1.00 72.14  ? 705 79M B C12 1 
HETATM 9962  C  C3  . 79M S  3 .   ? 74.715 113.139 73.144  1.00 69.77  ? 705 79M B C3  1 
HETATM 9963  C  C2  . 79M S  3 .   ? 73.704 113.471 72.053  1.00 70.85  ? 705 79M B C2  1 
HETATM 9964  C  C24 . 79M S  3 .   ? 73.856 117.302 68.355  1.00 71.78  ? 705 79M B C24 1 
HETATM 9965  C  C22 . 79M S  3 .   ? 74.899 116.238 68.603  1.00 71.51  ? 705 79M B C22 1 
HETATM 9966  O  O19 . 79M S  3 .   ? 75.080 112.774 70.214  1.00 72.53  ? 705 79M B O19 1 
HETATM 9967  C  C1  . 79M S  3 .   ? 74.310 113.571 70.681  1.00 71.76  ? 705 79M B C1  1 
HETATM 9968  O  O20 . 79M S  3 .   ? 73.868 114.654 70.030  1.00 71.67  ? 705 79M B O20 1 
HETATM 9969  O  O23 . 79M S  3 .   ? 75.619 116.527 69.807  1.00 71.43  ? 705 79M B O23 1 
HETATM 9970  O  O25 . 79M S  3 .   ? 74.458 118.582 68.219  1.00 72.12  ? 705 79M B O25 1 
HETATM 9971  C  C8  . 79M T  3 .   ? 73.186 108.242 70.262  1.00 69.09  ? 706 79M B C8  1 
HETATM 9972  C  C7  . 79M T  3 .   ? 72.634 109.068 69.394  1.00 68.99  ? 706 79M B C7  1 
HETATM 9973  C  C6  . 79M T  3 .   ? 73.292 109.677 68.192  1.00 69.03  ? 706 79M B C6  1 
HETATM 9974  C  C21 . 79M T  3 .   ? 70.944 116.822 64.618  1.00 77.03  ? 706 79M B C21 1 
HETATM 9975  C  C5  . 79M T  3 .   ? 72.344 110.565 67.393  1.00 69.29  ? 706 79M B C5  1 
HETATM 9976  C  C4  . 79M T  3 .   ? 72.940 111.122 66.109  1.00 70.10  ? 706 79M B C4  1 
HETATM 9977  C  C3  . 79M T  3 .   ? 72.022 112.056 65.328  1.00 72.13  ? 706 79M B C3  1 
HETATM 9978  C  C2  . 79M T  3 .   ? 72.033 113.493 65.847  1.00 74.23  ? 706 79M B C2  1 
HETATM 9979  C  C22 . 79M T  3 .   ? 72.047 117.552 63.890  1.00 76.24  ? 706 79M B C22 1 
HETATM 9980  O  O19 . 79M T  3 .   ? 70.438 114.185 64.181  1.00 76.45  ? 706 79M B O19 1 
HETATM 9981  C  C1  . 79M T  3 .   ? 71.261 114.477 65.011  1.00 76.15  ? 706 79M B C1  1 
HETATM 9982  O  O20 . 79M T  3 .   ? 71.607 115.737 65.312  1.00 77.32  ? 706 79M B O20 1 
HETATM 9983  C  C8  . 79M U  3 .   ? 67.880 108.394 68.555  1.00 73.62  ? 707 79M B C8  1 
HETATM 9984  C  C7  . 79M U  3 .   ? 67.063 109.142 67.834  1.00 74.12  ? 707 79M B C7  1 
HETATM 9985  C  C9  . 79M U  3 .   ? 67.512 107.184 69.361  1.00 72.83  ? 707 79M B C9  1 
HETATM 9986  C  C6  . 79M U  3 .   ? 67.453 110.347 67.033  1.00 75.05  ? 707 79M B C6  1 
HETATM 9987  C  C21 . 79M U  3 .   ? 66.485 117.765 64.228  1.00 88.29  ? 707 79M B C21 1 
HETATM 9988  C  C10 . 79M U  3 .   ? 68.726 106.373 69.806  1.00 71.98  ? 707 79M B C10 1 
HETATM 9989  C  C5  . 79M U  3 .   ? 66.281 111.283 66.722  1.00 75.97  ? 707 79M B C5  1 
HETATM 9990  C  C4  . 79M U  3 .   ? 66.672 112.568 66.000  1.00 77.56  ? 707 79M B C4  1 
HETATM 9991  C  C3  . 79M U  3 .   ? 67.240 113.657 66.904  1.00 80.33  ? 707 79M B C3  1 
HETATM 9992  C  C2  . 79M U  3 .   ? 67.783 114.870 66.154  1.00 82.92  ? 707 79M B C2  1 
HETATM 9993  C  C24 . 79M U  3 .   ? 68.046 119.702 64.682  1.00 88.46  ? 707 79M B C24 1 
HETATM 9994  C  C22 . 79M U  3 .   ? 67.407 118.814 63.639  1.00 88.39  ? 707 79M B C22 1 
HETATM 9995  O  O19 . 79M U  3 .   ? 65.565 115.753 65.827  1.00 85.80  ? 707 79M B O19 1 
HETATM 9996  C  C1  . 79M U  3 .   ? 66.750 115.822 65.617  1.00 85.45  ? 707 79M B C1  1 
HETATM 9997  O  O20 . 79M U  3 .   ? 67.326 116.776 64.871  1.00 87.46  ? 707 79M B O20 1 
HETATM 9998  O  O23 . 79M U  3 .   ? 68.420 118.190 62.840  1.00 88.11  ? 707 79M B O23 1 
HETATM 9999  O  O25 . 79M U  3 .   ? 67.100 120.604 65.245  1.00 88.34  ? 707 79M B O25 1 
HETATM 10000 C  C19 . 79M V  3 .   ? 60.896 111.010 71.825  1.00 45.15  ? 708 79M B C19 1 
HETATM 10001 C  C8  . 79M V  3 .   ? 58.361 118.544 67.104  1.00 55.55  ? 708 79M B C8  1 
HETATM 10002 C  C7  . 79M V  3 .   ? 58.509 119.409 66.110  1.00 56.95  ? 708 79M B C7  1 
HETATM 10003 C  C15 . 79M V  3 .   ? 61.119 112.390 71.296  1.00 46.20  ? 708 79M B C15 1 
HETATM 10004 C  C9  . 79M V  3 .   ? 58.208 118.815 68.574  1.00 52.93  ? 708 79M B C9  1 
HETATM 10005 C  C6  . 79M V  3 .   ? 58.568 120.903 66.173  1.00 57.86  ? 708 79M B C6  1 
HETATM 10006 C  C21 . 79M V  3 .   ? 65.921 124.329 66.016  1.00 72.45  ? 708 79M B C21 1 
HETATM 10007 C  C14 . 79M V  3 .   ? 59.847 113.212 71.221  1.00 46.28  ? 708 79M B C14 1 
HETATM 10008 C  C10 . 79M V  3 .   ? 57.903 117.542 69.373  1.00 50.30  ? 708 79M B C10 1 
HETATM 10009 C  C5  . 79M V  3 .   ? 59.547 121.487 65.148  1.00 59.29  ? 708 79M B C5  1 
HETATM 10010 C  C13 . 79M V  3 .   ? 60.068 114.561 70.573  1.00 45.89  ? 708 79M B C13 1 
HETATM 10011 C  C11 . 79M V  3 .   ? 59.052 116.556 69.436  1.00 48.14  ? 708 79M B C11 1 
HETATM 10012 C  C4  . 79M V  3 .   ? 61.006 121.504 65.588  1.00 61.12  ? 708 79M B C4  1 
HETATM 10013 C  C12 . 79M V  3 .   ? 58.810 115.369 70.345  1.00 46.59  ? 708 79M B C12 1 
HETATM 10014 C  C3  . 79M V  3 .   ? 61.388 122.730 66.404  1.00 64.27  ? 708 79M B C3  1 
HETATM 10015 C  C2  . 79M V  3 .   ? 62.774 122.650 67.033  1.00 68.09  ? 708 79M B C2  1 
HETATM 10016 O  O19 . 79M V  3 .   ? 64.111 122.558 65.033  1.00 72.15  ? 708 79M B O19 1 
HETATM 10017 C  C1  . 79M V  3 .   ? 63.916 123.024 66.127  1.00 71.22  ? 708 79M B C1  1 
HETATM 10018 O  O20 . 79M V  3 .   ? 64.716 123.927 66.710  1.00 72.21  ? 708 79M B O20 1 
HETATM 10019 C  C19 . 79M W  3 .   ? 42.791 110.315 80.775  1.00 66.68  ? 709 79M B C19 1 
HETATM 10020 C  C8  . 79M W  3 .   ? 45.754 105.551 75.518  1.00 60.51  ? 709 79M B C8  1 
HETATM 10021 C  C7  . 79M W  3 .   ? 45.878 104.236 75.381  1.00 60.80  ? 709 79M B C7  1 
HETATM 10022 C  C15 . 79M W  3 .   ? 44.114 110.566 80.096  1.00 66.36  ? 709 79M B C15 1 
HETATM 10023 C  C9  . 79M W  3 .   ? 46.789 106.525 76.000  1.00 60.27  ? 709 79M B C9  1 
HETATM 10024 C  C6  . 79M W  3 .   ? 47.089 103.386 75.659  1.00 60.84  ? 709 79M B C6  1 
HETATM 10025 C  C21 . 79M W  3 .   ? 52.851 98.488  75.232  1.00 67.77  ? 709 79M B C21 1 
HETATM 10026 C  C14 . 79M W  3 .   ? 45.054 109.374 80.174  1.00 65.87  ? 709 79M B C14 1 
HETATM 10027 C  C10 . 79M W  3 .   ? 46.510 106.974 77.426  1.00 61.13  ? 709 79M B C10 1 
HETATM 10028 C  C5  . 79M W  3 .   ? 47.833 102.979 74.386  1.00 60.51  ? 709 79M B C5  1 
HETATM 10029 C  C13 . 79M W  3 .   ? 46.404 109.609 79.515  1.00 65.02  ? 709 79M B C13 1 
HETATM 10030 C  C11 . 79M W  3 .   ? 47.583 107.874 78.019  1.00 62.46  ? 709 79M B C11 1 
HETATM 10031 C  C4  . 79M W  3 .   ? 49.151 102.257 74.628  1.00 60.56  ? 709 79M B C4  1 
HETATM 10032 C  C12 . 79M W  3 .   ? 47.287 108.370 79.433  1.00 63.87  ? 709 79M B C12 1 
HETATM 10033 C  C3  . 79M W  3 .   ? 49.939 101.977 73.358  1.00 61.31  ? 709 79M B C3  1 
HETATM 10034 C  C2  . 79M W  3 .   ? 51.355 101.470 73.608  1.00 63.14  ? 709 79M B C2  1 
HETATM 10035 C  C24 . 79M W  3 .   ? 55.272 98.995  75.733  1.00 67.29  ? 709 79M B C24 1 
HETATM 10036 C  C22 . 79M W  3 .   ? 53.916 98.641  76.298  1.00 68.13  ? 709 79M B C22 1 
HETATM 10037 O  O19 . 79M W  3 .   ? 50.569 99.224  73.940  1.00 66.06  ? 709 79M B O19 1 
HETATM 10038 C  C1  . 79M W  3 .   ? 51.436 100.047 74.081  1.00 65.54  ? 709 79M B C1  1 
HETATM 10039 O  O20 . 79M W  3 .   ? 52.607 99.808  74.685  1.00 67.15  ? 709 79M B O20 1 
HETATM 10040 O  O23 . 79M W  3 .   ? 53.520 99.622  77.260  1.00 68.90  ? 709 79M B O23 1 
HETATM 10041 O  O25 . 79M W  3 .   ? 56.246 99.101  76.761  1.00 66.88  ? 709 79M B O25 1 
HETATM 10042 C  C21 . 79M X  3 .   ? 48.496 99.072  78.230  1.00 100.50 ? 710 79M B C21 1 
HETATM 10043 C  C2  . 79M X  3 .   ? 48.085 102.519 79.535  1.00 100.65 ? 710 79M B C2  1 
HETATM 10044 C  C24 . 79M X  3 .   ? 49.274 96.812  79.011  1.00 100.77 ? 710 79M B C24 1 
HETATM 10045 C  C22 . 79M X  3 .   ? 49.532 98.301  79.011  1.00 100.39 ? 710 79M B C22 1 
HETATM 10046 O  O19 . 79M X  3 .   ? 46.660 100.596 79.542  1.00 100.99 ? 710 79M B O19 1 
HETATM 10047 C  C1  . 79M X  3 .   ? 47.712 101.097 79.244  1.00 100.73 ? 710 79M B C1  1 
HETATM 10048 O  O20 . 79M X  3 .   ? 48.702 100.454 78.611  1.00 100.59 ? 710 79M B O20 1 
HETATM 10049 O  O23 . 79M X  3 .   ? 50.831 98.567  78.476  1.00 99.82  ? 710 79M B O23 1 
HETATM 10050 O  O25 . 79M X  3 .   ? 50.112 96.154  79.951  1.00 100.97 ? 710 79M B O25 1 
HETATM 10051 C  C7  . 79M Y  3 .   ? 42.078 105.892 85.763  1.00 50.37  ? 711 79M B C7  1 
HETATM 10052 C  C6  . 79M Y  3 .   ? 41.033 105.185 86.564  1.00 50.45  ? 711 79M B C6  1 
HETATM 10053 C  C21 . 79M Y  3 .   ? 40.565 98.046  91.214  1.00 64.18  ? 711 79M B C21 1 
HETATM 10054 C  C5  . 79M Y  3 .   ? 41.632 104.245 87.604  1.00 51.04  ? 711 79M B C5  1 
HETATM 10055 C  C4  . 79M Y  3 .   ? 40.603 103.606 88.504  1.00 52.26  ? 711 79M B C4  1 
HETATM 10056 C  C3  . 79M Y  3 .   ? 41.195 102.594 89.459  1.00 54.51  ? 711 79M B C3  1 
HETATM 10057 C  C2  . 79M Y  3 .   ? 40.513 101.242 89.357  1.00 57.74  ? 711 79M B C2  1 
