data_5ODS
# 
_entry.id   5ODS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ODS         
WWPDB D_1200005636 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ODS 
_pdbx_database_status.recvd_initial_deposition_date   2017-07-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mukherjee, M.' 1 ? 
'Bayliss, R.'   2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_id_ASTM           EMJODG 
_citation.journal_id_CSD            0897 
_citation.journal_id_ISSN           1460-2075 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure of a phosphoprotein-protein complex' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mukherjee, M.' 1 
primary 'Bayliss, R.'   2 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.72 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ODS 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     115.520 
_cell.length_a_esd                 ? 
_cell.length_b                     120.040 
_cell.length_b_esd                 ? 
_cell.length_c                     123.130 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ODS 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Clathrin heavy chain 1'                                                64355.828 4 ? ? ? ? 
2 polymer man LYS-GLU-SER-ALA-LEU-ARG-LYS-GLN-SEP-LEU-TYR-LEU-LYS-PHE-ASP-PRO-LEU-LEU 2233.542  4 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVI
ALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDA
KQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNR
KGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRR
FQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQ
QCTAFLLDALKNNR
;
;MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVI
ALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDA
KQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNR
KGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRR
FQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQ
QCTAFLLDALKNNR
;
A,B,C,D ? 
2 'polypeptide(L)' no yes 'KESALRKQ(SEP)LYLKFDPLL' KESALRKQSLYLKFDPLL E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLN n 
1 4   ILE n 
1 5   LEU n 
1 6   PRO n 
1 7   ILE n 
1 8   ARG n 
1 9   PHE n 
1 10  GLN n 
1 11  GLU n 
1 12  HIS n 
1 13  LEU n 
1 14  GLN n 
1 15  LEU n 
1 16  GLN n 
1 17  ASN n 
1 18  LEU n 
1 19  GLY n 
1 20  ILE n 
1 21  ASN n 
1 22  PRO n 
1 23  ALA n 
1 24  ASN n 
1 25  ILE n 
1 26  GLY n 
1 27  PHE n 
1 28  SER n 
1 29  THR n 
1 30  LEU n 
1 31  THR n 
1 32  MET n 
1 33  GLU n 
1 34  SER n 
1 35  ASP n 
1 36  LYS n 
1 37  PHE n 
1 38  ILE n 
1 39  CYS n 
1 40  ILE n 
1 41  ARG n 
1 42  GLU n 
1 43  LYS n 
1 44  VAL n 
1 45  GLY n 
1 46  GLU n 
1 47  GLN n 
1 48  ALA n 
1 49  GLN n 
1 50  VAL n 
1 51  VAL n 
1 52  ILE n 
1 53  ILE n 
1 54  ASP n 
1 55  MET n 
1 56  ASN n 
1 57  ASP n 
1 58  PRO n 
1 59  SER n 
1 60  ASN n 
1 61  PRO n 
1 62  ILE n 
1 63  ARG n 
1 64  ARG n 
1 65  PRO n 
1 66  ILE n 
1 67  SER n 
1 68  ALA n 
1 69  ASP n 
1 70  SER n 
1 71  ALA n 
1 72  ILE n 
1 73  MET n 
1 74  ASN n 
1 75  PRO n 
1 76  ALA n 
1 77  SER n 
1 78  LYS n 
1 79  VAL n 
1 80  ILE n 
1 81  ALA n 
1 82  LEU n 
1 83  LYS n 
1 84  ALA n 
1 85  GLY n 
1 86  LYS n 
1 87  THR n 
1 88  LEU n 
1 89  GLN n 
1 90  ILE n 
1 91  PHE n 
1 92  ASN n 
1 93  ILE n 
1 94  GLU n 
1 95  MET n 
1 96  LYS n 
1 97  SER n 
1 98  LYS n 
1 99  MET n 
1 100 LYS n 
1 101 ALA n 
1 102 HIS n 
1 103 THR n 
1 104 MET n 
1 105 THR n 
1 106 ASP n 
1 107 ASP n 
1 108 VAL n 
1 109 THR n 
1 110 PHE n 
1 111 TRP n 
1 112 LYS n 
1 113 TRP n 
1 114 ILE n 
1 115 SER n 
1 116 LEU n 
1 117 ASN n 
1 118 THR n 
1 119 VAL n 
1 120 ALA n 
1 121 LEU n 
1 122 VAL n 
1 123 THR n 
1 124 ASP n 
1 125 ASN n 
1 126 ALA n 
1 127 VAL n 
1 128 TYR n 
1 129 HIS n 
1 130 TRP n 
1 131 SER n 
1 132 MET n 
1 133 GLU n 
1 134 GLY n 
1 135 GLU n 
1 136 SER n 
1 137 GLN n 
1 138 PRO n 
1 139 VAL n 
1 140 LYS n 
1 141 MET n 
1 142 PHE n 
1 143 ASP n 
1 144 ARG n 
1 145 HIS n 
1 146 SER n 
1 147 SER n 
1 148 LEU n 
1 149 ALA n 
1 150 GLY n 
1 151 CYS n 
1 152 GLN n 
1 153 ILE n 
1 154 ILE n 
1 155 ASN n 
1 156 TYR n 
1 157 ARG n 
1 158 THR n 
1 159 ASP n 
1 160 ALA n 
1 161 LYS n 
1 162 GLN n 
1 163 LYS n 
1 164 TRP n 
1 165 LEU n 
1 166 LEU n 
1 167 LEU n 
1 168 THR n 
1 169 GLY n 
1 170 ILE n 
1 171 SER n 
1 172 ALA n 
1 173 GLN n 
1 174 GLN n 
1 175 ASN n 
1 176 ARG n 
1 177 VAL n 
1 178 VAL n 
1 179 GLY n 
1 180 ALA n 
1 181 MET n 
1 182 GLN n 
1 183 LEU n 
1 184 TYR n 
1 185 SER n 
1 186 VAL n 
1 187 ASP n 
1 188 ARG n 
1 189 LYS n 
1 190 VAL n 
1 191 SER n 
1 192 GLN n 
1 193 PRO n 
1 194 ILE n 
1 195 GLU n 
1 196 GLY n 
1 197 HIS n 
1 198 ALA n 
1 199 ALA n 
1 200 SER n 
1 201 PHE n 
1 202 ALA n 
1 203 GLN n 
1 204 PHE n 
1 205 LYS n 
1 206 MET n 
1 207 GLU n 
1 208 GLY n 
1 209 ASN n 
1 210 ALA n 
1 211 GLU n 
1 212 GLU n 
1 213 SER n 
1 214 THR n 
1 215 LEU n 
1 216 PHE n 
1 217 CYS n 
1 218 PHE n 
1 219 ALA n 
1 220 VAL n 
1 221 ARG n 
1 222 GLY n 
1 223 GLN n 
1 224 ALA n 
1 225 GLY n 
1 226 GLY n 
1 227 LYS n 
1 228 LEU n 
1 229 HIS n 
1 230 ILE n 
1 231 ILE n 
1 232 GLU n 
1 233 VAL n 
1 234 GLY n 
1 235 THR n 
1 236 PRO n 
1 237 PRO n 
1 238 THR n 
1 239 GLY n 
1 240 ASN n 
1 241 GLN n 
1 242 PRO n 
1 243 PHE n 
1 244 PRO n 
1 245 LYS n 
1 246 LYS n 
1 247 ALA n 
1 248 VAL n 
1 249 ASP n 
1 250 VAL n 
1 251 PHE n 
1 252 PHE n 
1 253 PRO n 
1 254 PRO n 
1 255 GLU n 
1 256 ALA n 
1 257 GLN n 
1 258 ASN n 
1 259 ASP n 
1 260 PHE n 
1 261 PRO n 
1 262 VAL n 
1 263 ALA n 
1 264 MET n 
1 265 GLN n 
1 266 ILE n 
1 267 SER n 
1 268 GLU n 
1 269 LYS n 
1 270 HIS n 
1 271 ASP n 
1 272 VAL n 
1 273 VAL n 
1 274 PHE n 
1 275 LEU n 
1 276 ILE n 
1 277 THR n 
1 278 LYS n 
1 279 TYR n 
1 280 GLY n 
1 281 TYR n 
1 282 ILE n 
1 283 HIS n 
1 284 LEU n 
1 285 TYR n 
1 286 ASP n 
1 287 LEU n 
1 288 GLU n 
1 289 THR n 
1 290 GLY n 
1 291 THR n 
1 292 CYS n 
1 293 ILE n 
1 294 TYR n 
1 295 MET n 
1 296 ASN n 
1 297 ARG n 
1 298 ILE n 
1 299 SER n 
1 300 GLY n 
1 301 GLU n 
1 302 THR n 
1 303 ILE n 
1 304 PHE n 
1 305 VAL n 
1 306 THR n 
1 307 ALA n 
1 308 PRO n 
1 309 HIS n 
1 310 GLU n 
1 311 ALA n 
1 312 THR n 
1 313 ALA n 
1 314 GLY n 
1 315 ILE n 
1 316 ILE n 
1 317 GLY n 
1 318 VAL n 
1 319 ASN n 
1 320 ARG n 
1 321 LYS n 
1 322 GLY n 
1 323 GLN n 
1 324 VAL n 
1 325 LEU n 
1 326 SER n 
1 327 VAL n 
1 328 CYS n 
1 329 VAL n 
1 330 GLU n 
1 331 GLU n 
1 332 GLU n 
1 333 ASN n 
1 334 ILE n 
1 335 ILE n 
1 336 PRO n 
1 337 TYR n 
1 338 ILE n 
1 339 THR n 
1 340 ASN n 
1 341 VAL n 
1 342 LEU n 
1 343 GLN n 
1 344 ASN n 
1 345 PRO n 
1 346 ASP n 
1 347 LEU n 
1 348 ALA n 
1 349 LEU n 
1 350 ARG n 
1 351 MET n 
1 352 ALA n 
1 353 VAL n 
1 354 ARG n 
1 355 ASN n 
1 356 ASN n 
1 357 LEU n 
1 358 ALA n 
1 359 GLY n 
1 360 ALA n 
1 361 GLU n 
1 362 GLU n 
1 363 LEU n 
1 364 PHE n 
1 365 ALA n 
1 366 ARG n 
1 367 LYS n 
1 368 PHE n 
1 369 ASN n 
1 370 ALA n 
1 371 LEU n 
1 372 PHE n 
1 373 ALA n 
1 374 GLN n 
1 375 GLY n 
1 376 ASN n 
1 377 TYR n 
1 378 SER n 
1 379 GLU n 
1 380 ALA n 
1 381 ALA n 
1 382 LYS n 
1 383 VAL n 
1 384 ALA n 
1 385 ALA n 
1 386 ASN n 
1 387 ALA n 
1 388 PRO n 
1 389 LYS n 
1 390 GLY n 
1 391 ILE n 
1 392 LEU n 
1 393 ARG n 
1 394 THR n 
1 395 PRO n 
1 396 ASP n 
1 397 THR n 
1 398 ILE n 
1 399 ARG n 
1 400 ARG n 
1 401 PHE n 
1 402 GLN n 
1 403 SER n 
1 404 VAL n 
1 405 PRO n 
1 406 ALA n 
1 407 GLN n 
1 408 PRO n 
1 409 GLY n 
1 410 GLN n 
1 411 THR n 
1 412 SER n 
1 413 PRO n 
1 414 LEU n 
1 415 LEU n 
1 416 GLN n 
1 417 TYR n 
1 418 PHE n 
1 419 GLY n 
1 420 ILE n 
1 421 LEU n 
1 422 LEU n 
1 423 ASP n 
1 424 GLN n 
1 425 GLY n 
1 426 GLN n 
1 427 LEU n 
1 428 ASN n 
1 429 LYS n 
1 430 TYR n 
1 431 GLU n 
1 432 SER n 
1 433 LEU n 
1 434 GLU n 
1 435 LEU n 
1 436 CYS n 
1 437 ARG n 
1 438 PRO n 
1 439 VAL n 
1 440 LEU n 
1 441 GLN n 
1 442 GLN n 
1 443 GLY n 
1 444 ARG n 
1 445 LYS n 
1 446 GLN n 
1 447 LEU n 
1 448 LEU n 
1 449 GLU n 
1 450 LYS n 
1 451 TRP n 
1 452 LEU n 
1 453 LYS n 
1 454 GLU n 
1 455 ASP n 
1 456 LYS n 
1 457 LEU n 
1 458 GLU n 
1 459 CYS n 
1 460 SER n 
1 461 GLU n 
1 462 GLU n 
1 463 LEU n 
1 464 GLY n 
1 465 ASP n 
1 466 LEU n 
1 467 VAL n 
1 468 LYS n 
1 469 SER n 
1 470 VAL n 
1 471 ASP n 
1 472 PRO n 
1 473 THR n 
1 474 LEU n 
1 475 ALA n 
1 476 LEU n 
1 477 SER n 
1 478 VAL n 
1 479 TYR n 
1 480 LEU n 
1 481 ARG n 
1 482 ALA n 
1 483 ASN n 
1 484 VAL n 
1 485 PRO n 
1 486 ASN n 
1 487 LYS n 
1 488 VAL n 
1 489 ILE n 
1 490 GLN n 
1 491 CYS n 
1 492 PHE n 
1 493 ALA n 
1 494 GLU n 
1 495 THR n 
1 496 GLY n 
1 497 GLN n 
1 498 VAL n 
1 499 GLN n 
1 500 LYS n 
1 501 ILE n 
1 502 VAL n 
1 503 LEU n 
1 504 TYR n 
1 505 ALA n 
1 506 LYS n 
1 507 LYS n 
1 508 VAL n 
1 509 GLY n 
1 510 TYR n 
1 511 THR n 
1 512 PRO n 
1 513 ASP n 
1 514 TRP n 
1 515 ILE n 
1 516 PHE n 
1 517 LEU n 
1 518 LEU n 
1 519 ARG n 
1 520 ASN n 
1 521 VAL n 
1 522 MET n 
1 523 ARG n 
1 524 ILE n 
1 525 SER n 
1 526 PRO n 
1 527 ASP n 
1 528 GLN n 
1 529 GLY n 
1 530 GLN n 
1 531 GLN n 
1 532 PHE n 
1 533 ALA n 
1 534 GLN n 
1 535 MET n 
1 536 LEU n 
1 537 VAL n 
1 538 GLN n 
1 539 ASP n 
1 540 GLU n 
1 541 GLU n 
1 542 PRO n 
1 543 LEU n 
1 544 ALA n 
1 545 ASP n 
1 546 ILE n 
1 547 THR n 
1 548 GLN n 
1 549 ILE n 
1 550 VAL n 
1 551 ASP n 
1 552 VAL n 
1 553 PHE n 
1 554 MET n 
1 555 GLU n 
1 556 TYR n 
1 557 ASN n 
1 558 LEU n 
1 559 ILE n 
1 560 GLN n 
1 561 GLN n 
1 562 CYS n 
1 563 THR n 
1 564 ALA n 
1 565 PHE n 
1 566 LEU n 
1 567 LEU n 
1 568 ASP n 
1 569 ALA n 
1 570 LEU n 
1 571 LYS n 
1 572 ASN n 
1 573 ASN n 
1 574 ARG n 
2 1   LYS n 
2 2   GLU n 
2 3   SER n 
2 4   ALA n 
2 5   LEU n 
2 6   ARG n 
2 7   LYS n 
2 8   GLN n 
2 9   SEP n 
2 10  LEU n 
2 11  TYR n 
2 12  LEU n 
2 13  LYS n 
2 14  PHE n 
2 15  ASP n 
2 16  PRO n 
2 17  LEU n 
2 18  LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 574 'House Mouse' ? Cltc ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 18  Human         ? ?    ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CLH1_MOUSE Q68FD5 ? 1 
;MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVI
ALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDA
KQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNR
KGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRR
FQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQ
QCTAFLLDALKNNR
;
1 
2 PDB 5ODS       5ODS   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ODS A 1 ? 574 ? Q68FD5 1   ? 574 ? 1   574 
2 1 5ODS B 1 ? 574 ? Q68FD5 1   ? 574 ? 1   574 
3 1 5ODS C 1 ? 574 ? Q68FD5 1   ? 574 ? 1   574 
4 1 5ODS D 1 ? 574 ? Q68FD5 1   ? 574 ? 1   574 
5 2 5ODS E 1 ? 18  ? 5ODS   550 ? 567 ? 550 567 
6 2 5ODS F 1 ? 18  ? 5ODS   550 ? 567 ? 550 567 
7 2 5ODS G 1 ? 18  ? 5ODS   550 ? 567 ? 550 567 
8 2 5ODS H 1 ? 18  ? 5ODS   550 ? 567 ? 550 567 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ODS 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.19 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.43 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'BATCH MODE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 6000, sodium chloride, Tris' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-05-15 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97625 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97625 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ODS 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.09 
_reflns.d_resolution_low                 61.26 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       60689 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.084 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.101 
_reflns.pdbx_Rpim_I_all                  0.055 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.09 
_reflns_shell.d_res_low                   3.14 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3053 
_reflns_shell.percent_possible_all        99.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ODS 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.090 
_refine.ls_d_res_low                             61.258 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     60649 
_refine.ls_number_reflns_R_free                  2888 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.68 
_refine.ls_percent_reflns_R_free                 4.76 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2231 
_refine.ls_R_factor_R_free                       0.2690 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2208 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1BPO 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.43 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.50 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18224 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               18224 
_refine_hist.d_res_high                       3.090 
_refine_hist.d_res_low                        61.258 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 18585 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.204  ? 25225 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.673 ? 6870  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.050  ? 2890  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 3266  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.0900 3.1407  . . 151 2765 100.00 . . . 0.4253 . 0.3736 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1407 3.1948  . . 143 2736 99.00  . . . 0.4402 . 0.3607 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1948 3.2529  . . 142 2759 99.00  . . . 0.3463 . 0.3266 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2529 3.3155  . . 131 2762 100.00 . . . 0.3253 . 0.3032 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3155 3.3831  . . 117 2781 100.00 . . . 0.3202 . 0.2851 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3831 3.4567  . . 142 2748 99.00  . . . 0.3394 . 0.2740 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4567 3.5371  . . 140 2771 100.00 . . . 0.3126 . 0.2657 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5371 3.6255  . . 125 2802 100.00 . . . 0.2923 . 0.2633 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6255 3.7236  . . 141 2738 99.00  . . . 0.3287 . 0.2563 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7236 3.8331  . . 135 2773 100.00 . . . 0.3158 . 0.2429 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8331 3.9568  . . 155 2720 99.00  . . . 0.2813 . 0.2390 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9568 4.0982  . . 153 2763 99.00  . . . 0.2947 . 0.2195 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0982 4.2622  . . 136 2774 99.00  . . . 0.2423 . 0.2048 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2622 4.4562  . . 133 2739 99.00  . . . 0.2646 . 0.1914 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4562 4.6910  . . 128 2733 98.00  . . . 0.2380 . 0.1869 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6910 4.9848  . . 135 2759 99.00  . . . 0.1991 . 0.1857 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9848 5.3695  . . 123 2785 98.00  . . . 0.2311 . 0.1871 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3695 5.9094  . . 119 2744 98.00  . . . 0.2307 . 0.2073 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.9094 6.7636  . . 150 2715 98.00  . . . 0.2883 . 0.2216 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.7636 8.5178  . . 151 2705 96.00  . . . 0.2481 . 0.2203 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.5178 61.2705 . . 138 2689 93.00  . . . 0.2510 . 0.1925 . . . . . . . . . . 
# 
_struct.entry_id                     5ODS 
_struct.title                        'Structure of a phosphoprotein-protein complex' 
_struct.pdbx_descriptor              
'Clathrin heavy chain 1, LYS-GLU-SER-ALA-LEU-ARG-LYS-GLN-SEP-LEU-TYR-LEU-LYS-PHE-ASP-PRO-LEU-LEU' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ODS 
_struct_keywords.text            'Scaffolding protein, spindle association, CELL CYCLE' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 16  ? GLY A 19  ? GLN A 16  GLY A 19  5 ? 4  
HELX_P HELX_P2  AA2 ASN A 21  ? ILE A 25  ? ASN A 21  ILE A 25  5 ? 5  
HELX_P HELX_P3  AA3 HIS A 145 ? ALA A 149 ? HIS A 145 ALA A 149 5 ? 5  
HELX_P HELX_P4  AA4 ASN A 333 ? VAL A 341 ? ASN A 333 VAL A 341 1 ? 9  
HELX_P HELX_P5  AA5 ASN A 344 ? ASN A 355 ? ASN A 344 ASN A 355 1 ? 12 
HELX_P HELX_P6  AA6 ALA A 360 ? GLN A 374 ? ALA A 360 GLN A 374 1 ? 15 
HELX_P HELX_P7  AA7 ASN A 376 ? ASN A 386 ? ASN A 376 ASN A 386 1 ? 11 
HELX_P HELX_P8  AA8 THR A 394 ? SER A 403 ? THR A 394 SER A 403 1 ? 10 
HELX_P HELX_P9  AA9 SER A 412 ? GLY A 425 ? SER A 412 GLY A 425 1 ? 14 
HELX_P HELX_P10 AB1 ASN A 428 ? GLN A 442 ? ASN A 428 GLN A 442 1 ? 15 
HELX_P HELX_P11 AB2 LYS A 445 ? GLU A 454 ? LYS A 445 GLU A 454 1 ? 10 
HELX_P HELX_P12 AB3 SER A 460 ? SER A 469 ? SER A 460 SER A 469 1 ? 10 
HELX_P HELX_P13 AB4 ASP A 471 ? ALA A 482 ? ASP A 471 ALA A 482 1 ? 12 
HELX_P HELX_P14 AB5 VAL A 484 ? THR A 495 ? VAL A 484 THR A 495 1 ? 12 
HELX_P HELX_P15 AB6 GLN A 497 ? GLY A 509 ? GLN A 497 GLY A 509 1 ? 13 
HELX_P HELX_P16 AB7 ASP A 513 ? SER A 525 ? ASP A 513 SER A 525 1 ? 13 
HELX_P HELX_P17 AB8 SER A 525 ? VAL A 537 ? SER A 525 VAL A 537 1 ? 13 
HELX_P HELX_P18 AB9 ASP A 545 ? TYR A 556 ? ASP A 545 TYR A 556 1 ? 12 
HELX_P HELX_P19 AC1 LEU A 558 ? ARG A 574 ? LEU A 558 ARG A 574 1 ? 17 
HELX_P HELX_P20 AC2 GLN B 16  ? GLY B 19  ? GLN B 16  GLY B 19  5 ? 4  
HELX_P HELX_P21 AC3 ASN B 21  ? ILE B 25  ? ASN B 21  ILE B 25  5 ? 5  
HELX_P HELX_P22 AC4 HIS B 145 ? ALA B 149 ? HIS B 145 ALA B 149 5 ? 5  
HELX_P HELX_P23 AC5 ASN B 333 ? VAL B 341 ? ASN B 333 VAL B 341 1 ? 9  
HELX_P HELX_P24 AC6 ASN B 344 ? ASN B 355 ? ASN B 344 ASN B 355 1 ? 12 
HELX_P HELX_P25 AC7 ALA B 360 ? GLN B 374 ? ALA B 360 GLN B 374 1 ? 15 
HELX_P HELX_P26 AC8 ASN B 376 ? ASN B 386 ? ASN B 376 ASN B 386 1 ? 11 
HELX_P HELX_P27 AC9 THR B 394 ? SER B 403 ? THR B 394 SER B 403 1 ? 10 
HELX_P HELX_P28 AD1 SER B 412 ? ASP B 423 ? SER B 412 ASP B 423 1 ? 12 
HELX_P HELX_P29 AD2 ASN B 428 ? ARG B 437 ? ASN B 428 ARG B 437 1 ? 10 
HELX_P HELX_P30 AD3 PRO B 438 ? GLN B 442 ? PRO B 438 GLN B 442 5 ? 5  
HELX_P HELX_P31 AD4 ARG B 444 ? ASP B 455 ? ARG B 444 ASP B 455 1 ? 12 
HELX_P HELX_P32 AD5 SER B 460 ? SER B 469 ? SER B 460 SER B 469 1 ? 10 
HELX_P HELX_P33 AD6 ASP B 471 ? ALA B 482 ? ASP B 471 ALA B 482 1 ? 12 
HELX_P HELX_P34 AD7 PRO B 485 ? GLY B 496 ? PRO B 485 GLY B 496 1 ? 12 
HELX_P HELX_P35 AD8 VAL B 498 ? VAL B 508 ? VAL B 498 VAL B 508 1 ? 11 
HELX_P HELX_P36 AD9 TRP B 514 ? SER B 525 ? TRP B 514 SER B 525 1 ? 12 
HELX_P HELX_P37 AE1 SER B 525 ? VAL B 537 ? SER B 525 VAL B 537 1 ? 13 
HELX_P HELX_P38 AE2 ASP B 545 ? TYR B 556 ? ASP B 545 TYR B 556 1 ? 12 
HELX_P HELX_P39 AE3 LEU B 558 ? ASN B 572 ? LEU B 558 ASN B 572 1 ? 15 
HELX_P HELX_P40 AE4 GLN C 16  ? GLY C 19  ? GLN C 16  GLY C 19  5 ? 4  
HELX_P HELX_P41 AE5 ASN C 21  ? ILE C 25  ? ASN C 21  ILE C 25  5 ? 5  
HELX_P HELX_P42 AE6 HIS C 145 ? ALA C 149 ? HIS C 145 ALA C 149 5 ? 5  
HELX_P HELX_P43 AE7 ASN C 333 ? VAL C 341 ? ASN C 333 VAL C 341 1 ? 9  
HELX_P HELX_P44 AE8 ASN C 344 ? ASN C 355 ? ASN C 344 ASN C 355 1 ? 12 
HELX_P HELX_P45 AE9 ALA C 360 ? GLN C 374 ? ALA C 360 GLN C 374 1 ? 15 
HELX_P HELX_P46 AF1 ASN C 376 ? ASN C 386 ? ASN C 376 ASN C 386 1 ? 11 
HELX_P HELX_P47 AF2 THR C 394 ? SER C 403 ? THR C 394 SER C 403 1 ? 10 
HELX_P HELX_P48 AF3 PRO C 413 ? GLY C 425 ? PRO C 413 GLY C 425 1 ? 13 
HELX_P HELX_P49 AF4 ASN C 428 ? GLN C 442 ? ASN C 428 GLN C 442 1 ? 15 
HELX_P HELX_P50 AF5 LEU C 447 ? GLU C 454 ? LEU C 447 GLU C 454 1 ? 8  
HELX_P HELX_P51 AF6 GLU C 461 ? SER C 469 ? GLU C 461 SER C 469 1 ? 9  
HELX_P HELX_P52 AF7 ASP C 471 ? ALA C 482 ? ASP C 471 ALA C 482 1 ? 12 
HELX_P HELX_P53 AF8 VAL C 484 ? GLU C 494 ? VAL C 484 GLU C 494 1 ? 11 
HELX_P HELX_P54 AF9 VAL C 498 ? VAL C 508 ? VAL C 498 VAL C 508 1 ? 11 
HELX_P HELX_P55 AG1 ASP C 513 ? SER C 525 ? ASP C 513 SER C 525 1 ? 13 
HELX_P HELX_P56 AG2 SER C 525 ? VAL C 537 ? SER C 525 VAL C 537 1 ? 13 
HELX_P HELX_P57 AG3 ASP C 545 ? TYR C 556 ? ASP C 545 TYR C 556 1 ? 12 
HELX_P HELX_P58 AG4 LEU C 558 ? LYS C 571 ? LEU C 558 LYS C 571 1 ? 14 
HELX_P HELX_P59 AG5 GLN D 16  ? GLY D 19  ? GLN D 16  GLY D 19  5 ? 4  
HELX_P HELX_P60 AG6 ASN D 21  ? ILE D 25  ? ASN D 21  ILE D 25  5 ? 5  
HELX_P HELX_P61 AG7 HIS D 145 ? ALA D 149 ? HIS D 145 ALA D 149 5 ? 5  
HELX_P HELX_P62 AG8 ASN D 333 ? VAL D 341 ? ASN D 333 VAL D 341 1 ? 9  
HELX_P HELX_P63 AG9 ASN D 344 ? ASN D 355 ? ASN D 344 ASN D 355 1 ? 12 
HELX_P HELX_P64 AH1 GLY D 359 ? GLN D 374 ? GLY D 359 GLN D 374 1 ? 16 
HELX_P HELX_P65 AH2 TYR D 377 ? ASN D 386 ? TYR D 377 ASN D 386 1 ? 10 
HELX_P HELX_P66 AH3 THR D 394 ? SER D 403 ? THR D 394 SER D 403 1 ? 10 
HELX_P HELX_P67 AH4 SER D 412 ? GLY D 425 ? SER D 412 GLY D 425 1 ? 14 
HELX_P HELX_P68 AH5 ASN D 428 ? GLN D 442 ? ASN D 428 GLN D 442 1 ? 15 
HELX_P HELX_P69 AH6 LYS D 445 ? GLU D 454 ? LYS D 445 GLU D 454 1 ? 10 
HELX_P HELX_P70 AH7 SER D 460 ? SER D 469 ? SER D 460 SER D 469 1 ? 10 
HELX_P HELX_P71 AH8 ASP D 471 ? ALA D 482 ? ASP D 471 ALA D 482 1 ? 12 
HELX_P HELX_P72 AH9 PRO D 485 ? GLU D 494 ? PRO D 485 GLU D 494 1 ? 10 
HELX_P HELX_P73 AI1 VAL D 498 ? GLY D 509 ? VAL D 498 GLY D 509 1 ? 12 
HELX_P HELX_P74 AI2 ASP D 513 ? SER D 525 ? ASP D 513 SER D 525 1 ? 13 
HELX_P HELX_P75 AI3 SER D 525 ? GLN D 538 ? SER D 525 GLN D 538 1 ? 14 
HELX_P HELX_P76 AI4 ASP D 545 ? TYR D 556 ? ASP D 545 TYR D 556 1 ? 12 
HELX_P HELX_P77 AI5 LEU D 558 ? ASN D 572 ? LEU D 558 ASN D 572 1 ? 15 
HELX_P HELX_P78 AI6 GLU E 2   ? ASP E 15  ? GLU E 551 ASP E 564 1 ? 14 
HELX_P HELX_P79 AI7 GLU F 2   ? ASP F 15  ? GLU F 551 ASP F 564 1 ? 14 
HELX_P HELX_P80 AI8 GLU G 2   ? ASP G 15  ? GLU G 551 ASP G 564 1 ? 14 
HELX_P HELX_P81 AI9 GLU H 2   ? ASP H 15  ? GLU H 551 ASP H 564 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? E GLN 8 C ? ? ? 1_555 E SEP 9  N ? ? E GLN 557 E SEP 558 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2 covale both ? E SEP 9 C ? ? ? 1_555 E LEU 10 N ? ? E SEP 558 E LEU 559 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale both ? F GLN 8 C ? ? ? 1_555 F SEP 9  N ? ? F GLN 557 F SEP 558 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4 covale both ? F SEP 9 C ? ? ? 1_555 F LEU 10 N ? ? F SEP 558 F LEU 559 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale5 covale both ? G GLN 8 C ? ? ? 1_555 G SEP 9  N ? ? G GLN 557 G SEP 558 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale6 covale both ? G SEP 9 C ? ? ? 1_555 G LEU 10 N ? ? G SEP 558 G LEU 559 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale7 covale both ? H GLN 8 C ? ? ? 1_555 H SEP 9  N ? ? H GLN 557 H SEP 558 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale8 covale both ? H SEP 9 C ? ? ? 1_555 H LEU 10 N ? ? H SEP 558 H LEU 559 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 241 A . ? GLN 241 A PRO 242 A ? PRO 242 A 1 -5.57  
2 THR 411 A . ? THR 411 A SER 412 A ? SER 412 A 1 -16.23 
3 GLN 538 D . ? GLN 538 D ASP 539 D ? ASP 539 D 1 11.78  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
AC3 ? 3 ? 
AC4 ? 4 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 4 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 7   ? GLN A 14  ? ILE A 7   GLN A 14  
AA1 2 GLN A 323 ? VAL A 329 ? GLN A 323 VAL A 329 
AA1 3 GLY A 314 ? VAL A 318 ? GLY A 314 VAL A 318 
AA1 4 VAL A 305 ? HIS A 309 ? VAL A 305 HIS A 309 
AA2 1 LEU A 30  ? THR A 31  ? LEU A 30  THR A 31  
AA2 2 PHE A 37  ? VAL A 44  ? PHE A 37  VAL A 44  
AA2 3 GLN A 47  ? ASP A 54  ? GLN A 47  ASP A 54  
AA2 4 ILE A 62  ? ARG A 64  ? ILE A 62  ARG A 64  
AA3 1 SER A 70  ? MET A 73  ? SER A 70  MET A 73  
AA3 2 VAL A 79  ? ALA A 84  ? VAL A 79  ALA A 84  
AA3 3 THR A 87  ? ASN A 92  ? THR A 87  ASN A 92  
AA3 4 SER A 97  ? THR A 103 ? SER A 97  THR A 103 
AA4 1 VAL A 108 ? SER A 115 ? VAL A 108 SER A 115 
AA4 2 THR A 118 ? THR A 123 ? THR A 118 THR A 123 
AA4 3 ALA A 126 ? SER A 131 ? ALA A 126 SER A 131 
AA4 4 VAL A 139 ? ASP A 143 ? VAL A 139 ASP A 143 
AA5 1 GLN A 152 ? THR A 158 ? GLN A 152 THR A 158 
AA5 2 TRP A 164 ? ALA A 172 ? TRP A 164 ALA A 172 
AA5 3 VAL A 177 ? SER A 185 ? VAL A 177 SER A 185 
AA5 4 VAL A 190 ? ILE A 194 ? VAL A 190 ILE A 194 
AA6 1 ALA A 198 ? PHE A 204 ? ALA A 198 PHE A 204 
AA6 2 SER A 213 ? GLY A 222 ? SER A 213 GLY A 222 
AA6 3 GLY A 225 ? GLU A 232 ? GLY A 225 GLU A 232 
AA6 4 LYS A 246 ? ASP A 249 ? LYS A 246 ASP A 249 
AA7 1 PRO A 261 ? SER A 267 ? PRO A 261 SER A 267 
AA7 2 VAL A 272 ? THR A 277 ? VAL A 272 THR A 277 
AA7 3 TYR A 281 ? ASP A 286 ? TYR A 281 ASP A 286 
AA7 4 CYS A 292 ? ARG A 297 ? CYS A 292 ARG A 297 
AA8 1 ILE B 7   ? GLN B 14  ? ILE B 7   GLN B 14  
AA8 2 GLN B 323 ? VAL B 329 ? GLN B 323 VAL B 329 
AA8 3 GLY B 314 ? VAL B 318 ? GLY B 314 VAL B 318 
AA8 4 VAL B 305 ? HIS B 309 ? VAL B 305 HIS B 309 
AA9 1 LEU B 30  ? THR B 31  ? LEU B 30  THR B 31  
AA9 2 PHE B 37  ? VAL B 44  ? PHE B 37  VAL B 44  
AA9 3 GLN B 47  ? ASP B 54  ? GLN B 47  ASP B 54  
AA9 4 ILE B 62  ? ARG B 64  ? ILE B 62  ARG B 64  
AB1 1 SER B 70  ? MET B 73  ? SER B 70  MET B 73  
AB1 2 VAL B 79  ? ALA B 84  ? VAL B 79  ALA B 84  
AB1 3 THR B 87  ? ASN B 92  ? THR B 87  ASN B 92  
AB1 4 SER B 97  ? THR B 103 ? SER B 97  THR B 103 
AB2 1 VAL B 108 ? SER B 115 ? VAL B 108 SER B 115 
AB2 2 THR B 118 ? THR B 123 ? THR B 118 THR B 123 
AB2 3 ALA B 126 ? SER B 131 ? ALA B 126 SER B 131 
AB2 4 VAL B 139 ? ASP B 143 ? VAL B 139 ASP B 143 
AB3 1 GLN B 152 ? THR B 158 ? GLN B 152 THR B 158 
AB3 2 TRP B 164 ? ALA B 172 ? TRP B 164 ALA B 172 
AB3 3 VAL B 177 ? SER B 185 ? VAL B 177 SER B 185 
AB3 4 VAL B 190 ? GLU B 195 ? VAL B 190 GLU B 195 
AB4 1 ALA B 198 ? PHE B 204 ? ALA B 198 PHE B 204 
AB4 2 SER B 213 ? GLY B 222 ? SER B 213 GLY B 222 
AB4 3 GLY B 225 ? GLU B 232 ? GLY B 225 GLU B 232 
AB4 4 LYS B 246 ? ASP B 249 ? LYS B 246 ASP B 249 
AB5 1 PRO B 261 ? SER B 267 ? PRO B 261 SER B 267 
AB5 2 VAL B 272 ? THR B 277 ? VAL B 272 THR B 277 
AB5 3 TYR B 281 ? ASP B 286 ? TYR B 281 ASP B 286 
AB5 4 CYS B 292 ? ARG B 297 ? CYS B 292 ARG B 297 
AB6 1 ILE C 7   ? GLN C 14  ? ILE C 7   GLN C 14  
AB6 2 GLN C 323 ? VAL C 329 ? GLN C 323 VAL C 329 
AB6 3 GLY C 314 ? VAL C 318 ? GLY C 314 VAL C 318 
AB6 4 VAL C 305 ? HIS C 309 ? VAL C 305 HIS C 309 
AB7 1 LEU C 30  ? THR C 31  ? LEU C 30  THR C 31  
AB7 2 PHE C 37  ? ILE C 40  ? PHE C 37  ILE C 40  
AB7 3 VAL C 50  ? ASP C 54  ? VAL C 50  ASP C 54  
AB7 4 ILE C 62  ? ARG C 64  ? ILE C 62  ARG C 64  
AB8 1 SER C 70  ? MET C 73  ? SER C 70  MET C 73  
AB8 2 VAL C 79  ? ALA C 84  ? VAL C 79  ALA C 84  
AB8 3 THR C 87  ? ASN C 92  ? THR C 87  ASN C 92  
AB8 4 SER C 97  ? THR C 103 ? SER C 97  THR C 103 
AB9 1 VAL C 108 ? SER C 115 ? VAL C 108 SER C 115 
AB9 2 THR C 118 ? THR C 123 ? THR C 118 THR C 123 
AB9 3 ALA C 126 ? SER C 131 ? ALA C 126 SER C 131 
AB9 4 VAL C 139 ? ASP C 143 ? VAL C 139 ASP C 143 
AC1 1 GLN C 152 ? THR C 158 ? GLN C 152 THR C 158 
AC1 2 TRP C 164 ? ALA C 172 ? TRP C 164 ALA C 172 
AC1 3 VAL C 177 ? SER C 185 ? VAL C 177 SER C 185 
AC1 4 SER C 191 ? GLU C 195 ? SER C 191 GLU C 195 
AC2 1 ALA C 198 ? PHE C 204 ? ALA C 198 PHE C 204 
AC2 2 SER C 213 ? GLY C 222 ? SER C 213 GLY C 222 
AC2 3 GLY C 225 ? GLU C 232 ? GLY C 225 GLU C 232 
AC2 4 LYS C 246 ? ASP C 249 ? LYS C 246 ASP C 249 
AC3 1 PRO C 261 ? SER C 267 ? PRO C 261 SER C 267 
AC3 2 VAL C 272 ? THR C 277 ? VAL C 272 THR C 277 
AC3 3 ILE C 282 ? ASP C 286 ? ILE C 282 ASP C 286 
AC4 1 ILE D 7   ? GLN D 14  ? ILE D 7   GLN D 14  
AC4 2 GLN D 323 ? VAL D 329 ? GLN D 323 VAL D 329 
AC4 3 GLY D 314 ? VAL D 318 ? GLY D 314 VAL D 318 
AC4 4 VAL D 305 ? HIS D 309 ? VAL D 305 HIS D 309 
AC5 1 LEU D 30  ? THR D 31  ? LEU D 30  THR D 31  
AC5 2 PHE D 37  ? VAL D 44  ? PHE D 37  VAL D 44  
AC5 3 GLN D 47  ? ASP D 54  ? GLN D 47  ASP D 54  
AC5 4 ILE D 62  ? ARG D 64  ? ILE D 62  ARG D 64  
AC6 1 SER D 70  ? MET D 73  ? SER D 70  MET D 73  
AC6 2 VAL D 79  ? ALA D 84  ? VAL D 79  ALA D 84  
AC6 3 THR D 87  ? ASN D 92  ? THR D 87  ASN D 92  
AC6 4 SER D 97  ? HIS D 102 ? SER D 97  HIS D 102 
AC7 1 VAL D 108 ? SER D 115 ? VAL D 108 SER D 115 
AC7 2 THR D 118 ? THR D 123 ? THR D 118 THR D 123 
AC7 3 ALA D 126 ? SER D 131 ? ALA D 126 SER D 131 
AC7 4 VAL D 139 ? ASP D 143 ? VAL D 139 ASP D 143 
AC8 1 GLN D 152 ? THR D 158 ? GLN D 152 THR D 158 
AC8 2 TRP D 164 ? ALA D 172 ? TRP D 164 ALA D 172 
AC8 3 VAL D 177 ? SER D 185 ? VAL D 177 SER D 185 
AC8 4 VAL D 190 ? ILE D 194 ? VAL D 190 ILE D 194 
AC9 1 ALA D 198 ? PHE D 204 ? ALA D 198 PHE D 204 
AC9 2 SER D 213 ? GLY D 222 ? SER D 213 GLY D 222 
AC9 3 GLY D 225 ? GLU D 232 ? GLY D 225 GLU D 232 
AC9 4 LYS D 246 ? ASP D 249 ? LYS D 246 ASP D 249 
AD1 1 PRO D 261 ? SER D 267 ? PRO D 261 SER D 267 
AD1 2 VAL D 272 ? THR D 277 ? VAL D 272 THR D 277 
AD1 3 ILE D 282 ? ASP D 286 ? ILE D 282 ASP D 286 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 13  ? N LEU A 13  O VAL A 324 ? O VAL A 324 
AA1 2 3 O VAL A 327 ? O VAL A 327 N ILE A 315 ? N ILE A 315 
AA1 3 4 O ILE A 316 ? O ILE A 316 N ALA A 307 ? N ALA A 307 
AA2 1 2 N THR A 31  ? N THR A 31  O CYS A 39  ? O CYS A 39  
AA2 2 3 N ILE A 40  ? N ILE A 40  O VAL A 51  ? O VAL A 51  
AA2 3 4 N VAL A 50  ? N VAL A 50  O ARG A 64  ? O ARG A 64  
AA3 1 2 N ILE A 72  ? N ILE A 72  O ALA A 81  ? O ALA A 81  
AA3 2 3 N ILE A 80  ? N ILE A 80  O PHE A 91  ? O PHE A 91  
AA3 3 4 N LEU A 88  ? N LEU A 88  O HIS A 102 ? O HIS A 102 
AA4 1 2 N PHE A 110 ? N PHE A 110 O VAL A 122 ? O VAL A 122 
AA4 2 3 N LEU A 121 ? N LEU A 121 O TYR A 128 ? O TYR A 128 
AA4 3 4 N VAL A 127 ? N VAL A 127 O MET A 141 ? O MET A 141 
AA5 1 2 N ARG A 157 ? N ARG A 157 O LEU A 166 ? O LEU A 166 
AA5 2 3 N GLY A 169 ? N GLY A 169 O ALA A 180 ? O ALA A 180 
AA5 3 4 N LEU A 183 ? N LEU A 183 O GLN A 192 ? O GLN A 192 
AA6 1 2 N ALA A 202 ? N ALA A 202 O LEU A 215 ? O LEU A 215 
AA6 2 3 N PHE A 216 ? N PHE A 216 O ILE A 231 ? O ILE A 231 
AA6 3 4 N LEU A 228 ? N LEU A 228 O VAL A 248 ? O VAL A 248 
AA7 1 2 N GLN A 265 ? N GLN A 265 O PHE A 274 ? O PHE A 274 
AA7 2 3 N VAL A 273 ? N VAL A 273 O TYR A 285 ? O TYR A 285 
AA7 3 4 N ILE A 282 ? N ILE A 282 O ASN A 296 ? O ASN A 296 
AA8 1 2 N LEU B 13  ? N LEU B 13  O VAL B 324 ? O VAL B 324 
AA8 2 3 O LEU B 325 ? O LEU B 325 N GLY B 317 ? N GLY B 317 
AA8 3 4 O ILE B 316 ? O ILE B 316 N ALA B 307 ? N ALA B 307 
AA9 1 2 N THR B 31  ? N THR B 31  O CYS B 39  ? O CYS B 39  
AA9 2 3 N ILE B 40  ? N ILE B 40  O VAL B 51  ? O VAL B 51  
AA9 3 4 N VAL B 50  ? N VAL B 50  O ARG B 64  ? O ARG B 64  
AB1 1 2 N ILE B 72  ? N ILE B 72  O ALA B 81  ? O ALA B 81  
AB1 2 3 N ILE B 80  ? N ILE B 80  O PHE B 91  ? O PHE B 91  
AB1 3 4 N LEU B 88  ? N LEU B 88  O HIS B 102 ? O HIS B 102 
AB2 1 2 N PHE B 110 ? N PHE B 110 O VAL B 122 ? O VAL B 122 
AB2 2 3 N LEU B 121 ? N LEU B 121 O TYR B 128 ? O TYR B 128 
AB2 3 4 N VAL B 127 ? N VAL B 127 O MET B 141 ? O MET B 141 
AB3 1 2 N ARG B 157 ? N ARG B 157 O LEU B 166 ? O LEU B 166 
AB3 2 3 N GLY B 169 ? N GLY B 169 O ALA B 180 ? O ALA B 180 
AB3 3 4 N MET B 181 ? N MET B 181 O ILE B 194 ? O ILE B 194 
AB4 1 2 N ALA B 202 ? N ALA B 202 O LEU B 215 ? O LEU B 215 
AB4 2 3 N PHE B 216 ? N PHE B 216 O ILE B 231 ? O ILE B 231 
AB4 3 4 N LEU B 228 ? N LEU B 228 O VAL B 248 ? O VAL B 248 
AB5 1 2 N VAL B 262 ? N VAL B 262 O ILE B 276 ? O ILE B 276 
AB5 2 3 N VAL B 273 ? N VAL B 273 O TYR B 285 ? O TYR B 285 
AB5 3 4 N LEU B 284 ? N LEU B 284 O ILE B 293 ? O ILE B 293 
AB6 1 2 N LEU C 13  ? N LEU C 13  O VAL C 324 ? O VAL C 324 
AB6 2 3 O LEU C 325 ? O LEU C 325 N GLY C 317 ? N GLY C 317 
AB6 3 4 O ILE C 316 ? O ILE C 316 N ALA C 307 ? N ALA C 307 
AB7 1 2 N THR C 31  ? N THR C 31  O CYS C 39  ? O CYS C 39  
AB7 2 3 N ILE C 40  ? N ILE C 40  O VAL C 51  ? O VAL C 51  
AB7 3 4 N VAL C 50  ? N VAL C 50  O ARG C 64  ? O ARG C 64  
AB8 1 2 N ILE C 72  ? N ILE C 72  O ALA C 81  ? O ALA C 81  
AB8 2 3 N ILE C 80  ? N ILE C 80  O PHE C 91  ? O PHE C 91  
AB8 3 4 N LEU C 88  ? N LEU C 88  O HIS C 102 ? O HIS C 102 
AB9 1 2 N PHE C 110 ? N PHE C 110 O VAL C 122 ? O VAL C 122 
AB9 2 3 N LEU C 121 ? N LEU C 121 O TYR C 128 ? O TYR C 128 
AB9 3 4 N VAL C 127 ? N VAL C 127 O MET C 141 ? O MET C 141 
AC1 1 2 N ARG C 157 ? N ARG C 157 O LEU C 166 ? O LEU C 166 
AC1 2 3 N SER C 171 ? N SER C 171 O VAL C 178 ? O VAL C 178 
AC1 3 4 N MET C 181 ? N MET C 181 O ILE C 194 ? O ILE C 194 
AC2 1 2 N ALA C 202 ? N ALA C 202 O LEU C 215 ? O LEU C 215 
AC2 2 3 N PHE C 216 ? N PHE C 216 O ILE C 231 ? O ILE C 231 
AC2 3 4 N LEU C 228 ? N LEU C 228 O VAL C 248 ? O VAL C 248 
AC3 1 2 N GLN C 265 ? N GLN C 265 O PHE C 274 ? O PHE C 274 
AC3 2 3 N VAL C 273 ? N VAL C 273 O TYR C 285 ? O TYR C 285 
AC4 1 2 N LEU D 13  ? N LEU D 13  O VAL D 324 ? O VAL D 324 
AC4 2 3 O VAL D 327 ? O VAL D 327 N ILE D 315 ? N ILE D 315 
AC4 3 4 O ILE D 316 ? O ILE D 316 N ALA D 307 ? N ALA D 307 
AC5 1 2 N THR D 31  ? N THR D 31  O CYS D 39  ? O CYS D 39  
AC5 2 3 N ILE D 40  ? N ILE D 40  O VAL D 51  ? O VAL D 51  
AC5 3 4 N VAL D 50  ? N VAL D 50  O ARG D 64  ? O ARG D 64  
AC6 1 2 N SER D 70  ? N SER D 70  O LYS D 83  ? O LYS D 83  
AC6 2 3 N ILE D 80  ? N ILE D 80  O PHE D 91  ? O PHE D 91  
AC6 3 4 N LEU D 88  ? N LEU D 88  O HIS D 102 ? O HIS D 102 
AC7 1 2 N LYS D 112 ? N LYS D 112 O ALA D 120 ? O ALA D 120 
AC7 2 3 N LEU D 121 ? N LEU D 121 O TYR D 128 ? O TYR D 128 
AC7 3 4 N VAL D 127 ? N VAL D 127 O MET D 141 ? O MET D 141 
AC8 1 2 N ARG D 157 ? N ARG D 157 O LEU D 166 ? O LEU D 166 
AC8 2 3 N GLY D 169 ? N GLY D 169 O ALA D 180 ? O ALA D 180 
AC8 3 4 N MET D 181 ? N MET D 181 O ILE D 194 ? O ILE D 194 
AC9 1 2 N ALA D 202 ? N ALA D 202 O LEU D 215 ? O LEU D 215 
AC9 2 3 N PHE D 216 ? N PHE D 216 O ILE D 231 ? O ILE D 231 
AC9 3 4 N LEU D 228 ? N LEU D 228 O VAL D 248 ? O VAL D 248 
AD1 1 2 N GLN D 265 ? N GLN D 265 O PHE D 274 ? O PHE D 274 
AD1 2 3 N VAL D 273 ? N VAL D 273 O TYR D 285 ? O TYR D 285 
# 
_atom_sites.entry_id                    5ODS 
_atom_sites.fract_transf_matrix[1][1]   0.008657 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000867 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008331 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008162 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A 1 3   ? 128.492 2.497   193.561 1.00 129.59 ? 3   GLN A N   1 
ATOM   2     C CA  . GLN A 1 3   ? 128.615 1.147   193.033 1.00 126.45 ? 3   GLN A CA  1 
ATOM   3     C C   . GLN A 1 3   ? 129.252 1.165   191.651 1.00 106.39 ? 3   GLN A C   1 
ATOM   4     O O   . GLN A 1 3   ? 129.358 2.213   191.015 1.00 103.18 ? 3   GLN A O   1 
ATOM   5     C CB  . GLN A 1 3   ? 127.250 0.463   192.979 1.00 136.72 ? 3   GLN A CB  1 
ATOM   6     C CG  . GLN A 1 3   ? 127.214 -0.897  193.650 1.00 148.96 ? 3   GLN A CG  1 
ATOM   7     C CD  . GLN A 1 3   ? 126.900 -2.020  192.685 1.00 150.16 ? 3   GLN A CD  1 
ATOM   8     O OE1 . GLN A 1 3   ? 125.805 -2.084  192.130 1.00 156.88 ? 3   GLN A OE1 1 
ATOM   9     N NE2 . GLN A 1 3   ? 127.867 -2.905  192.469 1.00 133.90 ? 3   GLN A NE2 1 
ATOM   10    N N   . ILE A 1 4   ? 129.683 -0.003  191.191 1.00 88.09  ? 4   ILE A N   1 
ATOM   11    C CA  . ILE A 1 4   ? 130.362 -0.112  189.902 1.00 83.83  ? 4   ILE A CA  1 
ATOM   12    C C   . ILE A 1 4   ? 129.436 0.073   188.701 1.00 88.36  ? 4   ILE A C   1 
ATOM   13    O O   . ILE A 1 4   ? 128.238 -0.213  188.763 1.00 93.87  ? 4   ILE A O   1 
ATOM   14    C CB  . ILE A 1 4   ? 131.066 -1.465  189.762 1.00 82.02  ? 4   ILE A CB  1 
ATOM   15    C CG1 . ILE A 1 4   ? 130.063 -2.610  189.903 1.00 82.83  ? 4   ILE A CG1 1 
ATOM   16    C CG2 . ILE A 1 4   ? 132.181 -1.581  190.795 1.00 85.17  ? 4   ILE A CG2 1 
ATOM   17    C CD1 . ILE A 1 4   ? 130.370 -3.779  188.991 1.00 81.48  ? 4   ILE A CD1 1 
ATOM   18    N N   . LEU A 1 5   ? 130.017 0.570   187.614 1.00 74.66  ? 5   LEU A N   1 
ATOM   19    C CA  . LEU A 1 5   ? 129.326 0.723   186.342 1.00 75.31  ? 5   LEU A CA  1 
ATOM   20    C C   . LEU A 1 5   ? 130.232 0.230   185.218 1.00 83.35  ? 5   LEU A C   1 
ATOM   21    O O   . LEU A 1 5   ? 131.454 0.290   185.337 1.00 103.08 ? 5   LEU A O   1 
ATOM   22    C CB  . LEU A 1 5   ? 128.907 2.181   186.111 1.00 72.05  ? 5   LEU A CB  1 
ATOM   23    C CG  . LEU A 1 5   ? 129.605 3.302   186.879 1.00 77.83  ? 5   LEU A CG  1 
ATOM   24    C CD1 . LEU A 1 5   ? 130.182 4.325   185.915 1.00 102.09 ? 5   LEU A CD1 1 
ATOM   25    C CD2 . LEU A 1 5   ? 128.623 3.961   187.826 1.00 76.48  ? 5   LEU A CD2 1 
ATOM   26    N N   . PRO A 1 6   ? 129.638 -0.255  184.115 1.00 75.28  ? 6   PRO A N   1 
ATOM   27    C CA  . PRO A 1 6   ? 130.479 -0.825  183.061 1.00 77.50  ? 6   PRO A CA  1 
ATOM   28    C C   . PRO A 1 6   ? 131.116 0.229   182.165 1.00 70.78  ? 6   PRO A C   1 
ATOM   29    O O   . PRO A 1 6   ? 131.911 -0.117  181.296 1.00 67.62  ? 6   PRO A O   1 
ATOM   30    C CB  . PRO A 1 6   ? 129.494 -1.675  182.264 1.00 79.48  ? 6   PRO A CB  1 
ATOM   31    C CG  . PRO A 1 6   ? 128.200 -0.939  182.396 1.00 70.76  ? 6   PRO A CG  1 
ATOM   32    C CD  . PRO A 1 6   ? 128.207 -0.280  183.754 1.00 68.38  ? 6   PRO A CD  1 
ATOM   33    N N   . ILE A 1 7   ? 130.780 1.497   182.372 1.00 73.40  ? 7   ILE A N   1 
ATOM   34    C CA  . ILE A 1 7   ? 131.344 2.561   181.553 1.00 72.06  ? 7   ILE A CA  1 
ATOM   35    C C   . ILE A 1 7   ? 132.325 3.430   182.333 1.00 78.40  ? 7   ILE A C   1 
ATOM   36    O O   . ILE A 1 7   ? 132.374 3.393   183.562 1.00 80.55  ? 7   ILE A O   1 
ATOM   37    C CB  . ILE A 1 7   ? 130.250 3.460   180.952 1.00 65.68  ? 7   ILE A CB  1 
ATOM   38    C CG1 . ILE A 1 7   ? 129.429 4.111   182.063 1.00 65.15  ? 7   ILE A CG1 1 
ATOM   39    C CG2 . ILE A 1 7   ? 129.360 2.655   180.018 1.00 65.80  ? 7   ILE A CG2 1 
ATOM   40    C CD1 . ILE A 1 7   ? 129.502 5.624   182.054 1.00 67.80  ? 7   ILE A CD1 1 
ATOM   41    N N   . ARG A 1 8   ? 133.095 4.220   181.595 1.00 74.87  ? 8   ARG A N   1 
ATOM   42    C CA  . ARG A 1 8   ? 134.028 5.165   182.183 1.00 65.03  ? 8   ARG A CA  1 
ATOM   43    C C   . ARG A 1 8   ? 133.745 6.518   181.548 1.00 67.32  ? 8   ARG A C   1 
ATOM   44    O O   . ARG A 1 8   ? 134.279 6.852   180.495 1.00 99.56  ? 8   ARG A O   1 
ATOM   45    C CB  . ARG A 1 8   ? 135.476 4.718   181.948 1.00 68.30  ? 8   ARG A CB  1 
ATOM   46    C CG  . ARG A 1 8   ? 136.516 5.407   182.818 1.00 74.01  ? 8   ARG A CG  1 
ATOM   47    C CD  . ARG A 1 8   ? 137.923 5.207   182.264 1.00 75.75  ? 8   ARG A CD  1 
ATOM   48    N NE  . ARG A 1 8   ? 138.291 3.795   182.191 1.00 90.06  ? 8   ARG A NE  1 
ATOM   49    C CZ  . ARG A 1 8   ? 139.069 3.270   181.249 1.00 93.98  ? 8   ARG A CZ  1 
ATOM   50    N NH1 . ARG A 1 8   ? 139.350 1.974   181.267 1.00 88.34  ? 8   ARG A NH1 1 
ATOM   51    N NH2 . ARG A 1 8   ? 139.566 4.039   180.288 1.00 93.08  ? 8   ARG A NH2 1 
ATOM   52    N N   . PHE A 1 9   ? 132.898 7.294   182.215 1.00 66.17  ? 9   PHE A N   1 
ATOM   53    C CA  . PHE A 1 9   ? 132.501 8.621   181.750 1.00 65.34  ? 9   PHE A CA  1 
ATOM   54    C C   . PHE A 1 9   ? 133.515 9.677   182.173 1.00 68.12  ? 9   PHE A C   1 
ATOM   55    O O   . PHE A 1 9   ? 133.968 9.685   183.315 1.00 71.48  ? 9   PHE A O   1 
ATOM   56    C CB  . PHE A 1 9   ? 131.103 8.952   182.281 1.00 65.03  ? 9   PHE A CB  1 
ATOM   57    C CG  . PHE A 1 9   ? 130.639 10.344  181.967 1.00 66.09  ? 9   PHE A CG  1 
ATOM   58    C CD1 . PHE A 1 9   ? 130.182 10.668  180.702 1.00 66.65  ? 9   PHE A CD1 1 
ATOM   59    C CD2 . PHE A 1 9   ? 130.630 11.320  182.948 1.00 69.19  ? 9   PHE A CD2 1 
ATOM   60    C CE1 . PHE A 1 9   ? 129.750 11.949  180.414 1.00 70.03  ? 9   PHE A CE1 1 
ATOM   61    C CE2 . PHE A 1 9   ? 130.197 12.598  182.670 1.00 78.05  ? 9   PHE A CE2 1 
ATOM   62    C CZ  . PHE A 1 9   ? 129.754 12.913  181.402 1.00 72.94  ? 9   PHE A CZ  1 
ATOM   63    N N   . GLN A 1 10  ? 133.878 10.558  181.247 1.00 67.02  ? 10  GLN A N   1 
ATOM   64    C CA  . GLN A 1 10  ? 134.908 11.555  181.519 1.00 69.28  ? 10  GLN A CA  1 
ATOM   65    C C   . GLN A 1 10  ? 134.674 12.893  180.820 1.00 74.60  ? 10  GLN A C   1 
ATOM   66    O O   . GLN A 1 10  ? 134.217 12.936  179.676 1.00 83.84  ? 10  GLN A O   1 
ATOM   67    C CB  . GLN A 1 10  ? 136.274 11.003  181.103 1.00 82.53  ? 10  GLN A CB  1 
ATOM   68    C CG  . GLN A 1 10  ? 137.319 10.992  182.202 1.00 91.48  ? 10  GLN A CG  1 
ATOM   69    C CD  . GLN A 1 10  ? 138.487 11.905  181.897 1.00 122.54 ? 10  GLN A CD  1 
ATOM   70    O OE1 . GLN A 1 10  ? 138.329 13.120  181.794 1.00 144.99 ? 10  GLN A OE1 1 
ATOM   71    N NE2 . GLN A 1 10  ? 139.670 11.321  181.744 1.00 134.56 ? 10  GLN A NE2 1 
ATOM   72    N N   . GLU A 1 11  ? 134.981 13.984  181.518 1.00 83.38  ? 11  GLU A N   1 
ATOM   73    C CA  . GLU A 1 11  ? 134.937 15.309  180.913 1.00 86.99  ? 11  GLU A CA  1 
ATOM   74    C C   . GLU A 1 11  ? 136.360 15.745  180.615 1.00 94.56  ? 11  GLU A C   1 
ATOM   75    O O   . GLU A 1 11  ? 137.139 16.031  181.528 1.00 104.27 ? 11  GLU A O   1 
ATOM   76    C CB  . GLU A 1 11  ? 134.252 16.327  181.822 1.00 87.28  ? 11  GLU A CB  1 
ATOM   77    C CG  . GLU A 1 11  ? 133.863 17.604  181.093 1.00 98.54  ? 11  GLU A CG  1 
ATOM   78    C CD  . GLU A 1 11  ? 133.636 18.769  182.031 1.00 109.11 ? 11  GLU A CD  1 
ATOM   79    O OE1 . GLU A 1 11  ? 134.555 19.094  182.811 1.00 114.93 ? 11  GLU A OE1 1 
ATOM   80    O OE2 . GLU A 1 11  ? 132.538 19.362  181.989 1.00 106.86 ? 11  GLU A OE2 1 
ATOM   81    N N   . HIS A 1 12  ? 136.695 15.796  179.332 1.00 84.80  ? 12  HIS A N   1 
ATOM   82    C CA  . HIS A 1 12  ? 138.053 16.120  178.923 1.00 77.30  ? 12  HIS A CA  1 
ATOM   83    C C   . HIS A 1 12  ? 138.355 17.613  178.975 1.00 80.48  ? 12  HIS A C   1 
ATOM   84    O O   . HIS A 1 12  ? 139.451 17.995  179.377 1.00 90.60  ? 12  HIS A O   1 
ATOM   85    C CB  . HIS A 1 12  ? 138.317 15.558  177.525 1.00 76.77  ? 12  HIS A CB  1 
ATOM   86    C CG  . HIS A 1 12  ? 138.474 14.067  177.514 1.00 90.40  ? 12  HIS A CG  1 
ATOM   87    N ND1 . HIS A 1 12  ? 137.905 13.258  178.465 1.00 95.55  ? 12  HIS A ND1 1 
ATOM   88    C CD2 . HIS A 1 12  ? 139.159 13.249  176.677 1.00 119.88 ? 12  HIS A CD2 1 
ATOM   89    C CE1 . HIS A 1 12  ? 138.219 11.996  178.217 1.00 102.01 ? 12  HIS A CE1 1 
ATOM   90    N NE2 . HIS A 1 12  ? 138.974 11.965  177.135 1.00 117.36 ? 12  HIS A NE2 1 
ATOM   91    N N   . LEU A 1 13  ? 137.396 18.447  178.583 1.00 77.38  ? 13  LEU A N   1 
ATOM   92    C CA  . LEU A 1 13  ? 137.575 19.894  178.684 1.00 78.59  ? 13  LEU A CA  1 
ATOM   93    C C   . LEU A 1 13  ? 136.290 20.686  178.456 1.00 80.33  ? 13  LEU A C   1 
ATOM   94    O O   . LEU A 1 13  ? 135.309 20.175  177.913 1.00 85.24  ? 13  LEU A O   1 
ATOM   95    C CB  . LEU A 1 13  ? 138.652 20.389  177.707 1.00 79.20  ? 13  LEU A CB  1 
ATOM   96    C CG  . LEU A 1 13  ? 138.638 19.944  176.247 1.00 97.00  ? 13  LEU A CG  1 
ATOM   97    C CD1 . LEU A 1 13  ? 138.513 21.144  175.330 1.00 104.17 ? 13  LEU A CD1 1 
ATOM   98    C CD2 . LEU A 1 13  ? 139.905 19.170  175.938 1.00 104.22 ? 13  LEU A CD2 1 
ATOM   99    N N   . GLN A 1 14  ? 136.320 21.941  178.892 1.00 82.95  ? 14  GLN A N   1 
ATOM   100   C CA  . GLN A 1 14  ? 135.230 22.886  178.699 1.00 80.82  ? 14  GLN A CA  1 
ATOM   101   C C   . GLN A 1 14  ? 135.704 23.920  177.689 1.00 86.89  ? 14  GLN A C   1 
ATOM   102   O O   . GLN A 1 14  ? 136.643 24.667  177.960 1.00 98.74  ? 14  GLN A O   1 
ATOM   103   C CB  . GLN A 1 14  ? 134.852 23.546  180.029 1.00 84.79  ? 14  GLN A CB  1 
ATOM   104   C CG  . GLN A 1 14  ? 133.765 24.617  179.961 1.00 84.19  ? 14  GLN A CG  1 
ATOM   105   C CD  . GLN A 1 14  ? 132.409 24.077  179.564 1.00 91.70  ? 14  GLN A CD  1 
ATOM   106   O OE1 . GLN A 1 14  ? 131.945 24.291  178.446 1.00 81.08  ? 14  GLN A OE1 1 
ATOM   107   N NE2 . GLN A 1 14  ? 131.756 23.378  180.490 1.00 118.86 ? 14  GLN A NE2 1 
ATOM   108   N N   . LEU A 1 15  ? 135.042 23.979  176.536 1.00 82.53  ? 15  LEU A N   1 
ATOM   109   C CA  . LEU A 1 15  ? 135.468 24.873  175.461 1.00 82.64  ? 15  LEU A CA  1 
ATOM   110   C C   . LEU A 1 15  ? 135.338 26.342  175.832 1.00 92.85  ? 15  LEU A C   1 
ATOM   111   O O   . LEU A 1 15  ? 136.065 27.182  175.309 1.00 108.60 ? 15  LEU A O   1 
ATOM   112   C CB  . LEU A 1 15  ? 134.677 24.595  174.182 1.00 77.32  ? 15  LEU A CB  1 
ATOM   113   C CG  . LEU A 1 15  ? 134.867 23.201  173.586 1.00 77.50  ? 15  LEU A CG  1 
ATOM   114   C CD1 . LEU A 1 15  ? 133.801 22.912  172.551 1.00 75.95  ? 15  LEU A CD1 1 
ATOM   115   C CD2 . LEU A 1 15  ? 136.254 23.053  172.987 1.00 78.21  ? 15  LEU A CD2 1 
ATOM   116   N N   . GLN A 1 16  ? 134.414 26.648  176.735 1.00 84.89  ? 16  GLN A N   1 
ATOM   117   C CA  . GLN A 1 16  ? 134.228 28.016  177.202 1.00 87.04  ? 16  GLN A CA  1 
ATOM   118   C C   . GLN A 1 16  ? 135.487 28.506  177.919 1.00 92.31  ? 16  GLN A C   1 
ATOM   119   O O   . GLN A 1 16  ? 135.763 29.704  177.965 1.00 105.82 ? 16  GLN A O   1 
ATOM   120   C CB  . GLN A 1 16  ? 133.013 28.114  178.124 1.00 99.34  ? 16  GLN A CB  1 
ATOM   121   C CG  . GLN A 1 16  ? 131.745 27.487  177.543 1.00 113.59 ? 16  GLN A CG  1 
ATOM   122   C CD  . GLN A 1 16  ? 130.920 28.452  176.702 1.00 126.12 ? 16  GLN A CD  1 
ATOM   123   O OE1 . GLN A 1 16  ? 129.749 28.693  176.993 1.00 111.81 ? 16  GLN A OE1 1 
ATOM   124   N NE2 . GLN A 1 16  ? 131.519 28.988  175.642 1.00 138.75 ? 16  GLN A NE2 1 
ATOM   125   N N   . ASN A 1 17  ? 136.252 27.573  178.482 1.00 100.02 ? 17  ASN A N   1 
ATOM   126   C CA  . ASN A 1 17  ? 137.500 27.918  179.163 1.00 99.92  ? 17  ASN A CA  1 
ATOM   127   C C   . ASN A 1 17  ? 138.654 28.155  178.205 1.00 102.03 ? 17  ASN A C   1 
ATOM   128   O O   . ASN A 1 17  ? 139.793 28.339  178.626 1.00 109.41 ? 17  ASN A O   1 
ATOM   129   C CB  . ASN A 1 17  ? 137.882 26.819  180.146 1.00 100.74 ? 17  ASN A CB  1 
ATOM   130   C CG  . ASN A 1 17  ? 136.855 26.644  181.233 1.00 103.15 ? 17  ASN A CG  1 
ATOM   131   O OD1 . ASN A 1 17  ? 136.783 25.599  181.872 1.00 109.71 ? 17  ASN A OD1 1 
ATOM   132   N ND2 . ASN A 1 17  ? 136.061 27.681  181.464 1.00 98.50  ? 17  ASN A ND2 1 
ATOM   133   N N   . LEU A 1 18  ? 138.347 28.181  176.916 1.00 105.46 ? 18  LEU A N   1 
ATOM   134   C CA  . LEU A 1 18  ? 139.364 28.393  175.898 1.00 102.87 ? 18  LEU A CA  1 
ATOM   135   C C   . LEU A 1 18  ? 138.999 29.568  174.996 1.00 110.79 ? 18  LEU A C   1 
ATOM   136   O O   . LEU A 1 18  ? 139.470 29.666  173.863 1.00 106.47 ? 18  LEU A O   1 
ATOM   137   C CB  . LEU A 1 18  ? 139.566 27.120  175.074 1.00 90.21  ? 18  LEU A CB  1 
ATOM   138   C CG  . LEU A 1 18  ? 140.182 25.935  175.818 1.00 93.09  ? 18  LEU A CG  1 
ATOM   139   C CD1 . LEU A 1 18  ? 139.954 24.651  175.045 1.00 91.39  ? 18  LEU A CD1 1 
ATOM   140   C CD2 . LEU A 1 18  ? 141.669 26.158  176.043 1.00 102.82 ? 18  LEU A CD2 1 
ATOM   141   N N   . GLY A 1 19  ? 138.160 30.460  175.517 1.00 118.58 ? 19  GLY A N   1 
ATOM   142   C CA  . GLY A 1 19  ? 137.740 31.656  174.805 1.00 122.63 ? 19  GLY A CA  1 
ATOM   143   C C   . GLY A 1 19  ? 136.772 31.405  173.667 1.00 120.60 ? 19  GLY A C   1 
ATOM   144   O O   . GLY A 1 19  ? 136.450 32.312  172.899 1.00 136.20 ? 19  GLY A O   1 
ATOM   145   N N   . ILE A 1 20  ? 136.303 30.168  173.555 1.00 101.31 ? 20  ILE A N   1 
ATOM   146   C CA  . ILE A 1 20  ? 135.349 29.820  172.510 1.00 86.64  ? 20  ILE A CA  1 
ATOM   147   C C   . ILE A 1 20  ? 133.985 30.424  172.815 1.00 105.41 ? 20  ILE A C   1 
ATOM   148   O O   . ILE A 1 20  ? 133.436 30.217  173.897 1.00 126.11 ? 20  ILE A O   1 
ATOM   149   C CB  . ILE A 1 20  ? 135.202 28.302  172.348 1.00 84.55  ? 20  ILE A CB  1 
ATOM   150   C CG1 . ILE A 1 20  ? 136.554 27.683  172.007 1.00 88.14  ? 20  ILE A CG1 1 
ATOM   151   C CG2 . ILE A 1 20  ? 134.171 27.983  171.279 1.00 87.22  ? 20  ILE A CG2 1 
ATOM   152   C CD1 . ILE A 1 20  ? 137.189 28.284  170.778 1.00 88.11  ? 20  ILE A CD1 1 
ATOM   153   N N   . ASN A 1 21  ? 133.439 31.159  171.853 1.00 99.49  ? 21  ASN A N   1 
ATOM   154   C CA  . ASN A 1 21  ? 132.134 31.795  172.001 1.00 93.95  ? 21  ASN A CA  1 
ATOM   155   C C   . ASN A 1 21  ? 131.018 30.749  172.051 1.00 85.00  ? 21  ASN A C   1 
ATOM   156   O O   . ASN A 1 21  ? 130.934 29.901  171.163 1.00 85.54  ? 21  ASN A O   1 
ATOM   157   C CB  . ASN A 1 21  ? 131.905 32.772  170.846 1.00 98.40  ? 21  ASN A CB  1 
ATOM   158   C CG  . ASN A 1 21  ? 130.832 33.802  171.146 1.00 108.30 ? 21  ASN A CG  1 
ATOM   159   O OD1 . ASN A 1 21  ? 129.708 33.464  171.519 1.00 107.48 ? 21  ASN A OD1 1 
ATOM   160   N ND2 . ASN A 1 21  ? 131.173 35.073  170.958 1.00 110.65 ? 21  ASN A ND2 1 
ATOM   161   N N   . PRO A 1 22  ? 130.174 30.790  173.102 1.00 82.83  ? 22  PRO A N   1 
ATOM   162   C CA  . PRO A 1 22  ? 129.063 29.840  173.254 1.00 81.28  ? 22  PRO A CA  1 
ATOM   163   C C   . PRO A 1 22  ? 128.191 29.744  172.006 1.00 92.69  ? 22  PRO A C   1 
ATOM   164   O O   . PRO A 1 22  ? 127.668 28.671  171.697 1.00 104.89 ? 22  PRO A O   1 
ATOM   165   C CB  . PRO A 1 22  ? 128.255 30.419  174.424 1.00 93.17  ? 22  PRO A CB  1 
ATOM   166   C CG  . PRO A 1 22  ? 128.728 31.830  174.570 1.00 97.56  ? 22  PRO A CG  1 
ATOM   167   C CD  . PRO A 1 22  ? 130.170 31.791  174.179 1.00 86.26  ? 22  PRO A CD  1 
ATOM   168   N N   . ALA A 1 23  ? 128.040 30.864  171.306 1.00 92.58  ? 23  ALA A N   1 
ATOM   169   C CA  . ALA A 1 23  ? 127.226 30.915  170.100 1.00 86.16  ? 23  ALA A CA  1 
ATOM   170   C C   . ALA A 1 23  ? 127.780 30.021  168.998 1.00 87.02  ? 23  ALA A C   1 
ATOM   171   O O   . ALA A 1 23  ? 127.025 29.496  168.178 1.00 80.70  ? 23  ALA A O   1 
ATOM   172   C CB  . ALA A 1 23  ? 127.114 32.351  169.604 1.00 84.57  ? 23  ALA A CB  1 
ATOM   173   N N   . ASN A 1 24  ? 129.095 29.847  168.976 1.00 94.66  ? 24  ASN A N   1 
ATOM   174   C CA  . ASN A 1 24  ? 129.707 29.045  167.930 1.00 81.44  ? 24  ASN A CA  1 
ATOM   175   C C   . ASN A 1 24  ? 129.755 27.559  168.271 1.00 78.74  ? 24  ASN A C   1 
ATOM   176   O O   . ASN A 1 24  ? 130.234 26.749  167.486 1.00 81.45  ? 24  ASN A O   1 
ATOM   177   C CB  . ASN A 1 24  ? 131.097 29.569  167.639 1.00 81.75  ? 24  ASN A CB  1 
ATOM   178   C CG  . ASN A 1 24  ? 131.069 31.009  167.186 1.00 86.88  ? 24  ASN A CG  1 
ATOM   179   O OD1 . ASN A 1 24  ? 131.669 31.873  167.818 1.00 88.60  ? 24  ASN A OD1 1 
ATOM   180   N ND2 . ASN A 1 24  ? 130.295 31.291  166.146 1.00 90.41  ? 24  ASN A ND2 1 
ATOM   181   N N   . ILE A 1 25  ? 129.258 27.199  169.447 1.00 72.51  ? 25  ILE A N   1 
ATOM   182   C CA  . ILE A 1 25  ? 129.239 25.794  169.848 1.00 70.40  ? 25  ILE A CA  1 
ATOM   183   C C   . ILE A 1 25  ? 127.963 25.125  169.341 1.00 78.96  ? 25  ILE A C   1 
ATOM   184   O O   . ILE A 1 25  ? 126.962 25.007  170.050 1.00 111.62 ? 25  ILE A O   1 
ATOM   185   C CB  . ILE A 1 25  ? 129.381 25.631  171.375 1.00 77.16  ? 25  ILE A CB  1 
ATOM   186   C CG1 . ILE A 1 25  ? 130.706 26.235  171.846 1.00 79.17  ? 25  ILE A CG1 1 
ATOM   187   C CG2 . ILE A 1 25  ? 129.387 24.168  171.750 1.00 78.21  ? 25  ILE A CG2 1 
ATOM   188   C CD1 . ILE A 1 25  ? 130.826 26.312  173.352 1.00 76.74  ? 25  ILE A CD1 1 
ATOM   189   N N   . GLY A 1 26  ? 128.027 24.711  168.079 1.00 72.47  ? 26  GLY A N   1 
ATOM   190   C CA  . GLY A 1 26  ? 126.910 24.103  167.388 1.00 73.17  ? 26  GLY A CA  1 
ATOM   191   C C   . GLY A 1 26  ? 127.320 23.352  166.136 1.00 74.33  ? 26  GLY A C   1 
ATOM   192   O O   . GLY A 1 26  ? 128.433 23.513  165.632 1.00 89.57  ? 26  GLY A O   1 
ATOM   193   N N   . PHE A 1 27  ? 126.411 22.501  165.667 1.00 72.09  ? 27  PHE A N   1 
ATOM   194   C CA  . PHE A 1 27  ? 126.599 21.664  164.480 1.00 63.83  ? 27  PHE A CA  1 
ATOM   195   C C   . PHE A 1 27  ? 127.137 22.395  163.254 1.00 73.67  ? 27  PHE A C   1 
ATOM   196   O O   . PHE A 1 27  ? 127.989 21.870  162.537 1.00 65.14  ? 27  PHE A O   1 
ATOM   197   C CB  . PHE A 1 27  ? 125.264 21.009  164.124 1.00 63.20  ? 27  PHE A CB  1 
ATOM   198   C CG  . PHE A 1 27  ? 125.348 19.990  163.017 1.00 71.97  ? 27  PHE A CG  1 
ATOM   199   C CD1 . PHE A 1 27  ? 125.898 18.736  163.228 1.00 92.08  ? 27  PHE A CD1 1 
ATOM   200   C CD2 . PHE A 1 27  ? 124.847 20.291  161.762 1.00 66.54  ? 27  PHE A CD2 1 
ATOM   201   C CE1 . PHE A 1 27  ? 125.958 17.810  162.197 1.00 89.25  ? 27  PHE A CE1 1 
ATOM   202   C CE2 . PHE A 1 27  ? 124.903 19.376  160.732 1.00 71.52  ? 27  PHE A CE2 1 
ATOM   203   C CZ  . PHE A 1 27  ? 125.459 18.131  160.948 1.00 76.65  ? 27  PHE A CZ  1 
ATOM   204   N N   . SER A 1 28  ? 126.648 23.610  163.030 1.00 77.98  ? 28  SER A N   1 
ATOM   205   C CA  . SER A 1 28  ? 127.019 24.394  161.852 1.00 74.53  ? 28  SER A CA  1 
ATOM   206   C C   . SER A 1 28  ? 128.382 25.077  161.938 1.00 73.82  ? 28  SER A C   1 
ATOM   207   O O   . SER A 1 28  ? 128.987 25.388  160.913 1.00 85.22  ? 28  SER A O   1 
ATOM   208   C CB  . SER A 1 28  ? 125.948 25.451  161.572 1.00 83.01  ? 28  SER A CB  1 
ATOM   209   O OG  . SER A 1 28  ? 125.762 26.299  162.690 1.00 104.11 ? 28  SER A OG  1 
ATOM   210   N N   . THR A 1 29  ? 128.858 25.332  163.151 1.00 67.58  ? 29  THR A N   1 
ATOM   211   C CA  . THR A 1 29  ? 130.107 26.075  163.321 1.00 84.17  ? 29  THR A CA  1 
ATOM   212   C C   . THR A 1 29  ? 131.230 25.248  163.952 1.00 80.54  ? 29  THR A C   1 
ATOM   213   O O   . THR A 1 29  ? 132.404 25.597  163.834 1.00 87.55  ? 29  THR A O   1 
ATOM   214   C CB  . THR A 1 29  ? 129.877 27.351  164.155 1.00 100.57 ? 29  THR A CB  1 
ATOM   215   O OG1 . THR A 1 29  ? 128.954 27.063  165.212 1.00 120.30 ? 29  THR A OG1 1 
ATOM   216   C CG2 . THR A 1 29  ? 129.279 28.442  163.277 1.00 99.78  ? 29  THR A CG2 1 
ATOM   217   N N   . LEU A 1 30  ? 130.870 24.165  164.632 1.00 63.06  ? 30  LEU A N   1 
ATOM   218   C CA  . LEU A 1 30  ? 131.863 23.307  165.277 1.00 62.00  ? 30  LEU A CA  1 
ATOM   219   C C   . LEU A 1 30  ? 131.907 21.921  164.637 1.00 70.27  ? 30  LEU A C   1 
ATOM   220   O O   . LEU A 1 30  ? 130.876 21.275  164.465 1.00 66.88  ? 30  LEU A O   1 
ATOM   221   C CB  . LEU A 1 30  ? 131.564 23.181  166.769 1.00 61.88  ? 30  LEU A CB  1 
ATOM   222   C CG  . LEU A 1 30  ? 132.673 22.703  167.706 1.00 64.18  ? 30  LEU A CG  1 
ATOM   223   C CD1 . LEU A 1 30  ? 132.539 23.363  169.061 1.00 65.21  ? 30  LEU A CD1 1 
ATOM   224   C CD2 . LEU A 1 30  ? 132.638 21.192  167.855 1.00 63.53  ? 30  LEU A CD2 1 
ATOM   225   N N   . THR A 1 31  ? 133.104 21.467  164.281 1.00 81.19  ? 31  THR A N   1 
ATOM   226   C CA  . THR A 1 31  ? 133.264 20.133  163.704 1.00 66.18  ? 31  THR A CA  1 
ATOM   227   C C   . THR A 1 31  ? 134.279 19.286  164.453 1.00 59.59  ? 31  THR A C   1 
ATOM   228   O O   . THR A 1 31  ? 135.296 19.786  164.939 1.00 66.10  ? 31  THR A O   1 
ATOM   229   C CB  . THR A 1 31  ? 133.687 20.183  162.226 1.00 69.80  ? 31  THR A CB  1 
ATOM   230   O OG1 . THR A 1 31  ? 134.983 20.780  162.117 1.00 97.46  ? 31  THR A OG1 1 
ATOM   231   C CG2 . THR A 1 31  ? 132.690 20.982  161.406 1.00 58.75  ? 31  THR A CG2 1 
ATOM   232   N N   . MET A 1 32  ? 133.995 17.992  164.522 1.00 57.69  ? 32  MET A N   1 
ATOM   233   C CA  . MET A 1 32  ? 134.907 17.044  165.132 1.00 58.35  ? 32  MET A CA  1 
ATOM   234   C C   . MET A 1 32  ? 134.867 15.780  164.282 1.00 60.41  ? 32  MET A C   1 
ATOM   235   O O   . MET A 1 32  ? 133.867 15.068  164.260 1.00 69.34  ? 32  MET A O   1 
ATOM   236   C CB  . MET A 1 32  ? 134.519 16.772  166.594 1.00 61.15  ? 32  MET A CB  1 
ATOM   237   C CG  . MET A 1 32  ? 135.649 16.289  167.510 1.00 86.42  ? 32  MET A CG  1 
ATOM   238   S SD  . MET A 1 32  ? 135.028 15.586  169.056 1.00 85.63  ? 32  MET A SD  1 
ATOM   239   C CE  . MET A 1 32  ? 136.542 15.251  169.960 1.00 108.84 ? 32  MET A CE  1 
ATOM   240   N N   . GLU A 1 33  ? 135.983 15.493  163.617 1.00 66.30  ? 33  GLU A N   1 
ATOM   241   C CA  . GLU A 1 33  ? 136.084 14.398  162.653 1.00 61.47  ? 33  GLU A CA  1 
ATOM   242   C C   . GLU A 1 33  ? 136.852 13.216  163.236 1.00 64.20  ? 33  GLU A C   1 
ATOM   243   O O   . GLU A 1 33  ? 136.885 12.130  162.649 1.00 79.13  ? 33  GLU A O   1 
ATOM   244   C CB  . GLU A 1 33  ? 136.770 14.882  161.363 1.00 67.21  ? 33  GLU A CB  1 
ATOM   245   C CG  . GLU A 1 33  ? 136.033 15.963  160.572 1.00 82.53  ? 33  GLU A CG  1 
ATOM   246   C CD  . GLU A 1 33  ? 134.806 15.435  159.847 1.00 93.73  ? 33  GLU A CD  1 
ATOM   247   O OE1 . GLU A 1 33  ? 134.908 14.369  159.200 1.00 98.54  ? 33  GLU A OE1 1 
ATOM   248   O OE2 . GLU A 1 33  ? 133.735 16.075  159.926 1.00 101.74 ? 33  GLU A OE2 1 
ATOM   249   N N   . SER A 1 34  ? 137.477 13.446  164.384 1.00 60.88  ? 34  SER A N   1 
ATOM   250   C CA  . SER A 1 34  ? 138.210 12.413  165.099 1.00 59.54  ? 34  SER A CA  1 
ATOM   251   C C   . SER A 1 34  ? 138.475 12.900  166.518 1.00 63.30  ? 34  SER A C   1 
ATOM   252   O O   . SER A 1 34  ? 138.225 14.063  166.834 1.00 63.33  ? 34  SER A O   1 
ATOM   253   C CB  . SER A 1 34  ? 139.520 12.069  164.392 1.00 68.62  ? 34  SER A CB  1 
ATOM   254   O OG  . SER A 1 34  ? 140.368 13.202  164.289 1.00 80.01  ? 34  SER A OG  1 
ATOM   255   N N   . ASP A 1 35  ? 138.956 12.023  167.390 1.00 62.52  ? 35  ASP A N   1 
ATOM   256   C CA  . ASP A 1 35  ? 139.253 12.437  168.756 1.00 63.10  ? 35  ASP A CA  1 
ATOM   257   C C   . ASP A 1 35  ? 140.469 13.368  168.849 1.00 66.60  ? 35  ASP A C   1 
ATOM   258   O O   . ASP A 1 35  ? 140.798 13.845  169.932 1.00 82.69  ? 35  ASP A O   1 
ATOM   259   C CB  . ASP A 1 35  ? 139.448 11.208  169.649 1.00 68.74  ? 35  ASP A CB  1 
ATOM   260   C CG  . ASP A 1 35  ? 140.597 10.322  169.197 1.00 104.33 ? 35  ASP A CG  1 
ATOM   261   O OD1 . ASP A 1 35  ? 141.303 10.676  168.231 1.00 110.85 ? 35  ASP A OD1 1 
ATOM   262   O OD2 . ASP A 1 35  ? 140.793 9.252   169.810 1.00 132.95 ? 35  ASP A OD2 1 
ATOM   263   N N   . LYS A 1 36  ? 141.138 13.598  167.719 1.00 64.32  ? 36  LYS A N   1 
ATOM   264   C CA  . LYS A 1 36  ? 142.370 14.391  167.670 1.00 78.79  ? 36  LYS A CA  1 
ATOM   265   C C   . LYS A 1 36  ? 142.185 15.919  167.602 1.00 78.53  ? 36  LYS A C   1 
ATOM   266   O O   . LYS A 1 36  ? 142.922 16.659  168.254 1.00 88.02  ? 36  LYS A O   1 
ATOM   267   C CB  . LYS A 1 36  ? 143.217 13.910  166.502 1.00 71.75  ? 36  LYS A CB  1 
ATOM   268   C CG  . LYS A 1 36  ? 143.535 12.432  166.625 1.00 74.20  ? 36  LYS A CG  1 
ATOM   269   C CD  . LYS A 1 36  ? 144.722 12.015  165.785 1.00 93.83  ? 36  LYS A CD  1 
ATOM   270   C CE  . LYS A 1 36  ? 144.830 10.499  165.759 1.00 109.02 ? 36  LYS A CE  1 
ATOM   271   N NZ  . LYS A 1 36  ? 144.674 9.936   167.125 1.00 122.23 ? 36  LYS A NZ  1 
ATOM   272   N N   . PHE A 1 37  ? 141.228 16.397  166.809 1.00 65.92  ? 37  PHE A N   1 
ATOM   273   C CA  . PHE A 1 37  ? 141.008 17.841  166.694 1.00 66.21  ? 37  PHE A CA  1 
ATOM   274   C C   . PHE A 1 37  ? 139.550 18.269  166.790 1.00 72.04  ? 37  PHE A C   1 
ATOM   275   O O   . PHE A 1 37  ? 138.624 17.515  166.483 1.00 94.83  ? 37  PHE A O   1 
ATOM   276   C CB  . PHE A 1 37  ? 141.550 18.405  165.373 1.00 68.04  ? 37  PHE A CB  1 
ATOM   277   C CG  . PHE A 1 37  ? 142.960 18.018  165.057 1.00 77.51  ? 37  PHE A CG  1 
ATOM   278   C CD1 . PHE A 1 37  ? 143.235 16.926  164.258 1.00 78.80  ? 37  PHE A CD1 1 
ATOM   279   C CD2 . PHE A 1 37  ? 144.013 18.787  165.523 1.00 82.36  ? 37  PHE A CD2 1 
ATOM   280   C CE1 . PHE A 1 37  ? 144.537 16.591  163.952 1.00 77.43  ? 37  PHE A CE1 1 
ATOM   281   C CE2 . PHE A 1 37  ? 145.314 18.458  165.226 1.00 88.74  ? 37  PHE A CE2 1 
ATOM   282   C CZ  . PHE A 1 37  ? 145.578 17.358  164.437 1.00 95.24  ? 37  PHE A CZ  1 
ATOM   283   N N   . ILE A 1 38  ? 139.378 19.514  167.220 1.00 64.60  ? 38  ILE A N   1 
ATOM   284   C CA  . ILE A 1 38  ? 138.088 20.186  167.250 1.00 66.46  ? 38  ILE A CA  1 
ATOM   285   C C   . ILE A 1 38  ? 138.244 21.507  166.513 1.00 75.86  ? 38  ILE A C   1 
ATOM   286   O O   . ILE A 1 38  ? 139.039 22.358  166.904 1.00 72.51  ? 38  ILE A O   1 
ATOM   287   C CB  . ILE A 1 38  ? 137.589 20.421  168.682 1.00 69.60  ? 38  ILE A CB  1 
ATOM   288   C CG1 . ILE A 1 38  ? 137.246 19.086  169.341 1.00 74.95  ? 38  ILE A CG1 1 
ATOM   289   C CG2 . ILE A 1 38  ? 136.369 21.324  168.685 1.00 64.09  ? 38  ILE A CG2 1 
ATOM   290   C CD1 . ILE A 1 38  ? 137.014 19.184  170.827 1.00 81.46  ? 38  ILE A CD1 1 
ATOM   291   N N   . CYS A 1 39  ? 137.464 21.683  165.455 1.00 71.81  ? 39  CYS A N   1 
ATOM   292   C CA  . CYS A 1 39  ? 137.584 22.866  164.616 1.00 69.12  ? 39  CYS A CA  1 
ATOM   293   C C   . CYS A 1 39  ? 136.347 23.749  164.694 1.00 83.66  ? 39  CYS A C   1 
ATOM   294   O O   . CYS A 1 39  ? 135.236 23.319  164.396 1.00 95.21  ? 39  CYS A O   1 
ATOM   295   C CB  . CYS A 1 39  ? 137.839 22.448  163.169 1.00 69.60  ? 39  CYS A CB  1 
ATOM   296   S SG  . CYS A 1 39  ? 137.842 23.794  161.982 1.00 102.05 ? 39  CYS A SG  1 
ATOM   297   N N   . ILE A 1 40  ? 136.554 24.990  165.114 1.00 81.51  ? 40  ILE A N   1 
ATOM   298   C CA  . ILE A 1 40  ? 135.458 25.929  165.294 1.00 88.28  ? 40  ILE A CA  1 
ATOM   299   C C   . ILE A 1 40  ? 135.599 27.134  164.372 1.00 84.90  ? 40  ILE A C   1 
ATOM   300   O O   . ILE A 1 40  ? 136.692 27.664  164.187 1.00 95.87  ? 40  ILE A O   1 
ATOM   301   C CB  . ILE A 1 40  ? 135.356 26.427  166.749 1.00 91.74  ? 40  ILE A CB  1 
ATOM   302   C CG1 . ILE A 1 40  ? 135.516 25.268  167.736 1.00 84.81  ? 40  ILE A CG1 1 
ATOM   303   C CG2 . ILE A 1 40  ? 134.030 27.139  166.972 1.00 97.14  ? 40  ILE A CG2 1 
ATOM   304   C CD1 . ILE A 1 40  ? 136.928 25.088  168.265 1.00 96.16  ? 40  ILE A CD1 1 
ATOM   305   N N   . ARG A 1 41  ? 134.483 27.566  163.800 1.00 76.06  ? 41  ARG A N   1 
ATOM   306   C CA  . ARG A 1 41  ? 134.462 28.763  162.971 1.00 74.76  ? 41  ARG A CA  1 
ATOM   307   C C   . ARG A 1 41  ? 133.825 29.926  163.713 1.00 90.28  ? 41  ARG A C   1 
ATOM   308   O O   . ARG A 1 41  ? 132.647 29.895  164.052 1.00 112.33 ? 41  ARG A O   1 
ATOM   309   C CB  . ARG A 1 41  ? 133.712 28.516  161.666 1.00 74.74  ? 41  ARG A CB  1 
ATOM   310   C CG  . ARG A 1 41  ? 134.317 27.445  160.781 1.00 96.44  ? 41  ARG A CG  1 
ATOM   311   C CD  . ARG A 1 41  ? 133.634 27.392  159.416 1.00 103.45 ? 41  ARG A CD  1 
ATOM   312   N NE  . ARG A 1 41  ? 132.194 27.158  159.519 1.00 95.57  ? 41  ARG A NE  1 
ATOM   313   C CZ  . ARG A 1 41  ? 131.256 28.089  159.378 1.00 94.57  ? 41  ARG A CZ  1 
ATOM   314   N NH1 . ARG A 1 41  ? 129.977 27.758  159.492 1.00 114.80 ? 41  ARG A NH1 1 
ATOM   315   N NH2 . ARG A 1 41  ? 131.591 29.344  159.129 1.00 84.56  ? 41  ARG A NH2 1 
ATOM   316   N N   . GLU A 1 42  ? 134.619 30.954  163.972 1.00 84.61  ? 42  GLU A N   1 
ATOM   317   C CA  . GLU A 1 42  ? 134.145 32.122  164.693 1.00 87.20  ? 42  GLU A CA  1 
ATOM   318   C C   . GLU A 1 42  ? 134.354 33.377  163.850 1.00 98.79  ? 42  GLU A C   1 
ATOM   319   O O   . GLU A 1 42  ? 135.076 33.355  162.852 1.00 99.23  ? 42  GLU A O   1 
ATOM   320   C CB  . GLU A 1 42  ? 134.863 32.239  166.042 1.00 97.28  ? 42  GLU A CB  1 
ATOM   321   C CG  . GLU A 1 42  ? 134.799 30.992  166.913 1.00 105.73 ? 42  GLU A CG  1 
ATOM   322   C CD  . GLU A 1 42  ? 135.042 31.298  168.378 1.00 118.12 ? 42  GLU A CD  1 
ATOM   323   O OE1 . GLU A 1 42  ? 135.953 32.102  168.652 1.00 120.32 ? 42  GLU A OE1 1 
ATOM   324   O OE2 . GLU A 1 42  ? 134.333 30.754  169.250 1.00 122.80 ? 42  GLU A OE2 1 
ATOM   325   N N   . LYS A 1 43  ? 133.724 34.470  164.260 1.00 103.23 ? 43  LYS A N   1 
ATOM   326   C CA  . LYS A 1 43  ? 133.911 35.747  163.595 1.00 101.95 ? 43  LYS A CA  1 
ATOM   327   C C   . LYS A 1 43  ? 134.271 36.806  164.629 1.00 112.68 ? 43  LYS A C   1 
ATOM   328   O O   . LYS A 1 43  ? 133.419 37.261  165.392 1.00 120.71 ? 43  LYS A O   1 
ATOM   329   C CB  . LYS A 1 43  ? 132.648 36.135  162.822 1.00 107.65 ? 43  LYS A CB  1 
ATOM   330   C CG  . LYS A 1 43  ? 132.878 37.077  161.647 1.00 113.37 ? 43  LYS A CG  1 
ATOM   331   C CD  . LYS A 1 43  ? 131.550 37.532  161.051 1.00 117.26 ? 43  LYS A CD  1 
ATOM   332   C CE  . LYS A 1 43  ? 131.658 37.824  159.558 1.00 119.47 ? 43  LYS A CE  1 
ATOM   333   N NZ  . LYS A 1 43  ? 132.433 39.070  159.285 1.00 118.60 ? 43  LYS A NZ  1 
ATOM   334   N N   . VAL A 1 44  ? 135.541 37.197  164.651 1.00 115.98 ? 44  VAL A N   1 
ATOM   335   C CA  . VAL A 1 44  ? 135.985 38.262  165.543 1.00 125.92 ? 44  VAL A CA  1 
ATOM   336   C C   . VAL A 1 44  ? 135.953 39.627  164.871 1.00 133.82 ? 44  VAL A C   1 
ATOM   337   O O   . VAL A 1 44  ? 136.697 39.871  163.922 1.00 126.23 ? 44  VAL A O   1 
ATOM   338   C CB  . VAL A 1 44  ? 137.422 37.995  166.056 1.00 128.68 ? 44  VAL A CB  1 
ATOM   339   C CG1 . VAL A 1 44  ? 137.911 39.164  166.900 1.00 133.10 ? 44  VAL A CG1 1 
ATOM   340   C CG2 . VAL A 1 44  ? 137.476 36.695  166.846 1.00 127.63 ? 44  VAL A CG2 1 
ATOM   341   N N   . GLY A 1 45  ? 135.111 40.519  165.390 1.00 142.56 ? 45  GLY A N   1 
ATOM   342   C CA  . GLY A 1 45  ? 135.125 41.916  164.991 1.00 145.68 ? 45  GLY A CA  1 
ATOM   343   C C   . GLY A 1 45  ? 135.104 42.193  163.500 1.00 149.91 ? 45  GLY A C   1 
ATOM   344   O O   . GLY A 1 45  ? 136.012 42.860  163.000 1.00 163.46 ? 45  GLY A O   1 
ATOM   345   N N   . GLU A 1 46  ? 134.136 41.606  162.791 1.00 137.76 ? 46  GLU A N   1 
ATOM   346   C CA  . GLU A 1 46  ? 134.018 41.744  161.331 1.00 144.09 ? 46  GLU A CA  1 
ATOM   347   C C   . GLU A 1 46  ? 135.103 40.964  160.586 1.00 141.00 ? 46  GLU A C   1 
ATOM   348   O O   . GLU A 1 46  ? 135.175 41.022  159.358 1.00 129.24 ? 46  GLU A O   1 
ATOM   349   C CB  . GLU A 1 46  ? 134.048 43.235  160.928 1.00 152.37 ? 46  GLU A CB  1 
ATOM   350   C CG  . GLU A 1 46  ? 132.690 43.919  160.763 1.00 160.71 ? 46  GLU A CG  1 
ATOM   351   C CD  . GLU A 1 46  ? 132.048 43.586  159.418 1.00 166.34 ? 46  GLU A CD  1 
ATOM   352   O OE1 . GLU A 1 46  ? 132.670 43.903  158.379 1.00 168.45 ? 46  GLU A OE1 1 
ATOM   353   O OE2 . GLU A 1 46  ? 130.945 43.005  159.382 1.00 160.81 ? 46  GLU A OE2 1 
ATOM   354   N N   . GLN A 1 47  ? 135.924 40.219  161.326 1.00 145.63 ? 47  GLN A N   1 
ATOM   355   C CA  . GLN A 1 47  ? 136.895 39.309  160.726 1.00 142.48 ? 47  GLN A CA  1 
ATOM   356   C C   . GLN A 1 47  ? 136.627 37.846  161.100 1.00 136.00 ? 47  GLN A C   1 
ATOM   357   O O   . GLN A 1 47  ? 136.514 37.495  162.275 1.00 142.11 ? 47  GLN A O   1 
ATOM   358   C CB  . GLN A 1 47  ? 138.310 39.737  161.135 1.00 142.70 ? 47  GLN A CB  1 
ATOM   359   C CG  . GLN A 1 47  ? 139.309 38.616  161.334 1.00 145.43 ? 47  GLN A CG  1 
ATOM   360   C CD  . GLN A 1 47  ? 140.221 38.883  162.512 1.00 157.78 ? 47  GLN A CD  1 
ATOM   361   O OE1 . GLN A 1 47  ? 141.022 38.033  162.897 1.00 162.68 ? 47  GLN A OE1 1 
ATOM   362   N NE2 . GLN A 1 47  ? 140.096 40.070  163.100 1.00 160.47 ? 47  GLN A NE2 1 
ATOM   363   N N   . ALA A 1 48  ? 136.536 37.011  160.066 1.00 122.56 ? 48  ALA A N   1 
ATOM   364   C CA  . ALA A 1 48  ? 136.245 35.576  160.161 1.00 115.44 ? 48  ALA A CA  1 
ATOM   365   C C   . ALA A 1 48  ? 137.490 34.694  160.308 1.00 103.61 ? 48  ALA A C   1 
ATOM   366   O O   . ALA A 1 48  ? 138.402 34.786  159.492 1.00 115.15 ? 48  ALA A O   1 
ATOM   367   C CB  . ALA A 1 48  ? 135.445 35.143  158.940 1.00 128.32 ? 48  ALA A CB  1 
ATOM   368   N N   . GLN A 1 49  ? 137.533 33.851  161.339 1.00 90.88  ? 49  GLN A N   1 
ATOM   369   C CA  . GLN A 1 49  ? 138.709 33.016  161.573 1.00 94.90  ? 49  GLN A CA  1 
ATOM   370   C C   . GLN A 1 49  ? 138.332 31.589  161.951 1.00 86.21  ? 49  GLN A C   1 
ATOM   371   O O   . GLN A 1 49  ? 137.177 31.300  162.254 1.00 89.36  ? 49  GLN A O   1 
ATOM   372   C CB  . GLN A 1 49  ? 139.589 33.613  162.670 1.00 109.00 ? 49  GLN A CB  1 
ATOM   373   C CG  . GLN A 1 49  ? 138.877 33.883  163.981 1.00 110.06 ? 49  GLN A CG  1 
ATOM   374   C CD  . GLN A 1 49  ? 139.772 34.580  164.979 1.00 125.27 ? 49  GLN A CD  1 
ATOM   375   O OE1 . GLN A 1 49  ? 139.849 34.207  166.151 1.00 124.10 ? 49  GLN A OE1 1 
ATOM   376   N NE2 . GLN A 1 49  ? 140.450 35.620  164.515 1.00 140.42 ? 49  GLN A NE2 1 
ATOM   377   N N   . VAL A 1 50  ? 139.328 30.705  161.945 1.00 81.73  ? 50  VAL A N   1 
ATOM   378   C CA  . VAL A 1 50  ? 139.131 29.284  162.241 1.00 79.03  ? 50  VAL A CA  1 
ATOM   379   C C   . VAL A 1 50  ? 140.052 28.818  163.357 1.00 87.19  ? 50  VAL A C   1 
ATOM   380   O O   . VAL A 1 50  ? 141.271 28.950  163.268 1.00 106.78 ? 50  VAL A O   1 
ATOM   381   C CB  . VAL A 1 50  ? 139.398 28.407  161.008 1.00 79.73  ? 50  VAL A CB  1 
ATOM   382   C CG1 . VAL A 1 50  ? 139.613 26.952  161.419 1.00 77.93  ? 50  VAL A CG1 1 
ATOM   383   C CG2 . VAL A 1 50  ? 138.274 28.532  160.003 1.00 81.49  ? 50  VAL A CG2 1 
ATOM   384   N N   . VAL A 1 51  ? 139.459 28.266  164.408 1.00 77.59  ? 51  VAL A N   1 
ATOM   385   C CA  . VAL A 1 51  ? 140.236 27.792  165.538 1.00 77.10  ? 51  VAL A CA  1 
ATOM   386   C C   . VAL A 1 51  ? 140.346 26.272  165.536 1.00 77.23  ? 51  VAL A C   1 
ATOM   387   O O   . VAL A 1 51  ? 139.341 25.560  165.533 1.00 86.40  ? 51  VAL A O   1 
ATOM   388   C CB  . VAL A 1 51  ? 139.623 28.256  166.863 1.00 79.12  ? 51  VAL A CB  1 
ATOM   389   C CG1 . VAL A 1 51  ? 140.624 28.095  167.992 1.00 80.02  ? 51  VAL A CG1 1 
ATOM   390   C CG2 . VAL A 1 51  ? 139.171 29.705  166.744 1.00 80.23  ? 51  VAL A CG2 1 
ATOM   391   N N   . ILE A 1 52  ? 141.575 25.773  165.564 1.00 75.76  ? 52  ILE A N   1 
ATOM   392   C CA  . ILE A 1 52  ? 141.788 24.334  165.593 1.00 75.59  ? 52  ILE A CA  1 
ATOM   393   C C   . ILE A 1 52  ? 142.393 23.963  166.932 1.00 92.14  ? 52  ILE A C   1 
ATOM   394   O O   . ILE A 1 52  ? 143.462 24.445  167.304 1.00 125.35 ? 52  ILE A O   1 
ATOM   395   C CB  . ILE A 1 52  ? 142.692 23.846  164.459 1.00 77.35  ? 52  ILE A CB  1 
ATOM   396   C CG1 . ILE A 1 52  ? 142.160 24.317  163.106 1.00 81.48  ? 52  ILE A CG1 1 
ATOM   397   C CG2 . ILE A 1 52  ? 142.835 22.331  164.509 1.00 76.29  ? 52  ILE A CG2 1 
ATOM   398   C CD1 . ILE A 1 52  ? 142.967 25.432  162.499 1.00 110.44 ? 52  ILE A CD1 1 
ATOM   399   N N   . ILE A 1 53  ? 141.712 23.083  167.651 1.00 80.15  ? 53  ILE A N   1 
ATOM   400   C CA  . ILE A 1 53  ? 142.181 22.668  168.962 1.00 75.32  ? 53  ILE A CA  1 
ATOM   401   C C   . ILE A 1 53  ? 142.773 21.271  168.915 1.00 88.57  ? 53  ILE A C   1 
ATOM   402   O O   . ILE A 1 53  ? 142.072 20.279  168.719 1.00 78.06  ? 53  ILE A O   1 
ATOM   403   C CB  . ILE A 1 53  ? 141.058 22.703  169.999 1.00 75.61  ? 53  ILE A CB  1 
ATOM   404   C CG1 . ILE A 1 53  ? 140.506 24.119  170.133 1.00 75.98  ? 53  ILE A CG1 1 
ATOM   405   C CG2 . ILE A 1 53  ? 141.555 22.187  171.335 1.00 76.65  ? 53  ILE A CG2 1 
ATOM   406   C CD1 . ILE A 1 53  ? 139.258 24.196  170.976 1.00 75.85  ? 53  ILE A CD1 1 
ATOM   407   N N   . ASP A 1 54  ? 144.083 21.207  169.104 1.00 101.50 ? 54  ASP A N   1 
ATOM   408   C CA  . ASP A 1 54  ? 144.776 19.937  169.152 1.00 91.69  ? 54  ASP A CA  1 
ATOM   409   C C   . ASP A 1 54  ? 144.426 19.300  170.490 1.00 90.54  ? 54  ASP A C   1 
ATOM   410   O O   . ASP A 1 54  ? 144.582 19.926  171.533 1.00 101.95 ? 54  ASP A O   1 
ATOM   411   C CB  . ASP A 1 54  ? 146.282 20.149  169.010 1.00 84.44  ? 54  ASP A CB  1 
ATOM   412   C CG  . ASP A 1 54  ? 147.036 18.857  168.799 1.00 103.24 ? 54  ASP A CG  1 
ATOM   413   O OD1 . ASP A 1 54  ? 146.426 17.774  168.922 1.00 114.63 ? 54  ASP A OD1 1 
ATOM   414   O OD2 . ASP A 1 54  ? 148.248 18.922  168.504 1.00 96.67  ? 54  ASP A OD2 1 
ATOM   415   N N   . MET A 1 55  ? 143.964 18.054  170.468 1.00 83.41  ? 55  MET A N   1 
ATOM   416   C CA  . MET A 1 55  ? 143.518 17.412  171.700 1.00 89.50  ? 55  MET A CA  1 
ATOM   417   C C   . MET A 1 55  ? 144.694 16.877  172.507 1.00 112.12 ? 55  MET A C   1 
ATOM   418   O O   . MET A 1 55  ? 144.544 16.518  173.675 1.00 130.73 ? 55  MET A O   1 
ATOM   419   C CB  . MET A 1 55  ? 142.525 16.290  171.395 1.00 81.48  ? 55  MET A CB  1 
ATOM   420   C CG  . MET A 1 55  ? 141.214 16.791  170.816 1.00 92.84  ? 55  MET A CG  1 
ATOM   421   S SD  . MET A 1 55  ? 140.243 17.743  171.995 1.00 83.52  ? 55  MET A SD  1 
ATOM   422   C CE  . MET A 1 55  ? 139.824 16.471  173.180 1.00 100.93 ? 55  MET A CE  1 
ATOM   423   N N   . ASN A 1 56  ? 145.860 16.811  171.877 1.00 100.99 ? 56  ASN A N   1 
ATOM   424   C CA  . ASN A 1 56  ? 147.077 16.428  172.577 1.00 107.78 ? 56  ASN A CA  1 
ATOM   425   C C   . ASN A 1 56  ? 147.588 17.601  173.399 1.00 121.01 ? 56  ASN A C   1 
ATOM   426   O O   . ASN A 1 56  ? 148.104 17.431  174.503 1.00 137.66 ? 56  ASN A O   1 
ATOM   427   C CB  . ASN A 1 56  ? 148.133 15.956  171.590 1.00 126.18 ? 56  ASN A CB  1 
ATOM   428   C CG  . ASN A 1 56  ? 147.713 14.704  170.864 1.00 136.44 ? 56  ASN A CG  1 
ATOM   429   O OD1 . ASN A 1 56  ? 147.950 13.591  171.334 1.00 136.72 ? 56  ASN A OD1 1 
ATOM   430   N ND2 . ASN A 1 56  ? 147.075 14.874  169.715 1.00 139.94 ? 56  ASN A ND2 1 
ATOM   431   N N   . ASP A 1 57  ? 147.425 18.794  172.840 1.00 114.98 ? 57  ASP A N   1 
ATOM   432   C CA  . ASP A 1 57  ? 147.736 20.032  173.528 1.00 100.04 ? 57  ASP A CA  1 
ATOM   433   C C   . ASP A 1 57  ? 146.531 20.963  173.403 1.00 98.18  ? 57  ASP A C   1 
ATOM   434   O O   . ASP A 1 57  ? 146.505 21.850  172.548 1.00 97.54  ? 57  ASP A O   1 
ATOM   435   C CB  . ASP A 1 57  ? 148.994 20.652  172.916 1.00 104.13 ? 57  ASP A CB  1 
ATOM   436   C CG  . ASP A 1 57  ? 149.301 22.022  173.463 1.00 125.96 ? 57  ASP A CG  1 
ATOM   437   O OD1 . ASP A 1 57  ? 149.434 22.167  174.695 1.00 147.06 ? 57  ASP A OD1 1 
ATOM   438   O OD2 . ASP A 1 57  ? 149.400 22.959  172.646 1.00 129.03 ? 57  ASP A OD2 1 
ATOM   439   N N   . PRO A 1 58  ? 145.527 20.768  174.275 1.00 95.26  ? 58  PRO A N   1 
ATOM   440   C CA  . PRO A 1 58  ? 144.290 21.558  174.232 1.00 103.40 ? 58  PRO A CA  1 
ATOM   441   C C   . PRO A 1 58  ? 144.409 22.933  174.870 1.00 112.93 ? 58  PRO A C   1 
ATOM   442   O O   . PRO A 1 58  ? 143.639 23.829  174.525 1.00 122.59 ? 58  PRO A O   1 
ATOM   443   C CB  . PRO A 1 58  ? 143.297 20.692  175.012 1.00 97.77  ? 58  PRO A CB  1 
ATOM   444   C CG  . PRO A 1 58  ? 144.144 19.938  175.973 1.00 98.99  ? 58  PRO A CG  1 
ATOM   445   C CD  . PRO A 1 58  ? 145.490 19.735  175.327 1.00 96.12  ? 58  PRO A CD  1 
ATOM   446   N N   . SER A 1 59  ? 145.358 23.086  175.788 1.00 112.31 ? 59  SER A N   1 
ATOM   447   C CA  . SER A 1 59  ? 145.567 24.350  176.487 1.00 115.49 ? 59  SER A CA  1 
ATOM   448   C C   . SER A 1 59  ? 145.830 25.537  175.555 1.00 123.20 ? 59  SER A C   1 
ATOM   449   O O   . SER A 1 59  ? 145.356 26.640  175.817 1.00 124.46 ? 59  SER A O   1 
ATOM   450   C CB  . SER A 1 59  ? 146.721 24.213  177.480 1.00 124.77 ? 59  SER A CB  1 
ATOM   451   O OG  . SER A 1 59  ? 147.910 23.813  176.821 1.00 140.35 ? 59  SER A OG  1 
ATOM   452   N N   . ASN A 1 60  ? 146.584 25.318  174.481 1.00 125.46 ? 60  ASN A N   1 
ATOM   453   C CA  . ASN A 1 60  ? 146.913 26.400  173.555 1.00 129.99 ? 60  ASN A CA  1 
ATOM   454   C C   . ASN A 1 60  ? 146.332 26.226  172.152 1.00 146.76 ? 60  ASN A C   1 
ATOM   455   O O   . ASN A 1 60  ? 146.926 25.549  171.314 1.00 165.44 ? 60  ASN A O   1 
ATOM   456   C CB  . ASN A 1 60  ? 148.429 26.553  173.446 1.00 123.47 ? 60  ASN A CB  1 
ATOM   457   C CG  . ASN A 1 60  ? 149.106 26.609  174.792 1.00 137.38 ? 60  ASN A CG  1 
ATOM   458   O OD1 . ASN A 1 60  ? 149.399 25.577  175.395 1.00 138.79 ? 60  ASN A OD1 1 
ATOM   459   N ND2 . ASN A 1 60  ? 149.361 27.817  175.274 1.00 153.79 ? 60  ASN A ND2 1 
ATOM   460   N N   . PRO A 1 61  ? 145.169 26.842  171.887 1.00 130.60 ? 61  PRO A N   1 
ATOM   461   C CA  . PRO A 1 61  ? 144.578 26.752  170.549 1.00 110.43 ? 61  PRO A CA  1 
ATOM   462   C C   . PRO A 1 61  ? 145.146 27.770  169.561 1.00 110.76 ? 61  PRO A C   1 
ATOM   463   O O   . PRO A 1 61  ? 145.567 28.858  169.951 1.00 117.38 ? 61  PRO A O   1 
ATOM   464   C CB  . PRO A 1 61  ? 143.093 27.028  170.806 1.00 101.84 ? 61  PRO A CB  1 
ATOM   465   C CG  . PRO A 1 61  ? 142.988 27.522  172.254 1.00 105.82 ? 61  PRO A CG  1 
ATOM   466   C CD  . PRO A 1 61  ? 144.379 27.710  172.771 1.00 125.85 ? 61  PRO A CD  1 
ATOM   467   N N   . ILE A 1 62  ? 145.143 27.404  168.284 1.00 102.11 ? 62  ILE A N   1 
ATOM   468   C CA  . ILE A 1 62  ? 145.647 28.262  167.218 1.00 103.59 ? 62  ILE A CA  1 
ATOM   469   C C   . ILE A 1 62  ? 144.527 28.965  166.451 1.00 103.99 ? 62  ILE A C   1 
ATOM   470   O O   . ILE A 1 62  ? 143.689 28.308  165.837 1.00 111.33 ? 62  ILE A O   1 
ATOM   471   C CB  . ILE A 1 62  ? 146.504 27.462  166.228 1.00 113.17 ? 62  ILE A CB  1 
ATOM   472   C CG1 . ILE A 1 62  ? 147.454 26.543  166.993 1.00 120.85 ? 62  ILE A CG1 1 
ATOM   473   C CG2 . ILE A 1 62  ? 147.270 28.408  165.302 1.00 113.72 ? 62  ILE A CG2 1 
ATOM   474   C CD1 . ILE A 1 62  ? 147.010 25.092  167.013 1.00 120.59 ? 62  ILE A CD1 1 
ATOM   475   N N   . ARG A 1 63  ? 144.530 30.295  166.466 1.00 101.84 ? 63  ARG A N   1 
ATOM   476   C CA  . ARG A 1 63  ? 143.532 31.060  165.730 1.00 98.64  ? 63  ARG A CA  1 
ATOM   477   C C   . ARG A 1 63  ? 144.103 31.596  164.416 1.00 103.36 ? 63  ARG A C   1 
ATOM   478   O O   . ARG A 1 63  ? 144.828 32.587  164.395 1.00 114.18 ? 63  ARG A O   1 
ATOM   479   C CB  . ARG A 1 63  ? 142.988 32.205  166.589 1.00 99.77  ? 63  ARG A CB  1 
ATOM   480   C CG  . ARG A 1 63  ? 142.140 31.754  167.764 1.00 108.55 ? 63  ARG A CG  1 
ATOM   481   C CD  . ARG A 1 63  ? 141.562 32.945  168.516 1.00 113.93 ? 63  ARG A CD  1 
ATOM   482   N NE  . ARG A 1 63  ? 140.648 32.553  169.587 1.00 125.76 ? 63  ARG A NE  1 
ATOM   483   C CZ  . ARG A 1 63  ? 139.324 32.518  169.475 1.00 124.39 ? 63  ARG A CZ  1 
ATOM   484   N NH1 . ARG A 1 63  ? 138.587 32.148  170.513 1.00 131.49 ? 63  ARG A NH1 1 
ATOM   485   N NH2 . ARG A 1 63  ? 138.738 32.860  168.336 1.00 112.15 ? 63  ARG A NH2 1 
ATOM   486   N N   . ARG A 1 64  ? 143.735 30.940  163.318 1.00 95.60  ? 64  ARG A N   1 
ATOM   487   C CA  . ARG A 1 64  ? 144.204 31.319  161.988 1.00 93.72  ? 64  ARG A CA  1 
ATOM   488   C C   . ARG A 1 64  ? 143.080 32.032  161.239 1.00 95.99  ? 64  ARG A C   1 
ATOM   489   O O   . ARG A 1 64  ? 141.932 31.587  161.277 1.00 93.63  ? 64  ARG A O   1 
ATOM   490   C CB  . ARG A 1 64  ? 144.681 30.085  161.214 1.00 90.02  ? 64  ARG A CB  1 
ATOM   491   C CG  . ARG A 1 64  ? 145.927 29.425  161.798 1.00 94.05  ? 64  ARG A CG  1 
ATOM   492   C CD  . ARG A 1 64  ? 146.025 27.969  161.374 1.00 92.51  ? 64  ARG A CD  1 
ATOM   493   N NE  . ARG A 1 64  ? 147.236 27.311  161.862 1.00 98.99  ? 64  ARG A NE  1 
ATOM   494   C CZ  . ARG A 1 64  ? 148.371 27.206  161.180 1.00 134.71 ? 64  ARG A CZ  1 
ATOM   495   N NH1 . ARG A 1 64  ? 149.407 26.581  161.721 1.00 141.21 ? 64  ARG A NH1 1 
ATOM   496   N NH2 . ARG A 1 64  ? 148.472 27.714  159.959 1.00 149.43 ? 64  ARG A NH2 1 
ATOM   497   N N   . PRO A 1 65  ? 143.409 33.129  160.532 1.00 113.64 ? 65  PRO A N   1 
ATOM   498   C CA  . PRO A 1 65  ? 142.375 33.910  159.841 1.00 112.25 ? 65  PRO A CA  1 
ATOM   499   C C   . PRO A 1 65  ? 141.947 33.293  158.512 1.00 104.13 ? 65  PRO A C   1 
ATOM   500   O O   . PRO A 1 65  ? 142.575 33.508  157.479 1.00 108.11 ? 65  PRO A O   1 
ATOM   501   C CB  . PRO A 1 65  ? 143.056 35.265  159.620 1.00 118.35 ? 65  PRO A CB  1 
ATOM   502   C CG  . PRO A 1 65  ? 144.543 34.986  159.650 1.00 129.59 ? 65  PRO A CG  1 
ATOM   503   C CD  . PRO A 1 65  ? 144.767 33.597  160.205 1.00 128.84 ? 65  PRO A CD  1 
ATOM   504   N N   . ILE A 1 66  ? 140.875 32.508  158.560 1.00 91.52  ? 66  ILE A N   1 
ATOM   505   C CA  . ILE A 1 66  ? 140.362 31.813  157.381 1.00 92.39  ? 66  ILE A CA  1 
ATOM   506   C C   . ILE A 1 66  ? 138.883 32.079  157.131 1.00 110.03 ? 66  ILE A C   1 
ATOM   507   O O   . ILE A 1 66  ? 138.057 31.978  158.038 1.00 123.55 ? 66  ILE A O   1 
ATOM   508   C CB  . ILE A 1 66  ? 140.591 30.294  157.485 1.00 90.85  ? 66  ILE A CB  1 
ATOM   509   C CG1 . ILE A 1 66  ? 142.081 29.982  157.348 1.00 89.54  ? 66  ILE A CG1 1 
ATOM   510   C CG2 . ILE A 1 66  ? 139.834 29.553  156.395 1.00 101.10 ? 66  ILE A CG2 1 
ATOM   511   C CD1 . ILE A 1 66  ? 142.501 28.722  158.069 1.00 87.78  ? 66  ILE A CD1 1 
ATOM   512   N N   . SER A 1 67  ? 138.566 32.422  155.887 1.00 100.78 ? 67  SER A N   1 
ATOM   513   C CA  . SER A 1 67  ? 137.196 32.661  155.463 1.00 99.42  ? 67  SER A CA  1 
ATOM   514   C C   . SER A 1 67  ? 136.614 31.447  154.737 1.00 103.99 ? 67  SER A C   1 
ATOM   515   O O   . SER A 1 67  ? 136.943 31.187  153.581 1.00 108.53 ? 67  SER A O   1 
ATOM   516   C CB  . SER A 1 67  ? 137.136 33.889  154.558 1.00 114.32 ? 67  SER A CB  1 
ATOM   517   O OG  . SER A 1 67  ? 135.815 34.390  154.468 1.00 132.98 ? 67  SER A OG  1 
ATOM   518   N N   . ALA A 1 68  ? 135.753 30.704  155.423 1.00 96.63  ? 68  ALA A N   1 
ATOM   519   C CA  . ALA A 1 68  ? 135.145 29.508  154.849 1.00 92.05  ? 68  ALA A CA  1 
ATOM   520   C C   . ALA A 1 68  ? 133.765 29.245  155.441 1.00 93.12  ? 68  ALA A C   1 
ATOM   521   O O   . ALA A 1 68  ? 133.528 29.523  156.613 1.00 108.84 ? 68  ALA A O   1 
ATOM   522   C CB  . ALA A 1 68  ? 136.046 28.307  155.056 1.00 82.42  ? 68  ALA A CB  1 
ATOM   523   N N   . ASP A 1 69  ? 132.852 28.710  154.639 1.00 86.26  ? 69  ASP A N   1 
ATOM   524   C CA  . ASP A 1 69  ? 131.522 28.391  155.148 1.00 84.88  ? 69  ASP A CA  1 
ATOM   525   C C   . ASP A 1 69  ? 131.522 27.025  155.807 1.00 82.85  ? 69  ASP A C   1 
ATOM   526   O O   . ASP A 1 69  ? 130.512 26.600  156.363 1.00 97.80  ? 69  ASP A O   1 
ATOM   527   C CB  . ASP A 1 69  ? 130.486 28.408  154.029 1.00 93.98  ? 69  ASP A CB  1 
ATOM   528   C CG  . ASP A 1 69  ? 130.946 29.197  152.830 1.00 117.78 ? 69  ASP A CG  1 
ATOM   529   O OD1 . ASP A 1 69  ? 130.835 28.679  151.702 1.00 130.74 ? 69  ASP A OD1 1 
ATOM   530   O OD2 . ASP A 1 69  ? 131.412 30.341  153.011 1.00 120.16 ? 69  ASP A OD2 1 
ATOM   531   N N   . SER A 1 70  ? 132.659 26.341  155.737 1.00 80.35  ? 70  SER A N   1 
ATOM   532   C CA  . SER A 1 70  ? 132.806 25.032  156.360 1.00 80.07  ? 70  SER A CA  1 
ATOM   533   C C   . SER A 1 70  ? 134.271 24.615  156.435 1.00 89.53  ? 70  SER A C   1 
ATOM   534   O O   . SER A 1 70  ? 135.032 24.827  155.492 1.00 79.65  ? 70  SER A O   1 
ATOM   535   C CB  . SER A 1 70  ? 132.006 23.984  155.592 1.00 81.03  ? 70  SER A CB  1 
ATOM   536   O OG  . SER A 1 70  ? 131.834 22.824  156.380 1.00 73.63  ? 70  SER A OG  1 
ATOM   537   N N   . ALA A 1 71  ? 134.664 24.027  157.560 1.00 92.17  ? 71  ALA A N   1 
ATOM   538   C CA  . ALA A 1 71  ? 136.046 23.597  157.744 1.00 70.22  ? 71  ALA A CA  1 
ATOM   539   C C   . ALA A 1 71  ? 136.141 22.286  158.520 1.00 75.67  ? 71  ALA A C   1 
ATOM   540   O O   . ALA A 1 71  ? 135.748 22.221  159.684 1.00 84.75  ? 71  ALA A O   1 
ATOM   541   C CB  . ALA A 1 71  ? 136.838 24.682  158.448 1.00 69.73  ? 71  ALA A CB  1 
ATOM   542   N N   . ILE A 1 72  ? 136.668 21.246  157.878 1.00 83.04  ? 72  ILE A N   1 
ATOM   543   C CA  . ILE A 1 72  ? 136.780 19.936  158.516 1.00 79.56  ? 72  ILE A CA  1 
ATOM   544   C C   . ILE A 1 72  ? 138.201 19.365  158.462 1.00 72.17  ? 72  ILE A C   1 
ATOM   545   O O   . ILE A 1 72  ? 138.777 19.188  157.388 1.00 70.76  ? 72  ILE A O   1 
ATOM   546   C CB  . ILE A 1 72  ? 135.806 18.927  157.889 1.00 65.02  ? 72  ILE A CB  1 
ATOM   547   C CG1 . ILE A 1 72  ? 135.859 19.003  156.365 1.00 66.68  ? 72  ILE A CG1 1 
ATOM   548   C CG2 . ILE A 1 72  ? 134.389 19.199  158.360 1.00 63.54  ? 72  ILE A CG2 1 
ATOM   549   C CD1 . ILE A 1 72  ? 135.316 17.766  155.700 1.00 73.11  ? 72  ILE A CD1 1 
ATOM   550   N N   . MET A 1 73  ? 138.756 19.079  159.634 1.00 66.69  ? 73  MET A N   1 
ATOM   551   C CA  . MET A 1 73  ? 140.105 18.541  159.738 1.00 68.04  ? 73  MET A CA  1 
ATOM   552   C C   . MET A 1 73  ? 140.202 17.074  159.346 1.00 80.24  ? 73  MET A C   1 
ATOM   553   O O   . MET A 1 73  ? 139.214 16.349  159.362 1.00 83.31  ? 73  MET A O   1 
ATOM   554   C CB  . MET A 1 73  ? 140.633 18.705  161.164 1.00 69.97  ? 73  MET A CB  1 
ATOM   555   C CG  . MET A 1 73  ? 141.109 20.100  161.510 1.00 73.43  ? 73  MET A CG  1 
ATOM   556   S SD  . MET A 1 73  ? 142.699 20.517  160.767 1.00 108.04 ? 73  MET A SD  1 
ATOM   557   C CE  . MET A 1 73  ? 143.688 19.111  161.262 1.00 108.44 ? 73  MET A CE  1 
ATOM   558   N N   . ASN A 1 74  ? 141.414 16.651  159.002 1.00 95.47  ? 74  ASN A N   1 
ATOM   559   C CA  . ASN A 1 74  ? 141.693 15.253  158.713 1.00 95.13  ? 74  ASN A CA  1 
ATOM   560   C C   . ASN A 1 74  ? 141.631 14.459  160.006 1.00 88.09  ? 74  ASN A C   1 
ATOM   561   O O   . ASN A 1 74  ? 142.014 14.970  161.057 1.00 86.53  ? 74  ASN A O   1 
ATOM   562   C CB  . ASN A 1 74  ? 143.071 15.116  158.055 1.00 99.72  ? 74  ASN A CB  1 
ATOM   563   C CG  . ASN A 1 74  ? 143.331 13.723  157.517 1.00 101.30 ? 74  ASN A CG  1 
ATOM   564   O OD1 . ASN A 1 74  ? 143.742 12.824  158.252 1.00 108.53 ? 74  ASN A OD1 1 
ATOM   565   N ND2 . ASN A 1 74  ? 143.072 13.531  156.232 1.00 109.05 ? 74  ASN A ND2 1 
ATOM   566   N N   . PRO A 1 75  ? 141.154 13.204  159.941 1.00 86.50  ? 75  PRO A N   1 
ATOM   567   C CA  . PRO A 1 75  ? 141.087 12.391  161.161 1.00 83.31  ? 75  PRO A CA  1 
ATOM   568   C C   . PRO A 1 75  ? 142.441 12.155  161.838 1.00 81.43  ? 75  PRO A C   1 
ATOM   569   O O   . PRO A 1 75  ? 142.463 11.695  162.980 1.00 83.46  ? 75  PRO A O   1 
ATOM   570   C CB  . PRO A 1 75  ? 140.487 11.064  160.674 1.00 81.44  ? 75  PRO A CB  1 
ATOM   571   C CG  . PRO A 1 75  ? 140.626 11.069  159.192 1.00 83.93  ? 75  PRO A CG  1 
ATOM   572   C CD  . PRO A 1 75  ? 140.588 12.503  158.775 1.00 86.19  ? 75  PRO A CD  1 
ATOM   573   N N   . ALA A 1 76  ? 143.545 12.469  161.167 1.00 75.03  ? 76  ALA A N   1 
ATOM   574   C CA  . ALA A 1 76  ? 144.851 12.296  161.796 1.00 87.36  ? 76  ALA A CA  1 
ATOM   575   C C   . ALA A 1 76  ? 145.858 13.379  161.418 1.00 90.73  ? 76  ALA A C   1 
ATOM   576   O O   . ALA A 1 76  ? 146.469 14.004  162.284 1.00 82.55  ? 76  ALA A O   1 
ATOM   577   C CB  . ALA A 1 76  ? 145.410 10.925  161.453 1.00 85.88  ? 76  ALA A CB  1 
ATOM   578   N N   . SER A 1 77  ? 146.038 13.578  160.119 1.00 95.28  ? 77  SER A N   1 
ATOM   579   C CA  . SER A 1 77  ? 146.999 14.545  159.606 1.00 92.19  ? 77  SER A CA  1 
ATOM   580   C C   . SER A 1 77  ? 146.644 15.989  159.945 1.00 85.97  ? 77  SER A C   1 
ATOM   581   O O   . SER A 1 77  ? 145.488 16.311  160.224 1.00 95.00  ? 77  SER A O   1 
ATOM   582   C CB  . SER A 1 77  ? 147.138 14.384  158.091 1.00 101.88 ? 77  SER A CB  1 
ATOM   583   O OG  . SER A 1 77  ? 147.240 13.012  157.746 1.00 113.35 ? 77  SER A OG  1 
ATOM   584   N N   . LYS A 1 78  ? 147.651 16.856  159.933 1.00 87.37  ? 78  LYS A N   1 
ATOM   585   C CA  . LYS A 1 78  ? 147.426 18.280  160.147 1.00 86.52  ? 78  LYS A CA  1 
ATOM   586   C C   . LYS A 1 78  ? 147.008 18.888  158.815 1.00 96.97  ? 78  LYS A C   1 
ATOM   587   O O   . LYS A 1 78  ? 147.594 19.854  158.335 1.00 105.87 ? 78  LYS A O   1 
ATOM   588   C CB  . LYS A 1 78  ? 148.672 18.971  160.703 1.00 91.21  ? 78  LYS A CB  1 
ATOM   589   C CG  . LYS A 1 78  ? 149.034 18.524  162.111 1.00 93.69  ? 78  LYS A CG  1 
ATOM   590   C CD  . LYS A 1 78  ? 148.626 19.573  163.136 1.00 110.33 ? 78  LYS A CD  1 
ATOM   591   C CE  . LYS A 1 78  ? 149.155 19.235  164.522 1.00 130.12 ? 78  LYS A CE  1 
ATOM   592   N NZ  . LYS A 1 78  ? 150.595 19.558  164.684 1.00 142.28 ? 78  LYS A NZ  1 
ATOM   593   N N   . VAL A 1 79  ? 145.983 18.283  158.225 1.00 92.88  ? 79  VAL A N   1 
ATOM   594   C CA  . VAL A 1 79  ? 145.436 18.685  156.937 1.00 84.66  ? 79  VAL A CA  1 
ATOM   595   C C   . VAL A 1 79  ? 143.980 19.094  157.101 1.00 89.75  ? 79  VAL A C   1 
ATOM   596   O O   . VAL A 1 79  ? 143.193 18.367  157.698 1.00 102.89 ? 79  VAL A O   1 
ATOM   597   C CB  . VAL A 1 79  ? 145.532 17.546  155.907 1.00 83.11  ? 79  VAL A CB  1 
ATOM   598   C CG1 . VAL A 1 79  ? 144.689 17.858  154.686 1.00 90.50  ? 79  VAL A CG1 1 
ATOM   599   C CG2 . VAL A 1 79  ? 146.982 17.285  155.531 1.00 95.26  ? 79  VAL A CG2 1 
ATOM   600   N N   . ILE A 1 80  ? 143.619 20.256  156.573 1.00 79.75  ? 80  ILE A N   1 
ATOM   601   C CA  . ILE A 1 80  ? 142.245 20.726  156.686 1.00 71.16  ? 80  ILE A CA  1 
ATOM   602   C C   . ILE A 1 80  ? 141.561 20.837  155.324 1.00 73.81  ? 80  ILE A C   1 
ATOM   603   O O   . ILE A 1 80  ? 142.212 21.037  154.300 1.00 91.98  ? 80  ILE A O   1 
ATOM   604   C CB  . ILE A 1 80  ? 142.175 22.094  157.391 1.00 73.43  ? 80  ILE A CB  1 
ATOM   605   C CG1 . ILE A 1 80  ? 140.763 22.364  157.915 1.00 70.40  ? 80  ILE A CG1 1 
ATOM   606   C CG2 . ILE A 1 80  ? 142.661 23.209  156.471 1.00 75.31  ? 80  ILE A CG2 1 
ATOM   607   C CD1 . ILE A 1 80  ? 140.671 23.601  158.753 1.00 67.86  ? 80  ILE A CD1 1 
ATOM   608   N N   . ALA A 1 81  ? 140.243 20.678  155.317 1.00 75.58  ? 81  ALA A N   1 
ATOM   609   C CA  . ALA A 1 81  ? 139.456 20.862  154.105 1.00 67.90  ? 81  ALA A CA  1 
ATOM   610   C C   . ALA A 1 81  ? 138.450 21.988  154.310 1.00 69.01  ? 81  ALA A C   1 
ATOM   611   O O   . ALA A 1 81  ? 137.649 21.936  155.241 1.00 82.21  ? 81  ALA A O   1 
ATOM   612   C CB  . ALA A 1 81  ? 138.751 19.573  153.725 1.00 67.14  ? 81  ALA A CB  1 
ATOM   613   N N   . LEU A 1 82  ? 138.482 22.995  153.439 1.00 68.62  ? 82  LEU A N   1 
ATOM   614   C CA  . LEU A 1 82  ? 137.595 24.143  153.589 1.00 69.17  ? 82  LEU A CA  1 
ATOM   615   C C   . LEU A 1 82  ? 136.746 24.435  152.357 1.00 74.37  ? 82  LEU A C   1 
ATOM   616   O O   . LEU A 1 82  ? 137.191 24.313  151.218 1.00 76.25  ? 82  LEU A O   1 
ATOM   617   C CB  . LEU A 1 82  ? 138.393 25.398  153.948 1.00 69.88  ? 82  LEU A CB  1 
ATOM   618   C CG  . LEU A 1 82  ? 139.840 25.257  154.391 1.00 74.55  ? 82  LEU A CG  1 
ATOM   619   C CD1 . LEU A 1 82  ? 140.733 26.006  153.418 1.00 92.80  ? 82  LEU A CD1 1 
ATOM   620   C CD2 . LEU A 1 82  ? 140.003 25.798  155.797 1.00 74.44  ? 82  LEU A CD2 1 
ATOM   621   N N   . LYS A 1 83  ? 135.507 24.826  152.630 1.00 68.70  ? 83  LYS A N   1 
ATOM   622   C CA  . LYS A 1 83  ? 134.510 25.163  151.625 1.00 69.83  ? 83  LYS A CA  1 
ATOM   623   C C   . LYS A 1 83  ? 134.254 26.655  151.535 1.00 76.45  ? 83  LYS A C   1 
ATOM   624   O O   . LYS A 1 83  ? 134.039 27.316  152.549 1.00 76.78  ? 83  LYS A O   1 
ATOM   625   C CB  . LYS A 1 83  ? 133.202 24.448  151.944 1.00 71.72  ? 83  LYS A CB  1 
ATOM   626   C CG  . LYS A 1 83  ? 132.056 24.773  151.014 1.00 83.27  ? 83  LYS A CG  1 
ATOM   627   C CD  . LYS A 1 83  ? 130.778 24.164  151.571 1.00 94.42  ? 83  LYS A CD  1 
ATOM   628   C CE  . LYS A 1 83  ? 129.530 24.848  151.032 1.00 111.30 ? 83  LYS A CE  1 
ATOM   629   N NZ  . LYS A 1 83  ? 129.336 26.171  151.720 1.00 105.44 ? 83  LYS A NZ  1 
ATOM   630   N N   . ALA A 1 84  ? 134.286 27.192  150.324 1.00 77.59  ? 84  ALA A N   1 
ATOM   631   C CA  . ALA A 1 84  ? 133.953 28.594  150.139 1.00 80.26  ? 84  ALA A CA  1 
ATOM   632   C C   . ALA A 1 84  ? 133.026 28.651  148.938 1.00 86.05  ? 84  ALA A C   1 
ATOM   633   O O   . ALA A 1 84  ? 133.470 28.664  147.789 1.00 105.97 ? 84  ALA A O   1 
ATOM   634   C CB  . ALA A 1 84  ? 135.193 29.450  149.931 1.00 97.79  ? 84  ALA A CB  1 
ATOM   635   N N   . GLY A 1 85  ? 131.730 28.714  149.220 1.00 84.52  ? 85  GLY A N   1 
ATOM   636   C CA  . GLY A 1 85  ? 130.727 28.773  148.178 1.00 94.46  ? 85  GLY A CA  1 
ATOM   637   C C   . GLY A 1 85  ? 130.607 27.412  147.523 1.00 108.33 ? 85  GLY A C   1 
ATOM   638   O O   . GLY A 1 85  ? 130.204 26.441  148.162 1.00 114.83 ? 85  GLY A O   1 
ATOM   639   N N   . LYS A 1 86  ? 130.957 27.341  146.245 1.00 108.11 ? 86  LYS A N   1 
ATOM   640   C CA  . LYS A 1 86  ? 130.949 26.083  145.507 1.00 105.48 ? 86  LYS A CA  1 
ATOM   641   C C   . LYS A 1 86  ? 132.385 25.643  145.291 1.00 99.09  ? 86  LYS A C   1 
ATOM   642   O O   . LYS A 1 86  ? 132.656 24.672  144.588 1.00 100.80 ? 86  LYS A O   1 
ATOM   643   C CB  . LYS A 1 86  ? 130.240 26.238  144.166 1.00 112.10 ? 86  LYS A CB  1 
ATOM   644   C CG  . LYS A 1 86  ? 128.726 26.323  144.241 1.00 112.95 ? 86  LYS A CG  1 
ATOM   645   C CD  . LYS A 1 86  ? 128.136 26.596  142.870 1.00 108.49 ? 86  LYS A CD  1 
ATOM   646   C CE  . LYS A 1 86  ? 126.634 26.803  142.929 1.00 118.04 ? 86  LYS A CE  1 
ATOM   647   N NZ  . LYS A 1 86  ? 126.273 27.923  143.848 1.00 127.16 ? 86  LYS A NZ  1 
ATOM   648   N N   . THR A 1 87  ? 133.301 26.367  145.923 1.00 93.08  ? 87  THR A N   1 
ATOM   649   C CA  . THR A 1 87  ? 134.730 26.104  145.783 1.00 91.33  ? 87  THR A CA  1 
ATOM   650   C C   . THR A 1 87  ? 135.336 25.375  146.979 1.00 94.92  ? 87  THR A C   1 
ATOM   651   O O   . THR A 1 87  ? 135.358 25.887  148.098 1.00 109.44 ? 87  THR A O   1 
ATOM   652   C CB  . THR A 1 87  ? 135.493 27.404  145.559 1.00 94.77  ? 87  THR A CB  1 
ATOM   653   O OG1 . THR A 1 87  ? 134.853 28.158  144.521 1.00 108.90 ? 87  THR A OG1 1 
ATOM   654   C CG2 . THR A 1 87  ? 136.924 27.109  145.159 1.00 83.44  ? 87  THR A CG2 1 
ATOM   655   N N   . LEU A 1 88  ? 135.828 24.170  146.715 1.00 84.74  ? 88  LEU A N   1 
ATOM   656   C CA  . LEU A 1 88  ? 136.411 23.311  147.739 1.00 78.95  ? 88  LEU A CA  1 
ATOM   657   C C   . LEU A 1 88  ? 137.939 23.334  147.706 1.00 88.72  ? 88  LEU A C   1 
ATOM   658   O O   . LEU A 1 88  ? 138.544 23.541  146.654 1.00 87.43  ? 88  LEU A O   1 
ATOM   659   C CB  . LEU A 1 88  ? 135.909 21.880  147.559 1.00 73.50  ? 88  LEU A CB  1 
ATOM   660   C CG  . LEU A 1 88  ? 134.525 21.550  148.118 1.00 74.33  ? 88  LEU A CG  1 
ATOM   661   C CD1 . LEU A 1 88  ? 133.406 22.187  147.310 1.00 80.20  ? 88  LEU A CD1 1 
ATOM   662   C CD2 . LEU A 1 88  ? 134.347 20.057  148.159 1.00 74.08  ? 88  LEU A CD2 1 
ATOM   663   N N   . GLN A 1 89  ? 138.564 23.127  148.861 1.00 88.92  ? 89  GLN A N   1 
ATOM   664   C CA  . GLN A 1 89  ? 140.019 23.186  148.945 1.00 77.14  ? 89  GLN A CA  1 
ATOM   665   C C   . GLN A 1 89  ? 140.624 22.391  150.104 1.00 80.62  ? 89  GLN A C   1 
ATOM   666   O O   . GLN A 1 89  ? 140.363 22.679  151.270 1.00 109.57 ? 89  GLN A O   1 
ATOM   667   C CB  . GLN A 1 89  ? 140.450 24.647  149.045 1.00 81.72  ? 89  GLN A CB  1 
ATOM   668   C CG  . GLN A 1 89  ? 141.901 24.847  149.416 1.00 111.65 ? 89  GLN A CG  1 
ATOM   669   C CD  . GLN A 1 89  ? 142.179 26.247  149.920 1.00 127.28 ? 89  GLN A CD  1 
ATOM   670   O OE1 . GLN A 1 89  ? 143.032 26.451  150.782 1.00 134.25 ? 89  GLN A OE1 1 
ATOM   671   N NE2 . GLN A 1 89  ? 141.456 27.224  149.382 1.00 122.35 ? 89  GLN A NE2 1 
ATOM   672   N N   . ILE A 1 90  ? 141.441 21.393  149.775 1.00 76.10  ? 90  ILE A N   1 
ATOM   673   C CA  . ILE A 1 90  ? 142.194 20.654  150.790 1.00 79.18  ? 90  ILE A CA  1 
ATOM   674   C C   . ILE A 1 90  ? 143.539 21.352  150.997 1.00 82.23  ? 90  ILE A C   1 
ATOM   675   O O   . ILE A 1 90  ? 144.369 21.423  150.093 1.00 83.76  ? 90  ILE A O   1 
ATOM   676   C CB  . ILE A 1 90  ? 142.391 19.180  150.408 1.00 77.97  ? 90  ILE A CB  1 
ATOM   677   C CG1 . ILE A 1 90  ? 141.040 18.470  150.351 1.00 74.98  ? 90  ILE A CG1 1 
ATOM   678   C CG2 . ILE A 1 90  ? 143.266 18.480  151.424 1.00 76.41  ? 90  ILE A CG2 1 
ATOM   679   C CD1 . ILE A 1 90  ? 141.070 17.160  149.594 1.00 78.95  ? 90  ILE A CD1 1 
ATOM   680   N N   . PHE A 1 91  ? 143.750 21.833  152.215 1.00 81.77  ? 91  PHE A N   1 
ATOM   681   C CA  . PHE A 1 91  ? 144.869 22.705  152.544 1.00 84.17  ? 91  PHE A CA  1 
ATOM   682   C C   . PHE A 1 91  ? 145.795 22.110  153.615 1.00 87.05  ? 91  PHE A C   1 
ATOM   683   O O   . PHE A 1 91  ? 145.325 21.550  154.606 1.00 85.45  ? 91  PHE A O   1 
ATOM   684   C CB  . PHE A 1 91  ? 144.293 24.046  153.001 1.00 85.62  ? 91  PHE A CB  1 
ATOM   685   C CG  . PHE A 1 91  ? 145.320 25.057  153.412 1.00 89.21  ? 91  PHE A CG  1 
ATOM   686   C CD1 . PHE A 1 91  ? 145.584 25.284  154.751 1.00 91.39  ? 91  PHE A CD1 1 
ATOM   687   C CD2 . PHE A 1 91  ? 145.977 25.821  152.465 1.00 106.89 ? 91  PHE A CD2 1 
ATOM   688   C CE1 . PHE A 1 91  ? 146.509 26.230  155.140 1.00 102.51 ? 91  PHE A CE1 1 
ATOM   689   C CE2 . PHE A 1 91  ? 146.908 26.764  152.843 1.00 126.46 ? 91  PHE A CE2 1 
ATOM   690   C CZ  . PHE A 1 91  ? 147.174 26.973  154.183 1.00 123.60 ? 91  PHE A CZ  1 
ATOM   691   N N   . ASN A 1 92  ? 147.108 22.224  153.411 1.00 108.83 ? 92  ASN A N   1 
ATOM   692   C CA  . ASN A 1 92  ? 148.072 21.731  154.394 1.00 113.20 ? 92  ASN A CA  1 
ATOM   693   C C   . ASN A 1 92  ? 148.383 22.797  155.440 1.00 108.65 ? 92  ASN A C   1 
ATOM   694   O O   . ASN A 1 92  ? 149.002 23.818  155.141 1.00 107.72 ? 92  ASN A O   1 
ATOM   695   C CB  . ASN A 1 92  ? 149.361 21.265  153.716 1.00 101.84 ? 92  ASN A CB  1 
ATOM   696   C CG  . ASN A 1 92  ? 150.145 20.285  154.576 1.00 110.89 ? 92  ASN A CG  1 
ATOM   697   O OD1 . ASN A 1 92  ? 150.615 20.628  155.663 1.00 130.19 ? 92  ASN A OD1 1 
ATOM   698   N ND2 . ASN A 1 92  ? 150.282 19.057  154.094 1.00 109.61 ? 92  ASN A ND2 1 
ATOM   699   N N   . ILE A 1 93  ? 147.957 22.540  156.671 1.00 102.04 ? 93  ILE A N   1 
ATOM   700   C CA  . ILE A 1 93  ? 148.110 23.495  157.761 1.00 96.08  ? 93  ILE A CA  1 
ATOM   701   C C   . ILE A 1 93  ? 149.568 23.776  158.111 1.00 97.81  ? 93  ILE A C   1 
ATOM   702   O O   . ILE A 1 93  ? 149.976 24.932  158.214 1.00 99.24  ? 93  ILE A O   1 
ATOM   703   C CB  . ILE A 1 93  ? 147.377 23.011  159.031 1.00 90.81  ? 93  ILE A CB  1 
ATOM   704   C CG1 . ILE A 1 93  ? 145.865 23.126  158.835 1.00 93.77  ? 93  ILE A CG1 1 
ATOM   705   C CG2 . ILE A 1 93  ? 147.853 23.784  160.258 1.00 95.11  ? 93  ILE A CG2 1 
ATOM   706   C CD1 . ILE A 1 93  ? 145.375 24.549  158.747 1.00 108.21 ? 93  ILE A CD1 1 
ATOM   707   N N   . GLU A 1 94  ? 150.337 22.712  158.322 1.00 104.19 ? 94  GLU A N   1 
ATOM   708   C CA  . GLU A 1 94  ? 151.743 22.828  158.702 1.00 109.95 ? 94  GLU A CA  1 
ATOM   709   C C   . GLU A 1 94  ? 152.598 23.516  157.642 1.00 105.76 ? 94  GLU A C   1 
ATOM   710   O O   . GLU A 1 94  ? 153.470 24.323  157.967 1.00 107.09 ? 94  GLU A O   1 
ATOM   711   C CB  . GLU A 1 94  ? 152.328 21.444  159.006 1.00 114.81 ? 94  GLU A CB  1 
ATOM   712   C CG  . GLU A 1 94  ? 153.226 21.395  160.240 1.00 129.01 ? 94  GLU A CG  1 
ATOM   713   C CD  . GLU A 1 94  ? 152.466 21.571  161.542 1.00 150.64 ? 94  GLU A CD  1 
ATOM   714   O OE1 . GLU A 1 94  ? 152.662 22.601  162.223 1.00 151.63 ? 94  GLU A OE1 1 
ATOM   715   O OE2 . GLU A 1 94  ? 151.693 20.661  161.904 1.00 157.74 ? 94  GLU A OE2 1 
ATOM   716   N N   . MET A 1 95  ? 152.350 23.184  156.379 1.00 101.18 ? 95  MET A N   1 
ATOM   717   C CA  . MET A 1 95  ? 153.132 23.718  155.267 1.00 100.58 ? 95  MET A CA  1 
ATOM   718   C C   . MET A 1 95  ? 152.548 24.990  154.666 1.00 102.00 ? 95  MET A C   1 
ATOM   719   O O   . MET A 1 95  ? 153.093 25.519  153.696 1.00 103.18 ? 95  MET A O   1 
ATOM   720   C CB  . MET A 1 95  ? 153.267 22.670  154.163 1.00 101.94 ? 95  MET A CB  1 
ATOM   721   C CG  . MET A 1 95  ? 153.843 21.337  154.614 1.00 104.65 ? 95  MET A CG  1 
ATOM   722   S SD  . MET A 1 95  ? 155.548 21.435  155.187 1.00 135.04 ? 95  MET A SD  1 
ATOM   723   C CE  . MET A 1 95  ? 155.356 21.072  156.932 1.00 141.31 ? 95  MET A CE  1 
ATOM   724   N N   . LYS A 1 96  ? 151.456 25.482  155.254 1.00 101.17 ? 96  LYS A N   1 
ATOM   725   C CA  . LYS A 1 96  ? 150.707 26.649  154.759 1.00 105.74 ? 96  LYS A CA  1 
ATOM   726   C C   . LYS A 1 96  ? 150.575 26.677  153.233 1.00 100.87 ? 96  LYS A C   1 
ATOM   727   O O   . LYS A 1 96  ? 150.669 27.730  152.607 1.00 101.22 ? 96  LYS A O   1 
ATOM   728   C CB  . LYS A 1 96  ? 151.326 27.968  155.265 1.00 109.77 ? 96  LYS A CB  1 
ATOM   729   C CG  . LYS A 1 96  ? 152.852 28.047  155.350 1.00 136.91 ? 96  LYS A CG  1 
ATOM   730   C CD  . LYS A 1 96  ? 153.460 28.787  154.171 1.00 165.27 ? 96  LYS A CD  1 
ATOM   731   C CE  . LYS A 1 96  ? 154.950 29.005  154.387 1.00 166.40 ? 96  LYS A CE  1 
ATOM   732   N NZ  . LYS A 1 96  ? 155.694 27.717  154.426 1.00 158.04 ? 96  LYS A NZ  1 
ATOM   733   N N   . SER A 1 97  ? 150.363 25.504  152.647 1.00 97.55  ? 97  SER A N   1 
ATOM   734   C CA  . SER A 1 97  ? 150.255 25.365  151.200 1.00 95.76  ? 97  SER A CA  1 
ATOM   735   C C   . SER A 1 97  ? 149.007 24.588  150.785 1.00 95.05  ? 97  SER A C   1 
ATOM   736   O O   . SER A 1 97  ? 148.547 23.702  151.506 1.00 94.64  ? 97  SER A O   1 
ATOM   737   C CB  . SER A 1 97  ? 151.505 24.687  150.643 1.00 98.93  ? 97  SER A CB  1 
ATOM   738   O OG  . SER A 1 97  ? 151.657 23.383  151.173 1.00 101.66 ? 97  SER A OG  1 
ATOM   739   N N   . LYS A 1 98  ? 148.453 24.944  149.631 1.00 92.40  ? 98  LYS A N   1 
ATOM   740   C CA  . LYS A 1 98  ? 147.266 24.281  149.096 1.00 90.17  ? 98  LYS A CA  1 
ATOM   741   C C   . LYS A 1 98  ? 147.602 22.935  148.445 1.00 89.94  ? 98  LYS A C   1 
ATOM   742   O O   . LYS A 1 98  ? 148.472 22.859  147.580 1.00 91.07  ? 98  LYS A O   1 
ATOM   743   C CB  . LYS A 1 98  ? 146.568 25.199  148.086 1.00 97.05  ? 98  LYS A CB  1 
ATOM   744   C CG  . LYS A 1 98  ? 145.442 24.541  147.302 1.00 99.62  ? 98  LYS A CG  1 
ATOM   745   C CD  . LYS A 1 98  ? 144.282 25.503  147.062 1.00 92.92  ? 98  LYS A CD  1 
ATOM   746   C CE  . LYS A 1 98  ? 144.533 26.480  145.929 1.00 97.73  ? 98  LYS A CE  1 
ATOM   747   N NZ  . LYS A 1 98  ? 143.420 27.468  145.816 1.00 95.19  ? 98  LYS A NZ  1 
ATOM   748   N N   . MET A 1 99  ? 146.913 21.875  148.867 1.00 85.89  ? 99  MET A N   1 
ATOM   749   C CA  . MET A 1 99  ? 147.144 20.537  148.316 1.00 85.77  ? 99  MET A CA  1 
ATOM   750   C C   . MET A 1 99  ? 146.306 20.282  147.065 1.00 87.28  ? 99  MET A C   1 
ATOM   751   O O   . MET A 1 99  ? 146.840 20.030  145.991 1.00 93.26  ? 99  MET A O   1 
ATOM   752   C CB  . MET A 1 99  ? 146.834 19.455  149.356 1.00 85.49  ? 99  MET A CB  1 
ATOM   753   C CG  . MET A 1 99  ? 147.681 19.523  150.619 1.00 88.10  ? 99  MET A CG  1 
ATOM   754   S SD  . MET A 1 99  ? 147.038 18.518  151.975 1.00 88.51  ? 99  MET A SD  1 
ATOM   755   C CE  . MET A 1 99  ? 147.521 16.868  151.456 1.00 87.17  ? 99  MET A CE  1 
ATOM   756   N N   . LYS A 1 100 ? 144.986 20.338  147.224 1.00 82.53  ? 100 LYS A N   1 
ATOM   757   C CA  . LYS A 1 100 ? 144.035 20.129  146.127 1.00 80.13  ? 100 LYS A CA  1 
ATOM   758   C C   . LYS A 1 100 ? 142.958 21.208  146.093 1.00 81.09  ? 100 LYS A C   1 
ATOM   759   O O   . LYS A 1 100 ? 142.833 21.997  147.028 1.00 94.53  ? 100 LYS A O   1 
ATOM   760   C CB  . LYS A 1 100 ? 143.374 18.754  146.242 1.00 78.58  ? 100 LYS A CB  1 
ATOM   761   C CG  . LYS A 1 100 ? 144.237 17.588  145.806 1.00 78.38  ? 100 LYS A CG  1 
ATOM   762   C CD  . LYS A 1 100 ? 143.444 16.294  145.865 1.00 81.21  ? 100 LYS A CD  1 
ATOM   763   C CE  . LYS A 1 100 ? 143.251 15.667  144.493 1.00 87.51  ? 100 LYS A CE  1 
ATOM   764   N NZ  . LYS A 1 100 ? 142.357 16.477  143.616 1.00 97.94  ? 100 LYS A NZ  1 
ATOM   765   N N   . ALA A 1 101 ? 142.190 21.241  145.008 1.00 78.16  ? 101 ALA A N   1 
ATOM   766   C CA  . ALA A 1 101 ? 141.094 22.192  144.880 1.00 77.22  ? 101 ALA A CA  1 
ATOM   767   C C   . ALA A 1 101 ? 140.044 21.704  143.882 1.00 86.58  ? 101 ALA A C   1 
ATOM   768   O O   . ALA A 1 101 ? 140.365 20.995  142.930 1.00 98.90  ? 101 ALA A O   1 
ATOM   769   C CB  . ALA A 1 101 ? 141.626 23.556  144.459 1.00 79.13  ? 101 ALA A CB  1 
ATOM   770   N N   . HIS A 1 102 ? 138.789 22.078  144.113 1.00 88.84  ? 102 HIS A N   1 
ATOM   771   C CA  . HIS A 1 102 ? 137.703 21.729  143.204 1.00 78.86  ? 102 HIS A CA  1 
ATOM   772   C C   . HIS A 1 102 ? 136.510 22.662  143.338 1.00 77.68  ? 102 HIS A C   1 
ATOM   773   O O   . HIS A 1 102 ? 136.104 23.018  144.443 1.00 79.25  ? 102 HIS A O   1 
ATOM   774   C CB  . HIS A 1 102 ? 137.241 20.288  143.421 1.00 74.69  ? 102 HIS A CB  1 
ATOM   775   C CG  . HIS A 1 102 ? 136.389 19.758  142.307 1.00 80.13  ? 102 HIS A CG  1 
ATOM   776   N ND1 . HIS A 1 102 ? 135.017 19.695  142.380 1.00 84.68  ? 102 HIS A ND1 1 
ATOM   777   C CD2 . HIS A 1 102 ? 136.718 19.292  141.076 1.00 92.19  ? 102 HIS A CD2 1 
ATOM   778   C CE1 . HIS A 1 102 ? 134.531 19.201  141.255 1.00 91.69  ? 102 HIS A CE1 1 
ATOM   779   N NE2 . HIS A 1 102 ? 135.549 18.945  140.448 1.00 90.49  ? 102 HIS A NE2 1 
ATOM   780   N N   . THR A 1 103 ? 135.954 23.046  142.195 1.00 76.56  ? 103 THR A N   1 
ATOM   781   C CA  . THR A 1 103 ? 134.752 23.870  142.148 1.00 76.59  ? 103 THR A CA  1 
ATOM   782   C C   . THR A 1 103 ? 133.577 23.029  141.664 1.00 87.73  ? 103 THR A C   1 
ATOM   783   O O   . THR A 1 103 ? 133.594 22.522  140.544 1.00 80.16  ? 103 THR A O   1 
ATOM   784   C CB  . THR A 1 103 ? 134.922 25.069  141.218 1.00 81.26  ? 103 THR A CB  1 
ATOM   785   O OG1 . THR A 1 103 ? 135.989 25.905  141.685 1.00 89.10  ? 103 THR A OG1 1 
ATOM   786   C CG2 . THR A 1 103 ? 133.636 25.869  141.160 1.00 79.00  ? 103 THR A CG2 1 
ATOM   787   N N   . MET A 1 104 ? 132.553 22.906  142.503 1.00 100.96 ? 104 MET A N   1 
ATOM   788   C CA  . MET A 1 104 ? 131.394 22.063  142.214 1.00 84.86  ? 104 MET A CA  1 
ATOM   789   C C   . MET A 1 104 ? 130.256 22.766  141.489 1.00 80.90  ? 104 MET A C   1 
ATOM   790   O O   . MET A 1 104 ? 129.972 23.938  141.735 1.00 92.56  ? 104 MET A O   1 
ATOM   791   C CB  . MET A 1 104 ? 130.848 21.462  143.507 1.00 75.88  ? 104 MET A CB  1 
ATOM   792   C CG  . MET A 1 104 ? 131.779 20.469  144.173 1.00 76.65  ? 104 MET A CG  1 
ATOM   793   S SD  . MET A 1 104 ? 131.183 18.766  144.049 1.00 85.99  ? 104 MET A SD  1 
ATOM   794   C CE  . MET A 1 104 ? 131.200 18.511  142.283 1.00 125.03 ? 104 MET A CE  1 
ATOM   795   N N   . THR A 1 105 ? 129.609 22.029  140.591 1.00 80.10  ? 105 THR A N   1 
ATOM   796   C CA  . THR A 1 105 ? 128.467 22.549  139.847 1.00 88.21  ? 105 THR A CA  1 
ATOM   797   C C   . THR A 1 105 ? 127.308 22.853  140.793 1.00 97.39  ? 105 THR A C   1 
ATOM   798   O O   . THR A 1 105 ? 126.906 24.007  140.947 1.00 98.51  ? 105 THR A O   1 
ATOM   799   C CB  . THR A 1 105 ? 127.997 21.561  138.770 1.00 86.27  ? 105 THR A CB  1 
ATOM   800   O OG1 . THR A 1 105 ? 128.131 20.220  139.258 1.00 86.53  ? 105 THR A OG1 1 
ATOM   801   C CG2 . THR A 1 105 ? 128.838 21.725  137.514 1.00 91.83  ? 105 THR A CG2 1 
ATOM   802   N N   . ASP A 1 106 ? 126.754 21.817  141.412 1.00 98.84  ? 106 ASP A N   1 
ATOM   803   C CA  . ASP A 1 106 ? 125.719 22.026  142.424 1.00 90.66  ? 106 ASP A CA  1 
ATOM   804   C C   . ASP A 1 106 ? 126.328 21.949  143.825 1.00 78.58  ? 106 ASP A C   1 
ATOM   805   O O   . ASP A 1 106 ? 127.189 21.113  144.106 1.00 76.85  ? 106 ASP A O   1 
ATOM   806   C CB  . ASP A 1 106 ? 124.577 21.029  142.251 1.00 104.48 ? 106 ASP A CB  1 
ATOM   807   C CG  . ASP A 1 106 ? 125.075 19.632  142.010 1.00 112.60 ? 106 ASP A CG  1 
ATOM   808   O OD1 . ASP A 1 106 ? 126.285 19.480  141.727 1.00 131.53 ? 106 ASP A OD1 1 
ATOM   809   O OD2 . ASP A 1 106 ? 124.270 18.685  142.093 1.00 97.93  ? 106 ASP A OD2 1 
ATOM   810   N N   . ASP A 1 107 ? 125.848 22.832  144.693 1.00 88.94  ? 107 ASP A N   1 
ATOM   811   C CA  . ASP A 1 107 ? 126.382 23.040  146.038 1.00 82.83  ? 107 ASP A CA  1 
ATOM   812   C C   . ASP A 1 107 ? 126.505 21.803  146.921 1.00 81.21  ? 107 ASP A C   1 
ATOM   813   O O   . ASP A 1 107 ? 125.638 20.932  146.920 1.00 88.69  ? 107 ASP A O   1 
ATOM   814   C CB  . ASP A 1 107 ? 125.512 24.065  146.764 1.00 92.48  ? 107 ASP A CB  1 
ATOM   815   C CG  . ASP A 1 107 ? 126.330 25.106  147.490 1.00 126.30 ? 107 ASP A CG  1 
ATOM   816   O OD1 . ASP A 1 107 ? 126.865 24.796  148.577 1.00 143.84 ? 107 ASP A OD1 1 
ATOM   817   O OD2 . ASP A 1 107 ? 126.435 26.240  146.975 1.00 123.00 ? 107 ASP A OD2 1 
ATOM   818   N N   . VAL A 1 108 ? 127.598 21.752  147.679 1.00 69.10  ? 108 VAL A N   1 
ATOM   819   C CA  . VAL A 1 108 ? 127.834 20.676  148.638 1.00 70.20  ? 108 VAL A CA  1 
ATOM   820   C C   . VAL A 1 108 ? 127.125 20.975  149.955 1.00 74.03  ? 108 VAL A C   1 
ATOM   821   O O   . VAL A 1 108 ? 127.527 21.857  150.716 1.00 64.57  ? 108 VAL A O   1 
ATOM   822   C CB  . VAL A 1 108 ? 129.334 20.456  148.905 1.00 66.24  ? 108 VAL A CB  1 
ATOM   823   C CG1 . VAL A 1 108 ? 129.529 19.593  150.143 1.00 64.38  ? 108 VAL A CG1 1 
ATOM   824   C CG2 . VAL A 1 108 ? 129.992 19.815  147.697 1.00 74.05  ? 108 VAL A CG2 1 
ATOM   825   N N   . THR A 1 109 ? 126.063 20.220  150.209 1.00 90.27  ? 109 THR A N   1 
ATOM   826   C CA  . THR A 1 109 ? 125.206 20.422  151.371 1.00 78.85  ? 109 THR A CA  1 
ATOM   827   C C   . THR A 1 109 ? 125.729 19.746  152.649 1.00 75.38  ? 109 THR A C   1 
ATOM   828   O O   . THR A 1 109 ? 125.328 20.119  153.748 1.00 78.92  ? 109 THR A O   1 
ATOM   829   C CB  . THR A 1 109 ? 123.765 19.944  151.075 1.00 64.35  ? 109 THR A CB  1 
ATOM   830   O OG1 . THR A 1 109 ? 122.849 20.585  151.970 1.00 109.38 ? 109 THR A OG1 1 
ATOM   831   C CG2 . THR A 1 109 ? 123.639 18.430  151.192 1.00 60.29  ? 109 THR A CG2 1 
ATOM   832   N N   . PHE A 1 110 ? 126.580 18.732  152.502 1.00 64.08  ? 110 PHE A N   1 
ATOM   833   C CA  . PHE A 1 110 ? 127.170 18.027  153.645 1.00 65.26  ? 110 PHE A CA  1 
ATOM   834   C C   . PHE A 1 110 ? 128.501 17.392  153.248 1.00 57.26  ? 110 PHE A C   1 
ATOM   835   O O   . PHE A 1 110 ? 128.623 16.874  152.140 1.00 55.52  ? 110 PHE A O   1 
ATOM   836   C CB  . PHE A 1 110 ? 126.197 16.954  154.163 1.00 52.76  ? 110 PHE A CB  1 
ATOM   837   C CG  . PHE A 1 110 ? 126.751 16.100  155.280 1.00 52.16  ? 110 PHE A CG  1 
ATOM   838   C CD1 . PHE A 1 110 ? 126.585 16.469  156.603 1.00 53.22  ? 110 PHE A CD1 1 
ATOM   839   C CD2 . PHE A 1 110 ? 127.415 14.913  155.003 1.00 55.25  ? 110 PHE A CD2 1 
ATOM   840   C CE1 . PHE A 1 110 ? 127.081 15.684  157.627 1.00 52.48  ? 110 PHE A CE1 1 
ATOM   841   C CE2 . PHE A 1 110 ? 127.919 14.127  156.021 1.00 57.41  ? 110 PHE A CE2 1 
ATOM   842   C CZ  . PHE A 1 110 ? 127.750 14.511  157.335 1.00 51.29  ? 110 PHE A CZ  1 
ATOM   843   N N   . TRP A 1 111 ? 129.490 17.413  154.142 1.00 55.59  ? 111 TRP A N   1 
ATOM   844   C CA  . TRP A 1 111 ? 130.750 16.726  153.855 1.00 55.71  ? 111 TRP A CA  1 
ATOM   845   C C   . TRP A 1 111 ? 131.478 16.243  155.119 1.00 61.85  ? 111 TRP A C   1 
ATOM   846   O O   . TRP A 1 111 ? 131.407 16.859  156.185 1.00 65.03  ? 111 TRP A O   1 
ATOM   847   C CB  . TRP A 1 111 ? 131.677 17.595  152.984 1.00 57.29  ? 111 TRP A CB  1 
ATOM   848   C CG  . TRP A 1 111 ? 132.312 18.817  153.599 1.00 59.39  ? 111 TRP A CG  1 
ATOM   849   C CD1 . TRP A 1 111 ? 131.934 19.473  154.733 1.00 66.04  ? 111 TRP A CD1 1 
ATOM   850   C CD2 . TRP A 1 111 ? 133.442 19.535  153.078 1.00 62.65  ? 111 TRP A CD2 1 
ATOM   851   N NE1 . TRP A 1 111 ? 132.765 20.548  154.956 1.00 61.85  ? 111 TRP A NE1 1 
ATOM   852   C CE2 . TRP A 1 111 ? 133.696 20.609  153.952 1.00 63.30  ? 111 TRP A CE2 1 
ATOM   853   C CE3 . TRP A 1 111 ? 134.264 19.369  151.957 1.00 62.53  ? 111 TRP A CE3 1 
ATOM   854   C CZ2 . TRP A 1 111 ? 134.738 21.511  153.743 1.00 69.34  ? 111 TRP A CZ2 1 
ATOM   855   C CZ3 . TRP A 1 111 ? 135.293 20.264  151.751 1.00 64.69  ? 111 TRP A CZ3 1 
ATOM   856   C CH2 . TRP A 1 111 ? 135.524 21.320  152.640 1.00 71.43  ? 111 TRP A CH2 1 
ATOM   857   N N   . LYS A 1 112 ? 132.176 15.120  154.973 1.00 58.48  ? 112 LYS A N   1 
ATOM   858   C CA  . LYS A 1 112 ? 132.807 14.411  156.083 1.00 55.10  ? 112 LYS A CA  1 
ATOM   859   C C   . LYS A 1 112 ? 134.036 13.642  155.602 1.00 65.08  ? 112 LYS A C   1 
ATOM   860   O O   . LYS A 1 112 ? 134.118 13.272  154.434 1.00 71.47  ? 112 LYS A O   1 
ATOM   861   C CB  . LYS A 1 112 ? 131.792 13.451  156.718 1.00 55.70  ? 112 LYS A CB  1 
ATOM   862   C CG  . LYS A 1 112 ? 132.224 12.786  158.015 1.00 91.95  ? 112 LYS A CG  1 
ATOM   863   C CD  . LYS A 1 112 ? 131.262 11.643  158.337 1.00 93.77  ? 112 LYS A CD  1 
ATOM   864   C CE  . LYS A 1 112 ? 131.662 10.869  159.582 1.00 82.05  ? 112 LYS A CE  1 
ATOM   865   N NZ  . LYS A 1 112 ? 131.542 11.674  160.823 1.00 99.71  ? 112 LYS A NZ  1 
ATOM   866   N N   . TRP A 1 113 ? 134.988 13.396  156.498 1.00 59.60  ? 113 TRP A N   1 
ATOM   867   C CA  . TRP A 1 113 ? 136.143 12.580  156.139 1.00 61.34  ? 113 TRP A CA  1 
ATOM   868   C C   . TRP A 1 113 ? 135.812 11.105  156.326 1.00 68.89  ? 113 TRP A C   1 
ATOM   869   O O   . TRP A 1 113 ? 135.586 10.642  157.444 1.00 93.07  ? 113 TRP A O   1 
ATOM   870   C CB  . TRP A 1 113 ? 137.376 12.954  156.968 1.00 68.59  ? 113 TRP A CB  1 
ATOM   871   C CG  . TRP A 1 113 ? 138.058 14.228  156.539 1.00 68.62  ? 113 TRP A CG  1 
ATOM   872   C CD1 . TRP A 1 113 ? 137.794 15.483  156.994 1.00 71.63  ? 113 TRP A CD1 1 
ATOM   873   C CD2 . TRP A 1 113 ? 139.120 14.364  155.581 1.00 76.80  ? 113 TRP A CD2 1 
ATOM   874   N NE1 . TRP A 1 113 ? 138.621 16.394  156.384 1.00 78.76  ? 113 TRP A NE1 1 
ATOM   875   C CE2 . TRP A 1 113 ? 139.441 15.735  155.508 1.00 77.58  ? 113 TRP A CE2 1 
ATOM   876   C CE3 . TRP A 1 113 ? 139.824 13.464  154.774 1.00 85.94  ? 113 TRP A CE3 1 
ATOM   877   C CZ2 . TRP A 1 113 ? 140.436 16.227  154.666 1.00 80.84  ? 113 TRP A CZ2 1 
ATOM   878   C CZ3 . TRP A 1 113 ? 140.812 13.956  153.936 1.00 84.62  ? 113 TRP A CZ3 1 
ATOM   879   C CH2 . TRP A 1 113 ? 141.109 15.324  153.890 1.00 80.37  ? 113 TRP A CH2 1 
ATOM   880   N N   . ILE A 1 114 ? 135.796 10.369  155.221 1.00 66.03  ? 114 ILE A N   1 
ATOM   881   C CA  . ILE A 1 114 ? 135.491 8.944   155.242 1.00 65.78  ? 114 ILE A CA  1 
ATOM   882   C C   . ILE A 1 114 ? 136.609 8.180   155.917 1.00 68.67  ? 114 ILE A C   1 
ATOM   883   O O   . ILE A 1 114 ? 136.374 7.228   156.670 1.00 74.41  ? 114 ILE A O   1 
ATOM   884   C CB  . ILE A 1 114 ? 135.256 8.398   153.824 1.00 72.99  ? 114 ILE A CB  1 
ATOM   885   C CG1 . ILE A 1 114 ? 133.851 8.772   153.375 1.00 97.57  ? 114 ILE A CG1 1 
ATOM   886   C CG2 . ILE A 1 114 ? 135.444 6.885   153.779 1.00 81.16  ? 114 ILE A CG2 1 
ATOM   887   C CD1 . ILE A 1 114 ? 132.851 8.777   154.518 1.00 102.85 ? 114 ILE A CD1 1 
ATOM   888   N N   . SER A 1 115 ? 137.830 8.600   155.624 1.00 78.39  ? 115 SER A N   1 
ATOM   889   C CA  . SER A 1 115 ? 138.998 8.023   156.248 1.00 86.23  ? 115 SER A CA  1 
ATOM   890   C C   . SER A 1 115 ? 140.073 9.079   156.208 1.00 80.08  ? 115 SER A C   1 
ATOM   891   O O   . SER A 1 115 ? 139.806 10.232  155.870 1.00 101.10 ? 115 SER A O   1 
ATOM   892   C CB  . SER A 1 115 ? 139.459 6.759   155.518 1.00 97.26  ? 115 SER A CB  1 
ATOM   893   O OG  . SER A 1 115 ? 139.865 7.055   154.191 1.00 119.70 ? 115 SER A OG  1 
ATOM   894   N N   . LEU A 1 116 ? 141.290 8.690   156.549 1.00 73.67  ? 116 LEU A N   1 
ATOM   895   C CA  . LEU A 1 116 ? 142.424 9.571   156.355 1.00 75.38  ? 116 LEU A CA  1 
ATOM   896   C C   . LEU A 1 116 ? 142.674 9.468   154.858 1.00 94.91  ? 116 LEU A C   1 
ATOM   897   O O   . LEU A 1 116 ? 142.737 8.366   154.337 1.00 116.96 ? 116 LEU A O   1 
ATOM   898   C CB  . LEU A 1 116 ? 143.641 9.166   157.199 1.00 81.21  ? 116 LEU A CB  1 
ATOM   899   C CG  . LEU A 1 116 ? 143.589 7.957   158.142 1.00 89.54  ? 116 LEU A CG  1 
ATOM   900   C CD1 . LEU A 1 116 ? 143.728 6.666   157.357 1.00 93.02  ? 116 LEU A CD1 1 
ATOM   901   C CD2 . LEU A 1 116 ? 144.667 8.048   159.218 1.00 90.65  ? 116 LEU A CD2 1 
ATOM   902   N N   . ASN A 1 117 ? 142.715 10.625  154.194 1.00 93.01  ? 117 ASN A N   1 
ATOM   903   C CA  . ASN A 1 117 ? 142.890 10.843  152.738 1.00 103.89 ? 117 ASN A CA  1 
ATOM   904   C C   . ASN A 1 117 ? 141.619 10.679  151.896 1.00 95.87  ? 117 ASN A C   1 
ATOM   905   O O   . ASN A 1 117 ? 141.695 10.694  150.661 1.00 104.50 ? 117 ASN A O   1 
ATOM   906   C CB  . ASN A 1 117 ? 143.988 9.920   152.131 1.00 108.77 ? 117 ASN A CB  1 
ATOM   907   C CG  . ASN A 1 117 ? 143.441 8.565   151.600 1.00 115.76 ? 117 ASN A CG  1 
ATOM   908   O OD1 . ASN A 1 117 ? 143.681 7.514   152.196 1.00 113.86 ? 117 ASN A OD1 1 
ATOM   909   N ND2 . ASN A 1 117 ? 142.755 8.592   150.460 1.00 125.47 ? 117 ASN A ND2 1 
ATOM   910   N N   . THR A 1 118 ? 140.444 10.690  152.516 1.00 84.88  ? 118 THR A N   1 
ATOM   911   C CA  . THR A 1 118 ? 139.216 10.611  151.720 1.00 77.92  ? 118 THR A CA  1 
ATOM   912   C C   . THR A 1 118 ? 138.096 11.400  152.361 1.00 65.40  ? 118 THR A C   1 
ATOM   913   O O   . THR A 1 118 ? 137.695 11.144  153.495 1.00 69.92  ? 118 THR A O   1 
ATOM   914   C CB  . THR A 1 118 ? 138.707 9.165   151.513 1.00 83.10  ? 118 THR A CB  1 
ATOM   915   O OG1 . THR A 1 118 ? 139.637 8.218   152.051 1.00 114.55 ? 118 THR A OG1 1 
ATOM   916   C CG2 . THR A 1 118 ? 138.494 8.884   150.027 1.00 73.09  ? 118 THR A CG2 1 
ATOM   917   N N   . VAL A 1 119 ? 137.610 12.379  151.605 1.00 61.71  ? 119 VAL A N   1 
ATOM   918   C CA  . VAL A 1 119 ? 136.520 13.234  152.038 1.00 69.59  ? 119 VAL A CA  1 
ATOM   919   C C   . VAL A 1 119 ? 135.300 13.050  151.137 1.00 75.57  ? 119 VAL A C   1 
ATOM   920   O O   . VAL A 1 119 ? 135.362 13.239  149.923 1.00 81.47  ? 119 VAL A O   1 
ATOM   921   C CB  . VAL A 1 119 ? 136.947 14.712  152.054 1.00 61.21  ? 119 VAL A CB  1 
ATOM   922   C CG1 . VAL A 1 119 ? 137.630 15.097  150.748 1.00 64.03  ? 119 VAL A CG1 1 
ATOM   923   C CG2 . VAL A 1 119 ? 135.758 15.608  152.328 1.00 66.81  ? 119 VAL A CG2 1 
ATOM   924   N N   . ALA A 1 120 ? 134.181 12.694  151.759 1.00 74.11  ? 120 ALA A N   1 
ATOM   925   C CA  . ALA A 1 120 ? 132.932 12.473  151.047 1.00 57.38  ? 120 ALA A CA  1 
ATOM   926   C C   . ALA A 1 120 ? 132.122 13.752  150.917 1.00 60.44  ? 120 ALA A C   1 
ATOM   927   O O   . ALA A 1 120 ? 132.031 14.534  151.857 1.00 59.88  ? 120 ALA A O   1 
ATOM   928   C CB  . ALA A 1 120 ? 132.119 11.401  151.741 1.00 56.54  ? 120 ALA A CB  1 
ATOM   929   N N   . LEU A 1 121 ? 131.537 13.956  149.741 1.00 66.02  ? 121 LEU A N   1 
ATOM   930   C CA  . LEU A 1 121 ? 130.768 15.163  149.469 1.00 61.14  ? 121 LEU A CA  1 
ATOM   931   C C   . LEU A 1 121 ? 129.322 14.841  149.118 1.00 60.31  ? 121 LEU A C   1 
ATOM   932   O O   . LEU A 1 121 ? 129.053 13.952  148.312 1.00 77.62  ? 121 LEU A O   1 
ATOM   933   C CB  . LEU A 1 121 ? 131.405 15.963  148.333 1.00 66.95  ? 121 LEU A CB  1 
ATOM   934   C CG  . LEU A 1 121 ? 132.924 16.079  148.342 1.00 74.64  ? 121 LEU A CG  1 
ATOM   935   C CD1 . LEU A 1 121 ? 133.423 16.632  147.016 1.00 83.05  ? 121 LEU A CD1 1 
ATOM   936   C CD2 . LEU A 1 121 ? 133.400 16.925  149.513 1.00 89.92  ? 121 LEU A CD2 1 
ATOM   937   N N   . VAL A 1 122 ? 128.390 15.557  149.737 1.00 59.79  ? 122 VAL A N   1 
ATOM   938   C CA  . VAL A 1 122 ? 126.977 15.327  149.471 1.00 62.91  ? 122 VAL A CA  1 
ATOM   939   C C   . VAL A 1 122 ? 126.309 16.563  148.885 1.00 71.64  ? 122 VAL A C   1 
ATOM   940   O O   . VAL A 1 122 ? 126.229 17.608  149.529 1.00 75.83  ? 122 VAL A O   1 
ATOM   941   C CB  . VAL A 1 122 ? 126.213 14.913  150.732 1.00 58.05  ? 122 VAL A CB  1 
ATOM   942   C CG1 . VAL A 1 122 ? 124.792 14.531  150.373 1.00 71.21  ? 122 VAL A CG1 1 
ATOM   943   C CG2 . VAL A 1 122 ? 126.917 13.757  151.431 1.00 57.03  ? 122 VAL A CG2 1 
ATOM   944   N N   . THR A 1 123 ? 125.832 16.428  147.653 1.00 65.78  ? 123 THR A N   1 
ATOM   945   C CA  . THR A 1 123 ? 125.048 17.471  147.008 1.00 66.68  ? 123 THR A CA  1 
ATOM   946   C C   . THR A 1 123 ? 123.588 17.072  147.143 1.00 82.60  ? 123 THR A C   1 
ATOM   947   O O   . THR A 1 123 ? 123.283 16.031  147.718 1.00 102.05 ? 123 THR A O   1 
ATOM   948   C CB  . THR A 1 123 ? 125.411 17.651  145.530 1.00 75.64  ? 123 THR A CB  1 
ATOM   949   O OG1 . THR A 1 123 ? 125.265 16.401  144.844 1.00 90.38  ? 123 THR A OG1 1 
ATOM   950   C CG2 . THR A 1 123 ? 126.847 18.140  145.398 1.00 75.91  ? 123 THR A CG2 1 
ATOM   951   N N   . ASP A 1 124 ? 122.679 17.891  146.632 1.00 85.90  ? 124 ASP A N   1 
ATOM   952   C CA  . ASP A 1 124 ? 121.265 17.555  146.744 1.00 83.94  ? 124 ASP A CA  1 
ATOM   953   C C   . ASP A 1 124 ? 120.880 16.360  145.882 1.00 92.30  ? 124 ASP A C   1 
ATOM   954   O O   . ASP A 1 124 ? 119.818 15.774  146.072 1.00 110.54 ? 124 ASP A O   1 
ATOM   955   C CB  . ASP A 1 124 ? 120.392 18.752  146.368 1.00 87.25  ? 124 ASP A CB  1 
ATOM   956   C CG  . ASP A 1 124 ? 120.795 20.019  147.089 1.00 106.12 ? 124 ASP A CG  1 
ATOM   957   O OD1 . ASP A 1 124 ? 120.005 20.493  147.933 1.00 99.38  ? 124 ASP A OD1 1 
ATOM   958   O OD2 . ASP A 1 124 ? 121.906 20.531  146.836 1.00 127.75 ? 124 ASP A OD2 1 
ATOM   959   N N   . ASN A 1 125 ? 121.745 15.986  144.946 1.00 83.35  ? 125 ASN A N   1 
ATOM   960   C CA  . ASN A 1 125 ? 121.414 14.922  144.002 1.00 73.82  ? 125 ASN A CA  1 
ATOM   961   C C   . ASN A 1 125 ? 122.283 13.669  144.088 1.00 76.31  ? 125 ASN A C   1 
ATOM   962   O O   . ASN A 1 125 ? 121.847 12.590  143.695 1.00 78.34  ? 125 ASN A O   1 
ATOM   963   C CB  . ASN A 1 125 ? 121.460 15.465  142.576 1.00 74.21  ? 125 ASN A CB  1 
ATOM   964   C CG  . ASN A 1 125 ? 120.709 16.770  142.429 1.00 95.49  ? 125 ASN A CG  1 
ATOM   965   O OD1 . ASN A 1 125 ? 119.483 16.785  142.299 1.00 103.84 ? 125 ASN A OD1 1 
ATOM   966   N ND2 . ASN A 1 125 ? 121.439 17.877  142.456 1.00 111.30 ? 125 ASN A ND2 1 
ATOM   967   N N   . ALA A 1 126 ? 123.509 13.799  144.585 1.00 76.41  ? 126 ALA A N   1 
ATOM   968   C CA  . ALA A 1 126 ? 124.405 12.645  144.640 1.00 64.77  ? 126 ALA A CA  1 
ATOM   969   C C   . ALA A 1 126 ? 125.469 12.715  145.731 1.00 64.18  ? 126 ALA A C   1 
ATOM   970   O O   . ALA A 1 126 ? 125.606 13.720  146.424 1.00 62.84  ? 126 ALA A O   1 
ATOM   971   C CB  . ALA A 1 126 ? 125.072 12.460  143.290 1.00 72.70  ? 126 ALA A CB  1 
ATOM   972   N N   . VAL A 1 127 ? 126.207 11.618  145.878 1.00 64.67  ? 127 VAL A N   1 
ATOM   973   C CA  . VAL A 1 127 ? 127.291 11.512  146.855 1.00 71.81  ? 127 VAL A CA  1 
ATOM   974   C C   . VAL A 1 127 ? 128.636 11.254  146.174 1.00 70.45  ? 127 VAL A C   1 
ATOM   975   O O   . VAL A 1 127 ? 128.745 10.376  145.321 1.00 79.70  ? 127 VAL A O   1 
ATOM   976   C CB  . VAL A 1 127 ? 127.021 10.395  147.867 1.00 62.09  ? 127 VAL A CB  1 
ATOM   977   C CG1 . VAL A 1 127 ? 128.226 10.183  148.765 1.00 66.70  ? 127 VAL A CG1 1 
ATOM   978   C CG2 . VAL A 1 127 ? 125.786 10.730  148.686 1.00 60.27  ? 127 VAL A CG2 1 
ATOM   979   N N   . TYR A 1 128 ? 129.659 12.012  146.553 1.00 73.67  ? 128 TYR A N   1 
ATOM   980   C CA  . TYR A 1 128 ? 130.970 11.887  145.918 1.00 78.86  ? 128 TYR A CA  1 
ATOM   981   C C   . TYR A 1 128 ? 132.093 11.510  146.884 1.00 70.27  ? 128 TYR A C   1 
ATOM   982   O O   . TYR A 1 128 ? 132.018 11.788  148.076 1.00 74.67  ? 128 TYR A O   1 
ATOM   983   C CB  . TYR A 1 128 ? 131.343 13.194  145.216 1.00 63.10  ? 128 TYR A CB  1 
ATOM   984   C CG  . TYR A 1 128 ? 130.313 13.714  144.239 1.00 77.42  ? 128 TYR A CG  1 
ATOM   985   C CD1 . TYR A 1 128 ? 129.202 14.425  144.680 1.00 80.95  ? 128 TYR A CD1 1 
ATOM   986   C CD2 . TYR A 1 128 ? 130.470 13.529  142.871 1.00 74.52  ? 128 TYR A CD2 1 
ATOM   987   C CE1 . TYR A 1 128 ? 128.264 14.915  143.789 1.00 85.18  ? 128 TYR A CE1 1 
ATOM   988   C CE2 . TYR A 1 128 ? 129.536 14.019  141.970 1.00 81.58  ? 128 TYR A CE2 1 
ATOM   989   C CZ  . TYR A 1 128 ? 128.436 14.711  142.436 1.00 92.02  ? 128 TYR A CZ  1 
ATOM   990   O OH  . TYR A 1 128 ? 127.502 15.201  141.551 1.00 103.00 ? 128 TYR A OH  1 
ATOM   991   N N   . HIS A 1 129 ? 133.132 10.873  146.350 1.00 72.25  ? 129 HIS A N   1 
ATOM   992   C CA  . HIS A 1 129 ? 134.332 10.566  147.121 1.00 63.28  ? 129 HIS A CA  1 
ATOM   993   C C   . HIS A 1 129 ? 135.547 11.275  146.531 1.00 67.45  ? 129 HIS A C   1 
ATOM   994   O O   . HIS A 1 129 ? 135.954 10.991  145.409 1.00 66.92  ? 129 HIS A O   1 
ATOM   995   C CB  . HIS A 1 129 ? 134.575 9.059   147.168 1.00 60.26  ? 129 HIS A CB  1 
ATOM   996   C CG  . HIS A 1 129 ? 133.713 8.335   148.156 1.00 60.28  ? 129 HIS A CG  1 
ATOM   997   N ND1 . HIS A 1 129 ? 133.950 7.040   148.546 1.00 61.15  ? 129 HIS A ND1 1 
ATOM   998   C CD2 . HIS A 1 129 ? 132.608 8.737   148.834 1.00 64.43  ? 129 HIS A CD2 1 
ATOM   999   C CE1 . HIS A 1 129 ? 133.036 6.666   149.424 1.00 66.33  ? 129 HIS A CE1 1 
ATOM   1000  N NE2 . HIS A 1 129 ? 132.209 7.679   149.613 1.00 63.92  ? 129 HIS A NE2 1 
ATOM   1001  N N   . TRP A 1 130 ? 136.133 12.187  147.301 1.00 65.04  ? 130 TRP A N   1 
ATOM   1002  C CA  . TRP A 1 130 ? 137.262 12.988  146.829 1.00 66.52  ? 130 TRP A CA  1 
ATOM   1003  C C   . TRP A 1 130 ? 138.555 12.627  147.563 1.00 72.98  ? 130 TRP A C   1 
ATOM   1004  O O   . TRP A 1 130 ? 138.668 12.843  148.765 1.00 78.19  ? 130 TRP A O   1 
ATOM   1005  C CB  . TRP A 1 130 ? 136.935 14.480  146.996 1.00 65.00  ? 130 TRP A CB  1 
ATOM   1006  C CG  . TRP A 1 130 ? 137.884 15.428  146.333 1.00 71.47  ? 130 TRP A CG  1 
ATOM   1007  C CD1 . TRP A 1 130 ? 138.658 15.185  145.237 1.00 69.86  ? 130 TRP A CD1 1 
ATOM   1008  C CD2 . TRP A 1 130 ? 138.110 16.798  146.687 1.00 66.79  ? 130 TRP A CD2 1 
ATOM   1009  N NE1 . TRP A 1 130 ? 139.374 16.308  144.905 1.00 70.59  ? 130 TRP A NE1 1 
ATOM   1010  C CE2 . TRP A 1 130 ? 139.053 17.314  145.778 1.00 70.57  ? 130 TRP A CE2 1 
ATOM   1011  C CE3 . TRP A 1 130 ? 137.613 17.635  147.692 1.00 66.39  ? 130 TRP A CE3 1 
ATOM   1012  C CZ2 . TRP A 1 130 ? 139.513 18.627  145.844 1.00 70.84  ? 130 TRP A CZ2 1 
ATOM   1013  C CZ3 . TRP A 1 130 ? 138.068 18.937  147.754 1.00 67.94  ? 130 TRP A CZ3 1 
ATOM   1014  C CH2 . TRP A 1 130 ? 139.008 19.421  146.836 1.00 71.98  ? 130 TRP A CH2 1 
ATOM   1015  N N   . SER A 1 131 ? 139.526 12.075  146.842 1.00 88.89  ? 131 SER A N   1 
ATOM   1016  C CA  . SER A 1 131 ? 140.776 11.676  147.473 1.00 87.80  ? 131 SER A CA  1 
ATOM   1017  C C   . SER A 1 131 ? 141.714 12.855  147.696 1.00 80.13  ? 131 SER A C   1 
ATOM   1018  O O   . SER A 1 131 ? 141.862 13.728  146.846 1.00 83.29  ? 131 SER A O   1 
ATOM   1019  C CB  . SER A 1 131 ? 141.494 10.611  146.644 1.00 97.16  ? 131 SER A CB  1 
ATOM   1020  O OG  . SER A 1 131 ? 142.647 10.135  147.319 1.00 92.45  ? 131 SER A OG  1 
ATOM   1021  N N   . MET A 1 132 ? 142.355 12.848  148.856 1.00 78.80  ? 132 MET A N   1 
ATOM   1022  C CA  . MET A 1 132 ? 143.324 13.861  149.250 1.00 79.95  ? 132 MET A CA  1 
ATOM   1023  C C   . MET A 1 132 ? 144.629 13.703  148.470 1.00 94.36  ? 132 MET A C   1 
ATOM   1024  O O   . MET A 1 132 ? 145.364 14.665  148.241 1.00 85.10  ? 132 MET A O   1 
ATOM   1025  C CB  . MET A 1 132 ? 143.554 13.762  150.758 1.00 80.76  ? 132 MET A CB  1 
ATOM   1026  C CG  . MET A 1 132 ? 144.488 14.781  151.363 1.00 100.97 ? 132 MET A CG  1 
ATOM   1027  S SD  . MET A 1 132 ? 145.058 14.171  152.960 1.00 91.59  ? 132 MET A SD  1 
ATOM   1028  C CE  . MET A 1 132 ? 146.539 13.281  152.491 1.00 133.92 ? 132 MET A CE  1 
ATOM   1029  N N   . GLU A 1 133 ? 144.896 12.464  148.076 1.00 101.84 ? 133 GLU A N   1 
ATOM   1030  C CA  . GLU A 1 133 ? 146.091 12.093  147.334 1.00 90.68  ? 133 GLU A CA  1 
ATOM   1031  C C   . GLU A 1 133 ? 145.947 12.338  145.829 1.00 93.21  ? 133 GLU A C   1 
ATOM   1032  O O   . GLU A 1 133 ? 144.846 12.244  145.277 1.00 95.24  ? 133 GLU A O   1 
ATOM   1033  C CB  . GLU A 1 133 ? 146.401 10.620  147.586 1.00 90.05  ? 133 GLU A CB  1 
ATOM   1034  C CG  . GLU A 1 133 ? 146.889 10.322  148.995 1.00 98.09  ? 133 GLU A CG  1 
ATOM   1035  C CD  . GLU A 1 133 ? 148.309 10.783  149.235 1.00 126.77 ? 133 GLU A CD  1 
ATOM   1036  O OE1 . GLU A 1 133 ? 149.215 10.290  148.531 1.00 134.93 ? 133 GLU A OE1 1 
ATOM   1037  O OE2 . GLU A 1 133 ? 148.524 11.624  150.134 1.00 136.37 ? 133 GLU A OE2 1 
ATOM   1038  N N   . GLY A 1 134 ? 147.062 12.672  145.181 1.00 102.20 ? 134 GLY A N   1 
ATOM   1039  C CA  . GLY A 1 134 ? 147.107 12.830  143.735 1.00 90.53  ? 134 GLY A CA  1 
ATOM   1040  C C   . GLY A 1 134 ? 146.413 14.026  143.111 1.00 90.57  ? 134 GLY A C   1 
ATOM   1041  O O   . GLY A 1 134 ? 146.332 15.099  143.706 1.00 89.49  ? 134 GLY A O   1 
ATOM   1042  N N   . GLU A 1 135 ? 145.924 13.836  141.889 1.00 88.77  ? 135 GLU A N   1 
ATOM   1043  C CA  . GLU A 1 135 ? 145.231 14.895  141.161 1.00 93.18  ? 135 GLU A CA  1 
ATOM   1044  C C   . GLU A 1 135 ? 143.820 14.478  140.762 1.00 107.71 ? 135 GLU A C   1 
ATOM   1045  O O   . GLU A 1 135 ? 143.217 15.052  139.857 1.00 100.64 ? 135 GLU A O   1 
ATOM   1046  C CB  . GLU A 1 135 ? 146.017 15.276  139.909 1.00 99.61  ? 135 GLU A CB  1 
ATOM   1047  C CG  . GLU A 1 135 ? 147.205 16.192  140.159 1.00 104.18 ? 135 GLU A CG  1 
ATOM   1048  C CD  . GLU A 1 135 ? 148.392 15.461  140.755 1.00 116.24 ? 135 GLU A CD  1 
ATOM   1049  O OE1 . GLU A 1 135 ? 148.613 14.280  140.407 1.00 112.88 ? 135 GLU A OE1 1 
ATOM   1050  O OE2 . GLU A 1 135 ? 149.119 16.075  141.562 1.00 127.12 ? 135 GLU A OE2 1 
ATOM   1051  N N   . SER A 1 136 ? 143.290 13.490  141.468 1.00 107.41 ? 136 SER A N   1 
ATOM   1052  C CA  . SER A 1 136 ? 141.969 12.938  141.185 1.00 82.67  ? 136 SER A CA  1 
ATOM   1053  C C   . SER A 1 136 ? 140.793 13.823  141.606 1.00 90.73  ? 136 SER A C   1 
ATOM   1054  O O   . SER A 1 136 ? 140.720 14.290  142.742 1.00 103.21 ? 136 SER A O   1 
ATOM   1055  C CB  . SER A 1 136 ? 141.845 11.563  141.850 1.00 83.53  ? 136 SER A CB  1 
ATOM   1056  O OG  . SER A 1 136 ? 142.111 11.638  143.241 1.00 88.58  ? 136 SER A OG  1 
ATOM   1057  N N   . GLN A 1 137 ? 139.887 14.059  140.660 1.00 103.04 ? 137 GLN A N   1 
ATOM   1058  C CA  . GLN A 1 137 ? 138.674 14.842  140.887 1.00 93.14  ? 137 GLN A CA  1 
ATOM   1059  C C   . GLN A 1 137 ? 137.690 14.032  141.732 1.00 76.46  ? 137 GLN A C   1 
ATOM   1060  O O   . GLN A 1 137 ? 137.828 12.813  141.815 1.00 75.58  ? 137 GLN A O   1 
ATOM   1061  C CB  . GLN A 1 137 ? 138.041 15.224  139.547 1.00 107.22 ? 137 GLN A CB  1 
ATOM   1062  C CG  . GLN A 1 137 ? 137.783 16.703  139.356 1.00 117.04 ? 137 GLN A CG  1 
ATOM   1063  C CD  . GLN A 1 137 ? 139.047 17.518  139.188 1.00 130.55 ? 137 GLN A CD  1 
ATOM   1064  O OE1 . GLN A 1 137 ? 139.873 17.609  140.096 1.00 157.88 ? 137 GLN A OE1 1 
ATOM   1065  N NE2 . GLN A 1 137 ? 139.210 18.110  138.011 1.00 115.78 ? 137 GLN A NE2 1 
ATOM   1066  N N   . PRO A 1 138 ? 136.717 14.700  142.388 1.00 83.66  ? 138 PRO A N   1 
ATOM   1067  C CA  . PRO A 1 138 ? 135.710 13.959  143.160 1.00 71.42  ? 138 PRO A CA  1 
ATOM   1068  C C   . PRO A 1 138 ? 134.933 12.956  142.310 1.00 72.85  ? 138 PRO A C   1 
ATOM   1069  O O   . PRO A 1 138 ? 134.409 13.303  141.253 1.00 74.28  ? 138 PRO A O   1 
ATOM   1070  C CB  . PRO A 1 138 ? 134.785 15.065  143.685 1.00 69.89  ? 138 PRO A CB  1 
ATOM   1071  C CG  . PRO A 1 138 ? 135.630 16.285  143.689 1.00 73.31  ? 138 PRO A CG  1 
ATOM   1072  C CD  . PRO A 1 138 ? 136.509 16.155  142.490 1.00 81.79  ? 138 PRO A CD  1 
ATOM   1073  N N   . VAL A 1 139 ? 134.860 11.719  142.791 1.00 69.53  ? 139 VAL A N   1 
ATOM   1074  C CA  . VAL A 1 139 ? 134.222 10.635  142.051 1.00 71.89  ? 139 VAL A CA  1 
ATOM   1075  C C   . VAL A 1 139 ? 132.815 10.339  142.559 1.00 90.68  ? 139 VAL A C   1 
ATOM   1076  O O   . VAL A 1 139 ? 132.616 10.093  143.747 1.00 99.10  ? 139 VAL A O   1 
ATOM   1077  C CB  . VAL A 1 139 ? 135.048 9.347   142.128 1.00 72.51  ? 139 VAL A CB  1 
ATOM   1078  C CG1 . VAL A 1 139 ? 134.512 8.329   141.144 1.00 73.67  ? 139 VAL A CG1 1 
ATOM   1079  C CG2 . VAL A 1 139 ? 136.512 9.638   141.849 1.00 87.10  ? 139 VAL A CG2 1 
ATOM   1080  N N   . LYS A 1 140 ? 131.845 10.356  141.649 1.00 82.60  ? 140 LYS A N   1 
ATOM   1081  C CA  . LYS A 1 140 ? 130.458 10.050  141.989 1.00 69.31  ? 140 LYS A CA  1 
ATOM   1082  C C   . LYS A 1 140 ? 130.284 8.598   142.430 1.00 71.64  ? 140 LYS A C   1 
ATOM   1083  O O   . LYS A 1 140 ? 130.684 7.668   141.725 1.00 81.17  ? 140 LYS A O   1 
ATOM   1084  C CB  . LYS A 1 140 ? 129.544 10.347  140.798 1.00 69.13  ? 140 LYS A CB  1 
ATOM   1085  C CG  . LYS A 1 140 ? 128.057 10.303  141.119 1.00 69.05  ? 140 LYS A CG  1 
ATOM   1086  C CD  . LYS A 1 140 ? 127.223 10.796  139.942 1.00 75.76  ? 140 LYS A CD  1 
ATOM   1087  C CE  . LYS A 1 140 ? 125.831 10.186  139.952 1.00 83.89  ? 140 LYS A CE  1 
ATOM   1088  N NZ  . LYS A 1 140 ? 124.992 10.691  138.831 1.00 92.76  ? 140 LYS A NZ  1 
ATOM   1089  N N   . MET A 1 141 ? 129.674 8.414   143.597 1.00 68.23  ? 141 MET A N   1 
ATOM   1090  C CA  . MET A 1 141 ? 129.485 7.082   144.161 1.00 66.50  ? 141 MET A CA  1 
ATOM   1091  C C   . MET A 1 141 ? 128.086 6.538   143.897 1.00 70.62  ? 141 MET A C   1 
ATOM   1092  O O   . MET A 1 141 ? 127.931 5.390   143.477 1.00 80.40  ? 141 MET A O   1 
ATOM   1093  C CB  . MET A 1 141 ? 129.767 7.097   145.663 1.00 70.80  ? 141 MET A CB  1 
ATOM   1094  C CG  . MET A 1 141 ? 131.220 7.404   146.002 1.00 91.30  ? 141 MET A CG  1 
ATOM   1095  S SD  . MET A 1 141 ? 132.335 6.054   145.578 1.00 72.07  ? 141 MET A SD  1 
ATOM   1096  C CE  . MET A 1 141 ? 133.394 6.852   144.367 1.00 135.71 ? 141 MET A CE  1 
ATOM   1097  N N   . PHE A 1 142 ? 127.072 7.361   144.144 1.00 75.29  ? 142 PHE A N   1 
ATOM   1098  C CA  . PHE A 1 142 ? 125.691 6.959   143.904 1.00 65.75  ? 142 PHE A CA  1 
ATOM   1099  C C   . PHE A 1 142 ? 124.773 8.177   143.876 1.00 69.56  ? 142 PHE A C   1 
ATOM   1100  O O   . PHE A 1 142 ? 125.132 9.249   144.364 1.00 68.40  ? 142 PHE A O   1 
ATOM   1101  C CB  . PHE A 1 142 ? 125.217 5.943   144.955 1.00 65.31  ? 142 PHE A CB  1 
ATOM   1102  C CG  . PHE A 1 142 ? 125.221 6.461   146.368 1.00 70.81  ? 142 PHE A CG  1 
ATOM   1103  C CD1 . PHE A 1 142 ? 126.350 6.349   147.163 1.00 73.73  ? 142 PHE A CD1 1 
ATOM   1104  C CD2 . PHE A 1 142 ? 124.082 7.028   146.912 1.00 74.98  ? 142 PHE A CD2 1 
ATOM   1105  C CE1 . PHE A 1 142 ? 126.349 6.813   148.466 1.00 62.91  ? 142 PHE A CE1 1 
ATOM   1106  C CE2 . PHE A 1 142 ? 124.074 7.496   148.212 1.00 71.64  ? 142 PHE A CE2 1 
ATOM   1107  C CZ  . PHE A 1 142 ? 125.207 7.384   148.992 1.00 61.22  ? 142 PHE A CZ  1 
ATOM   1108  N N   . ASP A 1 143 ? 123.594 8.011   143.286 1.00 70.98  ? 143 ASP A N   1 
ATOM   1109  C CA  . ASP A 1 143 ? 122.613 9.087   143.223 1.00 91.00  ? 143 ASP A CA  1 
ATOM   1110  C C   . ASP A 1 143 ? 121.716 9.070   144.457 1.00 96.83  ? 143 ASP A C   1 
ATOM   1111  O O   . ASP A 1 143 ? 121.318 8.007   144.930 1.00 101.58 ? 143 ASP A O   1 
ATOM   1112  C CB  . ASP A 1 143 ? 121.761 8.966   141.957 1.00 107.42 ? 143 ASP A CB  1 
ATOM   1113  C CG  . ASP A 1 143 ? 122.422 9.588   140.744 1.00 109.13 ? 143 ASP A CG  1 
ATOM   1114  O OD1 . ASP A 1 143 ? 122.546 10.830  140.708 1.00 95.81  ? 143 ASP A OD1 1 
ATOM   1115  O OD2 . ASP A 1 143 ? 122.818 8.839   139.825 1.00 123.98 ? 143 ASP A OD2 1 
ATOM   1116  N N   . ARG A 1 144 ? 121.407 10.253  144.979 1.00 90.41  ? 144 ARG A N   1 
ATOM   1117  C CA  . ARG A 1 144 ? 120.548 10.380  146.156 1.00 71.71  ? 144 ARG A CA  1 
ATOM   1118  C C   . ARG A 1 144 ? 119.126 9.884   145.904 1.00 79.24  ? 144 ARG A C   1 
ATOM   1119  O O   . ARG A 1 144 ? 118.503 10.229  144.899 1.00 105.37 ? 144 ARG A O   1 
ATOM   1120  C CB  . ARG A 1 144 ? 120.522 11.832  146.643 1.00 65.78  ? 144 ARG A CB  1 
ATOM   1121  C CG  . ARG A 1 144 ? 121.564 12.115  147.712 1.00 66.51  ? 144 ARG A CG  1 
ATOM   1122  C CD  . ARG A 1 144 ? 121.478 13.537  148.235 1.00 74.68  ? 144 ARG A CD  1 
ATOM   1123  N NE  . ARG A 1 144 ? 120.233 13.803  148.947 1.00 73.40  ? 144 ARG A NE  1 
ATOM   1124  C CZ  . ARG A 1 144 ? 120.019 14.890  149.680 1.00 71.44  ? 144 ARG A CZ  1 
ATOM   1125  N NH1 . ARG A 1 144 ? 118.857 15.059  150.295 1.00 76.74  ? 144 ARG A NH1 1 
ATOM   1126  N NH2 . ARG A 1 144 ? 120.968 15.809  149.796 1.00 71.74  ? 144 ARG A NH2 1 
ATOM   1127  N N   . HIS A 1 145 ? 118.630 9.063   146.824 1.00 70.45  ? 145 HIS A N   1 
ATOM   1128  C CA  . HIS A 1 145 ? 117.285 8.506   146.736 1.00 76.00  ? 145 HIS A CA  1 
ATOM   1129  C C   . HIS A 1 145 ? 116.232 9.579   146.994 1.00 84.05  ? 145 HIS A C   1 
ATOM   1130  O O   . HIS A 1 145 ? 116.476 10.527  147.738 1.00 91.92  ? 145 HIS A O   1 
ATOM   1131  C CB  . HIS A 1 145 ? 117.131 7.358   147.739 1.00 78.08  ? 145 HIS A CB  1 
ATOM   1132  C CG  . HIS A 1 145 ? 115.947 6.477   147.482 1.00 82.28  ? 145 HIS A CG  1 
ATOM   1133  N ND1 . HIS A 1 145 ? 114.657 6.852   147.776 1.00 85.21  ? 145 HIS A ND1 1 
ATOM   1134  C CD2 . HIS A 1 145 ? 115.863 5.225   146.965 1.00 83.30  ? 145 HIS A CD2 1 
ATOM   1135  C CE1 . HIS A 1 145 ? 113.824 5.880   147.450 1.00 90.41  ? 145 HIS A CE1 1 
ATOM   1136  N NE2 . HIS A 1 145 ? 114.536 4.879   146.954 1.00 82.83  ? 145 HIS A NE2 1 
ATOM   1137  N N   . SER A 1 146 ? 115.068 9.430   146.365 1.00 89.97  ? 146 SER A N   1 
ATOM   1138  C CA  . SER A 1 146 ? 113.965 10.384  146.518 1.00 85.39  ? 146 SER A CA  1 
ATOM   1139  C C   . SER A 1 146 ? 113.447 10.481  147.955 1.00 82.34  ? 146 SER A C   1 
ATOM   1140  O O   . SER A 1 146 ? 112.926 11.517  148.366 1.00 80.09  ? 146 SER A O   1 
ATOM   1141  C CB  . SER A 1 146 ? 112.811 10.016  145.588 1.00 84.58  ? 146 SER A CB  1 
ATOM   1142  O OG  . SER A 1 146 ? 112.358 8.695   145.828 1.00 91.79  ? 146 SER A OG  1 
ATOM   1143  N N   . SER A 1 147 ? 113.591 9.400   148.716 1.00 74.16  ? 147 SER A N   1 
ATOM   1144  C CA  . SER A 1 147 ? 113.152 9.366   150.111 1.00 67.93  ? 147 SER A CA  1 
ATOM   1145  C C   . SER A 1 147 ? 113.913 10.366  150.982 1.00 67.54  ? 147 SER A C   1 
ATOM   1146  O O   . SER A 1 147 ? 113.402 10.821  152.004 1.00 73.96  ? 147 SER A O   1 
ATOM   1147  C CB  . SER A 1 147 ? 113.311 7.958   150.683 1.00 68.86  ? 147 SER A CB  1 
ATOM   1148  O OG  . SER A 1 147 ? 114.679 7.636   150.861 1.00 77.98  ? 147 SER A OG  1 
ATOM   1149  N N   . LEU A 1 148 ? 115.135 10.699  150.579 1.00 68.35  ? 148 LEU A N   1 
ATOM   1150  C CA  . LEU A 1 148 ? 115.960 11.644  151.323 1.00 64.84  ? 148 LEU A CA  1 
ATOM   1151  C C   . LEU A 1 148 ? 115.819 13.083  150.831 1.00 68.95  ? 148 LEU A C   1 
ATOM   1152  O O   . LEU A 1 148 ? 116.498 13.980  151.329 1.00 78.67  ? 148 LEU A O   1 
ATOM   1153  C CB  . LEU A 1 148 ? 117.427 11.226  151.269 1.00 65.94  ? 148 LEU A CB  1 
ATOM   1154  C CG  . LEU A 1 148 ? 117.839 10.256  152.374 1.00 70.15  ? 148 LEU A CG  1 
ATOM   1155  C CD1 . LEU A 1 148 ? 117.736 8.821   151.893 1.00 87.89  ? 148 LEU A CD1 1 
ATOM   1156  C CD2 . LEU A 1 148 ? 119.242 10.566  152.849 1.00 60.39  ? 148 LEU A CD2 1 
ATOM   1157  N N   . ALA A 1 149 ? 114.959 13.299  149.841 1.00 72.75  ? 149 ALA A N   1 
ATOM   1158  C CA  . ALA A 1 149 ? 114.729 14.639  149.316 1.00 74.79  ? 149 ALA A CA  1 
ATOM   1159  C C   . ALA A 1 149 ? 114.088 15.547  150.365 1.00 78.03  ? 149 ALA A C   1 
ATOM   1160  O O   . ALA A 1 149 ? 113.080 15.194  150.978 1.00 102.32 ? 149 ALA A O   1 
ATOM   1161  C CB  . ALA A 1 149 ? 113.861 14.581  148.071 1.00 75.17  ? 149 ALA A CB  1 
ATOM   1162  N N   . GLY A 1 150 ? 114.676 16.726  150.554 1.00 72.17  ? 150 GLY A N   1 
ATOM   1163  C CA  . GLY A 1 150 ? 114.188 17.689  151.527 1.00 77.79  ? 150 GLY A CA  1 
ATOM   1164  C C   . GLY A 1 150 ? 114.724 17.486  152.933 1.00 85.89  ? 150 GLY A C   1 
ATOM   1165  O O   . GLY A 1 150 ? 114.467 18.289  153.826 1.00 93.24  ? 150 GLY A O   1 
ATOM   1166  N N   . CYS A 1 151 ? 115.463 16.400  153.127 1.00 88.29  ? 151 CYS A N   1 
ATOM   1167  C CA  . CYS A 1 151 ? 116.039 16.066  154.429 1.00 78.05  ? 151 CYS A CA  1 
ATOM   1168  C C   . CYS A 1 151 ? 117.304 16.855  154.753 1.00 82.60  ? 151 CYS A C   1 
ATOM   1169  O O   . CYS A 1 151 ? 118.037 17.267  153.856 1.00 93.53  ? 151 CYS A O   1 
ATOM   1170  C CB  . CYS A 1 151 ? 116.357 14.571  154.501 1.00 69.58  ? 151 CYS A CB  1 
ATOM   1171  S SG  . CYS A 1 151 ? 114.911 13.497  154.526 1.00 93.80  ? 151 CYS A SG  1 
ATOM   1172  N N   . GLN A 1 152 ? 117.535 17.086  156.043 1.00 81.07  ? 152 GLN A N   1 
ATOM   1173  C CA  . GLN A 1 152 ? 118.787 17.673  156.498 1.00 60.02  ? 152 GLN A CA  1 
ATOM   1174  C C   . GLN A 1 152 ? 119.748 16.518  156.706 1.00 70.76  ? 152 GLN A C   1 
ATOM   1175  O O   . GLN A 1 152 ? 119.540 15.679  157.581 1.00 80.39  ? 152 GLN A O   1 
ATOM   1176  C CB  . GLN A 1 152 ? 118.605 18.456  157.796 1.00 60.67  ? 152 GLN A CB  1 
ATOM   1177  C CG  . GLN A 1 152 ? 119.878 19.102  158.326 1.00 74.52  ? 152 GLN A CG  1 
ATOM   1178  C CD  . GLN A 1 152 ? 119.830 19.327  159.825 1.00 95.40  ? 152 GLN A CD  1 
ATOM   1179  O OE1 . GLN A 1 152 ? 119.891 18.379  160.607 1.00 102.14 ? 152 GLN A OE1 1 
ATOM   1180  N NE2 . GLN A 1 152 ? 119.707 20.584  160.233 1.00 115.85 ? 152 GLN A NE2 1 
ATOM   1181  N N   . ILE A 1 153 ? 120.803 16.473  155.901 1.00 70.15  ? 153 ILE A N   1 
ATOM   1182  C CA  . ILE A 1 153 ? 121.763 15.382  155.991 1.00 69.08  ? 153 ILE A CA  1 
ATOM   1183  C C   . ILE A 1 153 ? 122.571 15.502  157.265 1.00 62.13  ? 153 ILE A C   1 
ATOM   1184  O O   . ILE A 1 153 ? 123.218 16.516  157.505 1.00 67.58  ? 153 ILE A O   1 
ATOM   1185  C CB  . ILE A 1 153 ? 122.718 15.353  154.797 1.00 61.07  ? 153 ILE A CB  1 
ATOM   1186  C CG1 . ILE A 1 153 ? 121.924 15.203  153.507 1.00 56.04  ? 153 ILE A CG1 1 
ATOM   1187  C CG2 . ILE A 1 153 ? 123.687 14.197  154.936 1.00 60.02  ? 153 ILE A CG2 1 
ATOM   1188  C CD1 . ILE A 1 153 ? 121.000 14.017  153.529 1.00 64.51  ? 153 ILE A CD1 1 
ATOM   1189  N N   . ILE A 1 154 ? 122.536 14.461  158.085 1.00 65.64  ? 154 ILE A N   1 
ATOM   1190  C CA  . ILE A 1 154 ? 123.205 14.514  159.379 1.00 60.11  ? 154 ILE A CA  1 
ATOM   1191  C C   . ILE A 1 154 ? 124.475 13.677  159.436 1.00 60.47  ? 154 ILE A C   1 
ATOM   1192  O O   . ILE A 1 154 ? 125.348 13.939  160.263 1.00 73.45  ? 154 ILE A O   1 
ATOM   1193  C CB  . ILE A 1 154 ? 122.274 14.063  160.509 1.00 51.91  ? 154 ILE A CB  1 
ATOM   1194  C CG1 . ILE A 1 154 ? 121.643 12.711  160.170 1.00 65.00  ? 154 ILE A CG1 1 
ATOM   1195  C CG2 . ILE A 1 154 ? 121.211 15.114  160.750 1.00 51.28  ? 154 ILE A CG2 1 
ATOM   1196  C CD1 . ILE A 1 154 ? 121.814 11.695  161.275 1.00 59.19  ? 154 ILE A CD1 1 
ATOM   1197  N N   . ASN A 1 155 ? 124.562 12.649  158.596 1.00 47.60  ? 155 ASN A N   1 
ATOM   1198  C CA  . ASN A 1 155 ? 125.756 11.811  158.570 1.00 54.54  ? 155 ASN A CA  1 
ATOM   1199  C C   . ASN A 1 155 ? 125.926 10.969  157.303 1.00 61.10  ? 155 ASN A C   1 
ATOM   1200  O O   . ASN A 1 155 ? 124.972 10.738  156.557 1.00 50.47  ? 155 ASN A O   1 
ATOM   1201  C CB  . ASN A 1 155 ? 125.761 10.883  159.782 1.00 48.17  ? 155 ASN A CB  1 
ATOM   1202  C CG  . ASN A 1 155 ? 127.157 10.458  160.178 1.00 67.57  ? 155 ASN A CG  1 
ATOM   1203  O OD1 . ASN A 1 155 ? 127.506 9.283   160.089 1.00 98.18  ? 155 ASN A OD1 1 
ATOM   1204  N ND2 . ASN A 1 155 ? 127.965 11.415  160.619 1.00 67.78  ? 155 ASN A ND2 1 
ATOM   1205  N N   . TYR A 1 156 ? 127.161 10.515  157.083 1.00 56.65  ? 156 TYR A N   1 
ATOM   1206  C CA  . TYR A 1 156 ? 127.510 9.606   155.993 1.00 59.90  ? 156 TYR A CA  1 
ATOM   1207  C C   . TYR A 1 156 ? 128.569 8.597   156.442 1.00 53.45  ? 156 TYR A C   1 
ATOM   1208  O O   . TYR A 1 156 ? 129.647 8.980   156.894 1.00 61.58  ? 156 TYR A O   1 
ATOM   1209  C CB  . TYR A 1 156 ? 128.005 10.378  154.769 1.00 48.02  ? 156 TYR A CB  1 
ATOM   1210  C CG  . TYR A 1 156 ? 128.415 9.472   153.626 1.00 49.90  ? 156 TYR A CG  1 
ATOM   1211  C CD1 . TYR A 1 156 ? 127.466 8.801   152.869 1.00 61.88  ? 156 TYR A CD1 1 
ATOM   1212  C CD2 . TYR A 1 156 ? 129.752 9.296   153.300 1.00 53.81  ? 156 TYR A CD2 1 
ATOM   1213  C CE1 . TYR A 1 156 ? 127.840 7.969   151.824 1.00 66.33  ? 156 TYR A CE1 1 
ATOM   1214  C CE2 . TYR A 1 156 ? 130.136 8.470   152.258 1.00 51.97  ? 156 TYR A CE2 1 
ATOM   1215  C CZ  . TYR A 1 156 ? 129.177 7.810   151.522 1.00 59.28  ? 156 TYR A CZ  1 
ATOM   1216  O OH  . TYR A 1 156 ? 129.556 6.989   150.482 1.00 70.51  ? 156 TYR A OH  1 
ATOM   1217  N N   . ARG A 1 157 ? 128.255 7.310   156.307 1.00 64.63  ? 157 ARG A N   1 
ATOM   1218  C CA  . ARG A 1 157 ? 129.127 6.236   156.780 1.00 65.32  ? 157 ARG A CA  1 
ATOM   1219  C C   . ARG A 1 157 ? 129.384 5.149   155.732 1.00 61.06  ? 157 ARG A C   1 
ATOM   1220  O O   . ARG A 1 157 ? 128.615 4.989   154.788 1.00 83.44  ? 157 ARG A O   1 
ATOM   1221  C CB  . ARG A 1 157 ? 128.520 5.600   158.028 1.00 70.05  ? 157 ARG A CB  1 
ATOM   1222  C CG  . ARG A 1 157 ? 128.861 6.303   159.327 1.00 73.14  ? 157 ARG A CG  1 
ATOM   1223  C CD  . ARG A 1 157 ? 128.014 5.744   160.449 1.00 70.52  ? 157 ARG A CD  1 
ATOM   1224  N NE  . ARG A 1 157 ? 128.564 6.039   161.768 1.00 81.62  ? 157 ARG A NE  1 
ATOM   1225  C CZ  . ARG A 1 157 ? 129.480 5.289   162.371 1.00 84.52  ? 157 ARG A CZ  1 
ATOM   1226  N NH1 . ARG A 1 157 ? 129.927 5.622   163.572 1.00 91.45  ? 157 ARG A NH1 1 
ATOM   1227  N NH2 . ARG A 1 157 ? 129.949 4.203   161.772 1.00 81.61  ? 157 ARG A NH2 1 
ATOM   1228  N N   . THR A 1 158 ? 130.480 4.409   155.902 1.00 54.95  ? 158 THR A N   1 
ATOM   1229  C CA  . THR A 1 158 ? 130.848 3.301   155.009 1.00 76.84  ? 158 THR A CA  1 
ATOM   1230  C C   . THR A 1 158 ? 131.409 2.134   155.835 1.00 72.59  ? 158 THR A C   1 
ATOM   1231  O O   . THR A 1 158 ? 131.903 2.354   156.933 1.00 67.39  ? 158 THR A O   1 
ATOM   1232  C CB  . THR A 1 158 ? 131.919 3.718   153.955 1.00 79.30  ? 158 THR A CB  1 
ATOM   1233  O OG1 . THR A 1 158 ? 133.221 3.660   154.551 1.00 62.88  ? 158 THR A OG1 1 
ATOM   1234  C CG2 . THR A 1 158 ? 131.684 5.137   153.434 1.00 56.90  ? 158 THR A CG2 1 
ATOM   1235  N N   . ASP A 1 159 ? 131.350 0.899   155.338 1.00 71.78  ? 159 ASP A N   1 
ATOM   1236  C CA  . ASP A 1 159 ? 132.000 -0.186  156.076 1.00 69.63  ? 159 ASP A CA  1 
ATOM   1237  C C   . ASP A 1 159 ? 133.501 -0.087  155.842 1.00 79.25  ? 159 ASP A C   1 
ATOM   1238  O O   . ASP A 1 159 ? 133.978 0.788   155.112 1.00 69.80  ? 159 ASP A O   1 
ATOM   1239  C CB  . ASP A 1 159 ? 131.534 -1.578  155.662 1.00 91.89  ? 159 ASP A CB  1 
ATOM   1240  C CG  . ASP A 1 159 ? 132.045 -1.977  154.301 1.00 108.17 ? 159 ASP A CG  1 
ATOM   1241  O OD1 . ASP A 1 159 ? 131.659 -1.318  153.320 1.00 116.20 ? 159 ASP A OD1 1 
ATOM   1242  O OD2 . ASP A 1 159 ? 132.847 -2.936  154.215 1.00 102.18 ? 159 ASP A OD2 1 
ATOM   1243  N N   . ALA A 1 160 ? 134.236 -0.995  156.474 1.00 78.78  ? 160 ALA A N   1 
ATOM   1244  C CA  . ALA A 1 160 ? 135.688 -1.054  156.355 1.00 66.54  ? 160 ALA A CA  1 
ATOM   1245  C C   . ALA A 1 160 ? 136.151 -1.181  154.903 1.00 71.14  ? 160 ALA A C   1 
ATOM   1246  O O   . ALA A 1 160 ? 136.935 -0.365  154.423 1.00 70.07  ? 160 ALA A O   1 
ATOM   1247  C CB  . ALA A 1 160 ? 136.226 -2.217  157.182 1.00 75.04  ? 160 ALA A CB  1 
ATOM   1248  N N   . LYS A 1 161 ? 135.660 -2.202  154.207 1.00 76.30  ? 161 LYS A N   1 
ATOM   1249  C CA  . LYS A 1 161 ? 136.027 -2.437  152.808 1.00 71.87  ? 161 LYS A CA  1 
ATOM   1250  C C   . LYS A 1 161 ? 135.468 -1.386  151.838 1.00 73.96  ? 161 LYS A C   1 
ATOM   1251  O O   . LYS A 1 161 ? 135.818 -1.374  150.656 1.00 75.14  ? 161 LYS A O   1 
ATOM   1252  C CB  . LYS A 1 161 ? 135.566 -3.831  152.370 1.00 74.85  ? 161 LYS A CB  1 
ATOM   1253  C CG  . LYS A 1 161 ? 136.388 -4.995  152.930 1.00 87.34  ? 161 LYS A CG  1 
ATOM   1254  C CD  . LYS A 1 161 ? 135.678 -5.670  154.092 1.00 102.23 ? 161 LYS A CD  1 
ATOM   1255  C CE  . LYS A 1 161 ? 136.577 -6.678  154.794 1.00 113.13 ? 161 LYS A CE  1 
ATOM   1256  N NZ  . LYS A 1 161 ? 136.752 -7.925  154.001 1.00 111.28 ? 161 LYS A NZ  1 
ATOM   1257  N N   . GLN A 1 162 ? 134.605 -0.512  152.351 1.00 82.99  ? 162 GLN A N   1 
ATOM   1258  C CA  . GLN A 1 162 ? 133.945 0.529   151.558 1.00 79.10  ? 162 GLN A CA  1 
ATOM   1259  C C   . GLN A 1 162 ? 133.128 -0.046  150.408 1.00 87.34  ? 162 GLN A C   1 
ATOM   1260  O O   . GLN A 1 162 ? 133.088 0.514   149.313 1.00 92.03  ? 162 GLN A O   1 
ATOM   1261  C CB  . GLN A 1 162 ? 134.949 1.553   151.019 1.00 69.81  ? 162 GLN A CB  1 
ATOM   1262  C CG  . GLN A 1 162 ? 135.512 2.464   152.101 1.00 76.08  ? 162 GLN A CG  1 
ATOM   1263  C CD  . GLN A 1 162 ? 136.255 3.662   151.534 1.00 90.37  ? 162 GLN A CD  1 
ATOM   1264  O OE1 . GLN A 1 162 ? 135.945 4.139   150.441 1.00 100.07 ? 162 GLN A OE1 1 
ATOM   1265  N NE2 . GLN A 1 162 ? 137.216 4.176   152.293 1.00 109.98 ? 162 GLN A NE2 1 
ATOM   1266  N N   . LYS A 1 163 ? 132.489 -1.181  150.659 1.00 84.38  ? 163 LYS A N   1 
ATOM   1267  C CA  . LYS A 1 163 ? 131.615 -1.794  149.670 1.00 85.32  ? 163 LYS A CA  1 
ATOM   1268  C C   . LYS A 1 163 ? 130.171 -1.410  149.975 1.00 81.98  ? 163 LYS A C   1 
ATOM   1269  O O   . LYS A 1 163 ? 129.280 -1.581  149.146 1.00 74.58  ? 163 LYS A O   1 
ATOM   1270  C CB  . LYS A 1 163 ? 131.781 -3.307  149.655 1.00 82.48  ? 163 LYS A CB  1 
ATOM   1271  C CG  . LYS A 1 163 ? 133.180 -3.774  149.271 1.00 85.36  ? 163 LYS A CG  1 
ATOM   1272  C CD  . LYS A 1 163 ? 133.258 -4.194  147.806 1.00 97.53  ? 163 LYS A CD  1 
ATOM   1273  C CE  . LYS A 1 163 ? 133.723 -3.062  146.903 1.00 115.59 ? 163 LYS A CE  1 
ATOM   1274  N NZ  . LYS A 1 163 ? 135.170 -2.770  147.102 1.00 115.83 ? 163 LYS A NZ  1 
ATOM   1275  N N   . TRP A 1 164 ? 129.945 -0.910  151.186 1.00 77.92  ? 164 TRP A N   1 
ATOM   1276  C CA  . TRP A 1 164 ? 128.620 -0.442  151.586 1.00 67.61  ? 164 TRP A CA  1 
ATOM   1277  C C   . TRP A 1 164 ? 128.653 0.997   152.087 1.00 68.57  ? 164 TRP A C   1 
ATOM   1278  O O   . TRP A 1 164 ? 129.391 1.331   153.012 1.00 70.20  ? 164 TRP A O   1 
ATOM   1279  C CB  . TRP A 1 164 ? 128.015 -1.352  152.651 1.00 67.54  ? 164 TRP A CB  1 
ATOM   1280  C CG  . TRP A 1 164 ? 127.107 -2.385  152.074 1.00 85.50  ? 164 TRP A CG  1 
ATOM   1281  C CD1 . TRP A 1 164 ? 125.790 -2.230  151.742 1.00 97.79  ? 164 TRP A CD1 1 
ATOM   1282  C CD2 . TRP A 1 164 ? 127.442 -3.740  151.768 1.00 80.51  ? 164 TRP A CD2 1 
ATOM   1283  N NE1 . TRP A 1 164 ? 125.287 -3.408  151.245 1.00 72.93  ? 164 TRP A NE1 1 
ATOM   1284  C CE2 . TRP A 1 164 ? 126.281 -4.351  151.251 1.00 84.94  ? 164 TRP A CE2 1 
ATOM   1285  C CE3 . TRP A 1 164 ? 128.612 -4.497  151.876 1.00 82.70  ? 164 TRP A CE3 1 
ATOM   1286  C CZ2 . TRP A 1 164 ? 126.256 -5.681  150.847 1.00 94.36  ? 164 TRP A CZ2 1 
ATOM   1287  C CZ3 . TRP A 1 164 ? 128.586 -5.815  151.475 1.00 120.28 ? 164 TRP A CZ3 1 
ATOM   1288  C CH2 . TRP A 1 164 ? 127.417 -6.393  150.963 1.00 123.31 ? 164 TRP A CH2 1 
ATOM   1289  N N   . LEU A 1 165 ? 127.818 1.835   151.483 1.00 72.37  ? 165 LEU A N   1 
ATOM   1290  C CA  . LEU A 1 165 ? 127.772 3.256   151.796 1.00 71.30  ? 165 LEU A CA  1 
ATOM   1291  C C   . LEU A 1 165 ? 126.414 3.633   152.382 1.00 79.74  ? 165 LEU A C   1 
ATOM   1292  O O   . LEU A 1 165 ? 125.388 3.079   151.989 1.00 93.04  ? 165 LEU A O   1 
ATOM   1293  C CB  . LEU A 1 165 ? 128.044 4.074   150.539 1.00 70.96  ? 165 LEU A CB  1 
ATOM   1294  C CG  . LEU A 1 165 ? 129.157 3.540   149.635 1.00 68.43  ? 165 LEU A CG  1 
ATOM   1295  C CD1 . LEU A 1 165 ? 129.128 4.255   148.298 1.00 62.02  ? 165 LEU A CD1 1 
ATOM   1296  C CD2 . LEU A 1 165 ? 130.523 3.674   150.296 1.00 62.61  ? 165 LEU A CD2 1 
ATOM   1297  N N   . LEU A 1 166 ? 126.400 4.571   153.324 1.00 62.41  ? 166 LEU A N   1 
ATOM   1298  C CA  . LEU A 1 166 ? 125.148 4.935   153.987 1.00 51.57  ? 166 LEU A CA  1 
ATOM   1299  C C   . LEU A 1 166 ? 124.984 6.428   154.256 1.00 52.68  ? 166 LEU A C   1 
ATOM   1300  O O   . LEU A 1 166 ? 125.773 7.032   154.977 1.00 67.63  ? 166 LEU A O   1 
ATOM   1301  C CB  . LEU A 1 166 ? 125.014 4.175   155.304 1.00 50.40  ? 166 LEU A CB  1 
ATOM   1302  C CG  . LEU A 1 166 ? 123.716 4.468   156.051 1.00 59.90  ? 166 LEU A CG  1 
ATOM   1303  C CD1 . LEU A 1 166 ? 122.575 3.613   155.519 1.00 79.41  ? 166 LEU A CD1 1 
ATOM   1304  C CD2 . LEU A 1 166 ? 123.911 4.233   157.525 1.00 49.25  ? 166 LEU A CD2 1 
ATOM   1305  N N   . LEU A 1 167 ? 123.941 7.009   153.670 1.00 56.17  ? 167 LEU A N   1 
ATOM   1306  C CA  . LEU A 1 167 ? 123.609 8.418   153.866 1.00 59.87  ? 167 LEU A CA  1 
ATOM   1307  C C   . LEU A 1 167 ? 122.392 8.567   154.776 1.00 66.33  ? 167 LEU A C   1 
ATOM   1308  O O   . LEU A 1 167 ? 121.351 7.961   154.532 1.00 77.95  ? 167 LEU A O   1 
ATOM   1309  C CB  . LEU A 1 167 ? 123.344 9.096   152.521 1.00 54.77  ? 167 LEU A CB  1 
ATOM   1310  C CG  . LEU A 1 167 ? 123.143 10.611  152.516 1.00 51.83  ? 167 LEU A CG  1 
ATOM   1311  C CD1 . LEU A 1 167 ? 124.448 11.333  152.780 1.00 58.78  ? 167 LEU A CD1 1 
ATOM   1312  C CD2 . LEU A 1 167 ? 122.550 11.056  151.193 1.00 54.40  ? 167 LEU A CD2 1 
ATOM   1313  N N   . THR A 1 168 ? 122.523 9.371   155.827 1.00 66.29  ? 168 THR A N   1 
ATOM   1314  C CA  . THR A 1 168 ? 121.417 9.578   156.760 1.00 51.44  ? 168 THR A CA  1 
ATOM   1315  C C   . THR A 1 168 ? 120.924 11.021  156.764 1.00 50.53  ? 168 THR A C   1 
ATOM   1316  O O   . THR A 1 168 ? 121.716 11.961  156.857 1.00 62.37  ? 168 THR A O   1 
ATOM   1317  C CB  . THR A 1 168 ? 121.810 9.194   158.194 1.00 63.96  ? 168 THR A CB  1 
ATOM   1318  O OG1 . THR A 1 168 ? 122.477 7.926   158.186 1.00 96.72  ? 168 THR A OG1 1 
ATOM   1319  C CG2 . THR A 1 168 ? 120.573 9.104   159.073 1.00 66.48  ? 168 THR A CG2 1 
ATOM   1320  N N   . GLY A 1 169 ? 119.609 11.182  156.657 1.00 62.28  ? 169 GLY A N   1 
ATOM   1321  C CA  . GLY A 1 169 ? 118.980 12.490  156.689 1.00 77.36  ? 169 GLY A CA  1 
ATOM   1322  C C   . GLY A 1 169 ? 117.746 12.500  157.575 1.00 64.58  ? 169 GLY A C   1 
ATOM   1323  O O   . GLY A 1 169 ? 117.058 11.489  157.699 1.00 58.91  ? 169 GLY A O   1 
ATOM   1324  N N   . ILE A 1 170 ? 117.469 13.635  158.209 1.00 56.43  ? 170 ILE A N   1 
ATOM   1325  C CA  . ILE A 1 170 ? 116.289 13.751  159.062 1.00 62.60  ? 170 ILE A CA  1 
ATOM   1326  C C   . ILE A 1 170 ? 115.405 14.926  158.650 1.00 62.33  ? 170 ILE A C   1 
ATOM   1327  O O   . ILE A 1 170 ? 115.881 15.919  158.100 1.00 56.34  ? 170 ILE A O   1 
ATOM   1328  C CB  . ILE A 1 170 ? 116.662 13.904  160.547 1.00 55.95  ? 170 ILE A CB  1 
ATOM   1329  C CG1 . ILE A 1 170 ? 117.711 14.997  160.735 1.00 50.66  ? 170 ILE A CG1 1 
ATOM   1330  C CG2 . ILE A 1 170 ? 117.134 12.574  161.116 1.00 61.26  ? 170 ILE A CG2 1 
ATOM   1331  C CD1 . ILE A 1 170 ? 117.357 15.988  161.837 1.00 47.00  ? 170 ILE A CD1 1 
ATOM   1332  N N   . SER A 1 171 ? 114.112 14.806  158.930 1.00 71.74  ? 171 SER A N   1 
ATOM   1333  C CA  . SER A 1 171 ? 113.144 15.830  158.562 1.00 74.29  ? 171 SER A CA  1 
ATOM   1334  C C   . SER A 1 171 ? 112.005 15.853  159.570 1.00 68.70  ? 171 SER A C   1 
ATOM   1335  O O   . SER A 1 171 ? 111.715 14.847  160.215 1.00 79.57  ? 171 SER A O   1 
ATOM   1336  C CB  . SER A 1 171 ? 112.605 15.581  157.153 1.00 86.47  ? 171 SER A CB  1 
ATOM   1337  O OG  . SER A 1 171 ? 111.965 14.319  157.075 1.00 96.74  ? 171 SER A OG  1 
ATOM   1338  N N   . ALA A 1 172 ? 111.379 17.015  159.718 1.00 75.05  ? 172 ALA A N   1 
ATOM   1339  C CA  . ALA A 1 172 ? 110.276 17.182  160.659 1.00 71.64  ? 172 ALA A CA  1 
ATOM   1340  C C   . ALA A 1 172 ? 108.928 16.823  160.046 1.00 72.34  ? 172 ALA A C   1 
ATOM   1341  O O   . ALA A 1 172 ? 108.421 17.537  159.182 1.00 83.13  ? 172 ALA A O   1 
ATOM   1342  C CB  . ALA A 1 172 ? 110.247 18.605  161.184 1.00 66.46  ? 172 ALA A CB  1 
ATOM   1343  N N   . GLN A 1 173 ? 108.349 15.713  160.490 1.00 71.62  ? 173 GLN A N   1 
ATOM   1344  C CA  . GLN A 1 173 ? 107.054 15.291  159.975 1.00 69.65  ? 173 GLN A CA  1 
ATOM   1345  C C   . GLN A 1 173 ? 106.070 15.062  161.120 1.00 78.71  ? 173 GLN A C   1 
ATOM   1346  O O   . GLN A 1 173 ? 106.185 14.084  161.862 1.00 83.25  ? 173 GLN A O   1 
ATOM   1347  C CB  . GLN A 1 173 ? 107.195 14.012  159.138 1.00 69.73  ? 173 GLN A CB  1 
ATOM   1348  C CG  . GLN A 1 173 ? 108.245 14.065  158.025 1.00 80.56  ? 173 GLN A CG  1 
ATOM   1349  C CD  . GLN A 1 173 ? 107.816 14.915  156.846 1.00 119.70 ? 173 GLN A CD  1 
ATOM   1350  O OE1 . GLN A 1 173 ? 106.842 14.597  156.162 1.00 149.92 ? 173 GLN A OE1 1 
ATOM   1351  N NE2 . GLN A 1 173 ? 108.549 15.991  156.591 1.00 122.94 ? 173 GLN A NE2 1 
ATOM   1352  N N   . GLN A 1 174 ? 105.103 15.971  161.245 1.00 92.34  ? 174 GLN A N   1 
ATOM   1353  C CA  . GLN A 1 174 ? 104.035 15.877  162.243 1.00 86.81  ? 174 GLN A CA  1 
ATOM   1354  C C   . GLN A 1 174 ? 104.551 15.806  163.681 1.00 75.23  ? 174 GLN A C   1 
ATOM   1355  O O   . GLN A 1 174 ? 104.246 14.863  164.409 1.00 74.39  ? 174 GLN A O   1 
ATOM   1356  C CB  . GLN A 1 174 ? 103.136 14.678  161.951 1.00 96.43  ? 174 GLN A CB  1 
ATOM   1357  C CG  . GLN A 1 174 ? 102.538 14.698  160.559 1.00 109.15 ? 174 GLN A CG  1 
ATOM   1358  C CD  . GLN A 1 174 ? 101.613 15.881  160.354 1.00 134.45 ? 174 GLN A CD  1 
ATOM   1359  O OE1 . GLN A 1 174 ? 100.684 16.096  161.133 1.00 130.16 ? 174 GLN A OE1 1 
ATOM   1360  N NE2 . GLN A 1 174 ? 101.864 16.656  159.304 1.00 142.53 ? 174 GLN A NE2 1 
ATOM   1361  N N   . ASN A 1 175 ? 105.337 16.806  164.070 1.00 73.10  ? 175 ASN A N   1 
ATOM   1362  C CA  . ASN A 1 175 ? 105.919 16.895  165.411 1.00 77.23  ? 175 ASN A CA  1 
ATOM   1363  C C   . ASN A 1 175 ? 106.785 15.697  165.803 1.00 79.81  ? 175 ASN A C   1 
ATOM   1364  O O   . ASN A 1 175 ? 106.887 15.343  166.974 1.00 93.86  ? 175 ASN A O   1 
ATOM   1365  C CB  . ASN A 1 175 ? 104.821 17.119  166.457 1.00 79.00  ? 175 ASN A CB  1 
ATOM   1366  C CG  . ASN A 1 175 ? 103.854 18.218  166.061 1.00 96.90  ? 175 ASN A CG  1 
ATOM   1367  O OD1 . ASN A 1 175 ? 104.270 19.314  165.687 1.00 107.25 ? 175 ASN A OD1 1 
ATOM   1368  N ND2 . ASN A 1 175 ? 102.560 17.941  166.166 1.00 106.53 ? 175 ASN A ND2 1 
ATOM   1369  N N   . ARG A 1 176 ? 107.397 15.078  164.802 1.00 76.20  ? 176 ARG A N   1 
ATOM   1370  C CA  . ARG A 1 176 ? 108.339 13.986  165.006 1.00 73.72  ? 176 ARG A CA  1 
ATOM   1371  C C   . ARG A 1 176 ? 109.489 14.149  164.040 1.00 74.70  ? 176 ARG A C   1 
ATOM   1372  O O   . ARG A 1 176 ? 109.286 14.457  162.869 1.00 71.31  ? 176 ARG A O   1 
ATOM   1373  C CB  . ARG A 1 176 ? 107.696 12.607  164.822 1.00 73.52  ? 176 ARG A CB  1 
ATOM   1374  C CG  . ARG A 1 176 ? 107.107 11.997  166.086 1.00 99.24  ? 176 ARG A CG  1 
ATOM   1375  C CD  . ARG A 1 176 ? 105.666 12.379  166.344 1.00 122.47 ? 176 ARG A CD  1 
ATOM   1376  N NE  . ARG A 1 176 ? 105.452 12.562  167.777 1.00 134.20 ? 176 ARG A NE  1 
ATOM   1377  C CZ  . ARG A 1 176 ? 104.287 12.423  168.400 1.00 129.91 ? 176 ARG A CZ  1 
ATOM   1378  N NH1 . ARG A 1 176 ? 104.218 12.621  169.709 1.00 120.20 ? 176 ARG A NH1 1 
ATOM   1379  N NH2 . ARG A 1 176 ? 103.196 12.085  167.725 1.00 114.82 ? 176 ARG A NH2 1 
ATOM   1380  N N   . VAL A 1 177 ? 110.702 13.957  164.541 1.00 69.29  ? 177 VAL A N   1 
ATOM   1381  C CA  . VAL A 1 177 ? 111.873 13.985  163.687 1.00 56.17  ? 177 VAL A CA  1 
ATOM   1382  C C   . VAL A 1 177 ? 111.976 12.625  163.029 1.00 57.91  ? 177 VAL A C   1 
ATOM   1383  O O   . VAL A 1 177 ? 112.164 11.619  163.705 1.00 64.78  ? 177 VAL A O   1 
ATOM   1384  C CB  . VAL A 1 177 ? 113.152 14.301  164.465 1.00 57.13  ? 177 VAL A CB  1 
ATOM   1385  C CG1 . VAL A 1 177 ? 114.369 14.080  163.586 1.00 63.77  ? 177 VAL A CG1 1 
ATOM   1386  C CG2 . VAL A 1 177 ? 113.106 15.725  164.985 1.00 62.91  ? 177 VAL A CG2 1 
ATOM   1387  N N   . VAL A 1 178 ? 111.855 12.596  161.709 1.00 56.19  ? 178 VAL A N   1 
ATOM   1388  C CA  . VAL A 1 178 ? 111.833 11.333  160.983 1.00 59.03  ? 178 VAL A CA  1 
ATOM   1389  C C   . VAL A 1 178 ? 113.135 11.065  160.246 1.00 80.75  ? 178 VAL A C   1 
ATOM   1390  O O   . VAL A 1 178 ? 113.596 11.882  159.453 1.00 75.58  ? 178 VAL A O   1 
ATOM   1391  C CB  . VAL A 1 178 ? 110.680 11.285  159.977 1.00 58.59  ? 178 VAL A CB  1 
ATOM   1392  C CG1 . VAL A 1 178 ? 110.570 9.897   159.382 1.00 61.10  ? 178 VAL A CG1 1 
ATOM   1393  C CG2 . VAL A 1 178 ? 109.382 11.682  160.654 1.00 59.54  ? 178 VAL A CG2 1 
ATOM   1394  N N   . GLY A 1 179 ? 113.716 9.902   160.517 1.00 81.35  ? 179 GLY A N   1 
ATOM   1395  C CA  . GLY A 1 179 ? 114.981 9.511   159.923 1.00 60.97  ? 179 GLY A CA  1 
ATOM   1396  C C   . GLY A 1 179 ? 114.888 8.767   158.607 1.00 73.84  ? 179 GLY A C   1 
ATOM   1397  O O   . GLY A 1 179 ? 114.172 7.776   158.487 1.00 92.70  ? 179 GLY A O   1 
ATOM   1398  N N   . ALA A 1 180 ? 115.607 9.270   157.610 1.00 78.62  ? 180 ALA A N   1 
ATOM   1399  C CA  . ALA A 1 180 ? 115.648 8.639   156.300 1.00 65.42  ? 180 ALA A CA  1 
ATOM   1400  C C   . ALA A 1 180 ? 117.073 8.212   155.972 1.00 57.03  ? 180 ALA A C   1 
ATOM   1401  O O   . ALA A 1 180 ? 117.995 9.020   156.046 1.00 57.96  ? 180 ALA A O   1 
ATOM   1402  C CB  . ALA A 1 180 ? 115.123 9.589   155.235 1.00 56.04  ? 180 ALA A CB  1 
ATOM   1403  N N   . MET A 1 181 ? 117.258 6.940   155.631 1.00 56.24  ? 181 MET A N   1 
ATOM   1404  C CA  . MET A 1 181 ? 118.582 6.450   155.269 1.00 52.29  ? 181 MET A CA  1 
ATOM   1405  C C   . MET A 1 181 ? 118.585 5.782   153.900 1.00 60.90  ? 181 MET A C   1 
ATOM   1406  O O   . MET A 1 181 ? 117.571 5.258   153.444 1.00 85.78  ? 181 MET A O   1 
ATOM   1407  C CB  . MET A 1 181 ? 119.115 5.476   156.327 1.00 52.59  ? 181 MET A CB  1 
ATOM   1408  C CG  . MET A 1 181 ? 119.132 6.027   157.743 1.00 53.70  ? 181 MET A CG  1 
ATOM   1409  S SD  . MET A 1 181 ? 120.096 5.021   158.885 1.00 55.15  ? 181 MET A SD  1 
ATOM   1410  C CE  . MET A 1 181 ? 119.376 3.401   158.616 1.00 82.39  ? 181 MET A CE  1 
ATOM   1411  N N   . GLN A 1 182 ? 119.739 5.823   153.243 1.00 69.54  ? 182 GLN A N   1 
ATOM   1412  C CA  . GLN A 1 182 ? 119.920 5.162   151.957 1.00 58.64  ? 182 GLN A CA  1 
ATOM   1413  C C   . GLN A 1 182 ? 121.127 4.242   152.034 1.00 56.59  ? 182 GLN A C   1 
ATOM   1414  O O   . GLN A 1 182 ? 122.261 4.707   152.135 1.00 72.95  ? 182 GLN A O   1 
ATOM   1415  C CB  . GLN A 1 182 ? 120.102 6.190   150.838 1.00 55.97  ? 182 GLN A CB  1 
ATOM   1416  C CG  . GLN A 1 182 ? 120.241 5.593   149.447 1.00 61.89  ? 182 GLN A CG  1 
ATOM   1417  C CD  . GLN A 1 182 ? 120.502 6.642   148.383 1.00 75.27  ? 182 GLN A CD  1 
ATOM   1418  O OE1 . GLN A 1 182 ? 120.453 7.841   148.652 1.00 72.98  ? 182 GLN A OE1 1 
ATOM   1419  N NE2 . GLN A 1 182 ? 120.778 6.192   147.165 1.00 85.78  ? 182 GLN A NE2 1 
ATOM   1420  N N   . LEU A 1 183 ? 120.887 2.937   151.992 1.00 55.74  ? 183 LEU A N   1 
ATOM   1421  C CA  . LEU A 1 183 ? 121.984 1.980   152.030 1.00 58.19  ? 183 LEU A CA  1 
ATOM   1422  C C   . LEU A 1 183 ? 122.341 1.533   150.619 1.00 59.30  ? 183 LEU A C   1 
ATOM   1423  O O   . LEU A 1 183 ? 121.582 0.817   149.969 1.00 59.57  ? 183 LEU A O   1 
ATOM   1424  C CB  . LEU A 1 183 ? 121.623 0.776   152.899 1.00 55.41  ? 183 LEU A CB  1 
ATOM   1425  C CG  . LEU A 1 183 ? 122.718 -0.278  153.051 1.00 57.61  ? 183 LEU A CG  1 
ATOM   1426  C CD1 . LEU A 1 183 ? 123.887 0.277   153.844 1.00 72.87  ? 183 LEU A CD1 1 
ATOM   1427  C CD2 . LEU A 1 183 ? 122.165 -1.521  153.718 1.00 59.13  ? 183 LEU A CD2 1 
ATOM   1428  N N   . TYR A 1 184 ? 123.513 1.956   150.160 1.00 62.89  ? 184 TYR A N   1 
ATOM   1429  C CA  . TYR A 1 184 ? 123.977 1.657   148.810 1.00 60.45  ? 184 TYR A CA  1 
ATOM   1430  C C   . TYR A 1 184 ? 125.091 0.622   148.792 1.00 65.23  ? 184 TYR A C   1 
ATOM   1431  O O   . TYR A 1 184 ? 126.078 0.745   149.516 1.00 63.19  ? 184 TYR A O   1 
ATOM   1432  C CB  . TYR A 1 184 ? 124.446 2.945   148.132 1.00 61.02  ? 184 TYR A CB  1 
ATOM   1433  C CG  . TYR A 1 184 ? 124.974 2.769   146.727 1.00 68.35  ? 184 TYR A CG  1 
ATOM   1434  C CD1 . TYR A 1 184 ? 124.110 2.615   145.650 1.00 80.67  ? 184 TYR A CD1 1 
ATOM   1435  C CD2 . TYR A 1 184 ? 126.340 2.783   146.473 1.00 67.16  ? 184 TYR A CD2 1 
ATOM   1436  C CE1 . TYR A 1 184 ? 124.594 2.462   144.361 1.00 94.99  ? 184 TYR A CE1 1 
ATOM   1437  C CE2 . TYR A 1 184 ? 126.831 2.635   145.190 1.00 74.40  ? 184 TYR A CE2 1 
ATOM   1438  C CZ  . TYR A 1 184 ? 125.955 2.476   144.139 1.00 96.46  ? 184 TYR A CZ  1 
ATOM   1439  O OH  . TYR A 1 184 ? 126.442 2.328   142.860 1.00 110.46 ? 184 TYR A OH  1 
ATOM   1440  N N   . SER A 1 185 ? 124.912 -0.405  147.966 1.00 71.52  ? 185 SER A N   1 
ATOM   1441  C CA  . SER A 1 185 ? 125.929 -1.434  147.782 1.00 80.15  ? 185 SER A CA  1 
ATOM   1442  C C   . SER A 1 185 ? 126.739 -1.172  146.522 1.00 79.29  ? 185 SER A C   1 
ATOM   1443  O O   . SER A 1 185 ? 126.181 -1.037  145.432 1.00 77.28  ? 185 SER A O   1 
ATOM   1444  C CB  . SER A 1 185 ? 125.308 -2.824  147.710 1.00 84.76  ? 185 SER A CB  1 
ATOM   1445  O OG  . SER A 1 185 ? 126.326 -3.810  147.659 1.00 95.93  ? 185 SER A OG  1 
ATOM   1446  N N   . VAL A 1 186 ? 128.054 -1.088  146.679 1.00 85.11  ? 186 VAL A N   1 
ATOM   1447  C CA  . VAL A 1 186 ? 128.935 -0.822  145.551 1.00 80.59  ? 186 VAL A CA  1 
ATOM   1448  C C   . VAL A 1 186 ? 128.904 -1.975  144.551 1.00 78.00  ? 186 VAL A C   1 
ATOM   1449  O O   . VAL A 1 186 ? 128.812 -1.757  143.343 1.00 78.29  ? 186 VAL A O   1 
ATOM   1450  C CB  . VAL A 1 186 ? 130.386 -0.573  146.009 1.00 75.76  ? 186 VAL A CB  1 
ATOM   1451  C CG1 . VAL A 1 186 ? 131.289 -0.368  144.803 1.00 92.69  ? 186 VAL A CG1 1 
ATOM   1452  C CG2 . VAL A 1 186 ? 130.447 0.642   146.920 1.00 73.66  ? 186 VAL A CG2 1 
ATOM   1453  N N   . ASP A 1 187 ? 129.005 -3.201  145.054 1.00 77.33  ? 187 ASP A N   1 
ATOM   1454  C CA  . ASP A 1 187 ? 128.997 -4.385  144.198 1.00 79.89  ? 187 ASP A CA  1 
ATOM   1455  C C   . ASP A 1 187 ? 127.694 -4.598  143.434 1.00 82.72  ? 187 ASP A C   1 
ATOM   1456  O O   . ASP A 1 187 ? 127.707 -4.781  142.220 1.00 89.23  ? 187 ASP A O   1 
ATOM   1457  C CB  . ASP A 1 187 ? 129.303 -5.631  145.027 1.00 103.25 ? 187 ASP A CB  1 
ATOM   1458  C CG  . ASP A 1 187 ? 130.739 -5.675  145.495 1.00 125.30 ? 187 ASP A CG  1 
ATOM   1459  O OD1 . ASP A 1 187 ? 131.569 -4.926  144.936 1.00 142.05 ? 187 ASP A OD1 1 
ATOM   1460  O OD2 . ASP A 1 187 ? 131.043 -6.457  146.419 1.00 127.70 ? 187 ASP A OD2 1 
ATOM   1461  N N   . ARG A 1 188 ? 126.573 -4.584  144.147 1.00 98.33  ? 188 ARG A N   1 
ATOM   1462  C CA  . ARG A 1 188 ? 125.266 -4.795  143.528 1.00 85.34  ? 188 ARG A CA  1 
ATOM   1463  C C   . ARG A 1 188 ? 124.719 -3.545  142.828 1.00 81.55  ? 188 ARG A C   1 
ATOM   1464  O O   . ARG A 1 188 ? 123.741 -3.623  142.088 1.00 82.53  ? 188 ARG A O   1 
ATOM   1465  C CB  . ARG A 1 188 ? 124.270 -5.294  144.578 1.00 96.48  ? 188 ARG A CB  1 
ATOM   1466  C CG  . ARG A 1 188 ? 124.298 -6.805  144.773 1.00 110.55 ? 188 ARG A CG  1 
ATOM   1467  C CD  . ARG A 1 188 ? 124.040 -7.210  146.217 1.00 124.42 ? 188 ARG A CD  1 
ATOM   1468  N NE  . ARG A 1 188 ? 125.256 -7.685  146.874 1.00 143.59 ? 188 ARG A NE  1 
ATOM   1469  C CZ  . ARG A 1 188 ? 125.317 -8.768  147.642 1.00 148.86 ? 188 ARG A CZ  1 
ATOM   1470  N NH1 . ARG A 1 188 ? 126.467 -9.124  148.200 1.00 146.24 ? 188 ARG A NH1 1 
ATOM   1471  N NH2 . ARG A 1 188 ? 124.229 -9.495  147.854 1.00 145.10 ? 188 ARG A NH2 1 
ATOM   1472  N N   . LYS A 1 189 ? 125.356 -2.401  143.069 1.00 78.00  ? 189 LYS A N   1 
ATOM   1473  C CA  . LYS A 1 189 ? 124.966 -1.113  142.474 1.00 77.40  ? 189 LYS A CA  1 
ATOM   1474  C C   . LYS A 1 189 ? 123.504 -0.711  142.695 1.00 87.92  ? 189 LYS A C   1 
ATOM   1475  O O   . LYS A 1 189 ? 122.885 -0.115  141.816 1.00 82.32  ? 189 LYS A O   1 
ATOM   1476  C CB  . LYS A 1 189 ? 125.252 -1.118  140.967 1.00 88.87  ? 189 LYS A CB  1 
ATOM   1477  C CG  . LYS A 1 189 ? 126.305 -0.109  140.522 1.00 93.97  ? 189 LYS A CG  1 
ATOM   1478  C CD  . LYS A 1 189 ? 126.227 0.161   139.026 1.00 98.18  ? 189 LYS A CD  1 
ATOM   1479  C CE  . LYS A 1 189 ? 127.555 -0.119  138.350 1.00 108.95 ? 189 LYS A CE  1 
ATOM   1480  N NZ  . LYS A 1 189 ? 127.878 -1.572  138.364 1.00 123.33 ? 189 LYS A NZ  1 
ATOM   1481  N N   . VAL A 1 190 ? 122.951 -1.039  143.859 1.00 104.08 ? 190 VAL A N   1 
ATOM   1482  C CA  . VAL A 1 190 ? 121.559 -0.696  144.165 1.00 89.49  ? 190 VAL A CA  1 
ATOM   1483  C C   . VAL A 1 190 ? 121.385 -0.095  145.561 1.00 84.09  ? 190 VAL A C   1 
ATOM   1484  O O   . VAL A 1 190 ? 122.170 -0.363  146.467 1.00 81.73  ? 190 VAL A O   1 
ATOM   1485  C CB  . VAL A 1 190 ? 120.633 -1.914  144.023 1.00 80.81  ? 190 VAL A CB  1 
ATOM   1486  C CG1 . VAL A 1 190 ? 120.454 -2.283  142.551 1.00 103.75 ? 190 VAL A CG1 1 
ATOM   1487  C CG2 . VAL A 1 190 ? 121.157 -3.082  144.844 1.00 80.07  ? 190 VAL A CG2 1 
ATOM   1488  N N   . SER A 1 191 ? 120.350 0.724   145.722 1.00 75.93  ? 191 SER A N   1 
ATOM   1489  C CA  . SER A 1 191 ? 120.068 1.380   146.998 1.00 69.72  ? 191 SER A CA  1 
ATOM   1490  C C   . SER A 1 191 ? 118.811 0.861   147.700 1.00 84.03  ? 191 SER A C   1 
ATOM   1491  O O   . SER A 1 191 ? 117.844 0.463   147.054 1.00 90.36  ? 191 SER A O   1 
ATOM   1492  C CB  . SER A 1 191 ? 119.936 2.890   146.791 1.00 70.78  ? 191 SER A CB  1 
ATOM   1493  O OG  . SER A 1 191 ? 121.167 3.459   146.387 1.00 95.76  ? 191 SER A OG  1 
ATOM   1494  N N   . GLN A 1 192 ? 118.851 0.838   149.029 1.00 87.40  ? 192 GLN A N   1 
ATOM   1495  C CA  . GLN A 1 192 ? 117.691 0.466   149.835 1.00 70.99  ? 192 GLN A CA  1 
ATOM   1496  C C   . GLN A 1 192 ? 117.344 1.591   150.808 1.00 75.15  ? 192 GLN A C   1 
ATOM   1497  O O   . GLN A 1 192 ? 118.167 1.957   151.646 1.00 68.72  ? 192 GLN A O   1 
ATOM   1498  C CB  . GLN A 1 192 ? 117.951 -0.834  150.601 1.00 77.75  ? 192 GLN A CB  1 
ATOM   1499  C CG  . GLN A 1 192 ? 116.712 -1.439  151.246 1.00 97.47  ? 192 GLN A CG  1 
ATOM   1500  C CD  . GLN A 1 192 ? 117.025 -2.652  152.104 1.00 126.01 ? 192 GLN A CD  1 
ATOM   1501  O OE1 . GLN A 1 192 ? 117.922 -2.617  152.946 1.00 136.27 ? 192 GLN A OE1 1 
ATOM   1502  N NE2 . GLN A 1 192 ? 116.289 -3.737  151.886 1.00 137.87 ? 192 GLN A NE2 1 
ATOM   1503  N N   . PRO A 1 193 ? 116.127 2.152   150.695 1.00 82.32  ? 193 PRO A N   1 
ATOM   1504  C CA  . PRO A 1 193 ? 115.724 3.182   151.659 1.00 75.68  ? 193 PRO A CA  1 
ATOM   1505  C C   . PRO A 1 193 ? 115.321 2.569   152.995 1.00 66.32  ? 193 PRO A C   1 
ATOM   1506  O O   . PRO A 1 193 ? 114.545 1.616   153.033 1.00 90.63  ? 193 PRO A O   1 
ATOM   1507  C CB  . PRO A 1 193 ? 114.534 3.867   150.978 1.00 67.51  ? 193 PRO A CB  1 
ATOM   1508  C CG  . PRO A 1 193 ? 114.079 2.926   149.886 1.00 71.93  ? 193 PRO A CG  1 
ATOM   1509  C CD  . PRO A 1 193 ? 115.018 1.755   149.813 1.00 69.30  ? 193 PRO A CD  1 
ATOM   1510  N N   . ILE A 1 194 ? 115.852 3.117   154.082 1.00 59.54  ? 194 ILE A N   1 
ATOM   1511  C CA  . ILE A 1 194 ? 115.602 2.584   155.417 1.00 57.80  ? 194 ILE A CA  1 
ATOM   1512  C C   . ILE A 1 194 ? 115.215 3.693   156.391 1.00 60.26  ? 194 ILE A C   1 
ATOM   1513  O O   . ILE A 1 194 ? 115.827 4.755   156.386 1.00 57.90  ? 194 ILE A O   1 
ATOM   1514  C CB  . ILE A 1 194 ? 116.847 1.854   155.958 1.00 58.04  ? 194 ILE A CB  1 
ATOM   1515  C CG1 . ILE A 1 194 ? 117.260 0.725   155.013 1.00 59.23  ? 194 ILE A CG1 1 
ATOM   1516  C CG2 . ILE A 1 194 ? 116.601 1.326   157.360 1.00 57.13  ? 194 ILE A CG2 1 
ATOM   1517  C CD1 . ILE A 1 194 ? 118.648 0.188   155.279 1.00 76.51  ? 194 ILE A CD1 1 
ATOM   1518  N N   . GLU A 1 195 ? 114.211 3.461   157.232 1.00 66.71  ? 195 GLU A N   1 
ATOM   1519  C CA  . GLU A 1 195 ? 113.891 4.448   158.256 1.00 56.81  ? 195 GLU A CA  1 
ATOM   1520  C C   . GLU A 1 195 ? 114.798 4.222   159.460 1.00 68.38  ? 195 GLU A C   1 
ATOM   1521  O O   . GLU A 1 195 ? 114.624 3.260   160.214 1.00 73.40  ? 195 GLU A O   1 
ATOM   1522  C CB  . GLU A 1 195 ? 112.427 4.384   158.685 1.00 59.79  ? 195 GLU A CB  1 
ATOM   1523  C CG  . GLU A 1 195 ? 112.007 5.603   159.512 1.00 91.32  ? 195 GLU A CG  1 
ATOM   1524  C CD  . GLU A 1 195 ? 110.730 5.379   160.300 1.00 108.06 ? 195 GLU A CD  1 
ATOM   1525  O OE1 . GLU A 1 195 ? 110.193 4.251   160.271 1.00 113.97 ? 195 GLU A OE1 1 
ATOM   1526  O OE2 . GLU A 1 195 ? 110.264 6.336   160.956 1.00 106.61 ? 195 GLU A OE2 1 
ATOM   1527  N N   . GLY A 1 196 ? 115.764 5.117   159.637 1.00 55.84  ? 196 GLY A N   1 
ATOM   1528  C CA  . GLY A 1 196 ? 116.721 5.013   160.722 1.00 54.70  ? 196 GLY A CA  1 
ATOM   1529  C C   . GLY A 1 196 ? 117.220 6.374   161.165 1.00 69.99  ? 196 GLY A C   1 
ATOM   1530  O O   . GLY A 1 196 ? 117.324 7.302   160.363 1.00 80.58  ? 196 GLY A O   1 
ATOM   1531  N N   . HIS A 1 197 ? 117.530 6.489   162.452 1.00 81.13  ? 197 HIS A N   1 
ATOM   1532  C CA  . HIS A 1 197 ? 118.021 7.740   163.021 1.00 75.06  ? 197 HIS A CA  1 
ATOM   1533  C C   . HIS A 1 197 ? 119.537 7.763   163.171 1.00 70.76  ? 197 HIS A C   1 
ATOM   1534  O O   . HIS A 1 197 ? 120.172 8.782   162.917 1.00 80.02  ? 197 HIS A O   1 
ATOM   1535  C CB  . HIS A 1 197 ? 117.354 8.006   164.373 1.00 69.64  ? 197 HIS A CB  1 
ATOM   1536  C CG  . HIS A 1 197 ? 116.024 8.686   164.266 1.00 63.81  ? 197 HIS A CG  1 
ATOM   1537  N ND1 . HIS A 1 197 ? 114.890 8.214   164.886 1.00 63.69  ? 197 HIS A ND1 1 
ATOM   1538  C CD2 . HIS A 1 197 ? 115.649 9.812   163.609 1.00 56.12  ? 197 HIS A CD2 1 
ATOM   1539  C CE1 . HIS A 1 197 ? 113.871 9.008   164.616 1.00 71.14  ? 197 HIS A CE1 1 
ATOM   1540  N NE2 . HIS A 1 197 ? 114.308 9.990   163.842 1.00 65.83  ? 197 HIS A NE2 1 
ATOM   1541  N N   . ALA A 1 198 ? 120.110 6.640   163.587 1.00 64.96  ? 198 ALA A N   1 
ATOM   1542  C CA  . ALA A 1 198 ? 121.552 6.548   163.781 1.00 50.18  ? 198 ALA A CA  1 
ATOM   1543  C C   . ALA A 1 198 ? 122.033 5.163   163.386 1.00 51.06  ? 198 ALA A C   1 
ATOM   1544  O O   . ALA A 1 198 ? 121.367 4.169   163.677 1.00 50.89  ? 198 ALA A O   1 
ATOM   1545  C CB  . ALA A 1 198 ? 121.922 6.853   165.220 1.00 50.22  ? 198 ALA A CB  1 
ATOM   1546  N N   . ALA A 1 199 ? 123.179 5.092   162.719 1.00 70.91  ? 199 ALA A N   1 
ATOM   1547  C CA  . ALA A 1 199 ? 123.676 3.807   162.248 1.00 58.04  ? 199 ALA A CA  1 
ATOM   1548  C C   . ALA A 1 199 ? 125.192 3.692   162.270 1.00 71.26  ? 199 ALA A C   1 
ATOM   1549  O O   . ALA A 1 199 ? 125.900 4.678   162.470 1.00 91.17  ? 199 ALA A O   1 
ATOM   1550  C CB  . ALA A 1 199 ? 123.168 3.545   160.853 1.00 60.80  ? 199 ALA A CB  1 
ATOM   1551  N N   . SER A 1 200 ? 125.674 2.469   162.068 1.00 71.42  ? 200 SER A N   1 
ATOM   1552  C CA  . SER A 1 200 ? 127.102 2.176   162.056 1.00 52.96  ? 200 SER A CA  1 
ATOM   1553  C C   . SER A 1 200 ? 127.372 0.783   161.489 1.00 68.69  ? 200 SER A C   1 
ATOM   1554  O O   . SER A 1 200 ? 126.526 -0.106  161.577 1.00 81.21  ? 200 SER A O   1 
ATOM   1555  C CB  . SER A 1 200 ? 127.681 2.289   163.466 1.00 72.83  ? 200 SER A CB  1 
ATOM   1556  O OG  . SER A 1 200 ? 129.067 2.003   163.466 1.00 83.21  ? 200 SER A OG  1 
ATOM   1557  N N   . PHE A 1 201 ? 128.558 0.596   160.918 1.00 72.94  ? 201 PHE A N   1 
ATOM   1558  C CA  . PHE A 1 201 ? 128.968 -0.705  160.398 1.00 55.69  ? 201 PHE A CA  1 
ATOM   1559  C C   . PHE A 1 201 ? 129.963 -1.365  161.346 1.00 60.33  ? 201 PHE A C   1 
ATOM   1560  O O   . PHE A 1 201 ? 130.706 -0.682  162.047 1.00 77.11  ? 201 PHE A O   1 
ATOM   1561  C CB  . PHE A 1 201 ? 129.593 -0.571  159.010 1.00 57.07  ? 201 PHE A CB  1 
ATOM   1562  C CG  . PHE A 1 201 ? 128.636 -0.114  157.946 1.00 57.25  ? 201 PHE A CG  1 
ATOM   1563  C CD1 . PHE A 1 201 ? 127.835 -1.024  157.276 1.00 58.41  ? 201 PHE A CD1 1 
ATOM   1564  C CD2 . PHE A 1 201 ? 128.551 1.224   157.606 1.00 68.32  ? 201 PHE A CD2 1 
ATOM   1565  C CE1 . PHE A 1 201 ? 126.960 -0.605  156.293 1.00 58.57  ? 201 PHE A CE1 1 
ATOM   1566  C CE2 . PHE A 1 201 ? 127.679 1.651   156.623 1.00 58.60  ? 201 PHE A CE2 1 
ATOM   1567  C CZ  . PHE A 1 201 ? 126.882 0.734   155.965 1.00 57.61  ? 201 PHE A CZ  1 
ATOM   1568  N N   . ALA A 1 202 ? 129.970 -2.693  161.379 1.00 60.53  ? 202 ALA A N   1 
ATOM   1569  C CA  . ALA A 1 202 ? 130.903 -3.404  162.244 1.00 62.46  ? 202 ALA A CA  1 
ATOM   1570  C C   . ALA A 1 202 ? 131.371 -4.730  161.657 1.00 76.35  ? 202 ALA A C   1 
ATOM   1571  O O   . ALA A 1 202 ? 130.611 -5.433  160.989 1.00 87.95  ? 202 ALA A O   1 
ATOM   1572  C CB  . ALA A 1 202 ? 130.275 -3.636  163.606 1.00 87.20  ? 202 ALA A CB  1 
ATOM   1573  N N   . GLN A 1 203 ? 132.632 -5.064  161.918 1.00 77.99  ? 203 GLN A N   1 
ATOM   1574  C CA  . GLN A 1 203 ? 133.189 -6.350  161.515 1.00 84.77  ? 203 GLN A CA  1 
ATOM   1575  C C   . GLN A 1 203 ? 133.150 -7.265  162.736 1.00 90.14  ? 203 GLN A C   1 
ATOM   1576  O O   . GLN A 1 203 ? 133.722 -6.948  163.778 1.00 109.99 ? 203 GLN A O   1 
ATOM   1577  C CB  . GLN A 1 203 ? 134.618 -6.199  160.992 1.00 78.22  ? 203 GLN A CB  1 
ATOM   1578  C CG  . GLN A 1 203 ? 134.763 -5.299  159.766 1.00 88.05  ? 203 GLN A CG  1 
ATOM   1579  C CD  . GLN A 1 203 ? 134.037 -5.821  158.538 1.00 98.87  ? 203 GLN A CD  1 
ATOM   1580  O OE1 . GLN A 1 203 ? 133.941 -7.029  158.319 1.00 104.41 ? 203 GLN A OE1 1 
ATOM   1581  N NE2 . GLN A 1 203 ? 133.536 -4.904  157.718 1.00 99.07  ? 203 GLN A NE2 1 
ATOM   1582  N N   . PHE A 1 204 ? 132.479 -8.402  162.598 1.00 73.62  ? 204 PHE A N   1 
ATOM   1583  C CA  . PHE A 1 204 ? 132.262 -9.312  163.717 1.00 74.48  ? 204 PHE A CA  1 
ATOM   1584  C C   . PHE A 1 204 ? 132.376 -10.778 163.303 1.00 82.40  ? 204 PHE A C   1 
ATOM   1585  O O   . PHE A 1 204 ? 131.627 -11.239 162.445 1.00 82.24  ? 204 PHE A O   1 
ATOM   1586  C CB  . PHE A 1 204 ? 130.880 -9.007  164.318 1.00 86.24  ? 204 PHE A CB  1 
ATOM   1587  C CG  . PHE A 1 204 ? 130.442 -9.953  165.403 1.00 73.53  ? 204 PHE A CG  1 
ATOM   1588  C CD1 . PHE A 1 204 ? 130.887 -9.797  166.704 1.00 74.61  ? 204 PHE A CD1 1 
ATOM   1589  C CD2 . PHE A 1 204 ? 129.509 -10.942 165.137 1.00 74.66  ? 204 PHE A CD2 1 
ATOM   1590  C CE1 . PHE A 1 204 ? 130.465 -10.652 167.702 1.00 75.64  ? 204 PHE A CE1 1 
ATOM   1591  C CE2 . PHE A 1 204 ? 129.075 -11.801 166.132 1.00 82.01  ? 204 PHE A CE2 1 
ATOM   1592  C CZ  . PHE A 1 204 ? 129.557 -11.655 167.419 1.00 82.37  ? 204 PHE A CZ  1 
ATOM   1593  N N   . LYS A 1 205 ? 133.306 -11.507 163.919 1.00 93.37  ? 205 LYS A N   1 
ATOM   1594  C CA  . LYS A 1 205 ? 133.476 -12.930 163.626 1.00 106.76 ? 205 LYS A CA  1 
ATOM   1595  C C   . LYS A 1 205 ? 132.664 -13.776 164.601 1.00 102.48 ? 205 LYS A C   1 
ATOM   1596  O O   . LYS A 1 205 ? 132.907 -13.768 165.806 1.00 101.80 ? 205 LYS A O   1 
ATOM   1597  C CB  . LYS A 1 205 ? 134.954 -13.340 163.670 1.00 104.02 ? 205 LYS A CB  1 
ATOM   1598  C CG  . LYS A 1 205 ? 135.250 -14.629 162.895 1.00 102.51 ? 205 LYS A CG  1 
ATOM   1599  C CD  . LYS A 1 205 ? 136.724 -15.032 162.946 1.00 120.07 ? 205 LYS A CD  1 
ATOM   1600  C CE  . LYS A 1 205 ? 137.544 -14.348 161.861 1.00 131.76 ? 205 LYS A CE  1 
ATOM   1601  N NZ  . LYS A 1 205 ? 138.924 -14.904 161.777 1.00 135.78 ? 205 LYS A NZ  1 
ATOM   1602  N N   . MET A 1 206 ? 131.705 -14.516 164.059 1.00 91.35  ? 206 MET A N   1 
ATOM   1603  C CA  . MET A 1 206 ? 130.807 -15.350 164.852 1.00 93.52  ? 206 MET A CA  1 
ATOM   1604  C C   . MET A 1 206 ? 131.495 -16.538 165.514 1.00 99.29  ? 206 MET A C   1 
ATOM   1605  O O   . MET A 1 206 ? 132.657 -16.835 165.236 1.00 103.29 ? 206 MET A O   1 
ATOM   1606  C CB  . MET A 1 206 ? 129.665 -15.855 163.970 1.00 98.07  ? 206 MET A CB  1 
ATOM   1607  C CG  . MET A 1 206 ? 128.669 -14.783 163.580 1.00 103.08 ? 206 MET A CG  1 
ATOM   1608  S SD  . MET A 1 206 ? 127.517 -15.362 162.322 1.00 133.73 ? 206 MET A SD  1 
ATOM   1609  C CE  . MET A 1 206 ? 126.429 -16.389 163.296 1.00 120.63 ? 206 MET A CE  1 
ATOM   1610  N N   . GLU A 1 207 ? 130.762 -17.206 166.403 1.00 103.64 ? 207 GLU A N   1 
ATOM   1611  C CA  . GLU A 1 207 ? 131.245 -18.415 167.058 1.00 115.79 ? 207 GLU A CA  1 
ATOM   1612  C C   . GLU A 1 207 ? 131.255 -19.560 166.053 1.00 129.04 ? 207 GLU A C   1 
ATOM   1613  O O   . GLU A 1 207 ? 130.206 -19.970 165.559 1.00 141.86 ? 207 GLU A O   1 
ATOM   1614  C CB  . GLU A 1 207 ? 130.365 -18.770 168.260 1.00 124.56 ? 207 GLU A CB  1 
ATOM   1615  C CG  . GLU A 1 207 ? 130.876 -19.922 169.121 1.00 138.78 ? 207 GLU A CG  1 
ATOM   1616  C CD  . GLU A 1 207 ? 131.927 -19.504 170.131 1.00 146.33 ? 207 GLU A CD  1 
ATOM   1617  O OE1 . GLU A 1 207 ? 131.771 -19.851 171.321 1.00 156.23 ? 207 GLU A OE1 1 
ATOM   1618  O OE2 . GLU A 1 207 ? 132.910 -18.838 169.742 1.00 137.48 ? 207 GLU A OE2 1 
ATOM   1619  N N   . GLY A 1 208 ? 132.444 -20.076 165.763 1.00 121.65 ? 208 GLY A N   1 
ATOM   1620  C CA  . GLY A 1 208 ? 132.607 -21.153 164.801 1.00 121.71 ? 208 GLY A CA  1 
ATOM   1621  C C   . GLY A 1 208 ? 132.520 -20.702 163.353 1.00 121.41 ? 208 GLY A C   1 
ATOM   1622  O O   . GLY A 1 208 ? 132.065 -21.447 162.486 1.00 129.39 ? 208 GLY A O   1 
ATOM   1623  N N   . ASN A 1 209 ? 132.954 -19.473 163.094 1.00 112.81 ? 209 ASN A N   1 
ATOM   1624  C CA  . ASN A 1 209 ? 132.956 -18.921 161.742 1.00 120.39 ? 209 ASN A CA  1 
ATOM   1625  C C   . ASN A 1 209 ? 134.361 -18.605 161.246 1.00 124.24 ? 209 ASN A C   1 
ATOM   1626  O O   . ASN A 1 209 ? 135.164 -18.024 161.973 1.00 124.47 ? 209 ASN A O   1 
ATOM   1627  C CB  . ASN A 1 209 ? 132.083 -17.670 161.675 1.00 125.03 ? 209 ASN A CB  1 
ATOM   1628  C CG  . ASN A 1 209 ? 130.854 -17.876 160.821 1.00 118.58 ? 209 ASN A CG  1 
ATOM   1629  O OD1 . ASN A 1 209 ? 130.355 -18.993 160.695 1.00 110.76 ? 209 ASN A OD1 1 
ATOM   1630  N ND2 . ASN A 1 209 ? 130.359 -16.801 160.226 1.00 117.65 ? 209 ASN A ND2 1 
ATOM   1631  N N   . ALA A 1 210 ? 134.650 -18.996 160.009 1.00 131.46 ? 210 ALA A N   1 
ATOM   1632  C CA  . ALA A 1 210 ? 135.971 -18.795 159.422 1.00 131.59 ? 210 ALA A CA  1 
ATOM   1633  C C   . ALA A 1 210 ? 136.366 -17.325 159.251 1.00 120.21 ? 210 ALA A C   1 
ATOM   1634  O O   . ALA A 1 210 ? 137.438 -16.913 159.695 1.00 116.89 ? 210 ALA A O   1 
ATOM   1635  C CB  . ALA A 1 210 ? 136.049 -19.508 158.082 1.00 134.53 ? 210 ALA A CB  1 
ATOM   1636  N N   . GLU A 1 211 ? 135.499 -16.542 158.615 1.00 111.63 ? 211 GLU A N   1 
ATOM   1637  C CA  . GLU A 1 211 ? 135.801 -15.143 158.310 1.00 110.99 ? 211 GLU A CA  1 
ATOM   1638  C C   . GLU A 1 211 ? 134.918 -14.156 159.070 1.00 120.88 ? 211 GLU A C   1 
ATOM   1639  O O   . GLU A 1 211 ? 133.894 -14.527 159.636 1.00 126.34 ? 211 GLU A O   1 
ATOM   1640  C CB  . GLU A 1 211 ? 135.669 -14.891 156.805 1.00 117.60 ? 211 GLU A CB  1 
ATOM   1641  C CG  . GLU A 1 211 ? 136.691 -15.630 155.952 1.00 143.35 ? 211 GLU A CG  1 
ATOM   1642  C CD  . GLU A 1 211 ? 138.069 -14.996 156.015 1.00 160.19 ? 211 GLU A CD  1 
ATOM   1643  O OE1 . GLU A 1 211 ? 138.422 -14.250 155.077 1.00 156.91 ? 211 GLU A OE1 1 
ATOM   1644  O OE2 . GLU A 1 211 ? 138.808 -15.244 156.992 1.00 171.34 ? 211 GLU A OE2 1 
ATOM   1645  N N   . GLU A 1 212 ? 135.338 -12.895 159.081 1.00 119.81 ? 212 GLU A N   1 
ATOM   1646  C CA  . GLU A 1 212 ? 134.586 -11.829 159.733 1.00 101.45 ? 212 GLU A CA  1 
ATOM   1647  C C   . GLU A 1 212 ? 133.337 -11.449 158.946 1.00 99.84  ? 212 GLU A C   1 
ATOM   1648  O O   . GLU A 1 212 ? 133.385 -11.299 157.727 1.00 89.00  ? 212 GLU A O   1 
ATOM   1649  C CB  . GLU A 1 212 ? 135.467 -10.594 159.915 1.00 91.27  ? 212 GLU A CB  1 
ATOM   1650  C CG  . GLU A 1 212 ? 136.538 -10.733 160.977 1.00 112.51 ? 212 GLU A CG  1 
ATOM   1651  C CD  . GLU A 1 212 ? 137.305 -9.445  161.184 1.00 135.65 ? 212 GLU A CD  1 
ATOM   1652  O OE1 . GLU A 1 212 ? 137.610 -8.772  160.177 1.00 136.29 ? 212 GLU A OE1 1 
ATOM   1653  O OE2 . GLU A 1 212 ? 137.604 -9.102  162.348 1.00 146.74 ? 212 GLU A OE2 1 
ATOM   1654  N N   . SER A 1 213 ? 132.216 -11.304 159.646 1.00 103.52 ? 213 SER A N   1 
ATOM   1655  C CA  . SER A 1 213 ? 130.972 -10.880 159.014 1.00 83.30  ? 213 SER A CA  1 
ATOM   1656  C C   . SER A 1 213 ? 130.831 -9.367  159.086 1.00 78.82  ? 213 SER A C   1 
ATOM   1657  O O   . SER A 1 213 ? 131.126 -8.759  160.112 1.00 77.21  ? 213 SER A O   1 
ATOM   1658  C CB  . SER A 1 213 ? 129.763 -11.548 159.676 1.00 82.61  ? 213 SER A CB  1 
ATOM   1659  O OG  . SER A 1 213 ? 129.885 -12.957 159.668 1.00 89.12  ? 213 SER A OG  1 
ATOM   1660  N N   . THR A 1 214 ? 130.364 -8.758  158.003 1.00 74.82  ? 214 THR A N   1 
ATOM   1661  C CA  . THR A 1 214 ? 130.148 -7.315  157.999 1.00 76.89  ? 214 THR A CA  1 
ATOM   1662  C C   . THR A 1 214 ? 128.721 -7.002  158.414 1.00 74.32  ? 214 THR A C   1 
ATOM   1663  O O   . THR A 1 214 ? 127.773 -7.305  157.692 1.00 79.75  ? 214 THR A O   1 
ATOM   1664  C CB  . THR A 1 214 ? 130.414 -6.691  156.629 1.00 87.74  ? 214 THR A CB  1 
ATOM   1665  O OG1 . THR A 1 214 ? 131.758 -6.974  156.222 1.00 115.39 ? 214 THR A OG1 1 
ATOM   1666  C CG2 . THR A 1 214 ? 130.226 -5.184  156.704 1.00 73.92  ? 214 THR A CG2 1 
ATOM   1667  N N   . LEU A 1 215 ? 128.586 -6.375  159.577 1.00 70.21  ? 215 LEU A N   1 
ATOM   1668  C CA  . LEU A 1 215 ? 127.284 -6.063  160.142 1.00 64.35  ? 215 LEU A CA  1 
ATOM   1669  C C   . LEU A 1 215 ? 126.873 -4.603  159.954 1.00 64.22  ? 215 LEU A C   1 
ATOM   1670  O O   . LEU A 1 215 ? 127.685 -3.689  160.074 1.00 68.84  ? 215 LEU A O   1 
ATOM   1671  C CB  . LEU A 1 215 ? 127.266 -6.406  161.633 1.00 63.92  ? 215 LEU A CB  1 
ATOM   1672  C CG  . LEU A 1 215 ? 127.639 -7.831  162.045 1.00 68.67  ? 215 LEU A CG  1 
ATOM   1673  C CD1 . LEU A 1 215 ? 127.463 -7.997  163.544 1.00 67.33  ? 215 LEU A CD1 1 
ATOM   1674  C CD2 . LEU A 1 215 ? 126.799 -8.852  161.295 1.00 70.52  ? 215 LEU A CD2 1 
ATOM   1675  N N   . PHE A 1 216 ? 125.589 -4.408  159.671 1.00 71.44  ? 216 PHE A N   1 
ATOM   1676  C CA  . PHE A 1 216 ? 124.995 -3.084  159.570 1.00 64.72  ? 216 PHE A CA  1 
ATOM   1677  C C   . PHE A 1 216 ? 124.062 -2.898  160.754 1.00 62.05  ? 216 PHE A C   1 
ATOM   1678  O O   . PHE A 1 216 ? 123.062 -3.601  160.877 1.00 64.37  ? 216 PHE A O   1 
ATOM   1679  C CB  . PHE A 1 216 ? 124.235 -2.918  158.250 1.00 64.84  ? 216 PHE A CB  1 
ATOM   1680  C CG  . PHE A 1 216 ? 123.436 -1.645  158.163 1.00 60.25  ? 216 PHE A CG  1 
ATOM   1681  C CD1 . PHE A 1 216 ? 124.023 -0.416  158.412 1.00 62.92  ? 216 PHE A CD1 1 
ATOM   1682  C CD2 . PHE A 1 216 ? 122.088 -1.684  157.845 1.00 61.46  ? 216 PHE A CD2 1 
ATOM   1683  C CE1 . PHE A 1 216 ? 123.280 0.749   158.339 1.00 77.08  ? 216 PHE A CE1 1 
ATOM   1684  C CE2 . PHE A 1 216 ? 121.339 -0.524  157.767 1.00 77.28  ? 216 PHE A CE2 1 
ATOM   1685  C CZ  . PHE A 1 216 ? 121.938 0.696   158.016 1.00 77.32  ? 216 PHE A CZ  1 
ATOM   1686  N N   . CYS A 1 217 ? 124.386 -1.949  161.625 1.00 70.29  ? 217 CYS A N   1 
ATOM   1687  C CA  . CYS A 1 217 ? 123.575 -1.715  162.810 1.00 62.58  ? 217 CYS A CA  1 
ATOM   1688  C C   . CYS A 1 217 ? 122.951 -0.328  162.794 1.00 64.87  ? 217 CYS A C   1 
ATOM   1689  O O   . CYS A 1 217 ? 123.656 0.671   162.651 1.00 65.81  ? 217 CYS A O   1 
ATOM   1690  C CB  . CYS A 1 217 ? 124.425 -1.897  164.069 1.00 59.06  ? 217 CYS A CB  1 
ATOM   1691  S SG  . CYS A 1 217 ? 123.584 -1.488  165.611 1.00 107.58 ? 217 CYS A SG  1 
ATOM   1692  N N   . PHE A 1 218 ? 121.634 -0.256  162.956 1.00 70.32  ? 218 PHE A N   1 
ATOM   1693  C CA  . PHE A 1 218 ? 120.986 1.049   163.000 1.00 65.63  ? 218 PHE A CA  1 
ATOM   1694  C C   . PHE A 1 218 ? 119.888 1.115   164.053 1.00 61.51  ? 218 PHE A C   1 
ATOM   1695  O O   . PHE A 1 218 ? 119.225 0.127   164.362 1.00 69.92  ? 218 PHE A O   1 
ATOM   1696  C CB  . PHE A 1 218 ? 120.443 1.436   161.616 1.00 60.46  ? 218 PHE A CB  1 
ATOM   1697  C CG  . PHE A 1 218 ? 119.190 0.712   161.208 1.00 56.61  ? 218 PHE A CG  1 
ATOM   1698  C CD1 . PHE A 1 218 ? 119.257 -0.500  160.543 1.00 57.20  ? 218 PHE A CD1 1 
ATOM   1699  C CD2 . PHE A 1 218 ? 117.947 1.273   161.439 1.00 62.80  ? 218 PHE A CD2 1 
ATOM   1700  C CE1 . PHE A 1 218 ? 118.107 -1.154  160.146 1.00 59.40  ? 218 PHE A CE1 1 
ATOM   1701  C CE2 . PHE A 1 218 ? 116.792 0.625   161.050 1.00 72.21  ? 218 PHE A CE2 1 
ATOM   1702  C CZ  . PHE A 1 218 ? 116.871 -0.592  160.401 1.00 69.43  ? 218 PHE A CZ  1 
ATOM   1703  N N   . ALA A 1 219 ? 119.727 2.307   164.609 1.00 53.01  ? 219 ALA A N   1 
ATOM   1704  C CA  . ALA A 1 219 ? 118.733 2.569   165.632 1.00 48.44  ? 219 ALA A CA  1 
ATOM   1705  C C   . ALA A 1 219 ? 117.758 3.616   165.135 1.00 48.63  ? 219 ALA A C   1 
ATOM   1706  O O   . ALA A 1 219 ? 118.110 4.486   164.339 1.00 45.77  ? 219 ALA A O   1 
ATOM   1707  C CB  . ALA A 1 219 ? 119.395 3.022   166.915 1.00 54.62  ? 219 ALA A CB  1 
ATOM   1708  N N   . VAL A 1 220 ? 116.519 3.514   165.597 1.00 66.68  ? 220 VAL A N   1 
ATOM   1709  C CA  . VAL A 1 220 ? 115.474 4.414   165.148 1.00 59.31  ? 220 VAL A CA  1 
ATOM   1710  C C   . VAL A 1 220 ? 114.363 4.495   166.178 1.00 55.02  ? 220 VAL A C   1 
ATOM   1711  O O   . VAL A 1 220 ? 114.148 3.553   166.939 1.00 71.37  ? 220 VAL A O   1 
ATOM   1712  C CB  . VAL A 1 220 ? 114.893 3.946   163.787 1.00 49.35  ? 220 VAL A CB  1 
ATOM   1713  C CG1 . VAL A 1 220 ? 114.203 2.595   163.937 1.00 49.82  ? 220 VAL A CG1 1 
ATOM   1714  C CG2 . VAL A 1 220 ? 113.938 4.979   163.207 1.00 49.75  ? 220 VAL A CG2 1 
ATOM   1715  N N   . ARG A 1 221 ? 113.680 5.633   166.217 1.00 68.26  ? 221 ARG A N   1 
ATOM   1716  C CA  . ARG A 1 221 ? 112.437 5.735   166.955 1.00 51.79  ? 221 ARG A CA  1 
ATOM   1717  C C   . ARG A 1 221 ? 111.387 6.046   165.905 1.00 57.43  ? 221 ARG A C   1 
ATOM   1718  O O   . ARG A 1 221 ? 111.011 7.199   165.702 1.00 72.65  ? 221 ARG A O   1 
ATOM   1719  C CB  . ARG A 1 221 ? 112.486 6.816   168.035 1.00 50.22  ? 221 ARG A CB  1 
ATOM   1720  C CG  . ARG A 1 221 ? 111.577 6.519   169.223 1.00 58.71  ? 221 ARG A CG  1 
ATOM   1721  C CD  . ARG A 1 221 ? 111.134 7.769   169.972 1.00 64.75  ? 221 ARG A CD  1 
ATOM   1722  N NE  . ARG A 1 221 ? 110.312 7.439   171.137 1.00 59.58  ? 221 ARG A NE  1 
ATOM   1723  C CZ  . ARG A 1 221 ? 110.200 8.203   172.220 1.00 81.89  ? 221 ARG A CZ  1 
ATOM   1724  N NH1 . ARG A 1 221 ? 109.431 7.817   173.231 1.00 88.16  ? 221 ARG A NH1 1 
ATOM   1725  N NH2 . ARG A 1 221 ? 110.846 9.358   172.290 1.00 96.77  ? 221 ARG A NH2 1 
ATOM   1726  N N   . GLY A 1 222 ? 110.918 4.997   165.241 1.00 56.66  ? 222 GLY A N   1 
ATOM   1727  C CA  . GLY A 1 222 ? 110.029 5.137   164.107 1.00 65.56  ? 222 GLY A CA  1 
ATOM   1728  C C   . GLY A 1 222 ? 108.637 4.578   164.286 1.00 66.77  ? 222 GLY A C   1 
ATOM   1729  O O   . GLY A 1 222 ? 108.004 4.745   165.327 1.00 71.80  ? 222 GLY A O   1 
ATOM   1730  N N   . GLN A 1 223 ? 108.167 3.906   163.242 1.00 66.85  ? 223 GLN A N   1 
ATOM   1731  C CA  . GLN A 1 223 ? 106.810 3.383   163.186 1.00 70.14  ? 223 GLN A CA  1 
ATOM   1732  C C   . GLN A 1 223 ? 106.544 2.326   164.247 1.00 69.57  ? 223 GLN A C   1 
ATOM   1733  O O   . GLN A 1 223 ? 105.438 2.240   164.772 1.00 81.37  ? 223 GLN A O   1 
ATOM   1734  C CB  . GLN A 1 223 ? 106.532 2.822   161.794 1.00 76.69  ? 223 GLN A CB  1 
ATOM   1735  C CG  . GLN A 1 223 ? 106.720 3.861   160.703 1.00 89.96  ? 223 GLN A CG  1 
ATOM   1736  C CD  . GLN A 1 223 ? 105.475 4.699   160.465 1.00 116.37 ? 223 GLN A CD  1 
ATOM   1737  O OE1 . GLN A 1 223 ? 104.968 5.350   161.379 1.00 121.23 ? 223 GLN A OE1 1 
ATOM   1738  N NE2 . GLN A 1 223 ? 104.990 4.702   159.228 1.00 133.26 ? 223 GLN A NE2 1 
ATOM   1739  N N   . ALA A 1 224 ? 107.544 1.510   164.557 1.00 59.36  ? 224 ALA A N   1 
ATOM   1740  C CA  . ALA A 1 224 ? 107.380 0.526   165.620 1.00 59.00  ? 224 ALA A CA  1 
ATOM   1741  C C   . ALA A 1 224 ? 108.160 0.955   166.854 1.00 59.96  ? 224 ALA A C   1 
ATOM   1742  O O   . ALA A 1 224 ? 108.803 0.139   167.510 1.00 74.51  ? 224 ALA A O   1 
ATOM   1743  C CB  . ALA A 1 224 ? 107.814 -0.845  165.159 1.00 59.68  ? 224 ALA A CB  1 
ATOM   1744  N N   . GLY A 1 225 ? 108.071 2.244   167.171 1.00 56.31  ? 225 GLY A N   1 
ATOM   1745  C CA  . GLY A 1 225 ? 108.782 2.814   168.300 1.00 68.03  ? 225 GLY A CA  1 
ATOM   1746  C C   . GLY A 1 225 ? 110.289 2.706   168.189 1.00 67.24  ? 225 GLY A C   1 
ATOM   1747  O O   . GLY A 1 225 ? 110.831 2.574   167.088 1.00 70.01  ? 225 GLY A O   1 
ATOM   1748  N N   . GLY A 1 226 ? 110.959 2.749   169.337 1.00 62.47  ? 226 GLY A N   1 
ATOM   1749  C CA  . GLY A 1 226 ? 112.405 2.651   169.390 1.00 48.94  ? 226 GLY A CA  1 
ATOM   1750  C C   . GLY A 1 226 ? 112.896 1.242   169.130 1.00 50.09  ? 226 GLY A C   1 
ATOM   1751  O O   . GLY A 1 226 ? 112.581 0.311   169.875 1.00 53.66  ? 226 GLY A O   1 
ATOM   1752  N N   . LYS A 1 227 ? 113.683 1.076   168.075 1.00 63.69  ? 227 LYS A N   1 
ATOM   1753  C CA  . LYS A 1 227 ? 114.162 -0.250  167.724 1.00 54.06  ? 227 LYS A CA  1 
ATOM   1754  C C   . LYS A 1 227 ? 115.636 -0.209  167.348 1.00 55.58  ? 227 LYS A C   1 
ATOM   1755  O O   . LYS A 1 227 ? 116.112 0.767   166.771 1.00 56.56  ? 227 LYS A O   1 
ATOM   1756  C CB  . LYS A 1 227 ? 113.334 -0.840  166.572 1.00 48.36  ? 227 LYS A CB  1 
ATOM   1757  C CG  . LYS A 1 227 ? 111.916 -1.202  166.976 1.00 60.56  ? 227 LYS A CG  1 
ATOM   1758  C CD  . LYS A 1 227 ? 111.879 -2.513  167.745 1.00 77.03  ? 227 LYS A CD  1 
ATOM   1759  C CE  . LYS A 1 227 ? 110.456 -2.843  168.171 1.00 105.32 ? 227 LYS A CE  1 
ATOM   1760  N NZ  . LYS A 1 227 ? 109.955 -1.878  169.197 1.00 112.54 ? 227 LYS A NZ  1 
ATOM   1761  N N   . LEU A 1 228 ? 116.351 -1.283  167.671 1.00 53.51  ? 228 LEU A N   1 
ATOM   1762  C CA  . LEU A 1 228 ? 117.752 -1.428  167.285 1.00 60.98  ? 228 LEU A CA  1 
ATOM   1763  C C   . LEU A 1 228 ? 117.921 -2.670  166.426 1.00 67.79  ? 228 LEU A C   1 
ATOM   1764  O O   . LEU A 1 228 ? 117.587 -3.778  166.838 1.00 59.26  ? 228 LEU A O   1 
ATOM   1765  C CB  . LEU A 1 228 ? 118.657 -1.492  168.520 1.00 72.62  ? 228 LEU A CB  1 
ATOM   1766  C CG  . LEU A 1 228 ? 120.154 -1.646  168.247 1.00 54.78  ? 228 LEU A CG  1 
ATOM   1767  C CD1 . LEU A 1 228 ? 120.829 -0.296  167.978 1.00 48.71  ? 228 LEU A CD1 1 
ATOM   1768  C CD2 . LEU A 1 228 ? 120.804 -2.329  169.434 1.00 55.82  ? 228 LEU A CD2 1 
ATOM   1769  N N   . HIS A 1 229 ? 118.454 -2.473  165.229 1.00 82.88  ? 229 HIS A N   1 
ATOM   1770  C CA  . HIS A 1 229 ? 118.591 -3.569  164.292 1.00 75.49  ? 229 HIS A CA  1 
ATOM   1771  C C   . HIS A 1 229 ? 120.041 -3.926  164.009 1.00 74.97  ? 229 HIS A C   1 
ATOM   1772  O O   . HIS A 1 229 ? 120.863 -3.050  163.759 1.00 87.73  ? 229 HIS A O   1 
ATOM   1773  C CB  . HIS A 1 229 ? 117.877 -3.213  162.986 1.00 69.00  ? 229 HIS A CB  1 
ATOM   1774  C CG  . HIS A 1 229 ? 116.410 -2.958  163.156 1.00 72.96  ? 229 HIS A CG  1 
ATOM   1775  N ND1 . HIS A 1 229 ? 115.487 -3.966  163.268 1.00 85.83  ? 229 HIS A ND1 1 
ATOM   1776  C CD2 . HIS A 1 229 ? 115.713 -1.795  163.254 1.00 65.35  ? 229 HIS A CD2 1 
ATOM   1777  C CE1 . HIS A 1 229 ? 114.277 -3.449  163.421 1.00 84.70  ? 229 HIS A CE1 1 
ATOM   1778  N NE2 . HIS A 1 229 ? 114.393 -2.132  163.413 1.00 78.46  ? 229 HIS A NE2 1 
ATOM   1779  N N   . ILE A 1 230 ? 120.347 -5.217  164.079 1.00 73.31  ? 230 ILE A N   1 
ATOM   1780  C CA  . ILE A 1 230 ? 121.683 -5.705  163.766 1.00 77.28  ? 230 ILE A CA  1 
ATOM   1781  C C   . ILE A 1 230 ? 121.589 -6.772  162.687 1.00 65.91  ? 230 ILE A C   1 
ATOM   1782  O O   . ILE A 1 230 ? 121.207 -7.912  162.951 1.00 63.48  ? 230 ILE A O   1 
ATOM   1783  C CB  . ILE A 1 230 ? 122.389 -6.275  164.999 1.00 76.87  ? 230 ILE A CB  1 
ATOM   1784  C CG1 . ILE A 1 230 ? 122.430 -5.227  166.110 1.00 73.84  ? 230 ILE A CG1 1 
ATOM   1785  C CG2 . ILE A 1 230 ? 123.796 -6.710  164.647 1.00 82.97  ? 230 ILE A CG2 1 
ATOM   1786  C CD1 . ILE A 1 230 ? 122.452 -5.812  167.505 1.00 86.11  ? 230 ILE A CD1 1 
ATOM   1787  N N   . ILE A 1 231 ? 121.954 -6.396  161.466 1.00 67.76  ? 231 ILE A N   1 
ATOM   1788  C CA  . ILE A 1 231 ? 121.827 -7.287  160.320 1.00 76.24  ? 231 ILE A CA  1 
ATOM   1789  C C   . ILE A 1 231 ? 123.142 -7.421  159.553 1.00 71.49  ? 231 ILE A C   1 
ATOM   1790  O O   . ILE A 1 231 ? 123.974 -6.516  159.551 1.00 75.43  ? 231 ILE A O   1 
ATOM   1791  C CB  . ILE A 1 231 ? 120.717 -6.806  159.354 1.00 73.30  ? 231 ILE A CB  1 
ATOM   1792  C CG1 . ILE A 1 231 ? 121.110 -5.491  158.676 1.00 85.88  ? 231 ILE A CG1 1 
ATOM   1793  C CG2 . ILE A 1 231 ? 119.401 -6.652  160.096 1.00 65.51  ? 231 ILE A CG2 1 
ATOM   1794  C CD1 . ILE A 1 231 ? 121.278 -5.622  157.176 1.00 100.00 ? 231 ILE A CD1 1 
ATOM   1795  N N   . GLU A 1 232 ? 123.321 -8.567  158.908 1.00 73.11  ? 232 GLU A N   1 
ATOM   1796  C CA  . GLU A 1 232 ? 124.497 -8.820  158.086 1.00 71.50  ? 232 GLU A CA  1 
ATOM   1797  C C   . GLU A 1 232 ? 124.272 -8.334  156.658 1.00 71.69  ? 232 GLU A C   1 
ATOM   1798  O O   . GLU A 1 232 ? 123.252 -8.651  156.045 1.00 82.40  ? 232 GLU A O   1 
ATOM   1799  C CB  . GLU A 1 232 ? 124.816 -10.312 158.064 1.00 73.29  ? 232 GLU A CB  1 
ATOM   1800  C CG  . GLU A 1 232 ? 126.050 -10.674 157.270 1.00 84.68  ? 232 GLU A CG  1 
ATOM   1801  C CD  . GLU A 1 232 ? 126.171 -12.168 157.052 1.00 103.71 ? 232 GLU A CD  1 
ATOM   1802  O OE1 . GLU A 1 232 ? 125.153 -12.789 156.683 1.00 100.13 ? 232 GLU A OE1 1 
ATOM   1803  O OE2 . GLU A 1 232 ? 127.270 -12.724 157.254 1.00 113.57 ? 232 GLU A OE2 1 
ATOM   1804  N N   . VAL A 1 233 ? 125.221 -7.573  156.123 1.00 74.59  ? 233 VAL A N   1 
ATOM   1805  C CA  . VAL A 1 233 ? 125.079 -7.076  154.761 1.00 80.41  ? 233 VAL A CA  1 
ATOM   1806  C C   . VAL A 1 233 ? 125.818 -7.925  153.734 1.00 86.23  ? 233 VAL A C   1 
ATOM   1807  O O   . VAL A 1 233 ? 127.022 -8.166  153.835 1.00 84.26  ? 233 VAL A O   1 
ATOM   1808  C CB  . VAL A 1 233 ? 125.550 -5.613  154.631 1.00 75.54  ? 233 VAL A CB  1 
ATOM   1809  C CG1 . VAL A 1 233 ? 124.477 -4.667  155.141 1.00 75.97  ? 233 VAL A CG1 1 
ATOM   1810  C CG2 . VAL A 1 233 ? 126.865 -5.396  155.354 1.00 81.49  ? 233 VAL A CG2 1 
ATOM   1811  N N   . GLY A 1 234 ? 125.059 -8.359  152.736 1.00 98.91  ? 234 GLY A N   1 
ATOM   1812  C CA  . GLY A 1 234 ? 125.564 -9.140  151.626 1.00 117.12 ? 234 GLY A CA  1 
ATOM   1813  C C   . GLY A 1 234 ? 125.807 -10.613 151.875 1.00 120.16 ? 234 GLY A C   1 
ATOM   1814  O O   . GLY A 1 234 ? 125.566 -11.140 152.961 1.00 121.95 ? 234 GLY A O   1 
ATOM   1815  N N   . THR A 1 235 ? 126.277 -11.279 150.826 1.00 113.83 ? 235 THR A N   1 
ATOM   1816  C CA  . THR A 1 235 ? 126.545 -12.710 150.855 1.00 101.53 ? 235 THR A CA  1 
ATOM   1817  C C   . THR A 1 235 ? 127.676 -13.034 151.823 1.00 96.06  ? 235 THR A C   1 
ATOM   1818  O O   . THR A 1 235 ? 128.751 -12.438 151.750 1.00 96.90  ? 235 THR A O   1 
ATOM   1819  C CB  . THR A 1 235 ? 126.904 -13.241 149.452 1.00 103.89 ? 235 THR A CB  1 
ATOM   1820  O OG1 . THR A 1 235 ? 125.968 -12.735 148.493 1.00 102.21 ? 235 THR A OG1 1 
ATOM   1821  C CG2 . THR A 1 235 ? 126.887 -14.766 149.431 1.00 110.90 ? 235 THR A CG2 1 
ATOM   1822  N N   . PRO A 1 236 ? 127.437 -13.991 152.729 1.00 95.43  ? 236 PRO A N   1 
ATOM   1823  C CA  . PRO A 1 236 ? 128.472 -14.398 153.683 1.00 102.48 ? 236 PRO A CA  1 
ATOM   1824  C C   . PRO A 1 236 ? 129.625 -15.088 152.974 1.00 120.62 ? 236 PRO A C   1 
ATOM   1825  O O   . PRO A 1 236 ? 129.397 -15.745 151.956 1.00 129.76 ? 236 PRO A O   1 
ATOM   1826  C CB  . PRO A 1 236 ? 127.744 -15.374 154.615 1.00 97.73  ? 236 PRO A CB  1 
ATOM   1827  C CG  . PRO A 1 236 ? 126.291 -15.287 154.253 1.00 107.09 ? 236 PRO A CG  1 
ATOM   1828  C CD  . PRO A 1 236 ? 126.213 -14.797 152.859 1.00 103.98 ? 236 PRO A CD  1 
ATOM   1829  N N   . PRO A 1 237 ? 130.850 -14.938 153.499 1.00 111.67 ? 237 PRO A N   1 
ATOM   1830  C CA  . PRO A 1 237 ? 132.012 -15.590 152.888 1.00 111.63 ? 237 PRO A CA  1 
ATOM   1831  C C   . PRO A 1 237 ? 131.856 -17.105 152.845 1.00 120.87 ? 237 PRO A C   1 
ATOM   1832  O O   . PRO A 1 237 ? 131.029 -17.662 153.568 1.00 114.67 ? 237 PRO A O   1 
ATOM   1833  C CB  . PRO A 1 237 ? 133.170 -15.182 153.805 1.00 108.49 ? 237 PRO A CB  1 
ATOM   1834  C CG  . PRO A 1 237 ? 132.684 -13.960 154.521 1.00 104.84 ? 237 PRO A CG  1 
ATOM   1835  C CD  . PRO A 1 237 ? 131.215 -14.173 154.703 1.00 106.57 ? 237 PRO A CD  1 
ATOM   1836  N N   . THR A 1 238 ? 132.651 -17.756 152.006 1.00 129.95 ? 238 THR A N   1 
ATOM   1837  C CA  . THR A 1 238 ? 132.593 -19.199 151.864 1.00 128.17 ? 238 THR A CA  1 
ATOM   1838  C C   . THR A 1 238 ? 132.917 -19.881 153.189 1.00 128.31 ? 238 THR A C   1 
ATOM   1839  O O   . THR A 1 238 ? 133.969 -19.641 153.788 1.00 137.13 ? 238 THR A O   1 
ATOM   1840  C CB  . THR A 1 238 ? 133.558 -19.687 150.774 1.00 132.69 ? 238 THR A CB  1 
ATOM   1841  O OG1 . THR A 1 238 ? 134.782 -18.951 150.871 1.00 137.25 ? 238 THR A OG1 1 
ATOM   1842  C CG2 . THR A 1 238 ? 132.952 -19.461 149.397 1.00 130.73 ? 238 THR A CG2 1 
ATOM   1843  N N   . GLY A 1 239 ? 132.021 -20.769 153.613 1.00 118.80 ? 239 GLY A N   1 
ATOM   1844  C CA  . GLY A 1 239 ? 132.183 -21.491 154.864 1.00 118.00 ? 239 GLY A CA  1 
ATOM   1845  C C   . GLY A 1 239 ? 131.743 -20.766 156.125 1.00 122.58 ? 239 GLY A C   1 
ATOM   1846  O O   . GLY A 1 239 ? 132.283 -21.022 157.206 1.00 128.14 ? 239 GLY A O   1 
ATOM   1847  N N   . ASN A 1 240 ? 130.777 -19.858 155.991 1.00 126.66 ? 240 ASN A N   1 
ATOM   1848  C CA  . ASN A 1 240 ? 130.287 -19.104 157.134 1.00 120.09 ? 240 ASN A CA  1 
ATOM   1849  C C   . ASN A 1 240 ? 128.826 -19.480 157.440 1.00 119.44 ? 240 ASN A C   1 
ATOM   1850  O O   . ASN A 1 240 ? 128.218 -20.268 156.712 1.00 126.08 ? 240 ASN A O   1 
ATOM   1851  C CB  . ASN A 1 240 ? 130.476 -17.610 156.879 1.00 121.62 ? 240 ASN A CB  1 
ATOM   1852  C CG  . ASN A 1 240 ? 131.894 -17.147 157.227 1.00 123.93 ? 240 ASN A CG  1 
ATOM   1853  O OD1 . ASN A 1 240 ? 132.140 -16.550 158.274 1.00 121.92 ? 240 ASN A OD1 1 
ATOM   1854  N ND2 . ASN A 1 240 ? 132.842 -17.457 156.344 1.00 136.06 ? 240 ASN A ND2 1 
ATOM   1855  N N   . GLN A 1 241 ? 128.261 -18.916 158.509 1.00 113.92 ? 241 GLN A N   1 
ATOM   1856  C CA  . GLN A 1 241 ? 126.964 -19.407 159.030 1.00 118.40 ? 241 GLN A CA  1 
ATOM   1857  C C   . GLN A 1 241 ? 125.647 -19.108 158.277 1.00 129.47 ? 241 GLN A C   1 
ATOM   1858  O O   . GLN A 1 241 ? 125.001 -20.064 157.832 1.00 150.49 ? 241 GLN A O   1 
ATOM   1859  C CB  . GLN A 1 241 ? 126.805 -18.973 160.475 1.00 126.33 ? 241 GLN A CB  1 
ATOM   1860  C CG  . GLN A 1 241 ? 127.523 -19.914 161.447 1.00 139.90 ? 241 GLN A CG  1 
ATOM   1861  C CD  . GLN A 1 241 ? 127.170 -21.384 161.234 1.00 140.68 ? 241 GLN A CD  1 
ATOM   1862  O OE1 . GLN A 1 241 ? 126.001 -21.742 161.052 1.00 152.45 ? 241 GLN A OE1 1 
ATOM   1863  N NE2 . GLN A 1 241 ? 128.187 -22.236 161.232 1.00 134.93 ? 241 GLN A NE2 1 
ATOM   1864  N N   . PRO A 1 242 ? 125.201 -17.841 158.130 1.00 111.89 ? 242 PRO A N   1 
ATOM   1865  C CA  . PRO A 1 242 ? 125.444 -16.439 158.501 1.00 107.11 ? 242 PRO A CA  1 
ATOM   1866  C C   . PRO A 1 242 ? 124.894 -15.964 159.851 1.00 106.57 ? 242 PRO A C   1 
ATOM   1867  O O   . PRO A 1 242 ? 124.451 -16.747 160.696 1.00 111.78 ? 242 PRO A O   1 
ATOM   1868  C CB  . PRO A 1 242 ? 124.729 -15.673 157.394 1.00 106.57 ? 242 PRO A CB  1 
ATOM   1869  C CG  . PRO A 1 242 ? 123.614 -16.530 156.987 1.00 105.24 ? 242 PRO A CG  1 
ATOM   1870  C CD  . PRO A 1 242 ? 124.030 -17.949 157.236 1.00 108.33 ? 242 PRO A CD  1 
ATOM   1871  N N   . PHE A 1 243 ? 124.963 -14.644 160.024 1.00 98.14  ? 243 PHE A N   1 
ATOM   1872  C CA  . PHE A 1 243 ? 124.481 -13.926 161.200 1.00 89.24  ? 243 PHE A CA  1 
ATOM   1873  C C   . PHE A 1 243 ? 122.957 -13.773 161.203 1.00 95.65  ? 243 PHE A C   1 
ATOM   1874  O O   . PHE A 1 243 ? 122.395 -13.186 160.278 1.00 107.54 ? 243 PHE A O   1 
ATOM   1875  C CB  . PHE A 1 243 ? 125.142 -12.545 161.260 1.00 82.36  ? 243 PHE A CB  1 
ATOM   1876  C CG  . PHE A 1 243 ? 124.863 -11.790 162.528 1.00 77.21  ? 243 PHE A CG  1 
ATOM   1877  C CD1 . PHE A 1 243 ? 125.712 -11.918 163.614 1.00 78.25  ? 243 PHE A CD1 1 
ATOM   1878  C CD2 . PHE A 1 243 ? 123.771 -10.945 162.636 1.00 76.85  ? 243 PHE A CD2 1 
ATOM   1879  C CE1 . PHE A 1 243 ? 125.476 -11.230 164.786 1.00 77.15  ? 243 PHE A CE1 1 
ATOM   1880  C CE2 . PHE A 1 243 ? 123.525 -10.254 163.811 1.00 76.01  ? 243 PHE A CE2 1 
ATOM   1881  C CZ  . PHE A 1 243 ? 124.382 -10.396 164.887 1.00 75.04  ? 243 PHE A CZ  1 
ATOM   1882  N N   . PRO A 1 244 ? 122.284 -14.300 162.241 1.00 93.89  ? 244 PRO A N   1 
ATOM   1883  C CA  . PRO A 1 244 ? 120.827 -14.158 162.374 1.00 81.91  ? 244 PRO A CA  1 
ATOM   1884  C C   . PRO A 1 244 ? 120.412 -12.723 162.701 1.00 83.05  ? 244 PRO A C   1 
ATOM   1885  O O   . PRO A 1 244 ? 120.842 -12.188 163.723 1.00 89.14  ? 244 PRO A O   1 
ATOM   1886  C CB  . PRO A 1 244 ? 120.478 -15.102 163.527 1.00 76.09  ? 244 PRO A CB  1 
ATOM   1887  C CG  . PRO A 1 244 ? 121.724 -15.220 164.318 1.00 77.65  ? 244 PRO A CG  1 
ATOM   1888  C CD  . PRO A 1 244 ? 122.880 -15.031 163.374 1.00 83.69  ? 244 PRO A CD  1 
ATOM   1889  N N   . LYS A 1 245 ? 119.601 -12.120 161.834 1.00 81.40  ? 245 LYS A N   1 
ATOM   1890  C CA  . LYS A 1 245 ? 119.118 -10.753 162.018 1.00 73.05  ? 245 LYS A CA  1 
ATOM   1891  C C   . LYS A 1 245 ? 118.574 -10.497 163.420 1.00 67.76  ? 245 LYS A C   1 
ATOM   1892  O O   . LYS A 1 245 ? 117.828 -11.308 163.962 1.00 71.75  ? 245 LYS A O   1 
ATOM   1893  C CB  . LYS A 1 245 ? 118.033 -10.432 160.986 1.00 68.83  ? 245 LYS A CB  1 
ATOM   1894  C CG  . LYS A 1 245 ? 117.097 -9.313  161.417 1.00 106.43 ? 245 LYS A CG  1 
ATOM   1895  C CD  . LYS A 1 245 ? 116.426 -8.646  160.234 1.00 128.41 ? 245 LYS A CD  1 
ATOM   1896  C CE  . LYS A 1 245 ? 115.694 -7.388  160.678 1.00 137.20 ? 245 LYS A CE  1 
ATOM   1897  N NZ  . LYS A 1 245 ? 115.253 -6.558  159.523 1.00 133.13 ? 245 LYS A NZ  1 
ATOM   1898  N N   . LYS A 1 246 ? 118.953 -9.363  163.999 1.00 63.66  ? 246 LYS A N   1 
ATOM   1899  C CA  . LYS A 1 246 ? 118.468 -8.982  165.321 1.00 62.12  ? 246 LYS A CA  1 
ATOM   1900  C C   . LYS A 1 246 ? 117.605 -7.728  165.279 1.00 66.97  ? 246 LYS A C   1 
ATOM   1901  O O   . LYS A 1 246 ? 117.839 -6.820  164.485 1.00 75.30  ? 246 LYS A O   1 
ATOM   1902  C CB  . LYS A 1 246 ? 119.635 -8.755  166.283 1.00 62.37  ? 246 LYS A CB  1 
ATOM   1903  C CG  . LYS A 1 246 ? 120.604 -9.918  166.429 1.00 79.77  ? 246 LYS A CG  1 