HETATM 10058 C  C24 . 79M Y  3 .   ? 39.538 96.221  92.587  1.00 65.39  ? 711 79M B C24 1 
HETATM 10059 C  C22 . 79M Y  3 .   ? 39.287 97.355  91.624  1.00 64.54  ? 711 79M B C22 1 
HETATM 10060 O  O19 . 79M Y  3 .   ? 42.043 100.295 90.958  1.00 62.16  ? 711 79M B O19 1 
HETATM 10061 C  C1  . 79M Y  3 .   ? 41.020 100.213 90.325  1.00 61.15  ? 711 79M B C1  1 
HETATM 10062 O  O20 . 79M Y  3 .   ? 40.183 99.171  90.386  1.00 63.12  ? 711 79M B O20 1 
HETATM 10063 O  O23 . 79M Y  3 .   ? 38.392 98.307  92.211  1.00 64.46  ? 711 79M B O23 1 
HETATM 10064 O  O25 . 79M Y  3 .   ? 38.321 95.639  93.029  1.00 66.05  ? 711 79M B O25 1 
HETATM 10065 C  C19 . 79M Z  3 .   ? 50.594 104.697 86.679  1.00 44.57  ? 712 79M B C19 1 
HETATM 10066 C  C15 . 79M Z  3 .   ? 49.531 103.907 87.398  1.00 45.46  ? 712 79M B C15 1 
HETATM 10067 C  C9  . 79M Z  3 .   ? 44.628 100.729 84.634  1.00 56.28  ? 712 79M B C9  1 
HETATM 10068 C  C14 . 79M Z  3 .   ? 49.382 102.495 86.864  1.00 46.89  ? 712 79M B C14 1 
HETATM 10069 C  C10 . 79M Z  3 .   ? 45.520 100.589 85.866  1.00 55.86  ? 712 79M B C10 1 
HETATM 10070 C  C13 . 79M Z  3 .   ? 48.244 101.706 87.490  1.00 48.86  ? 712 79M B C13 1 
HETATM 10071 C  C11 . 79M Z  3 .   ? 47.010 100.500 85.554  1.00 54.34  ? 712 79M B C11 1 
HETATM 10072 C  C12 . 79M Z  3 .   ? 47.922 100.393 86.778  1.00 52.09  ? 712 79M B C12 1 
HETATM 10073 C  C19 . 79M AA 3 .   ? 41.205 109.609 100.723 1.00 40.91  ? 713 79M B C19 1 
HETATM 10074 C  C8  . 79M AA 3 .   ? 37.286 103.689 107.130 1.00 40.91  ? 713 79M B C8  1 
HETATM 10075 C  C7  . 79M AA 3 .   ? 37.560 103.057 108.257 1.00 40.23  ? 713 79M B C7  1 
HETATM 10076 C  C15 . 79M AA 3 .   ? 41.091 109.509 102.232 1.00 40.42  ? 713 79M B C15 1 
HETATM 10077 C  C9  . 79M AA 3 .   ? 37.922 104.959 106.657 1.00 40.64  ? 713 79M B C9  1 
HETATM 10078 C  C14 . 79M AA 3 .   ? 39.914 108.667 102.704 1.00 39.47  ? 713 79M B C14 1 
HETATM 10079 C  C10 . 79M AA 3 .   ? 37.918 105.117 105.141 1.00 39.75  ? 713 79M B C10 1 
HETATM 10080 C  C13 . 79M AA 3 .   ? 40.142 107.161 102.645 1.00 39.33  ? 713 79M B C13 1 
HETATM 10081 C  C11 . 79M AA 3 .   ? 38.862 106.201 104.653 1.00 40.18  ? 713 79M B C11 1 
HETATM 10082 C  C12 . 79M AA 3 .   ? 38.978 106.310 103.139 1.00 39.91  ? 713 79M B C12 1 
HETATM 10083 O  O   . HOH BA 4 .   ? 37.487 85.996  47.909  1.00 19.67  ? 801 HOH A O   1 
HETATM 10084 O  O   . HOH BA 4 .   ? 44.093 106.806 48.342  1.00 63.38  ? 802 HOH A O   1 
HETATM 10085 O  O   . HOH BA 4 .   ? 32.893 58.429  57.550  1.00 35.08  ? 803 HOH A O   1 
HETATM 10086 O  O   . HOH BA 4 .   ? 51.149 73.437  38.398  1.00 45.36  ? 804 HOH A O   1 
HETATM 10087 O  O   . HOH BA 4 .   ? 34.899 70.834  42.961  1.00 52.13  ? 805 HOH A O   1 
HETATM 10088 O  O   . HOH BA 4 .   ? 53.544 66.449  49.305  1.00 34.31  ? 806 HOH A O   1 
HETATM 10089 O  O   . HOH BA 4 .   ? 30.126 67.629  53.380  1.00 33.15  ? 807 HOH A O   1 
HETATM 10090 O  O   . HOH BA 4 .   ? 33.820 104.163 66.327  1.00 26.10  ? 808 HOH A O   1 
HETATM 10091 O  O   . HOH BA 4 .   ? 26.126 105.466 59.864  1.00 34.75  ? 809 HOH A O   1 
HETATM 10092 O  O   . HOH BA 4 .   ? 27.414 57.513  62.058  1.00 37.53  ? 810 HOH A O   1 
HETATM 10093 O  O   . HOH BA 4 .   ? 26.174 63.212  74.279  1.00 38.56  ? 811 HOH A O   1 
HETATM 10094 O  O   . HOH BA 4 .   ? 22.487 105.007 58.610  1.00 46.47  ? 812 HOH A O   1 
HETATM 10095 O  O   . HOH BA 4 .   ? 41.085 86.219  65.978  1.00 27.23  ? 813 HOH A O   1 
HETATM 10096 O  O   . HOH BA 4 .   ? 64.287 58.633  35.880  1.00 29.73  ? 814 HOH A O   1 
HETATM 10097 O  O   . HOH BA 4 .   ? 45.155 69.179  65.282  1.00 33.63  ? 815 HOH A O   1 
HETATM 10098 O  O   . HOH BA 4 .   ? 31.322 95.772  49.594  1.00 38.69  ? 816 HOH A O   1 
HETATM 10099 O  O   . HOH BA 4 .   ? 37.130 95.239  71.032  1.00 53.12  ? 817 HOH A O   1 
HETATM 10100 O  O   . HOH BA 4 .   ? 49.332 62.948  58.855  1.00 43.54  ? 818 HOH A O   1 
HETATM 10101 O  O   . HOH BA 4 .   ? 41.065 85.908  54.937  1.00 54.25  ? 819 HOH A O   1 
HETATM 10102 O  O   . HOH BA 4 .   ? 46.775 59.052  58.817  1.00 45.55  ? 820 HOH A O   1 
HETATM 10103 O  O   . HOH BA 4 .   ? 63.041 73.410  48.625  1.00 10.90  ? 821 HOH A O   1 
HETATM 10104 O  O   . HOH BA 4 .   ? 35.083 86.153  44.066  1.00 35.64  ? 822 HOH A O   1 
HETATM 10105 O  O   . HOH CA 4 .   ? 62.168 87.015  107.723 1.00 37.14  ? 801 HOH B O   1 
HETATM 10106 O  O   . HOH CA 4 .   ? 46.710 114.891 97.508  1.00 33.65  ? 802 HOH B O   1 
HETATM 10107 O  O   . HOH CA 4 .   ? 71.629 110.118 85.444  1.00 35.86  ? 803 HOH B O   1 
HETATM 10108 O  O   . HOH CA 4 .   ? 60.225 106.456 78.644  1.00 63.84  ? 804 HOH B O   1 
HETATM 10109 O  O   . HOH CA 4 .   ? 55.034 90.107  72.215  1.00 25.11  ? 805 HOH B O   1 
HETATM 10110 O  O   . HOH CA 4 .   ? 50.184 83.700  123.863 1.00 35.43  ? 806 HOH B O   1 
HETATM 10111 O  O   . HOH CA 4 .   ? 56.539 95.948  102.818 1.00 44.70  ? 807 HOH B O   1 
HETATM 10112 O  O   . HOH CA 4 .   ? 41.332 76.629  108.111 1.00 49.12  ? 808 HOH B O   1 
HETATM 10113 O  O   . HOH CA 4 .   ? 57.301 96.708  77.511  1.00 47.22  ? 809 HOH B O   1 
HETATM 10114 O  O   . HOH CA 4 .   ? 67.946 110.075 84.257  1.00 38.89  ? 810 HOH B O   1 
HETATM 10115 O  O   . HOH CA 4 .   ? 59.718 83.199  112.452 1.00 52.89  ? 811 HOH B O   1 
HETATM 10116 O  O   . HOH CA 4 .   ? 34.788 77.424  94.544  1.00 43.61  ? 812 HOH B O   1 
HETATM 10117 O  O   . HOH CA 4 .   ? 38.234 79.223  102.149 1.00 50.10  ? 813 HOH B O   1 
HETATM 10118 O  O   . HOH CA 4 .   ? 32.420 78.088  103.368 1.00 37.69  ? 814 HOH B O   1 
HETATM 10119 O  O   . HOH CA 4 .   ? 51.811 103.149 100.709 1.00 38.83  ? 815 HOH B O   1 
HETATM 10120 O  O   . HOH CA 4 .   ? 56.739 87.397  108.470 1.00 43.95  ? 816 HOH B O   1 
HETATM 10121 O  O   . HOH CA 4 .   ? 70.217 82.956  126.626 1.00 45.73  ? 817 HOH B O   1 
HETATM 10122 O  O   . HOH CA 4 .   ? 54.879 87.546  125.424 1.00 41.96  ? 818 HOH B O   1 
HETATM 10123 O  O   . HOH CA 4 .   ? 60.863 93.567  114.013 1.00 29.01  ? 819 HOH B O   1 
HETATM 10124 O  O   . HOH CA 4 .   ? 57.342 78.942  104.001 1.00 40.97  ? 820 HOH B O   1 
HETATM 10125 O  O   . HOH CA 4 .   ? 64.612 104.344 99.506  1.00 36.92  ? 821 HOH B O   1 
HETATM 10126 O  O   . HOH CA 4 .   ? 57.188 89.171  85.649  1.00 19.64  ? 822 HOH B O   1 
HETATM 10127 O  O   . HOH CA 4 .   ? 45.895 72.460  95.369  1.00 38.71  ? 823 HOH B O   1 
HETATM 10128 O  O   . HOH CA 4 .   ? 45.168 69.823  100.157 1.00 46.34  ? 824 HOH B O   1 
HETATM 10129 O  O   . HOH CA 4 .   ? 58.514 101.951 100.828 1.00 12.95  ? 825 HOH B O   1 
HETATM 10130 O  O   . HOH CA 4 .   ? 40.642 72.540  94.116  1.00 51.36  ? 826 HOH B O   1 
HETATM 10131 O  O   . HOH CA 4 .   ? 66.407 76.419  103.205 1.00 26.04  ? 827 HOH B O   1 
HETATM 10132 O  O   . HOH CA 4 .   ? 37.181 67.200  85.768  1.00 34.92  ? 828 HOH B O   1 
HETATM 10133 O  O   . HOH CA 4 .   ? 31.994 83.524  106.577 1.00 17.23  ? 829 HOH B O   1 
HETATM 10134 O  O   . HOH CA 4 .   ? 59.360 80.287  105.220 1.00 61.86  ? 830 HOH B O   1 
HETATM 10135 O  O   . HOH CA 4 .   ? 62.146 104.666 96.752  1.00 31.41  ? 831 HOH B O   1 
HETATM 10136 O  O   . HOH CA 4 .   ? 56.283 89.115  93.796  1.00 23.06  ? 832 HOH B O   1 
HETATM 10137 O  O   . HOH CA 4 .   ? 53.715 90.178  93.965  1.00 17.60  ? 833 HOH B O   1 
HETATM 10138 O  O   . HOH CA 4 .   ? 58.959 100.704 103.334 1.00 37.08  ? 834 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 14  ? 1.0957 0.7957 0.9145 -0.0936 0.0681  -0.2441 14  SER A N   
2    C  CA  . SER A 14  ? 1.0650 0.7882 0.8861 -0.0891 0.0623  -0.2349 14  SER A CA  
3    C  C   . SER A 14  ? 1.0892 0.8086 0.9151 -0.0910 0.0642  -0.2238 14  SER A C   
4    O  O   . SER A 14  ? 1.1024 0.8054 0.9311 -0.0985 0.0697  -0.2250 14  SER A O   
5    C  CB  . SER A 14  ? 1.1048 0.8538 0.9298 -0.0943 0.0556  -0.2427 14  SER A CB  
6    O  OG  . SER A 14  ? 1.2193 0.9717 1.0542 -0.1061 0.0556  -0.2488 14  SER A OG  
7    N  N   . PHE A 15  ? 1.0060 0.7399 0.8322 -0.0844 0.0601  -0.2132 15  PHE A N   
8    C  CA  . PHE A 15  ? 0.9811 0.7141 0.8104 -0.0845 0.0611  -0.2020 15  PHE A CA  
9    C  C   . PHE A 15  ? 0.9935 0.7532 0.8306 -0.0876 0.0555  -0.2002 15  PHE A C   
10   O  O   . PHE A 15  ? 0.9829 0.7608 0.8225 -0.0899 0.0506  -0.2078 15  PHE A O   
11   C  CB  . PHE A 15  ? 0.9935 0.7179 0.8163 -0.0727 0.0609  -0.1907 15  PHE A CB  
12   C  CG  . PHE A 15  ? 0.9966 0.7368 0.8175 -0.0638 0.0562  -0.1896 15  PHE A CG  
13   C  CD1 . PHE A 15  ? 1.0140 0.7766 0.8380 -0.0616 0.0511  -0.1841 15  PHE A CD1 
14   C  CD2 . PHE A 15  ? 1.0311 0.7628 0.8470 -0.0576 0.0576  -0.1941 15  PHE A CD2 
15   C  CE1 . PHE A 15  ? 1.0154 0.7911 0.8371 -0.0541 0.0481  -0.1830 15  PHE A CE1 
16   C  CE2 . PHE A 15  ? 1.0554 0.8015 0.8701 -0.0500 0.0548  -0.1933 15  PHE A CE2 
17   C  CZ  . PHE A 15  ? 1.0109 0.7785 0.8281 -0.0486 0.0504  -0.1876 15  PHE A CZ  
18   N  N   . THR A 16  ? 0.9270 0.6881 0.7668 -0.0871 0.0561  -0.1903 16  THR A N   
19   C  CA  . THR A 16  ? 0.9015 0.6862 0.7488 -0.0885 0.0511  -0.1871 16  THR A CA  
20   C  C   . THR A 16  ? 0.9157 0.7119 0.7581 -0.0778 0.0461  -0.1792 16  THR A C   
21   O  O   . THR A 16  ? 0.9103 0.6958 0.7480 -0.0711 0.0477  -0.1703 16  THR A O   
22   C  CB  . THR A 16  ? 1.0219 0.8019 0.8749 -0.0938 0.0553  -0.1815 16  THR A CB  
23   O  OG1 . THR A 16  ? 1.0297 0.7880 0.8740 -0.0885 0.0599  -0.1722 16  THR A OG1 
24   C  CG2 . THR A 16  ? 1.0248 0.8004 0.8864 -0.1061 0.0601  -0.1909 16  THR A CG2 
25   N  N   . PRO A 17  ? 0.8433 0.6602 0.6861 -0.0761 0.0401  -0.1826 17  PRO A N   
26   C  CA  . PRO A 17  ? 0.8226 0.6490 0.6606 -0.0667 0.0367  -0.1752 17  PRO A CA  
27   C  C   . PRO A 17  ? 0.8486 0.6840 0.6907 -0.0645 0.0346  -0.1649 17  PRO A C   
28   O  O   . PRO A 17  ? 0.8404 0.6884 0.6894 -0.0694 0.0321  -0.1658 17  PRO A O   
29   C  CB  . PRO A 17  ? 0.8455 0.6886 0.6806 -0.0668 0.0318  -0.1825 17  PRO A CB  
30   C  CG  . PRO A 17  ? 0.9171 0.7583 0.7554 -0.0756 0.0319  -0.1946 17  PRO A CG  
31   C  CD  . PRO A 17  ? 0.8629 0.6945 0.7097 -0.0824 0.0360  -0.1933 17  PRO A CD  
32   N  N   . LEU A 18  ? 0.7915 0.6208 0.6305 -0.0571 0.0356  -0.1558 18  LEU A N   
33   C  CA  . LEU A 18  ? 0.7751 0.6108 0.6172 -0.0546 0.0338  -0.1462 18  LEU A CA  
34   C  C   . LEU A 18  ? 0.8079 0.6559 0.6481 -0.0472 0.0303  -0.1407 18  LEU A C   
35   O  O   . LEU A 18  ? 0.8044 0.6664 0.6477 -0.0470 0.0270  -0.1365 18  LEU A O   
36   C  CB  . LEU A 18  ? 0.7826 0.5993 0.6228 -0.0531 0.0377  -0.1399 18  LEU A CB  
37   C  CG  . LEU A 18  ? 0.8627 0.6649 0.7039 -0.0609 0.0428  -0.1432 18  LEU A CG  
38   C  CD1 . LEU A 18  ? 0.8775 0.6572 0.7120 -0.0575 0.0466  -0.1368 18  LEU A CD1 
39   C  CD2 . LEU A 18  ? 0.8932 0.7075 0.7425 -0.0676 0.0426  -0.1431 18  LEU A CD2 
40   N  N   . VAL A 19  ? 0.7417 0.5842 0.5777 -0.0411 0.0316  -0.1406 19  VAL A N   
41   C  CA  . VAL A 19  ? 0.7122 0.5647 0.5473 -0.0345 0.0300  -0.1357 19  VAL A CA  
42   C  C   . VAL A 19  ? 0.7396 0.5969 0.5696 -0.0331 0.0309  -0.1425 19  VAL A C   
43   O  O   . VAL A 19  ? 0.7394 0.5864 0.5668 -0.0338 0.0336  -0.1494 19  VAL A O   
44   C  CB  . VAL A 19  ? 0.7504 0.5931 0.5872 -0.0280 0.0312  -0.1290 19  VAL A CB  
45   C  CG1 . VAL A 19  ? 0.7376 0.5904 0.5758 -0.0220 0.0305  -0.1253 19  VAL A CG1 
46   C  CG2 . VAL A 19  ? 0.7414 0.5792 0.5805 -0.0292 0.0301  -0.1223 19  VAL A CG2 
47   N  N   . VAL A 20  ? 0.6774 0.5490 0.5048 -0.0309 0.0290  -0.1405 20  VAL A N   
48   C  CA  . VAL A 20  ? 0.6778 0.5544 0.4979 -0.0292 0.0304  -0.1460 20  VAL A CA  
49   C  C   . VAL A 20  ? 0.7244 0.6030 0.5449 -0.0226 0.0336  -0.1409 20  VAL A C   
50   O  O   . VAL A 20  ? 0.7043 0.5881 0.5292 -0.0203 0.0325  -0.1328 20  VAL A O   
51   C  CB  . VAL A 20  ? 0.7236 0.6138 0.5377 -0.0322 0.0260  -0.1484 20  VAL A CB  
52   C  CG1 . VAL A 20  ? 0.7282 0.6230 0.5313 -0.0294 0.0277  -0.1525 20  VAL A CG1 
53   C  CG2 . VAL A 20  ? 0.7288 0.6181 0.5447 -0.0391 0.0231  -0.1560 20  VAL A CG2 
54   N  N   . ILE A 21  ? 0.6952 0.5699 0.5123 -0.0198 0.0380  -0.1465 21  ILE A N   
55   C  CA  . ILE A 21  ? 0.6901 0.5679 0.5089 -0.0141 0.0425  -0.1440 21  ILE A CA  
56   C  C   . ILE A 21  ? 0.7609 0.6452 0.5684 -0.0142 0.0453  -0.1489 21  ILE A C   
57   O  O   . ILE A 21  ? 0.7735 0.6532 0.5742 -0.0160 0.0463  -0.1576 21  ILE A O   
58   C  CB  . ILE A 21  ? 0.7294 0.5962 0.5557 -0.0095 0.0461  -0.1461 21  ILE A CB  
59   C  CG1 . ILE A 21  ? 0.7258 0.5831 0.5597 -0.0091 0.0427  -0.1416 21  ILE A CG1 
60   C  CG2 . ILE A 21  ? 0.7314 0.6044 0.5628 -0.0040 0.0509  -0.1442 21  ILE A CG2 
61   C  CD1 . ILE A 21  ? 0.8074 0.6509 0.6461 -0.0043 0.0447  -0.1446 21  ILE A CD1 
62   N  N   . GLU A 22  ? 0.7231 0.6168 0.5272 -0.0123 0.0468  -0.1434 22  GLU A N   
63   C  CA  . GLU A 22  ? 0.7398 0.6383 0.5304 -0.0117 0.0503  -0.1467 22  GLU A CA  
64   C  C   . GLU A 22  ? 0.8171 0.7158 0.6112 -0.0073 0.0588  -0.1462 22  GLU A C   
65   O  O   . GLU A 22  ? 0.8049 0.7072 0.6086 -0.0051 0.0605  -0.1390 22  GLU A O   
66   C  CB  . GLU A 22  ? 0.7533 0.6609 0.5347 -0.0130 0.0461  -0.1410 22  GLU A CB  
67   C  CG  . GLU A 22  ? 0.8986 0.8090 0.6615 -0.0125 0.0484  -0.1449 22  GLU A CG  
68   C  CD  . GLU A 22  ? 1.1577 1.0752 0.9093 -0.0116 0.0460  -0.1379 22  GLU A CD  
69   O  OE1 . GLU A 22  ? 0.9974 0.9183 0.7570 -0.0110 0.0439  -0.1290 22  GLU A OE1 
70   O  OE2 . GLU A 22  ? 1.1463 1.0648 0.8798 -0.0110 0.0463  -0.1412 22  GLU A OE2 
71   N  N   . LEU A 23  ? 0.8032 0.6984 0.5904 -0.0062 0.0644  -0.1544 23  LEU A N   
72   C  CA  . LEU A 23  ? 0.8123 0.7083 0.6033 -0.0022 0.0738  -0.1556 23  LEU A CA  
73   C  C   . LEU A 23  ? 0.8812 0.7824 0.6556 -0.0023 0.0792  -0.1549 23  LEU A C   
74   O  O   . LEU A 23  ? 0.8804 0.7826 0.6384 -0.0048 0.0747  -0.1561 23  LEU A O   
75   C  CB  . LEU A 23  ? 0.8258 0.7134 0.6205 -0.0001 0.0777  -0.1654 23  LEU A CB  
76   C  CG  . LEU A 23  ? 0.8777 0.7588 0.6904 0.0028  0.0758  -0.1651 23  LEU A CG  
77   C  CD1 . LEU A 23  ? 0.8767 0.7505 0.6896 -0.0006 0.0675  -0.1647 23  LEU A CD1 
78   C  CD2 . LEU A 23  ? 0.9182 0.7925 0.7351 0.0068  0.0820  -0.1739 23  LEU A CD2 
79   N  N   . ALA A 24  ? 0.8556 0.7599 0.6342 0.0004  0.0887  -0.1531 24  ALA A N   
80   C  CA  . ALA A 24  ? 0.8795 0.7865 0.6416 0.0005  0.0963  -0.1518 24  ALA A CA  
81   C  C   . ALA A 24  ? 0.9765 0.8787 0.7188 0.0002  0.0989  -0.1615 24  ALA A C   
82   O  O   . ALA A 24  ? 0.9828 0.8797 0.7292 0.0006  0.0983  -0.1703 24  ALA A O   
83   C  CB  . ALA A 24  ? 0.8875 0.7982 0.6620 0.0029  0.1074  -0.1495 24  ALA A CB  
84   N  N   . GLN A 25  ? 0.9564 0.8592 0.6760 -0.0004 0.1013  -0.1599 25  GLN A N   
85   C  CA  . GLN A 25  ? 0.9814 0.8798 0.6771 -0.0006 0.1024  -0.1683 25  GLN A CA  
86   C  C   . GLN A 25  ? 1.0376 0.9304 0.7357 0.0008  0.1095  -0.1801 25  GLN A C   
87   O  O   . GLN A 25  ? 1.0427 0.9309 0.7320 -0.0006 0.1041  -0.1889 25  GLN A O   
88   C  CB  . GLN A 25  ? 1.0203 0.9187 0.6927 0.0003  0.1089  -0.1637 25  GLN A CB  
89   C  CG  . GLN A 25  ? 1.2724 1.1681 0.9168 -0.0004 0.1013  -0.1676 25  GLN A CG  
90   C  CD  . GLN A 25  ? 1.6166 1.5088 1.2334 0.0015  0.1095  -0.1649 25  GLN A CD  
91   O  OE1 . GLN A 25  ? 1.5887 1.4819 1.2009 0.0022  0.1124  -0.1542 25  GLN A OE1 
92   N  NE2 . GLN A 25  ? 1.5435 1.4300 1.1399 0.0023  0.1133  -0.1745 25  GLN A NE2 
93   N  N   . ASP A 26  ? 0.9895 0.8829 0.7002 0.0035  0.1213  -0.1809 26  ASP A N   
94   C  CA  . ASP A 26  ? 0.9945 0.8827 0.7080 0.0057  0.1288  -0.1923 26  ASP A CA  
95   C  C   . ASP A 26  ? 1.0088 0.8985 0.7521 0.0088  0.1320  -0.1930 26  ASP A C   
96   O  O   . ASP A 26  ? 1.0099 0.9016 0.7618 0.0118  0.1437  -0.1959 26  ASP A O   
97   C  CB  . ASP A 26  ? 1.0429 0.9296 0.7373 0.0070  0.1420  -0.1960 26  ASP A CB  
98   C  CG  . ASP A 26  ? 1.2066 1.0895 0.8682 0.0052  0.1383  -0.1978 26  ASP A CG  
99   O  OD1 . ASP A 26  ? 1.2222 1.0999 0.8739 0.0042  0.1318  -0.2070 26  ASP A OD1 
100  O  OD2 . ASP A 26  ? 1.2978 1.1822 0.9432 0.0050  0.1421  -0.1904 26  ASP A OD2 
101  N  N   . VAL A 27  ? 0.9288 0.8171 0.6873 0.0084  0.1217  -0.1907 27  VAL A N   
102  C  CA  . VAL A 27  ? 0.9040 0.7921 0.6886 0.0121  0.1221  -0.1911 27  VAL A CA  
103  C  C   . VAL A 27  ? 0.9436 0.8231 0.7298 0.0151  0.1258  -0.2030 27  VAL A C   
104  O  O   . VAL A 27  ? 0.9517 0.8234 0.7239 0.0127  0.1215  -0.2094 27  VAL A O   
105  C  CB  . VAL A 27  ? 0.9307 0.8184 0.7276 0.0109  0.1102  -0.1840 27  VAL A CB  
106  C  CG1 . VAL A 27  ? 0.9189 0.8034 0.7388 0.0156  0.1093  -0.1856 27  VAL A CG1 
107  C  CG2 . VAL A 27  ? 0.9131 0.8094 0.7115 0.0088  0.1079  -0.1727 27  VAL A CG2 
108  N  N   . LYS A 28  ? 0.8771 0.7582 0.6811 0.0203  0.1338  -0.2066 28  LYS A N   
109  C  CA  . LYS A 28  ? 0.8775 0.7507 0.6864 0.0247  0.1384  -0.2177 28  LYS A CA  
110  C  C   . LYS A 28  ? 0.9145 0.7761 0.7276 0.0249  0.1281  -0.2200 28  LYS A C   
111  O  O   . LYS A 28  ? 0.8895 0.7513 0.7122 0.0242  0.1193  -0.2123 28  LYS A O   
112  C  CB  . LYS A 28  ? 0.8969 0.7765 0.7295 0.0310  0.1471  -0.2195 28  LYS A CB  
113  C  CG  . LYS A 28  ? 0.9971 0.8868 0.8270 0.0305  0.1603  -0.2190 28  LYS A CG  
114  C  CD  . LYS A 28  ? 1.0480 0.9459 0.9054 0.0363  0.1687  -0.2217 28  LYS A CD  
115  C  CE  . LYS A 28  ? 1.1306 1.0380 0.9858 0.0349  0.1836  -0.2215 28  LYS A CE  
116  N  NZ  . LYS A 28  ? 1.1999 1.1165 1.0842 0.0404  0.1928  -0.2262 28  LYS A NZ  
117  N  N   . GLU A 29  ? 0.8839 0.7343 0.6890 0.0257  0.1299  -0.2307 29  GLU A N   
118  C  CA  . GLU A 29  ? 0.8818 0.7183 0.6892 0.0255  0.1221  -0.2341 29  GLU A CA  
119  C  C   . GLU A 29  ? 0.9112 0.7444 0.7418 0.0322  0.1197  -0.2312 29  GLU A C   
120  O  O   . GLU A 29  ? 0.8979 0.7220 0.7321 0.0315  0.1112  -0.2277 29  GLU A O   