ATOM   1904  C CD  . LYS A 1 246 ? 119.917 -11.148 167.001 1.00 87.31  ? 246 LYS A CD  1 
ATOM   1905  C CE  . LYS A 1 246 ? 120.943 -12.154 167.507 1.00 106.54 ? 246 LYS A CE  1 
ATOM   1906  N NZ  . LYS A 1 246 ? 121.947 -12.521 166.473 1.00 92.31  ? 246 LYS A NZ  1 
ATOM   1907  N N   . ALA A 1 247 ? 116.606 -7.694  166.152 1.00 85.83  ? 247 ALA A N   1 
ATOM   1908  C CA  . ALA A 1 247 ? 115.728 -6.544  166.286 1.00 81.43  ? 247 ALA A CA  1 
ATOM   1909  C C   . ALA A 1 247 ? 115.335 -6.415  167.749 1.00 70.82  ? 247 ALA A C   1 
ATOM   1910  O O   . ALA A 1 247 ? 114.588 -7.237  168.276 1.00 93.66  ? 247 ALA A O   1 
ATOM   1911  C CB  . ALA A 1 247 ? 114.503 -6.689  165.404 1.00 82.69  ? 247 ALA A CB  1 
ATOM   1912  N N   . VAL A 1 248 ? 115.841 -5.371  168.398 1.00 58.41  ? 248 VAL A N   1 
ATOM   1913  C CA  . VAL A 1 248 ? 115.618 -5.175  169.826 1.00 57.54  ? 248 VAL A CA  1 
ATOM   1914  C C   . VAL A 1 248 ? 114.980 -3.820  170.122 1.00 59.68  ? 248 VAL A C   1 
ATOM   1915  O O   . VAL A 1 248 ? 115.065 -2.903  169.312 1.00 78.51  ? 248 VAL A O   1 
ATOM   1916  C CB  . VAL A 1 248 ? 116.959 -5.318  170.604 1.00 59.23  ? 248 VAL A CB  1 
ATOM   1917  C CG1 . VAL A 1 248 ? 117.386 -4.006  171.264 1.00 68.14  ? 248 VAL A CG1 1 
ATOM   1918  C CG2 . VAL A 1 248 ? 116.861 -6.431  171.621 1.00 69.29  ? 248 VAL A CG2 1 
ATOM   1919  N N   . ASP A 1 249 ? 114.337 -3.696  171.280 1.00 56.84  ? 249 ASP A N   1 
ATOM   1920  C CA  . ASP A 1 249 ? 113.729 -2.429  171.667 1.00 60.03  ? 249 ASP A CA  1 
ATOM   1921  C C   . ASP A 1 249 ? 114.754 -1.432  172.184 1.00 56.61  ? 249 ASP A C   1 
ATOM   1922  O O   . ASP A 1 249 ? 115.741 -1.804  172.815 1.00 58.95  ? 249 ASP A O   1 
ATOM   1923  C CB  . ASP A 1 249 ? 112.668 -2.637  172.752 1.00 76.82  ? 249 ASP A CB  1 
ATOM   1924  C CG  . ASP A 1 249 ? 111.339 -3.089  172.196 1.00 123.12 ? 249 ASP A CG  1 
ATOM   1925  O OD1 . ASP A 1 249 ? 111.320 -3.917  171.261 1.00 146.88 ? 249 ASP A OD1 1 
ATOM   1926  O OD2 . ASP A 1 249 ? 110.305 -2.593  172.691 1.00 135.20 ? 249 ASP A OD2 1 
ATOM   1927  N N   . VAL A 1 250 ? 114.505 -0.156  171.908 1.00 60.26  ? 250 VAL A N   1 
ATOM   1928  C CA  . VAL A 1 250 ? 115.317 0.923   172.457 1.00 57.53  ? 250 VAL A CA  1 
ATOM   1929  C C   . VAL A 1 250 ? 114.450 1.711   173.427 1.00 57.18  ? 250 VAL A C   1 
ATOM   1930  O O   . VAL A 1 250 ? 113.434 2.281   173.035 1.00 59.39  ? 250 VAL A O   1 
ATOM   1931  C CB  . VAL A 1 250 ? 115.858 1.854   171.370 1.00 56.91  ? 250 VAL A CB  1 
ATOM   1932  C CG1 . VAL A 1 250 ? 116.599 3.014   172.006 1.00 51.13  ? 250 VAL A CG1 1 
ATOM   1933  C CG2 . VAL A 1 250 ? 116.773 1.090   170.429 1.00 51.66  ? 250 VAL A CG2 1 
ATOM   1934  N N   . PHE A 1 251 ? 114.864 1.774   174.688 1.00 53.80  ? 251 PHE A N   1 
ATOM   1935  C CA  . PHE A 1 251 ? 114.025 2.384   175.713 1.00 50.51  ? 251 PHE A CA  1 
ATOM   1936  C C   . PHE A 1 251 ? 114.119 3.903   175.831 1.00 54.15  ? 251 PHE A C   1 
ATOM   1937  O O   . PHE A 1 251 ? 115.200 4.479   175.955 1.00 65.70  ? 251 PHE A O   1 
ATOM   1938  C CB  . PHE A 1 251 ? 114.317 1.778   177.084 1.00 62.43  ? 251 PHE A CB  1 
ATOM   1939  C CG  . PHE A 1 251 ? 113.479 2.373   178.182 1.00 69.90  ? 251 PHE A CG  1 
ATOM   1940  C CD1 . PHE A 1 251 ? 112.106 2.198   178.194 1.00 71.05  ? 251 PHE A CD1 1 
ATOM   1941  C CD2 . PHE A 1 251 ? 114.061 3.123   179.189 1.00 76.05  ? 251 PHE A CD2 1 
ATOM   1942  C CE1 . PHE A 1 251 ? 111.329 2.755   179.191 1.00 78.13  ? 251 PHE A CE1 1 
ATOM   1943  C CE2 . PHE A 1 251 ? 113.293 3.682   180.190 1.00 68.41  ? 251 PHE A CE2 1 
ATOM   1944  C CZ  . PHE A 1 251 ? 111.925 3.498   180.193 1.00 78.83  ? 251 PHE A CZ  1 
ATOM   1945  N N   . PHE A 1 252 ? 112.949 4.531   175.777 1.00 57.32  ? 252 PHE A N   1 
ATOM   1946  C CA  . PHE A 1 252 ? 112.799 5.963   175.984 1.00 55.21  ? 252 PHE A CA  1 
ATOM   1947  C C   . PHE A 1 252 ? 111.800 6.170   177.117 1.00 70.43  ? 252 PHE A C   1 
ATOM   1948  O O   . PHE A 1 252 ? 110.640 5.774   176.996 1.00 90.68  ? 252 PHE A O   1 
ATOM   1949  C CB  . PHE A 1 252 ? 112.313 6.656   174.712 1.00 52.20  ? 252 PHE A CB  1 
ATOM   1950  C CG  . PHE A 1 252 ? 113.309 6.632   173.587 1.00 51.53  ? 252 PHE A CG  1 
ATOM   1951  C CD1 . PHE A 1 252 ? 114.351 7.544   173.538 1.00 63.85  ? 252 PHE A CD1 1 
ATOM   1952  C CD2 . PHE A 1 252 ? 113.204 5.688   172.581 1.00 62.98  ? 252 PHE A CD2 1 
ATOM   1953  C CE1 . PHE A 1 252 ? 115.265 7.516   172.499 1.00 73.16  ? 252 PHE A CE1 1 
ATOM   1954  C CE2 . PHE A 1 252 ? 114.113 5.653   171.544 1.00 75.19  ? 252 PHE A CE2 1 
ATOM   1955  C CZ  . PHE A 1 252 ? 115.144 6.567   171.500 1.00 72.94  ? 252 PHE A CZ  1 
ATOM   1956  N N   . PRO A 1 253 ? 112.244 6.781   178.230 1.00 80.45  ? 253 PRO A N   1 
ATOM   1957  C CA  . PRO A 1 253 ? 111.356 7.013   179.376 1.00 85.27  ? 253 PRO A CA  1 
ATOM   1958  C C   . PRO A 1 253 ? 110.145 7.858   178.990 1.00 89.42  ? 253 PRO A C   1 
ATOM   1959  O O   . PRO A 1 253 ? 110.195 8.540   177.965 1.00 75.95  ? 253 PRO A O   1 
ATOM   1960  C CB  . PRO A 1 253 ? 112.248 7.763   180.371 1.00 92.83  ? 253 PRO A CB  1 
ATOM   1961  C CG  . PRO A 1 253 ? 113.355 8.329   179.560 1.00 85.58  ? 253 PRO A CG  1 
ATOM   1962  C CD  . PRO A 1 253 ? 113.574 7.382   178.426 1.00 86.81  ? 253 PRO A CD  1 
ATOM   1963  N N   . PRO A 1 254 ? 109.074 7.823   179.802 1.00 96.98  ? 254 PRO A N   1 
ATOM   1964  C CA  . PRO A 1 254 ? 107.850 8.566   179.482 1.00 90.77  ? 254 PRO A CA  1 
ATOM   1965  C C   . PRO A 1 254 ? 108.056 10.079  179.400 1.00 90.07  ? 254 PRO A C   1 
ATOM   1966  O O   . PRO A 1 254 ? 107.364 10.746  178.631 1.00 92.59  ? 254 PRO A O   1 
ATOM   1967  C CB  . PRO A 1 254 ? 106.914 8.208   180.643 1.00 88.24  ? 254 PRO A CB  1 
ATOM   1968  C CG  . PRO A 1 254 ? 107.826 7.813   181.755 1.00 91.74  ? 254 PRO A CG  1 
ATOM   1969  C CD  . PRO A 1 254 ? 108.946 7.093   181.076 1.00 85.13  ? 254 PRO A CD  1 
ATOM   1970  N N   . GLU A 1 255 ? 108.982 10.611  180.192 1.00 76.66  ? 255 GLU A N   1 
ATOM   1971  C CA  . GLU A 1 255 ? 109.265 12.044  180.183 1.00 87.82  ? 255 GLU A CA  1 
ATOM   1972  C C   . GLU A 1 255 ? 109.954 12.500  178.895 1.00 91.56  ? 255 GLU A C   1 
ATOM   1973  O O   . GLU A 1 255 ? 109.806 13.646  178.477 1.00 89.03  ? 255 GLU A O   1 
ATOM   1974  C CB  . GLU A 1 255 ? 110.108 12.420  181.402 1.00 89.73  ? 255 GLU A CB  1 
ATOM   1975  C CG  . GLU A 1 255 ? 111.350 11.573  181.586 1.00 105.09 ? 255 GLU A CG  1 
ATOM   1976  C CD  . GLU A 1 255 ? 112.620 12.368  181.372 1.00 147.58 ? 255 GLU A CD  1 
ATOM   1977  O OE1 . GLU A 1 255 ? 112.881 12.784  180.222 1.00 153.84 ? 255 GLU A OE1 1 
ATOM   1978  O OE2 . GLU A 1 255 ? 113.357 12.583  182.357 1.00 167.47 ? 255 GLU A OE2 1 
ATOM   1979  N N   . ALA A 1 256 ? 110.716 11.606  178.278 1.00 85.72  ? 256 ALA A N   1 
ATOM   1980  C CA  . ALA A 1 256 ? 111.448 11.914  177.050 1.00 81.17  ? 256 ALA A CA  1 
ATOM   1981  C C   . ALA A 1 256 ? 110.637 11.654  175.773 1.00 81.94  ? 256 ALA A C   1 
ATOM   1982  O O   . ALA A 1 256 ? 111.110 10.951  174.888 1.00 95.84  ? 256 ALA A O   1 
ATOM   1983  C CB  . ALA A 1 256 ? 112.751 11.123  177.009 1.00 73.02  ? 256 ALA A CB  1 
ATOM   1984  N N   . GLN A 1 257 ? 109.432 12.206  175.660 1.00 87.72  ? 257 GLN A N   1 
ATOM   1985  C CA  . GLN A 1 257 ? 108.615 11.958  174.466 1.00 89.63  ? 257 GLN A CA  1 
ATOM   1986  C C   . GLN A 1 257 ? 109.113 12.544  173.130 1.00 75.13  ? 257 GLN A C   1 
ATOM   1987  O O   . GLN A 1 257 ? 108.578 12.208  172.079 1.00 85.26  ? 257 GLN A O   1 
ATOM   1988  C CB  . GLN A 1 257 ? 107.191 12.459  174.697 1.00 97.94  ? 257 GLN A CB  1 
ATOM   1989  C CG  . GLN A 1 257 ? 106.320 11.553  175.537 1.00 99.60  ? 257 GLN A CG  1 
ATOM   1990  C CD  . GLN A 1 257 ? 104.950 12.145  175.769 1.00 118.05 ? 257 GLN A CD  1 
ATOM   1991  O OE1 . GLN A 1 257 ? 104.126 12.174  174.856 1.00 123.75 ? 257 GLN A OE1 1 
ATOM   1992  N NE2 . GLN A 1 257 ? 104.698 12.635  176.981 1.00 128.46 ? 257 GLN A NE2 1 
ATOM   1993  N N   . ASN A 1 258 ? 110.098 13.431  173.147 1.00 76.67  ? 258 ASN A N   1 
ATOM   1994  C CA  . ASN A 1 258 ? 110.641 13.945  171.884 1.00 86.51  ? 258 ASN A CA  1 
ATOM   1995  C C   . ASN A 1 258 ? 112.141 13.692  171.777 1.00 91.54  ? 258 ASN A C   1 
ATOM   1996  O O   . ASN A 1 258 ? 112.909 14.529  171.305 1.00 102.98 ? 258 ASN A O   1 
ATOM   1997  C CB  . ASN A 1 258 ? 110.318 15.426  171.678 1.00 82.07  ? 258 ASN A CB  1 
ATOM   1998  C CG  . ASN A 1 258 ? 108.835 15.674  171.471 1.00 98.86  ? 258 ASN A CG  1 
ATOM   1999  O OD1 . ASN A 1 258 ? 108.343 15.601  170.343 1.00 100.47 ? 258 ASN A OD1 1 
ATOM   2000  N ND2 . ASN A 1 258 ? 108.118 15.976  172.547 1.00 116.52 ? 258 ASN A ND2 1 
ATOM   2001  N N   . ASP A 1 259 ? 112.541 12.525  172.264 1.00 78.86  ? 259 ASP A N   1 
ATOM   2002  C CA  . ASP A 1 259 ? 113.909 12.038  172.163 1.00 74.53  ? 259 ASP A CA  1 
ATOM   2003  C C   . ASP A 1 259 ? 114.028 11.006  171.034 1.00 67.85  ? 259 ASP A C   1 
ATOM   2004  O O   . ASP A 1 259 ? 113.057 10.326  170.717 1.00 74.03  ? 259 ASP A O   1 
ATOM   2005  C CB  . ASP A 1 259 ? 114.340 11.432  173.500 1.00 85.43  ? 259 ASP A CB  1 
ATOM   2006  C CG  . ASP A 1 259 ? 115.831 11.244  173.597 1.00 81.32  ? 259 ASP A CG  1 
ATOM   2007  O OD1 . ASP A 1 259 ? 116.553 11.856  172.788 1.00 86.98  ? 259 ASP A OD1 1 
ATOM   2008  O OD2 . ASP A 1 259 ? 116.283 10.501  174.491 1.00 66.55  ? 259 ASP A OD2 1 
ATOM   2009  N N   . PHE A 1 260 ? 115.207 10.892  170.426 1.00 53.12  ? 260 PHE A N   1 
ATOM   2010  C CA  . PHE A 1 260 ? 115.442 9.914   169.355 1.00 48.50  ? 260 PHE A CA  1 
ATOM   2011  C C   . PHE A 1 260 ? 116.946 9.657   169.218 1.00 56.12  ? 260 PHE A C   1 
ATOM   2012  O O   . PHE A 1 260 ? 117.745 10.474  169.673 1.00 57.65  ? 260 PHE A O   1 
ATOM   2013  C CB  . PHE A 1 260 ? 114.849 10.391  168.022 1.00 50.60  ? 260 PHE A CB  1 
ATOM   2014  C CG  . PHE A 1 260 ? 115.293 11.766  167.606 1.00 55.64  ? 260 PHE A CG  1 
ATOM   2015  C CD1 . PHE A 1 260 ? 116.372 11.932  166.751 1.00 49.39  ? 260 PHE A CD1 1 
ATOM   2016  C CD2 . PHE A 1 260 ? 114.619 12.890  168.050 1.00 61.65  ? 260 PHE A CD2 1 
ATOM   2017  C CE1 . PHE A 1 260 ? 116.781 13.195  166.361 1.00 48.75  ? 260 PHE A CE1 1 
ATOM   2018  C CE2 . PHE A 1 260 ? 115.022 14.157  167.663 1.00 63.43  ? 260 PHE A CE2 1 
ATOM   2019  C CZ  . PHE A 1 260 ? 116.105 14.310  166.817 1.00 50.09  ? 260 PHE A CZ  1 
ATOM   2020  N N   . PRO A 1 261 ? 117.343 8.524   168.600 1.00 57.03  ? 261 PRO A N   1 
ATOM   2021  C CA  . PRO A 1 261 ? 118.789 8.296   168.463 1.00 54.77  ? 261 PRO A CA  1 
ATOM   2022  C C   . PRO A 1 261 ? 119.483 9.347   167.596 1.00 52.67  ? 261 PRO A C   1 
ATOM   2023  O O   . PRO A 1 261 ? 119.018 9.689   166.507 1.00 55.95  ? 261 PRO A O   1 
ATOM   2024  C CB  . PRO A 1 261 ? 118.876 6.907   167.809 1.00 47.09  ? 261 PRO A CB  1 
ATOM   2025  C CG  . PRO A 1 261 ? 117.521 6.291   168.011 1.00 49.80  ? 261 PRO A CG  1 
ATOM   2026  C CD  . PRO A 1 261 ? 116.558 7.424   168.014 1.00 47.65  ? 261 PRO A CD  1 
ATOM   2027  N N   . VAL A 1 262 ? 120.617 9.838   168.088 1.00 47.77  ? 262 VAL A N   1 
ATOM   2028  C CA  . VAL A 1 262 ? 121.359 10.906  167.421 1.00 47.74  ? 262 VAL A CA  1 
ATOM   2029  C C   . VAL A 1 262 ? 122.725 10.444  166.913 1.00 56.57  ? 262 VAL A C   1 
ATOM   2030  O O   . VAL A 1 262 ? 123.176 10.878  165.853 1.00 59.16  ? 262 VAL A O   1 
ATOM   2031  C CB  . VAL A 1 262 ? 121.528 12.130  168.363 1.00 62.14  ? 262 VAL A CB  1 
ATOM   2032  C CG1 . VAL A 1 262 ? 122.891 12.793  168.196 1.00 70.87  ? 262 VAL A CG1 1 
ATOM   2033  C CG2 . VAL A 1 262 ? 120.413 13.128  168.118 1.00 75.10  ? 262 VAL A CG2 1 
ATOM   2034  N N   . ALA A 1 263 ? 123.382 9.563   167.664 1.00 58.09  ? 263 ALA A N   1 
ATOM   2035  C CA  . ALA A 1 263 ? 124.704 9.076   167.274 1.00 48.30  ? 263 ALA A CA  1 
ATOM   2036  C C   . ALA A 1 263 ? 124.930 7.617   167.672 1.00 58.95  ? 263 ALA A C   1 
ATOM   2037  O O   . ALA A 1 263 ? 124.350 7.133   168.642 1.00 80.82  ? 263 ALA A O   1 
ATOM   2038  C CB  . ALA A 1 263 ? 125.780 9.958   167.879 1.00 48.92  ? 263 ALA A CB  1 
ATOM   2039  N N   . MET A 1 264 ? 125.776 6.922   166.916 1.00 51.07  ? 264 MET A N   1 
ATOM   2040  C CA  . MET A 1 264 ? 126.108 5.532   167.217 1.00 58.28  ? 264 MET A CA  1 
ATOM   2041  C C   . MET A 1 264 ? 127.543 5.176   166.830 1.00 62.64  ? 264 MET A C   1 
ATOM   2042  O O   . MET A 1 264 ? 127.972 5.413   165.701 1.00 87.60  ? 264 MET A O   1 
ATOM   2043  C CB  . MET A 1 264 ? 125.140 4.584   166.510 1.00 58.40  ? 264 MET A CB  1 
ATOM   2044  C CG  . MET A 1 264 ? 125.393 3.114   166.806 1.00 54.10  ? 264 MET A CG  1 
ATOM   2045  S SD  . MET A 1 264 ? 124.597 1.976   165.658 1.00 77.66  ? 264 MET A SD  1 
ATOM   2046  C CE  . MET A 1 264 ? 122.885 2.157   166.145 1.00 72.03  ? 264 MET A CE  1 
ATOM   2047  N N   . GLN A 1 265 ? 128.280 4.608   167.781 1.00 54.63  ? 265 GLN A N   1 
ATOM   2048  C CA  . GLN A 1 265 ? 129.643 4.134   167.544 1.00 55.16  ? 265 GLN A CA  1 
ATOM   2049  C C   . GLN A 1 265 ? 129.773 2.708   168.066 1.00 55.41  ? 265 GLN A C   1 
ATOM   2050  O O   . GLN A 1 265 ? 129.398 2.423   169.199 1.00 69.09  ? 265 GLN A O   1 
ATOM   2051  C CB  . GLN A 1 265 ? 130.666 5.040   168.232 1.00 63.18  ? 265 GLN A CB  1 
ATOM   2052  C CG  . GLN A 1 265 ? 130.816 6.441   167.642 1.00 80.69  ? 265 GLN A CG  1 
ATOM   2053  C CD  . GLN A 1 265 ? 131.390 6.455   166.238 1.00 90.99  ? 265 GLN A CD  1 
ATOM   2054  O OE1 . GLN A 1 265 ? 132.060 5.512   165.815 1.00 98.19  ? 265 GLN A OE1 1 
ATOM   2055  N NE2 . GLN A 1 265 ? 131.164 7.550   165.523 1.00 90.44  ? 265 GLN A NE2 1 
ATOM   2056  N N   . ILE A 1 266 ? 130.306 1.810   167.247 1.00 53.96  ? 266 ILE A N   1 
ATOM   2057  C CA  . ILE A 1 266 ? 130.475 0.421   167.668 1.00 55.09  ? 266 ILE A CA  1 
ATOM   2058  C C   . ILE A 1 266 ? 131.927 0.108   167.995 1.00 59.96  ? 266 ILE A C   1 
ATOM   2059  O O   . ILE A 1 266 ? 132.823 0.353   167.189 1.00 77.91  ? 266 ILE A O   1 
ATOM   2060  C CB  . ILE A 1 266 ? 129.988 -0.567  166.600 1.00 57.24  ? 266 ILE A CB  1 
ATOM   2061  C CG1 . ILE A 1 266 ? 128.505 -0.343  166.316 1.00 62.04  ? 266 ILE A CG1 1 
ATOM   2062  C CG2 . ILE A 1 266 ? 130.222 -1.998  167.056 1.00 72.69  ? 266 ILE A CG2 1 
ATOM   2063  C CD1 . ILE A 1 266 ? 128.039 -0.971  165.025 1.00 61.00  ? 266 ILE A CD1 1 
ATOM   2064  N N   . SER A 1 267 ? 132.152 -0.450  169.178 1.00 59.15  ? 267 SER A N   1 
ATOM   2065  C CA  . SER A 1 267 ? 133.494 -0.820  169.606 1.00 61.11  ? 267 SER A CA  1 
ATOM   2066  C C   . SER A 1 267 ? 133.825 -2.253  169.206 1.00 79.22  ? 267 SER A C   1 
ATOM   2067  O O   . SER A 1 267 ? 133.303 -3.203  169.783 1.00 95.08  ? 267 SER A O   1 
ATOM   2068  C CB  . SER A 1 267 ? 133.638 -0.649  171.117 1.00 63.23  ? 267 SER A CB  1 
ATOM   2069  O OG  . SER A 1 267 ? 134.763 -1.355  171.606 1.00 69.12  ? 267 SER A OG  1 
ATOM   2070  N N   . GLU A 1 268 ? 134.713 -2.397  168.228 1.00 97.75  ? 268 GLU A N   1 
ATOM   2071  C CA  . GLU A 1 268 ? 135.116 -3.704  167.724 1.00 93.36  ? 268 GLU A CA  1 
ATOM   2072  C C   . GLU A 1 268 ? 135.849 -4.500  168.800 1.00 78.33  ? 268 GLU A C   1 
ATOM   2073  O O   . GLU A 1 268 ? 135.772 -5.728  168.843 1.00 75.90  ? 268 GLU A O   1 
ATOM   2074  C CB  . GLU A 1 268 ? 136.016 -3.539  166.497 1.00 102.03 ? 268 GLU A CB  1 
ATOM   2075  C CG  . GLU A 1 268 ? 135.458 -2.610  165.423 1.00 114.47 ? 268 GLU A CG  1 
ATOM   2076  C CD  . GLU A 1 268 ? 134.815 -3.354  164.269 1.00 116.39 ? 268 GLU A CD  1 
ATOM   2077  O OE1 . GLU A 1 268 ? 135.497 -3.550  163.241 1.00 94.94  ? 268 GLU A OE1 1 
ATOM   2078  O OE2 . GLU A 1 268 ? 133.630 -3.736  164.381 1.00 123.18 ? 268 GLU A OE2 1 
ATOM   2079  N N   . LYS A 1 269 ? 136.551 -3.783  169.671 1.00 76.53  ? 269 LYS A N   1 
ATOM   2080  C CA  . LYS A 1 269 ? 137.342 -4.386  170.739 1.00 77.55  ? 269 LYS A CA  1 
ATOM   2081  C C   . LYS A 1 269 ? 136.499 -5.208  171.713 1.00 75.78  ? 269 LYS A C   1 
ATOM   2082  O O   . LYS A 1 269 ? 136.797 -6.372  171.976 1.00 77.11  ? 269 LYS A O   1 
ATOM   2083  C CB  . LYS A 1 269 ? 138.101 -3.294  171.491 1.00 84.10  ? 269 LYS A CB  1 
ATOM   2084  C CG  . LYS A 1 269 ? 139.412 -3.749  172.102 1.00 99.25  ? 269 LYS A CG  1 
ATOM   2085  C CD  . LYS A 1 269 ? 139.951 -2.697  173.053 1.00 106.22 ? 269 LYS A CD  1 
ATOM   2086  C CE  . LYS A 1 269 ? 141.313 -3.082  173.601 1.00 100.88 ? 269 LYS A CE  1 
ATOM   2087  N NZ  . LYS A 1 269 ? 141.267 -4.339  174.390 1.00 105.74 ? 269 LYS A NZ  1 
ATOM   2088  N N   . HIS A 1 270 ? 135.450 -4.597  172.251 1.00 84.32  ? 270 HIS A N   1 
ATOM   2089  C CA  . HIS A 1 270 ? 134.584 -5.268  173.219 1.00 83.00  ? 270 HIS A CA  1 
ATOM   2090  C C   . HIS A 1 270 ? 133.304 -5.790  172.586 1.00 70.40  ? 270 HIS A C   1 
ATOM   2091  O O   . HIS A 1 270 ? 132.509 -6.459  173.248 1.00 69.29  ? 270 HIS A O   1 
ATOM   2092  C CB  . HIS A 1 270 ? 134.246 -4.319  174.369 1.00 92.56  ? 270 HIS A CB  1 
ATOM   2093  C CG  . HIS A 1 270 ? 135.405 -3.478  174.807 1.00 96.88  ? 270 HIS A CG  1 
ATOM   2094  N ND1 . HIS A 1 270 ? 135.771 -2.322  174.162 1.00 90.55  ? 270 HIS A ND1 1 
ATOM   2095  C CD2 . HIS A 1 270 ? 136.287 -3.635  175.828 1.00 103.04 ? 270 HIS A CD2 1 
ATOM   2096  C CE1 . HIS A 1 270 ? 136.829 -1.793  174.758 1.00 100.69 ? 270 HIS A CE1 1 
ATOM   2097  N NE2 . HIS A 1 270 ? 137.155 -2.574  175.775 1.00 102.55 ? 270 HIS A NE2 1 
ATOM   2098  N N   . ASP A 1 271 ? 133.111 -5.464  171.311 1.00 70.55  ? 271 ASP A N   1 
ATOM   2099  C CA  . ASP A 1 271 ? 131.907 -5.852  170.569 1.00 73.44  ? 271 ASP A CA  1 
ATOM   2100  C C   . ASP A 1 271 ? 130.623 -5.332  171.191 1.00 72.28  ? 271 ASP A C   1 
ATOM   2101  O O   . ASP A 1 271 ? 129.704 -6.096  171.477 1.00 70.86  ? 271 ASP A O   1 
ATOM   2102  C CB  . ASP A 1 271 ? 131.824 -7.373  170.436 1.00 90.20  ? 271 ASP A CB  1 
ATOM   2103  C CG  . ASP A 1 271 ? 132.886 -7.922  169.526 1.00 110.56 ? 271 ASP A CG  1 
ATOM   2104  O OD1 . ASP A 1 271 ? 133.073 -7.345  168.435 1.00 129.38 ? 271 ASP A OD1 1 
ATOM   2105  O OD2 . ASP A 1 271 ? 133.542 -8.919  169.889 1.00 108.94 ? 271 ASP A OD2 1 
ATOM   2106  N N   . VAL A 1 272 ? 130.586 -4.024  171.418 1.00 63.52  ? 272 VAL A N   1 
ATOM   2107  C CA  . VAL A 1 272 ? 129.426 -3.346  171.985 1.00 56.82  ? 272 VAL A CA  1 
ATOM   2108  C C   . VAL A 1 272 ? 129.049 -2.098  171.200 1.00 58.09  ? 272 VAL A C   1 
ATOM   2109  O O   . VAL A 1 272 ? 129.896 -1.465  170.572 1.00 53.78  ? 272 VAL A O   1 
ATOM   2110  C CB  . VAL A 1 272 ? 129.645 -2.944  173.448 1.00 58.64  ? 272 VAL A CB  1 
ATOM   2111  C CG1 . VAL A 1 272 ? 129.883 -4.170  174.313 1.00 59.90  ? 272 VAL A CG1 1 
ATOM   2112  C CG2 . VAL A 1 272 ? 130.783 -1.943  173.561 1.00 58.44  ? 272 VAL A CG2 1 
ATOM   2113  N N   . VAL A 1 273 ? 127.766 -1.757  171.237 1.00 68.57  ? 273 VAL A N   1 
ATOM   2114  C CA  . VAL A 1 273 ? 127.251 -0.590  170.529 1.00 54.27  ? 273 VAL A CA  1 
ATOM   2115  C C   . VAL A 1 273 ? 126.968 0.589   171.454 1.00 54.59  ? 273 VAL A C   1 
ATOM   2116  O O   . VAL A 1 273 ? 126.234 0.461   172.429 1.00 80.51  ? 273 VAL A O   1 
ATOM   2117  C CB  . VAL A 1 273 ? 125.948 -0.913  169.774 1.00 52.98  ? 273 VAL A CB  1 
ATOM   2118  C CG1 . VAL A 1 273 ? 125.449 0.311   169.039 1.00 51.66  ? 273 VAL A CG1 1 
ATOM   2119  C CG2 . VAL A 1 273 ? 126.146 -2.089  168.831 1.00 55.16  ? 273 VAL A CG2 1 
ATOM   2120  N N   . PHE A 1 274 ? 127.539 1.744   171.128 1.00 49.71  ? 274 PHE A N   1 
ATOM   2121  C CA  . PHE A 1 274 ? 127.265 2.956   171.884 1.00 48.91  ? 274 PHE A CA  1 
ATOM   2122  C C   . PHE A 1 274 ? 126.151 3.714   171.182 1.00 61.64  ? 274 PHE A C   1 
ATOM   2123  O O   . PHE A 1 274 ? 126.201 3.914   169.971 1.00 67.12  ? 274 PHE A O   1 
ATOM   2124  C CB  . PHE A 1 274 ? 128.505 3.846   171.986 1.00 51.34  ? 274 PHE A CB  1 
ATOM   2125  C CG  . PHE A 1 274 ? 129.623 3.254   172.794 1.00 64.53  ? 274 PHE A CG  1 
ATOM   2126  C CD1 . PHE A 1 274 ? 129.585 3.273   174.176 1.00 64.61  ? 274 PHE A CD1 1 
ATOM   2127  C CD2 . PHE A 1 274 ? 130.724 2.698   172.166 1.00 57.77  ? 274 PHE A CD2 1 
ATOM   2128  C CE1 . PHE A 1 274 ? 130.618 2.734   174.918 1.00 74.41  ? 274 PHE A CE1 1 
ATOM   2129  C CE2 . PHE A 1 274 ? 131.760 2.160   172.900 1.00 79.64  ? 274 PHE A CE2 1 
ATOM   2130  C CZ  . PHE A 1 274 ? 131.707 2.177   174.279 1.00 78.34  ? 274 PHE A CZ  1 
ATOM   2131  N N   . LEU A 1 275 ? 125.147 4.137   171.941 1.00 62.91  ? 275 LEU A N   1 
ATOM   2132  C CA  . LEU A 1 275 ? 124.041 4.883   171.364 1.00 47.17  ? 275 LEU A CA  1 
ATOM   2133  C C   . LEU A 1 275 ? 123.766 6.138   172.174 1.00 52.29  ? 275 LEU A C   1 
ATOM   2134  O O   . LEU A 1 275 ? 123.543 6.076   173.383 1.00 75.75  ? 275 LEU A O   1 
ATOM   2135  C CB  . LEU A 1 275 ? 122.785 4.015   171.290 1.00 46.85  ? 275 LEU A CB  1 
ATOM   2136  C CG  . LEU A 1 275 ? 121.657 4.536   170.398 1.00 57.60  ? 275 LEU A CG  1 
ATOM   2137  C CD1 . LEU A 1 275 ? 122.118 4.611   168.949 1.00 66.76  ? 275 LEU A CD1 1 
ATOM   2138  C CD2 . LEU A 1 275 ? 120.421 3.663   170.525 1.00 48.32  ? 275 LEU A CD2 1 
ATOM   2139  N N   . ILE A 1 276 ? 123.785 7.280   171.499 1.00 54.29  ? 276 ILE A N   1 
ATOM   2140  C CA  . ILE A 1 276 ? 123.533 8.556   172.155 1.00 56.31  ? 276 ILE A CA  1 
ATOM   2141  C C   . ILE A 1 276 ? 122.276 9.190   171.577 1.00 62.77  ? 276 ILE A C   1 
ATOM   2142  O O   . ILE A 1 276 ? 122.141 9.327   170.360 1.00 76.36  ? 276 ILE A O   1 
ATOM   2143  C CB  . ILE A 1 276 ? 124.727 9.512   171.988 1.00 58.66  ? 276 ILE A CB  1 
ATOM   2144  C CG1 . ILE A 1 276 ? 125.895 9.072   172.872 1.00 60.27  ? 276 ILE A CG1 1 
ATOM   2145  C CG2 . ILE A 1 276 ? 124.322 10.951  172.271 1.00 66.04  ? 276 ILE A CG2 1 
ATOM   2146  C CD1 . ILE A 1 276 ? 127.157 9.869   172.647 1.00 61.56  ? 276 ILE A CD1 1 
ATOM   2147  N N   . THR A 1 277 ? 121.364 9.593   172.452 1.00 62.54  ? 277 THR A N   1 
ATOM   2148  C CA  . THR A 1 277 ? 120.109 10.195  172.017 1.00 71.94  ? 277 THR A CA  1 
ATOM   2149  C C   . THR A 1 277 ? 120.157 11.721  172.123 1.00 65.08  ? 277 THR A C   1 
ATOM   2150  O O   . THR A 1 277 ? 121.069 12.280  172.733 1.00 61.84  ? 277 THR A O   1 
ATOM   2151  C CB  . THR A 1 277 ? 118.926 9.643   172.824 1.00 66.72  ? 277 THR A CB  1 
ATOM   2152  O OG1 . THR A 1 277 ? 118.986 10.153  174.160 1.00 72.61  ? 277 THR A OG1 1 
ATOM   2153  C CG2 . THR A 1 277 ? 118.996 8.117   172.869 1.00 56.94  ? 277 THR A CG2 1 
ATOM   2154  N N   . LYS A 1 278 ? 119.153 12.376  171.545 1.00 56.86  ? 278 LYS A N   1 
ATOM   2155  C CA  . LYS A 1 278 ? 119.064 13.834  171.494 1.00 53.96  ? 278 LYS A CA  1 
ATOM   2156  C C   . LYS A 1 278 ? 119.088 14.487  172.872 1.00 55.72  ? 278 LYS A C   1 
ATOM   2157  O O   . LYS A 1 278 ? 119.682 15.547  173.055 1.00 64.17  ? 278 LYS A O   1 
ATOM   2158  C CB  . LYS A 1 278 ? 117.787 14.254  170.752 1.00 53.45  ? 278 LYS A CB  1 
ATOM   2159  C CG  . LYS A 1 278 ? 117.615 15.760  170.561 1.00 49.39  ? 278 LYS A CG  1 
ATOM   2160  C CD  . LYS A 1 278 ? 118.204 16.242  169.235 1.00 63.37  ? 278 LYS A CD  1 
ATOM   2161  C CE  . LYS A 1 278 ? 118.053 17.753  169.088 1.00 88.52  ? 278 LYS A CE  1 
ATOM   2162  N NZ  . LYS A 1 278 ? 117.897 18.177  167.667 1.00 113.08 ? 278 LYS A NZ  1 
ATOM   2163  N N   . TYR A 1 279 ? 118.430 13.859  173.839 1.00 56.60  ? 279 TYR A N   1 
ATOM   2164  C CA  . TYR A 1 279 ? 118.360 14.410  175.193 1.00 68.07  ? 279 TYR A CA  1 
ATOM   2165  C C   . TYR A 1 279 ? 119.678 14.287  175.954 1.00 66.44  ? 279 TYR A C   1 
ATOM   2166  O O   . TYR A 1 279 ? 119.889 14.972  176.954 1.00 84.43  ? 279 TYR A O   1 
ATOM   2167  C CB  . TYR A 1 279 ? 117.248 13.720  175.990 1.00 67.40  ? 279 TYR A CB  1 
ATOM   2168  C CG  . TYR A 1 279 ? 115.852 14.232  175.707 1.00 66.88  ? 279 TYR A CG  1 
ATOM   2169  C CD1 . TYR A 1 279 ? 115.484 14.669  174.439 1.00 65.67  ? 279 TYR A CD1 1 
ATOM   2170  C CD2 . TYR A 1 279 ? 114.898 14.270  176.714 1.00 89.29  ? 279 TYR A CD2 1 
ATOM   2171  C CE1 . TYR A 1 279 ? 114.207 15.130  174.189 1.00 77.53  ? 279 TYR A CE1 1 
ATOM   2172  C CE2 . TYR A 1 279 ? 113.620 14.733  176.473 1.00 103.58 ? 279 TYR A CE2 1 
ATOM   2173  C CZ  . TYR A 1 279 ? 113.277 15.158  175.212 1.00 96.41  ? 279 TYR A CZ  1 
ATOM   2174  O OH  . TYR A 1 279 ? 111.998 15.616  174.984 1.00 118.67 ? 279 TYR A OH  1 
ATOM   2175  N N   . GLY A 1 280 ? 120.566 13.421  175.479 1.00 53.72  ? 280 GLY A N   1 
ATOM   2176  C CA  . GLY A 1 280 ? 121.852 13.240  176.128 1.00 58.90  ? 280 GLY A CA  1 
ATOM   2177  C C   . GLY A 1 280 ? 121.998 11.923  176.868 1.00 65.77  ? 280 GLY A C   1 
ATOM   2178  O O   . GLY A 1 280 ? 122.912 11.754  177.674 1.00 58.65  ? 280 GLY A O   1 
ATOM   2179  N N   . TYR A 1 281 ? 121.091 10.991  176.596 1.00 66.98  ? 281 TYR A N   1 
ATOM   2180  C CA  . TYR A 1 281 ? 121.138 9.661   177.196 1.00 58.00  ? 281 TYR A CA  1 
ATOM   2181  C C   . TYR A 1 281 ? 122.098 8.758   176.438 1.00 64.86  ? 281 TYR A C   1 
ATOM   2182  O O   . TYR A 1 281 ? 122.114 8.767   175.209 1.00 56.60  ? 281 TYR A O   1 
ATOM   2183  C CB  . TYR A 1 281 ? 119.753 9.019   177.199 1.00 55.53  ? 281 TYR A CB  1 
ATOM   2184  C CG  . TYR A 1 281 ? 118.754 9.625   178.153 1.00 72.26  ? 281 TYR A CG  1 
ATOM   2185  C CD1 . TYR A 1 281 ? 118.637 9.159   179.457 1.00 64.96  ? 281 TYR A CD1 1 
ATOM   2186  C CD2 . TYR A 1 281 ? 117.910 10.648  177.745 1.00 94.51  ? 281 TYR A CD2 1 
ATOM   2187  C CE1 . TYR A 1 281 ? 117.718 9.705   180.332 1.00 66.91  ? 281 TYR A CE1 1 
ATOM   2188  C CE2 . TYR A 1 281 ? 116.986 11.200  178.615 1.00 93.86  ? 281 TYR A CE2 1 
ATOM   2189  C CZ  . TYR A 1 281 ? 116.896 10.724  179.907 1.00 77.17  ? 281 TYR A CZ  1 
ATOM   2190  O OH  . TYR A 1 281 ? 115.982 11.268  180.778 1.00 71.93  ? 281 TYR A OH  1 
ATOM   2191  N N   . ILE A 1 282 ? 122.918 7.997   177.156 1.00 54.53  ? 282 ILE A N   1 
ATOM   2192  C CA  . ILE A 1 282 ? 123.772 7.016   176.495 1.00 51.35  ? 282 ILE A CA  1 
ATOM   2193  C C   . ILE A 1 282 ? 123.191 5.608   176.654 1.00 53.99  ? 282 ILE A C   1 
ATOM   2194  O O   . ILE A 1 282 ? 122.567 5.295   177.664 1.00 57.59  ? 282 ILE A O   1 
ATOM   2195  C CB  . ILE A 1 282 ? 125.226 7.042   177.024 1.00 62.73  ? 282 ILE A CB  1 
ATOM   2196  C CG1 . ILE A 1 282 ? 126.130 6.217   176.102 1.00 54.98  ? 282 ILE A CG1 1 
ATOM   2197  C CG2 . ILE A 1 282 ? 125.304 6.539   178.457 1.00 62.39  ? 282 ILE A CG2 1 
ATOM   2198  C CD1 . ILE A 1 282 ? 127.468 6.844   175.818 1.00 66.91  ? 282 ILE A CD1 1 
ATOM   2199  N N   . HIS A 1 283 ? 123.405 4.766   175.650 1.00 51.53  ? 283 HIS A N   1 
ATOM   2200  C CA  . HIS A 1 283 ? 122.911 3.398   175.657 1.00 51.67  ? 283 HIS A CA  1 
ATOM   2201  C C   . HIS A 1 283 ? 124.047 2.443   175.318 1.00 58.46  ? 283 HIS A C   1 
ATOM   2202  O O   . HIS A 1 283 ? 124.926 2.775   174.533 1.00 64.62  ? 283 HIS A O   1 
ATOM   2203  C CB  . HIS A 1 283 ? 121.767 3.221   174.652 1.00 56.82  ? 283 HIS A CB  1 
ATOM   2204  C CG  . HIS A 1 283 ? 120.446 3.776   175.103 1.00 67.81  ? 283 HIS A CG  1 
ATOM   2205  N ND1 . HIS A 1 283 ? 119.284 3.046   175.055 1.00 77.10  ? 283 HIS A ND1 1 
ATOM   2206  C CD2 . HIS A 1 283 ? 120.104 4.997   175.588 1.00 61.77  ? 283 HIS A CD2 1 
ATOM   2207  C CE1 . HIS A 1 283 ? 118.276 3.780   175.498 1.00 81.67  ? 283 HIS A CE1 1 
ATOM   2208  N NE2 . HIS A 1 283 ? 118.751 4.969   175.830 1.00 71.35  ? 283 HIS A NE2 1 
ATOM   2209  N N   . LEU A 1 284 ? 124.043 1.265   175.932 1.00 63.45  ? 284 LEU A N   1 
ATOM   2210  C CA  . LEU A 1 284 ? 125.083 0.270   175.679 1.00 51.27  ? 284 LEU A CA  1 
ATOM   2211  C C   . LEU A 1 284 ? 124.436 -1.045  175.274 1.00 54.79  ? 284 LEU A C   1 
ATOM   2212  O O   . LEU A 1 284 ? 123.564 -1.554  175.976 1.00 74.58  ? 284 LEU A O   1 
ATOM   2213  C CB  . LEU A 1 284 ? 125.949 0.063   176.928 1.00 54.45  ? 284 LEU A CB  1 
ATOM   2214  C CG  . LEU A 1 284 ? 127.426 0.478   177.020 1.00 57.65  ? 284 LEU A CG  1 
ATOM   2215  C CD1 . LEU A 1 284 ? 128.318 -0.374  176.117 1.00 67.69  ? 284 LEU A CD1 1 
ATOM   2216  C CD2 . LEU A 1 284 ? 127.636 1.970   176.757 1.00 67.84  ? 284 LEU A CD2 1 
ATOM   2217  N N   . TYR A 1 285 ? 124.854 -1.600  174.143 1.00 57.88  ? 285 TYR A N   1 
ATOM   2218  C CA  . TYR A 1 285 ? 124.257 -2.843  173.673 1.00 63.53  ? 285 TYR A CA  1 
ATOM   2219  C C   . TYR A 1 285 ? 125.312 -3.866  173.291 1.00 53.74  ? 285 TYR A C   1 
ATOM   2220  O O   . TYR A 1 285 ? 126.413 -3.516  172.876 1.00 54.46  ? 285 TYR A O   1 
ATOM   2221  C CB  . TYR A 1 285 ? 123.342 -2.590  172.470 1.00 71.38  ? 285 TYR A CB  1 
ATOM   2222  C CG  . TYR A 1 285 ? 122.148 -1.703  172.760 1.00 70.48  ? 285 TYR A CG  1 
ATOM   2223  C CD1 . TYR A 1 285 ? 120.963 -2.237  173.257 1.00 75.59  ? 285 TYR A CD1 1 
ATOM   2224  C CD2 . TYR A 1 285 ? 122.190 -0.338  172.501 1.00 52.12  ? 285 TYR A CD2 1 
ATOM   2225  C CE1 . TYR A 1 285 ? 119.864 -1.427  173.515 1.00 64.48  ? 285 TYR A CE1 1 
ATOM   2226  C CE2 . TYR A 1 285 ? 121.094 0.474   172.750 1.00 51.80  ? 285 TYR A CE2 1 
ATOM   2227  C CZ  . TYR A 1 285 ? 119.937 -0.073  173.259 1.00 67.44  ? 285 TYR A CZ  1 
ATOM   2228  O OH  . TYR A 1 285 ? 118.853 0.742   173.508 1.00 94.58  ? 285 TYR A OH  1 
ATOM   2229  N N   . ASP A 1 286 ? 124.961 -5.138  173.430 1.00 54.14  ? 286 ASP A N   1 
ATOM   2230  C CA  . ASP A 1 286 ? 125.808 -6.207  172.941 1.00 55.93  ? 286 ASP A CA  1 
ATOM   2231  C C   . ASP A 1 286 ? 125.637 -6.272  171.429 1.00 59.41  ? 286 ASP A C   1 
ATOM   2232  O O   . ASP A 1 286 ? 124.518 -6.376  170.934 1.00 64.24  ? 286 ASP A O   1 
ATOM   2233  C CB  . ASP A 1 286 ? 125.442 -7.535  173.601 1.00 58.62  ? 286 ASP A CB  1 
ATOM   2234  C CG  . ASP A 1 286 ? 126.162 -8.711  172.980 1.00 84.52  ? 286 ASP A CG  1 
ATOM   2235  O OD1 . ASP A 1 286 ? 127.304 -8.527  172.504 1.00 93.44  ? 286 ASP A OD1 1 
ATOM   2236  O OD2 . ASP A 1 286 ? 125.590 -9.819  172.963 1.00 102.80 ? 286 ASP A OD2 1 
ATOM   2237  N N   . LEU A 1 287 ? 126.740 -6.216  170.695 1.00 67.58  ? 287 LEU A N   1 
ATOM   2238  C CA  . LEU A 1 287 ? 126.674 -6.255  169.238 1.00 69.87  ? 287 LEU A CA  1 
ATOM   2239  C C   . LEU A 1 287 ? 126.129 -7.594  168.741 1.00 74.29  ? 287 LEU A C   1 
ATOM   2240  O O   . LEU A 1 287 ? 125.424 -7.653  167.734 1.00 82.71  ? 287 LEU A O   1 
ATOM   2241  C CB  . LEU A 1 287 ? 128.051 -5.976  168.635 1.00 67.66  ? 287 LEU A CB  1 
ATOM   2242  C CG  . LEU A 1 287 ? 128.158 -5.989  167.111 1.00 63.70  ? 287 LEU A CG  1 
ATOM   2243  C CD1 . LEU A 1 287 ? 127.362 -4.837  166.520 1.00 62.23  ? 287 LEU A CD1 1 
ATOM   2244  C CD2 . LEU A 1 287 ? 129.611 -5.898  166.687 1.00 78.17  ? 287 LEU A CD2 1 
ATOM   2245  N N   . GLU A 1 288 ? 126.457 -8.665  169.454 1.00 70.54  ? 288 GLU A N   1 
ATOM   2246  C CA  . GLU A 1 288 ? 126.025 -10.007 169.071 1.00 70.04  ? 288 GLU A CA  1 
ATOM   2247  C C   . GLU A 1 288 ? 124.516 -10.247 169.219 1.00 81.01  ? 288 GLU A C   1 
ATOM   2248  O O   . GLU A 1 288 ? 123.875 -10.744 168.294 1.00 92.87  ? 288 GLU A O   1 
ATOM   2249  C CB  . GLU A 1 288 ? 126.800 -11.053 169.873 1.00 69.66  ? 288 GLU A CB  1 
ATOM   2250  C CG  . GLU A 1 288 ? 126.572 -12.479 169.401 1.00 76.79  ? 288 GLU A CG  1 
ATOM   2251  C CD  . GLU A 1 288 ? 127.662 -13.419 169.868 1.00 94.36  ? 288 GLU A CD  1 
ATOM   2252  O OE1 . GLU A 1 288 ? 128.250 -13.159 170.938 1.00 94.02  ? 288 GLU A OE1 1 
ATOM   2253  O OE2 . GLU A 1 288 ? 127.928 -14.419 169.167 1.00 106.38 ? 288 GLU A OE2 1 
ATOM   2254  N N   . THR A 1 289 ? 123.945 -9.899  170.369 1.00 67.64  ? 289 THR A N   1 
ATOM   2255  C CA  . THR A 1 289 ? 122.531 -10.198 170.617 1.00 63.17  ? 289 THR A CA  1 
ATOM   2256  C C   . THR A 1 289 ? 121.619 -8.972  170.686 1.00 64.54  ? 289 THR A C   1 
ATOM   2257  O O   . THR A 1 289 ? 120.396 -9.097  170.600 1.00 64.33  ? 289 THR A O   1 
ATOM   2258  C CB  . THR A 1 289 ? 122.356 -11.001 171.925 1.00 64.66  ? 289 THR A CB  1 
ATOM   2259  O OG1 . THR A 1 289 ? 122.950 -10.287 173.016 1.00 54.62  ? 289 THR A OG1 1 
ATOM   2260  C CG2 . THR A 1 289 ? 123.013 -12.366 171.799 1.00 81.98  ? 289 THR A CG2 1 
ATOM   2261  N N   . GLY A 1 290 ? 122.209 -7.793  170.837 1.00 67.53  ? 290 GLY A N   1 
ATOM   2262  C CA  . GLY A 1 290 ? 121.436 -6.573  170.985 1.00 60.82  ? 290 GLY A CA  1 
ATOM   2263  C C   . GLY A 1 290 ? 120.900 -6.405  172.392 1.00 64.14  ? 290 GLY A C   1 
ATOM   2264  O O   . GLY A 1 290 ? 120.014 -5.589  172.639 1.00 88.80  ? 290 GLY A O   1 
ATOM   2265  N N   . THR A 1 291 ? 121.443 -7.188  173.318 1.00 60.25  ? 291 THR A N   1 
ATOM   2266  C CA  . THR A 1 291 ? 121.054 -7.093  174.717 1.00 59.79  ? 291 THR A CA  1 
ATOM   2267  C C   . THR A 1 291 ? 121.509 -5.757  175.275 1.00 59.98  ? 291 THR A C   1 
ATOM   2268  O O   . THR A 1 291 ? 122.652 -5.352  175.072 1.00 72.63  ? 291 THR A O   1 
ATOM   2269  C CB  . THR A 1 291 ? 121.654 -8.232  175.561 1.00 65.19  ? 291 THR A CB  1 
ATOM   2270  O OG1 . THR A 1 291 ? 121.161 -9.492  175.090 1.00 88.84  ? 291 THR A OG1 1 
ATOM   2271  C CG2 . THR A 1 291 ? 121.286 -8.065  177.030 1.00 62.48  ? 291 THR A CG2 1 
ATOM   2272  N N   . CYS A 1 292 ? 120.617 -5.080  175.989 1.00 64.99  ? 292 CYS A N   1 
ATOM   2273  C CA  . CYS A 1 292 ? 120.951 -3.803  176.598 1.00 64.51  ? 292 CYS A CA  1 
ATOM   2274  C C   . CYS A 1 292 ? 121.765 -4.052  177.854 1.00 74.25  ? 292 CYS A C   1 
ATOM   2275  O O   . CYS A 1 292 ? 121.474 -4.954  178.641 1.00 77.49  ? 292 CYS A O   1 
ATOM   2276  C CB  . CYS A 1 292 ? 119.707 -2.978  176.921 1.00 54.59  ? 292 CYS A CB  1 
ATOM   2277  S SG  . CYS A 1 292 ? 120.090 -1.248  177.301 1.00 63.57  ? 292 CYS A SG  1 
ATOM   2278  N N   . ILE A 1 293 ? 122.810 -3.255  178.019 1.00 68.87  ? 293 ILE A N   1 
ATOM   2279  C CA  . ILE A 1 293 ? 123.706 -3.406  179.154 1.00 57.82  ? 293 ILE A CA  1 
ATOM   2280  C C   . ILE A 1 293 ? 123.609 -2.227  180.121 1.00 69.09  ? 293 ILE A C   1 
ATOM   2281  O O   . ILE A 1 293 ? 123.364 -2.402  181.307 1.00 86.10  ? 293 ILE A O   1 
ATOM   2282  C CB  . ILE A 1 293 ? 125.181 -3.563  178.685 1.00 71.45  ? 293 ILE A CB  1 
ATOM   2283  C CG1 . ILE A 1 293 ? 125.340 -4.755  177.738 1.00 80.98  ? 293 ILE A CG1 1 
ATOM   2284  C CG2 . ILE A 1 293 ? 126.111 -3.736  179.861 1.00 62.71  ? 293 ILE A CG2 1 
ATOM   2285  C CD1 . ILE A 1 293 ? 126.439 -4.548  176.699 1.00 91.40  ? 293 ILE A CD1 1 
ATOM   2286  N N   . TYR A 1 294 ? 123.793 -1.022  179.605 1.00 56.15  ? 294 TYR A N   1 
ATOM   2287  C CA  . TYR A 1 294 ? 123.729 0.175   180.426 1.00 56.03  ? 294 TYR A CA  1 
ATOM   2288  C C   . TYR A 1 294 ? 122.949 1.271   179.729 1.00 59.14  ? 294 TYR A C   1 
ATOM   2289  O O   . TYR A 1 294 ? 123.001 1.411   178.517 1.00 53.78  ? 294 TYR A O   1 
ATOM   2290  C CB  . TYR A 1 294 ? 125.156 0.630   180.771 1.00 57.47  ? 294 TYR A CB  1 
ATOM   2291  C CG  . TYR A 1 294 ? 125.277 1.791   181.733 1.00 59.58  ? 294 TYR A CG  1 
ATOM   2292  C CD1 . TYR A 1 294 ? 125.086 1.627   183.101 1.00 61.54  ? 294 TYR A CD1 1 
ATOM   2293  C CD2 . TYR A 1 294 ? 125.654 3.042   181.273 1.00 64.57  ? 294 TYR A CD2 1 
ATOM   2294  C CE1 . TYR A 1 294 ? 125.216 2.698   183.974 1.00 64.31  ? 294 TYR A CE1 1 
ATOM   2295  C CE2 . TYR A 1 294 ? 125.795 4.108   182.134 1.00 66.47  ? 294 TYR A CE2 1 
ATOM   2296  C CZ  . TYR A 1 294 ? 125.572 3.936   183.480 1.00 66.79  ? 294 TYR A CZ  1 
ATOM   2297  O OH  . TYR A 1 294 ? 125.712 5.007   184.334 1.00 78.61  ? 294 TYR A OH  1 
ATOM   2298  N N   . MET A 1 295 ? 122.220 2.041   180.522 1.00 66.97  ? 295 MET A N   1 
ATOM   2299  C CA  . MET A 1 295 ? 121.500 3.205   180.039 1.00 58.91  ? 295 MET A CA  1 
ATOM   2300  C C   . MET A 1 295 ? 121.701 4.293   181.050 1.00 58.72  ? 295 MET A C   1 
ATOM   2301  O O   . MET A 1 295 ? 121.692 4.020   182.249 1.00 80.28  ? 295 MET A O   1 
ATOM   2302  C CB  . MET A 1 295 ? 120.008 2.948   179.858 1.00 69.53  ? 295 MET A CB  1 
ATOM   2303  C CG  . MET A 1 295 ? 119.635 2.119   178.664 1.00 76.48  ? 295 MET A CG  1 
ATOM   2304  S SD  . MET A 1 295 ? 117.830 2.077   178.564 1.00 83.00  ? 295 MET A SD  1 
ATOM   2305  C CE  . MET A 1 295 ? 117.442 3.798   178.839 1.00 98.86  ? 295 MET A CE  1 
ATOM   2306  N N   . ASN A 1 296 ? 121.845 5.525   180.572 1.00 56.23  ? 296 ASN A N   1 
ATOM   2307  C CA  . ASN A 1 296 ? 122.067 6.636   181.472 1.00 57.05  ? 296 ASN A CA  1 
ATOM   2308  C C   . ASN A 1 296 ? 122.079 7.985   180.783 1.00 63.87  ? 296 ASN A C   1 
ATOM   2309  O O   . ASN A 1 296 ? 122.486 8.082   179.625 1.00 88.69  ? 296 ASN A O   1 
ATOM   2310  C CB  . ASN A 1 296 ? 123.413 6.421   182.150 1.00 60.18  ? 296 ASN A CB  1 
ATOM   2311  C CG  . ASN A 1 296 ? 123.563 7.203   183.416 1.00 75.40  ? 296 ASN A CG  1 
ATOM   2312  O OD1 . ASN A 1 296 ? 122.861 6.958   184.396 1.00 88.28  ? 296 ASN A OD1 1 
ATOM   2313  N ND2 . ASN A 1 296 ? 124.503 8.133   183.424 1.00 68.73  ? 296 ASN A ND2 1 
ATOM   2314  N N   . ARG A 1 297 ? 121.680 9.033   181.499 1.00 62.39  ? 297 ARG A N   1 
ATOM   2315  C CA  . ARG A 1 297 ? 121.808 10.376  180.957 1.00 60.24  ? 297 ARG A CA  1 
ATOM   2316  C C   . ARG A 1 297 ? 123.173 10.877  181.379 1.00 66.91  ? 297 ARG A C   1 
ATOM   2317  O O   . ARG A 1 297 ? 123.483 10.938  182.570 1.00 82.66  ? 297 ARG A O   1 
ATOM   2318  C CB  . ARG A 1 297 ? 120.691 11.309  181.450 1.00 69.54  ? 297 ARG A CB  1 
ATOM   2319  C CG  . ARG A 1 297 ? 120.627 12.633  180.684 1.00 69.37  ? 297 ARG A CG  1 
ATOM   2320  C CD  . ARG A 1 297 ? 119.276 13.342  180.798 1.00 53.46  ? 297 ARG A CD  1 
ATOM   2321  N NE  . ARG A 1 297 ? 119.214 14.509  179.916 1.00 60.62  ? 297 ARG A NE  1 
ATOM   2322  C CZ  . ARG A 1 297 ? 118.222 15.395  179.895 1.00 80.86  ? 297 ARG A CZ  1 
ATOM   2323  N NH1 . ARG A 1 297 ? 118.266 16.417  179.051 1.00 80.13  ? 297 ARG A NH1 1 
ATOM   2324  N NH2 . ARG A 1 297 ? 117.164 15.234  180.678 1.00 106.35 ? 297 ARG A NH2 1 
ATOM   2325  N N   . ILE A 1 298 ? 123.978 11.264  180.401 1.00 77.37  ? 298 ILE A N   1 
ATOM   2326  C CA  . ILE A 1 298 ? 125.328 11.722  180.677 1.00 77.12  ? 298 ILE A CA  1 
ATOM   2327  C C   . ILE A 1 298 ? 125.411 13.227  180.458 1.00 79.70  ? 298 ILE A C   1 
ATOM   2328  O O   . ILE A 1 298 ? 126.323 13.890  180.952 1.00 91.95  ? 298 ILE A O   1 
ATOM   2329  C CB  . ILE A 1 298 ? 126.364 10.977  179.816 1.00 66.77  ? 298 ILE A CB  1 
ATOM   2330  C CG1 . ILE A 1 298 ? 125.909 10.896  178.358 1.00 66.39  ? 298 ILE A CG1 1 
ATOM   2331  C CG2 . ILE A 1 298 ? 126.615 9.585   180.384 1.00 75.35  ? 298 ILE A CG2 1 
ATOM   2332  C CD1 . ILE A 1 298 ? 127.071 10.813  177.385 1.00 57.32  ? 298 ILE A CD1 1 
ATOM   2333  N N   . SER A 1 299 ? 124.458 13.756  179.694 1.00 72.83  ? 299 SER A N   1 
ATOM   2334  C CA  . SER A 1 299 ? 124.448 15.179  179.380 1.00 64.69  ? 299 SER A CA  1 
ATOM   2335  C C   . SER A 1 299 ? 123.051 15.788  179.459 1.00 63.87  ? 299 SER A C   1 
ATOM   2336  O O   . SER A 1 299 ? 122.054 15.137  179.142 1.00 62.68  ? 299 SER A O   1 
ATOM   2337  C CB  . SER A 1 299 ? 125.029 15.419  177.985 1.00 61.83  ? 299 SER A CB  1 
ATOM   2338  O OG  . SER A 1 299 ? 125.116 16.805  177.708 1.00 65.23  ? 299 SER A OG  1 
ATOM   2339  N N   . GLY A 1 300 ? 122.994 17.038  179.910 1.00 64.19  ? 300 GLY A N   1 
ATOM   2340  C CA  . GLY A 1 300 ? 121.752 17.788  179.957 1.00 67.45  ? 300 GLY A CA  1 
ATOM   2341  C C   . GLY A 1 300 ? 121.481 18.493  178.643 1.00 84.41  ? 300 GLY A C   1 
ATOM   2342  O O   . GLY A 1 300 ? 120.348 18.871  178.342 1.00 98.30  ? 300 GLY A O   1 
ATOM   2343  N N   . GLU A 1 301 ? 122.537 18.656  177.853 1.00 81.63  ? 301 GLU A N   1 
ATOM   2344  C CA  . GLU A 1 301 ? 122.458 19.315  176.555 1.00 73.84  ? 301 GLU A CA  1 
ATOM   2345  C C   . GLU A 1 301 ? 122.731 18.308  175.444 1.00 85.12  ? 301 GLU A C   1 
ATOM   2346  O O   . GLU A 1 301 ? 123.391 17.297  175.669 1.00 100.98 ? 301 GLU A O   1 
ATOM   2347  C CB  . GLU A 1 301 ? 123.461 20.470  176.471 1.00 78.46  ? 301 GLU A CB  1 
ATOM   2348  C CG  . GLU A 1 301 ? 123.209 21.617  177.444 1.00 103.19 ? 301 GLU A CG  1 
ATOM   2349  C CD  . GLU A 1 301 ? 121.902 22.340  177.176 1.00 120.43 ? 301 GLU A CD  1 
ATOM   2350  O OE1 . GLU A 1 301 ? 121.496 22.434  175.997 1.00 137.41 ? 301 GLU A OE1 1 
ATOM   2351  O OE2 . GLU A 1 301 ? 121.291 22.839  178.144 1.00 110.98 ? 301 GLU A OE2 1 
ATOM   2352  N N   . THR A 1 302 ? 122.192 18.571  174.258 1.00 80.63  ? 302 THR A N   1 
ATOM   2353  C CA  . THR A 1 302 ? 122.415 17.704  173.105 1.00 71.00  ? 302 THR A CA  1 
ATOM   2354  C C   . THR A 1 302 ? 123.893 17.593  172.755 1.00 82.98  ? 302 THR A C   1 
ATOM   2355  O O   . THR A 1 302 ? 124.603 18.592  172.719 1.00 82.10  ? 302 THR A O   1 
ATOM   2356  C CB  . THR A 1 302 ? 121.670 18.211  171.856 1.00 65.84  ? 302 THR A CB  1 
ATOM   2357  O OG1 . THR A 1 302 ? 120.287 18.410  172.164 1.00 84.06  ? 302 THR A OG1 1 
ATOM   2358  C CG2 . THR A 1 302 ? 121.792 17.207  170.725 1.00 61.66  ? 302 THR A CG2 1 
ATOM   2359  N N   . ILE A 1 303 ? 124.348 16.372  172.488 1.00 82.24  ? 303 ILE A N   1 
ATOM   2360  C CA  . ILE A 1 303 ? 125.722 16.145  172.042 1.00 73.29  ? 303 ILE A CA  1 
ATOM   2361  C C   . ILE A 1 303 ? 125.738 16.084  170.516 1.00 86.55  ? 303 ILE A C   1 
ATOM   2362  O O   . ILE A 1 303 ? 125.617 15.015  169.920 1.00 100.89 ? 303 ILE A O   1 
ATOM   2363  C CB  . ILE A 1 303 ? 126.305 14.856  172.636 1.00 59.40  ? 303 ILE A CB  1 
ATOM   2364  C CG1 . ILE A 1 303 ? 126.322 14.950  174.161 1.00 65.00  ? 303 ILE A CG1 1 
ATOM   2365  C CG2 . ILE A 1 303 ? 127.708 14.605  172.115 1.00 60.36  ? 303 ILE A CG2 1 
ATOM   2366  C CD1 . ILE A 1 303 ? 126.542 13.621  174.848 1.00 56.09  ? 303 ILE A CD1 1 
ATOM   2367  N N   . PHE A 1 304 ? 125.895 17.247  169.889 1.00 76.71  ? 304 PHE A N   1 
ATOM   2368  C CA  . PHE A 1 304 ? 125.755 17.362  168.436 1.00 64.86  ? 304 PHE A CA  1 
ATOM   2369  C C   . PHE A 1 304 ? 126.847 16.700  167.583 1.00 66.18  ? 304 PHE A C   1 
ATOM   2370  O O   . PHE A 1 304 ? 126.553 16.204  166.498 1.00 96.42  ? 304 PHE A O   1 
ATOM   2371  C CB  . PHE A 1 304 ? 125.616 18.842  168.041 1.00 61.81  ? 304 PHE A CB  1 
ATOM   2372  C CG  . PHE A 1 304 ? 126.708 19.733  168.564 1.00 70.18  ? 304 PHE A CG  1 
ATOM   2373  C CD1 . PHE A 1 304 ? 127.859 19.950  167.828 1.00 62.77  ? 304 PHE A CD1 1 
ATOM   2374  C CD2 . PHE A 1 304 ? 126.563 20.386  169.776 1.00 87.60  ? 304 PHE A CD2 1 
ATOM   2375  C CE1 . PHE A 1 304 ? 128.858 20.782  168.304 1.00 63.91  ? 304 PHE A CE1 1 
ATOM   2376  C CE2 . PHE A 1 304 ? 127.554 21.219  170.257 1.00 82.17  ? 304 PHE A CE2 1 
ATOM   2377  C CZ  . PHE A 1 304 ? 128.705 21.417  169.520 1.00 64.50  ? 304 PHE A CZ  1 
ATOM   2378  N N   . VAL A 1 305 ? 128.092 16.688  168.045 1.00 56.58  ? 305 VAL A N   1 
ATOM   2379  C CA  . VAL A 1 305 ? 129.153 16.024  167.282 1.00 56.15  ? 305 VAL A CA  1 
ATOM   2380  C C   . VAL A 1 305 ? 129.775 14.875  168.064 1.00 59.24  ? 305 VAL A C   1 
ATOM   2381  O O   . VAL A 1 305 ? 130.008 14.982  169.263 1.00 71.47  ? 305 VAL A O   1 
ATOM   2382  C CB  . VAL A 1 305 ? 130.267 16.999  166.858 1.00 68.37  ? 305 VAL A CB  1 
ATOM   2383  C CG1 . VAL A 1 305 ? 129.781 17.923  165.751 1.00 92.80  ? 305 VAL A CG1 1 
ATOM   2384  C CG2 . VAL A 1 305 ? 130.784 17.781  168.049 1.00 96.36  ? 305 VAL A CG2 1 
ATOM   2385  N N   . THR A 1 306 ? 130.022 13.767  167.374 1.00 65.75  ? 306 THR A N   1 
ATOM   2386  C CA  . THR A 1 306 ? 130.637 12.597  167.986 1.00 55.59  ? 306 THR A CA  1 
ATOM   2387  C C   . THR A 1 306 ? 131.737 12.024  167.101 1.00 68.84  ? 306 THR A C   1 
ATOM   2388  O O   . THR A 1 306 ? 131.804 12.304  165.906 1.00 100.73 ? 306 THR A O   1 
ATOM   2389  C CB  . THR A 1 306 ? 129.609 11.493  168.268 1.00 62.13  ? 306 THR A CB  1 
ATOM   2390  O OG1 . THR A 1 306 ? 128.761 11.333  167.126 1.00 84.04  ? 306 THR A OG1 1 
ATOM   2391  C CG2 . THR A 1 306 ? 128.760 11.847  169.480 1.00 79.69  ? 306 THR A CG2 1 
ATOM   2392  N N   . ALA A 1 307 ? 132.596 11.216  167.706 1.00 62.22  ? 307 ALA A N   1 
ATOM   2393  C CA  . ALA A 1 307 ? 133.706 10.601  166.998 1.00 58.68  ? 307 ALA A CA  1 
ATOM   2394  C C   . ALA A 1 307 ? 134.180 9.393   167.794 1.00 65.28  ? 307 ALA A C   1 
ATOM   2395  O O   . ALA A 1 307 ? 133.911 9.303   168.992 1.00 87.73  ? 307 ALA A O   1 
ATOM   2396  C CB  . ALA A 1 307 ? 134.832 11.605  166.796 1.00 76.30  ? 307 ALA A CB  1 
ATOM   2397  N N   . PRO A 1 308 ? 134.878 8.451   167.139 1.00 68.57  ? 308 PRO A N   1 
ATOM   2398  C CA  . PRO A 1 308 ? 135.360 7.321   167.938 1.00 64.29  ? 308 PRO A CA  1 
ATOM   2399  C C   . PRO A 1 308 ? 136.539 7.722   168.815 1.00 64.61  ? 308 PRO A C   1 
ATOM   2400  O O   . PRO A 1 308 ? 137.435 8.437   168.363 1.00 67.46  ? 308 PRO A O   1 
ATOM   2401  C CB  . PRO A 1 308 ? 135.775 6.282   166.884 1.00 61.06  ? 308 PRO A CB  1 
ATOM   2402  C CG  . PRO A 1 308 ? 135.405 6.875   165.536 1.00 62.79  ? 308 PRO A CG  1 
ATOM   2403  C CD  . PRO A 1 308 ? 135.278 8.344   165.727 1.00 75.99  ? 308 PRO A CD  1 
ATOM   2404  N N   . HIS A 1 309 ? 136.533 7.257   170.059 1.00 70.08  ? 309 HIS A N   1 
ATOM   2405  C CA  . HIS A 1 309 ? 137.622 7.550   170.968 1.00 69.41  ? 309 HIS A CA  1 
ATOM   2406  C C   . HIS A 1 309 ? 138.618 6.407   170.805 1.00 72.72  ? 309 HIS A C   1 
ATOM   2407  O O   . HIS A 1 309 ? 138.649 5.470   171.602 1.00 83.87  ? 309 HIS A O   1 
ATOM   2408  C CB  . HIS A 1 309 ? 137.092 7.672   172.400 1.00 82.14  ? 309 HIS A CB  1 
ATOM   2409  C CG  . HIS A 1 309 ? 137.992 8.433   173.325 1.00 89.43  ? 309 HIS A CG  1 
ATOM   2410  N ND1 . HIS A 1 309 ? 139.258 8.839   172.977 1.00 102.74 ? 309 HIS A ND1 1 
ATOM   2411  C CD2 . HIS A 1 309 ? 137.782 8.902   174.582 1.00 86.52  ? 309 HIS A CD2 1 
ATOM   2412  C CE1 . HIS A 1 309 ? 139.803 9.507   173.977 1.00 105.23 ? 309 HIS A CE1 1 
ATOM   2413  N NE2 . HIS A 1 309 ? 138.923 9.558   174.966 1.00 93.88  ? 309 HIS A NE2 1 
ATOM   2414  N N   . GLU A 1 310 ? 139.417 6.510   169.745 1.00 75.10  ? 310 GLU A N   1 
ATOM   2415  C CA  . GLU A 1 310 ? 140.347 5.467   169.293 1.00 82.43  ? 310 GLU A CA  1 
ATOM   2416  C C   . GLU A 1 310 ? 141.173 4.746   170.361 1.00 78.66  ? 310 GLU A C   1 
ATOM   2417  O O   . GLU A 1 310 ? 141.234 3.517   170.363 1.00 86.14  ? 310 GLU A O   1 
ATOM   2418  C CB  . GLU A 1 310 ? 141.292 6.058   168.245 1.00 103.92 ? 310 GLU A CB  1 
ATOM   2419  C CG  . GLU A 1 310 ? 140.600 6.413   166.930 1.00 132.93 ? 310 GLU A CG  1 
ATOM   2420  C CD  . GLU A 1 310 ? 141.036 7.757   166.385 1.00 152.09 ? 310 GLU A CD  1 
ATOM   2421  O OE1 . GLU A 1 310 ? 140.167 8.498   165.877 1.00 162.57 ? 310 GLU A OE1 1 
ATOM   2422  O OE2 . GLU A 1 310 ? 142.242 8.071   166.458 1.00 143.81 ? 310 GLU A OE2 1 
ATOM   2423  N N   . ALA A 1 311 ? 141.814 5.498   171.251 1.00 73.56  ? 311 ALA A N   1 
ATOM   2424  C CA  . ALA A 1 311 ? 142.662 4.912   172.294 1.00 76.53  ? 311 ALA A CA  1 
ATOM   2425  C C   . ALA A 1 311 ? 141.918 3.919   173.183 1.00 78.01  ? 311 ALA A C   1 
ATOM   2426  O O   . ALA A 1 311 ? 142.314 2.760   173.317 1.00 77.09  ? 311 ALA A O   1 
ATOM   2427  C CB  . ALA A 1 311 ? 143.277 6.012   173.151 1.00 91.64  ? 311 ALA A CB  1 
ATOM   2428  N N   . THR A 1 312 ? 140.835 4.388   173.788 1.00 94.67  ? 312 THR A N   1 
ATOM   2429  C CA  . THR A 1 312 ? 140.051 3.585   174.723 1.00 80.74  ? 312 THR A CA  1 
ATOM   2430  C C   . THR A 1 312 ? 138.992 2.718   174.054 1.00 72.05  ? 312 THR A C   1 
ATOM   2431  O O   . THR A 1 312 ? 138.315 1.945   174.729 1.00 94.13  ? 312 THR A O   1 
ATOM   2432  C CB  . THR A 1 312 ? 139.358 4.471   175.750 1.00 77.82  ? 312 THR A CB  1 
ATOM   2433  O OG1 . THR A 1 312 ? 138.459 5.353   175.070 1.00 78.02  ? 312 THR A OG1 1 
ATOM   2434  C CG2 . THR A 1 312 ? 140.389 5.293   176.496 1.00 85.63  ? 312 THR A CG2 1 
ATOM   2435  N N   . ALA A 1 313 ? 138.850 2.862   172.739 1.00 67.84  ? 313 ALA A N   1 
ATOM   2436  C CA  . ALA A 1 313 ? 137.821 2.165   171.974 1.00 66.54  ? 313 ALA A CA  1 
ATOM   2437  C C   . ALA A 1 313 ? 136.429 2.512   172.490 1.00 87.77  ? 313 ALA A C   1 
ATOM   2438  O O   . ALA A 1 313 ? 135.637 1.631   172.842 1.00 100.23 ? 313 ALA A O   1 
ATOM   2439  C CB  . ALA A 1 313 ? 138.046 0.652   172.023 1.00 67.91  ? 313 ALA A CB  1 
ATOM   2440  N N   . GLY A 1 314 ? 136.132 3.806   172.505 1.00 91.76  ? 314 GLY A N   1 
ATOM   2441  C CA  . GLY A 1 314 ? 134.854 4.291   172.985 1.00 90.45  ? 314 GLY A CA  1 
ATOM   2442  C C   . GLY A 1 314 ? 134.324 5.402   172.103 1.00 82.36  ? 314 GLY A C   1 
ATOM   2443  O O   . GLY A 1 314 ? 134.617 5.457   170.912 1.00 93.21  ? 314 GLY A O   1 
ATOM   2444  N N   . ILE A 1 315 ? 133.544 6.298   172.699 1.00 73.28  ? 315 ILE A N   1 
ATOM   2445  C CA  . ILE A 1 315 ? 132.941 7.404   171.965 1.00 59.31  ? 315 ILE A CA  1 
ATOM   2446  C C   . ILE A 1 315 ? 133.242 8.749   172.631 1.00 71.64  ? 315 ILE A C   1 
ATOM   2447  O O   . ILE A 1 315 ? 133.146 8.891   173.847 1.00 84.82  ? 315 ILE A O   1 
ATOM   2448  C CB  . ILE A 1 315 ? 131.420 7.219   171.842 1.00 65.01  ? 315 ILE A CB  1 
ATOM   2449  C CG1 . ILE A 1 315 ? 130.812 8.326   170.984 1.00 74.06  ? 315 ILE A CG1 1 
ATOM   2450  C CG2 . ILE A 1 315 ? 130.762 7.172   173.217 1.00 59.63  ? 315 ILE A CG2 1 
ATOM   2451  C CD1 . ILE A 1 315 ? 129.436 7.998   170.496 1.00 57.74  ? 315 ILE A CD1 1 
ATOM   2452  N N   . ILE A 1 316 ? 133.619 9.734   171.823 1.00 69.18  ? 316 ILE A N   1 
ATOM   2453  C CA  . ILE A 1 316 ? 133.912 11.071  172.333 1.00 62.78  ? 316 ILE A CA  1 
ATOM   2454  C C   . ILE A 1 316 ? 133.094 12.137  171.611 1.00 68.02  ? 316 ILE A C   1 
ATOM   2455  O O   . ILE A 1 316 ? 133.150 12.256  170.388 1.00 81.69  ? 316 ILE A O   1 
ATOM   2456  C CB  . ILE A 1 316 ? 135.411 11.412  172.224 1.00 64.35  ? 316 ILE A CB  1 
ATOM   2457  C CG1 . ILE A 1 316 ? 135.653 12.853  172.673 1.00 61.40  ? 316 ILE A CG1 1 
ATOM   2458  C CG2 . ILE A 1 316 ? 135.940 11.184  170.807 1.00 58.10  ? 316 ILE A CG2 1 
ATOM   2459  C CD1 . ILE A 1 316 ? 137.040 13.107  173.189 1.00 74.12  ? 316 ILE A CD1 1 
ATOM   2460  N N   . GLY A 1 317 ? 132.316 12.903  172.367 1.00 70.93  ? 317 GLY A N   1 
ATOM   2461  C CA  . GLY A 1 317 ? 131.493 13.931  171.766 1.00 65.32  ? 317 GLY A CA  1 
ATOM   2462  C C   . GLY A 1 317 ? 131.621 15.305  172.391 1.00 70.78  ? 317 GLY A C   1 
ATOM   2463  O O   . GLY A 1 317 ? 132.365 15.498  173.349 1.00 80.46  ? 317 GLY A O   1 
ATOM   2464  N N   . VAL A 1 318 ? 130.901 16.269  171.823 1.00 63.77  ? 318 VAL A N   1 
ATOM   2465  C CA  . VAL A 1 318 ? 130.862 17.635  172.345 1.00 65.73  ? 318 VAL A CA  1 
ATOM   2466  C C   . VAL A 1 318 ? 129.419 18.112  172.413 1.00 64.35  ? 318 VAL A C   1 
ATOM   2467  O O   . VAL A 1 318 ? 128.695 18.043  171.426 1.00 66.85  ? 318 VAL A O   1 
ATOM   2468  C CB  . VAL A 1 318 ? 131.668 18.617  171.469 1.00 56.83  ? 318 VAL A CB  1 
ATOM   2469  C CG1 . VAL A 1 318 ? 131.492 20.045  171.967 1.00 57.90  ? 318 VAL A CG1 1 
ATOM   2470  C CG2 . VAL A 1 318 ? 133.136 18.237  171.430 1.00 61.30  ? 318 VAL A CG2 1 
ATOM   2471  N N   . ASN A 1 319 ? 129.003 18.614  173.569 1.00 66.20  ? 319 ASN A N   1 
ATOM   2472  C CA  . ASN A 1 319 ? 127.638 19.103  173.706 1.00 74.25  ? 319 ASN A CA  1 
ATOM   2473  C C   . ASN A 1 319 ? 127.524 20.623  173.599 1.00 69.97  ? 319 ASN A C   1 
ATOM   2474  O O   . ASN A 1 319 ? 128.524 21.340  173.647 1.00 65.11  ? 319 ASN A O   1 
ATOM   2475  C CB  . ASN A 1 319 ? 127.033 18.609  175.020 1.00 73.32  ? 319 ASN A CB  1 
ATOM   2476  C CG  . ASN A 1 319 ? 127.639 19.277  176.241 1.00 67.26  ? 319 ASN A CG  1 
ATOM   2477  O OD1 . ASN A 1 319 ? 128.664 19.953  176.162 1.00 74.89  ? 319 ASN A OD1 1 
ATOM   2478  N ND2 . ASN A 1 319 ? 127.011 19.068  177.390 1.00 65.59  ? 319 ASN A ND2 1 
ATOM   2479  N N   . ARG A 1 320 ? 126.288 21.099  173.472 1.00 69.83  ? 320 ARG A N   1 
ATOM   2480  C CA  . ARG A 1 320 ? 125.980 22.521  173.310 1.00 66.30  ? 320 ARG A CA  1 
ATOM   2481  C C   . ARG A 1 320 ? 126.464 23.386  174.471 1.00 68.34  ? 320 ARG A C   1 
ATOM   2482  O O   . ARG A 1 320 ? 126.564 24.605  174.346 1.00 66.50  ? 320 ARG A O   1 
ATOM   2483  C CB  . ARG A 1 320 ? 124.472 22.698  173.121 1.00 69.01  ? 320 ARG A CB  1 
ATOM   2484  C CG  . ARG A 1 320 ? 123.966 22.085  171.823 1.00 61.34  ? 320 ARG A CG  1 
ATOM   2485  C CD  . ARG A 1 320 ? 123.046 23.012  171.050 1.00 77.42  ? 320 ARG A CD  1 
ATOM   2486  N NE  . ARG A 1 320 ? 121.645 22.648  171.235 1.00 99.49  ? 320 ARG A NE  1 
ATOM   2487  C CZ  . ARG A 1 320 ? 120.618 23.395  170.849 1.00 117.49 ? 320 ARG A CZ  1 
ATOM   2488  N NH1 . ARG A 1 320 ? 119.379 22.973  171.056 1.00 128.74 ? 320 ARG A NH1 1 
ATOM   2489  N NH2 . ARG A 1 320 ? 120.830 24.565  170.262 1.00 118.25 ? 320 ARG A NH2 1 
ATOM   2490  N N   . LYS A 1 321 ? 126.758 22.754  175.600 1.00 73.40  ? 321 LYS A N   1 
ATOM   2491  C CA  . LYS A 1 321 ? 127.252 23.474  176.765 1.00 71.71  ? 321 LYS A CA  1 
ATOM   2492  C C   . LYS A 1 321 ? 128.745 23.772  176.639 1.00 74.19  ? 321 LYS A C   1 
ATOM   2493  O O   . LYS A 1 321 ? 129.281 24.632  177.340 1.00 85.19  ? 321 LYS A O   1 
ATOM   2494  C CB  . LYS A 1 321 ? 126.981 22.667  178.028 1.00 81.22  ? 321 LYS A CB  1 
ATOM   2495  C CG  . LYS A 1 321 ? 126.131 23.392  179.046 1.00 87.09  ? 321 LYS A CG  1 
ATOM   2496  C CD  . LYS A 1 321 ? 125.784 22.461  180.188 1.00 102.03 ? 321 LYS A CD  1 
ATOM   2497  C CE  . LYS A 1 321 ? 124.855 23.119  181.183 1.00 128.02 ? 321 LYS A CE  1 
ATOM   2498  N NZ  . LYS A 1 321 ? 124.349 22.109  182.152 1.00 141.48 ? 321 LYS A NZ  1 
ATOM   2499  N N   . GLY A 1 322 ? 129.405 23.058  175.732 1.00 76.22  ? 322 GLY A N   1 
ATOM   2500  C CA  . GLY A 1 322 ? 130.831 23.213  175.513 1.00 79.05  ? 322 GLY A CA  1 
ATOM   2501  C C   . GLY A 1 322 ? 131.658 22.138  176.194 1.00 76.61  ? 322 GLY A C   1 
ATOM   2502  O O   . GLY A 1 322 ? 132.887 22.182  176.168 1.00 80.44  ? 322 GLY A O   1 
ATOM   2503  N N   . GLN A 1 323 ? 130.986 21.173  176.815 1.00 62.77  ? 323 GLN A N   1 
ATOM   2504  C CA  . GLN A 1 323 ? 131.680 20.071  177.473 1.00 62.26  ? 323 GLN A CA  1 
ATOM   2505  C C   . GLN A 1 323 ? 132.126 19.016  176.474 1.00 63.57  ? 323 GLN A C   1 
ATOM   2506  O O   . GLN A 1 323 ? 131.337 18.550  175.654 1.00 66.18  ? 323 GLN A O   1 
ATOM   2507  C CB  . GLN A 1 323 ? 130.798 19.413  178.535 1.00 72.50  ? 323 GLN A CB  1 
ATOM   2508  C CG  . GLN A 1 323 ? 130.243 20.354  179.584 1.00 81.14  ? 323 GLN A CG  1 
ATOM   2509  C CD  . GLN A 1 323 ? 129.174 19.695  180.430 1.00 102.53 ? 323 GLN A CD  1 
ATOM   2510  O OE1 . GLN A 1 323 ? 127.987 19.762  180.112 1.00 124.68 ? 323 GLN A OE1 1 
ATOM   2511  N NE2 . GLN A 1 323 ? 129.591 19.048  181.512 1.00 97.18  ? 323 GLN A NE2 1 
ATOM   2512  N N   . VAL A 1 324 ? 133.398 18.645  176.541 1.00 66.78  ? 324 VAL A N   1 
ATOM   2513  C CA  . VAL A 1 324 ? 133.918 17.590  175.681 1.00 65.63  ? 324 VAL A CA  1 
ATOM   2514  C C   . VAL A 1 324 ? 133.875 16.278  176.451 1.00 75.91  ? 324 VAL A C   1 
ATOM   2515  O O   . VAL A 1 324 ? 134.810 15.939  177.175 1.00 91.04  ? 324 VAL A O   1 
ATOM   2516  C CB  . VAL A 1 324 ? 135.348 17.874  175.206 1.00 64.96  ? 324 VAL A CB  1 
ATOM   2517  C CG1 . VAL A 1 324 ? 135.843 16.728  174.336 1.00 63.93  ? 324 VAL A CG1 1 
ATOM   2518  C CG2 . VAL A 1 324 ? 135.393 19.186  174.443 1.00 65.26  ? 324 VAL A CG2 1 
ATOM   2519  N N   . LEU A 1 325 ? 132.789 15.536  176.280 1.00 64.24  ? 325 LEU A N   1 
ATOM   2520  C CA  . LEU A 1 325 ? 132.577 14.320  177.049 1.00 59.92  ? 325 LEU A CA  1 
ATOM   2521  C C   . LEU A 1 325 ? 133.070 13.053  176.364 1.00 61.49  ? 325 LEU A C   1 
ATOM   2522  O O   . LEU A 1 325 ? 133.119 12.958  175.145 1.00 59.93  ? 325 LEU A O   1 
ATOM   2523  C CB  . LEU A 1 325 ? 131.097 14.162  177.404 1.00 59.35  ? 325 LEU A CB  1 
ATOM   2524  C CG  . LEU A 1 325 ? 130.424 15.404  177.983 1.00 61.74  ? 325 LEU A CG  1 
ATOM   2525  C CD1 . LEU A 1 325 ? 128.921 15.247  177.906 1.00 64.16  ? 325 LEU A CD1 1 
ATOM   2526  C CD2 . LEU A 1 325 ? 130.882 15.639  179.414 1.00 64.05  ? 325 LEU A CD2 1 
ATOM   2527  N N   . SER A 1 326 ? 133.444 12.077  177.185 1.00 70.83  ? 326 SER A N   1 
ATOM   2528  C CA  . SER A 1 326 ? 133.959 10.797  176.699 1.00 77.71  ? 326 SER A CA  1 
ATOM   2529  C C   . SER A 1 326 ? 133.432 9.605   177.489 1.00 76.32  ? 326 SER A C   1 
ATOM   2530  O O   . SER A 1 326 ? 133.489 9.584   178.720 1.00 96.21  ? 326 SER A O   1 
ATOM   2531  C CB  . SER A 1 326 ? 135.485 10.791  176.752 1.00 96.58  ? 326 SER A CB  1 
ATOM   2532  O OG  . SER A 1 326 ? 135.957 9.579   177.322 1.00 102.35 ? 326 SER A OG  1 
ATOM   2533  N N   . VAL A 1 327 ? 132.888 8.629   176.770 1.00 61.71  ? 327 VAL A N   1 
ATOM   2534  C CA  . VAL A 1 327 ? 132.392 7.405   177.389 1.00 66.86  ? 327 VAL A CA  1 
ATOM   2535  C C   . VAL A 1 327 ? 133.008 6.165   176.741 1.00 73.51  ? 327 VAL A C   1 
ATOM   2536  O O   . VAL A 1 327 ? 133.008 6.036   175.516 1.00 69.92  ? 327 VAL A O   1 
ATOM   2537  C CB  . VAL A 1 327 ? 130.862 7.303   177.300 1.00 61.90  ? 327 VAL A CB  1 
ATOM   2538  C CG1 . VAL A 1 327 ? 130.379 6.027   177.982 1.00 61.69  ? 327 VAL A CG1 1 
ATOM   2539  C CG2 . VAL A 1 327 ? 130.209 8.518   177.943 1.00 61.92  ? 327 VAL A CG2 1 
ATOM   2540  N N   . CYS A 1 328 ? 133.528 5.253   177.557 1.00 77.66  ? 328 CYS A N   1 
ATOM   2541  C CA  . CYS A 1 328 ? 134.104 4.027   177.025 1.00 78.70  ? 328 CYS A CA  1 
ATOM   2542  C C   . CYS A 1 328 ? 133.880 2.861   177.980 1.00 69.92  ? 328 CYS A C   1 
ATOM   2543  O O   . CYS A 1 328 ? 133.490 3.051   179.131 1.00 70.73  ? 328 CYS A O   1 
ATOM   2544  C CB  . CYS A 1 328 ? 135.600 4.203   176.748 1.00 73.09  ? 328 CYS A CB  1 
ATOM   2545  S SG  . CYS A 1 328 ? 136.658 4.108   178.210 1.00 80.58  ? 328 CYS A SG  1 
ATOM   2546  N N   . VAL A 1 329 ? 134.122 1.650   177.492 1.00 77.56  ? 329 VAL A N   1 
ATOM   2547  C CA  . VAL A 1 329 ? 133.968 0.454   178.310 1.00 69.67  ? 329 VAL A CA  1 
ATOM   2548  C C   . VAL A 1 329 ? 135.035 0.357   179.393 1.00 78.50  ? 329 VAL A C   1 
ATOM   2549  O O   . VAL A 1 329 ? 136.230 0.411   179.105 1.00 100.10 ? 329 VAL A O   1 
ATOM   2550  C CB  . VAL A 1 329 ? 134.029 -0.823  177.458 1.00 72.31  ? 329 VAL A CB  1 
ATOM   2551  C CG1 . VAL A 1 329 ? 133.816 -2.051  178.329 1.00 73.29  ? 329 VAL A CG1 1 
ATOM   2552  C CG2 . VAL A 1 329 ? 133.013 -0.759  176.328 1.00 70.63  ? 329 VAL A CG2 1 
ATOM   2553  N N   . GLU A 1 330 ? 134.597 0.215   180.639 1.00 74.12  ? 330 GLU A N   1 
ATOM   2554  C CA  . GLU A 1 330 ? 135.515 -0.015  181.743 1.00 74.82  ? 330 GLU A CA  1 
ATOM   2555  C C   . GLU A 1 330 ? 135.811 -1.506  181.786 1.00 82.35  ? 330 GLU A C   1 
ATOM   2556  O O   . GLU A 1 330 ? 135.025 -2.293  182.308 1.00 83.04  ? 330 GLU A O   1 
ATOM   2557  C CB  . GLU A 1 330 ? 134.909 0.468   183.063 1.00 74.76  ? 330 GLU A CB  1 
ATOM   2558  C CG  . GLU A 1 330 ? 135.727 0.176   184.319 1.00 84.71  ? 330 GLU A CG  1 
ATOM   2559  C CD  . GLU A 1 330 ? 137.144 0.719   184.258 1.00 106.59 ? 330 GLU A CD  1 
ATOM   2560  O OE1 . GLU A 1 330 ? 137.314 1.948   184.410 1.00 114.33 ? 330 GLU A OE1 1 
ATOM   2561  O OE2 . GLU A 1 330 ? 138.091 -0.079  184.091 1.00 132.56 ? 330 GLU A OE2 1 
ATOM   2562  N N   . GLU A 1 331 ? 136.964 -1.877  181.241 1.00 88.21  ? 331 GLU A N   1 
ATOM   2563  C CA  . GLU A 1 331 ? 137.351 -3.273  181.067 1.00 77.82  ? 331 GLU A CA  1 
ATOM   2564  C C   . GLU A 1 331 ? 137.418 -4.060  182.378 1.00 79.86  ? 331 GLU A C   1 
ATOM   2565  O O   . GLU A 1 331 ? 137.230 -5.274  182.388 1.00 79.17  ? 331 GLU A O   1 
ATOM   2566  C CB  . GLU A 1 331 ? 138.690 -3.337  180.334 1.00 89.09  ? 331 GLU A CB  1 
ATOM   2567  C CG  . GLU A 1 331 ? 138.611 -2.784  178.915 1.00 104.93 ? 331 GLU A CG  1 
ATOM   2568  C CD  . GLU A 1 331 ? 139.920 -2.894  178.165 1.00 115.96 ? 331 GLU A CD  1 
ATOM   2569  O OE1 . GLU A 1 331 ? 140.357 -4.031  177.889 1.00 118.06 ? 331 GLU A OE1 1 
ATOM   2570  O OE2 . GLU A 1 331 ? 140.513 -1.840  177.854 1.00 127.50 ? 331 GLU A OE2 1 
ATOM   2571  N N   . GLU A 1 332 ? 137.677 -3.366  183.480 1.00 78.53  ? 332 GLU A N   1 
ATOM   2572  C CA  . GLU A 1 332 ? 137.761 -4.007  184.789 1.00 81.82  ? 332 GLU A CA  1 
ATOM   2573  C C   . GLU A 1 332 ? 136.374 -4.338  185.347 1.00 91.25  ? 332 GLU A C   1 
ATOM   2574  O O   . GLU A 1 332 ? 136.198 -5.351  186.021 1.00 99.72  ? 332 GLU A O   1 
ATOM   2575  C CB  . GLU A 1 332 ? 138.521 -3.114  185.776 1.00 92.30  ? 332 GLU A CB  1 
ATOM   2576  C CG  . GLU A 1 332 ? 139.108 -3.828  187.002 1.00 109.38 ? 332 GLU A CG  1 
ATOM   2577  C CD  . GLU A 1 332 ? 140.412 -4.553  186.703 1.00 131.64 ? 332 GLU A CD  1 
ATOM   2578  O OE1 . GLU A 1 332 ? 141.343 -3.911  186.171 1.00 148.44 ? 332 GLU A OE1 1 
ATOM   2579  O OE2 . GLU A 1 332 ? 140.520 -5.756  187.026 1.00 132.75 ? 332 GLU A OE2 1 
ATOM   2580  N N   . ASN A 1 333 ? 135.392 -3.482  185.076 1.00 85.13  ? 333 ASN A N   1 
ATOM   2581  C CA  . ASN A 1 333 ? 134.065 -3.645  185.678 1.00 74.35  ? 333 ASN A CA  1 
ATOM   2582  C C   . ASN A 1 333 ? 132.940 -4.235  184.829 1.00 72.81  ? 333 ASN A C   1 
ATOM   2583  O O   . ASN A 1 333 ? 131.927 -4.663  185.377 1.00 85.44  ? 333 ASN A O   1 
ATOM   2584  C CB  . ASN A 1 333 ? 133.576 -2.289  186.199 1.00 80.89  ? 333 ASN A CB  1 
ATOM   2585  C CG  . ASN A 1 333 ? 134.546 -1.649  187.158 1.00 89.34  ? 333 ASN A CG  1 
ATOM   2586  O OD1 . ASN A 1 333 ? 134.617 -0.426  187.263 1.00 107.79 ? 333 ASN A OD1 1 
ATOM   2587  N ND2 . ASN A 1 333 ? 135.295 -2.473  187.877 1.00 74.58  ? 333 ASN A ND2 1 
ATOM   2588  N N   . ILE A 1 334 ? 133.098 -4.249  183.511 1.00 69.17  ? 334 ILE A N   1 
ATOM   2589  C CA  . ILE A 1 334 ? 132.017 -4.682  182.628 1.00 71.15  ? 334 ILE A CA  1 
ATOM   2590  C C   . ILE A 1 334 ? 131.485 -6.088  182.947 1.00 83.79  ? 334 ILE A C   1 
ATOM   2591  O O   . ILE A 1 334 ? 130.272 -6.282  183.042 1.00 111.57 ? 334 ILE A O   1 
ATOM   2592  C CB  . ILE A 1 334 ? 132.443 -4.605  181.132 1.00 69.22  ? 334 ILE A CB  1 
ATOM   2593  C CG1 . ILE A 1 334 ? 131.259 -4.943  180.224 1.00 68.11  ? 334 ILE A CG1 1 
ATOM   2594  C CG2 . ILE A 1 334 ? 133.674 -5.459  180.839 1.00 86.46  ? 334 ILE A CG2 1 
ATOM   2595  C CD1 . ILE A 1 334 ? 130.760 -3.753  179.418 1.00 68.88  ? 334 ILE A CD1 1 
ATOM   2596  N N   . ILE A 1 335 ? 132.374 -7.065  183.107 1.00 71.55  ? 335 ILE A N   1 
ATOM   2597  C CA  . ILE A 1 335 ? 131.937 -8.429  183.405 1.00 80.73  ? 335 ILE A CA  1 
ATOM   2598  C C   . ILE A 1 335 ? 131.264 -8.555  184.780 1.00 90.17  ? 335 ILE A C   1 
ATOM   2599  O O   . ILE A 1 335 ? 130.220 -9.208  184.884 1.00 113.76 ? 335 ILE A O   1 
ATOM   2600  C CB  . ILE A 1 335 ? 133.095 -9.455  183.324 1.00 77.43  ? 335 ILE A CB  1 
ATOM   2601  C CG1 . ILE A 1 335 ? 133.762 -9.387  181.960 1.00 79.53  ? 335 ILE A CG1 1 
ATOM   2602  C CG2 . ILE A 1 335 ? 132.550 -10.853 183.499 1.00 70.34  ? 335 ILE A CG2 1 
ATOM   2603  C CD1 . ILE A 1 335 ? 132.810 -9.732  180.842 1.00 69.67  ? 335 ILE A CD1 1 
ATOM   2604  N N   . PRO A 1 336 ? 131.875 -7.995  185.846 1.00 74.82  ? 336 PRO A N   1 
ATOM   2605  C CA  . PRO A 1 336 ? 131.139 -8.035  187.117 1.00 73.73  ? 336 PRO A CA  1 
ATOM   2606  C C   . PRO A 1 336 ? 129.757 -7.373  187.048 1.00 81.90  ? 336 PRO A C   1 
ATOM   2607  O O   . PRO A 1 336 ? 128.800 -7.926  187.591 1.00 96.64  ? 336 PRO A O   1 
ATOM   2608  C CB  . PRO A 1 336 ? 132.056 -7.276  188.083 1.00 72.80  ? 336 PRO A CB  1 
ATOM   2609  C CG  . PRO A 1 336 ? 133.408 -7.395  187.493 1.00 87.86  ? 336 PRO A CG  1 
ATOM   2610  C CD  . PRO A 1 336 ? 133.223 -7.419  186.013 1.00 79.97  ? 336 PRO A CD  1 
ATOM   2611  N N   . TYR A 1 337 ? 129.657 -6.216  186.396 1.00 70.65  ? 337 TYR A N   1 
ATOM   2612  C CA  . TYR A 1 337 ? 128.386 -5.500  186.273 1.00 66.86  ? 337 TYR A CA  1 
ATOM   2613  C C   . TYR A 1 337 ? 127.312 -6.322  185.564 1.00 72.16  ? 337 TYR A C   1 
ATOM   2614  O O   . TYR A 1 337 ? 126.179 -6.425  186.040 1.00 82.04  ? 337 TYR A O   1 
ATOM   2615  C CB  . TYR A 1 337 ? 128.604 -4.179  185.532 1.00 63.88  ? 337 TYR A CB  1 
ATOM   2616  C CG  . TYR A 1 337 ? 127.356 -3.341  185.355 1.00 74.76  ? 337 TYR A CG  1 
ATOM   2617  C CD1 . TYR A 1 337 ? 127.000 -2.386  186.297 1.00 82.76  ? 337 TYR A CD1 1 
ATOM   2618  C CD2 . TYR A 1 337 ? 126.533 -3.508  184.247 1.00 86.36  ? 337 TYR A CD2 1 
ATOM   2619  C CE1 . TYR A 1 337 ? 125.868 -1.619  186.141 1.00 79.80  ? 337 TYR A CE1 1 
ATOM   2620  C CE2 . TYR A 1 337 ? 125.402 -2.745  184.083 1.00 93.36  ? 337 TYR A CE2 1 
ATOM   2621  C CZ  . TYR A 1 337 ? 125.072 -1.804  185.034 1.00 85.36  ? 337 TYR A CZ  1 
ATOM   2622  O OH  . TYR A 1 337 ? 123.940 -1.045  184.869 1.00 90.31  ? 337 TYR A OH  1 
ATOM   2623  N N   . ILE A 1 338 ? 127.673 -6.896  184.422 1.00 62.36  ? 338 ILE A N   1 
ATOM   2624  C CA  . ILE A 1 338 ? 126.758 -7.736  183.663 1.00 62.26  ? 338 ILE A CA  1 
ATOM   2625  C C   . ILE A 1 338 ? 126.324 -8.918  184.518 1.00 65.25  ? 338 ILE A C   1 
ATOM   2626  O O   . ILE A 1 338 ? 125.172 -9.346  184.473 1.00 61.18  ? 338 ILE A O   1 
ATOM   2627  C CB  . ILE A 1 338 ? 127.397 -8.234  182.354 1.00 63.03  ? 338 ILE A CB  1 
ATOM   2628  C CG1 . ILE A 1 338 ? 127.597 -7.058  181.403 1.00 60.91  ? 338 ILE A CG1 1 
ATOM   2629  C CG2 . ILE A 1 338 ? 126.529 -9.291  181.691 1.00 65.35  ? 338 ILE A CG2 1 
ATOM   2630  C CD1 . ILE A 1 338 ? 128.374 -7.411  180.163 1.00 63.11  ? 338 ILE A CD1 1 
ATOM   2631  N N   . THR A 1 339 ? 127.261 -9.447  185.295 1.00 77.28  ? 339 THR A N   1 
ATOM   2632  C CA  . THR A 1 339 ? 126.985 -10.583 186.166 1.00 76.41  ? 339 THR A CA  1 
ATOM   2633  C C   . THR A 1 339 ? 126.090 -10.239 187.359 1.00 77.52  ? 339 THR A C   1 
ATOM   2634  O O   . THR A 1 339 ? 125.082 -10.901 187.590 1.00 91.90  ? 339 THR A O   1 
ATOM   2635  C CB  . THR A 1 339 ? 128.280 -11.206 186.714 1.00 66.20  ? 339 THR A CB  1 
ATOM   2636  O OG1 . THR A 1 339 ? 129.163 -11.520 185.630 1.00 77.64  ? 339 THR A OG1 1 
ATOM   2637  C CG2 . THR A 1 339 ? 127.965 -12.475 187.495 1.00 66.16  ? 339 THR A CG2 1 
ATOM   2638  N N   . ASN A 1 340 ? 126.468 -9.223  188.130 1.00 68.20  ? 340 ASN A N   1 
ATOM   2639  C CA  . ASN A 1 340 ? 125.793 -8.956  189.399 1.00 63.41  ? 340 ASN A CA  1 
ATOM   2640  C C   . ASN A 1 340 ? 124.773 -7.813  189.421 1.00 70.10  ? 340 ASN A C   1 
ATOM   2641  O O   . ASN A 1 340 ? 123.769 -7.898  190.129 1.00 98.39  ? 340 ASN A O   1 
ATOM   2642  C CB  . ASN A 1 340 ? 126.845 -8.709  190.479 1.00 65.63  ? 340 ASN A CB  1 
ATOM   2643  C CG  . ASN A 1 340 ? 127.774 -9.890  190.661 1.00 80.14  ? 340 ASN A CG  1 
ATOM   2644  O OD1 . ASN A 1 340 ? 128.914 -9.883  190.195 1.00 81.21  ? 340 ASN A OD1 1 
ATOM   2645  N ND2 . ASN A 1 340 ? 127.286 -10.920 191.342 1.00 83.58  ? 340 ASN A ND2 1 
ATOM   2646  N N   . VAL A 1 341 ? 125.016 -6.751  188.663 1.00 60.81  ? 341 VAL A N   1 
ATOM   2647  C CA  . VAL A 1 341 ? 124.081 -5.629  188.641 1.00 65.14  ? 341 VAL A CA  1 
ATOM   2648  C C   . VAL A 1 341 ? 122.988 -5.857  187.604 1.00 64.32  ? 341 VAL A C   1 
ATOM   2649  O O   . VAL A 1 341 ? 121.808 -5.636  187.869 1.00 65.65  ? 341 VAL A O   1 
ATOM   2650  C CB  . VAL A 1 341 ? 124.791 -4.299  188.349 1.00 68.14  ? 341 VAL A CB  1 
ATOM   2651  C CG1 . VAL A 1 341 ? 123.858 -3.131  188.636 1.00 68.16  ? 341 VAL A CG1 1 
ATOM   2652  C CG2 . VAL A 1 341 ? 126.053 -4.188  189.183 1.00 74.15  ? 341 VAL A CG2 1 
ATOM   2653  N N   . LEU A 1 342 ? 123.394 -6.287  186.417 1.00 64.25  ? 342 LEU A N   1 
ATOM   2654  C CA  . LEU A 1 342 ? 122.457 -6.617  185.354 1.00 66.37  ? 342 LEU A CA  1 
ATOM   2655  C C   . LEU A 1 342 ? 121.841 -7.991  185.620 1.00 73.17  ? 342 LEU A C   1 
ATOM   2656  O O   . LEU A 1 342 ? 120.688 -8.241  185.272 1.00 84.94  ? 342 LEU A O   1 
ATOM   2657  C CB  . LEU A 1 342 ? 123.161 -6.594  183.996 1.00 61.02  ? 342 LEU A CB  1 
ATOM   2658  C CG  . LEU A 1 342 ? 122.407 -6.108  182.759 1.00 60.32  ? 342 LEU A CG  1 
ATOM   2659  C CD1 . LEU A 1 342 ? 123.414 -5.806  181.685 1.00 60.51  ? 342 LEU A CD1 1 
ATOM   2660  C CD2 . LEU A 1 342 ? 121.426 -7.148  182.264 1.00 70.59  ? 342 LEU A CD2 1 
ATOM   2661  N N   . GLN A 1 343 ? 122.628 -8.868  186.240 1.00 71.48  ? 343 GLN A N   1 
ATOM   2662  C CA  . GLN A 1 343 ? 122.221 -10.238 186.551 1.00 63.95  ? 343 GLN A CA  1 
ATOM   2663  C C   . GLN A 1 343 ? 121.886 -11.026 185.285 1.00 63.23  ? 343 GLN A C   1 
ATOM   2664  O O   . GLN A 1 343 ? 120.846 -11.685 185.179 1.00 80.81  ? 343 GLN A O   1 
ATOM   2665  C CB  . GLN A 1 343 ? 121.063 -10.247 187.550 1.00 72.19  ? 343 GLN A CB  1 
ATOM   2666  C CG  . GLN A 1 343 ? 121.557 -10.100 188.985 1.00 82.50  ? 343 GLN A CG  1 
ATOM   2667  C CD  . GLN A 1 343 ? 120.556 -9.447  189.911 1.00 109.38 ? 343 GLN A CD  1 
ATOM   2668  O OE1 . GLN A 1 343 ? 120.557 -8.228  190.086 1.00 127.41 ? 343 GLN A OE1 1 
ATOM   2669  N NE2 . GLN A 1 343 ? 119.699 -10.258 190.518 1.00 106.95 ? 343 GLN A NE2 1 
ATOM   2670  N N   . ASN A 1 344 ? 122.803 -10.937 184.328 1.00 66.02  ? 344 ASN A N   1 
ATOM   2671  C CA  . ASN A 1 344 ? 122.731 -11.661 183.068 1.00 65.05  ? 344 ASN A CA  1 
ATOM   2672  C C   . ASN A 1 344 ? 123.957 -12.553 182.875 1.00 64.33  ? 344 ASN A C   1 
ATOM   2673  O O   . ASN A 1 344 ? 124.797 -12.256 182.022 1.00 67.11  ? 344 ASN A O   1 
ATOM   2674  C CB  . ASN A 1 344 ? 122.626 -10.674 181.906 1.00 66.76  ? 344 ASN A CB  1 
ATOM   2675  C CG  . ASN A 1 344 ? 122.043 -11.299 180.658 1.00 66.47  ? 344 ASN A CG  1 
ATOM   2676  O OD1 . ASN A 1 344 ? 122.385 -12.424 180.292 1.00 60.44  ? 344 ASN A OD1 1 
ATOM   2677  N ND2 . ASN A 1 344 ? 121.176 -10.558 179.980 1.00 74.81  ? 344 ASN A ND2 1 
ATOM   2678  N N   . PRO A 1 345 ? 124.074 -13.636 183.666 1.00 60.80  ? 345 PRO A N   1 
ATOM   2679  C CA  . PRO A 1 345 ? 125.247 -14.518 183.594 1.00 67.30  ? 345 PRO A CA  1 
ATOM   2680  C C   . PRO A 1 345 ? 125.571 -15.045 182.198 1.00 81.75  ? 345 PRO A C   1 
ATOM   2681  O O   . PRO A 1 345 ? 126.751 -15.099 181.848 1.00 92.67  ? 345 PRO A O   1 
ATOM   2682  C CB  . PRO A 1 345 ? 124.877 -15.684 184.526 1.00 65.22  ? 345 PRO A CB  1 
ATOM   2683  C CG  . PRO A 1 345 ? 123.433 -15.527 184.840 1.00 69.85  ? 345 PRO A CG  1 
ATOM   2684  C CD  . PRO A 1 345 ? 123.111 -14.084 184.685 1.00 64.33  ? 345 PRO A CD  1 
ATOM   2685  N N   . ASP A 1 346 ? 124.561 -15.438 181.427 1.00 82.73  ? 346 ASP A N   1 
ATOM   2686  C CA  . ASP A 1 346 ? 124.793 -15.952 180.076 1.00 74.15  ? 346 ASP A CA  1 
ATOM   2687  C C   . ASP A 1 346 ? 125.570 -14.983 179.196 1.00 66.23  ? 346 ASP A C   1 
ATOM   2688  O O   . ASP A 1 346 ? 126.449 -15.397 178.442 1.00 87.32  ? 346 ASP A O   1 
ATOM   2689  C CB  . ASP A 1 346 ? 123.469 -16.315 179.406 1.00 87.20  ? 346 ASP A CB  1 
ATOM   2690  C CG  . ASP A 1 346 ? 122.894 -17.607 179.941 1.00 100.10 ? 346 ASP A CG  1 
ATOM   2691  O OD1 . ASP A 1 346 ? 123.505 -18.185 180.867 1.00 108.19 ? 346 ASP A OD1 1 
ATOM   2692  O OD2 . ASP A 1 346 ? 121.843 -18.054 179.436 1.00 98.53  ? 346 ASP A OD2 1 
ATOM   2693  N N   . LEU A 1 347 ? 125.243 -13.698 179.290 1.00 60.57  ? 347 LEU A N   1 
ATOM   2694  C CA  . LEU A 1 347 ? 125.953 -12.670 178.532 1.00 59.96  ? 347 LEU A CA  1 
ATOM   2695  C C   . LEU A 1 347 ? 127.362 -12.449 179.075 1.00 67.61  ? 347 LEU A C   1 
ATOM   2696  O O   . LEU A 1 347 ? 128.300 -12.246 178.306 1.00 74.12  ? 347 LEU A O   1 
ATOM   2697  C CB  . LEU A 1 347 ? 125.183 -11.354 178.538 1.00 58.82  ? 347 LEU A CB  1 
ATOM   2698  C CG  . LEU A 1 347 ? 125.852 -10.223 177.757 1.00 60.68  ? 347 LEU A CG  1 
ATOM   2699  C CD1 . LEU A 1 347 ? 125.851 -10.498 176.250 1.00 76.19  ? 347 LEU A CD1 1 
ATOM   2700  C CD2 . LEU A 1 347 ? 125.160 -8.910  178.071 1.00 59.75  ? 347 LEU A CD2 1 
ATOM   2701  N N   . ALA A 1 348 ? 127.503 -12.481 180.397 1.00 77.01  ? 348 ALA A N   1 
ATOM   2702  C CA  . ALA A 1 348 ? 128.807 -12.313 181.033 1.00 73.57  ? 348 ALA A CA  1 
ATOM   2703  C C   . ALA A 1 348 ? 129.772 -13.416 180.602 1.00 67.64  ? 348 ALA A C   1 
ATOM   2704  O O   . ALA A 1 348 ? 130.931 -13.150 180.288 1.00 71.56  ? 348 ALA A O   1 
ATOM   2705  C CB  . ALA A 1 348 ? 128.666 -12.297 182.547 1.00 76.50  ? 348 ALA A CB  1 
ATOM   2706  N N   . LEU A 1 349 ? 129.288 -14.654 180.609 1.00 69.70  ? 349 LEU A N   1 
ATOM   2707  C CA  . LEU A 1 349 ? 130.076 -15.801 180.163 1.00 74.39  ? 349 LEU A CA  1 
ATOM   2708  C C   . LEU A 1 349 ? 130.490 -15.652 178.703 1.00 81.26  ? 349 LEU A C   1 
ATOM   2709  O O   . LEU A 1 349 ? 131.652 -15.851 178.357 1.00 84.27  ? 349 LEU A O   1 
ATOM   2710  C CB  . LEU A 1 349 ? 129.297 -17.100 180.363 1.00 74.87  ? 349 LEU A CB  1 
ATOM   2711  C CG  . LEU A 1 349 ? 129.299 -17.615 181.802 1.00 84.83  ? 349 LEU A CG  1 
ATOM   2712  C CD1 . LEU A 1 349 ? 127.942 -18.196 182.155 1.00 109.13 ? 349 LEU A CD1 1 
ATOM   2713  C CD2 . LEU A 1 349 ? 130.408 -18.639 182.010 1.00 75.48  ? 349 LEU A CD2 1 
ATOM   2714  N N   . ARG A 1 350 ? 129.535 -15.281 177.857 1.00 81.66  ? 350 ARG A N   1 
ATOM   2715  C CA  . ARG A 1 350 ? 129.805 -15.101 176.434 1.00 74.74  ? 350 ARG A CA  1 
ATOM   2716  C C   . ARG A 1 350 ? 130.812 -13.987 176.198 1.00 74.26  ? 350 ARG A C   1 
ATOM   2717  O O   . ARG A 1 350 ? 131.697 -14.102 175.350 1.00 87.07  ? 350 ARG A O   1 
ATOM   2718  C CB  . ARG A 1 350 ? 128.515 -14.784 175.677 1.00 70.25  ? 350 ARG A CB  1 
ATOM   2719  C CG  . ARG A 1 350 ? 128.726 -14.545 174.194 1.00 79.79  ? 350 ARG A CG  1 
ATOM   2720  C CD  . ARG A 1 350 ? 129.010 -15.838 173.455 1.00 111.35 ? 350 ARG A CD  1 
ATOM   2721  N NE  . ARG A 1 350 ? 129.506 -15.575 172.110 1.00 121.93 ? 350 ARG A NE  1 
ATOM   2722  C CZ  . ARG A 1 350 ? 130.778 -15.700 171.746 1.00 114.17 ? 350 ARG A CZ  1 
ATOM   2723  N NH1 . ARG A 1 350 ? 131.136 -15.429 170.499 1.00 112.51 ? 350 ARG A NH1 1 
ATOM   2724  N NH2 . ARG A 1 350 ? 131.693 -16.098 172.623 1.00 100.20 ? 350 ARG A NH2 1 
ATOM   2725  N N   . MET A 1 351 ? 130.676 -12.909 176.962 1.00 71.70  ? 351 MET A N   1 
ATOM   2726  C CA  . MET A 1 351 ? 131.561 -11.754 176.839 1.00 72.23  ? 351 MET A CA  1 
ATOM   2727  C C   . MET A 1 351 ? 132.994 -12.007 177.299 1.00 73.78  ? 351 MET A C   1 
ATOM   2728  O O   . MET A 1 351 ? 133.941 -11.535 176.676 1.00 73.25  ? 351 MET A O   1 
ATOM   2729  C CB  . MET A 1 351 ? 130.989 -10.580 177.623 1.00 74.46  ? 351 MET A CB  1 
ATOM   2730  C CG  . MET A 1 351 ? 131.363 -9.218  177.067 1.00 86.83  ? 351 MET A CG  1 
ATOM   2731  S SD  . MET A 1 351 ? 129.924 -8.184  176.767 1.00 95.55  ? 351 MET A SD  1 
ATOM   2732  C CE  . MET A 1 351 ? 130.639 -6.551  176.919 1.00 106.04 ? 351 MET A CE  1 
ATOM   2733  N N   . ALA A 1 352 ? 133.154 -12.777 178.369 1.00 76.07  ? 352 ALA A N   1 
ATOM   2734  C CA  . ALA A 1 352 ? 134.479 -13.048 178.924 1.00 72.89  ? 352 ALA A CA  1 
ATOM   2735  C C   . ALA A 1 352 ? 135.293 -14.000 178.062 1.00 78.33  ? 352 ALA A C   1 
ATOM   2736  O O   . ALA A 1 352 ? 136.522 -13.977 178.082 1.00 114.87 ? 352 ALA A O   1 
ATOM   2737  C CB  . ALA A 1 352 ? 134.354 -13.600 180.316 1.00 73.05  ? 352 ALA A CB  1 
ATOM   2738  N N   . VAL A 1 353 ? 134.598 -14.854 177.325 1.00 75.44  ? 353 VAL A N   1 
ATOM   2739  C CA  . VAL A 1 353 ? 135.256 -15.813 176.452 1.00 76.88  ? 353 VAL A CA  1 
ATOM   2740  C C   . VAL A 1 353 ? 135.475 -15.207 175.060 1.00 80.60  ? 353 VAL A C   1 
ATOM   2741  O O   . VAL A 1 353 ? 136.473 -15.497 174.400 1.00 83.24  ? 353 VAL A O   1 
ATOM   2742  C CB  . VAL A 1 353 ? 134.459 -17.140 176.367 1.00 79.32  ? 353 VAL A CB  1 
ATOM   2743  C CG1 . VAL A 1 353 ? 133.191 -16.974 175.555 1.00 81.64  ? 353 VAL A CG1 1 
ATOM   2744  C CG2 . VAL A 1 353 ? 135.334 -18.240 175.802 1.00 88.44  ? 353 VAL A CG2 1 
ATOM   2745  N N   . ARG A 1 354 ? 134.536 -14.371 174.621 1.00 85.08  ? 354 ARG A N   1 
ATOM   2746  C CA  . ARG A 1 354 ? 134.608 -13.730 173.309 1.00 86.84  ? 354 ARG A CA  1 
ATOM   2747  C C   . ARG A 1 354 ? 135.781 -12.767 173.252 1.00 84.08  ? 354 ARG A C   1 
ATOM   2748  O O   . ARG A 1 354 ? 136.670 -12.904 172.409 1.00 85.07  ? 354 ARG A O   1 
ATOM   2749  C CB  . ARG A 1 354 ? 133.309 -12.984 173.008 1.00 83.27  ? 354 ARG A CB  1 
ATOM   2750  C CG  . ARG A 1 354 ? 133.117 -12.593 171.564 1.00 84.01  ? 354 ARG A CG  1 
ATOM   2751  C CD  . ARG A 1 354 ? 131.773 -11.914 171.356 1.00 85.30  ? 354 ARG A CD  1 
ATOM   2752  N NE  . ARG A 1 354 ? 131.654 -10.671 172.114 1.00 83.86  ? 354 ARG A NE  1 
ATOM   2753  C CZ  . ARG A 1 354 ? 130.497 -10.131 172.483 1.00 88.97  ? 354 ARG A CZ  1 
ATOM   2754  N NH1 . ARG A 1 354 ? 130.478 -8.995  173.167 1.00 85.80  ? 354 ARG A NH1 1 
ATOM   2755  N NH2 . ARG A 1 354 ? 129.358 -10.727 172.161 1.00 99.43  ? 354 ARG A NH2 1 
ATOM   2756  N N   . ASN A 1 355 ? 135.768 -11.792 174.157 1.00 82.82  ? 355 ASN A N   1 
ATOM   2757  C CA  . ASN A 1 355 ? 136.852 -10.837 174.281 1.00 84.04  ? 355 ASN A CA  1 
ATOM   2758  C C   . ASN A 1 355 ? 137.601 -11.361 175.488 1.00 95.95  ? 355 ASN A C   1 
ATOM   2759  O O   . ASN A 1 355 ? 136.964 -11.834 176.422 1.00 127.77 ? 355 ASN A O   1 
ATOM   2760  C CB  . ASN A 1 355 ? 136.348 -9.414  174.529 1.00 88.69  ? 355 ASN A CB  1 
ATOM   2761  C CG  . ASN A 1 355 ? 135.083 -9.099  173.762 1.00 85.29  ? 355 ASN A CG  1 
ATOM   2762  O OD1 . ASN A 1 355 ? 133.983 -9.223  174.299 1.00 82.66  ? 355 ASN A OD1 1 
ATOM   2763  N ND2 . ASN A 1 355 ? 135.222 -8.719  172.502 1.00 87.21  ? 355 ASN A ND2 1 
ATOM   2764  N N   . ASN A 1 356 ? 138.924 -11.317 175.508 1.00 97.41  ? 356 ASN A N   1 
ATOM   2765  C CA  . ASN A 1 356 ? 139.590 -11.882 176.677 1.00 109.20 ? 356 ASN A CA  1 
ATOM   2766  C C   . ASN A 1 356 ? 139.540 -10.961 177.895 1.00 123.92 ? 356 ASN A C   1 
ATOM   2767  O O   . ASN A 1 356 ? 140.532 -10.351 178.287 1.00 135.85 ? 356 ASN A O   1 
ATOM   2768  C CB  . ASN A 1 356 ? 141.017 -12.291 176.355 1.00 101.77 ? 356 ASN A CB  1 
ATOM   2769  C CG  . ASN A 1 356 ? 141.401 -13.584 177.052 1.00 125.48 ? 356 ASN A CG  1 
ATOM   2770  O OD1 . ASN A 1 356 ? 140.603 -14.521 177.125 1.00 139.33 ? 356 ASN A OD1 1 
ATOM   2771  N ND2 . ASN A 1 356 ? 142.636 -13.654 177.536 1.00 130.05 ? 356 ASN A ND2 1 
ATOM   2772  N N   . LEU A 1 357 ? 138.347 -10.872 178.477 1.00 107.74 ? 357 LEU A N   1 
ATOM   2773  C CA  . LEU A 1 357 ? 138.092 -10.073 179.667 1.00 99.14  ? 357 LEU A CA  1 
ATOM   2774  C C   . LEU A 1 357 ? 138.095 -10.980 180.898 1.00 117.02 ? 357 LEU A C   1 
ATOM   2775  O O   . LEU A 1 357 ? 137.885 -12.183 180.796 1.00 126.83 ? 357 LEU A O   1 
ATOM   2776  C CB  . LEU A 1 357 ? 136.753 -9.340  179.536 1.00 89.15  ? 357 LEU A CB  1 
ATOM   2777  C CG  . LEU A 1 357 ? 136.748 -8.186  178.532 1.00 91.78  ? 357 LEU A CG  1 
ATOM   2778  C CD1 . LEU A 1 357 ? 135.404 -8.064  177.847 1.00 90.73  ? 357 LEU A CD1 1 
ATOM   2779  C CD2 . LEU A 1 357 ? 137.102 -6.895  179.243 1.00 93.62  ? 357 LEU A CD2 1 
ATOM   2780  N N   . ALA A 1 358 ? 138.345 -10.391 182.062 1.00 119.31 ? 358 ALA A N   1 
ATOM   2781  C CA  . ALA A 1 358 ? 138.475 -11.137 183.318 1.00 113.54 ? 358 ALA A CA  1 
ATOM   2782  C C   . ALA A 1 358 ? 137.449 -10.734 184.387 1.00 119.10 ? 358 ALA A C   1 
ATOM   2783  O O   . ALA A 1 358 ? 137.026 -9.576  184.437 1.00 116.14 ? 358 ALA A O   1 
ATOM   2784  C CB  . ALA A 1 358 ? 139.876 -10.968 183.867 1.00 100.81 ? 358 ALA A CB  1 
ATOM   2785  N N   . GLY A 1 359 ? 137.054 -11.690 185.232 1.00 123.90 ? 359 GLY A N   1 
ATOM   2786  C CA  . GLY A 1 359 ? 136.090 -11.456 186.301 1.00 131.73 ? 359 GLY A CA  1 
ATOM   2787  C C   . GLY A 1 359 ? 134.926 -12.433 186.240 1.00 130.27 ? 359 GLY A C   1 
ATOM   2788  O O   . GLY A 1 359 ? 133.984 -12.362 187.039 1.00 118.98 ? 359 GLY A O   1 
ATOM   2789  N N   . ALA A 1 360 ? 135.023 -13.368 185.299 1.00 132.92 ? 360 ALA A N   1 
ATOM   2790  C CA  . ALA A 1 360 ? 134.002 -14.378 185.059 1.00 125.85 ? 360 ALA A CA  1 
ATOM   2791  C C   . ALA A 1 360 ? 134.222 -15.703 185.812 1.00 123.72 ? 360 ALA A C   1 
ATOM   2792  O O   . ALA A 1 360 ? 133.338 -16.558 185.799 1.00 123.21 ? 360 ALA A O   1 
ATOM   2793  C CB  . ALA A 1 360 ? 133.900 -14.641 183.574 1.00 121.96 ? 360 ALA A CB  1 
ATOM   2794  N N   . GLU A 1 361 ? 135.376 -15.864 186.466 1.00 119.65 ? 361 GLU A N   1 
ATOM   2795  C CA  . GLU A 1 361 ? 135.768 -17.137 187.091 1.00 114.33 ? 361 GLU A CA  1 
ATOM   2796  C C   . GLU A 1 361 ? 134.707 -17.896 187.887 1.00 112.17 ? 361 GLU A C   1 
ATOM   2797  O O   . GLU A 1 361 ? 134.597 -19.114 187.739 1.00 103.58 ? 361 GLU A O   1 
ATOM   2798  C CB  . GLU A 1 361 ? 136.987 -16.916 187.997 1.00 113.88 ? 361 GLU A CB  1 
ATOM   2799  C CG  . GLU A 1 361 ? 138.259 -16.511 187.262 1.00 131.34 ? 361 GLU A CG  1 
ATOM   2800  C CD  . GLU A 1 361 ? 138.381 -15.023 186.990 1.00 141.22 ? 361 GLU A CD  1 
ATOM   2801  O OE1 . GLU A 1 361 ? 137.707 -14.213 187.663 1.00 142.78 ? 361 GLU A OE1 1 
ATOM   2802  O OE2 . GLU A 1 361 ? 139.149 -14.670 186.070 1.00 135.68 ? 361 GLU A OE2 1 
ATOM   2803  N N   . GLU A 1 362 ? 133.966 -17.216 188.753 1.00 104.56 ? 362 GLU A N   1 
ATOM   2804  C CA  . GLU A 1 362 ? 132.962 -17.908 189.558 1.00 96.15  ? 362 GLU A CA  1 
ATOM   2805  C C   . GLU A 1 362 ? 131.938 -18.608 188.655 1.00 99.80  ? 362 GLU A C   1 
ATOM   2806  O O   . GLU A 1 362 ? 131.523 -19.735 188.936 1.00 92.92  ? 362 GLU A O   1 
ATOM   2807  C CB  . GLU A 1 362 ? 132.269 -16.939 190.519 1.00 113.09 ? 362 GLU A CB  1 
ATOM   2808  C CG  . GLU A 1 362 ? 131.985 -17.515 191.914 1.00 143.34 ? 362 GLU A CG  1 
ATOM   2809  C CD  . GLU A 1 362 ? 130.828 -18.501 191.943 1.00 152.98 ? 362 GLU A CD  1 
ATOM   2810  O OE1 . GLU A 1 362 ? 129.714 -18.088 192.338 1.00 129.44 ? 362 GLU A OE1 1 
ATOM   2811  O OE2 . GLU A 1 362 ? 131.033 -19.686 191.588 1.00 166.61 ? 362 GLU A OE2 1 
ATOM   2812  N N   . LEU A 1 363 ? 131.579 -17.956 187.550 1.00 107.20 ? 363 LEU A N   1 
ATOM   2813  C CA  . LEU A 1 363 ? 130.569 -18.468 186.621 1.00 109.93 ? 363 LEU A CA  1 
ATOM   2814  C C   . LEU A 1 363 ? 131.008 -19.752 185.923 1.00 104.30 ? 363 LEU A C   1 
ATOM   2815  O O   . LEU A 1 363 ? 130.218 -20.680 185.742 1.00 106.51 ? 363 LEU A O   1 
ATOM   2816  C CB  . LEU A 1 363 ? 130.267 -17.411 185.566 1.00 110.22 ? 363 LEU A CB  1 
ATOM   2817  C CG  . LEU A 1 363 ? 129.645 -16.113 186.068 1.00 104.58 ? 363 LEU A CG  1 
ATOM   2818  C CD1 . LEU A 1 363 ? 129.877 -15.017 185.053 1.00 110.37 ? 363 LEU A CD1 1 
ATOM   2819  C CD2 . LEU A 1 363 ? 128.164 -16.284 186.343 1.00 88.46  ? 363 LEU A CD2 1 
ATOM   2820  N N   . PHE A 1 364 ? 132.278 -19.791 185.532 1.00 89.85  ? 364 PHE A N   1 
ATOM   2821  C CA  . PHE A 1 364 ? 132.848 -20.952 184.856 1.00 84.36  ? 364 PHE A CA  1 
ATOM   2822  C C   . PHE A 1 364 ? 132.903 -22.148 185.792 1.00 86.91  ? 364 PHE A C   1 
ATOM   2823  O O   . PHE A 1 364 ? 132.696 -23.284 185.369 1.00 87.12  ? 364 PHE A O   1 
ATOM   2824  C CB  . PHE A 1 364 ? 134.237 -20.632 184.304 1.00 85.70  ? 364 PHE A CB  1 
ATOM   2825  C CG  . PHE A 1 364 ? 134.204 -19.812 183.047 1.00 85.99  ? 364 PHE A CG  1 
ATOM   2826  C CD1 . PHE A 1 364 ? 133.866 -20.384 181.831 1.00 88.02  ? 364 PHE A CD1 1 
ATOM   2827  C CD2 . PHE A 1 364 ? 134.496 -18.461 183.088 1.00 86.30  ? 364 PHE A CD2 1 
ATOM   2828  C CE1 . PHE A 1 364 ? 133.827 -19.619 180.680 1.00 88.01  ? 364 PHE A CE1 1 
ATOM   2829  C CE2 . PHE A 1 364 ? 134.461 -17.695 181.947 1.00 87.36  ? 364 PHE A CE2 1 
ATOM   2830  C CZ  . PHE A 1 364 ? 134.127 -18.273 180.739 1.00 91.13  ? 364 PHE A CZ  1 
ATOM   2831  N N   . ALA A 1 365 ? 133.200 -21.890 187.063 1.00 87.29  ? 365 ALA A N   1 
ATOM   2832  C CA  . ALA A 1 365 ? 133.185 -22.941 188.078 1.00 85.79  ? 365 ALA A CA  1 
ATOM   2833  C C   . ALA A 1 365 ? 131.760 -23.464 188.287 1.00 105.50 ? 365 ALA A C   1 
ATOM   2834  O O   . ALA A 1 365 ? 131.542 -24.674 188.328 1.00 120.83 ? 365 ALA A O   1 
ATOM   2835  C CB  . ALA A 1 365 ? 133.777 -22.436 189.389 1.00 86.06  ? 365 ALA A CB  1 
ATOM   2836  N N   . ARG A 1 366 ? 130.800 -22.549 188.427 1.00 98.92  ? 366 ARG A N   1 
ATOM   2837  C CA  . ARG A 1 366 ? 129.387 -22.915 188.563 1.00 97.94  ? 366 ARG A CA  1 
ATOM   2838  C C   . ARG A 1 366 ? 128.898 -23.744 187.381 1.00 91.16  ? 366 ARG A C   1 
ATOM   2839  O O   . ARG A 1 366 ? 128.280 -24.796 187.560 1.00 101.51 ? 366 ARG A O   1 
ATOM   2840  C CB  . ARG A 1 366 ? 128.499 -21.667 188.703 1.00 123.19 ? 366 ARG A CB  1 
ATOM   2841  C CG  . ARG A 1 366 ? 128.466 -21.037 190.090 1.00 135.40 ? 366 ARG A CG  1 
ATOM   2842  C CD  . ARG A 1 366 ? 127.362 -19.987 190.200 1.00 132.01 ? 366 ARG A CD  1 
ATOM   2843  N NE  . ARG A 1 366 ? 127.614 -19.067 191.309 1.00 134.53 ? 366 ARG A NE  1 
ATOM   2844  C CZ  . ARG A 1 366 ? 126.758 -18.151 191.749 1.00 144.52 ? 366 ARG A CZ  1 
ATOM   2845  N NH1 . ARG A 1 366 ? 127.094 -17.374 192.766 1.00 149.00 ? 366 ARG A NH1 1 
ATOM   2846  N NH2 . ARG A 1 366 ? 125.582 -17.997 191.161 1.00 143.81 ? 366 ARG A NH2 1 
ATOM   2847  N N   . LYS A 1 367 ? 129.191 -23.275 186.172 1.00 89.10  ? 367 LYS A N   1 
ATOM   2848  C CA  . LYS A 1 367 ? 128.772 -23.981 184.966 1.00 90.80  ? 367 LYS A CA  1 
ATOM   2849  C C   . LYS A 1 367 ? 129.395 -25.376 184.888 1.00 104.64 ? 367 LYS A C   1 
ATOM   2850  O O   . LYS A 1 367 ? 128.768 -26.317 184.400 1.00 110.42 ? 367 LYS A O   1 
ATOM   2851  C CB  . LYS A 1 367 ? 129.130 -23.169 183.720 1.00 91.32  ? 367 LYS A CB  1 
ATOM   2852  C CG  . LYS A 1 367 ? 128.181 -22.007 183.444 1.00 100.93 ? 367 LYS A CG  1 
ATOM   2853  C CD  . LYS A 1 367 ? 126.985 -22.446 182.605 1.00 138.74 ? 367 LYS A CD  1 
ATOM   2854  C CE  . LYS A 1 367 ? 125.921 -21.358 182.534 1.00 147.44 ? 367 LYS A CE  1 
ATOM   2855  N NZ  . LYS A 1 367 ? 124.764 -21.764 181.687 1.00 140.33 ? 367 LYS A NZ  1 
ATOM   2856  N N   . PHE A 1 368 ? 130.623 -25.505 185.378 1.00 109.89 ? 368 PHE A N   1 
ATOM   2857  C CA  . PHE A 1 368 ? 131.312 -26.792 185.408 1.00 109.23 ? 368 PHE A CA  1 
ATOM   2858  C C   . PHE A 1 368 ? 130.700 -27.747 186.433 1.00 103.32 ? 368 PHE A C   1 
ATOM   2859  O O   . PHE A 1 368 ? 130.338 -28.874 186.098 1.00 102.01 ? 368 PHE A O   1 
ATOM   2860  C CB  . PHE A 1 368 ? 132.806 -26.594 185.677 1.00 106.86 ? 368 PHE A CB  1 
ATOM   2861  C CG  . PHE A 1 368 ? 133.597 -27.871 185.660 1.00 100.49 ? 368 PHE A CG  1 
ATOM   2862  C CD1 . PHE A 1 368 ? 133.981 -28.459 184.467 1.00 102.21 ? 368 PHE A CD1 1 
ATOM   2863  C CD2 . PHE A 1 368 ? 133.986 -28.466 186.849 1.00 101.83 ? 368 PHE A CD2 1 
ATOM   2864  C CE1 . PHE A 1 368 ? 134.709 -29.636 184.463 1.00 104.26 ? 368 PHE A CE1 1 
ATOM   2865  C CE2 . PHE A 1 368 ? 134.716 -29.634 186.853 1.00 104.92 ? 368 PHE A CE2 1 
ATOM   2866  C CZ  . PHE A 1 368 ? 135.080 -30.221 185.659 1.00 105.64 ? 368 PHE A CZ  1 
ATOM   2867  N N   . ASN A 1 369 ? 130.602 -27.300 187.681 1.00 98.37  ? 369 ASN A N   1 
ATOM   2868  C CA  . ASN A 1 369 ? 130.026 -28.123 188.737 1.00 104.36 ? 369 ASN A CA  1 
ATOM   2869  C C   . ASN A 1 369 ? 128.608 -28.577 188.409 1.00 115.43 ? 369 ASN A C   1 
ATOM   2870  O O   . ASN A 1 369 ? 128.211 -29.690 188.747 1.00 125.44 ? 369 ASN A O   1 
ATOM   2871  C CB  . ASN A 1 369 ? 130.037 -27.371 190.066 1.00 107.55 ? 369 ASN A CB  1 
ATOM   2872  C CG  . ASN A 1 369 ? 131.428 -26.963 190.484 1.00 108.15 ? 369 ASN A CG  1 
ATOM   2873  O OD1 . ASN A 1 369 ? 132.351 -27.778 190.478 1.00 105.15 ? 369 ASN A OD1 1 
ATOM   2874  N ND2 . ASN A 1 369 ? 131.592 -25.698 190.845 1.00 115.78 ? 369 ASN A ND2 1 
ATOM   2875  N N   . ALA A 1 370 ? 127.850 -27.710 187.744 1.00 106.91 ? 370 ALA A N   1 
ATOM   2876  C CA  . ALA A 1 370 ? 126.475 -28.024 187.358 1.00 106.64 ? 370 ALA A CA  1 
ATOM   2877  C C   . ALA A 1 370 ? 126.401 -29.118 186.293 1.00 119.47 ? 370 ALA A C   1 
ATOM   2878  O O   . ALA A 1 370 ? 125.559 -30.010 186.375 1.00 131.20 ? 370 ALA A O   1 
ATOM   2879  C CB  . ALA A 1 370 ? 125.768 -26.771 186.862 1.00 104.74 ? 370 ALA A CB  1 
ATOM   2880  N N   . LEU A 1 371 ? 127.282 -29.047 185.299 1.00 118.02 ? 371 LEU A N   1 
ATOM   2881  C CA  . LEU A 1 371 ? 127.324 -30.040 184.224 1.00 125.67 ? 371 LEU A CA  1 
ATOM   2882  C C   . LEU A 1 371 ? 127.923 -31.356 184.703 1.00 136.63 ? 371 LEU A C   1 
ATOM   2883  O O   . LEU A 1 371 ? 127.613 -32.424 184.174 1.00 138.70 ? 371 LEU A O   1 
ATOM   2884  C CB  . LEU A 1 371 ? 128.113 -29.503 183.027 1.00 120.17 ? 371 LEU A CB  1 
ATOM   2885  C CG  . LEU A 1 371 ? 127.320 -28.639 182.043 1.00 122.44 ? 371 LEU A CG  1 
ATOM   2886  C CD1 . LEU A 1 371 ? 128.232 -27.666 181.326 1.00 124.90 ? 371 LEU A CD1 1 
ATOM   2887  C CD2 . LEU A 1 371 ? 126.578 -29.510 181.042 1.00 128.32 ? 371 LEU A CD2 1 
ATOM   2888  N N   . PHE A 1 372 ? 128.777 -31.263 185.717 1.00 135.46 ? 372 PHE A N   1 
ATOM   2889  C CA  . PHE A 1 372 ? 129.419 -32.431 186.309 1.00 134.71 ? 372 PHE A CA  1 
ATOM   2890  C C   . PHE A 1 372 ? 128.367 -33.234 187.067 1.00 136.49 ? 372 PHE A C   1 
ATOM   2891  O O   . PHE A 1 372 ? 128.276 -34.455 186.938 1.00 137.01 ? 372 PHE A O   1 
ATOM   2892  C CB  . PHE A 1 372 ? 130.552 -31.996 187.242 1.00 132.48 ? 372 PHE A CB  1 
ATOM   2893  C CG  . PHE A 1 372 ? 131.551 -33.077 187.541 1.00 133.32 ? 372 PHE A CG  1 
ATOM   2894  C CD1 . PHE A 1 372 ? 132.631 -33.285 186.702 1.00 125.51 ? 372 PHE A CD1 1 
ATOM   2895  C CD2 . PHE A 1 372 ? 131.422 -33.872 188.667 1.00 142.80 ? 372 PHE A CD2 1 
ATOM   2896  C CE1 . PHE A 1 372 ? 133.557 -34.270 186.969 1.00 131.95 ? 372 PHE A CE1 1 
ATOM   2897  C CE2 . PHE A 1 372 ? 132.346 -34.862 188.943 1.00 141.25 ? 372 PHE A CE2 1 
ATOM   2898  C CZ  . PHE A 1 372 ? 133.416 -35.061 188.092 1.00 135.19 ? 372 PHE A CZ  1 
ATOM   2899  N N   . ALA A 1 373 ? 127.574 -32.522 187.860 1.00 134.90 ? 373 ALA A N   1 
ATOM   2900  C CA  . ALA A 1 373 ? 126.463 -33.103 188.604 1.00 133.82 ? 373 ALA A CA  1 
ATOM   2901  C C   . ALA A 1 373 ? 125.381 -33.594 187.645 1.00 133.53 ? 373 ALA A C   1 
ATOM   2902  O O   . ALA A 1 373 ? 124.645 -34.526 187.951 1.00 138.46 ? 373 ALA A O   1 
ATOM   2903  C CB  . ALA A 1 373 ? 125.889 -32.087 189.590 1.00 129.10 ? 373 ALA A CB  1 
ATOM   2904  N N   . GLN A 1 374 ? 125.289 -32.947 186.487 1.00 132.21 ? 374 GLN A N   1 
ATOM   2905  C CA  . GLN A 1 374 ? 124.282 -33.288 185.485 1.00 131.55 ? 374 GLN A CA  1 
ATOM   2906  C C   . GLN A 1 374 ? 124.567 -34.575 184.713 1.00 132.05 ? 374 GLN A C   1 
ATOM   2907  O O   . GLN A 1 374 ? 123.704 -35.071 183.989 1.00 131.29 ? 374 GLN A O   1 
ATOM   2908  C CB  . GLN A 1 374 ? 124.180 -32.155 184.457 1.00 136.21 ? 374 GLN A CB  1 
ATOM   2909  C CG  . GLN A 1 374 ? 122.868 -32.034 183.684 1.00 155.52 ? 374 GLN A CG  1 
ATOM   2910  C CD  . GLN A 1 374 ? 121.813 -31.237 184.417 1.00 164.97 ? 374 GLN A CD  1 
ATOM   2911  O OE1 . GLN A 1 374 ? 122.089 -30.145 184.911 1.00 167.65 ? 374 GLN A OE1 1 
ATOM   2912  N NE2 . GLN A 1 374 ? 120.590 -31.755 184.459 1.00 165.22 ? 374 GLN A NE2 1 
ATOM   2913  N N   . GLY A 1 375 ? 125.758 -35.136 184.885 1.00 140.08 ? 375 GLY A N   1 
ATOM   2914  C CA  . GLY A 1 375 ? 126.120 -36.349 184.174 1.00 149.88 ? 375 GLY A CA  1 
ATOM   2915  C C   . GLY A 1 375 ? 126.687 -36.027 182.801 1.00 158.36 ? 375 GLY A C   1 
ATOM   2916  O O   . GLY A 1 375 ? 127.312 -36.869 182.158 1.00 167.07 ? 375 GLY A O   1 
ATOM   2917  N N   . ASN A 1 376 ? 126.466 -34.800 182.340 1.00 154.58 ? 376 ASN A N   1 
ATOM   2918  C CA  . ASN A 1 376 ? 126.950 -34.412 181.023 1.00 151.02 ? 376 ASN A CA  1 
ATOM   2919  C C   . ASN A 1 376 ? 128.415 -34.033 181.167 1.00 149.41 ? 376 ASN A C   1 
ATOM   2920  O O   . ASN A 1 376 ? 128.755 -32.859 181.285 1.00 148.30 ? 376 ASN A O   1 
ATOM   2921  C CB  . ASN A 1 376 ? 126.122 -33.246 180.458 1.00 152.58 ? 376 ASN A CB  1 
ATOM   2922  C CG  . ASN A 1 376 ? 126.278 -33.073 178.956 1.00 159.06 ? 376 ASN A CG  1 
ATOM   2923  O OD1 . ASN A 1 376 ? 127.303 -33.429 178.375 1.00 157.24 ? 376 ASN A OD1 1 
ATOM   2924  N ND2 . ASN A 1 376 ? 125.249 -32.521 178.318 1.00 160.30 ? 376 ASN A ND2 1 
ATOM   2925  N N   . TYR A 1 377 ? 129.284 -35.037 181.101 1.00 145.58 ? 377 TYR A N   1 
ATOM   2926  C CA  . TYR A 1 377 ? 130.719 -34.831 181.270 1.00 139.27 ? 377 TYR A CA  1 
ATOM   2927  C C   . TYR A 1 377 ? 131.364 -34.333 179.985 1.00 139.40 ? 377 TYR A C   1 
ATOM   2928  O O   . TYR A 1 377 ? 132.434 -33.723 180.009 1.00 140.76 ? 377 TYR A O   1 
ATOM   2929  C CB  . TYR A 1 377 ? 131.400 -36.120 181.740 1.00 139.51 ? 377 TYR A CB  1 
ATOM   2930  C CG  . TYR A 1 377 ? 130.938 -36.600 183.099 1.00 137.95 ? 377 TYR A CG  1 
ATOM   2931  C CD1 . TYR A 1 377 ? 131.442 -36.042 184.268 1.00 142.15 ? 377 TYR A CD1 1 
ATOM   2932  C CD2 . TYR A 1 377 ? 130.009 -37.625 183.212 1.00 136.88 ? 377 TYR A CD2 1 
ATOM   2933  C CE1 . TYR A 1 377 ? 131.018 -36.485 185.513 1.00 147.08 ? 377 TYR A CE1 1 
ATOM   2934  C CE2 . TYR A 1 377 ? 129.581 -38.072 184.448 1.00 142.84 ? 377 TYR A CE2 1 
ATOM   2935  C CZ  . TYR A 1 377 ? 130.088 -37.501 185.593 1.00 150.50 ? 377 TYR A CZ  1 
ATOM   2936  O OH  . TYR A 1 377 ? 129.660 -37.954 186.819 1.00 157.84 ? 377 TYR A OH  1 
ATOM   2937  N N   . SER A 1 378 ? 130.716 -34.618 178.860 1.00 142.62 ? 378 SER A N   1 
ATOM   2938  C CA  . SER A 1 378 ? 131.207 -34.198 177.549 1.00 141.25 ? 378 SER A CA  1 
ATOM   2939  C C   . SER A 1 378 ? 131.208 -32.680 177.399 1.00 133.95 ? 378 SER A C   1 
ATOM   2940  O O   . SER A 1 378 ? 132.185 -32.094 176.932 1.00 123.69 ? 378 SER A O   1 
ATOM   2941  C CB  . SER A 1 378 ? 130.364 -34.823 176.439 1.00 144.50 ? 378 SER A CB  1 
ATOM   2942  O OG  . SER A 1 378 ? 130.767 -34.349 175.168 1.00 146.61 ? 378 SER A OG  1 
ATOM   2943  N N   . GLU A 1 379 ? 130.108 -32.053 177.804 1.00 142.41 ? 379 GLU A N   1 
ATOM   2944  C CA  . GLU A 1 379 ? 129.974 -30.600 177.740 1.00 143.57 ? 379 GLU A CA  1 
ATOM   2945  C C   . GLU A 1 379 ? 130.729 -29.922 178.876 1.00 127.86 ? 379 GLU A C   1 
ATOM   2946  O O   . GLU A 1 379 ? 131.232 -28.809 178.720 1.00 117.47 ? 379 GLU A O   1 
ATOM   2947  C CB  . GLU A 1 379 ? 128.499 -30.192 177.775 1.00 147.74 ? 379 GLU A CB  1 
ATOM   2948  C CG  . GLU A 1 379 ? 127.797 -30.231 176.424 1.00 152.97 ? 379 GLU A CG  1 
ATOM   2949  C CD  . GLU A 1 379 ? 128.459 -29.328 175.394 1.00 159.56 ? 379 GLU A CD  1 
ATOM   2950  O OE1 . GLU A 1 379 ? 128.794 -28.170 175.731 1.00 156.74 ? 379 GLU A OE1 1 
ATOM   2951  O OE2 . GLU A 1 379 ? 128.640 -29.770 174.241 1.00 164.19 ? 379 GLU A OE2 1 
ATOM   2952  N N   . ALA A 1 380 ? 130.789 -30.598 180.019 1.00 124.99 ? 380 ALA A N   1 
ATOM   2953  C CA  . ALA A 1 380 ? 131.531 -30.101 181.172 1.00 123.91 ? 380 ALA A CA  1 
ATOM   2954  C C   . ALA A 1 380 ? 132.997 -29.889 180.811 1.00 120.21 ? 380 ALA A C   1 
ATOM   2955  O O   . ALA A 1 380 ? 133.621 -28.925 181.250 1.00 111.55 ? 380 ALA A O   1 
ATOM   2956  C CB  . ALA A 1 380 ? 131.403 -31.064 182.348 1.00 128.76 ? 380 ALA A CB  1 
ATOM   2957  N N   . ALA A 1 381 ? 133.538 -30.798 180.007 1.00 125.25 ? 381 ALA A N   1 
ATOM   2958  C CA  . ALA A 1 381 ? 134.922 -30.706 179.550 1.00 114.41 ? 381 ALA A CA  1 
ATOM   2959  C C   . ALA A 1 381 ? 135.148 -29.483 178.662 1.00 112.00 ? 381 ALA A C   1 
ATOM   2960  O O   . ALA A 1 381 ? 136.168 -28.804 178.774 1.00 107.62 ? 381 ALA A O   1 
ATOM   2961  C CB  . ALA A 1 381 ? 135.321 -31.977 178.811 1.00 111.42 ? 381 ALA A CB  1 
ATOM   2962  N N   . LYS A 1 382 ? 134.190 -29.214 177.780 1.00 113.26 ? 382 LYS A N   1 
ATOM   2963  C CA  . LYS A 1 382 ? 134.273 -28.075 176.869 1.00 111.25 ? 382 LYS A CA  1 
ATOM   2964  C C   . LYS A 1 382 ? 134.348 -26.759 177.635 1.00 116.21 ? 382 LYS A C   1 
ATOM   2965  O O   . LYS A 1 382 ? 135.042 -25.827 177.229 1.00 105.49 ? 382 LYS A O   1 
ATOM   2966  C CB  . LYS A 1 382 ? 133.075 -28.057 175.922 1.00 112.68 ? 382 LYS A CB  1 
ATOM   2967  C CG  . LYS A 1 382 ? 133.073 -29.192 174.917 1.00 126.00 ? 382 LYS A CG  1 
ATOM   2968  C CD  . LYS A 1 382 ? 131.978 -28.992 173.884 1.00 133.91 ? 382 LYS A CD  1 
ATOM   2969  C CE  . LYS A 1 382 ? 131.887 -30.175 172.931 1.00 145.12 ? 382 LYS A CE  1 
ATOM   2970  N NZ  . LYS A 1 382 ? 131.219 -31.357 173.544 1.00 152.21 ? 382 LYS A NZ  1 
ATOM   2971  N N   . VAL A 1 383 ? 133.627 -26.695 178.749 1.00 124.33 ? 383 VAL A N   1 
ATOM   2972  C CA  . VAL A 1 383 ? 133.633 -25.512 179.601 1.00 116.14 ? 383 VAL A CA  1 
ATOM   2973  C C   . VAL A 1 383 ? 135.027 -25.263 180.163 1.00 110.97 ? 383 VAL A C   1 
ATOM   2974  O O   . VAL A 1 383 ? 135.517 -24.134 180.162 1.00 114.73 ? 383 VAL A O   1 
ATOM   2975  C CB  . VAL A 1 383 ? 132.638 -25.644 180.757 1.00 103.10 ? 383 VAL A CB  1 
ATOM   2976  C CG1 . VAL A 1 383 ? 132.713 -24.421 181.660 1.00 101.58 ? 383 VAL A CG1 1 
ATOM   2977  C CG2 . VAL A 1 383 ? 131.237 -25.823 180.213 1.00 103.54 ? 383 VAL A CG2 1 
ATOM   2978  N N   . ALA A 1 384 ? 135.650 -26.326 180.660 1.00 104.82 ? 384 ALA A N   1 
ATOM   2979  C CA  . ALA A 1 384 ? 137.005 -26.249 181.185 1.00 105.57 ? 384 ALA A CA  1 
ATOM   2980  C C   . ALA A 1 384 ? 137.991 -25.868 180.083 1.00 109.74 ? 384 ALA A C   1 
ATOM   2981  O O   . ALA A 1 384 ? 138.922 -25.097 180.313 1.00 108.53 ? 384 ALA A O   1 
ATOM   2982  C CB  . ALA A 1 384 ? 137.405 -27.571 181.825 1.00 107.38 ? 384 ALA A CB  1 
ATOM   2983  N N   . ALA A 1 385 ? 137.776 -26.412 178.887 1.00 117.07 ? 385 ALA A N   1 
ATOM   2984  C CA  . ALA A 1 385 ? 138.642 -26.144 177.737 1.00 116.59 ? 385 ALA A CA  1 
ATOM   2985  C C   . ALA A 1 385 ? 138.597 -24.690 177.273 1.00 120.51 ? 385 ALA A C   1 
ATOM   2986  O O   . ALA A 1 385 ? 139.627 -24.112 176.931 1.00 128.48 ? 385 ALA A O   1 
ATOM   2987  C CB  . ALA A 1 385 ? 138.277 -27.066 176.582 1.00 113.49 ? 385 ALA A CB  1 
ATOM   2988  N N   . ASN A 1 386 ? 137.409 -24.097 177.267 1.00 118.99 ? 386 ASN A N   1 
ATOM   2989  C CA  . ASN A 1 386 ? 137.271 -22.718 176.818 1.00 114.37 ? 386 ASN A CA  1 
ATOM   2990  C C   . ASN A 1 386 ? 137.204 -21.725 177.965 1.00 112.42 ? 386 ASN A C   1 
ATOM   2991  O O   . ASN A 1 386 ? 136.379 -20.810 177.971 1.00 110.68 ? 386 ASN A O   1 
ATOM   2992  C CB  . ASN A 1 386 ? 136.041 -22.558 175.925 1.00 115.16 ? 386 ASN A CB  1 
ATOM   2993  C CG  . ASN A 1 386 ? 136.154 -23.339 174.638 1.00 125.50 ? 386 ASN A CG  1 
ATOM   2994  O OD1 . ASN A 1 386 ? 136.604 -22.813 173.620 1.00 140.45 ? 386 ASN A OD1 1 
ATOM   2995  N ND2 . ASN A 1 386 ? 135.760 -24.605 174.675 1.00 127.86 ? 386 ASN A ND2 1 
ATOM   2996  N N   . ALA A 1 387 ? 138.071 -21.928 178.947 1.00 112.73 ? 387 ALA A N   1 
ATOM   2997  C CA  . ALA A 1 387 ? 138.244 -20.960 180.013 1.00 134.52 ? 387 ALA A CA  1 
ATOM   2998  C C   . ALA A 1 387 ? 139.039 -19.799 179.436 1.00 153.20 ? 387 ALA A C   1 
ATOM   2999  O O   . ALA A 1 387 ? 139.901 -20.013 178.582 1.00 171.69 ? 387 ALA A O   1 
ATOM   3000  C CB  . ALA A 1 387 ? 138.953 -21.579 181.204 1.00 145.95 ? 387 ALA A CB  1 
ATOM   3001  N N   . PRO A 1 388 ? 138.742 -18.568 179.880 1.00 142.37 ? 388 PRO A N   1 
ATOM   3002  C CA  . PRO A 1 388 ? 139.394 -17.387 179.304 1.00 143.25 ? 388 PRO A CA  1 
ATOM   3003  C C   . PRO A 1 388 ? 140.919 -17.430 179.407 1.00 159.83 ? 388 PRO A C   1 
ATOM   3004  O O   . PRO A 1 388 ? 141.601 -17.288 178.390 1.00 163.46 ? 388 PRO A O   1 
ATOM   3005  C CB  . PRO A 1 388 ? 138.828 -16.226 180.140 1.00 128.02 ? 388 PRO A CB  1 
ATOM   3006  C CG  . PRO A 1 388 ? 138.294 -16.857 181.386 1.00 133.10 ? 388 PRO A CG  1 
ATOM   3007  C CD  . PRO A 1 388 ? 137.833 -18.220 180.985 1.00 134.08 ? 388 PRO A CD  1 
ATOM   3008  N N   . LYS A 1 389 ? 141.447 -17.642 180.606 1.00 157.94 ? 389 LYS A N   1 
ATOM   3009  C CA  . LYS A 1 389 ? 142.894 -17.687 180.786 1.00 152.25 ? 389 LYS A CA  1 
ATOM   3010  C C   . LYS A 1 389 ? 143.345 -18.969 181.487 1.00 140.26 ? 389 LYS A C   1 
ATOM   3011  O O   . LYS A 1 389 ? 144.095 -18.927 182.464 1.00 129.25 ? 389 LYS A O   1 
ATOM   3012  C CB  . LYS A 1 389 ? 143.367 -16.445 181.542 1.00 149.64 ? 389 LYS A CB  1 
ATOM   3013  C CG  . LYS A 1 389 ? 143.218 -15.168 180.720 1.00 147.80 ? 389 LYS A CG  1 
ATOM   3014  C CD  . LYS A 1 389 ? 142.802 -13.972 181.560 1.00 149.60 ? 389 LYS A CD  1 
ATOM   3015  C CE  . LYS A 1 389 ? 142.631 -12.749 180.671 1.00 150.62 ? 389 LYS A CE  1 
ATOM   3016  N NZ  . LYS A 1 389 ? 142.354 -11.506 181.434 1.00 140.07 ? 389 LYS A NZ  1 
ATOM   3017  N N   . GLY A 1 390 ? 142.885 -20.104 180.959 1.00 134.34 ? 390 GLY A N   1 
ATOM   3018  C CA  . GLY A 1 390 ? 143.181 -21.422 181.499 1.00 127.56 ? 390 GLY A CA  1 
ATOM   3019  C C   . GLY A 1 390 ? 142.774 -21.581 182.949 1.00 128.03 ? 390 GLY A C   1 
ATOM   3020  O O   . GLY A 1 390 ? 143.465 -22.221 183.740 1.00 128.10 ? 390 GLY A O   1 
ATOM   3021  N N   . ILE A 1 391 ? 141.639 -20.985 183.294 1.00 130.33 ? 391 ILE A N   1 
ATOM   3022  C CA  . ILE A 1 391 ? 141.148 -20.990 184.669 1.00 127.52 ? 391 ILE A CA  1 
ATOM   3023  C C   . ILE A 1 391 ? 140.818 -22.387 185.186 1.00 114.08 ? 391 ILE A C   1 
ATOM   3024  O O   . ILE A 1 391 ? 141.146 -22.728 186.323 1.00 111.75 ? 391 ILE A O   1 
ATOM   3025  C CB  . ILE A 1 391 ? 139.905 -20.108 184.813 1.00 131.04 ? 391 ILE A CB  1 
ATOM   3026  C CG1 . ILE A 1 391 ? 140.057 -18.866 183.938 1.00 133.11 ? 391 ILE A CG1 1 
ATOM   3027  C CG2 . ILE A 1 391 ? 139.678 -19.753 186.273 1.00 126.85 ? 391 ILE A CG2 1 
ATOM   3028  C CD1 . ILE A 1 391 ? 141.182 -17.958 184.380 1.00 142.99 ? 391 ILE A CD1 1 
ATOM   3029  N N   . LEU A 1 392 ? 140.169 -23.188 184.347 1.00 109.74 ? 392 LEU A N   1 
ATOM   3030  C CA  . LEU A 1 392 ? 139.779 -24.545 184.724 1.00 108.55 ? 392 LEU A CA  1 
ATOM   3031  C C   . LEU A 1 392 ? 140.702 -25.615 184.157 1.00 111.70 ? 392 LEU A C   1 
ATOM   3032  O O   . LEU A 1 392 ? 140.404 -26.805 184.240 1.00 111.96 ? 392 LEU A O   1 
ATOM   3033  C CB  . LEU A 1 392 ? 138.344 -24.835 184.291 1.00 110.10 ? 392 LEU A CB  1 
ATOM   3034  C CG  . LEU A 1 392 ? 137.230 -24.172 185.097 1.00 109.10 ? 392 LEU A CG  1 
ATOM   3035  C CD1 . LEU A 1 392 ? 135.916 -24.274 184.348 1.00 108.15 ? 392 LEU A CD1 1 
ATOM   3036  C CD2 . LEU A 1 392 ? 137.121 -24.822 186.465 1.00 123.98 ? 392 LEU A CD2 1 
ATOM   3037  N N   . ARG A 1 393 ? 141.823 -25.184 183.590 1.00 116.30 ? 393 ARG A N   1 
ATOM   3038  C CA  . ARG A 1 393 ? 142.843 -26.097 183.081 1.00 120.90 ? 393 ARG A CA  1 
ATOM   3039  C C   . ARG A 1 393 ? 143.905 -26.332 184.149 1.00 122.40 ? 393 ARG A C   1 
ATOM   3040  O O   . ARG A 1 393 ? 145.058 -25.930 184.011 1.00 125.07 ? 393 ARG A O   1 
ATOM   3041  C CB  . ARG A 1 393 ? 143.478 -25.544 181.806 1.00 128.85 ? 393 ARG A CB  1 
ATOM   3042  C CG  . ARG A 1 393 ? 143.797 -26.589 180.749 1.00 131.37 ? 393 ARG A CG  1 
ATOM   3043  C CD  . ARG A 1 393 ? 144.414 -25.936 179.526 1.00 131.23 ? 393 ARG A CD  1 
ATOM   3044  N NE  . ARG A 1 393 ? 144.929 -26.910 178.570 1.00 132.05 ? 393 ARG A NE  1 
ATOM   3045  C CZ  . ARG A 1 393 ? 145.945 -26.662 177.751 1.00 140.32 ? 393 ARG A CZ  1 
ATOM   3046  N NH1 . ARG A 1 393 ? 146.377 -27.591 176.908 1.00 154.82 ? 393 ARG A NH1 1 
ATOM   3047  N NH2 . ARG A 1 393 ? 146.532 -25.474 177.784 1.00 136.36 ? 393 ARG A NH2 1 
ATOM   3048  N N   . THR A 1 394 ? 143.490 -27.014 185.211 1.00 122.59 ? 394 THR A N   1 
ATOM   3049  C CA  . THR A 1 394 ? 144.321 -27.247 186.388 1.00 119.69 ? 394 THR A CA  1 
ATOM   3050  C C   . THR A 1 394 ? 144.301 -28.716 186.815 1.00 123.83 ? 394 THR A C   1 
ATOM   3051  O O   . THR A 1 394 ? 143.465 -29.485 186.338 1.00 129.62 ? 394 THR A O   1 
ATOM   3052  C CB  . THR A 1 394 ? 143.849 -26.371 187.568 1.00 118.78 ? 394 THR A CB  1 
ATOM   3053  O OG1 . THR A 1 394 ? 142.453 -26.592 187.800 1.00 125.07 ? 394 THR A OG1 1 
ATOM   3054  C CG2 . THR A 1 394 ? 144.091 -24.897 187.270 1.00 115.12 ? 394 THR A CG2 1 
ATOM   3055  N N   . PRO A 1 395 ? 145.244 -29.124 187.687 1.00 121.42 ? 395 PRO A N   1 
ATOM   3056  C CA  . PRO A 1 395 ? 145.202 -30.514 188.153 1.00 119.02 ? 395 PRO A CA  1 
ATOM   3057  C C   . PRO A 1 395 ? 143.939 -30.869 188.945 1.00 123.15 ? 395 PRO A C   1 
ATOM   3058  O O   . PRO A 1 395 ? 143.512 -32.023 188.886 1.00 119.65 ? 395 PRO A O   1 
ATOM   3059  C CB  . PRO A 1 395 ? 146.449 -30.626 189.037 1.00 121.05 ? 395 PRO A CB  1 
ATOM   3060  C CG  . PRO A 1 395 ? 146.769 -29.229 189.430 1.00 122.76 ? 395 PRO A CG  1 
ATOM   3061  C CD  . PRO A 1 395 ? 146.422 -28.417 188.223 1.00 119.99 ? 395 PRO A CD  1 
ATOM   3062  N N   . ASP A 1 396 ? 143.362 -29.919 189.680 1.00 135.98 ? 396 ASP A N   1 
ATOM   3063  C CA  . ASP A 1 396 ? 142.144 -30.195 190.450 1.00 137.85 ? 396 ASP A CA  1 
ATOM   3064  C C   . ASP A 1 396 ? 141.031 -30.664 189.534 1.00 120.58 ? 396 ASP A C   1 
ATOM   3065  O O   . ASP A 1 396 ? 140.196 -31.477 189.919 1.00 115.45 ? 396 ASP A O   1 
ATOM   3066  C CB  . ASP A 1 396 ? 141.692 -28.961 191.219 1.00 147.48 ? 396 ASP A CB  1 
ATOM   3067  C CG  . ASP A 1 396 ? 142.701 -27.852 191.154 1.00 150.69 ? 396 ASP A CG  1 
ATOM   3068  O OD1 . ASP A 1 396 ? 143.910 -28.163 191.168 1.00 153.45 ? 396 ASP A OD1 1 
ATOM   3069  O OD2 . ASP A 1 396 ? 142.295 -26.674 191.080 1.00 145.88 ? 396 ASP A OD2 1 
ATOM   3070  N N   . THR A 1 397 ? 141.029 -30.144 188.312 1.00 112.62 ? 397 THR A N   1 
ATOM   3071  C CA  . THR A 1 397 ? 140.036 -30.529 187.322 1.00 111.98 ? 397 THR A CA  1 
ATOM   3072  C C   . THR A 1 397 ? 140.194 -31.990 186.935 1.00 116.16 ? 397 THR A C   1 
ATOM   3073  O O   . THR A 1 397 ? 139.221 -32.736 186.872 1.00 122.91 ? 397 THR A O   1 
ATOM   3074  C CB  . THR A 1 397 ? 140.144 -29.671 186.059 1.00 113.88 ? 397 THR A CB  1 
ATOM   3075  O OG1 . THR A 1 397 ? 140.149 -28.284 186.422 1.00 112.92 ? 397 THR A OG1 1 
ATOM   3076  C CG2 . THR A 1 397 ? 138.979 -29.959 185.127 1.00 111.31 ? 397 THR A CG2 1 
ATOM   3077  N N   . ILE A 1 398 ? 141.431 -32.382 186.654 1.00 118.21 ? 398 ILE A N   1 
ATOM   3078  C CA  . ILE A 1 398 ? 141.750 -33.759 186.295 1.00 119.49 ? 398 ILE A CA  1 
ATOM   3079  C C   . ILE A 1 398 ? 141.428 -34.709 187.442 1.00 122.25 ? 398 ILE A C   1 
ATOM   3080  O O   . ILE A 1 398 ? 140.959 -35.827 187.228 1.00 121.76 ? 398 ILE A O   1 
ATOM   3081  C CB  . ILE A 1 398 ? 143.227 -33.899 185.909 1.00 119.91 ? 398 ILE A CB  1 
ATOM   3082  C CG1 . ILE A 1 398 ? 143.563 -32.858 184.845 1.00 123.23 ? 398 ILE A CG1 1 
ATOM   3083  C CG2 . ILE A 1 398 ? 143.514 -35.301 185.392 1.00 121.87 ? 398 ILE A CG2 1 
ATOM   3084  C CD1 . ILE A 1 398 ? 144.997 -32.417 184.853 1.00 123.83 ? 398 ILE A CD1 1 
ATOM   3085  N N   . ARG A 1 399 ? 141.710 -34.255 188.657 1.00 130.97 ? 399 ARG A N   1 
ATOM   3086  C CA  . ARG A 1 399 ? 141.407 -35.002 189.871 1.00 136.61 ? 399 ARG A CA  1 
ATOM   3087  C C   . ARG A 1 399 ? 139.910 -35.269 190.000 1.00 125.19 ? 399 ARG A C   1 
ATOM   3088  O O   . ARG A 1 399 ? 139.493 -36.312 190.503 1.00 123.24 ? 399 ARG A O   1 
ATOM   3089  C CB  . ARG A 1 399 ? 141.911 -34.239 191.095 1.00 145.77 ? 399 ARG A CB  1 
ATOM   3090  C CG  . ARG A 1 399 ? 143.404 -34.379 191.320 1.00 146.21 ? 399 ARG A CG  1 
ATOM   3091  C CD  . ARG A 1 399 ? 143.969 -33.203 192.099 1.00 151.38 ? 399 ARG A CD  1 
ATOM   3092  N NE  . ARG A 1 399 ? 145.429 -33.200 192.080 1.00 164.39 ? 399 ARG A NE  1 
ATOM   3093  C CZ  . ARG A 1 399 ? 146.183 -32.162 192.427 1.00 163.72 ? 399 ARG A CZ  1 
ATOM   3094  N NH1 . ARG A 1 399 ? 147.505 -32.254 192.378 1.00 161.28 ? 399 ARG A NH1 1 
ATOM   3095  N NH2 . ARG A 1 399 ? 145.615 -31.031 192.824 1.00 156.74 ? 399 ARG A NH2 1 
ATOM   3096  N N   . ARG A 1 400 ? 139.105 -34.316 189.541 1.00 119.92 ? 400 ARG A N   1 
ATOM   3097  C CA  . ARG A 1 400 ? 137.656 -34.452 189.607 1.00 121.47 ? 400 ARG A CA  1 
ATOM   3098  C C   . ARG A 1 400 ? 137.203 -35.499 188.587 1.00 123.57 ? 400 ARG A C   1 
ATOM   3099  O O   . ARG A 1 400 ? 136.360 -36.350 188.880 1.00 127.82 ? 400 ARG A O   1 
ATOM   3100  C CB  . ARG A 1 400 ? 136.980 -33.107 189.338 1.00 119.92 ? 400 ARG A CB  1 
ATOM   3101  C CG  . ARG A 1 400 ? 136.714 -32.316 190.612 1.00 126.35 ? 400 ARG A CG  1 
ATOM   3102  C CD  . ARG A 1 400 ? 135.254 -32.188 191.004 1.00 127.83 ? 400 ARG A CD  1 
ATOM   3103  N NE  . ARG A 1 400 ? 134.524 -31.253 190.157 1.00 124.88 ? 400 ARG A NE  1 
ATOM   3104  C CZ  . ARG A 1 400 ? 133.206 -31.108 190.189 1.00 128.46 ? 400 ARG A CZ  1 
ATOM   3105  N NH1 . ARG A 1 400 ? 132.610 -30.240 189.384 1.00 142.10 ? 400 ARG A NH1 1 
ATOM   3106  N NH2 . ARG A 1 400 ? 132.486 -31.810 191.053 1.00 128.25 ? 400 ARG A NH2 1 
ATOM   3107  N N   . PHE A 1 401 ? 137.774 -35.415 187.384 1.00 126.91 ? 401 PHE A N   1 
ATOM   3108  C CA  . PHE A 1 401 ? 137.508 -36.356 186.285 1.00 130.35 ? 401 PHE A CA  1 
ATOM   3109  C C   . PHE A 1 401 ? 138.082 -37.738 186.567 1.00 142.00 ? 401 PHE A C   1 
ATOM   3110  O O   . PHE A 1 401 ? 137.675 -38.729 185.985 1.00 151.89 ? 401 PHE A O   1 
ATOM   3111  C CB  . PHE A 1 401 ? 138.063 -35.849 184.962 1.00 127.30 ? 401 PHE A CB  1 
ATOM   3112  C CG  . PHE A 1 401 ? 137.158 -34.870 184.258 1.00 124.46 ? 401 PHE A CG  1 
ATOM   3113  C CD1 . PHE A 1 401 ? 135.949 -35.282 183.714 1.00 124.31 ? 401 PHE A CD1 1 
ATOM   3114  C CD2 . PHE A 1 401 ? 137.540 -33.546 184.099 1.00 122.05 ? 401 PHE A CD2 1 
ATOM   3115  C CE1 . PHE A 1 401 ? 135.126 -34.383 183.059 1.00 123.07 ? 401 PHE A CE1 1 
ATOM   3116  C CE2 . PHE A 1 401 ? 136.721 -32.645 183.439 1.00 121.84 ? 401 PHE A CE2 1 
ATOM   3117  C CZ  . PHE A 1 401 ? 135.515 -33.064 182.920 1.00 120.82 ? 401 PHE A CZ  1 
ATOM   3118  N N   . GLN A 1 402 ? 139.143 -37.786 187.352 1.00 142.67 ? 402 GLN A N   1 
ATOM   3119  C CA  . GLN A 1 402 ? 139.710 -39.077 187.745 1.00 145.82 ? 402 GLN A CA  1 
ATOM   3120  C C   . GLN A 1 402 ? 138.810 -39.826 188.739 1.00 153.48 ? 402 GLN A C   1 
ATOM   3121  O O   . GLN A 1 402 ? 138.799 -41.057 188.780 1.00 162.94 ? 402 GLN A O   1 
ATOM   3122  C CB  . GLN A 1 402 ? 141.106 -38.881 188.334 1.00 144.62 ? 402 GLN A CB  1 
ATOM   3123  C CG  . GLN A 1 402 ? 142.100 -39.825 187.721 1.00 157.75 ? 402 GLN A CG  1 
ATOM   3124  C CD  . GLN A 1 402 ? 143.542 -39.438 187.980 1.00 169.51 ? 402 GLN A CD  1 
ATOM   3125  O OE1 . GLN A 1 402 ? 144.073 -39.607 189.083 1.00 177.63 ? 402 GLN A OE1 1 
ATOM   3126  N NE2 . GLN A 1 402 ? 144.190 -38.917 186.949 1.00 169.59 ? 402 GLN A NE2 1 
ATOM   3127  N N   . SER A 1 403 ? 138.041 -39.060 189.509 1.00 145.18 ? 403 SER A N   1 
ATOM   3128  C CA  . SER A 1 403 ? 137.116 -39.584 190.519 1.00 142.16 ? 403 SER A CA  1 
ATOM   3129  C C   . SER A 1 403 ? 135.911 -40.344 189.978 1.00 142.38 ? 403 SER A C   1 
ATOM   3130  O O   . SER A 1 403 ? 135.213 -41.014 190.724 1.00 145.06 ? 403 SER A O   1 
ATOM   3131  C CB  . SER A 1 403 ? 136.612 -38.441 191.401 1.00 146.90 ? 403 SER A CB  1 
ATOM   3132  O OG  . SER A 1 403 ? 137.679 -37.881 192.137 1.00 157.81 ? 403 SER A OG  1 
ATOM   3133  N N   . VAL A 1 404 ? 135.665 -40.230 188.686 1.00 142.96 ? 404 VAL A N   1 
ATOM   3134  C CA  . VAL A 1 404 ? 134.559 -40.933 188.078 1.00 152.31 ? 404 VAL A CA  1 
ATOM   3135  C C   . VAL A 1 404 ? 135.082 -42.163 187.376 1.00 163.88 ? 404 VAL A C   1 
ATOM   3136  O O   . VAL A 1 404 ? 136.171 -42.141 186.792 1.00 162.12 ? 404 VAL A O   1 
ATOM   3137  C CB  . VAL A 1 404 ? 133.803 -40.061 187.104 1.00 151.59 ? 404 VAL A CB  1 
ATOM   3138  C CG1 . VAL A 1 404 ? 132.955 -39.055 187.863 1.00 154.87 ? 404 VAL A CG1 1 
ATOM   3139  C CG2 . VAL A 1 404 ? 134.755 -39.385 186.180 1.00 148.07 ? 404 VAL A CG2 1 
ATOM   3140  N N   . PRO A 1 405 ? 134.297 -43.251 187.433 1.00 170.45 ? 405 PRO A N   1 
ATOM   3141  C CA  . PRO A 1 405 ? 134.787 -44.535 186.949 1.00 171.81 ? 405 PRO A CA  1 
ATOM   3142  C C   . PRO A 1 405 ? 134.741 -44.774 185.451 1.00 172.27 ? 405 PRO A C   1 
ATOM   3143  O O   . PRO A 1 405 ? 134.548 -43.879 184.621 1.00 172.58 ? 405 PRO A O   1 
ATOM   3144  C CB  . PRO A 1 405 ? 133.827 -45.510 187.627 1.00 172.78 ? 405 PRO A CB  1 
ATOM   3145  C CG  . PRO A 1 405 ? 132.524 -44.807 187.539 1.00 169.44 ? 405 PRO A CG  1 
ATOM   3146  C CD  . PRO A 1 405 ? 132.854 -43.335 187.758 1.00 166.60 ? 405 PRO A CD  1 
ATOM   3147  N N   . ALA A 1 406 ? 134.932 -46.047 185.146 1.00 175.06 ? 406 ALA A N   1 
ATOM   3148  C CA  . ALA A 1 406 ? 134.779 -46.579 183.830 1.00 175.68 ? 406 ALA A CA  1 
ATOM   3149  C C   . ALA A 1 406 ? 133.439 -47.213 183.919 1.00 181.18 ? 406 ALA A C   1 
ATOM   3150  O O   . ALA A 1 406 ? 133.190 -47.942 184.864 1.00 184.54 ? 406 ALA A O   1 
ATOM   3151  C CB  . ALA A 1 406 ? 135.868 -47.609 183.510 1.00 171.76 ? 406 ALA A CB  1 
ATOM   3152  N N   . GLN A 1 407 ? 132.565 -46.894 182.976 1.00 181.31 ? 407 GLN A N   1 
ATOM   3153  C CA  . GLN A 1 407 ? 131.174 -47.356 183.012 1.00 183.80 ? 407 GLN A CA  1 
ATOM   3154  C C   . GLN A 1 407 ? 130.992 -48.567 182.061 1.00 192.75 ? 407 GLN A C   1 
ATOM   3155  O O   . GLN A 1 407 ? 131.983 -49.080 181.534 1.00 188.33 ? 407 GLN A O   1 
ATOM   3156  C CB  . GLN A 1 407 ? 130.207 -46.204 182.649 1.00 178.03 ? 407 GLN A CB  1 
ATOM   3157  C CG  . GLN A 1 407 ? 129.979 -45.136 183.753 1.00 183.41 ? 407 GLN A CG  1 
ATOM   3158  C CD  . GLN A 1 407 ? 129.239 -45.665 184.968 1.00 180.04 ? 407 GLN A CD  1 
ATOM   3159  O OE1 . GLN A 1 407 ? 129.850 -45.999 185.982 1.00 179.11 ? 407 GLN A OE1 1 
ATOM   3160  N NE2 . GLN A 1 407 ? 127.919 -45.744 184.870 1.00 180.19 ? 407 GLN A NE2 1 
ATOM   3161  N N   . PRO A 1 408 ? 129.746 -49.089 181.872 1.00 192.09 ? 408 PRO A N   1 
ATOM   3162  C CA  . PRO A 1 408 ? 129.808 -50.201 180.906 1.00 193.28 ? 408 PRO A CA  1 
ATOM   3163  C C   . PRO A 1 408 ? 130.038 -49.796 179.441 1.00 192.55 ? 408 PRO A C   1 
ATOM   3164  O O   . PRO A 1 408 ? 129.093 -49.885 178.645 1.00 191.74 ? 408 PRO A O   1 
ATOM   3165  C CB  . PRO A 1 408 ? 128.417 -50.854 181.015 1.00 187.79 ? 408 PRO A CB  1 
ATOM   3166  C CG  . PRO A 1 408 ? 127.843 -50.375 182.267 1.00 184.26 ? 408 PRO A CG  1 
ATOM   3167  C CD  . PRO A 1 408 ? 128.403 -49.004 182.483 1.00 184.59 ? 408 PRO A CD  1 
ATOM   3168  N N   . GLY A 1 409 ? 131.242 -49.367 179.079 1.00 186.73 ? 409 GLY A N   1 
ATOM   3169  C CA  . GLY A 1 409 ? 131.537 -49.089 177.685 1.00 179.23 ? 409 GLY A CA  1 
ATOM   3170  C C   . GLY A 1 409 ? 131.359 -47.626 177.316 1.00 177.57 ? 409 GLY A C   1 
ATOM   3171  O O   . GLY A 1 409 ? 131.686 -47.221 176.200 1.00 180.68 ? 409 GLY A O   1 
ATOM   3172  N N   . GLN A 1 410 ? 130.828 -46.839 178.251 1.00 175.41 ? 410 GLN A N   1 
ATOM   3173  C CA  . GLN A 1 410 ? 130.563 -45.410 178.052 1.00 175.82 ? 410 GLN A CA  1 
ATOM   3174  C C   . GLN A 1 410 ? 131.749 -44.554 178.475 1.00 173.88 ? 410 GLN A C   1 
ATOM   3175  O O   . GLN A 1 410 ? 131.730 -43.328 178.374 1.00 161.67 ? 410 GLN A O   1 
ATOM   3176  C CB  . GLN A 1 410 ? 129.337 -44.994 178.866 1.00 178.16 ? 410 GLN A CB  1 
ATOM   3177  C CG  . GLN A 1 410 ? 128.562 -43.851 178.273 1.00 184.31 ? 410 GLN A CG  1 
ATOM   3178  C CD  . GLN A 1 410 ? 127.600 -44.323 177.211 1.00 192.65 ? 410 GLN A CD  1 
ATOM   3179  O OE1 . GLN A 1 410 ? 126.714 -45.134 177.480 1.00 199.88 ? 410 GLN A OE1 1 
ATOM   3180  N NE2 . GLN A 1 410 ? 127.777 -43.833 175.991 1.00 193.55 ? 410 GLN A NE2 1 
ATOM   3181  N N   . THR A 1 411 ? 132.774 -45.248 178.954 1.00 185.87 ? 411 THR A N   1 
ATOM   3182  C CA  . THR A 1 411 ? 134.011 -44.692 179.496 1.00 187.37 ? 411 THR A CA  1 
ATOM   3183  C C   . THR A 1 411 ? 134.773 -43.740 178.570 1.00 177.47 ? 411 THR A C   1 
ATOM   3184  O O   . THR A 1 411 ? 134.639 -43.829 177.353 1.00 165.23 ? 411 THR A O   1 
ATOM   3185  C CB  . THR A 1 411 ? 134.981 -45.853 179.857 1.00 171.86 ? 411 THR A CB  1 
ATOM   3186  O OG1 . THR A 1 411 ? 135.846 -46.121 178.745 1.00 167.95 ? 411 THR A OG1 1 
ATOM   3187  C CG2 . THR A 1 411 ? 134.226 -47.123 180.144 1.00 171.76 ? 411 THR A CG2 1 
ATOM   3188  N N   . SER A 1 412 ? 135.603 -42.848 179.116 1.00 173.77 ? 412 SER A N   1 
ATOM   3189  C CA  . SER A 1 412 ? 135.632 -42.444 180.527 1.00 167.32 ? 412 SER A CA  1 
ATOM   3190  C C   . SER A 1 412 ? 135.641 -40.911 180.548 1.00 166.08 ? 412 SER A C   1 
ATOM   3191  O O   . SER A 1 412 ? 136.208 -40.293 179.647 1.00 171.74 ? 412 SER A O   1 
ATOM   3192  C CB  . SER A 1 412 ? 136.836 -43.040 181.276 1.00 167.18 ? 412 SER A CB  1 
ATOM   3193  O OG  . SER A 1 412 ? 138.055 -42.423 180.920 1.00 171.47 ? 412 SER A OG  1 
ATOM   3194  N N   . PRO A 1 413 ? 134.976 -40.288 181.538 1.00 158.82 ? 413 PRO A N   1 
ATOM   3195  C CA  . PRO A 1 413 ? 134.914 -38.821 181.482 1.00 154.91 ? 413 PRO A CA  1 
ATOM   3196  C C   . PRO A 1 413 ? 136.292 -38.146 181.457 1.00 153.27 ? 413 PRO A C   1 
ATOM   3197  O O   . PRO A 1 413 ? 136.414 -37.083 180.846 1.00 154.03 ? 413 PRO A O   1 
ATOM   3198  C CB  . PRO A 1 413 ? 134.137 -38.459 182.751 1.00 153.68 ? 413 PRO A CB  1 
ATOM   3199  C CG  . PRO A 1 413 ? 133.329 -39.694 183.060 1.00 154.79 ? 413 PRO A CG  1 
ATOM   3200  C CD  . PRO A 1 413 ? 134.241 -40.828 182.695 1.00 155.20 ? 413 PRO A CD  1 
ATOM   3201  N N   . LEU A 1 414 ? 137.301 -38.741 182.087 1.00 152.32 ? 414 LEU A N   1 
ATOM   3202  C CA  . LEU A 1 414 ? 138.651 -38.190 182.004 1.00 150.60 ? 414 LEU A CA  1 
ATOM   3203  C C   . LEU A 1 414 ? 139.180 -38.363 180.576 1.00 158.38 ? 414 LEU A C   1 
ATOM   3204  O O   . LEU A 1 414 ? 139.867 -37.491 180.051 1.00 160.94 ? 414 LEU A O   1 
ATOM   3205  C CB  . LEU A 1 414 ? 139.597 -38.830 183.024 1.00 142.59 ? 414 LEU A CB  1 
ATOM   3206  C CG  . LEU A 1 414 ? 139.838 -40.333 183.047 1.00 147.57 ? 414 LEU A CG  1 
ATOM   3207  C CD1 . LEU A 1 414 ? 141.239 -40.587 183.559 1.00 155.16 ? 414 LEU A CD1 1 
ATOM   3208  C CD2 . LEU A 1 414 ? 138.820 -41.010 183.943 1.00 151.76 ? 414 LEU A CD2 1 
ATOM   3209  N N   . LEU A 1 415 ? 138.845 -39.490 179.950 1.00 157.42 ? 415 LEU A N   1 
ATOM   3210  C CA  . LEU A 1 415 ? 139.234 -39.743 178.560 1.00 153.60 ? 415 LEU A CA  1 
ATOM   3211  C C   . LEU A 1 415 ? 138.588 -38.713 177.638 1.00 149.35 ? 415 LEU A C   1 
ATOM   3212  O O   . LEU A 1 415 ? 139.225 -38.203 176.716 1.00 141.56 ? 415 LEU A O   1 
ATOM   3213  C CB  . LEU A 1 415 ? 138.825 -41.156 178.126 1.00 156.48 ? 415 LEU A CB  1 
ATOM   3214  C CG  . LEU A 1 415 ? 139.472 -41.775 176.884 1.00 162.67 ? 415 LEU A CG  1 
ATOM   3215  C CD1 . LEU A 1 415 ? 140.577 -42.746 177.266 1.00 160.55 ? 415 LEU A CD1 1 
ATOM   3216  C CD2 . LEU A 1 415 ? 138.418 -42.457 176.024 1.00 168.62 ? 415 LEU A CD2 1 
ATOM   3217  N N   . GLN A 1 416 ? 137.320 -38.409 177.897 1.00 149.74 ? 416 GLN A N   1 
ATOM   3218  C CA  . GLN A 1 416 ? 136.595 -37.403 177.130 1.00 143.71 ? 416 GLN A CA  1 
ATOM   3219  C C   . GLN A 1 416 ? 137.223 -36.017 177.276 1.00 133.30 ? 416 GLN A C   1 
ATOM   3220  O O   . GLN A 1 416 ? 137.367 -35.287 176.298 1.00 132.13 ? 416 GLN A O   1 
ATOM   3221  C CB  . GLN A 1 416 ? 135.127 -37.364 177.551 1.00 146.67 ? 416 GLN A CB  1 
ATOM   3222  C CG  . GLN A 1 416 ? 134.357 -38.612 177.175 1.00 152.92 ? 416 GLN A CG  1 
ATOM   3223  C CD  . GLN A 1 416 ? 132.860 -38.428 177.288 1.00 154.49 ? 416 GLN A CD  1 
ATOM   3224  O OE1 . GLN A 1 416 ? 132.240 -37.770 176.453 1.00 156.62 ? 416 GLN A OE1 1 
ATOM   3225  N NE2 . GLN A 1 416 ? 132.269 -39.012 178.323 1.00 155.24 ? 416 GLN A NE2 1 
ATOM   3226  N N   . TYR A 1 417 ? 137.600 -35.671 178.503 1.00 129.69 ? 417 TYR A N   1 
ATOM   3227  C CA  . TYR A 1 417 ? 138.205 -34.376 178.806 1.00 129.42 ? 417 TYR A CA  1 
ATOM   3228  C C   . TYR A 1 417 ? 139.486 -34.145 178.002 1.00 141.04 ? 417 TYR A C   1 
ATOM   3229  O O   . TYR A 1 417 ? 139.690 -33.069 177.437 1.00 139.16 ? 417 TYR A O   1 
ATOM   3230  C CB  . TYR A 1 417 ? 138.476 -34.273 180.310 1.00 127.64 ? 417 TYR A CB  1 
ATOM   3231  C CG  . TYR A 1 417 ? 139.211 -33.029 180.755 1.00 127.04 ? 417 TYR A CG  1 
ATOM   3232  C CD1 . TYR A 1 417 ? 138.706 -31.764 180.483 1.00 126.44 ? 417 TYR A CD1 1 
ATOM   3233  C CD2 . TYR A 1 417 ? 140.382 -33.121 181.494 1.00 128.00 ? 417 TYR A CD2 1 
ATOM   3234  C CE1 . TYR A 1 417 ? 139.366 -30.626 180.906 1.00 129.68 ? 417 TYR A CE1 1 
ATOM   3235  C CE2 . TYR A 1 417 ? 141.046 -31.990 181.924 1.00 127.47 ? 417 TYR A CE2 1 
ATOM   3236  C CZ  . TYR A 1 417 ? 140.533 -30.747 181.631 1.00 129.59 ? 417 TYR A CZ  1 
ATOM   3237  O OH  . TYR A 1 417 ? 141.203 -29.626 182.060 1.00 128.62 ? 417 TYR A OH  1 
ATOM   3238  N N   . PHE A 1 418 ? 140.347 -35.154 177.951 1.00 145.38 ? 418 PHE A N   1 
ATOM   3239  C CA  . PHE A 1 418 ? 141.580 -35.054 177.177 1.00 141.37 ? 418 PHE A CA  1 
ATOM   3240  C C   . PHE A 1 418 ? 141.314 -35.004 175.676 1.00 139.67 ? 418 PHE A C   1 
ATOM   3241  O O   . PHE A 1 418 ? 141.977 -34.262 174.950 1.00 137.96 ? 418 PHE A O   1 
ATOM   3242  C CB  . PHE A 1 418 ? 142.525 -36.219 177.492 1.00 139.60 ? 418 PHE A CB  1 
ATOM   3243  C CG  . PHE A 1 418 ? 143.134 -36.151 178.862 1.00 135.56 ? 418 PHE A CG  1 
ATOM   3244  C CD1 . PHE A 1 418 ? 144.049 -35.162 179.177 1.00 136.53 ? 418 PHE A CD1 1 
ATOM   3245  C CD2 . PHE A 1 418 ? 142.804 -37.082 179.827 1.00 137.29 ? 418 PHE A CD2 1 
ATOM   3246  C CE1 . PHE A 1 418 ? 144.610 -35.092 180.435 1.00 137.07 ? 418 PHE A CE1 1 
ATOM   3247  C CE2 . PHE A 1 418 ? 143.358 -37.021 181.086 1.00 138.87 ? 418 PHE A CE2 1 
ATOM   3248  C CZ  . PHE A 1 418 ? 144.266 -36.025 181.392 1.00 137.18 ? 418 PHE A CZ  1 
ATOM   3249  N N   . GLY A 1 419 ? 140.357 -35.806 175.217 1.00 138.92 ? 419 GLY A N   1 
ATOM   3250  C CA  . GLY A 1 419 ? 140.032 -35.880 173.802 1.00 144.05 ? 419 GLY A CA  1 
ATOM   3251  C C   . GLY A 1 419 ? 139.728 -34.544 173.145 1.00 146.38 ? 419 GLY A C   1 
ATOM   3252  O O   . GLY A 1 419 ? 140.216 -34.260 172.049 1.00 150.88 ? 419 GLY A O   1 
ATOM   3253  N N   . ILE A 1 420 ? 138.925 -33.716 173.801 1.00 144.95 ? 420 ILE A N   1 
ATOM   3254  C CA  . ILE A 1 420 ? 138.633 -32.394 173.262 1.00 146.21 ? 420 ILE A CA  1 
ATOM   3255  C C   . ILE A 1 420 ? 139.782 -31.416 173.561 1.00 134.68 ? 420 ILE A C   1 
ATOM   3256  O O   . ILE A 1 420 ? 140.029 -30.501 172.779 1.00 129.84 ? 420 ILE A O   1 
ATOM   3257  C CB  . ILE A 1 420 ? 137.265 -31.841 173.767 1.00 141.18 ? 420 ILE A CB  1 
ATOM   3258  C CG1 . ILE A 1 420 ? 137.434 -30.634 174.683 1.00 136.78 ? 420 ILE A CG1 1 
ATOM   3259  C CG2 . ILE A 1 420 ? 136.443 -32.933 174.427 1.00 131.38 ? 420 ILE A CG2 1 
ATOM   3260  C CD1 . ILE A 1 420 ? 137.535 -30.991 176.141 1.00 142.25 ? 420 ILE A CD1 1 
ATOM   3261  N N   . LEU A 1 421 ? 140.455 -31.589 174.700 1.00 128.91 ? 421 LEU A N   1 
ATOM   3262  C CA  . LEU A 1 421 ? 141.516 -30.662 175.094 1.00 131.32 ? 421 LEU A CA  1 
ATOM   3263  C C   . LEU A 1 421 ? 142.648 -30.478 174.096 1.00 138.44 ? 421 LEU A C   1 
ATOM   3264  O O   . LEU A 1 421 ? 143.039 -29.344 173.816 1.00 140.57 ? 421 LEU A O   1 
ATOM   3265  C CB  . LEU A 1 421 ? 142.155 -31.109 176.410 1.00 135.58 ? 421 LEU A CB  1 
ATOM   3266  C CG  . LEU A 1 421 ? 141.930 -30.238 177.639 1.00 142.09 ? 421 LEU A CG  1 
ATOM   3267  C CD1 . LEU A 1 421 ? 142.420 -30.966 178.862 1.00 151.22 ? 421 LEU A CD1 1 
ATOM   3268  C CD2 . LEU A 1 421 ? 142.667 -28.931 177.476 1.00 138.32 ? 421 LEU A CD2 1 
ATOM   3269  N N   . LEU A 1 422 ? 143.187 -31.572 173.567 1.00 140.67 ? 422 LEU A N   1 
ATOM   3270  C CA  . LEU A 1 422 ? 144.265 -31.456 172.588 1.00 145.67 ? 422 LEU A CA  1 
ATOM   3271  C C   . LEU A 1 422 ? 143.793 -30.784 171.303 1.00 146.84 ? 422 LEU A C   1 
ATOM   3272  O O   . LEU A 1 422 ? 144.602 -30.249 170.548 1.00 152.14 ? 422 LEU A O   1 
ATOM   3273  C CB  . LEU A 1 422 ? 144.903 -32.807 172.277 1.00 143.94 ? 422 LEU A CB  1 
ATOM   3274  C CG  . LEU A 1 422 ? 144.135 -34.108 172.458 1.00 141.84 ? 422 LEU A CG  1 
ATOM   3275  C CD1 . LEU A 1 422 ? 143.339 -34.448 171.214 1.00 146.82 ? 422 LEU A CD1 1 
ATOM   3276  C CD2 . LEU A 1 422 ? 145.130 -35.203 172.778 1.00 138.92 ? 422 LEU A CD2 1 
ATOM   3277  N N   . ASP A 1 423 ? 142.490 -30.830 171.037 1.00 140.93 ? 423 ASP A N   1 
ATOM   3278  C CA  . ASP A 1 423 ? 141.956 -30.208 169.825 1.00 134.52 ? 423 ASP A CA  1 
ATOM   3279  C C   . ASP A 1 423 ? 142.064 -28.695 169.862 1.00 127.51 ? 423 ASP A C   1 
ATOM   3280  O O   . ASP A 1 423 ? 142.032 -28.040 168.828 1.00 137.02 ? 423 ASP A O   1 
ATOM   3281  C CB  . ASP A 1 423 ? 140.482 -30.539 169.639 1.00 137.73 ? 423 ASP A CB  1 
ATOM   3282  C CG  . ASP A 1 423 ? 140.219 -32.005 169.589 1.00 137.88 ? 423 ASP A CG  1 
ATOM   3283  O OD1 . ASP A 1 423 ? 141.189 -32.788 169.560 1.00 136.75 ? 423 ASP A OD1 1 
ATOM   3284  O OD2 . ASP A 1 423 ? 139.028 -32.372 169.595 1.00 138.00 ? 423 ASP A OD2 1 
ATOM   3285  N N   . GLN A 1 424 ? 142.199 -28.142 171.058 1.00 123.88 ? 424 GLN A N   1 
ATOM   3286  C CA  . GLN A 1 424 ? 142.279 -26.698 171.228 1.00 125.73 ? 424 GLN A CA  1 
ATOM   3287  C C   . GLN A 1 424 ? 143.700 -26.180 171.065 1.00 143.30 ? 424 GLN A C   1 
ATOM   3288  O O   . GLN A 1 424 ? 143.940 -25.157 170.420 1.00 147.36 ? 424 GLN A O   1 
ATOM   3289  C CB  . GLN A 1 424 ? 141.765 -26.307 172.607 1.00 124.49 ? 424 GLN A CB  1 
ATOM   3290  C CG  . GLN A 1 424 ? 140.500 -27.050 173.036 1.00 132.64 ? 424 GLN A CG  1 
ATOM   3291  C CD  . GLN A 1 424 ? 139.210 -26.392 172.581 1.00 141.31 ? 424 GLN A CD  1 
ATOM   3292  O OE1 . GLN A 1 424 ? 138.882 -25.280 173.000 1.00 138.50 ? 424 GLN A OE1 1 
ATOM   3293  N NE2 . GLN A 1 424 ? 138.455 -27.090 171.738 1.00 139.89 ? 424 GLN A NE2 1 
ATOM   3294  N N   . GLY A 1 425 ? 144.638 -26.892 171.678 1.00 160.19 ? 425 GLY A N   1 
ATOM   3295  C CA  . GLY A 1 425 ? 146.033 -26.516 171.653 1.00 147.01 ? 425 GLY A CA  1 
ATOM   3296  C C   . GLY A 1 425 ? 146.891 -27.601 172.266 1.00 151.55 ? 425 GLY A C   1 
ATOM   3297  O O   . GLY A 1 425 ? 146.487 -28.762 172.393 1.00 156.06 ? 425 GLY A O   1 
ATOM   3298  N N   . GLN A 1 426 ? 148.095 -27.207 172.640 1.00 152.77 ? 426 GLN A N   1 
ATOM   3299  C CA  . GLN A 1 426 ? 149.076 -28.123 173.192 1.00 146.34 ? 426 GLN A CA  1 
ATOM   3300  C C   . GLN A 1 426 ? 148.894 -28.449 174.678 1.00 144.52 ? 426 GLN A C   1 
ATOM   3301  O O   . GLN A 1 426 ? 148.824 -27.549 175.511 1.00 146.18 ? 426 GLN A O   1 
ATOM   3302  C CB  . GLN A 1 426 ? 150.464 -27.549 172.931 1.00 145.93 ? 426 GLN A CB  1 
ATOM   3303  C CG  . GLN A 1 426 ? 151.276 -28.381 171.963 1.00 158.59 ? 426 GLN A CG  1 
ATOM   3304  C CD  . GLN A 1 426 ? 152.647 -27.789 171.706 1.00 167.34 ? 426 GLN A CD  1 
ATOM   3305  O OE1 . GLN A 1 426 ? 152.764 -26.612 171.364 1.00 170.56 ? 426 GLN A OE1 1 
ATOM   3306  N NE2 . GLN A 1 426 ? 153.691 -28.597 171.866 1.00 168.33 ? 426 GLN A NE2 1 
ATOM   3307  N N   . LEU A 1 427 ? 148.827 -29.739 175.008 1.00 140.74 ? 427 LEU A N   1 
ATOM   3308  C CA  . LEU A 1 427 ? 148.631 -30.134 176.401 1.00 133.00 ? 427 LEU A CA  1 
ATOM   3309  C C   . LEU A 1 427 ? 149.859 -29.863 177.257 1.00 130.14 ? 427 LEU A C   1 
ATOM   3310  O O   . LEU A 1 427 ? 150.990 -30.131 176.850 1.00 131.12 ? 427 LEU A O   1 
ATOM   3311  C CB  . LEU A 1 427 ? 148.278 -31.621 176.500 1.00 125.14 ? 427 LEU A CB  1 
ATOM   3312  C CG  . LEU A 1 427 ? 146.889 -32.115 176.099 1.00 128.99 ? 427 LEU A CG  1 
ATOM   3313  C CD1 . LEU A 1 427 ? 146.840 -33.626 176.242 1.00 128.38 ? 427 LEU A CD1 1 
ATOM   3314  C CD2 . LEU A 1 427 ? 145.792 -31.474 176.935 1.00 131.56 ? 427 LEU A CD2 1 
ATOM   3315  N N   . ASN A 1 428 ? 149.614 -29.358 178.462 1.00 132.47 ? 428 ASN A N   1 
ATOM   3316  C CA  . ASN A 1 428 ? 150.680 -29.037 179.402 1.00 138.87 ? 428 ASN A CA  1 
ATOM   3317  C C   . ASN A 1 428 ? 151.301 -30.290 180.017 1.00 139.79 ? 428 ASN A C   1 
ATOM   3318  O O   . ASN A 1 428 ? 150.654 -31.337 180.094 1.00 139.23 ? 428 ASN A O   1 
ATOM   3319  C CB  . ASN A 1 428 ? 150.164 -28.099 180.492 1.00 150.56 ? 428 ASN A CB  1 
ATOM   3320  C CG  . ASN A 1 428 ? 151.282 -27.485 181.305 1.00 168.97 ? 428 ASN A CG  1 
ATOM   3321  O OD1 . ASN A 1 428 ? 151.996 -26.603 180.827 1.00 184.62 ? 428 ASN A OD1 1 
ATOM   3322  N ND2 . ASN A 1 428 ? 151.427 -27.928 182.548 1.00 158.79 ? 428 ASN A ND2 1 
ATOM   3323  N N   . LYS A 1 429 ? 152.557 -30.161 180.441 1.00 133.73 ? 429 LYS A N   1 
ATOM   3324  C CA  . LYS A 1 429 ? 153.344 -31.239 181.047 1.00 115.66 ? 429 LYS A CA  1 
ATOM   3325  C C   . LYS A 1 429 ? 152.560 -32.209 181.944 1.00 117.31 ? 429 LYS A C   1 
ATOM   3326  O O   . LYS A 1 429 ? 152.662 -33.422 181.776 1.00 116.08 ? 429 LYS A O   1 
ATOM   3327  C CB  . LYS A 1 429 ? 154.507 -30.627 181.832 1.00 116.23 ? 429 LYS A CB  1 
ATOM   3328  C CG  . LYS A 1 429 ? 155.405 -29.757 180.962 1.00 125.39 ? 429 LYS A CG  1 
ATOM   3329  C CD  . LYS A 1 429 ? 156.641 -29.279 181.700 1.00 126.03 ? 429 LYS A CD  1 
ATOM   3330  C CE  . LYS A 1 429 ? 157.686 -28.784 180.714 1.00 127.55 ? 429 LYS A CE  1 
ATOM   3331  N NZ  . LYS A 1 429 ? 159.050 -28.795 181.305 1.00 138.11 ? 429 LYS A NZ  1 
ATOM   3332  N N   . TYR A 1 430 ? 151.777 -31.684 182.882 1.00 122.68 ? 430 TYR A N   1 
ATOM   3333  C CA  . TYR A 1 430 ? 151.006 -32.538 183.790 1.00 120.85 ? 430 TYR A CA  1 
ATOM   3334  C C   . TYR A 1 430 ? 149.889 -33.301 183.082 1.00 119.86 ? 430 TYR A C   1 
ATOM   3335  O O   . TYR A 1 430 ? 149.612 -34.460 183.404 1.00 118.93 ? 430 TYR A O   1 
ATOM   3336  C CB  . TYR A 1 430 ? 150.405 -31.713 184.928 1.00 119.39 ? 430 TYR A CB  1 
ATOM   3337  C CG  . TYR A 1 430 ? 149.750 -32.550 186.007 1.00 121.86 ? 430 TYR A CG  1 
ATOM   3338  C CD1 . TYR A 1 430 ? 150.513 -33.196 186.972 1.00 123.56 ? 430 TYR A CD1 1 
ATOM   3339  C CD2 . TYR A 1 430 ? 148.369 -32.684 186.067 1.00 138.02 ? 430 TYR A CD2 1 
ATOM   3340  C CE1 . TYR A 1 430 ? 149.920 -33.958 187.961 1.00 131.54 ? 430 TYR A CE1 1 
ATOM   3341  C CE2 . TYR A 1 430 ? 147.767 -33.444 187.054 1.00 151.29 ? 430 TYR A CE2 1 
ATOM   3342  C CZ  . TYR A 1 430 ? 148.547 -34.078 187.997 1.00 149.80 ? 430 TYR A CZ  1 
ATOM   3343  O OH  . TYR A 1 430 ? 147.949 -34.832 188.979 1.00 159.55 ? 430 TYR A OH  1 
ATOM   3344  N N   . GLU A 1 431 ? 149.247 -32.643 182.124 1.00 125.89 ? 431 GLU A N   1 
ATOM   3345  C CA  . GLU A 1 431 ? 148.161 -33.260 181.376 1.00 136.51 ? 431 GLU A CA  1 
ATOM   3346  C C   . GLU A 1 431 ? 148.683 -34.415 180.527 1.00 128.70 ? 431 GLU A C   1 
ATOM   3347  O O   . GLU A 1 431 ? 148.044 -35.460 180.430 1.00 121.75 ? 431 GLU A O   1 
ATOM   3348  C CB  . GLU A 1 431 ? 147.454 -32.225 180.509 1.00 141.70 ? 431 GLU A CB  1 
ATOM   3349  C CG  . GLU A 1 431 ? 146.678 -31.200 181.314 1.00 138.08 ? 431 GLU A CG  1 
ATOM   3350  C CD  . GLU A 1 431 ? 146.370 -29.955 180.523 1.00 136.52 ? 431 GLU A CD  1 
ATOM   3351  O OE1 . GLU A 1 431 ? 147.314 -29.345 179.980 1.00 122.38 ? 431 GLU A OE1 1 
ATOM   3352  O OE2 . GLU A 1 431 ? 145.180 -29.589 180.434 1.00 140.61 ? 431 GLU A OE2 1 
ATOM   3353  N N   . SER A 1 432 ? 149.846 -34.216 179.913 1.00 131.01 ? 432 SER A N   1 
ATOM   3354  C CA  . SER A 1 432 ? 150.496 -35.252 179.110 1.00 126.19 ? 432 SER A CA  1 
ATOM   3355  C C   . SER A 1 432 ? 150.850 -36.479 179.945 1.00 124.95 ? 432 SER A C   1 
ATOM   3356  O O   . SER A 1 432 ? 150.698 -37.615 179.498 1.00 130.23 ? 432 SER A O   1 
ATOM   3357  C CB  . SER A 1 432 ? 151.758 -34.702 178.449 1.00 116.81 ? 432 SER A CB  1 
ATOM   3358  O OG  . SER A 1 432 ? 151.482 -33.503 177.747 1.00 120.24 ? 432 SER A OG  1 
ATOM   3359  N N   . LEU A 1 433 ? 151.325 -36.236 181.162 1.00 117.19 ? 433 LEU A N   1 
ATOM   3360  C CA  . LEU A 1 433 ? 151.702 -37.304 182.080 1.00 125.67 ? 433 LEU A CA  1 
ATOM   3361  C C   . LEU A 1 433 ? 150.508 -38.182 182.438 1.00 138.11 ? 433 LEU A C   1 
ATOM   3362  O O   . LEU A 1 433 ? 150.568 -39.406 182.317 1.00 145.92 ? 433 LEU A O   1 
ATOM   3363  C CB  . LEU A 1 433 ? 152.323 -36.714 183.351 1.00 128.34 ? 433 LEU A CB  1 
ATOM   3364  C CG  . LEU A 1 433 ? 153.833 -36.466 183.332 1.00 117.02 ? 433 LEU A CG  1 
ATOM   3365  C CD1 . LEU A 1 433 ? 154.193 -35.367 184.315 1.00 116.90 ? 433 LEU A CD1 1 
ATOM   3366  C CD2 . LEU A 1 433 ? 154.591 -37.742 183.654 1.00 117.39 ? 433 LEU A CD2 1 
ATOM   3367  N N   . GLU A 1 434 ? 149.424 -37.548 182.878 1.00 135.42 ? 434 GLU A N   1 
ATOM   3368  C CA  . GLU A 1 434 ? 148.218 -38.262 183.304 1.00 135.48 ? 434 GLU A CA  1 
ATOM   3369  C C   . GLU A 1 434 ? 147.491 -38.919 182.130 1.00 127.68 ? 434 GLU A C   1 
ATOM   3370  O O   . GLU A 1 434 ? 146.707 -39.851 182.316 1.00 128.19 ? 434 GLU A O   1 
ATOM   3371  C CB  . GLU A 1 434 ? 147.265 -37.314 184.027 1.00 143.00 ? 434 GLU A CB  1 
ATOM   3372  C CG  . GLU A 1 434 ? 147.840 -36.705 185.301 1.00 150.43 ? 434 GLU A CG  1 
ATOM   3373  C CD  . GLU A 1 434 ? 148.139 -37.732 186.375 1.00 155.83 ? 434 GLU A CD  1 
ATOM   3374  O OE1 . GLU A 1 434 ? 147.260 -38.564 186.692 1.00 153.77 ? 434 GLU A OE1 1 
ATOM   3375  O OE2 . GLU A 1 434 ? 149.268 -37.709 186.908 1.00 161.22 ? 434 GLU A OE2 1 
ATOM   3376  N N   . LEU A 1 435 ? 147.770 -38.437 180.923 1.00 125.64 ? 435 LEU A N   1 
ATOM   3377  C CA  . LEU A 1 435 ? 147.174 -38.989 179.705 1.00 128.74 ? 435 LEU A CA  1 
ATOM   3378  C C   . LEU A 1 435 ? 147.756 -40.321 179.280 1.00 141.61 ? 435 LEU A C   1 
ATOM   3379  O O   . LEU A 1 435 ? 147.029 -41.231 178.898 1.00 140.74 ? 435 LEU A O   1 
ATOM   3380  C CB  . LEU A 1 435 ? 147.342 -38.002 178.549 1.00 126.98 ? 435 LEU A CB  1 
ATOM   3381  C CG  . LEU A 1 435 ? 146.923 -38.451 177.141 1.00 129.91 ? 435 LEU A CG  1 
ATOM   3382  C CD1 . LEU A 1 435 ? 145.416 -38.610 176.941 1.00 132.08 ? 435 LEU A CD1 1 
ATOM   3383  C CD2 . LEU A 1 435 ? 147.497 -37.470 176.133 1.00 130.20 ? 435 LEU A CD2 1 
ATOM   3384  N N   . CYS A 1 436 ? 149.072 -40.432 179.368 1.00 142.12 ? 436 CYS A N   1 
ATOM   3385  C CA  . CYS A 1 436 ? 149.790 -41.624 178.927 1.00 132.71 ? 436 CYS A CA  1 
ATOM   3386  C C   . CYS A 1 436 ? 149.797 -42.774 179.932 1.00 132.45 ? 436 CYS A C   1 
ATOM   3387  O O   . CYS A 1 436 ? 149.979 -43.927 179.551 1.00 136.09 ? 436 CYS A O   1 
ATOM   3388  C CB  . CYS A 1 436 ? 151.223 -41.248 178.564 1.00 131.54 ? 436 CYS A CB  1 
ATOM   3389  S SG  . CYS A 1 436 ? 151.324 -39.933 177.333 1.00 135.98 ? 436 CYS A SG  1 
ATOM   3390  N N   . ARG A 1 437 ? 149.600 -42.456 181.208 1.00 132.45 ? 437 ARG A N   1 
ATOM   3391  C CA  . ARG A 1 437 ? 149.639 -43.466 182.264 1.00 139.09 ? 437 ARG A CA  1 
ATOM   3392  C C   . ARG A 1 437 ? 148.664 -44.634 182.036 1.00 150.42 ? 437 ARG A C   1 
ATOM   3393  O O   . ARG A 1 437 ? 149.077 -45.793 182.115 1.00 151.35 ? 437 ARG A O   1 
ATOM   3394  C CB  . ARG A 1 437 ? 149.390 -42.815 183.635 1.00 141.45 ? 437 ARG A CB  1 
ATOM   3395  C CG  . ARG A 1 437 ? 150.667 -42.295 184.282 1.00 131.39 ? 437 ARG A CG  1 
ATOM   3396  C CD  . ARG A 1 437 ? 150.443 -41.786 185.693 1.00 132.40 ? 437 ARG A CD  1 
ATOM   3397  N NE  . ARG A 1 437 ? 151.667 -41.239 186.274 1.00 134.54 ? 437 ARG A NE  1 
ATOM   3398  C CZ  . ARG A 1 437 ? 152.005 -39.954 186.240 1.00 137.24 ? 437 ARG A CZ  1 
ATOM   3399  N NH1 . ARG A 1 437 ? 151.210 -39.069 185.652 1.00 136.50 ? 437 ARG A NH1 1 
ATOM   3400  N NH2 . ARG A 1 437 ? 153.139 -39.552 186.796 1.00 137.00 ? 437 ARG A NH2 1 
ATOM   3401  N N   . PRO A 1 438 ? 147.371 -44.355 181.756 1.00 155.12 ? 438 PRO A N   1 
ATOM   3402  C CA  . PRO A 1 438 ? 146.505 -45.514 181.503 1.00 156.65 ? 438 PRO A CA  1 
ATOM   3403  C C   . PRO A 1 438 ? 146.688 -46.101 180.106 1.00 156.29 ? 438 PRO A C   1 
ATOM   3404  O O   . PRO A 1 438 ? 146.259 -47.225 179.849 1.00 160.91 ? 438 PRO A O   1 
ATOM   3405  C CB  . PRO A 1 438 ? 145.085 -44.945 181.651 1.00 153.58 ? 438 PRO A CB  1 
ATOM   3406  C CG  . PRO A 1 438 ? 145.249 -43.519 182.108 1.00 152.22 ? 438 PRO A CG  1 
ATOM   3407  C CD  . PRO A 1 438 ? 146.607 -43.102 181.660 1.00 149.94 ? 438 PRO A CD  1 
ATOM   3408  N N   . VAL A 1 439 ? 147.322 -45.346 179.214 1.00 145.65 ? 439 VAL A N   1 
ATOM   3409  C CA  . VAL A 1 439 ? 147.536 -45.823 177.852 1.00 147.54 ? 439 VAL A CA  1 
ATOM   3410  C C   . VAL A 1 439 ? 148.681 -46.803 177.779 1.00 151.26 ? 439 VAL A C   1 
ATOM   3411  O O   . VAL A 1 439 ? 148.604 -47.829 177.113 1.00 157.25 ? 439 VAL A O   1 
ATOM   3412  C CB  . VAL A 1 439 ? 147.860 -44.664 176.894 1.00 143.47 ? 439 VAL A CB  1 
ATOM   3413  C CG1 . VAL A 1 439 ? 148.144 -45.182 175.489 1.00 139.94 ? 439 VAL A CG1 1 
ATOM   3414  C CG2 . VAL A 1 439 ? 146.765 -43.627 176.916 1.00 140.85 ? 439 VAL A CG2 1 
ATOM   3415  N N   . LEU A 1 440 ? 149.739 -46.477 178.502 1.00 145.05 ? 440 LEU A N   1 
ATOM   3416  C CA  . LEU A 1 440 ? 150.929 -47.303 178.568 1.00 145.66 ? 440 LEU A CA  1 
ATOM   3417  C C   . LEU A 1 440 ? 150.648 -48.544 179.409 1.00 151.54 ? 440 LEU A C   1 
ATOM   3418  O O   . LEU A 1 440 ? 151.262 -49.597 179.222 1.00 153.35 ? 440 LEU A O   1 
ATOM   3419  C CB  . LEU A 1 440 ? 152.110 -46.503 179.124 1.00 140.12 ? 440 LEU A CB  1 
ATOM   3420  C CG  . LEU A 1 440 ? 152.656 -45.470 178.130 1.00 134.25 ? 440 LEU A CG  1 
ATOM   3421  C CD1 . LEU A 1 440 ? 153.274 -44.275 178.841 1.00 132.65 ? 440 LEU A CD1 1 
ATOM   3422  C CD2 . LEU A 1 440 ? 153.648 -46.107 177.167 1.00 134.73 ? 440 LEU A CD2 1 
ATOM   3423  N N   . GLN A 1 441 ? 149.714 -48.393 180.346 1.00 146.44 ? 441 GLN A N   1 
ATOM   3424  C CA  . GLN A 1 441 ? 149.327 -49.450 181.286 1.00 156.90 ? 441 GLN A CA  1 
ATOM   3425  C C   . GLN A 1 441 ? 148.974 -50.824 180.703 1.00 167.13 ? 441 GLN A C   1 
ATOM   3426  O O   . GLN A 1 441 ? 149.466 -51.836 181.201 1.00 170.41 ? 441 GLN A O   1 
ATOM   3427  C CB  . GLN A 1 441 ? 148.139 -48.964 182.108 1.00 167.65 ? 441 GLN A CB  1 
ATOM   3428  C CG  . GLN A 1 441 ? 147.693 -49.940 183.172 1.00 170.80 ? 441 GLN A CG  1 
ATOM   3429  C CD  . GLN A 1 441 ? 148.595 -49.905 184.381 1.00 167.00 ? 441 GLN A CD  1 
ATOM   3430  O OE1 . GLN A 1 441 ? 148.593 -48.933 185.135 1.00 158.66 ? 441 GLN A OE1 1 
ATOM   3431  N NE2 . GLN A 1 441 ? 149.386 -50.955 184.566 1.00 171.23 ? 441 GLN A NE2 1 
ATOM   3432  N N   . GLN A 1 442 ? 148.154 -50.889 179.658 1.00 171.13 ? 442 GLN A N   1 
ATOM   3433  C CA  . GLN A 1 442 ? 147.860 -52.199 179.065 1.00 168.47 ? 442 GLN A CA  1 
ATOM   3434  C C   . GLN A 1 442 ? 148.277 -52.284 177.600 1.00 160.11 ? 442 GLN A C   1 
ATOM   3435  O O   . GLN A 1 442 ? 147.464 -52.099 176.685 1.00 151.86 ? 442 GLN A O   1 
ATOM   3436  C CB  . GLN A 1 442 ? 146.377 -52.579 179.227 1.00 169.61 ? 442 GLN A CB  1 
ATOM   3437  C CG  . GLN A 1 442 ? 145.988 -52.951 180.647 1.00 174.03 ? 442 GLN A CG  1 
ATOM   3438  C CD  . GLN A 1 442 ? 144.520 -53.327 180.775 1.00 181.34 ? 442 GLN A CD  1 
ATOM   3439  O OE1 . GLN A 1 442 ? 143.668 -52.789 180.071 1.00 178.22 ? 442 GLN A OE1 1 
ATOM   3440  N NE2 . GLN A 1 442 ? 144.220 -54.264 181.672 1.00 187.76 ? 442 GLN A NE2 1 
ATOM   3441  N N   . GLY A 1 443 ? 149.566 -52.556 177.415 1.00 158.46 ? 443 GLY A N   1 
ATOM   3442  C CA  . GLY A 1 443 ? 150.169 -52.790 176.115 1.00 164.60 ? 443 GLY A CA  1 
ATOM   3443  C C   . GLY A 1 443 ? 149.798 -51.913 174.935 1.00 173.58 ? 443 GLY A C   1 
ATOM   3444  O O   . GLY A 1 443 ? 149.719 -52.386 173.803 1.00 178.12 ? 443 GLY A O   1 
ATOM   3445  N N   . ARG A 1 444 ? 149.573 -50.631 175.190 1.00 170.91 ? 444 ARG A N   1 
ATOM   3446  C CA  . ARG A 1 444 ? 149.219 -49.706 174.117 1.00 162.25 ? 444 ARG A CA  1 
ATOM   3447  C C   . ARG A 1 444 ? 150.238 -48.563 174.063 1.00 167.34 ? 444 ARG A C   1 
ATOM   3448  O O   . ARG A 1 444 ? 150.301 -47.741 174.980 1.00 176.91 ? 444 ARG A O   1 
ATOM   3449  C CB  . ARG A 1 444 ? 147.805 -49.153 174.310 1.00 146.45 ? 444 ARG A CB  1 
ATOM   3450  N N   . LYS A 1 445 ? 151.046 -48.518 173.004 1.00 158.11 ? 445 LYS A N   1 
ATOM   3451  C CA  . LYS A 1 445 ? 152.046 -47.458 172.851 1.00 149.04 ? 445 LYS A CA  1 
ATOM   3452  C C   . LYS A 1 445 ? 152.004 -46.727 171.504 1.00 152.44 ? 445 LYS A C   1 
ATOM   3453  O O   . LYS A 1 445 ? 152.574 -45.642 171.370 1.00 162.78 ? 445 LYS A O   1 
ATOM   3454  C CB  . LYS A 1 445 ? 153.458 -48.011 173.071 1.00 139.44 ? 445 LYS A CB  1 
ATOM   3455  C CG  . LYS A 1 445 ? 153.561 -49.500 173.330 1.00 147.63 ? 445 LYS A CG  1 
ATOM   3456  C CD  . LYS A 1 445 ? 154.779 -50.083 172.626 1.00 156.40 ? 445 LYS A CD  1 
ATOM   3457  C CE  . LYS A 1 445 ? 154.924 -51.564 172.906 1.00 165.83 ? 445 LYS A CE  1 
ATOM   3458  N NZ  . LYS A 1 445 ? 154.959 -51.780 174.377 1.00 171.16 ? 445 LYS A NZ  1 
ATOM   3459  N N   . GLN A 1 446 ? 151.346 -47.313 170.510 1.00 139.34 ? 446 GLN A N   1 
ATOM   3460  C CA  . GLN A 1 446 ? 151.309 -46.722 169.172 1.00 138.30 ? 446 GLN A CA  1 
ATOM   3461  C C   . GLN A 1 446 ? 150.646 -45.337 169.163 1.00 146.99 ? 446 GLN A C   1 
ATOM   3462  O O   . GLN A 1 446 ? 151.051 -44.466 168.396 1.00 141.25 ? 446 GLN A O   1 
ATOM   3463  C CB  . GLN A 1 446 ? 150.602 -47.655 168.187 1.00 141.28 ? 446 GLN A CB  1 
ATOM   3464  N N   . LEU A 1 447 ? 149.629 -45.134 170.000 1.00 163.30 ? 447 LEU A N   1 
ATOM   3465  C CA  . LEU A 1 447 ? 148.936 -43.838 170.064 1.00 156.96 ? 447 LEU A CA  1 
ATOM   3466  C C   . LEU A 1 447 ? 149.890 -42.684 170.334 1.00 146.69 ? 447 LEU A C   1 
ATOM   3467  O O   . LEU A 1 447 ? 149.664 -41.559 169.879 1.00 147.44 ? 447 LEU A O   1 
ATOM   3468  C CB  . LEU A 1 447 ? 147.842 -43.836 171.133 1.00 148.69 ? 447 LEU A CB  1 
ATOM   3469  C CG  . LEU A 1 447 ? 146.418 -44.235 170.750 1.00 150.02 ? 447 LEU A CG  1 
ATOM   3470  C CD1 . LEU A 1 447 ? 145.731 -44.976 171.880 1.00 155.57 ? 447 LEU A CD1 1 
ATOM   3471  C CD2 . LEU A 1 447 ? 145.628 -42.982 170.376 1.00 146.53 ? 447 LEU A CD2 1 
ATOM   3472  N N   . LEU A 1 448 ? 150.942 -42.960 171.094 1.00 134.69 ? 448 LEU A N   1 
ATOM   3473  C CA  . LEU A 1 448 ? 151.942 -41.948 171.388 1.00 132.35 ? 448 LEU A CA  1 
ATOM   3474  C C   . LEU A 1 448 ? 152.645 -41.488 170.115 1.00 131.35 ? 448 LEU A C   1 
ATOM   3475  O O   . LEU A 1 448 ? 152.965 -40.312 169.978 1.00 130.16 ? 448 LEU A O   1 
ATOM   3476  C CB  . LEU A 1 448 ? 152.963 -42.476 172.396 1.00 129.57 ? 448 LEU A CB  1 
ATOM   3477  C CG  . LEU A 1 448 ? 152.518 -42.532 173.856 1.00 131.87 ? 448 LEU A CG  1 
ATOM   3478  C CD1 . LEU A 1 448 ? 152.095 -43.940 174.220 1.00 143.60 ? 448 LEU A CD1 1 
ATOM   3479  C CD2 . LEU A 1 448 ? 153.643 -42.052 174.747 1.00 130.51 ? 448 LEU A CD2 1 
ATOM   3480  N N   . GLU A 1 449 ? 152.868 -42.412 169.183 1.00 131.46 ? 449 GLU A N   1 
ATOM   3481  C CA  . GLU A 1 449 ? 153.529 -42.084 167.917 1.00 135.88 ? 449 GLU A CA  1 
ATOM   3482  C C   . GLU A 1 449 ? 152.827 -40.944 167.177 1.00 140.61 ? 449 GLU A C   1 
ATOM   3483  O O   . GLU A 1 449 ? 153.478 -40.010 166.712 1.00 148.26 ? 449 GLU A O   1 
ATOM   3484  C CB  . GLU A 1 449 ? 153.621 -43.316 167.013 1.00 138.75 ? 449 GLU A CB  1 
ATOM   3485  C CG  . GLU A 1 449 ? 154.692 -44.295 167.450 1.00 138.03 ? 449 GLU A CG  1 
ATOM   3486  C CD  . GLU A 1 449 ? 154.712 -45.549 166.609 1.00 150.16 ? 449 GLU A CD  1 
ATOM   3487  O OE1 . GLU A 1 449 ? 154.864 -45.428 165.375 1.00 165.67 ? 449 GLU A OE1 1 
ATOM   3488  O OE2 . GLU A 1 449 ? 154.558 -46.650 167.176 1.00 148.73 ? 449 GLU A OE2 1 
ATOM   3489  N N   . LYS A 1 450 ? 151.502 -41.028 167.072 1.00 132.93 ? 450 LYS A N   1 
ATOM   3490  C CA  . LYS A 1 450 ? 150.701 -39.998 166.408 1.00 134.80 ? 450 LYS A CA  1 
ATOM   3491  C C   . LYS A 1 450 ? 150.755 -38.687 167.186 1.00 139.29 ? 450 LYS A C   1 
ATOM   3492  O O   . LYS A 1 450 ? 150.962 -37.622 166.614 1.00 134.06 ? 450 LYS A O   1 
ATOM   3493  C CB  . LYS A 1 450 ? 149.249 -40.457 166.252 1.00 137.11 ? 450 LYS A CB  1 
ATOM   3494  N N   . TRP A 1 451 ? 150.563 -38.782 168.496 1.00 147.06 ? 451 TRP A N   1 
ATOM   3495  C CA  . TRP A 1 451 ? 150.587 -37.610 169.364 1.00 135.79 ? 451 TRP A CA  1 
ATOM   3496  C C   . TRP A 1 451 ? 151.917 -36.854 169.308 1.00 132.81 ? 451 TRP A C   1 
ATOM   3497  O O   . TRP A 1 451 ? 151.931 -35.629 169.187 1.00 129.73 ? 451 TRP A O   1 
ATOM   3498  C CB  . TRP A 1 451 ? 150.294 -38.024 170.810 1.00 131.13 ? 451 TRP A CB  1 
ATOM   3499  C CG  . TRP A 1 451 ? 148.854 -38.303 171.140 1.00 135.64 ? 451 TRP A CG  1 
ATOM   3500  C CD1 . TRP A 1 451 ? 147.755 -37.645 170.665 1.00 140.11 ? 451 TRP A CD1 1 
ATOM   3501  C CD2 . TRP A 1 451 ? 148.362 -39.345 171.987 1.00 135.46 ? 451 TRP A CD2 1 
ATOM   3502  N NE1 . TRP A 1 451 ? 146.611 -38.193 171.194 1.00 136.30 ? 451 TRP A NE1 1 
ATOM   3503  C CE2 . TRP A 1 451 ? 146.957 -39.244 172.002 1.00 136.25 ? 451 TRP A CE2 1 
ATOM   3504  C CE3 . TRP A 1 451 ? 148.975 -40.348 172.742 1.00 140.18 ? 451 TRP A CE3 1 
ATOM   3505  C CZ2 . TRP A 1 451 ? 146.157 -40.109 172.740 1.00 144.45 ? 451 TRP A CZ2 1 
ATOM   3506  C CZ3 . TRP A 1 451 ? 148.181 -41.204 173.473 1.00 141.55 ? 451 TRP A CZ3 1 
ATOM   3507  C CH2 . TRP A 1 451 ? 146.786 -41.081 173.467 1.00 145.63 ? 451 TRP A CH2 1 
ATOM   3508  N N   . LEU A 1 452 ? 153.030 -37.579 169.384 1.00 130.84 ? 452 LEU A N   1 
ATOM   3509  C CA  . LEU A 1 452 ? 154.357 -36.961 169.326 1.00 126.04 ? 452 LEU A CA  1 
ATOM   3510  C C   . LEU A 1 452 ? 154.711 -36.414 167.943 1.00 131.53 ? 452 LEU A C   1 
ATOM   3511  O O   . LEU A 1 452 ? 155.326 -35.353 167.835 1.00 136.18 ? 452 LEU A O   1 
ATOM   3512  C CB  . LEU A 1 452 ? 155.431 -37.951 169.771 1.00 123.18 ? 452 LEU A CB  1 
ATOM   3513  C CG  . LEU A 1 452 ? 155.768 -37.931 171.265 1.00 123.55 ? 452 LEU A CG  1 
ATOM   3514  C CD1 . LEU A 1 452 ? 154.895 -38.897 172.046 1.00 123.97 ? 452 LEU A CD1 1 
ATOM   3515  C CD2 . LEU A 1 452 ? 157.237 -38.231 171.486 1.00 136.95 ? 452 LEU A CD2 1 
ATOM   3516  N N   . LYS A 1 453 ? 154.333 -37.143 166.895 1.00 128.77 ? 453 LYS A N   1 
ATOM   3517  C CA  . LYS A 1 453 ? 154.607 -36.708 165.531 1.00 127.85 ? 453 LYS A CA  1 
ATOM   3518  C C   . LYS A 1 453 ? 153.809 -35.442 165.250 1.00 134.17 ? 453 LYS A C   1 
ATOM   3519  O O   . LYS A 1 453 ? 154.308 -34.512 164.613 1.00 134.68 ? 453 LYS A O   1 
ATOM   3520  C CB  . LYS A 1 453 ? 154.260 -37.801 164.517 1.00 130.21 ? 453 LYS A CB  1 
ATOM   3521  N N   . GLU A 1 454 ? 152.568 -35.407 165.731 1.00 137.65 ? 454 GLU A N   1 
ATOM   3522  C CA  . GLU A 1 454 ? 151.732 -34.230 165.539 1.00 147.16 ? 454 GLU A CA  1 
ATOM   3523  C C   . GLU A 1 454 ? 152.167 -33.100 166.464 1.00 146.42 ? 454 GLU A C   1 
ATOM   3524  O O   . GLU A 1 454 ? 151.728 -31.965 166.310 1.00 139.43 ? 454 GLU A O   1 
ATOM   3525  C CB  . GLU A 1 454 ? 150.266 -34.572 165.802 1.00 156.77 ? 454 GLU A CB  1 
ATOM   3526  C CG  . GLU A 1 454 ? 149.265 -33.809 164.965 1.00 163.07 ? 454 GLU A CG  1 
ATOM   3527  C CD  . GLU A 1 454 ? 147.851 -34.244 165.268 1.00 161.60 ? 454 GLU A CD  1 
ATOM   3528  O OE1 . GLU A 1 454 ? 147.609 -35.469 165.279 1.00 162.15 ? 454 GLU A OE1 1 
ATOM   3529  O OE2 . GLU A 1 454 ? 146.991 -33.375 165.520 1.00 160.03 ? 454 GLU A OE2 1 
ATOM   3530  N N   . ASP A 1 455 ? 153.022 -33.420 167.430 1.00 150.21 ? 455 ASP A N   1 
ATOM   3531  C CA  . ASP A 1 455 ? 153.525 -32.430 168.377 1.00 146.69 ? 455 ASP A CA  1 
ATOM   3532  C C   . ASP A 1 455 ? 152.478 -31.725 169.256 1.00 136.01 ? 455 ASP A C   1 
ATOM   3533  O O   . ASP A 1 455 ? 152.680 -30.582 169.656 1.00 130.79 ? 455 ASP A O   1 
ATOM   3534  C CB  . ASP A 1 455 ? 154.371 -31.403 167.620 1.00 157.57 ? 455 ASP A CB  1 
ATOM   3535  C CG  . ASP A 1 455 ? 155.492 -32.056 166.835 1.00 163.55 ? 455 ASP A CG  1 
ATOM   3536  O OD1 . ASP A 1 455 ? 156.301 -32.747 167.478 1.00 169.47 ? 455 ASP A OD1 1 
ATOM   3537  O OD2 . ASP A 1 455 ? 155.580 -31.889 165.600 1.00 149.78 ? 455 ASP A OD2 1 
ATOM   3538  N N   . LYS A 1 456 ? 151.370 -32.401 169.546 1.00 133.87 ? 456 LYS A N   1 
ATOM   3539  C CA  . LYS A 1 456 ? 150.274 -31.827 170.341 1.00 130.39 ? 456 LYS A CA  1 
ATOM   3540  C C   . LYS A 1 456 ? 150.461 -31.765 171.875 1.00 129.08 ? 456 LYS A C   1 
ATOM   3541  O O   . LYS A 1 456 ? 149.672 -31.111 172.552 1.00 131.14 ? 456 LYS A O   1 
ATOM   3542  C CB  . LYS A 1 456 ? 148.968 -32.556 170.028 1.00 136.85 ? 456 LYS A CB  1 
ATOM   3543  C CG  . LYS A 1 456 ? 149.052 -34.068 170.040 1.00 137.33 ? 456 LYS A CG  1 
ATOM   3544  C CD  . LYS A 1 456 ? 148.185 -34.658 168.932 1.00 146.78 ? 456 LYS A CD  1 
ATOM   3545  C CE  . LYS A 1 456 ? 146.701 -34.477 169.216 1.00 145.18 ? 456 LYS A CE  1 
ATOM   3546  N NZ  . LYS A 1 456 ? 146.109 -33.298 168.523 1.00 148.14 ? 456 LYS A NZ  1 
ATOM   3547  N N   . LEU A 1 457 ? 151.430 -32.489 172.437 1.00 133.13 ? 457 LEU A N   1 
ATOM   3548  C CA  . LEU A 1 457 ? 151.650 -32.489 173.902 1.00 133.06 ? 457 LEU A CA  1 
ATOM   3549  C C   . LEU A 1 457 ? 152.986 -31.898 174.334 1.00 127.50 ? 457 LEU A C   1 
ATOM   3550  O O   . LEU A 1 457 ? 153.931 -31.939 173.586 1.00 120.78 ? 457 LEU A O   1 
ATOM   3551  C CB  . LEU A 1 457 ? 151.555 -33.902 174.482 1.00 120.96 ? 457 LEU A CB  1 
ATOM   3552  C CG  . LEU A 1 457 ? 152.485 -34.989 173.948 1.00 121.79 ? 457 LEU A CG  1 
ATOM   3553  C CD1 . LEU A 1 457 ? 152.901 -35.987 175.018 1.00 120.58 ? 457 LEU A CD1 1 
ATOM   3554  C CD2 . LEU A 1 457 ? 151.787 -35.722 172.840 1.00 124.04 ? 457 LEU A CD2 1 
ATOM   3555  N N   . GLU A 1 458 ? 153.070 -31.327 175.529 1.00 128.31 ? 458 GLU A N   1 
ATOM   3556  C CA  . GLU A 1 458 ? 154.343 -30.758 175.972 1.00 130.20 ? 458 GLU A CA  1 
ATOM   3557  C C   . GLU A 1 458 ? 155.092 -31.736 176.869 1.00 131.49 ? 458 GLU A C   1 
ATOM   3558  O O   . GLU A 1 458 ? 154.538 -32.267 177.833 1.00 127.74 ? 458 GLU A O   1 
ATOM   3559  C CB  . GLU A 1 458 ? 154.154 -29.437 176.696 1.00 135.50 ? 458 GLU A CB  1 
ATOM   3560  C CG  . GLU A 1 458 ? 155.466 -28.686 176.830 1.00 134.07 ? 458 GLU A CG  1 
ATOM   3561  C CD  . GLU A 1 458 ? 155.453 -27.588 177.884 1.00 141.08 ? 458 GLU A CD  1 
ATOM   3562  O OE1 . GLU A 1 458 ? 154.536 -27.548 178.733 1.00 143.68 ? 458 GLU A OE1 1 
ATOM   3563  O OE2 . GLU A 1 458 ? 156.410 -26.787 177.885 1.00 144.33 ? 458 GLU A OE2 1 
ATOM   3564  N N   . CYS A 1 459 ? 156.366 -31.964 176.542 1.00 136.37 ? 459 CYS A N   1 
ATOM   3565  C CA  . CYS A 1 459 ? 157.225 -32.954 177.235 1.00 126.26 ? 459 CYS A CA  1 
ATOM   3566  C C   . CYS A 1 459 ? 158.252 -32.418 178.209 1.00 118.79 ? 459 CYS A C   1 
ATOM   3567  O O   . CYS A 1 459 ? 158.965 -31.463 177.905 1.00 115.49 ? 459 CYS A O   1 
ATOM   3568  C CB  . CYS A 1 459 ? 157.989 -33.787 176.205 1.00 130.94 ? 459 CYS A CB  1 
ATOM   3569  S SG  . CYS A 1 459 ? 157.864 -33.157 174.515 1.00 138.25 ? 459 CYS A SG  1 
ATOM   3570  N N   . SER A 1 460 ? 158.312 -33.038 179.378 1.00 126.62 ? 460 SER A N   1 
ATOM   3571  C CA  . SER A 1 460 ? 159.336 -32.729 180.345 1.00 132.98 ? 460 SER A CA  1 
ATOM   3572  C C   . SER A 1 460 ? 160.034 -34.059 180.560 1.00 120.94 ? 460 SER A C   1 
ATOM   3573  O O   . SER A 1 460 ? 159.677 -35.019 179.890 1.00 109.15 ? 460 SER A O   1 
ATOM   3574  C CB  . SER A 1 460 ? 158.726 -32.159 181.623 1.00 145.24 ? 460 SER A CB  1 
ATOM   3575  O OG  . SER A 1 460 ? 158.135 -33.163 182.436 1.00 154.78 ? 460 SER A OG  1 
ATOM   3576  N N   . GLU A 1 461 ? 160.836 -34.201 181.607 1.00 120.39 ? 461 GLU A N   1 
ATOM   3577  C CA  . GLU A 1 461 ? 161.636 -35.419 181.742 1.00 108.11 ? 461 GLU A CA  1 
ATOM   3578  C C   . GLU A 1 461 ? 160.803 -36.559 182.318 1.00 105.78 ? 461 GLU A C   1 
ATOM   3579  O O   . GLU A 1 461 ? 160.953 -37.719 181.919 1.00 104.12 ? 461 GLU A O   1 
ATOM   3580  C CB  . GLU A 1 461 ? 162.867 -35.171 182.608 1.00 104.14 ? 461 GLU A CB  1 
ATOM   3581  C CG  . GLU A 1 461 ? 164.000 -36.139 182.306 1.00 113.02 ? 461 GLU A CG  1 
ATOM   3582  C CD  . GLU A 1 461 ? 164.710 -36.581 183.553 1.00 137.20 ? 461 GLU A CD  1 
ATOM   3583  O OE1 . GLU A 1 461 ? 164.276 -37.590 184.147 1.00 140.85 ? 461 GLU A OE1 1 
ATOM   3584  O OE2 . GLU A 1 461 ? 165.684 -35.911 183.960 1.00 151.12 ? 461 GLU A OE2 1 
ATOM   3585  N N   . GLU A 1 462 ? 159.938 -36.222 183.265 1.00 110.31 ? 462 GLU A N   1 
ATOM   3586  C CA  . GLU A 1 462 ? 159.180 -37.225 183.992 1.00 109.14 ? 462 GLU A CA  1 
ATOM   3587  C C   . GLU A 1 462 ? 158.373 -38.144 183.065 1.00 117.19 ? 462 GLU A C   1 
ATOM   3588  O O   . GLU A 1 462 ? 158.130 -39.295 183.403 1.00 115.69 ? 462 GLU A O   1 
ATOM   3589  C CB  . GLU A 1 462 ? 158.256 -36.531 184.980 1.00 105.01 ? 462 GLU A CB  1 
ATOM   3590  C CG  . GLU A 1 462 ? 157.938 -37.349 186.204 1.00 119.29 ? 462 GLU A CG  1 
ATOM   3591  C CD  . GLU A 1 462 ? 156.838 -36.730 187.028 1.00 142.35 ? 462 GLU A CD  1 
ATOM   3592  O OE1 . GLU A 1 462 ? 155.933 -37.472 187.460 1.00 148.47 ? 462 GLU A OE1 1 
ATOM   3593  O OE2 . GLU A 1 462 ? 156.870 -35.499 187.228 1.00 156.50 ? 462 GLU A OE2 1 
ATOM   3594  N N   . LEU A 1 463 ? 157.989 -37.650 181.891 1.00 117.19 ? 463 LEU A N   1 
ATOM   3595  C CA  . LEU A 1 463 ? 157.298 -38.473 180.892 1.00 116.22 ? 463 LEU A CA  1 
ATOM   3596  C C   . LEU A 1 463 ? 158.231 -39.497 180.246 1.00 123.82 ? 463 LEU A C   1 
ATOM   3597  O O   . LEU A 1 463 ? 157.851 -40.649 180.026 1.00 129.05 ? 463 LEU A O   1 
ATOM   3598  C CB  . LEU A 1 463 ? 156.663 -37.587 179.809 1.00 116.26 ? 463 LEU A CB  1 
ATOM   3599  C CG  . LEU A 1 463 ? 155.774 -38.225 178.726 1.00 107.90 ? 463 LEU A CG  1 
ATOM   3600  C CD1 . LEU A 1 463 ? 154.544 -38.922 179.281 1.00 109.03 ? 463 LEU A CD1 1 
ATOM   3601  C CD2 . LEU A 1 463 ? 155.372 -37.146 177.743 1.00 109.22 ? 463 LEU A CD2 1 
ATOM   3602  N N   . GLY A 1 464 ? 159.446 -39.054 179.932 1.00 119.81 ? 464 GLY A N   1 
ATOM   3603  C CA  . GLY A 1 464 ? 160.448 -39.889 179.294 1.00 110.86 ? 464 GLY A CA  1 
ATOM   3604  C C   . GLY A 1 464 ? 160.824 -41.133 180.071 1.00 107.98 ? 464 GLY A C   1 
ATOM   3605  O O   . GLY A 1 464 ? 160.837 -42.223 179.515 1.00 115.21 ? 464 GLY A O   1 
ATOM   3606  N N   . ASP A 1 465 ? 161.124 -40.993 181.354 1.00 102.76 ? 465 ASP A N   1 
ATOM   3607  C CA  . ASP A 1 465 ? 161.430 -42.173 182.145 1.00 103.15 ? 465 ASP A CA  1 
ATOM   3608  C C   . ASP A 1 465 ? 160.163 -43.010 182.357 1.00 112.52 ? 465 ASP A C   1 
ATOM   3609  O O   . ASP A 1 465 ? 160.253 -44.208 182.621 1.00 123.11 ? 465 ASP A O   1 
ATOM   3610  C CB  . ASP A 1 465 ? 162.116 -41.805 183.471 1.00 103.93 ? 465 ASP A CB  1 
ATOM   3611  C CG  . ASP A 1 465 ? 161.441 -40.670 184.195 1.00 141.49 ? 465 ASP A CG  1 
ATOM   3612  O OD1 . ASP A 1 465 ? 160.342 -40.875 184.741 1.00 162.47 ? 465 ASP A OD1 1 
ATOM   3613  O OD2 . ASP A 1 465 ? 162.026 -39.567 184.233 1.00 148.61 ? 465 ASP A OD2 1 
ATOM   3614  N N   . LEU A 1 466 ? 158.987 -42.387 182.264 1.00 121.39 ? 466 LEU A N   1 
ATOM   3615  C CA  . LEU A 1 466 ? 157.737 -43.144 182.358 1.00 126.72 ? 466 LEU A CA  1 
ATOM   3616  C C   . LEU A 1 466 ? 157.512 -44.032 181.134 1.00 123.56 ? 466 LEU A C   1 
ATOM   3617  O O   . LEU A 1 466 ? 157.127 -45.195 181.269 1.00 134.98 ? 466 LEU A O   1 
ATOM   3618  C CB  . LEU A 1 466 ? 156.537 -42.209 182.507 1.00 127.53 ? 466 LEU A CB  1 
ATOM   3619  C CG  . LEU A 1 466 ? 155.623 -42.505 183.694 1.00 142.01 ? 466 LEU A CG  1 
ATOM   3620  C CD1 . LEU A 1 466 ? 156.124 -41.768 184.926 1.00 150.19 ? 466 LEU A CD1 1 
ATOM   3621  C CD2 . LEU A 1 466 ? 154.178 -42.149 183.392 1.00 147.44 ? 466 LEU A CD2 1 
ATOM   3622  N N   . VAL A 1 467 ? 157.744 -43.491 179.942 1.00 109.47 ? 467 VAL A N   1 
ATOM   3623  C CA  . VAL A 1 467 ? 157.609 -44.284 178.724 1.00 109.56 ? 467 VAL A CA  1 
ATOM   3624  C C   . VAL A 1 467 ? 158.794 -45.216 178.535 1.00 114.85 ? 467 VAL A C   1 
ATOM   3625  O O   . VAL A 1 467 ? 158.677 -46.277 177.928 1.00 111.97 ? 467 VAL A O   1 
ATOM   3626  C CB  . VAL A 1 467 ? 157.474 -43.397 177.470 1.00 111.47 ? 467 VAL A CB  1 
ATOM   3627  C CG1 . VAL A 1 467 ? 156.145 -42.691 177.462 1.00 126.26 ? 467 VAL A CG1 1 
ATOM   3628  C CG2 . VAL A 1 467 ? 158.617 -42.409 177.376 1.00 109.80 ? 467 VAL A CG2 1 
ATOM   3629  N N   . LYS A 1 468 ? 159.944 -44.795 179.045 1.00 124.63 ? 468 LYS A N   1 
ATOM   3630  C CA  . LYS A 1 468 ? 161.155 -45.586 178.941 1.00 124.56 ? 468 LYS A CA  1 
ATOM   3631  C C   . LYS A 1 468 ? 160.894 -46.957 179.582 1.00 123.40 ? 468 LYS A C   1 
ATOM   3632  O O   . LYS A 1 468 ? 161.444 -47.967 179.148 1.00 118.26 ? 468 LYS A O   1 
ATOM   3633  C CB  . LYS A 1 468 ? 162.356 -44.897 179.593 1.00 119.40 ? 468 LYS A CB  1 
ATOM   3634  C CG  . LYS A 1 468 ? 163.658 -45.478 179.070 1.00 121.20 ? 468 LYS A CG  1 
ATOM   3635  C CD  . LYS A 1 468 ? 164.735 -45.612 180.123 1.00 130.28 ? 468 LYS A CD  1 
ATOM   3636  C CE  . LYS A 1 468 ? 165.097 -47.082 180.211 1.00 138.32 ? 468 LYS A CE  1 
ATOM   3637  N NZ  . LYS A 1 468 ? 165.866 -47.398 181.431 1.00 135.47 ? 468 LYS A NZ  1 
ATOM   3638  N N   . SER A 1 469 ? 160.067 -46.962 180.629 1.00 126.57 ? 469 SER A N   1 
ATOM   3639  C CA  . SER A 1 469 ? 159.631 -48.163 181.364 1.00 132.20 ? 469 SER A CA  1 
ATOM   3640  C C   . SER A 1 469 ? 159.161 -49.347 180.520 1.00 134.95 ? 469 SER A C   1 
ATOM   3641  O O   . SER A 1 469 ? 159.348 -50.498 180.920 1.00 134.18 ? 469 SER A O   1 
ATOM   3642  C CB  . SER A 1 469 ? 158.492 -47.784 182.315 1.00 130.99 ? 469 SER A CB  1 
ATOM   3643  O OG  . SER A 1 469 ? 158.688 -46.490 182.865 1.00 139.27 ? 469 SER A OG  1 
ATOM   3644  N N   . VAL A 1 470 ? 158.543 -49.067 179.372 1.00 135.43 ? 470 VAL A N   1 
ATOM   3645  C CA  . VAL A 1 470 ? 158.137 -50.126 178.430 1.00 140.97 ? 470 VAL A CA  1 
ATOM   3646  C C   . VAL A 1 470 ? 158.881 -50.225 177.068 1.00 159.40 ? 470 VAL A C   1 
ATOM   3647  O O   . VAL A 1 470 ? 159.280 -51.313 176.664 1.00 164.44 ? 470 VAL A O   1 
ATOM   3648  C CB  . VAL A 1 470 ? 156.614 -49.984 178.143 1.00 139.38 ? 470 VAL A CB  1 
ATOM   3649  C CG1 . VAL A 1 470 ? 156.291 -48.624 177.485 1.00 141.54 ? 470 VAL A CG1 1 
ATOM   3650  C CG2 . VAL A 1 470 ? 156.107 -51.123 177.291 1.00 147.79 ? 470 VAL A CG2 1 
ATOM   3651  N N   . ASP A 1 471 ? 159.155 -49.070 176.449 1.00 146.65 ? 471 ASP A N   1 
ATOM   3652  C CA  . ASP A 1 471 ? 159.800 -48.896 175.123 1.00 136.44 ? 471 ASP A CA  1 
ATOM   3653  C C   . ASP A 1 471 ? 160.793 -47.748 175.203 1.00 132.33 ? 471 ASP A C   1 
ATOM   3654  O O   . ASP A 1 471 ? 160.415 -46.592 175.013 1.00 126.43 ? 471 ASP A O   1 
ATOM   3655  C CB  . ASP A 1 471 ? 158.736 -48.558 174.052 1.00 132.14 ? 471 ASP A CB  1 
ATOM   3656  C CG  . ASP A 1 471 ? 159.287 -48.560 172.634 1.00 147.02 ? 471 ASP A CG  1 
ATOM   3657  O OD1 . ASP A 1 471 ? 158.985 -49.533 171.906 1.00 161.36 ? 471 ASP A OD1 1 
ATOM   3658  O OD2 . ASP A 1 471 ? 160.042 -47.627 172.276 1.00 147.97 ? 471 ASP A OD2 1 
ATOM   3659  N N   . PRO A 1 472 ? 162.086 -48.069 175.389 1.00 129.75 ? 472 PRO A N   1 
ATOM   3660  C CA  . PRO A 1 472 ? 163.079 -47.002 175.563 1.00 123.15 ? 472 PRO A CA  1 
ATOM   3661  C C   . PRO A 1 472 ? 163.393 -46.264 174.261 1.00 112.03 ? 472 PRO A C   1 
ATOM   3662  O O   . PRO A 1 472 ? 163.848 -45.122 174.306 1.00 108.97 ? 472 PRO A O   1 
ATOM   3663  C CB  . PRO A 1 472 ? 164.301 -47.757 176.089 1.00 116.76 ? 472 PRO A CB  1 
ATOM   3664  C CG  . PRO A 1 472 ? 164.169 -49.109 175.467 1.00 123.06 ? 472 PRO A CG  1 
ATOM   3665  C CD  . PRO A 1 472 ? 162.696 -49.409 175.471 1.00 122.33 ? 472 PRO A CD  1 
ATOM   3666  N N   . THR A 1 473 ? 163.128 -46.903 173.125 1.00 111.94 ? 473 THR A N   1 
ATOM   3667  C CA  . THR A 1 473 ? 163.344 -46.286 171.821 1.00 122.37 ? 473 THR A CA  1 
ATOM   3668  C C   . THR A 1 473 ? 162.401 -45.100 171.624 1.00 126.26 ? 473 THR A C   1 
ATOM   3669  O O   . THR A 1 473 ? 162.794 -44.067 171.082 1.00 113.94 ? 473 THR A O   1 
ATOM   3670  C CB  . THR A 1 473 ? 163.147 -47.302 170.670 1.00 121.60 ? 473 THR A CB  1 
ATOM   3671  O OG1 . THR A 1 473 ? 161.827 -47.856 170.731 1.00 131.08 ? 473 THR A OG1 1 
ATOM   3672  C CG2 . THR A 1 473 ? 164.168 -48.434 170.769 1.00 114.27 ? 473 THR A CG2 1 
ATOM   3673  N N   . LEU A 1 474 ? 161.162 -45.254 172.085 1.00 133.42 ? 474 LEU A N   1 
ATOM   3674  C CA  . LEU A 1 474 ? 160.161 -44.188 172.016 1.00 125.08 ? 474 LEU A CA  1 
ATOM   3675  C C   . LEU A 1 474 ? 160.485 -43.086 173.026 1.00 119.24 ? 474 LEU A C   1 
ATOM   3676  O O   . LEU A 1 474 ? 160.241 -41.907 172.775 1.00 109.26 ? 474 LEU A O   1 
ATOM   3677  C CB  . LEU A 1 474 ? 158.755 -44.756 172.249 1.00 123.40 ? 474 LEU A CB  1 
ATOM   3678  C CG  . LEU A 1 474 ? 157.524 -43.855 172.109 1.00 122.17 ? 474 LEU A CG  1 
ATOM   3679  C CD1 . LEU A 1 474 ? 157.515 -43.088 170.789 1.00 117.69 ? 474 LEU A CD1 1 
ATOM   3680  C CD2 . LEU A 1 474 ? 156.263 -44.693 172.245 1.00 118.54 ? 474 LEU A CD2 1 
ATOM   3681  N N   . ALA A 1 475 ? 161.039 -43.481 174.169 1.00 123.11 ? 475 ALA A N   1 
ATOM   3682  C CA  . ALA A 1 475 ? 161.454 -42.536 175.204 1.00 116.23 ? 475 ALA A CA  1 
ATOM   3683  C C   . ALA A 1 475 ? 162.459 -41.521 174.671 1.00 111.53 ? 475 ALA A C   1 
ATOM   3684  O O   . ALA A 1 475 ? 162.480 -40.371 175.104 1.00 112.75 ? 475 ALA A O   1 
ATOM   3685  C CB  . ALA A 1 475 ? 162.039 -43.273 176.388 1.00 101.71 ? 475 ALA A CB  1 
ATOM   3686  N N   . LEU A 1 476 ? 163.301 -41.961 173.742 1.00 98.20  ? 476 LEU A N   1 
ATOM   3687  C CA  . LEU A 1 476 ? 164.288 -41.081 173.124 1.00 96.47  ? 476 LEU A CA  1 
ATOM   3688  C C   . LEU A 1 476 ? 163.602 -39.903 172.438 1.00 98.95  ? 476 LEU A C   1 
ATOM   3689  O O   . LEU A 1 476 ? 164.062 -38.766 172.535 1.00 101.08 ? 476 LEU A O   1 
ATOM   3690  C CB  . LEU A 1 476 ? 165.161 -41.858 172.136 1.00 100.34 ? 476 LEU A CB  1 
ATOM   3691  C CG  . LEU A 1 476 ? 166.145 -41.055 171.284 1.00 98.36  ? 476 LEU A CG  1 
ATOM   3692  C CD1 . LEU A 1 476 ? 167.409 -40.768 172.064 1.00 96.92  ? 476 LEU A CD1 1 
ATOM   3693  C CD2 . LEU A 1 476 ? 166.483 -41.834 170.027 1.00 100.69 ? 476 LEU A CD2 1 
ATOM   3694  N N   . SER A 1 477 ? 162.494 -40.181 171.758 1.00 102.52 ? 477 SER A N   1 
ATOM   3695  C CA  . SER A 1 477 ? 161.718 -39.144 171.085 1.00 103.92 ? 477 SER A CA  1 
ATOM   3696  C C   . SER A 1 477 ? 161.175 -38.129 172.082 1.00 98.79  ? 477 SER A C   1 
ATOM   3697  O O   . SER A 1 477 ? 161.189 -36.925 171.833 1.00 98.77  ? 477 SER A O   1 
ATOM   3698  C CB  . SER A 1 477 ? 160.565 -39.763 170.292 1.00 113.83 ? 477 SER A CB  1 
ATOM   3699  O OG  . SER A 1 477 ? 160.433 -39.135 169.027 1.00 128.38 ? 477 SER A OG  1 
ATOM   3700  N N   . VAL A 1 478 ? 160.676 -38.631 173.205 1.00 95.74  ? 478 VAL A N   1 
ATOM   3701  C CA  . VAL A 1 478 ? 160.169 -37.780 174.273 1.00 100.24 ? 478 VAL A CA  1 
ATOM   3702  C C   . VAL A 1 478 ? 161.283 -36.922 174.860 1.00 103.65 ? 478 VAL A C   1 
ATOM   3703  O O   . VAL A 1 478 ? 161.138 -35.709 175.013 1.00 97.45  ? 478 VAL A O   1 
ATOM   3704  C CB  . VAL A 1 478 ? 159.528 -38.609 175.390 1.00 97.44  ? 478 VAL A CB  1 
ATOM   3705  C CG1 . VAL A 1 478 ? 159.060 -37.704 176.514 1.00 97.23  ? 478 VAL A CG1 1 
ATOM   3706  C CG2 . VAL A 1 478 ? 158.375 -39.418 174.834 1.00 103.33 ? 478 VAL A CG2 1 
ATOM   3707  N N   . TYR A 1 479 ? 162.389 -37.574 175.204 1.00 109.39 ? 479 TYR A N   1 
ATOM   3708  C CA  . TYR A 1 479 ? 163.556 -36.900 175.766 1.00 101.82 ? 479 TYR A CA  1 
ATOM   3709  C C   . TYR A 1 479 ? 164.121 -35.826 174.841 1.00 97.87  ? 479 TYR A C   1 
ATOM   3710  O O   . TYR A 1 479 ? 164.582 -34.781 175.304 1.00 97.05  ? 479 TYR A O   1 
ATOM   3711  C CB  . TYR A 1 479 ? 164.652 -37.915 176.074 1.00 97.98  ? 479 TYR A CB  1 
ATOM   3712  C CG  . TYR A 1 479 ? 164.455 -38.681 177.358 1.00 96.07  ? 479 TYR A CG  1 
ATOM   3713  C CD1 . TYR A 1 479 ? 164.102 -38.032 178.533 1.00 102.84 ? 479 TYR A CD1 1 
ATOM   3714  C CD2 . TYR A 1 479 ? 164.623 -40.057 177.394 1.00 96.42  ? 479 TYR A CD2 1 
ATOM   3715  C CE1 . TYR A 1 479 ? 163.924 -38.734 179.708 1.00 109.53 ? 479 TYR A CE1 1 
ATOM   3716  C CE2 . TYR A 1 479 ? 164.444 -40.766 178.557 1.00 96.97  ? 479 TYR A CE2 1 
ATOM   3717  C CZ  . TYR A 1 479 ? 164.097 -40.102 179.712 1.00 109.92 ? 479 TYR A CZ  1 
ATOM   3718  O OH  . TYR A 1 479 ? 163.928 -40.822 180.870 1.00 129.16 ? 479 TYR A OH  1 
ATOM   3719  N N   . LEU A 1 480 ? 164.079 -36.092 173.537 1.00 97.81  ? 480 LEU A N   1 
ATOM   3720  C CA  . LEU A 1 480 ? 164.589 -35.166 172.526 1.00 101.16 ? 480 LEU A CA  1 
ATOM   3721  C C   . LEU A 1 480 ? 163.863 -33.830 172.582 1.00 106.52 ? 480 LEU A C   1 
ATOM   3722  O O   . LEU A 1 480 ? 164.482 -32.767 172.628 1.00 112.36 ? 480 LEU A O   1 
ATOM   3723  C CB  . LEU A 1 480 ? 164.442 -35.766 171.123 1.00 100.96 ? 480 LEU A CB  1 
ATOM   3724  C CG  . LEU A 1 480 ? 165.695 -36.013 170.274 1.00 101.06 ? 480 LEU A CG  1 
ATOM   3725  C CD1 . LEU A 1 480 ? 166.584 -34.777 170.227 1.00 101.61 ? 480 LEU A CD1 1 
ATOM   3726  C CD2 . LEU A 1 480 ? 166.469 -37.227 170.767 1.00 101.60 ? 480 LEU A CD2 1 
ATOM   3727  N N   . ARG A 1 481 ? 162.539 -33.906 172.581 1.00 109.08 ? 481 ARG A N   1 
ATOM   3728  C CA  . ARG A 1 481 ? 161.683 -32.730 172.616 1.00 104.06 ? 481 ARG A CA  1 
ATOM   3729  C C   . ARG A 1 481 ? 161.683 -32.038 173.988 1.00 109.10 ? 481 ARG A C   1 
ATOM   3730  O O   . ARG A 1 481 ? 161.442 -30.835 174.079 1.00 123.88 ? 481 ARG A O   1 
ATOM   3731  C CB  . ARG A 1 481 ? 160.268 -33.125 172.189 1.00 104.68 ? 481 ARG A CB  1 
ATOM   3732  C CG  . ARG A 1 481 ? 160.194 -33.579 170.732 1.00 112.75 ? 481 ARG A CG  1 
ATOM   3733  C CD  . ARG A 1 481 ? 158.801 -34.021 170.316 1.00 122.08 ? 481 ARG A CD  1 
ATOM   3734  N NE  . ARG A 1 481 ? 158.730 -34.337 168.889 1.00 128.66 ? 481 ARG A NE  1 
ATOM   3735  C CZ  . ARG A 1 481 ? 158.990 -35.530 168.361 1.00 140.91 ? 481 ARG A CZ  1 
ATOM   3736  N NH1 . ARG A 1 481 ? 158.892 -35.709 167.050 1.00 140.34 ? 481 ARG A NH1 1 
ATOM   3737  N NH2 . ARG A 1 481 ? 159.348 -36.542 169.137 1.00 149.15 ? 481 ARG A NH2 1 
ATOM   3738  N N   . ALA A 1 482 ? 161.944 -32.800 175.048 1.00 101.85 ? 482 ALA A N   1 
ATOM   3739  C CA  . ALA A 1 482 ? 161.995 -32.261 176.413 1.00 101.13 ? 482 ALA A CA  1 
ATOM   3740  C C   . ALA A 1 482 ? 163.226 -31.393 176.692 1.00 106.81 ? 482 ALA A C   1 
ATOM   3741  O O   . ALA A 1 482 ? 163.303 -30.745 177.737 1.00 105.43 ? 482 ALA A O   1 
ATOM   3742  C CB  . ALA A 1 482 ? 161.930 -33.396 177.422 1.00 101.41 ? 482 ALA A CB  1 
ATOM   3743  N N   . ASN A 1 483 ? 164.186 -31.428 175.767 1.00 115.53 ? 483 ASN A N   1 
ATOM   3744  C CA  . ASN A 1 483 ? 165.444 -30.662 175.812 1.00 112.29 ? 483 ASN A CA  1 
ATOM   3745  C C   . ASN A 1 483 ? 166.528 -31.225 176.750 1.00 117.29 ? 483 ASN A C   1 
ATOM   3746  O O   . ASN A 1 483 ? 167.675 -30.785 176.704 1.00 136.59 ? 483 ASN A O   1 
ATOM   3747  C CB  . ASN A 1 483 ? 165.157 -29.199 176.178 1.00 119.49 ? 483 ASN A CB  1 
ATOM   3748  C CG  . ASN A 1 483 ? 166.388 -28.323 176.101 1.00 132.00 ? 483 ASN A CG  1 
ATOM   3749  O OD1 . ASN A 1 483 ? 167.004 -28.195 175.044 1.00 133.72 ? 483 ASN A OD1 1 
ATOM   3750  N ND2 . ASN A 1 483 ? 166.758 -27.717 177.225 1.00 140.45 ? 483 ASN A ND2 1 
ATOM   3751  N N   . VAL A 1 484 ? 166.175 -32.194 177.589 1.00 106.46 ? 484 VAL A N   1 
ATOM   3752  C CA  . VAL A 1 484 ? 167.151 -32.852 178.469 1.00 109.23 ? 484 VAL A CA  1 
ATOM   3753  C C   . VAL A 1 484 ? 168.228 -33.624 177.696 1.00 105.79 ? 484 VAL A C   1 
ATOM   3754  O O   . VAL A 1 484 ? 167.967 -34.712 177.185 1.00 113.78 ? 484 VAL A O   1 
ATOM   3755  C CB  . VAL A 1 484 ? 166.465 -33.818 179.447 1.00 103.96 ? 484 VAL A CB  1 
ATOM   3756  C CG1 . VAL A 1 484 ? 165.996 -33.071 180.673 1.00 113.91 ? 484 VAL A CG1 1 
ATOM   3757  C CG2 . VAL A 1 484 ? 165.310 -34.536 178.763 1.00 96.36  ? 484 VAL A CG2 1 
ATOM   3758  N N   . PRO A 1 485 ? 169.447 -33.069 177.616 1.00 101.81 ? 485 PRO A N   1 
ATOM   3759  C CA  . PRO A 1 485 ? 170.506 -33.725 176.844 1.00 104.88 ? 485 PRO A CA  1 
ATOM   3760  C C   . PRO A 1 485 ? 171.072 -34.945 177.561 1.00 104.98 ? 485 PRO A C   1 
ATOM   3761  O O   . PRO A 1 485 ? 171.385 -35.945 176.914 1.00 97.28  ? 485 PRO A O   1 
ATOM   3762  C CB  . PRO A 1 485 ? 171.580 -32.635 176.715 1.00 96.07  ? 485 PRO A CB  1 
ATOM   3763  C CG  . PRO A 1 485 ? 171.011 -31.398 177.385 1.00 101.50 ? 485 PRO A CG  1 
ATOM   3764  C CD  . PRO A 1 485 ? 169.951 -31.878 178.315 1.00 111.00 ? 485 PRO A CD  1 
ATOM   3765  N N   . ASN A 1 486 ? 171.215 -34.838 178.879 1.00 99.01  ? 486 ASN A N   1 
ATOM   3766  C CA  . ASN A 1 486 ? 171.722 -35.916 179.722 1.00 107.38 ? 486 ASN A CA  1 
ATOM   3767  C C   . ASN A 1 486 ? 170.996 -37.236 179.495 1.00 108.88 ? 486 ASN A C   1 
ATOM   3768  O O   . ASN A 1 486 ? 171.613 -38.299 179.488 1.00 117.94 ? 486 ASN A O   1 
ATOM   3769  C CB  . ASN A 1 486 ? 171.638 -35.524 181.202 1.00 108.69 ? 486 ASN A CB  1 
ATOM   3770  C CG  . ASN A 1 486 ? 170.213 -35.261 181.659 1.00 124.35 ? 486 ASN A CG  1 
ATOM   3771  O OD1 . ASN A 1 486 ? 169.630 -36.051 182.409 1.00 123.51 ? 486 ASN A OD1 1 
ATOM   3772  N ND2 . ASN A 1 486 ? 169.642 -34.148 181.206 1.00 142.25 ? 486 ASN A ND2 1 
ATOM   3773  N N   . LYS A 1 487 ? 169.683 -37.162 179.312 1.00 98.92  ? 487 LYS A N   1 
ATOM   3774  C CA  . LYS A 1 487 ? 168.871 -38.360 179.143 1.00 102.55 ? 487 LYS A CA  1 
ATOM   3775  C C   . LYS A 1 487 ? 168.782 -38.815 177.689 1.00 103.34 ? 487 LYS A C   1 
ATOM   3776  O O   . LYS A 1 487 ? 168.366 -39.934 177.399 1.00 109.31 ? 487 LYS A O   1 
ATOM   3777  C CB  . LYS A 1 487 ? 167.467 -38.089 179.672 1.00 99.54  ? 487 LYS A CB  1 
ATOM   3778  C CG  . LYS A 1 487 ? 167.358 -38.142 181.180 1.00 92.32  ? 487 LYS A CG  1 
ATOM   3779  C CD  . LYS A 1 487 ? 167.050 -39.526 181.706 1.00 97.43  ? 487 LYS A CD  1 
ATOM   3780  C CE  . LYS A 1 487 ? 167.070 -39.510 183.227 1.00 118.95 ? 487 LYS A CE  1 
ATOM   3781  N NZ  . LYS A 1 487 ? 165.889 -40.191 183.824 1.00 128.50 ? 487 LYS A NZ  1 
ATOM   3782  N N   . VAL A 1 488 ? 169.188 -37.943 176.775 1.00 95.79  ? 488 VAL A N   1 
ATOM   3783  C CA  . VAL A 1 488 ? 169.220 -38.280 175.353 1.00 88.21  ? 488 VAL A CA  1 
ATOM   3784  C C   . VAL A 1 488 ? 170.477 -39.060 175.016 1.00 104.46 ? 488 VAL A C   1 
ATOM   3785  O O   . VAL A 1 488 ? 170.439 -40.100 174.358 1.00 114.37 ? 488 VAL A O   1 
ATOM   3786  C CB  . VAL A 1 488 ? 169.160 -37.025 174.477 1.00 90.52  ? 488 VAL A CB  1 
ATOM   3787  C CG1 . VAL A 1 488 ? 169.655 -37.330 173.071 1.00 100.74 ? 488 VAL A CG1 1 
ATOM   3788  C CG2 . VAL A 1 488 ? 167.752 -36.491 174.445 1.00 91.40  ? 488 VAL A CG2 1 
ATOM   3789  N N   . ILE A 1 489 ? 171.597 -38.522 175.479 1.00 103.48 ? 489 ILE A N   1 
ATOM   3790  C CA  . ILE A 1 489 ? 172.901 -39.135 175.308 1.00 95.16  ? 489 ILE A CA  1 
ATOM   3791  C C   . ILE A 1 489 ? 172.905 -40.485 175.997 1.00 86.00  ? 489 ILE A C   1 
ATOM   3792  O O   . ILE A 1 489 ? 173.533 -41.433 175.522 1.00 96.82  ? 489 ILE A O   1 
ATOM   3793  C CB  . ILE A 1 489 ? 174.029 -38.248 175.847 1.00 85.16  ? 489 ILE A CB  1 
ATOM   3794  C CG1 . ILE A 1 489 ? 174.216 -37.063 174.909 1.00 85.57  ? 489 ILE A CG1 1 
ATOM   3795  C CG2 . ILE A 1 489 ? 175.326 -39.019 175.929 1.00 84.34  ? 489 ILE A CG2 1 
ATOM   3796  C CD1 . ILE A 1 489 ? 175.088 -35.995 175.471 1.00 88.89  ? 489 ILE A CD1 1 
ATOM   3797  N N   . GLN A 1 490 ? 172.224 -40.562 177.136 1.00 82.39  ? 490 GLN A N   1 
ATOM   3798  C CA  . GLN A 1 490 ? 172.124 -41.826 177.844 1.00 82.17  ? 490 GLN A CA  1 
ATOM   3799  C C   . GLN A 1 490 ? 171.476 -42.903 176.976 1.00 85.08  ? 490 GLN A C   1 
ATOM   3800  O O   . GLN A 1 490 ? 171.949 -44.023 176.957 1.00 95.44  ? 490 GLN A O   1 
ATOM   3801  C CB  . GLN A 1 490 ? 171.300 -41.654 179.122 1.00 83.20  ? 490 GLN A CB  1 
ATOM   3802  C CG  . GLN A 1 490 ? 171.636 -42.643 180.221 1.00 91.69  ? 490 GLN A CG  1 
ATOM   3803  C CD  . GLN A 1 490 ? 170.518 -42.800 181.233 1.00 106.91 ? 490 GLN A CD  1 
ATOM   3804  O OE1 . GLN A 1 490 ? 170.291 -43.894 181.751 1.00 111.35 ? 490 GLN A OE1 1 
ATOM   3805  N NE2 . GLN A 1 490 ? 169.804 -41.714 181.508 1.00 108.13 ? 490 GLN A NE2 1 
ATOM   3806  N N   . CYS A 1 491 ? 170.499 -42.524 176.156 1.00 83.36  ? 491 CYS A N   1 
ATOM   3807  C CA  . CYS A 1 491 ? 169.791 -43.469 175.290 1.00 84.04  ? 491 CYS A CA  1 
ATOM   3808  C C   . CYS A 1 491 ? 170.670 -43.970 174.154 1.00 84.89  ? 491 CYS A C   1 
ATOM   3809  O O   . CYS A 1 491 ? 170.653 -45.153 173.803 1.00 84.34  ? 491 CYS A O   1 
ATOM   3810  C CB  . CYS A 1 491 ? 168.531 -42.821 174.718 1.00 85.63  ? 491 CYS A CB  1 
ATOM   3811  S SG  . CYS A 1 491 ? 167.277 -42.460 175.952 1.00 118.22 ? 491 CYS A SG  1 
ATOM   3812  N N   . PHE A 1 492 ? 171.426 -43.052 173.570 1.00 85.28  ? 492 PHE A N   1 
ATOM   3813  C CA  . PHE A 1 492 ? 172.335 -43.397 172.493 1.00 91.17  ? 492 PHE A CA  1 
ATOM   3814  C C   . PHE A 1 492 ? 173.420 -44.323 173.021 1.00 99.47  ? 492 PHE A C   1 
ATOM   3815  O O   . PHE A 1 492 ? 173.891 -45.217 172.319 1.00 98.70  ? 492 PHE A O   1 
ATOM   3816  C CB  . PHE A 1 492 ? 172.952 -42.137 171.902 1.00 85.54  ? 492 PHE A CB  1 
ATOM   3817  C CG  . PHE A 1 492 ? 172.001 -41.352 171.060 1.00 85.66  ? 492 PHE A CG  1 
ATOM   3818  C CD1 . PHE A 1 492 ? 171.154 -41.990 170.173 1.00 87.69  ? 492 PHE A CD1 1 
ATOM   3819  C CD2 . PHE A 1 492 ? 171.945 -39.978 171.165 1.00 86.55  ? 492 PHE A CD2 1 
ATOM   3820  C CE1 . PHE A 1 492 ? 170.274 -41.270 169.405 1.00 89.09  ? 492 PHE A CE1 1 
ATOM   3821  C CE2 . PHE A 1 492 ? 171.066 -39.243 170.395 1.00 89.05  ? 492 PHE A CE2 1 
ATOM   3822  C CZ  . PHE A 1 492 ? 170.224 -39.895 169.510 1.00 88.77  ? 492 PHE A CZ  1 
ATOM   3823  N N   . ALA A 1 493 ? 173.803 -44.103 174.273 1.00 96.90  ? 493 ALA A N   1 
ATOM   3824  C CA  . ALA A 1 493 ? 174.853 -44.888 174.906 1.00 83.73  ? 493 ALA A CA  1 
ATOM   3825  C C   . ALA A 1 493 ? 174.391 -46.308 175.216 1.00 94.77  ? 493 ALA A C   1 
ATOM   3826  O O   . ALA A 1 493 ? 175.145 -47.254 174.993 1.00 105.75 ? 493 ALA A O   1 
ATOM   3827  C CB  . ALA A 1 493 ? 175.331 -44.200 176.176 1.00 20.00  ? 493 ALA A CB  1 
ATOM   3828  N N   . GLU A 1 494 ? 173.165 -46.465 175.721 1.00 83.46  ? 494 GLU A N   1 
ATOM   3829  C CA  . GLU A 1 494 ? 172.640 -47.805 176.005 1.00 84.58  ? 494 GLU A CA  1 
ATOM   3830  C C   . GLU A 1 494 ? 172.608 -48.632 174.734 1.00 107.48 ? 494 GLU A C   1 
ATOM   3831  O O   . GLU A 1 494 ? 172.996 -49.797 174.721 1.00 125.85 ? 494 GLU A O   1 
ATOM   3832  C CB  . GLU A 1 494 ? 171.218 -47.780 176.588 1.00 86.09  ? 494 GLU A CB  1 
ATOM   3833  C CG  . GLU A 1 494 ? 170.833 -46.586 177.427 1.00 115.79 ? 494 GLU A CG  1 
ATOM   3834  C CD  . GLU A 1 494 ? 171.256 -46.695 178.879 1.00 136.69 ? 494 GLU A CD  1 
ATOM   3835  O OE1 . GLU A 1 494 ? 172.472 -46.687 179.171 1.00 138.93 ? 494 GLU A OE1 1 
ATOM   3836  O OE2 . GLU A 1 494 ? 170.355 -46.772 179.740 1.00 136.27 ? 494 GLU A OE2 1 
ATOM   3837  N N   . THR A 1 495 ? 172.141 -48.004 173.661 1.00 106.72 ? 495 THR A N   1 
ATOM   3838  C CA  . THR A 1 495 ? 171.998 -48.681 172.377 1.00 107.62 ? 495 THR A CA  1 
ATOM   3839  C C   . THR A 1 495 ? 173.246 -48.637 171.484 1.00 116.69 ? 495 THR A C   1 
ATOM   3840  O O   . THR A 1 495 ? 173.178 -48.974 170.302 1.00 136.63 ? 495 THR A O   1 
ATOM   3841  C CB  . THR A 1 495 ? 170.814 -48.094 171.598 1.00 109.45 ? 495 THR A CB  1 
ATOM   3842  O OG1 . THR A 1 495 ? 171.013 -46.687 171.426 1.00 112.16 ? 495 THR A OG1 1 
ATOM   3843  C CG2 . THR A 1 495 ? 169.516 -48.325 172.363 1.00 110.96 ? 495 THR A CG2 1 
ATOM   3844  N N   . GLY A 1 496 ? 174.377 -48.224 172.050 1.00 97.72  ? 496 GLY A N   1 
ATOM   3845  C CA  . GLY A 1 496 ? 175.635 -48.176 171.323 1.00 90.60  ? 496 GLY A CA  1 
ATOM   3846  C C   . GLY A 1 496 ? 175.884 -47.129 170.250 1.00 95.60  ? 496 GLY A C   1 
ATOM   3847  O O   . GLY A 1 496 ? 177.020 -46.964 169.809 1.00 100.97 ? 496 GLY A O   1 
ATOM   3848  N N   . GLN A 1 497 ? 174.846 -46.413 169.835 1.00 94.45  ? 497 GLN A N   1 
ATOM   3849  C CA  . GLN A 1 497 ? 175.006 -45.364 168.829 1.00 96.34  ? 497 GLN A CA  1 
ATOM   3850  C C   . GLN A 1 497 ? 175.909 -44.262 169.327 1.00 95.12  ? 497 GLN A C   1 
ATOM   3851  O O   . GLN A 1 497 ? 175.445 -43.294 169.921 1.00 92.31  ? 497 GLN A O   1 
ATOM   3852  C CB  . GLN A 1 497 ? 173.641 -44.813 168.437 1.00 101.14 ? 497 GLN A CB  1 
ATOM   3853  C CG  . GLN A 1 497 ? 172.722 -45.922 167.992 1.00 114.56 ? 497 GLN A CG  1 
ATOM   3854  C CD  . GLN A 1 497 ? 171.282 -45.502 168.045 1.00 124.49 ? 497 GLN A CD  1 
ATOM   3855  O OE1 . GLN A 1 497 ? 170.511 -45.993 168.864 1.00 115.43 ? 497 GLN A OE1 1 
ATOM   3856  N NE2 . GLN A 1 497 ? 170.902 -44.593 167.158 1.00 129.98 ? 497 GLN A NE2 1 
ATOM   3857  N N   . VAL A 1 498 ? 177.176 -44.358 168.934 1.00 100.54 ? 498 VAL A N   1 
ATOM   3858  C CA  . VAL A 1 498 ? 178.220 -43.480 169.434 1.00 104.69 ? 498 VAL A CA  1 
ATOM   3859  C C   . VAL A 1 498 ? 178.338 -42.216 168.612 1.00 105.32 ? 498 VAL A C   1 
ATOM   3860  O O   . VAL A 1 498 ? 178.563 -41.124 169.132 1.00 103.68 ? 498 VAL A O   1 
ATOM   3861  C CB  . VAL A 1 498 ? 179.579 -44.213 169.377 1.00 103.81 ? 498 VAL A CB  1 
ATOM   3862  C CG1 . VAL A 1 498 ? 180.752 -43.250 169.380 1.00 110.27 ? 498 VAL A CG1 1 
ATOM   3863  C CG2 . VAL A 1 498 ? 179.687 -45.280 170.468 1.00 99.75  ? 498 VAL A CG2 1 
ATOM   3864  N N   . GLN A 1 499 ? 178.125 -42.377 167.318 1.00 99.98  ? 499 GLN A N   1 
ATOM   3865  C CA  . GLN A 1 499 ? 178.236 -41.292 166.364 1.00 95.25  ? 499 GLN A CA  1 
ATOM   3866  C C   . GLN A 1 499 ? 177.190 -40.204 166.659 1.00 96.38  ? 499 GLN A C   1 
ATOM   3867  O O   . GLN A 1 499 ? 177.477 -39.002 166.592 1.00 91.85  ? 499 GLN A O   1 
ATOM   3868  C CB  . GLN A 1 499 ? 178.119 -41.895 164.959 1.00 101.59 ? 499 GLN A CB  1 
ATOM   3869  C CG  . GLN A 1 499 ? 178.665 -41.065 163.817 1.00 118.50 ? 499 GLN A CG  1 
ATOM   3870  C CD  . GLN A 1 499 ? 178.746 -41.876 162.533 1.00 143.85 ? 499 GLN A CD  1 
ATOM   3871  O OE1 . GLN A 1 499 ? 178.300 -41.444 161.474 1.00 155.20 ? 499 GLN A OE1 1 
ATOM   3872  N NE2 . GLN A 1 499 ? 179.348 -43.062 162.628 1.00 148.50 ? 499 GLN A NE2 1 
ATOM   3873  N N   . LYS A 1 500 ? 175.972 -40.637 166.971 1.00 90.80  ? 500 LYS A N   1 
ATOM   3874  C CA  . LYS A 1 500 ? 174.893 -39.721 167.317 1.00 97.11  ? 500 LYS A CA  1 
ATOM   3875  C C   . LYS A 1 500 ? 175.142 -39.013 168.652 1.00 98.30  ? 500 LYS A C   1 
ATOM   3876  O O   . LYS A 1 500 ? 174.644 -37.911 168.876 1.00 101.16 ? 500 LYS A O   1 
ATOM   3877  C CB  . LYS A 1 500 ? 173.566 -40.466 167.333 1.00 110.22 ? 500 LYS A CB  1 
ATOM   3878  C CG  . LYS A 1 500 ? 173.074 -40.739 165.921 1.00 111.57 ? 500 LYS A CG  1 
ATOM   3879  C CD  . LYS A 1 500 ? 171.713 -41.397 165.867 1.00 105.36 ? 500 LYS A CD  1 
ATOM   3880  C CE  . LYS A 1 500 ? 171.418 -41.853 164.449 1.00 119.13 ? 500 LYS A CE  1 
ATOM   3881  N NZ  . LYS A 1 500 ? 170.187 -42.675 164.360 1.00 141.79 ? 500 LYS A NZ  1 
ATOM   3882  N N   . ILE A 1 501 ? 175.891 -39.656 169.546 1.00 87.37  ? 501 ILE A N   1 
ATOM   3883  C CA  . ILE A 1 501 ? 176.226 -39.037 170.824 1.00 86.48  ? 501 ILE A CA  1 
ATOM   3884  C C   . ILE A 1 501 ? 177.023 -37.772 170.552 1.00 96.92  ? 501 ILE A C   1 
ATOM   3885  O O   . ILE A 1 501 ? 176.737 -36.710 171.102 1.00 102.83 ? 501 ILE A O   1 
ATOM   3886  C CB  . ILE A 1 501 ? 177.048 -39.965 171.751 1.00 93.60  ? 501 ILE A CB  1 
ATOM   3887  C CG1 . ILE A 1 501 ? 176.148 -41.012 172.390 1.00 99.34  ? 501 ILE A CG1 1 
ATOM   3888  C CG2 . ILE A 1 501 ? 177.729 -39.155 172.844 1.00 93.28  ? 501 ILE A CG2 1 
ATOM   3889  C CD1 . ILE A 1 501 ? 176.885 -42.233 172.887 1.00 90.06  ? 501 ILE A CD1 1 
ATOM   3890  N N   . VAL A 1 502 ? 178.035 -37.904 169.699 1.00 93.44  ? 502 VAL A N   1 
ATOM   3891  C CA  . VAL A 1 502 ? 178.919 -36.792 169.356 1.00 90.96  ? 502 VAL A CA  1 
ATOM   3892  C C   . VAL A 1 502 ? 178.230 -35.703 168.540 1.00 93.80  ? 502 VAL A C   1 
ATOM   3893  O O   . VAL A 1 502 ? 178.470 -34.516 168.756 1.00 106.35 ? 502 VAL A O   1 
ATOM   3894  C CB  . VAL A 1 502 ? 180.150 -37.282 168.576 1.00 89.08  ? 502 VAL A CB  1 
ATOM   3895  C CG1 . VAL A 1 502 ? 181.153 -36.163 168.411 1.00 89.50  ? 502 VAL A CG1 1 
ATOM   3896  C CG2 . VAL A 1 502 ? 180.777 -38.479 169.272 1.00 87.53  ? 502 VAL A CG2 1 
ATOM   3897  N N   . LEU A 1 503 ? 177.384 -36.107 167.598 1.00 91.67  ? 503 LEU A N   1 
ATOM   3898  C CA  . LEU A 1 503 ? 176.680 -35.144 166.761 1.00 101.21 ? 503 LEU A CA  1 
ATOM   3899  C C   . LEU A 1 503 ? 175.686 -34.322 167.573 1.00 104.68 ? 503 LEU A C   1 
ATOM   3900  O O   . LEU A 1 503 ? 175.585 -33.107 167.395 1.00 98.66  ? 503 LEU A O   1 
ATOM   3901  C CB  . LEU A 1 503 ? 175.962 -35.842 165.605 1.00 106.59 ? 503 LEU A CB  1 
ATOM   3902  C CG  . LEU A 1 503 ? 176.828 -36.606 164.601 1.00 105.99 ? 503 LEU A CG  1 
ATOM   3903  C CD1 . LEU A 1 503 ? 175.967 -37.593 163.836 1.00 107.19 ? 503 LEU A CD1 1 
ATOM   3904  C CD2 . LEU A 1 503 ? 177.548 -35.662 163.646 1.00 99.84  ? 503 LEU A CD2 1 
ATOM   3905  N N   . TYR A 1 504 ? 174.950 -34.988 168.457 1.00 108.51 ? 504 TYR A N   1 
ATOM   3906  C CA  . TYR A 1 504 ? 173.974 -34.319 169.317 1.00 103.14 ? 504 TYR A CA  1 
ATOM   3907  C C   . TYR A 1 504 ? 174.616 -33.326 170.285 1.00 108.20 ? 504 TYR A C   1 
ATOM   3908  O O   . TYR A 1 504 ? 174.207 -32.168 170.356 1.00 112.96 ? 504 TYR A O   1 
ATOM   3909  C CB  . TYR A 1 504 ? 173.171 -35.362 170.097 1.00 96.37  ? 504 TYR A CB  1 
ATOM   3910  C CG  . TYR A 1 504 ? 172.170 -34.791 171.079 1.00 107.64 ? 504 TYR A CG  1 
ATOM   3911  C CD1 . TYR A 1 504 ? 170.905 -34.402 170.657 1.00 116.97 ? 504 TYR A CD1 1 
ATOM   3912  C CD2 . TYR A 1 504 ? 172.476 -34.664 172.428 1.00 106.92 ? 504 TYR A CD2 1 
ATOM   3913  C CE1 . TYR A 1 504 ? 169.980 -33.886 171.544 1.00 113.26 ? 504 TYR A CE1 1 
ATOM   3914  C CE2 . TYR A 1 504 ? 171.556 -34.147 173.324 1.00 111.70 ? 504 TYR A CE2 1 
ATOM   3915  C CZ  . TYR A 1 504 ? 170.310 -33.761 172.876 1.00 115.97 ? 504 TYR A CZ  1 
ATOM   3916  O OH  . TYR A 1 504 ? 169.390 -33.249 173.763 1.00 126.29 ? 504 TYR A OH  1 
ATOM   3917  N N   . ALA A 1 505 ? 175.624 -33.784 171.022 1.00 107.19 ? 505 ALA A N   1 
ATOM   3918  C CA  . ALA A 1 505 ? 176.323 -32.946 172.000 1.00 113.54 ? 505 ALA A CA  1 
ATOM   3919  C C   . ALA A 1 505 ? 177.018 -31.739 171.375 1.00 120.36 ? 505 ALA A C   1 
ATOM   3920  O O   . ALA A 1 505 ? 177.207 -30.721 172.032 1.00 130.72 ? 505 ALA A O   1 
ATOM   3921  C CB  . ALA A 1 505 ? 177.331 -33.780 172.784 1.00 114.08 ? 505 ALA A CB  1 
ATOM   3922  N N   . LYS A 1 506 ? 177.400 -31.852 170.109 1.00 110.68 ? 506 LYS A N   1 
ATOM   3923  C CA  . LYS A 1 506 ? 178.029 -30.731 169.417 1.00 108.56 ? 506 LYS A CA  1 
ATOM   3924  C C   . LYS A 1 506 ? 176.963 -29.739 168.961 1.00 116.95 ? 506 LYS A C   1 
ATOM   3925  O O   . LYS A 1 506 ? 177.208 -28.533 168.918 1.00 130.23 ? 506 LYS A O   1 
ATOM   3926  C CB  . LYS A 1 506 ? 178.872 -31.206 168.224 1.00 114.66 ? 506 LYS A CB  1 
ATOM   3927  C CG  . LYS A 1 506 ? 180.376 -31.276 168.508 1.00 117.53 ? 506 LYS A CG  1 
ATOM   3928  C CD  . LYS A 1 506 ? 181.157 -31.816 167.305 1.00 108.95 ? 506 LYS A CD  1 
ATOM   3929  C CE  . LYS A 1 506 ? 182.667 -31.756 167.522 1.00 110.04 ? 506 LYS A CE  1 
ATOM   3930  N NZ  . LYS A 1 506 ? 183.421 -32.363 166.385 1.00 131.79 ? 506 LYS A NZ  1 
ATOM   3931  N N   . LYS A 1 507 ? 175.784 -30.242 168.608 1.00 115.35 ? 507 LYS A N   1 
ATOM   3932  C CA  . LYS A 1 507 ? 174.699 -29.366 168.174 1.00 114.78 ? 507 LYS A CA  1 
ATOM   3933  C C   . LYS A 1 507 ? 174.059 -28.579 169.318 1.00 121.09 ? 507 LYS A C   1 
ATOM   3934  O O   . LYS A 1 507 ? 173.941 -27.359 169.244 1.00 134.65 ? 507 LYS A O   1 
ATOM   3935  C CB  . LYS A 1 507 ? 173.627 -30.177 167.451 1.00 110.74 ? 507 LYS A CB  1 
ATOM   3936  C CG  . LYS A 1 507 ? 173.774 -30.165 165.945 1.00 137.93 ? 507 LYS A CG  1 
ATOM   3937  C CD  . LYS A 1 507 ? 173.643 -28.751 165.409 1.00 151.93 ? 507 LYS A CD  1 
ATOM   3938  C CE  . LYS A 1 507 ? 173.665 -28.738 163.890 1.00 153.14 ? 507 LYS A CE  1 
ATOM   3939  N NZ  . LYS A 1 507 ? 173.932 -27.374 163.355 1.00 150.18 ? 507 LYS A NZ  1 
ATOM   3940  N N   . VAL A 1 508 ? 173.653 -29.272 170.377 1.00 112.47 ? 508 VAL A N   1 
ATOM   3941  C CA  . VAL A 1 508 ? 173.018 -28.610 171.521 1.00 113.79 ? 508 VAL A CA  1 
ATOM   3942  C C   . VAL A 1 508 ? 174.005 -27.920 172.478 1.00 113.43 ? 508 VAL A C   1 
ATOM   3943  O O   . VAL A 1 508 ? 173.594 -27.167 173.358 1.00 107.63 ? 508 VAL A O   1 
ATOM   3944  C CB  . VAL A 1 508 ? 172.130 -29.602 172.316 1.00 108.56 ? 508 VAL A CB  1 
ATOM   3945  C CG1 . VAL A 1 508 ? 171.201 -30.364 171.377 1.00 105.63 ? 508 VAL A CG1 1 
ATOM   3946  C CG2 . VAL A 1 508 ? 172.983 -30.542 173.151 1.00 121.23 ? 508 VAL A CG2 1 
ATOM   3947  N N   . GLY A 1 509 ? 175.298 -28.192 172.314 1.00 107.82 ? 509 GLY A N   1 
ATOM   3948  C CA  . GLY A 1 509 ? 176.346 -27.552 173.100 1.00 109.07 ? 509 GLY A CA  1 
ATOM   3949  C C   . GLY A 1 509 ? 176.580 -28.126 174.486 1.00 110.96 ? 509 GLY A C   1 
ATOM   3950  O O   . GLY A 1 509 ? 177.334 -27.572 175.293 1.00 119.95 ? 509 GLY A O   1 
ATOM   3951  N N   . TYR A 1 510 ? 175.914 -29.240 174.758 1.00 109.98 ? 510 TYR A N   1 
ATOM   3952  C CA  . TYR A 1 510 ? 176.019 -29.946 176.033 1.00 109.36 ? 510 TYR A CA  1 
ATOM   3953  C C   . TYR A 1 510 ? 177.356 -30.681 176.141 1.00 113.95 ? 510 TYR A C   1 
ATOM   3954  O O   . TYR A 1 510 ? 177.771 -31.304 175.167 1.00 120.88 ? 510 TYR A O   1 
ATOM   3955  C CB  . TYR A 1 510 ? 174.876 -30.948 176.183 1.00 103.01 ? 510 TYR A CB  1 
ATOM   3956  C CG  . TYR A 1 510 ? 174.976 -31.812 177.417 1.00 108.75 ? 510 TYR A CG  1 
ATOM   3957  C CD1 . TYR A 1 510 ? 175.171 -31.239 178.668 1.00 115.04 ? 510 TYR A CD1 1 
ATOM   3958  C CD2 . TYR A 1 510 ? 174.890 -33.191 177.337 1.00 107.35 ? 510 TYR A CD2 1 
ATOM   3959  C CE1 . TYR A 1 510 ? 175.256 -32.016 179.803 1.00 111.31 ? 510 TYR A CE1 1 
ATOM   3960  C CE2 . TYR A 1 510 ? 174.976 -33.980 178.469 1.00 109.44 ? 510 TYR A CE2 1 
ATOM   3961  C CZ  . TYR A 1 510 ? 175.160 -33.385 179.698 1.00 111.23 ? 510 TYR A CZ  1 
ATOM   3962  O OH  . TYR A 1 510 ? 175.250 -34.161 180.830 1.00 108.39 ? 510 TYR A OH  1 
ATOM   3963  N N   . THR A 1 511 ? 178.067 -30.572 177.264 1.00 99.12  ? 511 THR A N   1 
ATOM   3964  C CA  . THR A 1 511 ? 179.308 -31.337 177.406 1.00 95.25  ? 511 THR A CA  1 
ATOM   3965  C C   . THR A 1 511 ? 179.187 -32.424 178.471 1.00 91.83  ? 511 THR A C   1 
ATOM   3966  O O   . THR A 1 511 ? 179.074 -32.137 179.662 1.00 93.40  ? 511 THR A O   1 
ATOM   3967  C CB  . THR A 1 511 ? 180.497 -30.458 177.763 1.00 100.05 ? 511 THR A CB  1 
ATOM   3968  O OG1 . THR A 1 511 ? 180.613 -29.402 176.802 1.00 100.99 ? 511 THR A OG1 1 
ATOM   3969  C CG2 . THR A 1 511 ? 181.756 -31.302 177.748 1.00 105.30 ? 511 THR A CG2 1 
ATOM   3970  N N   . PRO A 1 512 ? 179.211 -33.688 178.044 1.00 92.23  ? 512 PRO A N   1 
ATOM   3971  C CA  . PRO A 1 512 ? 179.140 -34.800 178.989 1.00 90.60  ? 512 PRO A CA  1 
ATOM   3972  C C   . PRO A 1 512 ? 180.535 -35.232 179.461 1.00 104.29 ? 512 PRO A C   1 
ATOM   3973  O O   . PRO A 1 512 ? 181.533 -34.627 179.071 1.00 111.83 ? 512 PRO A O   1 
ATOM   3974  C CB  . PRO A 1 512 ? 178.463 -35.898 178.170 1.00 86.41  ? 512 PRO A CB  1 
ATOM   3975  C CG  . PRO A 1 512 ? 178.853 -35.594 176.739 1.00 89.50  ? 512 PRO A CG  1 
ATOM   3976  C CD  . PRO A 1 512 ? 179.355 -34.170 176.663 1.00 93.64  ? 512 PRO A CD  1 
ATOM   3977  N N   . ASP A 1 513 ? 180.600 -36.266 180.295 1.00 95.72  ? 513 ASP A N   1 
ATOM   3978  C CA  . ASP A 1 513 ? 181.875 -36.784 180.780 1.00 93.32  ? 513 ASP A CA  1 
ATOM   3979  C C   . ASP A 1 513 ? 182.353 -37.779 179.726 1.00 95.02  ? 513 ASP A C   1 
ATOM   3980  O O   . ASP A 1 513 ? 182.001 -38.961 179.776 1.00 99.11  ? 513 ASP A O   1 
ATOM   3981  C CB  . ASP A 1 513 ? 181.751 -37.431 182.160 1.00 96.12  ? 513 ASP A CB  1 
ATOM   3982  C CG  . ASP A 1 513 ? 183.097 -37.614 182.836 1.00 110.68 ? 513 ASP A CG  1 
ATOM   3983  O OD1 . ASP A 1 513 ? 184.134 -37.592 182.136 1.00 122.93 ? 513 ASP A OD1 1 
ATOM   3984  O OD2 . ASP A 1 513 ? 183.111 -37.792 184.070 1.00 106.73 ? 513 ASP A OD2 1 
ATOM   3985  N N   . TRP A 1 514 ? 183.046 -37.254 178.719 1.00 83.53  ? 514 TRP A N   1 
ATOM   3986  C CA  . TRP A 1 514 ? 183.538 -38.009 177.575 1.00 75.61  ? 514 TRP A CA  1 
ATOM   3987  C C   . TRP A 1 514 ? 184.321 -39.292 177.933 1.00 73.53  ? 514 TRP A C   1 
ATOM   3988  O O   . TRP A 1 514 ? 184.063 -40.360 177.369 1.00 73.20  ? 514 TRP A O   1 
ATOM   3989  C CB  . TRP A 1 514 ? 184.400 -37.069 176.717 1.00 75.96  ? 514 TRP A CB  1 
ATOM   3990  C CG  . TRP A 1 514 ? 183.601 -35.985 176.025 1.00 78.12  ? 514 TRP A CG  1 
ATOM   3991  C CD1 . TRP A 1 514 ? 183.791 -34.636 176.119 1.00 94.88  ? 514 TRP A CD1 1 
ATOM   3992  C CD2 . TRP A 1 514 ? 182.504 -36.169 175.120 1.00 78.35  ? 514 TRP A CD2 1 
ATOM   3993  N NE1 . TRP A 1 514 ? 182.872 -33.969 175.339 1.00 96.60  ? 514 TRP A NE1 1 
ATOM   3994  C CE2 . TRP A 1 514 ? 182.073 -34.890 174.714 1.00 85.50  ? 514 TRP A CE2 1 
ATOM   3995  C CE3 . TRP A 1 514 ? 181.844 -37.292 174.617 1.00 78.84  ? 514 TRP A CE3 1 
ATOM   3996  C CZ2 . TRP A 1 514 ? 181.013 -34.707 173.828 1.00 82.24  ? 514 TRP A CZ2 1 
ATOM   3997  C CZ3 . TRP A 1 514 ? 180.795 -37.108 173.745 1.00 80.53  ? 514 TRP A CZ3 1 
ATOM   3998  C CH2 . TRP A 1 514 ? 180.387 -35.828 173.360 1.00 81.95  ? 514 TRP A CH2 1 
ATOM   3999  N N   . ILE A 1 515 ? 185.277 -39.185 178.854 1.00 68.64  ? 515 ILE A N   1 
ATOM   4000  C CA  . ILE A 1 515 ? 186.081 -40.335 179.278 1.00 68.84  ? 515 ILE A CA  1 
ATOM   4001  C C   . ILE A 1 515 ? 185.228 -41.450 179.882 1.00 68.95  ? 515 ILE A C   1 
ATOM   4002  O O   . ILE A 1 515 ? 185.417 -42.630 179.562 1.00 68.49  ? 515 ILE A O   1 
ATOM   4003  C CB  . ILE A 1 515 ? 187.152 -39.921 180.315 1.00 68.73  ? 515 ILE A CB  1 
ATOM   4004  C CG1 . ILE A 1 515 ? 187.940 -38.708 179.816 1.00 70.86  ? 515 ILE A CG1 1 
ATOM   4005  C CG2 . ILE A 1 515 ? 188.116 -41.076 180.600 1.00 70.84  ? 515 ILE A CG2 1 
ATOM   4006  C CD1 . ILE A 1 515 ? 188.723 -38.953 178.531 1.00 71.87  ? 515 ILE A CD1 1 
ATOM   4007  N N   . PHE A 1 516 ? 184.316 -41.082 180.777 1.00 67.40  ? 516 PHE A N   1 
ATOM   4008  C CA  . PHE A 1 516 ? 183.430 -42.058 181.405 1.00 71.83  ? 516 PHE A CA  1 
ATOM   4009  C C   . PHE A 1 516 ? 182.588 -42.787 180.359 1.00 84.90  ? 516 PHE A C   1 
ATOM   4010  O O   . PHE A 1 516 ? 182.286 -43.971 180.508 1.00 99.73  ? 516 PHE A O   1 
ATOM   4011  C CB  . PHE A 1 516 ? 182.535 -41.383 182.439 1.00 78.54  ? 516 PHE A CB  1 
ATOM   4012  C CG  . PHE A 1 516 ? 181.437 -42.270 182.960 1.00 79.85  ? 516 PHE A CG  1 
ATOM   4013  C CD1 . PHE A 1 516 ? 181.723 -43.292 183.853 1.00 79.33  ? 516 PHE A CD1 1 
ATOM   4014  C CD2 . PHE A 1 516 ? 180.120 -42.072 182.579 1.00 71.75  ? 516 PHE A CD2 1 
ATOM   4015  C CE1 . PHE A 1 516 ? 180.721 -44.112 184.338 1.00 76.25  ? 516 PHE A CE1 1 
ATOM   4016  C CE2 . PHE A 1 516 ? 179.116 -42.885 183.063 1.00 75.32  ? 516 PHE A CE2 1 
ATOM   4017  C CZ  . PHE A 1 516 ? 179.415 -43.906 183.945 1.00 72.63  ? 516 PHE A CZ  1 
ATOM   4018  N N   . LEU A 1 517 ? 182.219 -42.070 179.299 1.00 82.29  ? 517 LEU A N   1 
ATOM   4019  C CA  . LEU A 1 517 ? 181.482 -42.660 178.186 1.00 76.02  ? 517 LEU A CA  1 
ATOM   4020  C C   . LEU A 1 517 ? 182.386 -43.609 177.414 1.00 82.84  ? 517 LEU A C   1 
ATOM   4021  O O   . LEU A 1 517 ? 181.951 -44.671 176.971 1.00 95.13  ? 517 LEU A O   1 
ATOM   4022  C CB  . LEU A 1 517 ? 180.927 -41.582 177.252 1.00 71.52  ? 517 LEU A CB  1 
ATOM   4023  C CG  . LEU A 1 517 ? 179.832 -40.679 177.820 1.00 74.36  ? 517 LEU A CG  1 
ATOM   4024  C CD1 . LEU A 1 517 ? 179.409 -39.658 176.784 1.00 75.27  ? 517 LEU A CD1 1 
ATOM   4025  C CD2 . LEU A 1 517 ? 178.644 -41.509 178.267 1.00 75.45  ? 517 LEU A CD2 1 
ATOM   4026  N N   . LEU A 1 518 ? 183.645 -43.205 177.253 1.00 77.22  ? 518 LEU A N   1 
ATOM   4027  C CA  . LEU A 1 518 ? 184.660 -44.015 176.577 1.00 69.80  ? 518 LEU A CA  1 
ATOM   4028  C C   . LEU A 1 518 ? 184.842 -45.349 177.291 1.00 76.05  ? 518 LEU A C   1 
ATOM   4029  O O   . LEU A 1 518 ? 184.803 -46.406 176.663 1.00 89.70  ? 518 LEU A O   1 
ATOM   4030  C CB  . LEU A 1 518 ? 185.993 -43.267 176.507 1.00 73.29  ? 518 LEU A CB  1 
ATOM   4031  C CG  . LEU A 1 518 ? 186.830 -43.366 175.228 1.00 71.97  ? 518 LEU A CG  1 
ATOM   4032  C CD1 . LEU A 1 518 ? 188.220 -42.855 175.504 1.00 71.71  ? 518 LEU A CD1 1 
ATOM   4033  C CD2 . LEU A 1 518 ? 186.896 -44.784 174.684 1.00 77.39  ? 518 LEU A CD2 1 
ATOM   4034  N N   . ARG A 1 519 ? 185.046 -45.287 178.603 1.00 69.03  ? 519 ARG A N   1 
ATOM   4035  C CA  . ARG A 1 519 ? 185.230 -46.482 179.416 1.00 69.15  ? 519 ARG A CA  1 
ATOM   4036  C C   . ARG A 1 519 ? 184.046 -47.421 179.266 1.00 79.84  ? 519 ARG A C   1 
ATOM   4037  O O   . ARG A 1 519 ? 184.212 -48.636 179.167 1.00 79.77  ? 519 ARG A O   1 
ATOM   4038  C CB  . ARG A 1 519 ? 185.412 -46.118 180.887 1.00 68.36  ? 519 ARG A CB  1 
ATOM   4039  C CG  . ARG A 1 519 ? 186.757 -45.515 181.233 1.00 78.85  ? 519 ARG A CG  1 
ATOM   4040  C CD  . ARG A 1 519 ? 187.111 -45.797 182.677 1.00 80.91  ? 519 ARG A CD  1 
ATOM   4041  N NE  . ARG A 1 519 ? 188.413 -45.254 183.045 1.00 76.93  ? 519 ARG A NE  1 
ATOM   4042  C CZ  . ARG A 1 519 ? 188.595 -44.067 183.610 1.00 86.82  ? 519 ARG A CZ  1 
ATOM   4043  N NH1 . ARG A 1 519 ? 189.819 -43.656 183.915 1.00 85.23  ? 519 ARG A NH1 1 
ATOM   4044  N NH2 . ARG A 1 519 ? 187.550 -43.298 183.882 1.00 94.89  ? 519 ARG A NH2 1 
ATOM   4045  N N   . ASN A 1 520 ? 182.843 -46.856 179.251 1.00 82.97  ? 520 ASN A N   1 
ATOM   4046  C CA  . ASN A 1 520 ? 181.650 -47.674 179.088 1.00 93.10  ? 520 ASN A CA  1 
ATOM   4047  C C   . ASN A 1 520 ? 181.662 -48.355 177.739 1.00 97.10  ? 520 ASN A C   1 
ATOM   4048  O O   . ASN A 1 520 ? 181.312 -49.529 177.615 1.00 112.72 ? 520 ASN A O   1 
ATOM   4049  C CB  . ASN A 1 520 ? 180.367 -46.855 179.224 1.00 99.87  ? 520 ASN A CB  1 
ATOM   4050  C CG  . ASN A 1 520 ? 180.138 -46.390 180.629 1.00 111.48 ? 520 ASN A CG  1 
ATOM   4051  O OD1 . ASN A 1 520 ? 181.028 -46.499 181.472 1.00 79.51  ? 520 ASN A OD1 1 
ATOM   4052  N ND2 . ASN A 1 520 ? 178.916 -45.964 180.924 1.00 136.84 ? 520 ASN A ND2 1 
ATOM   4053  N N   . VAL A 1 521 ? 182.018 -47.587 176.716 1.00 76.07  ? 521 VAL A N   1 
ATOM   4054  C CA  . VAL A 1 521 ? 182.070 -48.109 175.355 1.00 74.91  ? 521 VAL A CA  1 
ATOM   4055  C C   . VAL A 1 521 ? 183.129 -49.203 175.262 1.00 77.75  ? 521 VAL A C   1 
ATOM   4056  O O   . VAL A 1 521 ? 182.916 -50.239 174.642 1.00 84.34  ? 521 VAL A O   1 
ATOM   4057  C CB  . VAL A 1 521 ? 182.395 -47.033 174.337 1.00 77.12  ? 521 VAL A CB  1 
ATOM   4058  C CG1 . VAL A 1 521 ? 182.676 -47.689 173.007 1.00 77.56  ? 521 VAL A CG1 1 
ATOM   4059  C CG2 . VAL A 1 521 ? 181.213 -46.124 174.160 1.00 86.77  ? 521 VAL A CG2 1 
ATOM   4060  N N   . MET A 1 522 ? 184.287 -48.933 175.859 1.00 77.58  ? 522 MET A N   1 
ATOM   4061  C CA  . MET A 1 522 ? 185.412 -49.864 175.870 1.00 75.99  ? 522 MET A CA  1 
ATOM   4062  C C   . MET A 1 522 ? 185.041 -51.173 176.549 1.00 77.87  ? 522 MET A C   1 
ATOM   4063  O O   . MET A 1 522 ? 185.446 -52.254 176.121 1.00 77.80  ? 522 MET A O   1 
ATOM   4064  C CB  . MET A 1 522 ? 186.627 -49.258 176.584 1.00 86.91  ? 522 MET A CB  1 
ATOM   4065  C CG  . MET A 1 522 ? 187.313 -48.133 175.851 1.00 100.58 ? 522 MET A CG  1 
ATOM   4066  S SD  . MET A 1 522 ? 188.484 -48.740 174.635 1.00 109.21 ? 522 MET A SD  1 
ATOM   4067  C CE  . MET A 1 522 ? 189.789 -47.533 174.839 1.00 114.59 ? 522 MET A CE  1 
ATOM   4068  N N   . ARG A 1 523 ? 184.275 -51.050 177.627 1.00 76.21  ? 523 ARG A N   1 
ATOM   4069  C CA  . ARG A 1 523 ? 183.849 -52.186 178.438 1.00 77.96  ? 523 ARG A CA  1 
ATOM   4070  C C   . ARG A 1 523 ? 183.012 -53.160 177.622 1.00 83.66  ? 523 ARG A C   1 
ATOM   4071  O O   . ARG A 1 523 ? 183.353 -54.336 177.493 1.00 82.28  ? 523 ARG A O   1 
ATOM   4072  C CB  . ARG A 1 523 ? 183.029 -51.681 179.636 1.00 77.62  ? 523 ARG A CB  1 
ATOM   4073  C CG  . ARG A 1 523 ? 183.340 -52.317 180.979 1.00 72.67  ? 523 ARG A CG  1 
ATOM   4074  C CD  . ARG A 1 523 ? 182.304 -51.951 182.058 1.00 67.41  ? 523 ARG A CD  1 
ATOM   4075  N NE  . ARG A 1 523 ? 181.917 -50.533 182.094 1.00 69.03  ? 523 ARG A NE  1 
ATOM   4076  C CZ  . ARG A 1 523 ? 182.656 -49.543 182.594 1.00 82.38  ? 523 ARG A CZ  1 
ATOM   4077  N NH1 . ARG A 1 523 ? 183.857 -49.788 183.081 1.00 94.43  ? 523 ARG A NH1 1 
ATOM   4078  N NH2 . ARG A 1 523 ? 182.202 -48.295 182.591 1.00 75.41  ? 523 ARG A NH2 1 
ATOM   4079  N N   . ILE A 1 524 ? 181.921 -52.651 177.060 1.00 93.81  ? 524 ILE A N   1 
ATOM   4080  C CA  . ILE A 1 524 ? 181.007 -53.476 176.290 1.00 84.96  ? 524 ILE A CA  1 
ATOM   4081  C C   . ILE A 1 524 ? 181.681 -53.985 175.008 1.00 100.91 ? 524 ILE A C   1 
ATOM   4082  O O   . ILE A 1 524 ? 181.688 -55.189 174.738 1.00 123.60 ? 524 ILE A O   1 
ATOM   4083  C CB  . ILE A 1 524 ? 179.709 -52.696 175.974 1.00 86.67  ? 524 ILE A CB  1 
ATOM   4084  C CG1 . ILE A 1 524 ? 178.826 -52.631 177.231 1.00 96.67  ? 524 ILE A CG1 1 
ATOM   4085  C CG2 . ILE A 1 524 ? 179.000 -53.245 174.724 1.00 107.16 ? 524 ILE A CG2 1 
ATOM   4086  C CD1 . ILE A 1 524 ? 177.321 -52.561 176.985 1.00 123.46 ? 524 ILE A CD1 1 
ATOM   4087  N N   . SER A 1 525 ? 182.262 -53.071 174.230 1.00 102.30 ? 525 SER A N   1 
ATOM   4088  C CA  . SER A 1 525 ? 182.880 -53.427 172.949 1.00 119.51 ? 525 SER A CA  1 
ATOM   4089  C C   . SER A 1 525 ? 183.952 -52.402 172.533 1.00 101.36 ? 525 SER A C   1 
ATOM   4090  O O   . SER A 1 525 ? 183.629 -51.283 172.129 1.00 108.04 ? 525 SER A O   1 
ATOM   4091  C CB  . SER A 1 525 ? 181.814 -53.587 171.862 1.00 145.21 ? 525 SER A CB  1 
ATOM   4092  O OG  . SER A 1 525 ? 182.229 -54.514 170.873 1.00 155.13 ? 525 SER A OG  1 
ATOM   4093  N N   . PRO A 1 526 ? 185.232 -52.787 172.641 1.00 87.07  ? 526 PRO A N   1 
ATOM   4094  C CA  . PRO A 1 526 ? 186.439 -51.995 172.360 1.00 96.40  ? 526 PRO A CA  1 
ATOM   4095  C C   . PRO A 1 526 ? 186.553 -51.519 170.911 1.00 110.24 ? 526 PRO A C   1 
ATOM   4096  O O   . PRO A 1 526 ? 187.136 -50.457 170.672 1.00 118.61 ? 526 PRO A O   1 
ATOM   4097  C CB  . PRO A 1 526 ? 187.576 -52.976 172.674 1.00 103.12 ? 526 PRO A CB  1 
ATOM   4098  C CG  . PRO A 1 526 ? 186.953 -54.324 172.506 1.00 109.73 ? 526 PRO A CG  1 
ATOM   4099  C CD  . PRO A 1 526 ? 185.574 -54.157 173.049 1.00 93.95  ? 526 PRO A CD  1 
ATOM   4100  N N   . ASP A 1 527 ? 186.059 -52.315 169.968 1.00 115.48 ? 527 ASP A N   1 
ATOM   4101  C CA  . ASP A 1 527 ? 186.129 -51.977 168.554 1.00 115.02 ? 527 ASP A CA  1 
ATOM   4102  C C   . ASP A 1 527 ? 185.424 -50.653 168.329 1.00 100.43 ? 527 ASP A C   1 
ATOM   4103  O O   . ASP A 1 527 ? 185.902 -49.790 167.587 1.00 88.96  ? 527 ASP A O   1 
ATOM   4104  C CB  . ASP A 1 527 ? 185.496 -53.083 167.714 1.00 133.91 ? 527 ASP A CB  1 
ATOM   4105  C CG  . ASP A 1 527 ? 184.315 -53.747 168.413 1.00 139.09 ? 527 ASP A CG  1 
ATOM   4106  O OD1 . ASP A 1 527 ? 184.299 -53.779 169.660 1.00 142.62 ? 527 ASP A OD1 1 
ATOM   4107  O OD2 . ASP A 1 527 ? 183.403 -54.235 167.713 1.00 121.80 ? 527 ASP A OD2 1 
ATOM   4108  N N   . GLN A 1 528 ? 184.270 -50.516 168.971 1.00 97.16  ? 528 GLN A N   1 
ATOM   4109  C CA  . GLN A 1 528 ? 183.510 -49.288 168.895 1.00 94.40  ? 528 GLN A CA  1 
ATOM   4110  C C   . GLN A 1 528 ? 184.268 -48.224 169.681 1.00 85.47  ? 528 GLN A C   1 
ATOM   4111  O O   . GLN A 1 528 ? 184.215 -47.037 169.357 1.00 83.07  ? 528 GLN A O   1 
ATOM   4112  C CB  . GLN A 1 528 ? 182.092 -49.477 169.427 1.00 97.74  ? 528 GLN A CB  1 
ATOM   4113  C CG  . GLN A 1 528 ? 181.222 -50.251 168.446 1.00 114.25 ? 528 GLN A CG  1 
ATOM   4114  C CD  . GLN A 1 528 ? 179.749 -49.992 168.606 1.00 121.90 ? 528 GLN A CD  1 
ATOM   4115  O OE1 . GLN A 1 528 ? 179.305 -48.872 168.385 1.00 128.14 ? 528 GLN A OE1 1 
ATOM   4116  N NE2 . GLN A 1 528 ? 178.977 -51.017 168.957 1.00 112.44 ? 528 GLN A NE2 1 
ATOM   4117  N N   . GLY A 1 529 ? 184.946 -48.669 170.737 1.00 83.69  ? 529 GLY A N   1 
ATOM   4118  C CA  . GLY A 1 529 ? 185.748 -47.803 171.584 1.00 86.41  ? 529 GLY A CA  1 
ATOM   4119  C C   . GLY A 1 529 ? 186.768 -46.984 170.825 1.00 80.96  ? 529 GLY A C   1 
ATOM   4120  O O   . GLY A 1 529 ? 186.888 -45.775 171.022 1.00 81.25  ? 529 GLY A O   1 
ATOM   4121  N N   . GLN A 1 530 ? 187.514 -47.655 169.955 1.00 79.35  ? 530 GLN A N   1 
ATOM   4122  C CA  . GLN A 1 530 ? 188.536 -46.991 169.154 1.00 81.54  ? 530 GLN A CA  1 
ATOM   4123  C C   . GLN A 1 530 ? 187.946 -45.965 168.189 1.00 97.55  ? 530 GLN A C   1 
ATOM   4124  O O   . GLN A 1 530 ? 188.514 -44.888 167.991 1.00 82.80  ? 530 GLN A O   1 
ATOM   4125  C CB  . GLN A 1 530 ? 189.363 -48.022 168.387 1.00 85.80  ? 530 GLN A CB  1 
ATOM   4126  C CG  . GLN A 1 530 ? 190.505 -47.394 167.623 1.00 93.64  ? 530 GLN A CG  1 
ATOM   4127  C CD  . GLN A 1 530 ? 191.103 -48.311 166.587 1.00 96.48  ? 530 GLN A CD  1 
ATOM   4128  O OE1 . GLN A 1 530 ? 190.961 -49.531 166.663 1.00 105.64 ? 530 GLN A OE1 1 
ATOM   4129  N NE2 . GLN A 1 530 ? 191.728 -47.723 165.573 1.00 87.82  ? 530 GLN A NE2 1 
ATOM   4130  N N   . GLN A 1 531 ? 186.809 -46.303 167.588 1.00 113.84 ? 531 GLN A N   1 
ATOM   4131  C CA  . GLN A 1 531 ? 186.127 -45.385 166.682 1.00 96.03  ? 531 GLN A CA  1 
ATOM   4132  C C   . GLN A 1 531 ? 185.706 -44.140 167.446 1.00 99.73  ? 531 GLN A C   1 
ATOM   4133  O O   . GLN A 1 531 ? 185.866 -43.018 166.973 1.00 99.28  ? 531 GLN A O   1 
ATOM   4134  C CB  . GLN A 1 531 ? 184.903 -46.030 166.032 1.00 84.29  ? 531 GLN A CB  1 
ATOM   4135  C CG  . GLN A 1 531 ? 184.119 -45.040 165.173 1.00 103.23 ? 531 GLN A CG  1 
ATOM   4136  C CD  . GLN A 1 531 ? 182.737 -45.530 164.790 1.00 121.16 ? 531 GLN A CD  1 
ATOM   4137  O OE1 . GLN A 1 531 ? 182.415 -46.709 164.938 1.00 132.24 ? 531 GLN A OE1 1 
ATOM   4138  N NE2 . GLN A 1 531 ? 181.910 -44.619 164.291 1.00 123.20 ? 531 GLN A NE2 1 
ATOM   4139  N N   . PHE A 1 532 ? 185.150 -44.365 168.629 1.00 91.22  ? 532 PHE A N   1 
ATOM   4140  C CA  . PHE A 1 532 ? 184.713 -43.295 169.510 1.00 82.76  ? 532 PHE A CA  1 
ATOM   4141  C C   . PHE A 1 532 ? 185.880 -42.402 169.912 1.00 81.73  ? 532 PHE A C   1 
ATOM   4142  O O   . PHE A 1 532 ? 185.748 -41.179 169.939 1.00 81.46  ? 532 PHE A O   1 
ATOM   4143  C CB  . PHE A 1 532 ? 183.998 -43.900 170.727 1.00 81.69  ? 532 PHE A CB  1 
ATOM   4144  C CG  . PHE A 1 532 ? 183.472 -42.886 171.711 1.00 81.39  ? 532 PHE A CG  1 
ATOM   4145  C CD1 . PHE A 1 532 ? 182.884 -41.711 171.284 1.00 83.78  ? 532 PHE A CD1 1 
ATOM   4146  C CD2 . PHE A 1 532 ? 183.460 -43.170 173.059 1.00 82.18  ? 532 PHE A CD2 1 
ATOM   4147  C CE1 . PHE A 1 532 ? 182.371 -40.809 172.183 1.00 84.07  ? 532 PHE A CE1 1 
ATOM   4148  C CE2 . PHE A 1 532 ? 182.944 -42.274 173.966 1.00 90.93  ? 532 PHE A CE2 1 
ATOM   4149  C CZ  . PHE A 1 532 ? 182.403 -41.085 173.536 1.00 83.25  ? 532 PHE A CZ  1 
ATOM   4150  N N   . ALA A 1 533 ? 187.021 -43.017 170.206 1.00 80.34  ? 533 ALA A N   1 
ATOM   4151  C CA  . ALA A 1 533 ? 188.230 -42.275 170.549 1.00 79.49  ? 533 ALA A CA  1 
ATOM   4152  C C   . ALA A 1 533 ? 188.634 -41.337 169.412 1.00 84.51  ? 533 ALA A C   1 
ATOM   4153  O O   . ALA A 1 533 ? 189.141 -40.241 169.647 1.00 88.83  ? 533 ALA A O   1 
ATOM   4154  C CB  . ALA A 1 533 ? 189.367 -43.232 170.875 1.00 79.18  ? 533 ALA A CB  1 
ATOM   4155  N N   . GLN A 1 534 ? 188.402 -41.774 168.178 1.00 84.80  ? 534 GLN A N   1 
ATOM   4156  C CA  . GLN A 1 534 ? 188.733 -40.981 166.995 1.00 88.89  ? 534 GLN A CA  1 
ATOM   4157  C C   . GLN A 1 534 ? 187.936 -39.688 166.912 1.00 88.82  ? 534 GLN A C   1 
ATOM   4158  O O   . GLN A 1 534 ? 188.475 -38.631 166.589 1.00 89.31  ? 534 GLN A O   1 
ATOM   4159  C CB  . GLN A 1 534 ? 188.481 -41.806 165.735 1.00 108.19 ? 534 GLN A CB  1 
ATOM   4160  C CG  . GLN A 1 534 ? 188.936 -41.170 164.438 1.00 135.47 ? 534 GLN A CG  1 
ATOM   4161  C CD  . GLN A 1 534 ? 188.014 -41.521 163.286 1.00 146.45 ? 534 GLN A CD  1 
ATOM   4162  O OE1 . GLN A 1 534 ? 188.103 -42.609 162.720 1.00 155.33 ? 534 GLN A OE1 1 
ATOM   4163  N NE2 . GLN A 1 534 ? 187.118 -40.603 162.938 1.00 133.83 ? 534 GLN A NE2 1 
ATOM   4164  N N   . MET A 1 535 ? 186.652 -39.789 167.230 1.00 99.87  ? 535 MET A N   1 
ATOM   4165  C CA  . MET A 1 535 ? 185.741 -38.655 167.181 1.00 97.63  ? 535 MET A CA  1 
ATOM   4166  C C   . MET A 1 535 ? 186.043 -37.613 168.252 1.00 100.16 ? 535 MET A C   1 
ATOM   4167  O O   . MET A 1 535 ? 185.875 -36.413 168.037 1.00 99.21  ? 535 MET A O   1 
ATOM   4168  C CB  . MET A 1 535 ? 184.307 -39.151 167.320 1.00 88.55  ? 535 MET A CB  1 
ATOM   4169  C CG  . MET A 1 535 ? 183.917 -40.123 166.230 1.00 92.27  ? 535 MET A CG  1 
ATOM   4170  S SD  . MET A 1 535 ? 182.219 -40.701 166.361 1.00 102.53 ? 535 MET A SD  1 
ATOM   4171  C CE  . MET A 1 535 ? 181.346 -39.296 165.689 1.00 123.65 ? 535 MET A CE  1 
ATOM   4172  N N   . LEU A 1 536 ? 186.507 -38.083 169.404 1.00 99.45  ? 536 LEU A N   1 
ATOM   4173  C CA  . LEU A 1 536 ? 186.807 -37.203 170.525 1.00 93.70  ? 536 LEU A CA  1 
ATOM   4174  C C   . LEU A 1 536 ? 187.940 -36.232 170.233 1.00 96.84  ? 536 LEU A C   1 
ATOM   4175  O O   . LEU A 1 536 ? 187.983 -35.148 170.810 1.00 96.99  ? 536 LEU A O   1 
ATOM   4176  C CB  . LEU A 1 536 ? 187.125 -38.046 171.763 1.00 91.67  ? 536 LEU A CB  1 
ATOM   4177  C CG  . LEU A 1 536 ? 185.990 -38.062 172.788 1.00 99.82  ? 536 LEU A CG  1 
ATOM   4178  C CD1 . LEU A 1 536 ? 184.712 -38.535 172.156 1.00 107.25 ? 536 LEU A CD1 1 
ATOM   4179  C CD2 . LEU A 1 536 ? 186.371 -38.991 173.924 1.00 102.62 ? 536 LEU A CD2 1 
ATOM   4180  N N   . VAL A 1 537 ? 188.869 -36.620 169.363 1.00 103.61 ? 537 VAL A N   1 
ATOM   4181  C CA  . VAL A 1 537 ? 189.946 -35.708 168.977 1.00 101.99 ? 537 VAL A CA  1 
ATOM   4182  C C   . VAL A 1 537 ? 189.897 -35.239 167.519 1.00 108.36 ? 537 VAL A C   1 
ATOM   4183  O O   . VAL A 1 537 ? 190.377 -35.928 166.624 1.00 114.38 ? 537 VAL A O   1 
ATOM   4184  C CB  . VAL A 1 537 ? 191.337 -36.311 169.230 1.00 101.39 ? 537 VAL A CB  1 
ATOM   4185  C CG1 . VAL A 1 537 ? 192.409 -35.292 168.870 1.00 115.53 ? 537 VAL A CG1 1 