121  C  CB  . GLU A 29  ? 0.9250 0.7498 0.7199 0.0254  0.1262  -0.2472 29  GLU A CB  
122  C  CG  . GLU A 29  ? 1.1055 0.9310 0.8757 0.0186  0.1252  -0.2512 29  GLU A CG  
123  C  CD  . GLU A 29  ? 1.4113 1.2368 1.1737 0.0114  0.1138  -0.2460 29  GLU A CD  
124  O  OE1 . GLU A 29  ? 1.3192 1.1355 1.0895 0.0100  0.1071  -0.2453 29  GLU A OE1 
125  O  OE2 . GLU A 29  ? 1.3604 1.1948 1.1085 0.0074  0.1118  -0.2426 29  GLU A OE2 
126  N  N   . GLU A 30  ? 0.8635 0.7042 0.7095 0.0388  0.1274  -0.2327 30  GLU A N   
127  C  CA  . GLU A 30  ? 0.8485 0.6894 0.7183 0.0467  0.1256  -0.2308 30  GLU A CA  
128  C  C   . GLU A 30  ? 0.8655 0.7110 0.7432 0.0451  0.1159  -0.2189 30  GLU A C   
129  O  O   . GLU A 30  ? 0.8634 0.7006 0.7512 0.0494  0.1086  -0.2164 30  GLU A O   
130  C  CB  . GLU A 30  ? 0.8685 0.7220 0.7530 0.0520  0.1367  -0.2346 30  GLU A CB  
131  C  CG  . GLU A 30  ? 1.0039 0.8599 0.9154 0.0613  0.1352  -0.2350 30  GLU A CG  
132  C  CD  . GLU A 30  ? 1.2816 1.1539 1.2117 0.0655  0.1459  -0.2381 30  GLU A CD  
133  O  OE1 . GLU A 30  ? 1.1923 1.0728 1.1126 0.0609  0.1562  -0.2395 30  GLU A OE1 
134  O  OE2 . GLU A 30  ? 1.2188 1.0954 1.1733 0.0734  0.1440  -0.2391 30  GLU A OE2 
135  N  N   . THR A 31  ? 0.7938 0.6510 0.6652 0.0394  0.1158  -0.2117 31  THR A N   
136  C  CA  . THR A 31  ? 0.7639 0.6264 0.6406 0.0370  0.1076  -0.2007 31  THR A CA  
137  C  C   . THR A 31  ? 0.7926 0.6436 0.6572 0.0323  0.0979  -0.1975 31  THR A C   
138  O  O   . THR A 31  ? 0.7747 0.6208 0.6474 0.0340  0.0903  -0.1920 31  THR A O   
139  C  CB  . THR A 31  ? 0.8246 0.7015 0.6963 0.0324  0.1120  -0.1949 31  THR A CB  
140  O  OG1 . THR A 31  ? 0.8123 0.6975 0.6899 0.0351  0.1238  -0.1999 31  THR A OG1 
141  C  CG2 . THR A 31  ? 0.7664 0.6507 0.6488 0.0316  0.1056  -0.1845 31  THR A CG2 
142  N  N   . LYS A 32  ? 0.7466 0.5937 0.5921 0.0262  0.0985  -0.2014 32  LYS A N   
143  C  CA  . LYS A 32  ? 0.7365 0.5746 0.5708 0.0202  0.0907  -0.2003 32  LYS A CA  
144  C  C   . LYS A 32  ? 0.7857 0.6070 0.6253 0.0230  0.0869  -0.2030 32  LYS A C   
145  O  O   . LYS A 32  ? 0.7791 0.5941 0.6184 0.0201  0.0799  -0.1975 32  LYS A O   
146  C  CB  . LYS A 32  ? 0.7791 0.6165 0.5940 0.0145  0.0927  -0.2072 32  LYS A CB  
147  C  CG  . LYS A 32  ? 0.9543 0.8053 0.7584 0.0107  0.0939  -0.2028 32  LYS A CG  
148  C  CD  . LYS A 32  ? 1.1054 0.9548 0.8897 0.0072  0.0966  -0.2114 32  LYS A CD  
149  C  CE  . LYS A 32  ? 1.2343 1.0944 1.0042 0.0035  0.0953  -0.2066 32  LYS A CE  
150  N  NZ  . LYS A 32  ? 1.3843 1.2419 1.1331 0.0006  0.0962  -0.2156 32  LYS A NZ  
151  N  N   . GLU A 33  ? 0.7474 0.5602 0.5909 0.0286  0.0920  -0.2115 33  GLU A N   
152  C  CA  . GLU A 33  ? 0.7504 0.5445 0.5976 0.0322  0.0891  -0.2143 33  GLU A CA  
153  C  C   . GLU A 33  ? 0.7883 0.5808 0.6505 0.0389  0.0840  -0.2066 33  GLU A C   
154  O  O   . GLU A 33  ? 0.7905 0.5683 0.6515 0.0392  0.0783  -0.2033 33  GLU A O   
155  C  CB  . GLU A 33  ? 0.7848 0.5700 0.6319 0.0371  0.0962  -0.2259 33  GLU A CB  
156  C  CG  . GLU A 33  ? 0.9265 0.7076 0.7565 0.0305  0.0997  -0.2351 33  GLU A CG  
157  C  CD  . GLU A 33  ? 1.2215 0.9912 1.0402 0.0222  0.0939  -0.2355 33  GLU A CD  
158  O  OE1 . GLU A 33  ? 1.0828 0.8375 0.9055 0.0231  0.0897  -0.2329 33  GLU A OE1 
159  O  OE2 . GLU A 33  ? 1.2111 0.9866 1.0167 0.0148  0.0936  -0.2390 33  GLU A OE2 
160  N  N   . TRP A 34  ? 0.7226 0.5298 0.5986 0.0442  0.0862  -0.2039 34  TRP A N   
161  C  CA  . TRP A 34  ? 0.7020 0.5110 0.5937 0.0510  0.0807  -0.1974 34  TRP A CA  
162  C  C   . TRP A 34  ? 0.7288 0.5379 0.6160 0.0459  0.0727  -0.1871 34  TRP A C   
163  O  O   . TRP A 34  ? 0.7266 0.5253 0.6173 0.0498  0.0660  -0.1825 34  TRP A O   
164  C  CB  . TRP A 34  ? 0.6745 0.5019 0.5827 0.0557  0.0857  -0.1980 34  TRP A CB  
165  C  CG  . TRP A 34  ? 0.6691 0.5031 0.5934 0.0607  0.0792  -0.1910 34  TRP A CG  
166  C  CD1 . TRP A 34  ? 0.7084 0.5359 0.6462 0.0702  0.0740  -0.1915 34  TRP A CD1 
167  C  CD2 . TRP A 34  ? 0.6478 0.4955 0.5757 0.0566  0.0765  -0.1828 34  TRP A CD2 
168  N  NE1 . TRP A 34  ? 0.6855 0.5227 0.6352 0.0722  0.0678  -0.1846 34  TRP A NE1 
169  C  CE2 . TRP A 34  ? 0.6900 0.5395 0.6342 0.0637  0.0697  -0.1793 34  TRP A CE2 
170  C  CE3 . TRP A 34  ? 0.6520 0.5102 0.5705 0.0481  0.0789  -0.1783 34  TRP A CE3 
171  C  CZ2 . TRP A 34  ? 0.6644 0.5258 0.6163 0.0618  0.0657  -0.1720 34  TRP A CZ2 
172  C  CZ3 . TRP A 34  ? 0.6542 0.5233 0.5802 0.0466  0.0754  -0.1704 34  TRP A CZ3 
173  C  CH2 . TRP A 34  ? 0.6560 0.5268 0.5988 0.0530  0.0691  -0.1676 34  TRP A CH2 
174  N  N   . LEU A 35  ? 0.6651 0.4852 0.5435 0.0377  0.0735  -0.1836 35  LEU A N   
175  C  CA  . LEU A 35  ? 0.6437 0.4654 0.5173 0.0322  0.0669  -0.1747 35  LEU A CA  
176  C  C   . LEU A 35  ? 0.7048 0.5087 0.5677 0.0284  0.0629  -0.1749 35  LEU A C   
177  O  O   . LEU A 35  ? 0.6901 0.4875 0.5533 0.0282  0.0570  -0.1681 35  LEU A O   
178  C  CB  . LEU A 35  ? 0.6330 0.4698 0.4991 0.0252  0.0693  -0.1723 35  LEU A CB  
179  C  CG  . LEU A 35  ? 0.6766 0.5167 0.5372 0.0191  0.0632  -0.1639 35  LEU A CG  
180  C  CD1 . LEU A 35  ? 0.6616 0.5057 0.5338 0.0227  0.0586  -0.1557 35  LEU A CD1 
181  C  CD2 . LEU A 35  ? 0.7030 0.5559 0.5544 0.0135  0.0657  -0.1630 35  LEU A CD2 
182  N  N   . LYS A 36  ? 0.6847 0.4799 0.5382 0.0252  0.0666  -0.1832 36  LYS A N   
183  C  CA  . LYS A 36  ? 0.6961 0.4737 0.5403 0.0206  0.0646  -0.1854 36  LYS A CA  
184  C  C   . LYS A 36  ? 0.7595 0.5183 0.6080 0.0274  0.0619  -0.1834 36  LYS A C   
185  O  O   . LYS A 36  ? 0.7591 0.5054 0.6023 0.0242  0.0583  -0.1790 36  LYS A O   
186  C  CB  . LYS A 36  ? 0.7425 0.5155 0.5776 0.0169  0.0697  -0.1965 36  LYS A CB  
187  C  CG  . LYS A 36  ? 0.9092 0.6629 0.7364 0.0117  0.0688  -0.2006 36  LYS A CG  
188  C  CD  . LYS A 36  ? 1.0368 0.7893 0.8546 0.0062  0.0726  -0.2118 36  LYS A CD  
189  C  CE  . LYS A 36  ? 1.1732 0.9092 0.9846 -0.0012 0.0715  -0.2157 36  LYS A CE  
190  N  NZ  . LYS A 36  ? 1.3096 1.0459 1.1121 -0.0074 0.0740  -0.2273 36  LYS A NZ  
191  N  N   . ASN A 37  ? 0.7231 0.4799 0.5810 0.0371  0.0637  -0.1867 37  ASN A N   
192  C  CA  . ASN A 37  ? 0.7314 0.4704 0.5934 0.0458  0.0605  -0.1853 37  ASN A CA  
193  C  C   . ASN A 37  ? 0.7711 0.5101 0.6366 0.0485  0.0531  -0.1748 37  ASN A C   
194  O  O   . ASN A 37  ? 0.7863 0.5058 0.6451 0.0499  0.0495  -0.1710 37  ASN A O   
195  C  CB  . ASN A 37  ? 0.7430 0.4844 0.6172 0.0562  0.0637  -0.1916 37  ASN A CB  
196  C  CG  . ASN A 37  ? 0.9989 0.7213 0.8770 0.0666  0.0592  -0.1903 37  ASN A CG  
197  O  OD1 . ASN A 37  ? 0.9003 0.5999 0.7687 0.0667  0.0594  -0.1924 37  ASN A OD1 
198  N  ND2 . ASN A 37  ? 0.9014 0.6323 0.7933 0.0755  0.0545  -0.1866 37  ASN A ND2 
199  N  N   . ARG A 38  ? 0.6944 0.4537 0.5689 0.0490  0.0513  -0.1701 38  ARG A N   
200  C  CA  . ARG A 38  ? 0.6791 0.4397 0.5571 0.0516  0.0441  -0.1610 38  ARG A CA  
201  C  C   . ARG A 38  ? 0.7418 0.4956 0.6070 0.0429  0.0416  -0.1546 38  ARG A C   
202  O  O   . ARG A 38  ? 0.7450 0.4889 0.6074 0.0454  0.0361  -0.1480 38  ARG A O   
203  C  CB  . ARG A 38  ? 0.6521 0.4362 0.5439 0.0533  0.0437  -0.1586 38  ARG A CB  
204  C  CG  . ARG A 38  ? 0.7668 0.5609 0.6748 0.0615  0.0470  -0.1650 38  ARG A CG  
205  C  CD  . ARG A 38  ? 0.8964 0.6789 0.8132 0.0734  0.0421  -0.1665 38  ARG A CD  
206  N  NE  . ARG A 38  ? 0.9801 0.7569 0.8970 0.0771  0.0326  -0.1586 38  ARG A NE  
207  C  CZ  . ARG A 38  ? 1.1070 0.8972 1.0385 0.0821  0.0275  -0.1560 38  ARG A CZ  
208  N  NH1 . ARG A 38  ? 0.9614 0.7442 0.8899 0.0854  0.0184  -0.1492 38  ARG A NH1 
209  N  NH2 . ARG A 38  ? 0.8900 0.7008 0.8391 0.0836  0.0318  -0.1604 38  ARG A NH2 
210  N  N   . ILE A 39  ? 0.7036 0.4622 0.5609 0.0330  0.0455  -0.1572 39  ILE A N   
211  C  CA  . ILE A 39  ? 0.7008 0.4551 0.5483 0.0241  0.0440  -0.1528 39  ILE A CA  
212  C  C   . ILE A 39  ? 0.7896 0.5193 0.6271 0.0218  0.0454  -0.1552 39  ILE A C   
213  O  O   . ILE A 39  ? 0.7888 0.5099 0.6195 0.0166  0.0440  -0.1503 39  ILE A O   
214  C  CB  . ILE A 39  ? 0.7258 0.4979 0.5709 0.0153  0.0466  -0.1549 39  ILE A CB  
215  C  CG1 . ILE A 39  ? 0.7126 0.5058 0.5659 0.0172  0.0455  -0.1505 39  ILE A CG1 
216  C  CG2 . ILE A 39  ? 0.7312 0.4997 0.5682 0.0059  0.0455  -0.1526 39  ILE A CG2 
217  C  CD1 . ILE A 39  ? 0.7949 0.6047 0.6451 0.0115  0.0485  -0.1530 39  ILE A CD1 
218  N  N   . ILE A 40  ? 0.7763 0.4942 0.6131 0.0254  0.0488  -0.1627 40  ILE A N   
219  C  CA  . ILE A 40  ? 0.8046 0.4976 0.6320 0.0230  0.0512  -0.1657 40  ILE A CA  
220  C  C   . ILE A 40  ? 0.8965 0.5673 0.7219 0.0330  0.0482  -0.1616 40  ILE A C   
221  O  O   . ILE A 40  ? 0.9052 0.5563 0.7207 0.0304  0.0478  -0.1571 40  ILE A O   
222  C  CB  . ILE A 40  ? 0.8554 0.5463 0.6809 0.0198  0.0569  -0.1771 40  ILE A CB  