ATOM   4186  C CG2 . VAL A 1 537 ? 191.484 -36.739 170.679 1.00 99.71  ? 537 VAL A CG2 1 
ATOM   4187  N N   . GLN A 1 538 ? 189.332 -34.058 167.293 1.00 123.52 ? 538 GLN A N   1 
ATOM   4188  C CA  . GLN A 1 538 ? 189.343 -33.431 165.969 1.00 121.70 ? 538 GLN A CA  1 
ATOM   4189  C C   . GLN A 1 538 ? 189.437 -31.908 166.121 1.00 122.12 ? 538 GLN A C   1 
ATOM   4190  O O   . GLN A 1 538 ? 189.072 -31.352 167.156 1.00 125.93 ? 538 GLN A O   1 
ATOM   4191  C CB  . GLN A 1 538 ? 188.134 -33.866 165.122 1.00 125.25 ? 538 GLN A CB  1 
ATOM   4192  C CG  . GLN A 1 538 ? 188.350 -35.237 164.445 1.00 129.37 ? 538 GLN A CG  1 
ATOM   4193  C CD  . GLN A 1 538 ? 187.084 -35.885 163.907 1.00 137.82 ? 538 GLN A CD  1 
ATOM   4194  O OE1 . GLN A 1 538 ? 185.988 -35.342 164.030 1.00 140.07 ? 538 GLN A OE1 1 
ATOM   4195  N NE2 . GLN A 1 538 ? 187.235 -37.065 163.312 1.00 137.60 ? 538 GLN A NE2 1 
ATOM   4196  N N   . ASP A 1 539 ? 189.914 -31.252 165.065 1.00 134.37 ? 539 ASP A N   1 
ATOM   4197  C CA  . ASP A 1 539 ? 190.699 -30.011 165.155 1.00 147.76 ? 539 ASP A CA  1 
ATOM   4198  C C   . ASP A 1 539 ? 189.976 -28.801 165.775 1.00 147.77 ? 539 ASP A C   1 
ATOM   4199  O O   . ASP A 1 539 ? 188.744 -28.723 165.759 1.00 150.11 ? 539 ASP A O   1 
ATOM   4200  C CB  . ASP A 1 539 ? 191.204 -29.646 163.746 1.00 152.34 ? 539 ASP A CB  1 
ATOM   4201  C CG  . ASP A 1 539 ? 192.122 -28.416 163.729 1.00 154.82 ? 539 ASP A CG  1 
ATOM   4202  O OD1 . ASP A 1 539 ? 191.669 -27.284 164.013 1.00 148.24 ? 539 ASP A OD1 1 
ATOM   4203  O OD2 . ASP A 1 539 ? 193.321 -28.587 163.414 1.00 163.72 ? 539 ASP A OD2 1 
ATOM   4204  N N   . GLU A 1 540 ? 190.778 -27.917 166.384 1.00 145.19 ? 540 GLU A N   1 
ATOM   4205  C CA  . GLU A 1 540 ? 190.367 -26.622 166.962 1.00 148.98 ? 540 GLU A CA  1 
ATOM   4206  C C   . GLU A 1 540 ? 189.677 -26.739 168.297 1.00 145.65 ? 540 GLU A C   1 
ATOM   4207  O O   . GLU A 1 540 ? 189.973 -26.008 169.247 1.00 148.06 ? 540 GLU A O   1 
ATOM   4208  C CB  . GLU A 1 540 ? 189.436 -25.858 166.011 1.00 146.99 ? 540 GLU A CB  1 
ATOM   4209  C CG  . GLU A 1 540 ? 189.097 -24.437 166.450 1.00 147.57 ? 540 GLU A CG  1 
ATOM   4210  C CD  . GLU A 1 540 ? 189.670 -23.391 165.508 1.00 150.29 ? 540 GLU A CD  1 
ATOM   4211  O OE1 . GLU A 1 540 ? 190.312 -23.776 164.509 1.00 146.10 ? 540 GLU A OE1 1 
ATOM   4212  O OE2 . GLU A 1 540 ? 189.483 -22.182 165.763 1.00 153.66 ? 540 GLU A OE2 1 
ATOM   4213  N N   . GLU A 1 541 ? 188.755 -27.684 168.347 1.00 138.18 ? 541 GLU A N   1 
ATOM   4214  C CA  . GLU A 1 541 ? 188.010 -27.977 169.540 1.00 137.88 ? 541 GLU A CA  1 
ATOM   4215  C C   . GLU A 1 541 ? 187.997 -29.499 169.689 1.00 138.24 ? 541 GLU A C   1 
ATOM   4216  O O   . GLU A 1 541 ? 187.352 -30.216 168.924 1.00 153.02 ? 541 GLU A O   1 
ATOM   4217  C CB  . GLU A 1 541 ? 186.606 -27.341 169.436 1.00 144.72 ? 541 GLU A CB  1 
ATOM   4218  C CG  . GLU A 1 541 ? 185.383 -28.258 169.554 1.00 153.70 ? 541 GLU A CG  1 
ATOM   4219  C CD  . GLU A 1 541 ? 184.093 -27.579 169.115 1.00 153.24 ? 541 GLU A CD  1 
ATOM   4220  O OE1 . GLU A 1 541 ? 184.151 -26.727 168.205 1.00 154.98 ? 541 GLU A OE1 1 
ATOM   4221  O OE2 . GLU A 1 541 ? 183.025 -27.904 169.676 1.00 141.76 ? 541 GLU A OE2 1 
ATOM   4222  N N   . PRO A 1 542 ? 188.793 -30.004 170.637 1.00 119.40 ? 542 PRO A N   1 
ATOM   4223  C CA  . PRO A 1 542 ? 188.831 -31.432 170.935 1.00 109.35 ? 542 PRO A CA  1 
ATOM   4224  C C   . PRO A 1 542 ? 187.930 -31.683 172.141 1.00 110.78 ? 542 PRO A C   1 
ATOM   4225  O O   . PRO A 1 542 ? 188.031 -31.013 173.176 1.00 119.36 ? 542 PRO A O   1 
ATOM   4226  C CB  . PRO A 1 542 ? 190.320 -31.701 171.201 1.00 101.83 ? 542 PRO A CB  1 
ATOM   4227  C CG  . PRO A 1 542 ? 190.981 -30.302 171.303 1.00 112.50 ? 542 PRO A CG  1 
ATOM   4228  C CD  . PRO A 1 542 ? 189.884 -29.294 171.317 1.00 113.50 ? 542 PRO A CD  1 
ATOM   4229  N N   . LEU A 1 543 ? 187.050 -32.666 171.998 1.00 103.35 ? 543 LEU A N   1 
ATOM   4230  C CA  . LEU A 1 543 ? 186.038 -32.919 173.008 1.00 95.13  ? 543 LEU A CA  1 
ATOM   4231  C C   . LEU A 1 543 ? 186.669 -33.477 174.263 1.00 94.79  ? 543 LEU A C   1 
ATOM   4232  O O   . LEU A 1 543 ? 186.209 -33.209 175.366 1.00 107.69 ? 543 LEU A O   1 
ATOM   4233  C CB  . LEU A 1 543 ? 184.983 -33.895 172.479 1.00 91.24  ? 543 LEU A CB  1 
ATOM   4234  C CG  . LEU A 1 543 ? 184.204 -33.477 171.229 1.00 94.43  ? 543 LEU A CG  1 
ATOM   4235  C CD1 . LEU A 1 543 ? 183.468 -34.663 170.644 1.00 93.85  ? 543 LEU A CD1 1 
ATOM   4236  C CD2 . LEU A 1 543 ? 183.233 -32.348 171.526 1.00 107.21 ? 543 LEU A CD2 1 
ATOM   4237  N N   . ALA A 1 544 ? 187.763 -34.208 174.096 1.00 85.36  ? 544 ALA A N   1 
ATOM   4238  C CA  . ALA A 1 544 ? 188.440 -34.824 175.236 1.00 83.54  ? 544 ALA A CA  1 
ATOM   4239  C C   . ALA A 1 544 ? 189.966 -34.733 175.182 1.00 83.29  ? 544 ALA A C   1 
ATOM   4240  O O   . ALA A 1 544 ? 190.559 -34.449 174.136 1.00 83.20  ? 544 ALA A O   1 
ATOM   4241  C CB  . ALA A 1 544 ? 188.020 -36.265 175.358 1.00 81.98  ? 544 ALA A CB  1 
ATOM   4242  N N   . ASP A 1 545 ? 190.589 -34.969 176.333 1.00 84.78  ? 545 ASP A N   1 
ATOM   4243  C CA  . ASP A 1 545 ? 192.044 -34.963 176.444 1.00 81.62  ? 545 ASP A CA  1 
ATOM   4244  C C   . ASP A 1 545 ? 192.657 -36.221 175.819 1.00 79.41  ? 545 ASP A C   1 
ATOM   4245  O O   . ASP A 1 545 ? 192.249 -37.341 176.126 1.00 77.52  ? 545 ASP A O   1 
ATOM   4246  C CB  . ASP A 1 545 ? 192.436 -34.849 177.921 1.00 91.67  ? 545 ASP A CB  1 
ATOM   4247  C CG  . ASP A 1 545 ? 193.913 -34.577 178.131 1.00 107.21 ? 545 ASP A CG  1 
ATOM   4248  O OD1 . ASP A 1 545 ? 194.754 -35.104 177.378 1.00 123.69 ? 545 ASP A OD1 1 
ATOM   4249  O OD2 . ASP A 1 545 ? 194.233 -33.819 179.069 1.00 107.39 ? 545 ASP A OD2 1 
ATOM   4250  N N   . ILE A 1 546 ? 193.640 -36.023 174.943 1.00 77.66  ? 546 ILE A N   1 
ATOM   4251  C CA  . ILE A 1 546 ? 194.298 -37.127 174.251 1.00 77.14  ? 546 ILE A CA  1 
ATOM   4252  C C   . ILE A 1 546 ? 195.094 -38.032 175.196 1.00 78.59  ? 546 ILE A C   1 
ATOM   4253  O O   . ILE A 1 546 ? 195.120 -39.253 175.026 1.00 89.88  ? 546 ILE A O   1 
ATOM   4254  C CB  . ILE A 1 546 ? 195.227 -36.612 173.122 1.00 80.26  ? 546 ILE A CB  1 
ATOM   4255  C CG1 . ILE A 1 546 ? 195.795 -37.788 172.320 1.00 80.45  ? 546 ILE A CG1 1 
ATOM   4256  C CG2 . ILE A 1 546 ? 196.329 -35.717 173.663 1.00 88.50  ? 546 ILE A CG2 1 
ATOM   4257  C CD1 . ILE A 1 546 ? 194.887 -38.279 171.213 1.00 86.06  ? 546 ILE A CD1 1 
ATOM   4258  N N   . THR A 1 547 ? 195.779 -37.431 176.165 1.00 79.45  ? 547 THR A N   1 
ATOM   4259  C CA  . THR A 1 547 ? 196.520 -38.202 177.151 1.00 76.87  ? 547 THR A CA  1 
ATOM   4260  C C   . THR A 1 547 ? 195.542 -39.030 177.975 1.00 82.49  ? 547 THR A C   1 
ATOM   4261  O O   . THR A 1 547 ? 195.817 -40.182 178.295 1.00 82.04  ? 547 THR A O   1 
ATOM   4262  C CB  . THR A 1 547 ? 197.344 -37.319 178.094 1.00 82.80  ? 547 THR A CB  1 
ATOM   4263  O OG1 . THR A 1 547 ? 196.458 -36.564 178.928 1.00 104.59 ? 547 THR A OG1 1 
ATOM   4264  C CG2 . THR A 1 547 ? 198.237 -36.376 177.307 1.00 80.13  ? 547 THR A CG2 1 
ATOM   4265  N N   . GLN A 1 548 ? 194.407 -38.438 178.336 1.00 84.17  ? 548 GLN A N   1 
ATOM   4266  C CA  . GLN A 1 548 ? 193.406 -39.169 179.107 1.00 78.86  ? 548 GLN A CA  1 
ATOM   4267  C C   . GLN A 1 548 ? 192.791 -40.338 178.359 1.00 83.56  ? 548 GLN A C   1 
ATOM   4268  O O   . GLN A 1 548 ? 192.454 -41.346 178.973 1.00 71.71  ? 548 GLN A O   1 
ATOM   4269  C CB  . GLN A 1 548 ? 192.282 -38.235 179.560 1.00 75.96  ? 548 GLN A CB  1 
ATOM   4270  C CG  . GLN A 1 548 ? 192.458 -37.641 180.942 1.00 79.80  ? 548 GLN A CG  1 
ATOM   4271  C CD  . GLN A 1 548 ? 191.323 -36.707 181.322 1.00 87.99  ? 548 GLN A CD  1 
ATOM   4272  O OE1 . GLN A 1 548 ? 191.080 -35.714 180.641 1.00 90.61  ? 548 GLN A OE1 1 
ATOM   4273  N NE2 . GLN A 1 548 ? 190.649 -36.996 182.427 1.00 93.33  ? 548 GLN A NE2 1 
ATOM   4274  N N   . ILE A 1 549 ? 192.611 -40.221 177.051 1.00 88.77  ? 549 ILE A N   1 
ATOM   4275  C CA  . ILE A 1 549 ? 192.013 -41.340 176.335 1.00 79.85  ? 549 ILE A CA  1 
ATOM   4276  C C   . ILE A 1 549 ? 193.006 -42.490 176.146 1.00 82.29  ? 549 ILE A C   1 
ATOM   4277  O O   . ILE A 1 549 ? 192.607 -43.656 176.173 1.00 93.66  ? 549 ILE A O   1 
ATOM   4278  C CB  . ILE A 1 549 ? 191.398 -40.909 174.987 1.00 74.90  ? 549 ILE A CB  1 
ATOM   4279  C CG1 . ILE A 1 549 ? 192.448 -40.312 174.056 1.00 104.00 ? 549 ILE A CG1 1 
ATOM   4280  C CG2 . ILE A 1 549 ? 190.292 -39.896 175.226 1.00 75.21  ? 549 ILE A CG2 1 
ATOM   4281  C CD1 . ILE A 1 549 ? 191.847 -39.437 172.980 1.00 128.46 ? 549 ILE A CD1 1 
ATOM   4282  N N   . VAL A 1 550 ? 194.281 -42.184 175.921 1.00 79.64  ? 550 VAL A N   1 
ATOM   4283  C CA  . VAL A 1 550 ? 195.242 -43.263 175.729 1.00 89.96  ? 550 VAL A CA  1 
ATOM   4284  C C   . VAL A 1 550 ? 195.473 -44.094 176.995 1.00 91.44  ? 550 VAL A C   1 
ATOM   4285  O O   . VAL A 1 550 ? 195.677 -45.302 176.897 1.00 104.03 ? 550 VAL A O   1 
ATOM   4286  C CB  . VAL A 1 550 ? 196.615 -42.747 175.204 1.00 77.81  ? 550 VAL A CB  1 
ATOM   4287  C CG1 . VAL A 1 550 ? 196.443 -42.016 173.888 1.00 80.36  ? 550 VAL A CG1 1 
ATOM   4288  C CG2 . VAL A 1 550 ? 197.341 -41.895 176.231 1.00 91.50  ? 550 VAL A CG2 1 
ATOM   4289  N N   . ASP A 1 551 ? 195.450 -43.486 178.179 1.00 80.38  ? 551 ASP A N   1 
ATOM   4290  C CA  . ASP A 1 551 ? 195.634 -44.299 179.377 1.00 78.79  ? 551 ASP A CA  1 
ATOM   4291  C C   . ASP A 1 551 ? 194.368 -45.111 179.658 1.00 80.35  ? 551 ASP A C   1 
ATOM   4292  O O   . ASP A 1 551 ? 194.400 -46.040 180.458 1.00 92.88  ? 551 ASP A O   1 
ATOM   4293  C CB  . ASP A 1 551 ? 196.070 -43.469 180.598 1.00 73.10  ? 551 ASP A CB  1 
ATOM   4294  C CG  . ASP A 1 551 ? 195.254 -42.224 180.803 1.00 111.01 ? 551 ASP A CG  1 
ATOM   4295  O OD1 . ASP A 1 551 ? 194.021 -42.321 180.897 1.00 144.20 ? 551 ASP A OD1 1 
ATOM   4296  O OD2 . ASP A 1 551 ? 195.870 -41.143 180.914 1.00 109.78 ? 551 ASP A OD2 1 
ATOM   4297  N N   . VAL A 1 552 ? 193.251 -44.748 179.028 1.00 72.73  ? 552 VAL A N   1 
ATOM   4298  C CA  . VAL A 1 552 ? 192.051 -45.585 179.109 1.00 76.00  ? 552 VAL A CA  1 
ATOM   4299  C C   . VAL A 1 552 ? 192.292 -46.839 178.271 1.00 79.39  ? 552 VAL A C   1 
ATOM   4300  O O   . VAL A 1 552 ? 191.902 -47.943 178.661 1.00 78.11  ? 552 VAL A O   1 
ATOM   4301  C CB  . VAL A 1 552 ? 190.781 -44.872 178.615 1.00 69.63  ? 552 VAL A CB  1 
ATOM   4302  C CG1 . VAL A 1 552 ? 189.649 -45.872 178.405 1.00 69.04  ? 552 VAL A CG1 1 
ATOM   4303  C CG2 . VAL A 1 552 ? 190.364 -43.810 179.604 1.00 69.57  ? 552 VAL A CG2 1 
ATOM   4304  N N   . PHE A 1 553 ? 192.926 -46.656 177.114 1.00 72.89  ? 553 PHE A N   1 
ATOM   4305  C CA  . PHE A 1 553 ? 193.302 -47.769 176.250 1.00 71.70  ? 553 PHE A CA  1 
ATOM   4306  C C   . PHE A 1 553 ? 194.223 -48.719 177.000 1.00 73.79  ? 553 PHE A C   1 
ATOM   4307  O O   . PHE A 1 553 ? 194.074 -49.934 176.938 1.00 78.49  ? 553 PHE A O   1 
ATOM   4308  C CB  . PHE A 1 553 ? 194.018 -47.276 174.986 1.00 73.41  ? 553 PHE A CB  1 
ATOM   4309  C CG  . PHE A 1 553 ? 193.105 -46.960 173.834 1.00 76.08  ? 553 PHE A CG  1 
ATOM   4310  C CD1 . PHE A 1 553 ? 192.602 -47.974 173.036 1.00 84.64  ? 553 PHE A CD1 1 
ATOM   4311  C CD2 . PHE A 1 553 ? 192.771 -45.652 173.535 1.00 89.06  ? 553 PHE A CD2 1 
ATOM   4312  C CE1 . PHE A 1 553 ? 191.767 -47.691 171.974 1.00 93.70  ? 553 PHE A CE1 1 
ATOM   4313  C CE2 . PHE A 1 553 ? 191.937 -45.357 172.473 1.00 96.44  ? 553 PHE A CE2 1 
ATOM   4314  C CZ  . PHE A 1 553 ? 191.432 -46.380 171.690 1.00 95.78  ? 553 PHE A CZ  1 
ATOM   4315  N N   . MET A 1 554 ? 195.194 -48.134 177.693 1.00 71.99  ? 554 MET A N   1 
ATOM   4316  C CA  . MET A 1 554 ? 196.195 -48.875 178.451 1.00 77.66  ? 554 MET A CA  1 
ATOM   4317  C C   . MET A 1 554 ? 195.601 -49.716 179.572 1.00 78.20  ? 554 MET A C   1 
ATOM   4318  O O   . MET A 1 554 ? 196.122 -50.786 179.891 1.00 87.93  ? 554 MET A O   1 
ATOM   4319  C CB  . MET A 1 554 ? 197.237 -47.914 179.018 1.00 87.31  ? 554 MET A CB  1 
ATOM   4320  C CG  . MET A 1 554 ? 198.021 -47.183 177.946 1.00 83.68  ? 554 MET A CG  1 
ATOM   4321  S SD  . MET A 1 554 ? 198.809 -48.349 176.808 1.00 103.14 ? 554 MET A SD  1 
ATOM   4322  C CE  . MET A 1 554 ? 200.305 -47.465 176.383 1.00 121.57 ? 554 MET A CE  1 
ATOM   4323  N N   . GLU A 1 555 ? 194.519 -49.221 180.165 1.00 76.20  ? 555 GLU A N   1 
ATOM   4324  C CA  . GLU A 1 555 ? 193.842 -49.916 181.248 1.00 73.35  ? 555 GLU A CA  1 
ATOM   4325  C C   . GLU A 1 555 ? 193.334 -51.271 180.764 1.00 72.15  ? 555 GLU A C   1 
ATOM   4326  O O   . GLU A 1 555 ? 193.408 -52.271 181.484 1.00 88.15  ? 555 GLU A O   1 
ATOM   4327  C CB  . GLU A 1 555 ? 192.696 -49.053 181.792 1.00 84.56  ? 555 GLU A CB  1 
ATOM   4328  C CG  . GLU A 1 555 ? 193.187 -47.860 182.624 1.00 106.29 ? 555 GLU A CG  1 
ATOM   4329  C CD  . GLU A 1 555 ? 192.066 -46.986 183.168 1.00 118.19 ? 555 GLU A CD  1 
ATOM   4330  O OE1 . GLU A 1 555 ? 192.362 -45.875 183.660 1.00 115.02 ? 555 GLU A OE1 1 
ATOM   4331  O OE2 . GLU A 1 555 ? 190.894 -47.413 183.118 1.00 124.00 ? 555 GLU A OE2 1 
ATOM   4332  N N   . TYR A 1 556 ? 192.804 -51.295 179.548 1.00 68.68  ? 556 TYR A N   1 
ATOM   4333  C CA  . TYR A 1 556 ? 192.348 -52.535 178.944 1.00 68.82  ? 556 TYR A CA  1 
ATOM   4334  C C   . TYR A 1 556 ? 193.482 -53.241 178.179 1.00 81.68  ? 556 TYR A C   1 
ATOM   4335  O O   . TYR A 1 556 ? 193.267 -54.314 177.610 1.00 91.92  ? 556 TYR A O   1 
ATOM   4336  C CB  . TYR A 1 556 ? 191.150 -52.245 178.034 1.00 67.93  ? 556 TYR A CB  1 
ATOM   4337  C CG  . TYR A 1 556 ? 189.964 -51.709 178.814 1.00 69.46  ? 556 TYR A CG  1 
ATOM   4338  C CD1 . TYR A 1 556 ? 189.024 -52.566 179.380 1.00 68.30  ? 556 TYR A CD1 1 
ATOM   4339  C CD2 . TYR A 1 556 ? 189.796 -50.342 179.000 1.00 68.62  ? 556 TYR A CD2 1 
ATOM   4340  C CE1 . TYR A 1 556 ? 187.946 -52.070 180.102 1.00 73.02  ? 556 TYR A CE1 1 
ATOM   4341  C CE2 . TYR A 1 556 ? 188.726 -49.840 179.717 1.00 83.25  ? 556 TYR A CE2 1 
ATOM   4342  C CZ  . TYR A 1 556 ? 187.804 -50.705 180.267 1.00 82.29  ? 556 TYR A CZ  1 
ATOM   4343  O OH  . TYR A 1 556 ? 186.739 -50.198 180.981 1.00 73.01  ? 556 TYR A OH  1 
ATOM   4344  N N   . ASN A 1 557 ? 194.679 -52.642 178.172 1.00 82.87  ? 557 ASN A N   1 
ATOM   4345  C CA  . ASN A 1 557 ? 195.822 -53.202 177.440 1.00 85.97  ? 557 ASN A CA  1 
ATOM   4346  C C   . ASN A 1 557 ? 195.508 -53.397 175.973 1.00 89.29  ? 557 ASN A C   1 
ATOM   4347  O O   . ASN A 1 557 ? 195.797 -54.440 175.381 1.00 105.98 ? 557 ASN A O   1 
ATOM   4348  C CB  . ASN A 1 557 ? 196.323 -54.505 178.057 1.00 105.70 ? 557 ASN A CB  1 
ATOM   4349  C CG  . ASN A 1 557 ? 197.102 -54.273 179.330 1.00 129.45 ? 557 ASN A CG  1 
ATOM   4350  O OD1 . ASN A 1 557 ? 197.832 -53.286 179.446 1.00 127.61 ? 557 ASN A OD1 1 
ATOM   4351  N ND2 . ASN A 1 557 ? 196.960 -55.174 180.289 1.00 141.74 ? 557 ASN A ND2 1 
ATOM   4352  N N   . LEU A 1 558 ? 194.939 -52.355 175.388 1.00 77.61  ? 558 LEU A N   1 
ATOM   4353  C CA  . LEU A 1 558 ? 194.625 -52.351 173.977 1.00 82.35  ? 558 LEU A CA  1 
ATOM   4354  C C   . LEU A 1 558 ? 195.728 -51.589 173.267 1.00 92.83  ? 558 LEU A C   1 
ATOM   4355  O O   . LEU A 1 558 ? 195.496 -50.569 172.617 1.00 91.02  ? 558 LEU A O   1 
ATOM   4356  C CB  . LEU A 1 558 ? 193.256 -51.712 173.744 1.00 90.34  ? 558 LEU A CB  1 
ATOM   4357  C CG  . LEU A 1 558 ? 192.076 -52.204 174.589 1.00 96.49  ? 558 LEU A CG  1 
ATOM   4358  C CD1 . LEU A 1 558 ? 190.778 -51.572 174.123 1.00 95.73  ? 558 LEU A CD1 1 
ATOM   4359  C CD2 . LEU A 1 558 ? 191.970 -53.714 174.503 1.00 99.85  ? 558 LEU A CD2 1 
ATOM   4360  N N   . ILE A 1 559 ? 196.936 -52.134 173.409 1.00 100.38 ? 559 ILE A N   1 
ATOM   4361  C CA  . ILE A 1 559 ? 198.167 -51.554 172.880 1.00 90.71  ? 559 ILE A CA  1 
ATOM   4362  C C   . ILE A 1 559 ? 198.168 -51.439 171.366 1.00 85.70  ? 559 ILE A C   1 
ATOM   4363  O O   . ILE A 1 559 ? 198.519 -50.389 170.826 1.00 92.86  ? 559 ILE A O   1 
ATOM   4364  C CB  . ILE A 1 559 ? 199.397 -52.388 173.316 1.00 90.91  ? 559 ILE A CB  1 
ATOM   4365  C CG1 . ILE A 1 559 ? 199.921 -51.914 174.675 1.00 104.91 ? 559 ILE A CG1 1 
ATOM   4366  C CG2 . ILE A 1 559 ? 200.557 -52.212 172.345 1.00 84.39  ? 559 ILE A CG2 1 
ATOM   4367  C CD1 . ILE A 1 559 ? 198.937 -52.022 175.824 1.00 112.07 ? 559 ILE A CD1 1 
ATOM   4368  N N   . GLN A 1 560 ? 197.786 -52.508 170.677 1.00 83.91  ? 560 GLN A N   1 
ATOM   4369  C CA  . GLN A 1 560 ? 197.785 -52.456 169.226 1.00 89.24  ? 560 GLN A CA  1 
ATOM   4370  C C   . GLN A 1 560 ? 196.724 -51.504 168.670 1.00 85.67  ? 560 GLN A C   1 
ATOM   4371  O O   . GLN A 1 560 ? 197.000 -50.780 167.713 1.00 93.00  ? 560 GLN A O   1 
ATOM   4372  C CB  . GLN A 1 560 ? 197.620 -53.859 168.632 1.00 98.88  ? 560 GLN A CB  1 
ATOM   4373  C CG  . GLN A 1 560 ? 196.461 -54.653 169.172 1.00 126.52 ? 560 GLN A CG  1 
ATOM   4374  C CD  . GLN A 1 560 ? 196.904 -55.582 170.278 1.00 126.46 ? 560 GLN A CD  1 
ATOM   4375  O OE1 . GLN A 1 560 ? 197.649 -56.533 170.039 1.00 127.73 ? 560 GLN A OE1 1 
ATOM   4376  N NE2 . GLN A 1 560 ? 196.462 -55.308 171.498 1.00 102.14 ? 560 GLN A NE2 1 
ATOM   4377  N N   . GLN A 1 561 ? 195.516 -51.510 169.235 1.00 87.11  ? 561 GLN A N   1 
ATOM   4378  C CA  . GLN A 1 561 ? 194.494 -50.573 168.766 1.00 94.24  ? 561 GLN A CA  1 
ATOM   4379  C C   . GLN A 1 561 ? 194.792 -49.143 169.252 1.00 102.47 ? 561 GLN A C   1 
ATOM   4380  O O   . GLN A 1 561 ? 194.421 -48.177 168.581 1.00 110.47 ? 561 GLN A O   1 
ATOM   4381  C CB  . GLN A 1 561 ? 193.068 -51.019 169.140 1.00 85.46  ? 561 GLN A CB  1 
ATOM   4382  C CG  . GLN A 1 561 ? 192.864 -51.664 170.480 1.00 97.37  ? 561 GLN A CG  1 
ATOM   4383  C CD  . GLN A 1 561 ? 192.978 -53.176 170.451 1.00 99.27  ? 561 GLN A CD  1 
ATOM   4384  O OE1 . GLN A 1 561 ? 193.984 -53.735 170.882 1.00 95.06  ? 561 GLN A OE1 1 
ATOM   4385  N NE2 . GLN A 1 561 ? 191.946 -53.847 169.946 1.00 102.80 ? 561 GLN A NE2 1 
ATOM   4386  N N   . CYS A 1 562 ? 195.437 -49.006 170.414 1.00 91.97  ? 562 CYS A N   1 
ATOM   4387  C CA  . CYS A 1 562 ? 195.844 -47.681 170.891 1.00 78.57  ? 562 CYS A CA  1 
ATOM   4388  C C   . CYS A 1 562 ? 196.801 -47.093 169.877 1.00 81.29  ? 562 CYS A C   1 
ATOM   4389  O O   . CYS A 1 562 ? 196.685 -45.932 169.486 1.00 81.37  ? 562 CYS A O   1 
ATOM   4390  C CB  . CYS A 1 562 ? 196.531 -47.738 172.261 1.00 78.48  ? 562 CYS A CB  1 
ATOM   4391  S SG  . CYS A 1 562 ? 197.030 -46.109 172.908 1.00 97.77  ? 562 CYS A SG  1 
ATOM   4392  N N   . THR A 1 563 ? 197.752 -47.924 169.465 1.00 81.54  ? 563 THR A N   1 
ATOM   4393  C CA  . THR A 1 563 ? 198.724 -47.574 168.442 1.00 79.50  ? 563 THR A CA  1 
ATOM   4394  C C   . THR A 1 563 ? 198.056 -47.170 167.140 1.00 82.16  ? 563 THR A C   1 
ATOM   4395  O O   . THR A 1 563 ? 198.407 -46.155 166.537 1.00 83.98  ? 563 THR A O   1 
ATOM   4396  C CB  . THR A 1 563 ? 199.670 -48.740 168.150 1.00 89.24  ? 563 THR A CB  1 
ATOM   4397  O OG1 . THR A 1 563 ? 200.362 -49.105 169.350 1.00 113.27 ? 563 THR A OG1 1 
ATOM   4398  C CG2 . THR A 1 563 ? 200.672 -48.332 167.104 1.00 93.17  ? 563 THR A CG2 1 
ATOM   4399  N N   . ALA A 1 564 ? 197.120 -48.002 166.694 1.00 85.15  ? 564 ALA A N   1 
ATOM   4400  C CA  . ALA A 1 564 ? 196.343 -47.745 165.485 1.00 79.06  ? 564 ALA A CA  1 
ATOM   4401  C C   . ALA A 1 564 ? 195.568 -46.437 165.587 1.00 79.86  ? 564 ALA A C   1 
ATOM   4402  O O   . ALA A 1 564 ? 195.471 -45.682 164.622 1.00 90.33  ? 564 ALA A O   1 
ATOM   4403  C CB  . ALA A 1 564 ? 195.394 -48.901 165.209 1.00 81.93  ? 564 ALA A CB  1 
ATOM   4404  N N   . PHE A 1 565 ? 195.008 -46.188 166.765 1.00 76.06  ? 565 PHE A N   1 
ATOM   4405  C CA  . PHE A 1 565 ? 194.240 -44.978 167.029 1.00 76.26  ? 565 PHE A CA  1 
ATOM   4406  C C   . PHE A 1 565 ? 195.076 -43.710 166.853 1.00 79.74  ? 565 PHE A C   1 
ATOM   4407  O O   . PHE A 1 565 ? 194.618 -42.727 166.267 1.00 89.11  ? 565 PHE A O   1 
ATOM   4408  C CB  . PHE A 1 565 ? 193.660 -45.041 168.444 1.00 75.29  ? 565 PHE A CB  1 
ATOM   4409  C CG  . PHE A 1 565 ? 193.437 -43.698 169.071 1.00 75.93  ? 565 PHE A CG  1 
ATOM   4410  C CD1 . PHE A 1 565 ? 192.387 -42.895 168.670 1.00 78.25  ? 565 PHE A CD1 1 
ATOM   4411  C CD2 . PHE A 1 565 ? 194.275 -43.245 170.076 1.00 81.69  ? 565 PHE A CD2 1 
ATOM   4412  C CE1 . PHE A 1 565 ? 192.181 -41.661 169.249 1.00 83.94  ? 565 PHE A CE1 1 
ATOM   4413  C CE2 . PHE A 1 565 ? 194.076 -42.012 170.661 1.00 78.67  ? 565 PHE A CE2 1 
ATOM   4414  C CZ  . PHE A 1 565 ? 193.027 -41.218 170.245 1.00 78.07  ? 565 PHE A CZ  1 
ATOM   4415  N N   . LEU A 1 566 ? 196.304 -43.741 167.359 1.00 81.12  ? 566 LEU A N   1 
ATOM   4416  C CA  . LEU A 1 566 ? 197.204 -42.595 167.267 1.00 85.75  ? 566 LEU A CA  1 
ATOM   4417  C C   . LEU A 1 566 ? 197.743 -42.384 165.852 1.00 95.47  ? 566 LEU A C   1 
ATOM   4418  O O   . LEU A 1 566 ? 197.911 -41.246 165.411 1.00 95.61  ? 566 LEU A O   1 
ATOM   4419  C CB  . LEU A 1 566 ? 198.365 -42.752 168.246 1.00 79.16  ? 566 LEU A CB  1 
ATOM   4420  C CG  . LEU A 1 566 ? 197.945 -42.632 169.709 1.00 81.22  ? 566 LEU A CG  1 
ATOM   4421  C CD1 . LEU A 1 566 ? 198.953 -43.306 170.618 1.00 78.61  ? 566 LEU A CD1 1 
ATOM   4422  C CD2 . LEU A 1 566 ? 197.759 -41.172 170.084 1.00 87.99  ? 566 LEU A CD2 1 
ATOM   4423  N N   . LEU A 1 567 ? 198.025 -43.479 165.149 1.00 90.85  ? 567 LEU A N   1 
ATOM   4424  C CA  . LEU A 1 567 ? 198.497 -43.393 163.768 1.00 92.70  ? 567 LEU A CA  1 
ATOM   4425  C C   . LEU A 1 567 ? 197.393 -42.868 162.860 1.00 103.50 ? 567 LEU A C   1 
ATOM   4426  O O   . LEU A 1 567 ? 197.655 -42.152 161.898 1.00 107.74 ? 567 LEU A O   1 
ATOM   4427  C CB  . LEU A 1 567 ? 198.987 -44.751 163.261 1.00 94.76  ? 567 LEU A CB  1 
ATOM   4428  C CG  . LEU A 1 567 ? 200.308 -45.288 163.816 1.00 87.53  ? 567 LEU A CG  1 
ATOM   4429  C CD1 . LEU A 1 567 ? 200.354 -46.800 163.703 1.00 87.34  ? 567 LEU A CD1 1 
ATOM   4430  C CD2 . LEU A 1 567 ? 201.502 -44.660 163.109 1.00 89.17  ? 567 LEU A CD2 1 
ATOM   4431  N N   . ASP A 1 568 ? 196.156 -43.237 163.173 1.00 110.54 ? 568 ASP A N   1 
ATOM   4432  C CA  . ASP A 1 568 ? 194.999 -42.737 162.444 1.00 111.38 ? 568 ASP A CA  1 
ATOM   4433  C C   . ASP A 1 568 ? 194.838 -41.248 162.703 1.00 97.96  ? 568 ASP A C   1 
ATOM   4434  O O   . ASP A 1 568 ? 194.498 -40.479 161.803 1.00 96.64  ? 568 ASP A O   1 
ATOM   4435  C CB  . ASP A 1 568 ? 193.726 -43.480 162.855 1.00 133.26 ? 568 ASP A CB  1 
ATOM   4436  C CG  . ASP A 1 568 ? 193.356 -44.582 161.886 1.00 150.60 ? 568 ASP A CG  1 
ATOM   4437  O OD1 . ASP A 1 568 ? 194.259 -45.328 161.460 1.00 147.98 ? 568 ASP A OD1 1 
ATOM   4438  O OD2 . ASP A 1 568 ? 192.159 -44.700 161.548 1.00 157.77 ? 568 ASP A OD2 1 
ATOM   4439  N N   . ALA A 1 569 ? 195.086 -40.857 163.949 1.00 98.02  ? 569 ALA A N   1 
ATOM   4440  C CA  . ALA A 1 569 ? 194.992 -39.466 164.367 1.00 99.56  ? 569 ALA A CA  1 
ATOM   4441  C C   . ALA A 1 569 ? 196.002 -38.584 163.641 1.00 109.59 ? 569 ALA A C   1 
ATOM   4442  O O   . ALA A 1 569 ? 195.749 -37.401 163.412 1.00 121.71 ? 569 ALA A O   1 
ATOM   4443  C CB  . ALA A 1 569 ? 195.188 -39.358 165.870 1.00 103.39 ? 569 ALA A CB  1 
ATOM   4444  N N   . LEU A 1 570 ? 197.142 -39.161 163.277 1.00 101.09 ? 570 LEU A N   1 
ATOM   4445  C CA  . LEU A 1 570 ? 198.161 -38.425 162.538 1.00 99.99  ? 570 LEU A CA  1 
ATOM   4446  C C   . LEU A 1 570 ? 197.773 -38.234 161.079 1.00 106.13 ? 570 LEU A C   1 
ATOM   4447  O O   . LEU A 1 570 ? 197.988 -37.165 160.511 1.00 109.48 ? 570 LEU A O   1 
ATOM   4448  C CB  . LEU A 1 570 ? 199.507 -39.147 162.623 1.00 101.11 ? 570 LEU A CB  1 
ATOM   4449  C CG  . LEU A 1 570 ? 200.320 -38.930 163.900 1.00 101.11 ? 570 LEU A CG  1 
ATOM   4450  C CD1 . LEU A 1 570 ? 201.423 -39.960 164.001 1.00 100.60 ? 570 LEU A CD1 1 
ATOM   4451  C CD2 . LEU A 1 570 ? 200.901 -37.530 163.917 1.00 104.10 ? 570 LEU A CD2 1 
ATOM   4452  N N   . LYS A 1 571 ? 197.203 -39.278 160.482 1.00 117.83 ? 571 LYS A N   1 
ATOM   4453  C CA  . LYS A 1 571 ? 196.757 -39.238 159.089 1.00 122.69 ? 571 LYS A CA  1 
ATOM   4454  C C   . LYS A 1 571 ? 195.560 -38.327 158.846 1.00 130.74 ? 571 LYS A C   1 
ATOM   4455  O O   . LYS A 1 571 ? 195.345 -37.850 157.733 1.00 131.32 ? 571 LYS A O   1 
ATOM   4456  C CB  . LYS A 1 571 ? 196.407 -40.646 158.606 1.00 112.26 ? 571 LYS A CB  1 
ATOM   4457  N N   . ASN A 1 572 ? 194.787 -38.075 159.892 1.00 134.26 ? 572 ASN A N   1 
ATOM   4458  C CA  . ASN A 1 572 ? 193.606 -37.237 159.769 1.00 137.82 ? 572 ASN A CA  1 
ATOM   4459  C C   . ASN A 1 572 ? 193.987 -35.783 159.968 1.00 143.77 ? 572 ASN A C   1 
ATOM   4460  O O   . ASN A 1 572 ? 193.285 -34.865 159.540 1.00 154.14 ? 572 ASN A O   1 
ATOM   4461  C CB  . ASN A 1 572 ? 192.556 -37.660 160.789 1.00 139.42 ? 572 ASN A CB  1 
ATOM   4462  C CG  . ASN A 1 572 ? 191.223 -36.994 160.563 1.00 156.52 ? 572 ASN A CG  1 
ATOM   4463  O OD1 . ASN A 1 572 ? 190.942 -36.497 159.474 1.00 149.84 ? 572 ASN A OD1 1 
ATOM   4464  N ND2 . ASN A 1 572 ? 190.385 -36.987 161.593 1.00 162.84 ? 572 ASN A ND2 1 
ATOM   4465  N N   . ASN A 1 573 ? 195.121 -35.592 160.631 1.00 134.36 ? 573 ASN A N   1 
ATOM   4466  C CA  . ASN A 1 573 ? 195.708 -34.276 160.803 1.00 128.97 ? 573 ASN A CA  1 
ATOM   4467  C C   . ASN A 1 573 ? 196.497 -33.875 159.564 1.00 145.76 ? 573 ASN A C   1 
ATOM   4468  O O   . ASN A 1 573 ? 196.857 -32.715 159.398 1.00 153.60 ? 573 ASN A O   1 
ATOM   4469  C CB  . ASN A 1 573 ? 196.607 -34.251 162.043 1.00 117.95 ? 573 ASN A CB  1 
ATOM   4470  N N   . ARG A 1 574 ? 196.767 -34.841 158.693 1.00 151.09 ? 574 ARG A N   1 
ATOM   4471  C CA  . ARG A 1 574 ? 197.507 -34.555 157.471 1.00 150.83 ? 574 ARG A CA  1 
ATOM   4472  C C   . ARG A 1 574 ? 196.569 -34.461 156.273 1.00 150.36 ? 574 ARG A C   1 
ATOM   4473  O O   . ARG A 1 574 ? 196.906 -33.846 155.261 1.00 150.18 ? 574 ARG A O   1 
ATOM   4474  C CB  . ARG A 1 574 ? 198.577 -35.621 157.223 1.00 138.48 ? 574 ARG A CB  1 
ATOM   4475  N N   . GLN B 1 3   ? 98.939  13.537  182.760 1.00 147.32 ? 3   GLN B N   1 
ATOM   4476  C CA  . GLN B 1 3   ? 98.832  13.006  181.410 1.00 151.21 ? 3   GLN B CA  1 
ATOM   4477  C C   . GLN B 1 3   ? 98.178  11.628  181.432 1.00 153.29 ? 3   GLN B C   1 
ATOM   4478  O O   . GLN B 1 3   ? 98.046  11.010  182.487 1.00 162.09 ? 3   GLN B O   1 
ATOM   4479  C CB  . GLN B 1 3   ? 100.211 12.939  180.752 1.00 148.93 ? 3   GLN B CB  1 
ATOM   4480  C CG  . GLN B 1 3   ? 100.278 13.604  179.389 1.00 150.92 ? 3   GLN B CG  1 
ATOM   4481  C CD  . GLN B 1 3   ? 100.580 12.624  178.276 1.00 145.81 ? 3   GLN B CD  1 
ATOM   4482  O OE1 . GLN B 1 3   ? 101.660 12.036  178.231 1.00 144.32 ? 3   GLN B OE1 1 
ATOM   4483  N NE2 . GLN B 1 3   ? 99.620  12.432  177.378 1.00 142.98 ? 3   GLN B NE2 1 
ATOM   4484  N N   . ILE B 1 4   ? 97.754  11.157  180.265 1.00 137.28 ? 4   ILE B N   1 
ATOM   4485  C CA  . ILE B 1 4   ? 97.068  9.871   180.156 1.00 121.18 ? 4   ILE B CA  1 
ATOM   4486  C C   . ILE B 1 4   ? 97.978  8.656   180.328 1.00 116.62 ? 4   ILE B C   1 
ATOM   4487  O O   . ILE B 1 4   ? 99.175  8.708   180.043 1.00 108.88 ? 4   ILE B O   1 
ATOM   4488  C CB  . ILE B 1 4   ? 96.345  9.748   178.810 1.00 116.02 ? 4   ILE B CB  1 
ATOM   4489  C CG1 . ILE B 1 4   ? 97.332  9.907   177.655 1.00 121.33 ? 4   ILE B CG1 1 
ATOM   4490  C CG2 . ILE B 1 4   ? 95.227  10.777  178.717 1.00 117.96 ? 4   ILE B CG2 1 
ATOM   4491  C CD1 . ILE B 1 4   ? 97.015  9.014   176.476 1.00 121.82 ? 4   ILE B CD1 1 
ATOM   4492  N N   . LEU B 1 5   ? 97.386  7.569   180.808 1.00 118.75 ? 5   LEU B N   1 
ATOM   4493  C CA  . LEU B 1 5   ? 98.061  6.284   180.938 1.00 106.46 ? 5   LEU B CA  1 
ATOM   4494  C C   . LEU B 1 5   ? 97.138  5.187   180.416 1.00 102.80 ? 5   LEU B C   1 
ATOM   4495  O O   . LEU B 1 5   ? 95.918  5.328   180.471 1.00 104.91 ? 5   LEU B O   1 
ATOM   4496  C CB  . LEU B 1 5   ? 98.468  6.015   182.392 1.00 102.84 ? 5   LEU B CB  1 
ATOM   4497  C CG  . LEU B 1 5   ? 97.741  6.767   183.506 1.00 125.78 ? 5   LEU B CG  1 
ATOM   4498  C CD1 . LEU B 1 5   ? 97.115  5.793   184.490 1.00 140.48 ? 5   LEU B CD1 1 
ATOM   4499  C CD2 . LEU B 1 5   ? 98.711  7.695   184.213 1.00 128.93 ? 5   LEU B CD2 1 
ATOM   4500  N N   . PRO B 1 6   ? 97.715  4.085   179.909 1.00 97.54  ? 6   PRO B N   1 
ATOM   4501  C CA  . PRO B 1 6   ? 96.863  3.055   179.310 1.00 103.21 ? 6   PRO B CA  1 
ATOM   4502  C C   . PRO B 1 6   ? 96.203  2.143   180.337 1.00 118.91 ? 6   PRO B C   1 
ATOM   4503  O O   . PRO B 1 6   ? 95.414  1.284   179.956 1.00 129.23 ? 6   PRO B O   1 
ATOM   4504  C CB  . PRO B 1 6   ? 97.843  2.266   178.447 1.00 102.58 ? 6   PRO B CB  1 
ATOM   4505  C CG  . PRO B 1 6   ? 99.134  2.364   179.188 1.00 104.17 ? 6   PRO B CG  1 
ATOM   4506  C CD  . PRO B 1 6   ? 99.140  3.707   179.879 1.00 99.33  ? 6   PRO B CD  1 
ATOM   4507  N N   . ILE B 1 7   ? 96.517  2.323   181.615 1.00 118.65 ? 7   ILE B N   1 
ATOM   4508  C CA  . ILE B 1 7   ? 95.930  1.484   182.654 1.00 110.44 ? 7   ILE B CA  1 
ATOM   4509  C C   . ILE B 1 7   ? 94.929  2.242   183.521 1.00 121.18 ? 7   ILE B C   1 
ATOM   4510  O O   . ILE B 1 7   ? 94.869  3.471   183.504 1.00 127.32 ? 7   ILE B O   1 
ATOM   4511  C CB  . ILE B 1 7   ? 97.006  0.868   183.563 1.00 93.11  ? 7   ILE B CB  1 
ATOM   4512  C CG1 . ILE B 1 7   ? 97.814  1.965   184.252 1.00 94.15  ? 7   ILE B CG1 1 
ATOM   4513  C CG2 . ILE B 1 7   ? 97.912  -0.047  182.757 1.00 91.27  ? 7   ILE B CG2 1 
ATOM   4514  C CD1 . ILE B 1 7   ? 97.714  1.920   185.761 1.00 105.53 ? 7   ILE B CD1 1 
ATOM   4515  N N   . ARG B 1 8   ? 94.148  1.484   184.281 1.00 121.27 ? 8   ARG B N   1 
ATOM   4516  C CA  . ARG B 1 8   ? 93.191  2.046   185.220 1.00 106.14 ? 8   ARG B CA  1 
ATOM   4517  C C   . ARG B 1 8   ? 93.430  1.393   186.574 1.00 112.21 ? 8   ARG B C   1 
ATOM   4518  O O   . ARG B 1 8   ? 92.890  0.332   186.873 1.00 133.93 ? 8   ARG B O   1 
ATOM   4519  C CB  . ARG B 1 8   ? 91.754  1.814   184.739 1.00 100.03 ? 8   ARG B CB  1 
ATOM   4520  C CG  . ARG B 1 8   ? 90.704  2.657   185.441 1.00 113.97 ? 8   ARG B CG  1 
ATOM   4521  C CD  . ARG B 1 8   ? 89.299  2.110   185.208 1.00 122.18 ? 8   ARG B CD  1 
ATOM   4522  N NE  . ARG B 1 8   ? 88.939  2.090   183.792 1.00 126.72 ? 8   ARG B NE  1 
ATOM   4523  C CZ  . ARG B 1 8   ? 88.167  1.167   183.227 1.00 120.75 ? 8   ARG B CZ  1 
ATOM   4524  N NH1 . ARG B 1 8   ? 87.892  1.235   181.932 1.00 123.40 ? 8   ARG B NH1 1 
ATOM   4525  N NH2 . ARG B 1 8   ? 87.673  0.174   183.955 1.00 114.16 ? 8   ARG B NH2 1 
ATOM   4526  N N   . PHE B 1 9   ? 94.244  2.053   187.392 1.00 105.51 ? 9   PHE B N   1 
ATOM   4527  C CA  . PHE B 1 9   ? 94.592  1.562   188.722 1.00 111.23 ? 9   PHE B CA  1 
ATOM   4528  C C   . PHE B 1 9   ? 93.530  1.950   189.741 1.00 116.43 ? 9   PHE B C   1 
ATOM   4529  O O   . PHE B 1 9   ? 93.071  3.089   189.765 1.00 127.53 ? 9   PHE B O   1 
ATOM   4530  C CB  . PHE B 1 9   ? 95.965  2.101   189.128 1.00 110.58 ? 9   PHE B CB  1 
ATOM   4531  C CG  . PHE B 1 9   ? 96.374  1.751   190.530 1.00 110.38 ? 9   PHE B CG  1 
ATOM   4532  C CD1 . PHE B 1 9   ? 96.838  0.483   190.835 1.00 120.20 ? 9   PHE B CD1 1 
ATOM   4533  C CD2 . PHE B 1 9   ? 96.326  2.701   191.535 1.00 105.74 ? 9   PHE B CD2 1 
ATOM   4534  C CE1 . PHE B 1 9   ? 97.222  0.162   192.122 1.00 127.04 ? 9   PHE B CE1 1 
ATOM   4535  C CE2 . PHE B 1 9   ? 96.711  2.388   192.822 1.00 109.57 ? 9   PHE B CE2 1 
ATOM   4536  C CZ  . PHE B 1 9   ? 97.161  1.117   193.116 1.00 120.39 ? 9   PHE B CZ  1 
ATOM   4537  N N   . GLN B 1 10  ? 93.139  0.997   190.580 1.00 113.73 ? 10  GLN B N   1 
ATOM   4538  C CA  . GLN B 1 10  ? 92.066  1.232   191.536 1.00 121.13 ? 10  GLN B CA  1 
ATOM   4539  C C   . GLN B 1 10  ? 92.262  0.498   192.859 1.00 120.62 ? 10  GLN B C   1 
ATOM   4540  O O   . GLN B 1 10  ? 92.728  -0.642  192.885 1.00 127.62 ? 10  GLN B O   1 
ATOM   4541  C CB  . GLN B 1 10  ? 90.733  0.810   190.916 1.00 120.74 ? 10  GLN B CB  1 
ATOM   4542  C CG  . GLN B 1 10  ? 89.666  1.885   190.910 1.00 128.86 ? 10  GLN B CG  1 
ATOM   4543  C CD  . GLN B 1 10  ? 88.473  1.523   191.769 1.00 141.04 ? 10  GLN B CD  1 
ATOM   4544  O OE1 . GLN B 1 10  ? 88.597  1.339   192.980 1.00 152.64 ? 10  GLN B OE1 1 
ATOM   4545  N NE2 . GLN B 1 10  ? 87.307  1.416   191.144 1.00 144.66 ? 10  GLN B NE2 1 
ATOM   4546  N N   . GLU B 1 11  ? 91.918  1.165   193.957 1.00 102.77 ? 11  GLU B N   1 
ATOM   4547  C CA  . GLU B 1 11  ? 91.921  0.522   195.263 1.00 102.53 ? 11  GLU B CA  1 
ATOM   4548  C C   . GLU B 1 11  ? 90.482  0.225   195.644 1.00 106.33 ? 11  GLU B C   1 
ATOM   4549  O O   . GLU B 1 11  ? 89.693  1.136   195.913 1.00 109.49 ? 11  GLU B O   1 
ATOM   4550  C CB  . GLU B 1 11  ? 92.599  1.388   196.322 1.00 105.13 ? 11  GLU B CB  1 
ATOM   4551  C CG  . GLU B 1 11  ? 92.938  0.622   197.588 1.00 109.03 ? 11  GLU B CG  1 
ATOM   4552  C CD  . GLU B 1 11  ? 93.189  1.534   198.767 1.00 122.59 ? 11  GLU B CD  1 
ATOM   4553  O OE1 . GLU B 1 11  ? 92.309  2.360   199.077 1.00 146.31 ? 11  GLU B OE1 1 
ATOM   4554  O OE2 . GLU B 1 11  ? 94.265  1.423   199.392 1.00 123.32 ? 11  GLU B OE2 1 
ATOM   4555  N N   . HIS B 1 12  ? 90.144  -1.058  195.655 1.00 103.28 ? 12  HIS B N   1 
ATOM   4556  C CA  . HIS B 1 12  ? 88.779  -1.479  195.925 1.00 106.31 ? 12  HIS B CA  1 
ATOM   4557  C C   . HIS B 1 12  ? 88.436  -1.444  197.412 1.00 125.74 ? 12  HIS B C   1 
ATOM   4558  O O   . HIS B 1 12  ? 87.322  -1.081  197.772 1.00 145.79 ? 12  HIS B O   1 
ATOM   4559  C CB  . HIS B 1 12  ? 88.538  -2.874  195.341 1.00 102.82 ? 12  HIS B CB  1 
ATOM   4560  C CG  . HIS B 1 12  ? 88.478  -2.872  193.836 1.00 105.33 ? 12  HIS B CG  1 
ATOM   4561  N ND1 . HIS B 1 12  ? 87.698  -3.770  193.133 1.00 122.90 ? 12  HIS B ND1 1 
ATOM   4562  C CD2 . HIS B 1 12  ? 89.079  -2.093  192.933 1.00 112.93 ? 12  HIS B CD2 1 
ATOM   4563  C CE1 . HIS B 1 12  ? 87.844  -3.535  191.840 1.00 130.64 ? 12  HIS B CE1 1 
ATOM   4564  N NE2 . HIS B 1 12  ? 88.673  -2.519  191.683 1.00 124.05 ? 12  HIS B NE2 1 
ATOM   4565  N N   . LEU B 1 13  ? 89.382  -1.822  198.267 1.00 112.24 ? 13  LEU B N   1 
ATOM   4566  C CA  . LEU B 1 13  ? 89.169  -1.757  199.716 1.00 112.57 ? 13  LEU B CA  1 
ATOM   4567  C C   . LEU B 1 13  ? 90.430  -1.975  200.549 1.00 109.66 ? 13  LEU B C   1 
ATOM   4568  O O   . LEU B 1 13  ? 91.439  -2.483  200.064 1.00 125.95 ? 13  LEU B O   1 
ATOM   4569  C CB  . LEU B 1 13  ? 88.102  -2.771  200.153 1.00 116.37 ? 13  LEU B CB  1 
ATOM   4570  C CG  . LEU B 1 13  ? 88.273  -4.236  199.765 1.00 116.57 ? 13  LEU B CG  1 
ATOM   4571  C CD1 . LEU B 1 13  ? 88.240  -5.119  200.999 1.00 108.87 ? 13  LEU B CD1 1 
ATOM   4572  C CD2 . LEU B 1 13  ? 87.187  -4.638  198.787 1.00 131.72 ? 13  LEU B CD2 1 
ATOM   4573  N N   . GLN B 1 14  ? 90.349  -1.564  201.811 1.00 110.40 ? 14  GLN B N   1 
ATOM   4574  C CA  . GLN B 1 14  ? 91.409  -1.775  202.786 1.00 110.72 ? 14  GLN B CA  1 
ATOM   4575  C C   . GLN B 1 14  ? 90.907  -2.826  203.767 1.00 117.76 ? 14  GLN B C   1 
ATOM   4576  O O   . GLN B 1 14  ? 89.924  -2.592  204.471 1.00 131.52 ? 14  GLN B O   1 
ATOM   4577  C CB  . GLN B 1 14  ? 91.749  -0.473  203.514 1.00 114.33 ? 14  GLN B CB  1 
ATOM   4578  C CG  . GLN B 1 14  ? 92.818  -0.582  204.596 1.00 116.68 ? 14  GLN B CG  1 
ATOM   4579  C CD  . GLN B 1 14  ? 94.181  -0.938  204.046 1.00 123.65 ? 14  GLN B CD  1 
ATOM   4580  O OE1 . GLN B 1 14  ? 94.817  -0.127  203.379 1.00 131.63 ? 14  GLN B OE1 1 
ATOM   4581  N NE2 . GLN B 1 14  ? 94.644  -2.147  204.334 1.00 123.30 ? 14  GLN B NE2 1 
ATOM   4582  N N   . LEU B 1 15  ? 91.576  -3.976  203.821 1.00 114.53 ? 15  LEU B N   1 
ATOM   4583  C CA  . LEU B 1 15  ? 91.122  -5.073  204.673 1.00 113.64 ? 15  LEU B CA  1 
ATOM   4584  C C   . LEU B 1 15  ? 91.196  -4.728  206.154 1.00 115.95 ? 15  LEU B C   1 
ATOM   4585  O O   . LEU B 1 15  ? 90.457  -5.290  206.961 1.00 118.98 ? 15  LEU B O   1 
ATOM   4586  C CB  . LEU B 1 15  ? 91.923  -6.349  204.400 1.00 108.05 ? 15  LEU B CB  1 
ATOM   4587  C CG  . LEU B 1 15  ? 91.780  -6.941  202.999 1.00 107.77 ? 15  LEU B CG  1 
ATOM   4588  C CD1 . LEU B 1 15  ? 92.862  -7.970  202.748 1.00 106.77 ? 15  LEU B CD1 1 
ATOM   4589  C CD2 . LEU B 1 15  ? 90.404  -7.554  202.813 1.00 109.55 ? 15  LEU B CD2 1 
ATOM   4590  N N   . GLN B 1 16  ? 92.094  -3.816  206.509 1.00 115.35 ? 16  GLN B N   1 
ATOM   4591  C CA  . GLN B 1 16  ? 92.222  -3.374  207.892 1.00 124.23 ? 16  GLN B CA  1 
ATOM   4592  C C   . GLN B 1 16  ? 90.936  -2.687  208.364 1.00 133.74 ? 16  GLN B C   1 
ATOM   4593  O O   . GLN B 1 16  ? 90.630  -2.677  209.557 1.00 148.70 ? 16  GLN B O   1 
ATOM   4594  C CB  . GLN B 1 16  ? 93.421  -2.436  208.048 1.00 145.73 ? 16  GLN B CB  1 
ATOM   4595  C CG  . GLN B 1 16  ? 94.726  -2.984  207.463 1.00 157.89 ? 16  GLN B CG  1 
ATOM   4596  C CD  . GLN B 1 16  ? 95.540  -3.817  208.446 1.00 161.71 ? 16  GLN B CD  1 
ATOM   4597  O OE1 . GLN B 1 16  ? 96.697  -3.503  208.727 1.00 145.59 ? 16  GLN B OE1 1 
ATOM   4598  N NE2 . GLN B 1 16  ? 94.948  -4.894  208.954 1.00 170.41 ? 16  GLN B NE2 1 
ATOM   4599  N N   . ASN B 1 17  ? 90.185  -2.106  207.432 1.00 130.18 ? 17  ASN B N   1 
ATOM   4600  C CA  . ASN B 1 17  ? 88.911  -1.468  207.775 1.00 125.43 ? 17  ASN B CA  1 
ATOM   4601  C C   . ASN B 1 17  ? 87.768  -2.462  207.935 1.00 124.95 ? 17  ASN B C   1 
ATOM   4602  O O   . ASN B 1 17  ? 86.606  -2.078  208.052 1.00 126.64 ? 17  ASN B O   1 
ATOM   4603  C CB  . ASN B 1 17  ? 88.531  -0.430  206.726 1.00 123.65 ? 17  ASN B CB  1 
ATOM   4604  C CG  . ASN B 1 17  ? 89.525  0.699   206.651 1.00 128.59 ? 17  ASN B CG  1 
ATOM   4605  O OD1 . ASN B 1 17  ? 90.589  0.648   207.269 1.00 128.38 ? 17  ASN B OD1 1 
ATOM   4606  N ND2 . ASN B 1 17  ? 89.185  1.731   205.895 1.00 122.35 ? 17  ASN B ND2 1 
ATOM   4607  N N   . LEU B 1 18  ? 88.103  -3.744  207.934 1.00 120.28 ? 18  LEU B N   1 
ATOM   4608  C CA  . LEU B 1 18  ? 87.098  -4.783  208.093 1.00 120.05 ? 18  LEU B CA  1 
ATOM   4609  C C   . LEU B 1 18  ? 87.451  -5.703  209.258 1.00 125.35 ? 18  LEU B C   1 
ATOM   4610  O O   . LEU B 1 18  ? 87.000  -6.846  209.322 1.00 127.01 ? 18  LEU B O   1 
ATOM   4611  C CB  . LEU B 1 18  ? 86.939  -5.581  206.798 1.00 116.61 ? 18  LEU B CB  1 
ATOM   4612  C CG  . LEU B 1 18  ? 86.320  -4.812  205.630 1.00 119.26 ? 18  LEU B CG  1 
ATOM   4613  C CD1 . LEU B 1 18  ? 86.574  -5.537  204.323 1.00 117.72 ? 18  LEU B CD1 1 
ATOM   4614  C CD2 . LEU B 1 18  ? 84.827  -4.619  205.845 1.00 123.77 ? 18  LEU B CD2 1 
ATOM   4615  N N   . GLY B 1 19  ? 88.254  -5.181  210.181 1.00 137.24 ? 19  GLY B N   1 
ATOM   4616  C CA  . GLY B 1 19  ? 88.654  -5.900  211.379 1.00 145.48 ? 19  GLY B CA  1 
ATOM   4617  C C   . GLY B 1 19  ? 89.655  -7.015  211.153 1.00 139.66 ? 19  GLY B C   1 
ATOM   4618  O O   . GLY B 1 19  ? 89.950  -7.791  212.061 1.00 134.86 ? 19  GLY B O   1 
ATOM   4619  N N   . ILE B 1 20  ? 90.173  -7.101  209.934 1.00 138.62 ? 20  ILE B N   1 
ATOM   4620  C CA  . ILE B 1 20  ? 91.164  -8.118  209.601 1.00 130.83 ? 20  ILE B CA  1 
ATOM   4621  C C   . ILE B 1 20  ? 92.510  -7.798  210.242 1.00 128.00 ? 20  ILE B C   1 
ATOM   4622  O O   . ILE B 1 20  ? 93.040  -6.701  210.075 1.00 120.56 ? 20  ILE B O   1 
ATOM   4623  C CB  . ILE B 1 20  ? 91.353  -8.258  208.086 1.00 117.62 ? 20  ILE B CB  1 
ATOM   4624  C CG1 . ILE B 1 20  ? 90.023  -8.612  207.428 1.00 120.01 ? 20  ILE B CG1 1 
ATOM   4625  C CG2 . ILE B 1 20  ? 92.415  -9.303  207.781 1.00 112.43 ? 20  ILE B CG2 1 
ATOM   4626  C CD1 . ILE B 1 20  ? 89.393  -9.858  208.001 1.00 120.67 ? 20  ILE B CD1 1 
ATOM   4627  N N   . ASN B 1 21  ? 93.064  -8.767  210.961 1.00 127.40 ? 21  ASN B N   1 
ATOM   4628  C CA  . ASN B 1 21  ? 94.354  -8.608  211.624 1.00 124.35 ? 21  ASN B CA  1 
ATOM   4629  C C   . ASN B 1 21  ? 95.477  -8.479  210.595 1.00 120.56 ? 21  ASN B C   1 
ATOM   4630  O O   . ASN B 1 21  ? 95.595  -9.328  209.711 1.00 121.04 ? 21  ASN B O   1 
ATOM   4631  C CB  . ASN B 1 21  ? 94.610  -9.802  212.550 1.00 126.96 ? 21  ASN B CB  1 
ATOM   4632  C CG  . ASN B 1 21  ? 95.662  -9.520  213.606 1.00 131.01 ? 21  ASN B CG  1 
ATOM   4633  O OD1 . ASN B 1 21  ? 96.778  -9.102  213.301 1.00 129.91 ? 21  ASN B OD1 1 
ATOM   4634  N ND2 . ASN B 1 21  ? 95.310  -9.769  214.862 1.00 135.61 ? 21  ASN B ND2 1 
ATOM   4635  N N   . PRO B 1 22  ? 96.292  -7.409  210.693 1.00 117.31 ? 22  PRO B N   1 
ATOM   4636  C CA  . PRO B 1 22  ? 97.402  -7.180  209.757 1.00 115.92 ? 22  PRO B CA  1 
ATOM   4637  C C   . PRO B 1 22  ? 98.292  -8.405  209.600 1.00 112.68 ? 22  PRO B C   1 
ATOM   4638  O O   . PRO B 1 22  ? 98.814  -8.659  208.516 1.00 109.38 ? 22  PRO B O   1 
ATOM   4639  C CB  . PRO B 1 22  ? 98.186  -6.028  210.404 1.00 122.88 ? 22  PRO B CB  1 
ATOM   4640  C CG  . PRO B 1 22  ? 97.708  -5.974  211.820 1.00 128.99 ? 22  PRO B CG  1 
ATOM   4641  C CD  . PRO B 1 22  ? 96.275  -6.395  211.759 1.00 126.72 ? 22  PRO B CD  1 
ATOM   4642  N N   . ALA B 1 23  ? 98.456  -9.149  210.689 1.00 116.09 ? 23  ALA B N   1 
ATOM   4643  C CA  . ALA B 1 23  ? 99.268  -10.359 210.702 1.00 117.40 ? 23  ALA B CA  1 
ATOM   4644  C C   . ALA B 1 23  ? 98.713  -11.461 209.795 1.00 117.64 ? 23  ALA B C   1 
ATOM   4645  O O   . ALA B 1 23  ? 99.474  -12.254 209.244 1.00 126.92 ? 23  ALA B O   1 
ATOM   4646  C CB  . ALA B 1 23  ? 99.408  -10.867 212.128 1.00 114.50 ? 23  ALA B CB  1 
ATOM   4647  N N   . ASN B 1 24  ? 97.395  -11.497 209.621 1.00 106.48 ? 24  ASN B N   1 
ATOM   4648  C CA  . ASN B 1 24  ? 96.759  -12.520 208.790 1.00 105.53 ? 24  ASN B CA  1 
ATOM   4649  C C   . ASN B 1 24  ? 96.750  -12.189 207.307 1.00 101.64 ? 24  ASN B C   1 
ATOM   4650  O O   . ASN B 1 24  ? 96.240  -12.958 206.491 1.00 104.41 ? 24  ASN B O   1 
ATOM   4651  C CB  . ASN B 1 24  ? 95.327  -12.775 209.257 1.00 115.07 ? 24  ASN B CB  1 
ATOM   4652  C CG  . ASN B 1 24  ? 95.267  -13.423 210.614 1.00 138.52 ? 24  ASN B CG  1 
ATOM   4653  O OD1 . ASN B 1 24  ? 94.755  -12.846 211.570 1.00 144.65 ? 24  ASN B OD1 1 
ATOM   4654  N ND2 . ASN B 1 24  ? 95.774  -14.645 210.703 1.00 149.01 ? 24  ASN B ND2 1 
ATOM   4655  N N   . ILE B 1 25  ? 97.310  -11.039 206.964 1.00 99.85  ? 25  ILE B N   1 
ATOM   4656  C CA  . ILE B 1 25  ? 97.390  -10.623 205.577 1.00 99.90  ? 25  ILE B CA  1 
ATOM   4657  C C   . ILE B 1 25  ? 98.668  -11.170 204.945 1.00 108.68 ? 25  ILE B C   1 
ATOM   4658  O O   . ILE B 1 25  ? 99.692  -10.485 204.885 1.00 115.75 ? 25  ILE B O   1 
ATOM   4659  C CB  . ILE B 1 25  ? 97.341  -9.098  205.457 1.00 103.72 ? 25  ILE B CB  1 
ATOM   4660  C CG1 . ILE B 1 25  ? 96.083  -8.573  206.143 1.00 105.51 ? 25  ILE B CG1 1 
ATOM   4661  C CG2 . ILE B 1 25  ? 97.351  -8.678  204.002 1.00 103.72 ? 25  ILE B CG2 1 
ATOM   4662  C CD1 . ILE B 1 25  ? 96.068  -7.079  206.310 1.00 113.01 ? 25  ILE B CD1 1 
ATOM   4663  N N   . GLY B 1 26  ? 98.603  -12.420 204.492 1.00 108.32 ? 26  GLY B N   1 
ATOM   4664  C CA  . GLY B 1 26  ? 99.753  -13.083 203.903 1.00 107.17 ? 26  GLY B CA  1 
ATOM   4665  C C   . GLY B 1 26  ? 99.437  -14.360 203.143 1.00 105.14 ? 26  GLY B C   1 
ATOM   4666  O O   . GLY B 1 26  ? 98.371  -14.950 203.315 1.00 116.28 ? 26  GLY B O   1 
ATOM   4667  N N   . PHE B 1 27  ? 100.382 -14.782 202.305 1.00 96.95  ? 27  PHE B N   1 
ATOM   4668  C CA  . PHE B 1 27  ? 100.269 -15.978 201.461 1.00 87.19  ? 27  PHE B CA  1 
ATOM   4669  C C   . PHE B 1 27  ? 99.752  -17.234 202.169 1.00 86.11  ? 27  PHE B C   1 
ATOM   4670  O O   . PHE B 1 27  ? 98.959  -17.987 201.606 1.00 84.83  ? 27  PHE B O   1 
ATOM   4671  C CB  . PHE B 1 27  ? 101.643 -16.286 200.858 1.00 83.69  ? 27  PHE B CB  1 
ATOM   4672  C CG  . PHE B 1 27  ? 101.636 -17.381 199.817 1.00 82.82  ? 27  PHE B CG  1 
ATOM   4673  C CD1 . PHE B 1 27  ? 101.134 -17.150 198.550 1.00 98.98  ? 27  PHE B CD1 1 
ATOM   4674  C CD2 . PHE B 1 27  ? 102.165 -18.633 200.102 1.00 83.83  ? 27  PHE B CD2 1 
ATOM   4675  C CE1 . PHE B 1 27  ? 101.136 -18.149 197.593 1.00 93.08  ? 27  PHE B CE1 1 
ATOM   4676  C CE2 . PHE B 1 27  ? 102.170 -19.638 199.150 1.00 84.29  ? 27  PHE B CE2 1 
ATOM   4677  C CZ  . PHE B 1 27  ? 101.655 -19.395 197.892 1.00 81.92  ? 27  PHE B CZ  1 
ATOM   4678  N N   . SER B 1 28  ? 100.190 -17.451 203.404 1.00 92.07  ? 28  SER B N   1 
ATOM   4679  C CA  . SER B 1 28  ? 99.819  -18.652 204.155 1.00 95.83  ? 28  SER B CA  1 
ATOM   4680  C C   . SER B 1 28  ? 98.414  -18.633 204.768 1.00 99.76  ? 28  SER B C   1 
ATOM   4681  O O   . SER B 1 28  ? 97.835  -19.686 205.017 1.00 95.87  ? 28  SER B O   1 
ATOM   4682  C CB  . SER B 1 28  ? 100.845 -18.904 205.259 1.00 101.30 ? 28  SER B CB  1 
ATOM   4683  O OG  . SER B 1 28  ? 100.947 -17.794 206.128 1.00 107.27 ? 28  SER B OG  1 
ATOM   4684  N N   . THR B 1 29  ? 97.866  -17.448 205.021 1.00 93.66  ? 29  THR B N   1 
ATOM   4685  C CA  . THR B 1 29  ? 96.571  -17.356 205.703 1.00 89.76  ? 29  THR B CA  1 
ATOM   4686  C C   . THR B 1 29  ? 95.458  -16.756 204.860 1.00 95.99  ? 29  THR B C   1 
ATOM   4687  O O   . THR B 1 29  ? 94.279  -16.974 205.125 1.00 123.07 ? 29  THR B O   1 
ATOM   4688  C CB  . THR B 1 29  ? 96.680  -16.517 206.977 1.00 103.10 ? 29  THR B CB  1 
ATOM   4689  O OG1 . THR B 1 29  ? 97.460  -15.346 206.715 1.00 124.55 ? 29  THR B OG1 1 
ATOM   4690  C CG2 . THR B 1 29  ? 97.329  -17.330 208.087 1.00 106.45 ? 29  THR B CG2 1 
ATOM   4691  N N   . LEU B 1 30  ? 95.845  -16.002 203.840 1.00 86.25  ? 30  LEU B N   1 
ATOM   4692  C CA  . LEU B 1 30  ? 94.882  -15.326 202.978 1.00 85.50  ? 30  LEU B CA  1 
ATOM   4693  C C   . LEU B 1 30  ? 94.930  -15.911 201.571 1.00 90.92  ? 30  LEU B C   1 
ATOM   4694  O O   . LEU B 1 30  ? 95.994  -16.029 200.963 1.00 113.57 ? 30  LEU B O   1 
ATOM   4695  C CB  . LEU B 1 30  ? 95.170  -13.827 202.938 1.00 86.09  ? 30  LEU B CB  1 
ATOM   4696  C CG  . LEU B 1 30  ? 94.078  -12.866 202.479 1.00 92.09  ? 30  LEU B CG  1 
ATOM   4697  C CD1 . LEU B 1 30  ? 94.199  -11.545 203.216 1.00 108.03 ? 30  LEU B CD1 1 
ATOM   4698  C CD2 . LEU B 1 30  ? 94.156  -12.649 200.981 1.00 87.73  ? 30  LEU B CD2 1 
ATOM   4699  N N   . THR B 1 31  ? 93.765  -16.282 201.059 1.00 89.29  ? 31  THR B N   1 
ATOM   4700  C CA  . THR B 1 31  ? 93.661  -16.859 199.727 1.00 93.60  ? 31  THR B CA  1 
ATOM   4701  C C   . THR B 1 31  ? 92.667  -16.099 198.865 1.00 90.18  ? 31  THR B C   1 
ATOM   4702  O O   . THR B 1 31  ? 91.638  -15.627 199.351 1.00 106.23 ? 31  THR B O   1 
ATOM   4703  C CB  . THR B 1 31  ? 93.235  -18.324 199.796 1.00 86.06  ? 31  THR B CB  1 
ATOM   4704  O OG1 . THR B 1 31  ? 91.928  -18.405 200.373 1.00 101.84 ? 31  THR B OG1 1 
ATOM   4705  C CG2 . THR B 1 31  ? 94.210  -19.113 200.665 1.00 85.81  ? 31  THR B CG2 1 
ATOM   4706  N N   . MET B 1 32  ? 92.986  -15.985 197.583 1.00 80.07  ? 32  MET B N   1 
ATOM   4707  C CA  . MET B 1 32  ? 92.091  -15.364 196.625 1.00 79.36  ? 32  MET B CA  1 
ATOM   4708  C C   . MET B 1 32  ? 92.178  -16.167 195.329 1.00 85.51  ? 32  MET B C   1 
ATOM   4709  O O   . MET B 1 32  ? 93.216  -16.210 194.659 1.00 123.32 ? 32  MET B O   1 
ATOM   4710  C CB  . MET B 1 32  ? 92.434  -13.893 196.410 1.00 81.26  ? 32  MET B CB  1 
ATOM   4711  C CG  . MET B 1 32  ? 91.257  -13.085 195.885 1.00 85.22  ? 32  MET B CG  1 
ATOM   4712  S SD  . MET B 1 32  ? 91.699  -11.497 195.163 1.00 142.70 ? 32  MET B SD  1 
ATOM   4713  C CE  . MET B 1 32  ? 90.074  -10.822 194.803 1.00 120.49 ? 32  MET B CE  1 
ATOM   4714  N N   . GLU B 1 33  ? 91.069  -16.817 194.999 1.00 75.84  ? 33  GLU B N   1 
ATOM   4715  C CA  . GLU B 1 33  ? 91.008  -17.764 193.899 1.00 74.20  ? 33  GLU B CA  1 
ATOM   4716  C C   . GLU B 1 33  ? 90.264  -17.163 192.707 1.00 77.28  ? 33  GLU B C   1 
ATOM   4717  O O   . GLU B 1 33  ? 90.313  -17.696 191.602 1.00 77.24  ? 33  GLU B O   1 
ATOM   4718  C CB  . GLU B 1 33  ? 90.325  -19.047 194.387 1.00 75.42  ? 33  GLU B CB  1 
ATOM   4719  C CG  . GLU B 1 33  ? 91.066  -19.745 195.527 1.00 96.59  ? 33  GLU B CG  1 
ATOM   4720  C CD  . GLU B 1 33  ? 92.339  -20.446 195.087 1.00 123.44 ? 33  GLU B CD  1 
ATOM   4721  O OE1 . GLU B 1 33  ? 92.291  -21.187 194.083 1.00 120.23 ? 33  GLU B OE1 1 
ATOM   4722  O OE2 . GLU B 1 33  ? 93.393  -20.229 195.725 1.00 142.36 ? 33  GLU B OE2 1 
ATOM   4723  N N   . SER B 1 34  ? 89.593  -16.039 192.943 1.00 77.49  ? 34  SER B N   1 
ATOM   4724  C CA  . SER B 1 34  ? 88.859  -15.317 191.905 1.00 85.81  ? 34  SER B CA  1 
ATOM   4725  C C   . SER B 1 34  ? 88.490  -13.931 192.422 1.00 92.93  ? 34  SER B C   1 
ATOM   4726  O O   . SER B 1 34  ? 88.673  -13.646 193.601 1.00 113.69 ? 34  SER B O   1 
ATOM   4727  C CB  . SER B 1 34  ? 87.606  -16.085 191.486 1.00 88.16  ? 34  SER B CB  1 
ATOM   4728  O OG  . SER B 1 34  ? 86.730  -16.262 192.585 1.00 84.39  ? 34  SER B OG  1 
ATOM   4729  N N   . ASP B 1 35  ? 88.006  -13.054 191.548 1.00 85.47  ? 35  ASP B N   1 
ATOM   4730  C CA  . ASP B 1 35  ? 87.599  -11.715 191.984 1.00 85.22  ? 35  ASP B CA  1 
ATOM   4731  C C   . ASP B 1 35  ? 86.322  -11.729 192.837 1.00 98.25  ? 35  ASP B C   1 
ATOM   4732  O O   . ASP B 1 35  ? 85.859  -10.675 193.274 1.00 107.23 ? 35  ASP B O   1 
ATOM   4733  C CB  . ASP B 1 35  ? 87.434  -10.773 190.789 1.00 90.88  ? 35  ASP B CB  1 
ATOM   4734  C CG  . ASP B 1 35  ? 86.368  -11.232 189.823 1.00 115.76 ? 35  ASP B CG  1 
ATOM   4735  O OD1 . ASP B 1 35  ? 85.829  -12.346 190.000 1.00 139.28 ? 35  ASP B OD1 1 
ATOM   4736  O OD2 . ASP B 1 35  ? 86.063  -10.474 188.876 1.00 112.53 ? 35  ASP B OD2 1 
ATOM   4737  N N   . LYS B 1 36  ? 85.742  -12.911 193.045 1.00 104.38 ? 36  LYS B N   1 
ATOM   4738  C CA  . LYS B 1 36  ? 84.491  -13.038 193.798 1.00 99.47  ? 36  LYS B CA  1 
ATOM   4739  C C   . LYS B 1 36  ? 84.659  -13.047 195.329 1.00 101.10 ? 36  LYS B C   1 
ATOM   4740  O O   . LYS B 1 36  ? 83.901  -12.395 196.040 1.00 107.82 ? 36  LYS B O   1 
ATOM   4741  C CB  . LYS B 1 36  ? 83.746  -14.307 193.377 1.00 96.13  ? 36  LYS B CB  1 
ATOM   4742  C CG  . LYS B 1 36  ? 83.389  -14.398 191.900 1.00 98.79  ? 36  LYS B CG  1 
ATOM   4743  C CD  . LYS B 1 36  ? 82.002  -13.831 191.623 1.00 121.90 ? 36  LYS B CD  1 
ATOM   4744  C CE  . LYS B 1 36  ? 81.621  -13.972 190.153 1.00 130.79 ? 36  LYS B CE  1 
ATOM   4745  N NZ  . LYS B 1 36  ? 82.443  -13.119 189.247 1.00 127.58 ? 36  LYS B NZ  1 
ATOM   4746  N N   . PHE B 1 37  ? 85.651  -13.775 195.837 1.00 104.04 ? 37  PHE B N   1 
ATOM   4747  C CA  . PHE B 1 37  ? 85.841  -13.894 197.289 1.00 98.42  ? 37  PHE B CA  1 
ATOM   4748  C C   . PHE B 1 37  ? 87.277  -13.716 197.750 1.00 101.23 ? 37  PHE B C   1 
ATOM   4749  O O   . PHE B 1 37  ? 88.221  -13.910 196.988 1.00 106.79 ? 37  PHE B O   1 
ATOM   4750  C CB  . PHE B 1 37  ? 85.380  -15.262 197.817 1.00 99.57  ? 37  PHE B CB  1 
ATOM   4751  C CG  . PHE B 1 37  ? 84.030  -15.697 197.339 1.00 112.76 ? 37  PHE B CG  1 
ATOM   4752  C CD1 . PHE B 1 37  ? 82.894  -15.372 198.059 1.00 105.52 ? 37  PHE B CD1 1 
ATOM   4753  C CD2 . PHE B 1 37  ? 83.898  -16.475 196.201 1.00 119.83 ? 37  PHE B CD2 1 
ATOM   4754  C CE1 . PHE B 1 37  ? 81.649  -15.785 197.639 1.00 104.97 ? 37  PHE B CE1 1 
ATOM   4755  C CE2 . PHE B 1 37  ? 82.654  -16.892 195.773 1.00 121.69 ? 37  PHE B CE2 1 
ATOM   4756  C CZ  . PHE B 1 37  ? 81.527  -16.547 196.494 1.00 117.12 ? 37  PHE B CZ  1 
ATOM   4757  N N   . ILE B 1 38  ? 87.414  -13.316 199.010 1.00 91.49  ? 38  ILE B N   1 
ATOM   4758  C CA  . ILE B 1 38  ? 88.699  -13.276 199.696 1.00 92.38  ? 38  ILE B CA  1 
ATOM   4759  C C   . ILE B 1 38  ? 88.549  -14.046 201.004 1.00 105.39 ? 38  ILE B C   1 
ATOM   4760  O O   . ILE B 1 38  ? 87.727  -13.685 201.842 1.00 128.92 ? 38  ILE B O   1 
ATOM   4761  C CB  . ILE B 1 38  ? 89.174  -11.851 199.990 1.00 93.16  ? 38  ILE B CB  1 
ATOM   4762  C CG1 . ILE B 1 38  ? 89.534  -11.121 198.700 1.00 101.41 ? 38  ILE B CG1 1 
ATOM   4763  C CG2 . ILE B 1 38  ? 90.381  -11.879 200.898 1.00 92.95  ? 38  ILE B CG2 1 
ATOM   4764  C CD1 . ILE B 1 38  ? 89.754  -9.634  198.895 1.00 104.82 ? 38  ILE B CD1 1 
ATOM   4765  N N   . CYS B 1 39  ? 89.347  -15.092 201.192 1.00 92.16  ? 39  CYS B N   1 
ATOM   4766  C CA  . CYS B 1 39  ? 89.207  -15.934 202.377 1.00 92.18  ? 39  CYS B CA  1 
ATOM   4767  C C   . CYS B 1 39  ? 90.417  -15.866 203.303 1.00 94.59  ? 39  CYS B C   1 
ATOM   4768  O O   . CYS B 1 39  ? 91.538  -16.180 202.911 1.00 94.60  ? 39  CYS B O   1 
ATOM   4769  C CB  . CYS B 1 39  ? 88.960  -17.380 201.955 1.00 91.50  ? 39  CYS B CB  1 
ATOM   4770  S SG  . CYS B 1 39  ? 88.912  -18.564 203.311 1.00 117.04 ? 39  CYS B SG  1 
ATOM   4771  N N   . ILE B 1 40  ? 90.170  -15.460 204.545 1.00 95.08  ? 40  ILE B N   1 
ATOM   4772  C CA  . ILE B 1 40  ? 91.232  -15.278 205.538 1.00 95.75  ? 40  ILE B CA  1 
ATOM   4773  C C   . ILE B 1 40  ? 91.079  -16.222 206.730 1.00 100.00 ? 40  ILE B C   1 
ATOM   4774  O O   . ILE B 1 40  ? 89.973  -16.433 207.229 1.00 106.40 ? 40  ILE B O   1 
ATOM   4775  C CB  . ILE B 1 40  ? 91.277  -13.834 206.067 1.00 99.31  ? 40  ILE B CB  1 
ATOM   4776  C CG1 . ILE B 1 40  ? 91.166  -12.828 204.918 1.00 112.34 ? 40  ILE B CG1 1 
ATOM   4777  C CG2 . ILE B 1 40  ? 92.559  -13.594 206.850 1.00 100.06 ? 40  ILE B CG2 1 
ATOM   4778  C CD1 . ILE B 1 40  ? 89.753  -12.329 204.664 1.00 138.59 ? 40  ILE B CD1 1 
ATOM   4779  N N   . ARG B 1 41  ? 92.194  -16.784 207.182 1.00 99.02  ? 41  ARG B N   1 
ATOM   4780  C CA  . ARG B 1 41  ? 92.194  -17.642 208.351 1.00 101.20 ? 41  ARG B CA  1 
ATOM   4781  C C   . ARG B 1 41  ? 92.793  -16.907 209.549 1.00 108.42 ? 41  ARG B C   1 
ATOM   4782  O O   . ARG B 1 41  ? 93.970  -16.563 209.547 1.00 118.84 ? 41  ARG B O   1 
ATOM   4783  C CB  . ARG B 1 41  ? 92.974  -18.928 208.068 1.00 99.32  ? 41  ARG B CB  1 
ATOM   4784  C CG  . ARG B 1 41  ? 92.414  -19.719 206.896 1.00 120.84 ? 41  ARG B CG  1 
ATOM   4785  C CD  . ARG B 1 41  ? 93.048  -21.100 206.738 1.00 135.70 ? 41  ARG B CD  1 
ATOM   4786  N NE  . ARG B 1 41  ? 94.503  -21.043 206.615 1.00 131.42 ? 41  ARG B NE  1 
ATOM   4787  C CZ  . ARG B 1 41  ? 95.355  -21.351 207.586 1.00 121.99 ? 41  ARG B CZ  1 
ATOM   4788  N NH1 . ARG B 1 41  ? 96.658  -21.267 207.371 1.00 128.19 ? 41  ARG B NH1 1 
ATOM   4789  N NH2 . ARG B 1 41  ? 94.907  -21.752 208.765 1.00 117.53 ? 41  ARG B NH2 1 
ATOM   4790  N N   . GLU B 1 42  ? 91.981  -16.675 210.576 1.00 114.58 ? 42  GLU B N   1 
ATOM   4791  C CA  . GLU B 1 42  ? 92.436  -15.954 211.760 1.00 119.05 ? 42  GLU B CA  1 
ATOM   4792  C C   . GLU B 1 42  ? 92.230  -16.779 213.025 1.00 128.16 ? 42  GLU B C   1 
ATOM   4793  O O   . GLU B 1 42  ? 91.492  -17.767 213.025 1.00 130.89 ? 42  GLU B O   1 
ATOM   4794  C CB  . GLU B 1 42  ? 91.705  -14.612 211.878 1.00 122.22 ? 42  GLU B CB  1 
ATOM   4795  C CG  . GLU B 1 42  ? 91.773  -13.717 210.654 1.00 136.01 ? 42  GLU B CG  1 
ATOM   4796  C CD  . GLU B 1 42  ? 91.511  -12.265 210.995 1.00 146.36 ? 42  GLU B CD  1 
ATOM   4797  O OE1 . GLU B 1 42  ? 90.588  -12.028 211.796 1.00 146.66 ? 42  GLU B OE1 1 
ATOM   4798  O OE2 . GLU B 1 42  ? 92.211  -11.368 210.478 1.00 160.34 ? 42  GLU B OE2 1 
ATOM   4799  N N   . LYS B 1 43  ? 92.883  -16.368 214.107 1.00 138.50 ? 43  LYS B N   1 
ATOM   4800  C CA  . LYS B 1 43  ? 92.686  -17.031 215.387 1.00 145.53 ? 43  LYS B CA  1 
ATOM   4801  C C   . LYS B 1 43  ? 92.424  -16.027 216.503 1.00 153.72 ? 43  LYS B C   1 
ATOM   4802  O O   . LYS B 1 43  ? 93.339  -15.354 216.980 1.00 165.56 ? 43  LYS B O   1 
ATOM   4803  C CB  . LYS B 1 43  ? 93.902  -17.895 215.720 1.00 151.83 ? 43  LYS B CB  1 
ATOM   4804  C CG  . LYS B 1 43  ? 93.607  -19.071 216.636 1.00 158.75 ? 43  LYS B CG  1 
ATOM   4805  C CD  . LYS B 1 43  ? 94.896  -19.768 217.028 1.00 163.40 ? 43  LYS B CD  1 
ATOM   4806  C CE  . LYS B 1 43  ? 94.694  -21.258 217.248 1.00 166.32 ? 43  LYS B CE  1 
ATOM   4807  N NZ  . LYS B 1 43  ? 93.924  -21.550 218.486 1.00 164.75 ? 43  LYS B NZ  1 
ATOM   4808  N N   . VAL B 1 44  ? 91.167  -15.920 216.913 1.00 151.34 ? 44  VAL B N   1 
ATOM   4809  C CA  . VAL B 1 44  ? 90.821  -15.092 218.057 1.00 159.16 ? 44  VAL B CA  1 
ATOM   4810  C C   . VAL B 1 44  ? 90.754  -15.931 219.330 1.00 167.98 ? 44  VAL B C   1 
ATOM   4811  O O   . VAL B 1 44  ? 89.960  -16.861 219.417 1.00 178.08 ? 44  VAL B O   1 
ATOM   4812  C CB  . VAL B 1 44  ? 89.477  -14.360 217.851 1.00 163.74 ? 44  VAL B CB  1 
ATOM   4813  C CG1 . VAL B 1 44  ? 89.457  -13.077 218.684 1.00 159.80 ? 44  VAL B CG1 1 
ATOM   4814  C CG2 . VAL B 1 44  ? 89.257  -14.046 216.368 1.00 163.27 ? 44  VAL B CG2 1 
ATOM   4815  N N   . GLY B 1 45  ? 91.595  -15.600 220.306 1.00 166.64 ? 45  GLY B N   1 
ATOM   4816  C CA  . GLY B 1 45  ? 91.501  -16.173 221.640 1.00 172.58 ? 45  GLY B CA  1 
ATOM   4817  C C   . GLY B 1 45  ? 91.402  -17.692 221.707 1.00 174.48 ? 45  GLY B C   1 
ATOM   4818  O O   . GLY B 1 45  ? 90.461  -18.219 222.296 1.00 170.55 ? 45  GLY B O   1 
ATOM   4819  N N   . GLU B 1 46  ? 92.307  -18.377 221.007 1.00 173.84 ? 46  GLU B N   1 
ATOM   4820  C CA  . GLU B 1 46  ? 92.375  -19.841 220.958 1.00 171.68 ? 46  GLU B CA  1 
ATOM   4821  C C   . GLU B 1 46  ? 91.205  -20.429 220.159 1.00 162.06 ? 46  GLU B C   1 
ATOM   4822  O O   . GLU B 1 46  ? 91.025  -21.648 220.143 1.00 151.72 ? 46  GLU B O   1 
ATOM   4823  C CB  . GLU B 1 46  ? 92.409  -20.455 222.368 1.00 174.54 ? 46  GLU B CB  1 
ATOM   4824  C CG  . GLU B 1 46  ? 93.771  -20.388 223.092 1.00 179.17 ? 46  GLU B CG  1 
ATOM   4825  C CD  . GLU B 1 46  ? 94.861  -21.310 222.538 1.00 179.09 ? 46  GLU B CD  1 
ATOM   4826  O OE1 . GLU B 1 46  ? 94.703  -22.553 222.534 1.00 172.98 ? 46  GLU B OE1 1 
ATOM   4827  O OE2 . GLU B 1 46  ? 95.917  -20.768 222.150 1.00 182.71 ? 46  GLU B OE2 1 
ATOM   4828  N N   . GLN B 1 47  ? 90.431  -19.579 219.480 1.00 161.73 ? 47  GLN B N   1 
ATOM   4829  C CA  . GLN B 1 47  ? 89.387  -20.083 218.589 1.00 160.64 ? 47  GLN B CA  1 
ATOM   4830  C C   . GLN B 1 47  ? 89.832  -20.008 217.132 1.00 156.17 ? 47  GLN B C   1 
ATOM   4831  O O   . GLN B 1 47  ? 90.283  -18.966 216.658 1.00 154.71 ? 47  GLN B O   1 
ATOM   4832  C CB  . GLN B 1 47  ? 88.076  -19.291 218.726 1.00 166.52 ? 47  GLN B CB  1 
ATOM   4833  C CG  . GLN B 1 47  ? 87.525  -19.095 220.121 1.00 177.24 ? 47  GLN B CG  1 
ATOM   4834  C CD  . GLN B 1 47  ? 86.342  -18.138 220.138 1.00 179.05 ? 47  GLN B CD  1 
ATOM   4835  O OE1 . GLN B 1 47  ? 85.284  -18.428 219.580 1.00 181.07 ? 47  GLN B OE1 1 
ATOM   4836  N NE2 . GLN B 1 47  ? 86.528  -16.978 220.760 1.00 180.52 ? 47  GLN B NE2 1 
ATOM   4837  N N   . ALA B 1 48  ? 89.702  -21.132 216.432 1.00 149.80 ? 48  ALA B N   1 
ATOM   4838  C CA  . ALA B 1 48  ? 90.079  -21.226 215.027 1.00 134.72 ? 48  ALA B CA  1 
ATOM   4839  C C   . ALA B 1 48  ? 88.883  -20.852 214.174 1.00 136.67 ? 48  ALA B C   1 
ATOM   4840  O O   . ALA B 1 48  ? 87.826  -21.473 214.269 1.00 153.19 ? 48  ALA B O   1 
ATOM   4841  C CB  . ALA B 1 48  ? 90.566  -22.625 214.681 1.00 126.44 ? 48  ALA B CB  1 
ATOM   4842  N N   . GLN B 1 49  ? 89.030  -19.830 213.346 1.00 122.02 ? 49  GLN B N   1 
ATOM   4843  C CA  . GLN B 1 49  ? 87.910  -19.417 212.522 1.00 126.68 ? 49  GLN B CA  1 
ATOM   4844  C C   . GLN B 1 49  ? 88.330  -19.013 211.121 1.00 123.07 ? 49  GLN B C   1 
ATOM   4845  O O   . GLN B 1 49  ? 89.509  -18.813 210.833 1.00 124.84 ? 49  GLN B O   1 
ATOM   4846  C CB  . GLN B 1 49  ? 87.145  -18.286 213.202 1.00 133.90 ? 49  GLN B CB  1 
ATOM   4847  C CG  . GLN B 1 49  ? 88.010  -17.139 213.662 1.00 138.24 ? 49  GLN B CG  1 
ATOM   4848  C CD  . GLN B 1 49  ? 87.201  -16.085 214.379 1.00 143.67 ? 49  GLN B CD  1 
ATOM   4849  O OE1 . GLN B 1 49  ? 86.820  -16.256 215.537 1.00 157.83 ? 49  GLN B OE1 1 
ATOM   4850  N NE2 . GLN B 1 49  ? 86.915  -14.992 213.686 1.00 140.60 ? 49  GLN B NE2 1 
ATOM   4851  N N   . VAL B 1 50  ? 87.335  -18.909 210.251 1.00 120.76 ? 50  VAL B N   1 
ATOM   4852  C CA  . VAL B 1 50  ? 87.553  -18.576 208.856 1.00 114.51 ? 50  VAL B CA  1 
ATOM   4853  C C   . VAL B 1 50  ? 86.674  -17.414 208.422 1.00 122.95 ? 50  VAL B C   1 
ATOM   4854  O O   . VAL B 1 50  ? 85.457  -17.453 208.575 1.00 140.77 ? 50  VAL B O   1 
ATOM   4855  C CB  . VAL B 1 50  ? 87.273  -19.780 207.950 1.00 109.16 ? 50  VAL B CB  1 
ATOM   4856  C CG1 . VAL B 1 50  ? 87.114  -19.333 206.512 1.00 107.21 ? 50  VAL B CG1 1 
ATOM   4857  C CG2 . VAL B 1 50  ? 88.382  -20.808 208.081 1.00 109.52 ? 50  VAL B CG2 1 
ATOM   4858  N N   . VAL B 1 51  ? 87.304  -16.380 207.875 1.00 107.51 ? 51  VAL B N   1 
ATOM   4859  C CA  . VAL B 1 51  ? 86.579  -15.204 207.400 1.00 107.96 ? 51  VAL B CA  1 
ATOM   4860  C C   . VAL B 1 51  ? 86.442  -15.157 205.887 1.00 107.13 ? 51  VAL B C   1 
ATOM   4861  O O   . VAL B 1 51  ? 87.430  -15.195 205.160 1.00 120.58 ? 51  VAL B O   1 
ATOM   4862  C CB  . VAL B 1 51  ? 87.256  -13.905 207.843 1.00 111.24 ? 51  VAL B CB  1 
ATOM   4863  C CG1 . VAL B 1 51  ? 86.317  -12.735 207.630 1.00 112.90 ? 51  VAL B CG1 1 
ATOM   4864  C CG2 . VAL B 1 51  ? 87.704  -13.996 209.296 1.00 117.27 ? 51  VAL B CG2 1 
ATOM   4865  N N   . ILE B 1 52  ? 85.202  -15.065 205.424 1.00 108.93 ? 52  ILE B N   1 
ATOM   4866  C CA  . ILE B 1 52  ? 84.922  -14.996 203.996 1.00 102.96 ? 52  ILE B CA  1 
ATOM   4867  C C   . ILE B 1 52  ? 84.355  -13.642 203.582 1.00 107.96 ? 52  ILE B C   1 
ATOM   4868  O O   . ILE B 1 52  ? 83.315  -13.218 204.082 1.00 137.89 ? 52  ILE B O   1 
ATOM   4869  C CB  . ILE B 1 52  ? 83.936  -16.084 203.575 1.00 104.23 ? 52  ILE B CB  1 
ATOM   4870  C CG1 . ILE B 1 52  ? 84.452  -17.456 204.005 1.00 103.47 ? 52  ILE B CG1 1 
ATOM   4871  C CG2 . ILE B 1 52  ? 83.694  -16.027 202.077 1.00 102.77 ? 52  ILE B CG2 1 
ATOM   4872  C CD1 . ILE B 1 52  ? 83.361  -18.458 204.284 1.00 135.51 ? 52  ILE B CD1 1 
ATOM   4873  N N   . ILE B 1 53  ? 85.045  -12.966 202.672 1.00 102.54 ? 53  ILE B N   1 
ATOM   4874  C CA  . ILE B 1 53  ? 84.579  -11.674 202.193 1.00 103.59 ? 53  ILE B CA  1 
ATOM   4875  C C   . ILE B 1 53  ? 84.022  -11.728 200.774 1.00 117.51 ? 53  ILE B C   1 
ATOM   4876  O O   . ILE B 1 53  ? 84.757  -11.924 199.810 1.00 116.80 ? 53  ILE B O   1 
ATOM   4877  C CB  . ILE B 1 53  ? 85.696  -10.630 202.254 1.00 104.19 ? 53  ILE B CB  1 
ATOM   4878  C CG1 . ILE B 1 53  ? 86.130  -10.424 203.706 1.00 105.76 ? 53  ILE B CG1 1 
ATOM   4879  C CG2 . ILE B 1 53  ? 85.230  -9.317  201.650 1.00 105.56 ? 53  ILE B CG2 1 
ATOM   4880  C CD1 . ILE B 1 53  ? 87.365  -9.567  203.862 1.00 107.14 ? 53  ILE B CD1 1 
ATOM   4881  N N   . ASP B 1 54  ? 82.712  -11.537 200.659 1.00 132.50 ? 54  ASP B N   1 
ATOM   4882  C CA  . ASP B 1 54  ? 82.061  -11.471 199.362 1.00 124.65 ? 54  ASP B CA  1 
ATOM   4883  C C   . ASP B 1 54  ? 82.394  -10.112 198.752 1.00 126.68 ? 54  ASP B C   1 
ATOM   4884  O O   . ASP B 1 54  ? 82.195  -9.084  199.393 1.00 128.97 ? 54  ASP B O   1 
ATOM   4885  C CB  . ASP B 1 54  ? 80.550  -11.659 199.511 1.00 117.88 ? 54  ASP B CB  1 
ATOM   4886  C CG  . ASP B 1 54  ? 79.849  -11.859 198.181 1.00 123.26 ? 54  ASP B CG  1 
ATOM   4887  O OD1 . ASP B 1 54  ? 80.493  -11.692 197.124 1.00 122.07 ? 54  ASP B OD1 1 
ATOM   4888  O OD2 . ASP B 1 54  ? 78.642  -12.181 198.194 1.00 136.61 ? 54  ASP B OD2 1 
ATOM   4889  N N   . MET B 1 55  ? 82.885  -10.098 197.516 1.00 119.94 ? 55  MET B N   1 
ATOM   4890  C CA  . MET B 1 55  ? 83.309  -8.841  196.909 1.00 114.72 ? 55  MET B CA  1 
ATOM   4891  C C   . MET B 1 55  ? 82.129  -8.050  196.352 1.00 117.94 ? 55  MET B C   1 
ATOM   4892  O O   . MET B 1 55  ? 82.263  -6.871  196.022 1.00 117.12 ? 55  MET B O   1 
ATOM   4893  C CB  . MET B 1 55  ? 84.345  -9.097  195.813 1.00 121.87 ? 55  MET B CB  1 
ATOM   4894  C CG  . MET B 1 55  ? 85.649  -9.654  196.351 1.00 121.60 ? 55  MET B CG  1 
ATOM   4895  S SD  . MET B 1 55  ? 86.546  -8.476  197.380 1.00 132.55 ? 55  MET B SD  1 
ATOM   4896  C CE  . MET B 1 55  ? 86.989  -7.229  196.178 1.00 147.51 ? 55  MET B CE  1 
ATOM   4897  N N   . ASN B 1 56  ? 80.979  -8.705  196.233 1.00 135.15 ? 56  ASN B N   1 
ATOM   4898  C CA  . ASN B 1 56  ? 79.757  -8.024  195.829 1.00 140.77 ? 56  ASN B CA  1 
ATOM   4899  C C   . ASN B 1 56  ? 79.194  -7.235  197.001 1.00 136.28 ? 56  ASN B C   1 
ATOM   4900  O O   . ASN B 1 56  ? 78.655  -6.140  196.838 1.00 131.86 ? 56  ASN B O   1 
ATOM   4901  C CB  . ASN B 1 56  ? 78.730  -9.022  195.314 1.00 145.91 ? 56  ASN B CB  1 
ATOM   4902  C CG  . ASN B 1 56  ? 79.186  -9.711  194.056 1.00 153.09 ? 56  ASN B CG  1 
ATOM   4903  O OD1 . ASN B 1 56  ? 78.960  -9.221  192.950 1.00 161.18 ? 56  ASN B OD1 1 
ATOM   4904  N ND2 . ASN B 1 56  ? 79.846  -10.849 194.214 1.00 142.86 ? 56  ASN B ND2 1 
ATOM   4905  N N   . ASP B 1 57  ? 79.335  -7.817  198.185 1.00 139.77 ? 57  ASP B N   1 
ATOM   4906  C CA  . ASP B 1 57  ? 78.972  -7.164  199.426 1.00 150.34 ? 57  ASP B CA  1 
ATOM   4907  C C   . ASP B 1 57  ? 80.153  -7.288  200.390 1.00 144.03 ? 57  ASP B C   1 
ATOM   4908  O O   . ASP B 1 57  ? 80.177  -8.173  201.248 1.00 139.56 ? 57  ASP B O   1 
ATOM   4909  C CB  . ASP B 1 57  ? 77.705  -7.812  199.988 1.00 153.49 ? 57  ASP B CB  1 
ATOM   4910  C CG  . ASP B 1 57  ? 77.341  -7.302  201.356 1.00 156.54 ? 57  ASP B CG  1 
ATOM   4911  O OD1 . ASP B 1 57  ? 77.181  -6.076  201.525 1.00 166.19 ? 57  ASP B OD1 1 
ATOM   4912  O OD2 . ASP B 1 57  ? 77.224  -8.143  202.270 1.00 150.33 ? 57  ASP B OD2 1 
ATOM   4913  N N   . PRO B 1 58  ? 81.137  -6.381  200.256 1.00 139.63 ? 58  PRO B N   1 
ATOM   4914  C CA  . PRO B 1 58  ? 82.352  -6.418  201.081 1.00 131.82 ? 58  PRO B CA  1 
ATOM   4915  C C   . PRO B 1 58  ? 82.179  -5.838  202.478 1.00 135.05 ? 58  PRO B C   1 
ATOM   4916  O O   . PRO B 1 58  ? 82.938  -6.194  203.378 1.00 131.27 ? 58  PRO B O   1 
ATOM   4917  C CB  . PRO B 1 58  ? 83.343  -5.576  200.273 1.00 129.90 ? 58  PRO B CB  1 
ATOM   4918  C CG  . PRO B 1 58  ? 82.488  -4.613  199.528 1.00 132.97 ? 58  PRO B CG  1 
ATOM   4919  C CD  . PRO B 1 58  ? 81.172  -5.293  199.262 1.00 140.86 ? 58  PRO B CD  1 
ATOM   4920  N N   . SER B 1 59  ? 81.201  -4.953  202.642 1.00 145.29 ? 59  SER B N   1 
ATOM   4921  C CA  . SER B 1 59  ? 80.924  -4.311  203.926 1.00 145.27 ? 59  SER B CA  1 
ATOM   4922  C C   . SER B 1 59  ? 80.643  -5.295  205.062 1.00 141.95 ? 59  SER B C   1 
ATOM   4923  O O   . SER B 1 59  ? 81.045  -5.063  206.200 1.00 142.27 ? 59  SER B O   1 
ATOM   4924  C CB  . SER B 1 59  ? 79.748  -3.346  203.784 1.00 146.58 ? 59  SER B CB  1 
ATOM   4925  O OG  . SER B 1 59  ? 78.594  -4.016  203.308 1.00 157.09 ? 59  SER B OG  1 
ATOM   4926  N N   . ASN B 1 60  ? 79.950  -6.386  204.752 1.00 145.74 ? 60  ASN B N   1 
ATOM   4927  C CA  . ASN B 1 60  ? 79.576  -7.366  205.765 1.00 152.77 ? 60  ASN B CA  1 
ATOM   4928  C C   . ASN B 1 60  ? 80.247  -8.734  205.592 1.00 152.43 ? 60  ASN B C   1 
ATOM   4929  O O   . ASN B 1 60  ? 79.743  -9.586  204.865 1.00 155.11 ? 60  ASN B O   1 
ATOM   4930  C CB  . ASN B 1 60  ? 78.053  -7.528  205.765 1.00 165.41 ? 60  ASN B CB  1 
ATOM   4931  C CG  . ASN B 1 60  ? 77.574  -8.533  206.785 1.00 182.61 ? 60  ASN B CG  1 
ATOM   4932  O OD1 . ASN B 1 60  ? 77.604  -8.279  207.988 1.00 190.25 ? 60  ASN B OD1 1 
ATOM   4933  N ND2 . ASN B 1 60  ? 77.120  -9.686  206.308 1.00 185.65 ? 60  ASN B ND2 1 
ATOM   4934  N N   . PRO B 1 61  ? 81.386  -8.954  206.275 1.00 144.25 ? 61  PRO B N   1 
ATOM   4935  C CA  . PRO B 1 61  ? 82.053  -10.255 206.188 1.00 130.84 ? 61  PRO B CA  1 
ATOM   4936  C C   . PRO B 1 61  ? 81.492  -11.285 207.167 1.00 132.70 ? 61  PRO B C   1 
ATOM   4937  O O   . PRO B 1 61  ? 81.009  -10.925 208.240 1.00 144.45 ? 61  PRO B O   1 
ATOM   4938  C CB  . PRO B 1 61  ? 83.508  -9.923  206.533 1.00 129.98 ? 61  PRO B CB  1 
ATOM   4939  C CG  . PRO B 1 61  ? 83.512  -8.485  207.065 1.00 135.29 ? 61  PRO B CG  1 
ATOM   4940  C CD  . PRO B 1 61  ? 82.086  -8.052  207.201 1.00 139.51 ? 61  PRO B CD  1 
ATOM   4941  N N   . ILE B 1 62  ? 81.568  -12.556 206.791 1.00 127.36 ? 62  ILE B N   1 
ATOM   4942  C CA  . ILE B 1 62  ? 81.067  -13.645 207.621 1.00 136.48 ? 62  ILE B CA  1 
ATOM   4943  C C   . ILE B 1 62  ? 82.181  -14.377 208.374 1.00 127.06 ? 62  ILE B C   1 
ATOM   4944  O O   . ILE B 1 62  ? 83.058  -14.974 207.756 1.00 123.73 ? 62  ILE B O   1 
ATOM   4945  C CB  . ILE B 1 62  ? 80.286  -14.660 206.775 1.00 154.41 ? 62  ILE B CB  1 
ATOM   4946  C CG1 . ILE B 1 62  ? 79.356  -13.924 205.814 1.00 162.46 ? 62  ILE B CG1 1 
ATOM   4947  C CG2 . ILE B 1 62  ? 79.507  -15.615 207.676 1.00 151.43 ? 62  ILE B CG2 1 
ATOM   4948  C CD1 . ILE B 1 62  ? 79.869  -13.875 204.382 1.00 160.75 ? 62  ILE B CD1 1 
ATOM   4949  N N   . ARG B 1 63  ? 82.125  -14.356 209.703 1.00 128.98 ? 63  ARG B N   1 
ATOM   4950  C CA  . ARG B 1 63  ? 83.106  -15.063 210.517 1.00 131.14 ? 63  ARG B CA  1 
ATOM   4951  C C   . ARG B 1 63  ? 82.541  -16.382 211.051 1.00 144.80 ? 63  ARG B C   1 
ATOM   4952  O O   . ARG B 1 63  ? 81.781  -16.400 212.017 1.00 151.37 ? 63  ARG B O   1 
ATOM   4953  C CB  . ARG B 1 63  ? 83.588  -14.180 211.671 1.00 128.57 ? 63  ARG B CB  1 
ATOM   4954  C CG  . ARG B 1 63  ? 84.436  -12.992 211.249 1.00 131.40 ? 63  ARG B CG  1 
ATOM   4955  C CD  . ARG B 1 63  ? 84.945  -12.233 212.469 1.00 137.95 ? 63  ARG B CD  1 
ATOM   4956  N NE  . ARG B 1 63  ? 85.858  -11.143 212.128 1.00 144.06 ? 63  ARG B NE  1 
ATOM   4957  C CZ  . ARG B 1 63  ? 87.184  -11.230 212.157 1.00 148.20 ? 63  ARG B CZ  1 
ATOM   4958  N NH1 . ARG B 1 63  ? 87.920  -10.177 211.831 1.00 144.97 ? 63  ARG B NH1 1 
ATOM   4959  N NH2 . ARG B 1 63  ? 87.776  -12.360 212.520 1.00 152.75 ? 63  ARG B NH2 1 
ATOM   4960  N N   . ARG B 1 64  ? 82.944  -17.484 210.423 1.00 144.40 ? 64  ARG B N   1 
ATOM   4961  C CA  . ARG B 1 64  ? 82.488  -18.818 210.807 1.00 135.60 ? 64  ARG B CA  1 
ATOM   4962  C C   . ARG B 1 64  ? 83.604  -19.562 211.542 1.00 126.77 ? 64  ARG B C   1 
ATOM   4963  O O   . ARG B 1 64  ? 84.759  -19.516 211.118 1.00 126.59 ? 64  ARG B O   1 
ATOM   4964  C CB  . ARG B 1 64  ? 82.028  -19.604 209.573 1.00 138.04 ? 64  ARG B CB  1 
ATOM   4965  C CG  . ARG B 1 64  ? 80.778  -19.037 208.904 1.00 148.50 ? 64  ARG B CG  1 
ATOM   4966  C CD  . ARG B 1 64  ? 80.696  -19.465 207.447 1.00 152.25 ? 64  ARG B CD  1 
ATOM   4967  N NE  . ARG B 1 64  ? 79.480  -19.000 206.783 1.00 162.54 ? 64  ARG B NE  1 
ATOM   4968  C CZ  . ARG B 1 64  ? 78.360  -19.707 206.676 1.00 164.60 ? 64  ARG B CZ  1 
ATOM   4969  N NH1 . ARG B 1 64  ? 77.312  -19.193 206.048 1.00 170.39 ? 64  ARG B NH1 1 
ATOM   4970  N NH2 . ARG B 1 64  ? 78.286  -20.928 207.191 1.00 154.64 ? 64  ARG B NH2 1 
ATOM   4971  N N   . PRO B 1 65  ? 83.260  -20.274 212.631 1.00 131.71 ? 65  PRO B N   1 
ATOM   4972  C CA  . PRO B 1 65  ? 84.279  -20.971 213.425 1.00 137.07 ? 65  PRO B CA  1 
ATOM   4973  C C   . PRO B 1 65  ? 84.704  -22.305 212.812 1.00 139.27 ? 65  PRO B C   1 
ATOM   4974  O O   . PRO B 1 65  ? 84.068  -23.335 213.018 1.00 138.76 ? 65  PRO B O   1 
ATOM   4975  C CB  . PRO B 1 65  ? 83.583  -21.184 214.774 1.00 144.69 ? 65  PRO B CB  1 
ATOM   4976  C CG  . PRO B 1 65  ? 82.102  -21.134 214.484 1.00 138.01 ? 65  PRO B CG  1 
ATOM   4977  C CD  . PRO B 1 65  ? 81.895  -20.576 213.095 1.00 134.45 ? 65  PRO B CD  1 
ATOM   4978  N N   . ILE B 1 66  ? 85.786  -22.260 212.040 1.00 140.57 ? 66  ILE B N   1 
ATOM   4979  C CA  . ILE B 1 66  ? 86.315  -23.434 211.344 1.00 138.39 ? 66  ILE B CA  1 
ATOM   4980  C C   . ILE B 1 66  ? 87.797  -23.663 211.627 1.00 136.70 ? 66  ILE B C   1 
ATOM   4981  O O   . ILE B 1 66  ? 88.602  -22.737 211.551 1.00 139.72 ? 66  ILE B O   1 
ATOM   4982  C CB  . ILE B 1 66  ? 86.104  -23.325 209.822 1.00 139.80 ? 66  ILE B CB  1 
ATOM   4983  C CG1 . ILE B 1 66  ? 84.617  -23.448 209.486 1.00 138.98 ? 66  ILE B CG1 1 
ATOM   4984  C CG2 . ILE B 1 66  ? 86.867  -24.415 209.088 1.00 141.12 ? 66  ILE B CG2 1 
ATOM   4985  C CD1 . ILE B 1 66  ? 84.224  -22.724 208.220 1.00 143.25 ? 66  ILE B CD1 1 
ATOM   4986  N N   . SER B 1 67  ? 88.141  -24.904 211.957 1.00 135.93 ? 67  SER B N   1 
ATOM   4987  C CA  . SER B 1 67  ? 89.522  -25.293 212.209 1.00 137.75 ? 67  SER B CA  1 
ATOM   4988  C C   . SER B 1 67  ? 90.155  -25.979 210.995 1.00 140.77 ? 67  SER B C   1 
ATOM   4989  O O   . SER B 1 67  ? 89.875  -27.143 210.714 1.00 149.91 ? 67  SER B O   1 
ATOM   4990  C CB  . SER B 1 67  ? 89.591  -26.219 213.420 1.00 139.93 ? 67  SER B CB  1 
ATOM   4991  O OG  . SER B 1 67  ? 90.906  -26.279 213.941 1.00 145.49 ? 67  SER B OG  1 
ATOM   4992  N N   . ALA B 1 68  ? 91.007  -25.251 210.279 1.00 131.95 ? 68  ALA B N   1 
ATOM   4993  C CA  . ALA B 1 68  ? 91.664  -25.785 209.086 1.00 128.74 ? 68  ALA B CA  1 
ATOM   4994  C C   . ALA B 1 68  ? 93.025  -25.134 208.850 1.00 122.63 ? 68  ALA B C   1 
ATOM   4995  O O   . ALA B 1 68  ? 93.214  -23.958 209.148 1.00 121.69 ? 68  ALA B O   1 
ATOM   4996  C CB  . ALA B 1 68  ? 90.774  -25.604 207.870 1.00 135.11 ? 68  ALA B CB  1 
ATOM   4997  N N   . ASP B 1 69  ? 93.976  -25.895 208.319 1.00 121.02 ? 69  ASP B N   1 
ATOM   4998  C CA  . ASP B 1 69  ? 95.292  -25.334 208.017 1.00 111.09 ? 69  ASP B CA  1 
ATOM   4999  C C   . ASP B 1 69  ? 95.296  -24.675 206.650 1.00 112.51 ? 69  ASP B C   1 
ATOM   5000  O O   . ASP B 1 69  ? 96.297  -24.093 206.239 1.00 101.65 ? 69  ASP B O   1 
ATOM   5001  C CB  . ASP B 1 69  ? 96.371  -26.409 208.057 1.00 111.21 ? 69  ASP B CB  1 
ATOM   5002  C CG  . ASP B 1 69  ? 95.911  -27.663 208.752 1.00 133.46 ? 69  ASP B CG  1 
ATOM   5003  O OD1 . ASP B 1 69  ? 96.046  -28.752 208.159 1.00 136.69 ? 69  ASP B OD1 1 
ATOM   5004  O OD2 . ASP B 1 69  ? 95.417  -27.566 209.896 1.00 145.30 ? 69  ASP B OD2 1 
ATOM   5005  N N   . SER B 1 70  ? 94.172  -24.769 205.947 1.00 126.13 ? 70  SER B N   1 
ATOM   5006  C CA  . SER B 1 70  ? 94.038  -24.153 204.632 1.00 113.28 ? 70  SER B CA  1 
ATOM   5007  C C   . SER B 1 70  ? 92.580  -24.095 204.190 1.00 108.14 ? 70  SER B C   1 
ATOM   5008  O O   . SER B 1 70  ? 91.824  -25.041 204.400 1.00 117.64 ? 70  SER B O   1 
ATOM   5009  C CB  . SER B 1 70  ? 94.863  -24.918 203.599 1.00 102.45 ? 70  SER B CB  1 
ATOM   5010  O OG  . SER B 1 70  ? 95.044  -24.138 202.434 1.00 114.50 ? 70  SER B OG  1 
ATOM   5011  N N   . ALA B 1 71  ? 92.186  -22.974 203.594 1.00 91.15  ? 71  ALA B N   1 
ATOM   5012  C CA  . ALA B 1 71  ? 90.809  -22.807 203.136 1.00 99.55  ? 71  ALA B CA  1 
ATOM   5013  C C   . ALA B 1 71  ? 90.727  -22.034 201.822 1.00 97.24  ? 71  ALA B C   1 
ATOM   5014  O O   . ALA B 1 71  ? 91.102  -20.863 201.762 1.00 109.41 ? 71  ALA B O   1 
ATOM   5015  C CB  . ALA B 1 71  ? 89.985  -22.110 204.202 1.00 108.75 ? 71  ALA B CB  1 
ATOM   5016  N N   . ILE B 1 72  ? 90.235  -22.686 200.771 1.00 85.00  ? 72  ILE B N   1 
ATOM   5017  C CA  . ILE B 1 72  ? 90.128  -22.044 199.462 1.00 87.85  ? 72  ILE B CA  1 
ATOM   5018  C C   . ILE B 1 72  ? 88.723  -22.132 198.861 1.00 92.35  ? 72  ILE B C   1 
ATOM   5019  O O   . ILE B 1 72  ? 88.169  -23.218 198.681 1.00 99.39  ? 72  ILE B O   1 
ATOM   5020  C CB  . ILE B 1 72  ? 91.139  -22.628 198.464 1.00 83.27  ? 72  ILE B CB  1 
ATOM   5021  C CG1 . ILE B 1 72  ? 91.120  -24.154 198.498 1.00 96.59  ? 72  ILE B CG1 1 
ATOM   5022  C CG2 . ILE B 1 72  ? 92.539  -22.112 198.766 1.00 82.81  ? 72  ILE B CG2 1 
ATOM   5023  C CD1 . ILE B 1 72  ? 91.709  -24.775 197.257 1.00 108.17 ? 72  ILE B CD1 1 
ATOM   5024  N N   . MET B 1 73  ? 88.157  -20.965 198.570 1.00 82.73  ? 73  MET B N   1 
ATOM   5025  C CA  . MET B 1 73  ? 86.821  -20.849 198.000 1.00 83.74  ? 73  MET B CA  1 
ATOM   5026  C C   . MET B 1 73  ? 86.766  -21.214 196.524 1.00 86.76  ? 73  MET B C   1 
ATOM   5027  O O   . MET B 1 73  ? 87.762  -21.111 195.813 1.00 102.13 ? 73  MET B O   1 
ATOM   5028  C CB  . MET B 1 73  ? 86.311  -19.413 198.165 1.00 102.08 ? 73  MET B CB  1 
ATOM   5029  C CG  . MET B 1 73  ? 84.814  -19.273 198.409 1.00 130.24 ? 73  MET B CG  1 
ATOM   5030  S SD  . MET B 1 73  ? 84.316  -19.967 199.992 1.00 104.77 ? 73  MET B SD  1 
ATOM   5031  C CE  . MET B 1 73  ? 85.470  -19.111 201.061 1.00 125.53 ? 73  MET B CE  1 
ATOM   5032  N N   . ASN B 1 74  ? 85.580  -21.596 196.062 1.00 96.58  ? 74  ASN B N   1 
ATOM   5033  C CA  . ASN B 1 74  ? 85.354  -21.860 194.643 1.00 95.35  ? 74  ASN B CA  1 
ATOM   5034  C C   . ASN B 1 74  ? 85.396  -20.546 193.875 1.00 89.53  ? 74  ASN B C   1 
ATOM   5035  O O   . ASN B 1 74  ? 84.992  -19.516 194.410 1.00 93.20  ? 74  ASN B O   1 
ATOM   5036  C CB  . ASN B 1 74  ? 84.007  -22.565 194.441 1.00 100.39 ? 74  ASN B CB  1 
ATOM   5037  C CG  . ASN B 1 74  ? 83.812  -23.066 193.024 1.00 96.13  ? 74  ASN B CG  1 
ATOM   5038  O OD1 . ASN B 1 74  ? 83.414  -22.311 192.137 1.00 89.10  ? 74  ASN B OD1 1 
ATOM   5039  N ND2 . ASN B 1 74  ? 84.112  -24.336 192.797 1.00 104.30 ? 74  ASN B ND2 1 
ATOM   5040  N N   . PRO B 1 75  ? 85.889  -20.569 192.622 1.00 89.17  ? 75  PRO B N   1 
ATOM   5041  C CA  . PRO B 1 75  ? 85.956  -19.317 191.855 1.00 86.84  ? 75  PRO B CA  1 
ATOM   5042  C C   . PRO B 1 75  ? 84.618  -18.591 191.641 1.00 94.05  ? 75  PRO B C   1 
ATOM   5043  O O   . PRO B 1 75  ? 84.634  -17.437 191.205 1.00 105.23 ? 75  PRO B O   1 
ATOM   5044  C CB  . PRO B 1 75  ? 86.546  -19.761 190.507 1.00 82.30  ? 75  PRO B CB  1 
ATOM   5045  C CG  . PRO B 1 75  ? 86.413  -21.244 190.463 1.00 83.49  ? 75  PRO B CG  1 
ATOM   5046  C CD  . PRO B 1 75  ? 86.461  -21.706 191.880 1.00 93.48  ? 75  PRO B CD  1 
ATOM   5047  N N   . ALA B 1 76  ? 83.489  -19.234 191.926 1.00 88.76  ? 76  ALA B N   1 
ATOM   5048  C CA  . ALA B 1 76  ? 82.203  -18.551 191.816 1.00 98.69  ? 76  ALA B CA  1 
ATOM   5049  C C   . ALA B 1 76  ? 81.220  -18.995 192.896 1.00 107.68 ? 76  ALA B C   1 
ATOM   5050  O O   . ALA B 1 76  ? 80.628  -18.169 193.590 1.00 115.25 ? 76  ALA B O   1 
ATOM   5051  C CB  . ALA B 1 76  ? 81.599  -18.761 190.440 1.00 105.62 ? 76  ALA B CB  1 
ATOM   5052  N N   . SER B 1 77  ? 81.046  -20.305 193.021 1.00 107.40 ? 77  SER B N   1 
ATOM   5053  C CA  . SER B 1 77  ? 80.091  -20.870 193.966 1.00 104.45 ? 77  SER B CA  1 
ATOM   5054  C C   . SER B 1 77  ? 80.430  -20.573 195.422 1.00 108.51 ? 77  SER B C   1 
ATOM   5055  O O   . SER B 1 77  ? 81.580  -20.298 195.767 1.00 119.85 ? 77  SER B O   1 
ATOM   5056  C CB  . SER B 1 77  ? 79.990  -22.382 193.758 1.00 94.99  ? 77  SER B CB  1 
ATOM   5057  O OG  . SER B 1 77  ? 79.908  -22.693 192.378 1.00 99.05  ? 77  SER B OG  1 
ATOM   5058  N N   . LYS B 1 78  ? 79.411  -20.621 196.274 1.00 99.90  ? 78  LYS B N   1 
ATOM   5059  C CA  . LYS B 1 78  ? 79.608  -20.441 197.706 1.00 98.48  ? 78  LYS B CA  1 
ATOM   5060  C C   . LYS B 1 78  ? 80.022  -21.785 198.288 1.00 98.26  ? 78  LYS B C   1 
ATOM   5061  O O   . LYS B 1 78  ? 79.424  -22.287 199.237 1.00 116.10 ? 78  LYS B O   1 
ATOM   5062  C CB  . LYS B 1 78  ? 78.343  -19.909 198.384 1.00 117.89 ? 78  LYS B CB  1 
ATOM   5063  C CG  . LYS B 1 78  ? 77.969  -18.497 197.961 1.00 128.64 ? 78  LYS B CG  1 
ATOM   5064  C CD  . LYS B 1 78  ? 78.340  -17.483 199.032 1.00 127.83 ? 78  LYS B CD  1 
ATOM   5065  C CE  . LYS B 1 78  ? 77.787  -16.102 198.711 1.00 131.18 ? 78  LYS B CE  1 
ATOM   5066  N NZ  . LYS B 1 78  ? 76.336  -15.976 199.013 1.00 135.47 ? 78  LYS B NZ  1 
ATOM   5067  N N   . VAL B 1 79  ? 81.057  -22.361 197.686 1.00 99.34  ? 79  VAL B N   1 
ATOM   5068  C CA  . VAL B 1 79  ? 81.594  -23.658 198.071 1.00 98.24  ? 79  VAL B CA  1 
ATOM   5069  C C   . VAL B 1 79  ? 83.038  -23.494 198.513 1.00 91.97  ? 79  VAL B C   1 
ATOM   5070  O O   . VAL B 1 79  ? 83.836  -22.877 197.814 1.00 91.66  ? 79  VAL B O   1 
ATOM   5071  C CB  . VAL B 1 79  ? 81.526  -24.667 196.909 1.00 94.74  ? 79  VAL B CB  1 
ATOM   5072  C CG1 . VAL B 1 79  ? 82.352  -25.901 197.225 1.00 93.75  ? 79  VAL B CG1 1 
ATOM   5073  C CG2 . VAL B 1 79  ? 80.082  -25.031 196.603 1.00 98.59  ? 79  VAL B CG2 1 
ATOM   5074  N N   . ILE B 1 80  ? 83.377  -24.046 199.672 1.00 90.22  ? 80  ILE B N   1 
ATOM   5075  C CA  . ILE B 1 80  ? 84.738  -23.933 200.181 1.00 91.76  ? 80  ILE B CA  1 
ATOM   5076  C C   . ILE B 1 80  ? 85.435  -25.291 200.275 1.00 98.00  ? 80  ILE B C   1 
ATOM   5077  O O   . ILE B 1 80  ? 84.789  -26.326 200.430 1.00 108.68 ? 80  ILE B O   1 
ATOM   5078  C CB  . ILE B 1 80  ? 84.765  -23.264 201.567 1.00 91.05  ? 80  ILE B CB  1 
ATOM   5079  C CG1 . ILE B 1 80  ? 86.166  -22.750 201.896 1.00 90.74  ? 80  ILE B CG1 1 
ATOM   5080  C CG2 . ILE B 1 80  ? 84.253  -24.214 202.640 1.00 92.64  ? 80  ILE B CG2 1 
ATOM   5081  C CD1 . ILE B 1 80  ? 86.219  -21.946 203.159 1.00 97.36  ? 80  ILE B CD1 1 
ATOM   5082  N N   . ALA B 1 81  ? 86.758  -25.280 200.150 1.00 89.87  ? 81  ALA B N   1 
ATOM   5083  C CA  . ALA B 1 81  ? 87.565  -26.481 200.330 1.00 88.67  ? 81  ALA B CA  1 
ATOM   5084  C C   . ALA B 1 81  ? 88.547  -26.266 201.480 1.00 92.76  ? 81  ALA B C   1 
ATOM   5085  O O   . ALA B 1 81  ? 89.334  -25.321 201.451 1.00 106.77 ? 81  ALA B O   1 
ATOM   5086  C CB  . ALA B 1 81  ? 88.299  -26.831 199.047 1.00 87.31  ? 81  ALA B CB  1 
ATOM   5087  N N   . LEU B 1 82  ? 88.524  -27.151 202.474 1.00 90.84  ? 82  LEU B N   1 
ATOM   5088  C CA  . LEU B 1 82  ? 89.375  -26.982 203.649 1.00 91.71  ? 82  LEU B CA  1 
ATOM   5089  C C   . LEU B 1 82  ? 90.275  -28.177 203.933 1.00 95.37  ? 82  LEU B C   1 
ATOM   5090  O O   . LEU B 1 82  ? 89.887  -29.329 203.766 1.00 95.71  ? 82  LEU B O   1 
ATOM   5091  C CB  . LEU B 1 82  ? 88.533  -26.700 204.894 1.00 93.93  ? 82  LEU B CB  1 
ATOM   5092  C CG  . LEU B 1 82  ? 87.081  -26.281 204.721 1.00 104.94 ? 82  LEU B CG  1 
ATOM   5093  C CD1 . LEU B 1 82  ? 86.191  -27.282 205.430 1.00 122.02 ? 82  LEU B CD1 1 
ATOM   5094  C CD2 . LEU B 1 82  ? 86.869  -24.889 205.281 1.00 99.60  ? 82  LEU B CD2 1 
ATOM   5095  N N   . LYS B 1 83  ? 91.491  -27.871 204.367 1.00 95.51  ? 83  LYS B N   1 
ATOM   5096  C CA  . LYS B 1 83  ? 92.496  -28.877 204.676 1.00 101.21 ? 83  LYS B CA  1 
ATOM   5097  C C   . LYS B 1 83  ? 92.715  -29.021 206.177 1.00 100.67 ? 83  LYS B C   1 
ATOM   5098  O O   . LYS B 1 83  ? 92.861  -28.025 206.884 1.00 100.87 ? 83  LYS B O   1 
ATOM   5099  C CB  . LYS B 1 83  ? 93.817  -28.512 203.996 1.00 110.77 ? 83  LYS B CB  1 
ATOM   5100  C CG  . LYS B 1 83  ? 94.943  -29.522 204.208 1.00 120.94 ? 83  LYS B CG  1 
ATOM   5101  C CD  . LYS B 1 83  ? 96.280  -28.991 203.693 1.00 136.84 ? 83  LYS B CD  1 
ATOM   5102  C CE  . LYS B 1 83  ? 97.462  -29.768 204.273 1.00 142.98 ? 83  LYS B CE  1 
ATOM   5103  N NZ  . LYS B 1 83  ? 97.758  -29.414 205.691 1.00 132.40 ? 83  LYS B NZ  1 
ATOM   5104  N N   . ALA B 1 84  ? 92.706  -30.252 206.673 1.00 107.09 ? 84  ALA B N   1 
ATOM   5105  C CA  . ALA B 1 84  ? 93.023  -30.463 208.076 1.00 119.00 ? 84  ALA B CA  1 
ATOM   5106  C C   . ALA B 1 84  ? 93.996  -31.629 208.123 1.00 123.41 ? 84  ALA B C   1 
ATOM   5107  O O   . ALA B 1 84  ? 93.597  -32.794 208.166 1.00 123.38 ? 84  ALA B O   1 
ATOM   5108  C CB  . ALA B 1 84  ? 91.775  -30.741 208.906 1.00 128.85 ? 84  ALA B CB  1 
ATOM   5109  N N   . GLY B 1 85  ? 95.282  -31.299 208.170 1.00 120.78 ? 85  GLY B N   1 
ATOM   5110  C CA  . GLY B 1 85  ? 96.328  -32.301 208.212 1.00 116.38 ? 85  GLY B CA  1 
ATOM   5111  C C   . GLY B 1 85  ? 96.467  -32.962 206.853 1.00 121.33 ? 85  GLY B C   1 
ATOM   5112  O O   . GLY B 1 85  ? 96.884  -32.331 205.886 1.00 110.86 ? 85  GLY B O   1 
ATOM   5113  N N   . LYS B 1 86  ? 96.120  -34.241 206.783 1.00 125.44 ? 86  LYS B N   1 
ATOM   5114  C CA  . LYS B 1 86  ? 96.147  -34.982 205.526 1.00 116.07 ? 86  LYS B CA  1 
ATOM   5115  C C   . LYS B 1 86  ? 94.715  -35.206 205.079 1.00 134.70 ? 86  LYS B C   1 
ATOM   5116  O O   . LYS B 1 86  ? 94.449  -35.902 204.101 1.00 149.40 ? 86  LYS B O   1 
ATOM   5117  C CB  . LYS B 1 86  ? 96.855  -36.320 205.693 1.00 110.61 ? 86  LYS B CB  1 
ATOM   5118  C CG  . LYS B 1 86  ? 98.366  -36.256 205.809 1.00 114.29 ? 86  LYS B CG  1 
ATOM   5119  C CD  . LYS B 1 86  ? 98.923  -37.638 206.090 1.00 122.64 ? 86  LYS B CD  1 
ATOM   5120  C CE  . LYS B 1 86  ? 100.419 -37.622 206.341 1.00 130.61 ? 86  LYS B CE  1 
ATOM   5121  N NZ  . LYS B 1 86  ? 101.197 -37.266 205.129 1.00 147.06 ? 86  LYS B NZ  1 
ATOM   5122  N N   . THR B 1 87  ? 93.794  -34.584 205.805 1.00 134.45 ? 87  THR B N   1 
ATOM   5123  C CA  . THR B 1 87  ? 92.365  -34.738 205.547 1.00 117.77 ? 87  THR B CA  1 
ATOM   5124  C C   . THR B 1 87  ? 91.740  -33.545 204.827 1.00 112.02 ? 87  THR B C   1 
ATOM   5125  O O   . THR B 1 87  ? 91.710  -32.427 205.343 1.00 120.03 ? 87  THR B O   1 
ATOM   5126  C CB  . THR B 1 87  ? 91.615  -34.981 206.850 1.00 110.21 ? 87  THR B CB  1 
ATOM   5127  O OG1 . THR B 1 87  ? 92.281  -36.011 207.594 1.00 110.40 ? 87  THR B OG1 1 
ATOM   5128  C CG2 . THR B 1 87  ? 90.190  -35.401 206.562 1.00 114.76 ? 87  THR B CG2 1 
ATOM   5129  N N   . LEU B 1 88  ? 91.251  -33.811 203.622 1.00 101.29 ? 88  LEU B N   1 
ATOM   5130  C CA  . LEU B 1 88  ? 90.651  -32.801 202.758 1.00 100.48 ? 88  LEU B CA  1 
ATOM   5131  C C   . LEU B 1 88  ? 89.121  -32.866 202.762 1.00 113.48 ? 88  LEU B C   1 
ATOM   5132  O O   . LEU B 1 88  ? 88.542  -33.933 202.970 1.00 126.10 ? 88  LEU B O   1 
ATOM   5133  C CB  . LEU B 1 88  ? 91.172  -32.977 201.336 1.00 101.63 ? 88  LEU B CB  1 
ATOM   5134  C CG  . LEU B 1 88  ? 92.554  -32.404 201.019 1.00 102.50 ? 88  LEU B CG  1 
ATOM   5135  C CD1 . LEU B 1 88  ? 93.680  -33.199 201.666 1.00 101.86 ? 88  LEU B CD1 1 
ATOM   5136  C CD2 . LEU B 1 88  ? 92.744  -32.370 199.529 1.00 104.56 ? 88  LEU B CD2 1 
ATOM   5137  N N   . GLN B 1 89  ? 88.465  -31.729 202.540 1.00 109.30 ? 89  GLN B N   1 
ATOM   5138  C CA  . GLN B 1 89  ? 87.004  -31.693 202.572 1.00 103.76 ? 89  GLN B CA  1 
ATOM   5139  C C   . GLN B 1 89  ? 86.387  -30.551 201.758 1.00 105.49 ? 89  GLN B C   1 
ATOM   5140  O O   . GLN B 1 89  ? 86.632  -29.377 202.032 1.00 117.43 ? 89  GLN B O   1 
ATOM   5141  C CB  . GLN B 1 89  ? 86.533  -31.612 204.025 1.00 111.45 ? 89  GLN B CB  1 
ATOM   5142  C CG  . GLN B 1 89  ? 85.054  -31.314 204.210 1.00 126.84 ? 89  GLN B CG  1 
ATOM   5143  C CD  . GLN B 1 89  ? 84.737  -30.815 205.608 1.00 128.77 ? 89  GLN B CD  1 
ATOM   5144  O OE1 . GLN B 1 89  ? 83.838  -29.997 205.800 1.00 135.30 ? 89  GLN B OE1 1 
ATOM   5145  N NE2 . GLN B 1 89  ? 85.481  -31.307 206.594 1.00 120.28 ? 89  GLN B NE2 1 
ATOM   5146  N N   . ILE B 1 90  ? 85.584  -30.906 200.757 1.00 104.13 ? 90  ILE B N   1 
ATOM   5147  C CA  . ILE B 1 90  ? 84.830  -29.912 199.995 1.00 114.21 ? 90  ILE B CA  1 
ATOM   5148  C C   . ILE B 1 90  ? 83.484  -29.689 200.682 1.00 119.12 ? 90  ILE B C   1 
ATOM   5149  O O   . ILE B 1 90  ? 82.657  -30.594 200.761 1.00 132.15 ? 90  ILE B O   1 
ATOM   5150  C CB  . ILE B 1 90  ? 84.617  -30.338 198.536 1.00 116.97 ? 90  ILE B CB  1 
ATOM   5151  C CG1 . ILE B 1 90  ? 85.964  -30.503 197.833 1.00 103.44 ? 90  ILE B CG1 1 
ATOM   5152  C CG2 . ILE B 1 90  ? 83.757  -29.321 197.805 1.00 127.28 ? 90  ILE B CG2 1 
ATOM   5153  C CD1 . ILE B 1 90  ? 85.886  -31.307 196.557 1.00 105.90 ? 90  ILE B CD1 1 
ATOM   5154  N N   . PHE B 1 91  ? 83.269  -28.466 201.150 1.00 110.92 ? 91  PHE B N   1 
ATOM   5155  C CA  . PHE B 1 91  ? 82.130  -28.141 202.000 1.00 112.89 ? 91  PHE B CA  1 
ATOM   5156  C C   . PHE B 1 91  ? 81.220  -27.057 201.412 1.00 118.70 ? 91  PHE B C   1 
ATOM   5157  O O   . PHE B 1 91  ? 81.701  -26.058 200.875 1.00 115.32 ? 91  PHE B O   1 
ATOM   5158  C CB  . PHE B 1 91  ? 82.678  -27.725 203.371 1.00 114.41 ? 91  PHE B CB  1 
ATOM   5159  C CG  . PHE B 1 91  ? 81.637  -27.323 204.367 1.00 130.59 ? 91  PHE B CG  1 
ATOM   5160  C CD1 . PHE B 1 91  ? 80.933  -28.278 205.080 1.00 136.82 ? 91  PHE B CD1 1 
ATOM   5161  C CD2 . PHE B 1 91  ? 81.420  -25.986 204.652 1.00 135.62 ? 91  PHE B CD2 1 
ATOM   5162  C CE1 . PHE B 1 91  ? 79.991  -27.905 206.018 1.00 140.49 ? 91  PHE B CE1 1 
ATOM   5163  C CE2 . PHE B 1 91  ? 80.485  -25.604 205.591 1.00 138.02 ? 91  PHE B CE2 1 
ATOM   5164  C CZ  . PHE B 1 91  ? 79.769  -26.566 206.276 1.00 142.65 ? 91  PHE B CZ  1 
ATOM   5165  N N   . ASN B 1 92  ? 79.906  -27.261 201.506 1.00 137.89 ? 92  ASN B N   1 
ATOM   5166  C CA  . ASN B 1 92  ? 78.942  -26.272 201.018 1.00 137.51 ? 92  ASN B CA  1 
ATOM   5167  C C   . ASN B 1 92  ? 78.610  -25.250 202.095 1.00 132.35 ? 92  ASN B C   1 
ATOM   5168  O O   . ASN B 1 92  ? 77.981  -25.568 203.103 1.00 126.20 ? 92  ASN B O   1 
ATOM   5169  C CB  . ASN B 1 92  ? 77.660  -26.947 200.534 1.00 134.22 ? 92  ASN B CB  1 
ATOM   5170  C CG  . ASN B 1 92  ? 76.880  -26.083 199.559 1.00 140.58 ? 92  ASN B CG  1 
ATOM   5171  O OD1 . ASN B 1 92  ? 76.411  -24.999 199.907 1.00 138.94 ? 92  ASN B OD1 1 
ATOM   5172  N ND2 . ASN B 1 92  ? 76.749  -26.556 198.326 1.00 145.24 ? 92  ASN B ND2 1 
ATOM   5173  N N   . ILE B 1 93  ? 79.031  -24.013 201.867 1.00 135.52 ? 93  ILE B N   1 
ATOM   5174  C CA  . ILE B 1 93  ? 78.850  -22.949 202.846 1.00 136.48 ? 93  ILE B CA  1 
ATOM   5175  C C   . ILE B 1 93  ? 77.379  -22.630 203.100 1.00 139.35 ? 93  ILE B C   1 
ATOM   5176  O O   . ILE B 1 93  ? 76.942  -22.571 204.249 1.00 134.84 ? 93  ILE B O   1 
ATOM   5177  C CB  . ILE B 1 93  ? 79.577  -21.662 202.411 1.00 131.85 ? 93  ILE B CB  1 
ATOM   5178  C CG1 . ILE B 1 93  ? 81.085  -21.845 202.566 1.00 122.14 ? 93  ILE B CG1 1 
ATOM   5179  C CG2 . ILE B 1 93  ? 79.068  -20.462 203.198 1.00 143.34 ? 93  ILE B CG2 1 
ATOM   5180  C CD1 . ILE B 1 93  ? 81.532  -21.956 204.003 1.00 126.27 ? 93  ILE B CD1 1 
ATOM   5181  N N   . GLU B 1 94  ? 76.629  -22.408 202.025 1.00 141.78 ? 94  GLU B N   1 
ATOM   5182  C CA  . GLU B 1 94  ? 75.214  -22.054 202.117 1.00 141.16 ? 94  GLU B CA  1 
ATOM   5183  C C   . GLU B 1 94  ? 74.358  -23.138 202.766 1.00 144.14 ? 94  GLU B C   1 
ATOM   5184  O O   . GLU B 1 94  ? 73.456  -22.839 203.550 1.00 147.80 ? 94  GLU B O   1 
ATOM   5185  C CB  . GLU B 1 94  ? 74.655  -21.733 200.727 1.00 140.41 ? 94  GLU B CB  1 
ATOM   5186  C CG  . GLU B 1 94  ? 73.736  -20.517 200.681 1.00 147.56 ? 94  GLU B CG  1 
ATOM   5187  C CD  . GLU B 1 94  ? 74.470  -19.205 200.892 1.00 166.19 ? 94  GLU B CD  1 
ATOM   5188  O OE1 . GLU B 1 94  ? 74.243  -18.544 201.928 1.00 177.07 ? 94  GLU B OE1 1 
ATOM   5189  O OE2 . GLU B 1 94  ? 75.254  -18.818 200.002 1.00 175.67 ? 94  GLU B OE2 1 
ATOM   5190  N N   . MET B 1 95  ? 74.633  -24.392 202.420 1.00 144.79 ? 95  MET B N   1 
ATOM   5191  C CA  . MET B 1 95  ? 73.854  -25.522 202.919 1.00 137.12 ? 95  MET B CA  1 
ATOM   5192  C C   . MET B 1 95  ? 74.421  -26.130 204.197 1.00 138.20 ? 95  MET B C   1 
ATOM   5193  O O   . MET B 1 95  ? 73.876  -27.108 204.710 1.00 139.22 ? 95  MET B O   1 
ATOM   5194  C CB  . MET B 1 95  ? 73.760  -26.615 201.854 1.00 137.18 ? 95  MET B CB  1 
ATOM   5195  C CG  . MET B 1 95  ? 73.211  -26.155 200.514 1.00 140.10 ? 95  MET B CG  1 
ATOM   5196  S SD  . MET B 1 95  ? 71.496  -25.603 200.579 1.00 225.34 ? 95  MET B SD  1 
ATOM   5197  C CE  . MET B 1 95  ? 71.674  -23.853 200.237 1.00 190.41 ? 95  MET B CE  1 
ATOM   5198  N N   . LYS B 1 96  ? 75.496  -25.532 204.713 1.00 144.64 ? 96  LYS B N   1 
ATOM   5199  C CA  . LYS B 1 96  ? 76.234  -26.027 205.886 1.00 141.60 ? 96  LYS B CA  1 
ATOM   5200  C C   . LYS B 1 96  ? 76.386  -27.552 205.905 1.00 141.59 ? 96  LYS B C   1 
ATOM   5201  O O   . LYS B 1 96  ? 76.278  -28.187 206.952 1.00 149.46 ? 96  LYS B O   1 
ATOM   5202  C CB  . LYS B 1 96  ? 75.588  -25.541 207.199 1.00 142.39 ? 96  LYS B CB  1 
ATOM   5203  C CG  . LYS B 1 96  ? 74.060  -25.469 207.249 1.00 162.24 ? 96  LYS B CG  1 
ATOM   5204  C CD  . LYS B 1 96  ? 73.449  -26.633 208.008 1.00 171.16 ? 96  LYS B CD  1 
ATOM   5205  C CE  . LYS B 1 96  ? 71.952  -26.432 208.194 1.00 168.95 ? 96  LYS B CE  1 
ATOM   5206  N NZ  . LYS B 1 96  ? 71.230  -26.426 206.893 1.00 169.74 ? 96  LYS B NZ  1 
ATOM   5207  N N   . SER B 1 97  ? 76.621  -28.129 204.731 1.00 137.88 ? 97  SER B N   1 
ATOM   5208  C CA  . SER B 1 97  ? 76.757  -29.575 204.588 1.00 137.84 ? 97  SER B CA  1 
ATOM   5209  C C   . SER B 1 97  ? 78.022  -29.947 203.810 1.00 141.72 ? 97  SER B C   1 
ATOM   5210  O O   . SER B 1 97  ? 78.453  -29.205 202.927 1.00 134.26 ? 97  SER B O   1 
ATOM   5211  C CB  . SER B 1 97  ? 75.522  -30.153 203.901 1.00 129.88 ? 97  SER B CB  1 
ATOM   5212  O OG  . SER B 1 97  ? 75.375  -29.624 202.596 1.00 132.39 ? 97  SER B OG  1 
ATOM   5213  N N   . LYS B 1 98  ? 78.624  -31.083 204.155 1.00 139.40 ? 98  LYS B N   1 
ATOM   5214  C CA  . LYS B 1 98  ? 79.830  -31.554 203.473 1.00 131.78 ? 98  LYS B CA  1 
ATOM   5215  C C   . LYS B 1 98  ? 79.512  -32.213 202.133 1.00 122.19 ? 98  LYS B C   1 
ATOM   5216  O O   . LYS B 1 98  ? 78.674  -33.113 202.059 1.00 118.55 ? 98  LYS B O   1 
ATOM   5217  C CB  . LYS B 1 98  ? 80.606  -32.542 204.347 1.00 136.44 ? 98  LYS B CB  1 
ATOM   5218  C CG  . LYS B 1 98  ? 80.983  -32.023 205.721 1.00 143.29 ? 98  LYS B CG  1 
ATOM   5219  C CD  . LYS B 1 98  ? 79.936  -32.429 206.740 1.00 152.37 ? 98  LYS B CD  1 
ATOM   5220  C CE  . LYS B 1 98  ? 79.250  -31.218 207.336 1.00 148.74 ? 98  LYS B CE  1 
ATOM   5221  N NZ  . LYS B 1 98  ? 77.978  -31.592 208.010 1.00 135.68 ? 98  LYS B NZ  1 
ATOM   5222  N N   . MET B 1 99  ? 80.187  -31.761 201.079 1.00 118.65 ? 99  MET B N   1 
ATOM   5223  C CA  . MET B 1 99  ? 79.987  -32.310 199.739 1.00 116.09 ? 99  MET B CA  1 
ATOM   5224  C C   . MET B 1 99  ? 80.863  -33.529 199.474 1.00 108.11 ? 99  MET B C   1 
ATOM   5225  O O   . MET B 1 99  ? 80.356  -34.619 199.209 1.00 109.51 ? 99  MET B O   1 
ATOM   5226  C CB  . MET B 1 99  ? 80.268  -31.245 198.677 1.00 114.70 ? 99  MET B CB  1 
ATOM   5227  C CG  . MET B 1 99  ? 79.371  -30.028 198.769 1.00 124.69 ? 99  MET B CG  1 
ATOM   5228  S SD  . MET B 1 99  ? 79.978  -28.629 197.811 1.00 111.28 ? 99  MET B SD  1 
ATOM   5229  C CE  . MET B 1 99  ? 79.545  -29.134 196.145 1.00 109.67 ? 99  MET B CE  1 
ATOM   5230  N N   . LYS B 1 100 ? 82.177  -33.339 199.541 1.00 106.05 ? 100 LYS B N   1 
ATOM   5231  C CA  . LYS B 1 100 ? 83.125  -34.426 199.313 1.00 102.92 ? 100 LYS B CA  1 
ATOM   5232  C C   . LYS B 1 100 ? 84.175  -34.468 200.415 1.00 100.76 ? 100 LYS B C   1 
ATOM   5233  O O   . LYS B 1 100 ? 84.275  -33.542 201.220 1.00 110.51 ? 100 LYS B O   1 
ATOM   5234  C CB  . LYS B 1 100 ? 83.803  -34.279 197.951 1.00 99.16  ? 100 LYS B CB  1 
ATOM   5235  C CG  . LYS B 1 100 ? 82.942  -34.692 196.772 1.00 100.90 ? 100 LYS B CG  1 
ATOM   5236  C CD  . LYS B 1 100 ? 83.740  -34.603 195.481 1.00 106.55 ? 100 LYS B CD  1 
ATOM   5237  C CE  . LYS B 1 100 ? 83.930  -35.963 194.829 1.00 116.38 ? 100 LYS B CE  1 
ATOM   5238  N NZ  . LYS B 1 100 ? 84.813  -36.863 195.622 1.00 122.92 ? 100 LYS B NZ  1 
ATOM   5239  N N   . ALA B 1 101 ? 84.950  -35.546 200.458 1.00 97.96  ? 101 ALA B N   1 
ATOM   5240  C CA  . ALA B 1 101 ? 86.018  -35.665 201.444 1.00 97.16  ? 101 ALA B CA  1 
ATOM   5241  C C   . ALA B 1 101 ? 87.076  -36.671 201.010 1.00 108.90 ? 101 ALA B C   1 
ATOM   5242  O O   . ALA B 1 101 ? 86.775  -37.645 200.326 1.00 116.02 ? 101 ALA B O   1 
ATOM   5243  C CB  . ALA B 1 101 ? 85.442  -36.057 202.797 1.00 99.29  ? 101 ALA B CB  1 
ATOM   5244  N N   . HIS B 1 102 ? 88.317  -36.431 201.419 1.00 113.00 ? 102 HIS B N   1 
ATOM   5245  C CA  . HIS B 1 102 ? 89.412  -37.339 201.107 1.00 101.95 ? 102 HIS B CA  1 
ATOM   5246  C C   . HIS B 1 102 ? 90.585  -37.204 202.070 1.00 100.27 ? 102 HIS B C   1 
ATOM   5247  O O   . HIS B 1 102 ? 90.973  -36.098 202.445 1.00 97.21  ? 102 HIS B O   1 
ATOM   5248  C CB  . HIS B 1 102 ? 89.905  -37.121 199.677 1.00 95.87  ? 102 HIS B CB  1 
ATOM   5249  C CG  . HIS B 1 102 ? 90.767  -38.234 199.162 1.00 98.35  ? 102 HIS B CG  1 
ATOM   5250  N ND1 . HIS B 1 102 ? 92.138  -38.158 199.125 1.00 101.78 ? 102 HIS B ND1 1 
ATOM   5251  C CD2 . HIS B 1 102 ? 90.445  -39.460 198.677 1.00 100.94 ? 102 HIS B CD2 1 
ATOM   5252  C CE1 . HIS B 1 102 ? 92.634  -39.283 198.633 1.00 105.38 ? 102 HIS B CE1 1 
ATOM   5253  N NE2 . HIS B 1 102 ? 91.623  -40.086 198.351 1.00 100.80 ? 102 HIS B NE2 1 
ATOM   5254  N N   . THR B 1 103 ? 91.136  -38.345 202.470 1.00 103.62 ? 103 THR B N   1 
ATOM   5255  C CA  . THR B 1 103 ? 92.326  -38.380 203.313 1.00 102.61 ? 103 THR B CA  1 
ATOM   5256  C C   . THR B 1 103 ? 93.514  -38.858 202.482 1.00 108.45 ? 103 THR B C   1 
ATOM   5257  O O   . THR B 1 103 ? 93.504  -39.977 201.970 1.00 104.09 ? 103 THR B O   1 
ATOM   5258  C CB  . THR B 1 103 ? 92.149  -39.308 204.514 1.00 105.76 ? 103 THR B CB  1 
ATOM   5259  O OG1 . THR B 1 103 ? 91.068  -38.848 205.335 1.00 106.04 ? 103 THR B OG1 1 
ATOM   5260  C CG2 . THR B 1 103 ? 93.427  -39.353 205.334 1.00 118.41 ? 103 THR B CG2 1 
ATOM   5261  N N   . MET B 1 104 ? 94.539  -38.018 202.371 1.00 121.56 ? 104 MET B N   1 
ATOM   5262  C CA  . MET B 1 104 ? 95.703  -38.301 201.532 1.00 122.12 ? 104 MET B CA  1 
ATOM   5263  C C   . MET B 1 104 ? 96.840  -39.036 202.231 1.00 124.99 ? 104 MET B C   1 
ATOM   5264  O O   . MET B 1 104 ? 97.118  -38.809 203.408 1.00 116.67 ? 104 MET B O   1 
ATOM   5265  C CB  . MET B 1 104 ? 96.255  -37.002 200.947 1.00 110.94 ? 104 MET B CB  1 
ATOM   5266  C CG  . MET B 1 104 ? 95.347  -36.340 199.927 1.00 99.86  ? 104 MET B CG  1 
ATOM   5267  S SD  . MET B 1 104 ? 95.983  -36.456 198.242 1.00 116.60 ? 104 MET B SD  1 
ATOM   5268  C CE  . MET B 1 104 ? 95.949  -38.224 197.969 1.00 101.19 ? 104 MET B CE  1 
ATOM   5269  N N   . THR B 1 105 ? 97.493  -39.921 201.483 1.00 130.98 ? 105 THR B N   1 
ATOM   5270  C CA  . THR B 1 105 ? 98.632  -40.676 201.997 1.00 133.24 ? 105 THR B CA  1 
ATOM   5271  C C   . THR B 1 105 ? 99.793  -39.745 202.333 1.00 127.09 ? 105 THR B C   1 
ATOM   5272  O O   . THR B 1 105 ? 100.190 -39.627 203.491 1.00 125.93 ? 105 THR B O   1 
ATOM   5273  C CB  . THR B 1 105 ? 99.107  -41.734 200.990 1.00 130.01 ? 105 THR B CB  1 
ATOM   5274  O OG1 . THR B 1 105 ? 98.986  -41.216 199.658 1.00 129.62 ? 105 THR B OG1 1 
ATOM   5275  C CG2 . THR B 1 105 ? 98.260  -42.988 201.118 1.00 127.72 ? 105 THR B CG2 1 
ATOM   5276  N N   . ASP B 1 106 ? 100.362 -39.107 201.317 1.00 121.72 ? 106 ASP B N   1 
ATOM   5277  C CA  . ASP B 1 106 ? 101.400 -38.104 201.552 1.00 122.70 ? 106 ASP B CA  1 
ATOM   5278  C C   . ASP B 1 106 ? 100.800 -36.699 201.493 1.00 107.29 ? 106 ASP B C   1 
ATOM   5279  O O   . ASP B 1 106 ? 99.936  -36.405 200.664 1.00 96.64  ? 106 ASP B O   1 
ATOM   5280  C CB  . ASP B 1 106 ? 102.551 -38.259 200.564 1.00 129.47 ? 106 ASP B CB  1 
ATOM   5281  C CG  . ASP B 1 106 ? 102.067 -38.461 199.158 1.00 146.40 ? 106 ASP B CG  1 
ATOM   5282  O OD1 . ASP B 1 106 ? 100.857 -38.734 198.983 1.00 153.81 ? 106 ASP B OD1 1 
ATOM   5283  O OD2 . ASP B 1 106 ? 102.884 -38.350 198.223 1.00 146.50 ? 106 ASP B OD2 1 
ATOM   5284  N N   . ASP B 1 107 ? 101.287 -35.843 202.384 1.00 104.13 ? 107 ASP B N   1 
ATOM   5285  C CA  . ASP B 1 107 ? 100.758 -34.498 202.605 1.00 100.37 ? 107 ASP B CA  1 
ATOM   5286  C C   . ASP B 1 107 ? 100.630 -33.609 201.374 1.00 97.05  ? 107 ASP B C   1 
ATOM   5287  O O   . ASP B 1 107 ? 101.492 -33.603 200.498 1.00 106.81 ? 107 ASP B O   1 
ATOM   5288  C CB  . ASP B 1 107 ? 101.639 -33.778 203.624 1.00 100.57 ? 107 ASP B CB  1 
ATOM   5289  C CG  . ASP B 1 107 ? 100.835 -33.041 204.667 1.00 125.35 ? 107 ASP B CG  1 
ATOM   5290  O OD1 . ASP B 1 107 ? 100.309 -31.952 204.356 1.00 133.77 ? 107 ASP B OD1 1 
ATOM   5291  O OD2 . ASP B 1 107 ? 100.733 -33.551 205.801 1.00 139.35 ? 107 ASP B OD2 1 
ATOM   5292  N N   . VAL B 1 108 ? 99.533  -32.857 201.327 1.00 86.18  ? 108 VAL B N   1 
ATOM   5293  C CA  . VAL B 1 108 ? 99.295  -31.887 200.260 1.00 88.23  ? 108 VAL B CA  1 
ATOM   5294  C C   . VAL B 1 108 ? 99.981  -30.563 200.583 1.00 90.69  ? 108 VAL B C   1 
ATOM   5295  O O   . VAL B 1 108 ? 99.554  -29.823 201.471 1.00 88.32  ? 108 VAL B O   1 
ATOM   5296  C CB  . VAL B 1 108 ? 97.791  -31.637 200.028 1.00 84.46  ? 108 VAL B CB  1 
ATOM   5297  C CG1 . VAL B 1 108 ? 97.590  -30.395 199.172 1.00 83.40  ? 108 VAL B CG1 1 
ATOM   5298  C CG2 . VAL B 1 108 ? 97.152  -32.845 199.370 1.00 84.74  ? 108 VAL B CG2 1 
ATOM   5299  N N   . THR B 1 109 ? 101.046 -30.274 199.844 1.00 86.98  ? 109 THR B N   1 
ATOM   5300  C CA  . THR B 1 109 ? 101.868 -29.091 200.077 1.00 79.85  ? 109 THR B CA  1 
ATOM   5301  C C   . THR B 1 109 ? 101.317 -27.817 199.419 1.00 75.31  ? 109 THR B C   1 
ATOM   5302  O O   . THR B 1 109 ? 101.676 -26.713 199.821 1.00 74.68  ? 109 THR B O   1 
ATOM   5303  C CB  . THR B 1 109 ? 103.317 -29.328 199.604 1.00 84.08  ? 109 THR B CB  1 
ATOM   5304  O OG1 . THR B 1 109 ? 104.196 -28.415 200.271 1.00 113.63 ? 109 THR B OG1 1 
ATOM   5305  C CG2 . THR B 1 109 ? 103.444 -29.169 198.093 1.00 81.67  ? 109 THR B CG2 1 
ATOM   5306  N N   . PHE B 1 110 ? 100.487 -27.969 198.388 1.00 74.84  ? 110 PHE B N   1 
ATOM   5307  C CA  . PHE B 1 110 ? 99.885  -26.829 197.692 1.00 78.02  ? 110 PHE B CA  1 
ATOM   5308  C C   . PHE B 1 110 ? 98.578  -27.244 197.017 1.00 80.07  ? 110 PHE B C   1 
ATOM   5309  O O   . PHE B 1 110 ? 98.483  -28.353 196.495 1.00 92.96  ? 110 PHE B O   1 
ATOM   5310  C CB  . PHE B 1 110 ? 100.869 -26.262 196.655 1.00 69.72  ? 110 PHE B CB  1 
ATOM   5311  C CG  . PHE B 1 110 ? 100.309 -25.137 195.816 1.00 65.07  ? 110 PHE B CG  1 
ATOM   5312  C CD1 . PHE B 1 110 ? 100.470 -23.816 196.202 1.00 65.04  ? 110 PHE B CD1 1 
ATOM   5313  C CD2 . PHE B 1 110 ? 99.647  -25.401 194.625 1.00 64.25  ? 110 PHE B CD2 1 
ATOM   5314  C CE1 . PHE B 1 110 ? 99.966  -22.784 195.430 1.00 64.04  ? 110 PHE B CE1 1 
ATOM   5315  C CE2 . PHE B 1 110 ? 99.139  -24.375 193.852 1.00 64.30  ? 110 PHE B CE2 1 
ATOM   5316  C CZ  . PHE B 1 110 ? 99.298  -23.065 194.254 1.00 62.60  ? 110 PHE B CZ  1 
ATOM   5317  N N   . TRP B 1 111 ? 97.572  -26.369 197.022 1.00 72.33  ? 111 TRP B N   1 
ATOM   5318  C CA  . TRP B 1 111 ? 96.330  -26.664 196.302 1.00 72.82  ? 111 TRP B CA  1 
ATOM   5319  C C   . TRP B 1 111 ? 95.594  -25.402 195.825 1.00 85.41  ? 111 TRP B C   1 
ATOM   5320  O O   . TRP B 1 111 ? 95.634  -24.351 196.466 1.00 103.94 ? 111 TRP B O   1 
ATOM   5321  C CB  . TRP B 1 111 ? 95.400  -27.559 197.141 1.00 86.68  ? 111 TRP B CB  1 
ATOM   5322  C CG  . TRP B 1 111 ? 94.747  -26.971 198.370 1.00 87.81  ? 111 TRP B CG  1 
ATOM   5323  C CD1 . TRP B 1 111 ? 95.158  -25.896 199.101 1.00 102.38 ? 111 TRP B CD1 1 
ATOM   5324  C CD2 . TRP B 1 111 ? 93.560  -27.464 199.013 1.00 80.33  ? 111 TRP B CD2 1 
ATOM   5325  N NE1 . TRP B 1 111 ? 94.292  -25.681 200.152 1.00 89.42  ? 111 TRP B NE1 1 
ATOM   5326  C CE2 . TRP B 1 111 ? 93.307  -26.633 200.121 1.00 83.07  ? 111 TRP B CE2 1 
ATOM   5327  C CE3 . TRP B 1 111 ? 92.687  -28.526 198.752 1.00 79.22  ? 111 TRP B CE3 1 
ATOM   5328  C CZ2 . TRP B 1 111 ? 92.217  -26.830 200.968 1.00 83.12  ? 111 TRP B CZ2 1 
ATOM   5329  C CZ3 . TRP B 1 111 ? 91.610  -28.722 199.591 1.00 85.90  ? 111 TRP B CZ3 1 
ATOM   5330  C CH2 . TRP B 1 111 ? 91.384  -27.878 200.688 1.00 87.37  ? 111 TRP B CH2 1 
ATOM   5331  N N   . LYS B 1 112 ? 94.923  -25.532 194.683 1.00 70.96  ? 112 LYS B N   1 
ATOM   5332  C CA  . LYS B 1 112 ? 94.292  -24.409 193.990 1.00 77.42  ? 112 LYS B CA  1 
ATOM   5333  C C   . LYS B 1 112 ? 93.075  -24.881 193.197 1.00 73.99  ? 112 LYS B C   1 
ATOM   5334  O O   . LYS B 1 112 ? 93.001  -26.047 192.815 1.00 94.02  ? 112 LYS B O   1 
ATOM   5335  C CB  . LYS B 1 112 ? 95.308  -23.747 193.052 1.00 78.49  ? 112 LYS B CB  1 
ATOM   5336  C CG  . LYS B 1 112 ? 94.875  -22.440 192.407 1.00 90.96  ? 112 LYS B CG  1 
ATOM   5337  C CD  . LYS B 1 112 ? 95.845  -22.087 191.283 1.00 91.87  ? 112 LYS B CD  1 
ATOM   5338  C CE  . LYS B 1 112 ? 95.434  -20.828 190.537 1.00 114.67 ? 112 LYS B CE  1 
ATOM   5339  N NZ  . LYS B 1 112 ? 95.534  -19.609 191.384 1.00 125.49 ? 112 LYS B NZ  1 
ATOM   5340  N N   . TRP B 1 113 ? 92.119  -23.987 192.954 1.00 71.57  ? 113 TRP B N   1 
ATOM   5341  C CA  . TRP B 1 113 ? 90.978  -24.342 192.116 1.00 87.30  ? 113 TRP B CA  1 
ATOM   5342  C C   . TRP B 1 113 ? 91.325  -24.138 190.650 1.00 89.51  ? 113 TRP B C   1 
ATOM   5343  O O   . TRP B 1 113 ? 91.552  -23.016 190.198 1.00 85.02  ? 113 TRP B O   1 
ATOM   5344  C CB  . TRP B 1 113 ? 89.737  -23.521 192.469 1.00 98.68  ? 113 TRP B CB  1 
ATOM   5345  C CG  . TRP B 1 113 ? 89.028  -23.953 193.721 1.00 86.84  ? 113 TRP B CG  1 
ATOM   5346  C CD1 . TRP B 1 113 ? 89.255  -23.496 194.983 1.00 85.10  ? 113 TRP B CD1 1 
ATOM   5347  C CD2 . TRP B 1 113 ? 87.965  -24.914 193.828 1.00 88.23  ? 113 TRP B CD2 1 
ATOM   5348  N NE1 . TRP B 1 113 ? 88.407  -24.111 195.871 1.00 91.27  ? 113 TRP B NE1 1 
ATOM   5349  C CE2 . TRP B 1 113 ? 87.605  -24.987 195.188 1.00 88.73  ? 113 TRP B CE2 1 
ATOM   5350  C CE3 . TRP B 1 113 ? 87.289  -25.724 192.908 1.00 93.13  ? 113 TRP B CE3 1 
ATOM   5351  C CZ2 . TRP B 1 113 ? 86.602  -25.835 195.653 1.00 85.83  ? 113 TRP B CZ2 1 
ATOM   5352  C CZ3 . TRP B 1 113 ? 86.293  -26.566 193.372 1.00 80.43  ? 113 TRP B CZ3 1 
ATOM   5353  C CH2 . TRP B 1 113 ? 85.957  -26.613 194.731 1.00 81.60  ? 113 TRP B CH2 1 
ATOM   5354  N N   . ILE B 1 114 ? 91.356  -25.237 189.908 1.00 82.79  ? 114 ILE B N   1 
ATOM   5355  C CA  . ILE B 1 114 ? 91.670  -25.191 188.488 1.00 72.97  ? 114 ILE B CA  1 
ATOM   5356  C C   . ILE B 1 114 ? 90.542  -24.541 187.699 1.00 77.49  ? 114 ILE B C   1 
ATOM   5357  O O   . ILE B 1 114 ? 90.782  -23.744 186.791 1.00 93.89  ? 114 ILE B O   1 
ATOM   5358  C CB  . ILE B 1 114 ? 91.948  -26.598 187.929 1.00 81.17  ? 114 ILE B CB  1 
ATOM   5359  C CG1 . ILE B 1 114 ? 93.354  -27.031 188.326 1.00 92.20  ? 114 ILE B CG1 1 
ATOM   5360  C CG2 . ILE B 1 114 ? 91.785  -26.625 186.415 1.00 80.20  ? 114 ILE B CG2 1 
ATOM   5361  C CD1 . ILE B 1 114 ? 94.342  -25.887 188.367 1.00 114.38 ? 114 ILE B CD1 1 
ATOM   5362  N N   . SER B 1 115 ? 89.310  -24.883 188.053 1.00 82.62  ? 115 SER B N   1 
ATOM   5363  C CA  . SER B 1 115 ? 88.143  -24.306 187.401 1.00 93.68  ? 115 SER B CA  1 
ATOM   5364  C C   . SER B 1 115 ? 86.955  -24.380 188.340 1.00 97.65  ? 115 SER B C   1 
ATOM   5365  O O   . SER B 1 115 ? 87.113  -24.651 189.531 1.00 104.98 ? 115 SER B O   1 
ATOM   5366  C CB  . SER B 1 115 ? 87.829  -25.033 186.094 1.00 97.35  ? 115 SER B CB  1 
ATOM   5367  O OG  . SER B 1 115 ? 87.488  -26.389 186.330 1.00 86.05  ? 115 SER B OG  1 
ATOM   5368  N N   . LEU B 1 116 ? 85.765  -24.125 187.812 1.00 103.88 ? 116 LEU B N   1 
ATOM   5369  C CA  . LEU B 1 116 ? 84.560  -24.349 188.591 1.00 103.23 ? 116 LEU B CA  1 
ATOM   5370  C C   . LEU B 1 116 ? 84.364  -25.848 188.612 1.00 113.43 ? 116 LEU B C   1 
ATOM   5371  O O   . LEU B 1 116 ? 84.275  -26.459 187.548 1.00 125.71 ? 116 LEU B O   1 
ATOM   5372  C CB  . LEU B 1 116 ? 83.349  -23.661 187.966 1.00 94.17  ? 116 LEU B CB  1 
ATOM   5373  C CG  . LEU B 1 116 ? 83.510  -22.175 187.659 1.00 105.87 ? 116 LEU B CG  1 
ATOM   5374  C CD1 . LEU B 1 116 ? 82.549  -21.788 186.561 1.00 100.95 ? 116 LEU B CD1 1 
ATOM   5375  C CD2 . LEU B 1 116 ? 83.259  -21.374 188.910 1.00 118.19 ? 116 LEU B CD2 1 
ATOM   5376  N N   . ASN B 1 117 ? 84.334  -26.424 189.815 1.00 114.02 ? 117 ASN B N   1 
ATOM   5377  C CA  . ASN B 1 117 ? 84.143  -27.863 190.048 1.00 123.67 ? 117 ASN B CA  1 
ATOM   5378  C C   . ASN B 1 117 ? 85.375  -28.731 189.784 1.00 109.39 ? 117 ASN B C   1 
ATOM   5379  O O   . ASN B 1 117 ? 85.260  -29.887 189.367 1.00 112.33 ? 117 ASN B O   1 
ATOM   5380  C CB  . ASN B 1 117 ? 82.930  -28.378 189.265 1.00 139.04 ? 117 ASN B CB  1 
ATOM   5381  C CG  . ASN B 1 117 ? 81.749  -27.433 189.361 1.00 164.38 ? 117 ASN B CG  1 
ATOM   5382  O OD1 . ASN B 1 117 ? 81.741  -26.522 190.190 1.00 171.70 ? 117 ASN B OD1 1 
ATOM   5383  N ND2 . ASN B 1 117 ? 80.740  -27.651 188.529 1.00 167.64 ? 117 ASN B ND2 1 
ATOM   5384  N N   . THR B 1 118 ? 86.553  -28.167 190.045 1.00 101.69 ? 118 THR B N   1 
ATOM   5385  C CA  . THR B 1 118 ? 87.802  -28.929 189.963 1.00 102.67 ? 118 THR B CA  1 
ATOM   5386  C C   . THR B 1 118 ? 88.928  -28.282 190.784 1.00 86.11  ? 118 THR B C   1 
ATOM   5387  O O   . THR B 1 118 ? 89.312  -27.138 190.534 1.00 86.36  ? 118 THR B O   1 
ATOM   5388  C CB  . THR B 1 118 ? 88.299  -29.098 188.516 1.00 102.87 ? 118 THR B CB  1 
ATOM   5389  O OG1 . THR B 1 118 ? 87.249  -28.794 187.593 1.00 120.16 ? 118 THR B OG1 1 
ATOM   5390  C CG2 . THR B 1 118 ? 88.756  -30.524 188.302 1.00 90.90  ? 118 THR B CG2 1 
ATOM   5391  N N   . VAL B 1 119 ? 89.458  -29.023 191.758 1.00 79.60  ? 119 VAL B N   1 
ATOM   5392  C CA  . VAL B 1 119 ? 90.560  -28.520 192.584 1.00 80.46  ? 119 VAL B CA  1 
ATOM   5393  C C   . VAL B 1 119 ? 91.833  -29.372 192.474 1.00 84.12  ? 119 VAL B C   1 
ATOM   5394  O O   . VAL B 1 119 ? 91.815  -30.576 192.715 1.00 88.78  ? 119 VAL B O   1 
ATOM   5395  C CB  . VAL B 1 119 ? 90.160  -28.405 194.064 1.00 80.47  ? 119 VAL B CB  1 
ATOM   5396  C CG1 . VAL B 1 119 ? 89.540  -29.703 194.583 1.00 81.80  ? 119 VAL B CG1 1 
ATOM   5397  C CG2 . VAL B 1 119 ? 91.368  -28.024 194.890 1.00 81.16  ? 119 VAL B CG2 1 
ATOM   5398  N N   . ALA B 1 120 ? 92.948  -28.725 192.142 1.00 79.52  ? 120 ALA B N   1 
ATOM   5399  C CA  . ALA B 1 120 ? 94.229  -29.417 191.995 1.00 80.78  ? 120 ALA B CA  1 
ATOM   5400  C C   . ALA B 1 120 ? 95.031  -29.536 193.294 1.00 77.98  ? 120 ALA B C   1 
ATOM   5401  O O   . ALA B 1 120 ? 95.119  -28.590 194.074 1.00 73.27  ? 120 ALA B O   1 
ATOM   5402  C CB  . ALA B 1 120 ? 95.062  -28.724 190.940 1.00 74.12  ? 120 ALA B CB  1 
ATOM   5403  N N   . LEU B 1 121 ? 95.629  -30.708 193.500 1.00 73.14  ? 121 LEU B N   1 
ATOM   5404  C CA  . LEU B 1 121 ? 96.394  -30.991 194.712 1.00 73.32  ? 121 LEU B CA  1 
ATOM   5405  C C   . LEU B 1 121 ? 97.852  -31.325 194.409 1.00 89.18  ? 121 LEU B C   1 
ATOM   5406  O O   . LEU B 1 121 ? 98.141  -32.131 193.525 1.00 93.91  ? 121 LEU B O   1 
ATOM   5407  C CB  . LEU B 1 121 ? 95.765  -32.148 195.490 1.00 74.92  ? 121 LEU B CB  1 
ATOM   5408  C CG  . LEU B 1 121 ? 94.244  -32.159 195.591 1.00 90.88  ? 121 LEU B CG  1 
ATOM   5409  C CD1 . LEU B 1 121 ? 93.746  -33.500 196.119 1.00 108.43 ? 121 LEU B CD1 1 
ATOM   5410  C CD2 . LEU B 1 121 ? 93.746  -30.998 196.440 1.00 79.20  ? 121 LEU B CD2 1 
ATOM   5411  N N   . VAL B 1 122 ? 98.770  -30.707 195.144 1.00 82.97  ? 122 VAL B N   1 
ATOM   5412  C CA  . VAL B 1 122 ? 100.190 -30.953 194.931 1.00 79.82  ? 122 VAL B CA  1 
ATOM   5413  C C   . VAL B 1 122 ? 100.856 -31.548 196.167 1.00 93.22  ? 122 VAL B C   1 
ATOM   5414  O O   . VAL B 1 122 ? 100.926 -30.914 197.220 1.00 95.63  ? 122 VAL B O   1 
ATOM   5415  C CB  . VAL B 1 122 ? 100.938 -29.671 194.544 1.00 81.84  ? 122 VAL B CB  1 
ATOM   5416  C CG1 . VAL B 1 122 ? 102.370 -30.001 194.172 1.00 88.69  ? 122 VAL B CG1 1 
ATOM   5417  C CG2 . VAL B 1 122 ? 100.232 -28.968 193.392 1.00 72.20  ? 122 VAL B CG2 1 
ATOM   5418  N N   . THR B 1 123 ? 101.345 -32.773 196.023 1.00 103.22 ? 123 THR B N   1 
ATOM   5419  C CA  . THR B 1 123 ? 102.124 -33.422 197.067 1.00 96.79  ? 123 THR B CA  1 
ATOM   5420  C C   . THR B 1 123 ? 103.587 -33.267 196.688 1.00 88.79  ? 123 THR B C   1 
ATOM   5421  O O   . THR B 1 123 ? 103.897 -32.683 195.654 1.00 98.57  ? 123 THR B O   1 
ATOM   5422  C CB  . THR B 1 123 ? 101.768 -34.908 197.222 1.00 92.50  ? 123 THR B CB  1 
ATOM   5423  O OG1 . THR B 1 123 ? 101.927 -35.575 195.963 1.00 90.01  ? 123 THR B OG1 1 
ATOM   5424  C CG2 . THR B 1 123 ? 100.329 -35.057 197.694 1.00 84.69  ? 123 THR B CG2 1 
ATOM   5425  N N   . ASP B 1 124 ? 104.492 -33.771 197.516 1.00 84.67  ? 124 ASP B N   1 
ATOM   5426  C CA  . ASP B 1 124 ? 105.909 -33.653 197.194 1.00 80.98  ? 124 ASP B CA  1 
ATOM   5427  C C   . ASP B 1 124 ? 106.301 -34.521 196.005 1.00 85.49  ? 124 ASP B C   1 
ATOM   5428  O O   . ASP B 1 124 ? 107.371 -34.339 195.432 1.00 99.32  ? 124 ASP B O   1 
ATOM   5429  C CB  . ASP B 1 124 ? 106.778 -34.018 198.399 1.00 93.78  ? 124 ASP B CB  1 
ATOM   5430  C CG  . ASP B 1 124 ? 106.367 -33.289 199.657 1.00 117.82 ? 124 ASP B CG  1 
ATOM   5431  O OD1 . ASP B 1 124 ? 107.151 -32.437 200.124 1.00 94.07  ? 124 ASP B OD1 1 
ATOM   5432  O OD2 . ASP B 1 124 ? 105.254 -33.540 200.164 1.00 148.36 ? 124 ASP B OD2 1 
ATOM   5433  N N   . ASN B 1 125 ? 105.438 -35.455 195.626 1.00 86.89  ? 125 ASN B N   1 
ATOM   5434  C CA  . ASN B 1 125 ? 105.785 -36.396 194.568 1.00 89.06  ? 125 ASN B CA  1 
ATOM   5435  C C   . ASN B 1 125 ? 104.939 -36.309 193.300 1.00 84.37  ? 125 ASN B C   1 
ATOM   5436  O O   . ASN B 1 125 ? 105.409 -36.674 192.222 1.00 84.37  ? 125 ASN B O   1 
ATOM   5437  C CB  . ASN B 1 125 ? 105.733 -37.822 195.116 1.00 100.61 ? 125 ASN B CB  1 
ATOM   5438  C CG  . ASN B 1 125 ? 106.474 -37.965 196.428 1.00 121.30 ? 125 ASN B CG  1 
ATOM   5439  O OD1 . ASN B 1 125 ? 107.699 -38.092 196.450 1.00 142.08 ? 125 ASN B OD1 1 
ATOM   5440  N ND2 . ASN B 1 125 ? 105.737 -37.937 197.531 1.00 113.52 ? 125 ASN B ND2 1 
ATOM   5441  N N   . ALA B 1 126 ? 103.704 -35.832 193.411 1.00 86.14  ? 126 ALA B N   1 
ATOM   5442  C CA  . ALA B 1 126 ? 102.845 -35.769 192.232 1.00 86.60  ? 126 ALA B CA  1 
ATOM   5443  C C   . ALA B 1 126 ? 101.764 -34.694 192.308 1.00 80.47  ? 126 ALA B C   1 
ATOM   5444  O O   . ALA B 1 126 ? 101.586 -34.038 193.333 1.00 81.91  ? 126 ALA B O   1 
ATOM   5445  C CB  . ALA B 1 126 ? 102.203 -37.127 191.989 1.00 91.25  ? 126 ALA B CB  1 
ATOM   5446  N N   . VAL B 1 127 ? 101.051 -34.522 191.198 1.00 78.16  ? 127 VAL B N   1 
ATOM   5447  C CA  . VAL B 1 127 ? 99.962  -33.552 191.095 1.00 79.97  ? 127 VAL B CA  1 
ATOM   5448  C C   . VAL B 1 127 ? 98.633  -34.234 190.784 1.00 80.60  ? 127 VAL B C   1 
ATOM   5449  O O   . VAL B 1 127 ? 98.545  -35.050 189.868 1.00 81.29  ? 127 VAL B O   1 
ATOM   5450  C CB  . VAL B 1 127 ? 100.252 -32.503 190.017 1.00 78.79  ? 127 VAL B CB  1 
ATOM   5451  C CG1 . VAL B 1 127 ? 99.038  -31.617 189.798 1.00 77.49  ? 127 VAL B CG1 1 
ATOM   5452  C CG2 . VAL B 1 127 ? 101.461 -31.679 190.408 1.00 80.09  ? 127 VAL B CG2 1 
ATOM   5453  N N   . TYR B 1 128 ? 97.594  -33.884 191.536 1.00 90.87  ? 128 TYR B N   1 
ATOM   5454  C CA  . TYR B 1 128 ? 96.293  -34.526 191.375 1.00 84.07  ? 128 TYR B CA  1 
ATOM   5455  C C   . TYR B 1 128 ? 95.171  -33.562 190.993 1.00 81.64  ? 128 TYR B C   1 
ATOM   5456  O O   . TYR B 1 128 ? 95.235  -32.371 191.287 1.00 80.09  ? 128 TYR B O   1 
ATOM   5457  C CB  . TYR B 1 128 ? 95.901  -35.249 192.664 1.00 82.48  ? 128 TYR B CB  1 
ATOM   5458  C CG  . TYR B 1 128 ? 96.938  -36.214 193.189 1.00 93.14  ? 128 TYR B CG  1 
ATOM   5459  C CD1 . TYR B 1 128 ? 96.936  -37.546 192.801 1.00 87.41  ? 128 TYR B CD1 1 
ATOM   5460  C CD2 . TYR B 1 128 ? 97.903  -35.798 194.098 1.00 109.77 ? 128 TYR B CD2 1 
ATOM   5461  C CE1 . TYR B 1 128 ? 97.878  -38.436 193.291 1.00 88.89  ? 128 TYR B CE1 1 
ATOM   5462  C CE2 . TYR B 1 128 ? 98.848  -36.680 194.593 1.00 115.15 ? 128 TYR B CE2 1 
ATOM   5463  C CZ  . TYR B 1 128 ? 98.830  -37.997 194.187 1.00 113.76 ? 128 TYR B CZ  1 
ATOM   5464  O OH  . TYR B 1 128 ? 99.769  -38.873 194.680 1.00 130.16 ? 128 TYR B OH  1 
ATOM   5465  N N   . HIS B 1 129 ? 94.148  -34.097 190.332 1.00 84.98  ? 129 HIS B N   1 
ATOM   5466  C CA  . HIS B 1 129 ? 92.943  -33.333 190.020 1.00 86.95  ? 129 HIS B CA  1 
ATOM   5467  C C   . HIS B 1 129 ? 91.718  -33.938 190.701 1.00 84.78  ? 129 HIS B C   1 
ATOM   5468  O O   . HIS B 1 129 ? 91.317  -35.057 190.401 1.00 85.62  ? 129 HIS B O   1 
ATOM   5469  C CB  . HIS B 1 129 ? 92.722  -33.263 188.508 1.00 84.55  ? 129 HIS B CB  1 
ATOM   5470  C CG  . HIS B 1 129 ? 93.577  -32.248 187.815 1.00 88.46  ? 129 HIS B CG  1 
ATOM   5471  N ND1 . HIS B 1 129 ? 93.352  -31.837 186.521 1.00 89.81  ? 129 HIS B ND1 1 
ATOM   5472  C CD2 . HIS B 1 129 ? 94.657  -31.552 188.247 1.00 102.11 ? 129 HIS B CD2 1 
ATOM   5473  C CE1 . HIS B 1 129 ? 94.255  -30.939 186.178 1.00 99.15  ? 129 HIS B CE1 1 
ATOM   5474  N NE2 . HIS B 1 129 ? 95.061  -30.748 187.210 1.00 104.35 ? 129 HIS B NE2 1 
ATOM   5475  N N   . TRP B 1 130 ? 91.122  -33.177 191.611 1.00 84.08  ? 130 TRP B N   1 
ATOM   5476  C CA  . TRP B 1 130 ? 89.983  -33.649 192.390 1.00 92.00  ? 130 TRP B CA  1 
ATOM   5477  C C   . TRP B 1 130 ? 88.718  -32.891 191.998 1.00 105.51 ? 130 TRP B C   1 
ATOM   5478  O O   . TRP B 1 130 ? 88.620  -31.685 192.210 1.00 104.69 ? 130 TRP B O   1 
ATOM   5479  C CB  . TRP B 1 130 ? 90.282  -33.496 193.888 1.00 85.44  ? 130 TRP B CB  1 
ATOM   5480  C CG  . TRP B 1 130 ? 89.327  -34.178 194.823 1.00 87.36  ? 130 TRP B CG  1 
ATOM   5481  C CD1 . TRP B 1 130 ? 88.570  -35.285 194.568 1.00 93.48  ? 130 TRP B CD1 1 
ATOM   5482  C CD2 . TRP B 1 130 ? 89.081  -33.829 196.190 1.00 87.48  ? 130 TRP B CD2 1 
ATOM   5483  N NE1 . TRP B 1 130 ? 87.846  -35.628 195.686 1.00 109.19 ? 130 TRP B NE1 1 
ATOM   5484  C CE2 . TRP B 1 130 ? 88.144  -34.751 196.695 1.00 100.12 ? 130 TRP B CE2 1 
ATOM   5485  C CE3 . TRP B 1 130 ? 89.553  -32.817 197.033 1.00 87.10  ? 130 TRP B CE3 1 
ATOM   5486  C CZ2 . TRP B 1 130 ? 87.669  -34.692 198.004 1.00 100.50 ? 130 TRP B CZ2 1 
ATOM   5487  C CZ3 . TRP B 1 130 ? 89.082  -32.761 198.331 1.00 88.86  ? 130 TRP B CZ3 1 
ATOM   5488  C CH2 . TRP B 1 130 ? 88.150  -33.693 198.804 1.00 99.19  ? 130 TRP B CH2 1 
ATOM   5489  N N   . SER B 1 131 ? 87.753  -33.600 191.421 1.00 109.81 ? 131 SER B N   1 
ATOM   5490  C CA  . SER B 1 131 ? 86.514  -32.970 190.982 1.00 107.67 ? 131 SER B CA  1 
ATOM   5491  C C   . SER B 1 131 ? 85.548  -32.749 192.133 1.00 97.89  ? 131 SER B C   1 
ATOM   5492  O O   . SER B 1 131 ? 85.375  -33.609 192.995 1.00 98.44  ? 131 SER B O   1 
ATOM   5493  C CB  . SER B 1 131 ? 85.832  -33.806 189.899 1.00 117.71 ? 131 SER B CB  1 
ATOM   5494  O OG  . SER B 1 131 ? 84.693  -33.135 189.385 1.00 104.17 ? 131 SER B OG  1 
ATOM   5495  N N   . MET B 1 132 ? 84.919  -31.580 192.129 1.00 103.13 ? 132 MET B N   1 
ATOM   5496  C CA  . MET B 1 132 ? 83.934  -31.208 193.137 1.00 109.09 ? 132 MET B CA  1 
ATOM   5497  C C   . MET B 1 132 ? 82.622  -31.964 192.948 1.00 103.94 ? 132 MET B C   1 
ATOM   5498  O O   . MET B 1 132 ? 81.907  -32.246 193.907 1.00 104.50 ? 132 MET B O   1 
ATOM   5499  C CB  . MET B 1 132 ? 83.694  -29.702 193.078 1.00 104.97 ? 132 MET B CB  1 
ATOM   5500  C CG  . MET B 1 132 ? 82.746  -29.144 194.117 1.00 102.13 ? 132 MET B CG  1 
ATOM   5501  S SD  . MET B 1 132 ? 82.112  -27.551 193.570 1.00 104.50 ? 132 MET B SD  1 
ATOM   5502  C CE  . MET B 1 132 ? 80.627  -28.058 192.704 1.00 175.69 ? 132 MET B CE  1 
ATOM   5503  N N   . GLU B 1 133 ? 82.322  -32.298 191.699 1.00 104.49 ? 133 GLU B N   1 
ATOM   5504  C CA  . GLU B 1 133 ? 81.093  -33.001 191.350 1.00 107.98 ? 133 GLU B CA  1 
ATOM   5505  C C   . GLU B 1 133 ? 81.185  -34.525 191.490 1.00 112.49 ? 133 GLU B C   1 
ATOM   5506  O O   . GLU B 1 133 ? 82.241  -35.120 191.268 1.00 111.27 ? 133 GLU B O   1 
ATOM   5507  C CB  . GLU B 1 133 ? 80.689  -32.631 189.925 1.00 116.76 ? 133 GLU B CB  1 
ATOM   5508  C CG  . GLU B 1 133 ? 80.147  -31.219 189.797 1.00 130.55 ? 133 GLU B CG  1 
ATOM   5509  C CD  . GLU B 1 133 ? 79.781  -30.872 188.372 1.00 140.09 ? 133 GLU B CD  1 
ATOM   5510  O OE1 . GLU B 1 133 ? 80.424  -31.415 187.449 1.00 144.30 ? 133 GLU B OE1 1 
ATOM   5511  O OE2 . GLU B 1 133 ? 78.849  -30.066 188.171 1.00 139.96 ? 133 GLU B OE2 1 
ATOM   5512  N N   . GLY B 1 134 ? 80.068  -35.141 191.878 1.00 126.45 ? 134 GLY B N   1 
ATOM   5513  C CA  . GLY B 1 134 ? 79.959  -36.590 191.982 1.00 133.77 ? 134 GLY B CA  1 
ATOM   5514  C C   . GLY B 1 134 ? 80.739  -37.271 193.093 1.00 131.07 ? 134 GLY B C   1 
ATOM   5515  O O   . GLY B 1 134 ? 80.982  -36.674 194.140 1.00 124.66 ? 134 GLY B O   1 
ATOM   5516  N N   . GLU B 1 135 ? 81.124  -38.528 192.861 1.00 135.88 ? 135 GLU B N   1 
ATOM   5517  C CA  . GLU B 1 135 ? 81.895  -39.313 193.835 1.00 143.27 ? 135 GLU B CA  1 
ATOM   5518  C C   . GLU B 1 135 ? 83.203  -39.833 193.226 1.00 131.48 ? 135 GLU B C   1 
ATOM   5519  O O   . GLU B 1 135 ? 83.439  -41.037 193.135 1.00 124.32 ? 135 GLU B O   1 
ATOM   5520  C CB  . GLU B 1 135 ? 81.038  -40.464 194.391 1.00 152.20 ? 135 GLU B CB  1 
ATOM   5521  C CG  . GLU B 1 135 ? 81.689  -41.279 195.516 1.00 168.02 ? 135 GLU B CG  1 
ATOM   5522  C CD  . GLU B 1 135 ? 82.753  -40.508 196.284 1.00 168.27 ? 135 GLU B CD  1 
ATOM   5523  O OE1 . GLU B 1 135 ? 83.954  -40.762 196.051 1.00 127.77 ? 135 GLU B OE1 1 
ATOM   5524  O OE2 . GLU B 1 135 ? 82.396  -39.663 197.131 1.00 185.42 ? 135 GLU B OE2 1 
ATOM   5525  N N   . SER B 1 136 ? 84.036  -38.896 192.789 1.00 116.46 ? 136 SER B N   1 
ATOM   5526  C CA  . SER B 1 136 ? 85.313  -39.227 192.180 1.00 110.19 ? 136 SER B CA  1 
ATOM   5527  C C   . SER B 1 136 ? 86.491  -38.853 193.086 1.00 117.09 ? 136 SER B C   1 
ATOM   5528  O O   . SER B 1 136 ? 86.586  -37.721 193.553 1.00 130.14 ? 136 SER B O   1 
ATOM   5529  C CB  . SER B 1 136 ? 85.440  -38.534 190.818 1.00 111.83 ? 136 SER B CB  1 
ATOM   5530  O OG  . SER B 1 136 ? 85.269  -37.133 190.930 1.00 124.26 ? 136 SER B OG  1 
ATOM   5531  N N   . GLN B 1 137 ? 87.374  -39.818 193.337 1.00 120.58 ? 137 GLN B N   1 
ATOM   5532  C CA  . GLN B 1 137 ? 88.567  -39.606 194.156 1.00 124.69 ? 137 GLN B CA  1 
ATOM   5533  C C   . GLN B 1 137 ? 89.577  -38.761 193.377 1.00 112.16 ? 137 GLN B C   1 
ATOM   5534  O O   . GLN B 1 137 ? 89.481  -38.678 192.154 1.00 116.45 ? 137 GLN B O   1 
ATOM   5535  C CB  . GLN B 1 137 ? 89.180  -40.952 194.552 1.00 135.58 ? 137 GLN B CB  1 
ATOM   5536  C CG  . GLN B 1 137 ? 89.423  -41.137 196.037 1.00 136.06 ? 137 GLN B CG  1 
ATOM   5537  C CD  . GLN B 1 137 ? 88.150  -41.290 196.848 1.00 146.72 ? 137 GLN B CD  1 
ATOM   5538  O OE1 . GLN B 1 137 ? 87.320  -40.384 196.911 1.00 162.63 ? 137 GLN B OE1 1 
ATOM   5539  N NE2 . GLN B 1 137 ? 87.990  -42.451 197.473 1.00 145.00 ? 137 GLN B NE2 1 
ATOM   5540  N N   . PRO B 1 138 ? 90.530  -38.108 194.076 1.00 101.14 ? 138 PRO B N   1 
ATOM   5541  C CA  . PRO B 1 138 ? 91.550  -37.329 193.357 1.00 95.28  ? 138 PRO B CA  1 
ATOM   5542  C C   . PRO B 1 138 ? 92.355  -38.161 192.360 1.00 91.75  ? 138 PRO B C   1 
ATOM   5543  O O   . PRO B 1 138 ? 92.893  -39.210 192.709 1.00 94.02  ? 138 PRO B O   1 
ATOM   5544  C CB  . PRO B 1 138 ? 92.450  -36.806 194.484 1.00 94.46  ? 138 PRO B CB  1 
ATOM   5545  C CG  . PRO B 1 138 ? 91.575  -36.809 195.689 1.00 98.60  ? 138 PRO B CG  1 
ATOM   5546  C CD  . PRO B 1 138 ? 90.704  -38.007 195.535 1.00 96.48  ? 138 PRO B CD  1 
ATOM   5547  N N   . VAL B 1 139 ? 92.444  -37.670 191.128 1.00 87.16  ? 139 VAL B N   1 
ATOM   5548  C CA  . VAL B 1 139 ? 93.110  -38.391 190.045 1.00 92.72  ? 139 VAL B CA  1 
ATOM   5549  C C   . VAL B 1 139 ? 94.518  -37.868 189.761 1.00 105.12 ? 139 VAL B C   1 
ATOM   5550  O O   . VAL B 1 139 ? 94.708  -36.677 189.527 1.00 102.07 ? 139 VAL B O   1 
ATOM   5551  C CB  . VAL B 1 139 ? 92.294  -38.319 188.751 1.00 89.27  ? 139 VAL B CB  1 
ATOM   5552  C CG1 . VAL B 1 139 ? 92.862  -39.279 187.724 1.00 90.38  ? 139 VAL B CG1 1 
ATOM   5553  C CG2 . VAL B 1 139 ? 90.833  -38.628 189.026 1.00 99.95  ? 139 VAL B CG2 1 
ATOM   5554  N N   . LYS B 1 140 ? 95.498  -38.768 189.773 1.00 104.36 ? 140 LYS B N   1 
ATOM   5555  C CA  . LYS B 1 140 ? 96.884  -38.406 189.486 1.00 95.31  ? 140 LYS B CA  1 
ATOM   5556  C C   . LYS B 1 140 ? 97.072  -37.948 188.039 1.00 103.44 ? 140 LYS B C   1 
ATOM   5557  O O   . LYS B 1 140 ? 96.691  -38.646 187.095 1.00 105.31 ? 140 LYS B O   1 
ATOM   5558  C CB  . LYS B 1 140 ? 97.808  -39.585 189.798 1.00 88.84  ? 140 LYS B CB  1 
ATOM   5559  C CG  . LYS B 1 140 ? 99.291  -39.246 189.806 1.00 91.87  ? 140 LYS B CG  1 
ATOM   5560  C CD  . LYS B 1 140 ? 100.120 -40.418 190.326 1.00 92.85  ? 140 LYS B CD  1 
ATOM   5561  C CE  . LYS B 1 140 ? 101.536 -40.393 189.774 1.00 95.46  ? 140 LYS B CE  1 
ATOM   5562  N NZ  . LYS B 1 140 ? 102.370 -41.509 190.301 1.00 102.43 ? 140 LYS B NZ  1 
ATOM   5563  N N   . MET B 1 141 ? 97.668  -36.768 187.879 1.00 98.45  ? 141 MET B N   1 
ATOM   5564  C CA  . MET B 1 141 ? 97.869  -36.171 186.559 1.00 95.51  ? 141 MET B CA  1 
ATOM   5565  C C   . MET B 1 141 ? 99.277  -36.401 186.021 1.00 105.26 ? 141 MET B C   1 
ATOM   5566  O O   . MET B 1 141 ? 99.450  -36.794 184.865 1.00 117.12 ? 141 MET B O   1 
ATOM   5567  C CB  . MET B 1 141 ? 97.563  -34.676 186.606 1.00 92.68  ? 141 MET B CB  1 
ATOM   5568  C CG  . MET B 1 141 ? 96.103  -34.372 186.909 1.00 107.20 ? 141 MET B CG  1 
ATOM   5569  S SD  . MET B 1 141 ? 95.019  -34.795 185.533 1.00 88.94  ? 141 MET B SD  1 
ATOM   5570  C CE  . MET B 1 141 ? 93.981  -36.045 186.302 1.00 127.87 ? 141 MET B CE  1 
ATOM   5571  N N   . PHE B 1 142 ? 100.278 -36.164 186.862 1.00 93.46  ? 142 PHE B N   1 
ATOM   5572  C CA  . PHE B 1 142 ? 101.663 -36.380 186.471 1.00 79.17  ? 142 PHE B CA  1 
ATOM   5573  C C   . PHE B 1 142 ? 102.549 -36.436 187.708 1.00 81.14  ? 142 PHE B C   1 
ATOM   5574  O O   . PHE B 1 142 ? 102.166 -35.968 188.778 1.00 81.69  ? 142 PHE B O   1 
ATOM   5575  C CB  . PHE B 1 142 ? 102.152 -35.295 185.494 1.00 78.55  ? 142 PHE B CB  1 
ATOM   5576  C CG  . PHE B 1 142 ? 102.136 -33.895 186.053 1.00 77.05  ? 142 PHE B CG  1 
ATOM   5577  C CD1 . PHE B 1 142 ? 101.039 -33.072 185.870 1.00 83.91  ? 142 PHE B CD1 1 
ATOM   5578  C CD2 . PHE B 1 142 ? 103.236 -33.392 186.726 1.00 83.47  ? 142 PHE B CD2 1 
ATOM   5579  C CE1 . PHE B 1 142 ? 101.030 -31.781 186.367 1.00 75.85  ? 142 PHE B CE1 1 
ATOM   5580  C CE2 . PHE B 1 142 ? 103.233 -32.104 187.229 1.00 76.81  ? 142 PHE B CE2 1 
ATOM   5581  C CZ  . PHE B 1 142 ? 102.130 -31.296 187.045 1.00 74.50  ? 142 PHE B CZ  1 
ATOM   5582  N N   . ASP B 1 143 ? 103.735 -37.013 187.556 1.00 81.98  ? 143 ASP B N   1 
ATOM   5583  C CA  . ASP B 1 143 ? 104.686 -37.098 188.656 1.00 83.61  ? 143 ASP B CA  1 
ATOM   5584  C C   . ASP B 1 143 ? 105.564 -35.858 188.684 1.00 79.92  ? 143 ASP B C   1 
ATOM   5585  O O   . ASP B 1 143 ? 105.977 -35.358 187.639 1.00 80.11  ? 143 ASP B O   1 
ATOM   5586  C CB  . ASP B 1 143 ? 105.551 -38.355 188.534 1.00 102.54 ? 143 ASP B CB  1 
ATOM   5587  C CG  . ASP B 1 143 ? 104.881 -39.582 189.117 1.00 131.22 ? 143 ASP B CG  1 
ATOM   5588  O OD1 . ASP B 1 143 ? 104.726 -39.638 190.354 1.00 149.29 ? 143 ASP B OD1 1 
ATOM   5589  O OD2 . ASP B 1 143 ? 104.512 -40.493 188.344 1.00 143.47 ? 143 ASP B OD2 1 
ATOM   5590  N N   . ARG B 1 144 ? 105.841 -35.358 189.883 1.00 76.29  ? 144 ARG B N   1 
ATOM   5591  C CA  . ARG B 1 144 ? 106.682 -34.173 190.037 1.00 76.78  ? 144 ARG B CA  1 
ATOM   5592  C C   . ARG B 1 144 ? 108.110 -34.416 189.554 1.00 81.26  ? 144 ARG B C   1 
ATOM   5593  O O   . ARG B 1 144 ? 108.745 -35.409 189.922 1.00 81.16  ? 144 ARG B O   1 
ATOM   5594  C CB  . ARG B 1 144 ? 106.687 -33.702 191.493 1.00 71.66  ? 144 ARG B CB  1 
ATOM   5595  C CG  . ARG B 1 144 ? 105.634 -32.645 191.776 1.00 68.96  ? 144 ARG B CG  1 
ATOM   5596  C CD  . ARG B 1 144 ? 105.705 -32.130 193.198 1.00 65.49  ? 144 ARG B CD  1 
ATOM   5597  N NE  . ARG B 1 144 ? 106.946 -31.418 193.477 1.00 82.89  ? 144 ARG B NE  1 
ATOM   5598  C CZ  . ARG B 1 144 ? 107.151 -30.686 194.566 1.00 94.57  ? 144 ARG B CZ  1 
ATOM   5599  N NH1 . ARG B 1 144 ? 108.310 -30.069 194.747 1.00 111.13 ? 144 ARG B NH1 1 
ATOM   5600  N NH2 . ARG B 1 144 ? 106.194 -30.574 195.477 1.00 90.73  ? 144 ARG B NH2 1 
ATOM   5601  N N   . HIS B 1 145 ? 108.597 -33.503 188.720 1.00 77.19  ? 145 HIS B N   1 
ATOM   5602  C CA  . HIS B 1 145 ? 109.944 -33.585 188.180 1.00 89.11  ? 145 HIS B CA  1 
ATOM   5603  C C   . HIS B 1 145 ? 110.980 -33.279 189.257 1.00 96.23  ? 145 HIS B C   1 
ATOM   5604  O O   . HIS B 1 145 ? 110.716 -32.506 190.176 1.00 108.48 ? 145 HIS B O   1 
ATOM   5605  C CB  . HIS B 1 145 ? 110.088 -32.627 186.994 1.00 87.88  ? 145 HIS B CB  1 
ATOM   5606  C CG  . HIS B 1 145 ? 111.295 -32.891 186.144 1.00 91.52  ? 145 HIS B CG  1 
ATOM   5607  N ND1 . HIS B 1 145 ? 112.564 -32.529 186.520 1.00 84.19  ? 145 HIS B ND1 1 
ATOM   5608  C CD2 . HIS B 1 145 ? 111.418 -33.500 184.937 1.00 103.58 ? 145 HIS B CD2 1 
ATOM   5609  C CE1 . HIS B 1 145 ? 113.427 -32.888 185.583 1.00 103.28 ? 145 HIS B CE1 1 
ATOM   5610  N NE2 . HIS B 1 145 ? 112.751 -33.479 184.611 1.00 109.41 ? 145 HIS B NE2 1 
ATOM   5611  N N   . SER B 1 146 ? 112.154 -33.895 189.137 1.00 85.50  ? 146 SER B N   1 
ATOM   5612  C CA  . SER B 1 146 ? 113.244 -33.716 190.102 1.00 85.83  ? 146 SER B CA  1 
ATOM   5613  C C   . SER B 1 146 ? 113.754 -32.278 190.201 1.00 83.30  ? 146 SER B C   1 
ATOM   5614  O O   . SER B 1 146 ? 114.277 -31.870 191.236 1.00 83.64  ? 146 SER B O   1 
ATOM   5615  C CB  . SER B 1 146 ? 114.410 -34.642 189.756 1.00 94.21  ? 146 SER B CB  1 
ATOM   5616  O OG  . SER B 1 146 ? 114.870 -34.416 188.435 1.00 113.93 ? 146 SER B OG  1 
ATOM   5617  N N   . SER B 1 147 ? 113.613 -31.515 189.123 1.00 77.31  ? 147 SER B N   1 
ATOM   5618  C CA  . SER B 1 147 ? 114.054 -30.122 189.106 1.00 74.74  ? 147 SER B CA  1 
ATOM   5619  C C   . SER B 1 147 ? 113.294 -29.261 190.115 1.00 83.29  ? 147 SER B C   1 
ATOM   5620  O O   . SER B 1 147 ? 113.809 -28.248 190.586 1.00 92.36  ? 147 SER B O   1 
ATOM   5621  C CB  . SER B 1 147 ? 113.899 -29.535 187.704 1.00 74.45  ? 147 SER B CB  1 
ATOM   5622  O OG  . SER B 1 147 ? 112.533 -29.356 187.379 1.00 74.23  ? 147 SER B OG  1 
ATOM   5623  N N   . LEU B 1 148 ? 112.071 -29.667 190.441 1.00 87.39  ? 148 LEU B N   1 
ATOM   5624  C CA  . LEU B 1 148 ? 111.238 -28.936 191.392 1.00 75.40  ? 148 LEU B CA  1 
ATOM   5625  C C   . LEU B 1 148 ? 111.362 -29.440 192.829 1.00 76.36  ? 148 LEU B C   1 
ATOM   5626  O O   . LEU B 1 148 ? 110.674 -28.944 193.720 1.00 82.50  ? 148 LEU B O   1 
ATOM   5627  C CB  . LEU B 1 148 ? 109.774 -28.987 190.961 1.00 76.30  ? 148 LEU B CB  1 
ATOM   5628  C CG  . LEU B 1 148 ? 109.363 -27.874 190.000 1.00 70.16  ? 148 LEU B CG  1 
ATOM   5629  C CD1 . LEU B 1 148 ? 109.476 -28.342 188.564 1.00 69.53  ? 148 LEU B CD1 1 
ATOM   5630  C CD2 . LEU B 1 148 ? 107.953 -27.413 190.303 1.00 70.42  ? 148 LEU B CD2 1 
ATOM   5631  N N   . ALA B 1 149 ? 112.218 -30.434 193.048 1.00 85.64  ? 149 ALA B N   1 
ATOM   5632  C CA  . ALA B 1 149 ? 112.429 -30.976 194.387 1.00 81.71  ? 149 ALA B CA  1 
ATOM   5633  C C   . ALA B 1 149 ? 113.049 -29.939 195.324 1.00 81.52  ? 149 ALA B C   1 
ATOM   5634  O O   . ALA B 1 149 ? 114.060 -29.313 194.999 1.00 94.70  ? 149 ALA B O   1 
ATOM   5635  C CB  . ALA B 1 149 ? 113.304 -32.219 194.326 1.00 79.51  ? 149 ALA B CB  1 
ATOM   5636  N N   . GLY B 1 150 ? 112.438 -29.773 196.494 1.00 77.71  ? 150 GLY B N   1 
ATOM   5637  C CA  . GLY B 1 150 ? 112.902 -28.813 197.482 1.00 78.59  ? 150 GLY B CA  1 
ATOM   5638  C C   . GLY B 1 150 ? 112.358 -27.408 197.295 1.00 81.08  ? 150 GLY B C   1 
ATOM   5639  O O   . GLY B 1 150 ? 112.601 -26.528 198.117 1.00 89.75  ? 150 GLY B O   1 
ATOM   5640  N N   . CYS B 1 151 ? 111.634 -27.197 196.201 1.00 86.28  ? 151 CYS B N   1 
ATOM   5641  C CA  . CYS B 1 151 ? 111.053 -25.893 195.885 1.00 89.61  ? 151 CYS B CA  1 
ATOM   5642  C C   . CYS B 1 151 ? 109.769 -25.603 196.656 1.00 83.04  ? 151 CYS B C   1 
ATOM   5643  O O   . CYS B 1 151 ? 109.036 -26.517 197.026 1.00 75.04  ? 151 CYS B O   1 
ATOM   5644  C CB  . CYS B 1 151 ? 110.767 -25.786 194.385 1.00 92.02  ? 151 CYS B CB  1 
ATOM   5645  S SG  . CYS B 1 151 ? 112.239 -25.717 193.342 1.00 112.52 ? 151 CYS B SG  1 
ATOM   5646  N N   . GLN B 1 152 ? 109.518 -24.323 196.915 1.00 82.84  ? 152 GLN B N   1 
ATOM   5647  C CA  . GLN B 1 152 ? 108.250 -23.894 197.492 1.00 71.00  ? 152 GLN B CA  1 
ATOM   5648  C C   . GLN B 1 152 ? 107.296 -23.663 196.338 1.00 82.92  ? 152 GLN B C   1 
ATOM   5649  O O   . GLN B 1 152 ? 107.499 -22.760 195.527 1.00 96.14  ? 152 GLN B O   1 
ATOM   5650  C CB  . GLN B 1 152 ? 108.406 -22.616 198.313 1.00 70.55  ? 152 GLN B CB  1 
ATOM   5651  C CG  . GLN B 1 152 ? 107.115 -22.111 198.930 1.00 78.55  ? 152 GLN B CG  1 
ATOM   5652  C CD  . GLN B 1 152 ? 107.148 -20.620 199.196 1.00 93.64  ? 152 GLN B CD  1 
ATOM   5653  O OE1 . GLN B 1 152 ? 107.277 -20.181 200.338 1.00 101.18 ? 152 GLN B OE1 1 
ATOM   5654  N NE2 . GLN B 1 152 ? 107.036 -19.830 198.134 1.00 111.14 ? 152 GLN B NE2 1 
ATOM   5655  N N   . ILE B 1 153 ? 106.250 -24.481 196.271 1.00 73.68  ? 153 ILE B N   1 
ATOM   5656  C CA  . ILE B 1 153 ? 105.288 -24.381 195.181 1.00 72.53  ? 153 ILE B CA  1 
ATOM   5657  C C   . ILE B 1 153 ? 104.473 -23.116 195.344 1.00 69.01  ? 153 ILE B C   1 
ATOM   5658  O O   . ILE B 1 153 ? 103.814 -22.906 196.361 1.00 71.41  ? 153 ILE B O   1 
ATOM   5659  C CB  . ILE B 1 153 ? 104.357 -25.587 195.117 1.00 75.54  ? 153 ILE B CB  1 
ATOM   5660  C CG1 . ILE B 1 153 ? 105.184 -26.856 194.956 1.00 68.46  ? 153 ILE B CG1 1 
ATOM   5661  C CG2 . ILE B 1 153 ? 103.394 -25.439 193.951 1.00 81.49  ? 153 ILE B CG2 1 
ATOM   5662  C CD1 . ILE B 1 153 ? 106.131 -26.804 193.787 1.00 69.36  ? 153 ILE B CD1 1 
ATOM   5663  N N   . ILE B 1 154 ? 104.523 -22.279 194.318 1.00 70.24  ? 154 ILE B N   1 
ATOM   5664  C CA  . ILE B 1 154 ? 103.903 -20.965 194.357 1.00 62.96  ? 154 ILE B CA  1 
ATOM   5665  C C   . ILE B 1 154 ? 102.644 -20.893 193.487 1.00 65.55  ? 154 ILE B C   1 
ATOM   5666  O O   . ILE B 1 154 ? 101.758 -20.082 193.749 1.00 66.33  ? 154 ILE B O   1 
ATOM   5667  C CB  . ILE B 1 154 ? 104.934 -19.873 193.938 1.00 102.43 ? 154 ILE B CB  1 
ATOM   5668  C CG1 . ILE B 1 154 ? 104.738 -18.586 194.747 1.00 122.67 ? 154 ILE B CG1 1 
ATOM   5669  C CG2 . ILE B 1 154 ? 104.902 -19.605 192.446 1.00 92.82  ? 154 ILE B CG2 1 
ATOM   5670  C CD1 . ILE B 1 154 ? 103.633 -17.681 194.238 1.00 134.76 ? 154 ILE B CD1 1 
ATOM   5671  N N   . ASN B 1 155 ? 102.565 -21.743 192.462 1.00 67.24  ? 155 ASN B N   1 
ATOM   5672  C CA  . ASN B 1 155 ? 101.410 -21.776 191.560 1.00 70.48  ? 155 ASN B CA  1 
ATOM   5673  C C   . ASN B 1 155 ? 101.231 -23.059 190.740 1.00 71.32  ? 155 ASN B C   1 
ATOM   5674  O O   . ASN B 1 155 ? 102.161 -23.852 190.591 1.00 71.76  ? 155 ASN B O   1 
ATOM   5675  C CB  . ASN B 1 155 ? 101.485 -20.603 190.586 1.00 68.97  ? 155 ASN B CB  1 
ATOM   5676  C CG  . ASN B 1 155 ? 100.130 -20.234 190.027 1.00 92.40  ? 155 ASN B CG  1 
ATOM   5677  O OD1 . ASN B 1 155 ? 99.885  -20.363 188.827 1.00 117.23 ? 155 ASN B OD1 1 
ATOM   5678  N ND2 . ASN B 1 155 ? 99.228  -19.810 190.898 1.00 102.99 ? 155 ASN B ND2 1 
ATOM   5679  N N   . TYR B 1 156 ? 100.005 -23.258 190.248 1.00 60.60  ? 156 TYR B N   1 
ATOM   5680  C CA  . TYR B 1 156 ? 99.663  -24.339 189.320 1.00 68.06  ? 156 TYR B CA  1 
ATOM   5681  C C   . TYR B 1 156 ? 98.609  -23.876 188.302 1.00 64.78  ? 156 TYR B C   1 
ATOM   5682  O O   . TYR B 1 156 ? 97.523  -23.440 188.680 1.00 60.81  ? 156 TYR B O   1 
ATOM   5683  C CB  . TYR B 1 156 ? 99.162  -25.576 190.066 1.00 63.44  ? 156 TYR B CB  1 
ATOM   5684  C CG  . TYR B 1 156 ? 98.786  -26.713 189.134 1.00 67.35  ? 156 TYR B CG  1 
ATOM   5685  C CD1 . TYR B 1 156 ? 99.760  -27.460 188.486 1.00 72.87  ? 156 TYR B CD1 1 
ATOM   5686  C CD2 . TYR B 1 156 ? 97.457  -27.042 188.906 1.00 72.25  ? 156 TYR B CD2 1 
ATOM   5687  C CE1 . TYR B 1 156 ? 99.419  -28.500 187.630 1.00 85.86  ? 156 TYR B CE1 1 
ATOM   5688  C CE2 . TYR B 1 156 ? 97.106  -28.078 188.054 1.00 69.51  ? 156 TYR B CE2 1 
ATOM   5689  C CZ  . TYR B 1 156 ? 98.091  -28.805 187.420 1.00 77.70  ? 156 TYR B CZ  1 
ATOM   5690  O OH  . TYR B 1 156 ? 97.744  -29.839 186.575 1.00 77.78  ? 156 TYR B OH  1 
ATOM   5691  N N   . ARG B 1 157 ? 98.933  -23.986 187.015 1.00 77.60  ? 157 ARG B N   1 
ATOM   5692  C CA  . ARG B 1 157 ? 98.063  -23.503 185.943 1.00 59.05  ? 157 ARG B CA  1 
ATOM   5693  C C   . ARG B 1 157 ? 97.838  -24.542 184.841 1.00 62.66  ? 157 ARG B C   1 
ATOM   5694  O O   . ARG B 1 157 ? 98.624  -25.472 184.685 1.00 77.02  ? 157 ARG B O   1 
ATOM   5695  C CB  . ARG B 1 157 ? 98.659  -22.236 185.332 1.00 60.60  ? 157 ARG B CB  1 
ATOM   5696  C CG  . ARG B 1 157 ? 98.309  -20.948 186.053 1.00 67.95  ? 157 ARG B CG  1 
ATOM   5697  C CD  . ARG B 1 157 ? 99.158  -19.811 185.517 1.00 70.02  ? 157 ARG B CD  1 
ATOM   5698  N NE  . ARG B 1 157 ? 98.612  -18.494 185.832 1.00 82.02  ? 157 ARG B NE  1 
ATOM   5699  C CZ  . ARG B 1 157 ? 97.706  -17.866 185.090 1.00 123.57 ? 157 ARG B CZ  1 
ATOM   5700  N NH1 . ARG B 1 157 ? 97.267  -16.669 185.449 1.00 141.09 ? 157 ARG B NH1 1 
ATOM   5701  N NH2 . ARG B 1 157 ? 97.240  -18.435 183.987 1.00 132.17 ? 157 ARG B NH2 1 
ATOM   5702  N N   . THR B 1 158 ? 96.750  -24.383 184.087 1.00 62.12  ? 158 THR B N   1 
ATOM   5703  C CA  . THR B 1 158 ? 96.420  -25.266 182.961 1.00 65.29  ? 158 THR B CA  1 
ATOM   5704  C C   . THR B 1 158 ? 95.854  -24.429 181.807 1.00 75.38  ? 158 THR B C   1 
ATOM   5705  O O   . THR B 1 158 ? 95.334  -23.346 182.044 1.00 85.97  ? 158 THR B O   1 
ATOM   5706  C CB  . THR B 1 158 ? 95.377  -26.356 183.344 1.00 80.69  ? 158 THR B CB  1 
ATOM   5707  O OG1 . THR B 1 158 ? 94.058  -25.801 183.268 1.00 81.76  ? 158 THR B OG1 1 
ATOM   5708  C CG2 . THR B 1 158 ? 95.604  -26.889 184.761 1.00 86.29  ? 158 THR B CG2 1 
ATOM   5709  N N   . ASP B 1 159 ? 95.935  -24.899 180.564 1.00 74.41  ? 159 ASP B N   1 
ATOM   5710  C CA  . ASP B 1 159 ? 95.282  -24.151 179.488 1.00 70.40  ? 159 ASP B CA  1 
ATOM   5711  C C   . ASP B 1 159 ? 93.786  -24.409 179.564 1.00 84.41  ? 159 ASP B C   1 
ATOM   5712  O O   . ASP B 1 159 ? 93.312  -25.175 180.410 1.00 80.19  ? 159 ASP B O   1 
ATOM   5713  C CB  . ASP B 1 159 ? 95.770  -24.526 178.092 1.00 72.19  ? 159 ASP B CB  1 
ATOM   5714  C CG  . ASP B 1 159 ? 95.299  -25.892 177.666 1.00 91.46  ? 159 ASP B CG  1 
ATOM   5715  O OD1 . ASP B 1 159 ? 95.700  -26.868 178.321 1.00 89.62  ? 159 ASP B OD1 1 
ATOM   5716  O OD2 . ASP B 1 159 ? 94.523  -25.990 176.686 1.00 112.23 ? 159 ASP B OD2 1 
ATOM   5717  N N   . ALA B 1 160 ? 93.054  -23.761 178.665 1.00 98.16  ? 160 ALA B N   1 
ATOM   5718  C CA  . ALA B 1 160 ? 91.605  -23.892 178.588 1.00 90.91  ? 160 ALA B CA  1 
ATOM   5719  C C   . ALA B 1 160 ? 91.168  -25.347 178.422 1.00 90.86  ? 160 ALA B C   1 
ATOM   5720  O O   . ALA B 1 160 ? 90.381  -25.859 179.214 1.00 97.24  ? 160 ALA B O   1 
ATOM   5721  C CB  . ALA B 1 160 ? 91.071  -23.049 177.437 1.00 89.58  ? 160 ALA B CB  1 
ATOM   5722  N N   . LYS B 1 161 ? 91.685  -26.006 177.391 1.00 80.13  ? 161 LYS B N   1 
ATOM   5723  C CA  . LYS B 1 161 ? 91.352  -27.402 177.109 1.00 86.26  ? 161 LYS B CA  1 
ATOM   5724  C C   . LYS B 1 161 ? 91.917  -28.399 178.133 1.00 82.41  ? 161 LYS B C   1 
ATOM   5725  O O   . LYS B 1 161 ? 91.605  -29.590 178.083 1.00 87.19  ? 161 LYS B O   1 
ATOM   5726  C CB  . LYS B 1 161 ? 91.823  -27.765 175.698 1.00 105.27 ? 161 LYS B CB  1 
ATOM   5727  C CG  . LYS B 1 161 ? 90.956  -27.171 174.587 1.00 117.73 ? 161 LYS B CG  1 
ATOM   5728  C CD  . LYS B 1 161 ? 91.603  -25.936 173.981 1.00 126.99 ? 161 LYS B CD  1 
ATOM   5729  C CE  . LYS B 1 161 ? 90.652  -25.212 173.032 1.00 134.31 ? 161 LYS B CE  1 
ATOM   5730  N NZ  . LYS B 1 161 ? 89.595  -24.435 173.744 1.00 135.30 ? 161 LYS B NZ  1 
ATOM   5731  N N   . GLN B 1 162 ? 92.753  -27.905 179.043 1.00 77.54  ? 162 GLN B N   1 
ATOM   5732  C CA  . GLN B 1 162 ? 93.391  -28.725 180.079 1.00 78.15  ? 162 GLN B CA  1 
ATOM   5733  C C   . GLN B 1 162 ? 94.227  -29.863 179.507 1.00 91.98  ? 162 GLN B C   1 
ATOM   5734  O O   . GLN B 1 162 ? 94.261  -30.965 180.054 1.00 93.37  ? 162 GLN B O   1 
ATOM   5735  C CB  . GLN B 1 162 ? 92.362  -29.290 181.064 1.00 88.69  ? 162 GLN B CB  1 
ATOM   5736  C CG  . GLN B 1 162 ? 91.767  -28.241 181.998 1.00 115.20 ? 162 GLN B CG  1 
ATOM   5737  C CD  . GLN B 1 162 ? 90.997  -28.859 183.155 1.00 133.61 ? 162 GLN B CD  1 
ATOM   5738  O OE1 . GLN B 1 162 ? 91.309  -29.965 183.602 1.00 141.04 ? 162 GLN B OE1 1 
ATOM   5739  N NE2 . GLN B 1 162 ? 90.005  -28.136 183.663 1.00 138.05 ? 162 GLN B NE2 1 
ATOM   5740  N N   . LYS B 1 163 ? 94.892  -29.591 178.394 1.00 100.12 ? 163 LYS B N   1 
ATOM   5741  C CA  . LYS B 1 163 ? 95.793  -30.558 177.786 1.00 102.75 ? 163 LYS B CA  1 
ATOM   5742  C C   . LYS B 1 163 ? 97.224  -30.220 178.201 1.00 88.14  ? 163 LYS B C   1 
ATOM   5743  O O   . LYS B 1 163 ? 98.145  -31.020 178.031 1.00 76.57  ? 163 LYS B O   1 
ATOM   5744  C CB  . LYS B 1 163 ? 95.646  -30.561 176.268 1.00 104.10 ? 163 LYS B CB  1 
ATOM   5745  C CG  . LYS B 1 163 ? 94.252  -30.946 175.775 1.00 108.99 ? 163 LYS B CG  1 
ATOM   5746  C CD  . LYS B 1 163 ? 94.174  -32.415 175.366 1.00 115.15 ? 163 LYS B CD  1 
ATOM   5747  C CE  . LYS B 1 163 ? 93.702  -33.307 176.505 1.00 121.25 ? 163 LYS B CE  1 
ATOM   5748  N NZ  . LYS B 1 163 ? 92.244  -33.136 176.751 1.00 123.36 ? 163 LYS B NZ  1 
ATOM   5749  N N   . TRP B 1 164 ? 97.404  -29.012 178.728 1.00 72.09  ? 164 TRP B N   1 
ATOM   5750  C CA  . TRP B 1 164 ? 98.709  -28.562 179.203 1.00 67.88  ? 164 TRP B CA  1 
ATOM   5751  C C   . TRP B 1 164 ? 98.648  -28.114 180.664 1.00 68.06  ? 164 TRP B C   1 
ATOM   5752  O O   . TRP B 1 164 ? 97.858  -27.246 181.026 1.00 80.93  ? 164 TRP B O   1 
ATOM   5753  C CB  . TRP B 1 164 ? 99.234  -27.423 178.327 1.00 70.79  ? 164 TRP B CB  1 
ATOM   5754  C CG  . TRP B 1 164 ? 99.509  -27.829 176.908 1.00 86.54  ? 164 TRP B CG  1 
ATOM   5755  C CD1 . TRP B 1 164 ? 98.649  -27.752 175.851 1.00 95.70  ? 164 TRP B CD1 1 
ATOM   5756  C CD2 . TRP B 1 164 ? 100.733 -28.364 176.390 1.00 86.61  ? 164 TRP B CD2 1 
ATOM   5757  N NE1 . TRP B 1 164 ? 99.262  -28.207 174.708 1.00 95.69  ? 164 TRP B NE1 1 
ATOM   5758  C CE2 . TRP B 1 164 ? 100.541 -28.592 175.013 1.00 86.40  ? 164 TRP B CE2 1 
ATOM   5759  C CE3 . TRP B 1 164 ? 101.972 -28.675 176.959 1.00 83.87  ? 164 TRP B CE3 1 
ATOM   5760  C CZ2 . TRP B 1 164 ? 101.542 -29.115 174.196 1.00 95.03  ? 164 TRP B CZ2 1 
ATOM   5761  C CZ3 . TRP B 1 164 ? 102.965 -29.191 176.146 1.00 90.70  ? 164 TRP B CZ3 1 
ATOM   5762  C CH2 . TRP B 1 164 ? 102.744 -29.407 174.780 1.00 101.65 ? 164 TRP B CH2 1 
ATOM   5763  N N   . LEU B 1 165 ? 99.503  -28.703 181.494 1.00 76.97  ? 165 LEU B N   1 
ATOM   5764  C CA  . LEU B 1 165 ? 99.523  -28.413 182.921 1.00 70.18  ? 165 LEU B CA  1 
ATOM   5765  C C   . LEU B 1 165 ? 100.858 -27.788 183.312 1.00 76.12  ? 165 LEU B C   1 
ATOM   5766  O O   . LEU B 1 165 ? 101.898 -28.144 182.757 1.00 74.73  ? 165 LEU B O   1 
ATOM   5767  C CB  . LEU B 1 165 ? 99.278  -29.689 183.721 1.00 63.93  ? 165 LEU B CB  1 
ATOM   5768  C CG  . LEU B 1 165 ? 98.193  -30.604 183.153 1.00 67.83  ? 165 LEU B CG  1 
ATOM   5769  C CD1 . LEU B 1 165 ? 98.219  -31.954 183.846 1.00 73.81  ? 165 LEU B CD1 1 
ATOM   5770  C CD2 . LEU B 1 165 ? 96.819  -29.962 183.259 1.00 68.77  ? 165 LEU B CD2 1 
ATOM   5771  N N   . LEU B 1 166 ? 100.842 -26.867 184.271 1.00 60.17  ? 166 LEU B N   1 
ATOM   5772  C CA  . LEU B 1 166 ? 102.073 -26.173 184.641 1.00 70.48  ? 166 LEU B CA  1 
ATOM   5773  C C   . LEU B 1 166 ? 102.236 -25.967 186.143 1.00 77.23  ? 166 LEU B C   1 
ATOM   5774  O O   . LEU B 1 166 ? 101.440 -25.283 186.780 1.00 92.52  ? 166 LEU B O   1 
ATOM   5775  C CB  . LEU B 1 166 ? 102.140 -24.812 183.952 1.00 57.97  ? 166 LEU B CB  1 
ATOM   5776  C CG  . LEU B 1 166 ? 103.447 -24.075 184.242 1.00 61.53  ? 166 LEU B CG  1 
ATOM   5777  C CD1 . LEU B 1 166 ? 104.550 -24.502 183.279 1.00 63.02  ? 166 LEU B CD1 1 
ATOM   5778  C CD2 . LEU B 1 166 ? 103.239 -22.587 184.213 1.00 59.35  ? 166 LEU B CD2 1 
ATOM   5779  N N   . LEU B 1 167 ? 103.290 -26.556 186.697 1.00 65.50  ? 167 LEU B N   1 
ATOM   5780  C CA  . LEU B 1 167 ? 103.606 -26.401 188.114 1.00 68.90  ? 167 LEU B CA  1 
ATOM   5781  C C   . LEU B 1 167 ? 104.819 -25.495 188.306 1.00 67.00  ? 167 LEU B C   1 
ATOM   5782  O O   . LEU B 1 167 ? 105.873 -25.722 187.713 1.00 77.38  ? 167 LEU B O   1 
ATOM   5783  C CB  . LEU B 1 167 ? 103.863 -27.761 188.761 1.00 60.49  ? 167 LEU B CB  1 
ATOM   5784  C CG  . LEU B 1 167 ? 104.042 -27.793 190.278 1.00 62.58  ? 167 LEU B CG  1 
ATOM   5785  C CD1 . LEU B 1 167 ? 102.725 -27.547 190.996 1.00 73.01  ? 167 LEU B CD1 1 
ATOM   5786  C CD2 . LEU B 1 167 ? 104.641 -29.120 190.701 1.00 65.35  ? 167 LEU B CD2 1 
ATOM   5787  N N   . THR B 1 168 ? 104.672 -24.468 189.136 1.00 63.09  ? 168 THR B N   1 
ATOM   5788  C CA  . THR B 1 168 ? 105.773 -23.542 189.389 1.00 58.36  ? 168 THR B CA  1 
ATOM   5789  C C   . THR B 1 168 ? 106.238 -23.574 190.841 1.00 63.71  ? 168 THR B C   1 
ATOM   5790  O O   . THR B 1 168 ? 105.429 -23.475 191.767 1.00 76.91  ? 168 THR B O   1 
ATOM   5791  C CB  . THR B 1 168 ? 105.384 -22.100 189.038 1.00 55.34  ? 168 THR B CB  1 
ATOM   5792  O OG1 . THR B 1 168 ? 104.744 -22.077 187.757 1.00 63.46  ? 168 THR B OG1 1 
ATOM   5793  C CG2 . THR B 1 168 ? 106.621 -21.214 189.004 1.00 52.16  ? 168 THR B CG2 1 
ATOM   5794  N N   . GLY B 1 169 ? 107.549 -23.693 191.028 1.00 75.91  ? 169 GLY B N   1 
ATOM   5795  C CA  . GLY B 1 169 ? 108.140 -23.690 192.352 1.00 81.73  ? 169 GLY B CA  1 
ATOM   5796  C C   . GLY B 1 169 ? 109.367 -22.798 192.386 1.00 84.19  ? 169 GLY B C   1 
ATOM   5797  O O   . GLY B 1 169 ? 110.080 -22.677 191.391 1.00 80.84  ? 169 GLY B O   1 
ATOM   5798  N N   . ILE B 1 170 ? 109.627 -22.176 193.530 1.00 82.13  ? 170 ILE B N   1 
ATOM   5799  C CA  . ILE B 1 170 ? 110.790 -21.303 193.661 1.00 70.63  ? 170 ILE B CA  1 
ATOM   5800  C C   . ILE B 1 170 ? 111.677 -21.695 194.835 1.00 75.26  ? 170 ILE B C   1 
ATOM   5801  O O   . ILE B 1 170 ? 111.208 -22.259 195.822 1.00 69.44  ? 170 ILE B O   1 
ATOM   5802  C CB  . ILE B 1 170 ? 110.377 -19.828 193.806 1.00 66.36  ? 170 ILE B CB  1 
ATOM   5803  C CG1 . ILE B 1 170 ? 109.278 -19.672 194.852 1.00 66.21  ? 170 ILE B CG1 1 
ATOM   5804  C CG2 . ILE B 1 170 ? 109.926 -19.273 192.463 1.00 68.34  ? 170 ILE B CG2 1 
ATOM   5805  C CD1 . ILE B 1 170 ? 109.568 -18.570 195.863 1.00 69.07  ? 170 ILE B CD1 1 
ATOM   5806  N N   . SER B 1 171 ? 112.962 -21.381 194.719 1.00 77.22  ? 171 SER B N   1 
ATOM   5807  C CA  . SER B 1 171 ? 113.939 -21.733 195.740 1.00 73.43  ? 171 SER B CA  1 
ATOM   5808  C C   . SER B 1 171 ? 115.060 -20.704 195.777 1.00 76.31  ? 171 SER B C   1 
ATOM   5809  O O   . SER B 1 171 ? 115.335 -20.038 194.780 1.00 78.16  ? 171 SER B O   1 
ATOM   5810  C CB  . SER B 1 171 ? 114.505 -23.130 195.483 1.00 82.54  ? 171 SER B CB  1 
ATOM   5811  O OG  . SER B 1 171 ? 115.142 -23.190 194.219 1.00 95.61  ? 171 SER B OG  1 
ATOM   5812  N N   . ALA B 1 172 ? 115.681 -20.555 196.942 1.00 87.75  ? 172 ALA B N   1 
ATOM   5813  C CA  . ALA B 1 172 ? 116.762 -19.592 197.125 1.00 79.82  ? 172 ALA B CA  1 
ATOM   5814  C C   . ALA B 1 172 ? 118.133 -20.166 196.771 1.00 87.49  ? 172 ALA B C   1 
ATOM   5815  O O   . ALA B 1 172 ? 118.668 -21.010 197.486 1.00 110.33 ? 172 ALA B O   1 
ATOM   5816  C CB  . ALA B 1 172 ? 116.765 -19.079 198.555 1.00 80.68  ? 172 ALA B CB  1 
ATOM   5817  N N   . GLN B 1 173 ? 118.698 -19.702 195.662 1.00 94.68  ? 173 GLN B N   1 
ATOM   5818  C CA  . GLN B 1 173 ? 120.008 -20.162 195.220 1.00 91.87  ? 173 GLN B CA  1 
ATOM   5819  C C   . GLN B 1 173 ? 120.925 -18.963 194.987 1.00 88.12  ? 173 GLN B C   1 
ATOM   5820  O O   . GLN B 1 173 ? 120.719 -18.185 194.054 1.00 86.38  ? 173 GLN B O   1 
ATOM   5821  C CB  . GLN B 1 173 ? 119.894 -21.006 193.946 1.00 94.32  ? 173 GLN B CB  1 
ATOM   5822  C CG  . GLN B 1 173 ? 118.898 -22.165 194.015 1.00 106.03 ? 173 GLN B CG  1 
ATOM   5823  C CD  . GLN B 1 173 ? 119.379 -23.316 194.881 1.00 135.57 ? 173 GLN B CD  1 
ATOM   5824  O OE1 . GLN B 1 173 ? 120.385 -23.957 194.577 1.00 148.51 ? 173 GLN B OE1 1 
ATOM   5825  N NE2 . GLN B 1 173 ? 118.653 -23.592 195.959 1.00 135.33 ? 173 GLN B NE2 1 
ATOM   5826  N N   . GLN B 1 174 ? 121.931 -18.830 195.850 1.00 102.35 ? 174 GLN B N   1 
ATOM   5827  C CA  . GLN B 1 174 ? 122.918 -17.751 195.780 1.00 118.64 ? 174 GLN B CA  1 
ATOM   5828  C C   . GLN B 1 174 ? 122.272 -16.377 195.906 1.00 114.57 ? 174 GLN B C   1 
ATOM   5829  O O   . GLN B 1 174 ? 122.468 -15.516 195.047 1.00 100.09 ? 174 GLN B O   1 
ATOM   5830  C CB  . GLN B 1 174 ? 123.712 -17.825 194.471 1.00 117.18 ? 174 GLN B CB  1 
ATOM   5831  C CG  . GLN B 1 174 ? 124.415 -19.145 194.232 1.00 124.76 ? 174 GLN B CG  1 
ATOM   5832  C CD  . GLN B 1 174 ? 125.494 -19.410 195.256 1.00 139.78 ? 174 GLN B CD  1 
ATOM   5833  O OE1 . GLN B 1 174 ? 126.382 -18.583 195.460 1.00 136.83 ? 174 GLN B OE1 1 
ATOM   5834  N NE2 . GLN B 1 174 ? 125.433 -20.571 195.900 1.00 153.05 ? 174 GLN B NE2 1 
ATOM   5835  N N   . ASN B 1 175 ? 121.494 -16.188 196.970 1.00 107.44 ? 175 ASN B N   1 
ATOM   5836  C CA  . ASN B 1 175 ? 120.812 -14.924 197.240 1.00 101.49 ? 175 ASN B CA  1 
ATOM   5837  C C   . ASN B 1 175 ? 119.943 -14.468 196.080 1.00 97.07  ? 175 ASN B C   1 
ATOM   5838  O O   . ASN B 1 175 ? 119.714 -13.274 195.890 1.00 96.23  ? 175 ASN B O   1 
ATOM   5839  C CB  . ASN B 1 175 ? 121.815 -13.831 197.605 1.00 114.49 ? 175 ASN B CB  1 
ATOM   5840  C CG  . ASN B 1 175 ? 122.841 -14.303 198.603 1.00 128.69 ? 175 ASN B CG  1 
ATOM   5841  O OD1 . ASN B 1 175 ? 122.496 -14.896 199.623 1.00 125.00 ? 175 ASN B OD1 1 
ATOM   5842  N ND2 . ASN B 1 175 ? 124.109 -14.016 198.333 1.00 135.13 ? 175 ASN B ND2 1 
ATOM   5843  N N   . ARG B 1 176 ? 119.442 -15.432 195.323 1.00 91.45  ? 176 ARG B N   1 
ATOM   5844  C CA  . ARG B 1 176 ? 118.600 -15.135 194.187 1.00 82.23  ? 176 ARG B CA  1 
ATOM   5845  C C   . ARG B 1 176 ? 117.467 -16.139 194.203 1.00 79.33  ? 176 ARG B C   1 
ATOM   5846  O O   . ARG B 1 176 ? 117.681 -17.331 194.413 1.00 82.98  ? 176 ARG B O   1 
ATOM   5847  C CB  . ARG B 1 176 ? 119.396 -15.212 192.881 1.00 82.22  ? 176 ARG B CB  1 
ATOM   5848  C CG  . ARG B 1 176 ? 119.316 -13.978 192.002 1.00 118.00 ? 176 ARG B CG  1 
ATOM   5849  C CD  . ARG B 1 176 ? 118.108 -14.029 191.080 1.00 148.83 ? 176 ARG B CD  1 
ATOM   5850  N NE  . ARG B 1 176 ? 118.297 -13.214 189.882 1.00 165.41 ? 176 ARG B NE  1 
ATOM   5851  C CZ  . ARG B 1 176 ? 118.751 -13.685 188.724 1.00 165.70 ? 176 ARG B CZ  1 
ATOM   5852  N NH1 . ARG B 1 176 ? 118.890 -12.874 187.684 1.00 151.50 ? 176 ARG B NH1 1 
ATOM   5853  N NH2 . ARG B 1 176 ? 119.070 -14.967 188.606 1.00 167.02 ? 176 ARG B NH2 1 
ATOM   5854  N N   . VAL B 1 177 ? 116.253 -15.656 193.983 1.00 90.51  ? 177 VAL B N   1 
ATOM   5855  C CA  . VAL B 1 177 ? 115.109 -16.546 193.943 1.00 85.01  ? 177 VAL B CA  1 
ATOM   5856  C C   . VAL B 1 177 ? 115.023 -17.176 192.568 1.00 81.03  ? 177 VAL B C   1 
ATOM   5857  O O   . VAL B 1 177 ? 114.812 -16.486 191.573 1.00 93.70  ? 177 VAL B O   1 
ATOM   5858  C CB  . VAL B 1 177 ? 113.809 -15.817 194.276 1.00 73.52  ? 177 VAL B CB  1 
ATOM   5859  C CG1 . VAL B 1 177 ? 112.628 -16.735 194.031 1.00 80.14  ? 177 VAL B CG1 1 
ATOM   5860  C CG2 . VAL B 1 177 ? 113.827 -15.352 195.719 1.00 73.68  ? 177 VAL B CG2 1 
ATOM   5861  N N   . VAL B 1 178 ? 115.173 -18.493 192.519 1.00 68.01  ? 178 VAL B N   1 
ATOM   5862  C CA  . VAL B 1 178 ? 115.209 -19.197 191.244 1.00 66.24  ? 178 VAL B CA  1 
ATOM   5863  C C   . VAL B 1 178 ? 113.912 -19.943 190.976 1.00 70.01  ? 178 VAL B C   1 
ATOM   5864  O O   . VAL B 1 178 ? 113.504 -20.806 191.755 1.00 67.87  ? 178 VAL B O   1 
ATOM   5865  C CB  . VAL B 1 178 ? 116.373 -20.194 191.192 1.00 69.32  ? 178 VAL B CB  1 
ATOM   5866  C CG1 . VAL B 1 178 ? 116.507 -20.768 189.797 1.00 68.62  ? 178 VAL B CG1 1 
ATOM   5867  C CG2 . VAL B 1 178 ? 117.661 -19.516 191.615 1.00 70.78  ? 178 VAL B CG2 1 
ATOM   5868  N N   . GLY B 1 179 ? 113.288 -19.625 189.849 1.00 75.09  ? 179 GLY B N   1 
ATOM   5869  C CA  . GLY B 1 179 ? 112.024 -20.228 189.485 1.00 72.49  ? 179 GLY B CA  1 
ATOM   5870  C C   . GLY B 1 179 ? 112.151 -21.502 188.676 1.00 74.09  ? 179 GLY B C   1 
ATOM   5871  O O   . GLY B 1 179 ? 112.839 -21.539 187.659 1.00 89.89  ? 179 GLY B O   1 
ATOM   5872  N N   . ALA B 1 180 ? 111.479 -22.555 189.125 1.00 66.64  ? 180 ALA B N   1 
ATOM   5873  C CA  . ALA B 1 180 ? 111.498 -23.829 188.417 1.00 61.51  ? 180 ALA B CA  1 
ATOM   5874  C C   . ALA B 1 180 ? 110.087 -24.236 188.012 1.00 73.70  ? 180 ALA B C   1 
ATOM   5875  O O   . ALA B 1 180 ? 109.179 -24.274 188.843 1.00 80.52  ? 180 ALA B O   1 
ATOM   5876  C CB  . ALA B 1 180 ? 112.140 -24.906 189.269 1.00 63.32  ? 180 ALA B CB  1 
ATOM   5877  N N   . MET B 1 181 ? 109.906 -24.546 186.734 1.00 72.24  ? 181 MET B N   1 
ATOM   5878  C CA  . MET B 1 181 ? 108.603 -24.950 186.236 1.00 59.10  ? 181 MET B CA  1 
ATOM   5879  C C   . MET B 1 181 ? 108.639 -26.314 185.555 1.00 64.46  ? 181 MET B C   1 
ATOM   5880  O O   . MET B 1 181 ? 109.668 -26.739 185.029 1.00 79.37  ? 181 MET B O   1 
ATOM   5881  C CB  . MET B 1 181 ? 108.064 -23.905 185.261 1.00 58.96  ? 181 MET B CB  1 
ATOM   5882  C CG  . MET B 1 181 ? 108.033 -22.496 185.826 1.00 60.22  ? 181 MET B CG  1 
ATOM   5883  S SD  . MET B 1 181 ? 107.088 -21.359 184.804 1.00 84.42  ? 181 MET B SD  1 
ATOM   5884  C CE  . MET B 1 181 ? 107.852 -21.623 183.204 1.00 86.84  ? 181 MET B CE  1 
ATOM   5885  N N   . GLN B 1 182 ? 107.501 -26.998 185.587 1.00 69.36  ? 182 GLN B N   1 
ATOM   5886  C CA  . GLN B 1 182 ? 107.332 -28.280 184.918 1.00 69.82  ? 182 GLN B CA  1 
ATOM   5887  C C   . GLN B 1 182 ? 106.125 -28.198 184.000 1.00 85.30  ? 182 GLN B C   1 
ATOM   5888  O O   . GLN B 1 182 ? 104.988 -28.114 184.460 1.00 98.92  ? 182 GLN B O   1 
ATOM   5889  C CB  . GLN B 1 182 ? 107.157 -29.408 185.934 1.00 63.51  ? 182 GLN B CB  1 
ATOM   5890  C CG  . GLN B 1 182 ? 107.019 -30.789 185.318 1.00 73.63  ? 182 GLN B CG  1 
ATOM   5891  C CD  . GLN B 1 182 ? 106.769 -31.862 186.356 1.00 82.63  ? 182 GLN B CD  1 
ATOM   5892  O OE1 . GLN B 1 182 ? 106.836 -31.604 187.557 1.00 78.83  ? 182 GLN B OE1 1 
ATOM   5893  N NE2 . GLN B 1 182 ? 106.485 -33.076 185.899 1.00 87.07  ? 182 GLN B NE2 1 
ATOM   5894  N N   . LEU B 1 183 ? 106.376 -28.225 182.698 1.00 75.82  ? 183 LEU B N   1 
ATOM   5895  C CA  . LEU B 1 183 ? 105.296 -28.168 181.722 1.00 78.54  ? 183 LEU B CA  1 
ATOM   5896  C C   . LEU B 1 183 ? 104.944 -29.565 181.248 1.00 76.01  ? 183 LEU B C   1 
ATOM   5897  O O   . LEU B 1 183 ? 105.723 -30.208 180.547 1.00 70.27  ? 183 LEU B O   1 
ATOM   5898  C CB  . LEU B 1 183 ? 105.687 -27.292 180.535 1.00 71.23  ? 183 LEU B CB  1 
ATOM   5899  C CG  . LEU B 1 183 ? 104.603 -27.126 179.471 1.00 66.13  ? 183 LEU B CG  1 
ATOM   5900  C CD1 . LEU B 1 183 ? 103.440 -26.319 180.023 1.00 65.35  ? 183 LEU B CD1 1 
ATOM   5901  C CD2 . LEU B 1 183 ? 105.180 -26.462 178.239 1.00 66.15  ? 183 LEU B CD2 1 
ATOM   5902  N N   . TYR B 1 184 ? 103.761 -30.029 181.633 1.00 76.22  ? 184 TYR B N   1 
ATOM   5903  C CA  . TYR B 1 184 ? 103.327 -31.377 181.292 1.00 77.23  ? 184 TYR B CA  1 
ATOM   5904  C C   . TYR B 1 184 ? 102.250 -31.415 180.213 1.00 74.09  ? 184 TYR B C   1 
ATOM   5905  O O   . TYR B 1 184 ? 101.252 -30.694 180.275 1.00 78.50  ? 184 TYR B O   1 
ATOM   5906  C CB  . TYR B 1 184 ? 102.841 -32.102 182.544 1.00 72.47  ? 184 TYR B CB  1 
ATOM   5907  C CG  . TYR B 1 184 ? 102.335 -33.501 182.280 1.00 75.59  ? 184 TYR B CG  1 
ATOM   5908  C CD1 . TYR B 1 184 ? 103.216 -34.553 182.070 1.00 78.12  ? 184 TYR B CD1 1 
ATOM   5909  C CD2 . TYR B 1 184 ? 100.973 -33.777 182.284 1.00 82.52  ? 184 TYR B CD2 1 
ATOM   5910  C CE1 . TYR B 1 184 ? 102.750 -35.837 181.838 1.00 92.13  ? 184 TYR B CE1 1 
ATOM   5911  C CE2 . TYR B 1 184 ? 100.501 -35.052 182.060 1.00 94.61  ? 184 TYR B CE2 1 
ATOM   5912  C CZ  . TYR B 1 184 ? 101.391 -36.079 181.836 1.00 91.04  ? 184 TYR B CZ  1 
ATOM   5913  O OH  . TYR B 1 184 ? 100.910 -37.349 181.613 1.00 88.92  ? 184 TYR B OH  1 
ATOM   5914  N N   . SER B 1 185 ? 102.479 -32.259 179.214 1.00 74.46  ? 185 SER B N   1 
ATOM   5915  C CA  . SER B 1 185 ? 101.519 -32.472 178.145 1.00 75.73  ? 185 SER B CA  1 
ATOM   5916  C C   . SER B 1 185 ? 100.697 -33.718 178.429 1.00 81.55  ? 185 SER B C   1 
ATOM   5917  O O   . SER B 1 185 ? 101.239 -34.807 178.601 1.00 83.60  ? 185 SER B O   1 
ATOM   5918  C CB  . SER B 1 185 ? 102.229 -32.607 176.801 1.00 79.51  ? 185 SER B CB  1 
ATOM   5919  O OG  . SER B 1 185 ? 101.294 -32.701 175.741 1.00 100.47 ? 185 SER B OG  1 
ATOM   5920  N N   . VAL B 1 186 ? 99.382  -33.550 178.482 1.00 81.47  ? 186 VAL B N   1 
ATOM   5921  C CA  . VAL B 1 186 ? 98.487  -34.667 178.754 1.00 88.85  ? 186 VAL B CA  1 
ATOM   5922  C C   . VAL B 1 186 ? 98.510  -35.656 177.599 1.00 97.48  ? 186 VAL B C   1 
ATOM   5923  O O   . VAL B 1 186 ? 98.620  -36.863 177.796 1.00 100.48 ? 186 VAL B O   1 
ATOM   5924  C CB  . VAL B 1 186 ? 97.047  -34.193 178.991 1.00 86.92  ? 186 VAL B CB  1 
ATOM   5925  C CG1 . VAL B 1 186 ? 96.124  -35.385 179.203 1.00 92.86  ? 186 VAL B CG1 1 
ATOM   5926  C CG2 . VAL B 1 186 ? 96.998  -33.268 180.192 1.00 83.55  ? 186 VAL B CG2 1 
ATOM   5927  N N   . ASP B 1 187 ? 98.380  -35.127 176.389 1.00 104.30 ? 187 ASP B N   1 
ATOM   5928  C CA  . ASP B 1 187 ? 98.407  -35.945 175.189 1.00 116.86 ? 187 ASP B CA  1 
ATOM   5929  C C   . ASP B 1 187 ? 99.763  -36.600 175.016 1.00 117.77 ? 187 ASP B C   1 
ATOM   5930  O O   . ASP B 1 187 ? 99.851  -37.808 174.793 1.00 117.15 ? 187 ASP B O   1 
ATOM   5931  C CB  . ASP B 1 187 ? 98.067  -35.115 173.957 1.00 129.68 ? 187 ASP B CB  1 
ATOM   5932  C CG  . ASP B 1 187 ? 96.615  -34.707 173.925 1.00 140.39 ? 187 ASP B CG  1 
ATOM   5933  O OD1 . ASP B 1 187 ? 95.816  -35.309 174.677 1.00 139.94 ? 187 ASP B OD1 1 
ATOM   5934  O OD2 . ASP B 1 187 ? 96.269  -33.798 173.146 1.00 144.31 ? 187 ASP B OD2 1 
ATOM   5935  N N   . ARG B 1 188 ? 100.822 -35.804 175.104 1.00 117.25 ? 188 ARG B N   1 
ATOM   5936  C CA  . ARG B 1 188 ? 102.172 -36.329 174.923 1.00 103.11 ? 188 ARG B CA  1 
ATOM   5937  C C   . ARG B 1 188 ? 102.743 -37.057 176.137 1.00 100.59 ? 188 ARG B C   1 
ATOM   5938  O O   . ARG B 1 188 ? 103.770 -37.709 176.014 1.00 115.40 ? 188 ARG B O   1 
ATOM   5939  C CB  . ARG B 1 188 ? 103.096 -35.191 174.472 1.00 94.33  ? 188 ARG B CB  1 
ATOM   5940  C CG  . ARG B 1 188 ? 103.163 -35.057 172.960 1.00 99.97  ? 188 ARG B CG  1 
ATOM   5941  C CD  . ARG B 1 188 ? 103.295 -33.614 172.478 1.00 118.41 ? 188 ARG B CD  1 
ATOM   5942  N NE  . ARG B 1 188 ? 102.037 -33.070 171.962 1.00 134.42 ? 188 ARG B NE  1 
ATOM   5943  C CZ  . ARG B 1 188 ? 101.928 -32.328 170.861 1.00 133.56 ? 188 ARG B CZ  1 
ATOM   5944  N NH1 . ARG B 1 188 ? 100.741 -31.874 170.485 1.00 141.96 ? 188 ARG B NH1 1 
ATOM   5945  N NH2 . ARG B 1 188 ? 102.998 -32.039 170.130 1.00 118.65 ? 188 ARG B NH2 1 
ATOM   5946  N N   . LYS B 1 189 ? 102.078 -36.949 177.286 1.00 94.79  ? 189 LYS B N   1 
ATOM   5947  C CA  . LYS B 1 189 ? 102.487 -37.647 178.514 1.00 88.57  ? 189 LYS B CA  1 
ATOM   5948  C C   . LYS B 1 189 ? 103.957 -37.448 178.891 1.00 92.23  ? 189 LYS B C   1 
ATOM   5949  O O   . LYS B 1 189 ? 104.600 -38.363 179.397 1.00 105.76 ? 189 LYS B O   1 
ATOM   5950  C CB  . LYS B 1 189 ? 102.197 -39.147 178.407 1.00 92.69  ? 189 LYS B CB  1 
ATOM   5951  C CG  . LYS B 1 189 ? 101.092 -39.615 179.355 1.00 120.95 ? 189 LYS B CG  1 
ATOM   5952  C CD  . LYS B 1 189 ? 101.540 -40.821 180.168 1.00 139.09 ? 189 LYS B CD  1 
ATOM   5953  C CE  . LYS B 1 189 ? 100.694 -40.996 181.424 1.00 144.23 ? 189 LYS B CE  1 
ATOM   5954  N NZ  . LYS B 1 189 ? 101.025 -40.001 182.482 1.00 144.31 ? 189 LYS B NZ  1 
ATOM   5955  N N   . VAL B 1 190 ? 104.495 -36.266 178.616 1.00 86.02  ? 190 VAL B N   1 
ATOM   5956  C CA  . VAL B 1 190 ? 105.887 -35.955 178.937 1.00 89.26  ? 190 VAL B CA  1 
ATOM   5957  C C   . VAL B 1 190 ? 106.027 -34.580 179.575 1.00 96.63  ? 190 VAL B C   1 
ATOM   5958  O O   . VAL B 1 190 ? 105.218 -33.689 179.335 1.00 96.02  ? 190 VAL B O   1 
ATOM   5959  C CB  . VAL B 1 190 ? 106.784 -36.035 177.698 1.00 92.33  ? 190 VAL B CB  1 
ATOM   5960  C CG1 . VAL B 1 190 ? 106.980 -37.487 177.268 1.00 98.47  ? 190 VAL B CG1 1 
ATOM   5961  C CG2 . VAL B 1 190 ? 106.214 -35.182 176.581 1.00 96.20  ? 190 VAL B CG2 1 
ATOM   5962  N N   . SER B 1 191 ? 107.058 -34.424 180.398 1.00 97.29  ? 191 SER B N   1 
ATOM   5963  C CA  . SER B 1 191 ? 107.320 -33.165 181.083 1.00 82.82  ? 191 SER B CA  1 
ATOM   5964  C C   . SER B 1 191 ? 108.569 -32.456 180.570 1.00 82.85  ? 191 SER B C   1 
ATOM   5965  O O   . SER B 1 191 ? 109.540 -33.093 180.160 1.00 97.47  ? 191 SER B O   1 
ATOM   5966  C CB  . SER B 1 191 ? 107.447 -33.402 182.587 1.00 77.18  ? 191 SER B CB  1 
ATOM   5967  O OG  . SER B 1 191 ? 106.211 -33.829 183.131 1.00 96.29  ? 191 SER B OG  1 
ATOM   5968  N N   . GLN B 1 192 ? 108.516 -31.128 180.570 1.00 75.57  ? 192 GLN B N   1 
ATOM   5969  C CA  . GLN B 1 192 ? 109.655 -30.298 180.195 1.00 71.71  ? 192 GLN B CA  1 
ATOM   5970  C C   . GLN B 1 192 ? 110.001 -29.363 181.352 1.00 81.63  ? 192 GLN B C   1 
ATOM   5971  O O   . GLN B 1 192 ? 109.176 -28.539 181.746 1.00 77.86  ? 192 GLN B O   1 
ATOM   5972  C CB  . GLN B 1 192 ? 109.340 -29.484 178.935 1.00 72.65  ? 192 GLN B CB  1 
ATOM   5973  C CG  . GLN B 1 192 ? 109.994 -29.973 177.640 1.00 108.71 ? 192 GLN B CG  1 
ATOM   5974  C CD  . GLN B 1 192 ? 111.503 -29.781 177.612 1.00 117.84 ? 192 GLN B CD  1 
ATOM   5975  O OE1 . GLN B 1 192 ? 112.013 -28.706 177.933 1.00 120.76 ? 192 GLN B OE1 1 
ATOM   5976  N NE2 . GLN B 1 192 ? 112.223 -30.817 177.196 1.00 109.33 ? 192 GLN B NE2 1 
ATOM   5977  N N   . PRO B 1 193 ? 111.220 -29.486 181.908 1.00 77.99  ? 193 PRO B N   1 
ATOM   5978  C CA  . PRO B 1 193 ? 111.584 -28.533 182.961 1.00 71.25  ? 193 PRO B CA  1 
ATOM   5979  C C   . PRO B 1 193 ? 111.972 -27.181 182.376 1.00 70.19  ? 193 PRO B C   1 
ATOM   5980  O O   . PRO B 1 193 ? 112.765 -27.118 181.438 1.00 77.45  ? 193 PRO B O   1 
ATOM   5981  C CB  . PRO B 1 193 ? 112.774 -29.204 183.660 1.00 68.70  ? 193 PRO B CB  1 
ATOM   5982  C CG  . PRO B 1 193 ? 113.267 -30.271 182.715 1.00 73.12  ? 193 PRO B CG  1 
ATOM   5983  C CD  . PRO B 1 193 ? 112.353 -30.341 181.520 1.00 71.01  ? 193 PRO B CD  1 
ATOM   5984  N N   . ILE B 1 194 ? 111.414 -26.110 182.930 1.00 62.22  ? 194 ILE B N   1 
ATOM   5985  C CA  . ILE B 1 194 ? 111.651 -24.763 182.420 1.00 60.81  ? 194 ILE B CA  1 
ATOM   5986  C C   . ILE B 1 194 ? 112.010 -23.801 183.548 1.00 63.68  ? 194 ILE B C   1 
ATOM   5987  O O   . ILE B 1 194 ? 111.392 -23.833 184.605 1.00 81.85  ? 194 ILE B O   1 
ATOM   5988  C CB  . ILE B 1 194 ? 110.411 -24.227 181.673 1.00 60.89  ? 194 ILE B CB  1 
ATOM   5989  C CG1 . ILE B 1 194 ? 110.030 -25.161 180.524 1.00 61.26  ? 194 ILE B CG1 1 
ATOM   5990  C CG2 . ILE B 1 194 ? 110.649 -22.813 181.166 1.00 60.64  ? 194 ILE B CG2 1 
ATOM   5991  C CD1 . ILE B 1 194 ? 108.652 -24.901 179.957 1.00 60.61  ? 194 ILE B CD1 1 
ATOM   5992  N N   . GLU B 1 195 ? 113.005 -22.947 183.335 1.00 64.08  ? 195 GLU B N   1 
ATOM   5993  C CA  . GLU B 1 195 ? 113.319 -21.937 184.339 1.00 68.44  ? 195 GLU B CA  1 
ATOM   5994  C C   . GLU B 1 195 ? 112.413 -20.729 184.135 1.00 71.40  ? 195 GLU B C   1 
ATOM   5995  O O   . GLU B 1 195 ? 112.590 -19.953 183.195 1.00 77.12  ? 195 GLU B O   1 
ATOM   5996  C CB  . GLU B 1 195 ? 114.786 -21.511 184.281 1.00 64.70  ? 195 GLU B CB  1 
ATOM   5997  C CG  . GLU B 1 195 ? 115.218 -20.706 185.508 1.00 83.98  ? 195 GLU B CG  1 
ATOM   5998  C CD  . GLU B 1 195 ? 116.505 -19.933 185.291 1.00 112.47 ? 195 GLU B CD  1 
ATOM   5999  O OE1 . GLU B 1 195 ? 117.041 -19.957 184.162 1.00 129.53 ? 195 GLU B OE1 1 
ATOM   6000  O OE2 . GLU B 1 195 ? 116.985 -19.301 186.257 1.00 112.60 ? 195 GLU B OE2 1 
ATOM   6001  N N   . GLY B 1 196 ? 111.443 -20.577 185.029 1.00 58.15  ? 196 GLY B N   1 
ATOM   6002  C CA  . GLY B 1 196 ? 110.482 -19.494 184.939 1.00 62.13  ? 196 GLY B CA  1 
ATOM   6003  C C   . GLY B 1 196 ? 109.963 -19.074 186.297 1.00 66.16  ? 196 GLY B C   1 
ATOM   6004  O O   . GLY B 1 196 ? 109.858 -19.891 187.211 1.00 83.72  ? 196 GLY B O   1 
ATOM   6005  N N   . HIS B 1 197 ? 109.640 -17.792 186.429 1.00 65.98  ? 197 HIS B N   1 
ATOM   6006  C CA  . HIS B 1 197 ? 109.132 -17.267 187.686 1.00 74.23  ? 197 HIS B CA  1 
ATOM   6007  C C   . HIS B 1 197 ? 107.611 -17.153 187.684 1.00 67.78  ? 197 HIS B C   1 
ATOM   6008  O O   . HIS B 1 197 ? 106.962 -17.456 188.679 1.00 71.32  ? 197 HIS B O   1 
ATOM   6009  C CB  . HIS B 1 197 ? 109.761 -15.904 187.975 1.00 65.48  ? 197 HIS B CB  1 
ATOM   6010  C CG  . HIS B 1 197 ? 111.113 -15.985 188.615 1.00 68.05  ? 197 HIS B CG  1 
ATOM   6011  N ND1 . HIS B 1 197 ? 112.274 -15.723 187.928 1.00 66.98  ? 197 HIS B ND1 1 
ATOM   6012  C CD2 . HIS B 1 197 ? 111.489 -16.305 189.880 1.00 70.88  ? 197 HIS B CD2 1 
ATOM   6013  C CE1 . HIS B 1 197 ? 113.312 -15.875 188.732 1.00 68.95  ? 197 HIS B CE1 1 
ATOM   6014  N NE2 . HIS B 1 197 ? 112.859 -16.225 189.925 1.00 66.56  ? 197 HIS B NE2 1 
ATOM   6015  N N   . ALA B 1 198 ? 107.054 -16.711 186.561 1.00 54.04  ? 198 ALA B N   1 
ATOM   6016  C CA  . ALA B 1 198 ? 105.612 -16.529 186.430 1.00 57.47  ? 198 ALA B CA  1 
ATOM   6017  C C   . ALA B 1 198 ? 105.152 -16.877 185.023 1.00 65.17  ? 198 ALA B C   1 
ATOM   6018  O O   . ALA B 1 198 ? 105.826 -16.545 184.051 1.00 57.89  ? 198 ALA B O   1 
ATOM   6019  C CB  . ALA B 1 198 ? 105.223 -15.104 186.769 1.00 61.55  ? 198 ALA B CB  1 
ATOM   6020  N N   . ALA B 1 199 ? 104.011 -17.548 184.910 1.00 80.22  ? 199 ALA B N   1 
ATOM   6021  C CA  . ALA B 1 199 ? 103.527 -17.963 183.601 1.00 70.77  ? 199 ALA B CA  1 
ATOM   6022  C C   . ALA B 1 199 ? 102.009 -17.938 183.485 1.00 73.13  ? 199 ALA B C   1 
ATOM   6023  O O   . ALA B 1 199 ? 101.299 -17.774 184.475 1.00 82.03  ? 199 ALA B O   1 
ATOM   6024  C CB  . ALA B 1 199 ? 104.045 -19.342 183.276 1.00 54.01  ? 199 ALA B CB  1 
ATOM   6025  N N   . SER B 1 200 ? 101.525 -18.098 182.258 1.00 59.10  ? 200 SER B N   1 
ATOM   6026  C CA  . SER B 1 200 ? 100.097 -18.089 181.979 1.00 52.91  ? 200 SER B CA  1 
ATOM   6027  C C   . SER B 1 200 ? 99.819  -18.635 180.584 1.00 54.67  ? 200 SER B C   1 
ATOM   6028  O O   . SER B 1 200 ? 100.663 -18.544 179.693 1.00 52.83  ? 200 SER B O   1 
ATOM   6029  C CB  . SER B 1 200 ? 99.537  -16.672 182.113 1.00 68.86  ? 200 SER B CB  1 
ATOM   6030  O OG  . SER B 1 200 ? 98.149  -16.645 181.837 1.00 104.42 ? 200 SER B OG  1 
ATOM   6031  N N   . PHE B 1 201 ? 98.628  -19.195 180.397 1.00 63.61  ? 201 PHE B N   1 
ATOM   6032  C CA  . PHE B 1 201 ? 98.215  -19.697 179.092 1.00 56.51  ? 201 PHE B CA  1 
ATOM   6033  C C   . PHE B 1 201 ? 97.231  -18.735 178.446 1.00 61.54  ? 201 PHE B C   1 
ATOM   6034  O O   . PHE B 1 201 ? 96.490  -18.037 179.136 1.00 73.43  ? 201 PHE B O   1 
ATOM   6035  C CB  . PHE B 1 201 ? 97.583  -21.085 179.209 1.00 58.29  ? 201 PHE B CB  1 
ATOM   6036  C CG  . PHE B 1 201 ? 98.541  -22.157 179.640 1.00 66.95  ? 201 PHE B CG  1 
ATOM   6037  C CD1 . PHE B 1 201 ? 98.774  -22.396 180.982 1.00 79.20  ? 201 PHE B CD1 1 
ATOM   6038  C CD2 . PHE B 1 201 ? 99.201  -22.935 178.701 1.00 66.51  ? 201 PHE B CD2 1 
ATOM   6039  C CE1 . PHE B 1 201 ? 99.653  -23.383 181.383 1.00 93.28  ? 201 PHE B CE1 1 
ATOM   6040  C CE2 . PHE B 1 201 ? 100.080 -23.926 179.094 1.00 82.00  ? 201 PHE B CE2 1 
ATOM   6041  C CZ  . PHE B 1 201 ? 100.307 -24.152 180.439 1.00 93.28  ? 201 PHE B CZ  1 
ATOM   6042  N N   . ALA B 1 202 ? 97.233  -18.688 177.120 1.00 60.90  ? 202 ALA B N   1 
ATOM   6043  C CA  . ALA B 1 202 ? 96.315  -17.813 176.406 1.00 68.31  ? 202 ALA B CA  1 
ATOM   6044  C C   . ALA B 1 202 ? 95.868  -18.399 175.070 1.00 74.29  ? 202 ALA B C   1 
ATOM   6045  O O   . ALA B 1 202 ? 96.632  -19.082 174.387 1.00 79.75  ? 202 ALA B O   1 
ATOM   6046  C CB  . ALA B 1 202 ? 96.952  -16.452 176.194 1.00 77.47  ? 202 ALA B CB  1 
ATOM   6047  N N   . GLN B 1 203 ? 94.615  -18.127 174.717 1.00 70.45  ? 203 GLN B N   1 
ATOM   6048  C CA  . GLN B 1 203 ? 94.062  -18.518 173.425 1.00 74.25  ? 203 GLN B CA  1 
ATOM   6049  C C   . GLN B 1 203 ? 94.112  -17.293 172.521 1.00 82.43  ? 203 GLN B C   1 
ATOM   6050  O O   . GLN B 1 203 ? 93.546  -16.249 172.848 1.00 85.96  ? 203 GLN B O   1 
ATOM   6051  C CB  . GLN B 1 203 ? 92.625  -19.025 173.560 1.00 72.21  ? 203 GLN B CB  1 
ATOM   6052  C CG  . GLN B 1 203 ? 92.463  -20.250 174.453 1.00 80.13  ? 203 GLN B CG  1 
ATOM   6053  C CD  . GLN B 1 203 ? 93.179  -21.480 173.928 1.00 87.04  ? 203 GLN B CD  1 
ATOM   6054  O OE1 . GLN B 1 203 ? 93.275  -21.696 172.719 1.00 96.56  ? 203 GLN B OE1 1 
ATOM   6055  N NE2 . GLN B 1 203 ? 93.676  -22.305 174.844 1.00 104.21 ? 203 GLN B NE2 1 
ATOM   6056  N N   . PHE B 1 204 ? 94.776  -17.415 171.379 1.00 83.78  ? 204 PHE B N   1 
ATOM   6057  C CA  . PHE B 1 204 ? 94.960  -16.264 170.507 1.00 79.09  ? 204 PHE B CA  1 
ATOM   6058  C C   . PHE B 1 204 ? 94.834  -16.672 169.039 1.00 82.27  ? 204 PHE B C   1 
ATOM   6059  O O   . PHE B 1 204 ? 95.556  -17.547 168.563 1.00 99.98  ? 204 PHE B O   1 
ATOM   6060  C CB  . PHE B 1 204 ? 96.326  -15.625 170.798 1.00 82.42  ? 204 PHE B CB  1 
ATOM   6061  C CG  . PHE B 1 204 ? 96.678  -14.468 169.902 1.00 75.28  ? 204 PHE B CG  1 
ATOM   6062  C CD1 . PHE B 1 204 ? 96.228  -13.189 170.189 1.00 80.37  ? 204 PHE B CD1 1 
ATOM   6063  C CD2 . PHE B 1 204 ? 97.490  -14.652 168.796 1.00 71.95  ? 204 PHE B CD2 1 
ATOM   6064  C CE1 . PHE B 1 204 ? 96.560  -12.120 169.376 1.00 82.72  ? 204 PHE B CE1 1 
ATOM   6065  C CE2 . PHE B 1 204 ? 97.824  -13.588 167.976 1.00 93.51  ? 204 PHE B CE2 1 
ATOM   6066  C CZ  . PHE B 1 204 ? 97.358  -12.320 168.268 1.00 93.17  ? 204 PHE B CZ  1 
ATOM   6067  N N   . LYS B 1 205 ? 93.903  -16.046 168.326 1.00 78.76  ? 205 LYS B N   1 
ATOM   6068  C CA  . LYS B 1 205 ? 93.733  -16.320 166.903 1.00 86.94  ? 205 LYS B CA  1 
ATOM   6069  C C   . LYS B 1 205 ? 94.554  -15.328 166.090 1.00 97.96  ? 205 LYS B C   1 
ATOM   6070  O O   . LYS B 1 205 ? 94.308  -14.124 166.120 1.00 103.23 ? 205 LYS B O   1 
ATOM   6071  C CB  . LYS B 1 205 ? 92.256  -16.260 166.493 1.00 87.28  ? 205 LYS B CB  1 
ATOM   6072  C CG  . LYS B 1 205 ? 91.958  -17.012 165.195 1.00 97.56  ? 205 LYS B CG  1 
ATOM   6073  C CD  . LYS B 1 205 ? 90.482  -16.947 164.797 1.00 117.73 ? 205 LYS B CD  1 
ATOM   6074  C CE  . LYS B 1 205 ? 89.663  -18.045 165.462 1.00 127.49 ? 205 LYS B CE  1 
ATOM   6075  N NZ  . LYS B 1 205 ? 88.279  -18.120 164.913 1.00 121.90 ? 205 LYS B NZ  1 
ATOM   6076  N N   . MET B 1 206 ? 95.524  -15.854 165.352 1.00 104.01 ? 206 MET B N   1 
ATOM   6077  C CA  . MET B 1 206 ? 96.428  -15.041 164.546 1.00 114.31 ? 206 MET B CA  1 
ATOM   6078  C C   . MET B 1 206 ? 95.714  -14.365 163.382 1.00 121.12 ? 206 MET B C   1 
ATOM   6079  O O   . MET B 1 206 ? 94.554  -14.663 163.094 1.00 127.80 ? 206 MET B O   1 
ATOM   6080  C CB  . MET B 1 206 ? 97.575  -15.906 164.019 1.00 107.96 ? 206 MET B CB  1 
ATOM   6081  C CG  . MET B 1 206 ? 98.567  -16.331 165.088 1.00 89.43  ? 206 MET B CG  1 
ATOM   6082  S SD  . MET B 1 206 ? 99.720  -17.579 164.488 1.00 131.80 ? 206 MET B SD  1 
ATOM   6083  C CE  . MET B 1 206 ? 100.817 -16.581 163.490 1.00 124.15 ? 206 MET B CE  1 
ATOM   6084  N N   . GLU B 1 207 ? 96.413  -13.443 162.725 1.00 115.45 ? 207 GLU B N   1 
ATOM   6085  C CA  . GLU B 1 207 ? 95.885  -12.766 161.548 1.00 115.77 ? 207 GLU B CA  1 
ATOM   6086  C C   . GLU B 1 207 ? 95.868  -13.732 160.374 1.00 118.40 ? 207 GLU B C   1 
ATOM   6087  O O   . GLU B 1 207 ? 96.916  -14.208 159.937 1.00 128.83 ? 207 GLU B O   1 
ATOM   6088  C CB  . GLU B 1 207 ? 96.721  -11.534 161.205 1.00 116.25 ? 207 GLU B CB  1 
ATOM   6089  C CG  . GLU B 1 207 ? 96.134  -10.660 160.107 1.00 130.12 ? 207 GLU B CG  1 
ATOM   6090  C CD  . GLU B 1 207 ? 95.071  -9.704  160.611 1.00 143.09 ? 207 GLU B CD  1 
ATOM   6091  O OE1 . GLU B 1 207 ? 95.173  -8.499  160.300 1.00 152.47 ? 207 GLU B OE1 1 
ATOM   6092  O OE2 . GLU B 1 207 ? 94.136  -10.147 161.311 1.00 134.02 ? 207 GLU B OE2 1 
ATOM   6093  N N   . GLY B 1 208 ? 94.675  -14.020 159.867 1.00 111.85 ? 208 GLY B N   1 
ATOM   6094  C CA  . GLY B 1 208 ? 94.517  -14.952 158.765 1.00 110.97 ? 208 GLY B CA  1 
ATOM   6095  C C   . GLY B 1 208 ? 94.625  -16.402 159.196 1.00 108.16 ? 208 GLY B C   1 
ATOM   6096  O O   . GLY B 1 208 ? 95.095  -17.251 158.436 1.00 108.96 ? 208 GLY B O   1 
ATOM   6097  N N   . ASN B 1 209 ? 94.191  -16.685 160.421 1.00 120.93 ? 209 ASN B N   1 
ATOM   6098  C CA  . ASN B 1 209 ? 94.219  -18.042 160.957 1.00 121.48 ? 209 ASN B CA  1 
ATOM   6099  C C   . ASN B 1 209 ? 92.817  -18.573 161.241 1.00 122.48 ? 209 ASN B C   1 
ATOM   6100  O O   . ASN B 1 209 ? 91.983  -17.869 161.810 1.00 118.96 ? 209 ASN B O   1 
ATOM   6101  C CB  . ASN B 1 209 ? 95.064  -18.096 162.228 1.00 111.27 ? 209 ASN B CB  1 
ATOM   6102  C CG  . ASN B 1 209 ? 96.324  -18.915 162.054 1.00 114.98 ? 209 ASN B CG  1 
ATOM   6103  O OD1 . ASN B 1 209 ? 96.850  -19.039 160.948 1.00 100.51 ? 209 ASN B OD1 1 
ATOM   6104  N ND2 . ASN B 1 209 ? 96.811  -19.492 163.147 1.00 132.35 ? 209 ASN B ND2 1 
ATOM   6105  N N   . ALA B 1 210 ? 92.562  -19.810 160.825 1.00 119.16 ? 210 ALA B N   1 
ATOM   6106  C CA  . ALA B 1 210 ? 91.250  -20.430 160.993 1.00 119.28 ? 210 ALA B CA  1 
ATOM   6107  C C   . ALA B 1 210 ? 90.851  -20.632 162.456 1.00 120.75 ? 210 ALA B C   1 
ATOM   6108  O O   . ALA B 1 210 ? 89.767  -20.221 162.871 1.00 132.78 ? 210 ALA B O   1 
ATOM   6109  C CB  . ALA B 1 210 ? 91.212  -21.762 160.258 1.00 124.31 ? 210 ALA B CB  1 
ATOM   6110  N N   . GLU B 1 211 ? 91.732  -21.258 163.232 1.00 112.11 ? 211 GLU B N   1 
ATOM   6111  C CA  . GLU B 1 211 ? 91.437  -21.591 164.625 1.00 108.45 ? 211 GLU B CA  1 
ATOM   6112  C C   . GLU B 1 211 ? 92.302  -20.830 165.625 1.00 98.43  ? 211 GLU B C   1 
ATOM   6113  O O   . GLU B 1 211 ? 93.318  -20.241 165.266 1.00 101.44 ? 211 GLU B O   1 
ATOM   6114  C CB  . GLU B 1 211 ? 91.605  -23.098 164.845 1.00 112.96 ? 211 GLU B CB  1 
ATOM   6115  C CG  . GLU B 1 211 ? 90.602  -23.954 164.083 1.00 128.46 ? 211 GLU B CG  1 
ATOM   6116  C CD  . GLU B 1 211 ? 89.222  -23.929 164.717 1.00 154.57 ? 211 GLU B CD  1 
ATOM   6117  O OE1 . GLU B 1 211 ? 88.256  -23.527 164.036 1.00 162.13 ? 211 GLU B OE1 1 
ATOM   6118  O OE2 . GLU B 1 211 ? 89.099  -24.326 165.896 1.00 162.79 ? 211 GLU B OE2 1 
ATOM   6119  N N   . GLU B 1 212 ? 91.875  -20.841 166.883 1.00 94.22  ? 212 GLU B N   1 
ATOM   6120  C CA  . GLU B 1 212 ? 92.610  -20.194 167.963 1.00 95.76  ? 212 GLU B CA  1 
ATOM   6121  C C   . GLU B 1 212 ? 93.860  -20.984 168.334 1.00 97.21  ? 212 GLU B C   1 
ATOM   6122  O O   . GLU B 1 212 ? 93.814  -22.206 168.470 1.00 103.30 ? 212 GLU B O   1 
ATOM   6123  C CB  . GLU B 1 212 ? 91.719  -20.033 169.196 1.00 121.56 ? 212 GLU B CB  1 
ATOM   6124  C CG  . GLU B 1 212 ? 90.642  -18.973 169.059 1.00 133.17 ? 212 GLU B CG  1 
ATOM   6125  C CD  . GLU B 1 212 ? 89.861  -18.784 170.343 1.00 118.86 ? 212 GLU B CD  1 
ATOM   6126  O OE1 . GLU B 1 212 ? 89.555  -19.801 171.001 1.00 111.23 ? 212 GLU B OE1 1 
ATOM   6127  O OE2 . GLU B 1 212 ? 89.555  -17.626 170.697 1.00 110.27 ? 212 GLU B OE2 1 
ATOM   6128  N N   . SER B 1 213 ? 94.977  -20.283 168.494 1.00 92.22  ? 213 SER B N   1 
ATOM   6129  C CA  . SER B 1 213 ? 96.223  -20.918 168.907 1.00 87.89  ? 213 SER B CA  1 
ATOM   6130  C C   . SER B 1 213 ? 96.365  -20.874 170.420 1.00 95.80  ? 213 SER B C   1 
ATOM   6131  O O   . SER B 1 213 ? 96.048  -19.868 171.048 1.00 100.75 ? 213 SER B O   1 
ATOM   6132  C CB  . SER B 1 213 ? 97.430  -20.242 168.249 1.00 79.11  ? 213 SER B CB  1 
ATOM   6133  O OG  . SER B 1 213 ? 97.305  -20.226 166.839 1.00 93.57  ? 213 SER B OG  1 
ATOM   6134  N N   . THR B 1 214 ? 96.847  -21.964 171.005 1.00 95.74  ? 214 THR B N   1 
ATOM   6135  C CA  . THR B 1 214 ? 97.074  -21.998 172.445 1.00 81.44  ? 214 THR B CA  1 
ATOM   6136  C C   . THR B 1 214 ? 98.506  -21.582 172.752 1.00 84.99  ? 214 THR B C   1 
ATOM   6137  O O   . THR B 1 214 ? 99.453  -22.294 172.426 1.00 81.80  ? 214 THR B O   1 
ATOM   6138  C CB  . THR B 1 214 ? 96.817  -23.385 173.045 1.00 74.88  ? 214 THR B CB  1 
ATOM   6139  O OG1 . THR B 1 214 ? 95.474  -23.797 172.759 1.00 92.37  ? 214 THR B OG1 1 
ATOM   6140  C CG2 . THR B 1 214 ? 97.013  -23.342 174.550 1.00 68.88  ? 214 THR B CG2 1 
ATOM   6141  N N   . LEU B 1 215 ? 98.647  -20.431 173.398 1.00 80.23  ? 215 LEU B N   1 
ATOM   6142  C CA  . LEU B 1 215 ? 99.954  -19.867 173.709 1.00 66.12  ? 215 LEU B CA  1 
ATOM   6143  C C   . LEU B 1 215 ? 100.382 -20.078 175.159 1.00 73.66  ? 215 LEU B C   1 
ATOM   6144  O O   . LEU B 1 215 ? 99.570  -20.000 176.081 1.00 81.30  ? 215 LEU B O   1 
ATOM   6145  C CB  . LEU B 1 215 ? 99.967  -18.369 173.394 1.00 63.98  ? 215 LEU B CB  1 
ATOM   6146  C CG  . LEU B 1 215 ? 99.572  -17.937 171.982 1.00 64.64  ? 215 LEU B CG  1 
ATOM   6147  C CD1 . LEU B 1 215 ? 99.746  -16.439 171.825 1.00 64.29  ? 215 LEU B CD1 1 
ATOM   6148  C CD2 . LEU B 1 215 ? 100.400 -18.674 170.948 1.00 65.75  ? 215 LEU B CD2 1 
ATOM   6149  N N   . PHE B 1 216 ? 101.668 -20.352 175.345 1.00 73.30  ? 216 PHE B N   1 
ATOM   6150  C CA  . PHE B 1 216 ? 102.251 -20.467 176.674 1.00 61.71  ? 216 PHE B CA  1 
ATOM   6151  C C   . PHE B 1 216 ? 103.187 -19.285 176.880 1.00 60.44  ? 216 PHE B C   1 
ATOM   6152  O O   . PHE B 1 216 ? 104.188 -19.145 176.176 1.00 76.37  ? 216 PHE B O   1 
ATOM   6153  C CB  . PHE B 1 216 ? 102.995 -21.794 176.830 1.00 63.76  ? 216 PHE B CB  1 
ATOM   6154  C CG  . PHE B 1 216 ? 103.781 -21.913 178.109 1.00 72.34  ? 216 PHE B CG  1 
ATOM   6155  C CD1 . PHE B 1 216 ? 103.187 -21.684 179.339 1.00 86.94  ? 216 PHE B CD1 1 
ATOM   6156  C CD2 . PHE B 1 216 ? 105.122 -22.261 178.075 1.00 74.37  ? 216 PHE B CD2 1 
ATOM   6157  C CE1 . PHE B 1 216 ? 103.918 -21.796 180.510 1.00 91.08  ? 216 PHE B CE1 1 
ATOM   6158  C CE2 . PHE B 1 216 ? 105.857 -22.376 179.237 1.00 79.84  ? 216 PHE B CE2 1 
ATOM   6159  C CZ  . PHE B 1 216 ? 105.256 -22.142 180.458 1.00 80.87  ? 216 PHE B CZ  1 
ATOM   6160  N N   . CYS B 1 217 ? 102.856 -18.427 177.839 1.00 59.53  ? 217 CYS B N   1 
ATOM   6161  C CA  . CYS B 1 217 ? 103.666 -17.246 178.102 1.00 68.96  ? 217 CYS B CA  1 
ATOM   6162  C C   . CYS B 1 217 ? 104.282 -17.304 179.489 1.00 71.77  ? 217 CYS B C   1 
ATOM   6163  O O   . CYS B 1 217 ? 103.571 -17.468 180.480 1.00 70.04  ? 217 CYS B O   1 
ATOM   6164  C CB  . CYS B 1 217 ? 102.816 -15.981 177.958 1.00 60.80  ? 217 CYS B CB  1 
ATOM   6165  S SG  . CYS B 1 217 ? 103.656 -14.444 178.405 1.00 159.37 ? 217 CYS B SG  1 
ATOM   6166  N N   . PHE B 1 218 ? 105.599 -17.154 179.572 1.00 73.38  ? 218 PHE B N   1 
ATOM   6167  C CA  . PHE B 1 218 ? 106.233 -17.143 180.881 1.00 69.60  ? 218 PHE B CA  1 
ATOM   6168  C C   . PHE B 1 218 ? 107.339 -16.102 180.972 1.00 54.01  ? 218 PHE B C   1 
ATOM   6169  O O   . PHE B 1 218 ? 108.016 -15.790 179.993 1.00 70.81  ? 218 PHE B O   1 
ATOM   6170  C CB  . PHE B 1 218 ? 106.756 -18.542 181.249 1.00 65.35  ? 218 PHE B CB  1 
ATOM   6171  C CG  . PHE B 1 218 ? 108.014 -18.952 180.537 1.00 63.10  ? 218 PHE B CG  1 
ATOM   6172  C CD1 . PHE B 1 218 ? 107.957 -19.601 179.316 1.00 67.04  ? 218 PHE B CD1 1 
ATOM   6173  C CD2 . PHE B 1 218 ? 109.251 -18.744 181.121 1.00 67.72  ? 218 PHE B CD2 1 
ATOM   6174  C CE1 . PHE B 1 218 ? 109.114 -20.003 178.675 1.00 56.76  ? 218 PHE B CE1 1 
ATOM   6175  C CE2 . PHE B 1 218 ? 110.410 -19.137 180.486 1.00 61.66  ? 218 PHE B CE2 1 
ATOM   6176  C CZ  . PHE B 1 218 ? 110.344 -19.767 179.259 1.00 57.42  ? 218 PHE B CZ  1 
ATOM   6177  N N   . ALA B 1 219 ? 107.496 -15.559 182.171 1.00 51.86  ? 219 ALA B N   1 
ATOM   6178  C CA  . ALA B 1 219 ? 108.501 -14.550 182.442 1.00 54.00  ? 219 ALA B CA  1 
ATOM   6179  C C   . ALA B 1 219 ? 109.463 -15.067 183.487 1.00 60.01  ? 219 ALA B C   1 
ATOM   6180  O O   . ALA B 1 219 ? 109.101 -15.872 184.345 1.00 63.60  ? 219 ALA B O   1 
ATOM   6181  C CB  . ALA B 1 219 ? 107.858 -13.257 182.899 1.00 52.52  ? 219 ALA B CB  1 
ATOM   6182  N N   . VAL B 1 220 ? 110.703 -14.613 183.397 1.00 62.83  ? 220 VAL B N   1 
ATOM   6183  C CA  . VAL B 1 220 ? 111.734 -15.087 184.295 1.00 67.98  ? 220 VAL B CA  1 
ATOM   6184  C C   . VAL B 1 220 ? 112.849 -14.062 184.400 1.00 61.49  ? 220 VAL B C   1 
ATOM   6185  O O   . VAL B 1 220 ? 113.079 -13.286 183.472 1.00 72.90  ? 220 VAL B O   1 
ATOM   6186  C CB  . VAL B 1 220 ? 112.305 -16.445 183.804 1.00 56.38  ? 220 VAL B CB  1 
ATOM   6187  C CG1 . VAL B 1 220 ? 112.993 -16.277 182.455 1.00 55.80  ? 220 VAL B CG1 1 
ATOM   6188  C CG2 . VAL B 1 220 ? 113.251 -17.055 184.827 1.00 57.41  ? 220 VAL B CG2 1 
ATOM   6189  N N   . ARG B 1 221 ? 113.522 -14.046 185.544 1.00 62.16  ? 221 ARG B N   1 
ATOM   6190  C CA  . ARG B 1 221 ? 114.762 -13.307 185.675 1.00 62.78  ? 221 ARG B CA  1 
ATOM   6191  C C   . ARG B 1 221 ? 115.815 -14.359 185.977 1.00 65.46  ? 221 ARG B C   1 
ATOM   6192  O O   . ARG B 1 221 ? 116.183 -14.583 187.131 1.00 66.91  ? 221 ARG B O   1 
ATOM   6193  C CB  . ARG B 1 221 ? 114.692 -12.247 186.777 1.00 61.31  ? 221 ARG B CB  1 
ATOM   6194  C CG  . ARG B 1 221 ? 115.589 -11.043 186.516 1.00 68.03  ? 221 ARG B CG  1 
ATOM   6195  C CD  . ARG B 1 221 ? 116.005 -10.318 187.789 1.00 78.34  ? 221 ARG B CD  1 
ATOM   6196  N NE  . ARG B 1 221 ? 116.811 -9.135  187.488 1.00 80.62  ? 221 ARG B NE  1 
ATOM   6197  C CZ  . ARG B 1 221 ? 116.900 -8.063  188.271 1.00 85.61  ? 221 ARG B CZ  1 
ATOM   6198  N NH1 . ARG B 1 221 ? 117.653 -7.035  187.903 1.00 106.21 ? 221 ARG B NH1 1 
ATOM   6199  N NH2 . ARG B 1 221 ? 116.249 -8.021  189.425 1.00 103.03 ? 221 ARG B NH2 1 
ATOM   6200  N N   . GLY B 1 222 ? 116.297 -14.998 184.917 1.00 84.70  ? 222 GLY B N   1 
ATOM   6201  C CA  . GLY B 1 222 ? 117.199 -16.126 185.039 1.00 90.30  ? 222 GLY B CA  1 
ATOM   6202  C C   . GLY B 1 222 ? 118.593 -15.931 184.482 1.00 88.49  ? 222 GLY B C   1 
ATOM   6203  O O   . GLY B 1 222 ? 119.212 -14.882 184.657 1.00 73.49  ? 222 GLY B O   1 
ATOM   6204  N N   . GLN B 1 223 ? 119.077 -16.968 183.806 1.00 84.79  ? 223 GLN B N   1 
ATOM   6205  C CA  . GLN B 1 223 ? 120.432 -17.019 183.269 1.00 74.53  ? 223 GLN B CA  1 
ATOM   6206  C C   . GLN B 1 223 ? 120.696 -15.975 182.189 1.00 68.86  ? 223 GLN B C   1 
ATOM   6207  O O   . GLN B 1 223 ? 121.798 -15.435 182.096 1.00 69.95  ? 223 GLN B O   1 
ATOM   6208  C CB  . GLN B 1 223 ? 120.708 -18.416 182.714 1.00 88.42  ? 223 GLN B CB  1 
ATOM   6209  C CG  . GLN B 1 223 ? 120.531 -19.520 183.739 1.00 96.40  ? 223 GLN B CG  1 
ATOM   6210  C CD  . GLN B 1 223 ? 121.788 -19.766 184.552 1.00 125.17 ? 223 GLN B CD  1 
ATOM   6211  O OE1 . GLN B 1 223 ? 122.267 -18.881 185.261 1.00 140.58 ? 223 GLN B OE1 1 
ATOM   6212  N NE2 . GLN B 1 223 ? 122.326 -20.978 184.458 1.00 138.85 ? 223 GLN B NE2 1 
ATOM   6213  N N   . ALA B 1 224 ? 119.689 -15.694 181.371 1.00 70.12  ? 224 ALA B N   1 
ATOM   6214  C CA  . ALA B 1 224 ? 119.834 -14.676 180.342 1.00 63.46  ? 224 ALA B CA  1 
ATOM   6215  C C   . ALA B 1 224 ? 119.069 -13.426 180.755 1.00 67.23  ? 224 ALA B C   1 
ATOM   6216  O O   . ALA B 1 224 ? 118.404 -12.784 179.944 1.00 70.22  ? 224 ALA B O   1 
ATOM   6217  C CB  . ALA B 1 224 ? 119.346 -15.192 179.000 1.00 75.34  ? 224 ALA B CB  1 
ATOM   6218  N N   . GLY B 1 225 ? 119.195 -13.084 182.033 1.00 76.78  ? 225 GLY B N   1 
ATOM   6219  C CA  . GLY B 1 225 ? 118.521 -11.935 182.609 1.00 75.13  ? 225 GLY B CA  1 
ATOM   6220  C C   . GLY B 1 225 ? 117.007 -12.020 182.562 1.00 68.70  ? 225 GLY B C   1 
ATOM   6221  O O   . GLY B 1 225 ? 116.431 -13.106 182.500 1.00 63.05  ? 225 GLY B O   1 
ATOM   6222  N N   . GLY B 1 226 ? 116.361 -10.860 182.610 1.00 72.03  ? 226 GLY B N   1 
ATOM   6223  C CA  . GLY B 1 226 ? 114.914 -10.781 182.540 1.00 77.98  ? 226 GLY B CA  1 
ATOM   6224  C C   . GLY B 1 226 ? 114.397 -11.023 181.136 1.00 70.38  ? 226 GLY B C   1 
ATOM   6225  O O   . GLY B 1 226 ? 114.703 -10.272 180.216 1.00 77.80  ? 226 GLY B O   1 
ATOM   6226  N N   . LYS B 1 227 ? 113.595 -12.069 180.975 1.00 65.87  ? 227 LYS B N   1 
ATOM   6227  C CA  . LYS B 1 227 ? 113.061 -12.426 179.664 1.00 57.59  ? 227 LYS B CA  1 
ATOM   6228  C C   . LYS B 1 227 ? 111.583 -12.794 179.721 1.00 63.94  ? 227 LYS B C   1 
ATOM   6229  O O   . LYS B 1 227 ? 111.111 -13.360 180.705 1.00 60.35  ? 227 LYS B O   1 
ATOM   6230  C CB  . LYS B 1 227 ? 113.854 -13.591 179.067 1.00 52.88  ? 227 LYS B CB  1 
ATOM   6231  C CG  . LYS B 1 227 ? 115.256 -13.251 178.586 1.00 66.40  ? 227 LYS B CG  1 
ATOM   6232  C CD  . LYS B 1 227 ? 115.201 -12.586 177.217 1.00 79.06  ? 227 LYS B CD  1 
ATOM   6233  C CE  . LYS B 1 227 ? 116.590 -12.228 176.709 1.00 92.75  ? 227 LYS B CE  1 
ATOM   6234  N NZ  . LYS B 1 227 ? 117.228 -11.132 177.486 1.00 98.36  ? 227 LYS B NZ  1 
ATOM   6235  N N   . LEU B 1 228 ? 110.858 -12.452 178.660 1.00 72.18  ? 228 LEU B N   1 
ATOM   6236  C CA  . LEU B 1 228 ? 109.456 -12.822 178.531 1.00 75.01  ? 228 LEU B CA  1 
ATOM   6237  C C   . LEU B 1 228 ? 109.303 -13.695 177.288 1.00 72.58  ? 228 LEU B C   1 
ATOM   6238  O O   . LEU B 1 228 ? 109.676 -13.287 176.191 1.00 57.61  ? 228 LEU B O   1 
ATOM   6239  C CB  . LEU B 1 228 ? 108.563 -11.584 178.425 1.00 72.33  ? 228 LEU B CB  1 
ATOM   6240  C CG  . LEU B 1 228 ? 107.059 -11.846 178.316 1.00 71.40  ? 228 LEU B CG  1 
ATOM   6241  C CD1 . LEU B 1 228 ? 106.465 -12.044 179.689 1.00 78.83  ? 228 LEU B CD1 1 
ATOM   6242  C CD2 . LEU B 1 228 ? 106.327 -10.735 177.581 1.00 79.85  ? 228 LEU B CD2 1 
ATOM   6243  N N   . HIS B 1 229 ? 108.762 -14.896 177.447 1.00 73.61  ? 229 HIS B N   1 
ATOM   6244  C CA  . HIS B 1 229 ? 108.627 -15.810 176.314 1.00 64.34  ? 229 HIS B CA  1 
ATOM   6245  C C   . HIS B 1 229 ? 107.182 -16.079 175.933 1.00 84.00  ? 229 HIS B C   1 
ATOM   6246  O O   . HIS B 1 229 ? 106.352 -16.370 176.790 1.00 101.88 ? 229 HIS B O   1 
ATOM   6247  C CB  . HIS B 1 229 ? 109.318 -17.145 176.612 1.00 61.60  ? 229 HIS B CB  1 
ATOM   6248  C CG  . HIS B 1 229 ? 110.798 -17.037 176.829 1.00 73.54  ? 229 HIS B CG  1 
ATOM   6249  N ND1 . HIS B 1 229 ? 111.361 -16.866 178.071 1.00 85.24  ? 229 HIS B ND1 1 
ATOM   6250  C CD2 . HIS B 1 229 ? 111.833 -17.107 175.954 1.00 64.36  ? 229 HIS B CD2 1 
ATOM   6251  C CE1 . HIS B 1 229 ? 112.679 -16.819 177.960 1.00 78.41  ? 229 HIS B CE1 1 
ATOM   6252  N NE2 . HIS B 1 229 ? 112.987 -16.962 176.682 1.00 63.41  ? 229 HIS B NE2 1 
ATOM   6253  N N   . ILE B 1 230 ? 106.890 -15.973 174.640 1.00 77.54  ? 230 ILE B N   1 
ATOM   6254  C CA  . ILE B 1 230 ? 105.557 -16.275 174.126 1.00 58.53  ? 230 ILE B CA  1 
ATOM   6255  C C   . ILE B 1 230 ? 105.663 -17.332 173.033 1.00 66.32  ? 230 ILE B C   1 
ATOM   6256  O O   . ILE B 1 230 ? 106.060 -17.045 171.904 1.00 69.74  ? 230 ILE B O   1 
ATOM   6257  C CB  . ILE B 1 230 ? 104.859 -15.029 173.573 1.00 60.27  ? 230 ILE B CB  1 
ATOM   6258  C CG1 . ILE B 1 230 ? 104.801 -13.945 174.645 1.00 68.65  ? 230 ILE B CG1 1 
ATOM   6259  C CG2 . ILE B 1 230 ? 103.458 -15.371 173.112 1.00 64.61  ? 230 ILE B CG2 1 
ATOM   6260  C CD1 . ILE B 1 230 ? 104.789 -12.537 174.090 1.00 67.79  ? 230 ILE B CD1 1 
ATOM   6261  N N   . ILE B 1 231 ? 105.302 -18.560 173.386 1.00 78.17  ? 231 ILE B N   1 
ATOM   6262  C CA  . ILE B 1 231 ? 105.449 -19.697 172.492 1.00 82.05  ? 231 ILE B CA  1 
ATOM   6263  C C   . ILE B 1 231 ? 104.129 -20.473 172.377 1.00 78.62  ? 231 ILE B C   1 
ATOM   6264  O O   . ILE B 1 231 ? 103.353 -20.521 173.326 1.00 72.50  ? 231 ILE B O   1 
ATOM   6265  C CB  . ILE B 1 231 ? 106.601 -20.599 172.994 1.00 81.25  ? 231 ILE B CB  1 
ATOM   6266  C CG1 . ILE B 1 231 ? 106.433 -22.046 172.537 1.00 95.20  ? 231 ILE B CG1 1 
ATOM   6267  C CG2 . ILE B 1 231 ? 106.692 -20.540 174.512 1.00 84.90  ? 231 ILE B CG2 1 
ATOM   6268  C CD1 . ILE B 1 231 ? 107.673 -22.881 172.718 1.00 105.77 ? 231 ILE B CD1 1 
ATOM   6269  N N   . GLU B 1 232 ? 103.878 -21.079 171.218 1.00 75.32  ? 232 GLU B N   1 
ATOM   6270  C CA  . GLU B 1 232 ? 102.671 -21.879 171.018 1.00 71.15  ? 232 GLU B CA  1 
ATOM   6271  C C   . GLU B 1 232 ? 102.915 -23.333 171.419 1.00 74.27  ? 232 GLU B C   1 
ATOM   6272  O O   . GLU B 1 232 ? 103.895 -23.947 171.000 1.00 92.45  ? 232 GLU B O   1 
ATOM   6273  C CB  . GLU B 1 232 ? 102.204 -21.799 169.561 1.00 77.72  ? 232 GLU B CB  1 
ATOM   6274  C CG  . GLU B 1 232 ? 100.895 -22.534 169.278 1.00 98.61  ? 232 GLU B CG  1 
ATOM   6275  C CD  . GLU B 1 232 ? 100.571 -22.599 167.797 1.00 109.41 ? 232 GLU B CD  1 
ATOM   6276  O OE1 . GLU B 1 232 ? 101.430 -22.197 166.983 1.00 87.85  ? 232 GLU B OE1 1 
ATOM   6277  O OE2 . GLU B 1 232 ? 99.466  -23.064 167.444 1.00 123.78 ? 232 GLU B OE2 1 
ATOM   6278  N N   . VAL B 1 233 ? 102.010 -23.880 172.225 1.00 84.76  ? 233 VAL B N   1 
ATOM   6279  C CA  . VAL B 1 233 ? 102.135 -25.253 172.706 1.00 87.57  ? 233 VAL B CA  1 
ATOM   6280  C C   . VAL B 1 233 ? 101.361 -26.265 171.868 1.00 96.10  ? 233 VAL B C   1 
ATOM   6281  O O   . VAL B 1 233 ? 100.164 -26.122 171.622 1.00 98.10  ? 233 VAL B O   1 
ATOM   6282  C CB  . VAL B 1 233 ? 101.678 -25.381 174.171 1.00 85.57  ? 233 VAL B CB  1 
ATOM   6283  C CG1 . VAL B 1 233 ? 102.769 -24.899 175.108 1.00 84.16  ? 233 VAL B CG1 1 
ATOM   6284  C CG2 . VAL B 1 233 ? 100.380 -24.626 174.399 1.00 87.85  ? 233 VAL B CG2 1 
ATOM   6285  N N   . GLY B 1 234 ? 102.081 -27.296 171.443 1.00 116.20 ? 234 GLY B N   1 
ATOM   6286  C CA  . GLY B 1 234 ? 101.538 -28.385 170.656 1.00 124.69 ? 234 GLY B CA  1 
ATOM   6287  C C   . GLY B 1 234 ? 101.353 -28.093 169.181 1.00 123.82 ? 234 GLY B C   1 
ATOM   6288  O O   . GLY B 1 234 ? 101.645 -27.001 168.693 1.00 126.81 ? 234 GLY B O   1 
ATOM   6289  N N   . THR B 1 235 ? 100.869 -29.104 168.470 1.00 113.61 ? 235 THR B N   1 
ATOM   6290  C CA  . THR B 1 235 ? 100.660 -29.024 167.031 1.00 111.71 ? 235 THR B CA  1 
ATOM   6291  C C   . THR B 1 235 ? 99.572  -28.020 166.685 1.00 110.40 ? 235 THR B C   1 
ATOM   6292  O O   . THR B 1 235 ? 98.471  -28.087 167.231 1.00 121.66 ? 235 THR B O   1 
ATOM   6293  C CB  . THR B 1 235 ? 100.287 -30.394 166.443 1.00 118.03 ? 235 THR B CB  1 
ATOM   6294  O OG1 . THR B 1 235 ? 101.180 -31.392 166.952 1.00 121.84 ? 235 THR B OG1 1 
ATOM   6295  C CG2 . THR B 1 235 ? 100.363 -30.367 164.921 1.00 116.93 ? 235 THR B CG2 1 
ATOM   6296  N N   . PRO B 1 236 ? 99.872  -27.092 165.765 1.00 107.71 ? 236 PRO B N   1 
ATOM   6297  C CA  . PRO B 1 236 ? 98.855  -26.116 165.364 1.00 102.58 ? 236 PRO B CA  1 
ATOM   6298  C C   . PRO B 1 236 ? 97.715  -26.795 164.622 1.00 113.68 ? 236 PRO B C   1 
ATOM   6299  O O   . PRO B 1 236 ? 97.948  -27.789 163.931 1.00 125.22 ? 236 PRO B O   1 
ATOM   6300  C CB  . PRO B 1 236 ? 99.617  -25.154 164.441 1.00 99.97  ? 236 PRO B CB  1 
ATOM   6301  C CG  . PRO B 1 236 ? 101.066 -25.521 164.560 1.00 101.69 ? 236 PRO B CG  1 
ATOM   6302  C CD  . PRO B 1 236 ? 101.124 -26.935 165.007 1.00 111.11 ? 236 PRO B CD  1 
ATOM   6303  N N   . PRO B 1 237 ? 96.492  -26.266 164.765 1.00 104.23 ? 237 PRO B N   1 
ATOM   6304  C CA  . PRO B 1 237 ? 95.344  -26.857 164.077 1.00 117.21 ? 237 PRO B CA  1 
ATOM   6305  C C   . PRO B 1 237 ? 95.498  -26.858 162.567 1.00 117.61 ? 237 PRO B C   1 
ATOM   6306  O O   . PRO B 1 237 ? 96.308  -26.117 162.009 1.00 112.35 ? 237 PRO B O   1 
ATOM   6307  C CB  . PRO B 1 237 ? 94.178  -25.957 164.499 1.00 119.94 ? 237 PRO B CB  1 
ATOM   6308  C CG  . PRO B 1 237 ? 94.640  -25.281 165.743 1.00 106.80 ? 237 PRO B CG  1 
ATOM   6309  C CD  . PRO B 1 237 ? 96.108  -25.089 165.559 1.00 102.73 ? 237 PRO B CD  1 
ATOM   6310  N N   . THR B 1 238 ? 94.699  -27.697 161.921 1.00 128.85 ? 238 THR B N   1 
ATOM   6311  C CA  . THR B 1 238 ? 94.702  -27.827 160.475 1.00 131.69 ? 238 THR B CA  1 
ATOM   6312  C C   . THR B 1 238 ? 94.325  -26.538 159.766 1.00 129.72 ? 238 THR B C   1 
ATOM   6313  O O   . THR B 1 238 ? 93.260  -25.969 160.003 1.00 134.19 ? 238 THR B O   1 
ATOM   6314  C CB  . THR B 1 238 ? 93.739  -28.924 160.030 1.00 142.52 ? 238 THR B CB  1 
ATOM   6315  O OG1 . THR B 1 238 ? 93.977  -30.102 160.812 1.00 142.39 ? 238 THR B OG1 1 
ATOM   6316  C CG2 . THR B 1 238 ? 93.960  -29.249 158.578 1.00 141.56 ? 238 THR B CG2 1 
ATOM   6317  N N   . GLY B 1 239 ? 95.200  -26.110 158.865 1.00 131.46 ? 239 GLY B N   1 
ATOM   6318  C CA  . GLY B 1 239 ? 94.999  -24.891 158.110 1.00 136.61 ? 239 GLY B CA  1 
ATOM   6319  C C   . GLY B 1 239 ? 95.371  -23.650 158.893 1.00 129.24 ? 239 GLY B C   1 
ATOM   6320  O O   . GLY B 1 239 ? 94.888  -22.555 158.602 1.00 127.79 ? 239 GLY B O   1 
ATOM   6321  N N   . ASN B 1 240 ? 96.229  -23.821 159.893 1.00 133.59 ? 240 ASN B N   1 
ATOM   6322  C CA  . ASN B 1 240 ? 96.701  -22.688 160.678 1.00 119.55 ? 240 ASN B CA  1 
ATOM   6323  C C   . ASN B 1 240 ? 98.195  -22.471 160.503 1.00 111.25 ? 240 ASN B C   1 
ATOM   6324  O O   . ASN B 1 240 ? 98.963  -23.431 160.441 1.00 112.85 ? 240 ASN B O   1 
ATOM   6325  C CB  . ASN B 1 240 ? 96.393  -22.882 162.168 1.00 105.17 ? 240 ASN B CB  1 
ATOM   6326  C CG  . ASN B 1 240 ? 95.043  -22.331 162.565 1.00 111.53 ? 240 ASN B CG  1 
ATOM   6327  O OD1 . ASN B 1 240 ? 94.116  -22.284 161.759 1.00 133.68 ? 240 ASN B OD1 1 
ATOM   6328  N ND2 . ASN B 1 240 ? 94.924  -21.909 163.819 1.00 107.52 ? 240 ASN B ND2 1 
ATOM   6329  N N   . GLN B 1 241 ? 98.599  -21.207 160.417 1.00 108.65 ? 241 GLN B N   1 
ATOM   6330  C CA  . GLN B 1 241 ? 100.010 -20.859 160.354 1.00 113.55 ? 241 GLN B CA  1 
ATOM   6331  C C   . GLN B 1 241 ? 100.529 -21.009 161.776 1.00 109.68 ? 241 GLN B C   1 
ATOM   6332  O O   . GLN B 1 241 ? 99.788  -20.748 162.728 1.00 108.55 ? 241 GLN B O   1 
ATOM   6333  C CB  . GLN B 1 241 ? 100.218 -19.435 159.828 1.00 117.01 ? 241 GLN B CB  1 
ATOM   6334  C CG  . GLN B 1 241 ? 100.171 -19.301 158.311 1.00 127.64 ? 241 GLN B CG  1 
ATOM   6335  C CD  . GLN B 1 241 ? 101.113 -20.251 157.596 1.00 136.77 ? 241 GLN B CD  1 
ATOM   6336  O OE1 . GLN B 1 241 ? 100.734 -20.901 156.621 1.00 143.84 ? 241 GLN B OE1 1 
ATOM   6337  N NE2 . GLN B 1 241 ? 102.359 -20.307 158.054 1.00 136.78 ? 241 GLN B NE2 1 
ATOM   6338  N N   . PRO B 1 242 ? 101.794 -21.418 161.948 1.00 104.15 ? 242 PRO B N   1 
ATOM   6339  C CA  . PRO B 1 242 ? 102.175 -21.536 163.357 1.00 92.09  ? 242 PRO B CA  1 
ATOM   6340  C C   . PRO B 1 242 ? 102.604 -20.198 163.955 1.00 88.65  ? 242 PRO B C   1 
ATOM   6341  O O   . PRO B 1 242 ? 103.034 -19.302 163.228 1.00 94.02  ? 242 PRO B O   1 
ATOM   6342  C CB  . PRO B 1 242 ? 103.342 -22.522 163.316 1.00 96.88  ? 242 PRO B CB  1 
ATOM   6343  C CG  . PRO B 1 242 ? 103.976 -22.277 161.977 1.00 109.00 ? 242 PRO B CG  1 
ATOM   6344  C CD  . PRO B 1 242 ? 102.883 -21.807 161.034 1.00 112.78 ? 242 PRO B CD  1 
ATOM   6345  N N   . PHE B 1 243 ? 102.495 -20.077 165.274 1.00 82.53  ? 243 PHE B N   1 
ATOM   6346  C CA  . PHE B 1 243 ? 102.887 -18.860 165.977 1.00 79.91  ? 243 PHE B CA  1 
ATOM   6347  C C   . PHE B 1 243 ? 104.405 -18.792 166.131 1.00 99.19  ? 243 PHE B C   1 
ATOM   6348  O O   . PHE B 1 243 ? 104.999 -19.671 166.754 1.00 112.15 ? 243 PHE B O   1 
ATOM   6349  C CB  . PHE B 1 243 ? 102.203 -18.789 167.346 1.00 78.70  ? 243 PHE B CB  1 
ATOM   6350  C CG  . PHE B 1 243 ? 102.427 -17.490 168.076 1.00 77.53  ? 243 PHE B CG  1 
ATOM   6351  C CD1 . PHE B 1 243 ? 101.560 -16.425 167.897 1.00 79.41  ? 243 PHE B CD1 1 
ATOM   6352  C CD2 . PHE B 1 243 ? 103.497 -17.334 168.944 1.00 77.17  ? 243 PHE B CD2 1 
ATOM   6353  C CE1 . PHE B 1 243 ? 101.752 -15.230 168.565 1.00 88.33  ? 243 PHE B CE1 1 
ATOM   6354  C CE2 . PHE B 1 243 ? 103.698 -16.141 169.614 1.00 85.41  ? 243 PHE B CE2 1 
ATOM   6355  C CZ  . PHE B 1 243 ? 102.824 -15.088 169.425 1.00 81.99  ? 243 PHE B CZ  1 
ATOM   6356  N N   . PRO B 1 244 ? 105.035 -17.745 165.575 1.00 92.82  ? 244 PRO B N   1 
ATOM   6357  C CA  . PRO B 1 244 ? 106.488 -17.578 165.702 1.00 89.50  ? 244 PRO B CA  1 
ATOM   6358  C C   . PRO B 1 244 ? 106.891 -17.250 167.140 1.00 86.39  ? 244 PRO B C   1 
ATOM   6359  O O   . PRO B 1 244 ? 106.437 -16.242 167.684 1.00 72.69  ? 244 PRO B O   1 
ATOM   6360  C CB  . PRO B 1 244 ? 106.797 -16.413 164.758 1.00 90.46  ? 244 PRO B CB  1 
ATOM   6361  C CG  . PRO B 1 244 ? 105.517 -15.654 164.649 1.00 87.85  ? 244 PRO B CG  1 
ATOM   6362  C CD  . PRO B 1 244 ? 104.399 -16.633 164.846 1.00 86.88  ? 244 PRO B CD  1 
ATOM   6363  N N   . LYS B 1 245 ? 107.715 -18.108 167.740 1.00 81.05  ? 245 LYS B N   1 
ATOM   6364  C CA  . LYS B 1 245 ? 108.177 -17.945 169.121 1.00 72.47  ? 245 LYS B CA  1 
ATOM   6365  C C   . LYS B 1 245 ? 108.694 -16.538 169.378 1.00 69.03  ? 245 LYS B C   1 
ATOM   6366  O O   . LYS B 1 245 ? 109.422 -15.980 168.557 1.00 68.58  ? 245 LYS B O   1 
ATOM   6367  C CB  . LYS B 1 245 ? 109.290 -18.937 169.444 1.00 75.84  ? 245 LYS B CB  1 
ATOM   6368  C CG  . LYS B 1 245 ? 108.863 -20.386 169.474 1.00 117.70 ? 245 LYS B CG  1 
ATOM   6369  C CD  . LYS B 1 245 ? 110.076 -21.253 169.726 1.00 123.27 ? 245 LYS B CD  1 
ATOM   6370  C CE  . LYS B 1 245 ? 109.910 -22.621 169.084 1.00 120.89 ? 245 LYS B CE  1 
ATOM   6371  N NZ  . LYS B 1 245 ? 109.329 -23.702 169.899 1.00 112.76 ? 245 LYS B NZ  1 
ATOM   6372  N N   . LYS B 1 246 ? 108.321 -15.972 170.517 1.00 73.96  ? 246 LYS B N   1 
ATOM   6373  C CA  . LYS B 1 246 ? 108.797 -14.651 170.897 1.00 79.82  ? 246 LYS B CA  1 
ATOM   6374  C C   . LYS B 1 246 ? 109.665 -14.707 172.147 1.00 95.23  ? 246 LYS B C   1 
ATOM   6375  O O   . LYS B 1 246 ? 109.446 -15.527 173.038 1.00 97.01  ? 246 LYS B O   1 
ATOM   6376  C CB  . LYS B 1 246 ? 107.626 -13.695 171.132 1.00 64.69  ? 246 LYS B CB  1 
ATOM   6377  C CG  . LYS B 1 246 ? 106.656 -13.550 169.971 1.00 75.53  ? 246 LYS B CG  1 
ATOM   6378  C CD  . LYS B 1 246 ? 107.341 -12.970 168.746 1.00 86.05  ? 246 LYS B CD  1 
ATOM   6379  C CE  . LYS B 1 246 ? 106.316 -12.466 167.741 1.00 91.88  ? 246 LYS B CE  1 
ATOM   6380  N NZ  . LYS B 1 246 ? 105.326 -13.514 167.377 1.00 82.94  ? 246 LYS B NZ  1 
ATOM   6381  N N   . ALA B 1 247 ? 110.665 -13.836 172.193 1.00 95.97  ? 247 ALA B N   1 
ATOM   6382  C CA  . ALA B 1 247 ? 111.523 -13.713 173.360 1.00 88.39  ? 247 ALA B CA  1 
ATOM   6383  C C   . ALA B 1 247 ? 111.977 -12.267 173.497 1.00 92.27  ? 247 ALA B C   1 
ATOM   6384  O O   . ALA B 1 247 ? 112.771 -11.775 172.697 1.00 105.59 ? 247 ALA B O   1 
ATOM   6385  C CB  . ALA B 1 247 ? 112.710 -14.649 173.256 1.00 71.43  ? 247 ALA B CB  1 
ATOM   6386  N N   . VAL B 1 248 ? 111.465 -11.593 174.519 1.00 76.45  ? 248 VAL B N   1 
ATOM   6387  C CA  . VAL B 1 248 ? 111.757 -10.183 174.741 1.00 70.46  ? 248 VAL B CA  1 
ATOM   6388  C C   . VAL B 1 248 ? 112.324 -9.937  176.130 1.00 74.59  ? 248 VAL B C   1 
ATOM   6389  O O   . VAL B 1 248 ? 112.169 -10.756 177.032 1.00 91.19  ? 248 VAL B O   1 
ATOM   6390  C CB  . VAL B 1 248 ? 110.505 -9.317  174.553 1.00 67.44  ? 248 VAL B CB  1 
ATOM   6391  C CG1 . VAL B 1 248 ? 109.975 -9.467  173.138 1.00 65.81  ? 248 VAL B CG1 1 
ATOM   6392  C CG2 . VAL B 1 248 ? 109.444 -9.709  175.565 1.00 83.01  ? 248 VAL B CG2 1 
ATOM   6393  N N   . ASP B 1 249 ? 112.980 -8.796  176.298 1.00 69.86  ? 249 ASP B N   1 
ATOM   6394  C CA  . ASP B 1 249 ? 113.559 -8.441  177.585 1.00 69.82  ? 249 ASP B CA  1 
ATOM   6395  C C   . ASP B 1 249 ? 112.517 -7.935  178.563 1.00 77.64  ? 249 ASP B C   1 
ATOM   6396  O O   . ASP B 1 249 ? 111.541 -7.291  178.179 1.00 86.89  ? 249 ASP B O   1 
ATOM   6397  C CB  . ASP B 1 249 ? 114.634 -7.364  177.418 1.00 84.17  ? 249 ASP B CB  1 
ATOM   6398  C CG  . ASP B 1 249 ? 115.959 -7.929  176.965 1.00 126.04 ? 249 ASP B CG  1 
ATOM   6399  O OD1 . ASP B 1 249 ? 115.965 -8.850  176.120 1.00 134.55 ? 249 ASP B OD1 1 
ATOM   6400  O OD2 . ASP B 1 249 ? 117.001 -7.460  177.467 1.00 147.44 ? 249 ASP B OD2 1 
ATOM   6401  N N   . VAL B 1 250 ? 112.743 -8.232  179.838 1.00 84.57  ? 250 VAL B N   1 
ATOM   6402  C CA  . VAL B 1 250 ? 111.922 -7.702  180.917 1.00 72.46  ? 250 VAL B CA  1 
ATOM   6403  C C   . VAL B 1 250 ? 112.784 -6.754  181.737 1.00 78.30  ? 250 VAL B C   1 
ATOM   6404  O O   . VAL B 1 250 ? 113.789 -7.164  182.312 1.00 86.46  ? 250 VAL B O   1 
ATOM   6405  C CB  . VAL B 1 250 ? 111.364 -8.809  181.815 1.00 64.67  ? 250 VAL B CB  1 
ATOM   6406  C CG1 . VAL B 1 250 ? 110.618 -8.198  182.988 1.00 64.57  ? 250 VAL B CG1 1 
ATOM   6407  C CG2 . VAL B 1 250 ? 110.451 -9.723  181.018 1.00 67.68  ? 250 VAL B CG2 1 
ATOM   6408  N N   . PHE B 1 251 ? 112.378 -5.493  181.816 1.00 69.59  ? 251 PHE B N   1 
ATOM   6409  C CA  . PHE B 1 251 ? 113.215 -4.483  182.456 1.00 77.43  ? 251 PHE B CA  1 
ATOM   6410  C C   . PHE B 1 251 ? 113.094 -4.378  183.974 1.00 89.79  ? 251 PHE B C   1 
ATOM   6411  O O   . PHE B 1 251 ? 112.002 -4.262  184.531 1.00 105.80 ? 251 PHE B O   1 
ATOM   6412  C CB  . PHE B 1 251 ? 112.948 -3.104  181.856 1.00 78.67  ? 251 PHE B CB  1 
ATOM   6413  C CG  . PHE B 1 251 ? 113.782 -2.018  182.476 1.00 93.57  ? 251 PHE B CG  1 
ATOM   6414  C CD1 . PHE B 1 251 ? 115.158 -2.019  182.331 1.00 112.28 ? 251 PHE B CD1 1 
ATOM   6415  C CD2 . PHE B 1 251 ? 113.194 -1.006  183.212 1.00 87.66  ? 251 PHE B CD2 1 
ATOM   6416  C CE1 . PHE B 1 251 ? 115.932 -1.030  182.910 1.00 115.71 ? 251 PHE B CE1 1 
ATOM   6417  C CE2 . PHE B 1 251 ? 113.957 -0.012  183.790 1.00 98.10  ? 251 PHE B CE2 1 
ATOM   6418  C CZ  . PHE B 1 251 ? 115.329 -0.022  183.639 1.00 113.06 ? 251 PHE B CZ  1 
ATOM   6419  N N   . PHE B 1 252 ? 114.250 -4.441  184.626 1.00 94.77  ? 252 PHE B N   1 
ATOM   6420  C CA  . PHE B 1 252 ? 114.370 -4.244  186.061 1.00 88.03  ? 252 PHE B CA  1 
ATOM   6421  C C   . PHE B 1 252 ? 115.375 -3.117  186.293 1.00 86.64  ? 252 PHE B C   1 
ATOM   6422  O O   . PHE B 1 252 ? 116.544 -3.252  185.929 1.00 99.47  ? 252 PHE B O   1 
ATOM   6423  C CB  . PHE B 1 252 ? 114.834 -5.524  186.752 1.00 88.80  ? 252 PHE B CB  1 
ATOM   6424  C CG  . PHE B 1 252 ? 113.835 -6.647  186.692 1.00 82.40  ? 252 PHE B CG  1 
ATOM   6425  C CD1 . PHE B 1 252 ? 112.768 -6.703  187.575 1.00 94.79  ? 252 PHE B CD1 1 
ATOM   6426  C CD2 . PHE B 1 252 ? 113.965 -7.646  185.744 1.00 77.78  ? 252 PHE B CD2 1 
ATOM   6427  C CE1 . PHE B 1 252 ? 111.855 -7.740  187.513 1.00 100.35 ? 252 PHE B CE1 1 
ATOM   6428  C CE2 . PHE B 1 252 ? 113.057 -8.680  185.674 1.00 77.97  ? 252 PHE B CE2 1 
ATOM   6429  C CZ  . PHE B 1 252 ? 112.000 -8.730  186.559 1.00 97.66  ? 252 PHE B CZ  1 
ATOM   6430  N N   . PRO B 1 253 ? 114.929 -2.001  186.896 1.00 88.33  ? 253 PRO B N   1 
ATOM   6431  C CA  . PRO B 1 253 ? 115.807 -0.849  187.147 1.00 104.33 ? 253 PRO B CA  1 
ATOM   6432  C C   . PRO B 1 253 ? 117.011 -1.220  188.014 1.00 111.12 ? 253 PRO B C   1 
ATOM   6433  O O   . PRO B 1 253 ? 116.967 -2.252  188.685 1.00 113.92 ? 253 PRO B O   1 
ATOM   6434  C CB  . PRO B 1 253 ? 114.890 0.146   187.872 1.00 124.62 ? 253 PRO B CB  1 
ATOM   6435  C CG  . PRO B 1 253 ? 113.771 -0.664  188.404 1.00 126.65 ? 253 PRO B CG  1 
ATOM   6436  C CD  . PRO B 1 253 ? 113.581 -1.803  187.455 1.00 112.54 ? 253 PRO B CD  1 
ATOM   6437  N N   . PRO B 1 254 ? 118.071 -0.391  188.001 1.00 121.94 ? 254 PRO B N   1 
ATOM   6438  C CA  . PRO B 1 254 ? 119.288 -0.704  188.759 1.00 124.93 ? 254 PRO B CA  1 
ATOM   6439  C C   . PRO B 1 254 ? 119.048 -0.810  190.262 1.00 128.42 ? 254 PRO B C   1 
ATOM   6440  O O   . PRO B 1 254 ? 119.719 -1.592  190.937 1.00 121.71 ? 254 PRO B O   1 
ATOM   6441  C CB  . PRO B 1 254 ? 120.209 0.480   188.441 1.00 127.44 ? 254 PRO B CB  1 
ATOM   6442  C CG  . PRO B 1 254 ? 119.283 1.586   188.051 1.00 134.68 ? 254 PRO B CG  1 
ATOM   6443  C CD  . PRO B 1 254 ? 118.186 0.899   187.298 1.00 127.41 ? 254 PRO B CD  1 
ATOM   6444  N N   . GLU B 1 255 ? 118.111 -0.022  190.777 1.00 132.62 ? 255 GLU B N   1 
ATOM   6445  C CA  . GLU B 1 255 ? 117.766 -0.073  192.192 1.00 131.86 ? 255 GLU B CA  1 
ATOM   6446  C C   . GLU B 1 255 ? 117.012 -1.349  192.546 1.00 118.16 ? 255 GLU B C   1 
ATOM   6447  O O   . GLU B 1 255 ? 117.113 -1.843  193.670 1.00 115.58 ? 255 GLU B O   1 
ATOM   6448  C CB  . GLU B 1 255 ? 116.938 1.146   192.585 1.00 138.72 ? 255 GLU B CB  1 
ATOM   6449  C CG  . GLU B 1 255 ? 115.700 1.350   191.731 1.00 143.62 ? 255 GLU B CG  1 
ATOM   6450  C CD  . GLU B 1 255 ? 114.417 1.136   192.506 1.00 156.28 ? 255 GLU B CD  1 
ATOM   6451  O OE1 . GLU B 1 255 ? 114.149 -0.010  192.927 1.00 148.49 ? 255 GLU B OE1 1 
ATOM   6452  O OE2 . GLU B 1 255 ? 113.673 2.121   192.695 1.00 169.38 ? 255 GLU B OE2 1 
ATOM   6453  N N   . ALA B 1 256 ? 116.269 -1.888  191.584 1.00 102.52 ? 256 ALA B N   1 
ATOM   6454  C CA  . ALA B 1 256 ? 115.451 -3.064  191.848 1.00 96.09  ? 256 ALA B CA  1 
ATOM   6455  C C   . ALA B 1 256 ? 116.197 -4.376  191.662 1.00 92.20  ? 256 ALA B C   1 
ATOM   6456  O O   . ALA B 1 256 ? 115.685 -5.304  191.040 1.00 89.46  ? 256 ALA B O   1 
ATOM   6457  C CB  . ALA B 1 256 ? 114.214 -3.050  190.967 1.00 100.82 ? 256 ALA B CB  1 
ATOM   6458  N N   . GLN B 1 257 ? 117.409 -4.458  192.194 1.00 91.40  ? 257 GLN B N   1 
ATOM   6459  C CA  . GLN B 1 257 ? 118.106 -5.732  192.215 1.00 93.31  ? 257 GLN B CA  1 
ATOM   6460  C C   . GLN B 1 257 ? 117.336 -6.572  193.217 1.00 98.26  ? 257 GLN B C   1 
ATOM   6461  O O   . GLN B 1 257 ? 116.748 -6.017  194.146 1.00 121.26 ? 257 GLN B O   1 
ATOM   6462  C CB  . GLN B 1 257 ? 119.576 -5.579  192.611 1.00 115.70 ? 257 GLN B CB  1 
ATOM   6463  C CG  . GLN B 1 257 ? 120.476 -5.128  191.467 1.00 122.32 ? 257 GLN B CG  1 
ATOM   6464  C CD  . GLN B 1 257 ? 121.889 -4.805  191.915 1.00 138.17 ? 257 GLN B CD  1 
ATOM   6465  O OE1 . GLN B 1 257 ? 122.791 -5.642  191.854 1.00 146.75 ? 257 GLN B OE1 1 
ATOM   6466  N NE2 . GLN B 1 257 ? 122.089 -3.571  192.358 1.00 151.28 ? 257 GLN B NE2 1 
ATOM   6467  N N   . ASN B 1 258 ? 117.296 -7.883  192.982 1.00 97.49  ? 258 ASN B N   1 