223  C  CG1 . ILE A 40  ? 0.8541 0.5563 0.6751 0.0074  0.0586  -0.1804 40  ILE A CG1 
224  C  CG2 . ILE A 40  ? 0.8973 0.5601 0.7167 0.0226  0.0595  -0.1814 40  ILE A CG2 
225  C  CD1 . ILE A 40  ? 0.9708 0.6746 0.7888 0.0033  0.0632  -0.1922 40  ILE A CD1 
226  N  N   . ALA A 41  ? 0.8719 0.5457 0.7065 0.0445  0.0462  -0.1632 41  ALA A N   
227  C  CA  . ALA A 41  ? 0.8942 0.5487 0.7283 0.0562  0.0421  -0.1605 41  ALA A CA  
228  C  C   . ALA A 41  ? 0.9573 0.6009 0.7836 0.0577  0.0362  -0.1500 41  ALA A C   
229  O  O   . ALA A 41  ? 0.9279 0.5873 0.7566 0.0539  0.0334  -0.1446 41  ALA A O   
230  C  CB  . ALA A 41  ? 0.8983 0.5672 0.7482 0.0675  0.0397  -0.1634 41  ALA A CB  
231  N  N   . LYS A 42  ? 0.9518 0.5667 0.7672 0.0634  0.0347  -0.1473 42  LYS A N   
232  C  CA  . LYS A 42  ? 0.9627 0.5613 0.7662 0.0657  0.0297  -0.1375 42  LYS A CA  
233  C  C   . LYS A 42  ? 1.0102 0.6232 0.8226 0.0751  0.0207  -0.1325 42  LYS A C   
234  O  O   . LYS A 42  ? 1.0006 0.6272 0.8280 0.0837  0.0178  -0.1368 42  LYS A O   
235  C  CB  . LYS A 42  ? 1.0247 0.5873 0.8132 0.0713  0.0303  -0.1359 42  LYS A CB  
236  C  CG  . LYS A 42  ? 1.2139 0.7677 1.0087 0.0843  0.0283  -0.1414 42  LYS A CG  
237  N  N   . LYS A 43  ? 0.9645 0.5750 0.7684 0.0730  0.0168  -0.1239 43  LYS A N   
238  C  CA  . LYS A 43  ? 0.9527 0.5759 0.7633 0.0804  0.0079  -0.1191 43  LYS A CA  
239  C  C   . LYS A 43  ? 1.0329 0.6451 0.8463 0.0963  -0.0002 -0.1192 43  LYS A C   
240  O  O   . LYS A 43  ? 1.0110 0.6411 0.8387 0.1035  -0.0072 -0.1196 43  LYS A O   
241  C  CB  . LYS A 43  ? 0.9813 0.5982 0.7784 0.0752  0.0060  -0.1103 43  LYS A CB  
242  C  CG  . LYS A 43  ? 1.1383 0.7764 0.9399 0.0620  0.0110  -0.1102 43  LYS A CG  
243  C  CD  . LYS A 43  ? 1.2586 0.8977 1.0526 0.0593  0.0076  -0.1023 43  LYS A CD  
244  C  CE  . LYS A 43  ? 1.3603 1.0244 1.1688 0.0629  0.0012  -0.1014 43  LYS A CE  
245  N  NZ  . LYS A 43  ? 1.4434 1.1111 1.2453 0.0579  -0.0005 -0.0948 43  LYS A NZ  
246  N  N   . LYS A 44  ? 1.0406 0.6238 0.8415 0.1019  0.0007  -0.1195 44  LYS A N   
247  C  CA  . LYS A 44  ? 1.0691 0.6385 0.8712 0.1181  -0.0071 -0.1201 44  LYS A CA  
248  C  C   . LYS A 44  ? 1.1338 0.7264 0.9610 0.1249  -0.0081 -0.1291 44  LYS A C   
249  O  O   . LYS A 44  ? 1.1349 0.7345 0.9736 0.1374  -0.0172 -0.1297 44  LYS A O   
250  C  CB  . LYS A 44  ? 1.1317 0.6645 0.9149 0.1208  -0.0034 -0.1193 44  LYS A CB  
251  N  N   . ASP A 45  ? 1.0903 0.6958 0.9262 0.1165  0.0014  -0.1364 45  ASP A N   
252  C  CA  . ASP A 45  ? 1.0807 0.7080 0.9388 0.1208  0.0036  -0.1455 45  ASP A CA  
253  C  C   . ASP A 45  ? 1.0923 0.7539 0.9672 0.1151  0.0040  -0.1462 45  ASP A C   
254  O  O   . ASP A 45  ? 1.0819 0.7637 0.9753 0.1172  0.0072  -0.1534 45  ASP A O   
255  C  CB  . ASP A 45  ? 1.1159 0.7368 0.9716 0.1147  0.0142  -0.1533 45  ASP A CB  
256  C  CG  . ASP A 45  ? 1.3011 0.8868 1.1387 0.1167  0.0164  -0.1529 45  ASP A CG  
257  O  OD1 . ASP A 45  ? 1.3300 0.8940 1.1576 0.1262  0.0092  -0.1469 45  ASP A OD1 
258  O  OD2 . ASP A 45  ? 1.3900 0.9690 1.2228 0.1088  0.0251  -0.1586 45  ASP A OD2 
259  N  N   . GLY A 46  ? 1.0194 0.6861 0.8871 0.1081  0.0015  -0.1389 46  GLY A N   
260  C  CA  . GLY A 46  ? 0.9819 0.6778 0.8628 0.1021  0.0019  -0.1384 46  GLY A CA  
261  C  C   . GLY A 46  ? 0.9948 0.7015 0.8730 0.0886  0.0116  -0.1409 46  GLY A C   
262  O  O   . GLY A 46  ? 0.9942 0.7028 0.8758 0.0871  0.0185  -0.1482 46  GLY A O   
263  N  N   . GLY A 47  ? 0.9182 0.6313 0.7896 0.0793  0.0117  -0.1351 47  GLY A N   
264  C  CA  . GLY A 47  ? 0.8980 0.6214 0.7655 0.0668  0.0192  -0.1364 47  GLY A CA  
265  C  C   . GLY A 47  ? 0.9397 0.6463 0.7893 0.0585  0.0207  -0.1319 47  GLY A C   
266  O  O   . GLY A 47  ? 0.9511 0.6330 0.7892 0.0617  0.0197  -0.1304 47  GLY A O   
267  N  N   . ALA A 48  ? 0.8738 0.5931 0.7212 0.0481  0.0233  -0.1298 48  ALA A N   
268  C  CA  . ALA A 48  ? 0.8713 0.5799 0.7052 0.0388  0.0256  -0.1262 48  ALA A CA  
269  C  C   . ALA A 48  ? 0.9333 0.6244 0.7586 0.0345  0.0313  -0.1315 48  ALA A C   
270  O  O   . ALA A 48  ? 0.9410 0.6375 0.7712 0.0342  0.0351  -0.1391 48  ALA A O   
271  C  CB  . ALA A 48  ? 0.8611 0.5909 0.6982 0.0296  0.0274  -0.1250 48  ALA A CB  
272  N  N   . GLN A 49  ? 0.8858 0.5550 0.6979 0.0313  0.0324  -0.1279 49  GLN A N   
273  C  CA  . GLN A 49  ? 0.8916 0.5405 0.6950 0.0264  0.0383  -0.1325 49  GLN A CA  
274  C  C   . GLN A 49  ? 0.8996 0.5579 0.7021 0.0127  0.0433  -0.1355 49  GLN A C   
275  O  O   . GLN A 49  ? 0.9128 0.5550 0.7065 0.0055  0.0473  -0.1349 49  GLN A O   
276  C  CB  . GLN A 49  ? 0.9313 0.5500 0.7204 0.0304  0.0374  -0.1265 49  GLN A CB  
277  C  CG  . GLN A 49  ? 1.1018 0.6939 0.8828 0.0317  0.0418  -0.1309 49  GLN A CG  
278  C  CD  . GLN A 49  ? 1.3406 0.9028 1.1061 0.0381  0.0399  -0.1233 49  GLN A CD  
279  O  OE1 . GLN A 49  ? 1.2596 0.8178 1.0246 0.0504  0.0326  -0.1191 49  GLN A OE1 
280  N  NE2 . GLN A 49  ? 1.2880 0.8286 1.0405 0.0299  0.0462  -0.1215 49  GLN A NE2 
281  N  N   . LEU A 50  ? 0.7972 0.4815 0.6090 0.0093  0.0431  -0.1388 50  LEU A N   
282  C  CA  . LEU A 50  ? 0.7679 0.4653 0.5805 -0.0022 0.0459  -0.1421 50  LEU A CA  
283  C  C   . LEU A 50  ? 0.7920 0.4879 0.6046 -0.0064 0.0503  -0.1527 50  LEU A C   
284  O  O   . LEU A 50  ? 0.7938 0.4767 0.6052 -0.0007 0.0519  -0.1570 50  LEU A O   
285  C  CB  . LEU A 50  ? 0.7429 0.4677 0.5634 -0.0028 0.0427  -0.1394 50  LEU A CB  
286  C  CG  . LEU A 50  ? 0.7855 0.5150 0.6072 0.0008  0.0381  -0.1299 50  LEU A CG  
287  C  CD1 . LEU A 50  ? 0.7660 0.5207 0.5964 0.0017  0.0358  -0.1285 50  LEU A CD1 
288  C  CD2 . LEU A 50  ? 0.8063 0.5286 0.6218 -0.0062 0.0391  -0.1252 50  LEU A CD2 
289  N  N   . LEU A 51  ? 0.7288 0.4378 0.5425 -0.0161 0.0517  -0.1571 51  LEU A N   
290  C  CA  . LEU A 51  ? 0.7306 0.4408 0.5436 -0.0214 0.0549  -0.1679 51  LEU A CA  
291  C  C   . LEU A 51  ? 0.7818 0.5176 0.5988 -0.0216 0.0530  -0.1709 51  LEU A C   
292  O  O   . LEU A 51  ? 0.7578 0.5104 0.5777 -0.0233 0.0499  -0.1655 51  LEU A O   
293  C  CB  . LEU A 51  ? 0.7346 0.4371 0.5451 -0.0330 0.0578  -0.1717 51  LEU A CB  
294  C  CG  . LEU A 51  ? 0.8008 0.4779 0.6058 -0.0348 0.0609  -0.1672 51  LEU A CG  
295  C  CD1 . LEU A 51  ? 0.8053 0.4804 0.6111 -0.0475 0.0644  -0.1711 51  LEU A CD1 
296  C  CD2 . LEU A 51  ? 0.8446 0.4962 0.6438 -0.0288 0.0639  -0.1698 51  LEU A CD2 
297  N  N   . PHE A 52  ? 0.7644 0.5019 0.5806 -0.0193 0.0552  -0.1792 52  PHE A N   
298  C  CA  . PHE A 52  ? 0.7605 0.5190 0.5775 -0.0188 0.0547  -0.1824 52  PHE A CA  
299  C  C   . PHE A 52  ? 0.8291 0.5875 0.6407 -0.0244 0.0569  -0.1941 52  PHE A C   
300  O  O   . PHE A 52  ? 0.8496 0.5916 0.6589 -0.0237 0.0604  -0.2010 52  PHE A O   
301  C  CB  . PHE A 52  ? 0.7855 0.5476 0.6069 -0.0085 0.0559  -0.1807 52  PHE A CB  
302  C  CG  . PHE A 52  ? 0.7994 0.5825 0.6218 -0.0069 0.0563  -0.1809 52  PHE A CG  
303  C  CD1 . PHE A 52  ? 0.8254 0.6227 0.6523 -0.0052 0.0535  -0.1721 52  PHE A CD1 
304  C  CD2 . PHE A 52  ? 0.8386 0.6255 0.6566 -0.0065 0.0602  -0.1898 52  PHE A CD2 
305  C  CE1 . PHE A 52  ? 0.8312 0.6455 0.6582 -0.0038 0.0550  -0.1717 52  PHE A CE1 
306  C  CE2 . PHE A 52  ? 0.8679 0.6720 0.6848 -0.0047 0.0619  -0.1894 52  PHE A CE2 
307  C  CZ  . PHE A 52  ? 0.8277 0.6450 0.6492 -0.0035 0.0594  -0.1801 52  PHE A CZ  
308  N  N   . ARG A 53  ? 0.7765 0.5526 0.5855 -0.0296 0.0545  -0.1966 53  ARG A N   
309  C  CA  . ARG A 53  ? 0.7839 0.5629 0.5867 -0.0351 0.0550  -0.2081 53  ARG A CA  
310  C  C   . ARG A 53  ? 0.8355 0.6365 0.6338 -0.0356 0.0518  -0.2079 53  ARG A C   
311  O  O   . ARG A 53  ? 0.8127 0.6256 0.6140 -0.0361 0.0481  -0.1996 53  ARG A O   
312  C  CB  . ARG A 53  ? 0.7782 0.5482 0.5820 -0.0448 0.0542  -0.2131 53  ARG A CB  
313  C  CG  . ARG A 53  ? 0.8609 0.6451 0.6626 -0.0530 0.0501  -0.2204 53  ARG A CG  
314  C  CD  . ARG A 53  ? 0.9201 0.6982 0.7280 -0.0625 0.0494  -0.2222 53  ARG A CD  
315  N  NE  . ARG A 53  ? 0.9539 0.7517 0.7648 -0.0684 0.0435  -0.2233 53  ARG A NE  
316  C  CZ  . ARG A 53  ? 1.0800 0.8808 0.8992 -0.0746 0.0421  -0.2201 53  ARG A CZ  
317  N  NH1 . ARG A 53  ? 0.8727 0.6569 0.6962 -0.0761 0.0467  -0.2148 53  ARG A NH1 
318  N  NH2 . ARG A 53  ? 0.9017 0.7218 0.7247 -0.0789 0.0361  -0.2220 53  ARG A NH2 
319  N  N   . PRO A 54  ? 0.8234 0.6287 0.6130 -0.0351 0.0534  -0.2167 54  PRO A N   
320  C  CA  . PRO A 54  ? 0.8249 0.6487 0.6069 -0.0352 0.0503  -0.2161 54  PRO A CA  
321  C  C   . PRO A 54  ? 0.9023 0.7352 0.6832 -0.0430 0.0434  -0.2187 54  PRO A C   
322  O  O   . PRO A 54  ? 0.9092 0.7339 0.6937 -0.0495 0.0425  -0.2254 54  PRO A O   
323  C  CB  . PRO A 54  ? 0.8616 0.6835 0.6329 -0.0326 0.0545  -0.2259 54  PRO A CB  
324  C  CG  . PRO A 54  ? 0.9248 0.7285 0.7006 -0.0299 0.0602  -0.2307 54  PRO A CG  
325  C  CD  . PRO A 54  ? 0.8649 0.6574 0.6496 -0.0342 0.0580  -0.2279 54  PRO A CD  
326  N  N   . LEU A 55  ? 0.8637 0.7134 0.6402 -0.0424 0.0388  -0.2139 55  LEU A N   
327  C  CA  . LEU A 55  ? 0.8664 0.7275 0.6428 -0.0484 0.0312  -0.2161 55  LEU A CA  
328  C  C   . LEU A 55  ? 0.9557 0.8143 0.7264 -0.0542 0.0289  -0.2307 55  LEU A C   
329  O  O   . LEU A 55  ? 0.9581 0.8184 0.7362 -0.0614 0.0246  -0.2355 55  LEU A O   
330  C  CB  . LEU A 55  ? 0.8577 0.7352 0.6268 -0.0448 0.0269  -0.2095 55  LEU A CB  
331  C  CG  . LEU A 55  ? 0.9114 0.8028 0.6802 -0.0492 0.0177  -0.2115 55  LEU A CG  
332  C  CD1 . LEU A 55  ? 0.8964 0.7885 0.6813 -0.0544 0.0152  -0.2082 55  LEU A CD1 
333  C  CD2 . LEU A 55  ? 0.9403 0.8442 0.6995 -0.0440 0.0144  -0.2038 55  LEU A CD2 
334  N  N   . LEU A 56  ? 0.9332 0.7875 0.6917 -0.0512 0.0323  -0.2381 56  LEU A N   
335  C  CA  . LEU A 56  ? 1.3965 1.2466 1.1479 -0.0560 0.0307  -0.2530 56  LEU A CA  
336  C  C   . LEU A 56  ? 1.8192 1.6507 1.5706 -0.0546 0.0389  -0.2592 56  LEU A C   
337  O  O   . LEU A 56  ? 1.3332 1.1601 1.0823 -0.0475 0.0453  -0.2545 56  LEU A O   
338  C  CB  . LEU A 56  ? 1.4091 1.2704 1.1425 -0.0537 0.0266  -0.2578 56  LEU A CB  
339  C  CG  . LEU A 56  ? 1.4618 1.3408 1.1933 -0.0545 0.0171  -0.2533 56  LEU A CG  
340  C  CD1 . LEU A 56  ? 1.4551 1.3413 1.1770 -0.0469 0.0187  -0.2418 56  LEU A CD1 
341  C  CD2 . LEU A 56  ? 1.5170 1.4029 1.2384 -0.0585 0.0087  -0.2662 56  LEU A CD2 
342  N  N   . GLN A 67  ? 1.1242 1.0126 0.8126 -0.0195 0.0503  -0.2087 67  GLN A N   
343  C  CA  . GLN A 67  ? 1.1052 1.0009 0.7977 -0.0171 0.0501  -0.1953 67  GLN A CA  
344  C  C   . GLN A 67  ? 1.1202 1.0135 0.8346 -0.0157 0.0550  -0.1881 67  GLN A C   
345  O  O   . GLN A 67  ? 1.1027 1.0013 0.8236 -0.0142 0.0546  -0.1774 67  GLN A O   
346  C  CB  . GLN A 67  ? 1.1158 1.0203 0.8078 -0.0197 0.0383  -0.1915 67  GLN A CB  
347  C  CG  . GLN A 67  ? 1.3536 1.2628 1.0218 -0.0184 0.0331  -0.1938 67  GLN A CG  
348  N  N   . ASN A 68  ? 1.0539 0.9384 0.7788 -0.0156 0.0595  -0.1944 68  ASN A N   
349  C  CA  . ASN A 68  ? 1.0196 0.8999 0.7640 -0.0133 0.0635  -0.1896 68  ASN A CA  
350  C  C   . ASN A 68  ? 1.0061 0.8892 0.7637 -0.0155 0.0564  -0.1813 68  ASN A C   
351  O  O   . ASN A 68  ? 0.9852 0.8710 0.7535 -0.0129 0.0579  -0.1724 68  ASN A O   
352  C  CB  . ASN A 68  ? 1.0237 0.9068 0.7705 -0.0082 0.0728  -0.1847 68  ASN A CB  
353  C  CG  . ASN A 68  ? 1.3348 1.2136 1.0720 -0.0056 0.0819  -0.1935 68  ASN A CG  
354  O  OD1 . ASN A 68  ? 1.2655 1.1379 0.9945 -0.0072 0.0813  -0.2039 68  ASN A OD1 
355  N  ND2 . ASN A 68  ? 1.2472 1.1295 0.9865 -0.0019 0.0910  -0.1901 68  ASN A ND2 
356  N  N   . LEU A 69  ? 0.9279 0.8103 0.6848 -0.0205 0.0489  -0.1851 69  LEU A N   
357  C  CA  . LEU A 69  ? 0.8896 0.7736 0.6582 -0.0236 0.0428  -0.1793 69  LEU A CA  
358  C  C   . LEU A 69  ? 0.9019 0.7735 0.6801 -0.0260 0.0434  -0.1844 69  LEU A C   
359  O  O   . LEU A 69  ? 0.9128 0.7782 0.6860 -0.0291 0.0435  -0.1946 69  LEU A O   
360  C  CB  . LEU A 69  ? 0.8885 0.7820 0.6507 -0.0276 0.0345  -0.1799 69  LEU A CB  
361  C  CG  . LEU A 69  ? 0.9405 0.8449 0.6953 -0.0248 0.0323  -0.1715 69  LEU A CG  
362  C  CD1 . LEU A 69  ? 0.9540 0.8663 0.6960 -0.0268 0.0248  -0.1762 69  LEU A CD1 
363  C  CD2 . LEU A 69  ? 0.9434 0.8515 0.7109 -0.0243 0.0301  -0.1608 69  LEU A CD2 
364  N  N   . TYR A 70  ? 0.8155 0.6820 0.6060 -0.0245 0.0440  -0.1775 70  TYR A N   
365  C  CA  . TYR A 70  ? 0.8050 0.6569 0.6028 -0.0258 0.0453  -0.1808 70  TYR A CA  
366  C  C   . TYR A 70  ? 0.8049 0.6547 0.6109 -0.0293 0.0413  -0.1747 70  TYR A C   
367  O  O   . TYR A 70  ? 0.7834 0.6408 0.5935 -0.0276 0.0391  -0.1657 70  TYR A O   
368  C  CB  . TYR A 70  ? 0.8241 0.6678 0.6273 -0.0189 0.0509  -0.1796 70  TYR A CB  
369  C  CG  . TYR A 70  ? 0.8606 0.7048 0.6567 -0.0157 0.0564  -0.1870 70  TYR A CG  
370  C  CD1 . TYR A 70  ? 0.9038 0.7365 0.6961 -0.0166 0.0592  -0.1975 70  TYR A CD1 
371  C  CD2 . TYR A 70  ? 0.8677 0.7230 0.6604 -0.0121 0.0597  -0.1838 70  TYR A CD2 
372  C  CE1 . TYR A 70  ? 0.9330 0.7659 0.7179 -0.0136 0.0649  -0.2049 70  TYR A CE1 
373  C  CE2 . TYR A 70  ? 0.8955 0.7508 0.6805 -0.0095 0.0660  -0.1907 70  TYR A CE2 
374  C  CZ  . TYR A 70  ? 1.0171 0.8616 0.7983 -0.0100 0.0685  -0.2015 70  TYR A CZ  
375  O  OH  . TYR A 70  ? 1.0519 0.8960 0.8250 -0.0072 0.0754  -0.2089 70  TYR A OH  
376  N  N   . LEU A 71  ? 0.7443 0.5829 0.5522 -0.0344 0.0410  -0.1801 71  LEU A N   
377  C  CA  . LEU A 71  ? 0.7267 0.5609 0.5413 -0.0389 0.0389  -0.1759 71  LEU A CA  
378  C  C   . LEU A 71  ? 0.7558 0.5722 0.5744 -0.0357 0.0422  -0.1720 71  LEU A C   
379  O  O   . LEU A 71  ? 0.7632 0.5664 0.5799 -0.0333 0.0457  -0.1772 71  LEU A O   
380  C  CB  . LEU A 71  ? 0.7375 0.5708 0.5519 -0.0477 0.0372  -0.1848 71  LEU A CB  
381  C  CG  . LEU A 71  ? 0.8008 0.6502 0.6098 -0.0506 0.0326  -0.1912 71  LEU A CG  
382  C  CD1 . LEU A 71  ? 0.8140 0.6584 0.6223 -0.0580 0.0321  -0.2036 71  LEU A CD1 
383  C  CD2 . LEU A 71  ? 0.8237 0.6893 0.6361 -0.0517 0.0271  -0.1847 71  LEU A CD2 
384  N  N   . VAL A 72  ? 0.6847 0.5003 0.5081 -0.0349 0.0406  -0.1628 72  VAL A N   
385  C  CA  . VAL A 72  ? 0.6776 0.4764 0.5028 -0.0310 0.0424  -0.1577 72  VAL A CA  
386  C  C   . VAL A 72  ? 0.7389 0.5294 0.5652 -0.0372 0.0425  -0.1548 72  VAL A C   
387  O  O   . VAL A 72  ? 0.7265 0.5290 0.5557 -0.0411 0.0400  -0.1516 72  VAL A O   
388  C  CB  . VAL A 72  ? 0.7071 0.5110 0.5357 -0.0227 0.0409  -0.1493 72  VAL A CB  
389  C  CG1 . VAL A 72  ? 0.7092 0.4951 0.5384 -0.0175 0.0414  -0.1449 72  VAL A CG1 
390  C  CG2 . VAL A 72  ? 0.7033 0.5165 0.5321 -0.0176 0.0424  -0.1525 72  VAL A CG2 
391  N  N   . GLY A 73  ? 0.7194 0.4887 0.5430 -0.0379 0.0459  -0.1562 73  GLY A N   
392  C  CA  . GLY A 73  ? 0.7302 0.4863 0.5530 -0.0435 0.0482  -0.1535 73  GLY A CA  
393  C  C   . GLY A 73  ? 0.8166 0.5484 0.6337 -0.0380 0.0506  -0.1493 73  GLY A C   
394  O  O   . GLY A 73  ? 0.8122 0.5408 0.6284 -0.0290 0.0491  -0.1479 73  GLY A O   
395  N  N   . ALA A 74  ? 0.8059 0.5200 0.6190 -0.0428 0.0543  -0.1472 74  ALA A N   
396  C  CA  . ALA A 74  ? 0.8319 0.5193 0.6364 -0.0376 0.0566  -0.1425 74  ALA A CA  
397  C  C   . ALA A 74  ? 0.9328 0.5995 0.7322 -0.0463 0.0633  -0.1439 74  ALA A C   
398  O  O   . ALA A 74  ? 0.9370 0.6128 0.7418 -0.0565 0.0658  -0.1478 74  ALA A O   
399  C  CB  . ALA A 74  ? 0.8310 0.5188 0.6330 -0.0301 0.0527  -0.1321 74  ALA A CB  
400  N  N   . SER A 75  ? 0.9154 0.5537 0.7043 -0.0420 0.0663  -0.1408 75  SER A N   
401  C  CA  . SER A 75  ? 0.9355 0.5490 0.7169 -0.0495 0.0740  -0.1408 75  SER A CA  
402  C  C   . SER A 75  ? 0.9867 0.5989 0.7644 -0.0525 0.0758  -0.1323 75  SER A C   
403  O  O   . SER A 75  ? 0.9659 0.5890 0.7434 -0.0456 0.0702  -0.1253 75  SER A O   
404  C  CB  . SER A 75  ? 1.0045 0.5867 0.7737 -0.0420 0.0761  -0.1390 75  SER A CB  
405  O  OG  . SER A 75  ? 1.1112 0.6962 0.8840 -0.0359 0.0734  -0.1455 75  SER A OG  
406  N  N   . LYS A 76  ? 0.9610 0.5597 0.7363 -0.0631 0.0841  -0.1334 76  LYS A N   
407  C  CA  . LYS A 76  ? 0.9581 0.5529 0.7291 -0.0669 0.0879  -0.1261 76  LYS A CA  
408  C  C   . LYS A 76  ? 1.0090 0.5817 0.7628 -0.0560 0.0861  -0.1153 76  LYS A C   
409  O  O   . LYS A 76  ? 0.9923 0.5727 0.7438 -0.0526 0.0830  -0.1083 76  LYS A O   
410  C  CB  . LYS A 76  ? 1.0112 0.5925 0.7830 -0.0805 0.0989  -0.1302 76  LYS A CB  
411  C  CG  . LYS A 76  ? 1.1793 0.7643 0.9517 -0.0868 0.1039  -0.1251 76  LYS A CG  
412  C  CD  . LYS A 76  ? 1.3199 0.8878 1.0925 -0.1001 0.1165  -0.1289 76  LYS A CD  
413  N  N   . ILE A 77  ? 0.9816 0.5270 0.7233 -0.0499 0.0872  -0.1146 77  ILE A N   
414  C  CA  . ILE A 77  ? 0.9929 0.5145 0.7170 -0.0381 0.0842  -0.1052 77  ILE A CA  
415  C  C   . ILE A 77  ? 1.0158 0.5570 0.7452 -0.0258 0.0725  -0.1025 77  ILE A C   
416  O  O   . ILE A 77  ? 1.0183 0.5556 0.7390 -0.0187 0.0682  -0.0944 77  ILE A O   
417  C  CB  . ILE A 77  ? 1.0640 0.5516 0.7752 -0.0345 0.0881  -0.1062 77  ILE A CB  
418  C  CG1 . ILE A 77  ? 1.0888 0.5591 0.7987 -0.0486 0.1006  -0.1114 77  ILE A CG1 
419  C  CG2 . ILE A 77  ? 1.0936 0.5533 0.7838 -0.0221 0.0850  -0.0960 77  ILE A CG2 
420  C  CD1 . ILE A 77  ? 1.1790 0.6372 0.8815 -0.0598 0.1112  -0.1069 77  ILE A CD1 
421  N  N   . ARG A 78  ? 0.9409 0.5035 0.6847 -0.0238 0.0680  -0.1097 78  ARG A N   
422  C  CA  . ARG A 78  ? 0.9112 0.4947 0.6631 -0.0137 0.0584  -0.1085 78  ARG A CA  
423  C  C   . ARG A 78  ? 0.9366 0.5427 0.6943 -0.0157 0.0551  -0.1040 78  ARG A C   
424  O  O   . ARG A 78  ? 0.9203 0.5312 0.6768 -0.0068 0.0483  -0.0984 78  ARG A O   
425  C  CB  . ARG A 78  ? 0.8835 0.4848 0.6488 -0.0136 0.0569  -0.1177 78  ARG A CB  
426  C  CG  . ARG A 78  ? 0.9366 0.5631 0.7129 -0.0056 0.0491  -0.1176 78  ARG A CG  
427  C  CD  . ARG A 78  ? 1.0305 0.6468 0.8023 0.0080  0.0428  -0.1123 78  ARG A CD  