ATOM   6468  C CA  . ASN B 1 258 ? 116.602 -8.858  193.831 1.00 112.45 ? 258 ASN B CA  1 
ATOM   6469  C C   . ASN B 1 258 ? 115.096 -8.876  193.583 1.00 100.14 ? 258 ASN B C   1 
ATOM   6470  O O   . ASN B 1 258 ? 114.322 -9.402  194.383 1.00 93.93  ? 258 ASN B O   1 
ATOM   6471  C CB  . ASN B 1 258 ? 116.876 -8.573  195.305 1.00 124.97 ? 258 ASN B CB  1 
ATOM   6472  C CG  . ASN B 1 258 ? 118.346 -8.581  195.623 1.00 145.07 ? 258 ASN B CG  1 
ATOM   6473  O OD1 . ASN B 1 258 ? 118.844 -7.691  196.314 1.00 153.76 ? 258 ASN B OD1 1 
ATOM   6474  N ND2 . ASN B 1 258 ? 119.064 -9.556  195.083 1.00 145.50 ? 258 ASN B ND2 1 
ATOM   6475  N N   . ASP B 1 259 ? 114.691 -8.281  192.469 1.00 83.90  ? 259 ASP B N   1 
ATOM   6476  C CA  . ASP B 1 259 ? 113.299 -8.284  192.042 1.00 94.54  ? 259 ASP B CA  1 
ATOM   6477  C C   . ASP B 1 259 ? 113.073 -9.337  190.963 1.00 90.26  ? 259 ASP B C   1 
ATOM   6478  O O   . ASP B 1 259 ? 113.986 -9.657  190.206 1.00 85.94  ? 259 ASP B O   1 
ATOM   6479  C CB  . ASP B 1 259 ? 112.910 -6.902  191.527 1.00 100.60 ? 259 ASP B CB  1 
ATOM   6480  C CG  . ASP B 1 259 ? 111.418 -6.724  191.412 1.00 103.13 ? 259 ASP B CG  1 
ATOM   6481  O OD1 . ASP B 1 259 ? 110.669 -7.522  192.015 1.00 93.95  ? 259 ASP B OD1 1 
ATOM   6482  O OD2 . ASP B 1 259 ? 110.994 -5.773  190.727 1.00 104.17 ? 259 ASP B OD2 1 
ATOM   6483  N N   . PHE B 1 260 ? 111.861 -9.873  190.882 1.00 76.21  ? 260 PHE B N   1 
ATOM   6484  C CA  . PHE B 1 260 ? 111.568 -10.897 189.886 1.00 71.65  ? 260 PHE B CA  1 
ATOM   6485  C C   . PHE B 1 260 ? 110.071 -10.984 189.625 1.00 83.63  ? 260 PHE B C   1 
ATOM   6486  O O   . PHE B 1 260 ? 109.274 -10.537 190.450 1.00 94.59  ? 260 PHE B O   1 
ATOM   6487  C CB  . PHE B 1 260 ? 112.115 -12.255 190.339 1.00 70.78  ? 260 PHE B CB  1 
ATOM   6488  C CG  . PHE B 1 260 ? 111.685 -12.656 191.720 1.00 74.71  ? 260 PHE B CG  1 
ATOM   6489  C CD1 . PHE B 1 260 ? 110.587 -13.477 191.901 1.00 91.02  ? 260 PHE B CD1 1 
ATOM   6490  C CD2 . PHE B 1 260 ? 112.381 -12.219 192.835 1.00 76.78  ? 260 PHE B CD2 1 
ATOM   6491  C CE1 . PHE B 1 260 ? 110.185 -13.852 193.166 1.00 83.04  ? 260 PHE B CE1 1 
ATOM   6492  C CE2 . PHE B 1 260 ? 111.984 -12.589 194.105 1.00 80.40  ? 260 PHE B CE2 1 
ATOM   6493  C CZ  . PHE B 1 260 ? 110.884 -13.407 194.271 1.00 77.91  ? 260 PHE B CZ  1 
ATOM   6494  N N   . PRO B 1 261 ? 109.677 -11.552 188.473 1.00 79.56  ? 261 PRO B N   1 
ATOM   6495  C CA  . PRO B 1 261 ? 108.233 -11.657 188.240 1.00 81.67  ? 261 PRO B CA  1 
ATOM   6496  C C   . PRO B 1 261 ? 107.540 -12.562 189.256 1.00 93.17  ? 261 PRO B C   1 
ATOM   6497  O O   . PRO B 1 261 ? 108.002 -13.670 189.542 1.00 102.60 ? 261 PRO B O   1 
ATOM   6498  C CB  . PRO B 1 261 ? 108.138 -12.240 186.823 1.00 65.84  ? 261 PRO B CB  1 
ATOM   6499  C CG  . PRO B 1 261 ? 109.485 -12.810 186.537 1.00 66.63  ? 261 PRO B CG  1 
ATOM   6500  C CD  . PRO B 1 261 ? 110.460 -11.986 187.303 1.00 66.82  ? 261 PRO B CD  1 
ATOM   6501  N N   . VAL B 1 262 ? 106.414 -12.082 189.774 1.00 85.80  ? 262 VAL B N   1 
ATOM   6502  C CA  . VAL B 1 262 ? 105.672 -12.777 190.822 1.00 73.11  ? 262 VAL B CA  1 
ATOM   6503  C C   . VAL B 1 262 ? 104.318 -13.276 190.322 1.00 70.31  ? 262 VAL B C   1 
ATOM   6504  O O   . VAL B 1 262 ? 103.862 -14.348 190.721 1.00 71.31  ? 262 VAL B O   1 
ATOM   6505  C CB  . VAL B 1 262 ? 105.478 -11.863 192.064 1.00 66.30  ? 262 VAL B CB  1 
ATOM   6506  C CG1 . VAL B 1 262 ? 104.101 -12.043 192.691 1.00 84.18  ? 262 VAL B CG1 1 
ATOM   6507  C CG2 . VAL B 1 262 ? 106.565 -12.135 193.086 1.00 85.17  ? 262 VAL B CG2 1 
ATOM   6508  N N   . ALA B 1 263 ? 103.681 -12.508 189.444 1.00 65.41  ? 263 ALA B N   1 
ATOM   6509  C CA  . ALA B 1 263 ? 102.371 -12.889 188.928 1.00 58.44  ? 263 ALA B CA  1 
ATOM   6510  C C   . ALA B 1 263 ? 102.181 -12.484 187.468 1.00 67.01  ? 263 ALA B C   1 
ATOM   6511  O O   . ALA B 1 263 ? 102.788 -11.522 186.998 1.00 81.07  ? 263 ALA B O   1 
ATOM   6512  C CB  . ALA B 1 263 ? 101.276 -12.280 189.787 1.00 59.73  ? 263 ALA B CB  1 
ATOM   6513  N N   . MET B 1 264 ? 101.343 -13.232 186.754 1.00 73.43  ? 264 MET B N   1 
ATOM   6514  C CA  . MET B 1 264 ? 101.032 -12.924 185.361 1.00 72.71  ? 264 MET B CA  1 
ATOM   6515  C C   . MET B 1 264 ? 99.603  -13.314 184.994 1.00 62.26  ? 264 MET B C   1 
ATOM   6516  O O   . MET B 1 264 ? 99.181  -14.450 185.204 1.00 69.20  ? 264 MET B O   1 
ATOM   6517  C CB  . MET B 1 264 ? 102.013 -13.626 184.420 1.00 64.48  ? 264 MET B CB  1 
ATOM   6518  C CG  . MET B 1 264 ? 101.781 -13.314 182.948 1.00 60.60  ? 264 MET B CG  1 
ATOM   6519  S SD  . MET B 1 264 ? 102.581 -14.465 181.817 1.00 103.89 ? 264 MET B SD  1 
ATOM   6520  C CE  . MET B 1 264 ? 104.309 -14.005 182.007 1.00 68.20  ? 264 MET B CE  1 
ATOM   6521  N N   . GLN B 1 265 ? 98.868  -12.357 184.436 1.00 57.32  ? 265 GLN B N   1 
ATOM   6522  C CA  . GLN B 1 265 ? 97.513  -12.591 183.950 1.00 62.02  ? 265 GLN B CA  1 
ATOM   6523  C C   . GLN B 1 265 ? 97.405  -12.047 182.531 1.00 69.04  ? 265 GLN B C   1 
ATOM   6524  O O   . GLN B 1 265 ? 97.810  -10.920 182.263 1.00 87.23  ? 265 GLN B O   1 
ATOM   6525  C CB  . GLN B 1 265 ? 96.477  -11.916 184.852 1.00 71.82  ? 265 GLN B CB  1 
ATOM   6526  C CG  . GLN B 1 265 ? 96.327  -12.522 186.247 1.00 81.62  ? 265 GLN B CG  1 
ATOM   6527  C CD  . GLN B 1 265 ? 95.779  -13.935 186.235 1.00 87.03  ? 265 GLN B CD  1 
ATOM   6528  O OE1 . GLN B 1 265 ? 95.124  -14.356 185.280 1.00 103.41 ? 265 GLN B OE1 1 
ATOM   6529  N NE2 . GLN B 1 265 ? 96.012  -14.664 187.318 1.00 87.60  ? 265 GLN B NE2 1 
ATOM   6530  N N   . ILE B 1 266 ? 96.871  -12.848 181.617 1.00 61.45  ? 266 ILE B N   1 
ATOM   6531  C CA  . ILE B 1 266 ? 96.719  -12.406 180.232 1.00 67.54  ? 266 ILE B CA  1 
ATOM   6532  C C   . ILE B 1 266 ? 95.273  -12.055 179.911 1.00 69.78  ? 266 ILE B C   1 
ATOM   6533  O O   . ILE B 1 266 ? 94.364  -12.849 180.143 1.00 84.91  ? 266 ILE B O   1 
ATOM   6534  C CB  . ILE B 1 266 ? 97.209  -13.468 179.240 1.00 73.23  ? 266 ILE B CB  1 
ATOM   6535  C CG1 . ILE B 1 266 ? 98.685  -13.764 179.486 1.00 77.19  ? 266 ILE B CG1 1 
ATOM   6536  C CG2 . ILE B 1 266 ? 96.996  -12.998 177.807 1.00 73.47  ? 266 ILE B CG2 1 
ATOM   6537  C CD1 . ILE B 1 266 ? 99.149  -15.053 178.855 1.00 85.48  ? 266 ILE B CD1 1 
ATOM   6538  N N   . SER B 1 267 ? 95.071  -10.862 179.364 1.00 67.17  ? 267 SER B N   1 
ATOM   6539  C CA  . SER B 1 267 ? 93.738  -10.412 178.986 1.00 84.23  ? 267 SER B CA  1 
ATOM   6540  C C   . SER B 1 267 ? 93.410  -10.787 177.547 1.00 95.96  ? 267 SER B C   1 
ATOM   6541  O O   . SER B 1 267 ? 93.936  -10.198 176.607 1.00 105.60 ? 267 SER B O   1 
ATOM   6542  C CB  . SER B 1 267 ? 93.612  -8.902  179.173 1.00 86.94  ? 267 SER B CB  1 
ATOM   6543  O OG  . SER B 1 267 ? 92.499  -8.393  178.462 1.00 88.38  ? 267 SER B OG  1 
ATOM   6544  N N   . GLU B 1 268 ? 92.514  -11.754 177.386 1.00 87.30  ? 268 GLU B N   1 
ATOM   6545  C CA  . GLU B 1 268 ? 92.117  -12.238 176.071 1.00 79.50  ? 268 GLU B CA  1 
ATOM   6546  C C   . GLU B 1 268 ? 91.395  -11.141 175.288 1.00 88.99  ? 268 GLU B C   1 
ATOM   6547  O O   . GLU B 1 268 ? 91.480  -11.078 174.062 1.00 89.07  ? 268 GLU B O   1 
ATOM   6548  C CB  . GLU B 1 268 ? 91.213  -13.464 176.220 1.00 78.09  ? 268 GLU B CB  1 
ATOM   6549  C CG  . GLU B 1 268 ? 91.775  -14.535 177.150 1.00 96.53  ? 268 GLU B CG  1 
ATOM   6550  C CD  . GLU B 1 268 ? 92.431  -15.682 176.408 1.00 122.32 ? 268 GLU B CD  1 
ATOM   6551  O OE1 . GLU B 1 268 ? 93.581  -16.030 176.748 1.00 144.60 ? 268 GLU B OE1 1 
ATOM   6552  O OE2 . GLU B 1 268 ? 91.792  -16.241 175.492 1.00 117.49 ? 268 GLU B OE2 1 
ATOM   6553  N N   . LYS B 1 269 ? 90.696  -10.275 176.015 1.00 93.66  ? 269 LYS B N   1 
ATOM   6554  C CA  . LYS B 1 269 ? 89.914  -9.192  175.424 1.00 99.13  ? 269 LYS B CA  1 
ATOM   6555  C C   . LYS B 1 269 ? 90.766  -8.216  174.614 1.00 102.14 ? 269 LYS B C   1 
ATOM   6556  O O   . LYS B 1 269 ? 90.463  -7.931  173.455 1.00 116.66 ? 269 LYS B O   1 
ATOM   6557  C CB  . LYS B 1 269 ? 89.162  -8.445  176.522 1.00 98.84  ? 269 LYS B CB  1 
ATOM   6558  C CG  . LYS B 1 269 ? 87.860  -7.808  176.073 1.00 104.81 ? 269 LYS B CG  1 
ATOM   6559  C CD  . LYS B 1 269 ? 87.338  -6.864  177.139 1.00 119.31 ? 269 LYS B CD  1 
ATOM   6560  C CE  . LYS B 1 269 ? 85.986  -6.285  176.762 1.00 132.27 ? 269 LYS B CE  1 
ATOM   6561  N NZ  . LYS B 1 269 ? 86.048  -5.476  175.518 1.00 130.70 ? 269 LYS B NZ  1 
ATOM   6562  N N   . HIS B 1 270 ? 91.821  -7.696  175.230 1.00 89.86  ? 270 HIS B N   1 
ATOM   6563  C CA  . HIS B 1 270 ? 92.700  -6.733  174.568 1.00 96.24  ? 270 HIS B CA  1 
ATOM   6564  C C   . HIS B 1 270 ? 93.973  -7.377  174.040 1.00 102.40 ? 270 HIS B C   1 
ATOM   6565  O O   . HIS B 1 270 ? 94.774  -6.717  173.379 1.00 98.14  ? 270 HIS B O   1 
ATOM   6566  C CB  . HIS B 1 270 ? 93.059  -5.597  175.527 1.00 90.57  ? 270 HIS B CB  1 
ATOM   6567  C CG  . HIS B 1 270 ? 91.911  -5.148  176.378 1.00 106.65 ? 270 HIS B CG  1 
ATOM   6568  N ND1 . HIS B 1 270 ? 91.541  -5.799  177.530 1.00 114.68 ? 270 HIS B ND1 1 
ATOM   6569  C CD2 . HIS B 1 270 ? 91.047  -4.109  176.241 1.00 121.69 ? 270 HIS B CD2 1 
ATOM   6570  C CE1 . HIS B 1 270 ? 90.498  -5.193  178.071 1.00 126.29 ? 270 HIS B CE1 1 
ATOM   6571  N NE2 . HIS B 1 270 ? 90.184  -4.160  177.305 1.00 126.49 ? 270 HIS B NE2 1 
ATOM   6572  N N   . ASP B 1 271 ? 94.157  -8.658  174.352 1.00 111.76 ? 271 ASP B N   1 
ATOM   6573  C CA  . ASP B 1 271 ? 95.360  -9.401  173.964 1.00 90.77  ? 271 ASP B CA  1 
ATOM   6574  C C   . ASP B 1 271 ? 96.637  -8.780  174.501 1.00 84.06  ? 271 ASP B C   1 
ATOM   6575  O O   . ASP B 1 271 ? 97.564  -8.491  173.750 1.00 79.97  ? 271 ASP B O   1 
ATOM   6576  C CB  . ASP B 1 271 ? 95.464  -9.526  172.444 1.00 80.38  ? 271 ASP B CB  1 
ATOM   6577  C CG  . ASP B 1 271 ? 94.416  -10.440 171.874 1.00 109.97 ? 271 ASP B CG  1 
ATOM   6578  O OD1 . ASP B 1 271 ? 94.231  -11.536 172.441 1.00 122.71 ? 271 ASP B OD1 1 
ATOM   6579  O OD2 . ASP B 1 271 ? 93.776  -10.079 170.864 1.00 108.37 ? 271 ASP B OD2 1 
ATOM   6580  N N   . VAL B 1 272 ? 96.662  -8.568  175.811 1.00 70.36  ? 272 VAL B N   1 
ATOM   6581  C CA  . VAL B 1 272 ? 97.812  -7.996  176.505 1.00 71.57  ? 272 VAL B CA  1 
ATOM   6582  C C   . VAL B 1 272 ? 98.187  -8.806  177.736 1.00 77.03  ? 272 VAL B C   1 
ATOM   6583  O O   . VAL B 1 272 ? 97.343  -9.463  178.342 1.00 69.52  ? 272 VAL B O   1 
ATOM   6584  C CB  . VAL B 1 272 ? 97.570  -6.545  176.934 1.00 71.66  ? 272 VAL B CB  1 
ATOM   6585  C CG1 . VAL B 1 272 ? 97.329  -5.661  175.724 1.00 72.79  ? 272 VAL B CG1 1 
ATOM   6586  C CG2 . VAL B 1 272 ? 96.423  -6.467  177.929 1.00 73.68  ? 272 VAL B CG2 1 
ATOM   6587  N N   . VAL B 1 273 ? 99.465  -8.770  178.088 1.00 84.37  ? 273 VAL B N   1 
ATOM   6588  C CA  . VAL B 1 273 ? 99.966  -9.523  179.229 1.00 73.27  ? 273 VAL B CA  1 
ATOM   6589  C C   . VAL B 1 273 ? 100.236 -8.633  180.442 1.00 76.76  ? 273 VAL B C   1 
ATOM   6590  O O   . VAL B 1 273 ? 100.959 -7.646  180.342 1.00 92.24  ? 273 VAL B O   1 
ATOM   6591  C CB  . VAL B 1 273 ? 101.263 -10.264 178.880 1.00 67.31  ? 273 VAL B CB  1 
ATOM   6592  C CG1 . VAL B 1 273 ? 101.722 -11.101 180.061 1.00 70.51  ? 273 VAL B CG1 1 
ATOM   6593  C CG2 . VAL B 1 273 ? 101.073 -11.128 177.634 1.00 69.55  ? 273 VAL B CG2 1 
ATOM   6594  N N   . PHE B 1 274 ? 99.659  -8.984  181.589 1.00 84.74  ? 274 PHE B N   1 
ATOM   6595  C CA  . PHE B 1 274 ? 99.935  -8.248  182.817 1.00 77.02  ? 274 PHE B CA  1 
ATOM   6596  C C   . PHE B 1 274 ? 101.045 -8.952  183.584 1.00 80.60  ? 274 PHE B C   1 
ATOM   6597  O O   . PHE B 1 274 ? 101.001 -10.164 183.774 1.00 93.18  ? 274 PHE B O   1 
ATOM   6598  C CB  . PHE B 1 274 ? 98.694  -8.149  183.704 1.00 72.53  ? 274 PHE B CB  1 
ATOM   6599  C CG  . PHE B 1 274 ? 97.583  -7.317  183.125 1.00 81.17  ? 274 PHE B CG  1 
ATOM   6600  C CD1 . PHE B 1 274 ? 97.619  -5.935  183.196 1.00 83.03  ? 274 PHE B CD1 1 
ATOM   6601  C CD2 . PHE B 1 274 ? 96.486  -7.924  182.538 1.00 89.60  ? 274 PHE B CD2 1 
ATOM   6602  C CE1 . PHE B 1 274 ? 96.588  -5.174  182.675 1.00 96.78  ? 274 PHE B CE1 1 
ATOM   6603  C CE2 . PHE B 1 274 ? 95.454  -7.172  182.014 1.00 99.81  ? 274 PHE B CE2 1 
ATOM   6604  C CZ  . PHE B 1 274 ? 95.503  -5.794  182.082 1.00 106.26 ? 274 PHE B CZ  1 
ATOM   6605  N N   . LEU B 1 275 ? 102.038 -8.193  184.032 1.00 63.87  ? 275 LEU B N   1 
ATOM   6606  C CA  . LEU B 1 275 ? 103.134 -8.775  184.797 1.00 58.05  ? 275 LEU B CA  1 
ATOM   6607  C C   . LEU B 1 275 ? 103.387 -7.982  186.072 1.00 62.53  ? 275 LEU B C   1 
ATOM   6608  O O   . LEU B 1 275 ? 103.614 -6.775  186.033 1.00 60.53  ? 275 LEU B O   1 
ATOM   6609  C CB  . LEU B 1 275 ? 104.407 -8.841  183.952 1.00 57.35  ? 275 LEU B CB  1 
ATOM   6610  C CG  . LEU B 1 275 ? 105.532 -9.733  184.480 1.00 59.90  ? 275 LEU B CG  1 
ATOM   6611  C CD1 . LEU B 1 275 ? 105.092 -11.187 184.548 1.00 77.25  ? 275 LEU B CD1 1 
ATOM   6612  C CD2 . LEU B 1 275 ? 106.773 -9.588  183.623 1.00 68.13  ? 275 LEU B CD2 1 
ATOM   6613  N N   . ILE B 1 276 ? 103.350 -8.676  187.202 1.00 61.63  ? 276 ILE B N   1 
ATOM   6614  C CA  . ILE B 1 276 ? 103.572 -8.046  188.494 1.00 65.19  ? 276 ILE B CA  1 
ATOM   6615  C C   . ILE B 1 276 ? 104.823 -8.619  189.144 1.00 67.24  ? 276 ILE B C   1 
ATOM   6616  O O   . ILE B 1 276 ? 104.995 -9.832  189.224 1.00 95.98  ? 276 ILE B O   1 
ATOM   6617  C CB  . ILE B 1 276 ? 102.359 -8.235  189.423 1.00 74.20  ? 276 ILE B CB  1 
ATOM   6618  C CG1 . ILE B 1 276 ? 101.209 -7.330  188.978 1.00 82.62  ? 276 ILE B CG1 1 
ATOM   6619  C CG2 . ILE B 1 276 ? 102.734 -7.987  190.879 1.00 73.16  ? 276 ILE B CG2 1 
ATOM   6620  C CD1 . ILE B 1 276 ? 99.931  -7.553  189.745 1.00 96.82  ? 276 ILE B CD1 1 
ATOM   6621  N N   . THR B 1 277 ? 105.694 -7.738  189.616 1.00 60.29  ? 277 THR B N   1 
ATOM   6622  C CA  . THR B 1 277 ? 106.949 -8.156  190.231 1.00 79.60  ? 277 THR B CA  1 
ATOM   6623  C C   . THR B 1 277 ? 106.865 -8.143  191.756 1.00 76.01  ? 277 THR B C   1 
ATOM   6624  O O   . THR B 1 277 ? 105.911 -7.620  192.330 1.00 92.94  ? 277 THR B O   1 
ATOM   6625  C CB  . THR B 1 277 ? 108.107 -7.253  189.780 1.00 80.37  ? 277 THR B CB  1 
ATOM   6626  O OG1 . THR B 1 277 ? 107.995 -5.980  190.423 1.00 88.66  ? 277 THR B OG1 1 
ATOM   6627  C CG2 . THR B 1 277 ? 108.075 -7.066  188.262 1.00 60.89  ? 277 THR B CG2 1 
ATOM   6628  N N   . LYS B 1 278 ? 107.873 -8.728  192.397 1.00 68.94  ? 278 LYS B N   1 
ATOM   6629  C CA  . LYS B 1 278 ? 107.927 -8.822  193.852 1.00 70.29  ? 278 LYS B CA  1 
ATOM   6630  C C   . LYS B 1 278 ? 107.895 -7.447  194.513 1.00 80.40  ? 278 LYS B C   1 
ATOM   6631  O O   . LYS B 1 278 ? 107.259 -7.264  195.550 1.00 105.07 ? 278 LYS B O   1 
ATOM   6632  C CB  . LYS B 1 278 ? 109.178 -9.582  194.296 1.00 76.70  ? 278 LYS B CB  1 
ATOM   6633  C CG  . LYS B 1 278 ? 109.267 -9.811  195.797 1.00 74.90  ? 278 LYS B CG  1 
ATOM   6634  C CD  . LYS B 1 278 ? 108.614 -11.132 196.193 1.00 88.56  ? 278 LYS B CD  1 
ATOM   6635  C CE  . LYS B 1 278 ? 108.653 -11.342 197.699 1.00 111.34 ? 278 LYS B CE  1 
ATOM   6636  N NZ  . LYS B 1 278 ? 108.746 -12.784 198.065 1.00 114.71 ? 278 LYS B NZ  1 
ATOM   6637  N N   . TYR B 1 279 ? 108.577 -6.480  193.910 1.00 74.77  ? 279 TYR B N   1 
ATOM   6638  C CA  . TYR B 1 279 ? 108.642 -5.128  194.463 1.00 77.22  ? 279 TYR B CA  1 
ATOM   6639  C C   . TYR B 1 279 ? 107.339 -4.353  194.304 1.00 93.42  ? 279 TYR B C   1 
ATOM   6640  O O   . TYR B 1 279 ? 107.135 -3.338  194.968 1.00 113.98 ? 279 TYR B O   1 
ATOM   6641  C CB  . TYR B 1 279 ? 109.771 -4.334  193.805 1.00 94.56  ? 279 TYR B CB  1 
ATOM   6642  C CG  . TYR B 1 279 ? 111.162 -4.615  194.330 1.00 98.54  ? 279 TYR B CG  1 
ATOM   6643  C CD1 . TYR B 1 279 ? 111.534 -5.884  194.758 1.00 101.22 ? 279 TYR B CD1 1 
ATOM   6644  C CD2 . TYR B 1 279 ? 112.116 -3.607  194.366 1.00 95.67  ? 279 TYR B CD2 1 
ATOM   6645  C CE1 . TYR B 1 279 ? 112.812 -6.129  195.232 1.00 98.68  ? 279 TYR B CE1 1 
ATOM   6646  C CE2 . TYR B 1 279 ? 113.391 -3.844  194.830 1.00 97.58  ? 279 TYR B CE2 1 
ATOM   6647  C CZ  . TYR B 1 279 ? 113.736 -5.105  195.262 1.00 98.80  ? 279 TYR B CZ  1 
ATOM   6648  O OH  . TYR B 1 279 ? 115.013 -5.333  195.723 1.00 100.90 ? 279 TYR B OH  1 
ATOM   6649  N N   . GLY B 1 280 ? 106.462 -4.820  193.423 1.00 84.83  ? 280 GLY B N   1 
ATOM   6650  C CA  . GLY B 1 280 ? 105.193 -4.149  193.218 1.00 86.92  ? 280 GLY B CA  1 
ATOM   6651  C C   . GLY B 1 280 ? 105.086 -3.399  191.905 1.00 96.59  ? 280 GLY B C   1 
ATOM   6652  O O   . GLY B 1 280 ? 104.188 -2.578  191.725 1.00 107.16 ? 280 GLY B O   1 
ATOM   6653  N N   . TYR B 1 281 ? 106.015 -3.664  190.992 1.00 89.56  ? 281 TYR B N   1 
ATOM   6654  C CA  . TYR B 1 281 ? 105.988 -3.049  189.668 1.00 77.48  ? 281 TYR B CA  1 
ATOM   6655  C C   . TYR B 1 281 ? 105.042 -3.800  188.744 1.00 89.44  ? 281 TYR B C   1 
ATOM   6656  O O   . TYR B 1 281 ? 105.041 -5.031  188.723 1.00 92.24  ? 281 TYR B O   1 
ATOM   6657  C CB  . TYR B 1 281 ? 107.381 -3.035  189.041 1.00 73.03  ? 281 TYR B CB  1 
ATOM   6658  C CG  . TYR B 1 281 ? 108.365 -2.087  189.678 1.00 95.82  ? 281 TYR B CG  1 
ATOM   6659  C CD1 . TYR B 1 281 ? 109.217 -2.520  190.683 1.00 113.29 ? 281 TYR B CD1 1 
ATOM   6660  C CD2 . TYR B 1 281 ? 108.460 -0.764  189.261 1.00 98.01  ? 281 TYR B CD2 1 
ATOM   6661  C CE1 . TYR B 1 281 ? 110.127 -1.659  191.267 1.00 116.85 ? 281 TYR B CE1 1 
ATOM   6662  C CE2 . TYR B 1 281 ? 109.367 0.104   189.839 1.00 103.43 ? 281 TYR B CE2 1 
ATOM   6663  C CZ  . TYR B 1 281 ? 110.197 -0.349  190.843 1.00 107.83 ? 281 TYR B CZ  1 
ATOM   6664  O OH  . TYR B 1 281 ? 111.102 0.509   191.424 1.00 98.80  ? 281 TYR B OH  1 
ATOM   6665  N N   . ILE B 1 282 ? 104.231 -3.070  187.987 1.00 91.40  ? 282 ILE B N   1 
ATOM   6666  C CA  . ILE B 1 282 ? 103.389 -3.714  186.988 1.00 74.05  ? 282 ILE B CA  1 
ATOM   6667  C C   . ILE B 1 282 ? 103.997 -3.529  185.597 1.00 73.91  ? 282 ILE B C   1 
ATOM   6668  O O   . ILE B 1 282 ? 104.610 -2.505  185.305 1.00 93.21  ? 282 ILE B O   1 
ATOM   6669  C CB  . ILE B 1 282 ? 101.939 -3.179  187.005 1.00 71.92  ? 282 ILE B CB  1 
ATOM   6670  C CG1 . ILE B 1 282 ? 101.036 -4.077  186.153 1.00 68.54  ? 282 ILE B CG1 1 
ATOM   6671  C CG2 . ILE B 1 282 ? 101.873 -1.739  186.523 1.00 80.21  ? 282 ILE B CG2 1 
ATOM   6672  C CD1 . ILE B 1 282 ? 99.685  -4.360  186.761 1.00 73.94  ? 282 ILE B CD1 1 
ATOM   6673  N N   . HIS B 1 283 ? 103.814 -4.527  184.741 1.00 67.91  ? 283 HIS B N   1 
ATOM   6674  C CA  . HIS B 1 283 ? 104.321 -4.494  183.377 1.00 71.08  ? 283 HIS B CA  1 
ATOM   6675  C C   . HIS B 1 283 ? 103.188 -4.848  182.427 1.00 80.22  ? 283 HIS B C   1 
ATOM   6676  O O   . HIS B 1 283 ? 102.353 -5.685  182.754 1.00 92.77  ? 283 HIS B O   1 
ATOM   6677  C CB  . HIS B 1 283 ? 105.475 -5.491  183.189 1.00 67.96  ? 283 HIS B CB  1 
ATOM   6678  C CG  . HIS B 1 283 ? 106.787 -5.054  183.767 1.00 64.71  ? 283 HIS B CG  1 
ATOM   6679  N ND1 . HIS B 1 283 ? 107.958 -5.087  183.044 1.00 62.22  ? 283 HIS B ND1 1 
ATOM   6680  C CD2 . HIS B 1 283 ? 107.126 -4.610  185.003 1.00 68.51  ? 283 HIS B CD2 1 
ATOM   6681  C CE1 . HIS B 1 283 ? 108.957 -4.666  183.793 1.00 73.58  ? 283 HIS B CE1 1 
ATOM   6682  N NE2 . HIS B 1 283 ? 108.478 -4.368  184.992 1.00 71.39  ? 283 HIS B NE2 1 
ATOM   6683  N N   . LEU B 1 284 ? 103.143 -4.203  181.266 1.00 79.27  ? 284 LEU B N   1 
ATOM   6684  C CA  . LEU B 1 284 ? 102.101 -4.506  180.295 1.00 72.52  ? 284 LEU B CA  1 
ATOM   6685  C C   . LEU B 1 284 ? 102.739 -4.803  178.943 1.00 66.28  ? 284 LEU B C   1 
ATOM   6686  O O   . LEU B 1 284 ? 103.531 -4.010  178.434 1.00 72.29  ? 284 LEU B O   1 
ATOM   6687  C CB  . LEU B 1 284 ? 101.100 -3.349  180.185 1.00 72.32  ? 284 LEU B CB  1 
ATOM   6688  C CG  . LEU B 1 284 ? 99.649  -3.743  179.885 1.00 72.61  ? 284 LEU B CG  1 
ATOM   6689  C CD1 . LEU B 1 284 ? 98.693  -3.027  180.814 1.00 87.53  ? 284 LEU B CD1 1 
ATOM   6690  C CD2 . LEU B 1 284 ? 99.273  -3.464  178.443 1.00 81.35  ? 284 LEU B CD2 1 
ATOM   6691  N N   . TYR B 1 285 ? 102.374 -5.935  178.352 1.00 69.36  ? 285 TYR B N   1 
ATOM   6692  C CA  . TYR B 1 285 ? 102.978 -6.353  177.096 1.00 67.04  ? 285 TYR B CA  1 
ATOM   6693  C C   . TYR B 1 285 ? 101.935 -6.735  176.066 1.00 79.41  ? 285 TYR B C   1 
ATOM   6694  O O   . TYR B 1 285 ? 100.840 -7.170  176.406 1.00 98.19  ? 285 TYR B O   1 
ATOM   6695  C CB  . TYR B 1 285 ? 103.913 -7.548  177.313 1.00 57.32  ? 285 TYR B CB  1 
ATOM   6696  C CG  . TYR B 1 285 ? 105.096 -7.292  178.215 1.00 70.43  ? 285 TYR B CG  1 
ATOM   6697  C CD1 . TYR B 1 285 ? 106.280 -6.772  177.710 1.00 78.96  ? 285 TYR B CD1 1 
ATOM   6698  C CD2 . TYR B 1 285 ? 105.043 -7.607  179.566 1.00 82.24  ? 285 TYR B CD2 1 
ATOM   6699  C CE1 . TYR B 1 285 ? 107.375 -6.549  178.535 1.00 74.18  ? 285 TYR B CE1 1 
ATOM   6700  C CE2 . TYR B 1 285 ? 106.131 -7.393  180.396 1.00 98.19  ? 285 TYR B CE2 1 
ATOM   6701  C CZ  . TYR B 1 285 ? 107.292 -6.862  179.878 1.00 93.85  ? 285 TYR B CZ  1 
ATOM   6702  O OH  . TYR B 1 285 ? 108.369 -6.650  180.710 1.00 106.40 ? 285 TYR B OH  1 
ATOM   6703  N N   . ASP B 1 286 ? 102.290 -6.576  174.799 1.00 72.65  ? 286 ASP B N   1 
ATOM   6704  C CA  . ASP B 1 286 ? 101.454 -7.062  173.720 1.00 75.04  ? 286 ASP B CA  1 
ATOM   6705  C C   . ASP B 1 286 ? 101.629 -8.573  173.651 1.00 67.56  ? 286 ASP B C   1 
ATOM   6706  O O   . ASP B 1 286 ? 102.749 -9.065  173.559 1.00 75.45  ? 286 ASP B O   1 
ATOM   6707  C CB  . ASP B 1 286 ? 101.836 -6.398  172.396 1.00 73.85  ? 286 ASP B CB  1 
ATOM   6708  C CG  . ASP B 1 286 ? 101.133 -7.019  171.210 1.00 89.56  ? 286 ASP B CG  1 
ATOM   6709  O OD1 . ASP B 1 286 ? 99.990  -7.494  171.375 1.00 102.07 ? 286 ASP B OD1 1 
ATOM   6710  O OD2 . ASP B 1 286 ? 101.721 -7.029  170.111 1.00 89.91  ? 286 ASP B OD2 1 
ATOM   6711  N N   . LEU B 1 287 ? 100.525 -9.309  173.695 1.00 65.36  ? 287 LEU B N   1 
ATOM   6712  C CA  . LEU B 1 287 ? 100.591 -10.766 173.648 1.00 73.12  ? 287 LEU B CA  1 
ATOM   6713  C C   . LEU B 1 287 ? 101.150 -11.257 172.312 1.00 85.36  ? 287 LEU B C   1 
ATOM   6714  O O   . LEU B 1 287 ? 101.860 -12.258 172.256 1.00 107.98 ? 287 LEU B O   1 
ATOM   6715  C CB  . LEU B 1 287 ? 99.208  -11.371 173.903 1.00 71.09  ? 287 LEU B CB  1 
ATOM   6716  C CG  . LEU B 1 287 ? 99.099  -12.897 173.875 1.00 73.64  ? 287 LEU B CG  1 
ATOM   6717  C CD1 . LEU B 1 287 ? 99.874  -13.508 175.031 1.00 70.98  ? 287 LEU B CD1 1 
ATOM   6718  C CD2 . LEU B 1 287 ? 97.647  -13.329 173.926 1.00 74.73  ? 287 LEU B CD2 1 
ATOM   6719  N N   . GLU B 1 288 ? 100.829 -10.541 171.241 1.00 74.29  ? 288 GLU B N   1 
ATOM   6720  C CA  . GLU B 1 288 ? 101.269 -10.923 169.905 1.00 82.77  ? 288 GLU B CA  1 
ATOM   6721  C C   . GLU B 1 288 ? 102.781 -10.780 169.682 1.00 79.94  ? 288 GLU B C   1 
ATOM   6722  O O   . GLU B 1 288 ? 103.424 -11.709 169.195 1.00 76.25  ? 288 GLU B O   1 
ATOM   6723  C CB  . GLU B 1 288 ? 100.507 -10.111 168.856 1.00 92.14  ? 288 GLU B CB  1 
ATOM   6724  C CG  . GLU B 1 288 ? 100.734 -10.582 167.431 1.00 93.58  ? 288 GLU B CG  1 
ATOM   6725  C CD  . GLU B 1 288 ? 99.650  -10.099 166.492 1.00 106.33 ? 288 GLU B CD  1 
ATOM   6726  O OE1 . GLU B 1 288 ? 99.078  -9.019  166.753 1.00 99.52  ? 288 GLU B OE1 1 
ATOM   6727  O OE2 . GLU B 1 288 ? 99.367  -10.798 165.496 1.00 125.11 ? 288 GLU B OE2 1 
ATOM   6728  N N   . THR B 1 289 ? 103.351 -9.630  170.033 1.00 71.18  ? 289 THR B N   1 
ATOM   6729  C CA  . THR B 1 289 ? 104.768 -9.382  169.746 1.00 66.77  ? 289 THR B CA  1 
ATOM   6730  C C   . THR B 1 289 ? 105.674 -9.311  170.978 1.00 69.47  ? 289 THR B C   1 
ATOM   6731  O O   . THR B 1 289 ? 106.898 -9.388  170.860 1.00 78.05  ? 289 THR B O   1 
ATOM   6732  C CB  . THR B 1 289 ? 104.952 -8.075  168.945 1.00 60.75  ? 289 THR B CB  1 
ATOM   6733  O OG1 . THR B 1 289 ? 104.365 -6.980  169.660 1.00 59.60  ? 289 THR B OG1 1 
ATOM   6734  C CG2 . THR B 1 289 ? 104.300 -8.194  167.576 1.00 65.98  ? 289 THR B CG2 1 
ATOM   6735  N N   . GLY B 1 290 ? 105.077 -9.166  172.155 1.00 72.32  ? 290 GLY B N   1 
ATOM   6736  C CA  . GLY B 1 290 ? 105.846 -9.013  173.377 1.00 63.56  ? 290 GLY B CA  1 
ATOM   6737  C C   . GLY B 1 290 ? 106.367 -7.601  173.553 1.00 61.73  ? 290 GLY B C   1 
ATOM   6738  O O   . GLY B 1 290 ? 107.255 -7.350  174.365 1.00 73.14  ? 290 GLY B O   1 
ATOM   6739  N N   . THR B 1 291 ? 105.813 -6.674  172.778 1.00 61.01  ? 291 THR B N   1 
ATOM   6740  C CA  . THR B 1 291 ? 106.185 -5.271  172.883 1.00 61.64  ? 291 THR B CA  1 
ATOM   6741  C C   . THR B 1 291 ? 105.714 -4.737  174.227 1.00 72.59  ? 291 THR B C   1 
ATOM   6742  O O   . THR B 1 291 ? 104.573 -4.961  174.618 1.00 101.65 ? 291 THR B O   1 
ATOM   6743  C CB  . THR B 1 291 ? 105.570 -4.427  171.753 1.00 64.53  ? 291 THR B CB  1 
ATOM   6744  O OG1 . THR B 1 291 ? 106.034 -4.906  170.486 1.00 80.09  ? 291 THR B OG1 1 
ATOM   6745  C CG2 . THR B 1 291 ? 105.934 -2.956  171.913 1.00 63.25  ? 291 THR B CG2 1 
ATOM   6746  N N   . CYS B 1 292 ? 106.587 -4.023  174.926 1.00 70.34  ? 292 CYS B N   1 
ATOM   6747  C CA  . CYS B 1 292 ? 106.233 -3.443  176.213 1.00 65.68  ? 292 CYS B CA  1 
ATOM   6748  C C   . CYS B 1 292 ? 105.418 -2.174  175.986 1.00 69.18  ? 292 CYS B C   1 
ATOM   6749  O O   . CYS B 1 292 ? 105.755 -1.357  175.124 1.00 81.98  ? 292 CYS B O   1 
ATOM   6750  C CB  . CYS B 1 292 ? 107.481 -3.146  177.046 1.00 67.87  ? 292 CYS B CB  1 
ATOM   6751  S SG  . CYS B 1 292 ? 107.156 -2.825  178.793 1.00 97.44  ? 292 CYS B SG  1 
ATOM   6752  N N   . ILE B 1 293 ? 104.345 -2.013  176.757 1.00 75.19  ? 293 ILE B N   1 
ATOM   6753  C CA  . ILE B 1 293 ? 103.463 -0.853  176.612 1.00 77.52  ? 293 ILE B CA  1 
ATOM   6754  C C   . ILE B 1 293 ? 103.491 0.109   177.798 1.00 74.96  ? 293 ILE B C   1 
ATOM   6755  O O   . ILE B 1 293 ? 103.537 1.321   177.609 1.00 89.22  ? 293 ILE B O   1 
ATOM   6756  C CB  . ILE B 1 293 ? 102.007 -1.297  176.391 1.00 80.94  ? 293 ILE B CB  1 
ATOM   6757  C CG1 . ILE B 1 293 ? 101.921 -2.190  175.153 1.00 86.49  ? 293 ILE B CG1 1 
ATOM   6758  C CG2 . ILE B 1 293 ? 101.089 -0.094  176.222 1.00 74.20  ? 293 ILE B CG2 1 
ATOM   6759  C CD1 . ILE B 1 293 ? 100.860 -3.242  175.224 1.00 72.04  ? 293 ILE B CD1 1 
ATOM   6760  N N   . TYR B 1 294 ? 103.461 -0.432  179.014 1.00 70.47  ? 294 TYR B N   1 
ATOM   6761  C CA  . TYR B 1 294 ? 103.498 0.375   180.241 1.00 71.72  ? 294 TYR B CA  1 
ATOM   6762  C C   . TYR B 1 294 ? 104.233 -0.311  181.378 1.00 73.52  ? 294 TYR B C   1 
ATOM   6763  O O   . TYR B 1 294 ? 104.136 -1.520  181.567 1.00 71.53  ? 294 TYR B O   1 
ATOM   6764  C CB  . TYR B 1 294 ? 102.077 0.731   180.681 1.00 75.82  ? 294 TYR B CB  1 
ATOM   6765  C CG  . TYR B 1 294 ? 101.981 1.646   181.884 1.00 77.37  ? 294 TYR B CG  1 
ATOM   6766  C CD1 . TYR B 1 294 ? 102.191 3.017   181.777 1.00 80.37  ? 294 TYR B CD1 1 
ATOM   6767  C CD2 . TYR B 1 294 ? 101.639 1.133   183.126 1.00 78.03  ? 294 TYR B CD2 1 
ATOM   6768  C CE1 . TYR B 1 294 ? 102.085 3.844   182.889 1.00 84.28  ? 294 TYR B CE1 1 
ATOM   6769  C CE2 . TYR B 1 294 ? 101.529 1.948   184.236 1.00 80.44  ? 294 TYR B CE2 1 
ATOM   6770  C CZ  . TYR B 1 294 ? 101.751 3.300   184.112 1.00 95.64  ? 294 TYR B CZ  1 
ATOM   6771  O OH  . TYR B 1 294 ? 101.639 4.104   185.219 1.00 125.95 ? 294 TYR B OH  1 
ATOM   6772  N N   . MET B 1 295 ? 104.957 0.506   182.133 1.00 74.04  ? 295 MET B N   1 
ATOM   6773  C CA  . MET B 1 295 ? 105.745 0.070   183.267 1.00 78.60  ? 295 MET B CA  1 
ATOM   6774  C C   . MET B 1 295 ? 105.664 1.098   184.367 1.00 93.42  ? 295 MET B C   1 
ATOM   6775  O O   . MET B 1 295 ? 105.952 2.248   184.089 1.00 107.61 ? 295 MET B O   1 
ATOM   6776  C CB  . MET B 1 295 ? 107.209 -0.111  182.852 1.00 83.43  ? 295 MET B CB  1 
ATOM   6777  C CG  . MET B 1 295 ? 107.462 -1.324  181.994 1.00 87.98  ? 295 MET B CG  1 
ATOM   6778  S SD  . MET B 1 295 ? 109.216 -1.567  181.679 1.00 113.03 ? 295 MET B SD  1 
ATOM   6779  C CE  . MET B 1 295 ? 109.832 -1.250  183.340 1.00 124.04 ? 295 MET B CE  1 
ATOM   6780  N N   . ASN B 1 296 ? 105.295 0.730   185.592 1.00 100.62 ? 296 ASN B N   1 
ATOM   6781  C CA  . ASN B 1 296 ? 105.270 1.726   186.664 1.00 106.77 ? 296 ASN B CA  1 
ATOM   6782  C C   . ASN B 1 296 ? 104.988 1.019   187.977 1.00 94.79  ? 296 ASN B C   1 
ATOM   6783  O O   . ASN B 1 296 ? 104.444 -0.089  187.987 1.00 92.03  ? 296 ASN B O   1 
ATOM   6784  C CB  . ASN B 1 296 ? 104.237 2.835   186.403 1.00 119.12 ? 296 ASN B CB  1 
ATOM   6785  C CG  . ASN B 1 296 ? 104.552 4.116   187.167 1.00 130.05 ? 296 ASN B CG  1 
ATOM   6786  O OD1 . ASN B 1 296 ? 105.550 4.785   186.890 1.00 137.14 ? 296 ASN B OD1 1 
ATOM   6787  N ND2 . ASN B 1 296 ? 103.709 4.457   188.134 1.00 128.30 ? 296 ASN B ND2 1 
ATOM   6788  N N   . ARG B 1 297 ? 105.352 1.650   189.088 1.00 87.10  ? 297 ARG B N   1 
ATOM   6789  C CA  . ARG B 1 297 ? 105.134 1.007   190.371 1.00 87.21  ? 297 ARG B CA  1 
ATOM   6790  C C   . ARG B 1 297 ? 103.720 1.262   190.854 1.00 86.17  ? 297 ARG B C   1 
ATOM   6791  O O   . ARG B 1 297 ? 103.280 2.409   190.913 1.00 92.12  ? 297 ARG B O   1 
ATOM   6792  C CB  . ARG B 1 297 ? 106.102 1.529   191.425 1.00 95.44  ? 297 ARG B CB  1 
ATOM   6793  C CG  . ARG B 1 297 ? 106.261 0.543   192.553 1.00 103.72 ? 297 ARG B CG  1 
ATOM   6794  C CD  . ARG B 1 297 ? 107.367 0.906   193.517 1.00 114.88 ? 297 ARG B CD  1 
ATOM   6795  N NE  . ARG B 1 297 ? 107.659 -0.229  194.387 1.00 115.98 ? 297 ARG B NE  1 
ATOM   6796  C CZ  . ARG B 1 297 ? 108.427 -0.193  195.472 1.00 116.71 ? 297 ARG B CZ  1 
ATOM   6797  N NH1 . ARG B 1 297 ? 108.645 -1.313  196.148 1.00 110.38 ? 297 ARG B NH1 1 
ATOM   6798  N NH2 . ARG B 1 297 ? 108.963 0.946   195.896 1.00 125.11 ? 297 ARG B NH2 1 
ATOM   6799  N N   . ILE B 1 298 ? 103.010 0.195   191.202 1.00 85.67  ? 298 ILE B N   1 
ATOM   6800  C CA  . ILE B 1 298 ? 101.642 0.343   191.673 1.00 93.34  ? 298 ILE B CA  1 
ATOM   6801  C C   . ILE B 1 298 ? 101.538 0.089   193.182 1.00 111.65 ? 298 ILE B C   1 
ATOM   6802  O O   . ILE B 1 298 ? 100.603 0.556   193.834 1.00 126.37 ? 298 ILE B O   1 
ATOM   6803  C CB  . ILE B 1 298 ? 100.678 -0.584  190.904 1.00 84.40  ? 298 ILE B CB  1 
ATOM   6804  C CG1 . ILE B 1 298 ? 101.253 -1.992  190.767 1.00 82.37  ? 298 ILE B CG1 1 
ATOM   6805  C CG2 . ILE B 1 298 ? 100.360 0.002   189.534 1.00 84.66  ? 298 ILE B CG2 1 
ATOM   6806  C CD1 . ILE B 1 298 ? 100.188 -3.061  190.641 1.00 84.98  ? 298 ILE B CD1 1 
ATOM   6807  N N   . SER B 1 299 ? 102.492 -0.654  193.736 1.00 103.03 ? 299 SER B N   1 
ATOM   6808  C CA  . SER B 1 299 ? 102.459 -0.956  195.164 1.00 96.71  ? 299 SER B CA  1 
ATOM   6809  C C   . SER B 1 299 ? 103.836 -0.905  195.825 1.00 105.08 ? 299 SER B C   1 
ATOM   6810  O O   . SER B 1 299 ? 104.847 -1.265  195.221 1.00 120.28 ? 299 SER B O   1 
ATOM   6811  C CB  . SER B 1 299 ? 101.833 -2.328  195.404 1.00 87.01  ? 299 SER B CB  1 
ATOM   6812  O OG  . SER B 1 299 ? 101.705 -2.583  196.793 1.00 98.98  ? 299 SER B OG  1 
ATOM   6813  N N   . GLY B 1 300 ? 103.859 -0.445  197.073 1.00 95.41  ? 300 GLY B N   1 
ATOM   6814  C CA  . GLY B 1 300 ? 105.075 -0.409  197.865 1.00 95.02  ? 300 GLY B CA  1 
ATOM   6815  C C   . GLY B 1 300 ? 105.310 -1.727  198.576 1.00 105.39 ? 300 GLY B C   1 
ATOM   6816  O O   . GLY B 1 300 ? 106.428 -2.038  198.990 1.00 125.92 ? 300 GLY B O   1 
ATOM   6817  N N   . GLU B 1 301 ? 104.244 -2.509  198.700 1.00 90.41  ? 301 GLU B N   1 
ATOM   6818  C CA  . GLU B 1 301 ? 104.298 -3.807  199.358 1.00 93.12  ? 301 GLU B CA  1 
ATOM   6819  C C   . GLU B 1 301 ? 104.054 -4.913  198.340 1.00 98.70  ? 301 GLU B C   1 
ATOM   6820  O O   . GLU B 1 301 ? 103.409 -4.692  197.318 1.00 112.70 ? 301 GLU B O   1 
ATOM   6821  C CB  . GLU B 1 301 ? 103.260 -3.886  200.481 1.00 99.21  ? 301 GLU B CB  1 
ATOM   6822  C CG  . GLU B 1 301 ? 103.485 -2.920  201.639 1.00 117.18 ? 301 GLU B CG  1 
ATOM   6823  C CD  . GLU B 1 301 ? 104.763 -3.203  202.407 1.00 135.13 ? 301 GLU B CD  1 
ATOM   6824  O OE1 . GLU B 1 301 ? 105.155 -4.386  202.509 1.00 148.95 ? 301 GLU B OE1 1 
ATOM   6825  O OE2 . GLU B 1 301 ? 105.364 -2.246  202.938 1.00 140.40 ? 301 GLU B OE2 1 
ATOM   6826  N N   . THR B 1 302 ? 104.595 -6.095  198.610 1.00 88.20  ? 302 THR B N   1 
ATOM   6827  C CA  . THR B 1 302 ? 104.399 -7.244  197.732 1.00 94.24  ? 302 THR B CA  1 
ATOM   6828  C C   . THR B 1 302 ? 102.927 -7.608  197.593 1.00 91.50  ? 302 THR B C   1 
ATOM   6829  O O   . THR B 1 302 ? 102.201 -7.663  198.581 1.00 93.91  ? 302 THR B O   1 
ATOM   6830  C CB  . THR B 1 302 ? 105.154 -8.482  198.244 1.00 98.45  ? 302 THR B CB  1 
ATOM   6831  O OG1 . THR B 1 302 ? 106.527 -8.147  198.470 1.00 126.93 ? 302 THR B OG1 1 
ATOM   6832  C CG2 . THR B 1 302 ? 105.068 -9.612  197.231 1.00 82.79  ? 302 THR B CG2 1 
ATOM   6833  N N   . ILE B 1 303 ? 102.494 -7.869  196.363 1.00 79.60  ? 303 ILE B N   1 
ATOM   6834  C CA  . ILE B 1 303 ? 101.129 -8.324  196.112 1.00 77.52  ? 303 ILE B CA  1 
ATOM   6835  C C   . ILE B 1 303 ? 101.128 -9.850  196.034 1.00 89.01  ? 303 ILE B C   1 
ATOM   6836  O O   . ILE B 1 303 ? 101.266 -10.433 194.959 1.00 97.39  ? 303 ILE B O   1 
ATOM   6837  C CB  . ILE B 1 303 ? 100.565 -7.715  194.822 1.00 77.78  ? 303 ILE B CB  1 
ATOM   6838  C CG1 . ILE B 1 303 ? 100.560 -6.191  194.928 1.00 79.19  ? 303 ILE B CG1 1 
ATOM   6839  C CG2 . ILE B 1 303 ? 99.167  -8.238  194.543 1.00 81.35  ? 303 ILE B CG2 1 
ATOM   6840  C CD1 . ILE B 1 303 ? 100.370 -5.488  193.605 1.00 80.77  ? 303 ILE B CD1 1 
ATOM   6841  N N   . PHE B 1 304 ? 100.960 -10.492 197.187 1.00 81.02  ? 304 PHE B N   1 
ATOM   6842  C CA  . PHE B 1 304 ? 101.111 -11.945 197.291 1.00 81.46  ? 304 PHE B CA  1 
ATOM   6843  C C   . PHE B 1 304 ? 100.039 -12.801 196.601 1.00 77.71  ? 304 PHE B C   1 
ATOM   6844  O O   . PHE B 1 304 ? 100.350 -13.882 196.105 1.00 79.24  ? 304 PHE B O   1 
ATOM   6845  C CB  . PHE B 1 304 ? 101.225 -12.353 198.769 1.00 80.64  ? 304 PHE B CB  1 
ATOM   6846  C CG  . PHE B 1 304 ? 100.111 -11.850 199.643 1.00 94.13  ? 304 PHE B CG  1 
ATOM   6847  C CD1 . PHE B 1 304 ? 100.183 -10.595 200.227 1.00 112.76 ? 304 PHE B CD1 1 
ATOM   6848  C CD2 . PHE B 1 304 ? 99.011  -12.645 199.913 1.00 88.44  ? 304 PHE B CD2 1 
ATOM   6849  C CE1 . PHE B 1 304 ? 99.169  -10.134 201.043 1.00 113.83 ? 304 PHE B CE1 1 
ATOM   6850  C CE2 . PHE B 1 304 ? 97.992  -12.189 200.729 1.00 89.10  ? 304 PHE B CE2 1 
ATOM   6851  C CZ  . PHE B 1 304 ? 98.072  -10.933 201.295 1.00 100.42 ? 304 PHE B CZ  1 
ATOM   6852  N N   . VAL B 1 305 ? 98.792  -12.346 196.569 1.00 85.75  ? 305 VAL B N   1 
ATOM   6853  C CA  . VAL B 1 305 ? 97.746  -13.103 195.874 1.00 78.21  ? 305 VAL B CA  1 
ATOM   6854  C C   . VAL B 1 305 ? 97.147  -12.304 194.725 1.00 74.50  ? 305 VAL B C   1 
ATOM   6855  O O   . VAL B 1 305 ? 96.894  -11.111 194.849 1.00 81.38  ? 305 VAL B O   1 
ATOM   6856  C CB  . VAL B 1 305 ? 96.613  -13.548 196.820 1.00 77.17  ? 305 VAL B CB  1 
ATOM   6857  C CG1 . VAL B 1 305 ? 97.084  -14.672 197.734 1.00 81.64  ? 305 VAL B CG1 1 
ATOM   6858  C CG2 . VAL B 1 305 ? 96.077  -12.371 197.612 1.00 88.57  ? 305 VAL B CG2 1 
ATOM   6859  N N   . THR B 1 306 ? 96.935  -12.974 193.599 1.00 70.78  ? 306 THR B N   1 
ATOM   6860  C CA  . THR B 1 306 ? 96.348  -12.342 192.427 1.00 75.32  ? 306 THR B CA  1 
ATOM   6861  C C   . THR B 1 306 ? 95.276  -13.225 191.807 1.00 80.55  ? 306 THR B C   1 
ATOM   6862  O O   . THR B 1 306 ? 95.211  -14.426 192.063 1.00 86.78  ? 306 THR B O   1 
ATOM   6863  C CB  . THR B 1 306 ? 97.405  -12.026 191.355 1.00 78.83  ? 306 THR B CB  1 
ATOM   6864  O OG1 . THR B 1 306 ? 98.261  -13.161 191.184 1.00 89.26  ? 306 THR B OG1 1 
ATOM   6865  C CG2 . THR B 1 306 ? 98.241  -10.817 191.756 1.00 75.74  ? 306 THR B CG2 1 
ATOM   6866  N N   . ALA B 1 307 ? 94.432  -12.611 190.992 1.00 70.22  ? 307 ALA B N   1 
ATOM   6867  C CA  . ALA B 1 307 ? 93.353  -13.317 190.325 1.00 70.19  ? 307 ALA B CA  1 
ATOM   6868  C C   . ALA B 1 307 ? 92.910  -12.486 189.131 1.00 77.45  ? 307 ALA B C   1 
ATOM   6869  O O   . ALA B 1 307 ? 93.161  -11.281 189.095 1.00 72.71  ? 307 ALA B O   1 
ATOM   6870  C CB  . ALA B 1 307 ? 92.202  -13.566 191.286 1.00 84.62  ? 307 ALA B CB  1 
ATOM   6871  N N   . PRO B 1 308 ? 92.264  -13.118 188.140 1.00 71.56  ? 308 PRO B N   1 
ATOM   6872  C CA  . PRO B 1 308 ? 91.814  -12.280 187.026 1.00 72.44  ? 308 PRO B CA  1 
ATOM   6873  C C   . PRO B 1 308 ? 90.589  -11.455 187.403 1.00 79.08  ? 308 PRO B C   1 
ATOM   6874  O O   . PRO B 1 308 ? 89.679  -11.975 188.053 1.00 82.34  ? 308 PRO B O   1 
ATOM   6875  C CB  . PRO B 1 308 ? 91.476  -13.298 185.924 1.00 72.81  ? 308 PRO B CB  1 
ATOM   6876  C CG  . PRO B 1 308 ? 91.834  -14.664 186.480 1.00 74.02  ? 308 PRO B CG  1 
ATOM   6877  C CD  . PRO B 1 308 ? 91.884  -14.528 187.962 1.00 71.82  ? 308 PRO B CD  1 
ATOM   6878  N N   . HIS B 1 309 ? 90.566  -10.187 187.004 1.00 84.44  ? 309 HIS B N   1 
ATOM   6879  C CA  . HIS B 1 309 ? 89.398  -9.359  187.254 1.00 95.29  ? 309 HIS B CA  1 
ATOM   6880  C C   . HIS B 1 309 ? 88.470  -9.499  186.061 1.00 95.19  ? 309 HIS B C   1 
ATOM   6881  O O   . HIS B 1 309 ? 88.459  -8.659  185.162 1.00 85.97  ? 309 HIS B O   1 
ATOM   6882  C CB  . HIS B 1 309 ? 89.785  -7.898  187.484 1.00 104.60 ? 309 HIS B CB  1 
ATOM   6883  C CG  . HIS B 1 309 ? 88.699  -7.080  188.114 1.00 108.41 ? 309 HIS B CG  1 
ATOM   6884  N ND1 . HIS B 1 309 ? 88.785  -6.586  189.394 1.00 98.37  ? 309 HIS B ND1 1 
ATOM   6885  C CD2 . HIS B 1 309 ? 87.493  -6.679  187.638 1.00 123.94 ? 309 HIS B CD2 1 
ATOM   6886  C CE1 . HIS B 1 309 ? 87.687  -5.912  189.687 1.00 120.25 ? 309 HIS B CE1 1 
ATOM   6887  N NE2 . HIS B 1 309 ? 86.887  -5.953  188.633 1.00 134.44 ? 309 HIS B NE2 1 
ATOM   6888  N N   . GLU B 1 310 ? 87.709  -10.588 186.076 1.00 109.58 ? 310 GLU B N   1 
ATOM   6889  C CA  . GLU B 1 310 ? 86.824  -10.995 184.987 1.00 108.72 ? 310 GLU B CA  1 
ATOM   6890  C C   . GLU B 1 310 ? 86.015  -9.868  184.343 1.00 105.38 ? 310 GLU B C   1 
ATOM   6891  O O   . GLU B 1 310 ? 85.957  -9.771  183.118 1.00 96.66  ? 310 GLU B O   1 
ATOM   6892  C CB  . GLU B 1 310 ? 85.888  -12.095 185.491 1.00 109.94 ? 310 GLU B CB  1 
ATOM   6893  C CG  . GLU B 1 310 ? 86.621  -13.398 185.791 1.00 128.75 ? 310 GLU B CG  1 
ATOM   6894  C CD  . GLU B 1 310 ? 86.182  -14.029 187.095 1.00 152.63 ? 310 GLU B CD  1 
ATOM   6895  O OE1 . GLU B 1 310 ? 87.054  -14.546 187.826 1.00 148.13 ? 310 GLU B OE1 1 
ATOM   6896  O OE2 . GLU B 1 310 ? 84.967  -14.015 187.390 1.00 161.15 ? 310 GLU B OE2 1 
ATOM   6897  N N   . ALA B 1 311 ? 85.379  -9.035  185.161 1.00 109.01 ? 311 ALA B N   1 
ATOM   6898  C CA  . ALA B 1 311 ? 84.548  -7.936  184.657 1.00 114.39 ? 311 ALA B CA  1 
ATOM   6899  C C   . ALA B 1 311 ? 85.303  -6.978  183.733 1.00 116.55 ? 311 ALA B C   1 
ATOM   6900  O O   . ALA B 1 311 ? 84.907  -6.761  182.587 1.00 117.20 ? 311 ALA B O   1 
ATOM   6901  C CB  . ALA B 1 311 ? 83.944  -7.159  185.823 1.00 106.54 ? 311 ALA B CB  1 
ATOM   6902  N N   . THR B 1 312 ? 86.390  -6.406  184.239 1.00 111.59 ? 312 THR B N   1 
ATOM   6903  C CA  . THR B 1 312 ? 87.167  -5.421  183.486 1.00 106.88 ? 312 THR B CA  1 
ATOM   6904  C C   . THR B 1 312 ? 88.223  -6.039  182.579 1.00 98.90  ? 312 THR B C   1 
ATOM   6905  O O   . THR B 1 312 ? 88.899  -5.323  181.843 1.00 114.22 ? 312 THR B O   1 
ATOM   6906  C CB  . THR B 1 312 ? 87.860  -4.430  184.420 1.00 107.90 ? 312 THR B CB  1 
ATOM   6907  O OG1 . THR B 1 312 ? 88.789  -5.134  185.251 1.00 110.11 ? 312 THR B OG1 1 
ATOM   6908  C CG2 . THR B 1 312 ? 86.833  -3.733  185.294 1.00 102.92 ? 312 THR B CG2 1 
ATOM   6909  N N   . ALA B 1 313 ? 88.365  -7.359  182.653 1.00 88.40  ? 313 ALA B N   1 
ATOM   6910  C CA  . ALA B 1 313 ? 89.393  -8.089  181.916 1.00 89.43  ? 313 ALA B CA  1 
ATOM   6911  C C   . ALA B 1 313 ? 90.784  -7.584  182.285 1.00 101.28 ? 313 ALA B C   1 
ATOM   6912  O O   . ALA B 1 313 ? 91.578  -7.204  181.422 1.00 106.77 ? 313 ALA B O   1 
ATOM   6913  C CB  . ALA B 1 313 ? 89.162  -7.969  180.407 1.00 89.19  ? 313 ALA B CB  1 
ATOM   6914  N N   . GLY B 1 314 ? 91.075  -7.611  183.581 1.00 101.87 ? 314 GLY B N   1 
ATOM   6915  C CA  . GLY B 1 314 ? 92.344  -7.143  184.100 1.00 92.29  ? 314 GLY B CA  1 
ATOM   6916  C C   . GLY B 1 314 ? 92.852  -8.065  185.188 1.00 93.36  ? 314 GLY B C   1 
ATOM   6917  O O   . GLY B 1 314 ? 92.565  -9.258  185.184 1.00 94.08  ? 314 GLY B O   1 
ATOM   6918  N N   . ILE B 1 315 ? 93.611  -7.503  186.123 1.00 89.79  ? 315 ILE B N   1 
ATOM   6919  C CA  . ILE B 1 315 ? 94.182  -8.265  187.229 1.00 82.07  ? 315 ILE B CA  1 
ATOM   6920  C C   . ILE B 1 315 ? 93.833  -7.628  188.577 1.00 83.16  ? 315 ILE B C   1 
ATOM   6921  O O   . ILE B 1 315 ? 93.933  -6.416  188.749 1.00 90.76  ? 315 ILE B O   1 
ATOM   6922  C CB  . ILE B 1 315 ? 95.711  -8.378  187.092 1.00 74.31  ? 315 ILE B CB  1 
ATOM   6923  C CG1 . ILE B 1 315 ? 96.293  -9.248  188.207 1.00 83.27  ? 315 ILE B CG1 1 
ATOM   6924  C CG2 . ILE B 1 315 ? 96.364  -7.003  187.098 1.00 75.68  ? 315 ILE B CG2 1 
ATOM   6925  C CD1 . ILE B 1 315 ? 97.686  -9.729  187.918 1.00 71.53  ? 315 ILE B CD1 1 
ATOM   6926  N N   . ILE B 1 316 ? 93.416  -8.453  189.532 1.00 75.95  ? 316 ILE B N   1 
ATOM   6927  C CA  . ILE B 1 316 ? 93.077  -7.964  190.869 1.00 80.73  ? 316 ILE B CA  1 
ATOM   6928  C C   . ILE B 1 316 ? 93.855  -8.710  191.954 1.00 77.94  ? 316 ILE B C   1 
ATOM   6929  O O   . ILE B 1 316 ? 93.784  -9.933  192.055 1.00 77.07  ? 316 ILE B O   1 
ATOM   6930  C CB  . ILE B 1 316 ? 91.568  -8.074  191.152 1.00 82.22  ? 316 ILE B CB  1 
ATOM   6931  C CG1 . ILE B 1 316 ? 91.278  -7.675  192.599 1.00 82.93  ? 316 ILE B CG1 1 
ATOM   6932  C CG2 . ILE B 1 316 ? 91.046  -9.478  190.867 1.00 80.94  ? 316 ILE B CG2 1 
ATOM   6933  C CD1 . ILE B 1 316 ? 89.883  -7.168  192.822 1.00 104.27 ? 316 ILE B CD1 1 
ATOM   6934  N N   . GLY B 1 317 ? 94.615  -7.970  192.754 1.00 76.13  ? 317 GLY B N   1 
ATOM   6935  C CA  . GLY B 1 317 ? 95.409  -8.587  193.798 1.00 80.08  ? 317 GLY B CA  1 
ATOM   6936  C C   . GLY B 1 317 ? 95.250  -7.982  195.178 1.00 88.48  ? 317 GLY B C   1 
ATOM   6937  O O   . GLY B 1 317 ? 94.502  -7.027  195.368 1.00 98.50  ? 317 GLY B O   1 
ATOM   6938  N N   . VAL B 1 318 ? 95.953  -8.560  196.150 1.00 79.78  ? 318 VAL B N   1 
ATOM   6939  C CA  . VAL B 1 318 ? 95.959  -8.059  197.524 1.00 88.06  ? 318 VAL B CA  1 
ATOM   6940  C C   . VAL B 1 318 ? 97.394  -7.989  198.031 1.00 95.83  ? 318 VAL B C   1 
ATOM   6941  O O   . VAL B 1 318 ? 98.124  -8.975  197.965 1.00 103.24 ? 318 VAL B O   1 
ATOM   6942  C CB  . VAL B 1 318 ? 95.141  -8.960  198.476 1.00 82.97  ? 318 VAL B CB  1 
ATOM   6943  C CG1 . VAL B 1 318 ? 95.278  -8.481  199.915 1.00 85.07  ? 318 VAL B CG1 1 
ATOM   6944  C CG2 . VAL B 1 318 ? 93.682  -9.012  198.060 1.00 89.32  ? 318 VAL B CG2 1 
ATOM   6945  N N   . ASN B 1 319 ? 97.795  -6.839  198.560 1.00 91.95  ? 319 ASN B N   1 
ATOM   6946  C CA  . ASN B 1 319 ? 99.150  -6.696  199.081 1.00 97.47  ? 319 ASN B CA  1 
ATOM   6947  C C   . ASN B 1 319 ? 99.234  -6.831  200.604 1.00 99.99  ? 319 ASN B C   1 
ATOM   6948  O O   . ASN B 1 319 ? 98.219  -6.808  201.301 1.00 105.34 ? 319 ASN B O   1 
ATOM   6949  C CB  . ASN B 1 319 ? 99.751  -5.366  198.624 1.00 101.38 ? 319 ASN B CB  1 
ATOM   6950  C CG  . ASN B 1 319 ? 99.116  -4.167  199.301 1.00 104.80 ? 319 ASN B CG  1 
ATOM   6951  O OD1 . ASN B 1 319 ? 98.076  -4.273  199.950 1.00 110.30 ? 319 ASN B OD1 1 
ATOM   6952  N ND2 . ASN B 1 319 ? 99.739  -3.007  199.137 1.00 102.16 ? 319 ASN B ND2 1 
ATOM   6953  N N   . ARG B 1 320 ? 100.460 -6.954  201.106 1.00 99.99  ? 320 ARG B N   1 
ATOM   6954  C CA  . ARG B 1 320 ? 100.735 -7.154  202.530 1.00 109.75 ? 320 ARG B CA  1 
ATOM   6955  C C   . ARG B 1 320 ? 100.213 -6.020  203.417 1.00 110.44 ? 320 ARG B C   1 
ATOM   6956  O O   . ARG B 1 320 ? 100.069 -6.186  204.627 1.00 101.28 ? 320 ARG B O   1 
ATOM   6957  C CB  . ARG B 1 320 ? 102.240 -7.340  202.733 1.00 114.73 ? 320 ARG B CB  1 
ATOM   6958  C CG  . ARG B 1 320 ? 102.768 -8.605  202.062 1.00 123.87 ? 320 ARG B CG  1 
ATOM   6959  C CD  . ARG B 1 320 ? 103.666 -9.445  202.953 1.00 142.02 ? 320 ARG B CD  1 
ATOM   6960  N NE  . ARG B 1 320 ? 105.080 -9.252  202.640 1.00 162.78 ? 320 ARG B NE  1 
ATOM   6961  C CZ  . ARG B 1 320 ? 106.079 -9.711  203.386 1.00 157.17 ? 320 ARG B CZ  1 
ATOM   6962  N NH1 . ARG B 1 320 ? 107.336 -9.490  203.025 1.00 141.51 ? 320 ARG B NH1 1 
ATOM   6963  N NH2 . ARG B 1 320 ? 105.820 -10.408 204.483 1.00 155.89 ? 320 ARG B NH2 1 
ATOM   6964  N N   . LYS B 1 321 ? 99.922  -4.874  202.812 1.00 111.45 ? 321 LYS B N   1 
ATOM   6965  C CA  . LYS B 1 321 ? 99.377  -3.736  203.545 1.00 110.04 ? 321 LYS B CA  1 
ATOM   6966  C C   . LYS B 1 321 ? 97.878  -3.893  203.792 1.00 111.66 ? 321 LYS B C   1 
ATOM   6967  O O   . LYS B 1 321 ? 97.304  -3.213  204.645 1.00 105.99 ? 321 LYS B O   1 
ATOM   6968  C CB  . LYS B 1 321 ? 99.651  -2.440  202.785 1.00 105.75 ? 321 LYS B CB  1 
ATOM   6969  C CG  . LYS B 1 321 ? 100.408 -1.391  203.579 1.00 115.62 ? 321 LYS B CG  1 
ATOM   6970  C CD  . LYS B 1 321 ? 100.787 -0.220  202.689 1.00 126.66 ? 321 LYS B CD  1 
ATOM   6971  C CE  . LYS B 1 321 ? 101.606 0.818   203.434 1.00 134.11 ? 321 LYS B CE  1 
ATOM   6972  N NZ  . LYS B 1 321 ? 102.186 1.813   202.493 1.00 139.60 ? 321 LYS B NZ  1 
ATOM   6973  N N   . GLY B 1 322 ? 97.253  -4.797  203.045 1.00 103.66 ? 322 GLY B N   1 
ATOM   6974  C CA  . GLY B 1 322 ? 95.828  -5.041  203.159 1.00 95.76  ? 322 GLY B CA  1 
ATOM   6975  C C   . GLY B 1 322 ? 95.024  -4.340  202.080 1.00 100.11 ? 322 GLY B C   1 
ATOM   6976  O O   . GLY B 1 322 ? 93.795  -4.379  202.089 1.00 115.97 ? 322 GLY B O   1 
ATOM   6977  N N   . GLN B 1 323 ? 95.718  -3.686  201.153 1.00 93.21  ? 323 GLN B N   1 
ATOM   6978  C CA  . GLN B 1 323 ? 95.053  -3.003  200.048 1.00 92.71  ? 323 GLN B CA  1 
ATOM   6979  C C   . GLN B 1 323 ? 94.648  -3.974  198.951 1.00 91.85  ? 323 GLN B C   1 
ATOM   6980  O O   . GLN B 1 323 ? 95.452  -4.784  198.495 1.00 101.22 ? 323 GLN B O   1 
ATOM   6981  C CB  . GLN B 1 323 ? 95.946  -1.917  199.448 1.00 93.48  ? 323 GLN B CB  1 
ATOM   6982  C CG  . GLN B 1 323 ? 96.457  -0.889  200.435 1.00 100.39 ? 323 GLN B CG  1 
ATOM   6983  C CD  . GLN B 1 323 ? 97.541  -0.018  199.838 1.00 105.73 ? 323 GLN B CD  1 
ATOM   6984  O OE1 . GLN B 1 323 ? 98.727  -0.324  199.945 1.00 102.66 ? 323 GLN B OE1 1 
ATOM   6985  N NE2 . GLN B 1 323 ? 97.138  1.073   199.195 1.00 96.88  ? 323 GLN B NE2 1 
ATOM   6986  N N   . VAL B 1 324 ? 93.388  -3.902  198.542 1.00 89.69  ? 324 VAL B N   1 
ATOM   6987  C CA  . VAL B 1 324 ? 92.897  -4.730  197.445 1.00 90.32  ? 324 VAL B CA  1 
ATOM   6988  C C   . VAL B 1 324 ? 92.936  -3.934  196.146 1.00 103.26 ? 324 VAL B C   1 
ATOM   6989  O O   . VAL B 1 324 ? 91.988  -3.229  195.811 1.00 108.69 ? 324 VAL B O   1 
ATOM   6990  C CB  . VAL B 1 324 ? 91.470  -5.224  197.694 1.00 90.16  ? 324 VAL B CB  1 
ATOM   6991  C CG1 . VAL B 1 324 ? 91.000  -6.077  196.526 1.00 88.11  ? 324 VAL B CG1 1 
ATOM   6992  C CG2 . VAL B 1 324 ? 91.411  -6.017  198.987 1.00 90.56  ? 324 VAL B CG2 1 
ATOM   6993  N N   . LEU B 1 325 ? 94.045  -4.049  195.422 1.00 103.76 ? 325 LEU B N   1 
ATOM   6994  C CA  . LEU B 1 325 ? 94.261  -3.271  194.204 1.00 92.64  ? 325 LEU B CA  1 
ATOM   6995  C C   . LEU B 1 325 ? 93.876  -4.043  192.937 1.00 90.30  ? 325 LEU B C   1 
ATOM   6996  O O   . LEU B 1 325 ? 94.049  -5.257  192.878 1.00 88.40  ? 325 LEU B O   1 
ATOM   6997  C CB  . LEU B 1 325 ? 95.733  -2.872  194.121 1.00 85.35  ? 325 LEU B CB  1 
ATOM   6998  C CG  . LEU B 1 325 ? 96.388  -2.366  195.405 1.00 89.67  ? 325 LEU B CG  1 
ATOM   6999  C CD1 . LEU B 1 325 ? 97.901  -2.461  195.289 1.00 94.99  ? 325 LEU B CD1 1 
ATOM   7000  C CD2 . LEU B 1 325 ? 95.967  -0.943  195.723 1.00 93.89  ? 325 LEU B CD2 1 
ATOM   7001  N N   . SER B 1 326 ? 93.369  -3.339  191.926 1.00 98.36  ? 326 SER B N   1 
ATOM   7002  C CA  . SER B 1 326 ? 93.020  -3.963  190.651 1.00 95.91  ? 326 SER B CA  1 
ATOM   7003  C C   . SER B 1 326 ? 93.435  -3.034  189.508 1.00 85.33  ? 326 SER B C   1 
ATOM   7004  O O   . SER B 1 326 ? 93.102  -1.847  189.501 1.00 97.54  ? 326 SER B O   1 
ATOM   7005  C CB  . SER B 1 326 ? 91.527  -4.298  190.582 1.00 111.68 ? 326 SER B CB  1 
ATOM   7006  O OG  . SER B 1 326 ? 90.729  -3.131  190.632 1.00 112.46 ? 326 SER B OG  1 
ATOM   7007  N N   . VAL B 1 327 ? 94.160  -3.596  188.542 1.00 91.14  ? 327 VAL B N   1 
ATOM   7008  C CA  . VAL B 1 327 ? 94.655  -2.854  187.381 1.00 90.05  ? 327 VAL B CA  1 
ATOM   7009  C C   . VAL B 1 327 ? 94.154  -3.475  186.084 1.00 85.92  ? 327 VAL B C   1 
ATOM   7010  O O   . VAL B 1 327 ? 94.263  -4.683  185.873 1.00 81.90  ? 327 VAL B O   1 
ATOM   7011  C CB  . VAL B 1 327 ? 96.196  -2.811  187.335 1.00 79.06  ? 327 VAL B CB  1 
ATOM   7012  C CG1 . VAL B 1 327 ? 96.671  -2.033  186.101 1.00 87.87  ? 327 VAL B CG1 1 
ATOM   7013  C CG2 . VAL B 1 327 ? 96.764  -2.192  188.610 1.00 79.76  ? 327 VAL B CG2 1 
ATOM   7014  N N   . CYS B 1 328 ? 93.619  -2.635  185.207 1.00 82.63  ? 328 CYS B N   1 
ATOM   7015  C CA  . CYS B 1 328 ? 93.100  -3.108  183.940 1.00 97.57  ? 328 CYS B CA  1 
ATOM   7016  C C   . CYS B 1 328 ? 93.337  -2.097  182.826 1.00 109.37 ? 328 CYS B C   1 
ATOM   7017  O O   . CYS B 1 328 ? 93.724  -0.951  183.069 1.00 118.22 ? 328 CYS B O   1 
ATOM   7018  C CB  . CYS B 1 328 ? 91.609  -3.411  184.058 1.00 98.47  ? 328 CYS B CB  1 
ATOM   7019  S SG  . CYS B 1 328 ? 90.554  -1.946  184.029 1.00 133.69 ? 328 CYS B SG  1 
ATOM   7020  N N   . VAL B 1 329 ? 93.123  -2.543  181.596 1.00 98.34  ? 329 VAL B N   1 
ATOM   7021  C CA  . VAL B 1 329 ? 93.296  -1.691  180.433 1.00 85.39  ? 329 VAL B CA  1 
ATOM   7022  C C   . VAL B 1 329 ? 92.235  -0.603  180.359 1.00 89.75  ? 329 VAL B C   1 
ATOM   7023  O O   . VAL B 1 329 ? 91.039  -0.888  180.399 1.00 119.19 ? 329 VAL B O   1 
ATOM   7024  C CB  . VAL B 1 329 ? 93.241  -2.508  179.136 1.00 92.51  ? 329 VAL B CB  1 
ATOM   7025  C CG1 . VAL B 1 329 ? 93.492  -1.609  177.937 1.00 96.58  ? 329 VAL B CG1 1 
ATOM   7026  C CG2 . VAL B 1 329 ? 94.242  -3.651  179.188 1.00 98.72  ? 329 VAL B CG2 1 
ATOM   7027  N N   . GLU B 1 330 ? 92.682  0.644   180.256 1.00 88.66  ? 330 GLU B N   1 
ATOM   7028  C CA  . GLU B 1 330 ? 91.774  1.763   180.050 1.00 91.51  ? 330 GLU B CA  1 
ATOM   7029  C C   . GLU B 1 330 ? 91.485  1.852   178.560 1.00 107.63 ? 330 GLU B C   1 
ATOM   7030  O O   . GLU B 1 330 ? 92.274  2.397   177.794 1.00 127.39 ? 330 GLU B O   1 
ATOM   7031  C CB  . GLU B 1 330 ? 92.389  3.064   180.571 1.00 93.35  ? 330 GLU B CB  1 
ATOM   7032  C CG  . GLU B 1 330 ? 91.585  4.336   180.303 1.00 110.43 ? 330 GLU B CG  1 
ATOM   7033  C CD  . GLU B 1 330 ? 90.164  4.272   180.833 1.00 144.02 ? 330 GLU B CD  1 
ATOM   7034  O OE1 . GLU B 1 330 ? 89.986  4.394   182.064 1.00 156.13 ? 330 GLU B OE1 1 
ATOM   7035  O OE2 . GLU B 1 330 ? 89.221  4.135   180.024 1.00 150.17 ? 330 GLU B OE2 1 
ATOM   7036  N N   . GLU B 1 331 ? 90.331  1.324   178.170 1.00 103.58 ? 331 GLU B N   1 
ATOM   7037  C CA  . GLU B 1 331 ? 89.948  1.192   176.769 1.00 95.79  ? 331 GLU B CA  1 
ATOM   7038  C C   . GLU B 1 331 ? 89.894  2.527   176.024 1.00 99.69  ? 331 GLU B C   1 
ATOM   7039  O O   . GLU B 1 331 ? 90.076  2.572   174.808 1.00 99.24  ? 331 GLU B O   1 
ATOM   7040  C CB  . GLU B 1 331 ? 88.608  0.462   176.678 1.00 105.83 ? 331 GLU B CB  1 
ATOM   7041  C CG  . GLU B 1 331 ? 88.692  -0.975  177.187 1.00 120.74 ? 331 GLU B CG  1 
ATOM   7042  C CD  . GLU B 1 331 ? 87.387  -1.729  177.052 1.00 136.43 ? 331 GLU B CD  1 
ATOM   7043  O OE1 . GLU B 1 331 ? 86.951  -1.973  175.907 1.00 126.22 ? 331 GLU B OE1 1 
ATOM   7044  O OE2 . GLU B 1 331 ? 86.797  -2.081  178.096 1.00 152.63 ? 331 GLU B OE2 1 
ATOM   7045  N N   . GLU B 1 332 ? 89.649  3.611   176.752 1.00 108.20 ? 332 GLU B N   1 
ATOM   7046  C CA  . GLU B 1 332 ? 89.580  4.943   176.153 1.00 121.24 ? 332 GLU B CA  1 
ATOM   7047  C C   . GLU B 1 332 ? 90.976  5.497   175.842 1.00 113.98 ? 332 GLU B C   1 
ATOM   7048  O O   . GLU B 1 332 ? 91.167  6.195   174.849 1.00 102.92 ? 332 GLU B O   1 
ATOM   7049  C CB  . GLU B 1 332 ? 88.832  5.906   177.080 1.00 126.47 ? 332 GLU B CB  1 
ATOM   7050  C CG  . GLU B 1 332 ? 88.251  7.157   176.409 1.00 139.43 ? 332 GLU B CG  1 
ATOM   7051  C CD  . GLU B 1 332 ? 86.934  6.895   175.693 1.00 147.37 ? 332 GLU B CD  1 
ATOM   7052  O OE1 . GLU B 1 332 ? 86.008  6.355   176.334 1.00 155.81 ? 332 GLU B OE1 1 
ATOM   7053  O OE2 . GLU B 1 332 ? 86.811  7.253   174.502 1.00 145.23 ? 332 GLU B OE2 1 
ATOM   7054  N N   . ASN B 1 333 ? 91.949  5.188   176.696 1.00 110.23 ? 333 ASN B N   1 
ATOM   7055  C CA  . ASN B 1 333 ? 93.292  5.765   176.570 1.00 103.11 ? 333 ASN B CA  1 
ATOM   7056  C C   . ASN B 1 333 ? 94.384  4.896   175.955 1.00 100.41 ? 333 ASN B C   1 
ATOM   7057  O O   . ASN B 1 333 ? 95.429  5.409   175.563 1.00 115.71 ? 333 ASN B O   1 
ATOM   7058  C CB  . ASN B 1 333 ? 93.781  6.217   177.947 1.00 102.91 ? 333 ASN B CB  1 
ATOM   7059  C CG  . ASN B 1 333 ? 92.833  7.179   178.609 1.00 111.90 ? 333 ASN B CG  1 
ATOM   7060  O OD1 . ASN B 1 333 ? 91.873  7.642   177.995 1.00 113.28 ? 333 ASN B OD1 1 
ATOM   7061  N ND2 . ASN B 1 333 ? 93.095  7.490   179.871 1.00 126.76 ? 333 ASN B ND2 1 
ATOM   7062  N N   . ILE B 1 334 ? 94.155  3.591   175.881 1.00 90.45  ? 334 ILE B N   1 
ATOM   7063  C CA  . ILE B 1 334 ? 95.189  2.669   175.413 1.00 96.12  ? 334 ILE B CA  1 
ATOM   7064  C C   . ILE B 1 334 ? 95.773  3.004   174.032 1.00 96.02  ? 334 ILE B C   1 
ATOM   7065  O O   . ILE B 1 334 ? 96.991  3.049   173.873 1.00 95.47  ? 334 ILE B O   1 
ATOM   7066  C CB  . ILE B 1 334 ? 94.674  1.211   175.404 1.00 91.88  ? 334 ILE B CB  1 
ATOM   7067  C CG1 . ILE B 1 334 ? 95.794  0.274   174.954 1.00 81.58  ? 334 ILE B CG1 1 
ATOM   7068  C CG2 . ILE B 1 334 ? 93.418  1.056   174.542 1.00 100.98 ? 334 ILE B CG2 1 
ATOM   7069  C CD1 . ILE B 1 334 ? 96.618  -0.254  176.111 1.00 78.55  ? 334 ILE B CD1 1 
ATOM   7070  N N   . ILE B 1 335 ? 94.920  3.236   173.042 1.00 92.60  ? 335 ILE B N   1 
ATOM   7071  C CA  . ILE B 1 335 ? 95.396  3.548   171.699 1.00 85.43  ? 335 ILE B CA  1 
ATOM   7072  C C   . ILE B 1 335 ? 96.107  4.900   171.612 1.00 89.64  ? 335 ILE B C   1 
ATOM   7073  O O   . ILE B 1 335 ? 97.164  4.989   170.982 1.00 101.60 ? 335 ILE B O   1 
ATOM   7074  C CB  . ILE B 1 335 ? 94.257  3.513   170.661 1.00 98.08  ? 335 ILE B CB  1 
ATOM   7075  C CG1 . ILE B 1 335 ? 93.511  2.191   170.769 1.00 110.16 ? 335 ILE B CG1 1 
ATOM   7076  C CG2 . ILE B 1 335 ? 94.819  3.690   169.256 1.00 89.82  ? 335 ILE B CG2 1 
ATOM   7077  C CD1 . ILE B 1 335 ? 94.402  1.002   170.508 1.00 91.07  ? 335 ILE B CD1 1 
ATOM   7078  N N   . PRO B 1 336 ? 95.510  5.969   172.181 1.00 96.14  ? 336 PRO B N   1 
ATOM   7079  C CA  . PRO B 1 336 ? 96.257  7.233   172.166 1.00 99.00  ? 336 PRO B CA  1 
ATOM   7080  C C   . PRO B 1 336 ? 97.639  7.155   172.828 1.00 90.87  ? 336 PRO B C   1 
ATOM   7081  O O   . PRO B 1 336 ? 98.593  7.722   172.292 1.00 88.09  ? 336 PRO B O   1 
ATOM   7082  C CB  . PRO B 1 336 ? 95.345  8.193   172.939 1.00 92.96  ? 336 PRO B CB  1 
ATOM   7083  C CG  . PRO B 1 336 ? 93.990  7.615   172.815 1.00 96.33  ? 336 PRO B CG  1 
ATOM   7084  C CD  . PRO B 1 336 ? 94.166  6.138   172.768 1.00 91.28  ? 336 PRO B CD  1 
ATOM   7085  N N   . TYR B 1 337 ? 97.738  6.484   173.973 1.00 88.25  ? 337 TYR B N   1 
ATOM   7086  C CA  . TYR B 1 337 ? 99.009  6.342   174.683 1.00 88.74  ? 337 TYR B CA  1 
ATOM   7087  C C   . TYR B 1 337 ? 100.066 5.642   173.833 1.00 83.82  ? 337 TYR B C   1 
ATOM   7088  O O   . TYR B 1 337 ? 101.202 6.106   173.724 1.00 95.27  ? 337 TYR B O   1 
ATOM   7089  C CB  . TYR B 1 337 ? 98.793  5.576   175.989 1.00 88.14  ? 337 TYR B CB  1 
ATOM   7090  C CG  . TYR B 1 337 ? 100.040 5.384   176.826 1.00 81.68  ? 337 TYR B CG  1 
ATOM   7091  C CD1 . TYR B 1 337 ? 100.868 4.284   176.636 1.00 82.52  ? 337 TYR B CD1 1 
ATOM   7092  C CD2 . TYR B 1 337 ? 100.381 6.297   177.813 1.00 81.36  ? 337 TYR B CD2 1 
ATOM   7093  C CE1 . TYR B 1 337 ? 101.998 4.106   177.402 1.00 94.23  ? 337 TYR B CE1 1 
ATOM   7094  C CE2 . TYR B 1 337 ? 101.510 6.127   178.582 1.00 80.55  ? 337 TYR B CE2 1 
ATOM   7095  C CZ  . TYR B 1 337 ? 102.315 5.030   178.372 1.00 92.92  ? 337 TYR B CZ  1 
ATOM   7096  O OH  . TYR B 1 337 ? 103.441 4.853   179.139 1.00 89.18  ? 337 TYR B OH  1 
ATOM   7097  N N   . ILE B 1 338 ? 99.681  4.518   173.240 1.00 79.54  ? 338 ILE B N   1 
ATOM   7098  C CA  . ILE B 1 338 ? 100.573 3.761   172.373 1.00 77.64  ? 338 ILE B CA  1 
ATOM   7099  C C   . ILE B 1 338 ? 101.009 4.627   171.199 1.00 81.71  ? 338 ILE B C   1 
ATOM   7100  O O   . ILE B 1 338 ? 102.154 4.570   170.759 1.00 89.95  ? 338 ILE B O   1 
ATOM   7101  C CB  . ILE B 1 338 ? 99.903  2.472   171.856 1.00 78.16  ? 338 ILE B CB  1 
ATOM   7102  C CG1 . ILE B 1 338 ? 99.707  1.493   173.009 1.00 76.47  ? 338 ILE B CG1 1 
ATOM   7103  C CG2 . ILE B 1 338 ? 100.743 1.816   170.776 1.00 79.73  ? 338 ILE B CG2 1 
ATOM   7104  C CD1 . ILE B 1 338 ? 98.896  0.282   172.637 1.00 78.46  ? 338 ILE B CD1 1 
ATOM   7105  N N   . THR B 1 339 ? 100.079 5.426   170.690 1.00 82.40  ? 339 THR B N   1 
ATOM   7106  C CA  . THR B 1 339 ? 100.357 6.310   169.563 1.00 92.87  ? 339 THR B CA  1 
ATOM   7107  C C   . THR B 1 339 ? 101.267 7.490   169.916 1.00 92.69  ? 339 THR B C   1 
ATOM   7108  O O   . THR B 1 339 ? 102.265 7.727   169.240 1.00 108.91 ? 339 THR B O   1 
ATOM   7109  C CB  . THR B 1 339 ? 99.059  6.871   168.955 1.00 102.90 ? 339 THR B CB  1 
ATOM   7110  O OG1 . THR B 1 339 ? 98.179  5.791   168.623 1.00 118.73 ? 339 THR B OG1 1 
ATOM   7111  C CG2 . THR B 1 339 ? 99.367  7.670   167.695 1.00 90.07  ? 339 THR B CG2 1 
ATOM   7112  N N   . ASN B 1 340 ? 100.911 8.246   170.950 1.00 86.50  ? 340 ASN B N   1 
ATOM   7113  C CA  . ASN B 1 340 ? 101.608 9.502   171.232 1.00 90.37  ? 340 ASN B CA  1 
ATOM   7114  C C   . ASN B 1 340 ? 102.642 9.483   172.361 1.00 85.66  ? 340 ASN B C   1 
ATOM   7115  O O   . ASN B 1 340 ? 103.654 10.179  172.282 1.00 99.90  ? 340 ASN B O   1 
ATOM   7116  C CB  . ASN B 1 340 ? 100.582 10.597  171.520 1.00 99.18  ? 340 ASN B CB  1 
ATOM   7117  C CG  . ASN B 1 340 ? 99.633  10.816  170.362 1.00 112.08 ? 340 ASN B CG  1 
ATOM   7118  O OD1 . ASN B 1 340 ? 99.995  11.441  169.366 1.00 123.17 ? 340 ASN B OD1 1 
ATOM   7119  N ND2 . ASN B 1 340 ? 98.415  10.301  170.482 1.00 126.19 ? 340 ASN B ND2 1 
ATOM   7120  N N   . VAL B 1 341 ? 102.399 8.701   173.406 1.00 81.00  ? 341 VAL B N   1 
ATOM   7121  C CA  . VAL B 1 341 ? 103.341 8.643   174.522 1.00 83.57  ? 341 VAL B CA  1 
ATOM   7122  C C   . VAL B 1 341 ? 104.424 7.604   174.265 1.00 80.48  ? 341 VAL B C   1 
ATOM   7123  O O   . VAL B 1 341 ? 105.606 7.858   174.480 1.00 96.10  ? 341 VAL B O   1 
ATOM   7124  C CB  . VAL B 1 341 ? 102.637 8.319   175.848 1.00 93.62  ? 341 VAL B CB  1 
ATOM   7125  C CG1 . VAL B 1 341 ? 103.582 8.563   177.016 1.00 102.03 ? 341 VAL B CG1 1 
ATOM   7126  C CG2 . VAL B 1 341 ? 101.380 9.155   175.992 1.00 101.85 ? 341 VAL B CG2 1 
ATOM   7127  N N   . LEU B 1 342 ? 104.004 6.428   173.818 1.00 74.93  ? 342 LEU B N   1 
ATOM   7128  C CA  . LEU B 1 342 ? 104.928 5.362   173.459 1.00 69.59  ? 342 LEU B CA  1 
ATOM   7129  C C   . LEU B 1 342 ? 105.525 5.642   172.078 1.00 81.83  ? 342 LEU B C   1 
ATOM   7130  O O   . LEU B 1 342 ? 106.672 5.294   171.803 1.00 105.04 ? 342 LEU B O   1 
ATOM   7131  C CB  . LEU B 1 342 ? 104.214 4.010   173.477 1.00 67.94  ? 342 LEU B CB  1 
ATOM   7132  C CG  . LEU B 1 342 ? 104.964 2.763   173.942 1.00 68.45  ? 342 LEU B CG  1 
ATOM   7133  C CD1 . LEU B 1 342 ? 103.949 1.699   174.262 1.00 75.14  ? 342 LEU B CD1 1 
ATOM   7134  C CD2 . LEU B 1 342 ? 105.917 2.264   172.877 1.00 67.81  ? 342 LEU B CD2 1 
ATOM   7135  N N   . GLN B 1 343 ? 104.730 6.279   171.221 1.00 74.12  ? 343 GLN B N   1 
ATOM   7136  C CA  . GLN B 1 343 ? 105.118 6.603   169.846 1.00 70.48  ? 343 GLN B CA  1 
ATOM   7137  C C   . GLN B 1 343 ? 105.418 5.344   169.034 1.00 70.88  ? 343 GLN B C   1 
ATOM   7138  O O   . GLN B 1 343 ? 106.445 5.228   168.357 1.00 76.19  ? 343 GLN B O   1 
ATOM   7139  C CB  . GLN B 1 343 ? 106.288 7.587   169.827 1.00 72.05  ? 343 GLN B CB  1 
ATOM   7140  C CG  . GLN B 1 343 ? 105.815 9.030   169.992 1.00 82.15  ? 343 GLN B CG  1 
ATOM   7141  C CD  . GLN B 1 343 ? 106.842 9.939   170.627 1.00 92.77  ? 343 GLN B CD  1 
ATOM   7142  O OE1 . GLN B 1 343 ? 107.629 10.583  169.934 1.00 92.70  ? 343 GLN B OE1 1 
ATOM   7143  N NE2 . GLN B 1 343 ? 106.831 10.010  171.954 1.00 104.62 ? 343 GLN B NE2 1 
ATOM   7144  N N   . ASN B 1 344 ? 104.486 4.403   169.127 1.00 71.71  ? 344 ASN B N   1 
ATOM   7145  C CA  . ASN B 1 344 ? 104.518 3.154   168.378 1.00 75.47  ? 344 ASN B CA  1 
ATOM   7146  C C   . ASN B 1 344 ? 103.271 2.995   167.507 1.00 74.29  ? 344 ASN B C   1 
ATOM   7147  O O   . ASN B 1 344 ? 102.432 2.141   167.797 1.00 69.69  ? 344 ASN B O   1 
ATOM   7148  C CB  . ASN B 1 344 ? 104.625 1.972   169.343 1.00 74.24  ? 344 ASN B CB  1 
ATOM   7149  C CG  . ASN B 1 344 ? 105.172 0.728   168.686 1.00 69.97  ? 344 ASN B CG  1 
ATOM   7150  O OD1 . ASN B 1 344 ? 104.793 0.384   167.569 1.00 69.81  ? 344 ASN B OD1 1 
ATOM   7151  N ND2 . ASN B 1 344 ? 106.056 0.030   169.387 1.00 67.37  ? 344 ASN B ND2 1 
ATOM   7152  N N   . PRO B 1 345 ? 103.142 3.810   166.441 1.00 74.93  ? 345 PRO B N   1 
ATOM   7153  C CA  . PRO B 1 345 ? 101.947 3.754   165.585 1.00 75.40  ? 345 PRO B CA  1 
ATOM   7154  C C   . PRO B 1 345 ? 101.617 2.362   165.044 1.00 78.07  ? 345 PRO B C   1 
ATOM   7155  O O   . PRO B 1 345 ? 100.442 2.001   165.008 1.00 89.81  ? 345 PRO B O   1 
ATOM   7156  C CB  . PRO B 1 345 ? 102.284 4.707   164.427 1.00 76.01  ? 345 PRO B CB  1 
ATOM   7157  C CG  . PRO B 1 345 ? 103.735 5.017   164.552 1.00 82.67  ? 345 PRO B CG  1 
ATOM   7158  C CD  . PRO B 1 345 ? 104.092 4.838   165.987 1.00 78.07  ? 345 PRO B CD  1 
ATOM   7159  N N   . ASP B 1 346 ? 102.625 1.604   164.623 1.00 75.80  ? 346 ASP B N   1 
ATOM   7160  C CA  . ASP B 1 346 ? 102.398 0.253   164.105 1.00 78.16  ? 346 ASP B CA  1 
ATOM   7161  C C   . ASP B 1 346 ? 101.658 -0.648  165.085 1.00 80.61  ? 346 ASP B C   1 
ATOM   7162  O O   . ASP B 1 346 ? 100.791 -1.424  164.688 1.00 95.12  ? 346 ASP B O   1 
ATOM   7163  C CB  . ASP B 1 346 ? 103.720 -0.396  163.706 1.00 91.25  ? 346 ASP B CB  1 
ATOM   7164  C CG  . ASP B 1 346 ? 104.258 0.158   162.408 1.00 99.35  ? 346 ASP B CG  1 
ATOM   7165  O OD1 . ASP B 1 346 ? 103.623 1.081   161.853 1.00 117.67 ? 346 ASP B OD1 1 
ATOM   7166  O OD2 . ASP B 1 346 ? 105.303 -0.331  161.933 1.00 84.74  ? 346 ASP B OD2 1 
ATOM   7167  N N   . LEU B 1 347 ? 102.009 -0.548  166.363 1.00 71.66  ? 347 LEU B N   1 
ATOM   7168  C CA  . LEU B 1 347 ? 101.352 -1.340  167.394 1.00 67.65  ? 347 LEU B CA  1 
ATOM   7169  C C   . LEU B 1 347 ? 99.921  -0.864  167.612 1.00 72.74  ? 347 LEU B C   1 
ATOM   7170  O O   . LEU B 1 347 ? 99.013  -1.676  167.791 1.00 86.77  ? 347 LEU B O   1 
ATOM   7171  C CB  . LEU B 1 347 ? 102.134 -1.272  168.707 1.00 65.73  ? 347 LEU B CB  1 
ATOM   7172  C CG  . LEU B 1 347 ? 101.573 -2.101  169.863 1.00 67.20  ? 347 LEU B CG  1 
ATOM   7173  C CD1 . LEU B 1 347 ? 101.704 -3.587  169.573 1.00 66.80  ? 347 LEU B CD1 1 
ATOM   7174  C CD2 . LEU B 1 347 ? 102.282 -1.743  171.153 1.00 66.54  ? 347 LEU B CD2 1 
ATOM   7175  N N   . ALA B 1 348 ? 99.727  0.451   167.595 1.00 77.27  ? 348 ALA B N   1 
ATOM   7176  C CA  . ALA B 1 348 ? 98.400  1.040   167.759 1.00 78.04  ? 348 ALA B CA  1 
ATOM   7177  C C   . ALA B 1 348 ? 97.441  0.603   166.651 1.00 85.01  ? 348 ALA B C   1 
ATOM   7178  O O   . ALA B 1 348 ? 96.296  0.247   166.921 1.00 93.59  ? 348 ALA B O   1 
ATOM   7179  C CB  . ALA B 1 348 ? 98.497  2.562   167.804 1.00 77.90  ? 348 ALA B CB  1 
ATOM   7180  N N   . LEU B 1 349 ? 97.918  0.633   165.409 1.00 84.24  ? 349 LEU B N   1 
ATOM   7181  C CA  . LEU B 1 349 ? 97.125  0.205   164.255 1.00 85.32  ? 349 LEU B CA  1 
ATOM   7182  C C   . LEU B 1 349 ? 96.676  -1.250  164.350 1.00 88.43  ? 349 LEU B C   1 
ATOM   7183  O O   . LEU B 1 349 ? 95.502  -1.553  164.140 1.00 105.78 ? 349 LEU B O   1 
ATOM   7184  C CB  . LEU B 1 349 ? 97.912  0.418   162.959 1.00 90.06  ? 349 LEU B CB  1 
ATOM   7185  C CG  . LEU B 1 349 ? 97.921  1.849   162.416 1.00 101.40 ? 349 LEU B CG  1 
ATOM   7186  C CD1 . LEU B 1 349 ? 99.284  2.203   161.847 1.00 124.16 ? 349 LEU B CD1 1 
ATOM   7187  C CD2 . LEU B 1 349 ? 96.840  2.010   161.360 1.00 94.90  ? 349 LEU B CD2 1 
ATOM   7188  N N   . ARG B 1 350 ? 97.609  -2.145  164.665 1.00 95.91  ? 350 ARG B N   1 
ATOM   7189  C CA  . ARG B 1 350 ? 97.291  -3.565  164.814 1.00 96.74  ? 350 ARG B CA  1 
ATOM   7190  C C   . ARG B 1 350 ? 96.337  -3.767  165.980 1.00 100.16 ? 350 ARG B C   1 
ATOM   7191  O O   . ARG B 1 350 ? 95.427  -4.594  165.913 1.00 114.11 ? 350 ARG B O   1 
ATOM   7192  C CB  . ARG B 1 350 ? 98.560  -4.389  165.021 1.00 82.20  ? 350 ARG B CB  1 
ATOM   7193  C CG  . ARG B 1 350 ? 98.355  -5.897  165.216 1.00 86.74  ? 350 ARG B CG  1 
ATOM   7194  C CD  . ARG B 1 350 ? 97.975  -6.616  163.928 1.00 116.39 ? 350 ARG B CD  1 
ATOM   7195  N NE  . ARG B 1 350 ? 97.574  -8.000  164.180 1.00 131.16 ? 350 ARG B NE  1 
ATOM   7196  C CZ  . ARG B 1 350 ? 96.322  -8.447  164.173 1.00 128.84 ? 350 ARG B CZ  1 
ATOM   7197  N NH1 . ARG B 1 350 ? 96.079  -9.727  164.417 1.00 127.63 ? 350 ARG B NH1 1 
ATOM   7198  N NH2 . ARG B 1 350 ? 95.317  -7.620  163.929 1.00 124.00 ? 350 ARG B NH2 1 
ATOM   7199  N N   . MET B 1 351 ? 96.546  -3.002  167.047 1.00 87.73  ? 351 MET B N   1 
ATOM   7200  C CA  . MET B 1 351 ? 95.704  -3.097  168.238 1.00 89.54  ? 351 MET B CA  1 
ATOM   7201  C C   . MET B 1 351 ? 94.269  -2.631  168.022 1.00 93.97  ? 351 MET B C   1 
ATOM   7202  O O   . MET B 1 351 ? 93.336  -3.251  168.520 1.00 105.44 ? 351 MET B O   1 
ATOM   7203  C CB  . MET B 1 351 ? 96.317  -2.290  169.377 1.00 91.35  ? 351 MET B CB  1 
ATOM   7204  C CG  . MET B 1 351 ? 95.970  -2.808  170.763 1.00 85.49  ? 351 MET B CG  1 
ATOM   7205  S SD  . MET B 1 351 ? 97.420  -3.196  171.745 1.00 111.69 ? 351 MET B SD  1 
ATOM   7206  C CE  . MET B 1 351 ? 96.740  -3.055  173.398 1.00 130.09 ? 351 MET B CE  1 
ATOM   7207  N N   . ALA B 1 352 ? 94.087  -1.568  167.248 1.00 97.30  ? 352 ALA B N   1 
ATOM   7208  C CA  . ALA B 1 352 ? 92.749  -1.022  166.999 1.00 92.22  ? 352 ALA B CA  1 
ATOM   7209  C C   . ALA B 1 352 ? 91.921  -1.869  166.046 1.00 94.31  ? 352 ALA B C   1 
ATOM   7210  O O   . ALA B 1 352 ? 90.697  -1.849  166.089 1.00 123.59 ? 352 ALA B O   1 
ATOM   7211  C CB  . ALA B 1 352 ? 92.849  0.396   166.469 1.00 93.92  ? 352 ALA B CB  1 
ATOM   7212  N N   . VAL B 1 353 ? 92.595  -2.600  165.172 1.00 91.53  ? 353 VAL B N   1 
ATOM   7213  C CA  . VAL B 1 353 ? 91.907  -3.440  164.198 1.00 93.46  ? 353 VAL B CA  1 
ATOM   7214  C C   . VAL B 1 353 ? 91.653  -4.828  164.792 1.00 95.34  ? 353 VAL B C   1 
ATOM   7215  O O   . VAL B 1 353 ? 90.646  -5.470  164.497 1.00 113.71 ? 353 VAL B O   1 
ATOM   7216  C CB  . VAL B 1 353 ? 92.696  -3.530  162.866 1.00 96.34  ? 353 VAL B CB  1 
ATOM   7217  C CG1 . VAL B 1 353 ? 93.957  -4.373  163.011 1.00 122.80 ? 353 VAL B CG1 1 
ATOM   7218  C CG2 . VAL B 1 353 ? 91.813  -4.046  161.753 1.00 100.54 ? 353 VAL B CG2 1 
ATOM   7219  N N   . ARG B 1 354 ? 92.582  -5.292  165.620 1.00 94.08  ? 354 ARG B N   1 
ATOM   7220  C CA  . ARG B 1 354 ? 92.469  -6.595  166.259 1.00 95.50  ? 354 ARG B CA  1 
ATOM   7221  C C   . ARG B 1 354 ? 91.348  -6.654  167.301 1.00 92.93  ? 354 ARG B C   1 
ATOM   7222  O O   . ARG B 1 354 ? 90.446  -7.482  167.201 1.00 93.50  ? 354 ARG B O   1 
ATOM   7223  C CB  . ARG B 1 354 ? 93.797  -6.977  166.904 1.00 90.59  ? 354 ARG B CB  1 
ATOM   7224  C CG  . ARG B 1 354 ? 93.914  -8.442  167.259 1.00 87.82  ? 354 ARG B CG  1 
ATOM   7225  C CD  . ARG B 1 354 ? 95.279  -8.722  167.836 1.00 86.17  ? 354 ARG B CD  1 
ATOM   7226  N NE  . ARG B 1 354 ? 95.488  -7.971  169.068 1.00 90.23  ? 354 ARG B NE  1 
ATOM   7227  C CZ  . ARG B 1 354 ? 96.682  -7.651  169.551 1.00 89.57  ? 354 ARG B CZ  1 
ATOM   7228  N NH1 . ARG B 1 354 ? 96.782  -6.963  170.680 1.00 75.62  ? 354 ARG B NH1 1 
ATOM   7229  N NH2 . ARG B 1 354 ? 97.778  -8.019  168.903 1.00 97.50  ? 354 ARG B NH2 1 
ATOM   7230  N N   . ASN B 1 355 ? 91.399  -5.767  168.293 1.00 114.91 ? 355 ASN B N   1 
ATOM   7231  C CA  . ASN B 1 355 ? 90.403  -5.761  169.370 1.00 111.53 ? 355 ASN B CA  1 
ATOM   7232  C C   . ASN B 1 355 ? 89.332  -4.677  169.248 1.00 126.66 ? 355 ASN B C   1 
ATOM   7233  O O   . ASN B 1 355 ? 88.735  -4.263  170.241 1.00 125.03 ? 355 ASN B O   1 
ATOM   7234  C CB  . ASN B 1 355 ? 91.109  -5.615  170.711 1.00 107.68 ? 355 ASN B CB  1 
ATOM   7235  C CG  . ASN B 1 355 ? 92.340  -6.480  170.810 1.00 112.22 ? 355 ASN B CG  1 
ATOM   7236  O OD1 . ASN B 1 355 ? 93.448  -6.037  170.516 1.00 116.03 ? 355 ASN B OD1 1 
ATOM   7237  N ND2 . ASN B 1 355 ? 92.156  -7.721  171.244 1.00 114.88 ? 355 ASN B ND2 1 
ATOM   7238  N N   . ASN B 1 356 ? 89.087  -4.256  168.013 1.00 136.39 ? 356 ASN B N   1 
ATOM   7239  C CA  . ASN B 1 356 ? 88.156  -3.177  167.673 1.00 123.54 ? 356 ASN B CA  1 
ATOM   7240  C C   . ASN B 1 356 ? 88.105  -2.054  168.712 1.00 121.35 ? 356 ASN B C   1 
ATOM   7241  O O   . ASN B 1 356 ? 87.083  -1.830  169.356 1.00 138.64 ? 356 ASN B O   1 
ATOM   7242  C CB  . ASN B 1 356 ? 86.754  -3.746  167.488 1.00 117.20 ? 356 ASN B CB  1 
ATOM   7243  C CG  . ASN B 1 356 ? 86.073  -3.213  166.254 1.00 126.60 ? 356 ASN B CG  1 
ATOM   7244  O OD1 . ASN B 1 356 ? 86.681  -3.166  165.190 1.00 133.09 ? 356 ASN B OD1 1 
ATOM   7245  N ND2 . ASN B 1 356 ? 84.819  -2.784  166.388 1.00 125.97 ? 356 ASN B ND2 1 
ATOM   7246  N N   . LEU B 1 357 ? 89.217  -1.345  168.850 1.00 109.73 ? 357 LEU B N   1 
ATOM   7247  C CA  . LEU B 1 357 ? 89.336  -0.204  169.755 1.00 108.70 ? 357 LEU B CA  1 
ATOM   7248  C C   . LEU B 1 357 ? 89.343  1.109   168.969 1.00 112.76 ? 357 LEU B C   1 
ATOM   7249  O O   . LEU B 1 357 ? 89.578  1.115   167.763 1.00 128.89 ? 357 LEU B O   1 
ATOM   7250  C CB  . LEU B 1 357 ? 90.586  -0.323  170.635 1.00 108.93 ? 357 LEU B CB  1 
ATOM   7251  C CG  . LEU B 1 357 ? 90.576  -1.333  171.790 1.00 112.28 ? 357 LEU B CG  1 
ATOM   7252  C CD1 . LEU B 1 357 ? 91.955  -1.931  171.977 1.00 117.93 ? 357 LEU B CD1 1 
ATOM   7253  C CD2 . LEU B 1 357 ? 90.111  -0.688  173.100 1.00 112.54 ? 357 LEU B CD2 1 
ATOM   7254  N N   . ALA B 1 358 ? 89.082  2.220   169.651 1.00 114.65 ? 358 ALA B N   1 
ATOM   7255  C CA  . ALA B 1 358 ? 88.976  3.527   168.988 1.00 120.48 ? 358 ALA B CA  1 
ATOM   7256  C C   . ALA B 1 358 ? 90.035  4.544   169.439 1.00 126.34 ? 358 ALA B C   1 
ATOM   7257  O O   . ALA B 1 358 ? 90.484  4.534   170.584 1.00 134.03 ? 358 ALA B O   1 
ATOM   7258  C CB  . ALA B 1 358 ? 87.589  4.111   169.204 1.00 120.21 ? 358 ALA B CB  1 
ATOM   7259  N N   . GLY B 1 359 ? 90.420  5.422   168.515 1.00 122.48 ? 359 GLY B N   1 
ATOM   7260  C CA  . GLY B 1 359 ? 91.412  6.459   168.758 1.00 126.53 ? 359 GLY B CA  1 
ATOM   7261  C C   . GLY B 1 359 ? 92.563  6.487   167.763 1.00 132.76 ? 359 GLY B C   1 
ATOM   7262  O O   . GLY B 1 359 ? 93.497  7.283   167.883 1.00 139.31 ? 359 GLY B O   1 
ATOM   7263  N N   . ALA B 1 360 ? 92.476  5.609   166.771 1.00 134.40 ? 360 ALA B N   1 
ATOM   7264  C CA  . ALA B 1 360 ? 93.469  5.476   165.709 1.00 138.48 ? 360 ALA B CA  1 
ATOM   7265  C C   . ALA B 1 360 ? 93.122  6.271   164.443 1.00 139.02 ? 360 ALA B C   1 
ATOM   7266  O O   . ALA B 1 360 ? 93.917  6.308   163.505 1.00 143.00 ? 360 ALA B O   1 
ATOM   7267  C CB  . ALA B 1 360 ? 93.667  4.003   165.368 1.00 140.37 ? 360 ALA B CB  1 
ATOM   7268  N N   . GLU B 1 361 ? 91.941  6.891   164.421 1.00 132.15 ? 361 GLU B N   1 
ATOM   7269  C CA  . GLU B 1 361 ? 91.389  7.525   163.212 1.00 133.37 ? 361 GLU B CA  1 
ATOM   7270  C C   . GLU B 1 361 ? 92.399  8.333   162.405 1.00 131.24 ? 361 GLU B C   1 
ATOM   7271  O O   . GLU B 1 361 ? 92.477  8.196   161.187 1.00 126.76 ? 361 GLU B O   1 
ATOM   7272  C CB  . GLU B 1 361 ? 90.216  8.447   163.568 1.00 139.82 ? 361 GLU B CB  1 
ATOM   7273  C CG  . GLU B 1 361 ? 89.140  7.805   164.413 1.00 152.80 ? 361 GLU B CG  1 
ATOM   7274  C CD  . GLU B 1 361 ? 89.454  7.926   165.885 1.00 172.99 ? 361 GLU B CD  1 
ATOM   7275  O OE1 . GLU B 1 361 ? 90.278  8.797   166.246 1.00 181.13 ? 361 GLU B OE1 1 
ATOM   7276  O OE2 . GLU B 1 361 ? 88.877  7.159   166.681 1.00 172.75 ? 361 GLU B OE2 1 
ATOM   7277  N N   . GLU B 1 362 ? 93.153  9.186   163.085 1.00 130.01 ? 362 GLU B N   1 
ATOM   7278  C CA  . GLU B 1 362 ? 94.162  10.022  162.437 1.00 132.28 ? 362 GLU B CA  1 
ATOM   7279  C C   . GLU B 1 362 ? 95.232  9.193   161.717 1.00 132.02 ? 362 GLU B C   1 
ATOM   7280  O O   . GLU B 1 362 ? 95.662  9.545   160.618 1.00 132.28 ? 362 GLU B O   1 
ATOM   7281  C CB  . GLU B 1 362 ? 94.816  10.940  163.470 1.00 143.41 ? 362 GLU B CB  1 
ATOM   7282  C CG  . GLU B 1 362 ? 94.950  12.386  163.026 1.00 154.53 ? 362 GLU B CG  1 
ATOM   7283  C CD  . GLU B 1 362 ? 96.195  12.613  162.200 1.00 162.15 ? 362 GLU B CD  1 
ATOM   7284  O OE1 . GLU B 1 362 ? 97.243  12.938  162.795 1.00 162.32 ? 362 GLU B OE1 1 
ATOM   7285  O OE2 . GLU B 1 362 ? 96.131  12.469  160.959 1.00 164.97 ? 362 GLU B OE2 1 
ATOM   7286  N N   . LEU B 1 363 ? 95.646  8.087   162.333 1.00 131.30 ? 363 LEU B N   1 
ATOM   7287  C CA  . LEU B 1 363 ? 96.674  7.220   161.754 1.00 127.23 ? 363 LEU B CA  1 
ATOM   7288  C C   . LEU B 1 363 ? 96.185  6.548   160.479 1.00 129.86 ? 363 LEU B C   1 
ATOM   7289  O O   . LEU B 1 363 ? 96.929  6.425   159.506 1.00 129.22 ? 363 LEU B O   1 
ATOM   7290  C CB  . LEU B 1 363 ? 97.114  6.149   162.755 1.00 119.93 ? 363 LEU B CB  1 
ATOM   7291  C CG  . LEU B 1 363 ? 97.865  6.605   164.004 1.00 121.37 ? 363 LEU B CG  1 
ATOM   7292  C CD1 . LEU B 1 363 ? 97.792  5.524   165.067 1.00 119.97 ? 363 LEU B CD1 1 
ATOM   7293  C CD2 . LEU B 1 363 ? 99.314  6.953   163.676 1.00 122.61 ? 363 LEU B CD2 1 
ATOM   7294  N N   . PHE B 1 364 ? 94.925  6.121   160.495 1.00 137.07 ? 364 PHE B N   1 
ATOM   7295  C CA  . PHE B 1 364 ? 94.312  5.476   159.337 1.00 127.32 ? 364 PHE B CA  1 
ATOM   7296  C C   . PHE B 1 364 ? 94.209  6.452   158.173 1.00 126.88 ? 364 PHE B C   1 
ATOM   7297  O O   . PHE B 1 364 ? 94.377  6.069   157.016 1.00 127.28 ? 364 PHE B O   1 
ATOM   7298  C CB  . PHE B 1 364 ? 92.933  4.919   159.693 1.00 123.90 ? 364 PHE B CB  1 
ATOM   7299  C CG  . PHE B 1 364 ? 92.989  3.622   160.445 1.00 121.88 ? 364 PHE B CG  1 
ATOM   7300  C CD1 . PHE B 1 364 ? 93.270  2.434   159.790 1.00 123.20 ? 364 PHE B CD1 1 
ATOM   7301  C CD2 . PHE B 1 364 ? 92.782  3.594   161.810 1.00 121.06 ? 364 PHE B CD2 1 
ATOM   7302  C CE1 . PHE B 1 364 ? 93.330  1.242   160.484 1.00 122.58 ? 364 PHE B CE1 1 
ATOM   7303  C CE2 . PHE B 1 364 ? 92.842  2.409   162.508 1.00 121.55 ? 364 PHE B CE2 1 
ATOM   7304  C CZ  . PHE B 1 364 ? 93.118  1.230   161.847 1.00 120.79 ? 364 PHE B CZ  1 
ATOM   7305  N N   . ALA B 1 365 ? 93.922  7.711   158.484 1.00 126.51 ? 365 ALA B N   1 
ATOM   7306  C CA  . ALA B 1 365 ? 93.903  8.758   157.469 1.00 129.48 ? 365 ALA B CA  1 
ATOM   7307  C C   . ALA B 1 365 ? 95.307  8.964   156.907 1.00 138.66 ? 365 ALA B C   1 
ATOM   7308  O O   . ALA B 1 365 ? 95.491  9.060   155.694 1.00 141.26 ? 365 ALA B O   1 
ATOM   7309  C CB  . ALA B 1 365 ? 93.354  10.058  158.043 1.00 130.35 ? 365 ALA B CB  1 
ATOM   7310  N N   . ARG B 1 366 ? 96.288  9.045   157.803 1.00 145.58 ? 366 ARG B N   1 
ATOM   7311  C CA  . ARG B 1 366 ? 97.691  9.208   157.421 1.00 142.24 ? 366 ARG B CA  1 
ATOM   7312  C C   . ARG B 1 366 ? 98.173  8.081   156.507 1.00 135.50 ? 366 ARG B C   1 
ATOM   7313  O O   . ARG B 1 366 ? 98.774  8.331   155.462 1.00 136.33 ? 366 ARG B O   1 
ATOM   7314  C CB  . ARG B 1 366 ? 98.578  9.269   158.664 1.00 151.90 ? 366 ARG B CB  1 
ATOM   7315  C CG  . ARG B 1 366 ? 98.547  10.594  159.410 1.00 160.95 ? 366 ARG B CG  1 
ATOM   7316  C CD  . ARG B 1 366 ? 99.663  10.651  160.436 1.00 168.46 ? 366 ARG B CD  1 
ATOM   7317  N NE  . ARG B 1 366 ? 99.410  11.630  161.488 1.00 173.76 ? 366 ARG B NE  1 
ATOM   7318  C CZ  . ARG B 1 366 ? 100.309 11.983  162.399 1.00 173.66 ? 366 ARG B CZ  1 
ATOM   7319  N NH1 . ARG B 1 366 ? 100.002 12.878  163.328 1.00 172.68 ? 366 ARG B NH1 1 
ATOM   7320  N NH2 . ARG B 1 366 ? 101.516 11.435  162.382 1.00 167.82 ? 366 ARG B NH2 1 
ATOM   7321  N N   . LYS B 1 367 ? 97.894  6.843   156.906 1.00 133.40 ? 367 LYS B N   1 
ATOM   7322  C CA  . LYS B 1 367 ? 98.284  5.667   156.130 1.00 134.45 ? 367 LYS B CA  1 
ATOM   7323  C C   . LYS B 1 367 ? 97.600  5.644   154.765 1.00 139.25 ? 367 LYS B C   1 
ATOM   7324  O O   . LYS B 1 367 ? 98.177  5.187   153.779 1.00 138.75 ? 367 LYS B O   1 
ATOM   7325  C CB  . LYS B 1 367 ? 97.950  4.387   156.898 1.00 138.59 ? 367 LYS B CB  1 
ATOM   7326  C CG  . LYS B 1 367 ? 98.913  4.053   158.035 1.00 151.12 ? 367 LYS B CG  1 
ATOM   7327  C CD  . LYS B 1 367 ? 100.105 3.221   157.566 1.00 166.68 ? 367 LYS B CD  1 
ATOM   7328  C CE  . LYS B 1 367 ? 101.153 3.092   158.670 1.00 167.08 ? 367 LYS B CE  1 
ATOM   7329  N NZ  . LYS B 1 367 ? 102.315 2.256   158.250 1.00 164.10 ? 367 LYS B NZ  1 
ATOM   7330  N N   . PHE B 1 368 ? 96.370  6.146   154.716 1.00 146.91 ? 368 PHE B N   1 
ATOM   7331  C CA  . PHE B 1 368 ? 95.607  6.196   153.473 1.00 144.95 ? 368 PHE B CA  1 
ATOM   7332  C C   . PHE B 1 368 ? 96.199  7.229   152.516 1.00 151.43 ? 368 PHE B C   1 
ATOM   7333  O O   . PHE B 1 368 ? 96.519  6.916   151.370 1.00 152.74 ? 368 PHE B O   1 
ATOM   7334  C CB  . PHE B 1 368 ? 94.136  6.519   153.753 1.00 138.37 ? 368 PHE B CB  1 
ATOM   7335  C CG  . PHE B 1 368 ? 93.245  6.392   152.547 1.00 139.38 ? 368 PHE B CG  1 
ATOM   7336  C CD1 . PHE B 1 368 ? 92.761  5.152   152.167 1.00 140.34 ? 368 PHE B CD1 1 
ATOM   7337  C CD2 . PHE B 1 368 ? 92.897  7.500   151.795 1.00 141.21 ? 368 PHE B CD2 1 
ATOM   7338  C CE1 . PHE B 1 368 ? 91.944  5.015   151.065 1.00 141.46 ? 368 PHE B CE1 1 
ATOM   7339  C CE2 . PHE B 1 368 ? 92.078  7.372   150.686 1.00 143.35 ? 368 PHE B CE2 1 
ATOM   7340  C CZ  . PHE B 1 368 ? 91.602  6.125   150.321 1.00 141.96 ? 368 PHE B CZ  1 
ATOM   7341  N N   . ASN B 1 369 ? 96.320  8.464   152.994 1.00 155.69 ? 369 ASN B N   1 
ATOM   7342  C CA  . ASN B 1 369 ? 96.875  9.557   152.198 1.00 155.94 ? 369 ASN B CA  1 
ATOM   7343  C C   . ASN B 1 369 ? 98.279  9.271   151.685 1.00 155.59 ? 369 ASN B C   1 
ATOM   7344  O O   . ASN B 1 369 ? 98.633  9.660   150.574 1.00 150.24 ? 369 ASN B O   1 
ATOM   7345  C CB  . ASN B 1 369 ? 96.891  10.854  153.007 1.00 155.81 ? 369 ASN B CB  1 
ATOM   7346  C CG  . ASN B 1 369 ? 95.515  11.262  153.472 1.00 152.18 ? 369 ASN B CG  1 
ATOM   7347  O OD1 . ASN B 1 369 ? 94.569  11.295  152.686 1.00 146.78 ? 369 ASN B OD1 1 
ATOM   7348  N ND2 . ASN B 1 369 ? 95.391  11.573  154.757 1.00 153.91 ? 369 ASN B ND2 1 
ATOM   7349  N N   . ALA B 1 370 ? 99.076  8.587   152.498 1.00 154.29 ? 370 ALA B N   1 
ATOM   7350  C CA  . ALA B 1 370 ? 100.447 8.246   152.122 1.00 147.15 ? 370 ALA B CA  1 
ATOM   7351  C C   . ALA B 1 370 ? 100.496 7.235   150.981 1.00 152.50 ? 370 ALA B C   1 
ATOM   7352  O O   . ALA B 1 370 ? 101.304 7.367   150.064 1.00 166.41 ? 370 ALA B O   1 
ATOM   7353  C CB  . ALA B 1 370 ? 101.207 7.710   153.326 1.00 146.00 ? 370 ALA B CB  1 
ATOM   7354  N N   . LEU B 1 371 ? 99.631  6.228   151.042 1.00 149.33 ? 371 LEU B N   1 
ATOM   7355  C CA  . LEU B 1 371 ? 99.564  5.194   150.010 1.00 155.89 ? 371 LEU B CA  1 
ATOM   7356  C C   . LEU B 1 371 ? 98.911  5.722   148.737 1.00 164.47 ? 371 LEU B C   1 
ATOM   7357  O O   . LEU B 1 371 ? 99.185  5.241   147.637 1.00 165.02 ? 371 LEU B O   1 
ATOM   7358  C CB  . LEU B 1 371 ? 98.807  3.969   150.527 1.00 156.44 ? 371 LEU B CB  1 
ATOM   7359  C CG  . LEU B 1 371 ? 99.646  2.970   151.328 1.00 162.44 ? 371 LEU B CG  1 
ATOM   7360  C CD1 . LEU B 1 371 ? 98.779  2.200   152.304 1.00 161.05 ? 371 LEU B CD1 1 
ATOM   7361  C CD2 . LEU B 1 371 ? 100.384 2.019   150.399 1.00 169.28 ? 371 LEU B CD2 1 
ATOM   7362  N N   . PHE B 1 372 ? 98.053  6.724   148.902 1.00 168.09 ? 372 PHE B N   1 
ATOM   7363  C CA  . PHE B 1 372 ? 97.366  7.357   147.782 1.00 166.50 ? 372 PHE B CA  1 
ATOM   7364  C C   . PHE B 1 372 ? 98.380  8.158   146.974 1.00 169.60 ? 372 PHE B C   1 
ATOM   7365  O O   . PHE B 1 372 ? 98.428  8.078   145.746 1.00 167.84 ? 372 PHE B O   1 
ATOM   7366  C CB  . PHE B 1 372 ? 96.242  8.261   148.295 1.00 167.67 ? 372 PHE B CB  1 
ATOM   7367  C CG  . PHE B 1 372 ? 95.204  8.597   147.262 1.00 170.16 ? 372 PHE B CG  1 
ATOM   7368  C CD1 . PHE B 1 372 ? 94.112  7.769   147.070 1.00 171.27 ? 372 PHE B CD1 1 
ATOM   7369  C CD2 . PHE B 1 372 ? 95.308  9.748   146.498 1.00 169.95 ? 372 PHE B CD2 1 
ATOM   7370  C CE1 . PHE B 1 372 ? 93.149  8.070   146.130 1.00 171.28 ? 372 PHE B CE1 1 
ATOM   7371  C CE2 . PHE B 1 372 ? 94.348  10.057  145.554 1.00 173.33 ? 372 PHE B CE2 1 
ATOM   7372  C CZ  . PHE B 1 372 ? 93.266  9.216   145.370 1.00 173.82 ? 372 PHE B CZ  1 
ATOM   7373  N N   . ALA B 1 373 ? 99.190  8.930   147.690 1.00 173.97 ? 373 ALA B N   1 
ATOM   7374  C CA  . ALA B 1 373 ? 100.274 9.710   147.103 1.00 175.46 ? 373 ALA B CA  1 
ATOM   7375  C C   . ALA B 1 373 ? 101.346 8.784   146.536 1.00 180.41 ? 373 ALA B C   1 
ATOM   7376  O O   . ALA B 1 373 ? 102.048 9.135   145.593 1.00 186.28 ? 373 ALA B O   1 
ATOM   7377  C CB  . ALA B 1 373 ? 100.872 10.660  148.139 1.00 170.08 ? 373 ALA B CB  1 
ATOM   7378  N N   . GLN B 1 374 ? 101.471 7.602   147.129 1.00 177.93 ? 374 GLN B N   1 
ATOM   7379  C CA  . GLN B 1 374 ? 102.474 6.625   146.709 1.00 181.54 ? 374 GLN B CA  1 
ATOM   7380  C C   . GLN B 1 374 ? 102.146 5.907   145.403 1.00 182.47 ? 374 GLN B C   1 
ATOM   7381  O O   . GLN B 1 374 ? 102.998 5.223   144.836 1.00 178.78 ? 374 GLN B O   1 
ATOM   7382  C CB  . GLN B 1 374 ? 102.624 5.549   147.791 1.00 180.77 ? 374 GLN B CB  1 
ATOM   7383  C CG  . GLN B 1 374 ? 103.944 4.782   147.831 1.00 187.80 ? 374 GLN B CG  1 
ATOM   7384  C CD  . GLN B 1 374 ? 105.025 5.484   148.622 1.00 197.45 ? 374 GLN B CD  1 
ATOM   7385  O OE1 . GLN B 1 374 ? 104.789 5.924   149.745 1.00 206.34 ? 374 GLN B OE1 1 
ATOM   7386  N NE2 . GLN B 1 374 ? 106.228 5.556   148.061 1.00 195.48 ? 374 GLN B NE2 1 
ATOM   7387  N N   . GLY B 1 375 ? 100.930 6.086   144.900 1.00 179.22 ? 375 GLY B N   1 
ATOM   7388  C CA  . GLY B 1 375 ? 100.528 5.426   143.672 1.00 177.82 ? 375 GLY B CA  1 
ATOM   7389  C C   . GLY B 1 375 ? 99.994  4.033   143.964 1.00 178.21 ? 375 GLY B C   1 
ATOM   7390  O O   . GLY B 1 375 ? 99.334  3.417   143.126 1.00 175.36 ? 375 GLY B O   1 
ATOM   7391  N N   . ASN B 1 376 ? 100.272 3.527   145.161 1.00 180.92 ? 376 ASN B N   1 
ATOM   7392  C CA  . ASN B 1 376 ? 99.827  2.188   145.516 1.00 179.88 ? 376 ASN B CA  1 
ATOM   7393  C C   . ASN B 1 376 ? 98.373  2.282   145.954 1.00 175.57 ? 376 ASN B C   1 
ATOM   7394  O O   . ASN B 1 376 ? 98.078  2.352   147.144 1.00 168.03 ? 376 ASN B O   1 
ATOM   7395  C CB  . ASN B 1 376 ? 100.712 1.601   146.629 1.00 174.97 ? 376 ASN B CB  1 
ATOM   7396  C CG  . ASN B 1 376 ? 100.590 0.089   146.757 1.00 172.28 ? 376 ASN B CG  1 
ATOM   7397  O OD1 . ASN B 1 376 ? 99.564  -0.499  146.422 1.00 174.80 ? 376 ASN B OD1 1 
ATOM   7398  N ND2 . ASN B 1 376 ? 101.652 -0.546  147.246 1.00 167.05 ? 376 ASN B ND2 1 
ATOM   7399  N N   . TYR B 1 377 ? 97.461  2.235   144.986 1.00 178.23 ? 377 TYR B N   1 
ATOM   7400  C CA  . TYR B 1 377 ? 96.034  2.349   145.286 1.00 181.47 ? 377 TYR B CA  1 
ATOM   7401  C C   . TYR B 1 377 ? 95.438  1.028   145.742 1.00 179.16 ? 377 TYR B C   1 
ATOM   7402  O O   . TYR B 1 377 ? 94.385  0.999   146.381 1.00 168.45 ? 377 TYR B O   1 
ATOM   7403  C CB  . TYR B 1 377 ? 95.249  2.903   144.091 1.00 182.61 ? 377 TYR B CB  1 
ATOM   7404  C CG  . TYR B 1 377 ? 95.596  2.334   142.733 1.00 189.50 ? 377 TYR B CG  1 
ATOM   7405  C CD1 . TYR B 1 377 ? 94.932  1.222   142.229 1.00 193.52 ? 377 TYR B CD1 1 
ATOM   7406  C CD2 . TYR B 1 377 ? 96.551  2.945   141.930 1.00 188.26 ? 377 TYR B CD2 1 
ATOM   7407  C CE1 . TYR B 1 377 ? 95.232  0.719   140.979 1.00 194.06 ? 377 TYR B CE1 1 
ATOM   7408  C CE2 . TYR B 1 377 ? 96.858  2.448   140.682 1.00 188.30 ? 377 TYR B CE2 1 
ATOM   7409  C CZ  . TYR B 1 377 ? 96.195  1.337   140.212 1.00 191.97 ? 377 TYR B CZ  1 
ATOM   7410  O OH  . TYR B 1 377 ? 96.499  0.842   138.967 1.00 190.16 ? 377 TYR B OH  1 
ATOM   7411  N N   . SER B 1 378 ? 96.100  -0.066  145.384 1.00 182.56 ? 378 SER B N   1 
ATOM   7412  C CA  . SER B 1 378 ? 95.652  -1.399  145.775 1.00 181.78 ? 378 SER B CA  1 
ATOM   7413  C C   . SER B 1 378 ? 95.716  -1.595  147.288 1.00 178.39 ? 378 SER B C   1 
ATOM   7414  O O   . SER B 1 378 ? 94.773  -2.100  147.897 1.00 176.43 ? 378 SER B O   1 
ATOM   7415  C CB  . SER B 1 378 ? 96.492  -2.466  145.080 1.00 181.13 ? 378 SER B CB  1 
ATOM   7416  O OG  . SER B 1 378 ? 96.132  -3.758  145.528 1.00 183.30 ? 378 SER B OG  1 
ATOM   7417  N N   . GLU B 1 379 ? 96.830  -1.184  147.887 1.00 169.09 ? 379 GLU B N   1 
ATOM   7418  C CA  . GLU B 1 379 ? 97.020  -1.295  149.333 1.00 161.64 ? 379 GLU B CA  1 
ATOM   7419  C C   . GLU B 1 379 ? 96.269  -0.206  150.086 1.00 156.84 ? 379 GLU B C   1 
ATOM   7420  O O   . GLU B 1 379 ? 95.818  -0.418  151.212 1.00 159.03 ? 379 GLU B O   1 
ATOM   7421  C CB  . GLU B 1 379 ? 98.508  -1.240  149.689 1.00 166.99 ? 379 GLU B CB  1 
ATOM   7422  C CG  . GLU B 1 379 ? 99.238  -2.570  149.578 1.00 172.70 ? 379 GLU B CG  1 
ATOM   7423  C CD  . GLU B 1 379 ? 98.636  -3.647  150.468 1.00 169.59 ? 379 GLU B CD  1 
ATOM   7424  O OE1 . GLU B 1 379 ? 98.335  -3.361  151.648 1.00 161.50 ? 379 GLU B OE1 1 
ATOM   7425  O OE2 . GLU B 1 379 ? 98.470  -4.788  149.990 1.00 172.64 ? 379 GLU B OE2 1 
ATOM   7426  N N   . ALA B 1 380 ? 96.156  0.964   149.463 1.00 156.90 ? 380 ALA B N   1 
ATOM   7427  C CA  . ALA B 1 380 ? 95.407  2.076   150.037 1.00 160.38 ? 380 ALA B CA  1 
ATOM   7428  C C   . ALA B 1 380 ? 93.956  1.674   150.287 1.00 150.74 ? 380 ALA B C   1 
ATOM   7429  O O   . ALA B 1 380 ? 93.360  2.059   151.291 1.00 149.22 ? 380 ALA B O   1 
ATOM   7430  C CB  . ALA B 1 380 ? 95.477  3.297   149.124 1.00 165.43 ? 380 ALA B CB  1 
ATOM   7431  N N   . ALA B 1 381 ? 93.396  0.898   149.364 1.00 152.73 ? 381 ALA B N   1 
ATOM   7432  C CA  . ALA B 1 381 ? 92.024  0.408   149.489 1.00 159.02 ? 381 ALA B CA  1 
ATOM   7433  C C   . ALA B 1 381 ? 91.860  -0.539  150.675 1.00 155.29 ? 381 ALA B C   1 
ATOM   7434  O O   . ALA B 1 381 ? 90.861  -0.481  151.391 1.00 156.11 ? 381 ALA B O   1 
ATOM   7435  C CB  . ALA B 1 381 ? 91.587  -0.283  148.200 1.00 165.66 ? 381 ALA B CB  1 
ATOM   7436  N N   . LYS B 1 382 ? 92.844  -1.412  150.872 1.00 150.45 ? 382 LYS B N   1 
ATOM   7437  C CA  . LYS B 1 382 ? 92.814  -2.373  151.972 1.00 149.45 ? 382 LYS B CA  1 
ATOM   7438  C C   . LYS B 1 382 ? 92.766  -1.667  153.321 1.00 142.20 ? 382 LYS B C   1 
ATOM   7439  O O   . LYS B 1 382 ? 92.112  -2.129  154.255 1.00 140.48 ? 382 LYS B O   1 
ATOM   7440  C CB  . LYS B 1 382 ? 94.032  -3.292  151.913 1.00 155.81 ? 382 LYS B CB  1 
ATOM   7441  C CG  . LYS B 1 382 ? 94.031  -4.249  150.737 1.00 159.45 ? 382 LYS B CG  1 
ATOM   7442  C CD  . LYS B 1 382 ? 95.158  -5.256  150.871 1.00 167.32 ? 382 LYS B CD  1 
ATOM   7443  C CE  . LYS B 1 382 ? 95.251  -6.160  149.651 1.00 170.26 ? 382 LYS B CE  1 
ATOM   7444  N NZ  . LYS B 1 382 ? 95.876  -5.481  148.482 1.00 174.38 ? 382 LYS B NZ  1 
ATOM   7445  N N   . VAL B 1 383 ? 93.465  -0.542  153.411 1.00 141.91 ? 383 VAL B N   1 
ATOM   7446  C CA  . VAL B 1 383 ? 93.483  0.255   154.632 1.00 138.32 ? 383 VAL B CA  1 
ATOM   7447  C C   . VAL B 1 383 ? 92.092  0.787   154.957 1.00 139.06 ? 383 VAL B C   1 
ATOM   7448  O O   . VAL B 1 383 ? 91.638  0.715   156.099 1.00 137.43 ? 383 VAL B O   1 
ATOM   7449  C CB  . VAL B 1 383 ? 94.456  1.432   154.521 1.00 141.21 ? 383 VAL B CB  1 
ATOM   7450  C CG1 . VAL B 1 383 ? 94.406  2.275   155.783 1.00 140.12 ? 383 VAL B CG1 1 
ATOM   7451  C CG2 . VAL B 1 383 ? 95.860  0.924   154.272 1.00 145.87 ? 383 VAL B CG2 1 
ATOM   7452  N N   . ALA B 1 384 ? 91.430  1.335   153.945 1.00 146.53 ? 384 ALA B N   1 
ATOM   7453  C CA  . ALA B 1 384 ? 90.072  1.842   154.093 1.00 141.54 ? 384 ALA B CA  1 
ATOM   7454  C C   . ALA B 1 384 ? 89.102  0.713   154.431 1.00 137.63 ? 384 ALA B C   1 
ATOM   7455  O O   . ALA B 1 384 ? 88.187  0.891   155.235 1.00 135.97 ? 384 ALA B O   1 
ATOM   7456  C CB  . ALA B 1 384 ? 89.632  2.562   152.827 1.00 138.27 ? 384 ALA B CB  1 
ATOM   7457  N N   . ALA B 1 385 ? 89.307  -0.447  153.811 1.00 138.73 ? 385 ALA B N   1 
ATOM   7458  C CA  . ALA B 1 385 ? 88.454  -1.617  154.031 1.00 136.62 ? 385 ALA B CA  1 
ATOM   7459  C C   . ALA B 1 385 ? 88.533  -2.166  155.453 1.00 140.63 ? 385 ALA B C   1 
ATOM   7460  O O   . ALA B 1 385 ? 87.516  -2.551  156.027 1.00 136.32 ? 385 ALA B O   1 
ATOM   7461  C CB  . ALA B 1 385 ? 88.802  -2.713  153.034 1.00 138.42 ? 385 ALA B CB  1 
ATOM   7462  N N   . ASN B 1 386 ? 89.733  -2.194  156.022 1.00 152.79 ? 386 ASN B N   1 
ATOM   7463  C CA  . ASN B 1 386 ? 89.906  -2.726  157.366 1.00 147.00 ? 386 ASN B CA  1 
ATOM   7464  C C   . ASN B 1 386 ? 89.984  -1.643  158.429 1.00 136.99 ? 386 ASN B C   1 
ATOM   7465  O O   . ASN B 1 386 ? 90.820  -1.697  159.333 1.00 135.93 ? 386 ASN B O   1 
ATOM   7466  C CB  . ASN B 1 386 ? 91.152  -3.609  157.443 1.00 159.67 ? 386 ASN B CB  1 
ATOM   7467  C CG  . ASN B 1 386 ? 91.044  -4.838  156.576 1.00 173.48 ? 386 ASN B CG  1 
ATOM   7468  O OD1 . ASN B 1 386 ? 91.602  -4.893  155.483 1.00 180.05 ? 386 ASN B OD1 1 
ATOM   7469  N ND2 . ASN B 1 386 ? 90.313  -5.835  157.059 1.00 171.96 ? 386 ASN B ND2 1 
ATOM   7470  N N   . ALA B 1 387 ? 89.111  -0.653  158.305 1.00 146.44 ? 387 ALA B N   1 
ATOM   7471  C CA  . ALA B 1 387 ? 88.959  0.358   159.336 1.00 161.81 ? 387 ALA B CA  1 
ATOM   7472  C C   . ALA B 1 387 ? 88.192  -0.270  160.489 1.00 171.63 ? 387 ALA B C   1 
ATOM   7473  O O   . ALA B 1 387 ? 87.316  -1.106  160.258 1.00 183.98 ? 387 ALA B O   1 
ATOM   7474  C CB  . ALA B 1 387 ? 88.239  1.580   158.794 1.00 167.57 ? 387 ALA B CB  1 
ATOM   7475  N N   . PRO B 1 388 ? 88.527  0.114   161.731 1.00 156.24 ? 388 PRO B N   1 
ATOM   7476  C CA  . PRO B 1 388 ? 87.909  -0.519  162.902 1.00 154.27 ? 388 PRO B CA  1 
ATOM   7477  C C   . PRO B 1 388 ? 86.384  -0.412  162.909 1.00 157.00 ? 388 PRO B C   1 
ATOM   7478  O O   . PRO B 1 388 ? 85.710  -1.437  163.017 1.00 170.74 ? 388 PRO B O   1 
ATOM   7479  C CB  . PRO B 1 388 ? 88.514  0.256   164.085 1.00 140.89 ? 388 PRO B CB  1 
ATOM   7480  C CG  . PRO B 1 388 ? 89.033  1.529   163.501 1.00 138.23 ? 388 PRO B CG  1 
ATOM   7481  C CD  . PRO B 1 388 ? 89.453  1.196   162.106 1.00 136.36 ? 388 PRO B CD  1 
ATOM   7482  N N   . LYS B 1 389 ? 85.845  0.795   162.778 1.00 139.03 ? 389 LYS B N   1 
ATOM   7483  C CA  . LYS B 1 389 ? 84.396  0.969   162.774 1.00 143.03 ? 389 LYS B CA  1 
ATOM   7484  C C   . LYS B 1 389 ? 83.915  1.743   161.545 1.00 148.45 ? 389 LYS B C   1 
ATOM   7485  O O   . LYS B 1 389 ? 83.166  2.715   161.663 1.00 147.31 ? 389 LYS B O   1 
ATOM   7486  C CB  . LYS B 1 389 ? 83.936  1.650   164.066 1.00 137.40 ? 389 LYS B CB  1 
ATOM   7487  C CG  . LYS B 1 389 ? 84.102  0.767   165.301 1.00 136.35 ? 389 LYS B CG  1 
ATOM   7488  C CD  . LYS B 1 389 ? 84.520  1.557   166.532 1.00 143.63 ? 389 LYS B CD  1 
ATOM   7489  C CE  . LYS B 1 389 ? 84.709  0.620   167.715 1.00 146.80 ? 389 LYS B CE  1 
ATOM   7490  N NZ  . LYS B 1 389 ? 84.982  1.333   168.990 1.00 142.47 ? 389 LYS B NZ  1 
ATOM   7491  N N   . GLY B 1 390 ? 84.350  1.288   160.370 1.00 150.67 ? 390 GLY B N   1 
ATOM   7492  C CA  . GLY B 1 390 ? 84.018  1.910   159.097 1.00 137.87 ? 390 GLY B CA  1 
ATOM   7493  C C   . GLY B 1 390 ? 84.421  3.367   159.020 1.00 138.17 ? 390 GLY B C   1 
ATOM   7494  O O   . GLY B 1 390 ? 83.712  4.198   158.456 1.00 147.75 ? 390 GLY B O   1 
ATOM   7495  N N   . ILE B 1 391 ? 85.573  3.673   159.604 1.00 142.54 ? 391 ILE B N   1 
ATOM   7496  C CA  . ILE B 1 391 ? 86.065  5.045   159.668 1.00 139.03 ? 391 ILE B CA  1 
ATOM   7497  C C   . ILE B 1 391 ? 86.346  5.635   158.291 1.00 139.69 ? 391 ILE B C   1 
ATOM   7498  O O   . ILE B 1 391 ? 86.018  6.791   158.023 1.00 139.53 ? 391 ILE B O   1 
ATOM   7499  C CB  . ILE B 1 391 ? 87.337  5.139   160.514 1.00 143.97 ? 391 ILE B CB  1 
ATOM   7500  C CG1 . ILE B 1 391 ? 87.227  4.196   161.710 1.00 145.22 ? 391 ILE B CG1 1 
ATOM   7501  C CG2 . ILE B 1 391 ? 87.570  6.576   160.950 1.00 139.35 ? 391 ILE B CG2 1 
ATOM   7502  C CD1 . ILE B 1 391 ? 86.140  4.590   162.679 1.00 148.93 ? 391 ILE B CD1 1 
ATOM   7503  N N   . LEU B 1 392 ? 86.961  4.836   157.426 1.00 153.58 ? 392 LEU B N   1 
ATOM   7504  C CA  . LEU B 1 392 ? 87.299  5.279   156.078 1.00 152.73 ? 392 LEU B CA  1 
ATOM   7505  C C   . LEU B 1 392 ? 86.333  4.757   155.019 1.00 148.89 ? 392 LEU B C   1 
ATOM   7506  O O   . LEU B 1 392 ? 86.595  4.880   153.825 1.00 146.70 ? 392 LEU B O   1 
ATOM   7507  C CB  . LEU B 1 392 ? 88.724  4.864   155.714 1.00 145.13 ? 392 LEU B CB  1 
ATOM   7508  C CG  . LEU B 1 392 ? 89.856  5.645   156.380 1.00 143.47 ? 392 LEU B CG  1 
ATOM   7509  C CD1 . LEU B 1 392 ? 91.173  4.910   156.205 1.00 151.14 ? 392 LEU B CD1 1 
ATOM   7510  C CD2 . LEU B 1 392 ? 89.940  7.045   155.798 1.00 145.36 ? 392 LEU B CD2 1 
ATOM   7511  N N   . ARG B 1 393 ? 85.221  4.177   155.457 1.00 143.73 ? 393 ARG B N   1 
ATOM   7512  C CA  . ARG B 1 393 ? 84.197  3.687   154.537 1.00 145.44 ? 393 ARG B CA  1 
ATOM   7513  C C   . ARG B 1 393 ? 83.127  4.766   154.370 1.00 151.07 ? 393 ARG B C   1 
ATOM   7514  O O   . ARG B 1 393 ? 81.989  4.615   154.803 1.00 149.05 ? 393 ARG B O   1 
ATOM   7515  C CB  . ARG B 1 393 ? 83.590  2.379   155.058 1.00 150.23 ? 393 ARG B CB  1 
ATOM   7516  C CG  . ARG B 1 393 ? 83.414  1.272   154.011 1.00 160.58 ? 393 ARG B CG  1 
ATOM   7517  C CD  . ARG B 1 393 ? 82.821  0.009   154.643 1.00 169.34 ? 393 ARG B CD  1 
ATOM   7518  N NE  . ARG B 1 393 ? 82.520  -1.037  153.666 1.00 175.13 ? 393 ARG B NE  1 
ATOM   7519  C CZ  . ARG B 1 393 ? 82.350  -2.321  153.972 1.00 175.21 ? 393 ARG B CZ  1 
ATOM   7520  N NH1 . ARG B 1 393 ? 82.073  -3.201  153.019 1.00 178.77 ? 393 ARG B NH1 1 
ATOM   7521  N NH2 . ARG B 1 393 ? 82.467  -2.728  155.229 1.00 170.30 ? 393 ARG B NH2 1 
ATOM   7522  N N   . THR B 1 394 ? 83.517  5.859   153.723 1.00 153.70 ? 394 THR B N   1 
ATOM   7523  C CA  . THR B 1 394 ? 82.666  7.034   153.566 1.00 152.55 ? 394 THR B CA  1 
ATOM   7524  C C   . THR B 1 394 ? 82.643  7.490   152.103 1.00 150.70 ? 394 THR B C   1 
ATOM   7525  O O   . THR B 1 394 ? 83.474  7.047   151.310 1.00 148.65 ? 394 THR B O   1 
ATOM   7526  C CB  . THR B 1 394 ? 83.160  8.187   154.476 1.00 158.79 ? 394 THR B CB  1 
ATOM   7527  O OG1 . THR B 1 394 ? 84.548  8.432   154.224 1.00 172.50 ? 394 THR B OG1 1 
ATOM   7528  C CG2 . THR B 1 394 ? 82.971  7.827   155.949 1.00 154.32 ? 394 THR B CG2 1 
ATOM   7529  N N   . PRO B 1 395 ? 81.673  8.349   151.728 1.00 153.73 ? 395 PRO B N   1 
ATOM   7530  C CA  . PRO B 1 395 ? 81.636  8.850   150.347 1.00 159.15 ? 395 PRO B CA  1 
ATOM   7531  C C   . PRO B 1 395 ? 82.878  9.653   149.967 1.00 159.99 ? 395 PRO B C   1 
ATOM   7532  O O   . PRO B 1 395 ? 83.283  9.672   148.803 1.00 164.74 ? 395 PRO B O   1 
ATOM   7533  C CB  . PRO B 1 395 ? 80.389  9.743   150.330 1.00 163.48 ? 395 PRO B CB  1 
ATOM   7534  C CG  . PRO B 1 395 ? 80.156  10.105  151.761 1.00 161.27 ? 395 PRO B CG  1 
ATOM   7535  C CD  . PRO B 1 395 ? 80.541  8.871   152.516 1.00 154.40 ? 395 PRO B CD  1 
ATOM   7536  N N   . ASP B 1 396 ? 83.461  10.314  150.958 1.00 156.40 ? 396 ASP B N   1 
ATOM   7537  C CA  . ASP B 1 396 ? 84.650  11.138  150.791 1.00 157.20 ? 396 ASP B CA  1 
ATOM   7538  C C   . ASP B 1 396 ? 85.795  10.341  150.206 1.00 155.64 ? 396 ASP B C   1 
ATOM   7539  O O   . ASP B 1 396 ? 86.573  10.828  149.388 1.00 157.45 ? 396 ASP B O   1 
ATOM   7540  C CB  . ASP B 1 396 ? 85.029  11.682  152.155 1.00 165.32 ? 396 ASP B CB  1 
ATOM   7541  C CG  . ASP B 1 396 ? 83.983  12.614  152.695 1.00 175.41 ? 396 ASP B CG  1 
ATOM   7542  O OD1 . ASP B 1 396 ? 82.973  12.099  153.218 1.00 176.52 ? 396 ASP B OD1 1 
ATOM   7543  O OD2 . ASP B 1 396 ? 84.204  13.843  152.688 1.00 180.15 ? 396 ASP B OD2 1 
ATOM   7544  N N   . THR B 1 397 ? 85.853  9.085   150.621 1.00 153.65 ? 397 THR B N   1 
ATOM   7545  C CA  . THR B 1 397 ? 86.845  8.137   150.152 1.00 155.37 ? 397 THR B CA  1 
ATOM   7546  C C   . THR B 1 397 ? 86.636  7.805   148.685 1.00 159.06 ? 397 THR B C   1 
ATOM   7547  O O   . THR B 1 397 ? 87.578  7.782   147.897 1.00 162.13 ? 397 THR B O   1 
ATOM   7548  C CB  . THR B 1 397 ? 86.785  6.847   150.970 1.00 154.52 ? 397 THR B CB  1 
ATOM   7549  O OG1 . THR B 1 397 ? 86.822  7.169   152.366 1.00 153.61 ? 397 THR B OG1 1 
ATOM   7550  C CG2 . THR B 1 397 ? 87.944  5.942   150.612 1.00 154.44 ? 397 THR B CG2 1 
ATOM   7551  N N   . ILE B 1 398 ? 85.389  7.512   148.339 1.00 160.31 ? 398 ILE B N   1 
ATOM   7552  C CA  . ILE B 1 398 ? 85.013  7.197   146.966 1.00 161.92 ? 398 ILE B CA  1 
ATOM   7553  C C   . ILE B 1 398 ? 85.269  8.384   146.049 1.00 163.33 ? 398 ILE B C   1 
ATOM   7554  O O   . ILE B 1 398 ? 85.693  8.224   144.905 1.00 158.54 ? 398 ILE B O   1 
ATOM   7555  C CB  . ILE B 1 398 ? 83.541  6.788   146.877 1.00 159.73 ? 398 ILE B CB  1 
ATOM   7556  C CG1 . ILE B 1 398 ? 83.265  5.682   147.893 1.00 156.82 ? 398 ILE B CG1 1 
ATOM   7557  C CG2 . ILE B 1 398 ? 83.207  6.314   145.473 1.00 160.75 ? 398 ILE B CG2 1 
ATOM   7558  C CD1 . ILE B 1 398 ? 81.850  5.656   148.391 1.00 155.79 ? 398 ILE B CD1 1 
ATOM   7559  N N   . ARG B 1 399 ? 84.984  9.574   146.564 1.00 170.13 ? 399 ARG B N   1 
ATOM   7560  C CA  . ARG B 1 399 ? 85.231  10.821  145.853 1.00 173.05 ? 399 ARG B CA  1 
ATOM   7561  C C   . ARG B 1 399 ? 86.708  10.996  145.517 1.00 175.57 ? 399 ARG B C   1 
ATOM   7562  O O   . ARG B 1 399 ? 87.056  11.558  144.479 1.00 173.82 ? 399 ARG B O   1 
ATOM   7563  C CB  . ARG B 1 399 ? 84.746  12.007  146.687 1.00 172.98 ? 399 ARG B CB  1 
ATOM   7564  C CG  . ARG B 1 399 ? 83.247  12.224  146.623 1.00 173.04 ? 399 ARG B CG  1 
ATOM   7565  C CD  . ARG B 1 399 ? 82.728  12.952  147.850 1.00 176.62 ? 399 ARG B CD  1 
ATOM   7566  N NE  . ARG B 1 399 ? 81.269  12.917  147.908 1.00 184.07 ? 399 ARG B NE  1 
ATOM   7567  C CZ  . ARG B 1 399 ? 80.553  13.217  148.987 1.00 187.76 ? 399 ARG B CZ  1 
ATOM   7568  N NH1 . ARG B 1 399 ? 79.229  13.158  148.941 1.00 180.91 ? 399 ARG B NH1 1 
ATOM   7569  N NH2 . ARG B 1 399 ? 81.159  13.577  150.110 1.00 191.70 ? 399 ARG B NH2 1 
ATOM   7570  N N   . ARG B 1 400 ? 87.574  10.510  146.402 1.00 177.47 ? 400 ARG B N   1 
ATOM   7571  C CA  . ARG B 1 400 ? 89.014  10.624  146.202 1.00 173.39 ? 400 ARG B CA  1 
ATOM   7572  C C   . ARG B 1 400 ? 89.482  9.692   145.085 1.00 165.58 ? 400 ARG B C   1 
ATOM   7573  O O   . ARG B 1 400 ? 90.285  10.079  144.235 1.00 166.35 ? 400 ARG B O   1 
ATOM   7574  C CB  . ARG B 1 400 ? 89.759  10.310  147.502 1.00 172.48 ? 400 ARG B CB  1 
ATOM   7575  C CG  . ARG B 1 400 ? 90.042  11.557  148.323 1.00 170.43 ? 400 ARG B CG  1 
ATOM   7576  C CD  . ARG B 1 400 ? 91.500  11.979  148.400 1.00 165.74 ? 400 ARG B CD  1 
ATOM   7577  N NE  . ARG B 1 400 ? 92.300  11.131  149.275 1.00 167.81 ? 400 ARG B NE  1 
ATOM   7578  C CZ  . ARG B 1 400 ? 93.623  11.205  149.362 1.00 177.06 ? 400 ARG B CZ  1 
ATOM   7579  N NH1 . ARG B 1 400 ? 94.283  10.397  150.180 1.00 188.07 ? 400 ARG B NH1 1 
ATOM   7580  N NH2 . ARG B 1 400 ? 94.282  12.114  148.656 1.00 177.16 ? 400 ARG B NH2 1 
ATOM   7581  N N   . PHE B 1 401 ? 88.973  8.462   145.093 1.00 163.12 ? 401 PHE B N   1 
ATOM   7582  C CA  . PHE B 1 401 ? 89.312  7.473   144.068 1.00 166.17 ? 401 PHE B CA  1 
ATOM   7583  C C   . PHE B 1 401 ? 88.737  7.846   142.700 1.00 173.95 ? 401 PHE B C   1 
ATOM   7584  O O   . PHE B 1 401 ? 89.334  7.557   141.662 1.00 169.96 ? 401 PHE B O   1 
ATOM   7585  C CB  . PHE B 1 401 ? 88.806  6.084   144.460 1.00 167.85 ? 401 PHE B CB  1 
ATOM   7586  C CG  . PHE B 1 401 ? 89.689  5.366   145.441 1.00 168.74 ? 401 PHE B CG  1 
ATOM   7587  C CD1 . PHE B 1 401 ? 90.946  4.914   145.076 1.00 167.35 ? 401 PHE B CD1 1 
ATOM   7588  C CD2 . PHE B 1 401 ? 89.231  5.097   146.721 1.00 167.09 ? 401 PHE B CD2 1 
ATOM   7589  C CE1 . PHE B 1 401 ? 91.746  4.246   145.985 1.00 166.15 ? 401 PHE B CE1 1 
ATOM   7590  C CE2 . PHE B 1 401 ? 90.019  4.426   147.629 1.00 164.48 ? 401 PHE B CE2 1 
ATOM   7591  C CZ  . PHE B 1 401 ? 91.279  3.999   147.262 1.00 164.13 ? 401 PHE B CZ  1 
ATOM   7592  N N   . GLN B 1 402 ? 87.571  8.487   142.713 1.00 183.62 ? 402 GLN B N   1 
ATOM   7593  C CA  . GLN B 1 402 ? 86.896  8.914   141.489 1.00 186.86 ? 402 GLN B CA  1 
ATOM   7594  C C   . GLN B 1 402 ? 87.681  10.025  140.800 1.00 192.24 ? 402 GLN B C   1 
ATOM   7595  O O   . GLN B 1 402 ? 87.594  10.211  139.585 1.00 194.01 ? 402 GLN B O   1 
ATOM   7596  C CB  . GLN B 1 402 ? 85.473  9.385   141.807 1.00 181.07 ? 402 GLN B CB  1 
ATOM   7597  C CG  . GLN B 1 402 ? 84.402  8.813   140.896 1.00 183.79 ? 402 GLN B CG  1 
ATOM   7598  C CD  . GLN B 1 402 ? 83.002  9.020   141.444 1.00 188.44 ? 402 GLN B CD  1 
ATOM   7599  O OE1 . GLN B 1 402 ? 82.470  10.130  141.421 1.00 192.39 ? 402 GLN B OE1 1 
ATOM   7600  N NE2 . GLN B 1 402 ? 82.395  7.946   141.935 1.00 189.95 ? 402 GLN B NE2 1 
ATOM   7601  N N   . SER B 1 403 ? 88.446  10.755  141.604 1.00 193.12 ? 403 SER B N   1 
ATOM   7602  C CA  . SER B 1 403 ? 89.295  11.859  141.149 1.00 191.29 ? 403 SER B CA  1 
ATOM   7603  C C   . SER B 1 403 ? 90.476  11.427  140.282 1.00 188.68 ? 403 SER B C   1 
ATOM   7604  O O   . SER B 1 403 ? 91.142  12.260  139.672 1.00 187.13 ? 403 SER B O   1 
ATOM   7605  C CB  . SER B 1 403 ? 89.834  12.638  142.344 1.00 187.36 ? 403 SER B CB  1 
ATOM   7606  O OG  . SER B 1 403 ? 91.038  13.301  141.997 1.00 187.46 ? 403 SER B OG  1 
ATOM   7607  N N   . VAL B 1 404 ? 90.740  10.127  140.234 1.00 187.62 ? 404 VAL B N   1 