428  N  NE  . ARG A 78  ? 1.0532 0.6936 0.8381 0.0147  0.0367  -0.1137 78  ARG A NE  
429  C  CZ  . ARG A 78  ? 1.1161 0.7699 0.9049 0.0190  0.0309  -0.1083 78  ARG A CZ  
430  N  NH1 . ARG A 78  ? 0.8789 0.5252 0.6587 0.0177  0.0299  -0.1011 78  ARG A NH1 
431  N  NH2 . ARG A 78  ? 0.9444 0.6187 0.7460 0.0244  0.0267  -0.1103 78  ARG A NH2 
432  N  N   . MET A 79  ? 0.8871 0.5069 0.6518 -0.0273 0.0598  -0.1068 79  MET A N   
433  C  CA  . MET A 79  ? 0.8650 0.5057 0.6359 -0.0300 0.0576  -0.1032 79  MET A CA  
434  C  C   . MET A 79  ? 0.9230 0.5481 0.6806 -0.0270 0.0581  -0.0942 79  MET A C   
435  O  O   . MET A 79  ? 0.9037 0.5416 0.6632 -0.0223 0.0525  -0.0895 79  MET A O   
436  C  CB  . MET A 79  ? 0.8862 0.5420 0.6673 -0.0427 0.0627  -0.1088 79  MET A CB  
437  C  CG  . MET A 79  ? 0.9170 0.5978 0.7118 -0.0447 0.0593  -0.1167 79  MET A CG  
438  S  SD  . MET A 79  ? 0.9449 0.6509 0.7475 -0.0353 0.0501  -0.1145 79  MET A SD  
439  C  CE  . MET A 79  ? 0.8923 0.6045 0.6937 -0.0342 0.0481  -0.1058 79  MET A CE  
440  N  N   . LEU A 80  ? 0.8987 0.4950 0.6419 -0.0297 0.0650  -0.0918 80  LEU A N   
441  C  CA  . LEU A 80  ? 0.9108 0.4874 0.6371 -0.0269 0.0667  -0.0832 80  LEU A CA  
442  C  C   . LEU A 80  ? 0.9717 0.5393 0.6883 -0.0125 0.0573  -0.0776 80  LEU A C   
443  O  O   . LEU A 80  ? 0.9676 0.5352 0.6771 -0.0080 0.0535  -0.0714 80  LEU A O   
444  C  CB  . LEU A 80  ? 0.9401 0.4858 0.6520 -0.0335 0.0775  -0.0822 80  LEU A CB  
445  C  CG  . LEU A 80  ? 0.9949 0.5479 0.7166 -0.0486 0.0877  -0.0875 80  LEU A CG  
446  C  CD1 . LEU A 80  ? 1.0296 0.5511 0.7392 -0.0549 0.0986  -0.0882 80  LEU A CD1 
447  C  CD2 . LEU A 80  ? 1.0150 0.5808 0.7393 -0.0534 0.0902  -0.0840 80  LEU A CD2 
448  N  N   . LEU A 81  ? 0.9321 0.4937 0.6501 -0.0051 0.0532  -0.0807 81  LEU A N   
449  C  CA  . LEU A 81  ? 0.9344 0.4902 0.6472 0.0092  0.0434  -0.0771 81  LEU A CA  
450  C  C   . LEU A 81  ? 0.9703 0.5571 0.6988 0.0132  0.0350  -0.0777 81  LEU A C   
451  O  O   . LEU A 81  ? 0.9631 0.5492 0.6876 0.0228  0.0270  -0.0733 81  LEU A O   
452  C  CB  . LEU A 81  ? 0.9450 0.4876 0.6577 0.0155  0.0422  -0.0813 81  LEU A CB  
453  C  CG  . LEU A 81  ? 1.0311 0.5367 0.7247 0.0152  0.0488  -0.0792 81  LEU A CG  
454  C  CD1 . LEU A 81  ? 1.0428 0.5412 0.7414 0.0179  0.0498  -0.0859 81  LEU A CD1 
455  C  CD2 . LEU A 81  ? 1.0798 0.5599 0.7520 0.0261  0.0439  -0.0703 81  LEU A CD2 
456  N  N   . GLY A 82  ? 0.9171 0.5299 0.6626 0.0058  0.0370  -0.0833 82  GLY A N   
457  C  CA  . GLY A 82  ? 0.8937 0.5359 0.6542 0.0076  0.0311  -0.0839 82  GLY A CA  
458  C  C   . GLY A 82  ? 0.9456 0.5948 0.7035 0.0047  0.0305  -0.0785 82  GLY A C   
459  O  O   . GLY A 82  ? 0.9365 0.6006 0.7006 0.0097  0.0239  -0.0764 82  GLY A O   
460  N  N   . ALA A 83  ? 0.9027 0.5411 0.6520 -0.0037 0.0381  -0.0767 83  ALA A N   
461  C  CA  . ALA A 83  ? 0.8910 0.5332 0.6365 -0.0072 0.0395  -0.0719 83  ALA A CA  
462  C  C   . ALA A 83  ? 0.9356 0.5599 0.6647 0.0018  0.0345  -0.0650 83  ALA A C   
463  O  O   . ALA A 83  ? 0.9107 0.5438 0.6396 0.0032  0.0312  -0.0616 83  ALA A O   
464  C  CB  . ALA A 83  ? 0.9116 0.5453 0.6532 -0.0185 0.0500  -0.0729 83  ALA A CB  
465  N  N   . GLU A 84  ? 0.9152 0.5136 0.6299 0.0084  0.0335  -0.0632 84  GLU A N   
466  C  CA  . GLU A 84  ? 0.9279 0.5062 0.6246 0.0187  0.0274  -0.0572 84  GLU A CA  
467  C  C   . GLU A 84  ? 0.9780 0.5739 0.6862 0.0288  0.0153  -0.0581 84  GLU A C   
468  O  O   . GLU A 84  ? 0.9720 0.5671 0.6736 0.0346  0.0087  -0.0541 84  GLU A O   
469  C  CB  . GLU A 84  ? 0.9720 0.5179 0.6514 0.0230  0.0298  -0.0557 84  GLU A CB  
470  C  CG  . GLU A 84  ? 1.0760 0.5973 0.7333 0.0348  0.0229  -0.0491 84  GLU A CG  
471  C  CD  . GLU A 84  ? 1.2839 0.7710 0.9221 0.0404  0.0246  -0.0468 84  GLU A CD  
472  O  OE1 . GLU A 84  ? 1.1317 0.6051 0.7662 0.0320  0.0355  -0.0483 84  GLU A OE1 
473  O  OE2 . GLU A 84  ? 1.2208 0.6935 0.8469 0.0534  0.0150  -0.0435 84  GLU A OE2 
474  N  N   . ALA A 85  ? 0.9311 0.5431 0.6569 0.0304  0.0129  -0.0639 85  ALA A N   
475  C  CA  . ALA A 85  ? 0.9162 0.5470 0.6572 0.0387  0.0034  -0.0664 85  ALA A CA  
476  C  C   . ALA A 85  ? 0.9509 0.6058 0.7030 0.0362  0.0003  -0.0655 85  ALA A C   
477  O  O   . ALA A 85  ? 0.9432 0.6032 0.6979 0.0439  -0.0083 -0.0643 85  ALA A O   
478  C  CB  . ALA A 85  ? 0.9158 0.5589 0.6725 0.0379  0.0052  -0.0732 85  ALA A CB  
479  N  N   . VAL A 86  ? 0.8957 0.5649 0.6545 0.0257  0.0071  -0.0665 86  VAL A N   
480  C  CA  . VAL A 86  ? 0.8716 0.5625 0.6404 0.0226  0.0054  -0.0655 86  VAL A CA  
481  C  C   . VAL A 86  ? 0.9498 0.6290 0.7038 0.0227  0.0049  -0.0599 86  VAL A C   
482  O  O   . VAL A 86  ? 0.9316 0.6239 0.6910 0.0234  0.0012  -0.0584 86  VAL A O   
483  C  CB  . VAL A 86  ? 0.8952 0.6058 0.6765 0.0127  0.0116  -0.0688 86  VAL A CB  
484  C  CG1 . VAL A 86  ? 0.8820 0.6064 0.6771 0.0136  0.0111  -0.0743 86  VAL A CG1 
485  C  CG2 . VAL A 86  ? 0.9023 0.6018 0.6755 0.0039  0.0205  -0.0690 86  VAL A CG2 
486  N  N   . GLY A 87  ? 0.9413 0.5950 0.6763 0.0220  0.0094  -0.0569 87  GLY A N   
487  C  CA  . GLY A 87  ? 0.9571 0.5951 0.6741 0.0222  0.0106  -0.0515 87  GLY A CA  
488  C  C   . GLY A 87  ? 1.0031 0.6503 0.7228 0.0120  0.0188  -0.0510 87  GLY A C   
489  O  O   . GLY A 87  ? 0.9858 0.6392 0.7042 0.0125  0.0167  -0.0487 87  GLY A O   
490  N  N   . LEU A 88  ? 0.9701 0.6184 0.6945 0.0029  0.0280  -0.0538 88  LEU A N   
491  C  CA  . LEU A 88  ? 0.9606 0.6187 0.6903 -0.0070 0.0361  -0.0544 88  LEU A CA  
492  C  C   . LEU A 88  ? 1.0319 0.6673 0.7415 -0.0090 0.0428  -0.0498 88  LEU A C   
493  O  O   . LEU A 88  ? 1.0482 0.6581 0.7416 -0.0086 0.0472  -0.0479 88  LEU A O   
494  C  CB  . LEU A 88  ? 0.9542 0.6213 0.6963 -0.0160 0.0429  -0.0599 88  LEU A CB  
495  C  CG  . LEU A 88  ? 0.9918 0.6832 0.7532 -0.0159 0.0381  -0.0649 88  LEU A CG  
496  C  CD1 . LEU A 88  ? 0.9946 0.6891 0.7636 -0.0239 0.0443  -0.0708 88  LEU A CD1 
497  C  CD2 . LEU A 88  ? 1.0046 0.7211 0.7791 -0.0166 0.0347  -0.0648 88  LEU A CD2 
498  N  N   . VAL A 89  ? 0.9822 0.6254 0.6918 -0.0107 0.0439  -0.0478 89  VAL A N   
499  C  CA  . VAL A 89  ? 0.9966 0.6200 0.6870 -0.0126 0.0510  -0.0436 89  VAL A CA  
500  C  C   . VAL A 89  ? 1.0516 0.6797 0.7497 -0.0245 0.0637  -0.0463 89  VAL A C   
501  O  O   . VAL A 89  ? 1.0208 0.6739 0.7384 -0.0294 0.0644  -0.0497 89  VAL A O   
502  C  CB  . VAL A 89  ? 1.0351 0.6630 0.7204 -0.0071 0.0449  -0.0406 89  VAL A CB  
503  C  CG1 . VAL A 89  ? 1.0535 0.6635 0.7199 -0.0100 0.0538  -0.0370 89  VAL A CG1 
504  C  CG2 . VAL A 89  ? 1.0363 0.6573 0.7134 0.0046  0.0323  -0.0387 89  VAL A CG2 
505  N  N   . LYS A 90  ? 1.0457 0.6493 0.7289 -0.0290 0.0737  -0.0449 90  LYS A N   
506  C  CA  . LYS A 90  ? 1.0547 0.6589 0.7443 -0.0410 0.0872  -0.0479 90  LYS A CA  
507  C  C   . LYS A 90  ? 1.1484 0.7277 0.8156 -0.0431 0.0977  -0.0431 90  LYS A C   
508  O  O   . LYS A 90  ? 1.1632 0.7178 0.8055 -0.0354 0.0948  -0.0373 90  LYS A O   
509  C  CB  . LYS A 90  ? 1.0943 0.6921 0.7893 -0.0466 0.0919  -0.0521 90  LYS A CB  
510  C  CG  . LYS A 90  ? 1.2503 0.8713 0.9659 -0.0453 0.0832  -0.0575 90  LYS A CG  
511  C  CD  . LYS A 90  ? 1.3599 1.0103 1.1006 -0.0539 0.0856  -0.0641 90  LYS A CD  
512  C  CE  . LYS A 90  ? 1.4930 1.1643 1.2505 -0.0522 0.0773  -0.0691 90  LYS A CE  
513  N  NZ  . LYS A 90  ? 1.5955 1.2800 1.3553 -0.0426 0.0659  -0.0664 90  LYS A NZ  
514  N  N   . GLU A 91  ? 1.1202 0.7057 0.7959 -0.0534 0.1098  -0.0457 91  GLU A N   
515  C  CA  . GLU A 91  ? 1.1509 0.7140 0.8069 -0.0570 0.1223  -0.0418 91  GLU A CA  
516  C  C   . GLU A 91  ? 1.2473 0.7779 0.8846 -0.0608 0.1324  -0.0396 91  GLU A C   
517  O  O   . GLU A 91  ? 1.2350 0.7686 0.8854 -0.0678 0.1365  -0.0444 91  GLU A O   
518  C  CB  . GLU A 91  ? 1.1568 0.7394 0.8314 -0.0668 0.1326  -0.0462 91  GLU A CB  
519  C  CG  . GLU A 91  ? 1.3116 0.8763 0.9669 -0.0683 0.1437  -0.0422 91  GLU A CG  
520  C  CD  . GLU A 91  ? 1.5780 1.1526 1.2490 -0.0805 0.1592  -0.0470 91  GLU A CD  
521  O  OE1 . GLU A 91  ? 1.3786 0.9833 1.0741 -0.0825 0.1570  -0.0517 91  GLU A OE1 
522  O  OE2 . GLU A 91  ? 1.5963 1.1477 1.2549 -0.0878 0.1740  -0.0460 91  GLU A OE2 
523  N  N   . CYS A 92  ? 1.2568 0.7555 0.8623 -0.0561 0.1362  -0.0325 92  CYS A N   
524  C  CA  . CYS A 92  ? 1.3006 0.7627 0.8824 -0.0587 0.1466  -0.0288 92  CYS A CA  
525  C  C   . CYS A 92  ? 1.3811 0.8339 0.9607 -0.0712 0.1666  -0.0295 92  CYS A C   
526  O  O   . CYS A 92  ? 1.3627 0.8380 0.9589 -0.0764 0.1710  -0.0330 92  CYS A O   
527  C  CB  . CYS A 92  ? 1.3339 0.7650 0.8804 -0.0459 0.1395  -0.0204 92  CYS A CB  
528  S  SG  . CYS A 92  ? 1.3662 0.8082 0.9173 -0.0310 0.1166  -0.0202 92  CYS A SG  
529  N  N   . ASN A 93  ? 1.3778 0.7968 0.9370 -0.0759 0.1792  -0.0264 93  ASN A N   
530  C  CA  . ASN A 93  ? 1.3986 0.8044 0.9540 -0.0885 0.2002  -0.0270 93  ASN A CA  
531  C  C   . ASN A 93  ? 1.4679 0.8596 0.9988 -0.0854 0.2065  -0.0211 93  ASN A C   
532  O  O   . ASN A 93  ? 1.4684 0.8615 1.0043 -0.0957 0.2228  -0.0232 93  ASN A O   
533  C  CB  . ASN A 93  ? 1.4398 0.8105 0.9782 -0.0938 0.2118  -0.0247 93  ASN A CB  
534  C  CG  . ASN A 93  ? 1.6785 1.0634 1.2434 -0.1002 0.2098  -0.0323 93  ASN A CG  
535  O  OD1 . ASN A 93  ? 1.5570 0.9718 1.1549 -0.1106 0.2137  -0.0412 93  ASN A OD1 
536  N  ND2 . ASN A 93  ? 1.5986 0.9617 1.1490 -0.0937 0.2035  -0.0293 93  ASN A ND2 
537  N  N   . ASP A 94  ? 1.4340 0.8137 0.9401 -0.0712 0.1933  -0.0145 94  ASP A N   
538  C  CA  . ASP A 94  ? 1.4508 0.8167 0.9312 -0.0666 0.1965  -0.0093 94  ASP A CA  
539  C  C   . ASP A 94  ? 1.4680 0.8707 0.9709 -0.0637 0.1870  -0.0136 94  ASP A C   
540  O  O   . ASP A 94  ? 1.4722 0.8684 0.9561 -0.0567 0.1837  -0.0100 94  ASP A O   
541  C  CB  . ASP A 94  ? 1.5076 0.8378 0.9466 -0.0527 0.1874  -0.0003 94  ASP A CB  
542  C  CG  . ASP A 94  ? 1.6204 0.9641 1.0638 -0.0389 0.1637  -0.0001 94  ASP A CG  
543  O  OD1 . ASP A 94  ? 1.6124 0.9792 1.0840 -0.0399 0.1556  -0.0052 94  ASP A OD1 
544  O  OD2 . ASP A 94  ? 1.6924 1.0221 1.1101 -0.0272 0.1537  0.0049  94  ASP A OD2 
545  N  N   . ASN A 95  ? 1.3901 0.8304 0.9327 -0.0692 0.1828  -0.0214 95  ASN A N   
546  C  CA  . ASN A 95  ? 1.3511 0.8291 0.9208 -0.0680 0.1746  -0.0263 95  ASN A CA  
547  C  C   . ASN A 95  ? 1.3770 0.8624 0.9407 -0.0541 0.1544  -0.0237 95  ASN A C   
548  O  O   . ASN A 95  ? 1.3457 0.8573 0.9265 -0.0521 0.1477  -0.0265 95  ASN A O   
549  C  CB  . ASN A 95  ? 1.3764 0.8589 0.9476 -0.0743 0.1885  -0.0277 95  ASN A CB  
550  C  CG  . ASN A 95  ? 1.7357 1.2149 1.3176 -0.0887 0.2087  -0.0316 95  ASN A CG  
551  O  OD1 . ASN A 95  ? 1.6228 1.1258 1.2366 -0.0968 0.2103  -0.0386 95  ASN A OD1 
552  N  ND2 . ASN A 95  ? 1.7083 1.1573 1.2633 -0.0923 0.2249  -0.0273 95  ASN A ND2 
553  N  N   . THR A 96  ? 1.3378 0.8012 0.8797 -0.0448 0.1446  -0.0188 96  THR A N   
554  C  CA  . THR A 96  ? 1.3147 0.7848 0.8527 -0.0319 0.1254  -0.0171 96  THR A CA  
555  C  C   . THR A 96  ? 1.3155 0.8107 0.8816 -0.0307 0.1140  -0.0216 96  THR A C   
556  O  O   . THR A 96  ? 1.3149 0.8069 0.8887 -0.0359 0.1184  -0.0235 96  THR A O   
557  C  CB  . THR A 96  ? 1.4375 0.8715 0.9372 -0.0213 0.1198  -0.0099 96  THR A CB  
558  O  OG1 . THR A 96  ? 1.4456 0.8581 0.9362 -0.0223 0.1234  -0.0079 96  THR A OG1 
559  C  CG2 . THR A 96  ? 1.4522 0.8613 0.9204 -0.0207 0.1293  -0.0052 96  THR A CG2 
560  N  N   . MET A 97  ? 1.2265 0.7456 0.8071 -0.0242 0.0999  -0.0235 97  MET A N   
561  C  CA  . MET A 97  ? 1.1820 0.7257 0.7882 -0.0224 0.0890  -0.0276 97  MET A CA  
562  C  C   . MET A 97  ? 1.2149 0.7448 0.8077 -0.0110 0.0758  -0.0248 97  MET A C   
563  O  O   . MET A 97  ? 1.2165 0.7422 0.7971 -0.0018 0.0658  -0.0223 97  MET A O   
564  C  CB  . MET A 97  ? 1.1756 0.7524 0.8056 -0.0221 0.0823  -0.0312 97  MET A CB  
565  C  CG  . MET A 97  ? 1.2077 0.8001 0.8530 -0.0318 0.0937  -0.0344 97  MET A CG  
566  S  SD  . MET A 97  ? 1.2373 0.8521 0.9129 -0.0421 0.0989  -0.0410 97  MET A SD  
567  C  CE  . MET A 97  ? 1.1877 0.8179 0.8775 -0.0512 0.1113  -0.0443 97  MET A CE  
568  N  N   . ARG A 98  ? 1.1557 0.6779 0.7506 -0.0114 0.0759  -0.0257 98  ARG A N   
569  C  CA  . ARG A 98  ? 1.1579 0.6668 0.7420 -0.0004 0.0641  -0.0236 98  ARG A CA  
570  C  C   . ARG A 98  ? 1.1581 0.6874 0.7674 -0.0007 0.0582  -0.0287 98  ARG A C   
571  O  O   . ARG A 98  ? 1.1360 0.6797 0.7639 -0.0103 0.0657  -0.0331 98  ARG A O   
572  C  CB  . ARG A 98  ? 1.2166 0.6859 0.7698 0.0017  0.0704  -0.0182 98  ARG A CB  
573  C  CG  . ARG A 98  ? 1.4038 0.8477 0.9264 0.0027  0.0770  -0.0125 98  ARG A CG  
574  C  CD  . ARG A 98  ? 1.5485 0.9754 1.0466 0.0170  0.0635  -0.0079 98  ARG A CD  
575  N  NE  . ARG A 98  ? 1.6593 1.0583 1.1241 0.0179  0.0707  -0.0023 98  ARG A NE  
576  C  CZ  . ARG A 98  ? 1.8609 1.2220 1.2937 0.0197  0.0778  0.0036  98  ARG A CZ  
577  N  NH1 . ARG A 98  ? 1.7088 1.0547 1.1390 0.0211  0.0782  0.0047  98  ARG A NH1 
578  N  NH2 . ARG A 98  ? 1.7069 1.0435 1.1087 0.0203  0.0850  0.0086  98  ARG A NH2 
579  N  N   . ALA A 99  ? 1.0945 0.6250 0.7043 0.0101  0.0447  -0.0287 99  ALA A N   
580  C  CA  . ALA A 99  ? 1.0664 0.6141 0.6976 0.0114  0.0390  -0.0335 99  ALA A CA  
581  C  C   . ALA A 99  ? 1.1205 0.6485 0.7453 0.0082  0.0463  -0.0340 99  ALA A C   
582  O  O   . ALA A 99  ? 1.1496 0.6460 0.7492 0.0121  0.0488  -0.0293 99  ALA A O   
583  C  CB  . ALA A 99  ? 1.0719 0.6240 0.7045 0.0239  0.0237  -0.0334 99  ALA A CB  
584  N  N   . PHE A 100 ? 1.0466 0.5919 0.6929 0.0008  0.0502  -0.0397 100 PHE A N   
585  C  CA  . PHE A 100 ? 1.0558 0.5857 0.6999 -0.0040 0.0579  -0.0418 100 PHE A CA  
586  C  C   . PHE A 100 ? 1.1242 0.6365 0.7591 0.0068  0.0503  -0.0409 100 PHE A C   
587  O  O   . PHE A 100 ? 1.1107 0.6367 0.7549 0.0157  0.0386  -0.0423 100 PHE A O   
588  C  CB  . PHE A 100 ? 1.0509 0.6066 0.7212 -0.0139 0.0621  -0.0493 100 PHE A CB  
589  C  CG  . PHE A 100 ? 1.0830 0.6241 0.7527 -0.0206 0.0709  -0.0527 100 PHE A CG  
590  C  CD1 . PHE A 100 ? 1.1409 0.6617 0.7991 -0.0295 0.0840  -0.0513 100 PHE A CD1 
591  C  CD2 . PHE A 100 ? 1.1052 0.6522 0.7859 -0.0183 0.0667  -0.0578 100 PHE A CD2 
592  C  CE1 . PHE A 100 ? 1.1693 0.6755 0.8275 -0.0363 0.0924  -0.0550 100 PHE A CE1 
593  C  CE2 . PHE A 100 ? 1.1586 0.6911 0.8385 -0.0246 0.0747  -0.0616 100 PHE A CE2 
594  C  CZ  . PHE A 100 ? 1.1561 0.6681 0.8251 -0.0338 0.0873  -0.0602 100 PHE A CZ  
595  N  N   . THR A 101 ? 1.1084 0.5895 0.7251 0.0057  0.0577  -0.0385 101 THR A N   
596  C  CA  . THR A 101 ? 1.1284 0.5863 0.7333 0.0151  0.0530  -0.0373 101 THR A CA  
597  C  C   . THR A 101 ? 1.2043 0.6457 0.8078 0.0057  0.0655  -0.0400 101 THR A C   
598  O  O   . THR A 101 ? 1.2169 0.6464 0.8121 -0.0045 0.0780  -0.0384 101 THR A O   
599  C  CB  . THR A 101 ? 1.2342 0.6629 0.8091 0.0264  0.0476  -0.0292 101 THR A CB  
600  O  OG1 . THR A 101 ? 1.2136 0.6613 0.7939 0.0345  0.0352  -0.0286 101 THR A OG1 
601  C  CG2 . THR A 101 ? 1.2372 0.6380 0.7970 0.0370  0.0430  -0.0272 101 THR A CG2 
602  N  N   . TYR A 102 ? 1.1609 0.6020 0.7736 0.0087  0.0626  -0.0447 102 TYR A N   
603  C  CA  . TYR A 102 ? 1.1729 0.5984 0.7857 0.0001  0.0736  -0.0484 102 TYR A CA  
604  C  C   . TYR A 102 ? 1.2486 0.6303 0.8309 0.0010  0.0819  -0.0414 102 TYR A C   
605  O  O   . TYR A 102 ? 1.2547 0.6224 0.8345 -0.0106 0.0953  -0.0430 102 TYR A O   
606  C  CB  . TYR A 102 ? 1.1852 0.6181 0.8123 0.0050  0.0679  -0.0549 102 TYR A CB  
607  C  CG  . TYR A 102 ? 1.2243 0.6465 0.8557 -0.0053 0.0788  -0.0608 102 TYR A CG  
608  C  CD1 . TYR A 102 ? 1.2288 0.6755 0.8812 -0.0187 0.0850  -0.0684 102 TYR A CD1 
609  C  CD2 . TYR A 102 ? 1.2705 0.6574 0.8847 -0.0015 0.0826  -0.0589 102 TYR A CD2 
610  C  CE1 . TYR A 102 ? 1.2552 0.6924 0.9121 -0.0287 0.0946  -0.0747 102 TYR A CE1 
611  C  CE2 . TYR A 102 ? 1.2960 0.6718 0.9142 -0.0116 0.0931  -0.0648 102 TYR A CE2 
612  C  CZ  . TYR A 102 ? 1.3818 0.7835 1.0220 -0.0255 0.0990  -0.0731 102 TYR A CZ  
613  O  OH  . TYR A 102 ? 1.4262 0.8180 1.0716 -0.0359 0.1086  -0.0800 102 TYR A OH  
614  N  N   . ARG A 103 ? 1.2174 0.5773 0.7766 0.0144  0.0740  -0.0338 103 ARG A N   
615  C  CA  . ARG A 103 ? 1.2588 0.5745 0.7846 0.0171  0.0807  -0.0259 103 ARG A CA  
616  C  C   . ARG A 103 ? 1.3143 0.6211 0.8266 0.0067  0.0932  -0.0214 103 ARG A C   
617  O  O   . ARG A 103 ? 1.3437 0.6173 0.8350 0.0013  0.1060  -0.0173 103 ARG A O   
618  C  CB  . ARG A 103 ? 1.2836 0.5813 0.7885 0.0356  0.0667  -0.0194 103 ARG A CB  
619  C  CG  . ARG A 103 ? 1.4358 0.7282 0.9462 0.0468  0.0576  -0.0224 103 ARG A CG  
620  N  N   . THR A 104 ? 1.2372 0.5727 0.7615 0.0040  0.0902  -0.0223 104 THR A N   
621  C  CA  . THR A 104 ? 1.2372 0.5692 0.7517 -0.0049 0.1011  -0.0188 104 THR A CA  
622  C  C   . THR A 104 ? 1.2495 0.6126 0.7934 -0.0208 0.1104  -0.0265 104 THR A C   
623  O  O   . THR A 104 ? 1.2305 0.6062 0.7773 -0.0266 0.1151  -0.0259 104 THR A O   
624  C  CB  . THR A 104 ? 1.3398 0.6787 0.8438 0.0051  0.0902  -0.0141 104 THR A CB  
625  O  OG1 . THR A 104 ? 1.2834 0.6641 0.8170 0.0054  0.0804  -0.0199 104 THR A OG1 
626  C  CG2 . THR A 104 ? 1.3577 0.6702 0.8354 0.0220  0.0780  -0.0077 104 THR A CG2 
627  N  N   . ARG A 105 ? 1.1950 0.5696 0.7601 -0.0274 0.1129  -0.0341 105 ARG A N   
628  C  CA  . ARG A 105 ? 1.1649 0.5700 0.7592 -0.0413 0.1194  -0.0426 105 ARG A CA  
629  C  C   . ARG A 105 ? 1.2416 0.6366 0.8325 -0.0557 0.1370  -0.0425 105 ARG A C   
630  O  O   . ARG A 105 ? 1.2158 0.6389 0.8281 -0.0649 0.1406  -0.0476 105 ARG A O   
631  C  CB  . ARG A 105 ? 1.1410 0.5551 0.7540 -0.0443 0.1179  -0.0508 105 ARG A CB  
632  C  CG  . ARG A 105 ? 1.2476 0.6264 0.8464 -0.0481 0.1280  -0.0507 105