ATOM   7608  C CA  . VAL B 1 404 ? 91.851  9.609   139.442 1.00 191.53 ? 404 VAL B CA  1 
ATOM   7609  C C   . VAL B 1 404 ? 91.356  8.976   138.143 1.00 199.37 ? 404 VAL B C   1 
ATOM   7610  O O   . VAL B 1 404 ? 90.545  8.051   138.165 1.00 199.72 ? 404 VAL B O   1 
ATOM   7611  C CB  . VAL B 1 404 ? 92.653  8.577   140.239 1.00 184.83 ? 404 VAL B CB  1 
ATOM   7612  C CG1 . VAL B 1 404 ? 93.952  8.250   139.526 1.00 183.19 ? 404 VAL B CG1 1 
ATOM   7613  C CG2 . VAL B 1 404 ? 92.930  9.101   141.643 1.00 183.04 ? 404 VAL B CG2 1 
ATOM   7614  N N   . PRO B 1 405 ? 91.858  9.474   136.999 1.00 200.90 ? 405 PRO B N   1 
ATOM   7615  C CA  . PRO B 1 405 ? 91.450  8.969   135.685 1.00 201.02 ? 405 PRO B CA  1 
ATOM   7616  C C   . PRO B 1 405 ? 92.154  7.675   135.285 1.00 204.13 ? 405 PRO B C   1 
ATOM   7617  O O   . PRO B 1 405 ? 93.268  7.398   135.736 1.00 205.16 ? 405 PRO B O   1 
ATOM   7618  C CB  . PRO B 1 405 ? 91.823  10.116  134.748 1.00 198.33 ? 405 PRO B CB  1 
ATOM   7619  C CG  . PRO B 1 405 ? 92.991  10.779  135.407 1.00 197.86 ? 405 PRO B CG  1 
ATOM   7620  C CD  . PRO B 1 405 ? 92.957  10.451  136.885 1.00 198.00 ? 405 PRO B CD  1 
ATOM   7621  N N   . ALA B 1 406 ? 91.493  6.906   134.423 1.00 202.28 ? 406 ALA B N   1 
ATOM   7622  C CA  . ALA B 1 406 ? 91.974  5.595   133.996 1.00 198.37 ? 406 ALA B CA  1 
ATOM   7623  C C   . ALA B 1 406 ? 93.130  5.628   133.002 1.00 199.69 ? 406 ALA B C   1 
ATOM   7624  O O   . ALA B 1 406 ? 92.991  6.092   131.869 1.00 195.76 ? 406 ALA B O   1 
ATOM   7625  C CB  . ALA B 1 406 ? 90.818  4.800   133.408 1.00 197.63 ? 406 ALA B CB  1 
ATOM   7626  N N   . GLN B 1 407 ? 94.278  5.141   133.460 1.00 205.39 ? 407 GLN B N   1 
ATOM   7627  C CA  . GLN B 1 407 ? 95.494  5.104   132.661 1.00 207.47 ? 407 GLN B CA  1 
ATOM   7628  C C   . GLN B 1 407 ? 95.356  4.099   131.518 1.00 211.29 ? 407 GLN B C   1 
ATOM   7629  O O   . GLN B 1 407 ? 94.797  3.021   131.714 1.00 213.16 ? 407 GLN B O   1 
ATOM   7630  C CB  . GLN B 1 407 ? 96.683  4.744   133.550 1.00 206.57 ? 407 GLN B CB  1 
ATOM   7631  C CG  . GLN B 1 407 ? 98.032  4.909   132.892 1.00 211.36 ? 407 GLN B CG  1 
ATOM   7632  C CD  . GLN B 1 407 ? 98.956  3.748   133.168 1.00 213.48 ? 407 GLN B CD  1 
ATOM   7633  O OE1 . GLN B 1 407 ? 99.241  3.430   134.320 1.00 213.77 ? 407 GLN B OE1 1 
ATOM   7634  N NE2 . GLN B 1 407 ? 99.416  3.091   132.108 1.00 214.60 ? 407 GLN B NE2 1 
ATOM   7635  N N   . PRO B 1 408 ? 95.856  4.447   130.320 1.00 211.77 ? 408 PRO B N   1 
ATOM   7636  C CA  . PRO B 1 408 ? 95.749  3.496   129.204 1.00 211.26 ? 408 PRO B CA  1 
ATOM   7637  C C   . PRO B 1 408 ? 96.664  2.277   129.357 1.00 213.59 ? 408 PRO B C   1 
ATOM   7638  O O   . PRO B 1 408 ? 97.680  2.157   128.668 1.00 215.16 ? 408 PRO B O   1 
ATOM   7639  C CB  . PRO B 1 408 ? 96.143  4.340   127.977 1.00 211.60 ? 408 PRO B CB  1 
ATOM   7640  C CG  . PRO B 1 408 ? 96.174  5.769   128.470 1.00 213.04 ? 408 PRO B CG  1 
ATOM   7641  C CD  . PRO B 1 408 ? 96.527  5.689   129.911 1.00 212.86 ? 408 PRO B CD  1 
ATOM   7642  N N   . GLY B 1 409 ? 96.282  1.380   130.263 1.00 213.63 ? 409 GLY B N   1 
ATOM   7643  C CA  . GLY B 1 409 ? 96.978  0.123   130.465 1.00 212.93 ? 409 GLY B CA  1 
ATOM   7644  C C   . GLY B 1 409 ? 96.720  -0.404  131.862 1.00 209.82 ? 409 GLY B C   1 
ATOM   7645  O O   . GLY B 1 409 ? 96.787  -1.611  132.104 1.00 211.07 ? 409 GLY B O   1 
ATOM   7646  N N   . GLN B 1 410 ? 96.466  0.515   132.789 1.00 206.75 ? 410 GLN B N   1 
ATOM   7647  C CA  . GLN B 1 410 ? 96.119  0.169   134.161 1.00 209.21 ? 410 GLN B CA  1 
ATOM   7648  C C   . GLN B 1 410 ? 94.632  0.360   134.433 1.00 212.21 ? 410 GLN B C   1 
ATOM   7649  O O   . GLN B 1 410 ? 93.945  1.086   133.712 1.00 213.27 ? 410 GLN B O   1 
ATOM   7650  C CB  . GLN B 1 410 ? 96.950  0.994   135.142 1.00 210.51 ? 410 GLN B CB  1 
ATOM   7651  N N   . THR B 1 411 ? 94.153  -0.222  135.525 1.00 212.08 ? 411 THR B N   1 
ATOM   7652  C CA  . THR B 1 411 ? 92.744  -0.103  135.850 1.00 207.64 ? 411 THR B CA  1 
ATOM   7653  C C   . THR B 1 411 ? 92.573  1.189   136.626 1.00 206.80 ? 411 THR B C   1 
ATOM   7654  O O   . THR B 1 411 ? 93.530  1.698   137.214 1.00 198.62 ? 411 THR B O   1 
ATOM   7655  C CB  . THR B 1 411 ? 92.234  -1.286  136.697 1.00 203.37 ? 411 THR B CB  1 
ATOM   7656  O OG1 . THR B 1 411 ? 93.264  -2.272  136.817 1.00 204.97 ? 411 THR B OG1 1 
ATOM   7657  C CG2 . THR B 1 411 ? 91.006  -1.910  136.067 1.00 198.84 ? 411 THR B CG2 1 
ATOM   7658  N N   . SER B 1 412 ? 91.359  1.723   136.625 1.00 212.43 ? 412 SER B N   1 
ATOM   7659  C CA  . SER B 1 412 ? 91.085  2.914   137.404 1.00 211.67 ? 412 SER B CA  1 
ATOM   7660  C C   . SER B 1 412 ? 91.021  2.485   138.866 1.00 213.81 ? 412 SER B C   1 
ATOM   7661  O O   . SER B 1 412 ? 90.415  1.462   139.185 1.00 217.38 ? 412 SER B O   1 
ATOM   7662  C CB  . SER B 1 412 ? 89.780  3.582   136.964 1.00 203.52 ? 412 SER B CB  1 
ATOM   7663  O OG  . SER B 1 412 ? 89.469  4.672   137.813 1.00 198.70 ? 412 SER B OG  1 
ATOM   7664  N N   . PRO B 1 413 ? 91.603  3.292   139.765 1.00 205.92 ? 413 PRO B N   1 
ATOM   7665  C CA  . PRO B 1 413 ? 91.720  2.970   141.193 1.00 202.96 ? 413 PRO B CA  1 
ATOM   7666  C C   . PRO B 1 413 ? 90.362  2.732   141.853 1.00 199.47 ? 413 PRO B C   1 
ATOM   7667  O O   . PRO B 1 413 ? 90.291  2.083   142.897 1.00 201.88 ? 413 PRO B O   1 
ATOM   7668  C CB  . PRO B 1 413 ? 92.432  4.198   141.771 1.00 202.24 ? 413 PRO B CB  1 
ATOM   7669  C CG  . PRO B 1 413 ? 93.157  4.793   140.599 1.00 201.25 ? 413 PRO B CG  1 
ATOM   7670  C CD  . PRO B 1 413 ? 92.228  4.588   139.448 1.00 201.06 ? 413 PRO B CD  1 
ATOM   7671  N N   . LEU B 1 414 ? 89.308  3.281   141.258 1.00 191.18 ? 414 LEU B N   1 
ATOM   7672  C CA  . LEU B 1 414 ? 87.955  3.147   141.786 1.00 187.19 ? 414 LEU B CA  1 
ATOM   7673  C C   . LEU B 1 414 ? 87.420  1.704   141.791 1.00 186.92 ? 414 LEU B C   1 
ATOM   7674  O O   . LEU B 1 414 ? 86.763  1.294   142.746 1.00 183.59 ? 414 LEU B O   1 
ATOM   7675  C CB  . LEU B 1 414 ? 87.013  4.042   140.977 1.00 182.52 ? 414 LEU B CB  1 
ATOM   7676  C CG  . LEU B 1 414 ? 85.574  4.245   141.441 1.00 180.08 ? 414 LEU B CG  1 
ATOM   7677  C CD1 . LEU B 1 414 ? 85.522  5.269   142.562 1.00 179.42 ? 414 LEU B CD1 1 
ATOM   7678  C CD2 . LEU B 1 414 ? 84.727  4.698   140.274 1.00 182.22 ? 414 LEU B CD2 1 
ATOM   7679  N N   . LEU B 1 415 ? 87.714  0.934   140.743 1.00 187.61 ? 415 LEU B N   1 
ATOM   7680  C CA  . LEU B 1 415 ? 87.278  -0.469  140.653 1.00 187.03 ? 415 LEU B CA  1 
ATOM   7681  C C   . LEU B 1 415 ? 87.917  -1.392  141.691 1.00 178.28 ? 415 LEU B C   1 
ATOM   7682  O O   . LEU B 1 415 ? 87.251  -2.252  142.268 1.00 177.57 ? 415 LEU B O   1 
ATOM   7683  C CB  . LEU B 1 415 ? 87.562  -1.020  139.252 1.00 189.10 ? 415 LEU B CB  1 
ATOM   7684  C CG  . LEU B 1 415 ? 86.834  -2.293  138.803 1.00 186.55 ? 415 LEU B CG  1 
ATOM   7685  C CD1 . LEU B 1 415 ? 85.642  -1.961  137.919 1.00 185.78 ? 415 LEU B CD1 1 
ATOM   7686  C CD2 . LEU B 1 415 ? 87.787  -3.226  138.076 1.00 181.53 ? 415 LEU B CD2 1 
ATOM   7687  N N   . GLN B 1 416 ? 89.212  -1.206  141.922 1.00 172.97 ? 416 GLN B N   1 
ATOM   7688  C CA  . GLN B 1 416 ? 89.958  -2.012  142.889 1.00 178.29 ? 416 GLN B CA  1 
ATOM   7689  C C   . GLN B 1 416 ? 89.406  -1.882  144.308 1.00 175.04 ? 416 GLN B C   1 
ATOM   7690  O O   . GLN B 1 416 ? 89.326  -2.861  145.047 1.00 172.04 ? 416 GLN B O   1 
ATOM   7691  C CB  . GLN B 1 416 ? 91.440  -1.631  142.868 1.00 191.41 ? 416 GLN B CB  1 
ATOM   7692  C CG  . GLN B 1 416 ? 92.312  -2.539  143.715 1.00 196.33 ? 416 GLN B CG  1 
ATOM   7693  C CD  . GLN B 1 416 ? 93.488  -3.102  142.941 1.00 191.71 ? 416 GLN B CD  1 
ATOM   7694  O OE1 . GLN B 1 416 ? 93.695  -4.314  142.897 1.00 189.31 ? 416 GLN B OE1 1 
ATOM   7695  N NE2 . GLN B 1 416 ? 94.269  -2.220  142.330 1.00 191.75 ? 416 GLN B NE2 1 
ATOM   7696  N N   . TYR B 1 417 ? 89.050  -0.658  144.682 1.00 173.59 ? 417 TYR B N   1 
ATOM   7697  C CA  . TYR B 1 417 ? 88.507  -0.361  146.004 1.00 173.19 ? 417 TYR B CA  1 
ATOM   7698  C C   . TYR B 1 417 ? 87.229  -1.157  146.295 1.00 178.31 ? 417 TYR B C   1 
ATOM   7699  O O   . TYR B 1 417 ? 87.076  -1.720  147.380 1.00 177.84 ? 417 TYR B O   1 
ATOM   7700  C CB  . TYR B 1 417 ? 88.250  1.144   146.129 1.00 168.39 ? 417 TYR B CB  1 
ATOM   7701  C CG  . TYR B 1 417 ? 87.582  1.588   147.412 1.00 167.66 ? 417 TYR B CG  1 
ATOM   7702  C CD1 . TYR B 1 417 ? 88.155  1.316   148.647 1.00 170.18 ? 417 TYR B CD1 1 
ATOM   7703  C CD2 . TYR B 1 417 ? 86.404  2.322   147.384 1.00 167.49 ? 417 TYR B CD2 1 
ATOM   7704  C CE1 . TYR B 1 417 ? 87.555  1.735   149.819 1.00 169.19 ? 417 TYR B CE1 1 
ATOM   7705  C CE2 . TYR B 1 417 ? 85.800  2.747   148.548 1.00 166.53 ? 417 TYR B CE2 1 
ATOM   7706  C CZ  . TYR B 1 417 ? 86.378  2.453   149.762 1.00 168.65 ? 417 TYR B CZ  1 
ATOM   7707  O OH  . TYR B 1 417 ? 85.767  2.880   150.917 1.00 167.67 ? 417 TYR B OH  1 
ATOM   7708  N N   . PHE B 1 418 ? 86.311  -1.199  145.333 1.00 178.66 ? 418 PHE B N   1 
ATOM   7709  C CA  . PHE B 1 418 ? 85.076  -1.965  145.504 1.00 177.54 ? 418 PHE B CA  1 
ATOM   7710  C C   . PHE B 1 418 ? 85.319  -3.471  145.531 1.00 176.26 ? 418 PHE B C   1 
ATOM   7711  O O   . PHE B 1 418 ? 84.722  -4.187  146.334 1.00 167.66 ? 418 PHE B O   1 
ATOM   7712  C CB  . PHE B 1 418 ? 84.070  -1.642  144.395 1.00 177.61 ? 418 PHE B CB  1 
ATOM   7713  C CG  . PHE B 1 418 ? 83.470  -0.273  144.500 1.00 173.50 ? 418 PHE B CG  1 
ATOM   7714  C CD1 . PHE B 1 418 ? 82.605  0.036   145.535 1.00 173.48 ? 418 PHE B CD1 1 
ATOM   7715  C CD2 . PHE B 1 418 ? 83.763  0.700   143.563 1.00 172.34 ? 418 PHE B CD2 1 
ATOM   7716  C CE1 . PHE B 1 418 ? 82.050  1.293   145.640 1.00 176.36 ? 418 PHE B CE1 1 
ATOM   7717  C CE2 . PHE B 1 418 ? 83.212  1.959   143.660 1.00 174.50 ? 418 PHE B CE2 1 
ATOM   7718  C CZ  . PHE B 1 418 ? 82.354  2.258   144.699 1.00 177.28 ? 418 PHE B CZ  1 
ATOM   7719  N N   . GLY B 1 419 ? 86.190  -3.940  144.641 1.00 180.98 ? 419 GLY B N   1 
ATOM   7720  C CA  . GLY B 1 419 ? 86.523  -5.351  144.528 1.00 187.56 ? 419 GLY B CA  1 
ATOM   7721  C C   . GLY B 1 419 ? 86.977  -6.030  145.806 1.00 190.84 ? 419 GLY B C   1 
ATOM   7722  O O   . GLY B 1 419 ? 86.578  -7.156  146.101 1.00 194.08 ? 419 GLY B O   1 
ATOM   7723  N N   . ILE B 1 420 ? 87.812  -5.334  146.568 1.00 183.41 ? 420 ILE B N   1 
ATOM   7724  C CA  . ILE B 1 420 ? 88.338  -5.850  147.829 1.00 175.33 ? 420 ILE B CA  1 
ATOM   7725  C C   . ILE B 1 420 ? 87.276  -5.780  148.915 1.00 171.89 ? 420 ILE B C   1 
ATOM   7726  O O   . ILE B 1 420 ? 87.170  -6.669  149.761 1.00 174.89 ? 420 ILE B O   1 
ATOM   7727  C CB  . ILE B 1 420 ? 89.575  -5.064  148.272 1.00 169.26 ? 420 ILE B CB  1 
ATOM   7728  C CG1 . ILE B 1 420 ? 90.637  -5.124  147.178 1.00 168.33 ? 420 ILE B CG1 1 
ATOM   7729  C CG2 . ILE B 1 420 ? 90.119  -5.603  149.585 1.00 167.17 ? 420 ILE B CG2 1 
ATOM   7730  C CD1 . ILE B 1 420 ? 91.621  -3.991  147.233 1.00 170.49 ? 420 ILE B CD1 1 
ATOM   7731  N N   . LEU B 1 421 ? 86.497  -4.705  148.877 1.00 164.10 ? 421 LEU B N   1 
ATOM   7732  C CA  . LEU B 1 421 ? 85.418  -4.470  149.829 1.00 166.36 ? 421 LEU B CA  1 
ATOM   7733  C C   . LEU B 1 421 ? 84.397  -5.605  149.832 1.00 169.45 ? 421 LEU B C   1 
ATOM   7734  O O   . LEU B 1 421 ? 83.886  -5.988  150.885 1.00 163.97 ? 421 LEU B O   1 
ATOM   7735  C CB  . LEU B 1 421 ? 84.709  -3.150  149.511 1.00 171.06 ? 421 LEU B CB  1 
ATOM   7736  C CG  . LEU B 1 421 ? 85.284  -1.885  150.145 1.00 171.62 ? 421 LEU B CG  1 
ATOM   7737  C CD1 . LEU B 1 421 ? 84.665  -0.649  149.519 1.00 173.51 ? 421 LEU B CD1 1 
ATOM   7738  C CD2 . LEU B 1 421 ? 85.064  -1.900  151.646 1.00 170.92 ? 421 LEU B CD2 1 
ATOM   7739  N N   . LEU B 1 422 ? 84.101  -6.126  148.645 1.00 175.57 ? 422 LEU B N   1 
ATOM   7740  C CA  . LEU B 1 422 ? 83.112  -7.188  148.483 1.00 178.32 ? 422 LEU B CA  1 
ATOM   7741  C C   . LEU B 1 422 ? 83.442  -8.452  149.262 1.00 180.15 ? 422 LEU B C   1 
ATOM   7742  O O   . LEU B 1 422 ? 82.591  -8.984  149.972 1.00 181.02 ? 422 LEU B O   1 
ATOM   7743  C CB  . LEU B 1 422 ? 82.975  -7.555  147.006 1.00 176.16 ? 422 LEU B CB  1 
ATOM   7744  C CG  . LEU B 1 422 ? 82.287  -6.559  146.078 1.00 173.58 ? 422 LEU B CG  1 
ATOM   7745  C CD1 . LEU B 1 422 ? 82.911  -6.664  144.703 1.00 167.18 ? 422 LEU B CD1 1 
ATOM   7746  C CD2 . LEU B 1 422 ? 80.791  -6.819  146.004 1.00 174.79 ? 422 LEU B CD2 1 
ATOM   7747  N N   . ASP B 1 423 ? 84.670  -8.942  149.133 1.00 178.58 ? 423 ASP B N   1 
ATOM   7748  C CA  . ASP B 1 423 ? 85.049  -10.151 149.857 1.00 181.23 ? 423 ASP B CA  1 
ATOM   7749  C C   . ASP B 1 423 ? 85.213  -9.871  151.345 1.00 179.70 ? 423 ASP B C   1 
ATOM   7750  O O   . ASP B 1 423 ? 85.477  -10.779 152.131 1.00 174.45 ? 423 ASP B O   1 
ATOM   7751  C CB  . ASP B 1 423 ? 86.321  -10.766 149.279 1.00 185.44 ? 423 ASP B CB  1 
ATOM   7752  C CG  . ASP B 1 423 ? 86.176  -11.104 147.813 1.00 190.00 ? 423 ASP B CG  1 
ATOM   7753  O OD1 . ASP B 1 423 ? 86.126  -10.164 146.995 1.00 188.51 ? 423 ASP B OD1 1 
ATOM   7754  O OD2 . ASP B 1 423 ? 86.034  -12.301 147.482 1.00 193.09 ? 423 ASP B OD2 1 
ATOM   7755  N N   . LEU B 1 427 ? 78.182  -4.882  151.861 1.00 146.81 ? 427 LEU B N   1 
ATOM   7756  C CA  . LEU B 1 427 ? 78.433  -3.447  151.924 1.00 154.37 ? 427 LEU B CA  1 
ATOM   7757  C C   . LEU B 1 427 ? 77.142  -2.646  152.072 1.00 166.20 ? 427 LEU B C   1 
ATOM   7758  O O   . LEU B 1 427 ? 76.040  -3.186  151.971 1.00 164.37 ? 427 LEU B O   1 
ATOM   7759  C CB  . LEU B 1 427 ? 79.205  -2.970  150.692 1.00 147.05 ? 427 LEU B CB  1 
ATOM   7760  C CG  . LEU B 1 427 ? 78.875  -3.604  149.345 1.00 143.49 ? 427 LEU B CG  1 
ATOM   7761  C CD1 . LEU B 1 427 ? 78.970  -2.568  148.241 1.00 144.27 ? 427 LEU B CD1 1 
ATOM   7762  C CD2 . LEU B 1 427 ? 79.832  -4.748  149.075 1.00 144.73 ? 427 LEU B CD2 1 
ATOM   7763  N N   . ASN B 1 428 ? 77.297  -1.378  152.433 1.00 169.54 ? 428 ASN B N   1 
ATOM   7764  C CA  . ASN B 1 428 ? 76.172  -0.464  152.603 1.00 165.70 ? 428 ASN B CA  1 
ATOM   7765  C C   . ASN B 1 428 ? 75.556  0.096   151.303 1.00 163.26 ? 428 ASN B C   1 
ATOM   7766  O O   . ASN B 1 428 ? 76.226  0.186   150.271 1.00 156.71 ? 428 ASN B O   1 
ATOM   7767  C CB  . ASN B 1 428 ? 76.594  0.681   153.512 1.00 164.30 ? 428 ASN B CB  1 
ATOM   7768  C CG  . ASN B 1 428 ? 75.419  1.471   154.016 1.00 170.17 ? 428 ASN B CG  1 
ATOM   7769  O OD1 . ASN B 1 428 ? 74.670  1.001   154.872 1.00 174.54 ? 428 ASN B OD1 1 
ATOM   7770  N ND2 . ASN B 1 428 ? 75.247  2.678   153.497 1.00 168.93 ? 428 ASN B ND2 1 
ATOM   7771  N N   . LYS B 1 429 ? 74.274  0.457   151.388 1.00 157.49 ? 429 LYS B N   1 
ATOM   7772  C CA  . LYS B 1 429 ? 73.471  1.019   150.289 1.00 146.60 ? 429 LYS B CA  1 
ATOM   7773  C C   . LYS B 1 429 ? 74.170  1.987   149.325 1.00 147.34 ? 429 LYS B C   1 
ATOM   7774  O O   . LYS B 1 429 ? 74.085  1.825   148.108 1.00 147.51 ? 429 LYS B O   1 
ATOM   7775  C CB  . LYS B 1 429 ? 72.246  1.731   150.871 1.00 145.11 ? 429 LYS B CB  1 
ATOM   7776  N N   . TYR B 1 430 ? 74.846  2.997   149.866 1.00 149.50 ? 430 TYR B N   1 
ATOM   7777  C CA  . TYR B 1 430 ? 75.494  4.011   149.033 1.00 153.99 ? 430 TYR B CA  1 
ATOM   7778  C C   . TYR B 1 430 ? 76.700  3.474   148.259 1.00 150.18 ? 430 TYR B C   1 
ATOM   7779  O O   . TYR B 1 430 ? 76.915  3.835   147.104 1.00 150.39 ? 430 TYR B O   1 
ATOM   7780  C CB  . TYR B 1 430 ? 75.920  5.206   149.891 1.00 154.54 ? 430 TYR B CB  1 
ATOM   7781  C CG  . TYR B 1 430 ? 76.373  6.410   149.090 1.00 161.53 ? 430 TYR B CG  1 
ATOM   7782  C CD1 . TYR B 1 430 ? 75.488  7.438   148.799 1.00 171.30 ? 430 TYR B CD1 1 
ATOM   7783  C CD2 . TYR B 1 430 ? 77.682  6.523   148.632 1.00 161.08 ? 430 TYR B CD2 1 
ATOM   7784  C CE1 . TYR B 1 430 ? 75.889  8.542   148.074 1.00 175.00 ? 430 TYR B CE1 1 
ATOM   7785  C CE2 . TYR B 1 430 ? 78.090  7.622   147.902 1.00 163.24 ? 430 TYR B CE2 1 
ATOM   7786  C CZ  . TYR B 1 430 ? 77.190  8.629   147.627 1.00 173.02 ? 430 TYR B CZ  1 
ATOM   7787  O OH  . TYR B 1 430 ? 77.591  9.727   146.904 1.00 177.35 ? 430 TYR B OH  1 
ATOM   7788  N N   . GLU B 1 431 ? 77.472  2.603   148.900 1.00 150.16 ? 431 GLU B N   1 
ATOM   7789  C CA  . GLU B 1 431 ? 78.660  2.008   148.289 1.00 165.29 ? 431 GLU B CA  1 
ATOM   7790  C C   . GLU B 1 431 ? 78.263  1.169   147.095 1.00 169.71 ? 431 GLU B C   1 
ATOM   7791  O O   . GLU B 1 431 ? 78.946  1.128   146.064 1.00 170.73 ? 431 GLU B O   1 
ATOM   7792  C CB  . GLU B 1 431 ? 79.418  1.148   149.299 1.00 171.04 ? 431 GLU B CB  1 
ATOM   7793  C CG  . GLU B 1 431 ? 80.106  1.944   150.389 1.00 173.81 ? 431 GLU B CG  1 
ATOM   7794  C CD  . GLU B 1 431 ? 79.507  1.717   151.764 1.00 175.41 ? 431 GLU B CD  1 
ATOM   7795  O OE1 . GLU B 1 431 ? 78.846  2.640   152.282 1.00 172.89 ? 431 GLU B OE1 1 
ATOM   7796  O OE2 . GLU B 1 431 ? 79.718  0.628   152.339 1.00 176.18 ? 431 GLU B OE2 1 
ATOM   7797  N N   . SER B 1 432 ? 77.139  0.498   147.285 1.00 165.36 ? 432 SER B N   1 
ATOM   7798  C CA  . SER B 1 432 ? 76.486  -0.352  146.313 1.00 161.14 ? 432 SER B CA  1 
ATOM   7799  C C   . SER B 1 432 ? 76.057  0.342   145.021 1.00 157.03 ? 432 SER B C   1 
ATOM   7800  O O   . SER B 1 432 ? 76.262  -0.163  143.916 1.00 154.77 ? 432 SER B O   1 
ATOM   7801  C CB  . SER B 1 432 ? 75.250  -0.917  146.990 1.00 160.82 ? 432 SER B CB  1 
ATOM   7802  O OG  . SER B 1 432 ? 75.562  -1.506  148.234 1.00 160.11 ? 432 SER B OG  1 
ATOM   7803  N N   . LEU B 1 433 ? 75.480  1.522   145.202 1.00 157.46 ? 433 LEU B N   1 
ATOM   7804  C CA  . LEU B 1 433 ? 74.975  2.381   144.133 1.00 159.05 ? 433 LEU B CA  1 
ATOM   7805  C C   . LEU B 1 433 ? 76.034  2.890   143.162 1.00 161.26 ? 433 LEU B C   1 
ATOM   7806  O O   . LEU B 1 433 ? 75.893  2.771   141.944 1.00 158.03 ? 433 LEU B O   1 
ATOM   7807  C CB  . LEU B 1 433 ? 74.264  3.577   144.754 1.00 160.25 ? 433 LEU B CB  1 
ATOM   7808  C CG  . LEU B 1 433 ? 72.792  3.376   145.091 1.00 165.14 ? 433 LEU B CG  1 
ATOM   7809  C CD1 . LEU B 1 433 ? 72.380  4.293   146.219 1.00 167.59 ? 433 LEU B CD1 1 
ATOM   7810  C CD2 . LEU B 1 433 ? 71.940  3.631   143.858 1.00 164.01 ? 433 LEU B CD2 1 
ATOM   7811  N N   . GLU B 1 434 ? 77.110  3.437   143.715 1.00 167.80 ? 434 GLU B N   1 
ATOM   7812  C CA  . GLU B 1 434 ? 78.133  4.084   142.905 1.00 171.02 ? 434 GLU B CA  1 
ATOM   7813  C C   . GLU B 1 434 ? 78.945  3.155   142.005 1.00 166.38 ? 434 GLU B C   1 
ATOM   7814  O O   . GLU B 1 434 ? 79.519  3.605   141.016 1.00 160.46 ? 434 GLU B O   1 
ATOM   7815  C CB  . GLU B 1 434 ? 79.095  4.851   143.811 1.00 172.92 ? 434 GLU B CB  1 
ATOM   7816  C CG  . GLU B 1 434 ? 79.704  6.080   143.158 1.00 175.88 ? 434 GLU B CG  1 
ATOM   7817  C CD  . GLU B 1 434 ? 78.708  7.219   143.032 1.00 179.15 ? 434 GLU B CD  1 
ATOM   7818  O OE1 . GLU B 1 434 ? 78.808  7.991   142.057 1.00 181.43 ? 434 GLU B OE1 1 
ATOM   7819  O OE2 . GLU B 1 434 ? 77.830  7.356   143.912 1.00 180.89 ? 434 GLU B OE2 1 
ATOM   7820  N N   . LEU B 1 435 ? 78.995  1.869   142.333 1.00 165.12 ? 435 LEU B N   1 
ATOM   7821  C CA  . LEU B 1 435 ? 79.709  0.907   141.493 1.00 161.68 ? 435 LEU B CA  1 
ATOM   7822  C C   . LEU B 1 435 ? 78.874  0.558   140.255 1.00 163.58 ? 435 LEU B C   1 
ATOM   7823  O O   . LEU B 1 435 ? 79.416  0.285   139.183 1.00 161.90 ? 435 LEU B O   1 
ATOM   7824  C CB  . LEU B 1 435 ? 80.099  -0.348  142.282 1.00 162.90 ? 435 LEU B CB  1 
ATOM   7825  C CG  . LEU B 1 435 ? 79.103  -1.322  142.905 1.00 168.19 ? 435 LEU B CG  1 
ATOM   7826  C CD1 . LEU B 1 435 ? 78.996  -2.571  142.054 1.00 173.34 ? 435 LEU B CD1 1 
ATOM   7827  C CD2 . LEU B 1 435 ? 79.560  -1.684  144.309 1.00 166.93 ? 435 LEU B CD2 1 
ATOM   7828  N N   . CYS B 1 436 ? 77.555  0.554   140.421 1.00 169.03 ? 436 CYS B N   1 
ATOM   7829  C CA  . CYS B 1 436 ? 76.618  0.201   139.350 1.00 165.75 ? 436 CYS B CA  1 
ATOM   7830  C C   . CYS B 1 436 ? 76.399  1.308   138.313 1.00 164.71 ? 436 CYS B C   1 
ATOM   7831  O O   . CYS B 1 436 ? 75.831  1.070   137.253 1.00 164.80 ? 436 CYS B O   1 
ATOM   7832  C CB  . CYS B 1 436 ? 75.274  -0.215  139.940 1.00 163.77 ? 436 CYS B CB  1 
ATOM   7833  S SG  . CYS B 1 436 ? 75.369  -1.613  141.072 1.00 159.72 ? 436 CYS B SG  1 
ATOM   7834  N N   . ARG B 1 437 ? 76.710  2.545   138.663 1.00 166.07 ? 437 ARG B N   1 
ATOM   7835  C CA  . ARG B 1 437 ? 76.589  3.626   137.680 1.00 171.76 ? 437 ARG B CA  1 
ATOM   7836  C C   . ARG B 1 437 ? 77.454  3.491   136.395 1.00 181.31 ? 437 ARG B C   1 
ATOM   7837  O O   . ARG B 1 437 ? 76.919  3.634   135.292 1.00 181.04 ? 437 ARG B O   1 
ATOM   7838  C CB  . ARG B 1 437 ? 76.832  4.973   138.356 1.00 170.73 ? 437 ARG B CB  1 
ATOM   7839  C CG  . ARG B 1 437 ? 75.520  5.514   138.888 1.00 166.57 ? 437 ARG B CG  1 
ATOM   7840  C CD  . ARG B 1 437 ? 75.632  6.904   139.460 1.00 165.80 ? 437 ARG B CD  1 
ATOM   7841  N NE  . ARG B 1 437 ? 75.863  6.857   140.899 1.00 169.36 ? 437 ARG B NE  1 
ATOM   7842  C CZ  . ARG B 1 437 ? 74.896  6.812   141.808 1.00 171.21 ? 437 ARG B CZ  1 
ATOM   7843  N NH1 . ARG B 1 437 ? 73.624  6.814   141.430 1.00 166.75 ? 437 ARG B NH1 1 
ATOM   7844  N NH2 . ARG B 1 437 ? 75.202  6.767   143.097 1.00 171.81 ? 437 ARG B NH2 1 
ATOM   7845  N N   . PRO B 1 438 ? 78.769  3.197   136.517 1.00 180.35 ? 438 PRO B N   1 
ATOM   7846  C CA  . PRO B 1 438 ? 79.609  3.070   135.312 1.00 181.37 ? 438 PRO B CA  1 
ATOM   7847  C C   . PRO B 1 438 ? 79.392  1.779   134.506 1.00 186.07 ? 438 PRO B C   1 
ATOM   7848  O O   . PRO B 1 438 ? 79.885  1.665   133.382 1.00 188.85 ? 438 PRO B O   1 
ATOM   7849  C CB  . PRO B 1 438 ? 81.047  3.104   135.875 1.00 174.27 ? 438 PRO B CB  1 
ATOM   7850  C CG  . PRO B 1 438 ? 80.918  3.437   137.330 1.00 171.14 ? 438 PRO B CG  1 
ATOM   7851  C CD  . PRO B 1 438 ? 79.564  2.987   137.738 1.00 175.55 ? 438 PRO B CD  1 
ATOM   7852  N N   . VAL B 1 439 ? 78.685  0.816   135.085 1.00 186.59 ? 439 VAL B N   1 
ATOM   7853  C CA  . VAL B 1 439 ? 78.470  -0.495  134.470 1.00 189.03 ? 439 VAL B CA  1 
ATOM   7854  C C   . VAL B 1 439 ? 77.436  -0.545  133.329 1.00 188.38 ? 439 VAL B C   1 
ATOM   7855  O O   . VAL B 1 439 ? 77.127  -1.613  132.820 1.00 184.00 ? 439 VAL B O   1 
ATOM   7856  C CB  . VAL B 1 439 ? 78.015  -1.504  135.569 1.00 170.14 ? 439 VAL B CB  1 
ATOM   7857  C CG1 . VAL B 1 439 ? 76.477  -1.508  135.718 1.00 170.63 ? 439 VAL B CG1 1 
ATOM   7858  C CG2 . VAL B 1 439 ? 78.571  -2.910  135.310 1.00 170.29 ? 439 VAL B CG2 1 
ATOM   7859  N N   . LEU B 1 440 ? 76.925  0.608   132.906 1.00 186.32 ? 440 LEU B N   1 
ATOM   7860  C CA  . LEU B 1 440 ? 75.820  0.668   131.926 1.00 182.84 ? 440 LEU B CA  1 
ATOM   7861  C C   . LEU B 1 440 ? 76.110  0.250   130.477 1.00 187.48 ? 440 LEU B C   1 
ATOM   7862  O O   . LEU B 1 440 ? 75.230  -0.267  129.806 1.00 194.36 ? 440 LEU B O   1 
ATOM   7863  C CB  . LEU B 1 440 ? 75.202  2.083   131.931 1.00 181.59 ? 440 LEU B CB  1 
ATOM   7864  C CG  . LEU B 1 440 ? 75.754  3.382   131.296 1.00 182.26 ? 440 LEU B CG  1 
ATOM   7865  C CD1 . LEU B 1 440 ? 77.275  3.445   131.216 1.00 185.96 ? 440 LEU B CD1 1 
ATOM   7866  C CD2 . LEU B 1 440 ? 75.119  3.752   129.939 1.00 178.07 ? 440 LEU B CD2 1 
ATOM   7867  N N   . GLN B 1 441 ? 77.333  0.447   130.005 1.00 188.19 ? 441 GLN B N   1 
ATOM   7868  C CA  . GLN B 1 441 ? 77.708  0.064   128.639 1.00 193.38 ? 441 GLN B CA  1 
ATOM   7869  C C   . GLN B 1 441 ? 77.363  -1.393  128.264 1.00 197.38 ? 441 GLN B C   1 
ATOM   7870  O O   . GLN B 1 441 ? 76.855  -1.661  127.173 1.00 193.26 ? 441 GLN B O   1 
ATOM   7871  C CB  . GLN B 1 441 ? 79.205  0.277   128.441 1.00 190.83 ? 441 GLN B CB  1 
ATOM   7872  N N   . GLN B 1 442 ? 77.653  -2.327  129.165 1.00 199.81 ? 442 GLN B N   1 
ATOM   7873  C CA  . GLN B 1 442 ? 77.361  -3.741  128.946 1.00 196.70 ? 442 GLN B CA  1 
ATOM   7874  C C   . GLN B 1 442 ? 77.533  -4.458  130.268 1.00 191.31 ? 442 GLN B C   1 
ATOM   7875  O O   . GLN B 1 442 ? 78.260  -5.444  130.377 1.00 191.05 ? 442 GLN B O   1 
ATOM   7876  C CB  . GLN B 1 442 ? 78.275  -4.322  127.867 1.00 197.64 ? 442 GLN B CB  1 
ATOM   7877  N N   . GLY B 1 443 ? 76.853  -3.935  131.280 1.00 188.30 ? 443 GLY B N   1 
ATOM   7878  C CA  . GLY B 1 443 ? 76.863  -4.536  132.600 1.00 192.43 ? 443 GLY B CA  1 
ATOM   7879  C C   . GLY B 1 443 ? 76.091  -5.821  132.664 1.00 198.16 ? 443 GLY B C   1 
ATOM   7880  O O   . GLY B 1 443 ? 74.885  -5.820  132.883 1.00 189.40 ? 443 GLY B O   1 
ATOM   7881  N N   . ARG B 1 444 ? 76.806  -6.929  132.554 1.00 203.14 ? 444 ARG B N   1 
ATOM   7882  C CA  . ARG B 1 444 ? 76.148  -8.217  132.470 1.00 197.76 ? 444 ARG B CA  1 
ATOM   7883  C C   . ARG B 1 444 ? 75.611  -8.637  133.819 1.00 196.74 ? 444 ARG B C   1 
ATOM   7884  O O   . ARG B 1 444 ? 76.262  -8.457  134.850 1.00 188.98 ? 444 ARG B O   1 
ATOM   7885  C CB  . ARG B 1 444 ? 77.101  -9.285  131.930 1.00 188.56 ? 444 ARG B CB  1 
ATOM   7886  N N   . LYS B 1 445 ? 74.389  -9.162  133.789 1.00 197.47 ? 445 LYS B N   1 
ATOM   7887  C CA  . LYS B 1 445 ? 73.686  -9.646  134.973 1.00 196.02 ? 445 LYS B CA  1 
ATOM   7888  C C   . LYS B 1 445 ? 74.438  -10.768 135.687 1.00 196.52 ? 445 LYS B C   1 
ATOM   7889  O O   . LYS B 1 445 ? 74.136  -11.078 136.830 1.00 194.79 ? 445 LYS B O   1 
ATOM   7890  C CB  . LYS B 1 445 ? 72.284  -10.120 134.600 1.00 192.28 ? 445 LYS B CB  1 
ATOM   7891  N N   . GLN B 1 446 ? 75.407  -11.383 135.014 1.00 194.08 ? 446 GLN B N   1 
ATOM   7892  C CA  . GLN B 1 446 ? 76.140  -12.506 135.595 1.00 188.44 ? 446 GLN B CA  1 
ATOM   7893  C C   . GLN B 1 446 ? 76.857  -12.079 136.859 1.00 188.11 ? 446 GLN B C   1 
ATOM   7894  O O   . GLN B 1 446 ? 76.861  -12.790 137.865 1.00 186.99 ? 446 GLN B O   1 
ATOM   7895  C CB  . GLN B 1 446 ? 77.164  -13.048 134.609 1.00 185.07 ? 446 GLN B CB  1 
ATOM   7896  C CG  . GLN B 1 446 ? 76.617  -14.062 133.640 1.00 183.23 ? 446 GLN B CG  1 
ATOM   7897  C CD  . GLN B 1 446 ? 76.949  -15.480 134.044 1.00 183.57 ? 446 GLN B CD  1 
ATOM   7898  O OE1 . GLN B 1 446 ? 76.092  -16.213 134.532 1.00 183.76 ? 446 GLN B OE1 1 
ATOM   7899  N NE2 . GLN B 1 446 ? 78.201  -15.878 133.840 1.00 183.58 ? 446 GLN B NE2 1 
ATOM   7900  N N   . LEU B 1 447 ? 77.462  -10.900 136.793 1.00 189.61 ? 447 LEU B N   1 
ATOM   7901  C CA  . LEU B 1 447 ? 78.166  -10.322 137.923 1.00 190.71 ? 447 LEU B CA  1 
ATOM   7902  C C   . LEU B 1 447 ? 77.223  -10.023 139.086 1.00 179.60 ? 447 LEU B C   1 
ATOM   7903  O O   . LEU B 1 447 ? 77.552  -10.264 140.245 1.00 172.05 ? 447 LEU B O   1 
ATOM   7904  C CB  . LEU B 1 447 ? 78.857  -9.040  137.477 1.00 194.50 ? 447 LEU B CB  1 
ATOM   7905  C CG  . LEU B 1 447 ? 80.226  -9.239  136.842 1.00 190.66 ? 447 LEU B CG  1 
ATOM   7906  C CD1 . LEU B 1 447 ? 80.425  -8.224  135.736 1.00 192.32 ? 447 LEU B CD1 1 
ATOM   7907  C CD2 . LEU B 1 447 ? 81.311  -9.131  137.895 1.00 182.30 ? 447 LEU B CD2 1 
ATOM   7908  N N   . LEU B 1 448 ? 76.043  -9.500  138.754 1.00 174.09 ? 448 LEU B N   1 
ATOM   7909  C CA  . LEU B 1 448 ? 75.023  -9.149  139.747 1.00 175.69 ? 448 LEU B CA  1 
ATOM   7910  C C   . LEU B 1 448 ? 74.428  -10.367 140.444 1.00 178.07 ? 448 LEU B C   1 
ATOM   7911  O O   . LEU B 1 448 ? 74.151  -10.345 141.643 1.00 174.40 ? 448 LEU B O   1 
ATOM   7912  C CB  . LEU B 1 448 ? 73.892  -8.338  139.099 1.00 171.80 ? 448 LEU B CB  1 
ATOM   7913  C CG  . LEU B 1 448 ? 74.069  -6.850  138.758 1.00 169.03 ? 448 LEU B CG  1 
ATOM   7914  C CD1 . LEU B 1 448 ? 74.444  -6.003  139.979 1.00 168.27 ? 448 LEU B CD1 1 
ATOM   7915  C CD2 . LEU B 1 448 ? 75.060  -6.649  137.615 1.00 172.32 ? 448 LEU B CD2 1 
ATOM   7916  N N   . GLU B 1 449 ? 74.239  -11.427 139.666 1.00 179.91 ? 449 GLU B N   1 
ATOM   7917  C CA  . GLU B 1 449 ? 73.671  -12.680 140.151 1.00 184.40 ? 449 GLU B CA  1 
ATOM   7918  C C   . GLU B 1 449 ? 74.434  -13.264 141.333 1.00 185.62 ? 449 GLU B C   1 
ATOM   7919  O O   . GLU B 1 449 ? 73.826  -13.659 142.323 1.00 183.82 ? 449 GLU B O   1 
ATOM   7920  C CB  . GLU B 1 449 ? 73.599  -13.694 139.022 1.00 188.74 ? 449 GLU B CB  1 
ATOM   7921  C CG  . GLU B 1 449 ? 72.484  -13.421 138.046 1.00 194.72 ? 449 GLU B CG  1 
ATOM   7922  C CD  . GLU B 1 449 ? 72.497  -14.387 136.898 1.00 195.65 ? 449 GLU B CD  1 
ATOM   7923  O OE1 . GLU B 1 449 ? 72.605  -13.943 135.738 1.00 191.69 ? 449 GLU B OE1 1 
ATOM   7924  O OE2 . GLU B 1 449 ? 72.426  -15.600 137.171 1.00 198.17 ? 449 GLU B OE2 1 
ATOM   7925  N N   . LYS B 1 450 ? 75.760  -13.304 141.243 1.00 182.33 ? 450 LYS B N   1 
ATOM   7926  C CA  . LYS B 1 450 ? 76.548  -13.833 142.350 1.00 178.52 ? 450 LYS B CA  1 
ATOM   7927  C C   . LYS B 1 450 ? 76.361  -12.931 143.551 1.00 180.15 ? 450 LYS B C   1 
ATOM   7928  O O   . LYS B 1 450 ? 76.062  -13.400 144.643 1.00 181.81 ? 450 LYS B O   1 
ATOM   7929  C CB  . LYS B 1 450 ? 78.041  -13.946 142.006 1.00 176.38 ? 450 LYS B CB  1 
ATOM   7930  C CG  . LYS B 1 450 ? 78.898  -14.595 143.113 1.00 167.87 ? 450 LYS B CG  1 
ATOM   7931  C CD  . LYS B 1 450 ? 78.894  -16.119 143.051 1.00 169.27 ? 450 LYS B CD  1 
ATOM   7932  C CE  . LYS B 1 450 ? 79.643  -16.734 144.227 1.00 170.64 ? 450 LYS B CE  1 
ATOM   7933  N NZ  . LYS B 1 450 ? 81.093  -16.420 144.188 1.00 176.10 ? 450 LYS B NZ  1 
ATOM   7934  N N   . TRP B 1 451 ? 76.481  -11.629 143.331 1.00 179.53 ? 451 TRP B N   1 
ATOM   7935  C CA  . TRP B 1 451 ? 76.379  -10.680 144.422 1.00 177.43 ? 451 TRP B CA  1 
ATOM   7936  C C   . TRP B 1 451 ? 75.019  -10.836 145.119 1.00 171.68 ? 451 TRP B C   1 
ATOM   7937  O O   . TRP B 1 451 ? 74.949  -10.798 146.349 1.00 169.35 ? 451 TRP B O   1 
ATOM   7938  C CB  . TRP B 1 451 ? 76.604  -9.246  143.921 1.00 180.15 ? 451 TRP B CB  1 
ATOM   7939  C CG  . TRP B 1 451 ? 77.942  -9.057  143.227 1.00 181.58 ? 451 TRP B CG  1 
ATOM   7940  C CD1 . TRP B 1 451 ? 79.104  -9.747  143.462 1.00 179.84 ? 451 TRP B CD1 1 
ATOM   7941  C CD2 . TRP B 1 451 ? 78.259  -8.073  142.237 1.00 178.14 ? 451 TRP B CD2 1 
ATOM   7942  N NE1 . TRP B 1 451 ? 80.107  -9.276  142.649 1.00 177.33 ? 451 TRP B NE1 1 
ATOM   7943  C CE2 . TRP B 1 451 ? 79.617  -8.244  141.893 1.00 176.63 ? 451 TRP B CE2 1 
ATOM   7944  C CE3 . TRP B 1 451 ? 77.525  -7.073  141.597 1.00 170.85 ? 451 TRP B CE3 1 
ATOM   7945  C CZ2 . TRP B 1 451 ? 80.251  -7.450  140.940 1.00 168.87 ? 451 TRP B CZ2 1 
ATOM   7946  C CZ3 . TRP B 1 451 ? 78.156  -6.287  140.652 1.00 164.69 ? 451 TRP B CZ3 1 
ATOM   7947  C CH2 . TRP B 1 451 ? 79.505  -6.479  140.332 1.00 165.38 ? 451 TRP B CH2 1 
ATOM   7948  N N   . LEU B 1 452 ? 73.955  -11.027 144.334 1.00 169.06 ? 452 LEU B N   1 
ATOM   7949  C CA  . LEU B 1 452 ? 72.587  -11.205 144.858 1.00 168.97 ? 452 LEU B CA  1 
ATOM   7950  C C   . LEU B 1 452 ? 72.308  -12.479 145.656 1.00 176.13 ? 452 LEU B C   1 
ATOM   7951  O O   . LEU B 1 452 ? 71.620  -12.436 146.677 1.00 181.97 ? 452 LEU B O   1 
ATOM   7952  C CB  . LEU B 1 452 ? 71.581  -11.167 143.705 1.00 163.99 ? 452 LEU B CB  1 
ATOM   7953  C CG  . LEU B 1 452 ? 70.903  -9.846  143.342 1.00 162.60 ? 452 LEU B CG  1 
ATOM   7954  C CD1 . LEU B 1 452 ? 69.820  -9.535  144.368 1.00 161.80 ? 452 LEU B CD1 1 
ATOM   7955  C CD2 . LEU B 1 452 ? 71.905  -8.712  143.253 1.00 163.84 ? 452 LEU B CD2 1 
ATOM   7956  N N   . LYS B 1 453 ? 72.849  -13.600 145.198 1.00 175.22 ? 453 LYS B N   1 
ATOM   7957  C CA  . LYS B 1 453 ? 72.659  -14.883 145.868 1.00 173.89 ? 453 LYS B CA  1 
ATOM   7958  C C   . LYS B 1 453 ? 73.321  -14.867 147.231 1.00 168.97 ? 453 LYS B C   1 
ATOM   7959  O O   . LYS B 1 453 ? 72.894  -15.551 148.157 1.00 165.72 ? 453 LYS B O   1 
ATOM   7960  C CB  . LYS B 1 453 ? 73.215  -16.039 145.031 1.00 176.15 ? 453 LYS B CB  1 
ATOM   7961  C CG  . LYS B 1 453 ? 72.197  -16.707 144.132 1.00 173.81 ? 453 LYS B CG  1 
ATOM   7962  C CD  . LYS B 1 453 ? 72.610  -16.631 142.670 1.00 178.16 ? 453 LYS B CD  1 
ATOM   7963  C CE  . LYS B 1 453 ? 73.443  -17.830 142.250 1.00 187.74 ? 453 LYS B CE  1 
ATOM   7964  N NZ  . LYS B 1 453 ? 73.850  -17.744 140.818 1.00 189.61 ? 453 LYS B NZ  1 
ATOM   7965  N N   . GLU B 1 454 ? 74.385  -14.084 147.334 1.00 173.16 ? 454 GLU B N   1 
ATOM   7966  C CA  . GLU B 1 454 ? 75.197  -14.046 148.538 1.00 180.40 ? 454 GLU B CA  1 
ATOM   7967  C C   . GLU B 1 454 ? 74.637  -13.380 149.804 1.00 181.56 ? 454 GLU B C   1 
ATOM   7968  O O   . GLU B 1 454 ? 74.892  -13.900 150.895 1.00 173.72 ? 454 GLU B O   1 
ATOM   7969  C CB  . GLU B 1 454 ? 76.518  -13.342 148.231 1.00 178.87 ? 454 GLU B CB  1 
ATOM   7970  C CG  . GLU B 1 454 ? 77.464  -14.087 147.328 1.00 185.46 ? 454 GLU B CG  1 
ATOM   7971  C CD  . GLU B 1 454 ? 78.867  -13.555 147.458 1.00 197.69 ? 454 GLU B CD  1 
ATOM   7972  O OE1 . GLU B 1 454 ? 79.756  -14.351 147.823 1.00 199.96 ? 454 GLU B OE1 1 
ATOM   7973  O OE2 . GLU B 1 454 ? 79.069  -12.342 147.247 1.00 202.77 ? 454 GLU B OE2 1 
ATOM   7974  N N   . ASP B 1 455 ? 73.787  -12.357 149.659 1.00 186.30 ? 455 ASP B N   1 
ATOM   7975  C CA  . ASP B 1 455 ? 73.373  -11.447 150.754 1.00 185.00 ? 455 ASP B CA  1 
ATOM   7976  C C   . ASP B 1 455 ? 74.506  -10.464 150.989 1.00 181.09 ? 455 ASP B C   1 
ATOM   7977  O O   . ASP B 1 455 ? 74.666  -9.910  152.075 1.00 183.23 ? 455 ASP B O   1 
ATOM   7978  C CB  . ASP B 1 455 ? 73.051  -12.174 152.074 1.00 184.50 ? 455 ASP B CB  1 
ATOM   7979  C CG  . ASP B 1 455 ? 72.053  -11.425 152.931 1.00 181.41 ? 455 ASP B CG  1 
ATOM   7980  O OD1 . ASP B 1 455 ? 71.946  -10.191 152.782 1.00 179.72 ? 455 ASP B OD1 1 
ATOM   7981  O OD2 . ASP B 1 455 ? 71.415  -12.072 153.786 1.00 177.68 ? 455 ASP B OD2 1 
ATOM   7982  N N   . LYS B 1 456 ? 75.259  -10.200 149.931 1.00 175.86 ? 456 LYS B N   1 
ATOM   7983  C CA  . LYS B 1 456 ? 76.413  -9.323  150.032 1.00 176.94 ? 456 LYS B CA  1 
ATOM   7984  C C   . LYS B 1 456 ? 75.970  -7.876  150.211 1.00 179.94 ? 456 LYS B C   1 
ATOM   7985  O O   . LYS B 1 456 ? 76.602  -7.098  150.916 1.00 182.12 ? 456 LYS B O   1 
ATOM   7986  C CB  . LYS B 1 456 ? 77.287  -9.439  148.780 1.00 174.66 ? 456 LYS B CB  1 
ATOM   7987  N N   . LEU B 1 457 ? 74.843  -7.541  149.604 1.00 178.77 ? 457 LEU B N   1 
ATOM   7988  C CA  . LEU B 1 457 ? 74.594  -6.184  149.137 1.00 173.21 ? 457 LEU B CA  1 
ATOM   7989  C C   . LEU B 1 457 ? 73.452  -5.498  149.893 1.00 167.61 ? 457 LEU B C   1 
ATOM   7990  O O   . LEU B 1 457 ? 72.485  -6.161  150.242 1.00 164.61 ? 457 LEU B O   1 
ATOM   7991  C CB  . LEU B 1 457 ? 74.281  -6.285  147.633 1.00 171.20 ? 457 LEU B CB  1 
ATOM   7992  C CG  . LEU B 1 457 ? 74.544  -5.296  146.482 1.00 167.64 ? 457 LEU B CG  1 
ATOM   7993  C CD1 . LEU B 1 457 ? 74.054  -3.905  146.884 1.00 167.30 ? 457 LEU B CD1 1 
ATOM   7994  C CD2 . LEU B 1 457 ? 75.996  -5.343  145.885 1.00 169.26 ? 457 LEU B CD2 1 
ATOM   7995  N N   . GLU B 1 458 ? 73.545  -4.190  150.147 1.00 170.36 ? 458 GLU B N   1 
ATOM   7996  C CA  . GLU B 1 458 ? 72.448  -3.519  150.839 1.00 173.33 ? 458 GLU B CA  1 
ATOM   7997  C C   . GLU B 1 458 ? 71.599  -2.872  149.794 1.00 175.72 ? 458 GLU B C   1 
ATOM   7998  O O   . GLU B 1 458 ? 72.084  -2.065  149.005 1.00 176.22 ? 458 GLU B O   1 
ATOM   7999  C CB  . GLU B 1 458 ? 72.895  -2.446  151.828 1.00 175.34 ? 458 GLU B CB  1 
ATOM   8000  C CG  . GLU B 1 458 ? 72.445  -2.662  153.289 1.00 178.38 ? 458 GLU B CG  1 
ATOM   8001  C CD  . GLU B 1 458 ? 72.296  -1.335  154.030 1.00 181.81 ? 458 GLU B CD  1 
ATOM   8002  O OE1 . GLU B 1 458 ? 72.736  -1.217  155.192 1.00 179.89 ? 458 GLU B OE1 1 
ATOM   8003  O OE2 . GLU B 1 458 ? 71.745  -0.392  153.421 1.00 188.06 ? 458 GLU B OE2 1 
ATOM   8004  N N   . CYS B 1 459 ? 70.315  -3.192  149.817 1.00 173.56 ? 459 CYS B N   1 
ATOM   8005  C CA  . CYS B 1 459 ? 69.425  -2.619  148.834 1.00 173.23 ? 459 CYS B CA  1 
ATOM   8006  C C   . CYS B 1 459 ? 68.521  -1.510  149.348 1.00 182.10 ? 459 CYS B C   1 
ATOM   8007  O O   . CYS B 1 459 ? 67.857  -1.630  150.380 1.00 188.97 ? 459 CYS B O   1 
ATOM   8008  C CB  . CYS B 1 459 ? 68.578  -3.725  148.218 1.00 174.03 ? 459 CYS B CB  1 
ATOM   8009  S SG  . CYS B 1 459 ? 69.553  -4.961  147.337 1.00 168.23 ? 459 CYS B SG  1 
ATOM   8010  N N   . SER B 1 460 ? 68.521  -0.429  148.582 1.00 181.06 ? 460 SER B N   1 
ATOM   8011  C CA  . SER B 1 460 ? 67.649  0.706   148.793 1.00 176.08 ? 460 SER B CA  1 
ATOM   8012  C C   . SER B 1 460 ? 66.902  0.889   147.474 1.00 172.47 ? 460 SER B C   1 
ATOM   8013  O O   . SER B 1 460 ? 67.219  0.215   146.494 1.00 165.13 ? 460 SER B O   1 
ATOM   8014  C CB  . SER B 1 460 ? 68.443  1.944   149.206 1.00 170.77 ? 460 SER B CB  1 
ATOM   8015  O OG  . SER B 1 460 ? 69.054  2.582   148.102 1.00 169.51 ? 460 SER B OG  1 
ATOM   8016  N N   . GLU B 1 461 ? 65.925  1.788   147.443 1.00 172.72 ? 461 GLU B N   1 
ATOM   8017  C CA  . GLU B 1 461 ? 65.081  1.974   146.269 1.00 167.34 ? 461 GLU B CA  1 
ATOM   8018  C C   . GLU B 1 461 ? 65.851  2.376   145.023 1.00 164.87 ? 461 GLU B C   1 
ATOM   8019  O O   . GLU B 1 461 ? 65.600  1.848   143.935 1.00 170.22 ? 461 GLU B O   1 
ATOM   8020  C CB  . GLU B 1 461 ? 64.017  3.029   146.549 1.00 169.83 ? 461 GLU B CB  1 
ATOM   8021  C CG  . GLU B 1 461 ? 63.020  3.199   145.407 1.00 179.26 ? 461 GLU B CG  1 
ATOM   8022  C CD  . GLU B 1 461 ? 63.031  4.599   144.815 1.00 182.95 ? 461 GLU B CD  1 
ATOM   8023  O OE1 . GLU B 1 461 ? 62.439  4.794   143.726 1.00 179.21 ? 461 GLU B OE1 1 
ATOM   8024  O OE2 . GLU B 1 461 ? 63.640  5.507   145.432 1.00 188.26 ? 461 GLU B OE2 1 
ATOM   8025  N N   . GLU B 1 462 ? 66.776  3.319   145.200 1.00 163.45 ? 462 GLU B N   1 
ATOM   8026  C CA  . GLU B 1 462 ? 67.493  3.960   144.099 1.00 165.51 ? 462 GLU B CA  1 
ATOM   8027  C C   . GLU B 1 462 ? 68.239  2.959   143.246 1.00 167.29 ? 462 GLU B C   1 
ATOM   8028  O O   . GLU B 1 462 ? 68.472  3.174   142.057 1.00 163.97 ? 462 GLU B O   1 
ATOM   8029  C CB  . GLU B 1 462 ? 68.494  4.970   144.647 1.00 168.42 ? 462 GLU B CB  1 
ATOM   8030  C CG  . GLU B 1 462 ? 67.886  6.142   145.416 1.00 176.70 ? 462 GLU B CG  1 
ATOM   8031  C CD  . GLU B 1 462 ? 67.588  5.786   146.877 1.00 188.32 ? 462 GLU B CD  1 
ATOM   8032  O OE1 . GLU B 1 462 ? 67.847  6.630   147.759 1.00 190.74 ? 462 GLU B OE1 1 
ATOM   8033  O OE2 . GLU B 1 462 ? 67.139  4.656   147.163 1.00 194.32 ? 462 GLU B OE2 1 
ATOM   8034  N N   . LEU B 1 463 ? 68.598  1.859   143.889 1.00 176.93 ? 463 LEU B N   1 
ATOM   8035  C CA  . LEU B 1 463 ? 69.316  0.775   143.267 1.00 182.38 ? 463 LEU B CA  1 
ATOM   8036  C C   . LEU B 1 463 ? 68.349  0.064   142.334 1.00 176.22 ? 463 LEU B C   1 
ATOM   8037  O O   . LEU B 1 463 ? 68.700  -0.327  141.223 1.00 170.39 ? 463 LEU B O   1 
ATOM   8038  C CB  . LEU B 1 463 ? 69.880  -0.159  144.336 1.00 178.72 ? 463 LEU B CB  1 
ATOM   8039  C CG  . LEU B 1 463 ? 70.855  -1.242  143.903 1.00 165.91 ? 463 LEU B CG  1 
ATOM   8040  C CD1 . LEU B 1 463 ? 72.101  -0.566  143.362 1.00 164.08 ? 463 LEU B CD1 1 
ATOM   8041  C CD2 . LEU B 1 463 ? 71.214  -2.125  145.089 1.00 164.06 ? 463 LEU B CD2 1 
ATOM   8042  N N   . GLY B 1 464 ? 67.123  -0.113  142.817 1.00 168.07 ? 464 GLY B N   1 
ATOM   8043  C CA  . GLY B 1 464 ? 66.076  -0.758  142.046 1.00 166.48 ? 464 GLY B CA  1 
ATOM   8044  C C   . GLY B 1 464 ? 65.680  -0.060  140.757 1.00 169.38 ? 464 GLY B C   1 
ATOM   8045  O O   . GLY B 1 464 ? 65.605  -0.678  139.708 1.00 174.19 ? 464 GLY B O   1 
ATOM   8046  N N   . ASP B 1 465 ? 65.417  1.237   140.839 1.00 168.07 ? 465 ASP B N   1 
ATOM   8047  C CA  . ASP B 1 465 ? 65.020  2.009   139.669 1.00 169.83 ? 465 ASP B CA  1 
ATOM   8048  C C   . ASP B 1 465 ? 66.182  2.216   138.708 1.00 175.58 ? 465 ASP B C   1 
ATOM   8049  O O   . ASP B 1 465 ? 65.975  2.407   137.508 1.00 183.88 ? 465 ASP B O   1 
ATOM   8050  C CB  . ASP B 1 465 ? 64.477  3.369   140.084 1.00 168.12 ? 465 ASP B CB  1 
ATOM   8051  C CG  . ASP B 1 465 ? 65.417  4.099   141.011 1.00 172.90 ? 465 ASP B CG  1 
ATOM   8052  O OD1 . ASP B 1 465 ? 66.459  4.598   140.516 1.00 165.83 ? 465 ASP B OD1 1 
ATOM   8053  O OD2 . ASP B 1 465 ? 65.140  4.152   142.235 1.00 183.88 ? 465 ASP B OD2 1 
ATOM   8054  N N   . LEU B 1 466 ? 67.403  2.209   139.238 1.00 169.64 ? 466 LEU B N   1 
ATOM   8055  C CA  . LEU B 1 466 ? 68.581  2.394   138.404 1.00 165.77 ? 466 LEU B CA  1 
ATOM   8056  C C   . LEU B 1 466 ? 68.765  1.167   137.503 1.00 167.23 ? 466 LEU B C   1 
ATOM   8057  O O   . LEU B 1 466 ? 69.044  1.301   136.309 1.00 170.29 ? 466 LEU B O   1 
ATOM   8058  C CB  . LEU B 1 466 ? 69.820  2.625   139.276 1.00 161.31 ? 466 LEU B CB  1 
ATOM   8059  C CG  . LEU B 1 466 ? 71.033  3.204   138.552 1.00 165.12 ? 466 LEU B CG  1 
ATOM   8060  C CD1 . LEU B 1 466 ? 70.930  4.730   138.540 1.00 164.33 ? 466 LEU B CD1 1 
ATOM   8061  C CD2 . LEU B 1 466 ? 72.319  2.769   139.220 1.00 171.02 ? 466 LEU B CD2 1 
ATOM   8062  N N   . VAL B 1 467 ? 68.598  -0.026  138.072 1.00 164.16 ? 467 VAL B N   1 
ATOM   8063  C CA  . VAL B 1 467 ? 68.677  -1.270  137.297 1.00 163.59 ? 467 VAL B CA  1 
ATOM   8064  C C   . VAL B 1 467 ? 67.418  -1.526  136.452 1.00 167.24 ? 467 VAL B C   1 
ATOM   8065  O O   . VAL B 1 467 ? 67.466  -2.269  135.474 1.00 167.84 ? 467 VAL B O   1 
ATOM   8066  C CB  . VAL B 1 467 ? 68.943  -2.505  138.192 1.00 158.94 ? 467 VAL B CB  1 
ATOM   8067  C CG1 . VAL B 1 467 ? 70.372  -2.476  138.728 1.00 158.86 ? 467 VAL B CG1 1 
ATOM   8068  C CG2 . VAL B 1 467 ? 67.936  -2.607  139.301 1.00 159.05 ? 467 VAL B CG2 1 
ATOM   8069  N N   . LYS B 1 468 ? 66.285  -0.964  136.877 1.00 165.65 ? 468 LYS B N   1 
ATOM   8070  C CA  . LYS B 1 468 ? 64.995  -1.109  136.183 1.00 158.47 ? 468 LYS B CA  1 
ATOM   8071  C C   . LYS B 1 468 ? 64.998  -0.693  134.721 1.00 158.43 ? 468 LYS B C   1 
ATOM   8072  O O   . LYS B 1 468 ? 64.473  -1.396  133.876 1.00 167.89 ? 468 LYS B O   1 
ATOM   8073  C CB  . LYS B 1 468 ? 63.923  -0.265  136.878 1.00 161.26 ? 468 LYS B CB  1 
ATOM   8074  C CG  . LYS B 1 468 ? 62.492  -0.573  136.419 1.00 168.20 ? 468 LYS B CG  1 
ATOM   8075  C CD  . LYS B 1 468 ? 61.642  0.713   136.376 1.00 169.27 ? 468 LYS B CD  1 
ATOM   8076  C CE  . LYS B 1 468 ? 60.402  0.537   135.494 1.00 169.60 ? 468 LYS B CE  1 
ATOM   8077  N NZ  . LYS B 1 468 ? 59.754  1.834   135.118 1.00 171.56 ? 468 LYS B NZ  1 
ATOM   8078  N N   . SER B 1 469 ? 65.617  0.448   134.444 1.00 158.38 ? 469 SER B N   1 
ATOM   8079  C CA  . SER B 1 469 ? 65.692  1.014   133.102 1.00 172.50 ? 469 SER B CA  1 
ATOM   8080  C C   . SER B 1 469 ? 66.158  0.172   131.928 1.00 183.42 ? 469 SER B C   1 
ATOM   8081  O O   . SER B 1 469 ? 65.471  0.117   130.899 1.00 190.31 ? 469 SER B O   1 
ATOM   8082  C CB  . SER B 1 469 ? 66.637  2.221   133.090 1.00 171.66 ? 469 SER B CB  1 
ATOM   8083  O OG  . SER B 1 469 ? 66.871  2.750   134.366 1.00 170.13 ? 469 SER B OG  1 
ATOM   8084  N N   . VAL B 1 470 ? 67.256  -0.562  132.081 1.00 179.72 ? 470 VAL B N   1 
ATOM   8085  C CA  . VAL B 1 470 ? 67.636  -1.482  131.004 1.00 180.30 ? 470 VAL B CA  1 
ATOM   8086  C C   . VAL B 1 470 ? 67.539  -2.986  131.274 1.00 181.37 ? 470 VAL B C   1 
ATOM   8087  O O   . VAL B 1 470 ? 67.777  -3.795  130.374 1.00 176.57 ? 470 VAL B O   1 
ATOM   8088  C CB  . VAL B 1 470 ? 69.071  -1.129  130.507 1.00 168.09 ? 470 VAL B CB  1 
ATOM   8089  C CG1 . VAL B 1 470 ? 69.174  0.372   130.208 1.00 167.16 ? 470 VAL B CG1 1 
ATOM   8090  C CG2 . VAL B 1 470 ? 70.143  -1.614  131.483 1.00 164.56 ? 470 VAL B CG2 1 
ATOM   8091  N N   . ASP B 1 471 ? 67.165  -3.362  132.491 1.00 182.99 ? 471 ASP B N   1 
ATOM   8092  C CA  . ASP B 1 471 ? 66.706  -4.733  132.741 1.00 179.18 ? 471 ASP B CA  1 
ATOM   8093  C C   . ASP B 1 471 ? 65.778  -4.729  133.953 1.00 181.38 ? 471 ASP B C   1 
ATOM   8094  O O   . ASP B 1 471 ? 66.249  -4.805  135.089 1.00 176.32 ? 471 ASP B O   1 
ATOM   8095  C CB  . ASP B 1 471 ? 67.911  -5.665  132.954 1.00 175.21 ? 471 ASP B CB  1 
ATOM   8096  C CG  . ASP B 1 471 ? 67.535  -7.142  132.962 1.00 176.69 ? 471 ASP B CG  1 
ATOM   8097  O OD1 . ASP B 1 471 ? 66.875  -7.583  133.925 1.00 172.67 ? 471 ASP B OD1 1 
ATOM   8098  O OD2 . ASP B 1 471 ? 67.900  -7.872  132.014 1.00 184.19 ? 471 ASP B OD2 1 
ATOM   8099  N N   . PRO B 1 472 ? 64.459  -4.673  133.717 1.00 160.34 ? 472 PRO B N   1 
ATOM   8100  C CA  . PRO B 1 472 ? 63.514  -4.645  134.842 1.00 156.86 ? 472 PRO B CA  1 
ATOM   8101  C C   . PRO B 1 472 ? 63.325  -5.979  135.560 1.00 147.58 ? 472 PRO B C   1 
ATOM   8102  O O   . PRO B 1 472 ? 62.917  -5.992  136.727 1.00 144.36 ? 472 PRO B O   1 
ATOM   8103  C CB  . PRO B 1 472 ? 62.206  -4.199  134.177 1.00 147.32 ? 472 PRO B CB  1 
ATOM   8104  C CG  . PRO B 1 472 ? 62.348  -4.633  132.752 1.00 144.54 ? 472 PRO B CG  1 
ATOM   8105  C CD  . PRO B 1 472 ? 63.797  -4.416  132.427 1.00 152.94 ? 472 PRO B CD  1 
ATOM   8106  N N   . THR B 1 473 ? 63.609  -7.081  134.877 1.00 147.19 ? 473 THR B N   1 
ATOM   8107  C CA  . THR B 1 473 ? 63.469  -8.396  135.486 1.00 155.82 ? 473 THR B CA  1 
ATOM   8108  C C   . THR B 1 473 ? 64.469  -8.574  136.632 1.00 167.27 ? 473 THR B C   1 
ATOM   8109  O O   . THR B 1 473 ? 64.161  -9.208  137.644 1.00 171.59 ? 473 THR B O   1 
ATOM   8110  C CB  . THR B 1 473 ? 63.632  -9.504  134.446 1.00 160.24 ? 473 THR B CB  1 
ATOM   8111  O OG1 . THR B 1 473 ? 64.885  -9.347  133.769 1.00 171.56 ? 473 THR B OG1 1 
ATOM   8112  C CG2 . THR B 1 473 ? 62.503  -9.417  133.427 1.00 150.64 ? 473 THR B CG2 1 
ATOM   8113  N N   . LEU B 1 474 ? 65.669  -8.026  136.457 1.00 164.68 ? 474 LEU B N   1 
ATOM   8114  C CA  . LEU B 1 474 ? 66.681  -8.051  137.507 1.00 152.36 ? 474 LEU B CA  1 
ATOM   8115  C C   . LEU B 1 474 ? 66.305  -7.108  138.646 1.00 148.09 ? 474 LEU B C   1 
ATOM   8116  O O   . LEU B 1 474 ? 66.568  -7.399  139.813 1.00 146.44 ? 474 LEU B O   1 
ATOM   8117  C CB  . LEU B 1 474 ? 68.053  -7.665  136.950 1.00 150.77 ? 474 LEU B CB  1 
ATOM   8118  C CG  . LEU B 1 474 ? 69.098  -8.769  136.740 1.00 158.26 ? 474 LEU B CG  1 
ATOM   8119  C CD1 . LEU B 1 474 ? 69.547  -9.378  138.068 1.00 156.06 ? 474 LEU B CD1 1 
ATOM   8120  C CD2 . LEU B 1 474 ? 68.578  -9.842  135.799 1.00 163.00 ? 474 LEU B CD2 1 
ATOM   8121  N N   . ALA B 1 475 ? 65.678  -5.987  138.295 1.00 151.95 ? 475 ALA B N   1 
ATOM   8122  C CA  . ALA B 1 475 ? 65.246  -4.978  139.264 1.00 144.77 ? 475 ALA B CA  1 
ATOM   8123  C C   . ALA B 1 475 ? 64.316  -5.518  140.344 1.00 142.02 ? 475 ALA B C   1 
ATOM   8124  O O   . ALA B 1 475 ? 64.352  -5.060  141.486 1.00 146.30 ? 475 ALA B O   1 
ATOM   8125  C CB  . ALA B 1 475 ? 64.575  -3.818  138.540 1.00 138.50 ? 475 ALA B CB  1 
ATOM   8126  N N   . LEU B 1 476 ? 63.479  -6.480  139.970 1.00 141.61 ? 476 LEU B N   1 
ATOM   8127  C CA  . LEU B 1 476 ? 62.543  -7.102  140.900 1.00 145.27 ? 476 LEU B CA  1 
ATOM   8128  C C   . LEU B 1 476 ? 63.284  -7.737  142.071 1.00 155.16 ? 476 LEU B C   1 
ATOM   8129  O O   . LEU B 1 476 ? 62.861  -7.634  143.222 1.00 161.68 ? 476 LEU B O   1 
ATOM   8130  C CB  . LEU B 1 476 ? 61.696  -8.150  140.180 1.00 145.94 ? 476 LEU B CB  1 
ATOM   8131  C CG  . LEU B 1 476 ? 60.757  -9.000  141.035 1.00 147.99 ? 476 LEU B CG  1 
ATOM   8132  C CD1 . LEU B 1 476 ? 59.439  -8.273  141.247 1.00 140.77 ? 476 LEU B CD1 1 
ATOM   8133  C CD2 . LEU B 1 476 ? 60.532  -10.347 140.376 1.00 155.69 ? 476 LEU B CD2 1 
ATOM   8134  N N   . SER B 1 477 ? 64.399  -8.388  141.760 1.00 152.61 ? 477 SER B N   1 
ATOM   8135  C CA  . SER B 1 477 ? 65.235  -9.028  142.767 1.00 154.10 ? 477 SER B CA  1 
ATOM   8136  C C   . SER B 1 477 ? 65.779  -8.003  143.753 1.00 154.24 ? 477 SER B C   1 
ATOM   8137  O O   . SER B 1 477 ? 65.821  -8.241  144.959 1.00 150.95 ? 477 SER B O   1 
ATOM   8138  C CB  . SER B 1 477 ? 66.390  -9.781  142.105 1.00 155.96 ? 477 SER B CB  1 
ATOM   8139  O OG  . SER B 1 477 ? 66.632  -11.014 142.764 1.00 160.93 ? 477 SER B OG  1 
ATOM   8140  N N   . VAL B 1 478 ? 66.217  -6.869  143.221 1.00 152.87 ? 478 VAL B N   1 
ATOM   8141  C CA  . VAL B 1 478 ? 66.715  -5.776  144.043 1.00 146.07 ? 478 VAL B CA  1 
ATOM   8142  C C   . VAL B 1 478 ? 65.611  -5.213  144.933 1.00 151.52 ? 478 VAL B C   1 
ATOM   8143  O O   . VAL B 1 478 ? 65.792  -5.055  146.140 1.00 157.78 ? 478 VAL B O   1 
ATOM   8144  C CB  . VAL B 1 478 ? 67.293  -4.649  143.183 1.00 142.72 ? 478 VAL B CB  1 
ATOM   8145  C CG1 . VAL B 1 478 ? 67.754  -3.503  144.062 1.00 143.60 ? 478 VAL B CG1 1 
ATOM   8146  C CG2 . VAL B 1 478 ? 68.440  -5.176  142.346 1.00 145.46 ? 478 VAL B CG2 1 
ATOM   8147  N N   . TYR B 1 479 ? 64.472  -4.901  144.322 1.00 144.07 ? 479 TYR B N   1 
ATOM   8148  C CA  . TYR B 1 479 ? 63.318  -4.372  145.045 1.00 137.54 ? 479 TYR B CA  1 
ATOM   8149  C C   . TYR B 1 479 ? 62.824  -5.315  146.140 1.00 141.48 ? 479 TYR B C   1 
ATOM   8150  O O   . TYR B 1 479 ? 62.380  -4.865  147.196 1.00 141.95 ? 479 TYR B O   1 
ATOM   8151  C CB  . TYR B 1 479 ? 62.170  -4.076  144.080 1.00 135.74 ? 479 TYR B CB  1 
ATOM   8152  C CG  . TYR B 1 479 ? 62.287  -2.760  143.346 1.00 135.41 ? 479 TYR B CG  1 
ATOM   8153  C CD1 . TYR B 1 479 ? 62.454  -1.569  144.039 1.00 137.62 ? 479 TYR B CD1 1 
ATOM   8154  C CD2 . TYR B 1 479 ? 62.221  -2.708  141.960 1.00 134.35 ? 479 TYR B CD2 1 
ATOM   8155  C CE1 . TYR B 1 479 ? 62.556  -0.364  143.373 1.00 137.70 ? 479 TYR B CE1 1 
ATOM   8156  C CE2 . TYR B 1 479 ? 62.324  -1.510  141.286 1.00 134.10 ? 479 TYR B CE2 1 
ATOM   8157  C CZ  . TYR B 1 479 ? 62.489  -0.341  141.996 1.00 138.66 ? 479 TYR B CZ  1 
ATOM   8158  O OH  . TYR B 1 479 ? 62.589  0.853   141.322 1.00 138.62 ? 479 TYR B OH  1 
ATOM   8159  N N   . LEU B 1 480 ? 62.901  -6.619  145.882 1.00 140.50 ? 480 LEU B N   1 
ATOM   8160  C CA  . LEU B 1 480 ? 62.464  -7.632  146.843 1.00 142.07 ? 480 LEU B CA  1 
ATOM   8161  C C   . LEU B 1 480 ? 63.240  -7.532  148.151 1.00 155.44 ? 480 LEU B C   1 
ATOM   8162  O O   . LEU B 1 480 ? 62.657  -7.488  149.234 1.00 161.58 ? 480 LEU B O   1 
ATOM   8163  C CB  . LEU B 1 480 ? 62.630  -9.038  146.258 1.00 142.45 ? 480 LEU B CB  1 
ATOM   8164  C CG  . LEU B 1 480 ? 61.393  -9.926  146.072 1.00 147.11 ? 480 LEU B CG  1 
ATOM   8165  C CD1 . LEU B 1 480 ? 60.563  -10.010 147.350 1.00 145.72 ? 480 LEU B CD1 1 
ATOM   8166  C CD2 . LEU B 1 480 ? 60.549  -9.454  144.896 1.00 161.97 ? 480 LEU B CD2 1 
ATOM   8167  N N   . ARG B 1 481 ? 64.562  -7.488  148.030 1.00 162.35 ? 481 ARG B N   1 
ATOM   8168  C CA  . ARG B 1 481 ? 65.458  -7.414  149.178 1.00 161.06 ? 481 ARG B CA  1 
ATOM   8169  C C   . ARG B 1 481 ? 65.429  -6.038  149.857 1.00 158.45 ? 481 ARG B C   1 
ATOM   8170  O O   . ARG B 1 481 ? 65.719  -5.923  151.047 1.00 158.82 ? 481 ARG B O   1 
ATOM   8171  C CB  . ARG B 1 481 ? 66.880  -7.788  148.744 1.00 163.15 ? 481 ARG B CB  1 
ATOM   8172  C CG  . ARG B 1 481 ? 66.972  -9.238  148.267 1.00 174.67 ? 481 ARG B CG  1 
ATOM   8173  C CD  . ARG B 1 481 ? 68.357  -9.637  147.792 1.00 181.91 ? 481 ARG B CD  1 
ATOM   8174  N NE  . ARG B 1 481 ? 68.411  -11.052 147.421 1.00 183.28 ? 481 ARG B NE  1 
ATOM   8175  C CZ  . ARG B 1 481 ? 68.796  -12.031 148.234 1.00 194.78 ? 481 ARG B CZ  1 
ATOM   8176  N NH1 . ARG B 1 481 ? 68.812  -13.285 147.801 1.00 198.27 ? 481 ARG B NH1 1 
ATOM   8177  N NH2 . ARG B 1 481 ? 69.168  -11.759 149.476 1.00 201.94 ? 481 ARG B NH2 1 
ATOM   8178  N N   . ALA B 1 482 ? 65.095  -4.999  149.094 1.00 150.26 ? 482 ALA B N   1 
ATOM   8179  C CA  . ALA B 1 482 ? 65.012  -3.631  149.618 1.00 148.02 ? 482 ALA B CA  1 
ATOM   8180  C C   . ALA B 1 482 ? 63.812  -3.391  150.542 1.00 157.53 ? 482 ALA B C   1 
ATOM   8181  O O   . ALA B 1 482 ? 63.721  -2.341  151.178 1.00 165.12 ? 482 ALA B O   1 
ATOM   8182  C CB  . ALA B 1 482 ? 64.980  -2.637  148.467 1.00 146.77 ? 482 ALA B CB  1 
ATOM   8183  N N   . ASN B 1 483 ? 62.892  -4.356  150.563 1.00 153.57 ? 483 ASN B N   1 
ATOM   8184  C CA  . ASN B 1 483 ? 61.676  -4.357  151.393 1.00 150.69 ? 483 ASN B CA  1 
ATOM   8185  C C   . ASN B 1 483 ? 60.526  -3.466  150.888 1.00 153.27 ? 483 ASN B C   1 
ATOM   8186  O O   . ASN B 1 483 ? 59.407  -3.558  151.388 1.00 164.15 ? 483 ASN B O   1 
ATOM   8187  C CB  . ASN B 1 483 ? 62.027  -3.970  152.838 1.00 161.02 ? 483 ASN B CB  1 
ATOM   8188  C CG  . ASN B 1 483 ? 60.852  -4.094  153.780 1.00 165.29 ? 483 ASN B CG  1 
ATOM   8189  O OD1 . ASN B 1 483 ? 60.290  -5.176  153.945 1.00 164.57 ? 483 ASN B OD1 1 
ATOM   8190  N ND2 . ASN B 1 483 ? 60.468  -2.984  154.401 1.00 164.94 ? 483 ASN B ND2 1 
ATOM   8191  N N   . VAL B 1 484 ? 60.794  -2.609  149.907 1.00 151.28 ? 484 VAL B N   1 
ATOM   8192  C CA  . VAL B 1 484 ? 59.749  -1.771  149.302 1.00 150.46 ? 484 VAL B CA  1 
ATOM   8193  C C   . VAL B 1 484 ? 58.677  -2.589  148.576 1.00 141.89 ? 484 VAL B C   1 
ATOM   8194  O O   . VAL B 1 484 ? 58.910  -3.084  147.476 1.00 141.79 ? 484 VAL B O   1 
ATOM   8195  C CB  . VAL B 1 484 ? 60.340  -0.756  148.310 1.00 144.92 ? 484 VAL B CB  1 
ATOM   8196  C CG1 . VAL B 1 484 ? 60.794  0.484   149.046 1.00 147.56 ? 484 VAL B CG1 1 
ATOM   8197  C CG2 . VAL B 1 484 ? 61.482  -1.382  147.525 1.00 141.78 ? 484 VAL B CG2 1 
ATOM   8198  N N   . PRO B 1 485 ? 57.493  -2.728  149.187 1.00 141.51 ? 485 PRO B N   1 
ATOM   8199  C CA  . PRO B 1 485 ? 56.447  -3.544  148.566 1.00 141.67 ? 485 PRO B CA  1 
ATOM   8200  C C   . PRO B 1 485 ? 55.789  -2.842  147.382 1.00 147.32 ? 485 PRO B C   1 
ATOM   8201  O O   . PRO B 1 485 ? 55.452  -3.496  146.394 1.00 141.98 ? 485 PRO B O   1 
ATOM   8202  C CB  . PRO B 1 485 ? 55.432  -3.746  149.700 1.00 146.92 ? 485 PRO B CB  1 
ATOM   8203  C CG  . PRO B 1 485 ? 56.020  -3.065  150.922 1.00 147.93 ? 485 PRO B CG  1 
ATOM   8204  C CD  . PRO B 1 485 ? 57.008  -2.075  150.411 1.00 145.67 ? 485 PRO B CD  1 
ATOM   8205  N N   . ASN B 1 486 ? 55.599  -1.530  147.503 1.00 150.22 ? 486 ASN B N   1 
ATOM   8206  C CA  . ASN B 1 486 ? 54.960  -0.720  146.467 1.00 141.19 ? 486 ASN B CA  1 
ATOM   8207  C C   . ASN B 1 486 ? 55.544  -0.905  145.075 1.00 133.49 ? 486 ASN B C   1 
ATOM   8208  O O   . ASN B 1 486 ? 54.808  -1.001  144.096 1.00 133.84 ? 486 ASN B O   1 
ATOM   8209  C CB  . ASN B 1 486 ? 55.024  0.760   146.851 1.00 152.24 ? 486 ASN B CB  1 
ATOM   8210  C CG  . ASN B 1 486 ? 54.256  1.066   148.123 1.00 168.25 ? 486 ASN B CG  1 
ATOM   8211  O OD1 . ASN B 1 486 ? 53.233  1.751   148.090 1.00 173.11 ? 486 ASN B OD1 1 
ATOM   8212  N ND2 . ASN B 1 486 ? 54.734  0.549   149.247 1.00 168.65 ? 486 ASN B ND2 1 
ATOM   8213  N N   . LYS B 1 487 ? 56.868  -0.955  144.993 1.00 133.64 ? 487 LYS B N   1 
ATOM   8214  C CA  . LYS B 1 487 ? 57.547  -1.131  143.714 1.00 133.86 ? 487 LYS B CA  1 
ATOM   8215  C C   . LYS B 1 487 ? 57.789  -2.593  143.346 1.00 132.08 ? 487 LYS B C   1 
ATOM   8216  O O   . LYS B 1 487 ? 58.227  -2.894  142.237 1.00 130.83 ? 487 LYS B O   1 
ATOM   8217  C CB  . LYS B 1 487 ? 58.849  -0.336  143.696 1.00 137.92 ? 487 LYS B CB  1 
ATOM   8218  C CG  . LYS B 1 487 ? 58.592  1.107   143.286 1.00 143.58 ? 487 LYS B CG  1 
ATOM   8219  C CD  . LYS B 1 487 ? 59.827  1.981   143.290 1.00 160.37 ? 487 LYS B CD  1 
ATOM   8220  C CE  . LYS B 1 487 ? 59.760  2.975   144.435 1.00 174.37 ? 487 LYS B CE  1 
ATOM   8221  N NZ  . LYS B 1 487 ? 59.830  2.335   145.778 1.00 182.41 ? 487 LYS B NZ  1 
ATOM   8222  N N   . VAL B 1 488 ? 57.537  -3.500  144.280 1.00 134.41 ? 488 VAL B N   1 
ATOM   8223  C CA  . VAL B 1 488 ? 57.617  -4.920  143.967 1.00 136.69 ? 488 VAL B CA  1 
ATOM   8224  C C   . VAL B 1 488 ? 56.345  -5.311  143.231 1.00 142.62 ? 488 VAL B C   1 
ATOM   8225  O O   . VAL B 1 488 ? 56.384  -5.975  142.195 1.00 147.50 ? 488 VAL B O   1 
ATOM   8226  C CB  . VAL B 1 488 ? 57.772  -5.791  145.224 1.00 135.12 ? 488 VAL B CB  1 
ATOM   8227  C CG1 . VAL B 1 488 ? 57.354  -7.228  144.939 1.00 135.19 ? 488 VAL B CG1 1 
ATOM   8228  C CG2 . VAL B 1 488 ? 59.196  -5.735  145.724 1.00 144.73 ? 488 VAL B CG2 1 
ATOM   8229  N N   . ILE B 1 489 ? 55.213  -4.899  143.790 1.00 140.61 ? 489 ILE B N   1 
ATOM   8230  C CA  . ILE B 1 489 ? 53.908  -5.166  143.197 1.00 137.21 ? 489 ILE B CA  1 
ATOM   8231  C C   . ILE B 1 489 ? 53.738  -4.499  141.833 1.00 144.23 ? 489 ILE B C   1 
ATOM   8232  O O   . ILE B 1 489 ? 53.253  -5.122  140.891 1.00 150.01 ? 489 ILE B O   1 
ATOM   8233  C CB  . ILE B 1 489 ? 52.779  -4.709  144.131 1.00 132.61 ? 489 ILE B CB  1 
ATOM   8234  C CG1 . ILE B 1 489 ? 52.728  -5.627  145.349 1.00 133.13 ? 489 ILE B CG1 1 
ATOM   8235  C CG2 . ILE B 1 489 ? 51.444  -4.728  143.411 1.00 130.40 ? 489 ILE B CG2 1 
ATOM   8236  C CD1 . ILE B 1 489 ? 51.871  -5.103  146.469 1.00 136.80 ? 489 ILE B CD1 1 
ATOM   8237  N N   . GLN B 1 490 ? 54.123  -3.230  141.733 1.00 142.96 ? 490 GLN B N   1 
ATOM   8238  C CA  . GLN B 1 490 ? 54.072  -2.520  140.457 1.00 139.74 ? 490 GLN B CA  1 
ATOM   8239  C C   . GLN B 1 490 ? 55.001  -3.183  139.434 1.00 129.07 ? 490 GLN B C   1 
ATOM   8240  O O   . GLN B 1 490 ? 54.770  -3.090  138.226 1.00 127.51 ? 490 GLN B O   1 
ATOM   8241  C CB  . GLN B 1 490 ? 54.402  -1.035  140.639 1.00 154.21 ? 490 GLN B CB  1 
ATOM   8242  C CG  . GLN B 1 490 ? 53.212  -0.236  141.178 1.00 166.42 ? 490 GLN B CG  1 
ATOM   8243  C CD  . GLN B 1 490 ? 53.542  1.219   141.459 1.00 170.58 ? 490 GLN B CD  1 
ATOM   8244  O OE1 . GLN B 1 490 ? 54.708  1.588   141.607 1.00 178.50 ? 490 GLN B OE1 1 
ATOM   8245  N NE2 . GLN B 1 490 ? 52.512  2.057   141.528 1.00 154.98 ? 490 GLN B NE2 1 
ATOM   8246  N N   . CYS B 1 491 ? 56.060  -3.827  139.923 1.00 131.95 ? 491 CYS B N   1 
ATOM   8247  C CA  . CYS B 1 491 ? 56.988  -4.569  139.065 1.00 136.71 ? 491 CYS B CA  1 
ATOM   8248  C C   . CYS B 1 491 ? 56.331  -5.847  138.535 1.00 137.43 ? 491 CYS B C   1 
ATOM   8249  O O   . CYS B 1 491 ? 56.488  -6.189  137.363 1.00 131.22 ? 491 CYS B O   1 
ATOM   8250  C CB  . CYS B 1 491 ? 58.273  -4.912  139.812 1.00 133.26 ? 491 CYS B CB  1 
ATOM   8251  S SG  . CYS B 1 491 ? 59.705  -5.180  138.733 1.00 132.70 ? 491 CYS B SG  1 
ATOM   8252  N N   . PHE B 1 492 ? 55.591  -6.543  139.397 1.00 138.08 ? 492 PHE B N   1 
ATOM   8253  C CA  . PHE B 1 492 ? 54.869  -7.748  138.994 1.00 133.02 ? 492 PHE B CA  1 
ATOM   8254  C C   . PHE B 1 492 ? 53.788  -7.415  137.975 1.00 139.93 ? 492 PHE B C   1 
ATOM   8255  O O   . PHE B 1 492 ? 53.596  -8.134  136.996 1.00 146.11 ? 492 PHE B O   1 
ATOM   8256  C CB  . PHE B 1 492 ? 54.204  -8.436  140.186 1.00 134.13 ? 492 PHE B CB  1 
ATOM   8257  C CG  . PHE B 1 492 ? 55.124  -9.258  141.034 1.00 137.22 ? 492 PHE B CG  1 
ATOM   8258  C CD1 . PHE B 1 492 ? 56.062  -10.100 140.467 1.00 139.77 ? 492 PHE B CD1 1 
ATOM   8259  C CD2 . PHE B 1 492 ? 55.008  -9.221  142.410 1.00 140.72 ? 492 PHE B CD2 1 
ATOM   8260  C CE1 . PHE B 1 492 ? 56.888  -10.866 141.261 1.00 140.08 ? 492 PHE B CE1 1 
ATOM   8261  C CE2 . PHE B 1 492 ? 55.826  -9.981  143.211 1.00 142.10 ? 492 PHE B CE2 1 
ATOM   8262  C CZ  . PHE B 1 492 ? 56.772  -10.807 142.637 1.00 140.76 ? 492 PHE B CZ  1 
ATOM   8263  N N   . ALA B 1 493 ? 53.076  -6.323  138.237 1.00 138.61 ? 493 ALA B N   1 
ATOM   8264  C CA  . ALA B 1 493 ? 51.993  -5.841  137.378 1.00 129.15 ? 493 ALA B CA  1 
ATOM   8265  C C   . ALA B 1 493 ? 52.471  -5.520  135.963 1.00 132.23 ? 493 ALA B C   1 
ATOM   8266  O O   . ALA B 1 493 ? 51.766  -5.803  134.998 1.00 129.54 ? 493 ALA B O   1 
ATOM   8267  C CB  . ALA B 1 493 ? 51.328  -4.621  137.997 1.00 127.28 ? 493 ALA B CB  1 
ATOM   8268  N N   . GLU B 1 494 ? 53.656  -4.926  135.837 1.00 140.96 ? 494 GLU B N   1 
ATOM   8269  C CA  . GLU B 1 494 ? 54.205  -4.613  134.517 1.00 142.79 ? 494 GLU B CA  1 
ATOM   8270  C C   . GLU B 1 494 ? 54.664  -5.869  133.819 1.00 146.14 ? 494 GLU B C   1 
ATOM   8271  O O   . GLU B 1 494 ? 54.580  -5.970  132.596 1.00 144.40 ? 494 GLU B O   1 
ATOM   8272  C CB  . GLU B 1 494 ? 55.366  -3.618  134.603 1.00 147.50 ? 494 GLU B CB  1 
ATOM   8273  C CG  . GLU B 1 494 ? 54.982  -2.196  134.909 1.00 153.94 ? 494 GLU B CG  1 
ATOM   8274  C CD  . GLU B 1 494 ? 56.156  -1.357  135.352 1.00 161.86 ? 494 GLU B CD  1 
ATOM   8275  O OE1 . GLU B 1 494 ? 57.162  -1.318  134.615 1.00 158.65 ? 494 GLU B OE1 1 
ATOM   8276  O OE2 . GLU B 1 494 ? 56.017  -0.623  136.359 1.00 169.08 ? 494 GLU B OE2 1 
ATOM   8277  N N   . THR B 1 495 ? 55.123  -6.830  134.610 1.00 149.78 ? 495 THR B N   1 
ATOM   8278  C CA  . THR B 1 495 ? 55.549  -8.120  134.093 1.00 142.84 ? 495 THR B CA  1 
ATOM   8279  C C   . THR B 1 495 ? 54.375  -8.863  133.472 1.00 138.04 ? 495 THR B C   1 
ATOM   8280  O O   . THR B 1 495 ? 54.529  -9.581  132.477 1.00 131.88 ? 495 THR B O   1 
ATOM   8281  C CB  . THR B 1 495 ? 56.140  -9.001  135.194 1.00 142.99 ? 495 THR B CB  1 
ATOM   8282  O OG1 . THR B 1 495 ? 56.764  -8.180  136.188 1.00 146.97 ? 495 THR B OG1 1 
ATOM   8283  C CG2 . THR B 1 495 ? 57.150  -9.970  134.602 1.00 143.23 ? 495 THR B CG2 1 
ATOM   8284  N N   . GLY B 1 496 ? 53.206  -8.697  134.086 1.00 145.93 ? 496 GLY B N   1 
ATOM   8285  C CA  . GLY B 1 496 ? 51.995  -9.356  133.636 1.00 153.39 ? 496 GLY B CA  1 
ATOM   8286  C C   . GLY B 1 496 ? 51.466  -10.356 134.642 1.00 151.29 ? 496 GLY B C   1 
ATOM   8287  O O   . GLY B 1 496 ? 50.264  -10.522 134.805 1.00 147.13 ? 496 GLY B O   1 
ATOM   8288  N N   . GLN B 1 497 ? 52.389  -11.006 135.344 1.00 151.67 ? 497 GLN B N   1 
ATOM   8289  C CA  . GLN B 1 497 ? 52.034  -11.982 136.364 1.00 149.31 ? 497 GLN B CA  1 
ATOM   8290  C C   . GLN B 1 497 ? 51.236  -11.280 137.434 1.00 148.20 ? 497 GLN B C   1 
ATOM   8291  O O   . GLN B 1 497 ? 51.706  -10.340 138.075 1.00 141.54 ? 497 GLN B O   1 
ATOM   8292  C CB  . GLN B 1 497 ? 53.293  -12.642 136.963 1.00 149.70 ? 497 GLN B CB  1 
ATOM   8293  C CG  . GLN B 1 497 ? 54.478  -11.690 137.195 1.00 156.70 ? 497 GLN B CG  1 
ATOM   8294  C CD  . GLN B 1 497 ? 55.827  -12.317 136.834 1.00 157.71 ? 497 GLN B CD  1 
ATOM   8295  O OE1 . GLN B 1 497 ? 55.890  -13.168 135.953 1.00 161.55 ? 497 GLN B OE1 1 
ATOM   8296  N NE2 . GLN B 1 497 ? 56.901  -11.918 137.531 1.00 153.67 ? 497 GLN B NE2 1 
ATOM   8297  N N   . VAL B 1 498 ? 50.010  -11.763 137.599 1.00 149.55 ? 498 VAL B N   1 
ATOM   8298  C CA  . VAL B 1 498 ? 49.075  -11.277 138.602 1.00 143.99 ? 498 VAL B CA  1 
ATOM   8299  C C   . VAL B 1 498 ? 48.985  -12.136 139.867 1.00 142.70 ? 498 VAL B C   1 
ATOM   8300  O O   . VAL B 1 498 ? 48.726  -11.602 140.937 1.00 142.73 ? 498 VAL B O   1 
ATOM   8301  C CB  . VAL B 1 498 ? 47.654  -11.111 137.991 1.00 139.12 ? 498 VAL B CB  1 
ATOM   8302  C CG1 . VAL B 1 498 ? 47.665  -10.016 136.921 1.00 133.77 ? 498 VAL B CG1 1 
ATOM   8303  C CG2 . VAL B 1 498 ? 47.147  -12.433 137.418 1.00 139.73 ? 498 VAL B CG2 1 
ATOM   8304  N N   . GLN B 1 499 ? 49.195  -13.450 139.755 1.00 145.10 ? 499 GLN B N   1 
ATOM   8305  C CA  . GLN B 1 499 ? 49.082  -14.342 140.921 1.00 149.81 ? 499 GLN B CA  1 
ATOM   8306  C C   . GLN B 1 499 ? 50.040  -13.994 142.042 1.00 146.67 ? 499 GLN B C   1 
ATOM   8307  O O   . GLN B 1 499 ? 49.663  -13.999 143.214 1.00 138.82 ? 499 GLN B O   1 
ATOM   8308  C CB  . GLN B 1 499 ? 49.315  -15.805 140.527 1.00 155.84 ? 499 GLN B CB  1 
ATOM   8309  C CG  . GLN B 1 499 ? 48.890  -16.823 141.601 1.00 158.84 ? 499 GLN B CG  1 
ATOM   8310  C CD  . GLN B 1 499 ? 49.089  -18.255 141.139 1.00 161.78 ? 499 GLN B CD  1 
ATOM   8311  O OE1 . GLN B 1 499 ? 50.166  -18.837 141.277 1.00 169.84 ? 499 GLN B OE1 1 
ATOM   8312  N NE2 . GLN B 1 499 ? 48.041  -18.823 140.562 1.00 159.86 ? 499 GLN B NE2 1 
ATOM   8313  N N   . LYS B 1 500 ? 51.279  -13.692 141.679 1.00 146.50 ? 500 LYS B N   1 
ATOM   8314  C CA  . LYS B 1 500 ? 52.294  -13.339 142.663 1.00 139.79 ? 500 LYS B CA  1 
ATOM   8315  C C   . LYS B 1 500 ? 51.999  -12.055 143.411 1.00 135.95 ? 500 LYS B C   1 
ATOM   8316  O O   . LYS B 1 500 ? 52.449  -11.884 144.537 1.00 137.31 ? 500 LYS B O   1 
ATOM   8317  C CB  . LYS B 1 500 ? 53.662  -13.241 141.999 1.00 138.69 ? 500 LYS B CB  1 
ATOM   8318  C CG  . LYS B 1 500 ? 54.323  -14.584 141.792 1.00 143.13 ? 500 LYS B CG  1 
ATOM   8319  C CD  . LYS B 1 500 ? 55.680  -14.437 141.137 1.00 148.03 ? 500 LYS B CD  1 
ATOM   8320  C CE  . LYS B 1 500 ? 56.215  -15.794 140.719 1.00 157.56 ? 500 LYS B CE  1 
ATOM   8321  N NZ  . LYS B 1 500 ? 57.438  -15.669 139.892 1.00 162.47 ? 500 LYS B NZ  1 
ATOM   8322  N N   . ILE B 1 501 ? 51.252  -11.155 142.782 1.00 136.68 ? 501 ILE B N   1 
ATOM   8323  C CA  . ILE B 1 501 ? 50.892  -9.883  143.400 1.00 135.38 ? 501 ILE B CA  1 
ATOM   8324  C C   . ILE B 1 501 ? 50.075  -10.083 144.677 1.00 134.83 ? 501 ILE B C   1 
ATOM   8325  O O   . ILE B 1 501 ? 50.363  -9.473  145.706 1.00 134.96 ? 501 ILE B O   1 
ATOM   8326  C CB  . ILE B 1 501 ? 50.097  -8.996  142.424 1.00 133.06 ? 501 ILE B CB  1 
ATOM   8327  C CG1 . ILE B 1 501 ? 51.029  -8.422  141.369 1.00 140.52 ? 501 ILE B CG1 1 
ATOM   8328  C CG2 . ILE B 1 501 ? 49.408  -7.879  143.157 1.00 131.39 ? 501 ILE B CG2 1 
ATOM   8329  C CD1 . ILE B 1 501 ? 50.337  -7.981  140.111 1.00 148.74 ? 501 ILE B CD1 1 
ATOM   8330  N N   . VAL B 1 502 ? 49.043  -10.917 144.598 1.00 133.63 ? 502 VAL B N   1 
ATOM   8331  C CA  . VAL B 1 502 ? 48.166  -11.184 145.740 1.00 138.68 ? 502 VAL B CA  1 
ATOM   8332  C C   . VAL B 1 502 ? 48.867  -11.977 146.841 1.00 143.83 ? 502 VAL B C   1 
ATOM   8333  O O   . VAL B 1 502 ? 48.649  -11.743 148.031 1.00 141.41 ? 502 VAL B O   1 
ATOM   8334  C CB  . VAL B 1 502 ? 46.896  -11.942 145.307 1.00 140.02 ? 502 VAL B CB  1 
ATOM   8335  C CG1 . VAL B 1 502 ? 45.889  -12.000 146.451 1.00 137.59 ? 502 VAL B CG1 1 
ATOM   8336  C CG2 . VAL B 1 502 ? 46.291  -11.281 144.084 1.00 140.35 ? 502 VAL B CG2 1 
ATOM   8337  N N   . LEU B 1 503 ? 49.686  -12.939 146.430 1.00 154.98 ? 503 LEU B N   1 
ATOM   8338  C CA  . LEU B 1 503 ? 50.422  -13.782 147.367 1.00 163.20 ? 503 LEU B CA  1 
ATOM   8339  C C   . LEU B 1 503 ? 51.451  -12.990 148.171 1.00 169.19 ? 503 LEU B C   1 
ATOM   8340  O O   . LEU B 1 503 ? 51.595  -13.195 149.376 1.00 175.48 ? 503 LEU B O   1 
ATOM   8341  C CB  . LEU B 1 503 ? 51.110  -14.931 146.627 1.00 159.27 ? 503 LEU B CB  1 
ATOM   8342  C CG  . LEU B 1 503 ? 50.169  -15.904 145.914 1.00 150.21 ? 503 LEU B CG  1 
ATOM   8343  C CD1 . LEU B 1 503 ? 50.910  -16.703 144.859 1.00 148.58 ? 503 LEU B CD1 1 
ATOM   8344  C CD2 . LEU B 1 503 ? 49.504  -16.829 146.927 1.00 148.89 ? 503 LEU B CD2 1 
ATOM   8345  N N   . TYR B 1 504 ? 52.173  -12.101 147.495 1.00 159.67 ? 504 TYR B N   1 
ATOM   8346  C CA  . TYR B 1 504 ? 53.149  -11.235 148.148 1.00 144.51 ? 504 TYR B CA  1 
ATOM   8347  C C   . TYR B 1 504 ? 52.424  -10.328 149.140 1.00 146.90 ? 504 TYR B C   1 
ATOM   8348  O O   . TYR B 1 504 ? 52.800  -10.231 150.310 1.00 150.32 ? 504 TYR B O   1 
ATOM   8349  C CB  . TYR B 1 504 ? 53.910  -10.414 147.096 1.00 142.98 ? 504 TYR B CB  1 
ATOM   8350  C CG  . TYR B 1 504 ? 54.913  -9.403  147.617 1.00 144.37 ? 504 TYR B CG  1 
ATOM   8351  C CD1 . TYR B 1 504 ? 56.208  -9.787  147.945 1.00 146.82 ? 504 TYR B CD1 1 
ATOM   8352  C CD2 . TYR B 1 504 ? 54.578  -8.060  147.746 1.00 150.91 ? 504 TYR B CD2 1 
ATOM   8353  C CE1 . TYR B 1 504 ? 57.135  -8.866  148.397 1.00 149.07 ? 504 TYR B CE1 1 
ATOM   8354  C CE2 . TYR B 1 504 ? 55.499  -7.132  148.203 1.00 155.64 ? 504 TYR B CE2 1 
ATOM   8355  C CZ  . TYR B 1 504 ? 56.772  -7.542  148.526 1.00 153.81 ? 504 TYR B CZ  1 
ATOM   8356  O OH  . TYR B 1 504 ? 57.686  -6.622  148.977 1.00 156.79 ? 504 TYR B OH  1 
ATOM   8357  N N   . ALA B 1 505 ? 51.391  -9.650  148.648 1.00 144.92 ? 505 ALA B N   1 
ATOM   8358  C CA  . ALA B 1 505 ? 50.558  -8.756  149.453 1.00 155.81 ? 505 ALA B CA  1 
ATOM   8359  C C   . ALA B 1 505 ? 49.774  -9.460  150.566 1.00 160.63 ? 505 ALA B C   1 
ATOM   8360  O O   . ALA B 1 505 ? 49.018  -8.827  151.300 1.00 156.52 ? 505 ALA B O   1 
ATOM   8361  C CB  . ALA B 1 505 ? 49.604  -7.992  148.546 1.00 157.83 ? 505 ALA B CB  1 
ATOM   8362  N N   . LYS B 1 506 ? 49.902  -10.775 150.657 1.00 164.21 ? 506 LYS B N   1 
ATOM   8363  C CA  . LYS B 1 506 ? 49.250  -11.518 151.731 1.00 163.26 ? 506 LYS B CA  1 
ATOM   8364  C C   . LYS B 1 506 ? 50.306  -11.997 152.727 1.00 171.49 ? 506 LYS B C   1 
ATOM   8365  O O   . LYS B 1 506 ? 50.042  -12.136 153.919 1.00 172.33 ? 506 LYS B O   1 
ATOM   8366  C CB  . LYS B 1 506 ? 48.432  -12.684 151.179 1.00 154.09 ? 506 LYS B CB  1 
ATOM   8367  N N   . LYS B 1 507 ? 51.504  -12.250 152.204 1.00 169.51 ? 507 LYS B N   1 
ATOM   8368  C CA  . LYS B 1 507 ? 52.663  -12.730 152.967 1.00 163.89 ? 507 LYS B CA  1 
ATOM   8369  C C   . LYS B 1 507 ? 53.227  -11.625 153.865 1.00 161.59 ? 507 LYS B C   1 
ATOM   8370  O O   . LYS B 1 507 ? 53.451  -11.817 155.062 1.00 167.86 ? 507 LYS B O   1 
ATOM   8371  C CB  . LYS B 1 507 ? 53.724  -13.234 151.990 1.00 164.60 ? 507 LYS B CB  1 
ATOM   8372  C CG  . LYS B 1 507 ? 55.110  -13.271 152.549 1.00 173.63 ? 507 LYS B CG  1 
ATOM   8373  C CD  . LYS B 1 507 ? 55.310  -14.514 153.380 1.00 179.81 ? 507 LYS B CD  1 
ATOM   8374  C CE  . LYS B 1 507 ? 55.023  -15.764 152.569 1.00 178.41 ? 507 LYS B CE  1 
ATOM   8375  N NZ  . LYS B 1 507 ? 54.017  -16.622 153.249 1.00 178.86 ? 507 LYS B NZ  1 
ATOM   8376  N N   . VAL B 1 508 ? 53.461  -10.477 153.237 1.00 156.39 ? 508 VAL B N   1 
ATOM   8377  C CA  . VAL B 1 508 ? 53.818  -9.243  153.898 1.00 156.59 ? 508 VAL B CA  1 
ATOM   8378  C C   . VAL B 1 508 ? 52.547  -8.667  154.482 1.00 159.08 ? 508 VAL B C   1 
ATOM   8379  O O   . VAL B 1 508 ? 52.559  -8.025  155.494 1.00 160.33 ? 508 VAL B O   1 
ATOM   8380  C CB  . VAL B 1 508 ? 54.382  -8.155  152.885 1.00 121.89 ? 508 VAL B CB  1 
ATOM   8381  C CG1 . VAL B 1 508 ? 54.469  -6.743  153.515 1.00 124.55 ? 508 VAL B CG1 1 
ATOM   8382  C CG2 . VAL B 1 508 ? 55.670  -8.553  152.166 1.00 115.55 ? 508 VAL B CG2 1 
ATOM   8383  N N   . GLY B 1 509 ? 51.431  -8.956  153.846 1.00 172.20 ? 509 GLY B N   1 
ATOM   8384  C CA  . GLY B 1 509 ? 50.224  -8.311  154.271 1.00 181.03 ? 509 GLY B CA  1 
ATOM   8385  C C   . GLY B 1 509 ? 50.110  -6.866  153.766 1.00 186.43 ? 509 GLY B C   1 
ATOM   8386  O O   . GLY B 1 509 ? 49.160  -6.185  154.181 1.00 187.64 ? 509 GLY B O   1 
ATOM   8387  N N   . TYR B 1 510 ? 50.935  -6.400  152.814 1.00 182.91 ? 510 TYR B N   1 
ATOM   8388  C CA  . TYR B 1 510 ? 50.824  -4.960  152.425 1.00 173.46 ? 510 TYR B CA  1 
ATOM   8389  C C   . TYR B 1 510 ? 49.569  -4.564  151.641 1.00 159.90 ? 510 TYR B C   1 
ATOM   8390  O O   . TYR B 1 510 ? 49.272  -5.143  150.597 1.00 149.95 ? 510 TYR B O   1 
ATOM   8391  C CB  . TYR B 1 510 ? 52.049  -4.454  151.603 1.00 150.32 ? 510 TYR B CB  1 
ATOM   8392  C CG  . TYR B 1 510 ? 51.913  -2.989  151.039 1.00 154.89 ? 510 TYR B CG  1 
ATOM   8393  C CD1 . TYR B 1 510 ? 51.521  -1.913  151.860 1.00 166.75 ? 510 TYR B CD1 1 
ATOM   8394  C CD2 . TYR B 1 510 ? 52.168  -2.692  149.697 1.00 148.99 ? 510 TYR B CD2 1 
ATOM   8395  C CE1 . TYR B 1 510 ? 51.392  -0.597  151.355 1.00 173.61 ? 510 TYR B CE1 1 
ATOM   8396  C CE2 . TYR B 1 510 ? 52.041  -1.381  149.193 1.00 151.30 ? 510 TYR B CE2 1 
ATOM   8397  C CZ  . TYR B 1 510 ? 51.654  -0.344  150.026 1.00 167.48 ? 510 TYR B CZ  1 
ATOM   8398  O OH  . TYR B 1 510 ? 51.522  0.947   149.551 1.00 167.25 ? 510 TYR B OH  1 
ATOM   8399  N N   . THR B 1 511 ? 48.889  -3.518  152.131 1.00 156.82 ? 511 THR B N   1 
ATOM   8400  C CA  . THR B 1 511 ? 47.658  -2.994  151.509 1.00 151.64 ? 511 THR B CA  1 
ATOM   8401  C C   . THR B 1 511 ? 47.822  -1.924  150.426 1.00 146.12 ? 511 THR B C   1 
ATOM   8402  O O   . THR B 1 511 ? 48.264  -0.806  150.694 1.00 152.04 ? 511 THR B O   1 
ATOM   8403  C CB  . THR B 1 511 ? 46.688  -2.366  152.556 1.00 150.71 ? 511 THR B CB  1 
ATOM   8404  O OG1 . THR B 1 511 ? 47.032  -0.991  152.791 1.00 158.87 ? 511 THR B OG1 1 
ATOM   8405  C CG2 . THR B 1 511 ? 46.711  -3.137  153.872 1.00 145.00 ? 511 THR B CG2 1 
ATOM   8406  N N   . PRO B 1 512 ? 47.478  -2.281  149.186 1.00 137.92 ? 512 PRO B N   1 
ATOM   8407  C CA  . PRO B 1 512 ? 47.457  -1.340  148.067 1.00 134.96 ? 512 PRO B CA  1 
ATOM   8408  C C   . PRO B 1 512 ? 46.014  -0.907  147.745 1.00 137.21 ? 512 PRO B C   1 
ATOM   8409  O O   . PRO B 1 512 ? 45.081  -1.496  148.303 1.00 152.66 ? 512 PRO B O   1 
ATOM   8410  C CB  . PRO B 1 512 ? 48.105  -2.143  146.942 1.00 138.00 ? 512 PRO B CB  1 
ATOM   8411  C CG  . PRO B 1 512 ? 47.810  -3.605  147.287 1.00 142.85 ? 512 PRO B CG  1 
ATOM   8412  C CD  . PRO B 1 512 ? 47.372  -3.676  148.728 1.00 143.76 ? 512 PRO B CD  1 
ATOM   8413  N N   . ASP B 1 513 ? 45.830  -0.050  146.743 1.00 131.53 ? 513 ASP B N   1 
ATOM   8414  C CA  . ASP B 1 513 ? 44.517  0.522   146.434 1.00 130.46 ? 513 ASP B CA  1 
ATOM   8415  C C   . ASP B 1 513 ? 43.723  -0.543  145.707 1.00 127.53 ? 513 ASP B C   1 
ATOM   8416  O O   . ASP B 1 513 ? 42.494  -0.587  145.786 1.00 143.07 ? 513 ASP B O   1 
ATOM   8417  C CB  . ASP B 1 513 ? 44.693  1.826   145.615 1.00 136.11 ? 513 ASP B CB  1 
ATOM   8418  C CG  . ASP B 1 513 ? 43.392  2.610   145.405 1.00 142.45 ? 513 ASP B CG  1 
ATOM   8419  O OD1 . ASP B 1 513 ? 43.481  3.853   145.312 1.00 139.02 ? 513 ASP B OD1 1 
ATOM   8420  O OD2 . ASP B 1 513 ? 42.290  2.025   145.410 1.00 149.46 ? 513 ASP B OD2 1 
ATOM   8421  N N   . TRP B 1 514 ? 44.457  -1.473  145.110 1.00 123.26 ? 514 TRP B N   1 
ATOM   8422  C CA  . TRP B 1 514 ? 43.890  -2.585  144.349 1.00 121.74 ? 514 TRP B CA  1 
ATOM   8423  C C   . TRP B 1 514 ? 43.019  -2.256  143.164 1.00 122.01 ? 514 TRP B C   1 
ATOM   8424  O O   . TRP B 1 514 ? 43.200  -2.841  142.099 1.00 138.26 ? 514 TRP B O   1 
ATOM   8425  C CB  . TRP B 1 514 ? 43.092  -3.519  145.249 1.00 122.18 ? 514 TRP B CB  1 
ATOM   8426  C CG  . TRP B 1 514 ? 43.917  -4.423  146.078 1.00 128.90 ? 514 TRP B CG  1 
ATOM   8427  C CD1 . TRP B 1 514 ? 43.834  -4.625  147.428 1.00 127.72 ? 514 TRP B CD1 1 
ATOM   8428  C CD2 . TRP B 1 514 ? 44.966  -5.276  145.608 1.00 142.65 ? 514 TRP B CD2 1 
ATOM   8429  N NE1 . TRP B 1 514 ? 44.772  -5.550  147.824 1.00 128.63 ? 514 TRP B NE1 1 
ATOM   8430  C CE2 . TRP B 1 514 ? 45.480  -5.959  146.727 1.00 130.26 ? 514 TRP B CE2 1 
ATOM   8431  C CE3 . TRP B 1 514 ? 45.535  -5.510  144.356 1.00 152.59 ? 514 TRP B CE3 1 
ATOM   8432  C CZ2 . TRP B 1 514 ? 46.524  -6.873  146.625 1.00 129.31 ? 514 TRP B CZ2 1 
ATOM   8433  C CZ3 . TRP B 1 514 ? 46.572  -6.408  144.263 1.00 149.53 ? 514 TRP B CZ3 1 
ATOM   8434  C CH2 . TRP B 1 514 ? 47.045  -7.093  145.386 1.00 140.98 ? 514 TRP B CH2 1 
ATOM   8435  N N   . ILE B 1 515 ? 42.062  -1.359  143.340 1.00 121.44 ? 515 ILE B N   1 
ATOM   8436  C CA  . ILE B 1 515 ? 41.235  -0.968  142.223 1.00 117.37 ? 515 ILE B CA  1 
ATOM   8437  C C   . ILE B 1 515 ? 42.204  -0.336  141.226 1.00 114.20 ? 515 ILE B C   1 
ATOM   8438  O O   . ILE B 1 515 ? 42.183  -0.646  140.035 1.00 111.13 ? 515 ILE B O   1 
ATOM   8439  C CB  . ILE B 1 515 ? 40.108  0.019   142.624 1.00 114.18 ? 515 ILE B CB  1 
ATOM   8440  C CG1 . ILE B 1 515 ? 39.467  -0.371  143.964 1.00 121.27 ? 515 ILE B CG1 1 
ATOM   8441  C CG2 . ILE B 1 515 ? 39.110  0.160   141.494 1.00 113.16 ? 515 ILE B CG2 1 
ATOM   8442  C CD1 . ILE B 1 515 ? 38.787  -1.737  143.994 1.00 122.92 ? 515 ILE B CD1 1 
ATOM   8443  N N   . PHE B 1 516 ? 43.060  0.542   141.748 1.00 116.70 ? 516 PHE B N   1 
ATOM   8444  C CA  . PHE B 1 516 ? 44.106  1.217   140.979 1.00 113.16 ? 516 PHE B CA  1 
ATOM   8445  C C   . PHE B 1 516 ? 45.055  0.202   140.359 1.00 110.92 ? 516 PHE B C   1 
ATOM   8446  O O   . PHE B 1 516 ? 45.568  0.385   139.247 1.00 110.81 ? 516 PHE B O   1 
ATOM   8447  C CB  . PHE B 1 516 ? 44.865  2.181   141.888 1.00 110.85 ? 516 PHE B CB  1 
ATOM   8448  C CG  . PHE B 1 516 ? 46.126  2.729   141.290 1.00 121.05 ? 516 PHE B CG  1 
ATOM   8449  C CD1 . PHE B 1 516 ? 46.077  3.701   140.306 1.00 112.25 ? 516 PHE B CD1 1 
ATOM   8450  C CD2 . PHE B 1 516 ? 47.361  2.293   141.733 1.00 134.75 ? 516 PHE B CD2 1 
ATOM   8451  C CE1 . PHE B 1 516 ? 47.236  4.217   139.764 1.00 122.05 ? 516 PHE B CE1 1 
ATOM   8452  C CE2 . PHE B 1 516 ? 48.527  2.804   141.197 1.00 129.99 ? 516 PHE B CE2 1 
ATOM   8453  C CZ  . PHE B 1 516 ? 48.466  3.769   140.210 1.00 126.28 ? 516 PHE B CZ  1 
ATOM   8454  N N   . LEU B 1 517 ? 45.299  -0.867  141.106 1.00 106.59 ? 517 LEU B N   1 
ATOM   8455  C CA  . LEU B 1 517 ? 46.081  -1.971  140.584 1.00 105.43 ? 517 LEU B CA  1 
ATOM   8456  C C   . LEU B 1 517 ? 45.313  -2.767  139.545 1.00 104.64 ? 517 LEU B C   1 
ATOM   8457  O O   . LEU B 1 517 ? 45.899  -3.198  138.557 1.00 104.05 ? 517 LEU B O   1 
ATOM   8458  C CB  . LEU B 1 517 ? 46.575  -2.874  141.698 1.00 106.81 ? 517 LEU B CB  1 
ATOM   8459  C CG  . LEU B 1 517 ? 47.637  -2.145  142.509 1.00 109.90 ? 517 LEU B CG  1 
ATOM   8460  C CD1 . LEU B 1 517 ? 48.120  -3.068  143.575 1.00 111.39 ? 517 LEU B CD1 1 
ATOM   8461  C CD2 . LEU B 1 517 ? 48.794  -1.724  141.634 1.00 125.92 ? 517 LEU B CD2 1 
ATOM   8462  N N   . LEU B 1 518 ? 44.015  -2.968  139.761 1.00 107.58 ? 518 LEU B N   1 
ATOM   8463  C CA  . LEU B 1 518 ? 43.212  -3.668  138.770 1.00 104.44 ? 518 LEU B CA  1 
ATOM   8464  C C   . LEU B 1 518 ? 43.225  -2.923  137.441 1.00 103.15 ? 518 LEU B C   1 
ATOM   8465  O O   . LEU B 1 518 ? 43.571  -3.526  136.427 1.00 120.58 ? 518 LEU B O   1 
ATOM   8466  C CB  . LEU B 1 518 ? 41.771  -3.860  139.252 1.00 99.05  ? 518 LEU B CB  1 
ATOM   8467  C CG  . LEU B 1 518 ? 41.132  -5.166  138.770 1.00 101.46 ? 518 LEU B CG  1 
ATOM   8468  C CD1 . LEU B 1 518 ? 40.504  -5.908  139.937 1.00 102.66 ? 518 LEU B CD1 1 
ATOM   8469  C CD2 . LEU B 1 518 ? 40.104  -4.913  137.686 1.00 101.41 ? 518 LEU B CD2 1 
ATOM   8470  N N   . ARG B 1 519 ? 42.869  -1.631  137.433 1.00 94.79  ? 519 ARG B N   1 
ATOM   8471  C CA  . ARG B 1 519 ? 42.882  -0.877  136.175 1.00 93.90  ? 519 ARG B CA  1 
ATOM   8472  C C   . ARG B 1 519 ? 44.278  -0.950  135.569 1.00 101.46 ? 519 ARG B C   1 
ATOM   8473  O O   . ARG B 1 519 ? 44.416  -1.084  134.351 1.00 98.22  ? 519 ARG B O   1 
ATOM   8474  C CB  . ARG B 1 519 ? 42.475  0.611   136.286 1.00 91.80  ? 519 ARG B CB  1 
ATOM   8475  C CG  . ARG B 1 519 ? 42.017  1.229   137.594 1.00 93.02  ? 519 ARG B CG  1 
ATOM   8476  C CD  . ARG B 1 519 ? 41.662  2.687   137.280 1.00 99.31  ? 519 ARG B CD  1 
ATOM   8477  N NE  . ARG B 1 519 ? 40.236  2.912   137.058 1.00 104.17 ? 519 ARG B NE  1 
ATOM   8478  C CZ  . ARG B 1 519 ? 39.400  3.373   137.981 1.00 111.04 ? 519 ARG B CZ  1 
ATOM   8479  N NH1 . ARG B 1 519 ? 38.117  3.537   137.693 1.00 110.36 ? 519 ARG B NH1 1 
ATOM   8480  N NH2 . ARG B 1 519 ? 39.859  3.713   139.177 1.00 113.33 ? 519 ARG B NH2 1 
ATOM   8481  N N   . ASN B 1 520 ? 45.304  -0.888  136.421 1.00 102.72 ? 520 ASN B N   1 
ATOM   8482  C CA  . ASN B 1 520 ? 46.687  -0.934  135.954 1.00 94.36  ? 520 ASN B CA  1 
ATOM   8483  C C   . ASN B 1 520 ? 46.945  -2.197  135.160 1.00 97.11  ? 520 ASN B C   1 
ATOM   8484  O O   . ASN B 1 520 ? 47.519  -2.156  134.070 1.00 96.49  ? 520 ASN B O   1 
ATOM   8485  C CB  . ASN B 1 520 ? 47.650  -0.867  137.134 1.00 95.84  ? 520 ASN B CB  1 
ATOM   8486  N N   . VAL B 1 521 ? 46.495  -3.315  135.707 1.00 96.28  ? 521 VAL B N   1 
ATOM   8487  C CA  . VAL B 1 521 ? 46.604  -4.596  135.045 1.00 96.79  ? 521 VAL B CA  1 
ATOM   8488  C C   . VAL B 1 521 ? 45.731  -4.575  133.782 1.00 98.80  ? 521 VAL B C   1 
ATOM   8489  O O   . VAL B 1 521 ? 46.166  -4.972  132.699 1.00 118.40 ? 521 VAL B O   1 
ATOM   8490  C CB  . VAL B 1 521 ? 46.217  -5.741  136.019 1.00 100.07 ? 521 VAL B CB  1 
ATOM   8491  C CG1 . VAL B 1 521 ? 45.831  -7.002  135.263 1.00 99.90  ? 521 VAL B CG1 1 
ATOM   8492  C CG2 . VAL B 1 521 ? 47.371  -6.018  136.978 1.00 101.74 ? 521 VAL B CG2 1 
ATOM   8493  N N   . MET B 1 522 ? 44.511  -4.063  133.928 1.00 97.34  ? 522 MET B N   1 
ATOM   8494  C CA  . MET B 1 522 ? 43.522  -4.036  132.846 1.00 96.86  ? 522 MET B CA  1 
ATOM   8495  C C   . MET B 1 522 ? 43.956  -3.282  131.582 1.00 98.40  ? 522 MET B C   1 
ATOM   8496  O O   . MET B 1 522 ? 43.589  -3.690  130.483 1.00 96.71  ? 522 MET B O   1 
ATOM   8497  C CB  . MET B 1 522 ? 42.198  -3.458  133.353 1.00 110.02 ? 522 MET B CB  1 
ATOM   8498  C CG  . MET B 1 522 ? 41.471  -4.362  134.335 1.00 125.58 ? 522 MET B CG  1 
ATOM   8499  S SD  . MET B 1 522 ? 40.508  -5.653  133.516 1.00 115.41 ? 522 MET B SD  1 
ATOM   8500  C CE  . MET B 1 522 ? 39.658  -4.705  132.262 1.00 100.58 ? 522 MET B CE  1 
ATOM   8501  N N   . ARG B 1 523 ? 44.692  -2.182  131.731 1.00 108.97 ? 523 ARG B N   1 
ATOM   8502  C CA  . ARG B 1 523 ? 45.139  -1.416  130.575 1.00 107.34 ? 523 ARG B CA  1 
ATOM   8503  C C   . ARG B 1 523 ? 46.007  -2.339  129.730 1.00 119.17 ? 523 ARG B C   1 
ATOM   8504  O O   . ARG B 1 523 ? 45.723  -2.607  128.559 1.00 126.65 ? 523 ARG B O   1 
ATOM   8505  C CB  . ARG B 1 523 ? 45.960  -0.183  131.002 1.00 102.66 ? 523 ARG B CB  1 
ATOM   8506  C CG  . ARG B 1 523 ? 45.280  0.854   131.886 1.00 114.39 ? 523 ARG B CG  1 
ATOM   8507  C CD  . ARG B 1 523 ? 46.120  2.130   131.980 1.00 106.23 ? 523 ARG B CD  1 
ATOM   8508  N NE  . ARG B 1 523 ? 45.638  3.122   132.952 1.00 118.15 ? 523 ARG B NE  1 
ATOM   8509  C CZ  . ARG B 1 523 ? 45.524  2.937   134.265 1.00 135.90 ? 523 ARG B CZ  1 
ATOM   8510  N NH1 . ARG B 1 523 ? 45.840  1.783   134.804 1.00 140.68 ? 523 ARG B NH1 1 
ATOM   8511  N NH2 . ARG B 1 523 ? 45.073  3.914   135.036 1.00 137.92 ? 523 ARG B NH2 1 
ATOM   8512  N N   . ILE B 1 524 ? 47.048  -2.852  130.371 1.00 115.49 ? 524 ILE B N   1 
ATOM   8513  C CA  . ILE B 1 524 ? 48.027  -3.717  129.745 1.00 118.06 ? 524 ILE B CA  1 
ATOM   8514  C C   . ILE B 1 524 ? 47.421  -5.009  129.172 1.00 125.46 ? 524 ILE B C   1 
ATOM   8515  O O   . ILE B 1 524 ? 47.685  -5.355  128.017 1.00 150.85 ? 524 ILE B O   1 
ATOM   8516  C CB  . ILE B 1 524 ? 49.151  -4.048  130.774 1.00 95.45  ? 524 ILE B CB  1 
ATOM   8517  C CG1 . ILE B 1 524 ? 50.196  -2.924  130.796 1.00 95.71  ? 524 ILE B CG1 1 
ATOM   8518  C CG2 . ILE B 1 524 ? 49.818  -5.380  130.465 1.00 103.98 ? 524 ILE B CG2 1 
ATOM   8519  C CD1 . ILE B 1 524 ? 50.703  -2.549  132.189 1.00 91.21  ? 524 ILE B CD1 1 
ATOM   8520  N N   . SER B 1 525 ? 46.589  -5.701  129.951 1.00 104.75 ? 525 SER B N   1 
ATOM   8521  C CA  . SER B 1 525 ? 46.094  -7.015  129.534 1.00 105.19 ? 525 SER B CA  1 
ATOM   8522  C C   . SER B 1 525 ? 44.721  -7.432  130.089 1.00 113.96 ? 525 SER B C   1 
ATOM   8523  O O   . SER B 1 525 ? 44.586  -7.693  131.287 1.00 139.42 ? 525 SER B O   1 
ATOM   8524  C CB  . SER B 1 525 ? 47.135  -8.073  129.893 1.00 119.17 ? 525 SER B CB  1 
ATOM   8525  O OG  . SER B 1 525 ? 48.236  -8.001  129.008 1.00 153.60 ? 525 SER B OG  1 
ATOM   8526  N N   . PRO B 1 526 ? 43.689  -7.462  129.227 1.00 103.47 ? 526 PRO B N   1 
ATOM   8527  C CA  . PRO B 1 526 ? 42.339  -7.847  129.659 1.00 102.80 ? 526 PRO B CA  1 
ATOM   8528  C C   . PRO B 1 526 ? 42.242  -9.288  130.156 1.00 104.98 ? 526 PRO B C   1 
ATOM   8529  O O   . PRO B 1 526 ? 41.500  -9.570  131.101 1.00 104.56 ? 526 PRO B O   1 
ATOM   8530  C CB  . PRO B 1 526 ? 41.510  -7.695  128.380 1.00 105.27 ? 526 PRO B CB  1 
ATOM   8531  C CG  . PRO B 1 526 ? 42.241  -6.692  127.577 1.00 120.74 ? 526 PRO B CG  1 
ATOM   8532  C CD  . PRO B 1 526 ? 43.695  -7.012  127.825 1.00 120.89 ? 526 PRO B CD  1 
ATOM   8533  N N   . ASP B 1 527 ? 43.005  -10.179 129.532 1.00 105.95 ? 527 ASP B N   1 
ATOM   8534  C CA  . ASP B 1 527 ? 42.956  -11.601 129.854 1.00 113.58 ? 527 ASP B CA  1 
ATOM   8535  C C   . ASP B 1 527 ? 43.286  -11.855 131.310 1.00 128.47 ? 527 ASP B C   1 
ATOM   8536  O O   . ASP B 1 527 ? 42.623  -12.639 131.991 1.00 139.10 ? 527 ASP B O   1 
ATOM   8537  C CB  . ASP B 1 527 ? 43.941  -12.376 128.980 1.00 106.78 ? 527 ASP B CB  1 
ATOM   8538  N N   . GLN B 1 528 ? 44.359  -11.219 131.757 1.00 125.43 ? 528 GLN B N   1 
ATOM   8539  C CA  . GLN B 1 528 ? 44.802  -11.296 133.138 1.00 121.30 ? 528 GLN B CA  1 
ATOM   8540  C C   . GLN B 1 528 ? 43.922  -10.475 134.080 1.00 109.63 ? 528 GLN B C   1 
ATOM   8541  O O   . GLN B 1 528 ? 43.805  -10.804 135.258 1.00 116.21 ? 528 GLN B O   1 
ATOM   8542  C CB  . GLN B 1 528 ? 46.251  -10.873 133.212 1.00 126.84 ? 528 GLN B CB  1 
ATOM   8543  C CG  . GLN B 1 528 ? 47.156  -11.987 132.736 1.00 132.69 ? 528 GLN B CG  1 
ATOM   8544  C CD  . GLN B 1 528 ? 48.576  -11.532 132.569 1.00 144.09 ? 528 GLN B CD  1 
ATOM   8545  O OE1 . GLN B 1 528 ? 48.828  -10.541 131.889 1.00 143.51 ? 528 GLN B OE1 1 
ATOM   8546  N NE2 . GLN B 1 528 ? 49.521  -12.250 133.185 1.00 157.84 ? 528 GLN B NE2 1 
ATOM   8547  N N   . GLY B 1 529 ? 43.366  -9.379  133.560 1.00 105.90 ? 529 GLY B N   1 
ATOM   8548  C CA  . GLY B 1 529 ? 42.470  -8.516  134.309 1.00 105.32 ? 529 GLY B CA  1 
ATOM   8549  C C   . GLY B 1 529 ? 41.371  -9.344  134.935 1.00 107.98 ? 529 GLY B C   1 
ATOM   8550  O O   . GLY B 1 529 ? 41.050  -9.192  136.113 1.00 107.95 ? 529 GLY B O   1 
ATOM   8551  N N   . GLN B 1 530 ? 40.777  -10.211 134.124 1.00 106.73 ? 530 GLN B N   1 
ATOM   8552  C CA  . GLN B 1 530 ? 39.732  -11.107 134.596 1.00 115.06 ? 530 GLN B CA  1 
ATOM   8553  C C   . GLN B 1 530 ? 40.326  -12.100 135.598 1.00 112.68 ? 530 GLN B C   1 
ATOM   8554  O O   . GLN B 1 530 ? 39.713  -12.411 136.621 1.00 114.10 ? 530 GLN B O   1 
ATOM   8555  C CB  . GLN B 1 530 ? 39.078  -11.823 133.412 1.00 128.44 ? 530 GLN B CB  1 
ATOM   8556  C CG  . GLN B 1 530 ? 37.850  -12.637 133.741 1.00 139.98 ? 530 GLN B CG  1 
ATOM   8557  C CD  . GLN B 1 530 ? 37.487  -13.577 132.620 1.00 141.35 ? 530 GLN B CD  1 
ATOM   8558  O OE1 . GLN B 1 530 ? 38.362  -14.164 131.992 1.00 138.88 ? 530 GLN B OE1 1 
ATOM   8559  N NE2 . GLN B 1 530 ? 36.194  -13.701 132.338 1.00 143.41 ? 530 GLN B NE2 1 
ATOM   8560  N N   . GLN B 1 531 ? 41.534  -12.573 135.293 1.00 118.93 ? 531 GLN B N   1 
ATOM   8561  C CA  . GLN B 1 531 ? 42.258  -13.511 136.150 1.00 121.49 ? 531 GLN B CA  1 
ATOM   8562  C C   . GLN B 1 531 ? 42.597  -12.875 137.486 1.00 116.65 ? 531 GLN B C   1 
ATOM   8563  O O   . GLN B 1 531 ? 42.402  -13.469 138.547 1.00 117.56 ? 531 GLN B O   1 
ATOM   8564  C CB  . GLN B 1 531 ? 43.537  -13.993 135.462 1.00 137.85 ? 531 GLN B CB  1 
ATOM   8565  C CG  . GLN B 1 531 ? 43.703  -15.511 135.442 1.00 151.24 ? 531 GLN B CG  1 
ATOM   8566  C CD  . GLN B 1 531 ? 44.328  -16.063 136.712 1.00 159.08 ? 531 GLN B CD  1 
ATOM   8567  O OE1 . GLN B 1 531 ? 45.538  -15.963 136.914 1.00 160.89 ? 531 GLN B OE1 1 
ATOM   8568  N NE2 . GLN B 1 531 ? 43.503  -16.644 137.578 1.00 157.22 ? 531 GLN B NE2 1 
ATOM   8569  N N   . PHE B 1 532 ? 43.120  -11.659 137.420 1.00 117.99 ? 532 PHE B N   1 
ATOM   8570  C CA  . PHE B 1 532 ? 43.467  -10.924 138.615 1.00 115.22 ? 532 PHE B CA  1 
ATOM   8571  C C   . PHE B 1 532 ? 42.227  -10.680 139.462 1.00 117.70 ? 532 PHE B C   1 
ATOM   8572  O O   . PHE B 1 532 ? 42.201  -11.010 140.649 1.00 127.45 ? 532 PHE B O   1 
ATOM   8573  C CB  . PHE B 1 532 ? 44.138  -9.614  138.213 1.00 114.41 ? 532 PHE B CB  1 
ATOM   8574  C CG  . PHE B 1 532 ? 44.534  -8.763  139.361 1.00 115.97 ? 532 PHE B CG  1 
ATOM   8575  C CD1 . PHE B 1 532 ? 45.145  -9.306  140.474 1.00 128.43 ? 532 PHE B CD1 1 
ATOM   8576  C CD2 . PHE B 1 532 ? 44.325  -7.402  139.305 1.00 116.46 ? 532 PHE B CD2 1 
ATOM   8577  C CE1 . PHE B 1 532 ? 45.510  -8.502  141.518 1.00 126.89 ? 532 PHE B CE1 1 
ATOM   8578  C CE2 . PHE B 1 532 ? 44.693  -6.594  140.339 1.00 118.66 ? 532 PHE B CE2 1 
ATOM   8579  C CZ  . PHE B 1 532 ? 45.285  -7.141  141.445 1.00 119.14 ? 532 PHE B CZ  1 
ATOM   8580  N N   . ALA B 1 533 ? 41.160  -10.237 138.805 1.00 114.94 ? 533 ALA B N   1 
ATOM   8581  C CA  . ALA B 1 533 ? 39.882  -9.947  139.452 1.00 113.78 ? 533 ALA B CA  1 
ATOM   8582  C C   . ALA B 1 533 ? 39.337  -11.145 140.217 1.00 118.25 ? 533 ALA B C   1 
ATOM   8583  O O   . ALA B 1 533 ? 38.644  -10.986 141.222 1.00 118.52 ? 533 ALA B O   1 
ATOM   8584  C CB  . ALA B 1 533 ? 38.873  -9.492  138.421 1.00 112.80 ? 533 ALA B CB  1 
ATOM   8585  N N   . GLN B 1 534 ? 39.628  -12.342 139.722 1.00 125.27 ? 534 GLN B N   1 
ATOM   8586  C CA  . GLN B 1 534 ? 39.179  -13.557 140.391 1.00 129.51 ? 534 GLN B CA  1 
ATOM   8587  C C   . GLN B 1 534 ? 39.773  -13.696 141.799 1.00 127.25 ? 534 GLN B C   1 
ATOM   8588  O O   . GLN B 1 534 ? 39.107  -14.197 142.708 1.00 125.11 ? 534 GLN B O   1 
ATOM   8589  C CB  . GLN B 1 534 ? 39.513  -14.804 139.568 1.00 135.93 ? 534 GLN B CB  1 
ATOM   8590  C CG  . GLN B 1 534 ? 38.899  -16.049 140.198 1.00 151.48 ? 534 GLN B CG  1 
ATOM   8591  C CD  . GLN B 1 534 ? 39.738  -17.305 140.029 1.00 156.97 ? 534 GLN B CD  1 
ATOM   8592  O OE1 . GLN B 1 534 ? 39.587  -18.053 139.064 1.00 156.86 ? 534 GLN B OE1 1 
ATOM   8593  N NE2 . GLN B 1 534 ? 40.705  -17.481 140.925 1.00 156.68 ? 534 GLN B NE2 1 
ATOM   8594  N N   . MET B 1 535 ? 41.033  -13.292 141.966 1.00 131.39 ? 535 MET B N   1 
ATOM   8595  C CA  . MET B 1 535 ? 41.716  -13.352 143.268 1.00 134.19 ? 535 MET B CA  1 
ATOM   8596  C C   . MET B 1 535 ? 41.111  -12.402 144.309 1.00 127.23 ? 535 MET B C   1 
ATOM   8597  O O   . MET B 1 535 ? 41.094  -12.707 145.506 1.00 128.58 ? 535 MET B O   1 
ATOM   8598  C CB  . MET B 1 535 ? 43.204  -13.008 143.126 1.00 134.74 ? 535 MET B CB  1 
ATOM   8599  C CG  . MET B 1 535 ? 44.195  -14.161 142.948 1.00 128.99 ? 535 MET B CG  1 
ATOM   8600  S SD  . MET B 1 535 ? 44.533  -14.403 141.195 1.00 132.10 ? 535 MET B SD  1 
ATOM   8601  C CE  . MET B 1 535 ? 45.611  -13.014 140.885 1.00 128.75 ? 535 MET B CE  1 
ATOM   8602  N N   . LEU B 1 536 ? 40.620  -11.252 143.849 1.00 124.34 ? 536 LEU B N   1 
ATOM   8603  C CA  . LEU B 1 536 ? 40.069  -10.245 144.749 1.00 127.26 ? 536 LEU B CA  1 
ATOM   8604  C C   . LEU B 1 536 ? 38.816  -10.794 145.409 1.00 140.02 ? 536 LEU B C   1 
ATOM   8605  O O   . LEU B 1 536 ? 38.492  -10.446 146.537 1.00 154.22 ? 536 LEU B O   1 
ATOM   8606  C CB  . LEU B 1 536 ? 39.776  -8.939  144.002 1.00 127.16 ? 536 LEU B CB  1 
ATOM   8607  C CG  . LEU B 1 536 ? 41.017  -8.065  143.762 1.00 124.50 ? 536 LEU B CG  1 
ATOM   8608  C CD1 . LEU B 1 536 ? 41.826  -8.517  142.492 1.00 123.68 ? 536 LEU B CD1 1 
ATOM   8609  C CD2 . LEU B 1 536 ? 40.728  -6.556  143.766 1.00 124.92 ? 536 LEU B CD2 1 
ATOM   8610  N N   . VAL B 1 537 ? 38.107  -11.681 144.733 1.00 135.59 ? 537 VAL B N   1 
ATOM   8611  C CA  . VAL B 1 537 ? 36.991  -12.279 145.434 1.00 133.04 ? 537 VAL B CA  1 
ATOM   8612  C C   . VAL B 1 537 ? 37.338  -13.710 145.785 1.00 140.98 ? 537 VAL B C   1 
ATOM   8613  O O   . VAL B 1 537 ? 37.367  -14.600 144.935 1.00 152.98 ? 537 VAL B O   1 
ATOM   8614  C CB  . VAL B 1 537 ? 35.655  -12.220 144.663 1.00 131.36 ? 537 VAL B CB  1 
ATOM   8615  C CG1 . VAL B 1 537 ? 34.561  -12.826 145.522 1.00 144.19 ? 537 VAL B CG1 1 
ATOM   8616  C CG2 . VAL B 1 537 ? 35.306  -10.783 144.308 1.00 128.54 ? 537 VAL B CG2 1 
ATOM   8617  N N   . GLN B 1 538 ? 37.636  -13.890 147.068 1.00 139.37 ? 538 GLN B N   1 
ATOM   8618  C CA  . GLN B 1 538 ? 37.922  -15.199 147.644 1.00 143.38 ? 538 GLN B CA  1 
ATOM   8619  C C   . GLN B 1 538 ? 37.286  -15.145 149.048 1.00 156.88 ? 538 GLN B C   1 
ATOM   8620  O O   . GLN B 1 538 ? 36.479  -14.256 149.310 1.00 159.36 ? 538 GLN B O   1 
ATOM   8621  C CB  . GLN B 1 538 ? 39.433  -15.503 147.704 1.00 144.23 ? 538 GLN B CB  1 
ATOM   8622  C CG  . GLN B 1 538 ? 40.157  -15.760 146.333 1.00 130.60 ? 538 GLN B CG  1 
ATOM   8623  C CD  . GLN B 1 538 ? 39.569  -16.862 145.439 1.00 127.00 ? 538 GLN B CD  1 
ATOM   8624  O OE1 . GLN B 1 538 ? 39.129  -17.919 145.908 1.00 130.07 ? 538 GLN B OE1 1 
ATOM   8625  N NE2 . GLN B 1 538 ? 39.557  -16.597 144.126 1.00 114.08 ? 538 GLN B NE2 1 
ATOM   8626  N N   . ASP B 1 539 ? 37.602  -16.080 149.938 1.00 163.98 ? 539 ASP B N   1 
ATOM   8627  C CA  . ASP B 1 539 ? 36.791  -16.241 151.154 1.00 165.09 ? 539 ASP B CA  1 
ATOM   8628  C C   . ASP B 1 539 ? 36.818  -15.151 152.250 1.00 160.34 ? 539 ASP B C   1 
ATOM   8629  O O   . ASP B 1 539 ? 37.821  -14.471 152.500 1.00 162.00 ? 539 ASP B O   1 
ATOM   8630  C CB  . ASP B 1 539 ? 37.143  -17.577 151.836 1.00 162.40 ? 539 ASP B CB  1 
ATOM   8631  C CG  . ASP B 1 539 ? 36.086  -18.681 151.615 1.00 153.44 ? 539 ASP B CG  1 
ATOM   8632  O OD1 . ASP B 1 539 ? 36.052  -19.301 150.522 1.00 152.52 ? 539 ASP B OD1 1 
ATOM   8633  O OD2 . ASP B 1 539 ? 35.306  -18.950 152.558 1.00 156.59 ? 539 ASP B OD2 1 
ATOM   8634  N N   . GLU B 1 540 ? 35.643  -14.997 152.859 1.00 153.93 ? 540 GLU B N   1 
ATOM   8635  C CA  . GLU B 1 540 ? 35.395  -14.253 154.106 1.00 160.56 ? 540 GLU B CA  1 
ATOM   8636  C C   . GLU B 1 540 ? 35.672  -12.753 154.286 1.00 169.69 ? 540 GLU B C   1 
ATOM   8637  O O   . GLU B 1 540 ? 34.934  -12.099 155.017 1.00 177.65 ? 540 GLU B O   1 
ATOM   8638  C CB  . GLU B 1 540 ? 36.129  -15.038 155.200 1.00 165.58 ? 540 GLU B CB  1 
ATOM   8639  C CG  . GLU B 1 540 ? 35.641  -16.440 155.313 1.00 167.18 ? 540 GLU B CG  1 
ATOM   8640  C CD  . GLU B 1 540 ? 35.737  -16.869 156.737 1.00 168.50 ? 540 GLU B CD  1 
ATOM   8641  O OE1 . GLU B 1 540 ? 35.837  -15.952 157.584 1.00 168.60 ? 540 GLU B OE1 1 
ATOM   8642  O OE2 . GLU B 1 540 ? 35.668  -18.081 157.026 1.00 164.53 ? 540 GLU B OE2 1 
ATOM   8643  N N   . GLU B 1 541 ? 36.696  -12.229 153.627 1.00 170.74 ? 541 GLU B N   1 
ATOM   8644  C CA  . GLU B 1 541 ? 37.033  -10.813 153.666 1.00 167.39 ? 541 GLU B CA  1 
ATOM   8645  C C   . GLU B 1 541 ? 37.241  -10.384 152.235 1.00 169.32 ? 541 GLU B C   1 
ATOM   8646  O O   . GLU B 1 541 ? 38.376  -10.264 151.806 1.00 167.95 ? 541 GLU B O   1 
ATOM   8647  C CB  . GLU B 1 541 ? 38.284  -10.556 154.513 1.00 160.13 ? 541 GLU B CB  1 
ATOM   8648  C CG  . GLU B 1 541 ? 38.685  -11.718 155.397 1.00 166.35 ? 541 GLU B CG  1 
ATOM   8649  C CD  . GLU B 1 541 ? 38.562  -11.413 156.881 1.00 176.61 ? 541 GLU B CD  1 
ATOM   8650  O OE1 . GLU B 1 541 ? 38.679  -10.225 157.231 1.00 181.86 ? 541 GLU B OE1 1 
ATOM   8651  O OE2 . GLU B 1 541 ? 38.383  -12.346 157.701 1.00 179.69 ? 541 GLU B OE2 1 
ATOM   8652  N N   . PRO B 1 542 ? 36.132  -10.296 151.465 1.00 163.95 ? 542 PRO B N   1 
ATOM   8653  C CA  . PRO B 1 542 ? 36.189  -9.922  150.046 1.00 158.57 ? 542 PRO B CA  1 
ATOM   8654  C C   . PRO B 1 542 ? 37.275  -8.892  149.801 1.00 157.68 ? 542 PRO B C   1 
ATOM   8655  O O   . PRO B 1 542 ? 37.205  -7.768  150.295 1.00 162.52 ? 542 PRO B O   1 
ATOM   8656  C CB  . PRO B 1 542 ? 34.809  -9.336  149.796 1.00 155.87 ? 542 PRO B CB  1 
ATOM   8657  C CG  . PRO B 1 542 ? 33.910  -10.058 150.736 1.00 157.29 ? 542 PRO B CG  1 
ATOM   8658  C CD  . PRO B 1 542 ? 34.739  -10.449 151.942 1.00 157.65 ? 542 PRO B CD  1 
ATOM   8659  N N   . LEU B 1 543 ? 38.284  -9.298  149.042 1.00 147.14 ? 543 LEU B N   1 
ATOM   8660  C CA  . LEU B 1 543 ? 39.417  -8.432  148.811 1.00 137.80 ? 543 LEU B CA  1 
ATOM   8661  C C   . LEU B 1 543 ? 38.913  -7.361  147.858 1.00 139.36 ? 543 LEU B C   1 
ATOM   8662  O O   . LEU B 1 543 ? 38.761  -7.608  146.664 1.00 143.74 ? 543 LEU B O   1 
ATOM   8663  C CB  . LEU B 1 543 ? 40.604  -9.200  148.219 1.00 138.00 ? 543 LEU B CB  1 
ATOM   8664  C CG  . LEU B 1 543 ? 41.073  -10.427 149.019 1.00 144.26 ? 543 LEU B CG  1 
ATOM   8665  C CD1 . LEU B 1 543 ? 42.040  -11.295 148.219 1.00 143.17 ? 543 LEU B CD1 1 
ATOM   8666  C CD2 . LEU B 1 543 ? 41.667  -10.066 150.366 1.00 157.72 ? 543 LEU B CD2 1 
ATOM   8667  N N   . ALA B 1 544 ? 38.589  -6.203  148.427 1.00 143.66 ? 544 ALA B N   1 
ATOM   8668  C CA  . ALA B 1 544 ? 38.062  -5.050  147.705 1.00 141.46 ? 544 ALA B CA  1 
ATOM   8669  C C   . ALA B 1 544 ? 36.607  -5.281  147.276 1.00 130.67 ? 544 ALA B C   1 
ATOM   8670  O O   . ALA B 1 544 ? 36.103  -6.406  147.261 1.00 129.13 ? 544 ALA B O   1 
ATOM   8671  C CB  . ALA B 1 544 ? 38.938  -4.699  146.512 1.00 140.32 ? 544 ALA B CB  1 
ATOM   8672  N N   . ASP B 1 545 ? 35.941  -4.188  146.925 1.00 126.08 ? 545 ASP B N   1 
ATOM   8673  C CA  . ASP B 1 545 ? 34.522  -4.202  146.579 1.00 128.26 ? 545 ASP B CA  1 
ATOM   8674  C C   . ASP B 1 545 ? 34.195  -4.744  145.171 1.00 132.81 ? 545 ASP B C   1 
ATOM   8675  O O   . ASP B 1 545 ? 34.791  -4.320  144.179 1.00 132.00 ? 545 ASP B O   1 
ATOM   8676  C CB  . ASP B 1 545 ? 34.001  -2.776  146.751 1.00 131.93 ? 545 ASP B CB  1 
ATOM   8677  C CG  . ASP B 1 545 ? 32.506  -2.710  146.825 1.00 145.28 ? 545 ASP B CG  1 
ATOM   8678  O OD1 . ASP B 1 545 ? 31.980  -2.954  147.932 1.00 157.11 ? 545 ASP B OD1 1 
ATOM   8679  O OD2 . ASP B 1 545 ? 31.857  -2.394  145.810 1.00 147.55 ? 545 ASP B OD2 1 
ATOM   8680  N N   . ILE B 1 546 ? 33.267  -5.700  145.103 1.00 139.26 ? 546 ILE B N   1 
ATOM   8681  C CA  . ILE B 1 546 ? 32.861  -6.322  143.837 1.00 131.67 ? 546 ILE B CA  1 
ATOM   8682  C C   . ILE B 1 546 ? 32.190  -5.336  142.901 1.00 112.54 ? 546 ILE B C   1 
ATOM   8683  O O   . ILE B 1 546 ? 32.369  -5.399  141.688 1.00 110.50 ? 546 ILE B O   1 
ATOM   8684  C CB  . ILE B 1 546 ? 31.886  -7.512  144.031 1.00 126.59 ? 546 ILE B CB  1 
ATOM   8685  C CG1 . ILE B 1 546 ? 32.113  -8.205  145.379 1.00 136.61 ? 546 ILE B CG1 1 
ATOM   8686  C CG2 . ILE B 1 546 ? 32.011  -8.498  142.864 1.00 117.32 ? 546 ILE B CG2 1 
ATOM   8687  C CD1 . ILE B 1 546 ? 31.387  -7.564  146.553 1.00 142.47 ? 546 ILE B CD1 1 
ATOM   8688  N N   . THR B 1 547 ? 31.375  -4.456  143.469 1.00 109.25 ? 547 THR B N   1 
ATOM   8689  C CA  . THR B 1 547 ? 30.706  -3.442  142.673 1.00 108.32 ? 547 THR B CA  1 
ATOM   8690  C C   . THR B 1 547 ? 31.742  -2.545  142.013 1.00 109.14 ? 547 THR B C   1 
ATOM   8691  O O   . THR B 1 547 ? 31.593  -2.177  140.854 1.00 105.51 ? 547 THR B O   1 
ATOM   8692  C CB  . THR B 1 547 ? 29.749  -2.564  143.509 1.00 114.27 ? 547 THR B CB  1 
ATOM   8693  O OG1 . THR B 1 547 ? 28.940  -3.392  144.354 1.00 129.27 ? 547 THR B OG1 1 
ATOM   8694  C CG2 . THR B 1 547 ? 28.855  -1.738  142.591 1.00 113.48 ? 547 THR B CG2 1 
ATOM   8695  N N   . GLN B 1 548 ? 32.782  -2.175  142.753 1.00 113.81 ? 548 GLN B N   1 
ATOM   8696  C CA  . GLN B 1 548 ? 33.842  -1.342  142.193 1.00 109.69 ? 548 GLN B CA  1 
ATOM   8697  C C   . GLN B 1 548 ? 34.648  -2.027  141.099 1.00 107.29 ? 548 GLN B C   1 
ATOM   8698  O O   . GLN B 1 548 ? 35.118  -1.365  140.178 1.00 103.95 ? 548 GLN B O   1 
ATOM   8699  C CB  . GLN B 1 548 ? 34.795  -0.873  143.293 1.00 106.03 ? 548 GLN B CB  1 
ATOM   8700  C CG  . GLN B 1 548 ? 34.447  0.469   143.894 1.00 110.62 ? 548 GLN B CG  1 
ATOM   8701  C CD  . GLN B 1 548 ? 35.403  0.883   144.995 1.00 121.20 ? 548 GLN B CD  1 
ATOM   8702  O OE1 . GLN B 1 548 ? 35.554  0.174   145.988 1.00 126.91 ? 548 GLN B OE1 1 
ATOM   8703  N NE2 . GLN B 1 548 ? 36.034  2.039   144.839 1.00 122.20 ? 548 GLN B NE2 1 
ATOM   8704  N N   . ILE B 1 549 ? 34.858  -3.334  141.196 1.00 103.07 ? 549 ILE B N   1 
ATOM   8705  C CA  . ILE B 1 549 ? 35.634  -3.984  140.145 1.00 102.40 ? 549 ILE B CA  1 
ATOM   8706  C C   . ILE B 1 549 ? 34.819  -4.151  138.860 1.00 109.15 ? 549 ILE B C   1 
ATOM   8707  O O   . ILE B 1 549 ? 35.378  -4.056  137.766 1.00 112.99 ? 549 ILE B O   1 
ATOM   8708  C CB  . ILE B 1 549 ? 36.240  -5.335  140.602 1.00 105.26 ? 549 ILE B CB  1 
ATOM   8709  C CG1 . ILE B 1 549 ? 35.160  -6.340  140.996 1.00 110.99 ? 549 ILE B CG1 1 
ATOM   8710  C CG2 . ILE B 1 549 ? 37.192  -5.108  141.763 1.00 107.19 ? 549 ILE B CG2 1 
ATOM   8711  C CD1 . ILE B 1 549 ? 35.677  -7.447  141.899 1.00 109.69 ? 549 ILE B CD1 1 
ATOM   8712  N N   . VAL B 1 550 ? 33.521  -4.426  138.970 1.00 115.94 ? 550 VAL B N   1 
ATOM   8713  C CA  . VAL B 1 550 ? 32.730  -4.596  137.757 1.00 103.18 ? 550 VAL B CA  1 
ATOM   8714  C C   . VAL B 1 550 ? 32.582  -3.299  136.955 1.00 101.16 ? 550 VAL B C   1 
ATOM   8715  O O   . VAL B 1 550 ? 32.572  -3.346  135.728 1.00 118.91 ? 550 VAL B O   1 
ATOM   8716  C CB  . VAL B 1 550 ? 31.313  -5.174  138.048 1.00 101.44 ? 550 VAL B CB  1 
ATOM   8717  C CG1 . VAL B 1 550 ? 31.418  -6.510  138.751 1.00 102.72 ? 550 VAL B CG1 1 
ATOM   8718  C CG2 . VAL B 1 550 ? 30.440  -4.199  138.822 1.00 101.23 ? 550 VAL B CG2 1 
ATOM   8719  N N   . ASP B 1 551 ? 32.472  -2.145  137.608 1.00 98.06  ? 551 ASP B N   1 
ATOM   8720  C CA  . ASP B 1 551 ? 32.365  -0.918  136.828 1.00 108.52 ? 551 ASP B CA  1 
ATOM   8721  C C   . ASP B 1 551 ? 33.722  -0.564  136.222 1.00 97.37  ? 551 ASP B C   1 
ATOM   8722  O O   . ASP B 1 551 ? 33.797  0.286   135.341 1.00 95.67  ? 551 ASP B O   1 
ATOM   8723  C CB  . ASP B 1 551 ? 31.770  0.252   137.634 1.00 129.21 ? 551 ASP B CB  1 
ATOM   8724  C CG  . ASP B 1 551 ? 32.386  0.423   138.995 1.00 148.91 ? 551 ASP B CG  1 
ATOM   8725  O OD1 . ASP B 1 551 ? 33.616  0.558   139.090 1.00 164.70 ? 551 ASP B OD1 1 
ATOM   8726  O OD2 . ASP B 1 551 ? 31.612  0.468   139.974 1.00 142.94 ? 551 ASP B OD2 1 
ATOM   8727  N N   . VAL B 1 552 ? 34.796  -1.180  136.713 1.00 102.36 ? 552 VAL B N   1 
ATOM   8728  C CA  . VAL B 1 552 ? 36.101  -1.026  136.066 1.00 100.64 ? 552 VAL B CA  1 
ATOM   8729  C C   . VAL B 1 552 ? 36.078  -1.822  134.762 1.00 98.65  ? 552 VAL B C   1 
ATOM   8730  O O   . VAL B 1 552 ? 36.603  -1.375  133.739 1.00 99.21  ? 552 VAL B O   1 
ATOM   8731  C CB  . VAL B 1 552 ? 37.270  -1.504  136.945 1.00 99.09  ? 552 VAL B CB  1 
ATOM   8732  C CG1 . VAL B 1 552 ? 38.545  -1.631  136.119 1.00 98.40  ? 552 VAL B CG1 1 
ATOM   8733  C CG2 . VAL B 1 552 ? 37.484  -0.540  138.093 1.00 112.29 ? 552 VAL B CG2 1 
ATOM   8734  N N   . PHE B 1 553 ? 35.478  -3.010  134.810 1.00 97.59  ? 553 PHE B N   1 
ATOM   8735  C CA  . PHE B 1 553 ? 35.303  -3.829  133.616 1.00 97.91  ? 553 PHE B CA  1 
ATOM   8736  C C   . PHE B 1 553 ? 34.490  -3.045  132.602 1.00 99.32  ? 553 PHE B C   1 
ATOM   8737  O O   . PHE B 1 553 ? 34.810  -2.993  131.418 1.00 97.24  ? 553 PHE B O   1 
ATOM   8738  C CB  . PHE B 1 553 ? 34.566  -5.132  133.927 1.00 98.80  ? 553 PHE B CB  1 
ATOM   8739  C CG  . PHE B 1 553 ? 35.455  -6.265  134.341 1.00 103.91 ? 553 PHE B CG  1 
ATOM   8740  C CD1 . PHE B 1 553 ? 36.163  -6.988  133.396 1.00 107.65 ? 553 PHE B CD1 1 
ATOM   8741  C CD2 . PHE B 1 553 ? 35.552  -6.633  135.669 1.00 112.41 ? 553 PHE B CD2 1 
ATOM   8742  C CE1 . PHE B 1 553 ? 36.969  -8.041  133.772 1.00 111.15 ? 553 PHE B CE1 1 
ATOM   8743  C CE2 . PHE B 1 553 ? 36.356  -7.685  136.055 1.00 106.96 ? 553 PHE B CE2 1 
ATOM   8744  C CZ  . PHE B 1 553 ? 37.067  -8.393  135.104 1.00 105.78 ? 553 PHE B CZ  1 
ATOM   8745  N N   . MET B 1 554 ? 33.418  -2.442  133.098 1.00 99.14  ? 554 MET B N   1 
ATOM   8746  C CA  . MET B 1 554 ? 32.495  -1.666  132.278 1.00 95.65  ? 554 MET B CA  1 
ATOM   8747  C C   . MET B 1 554 ? 33.162  -0.458  131.630 1.00 97.15  ? 554 MET B C   1 
ATOM   8748  O O   . MET B 1 554 ? 32.780  -0.046  130.534 1.00 98.94  ? 554 MET B O   1 
ATOM   8749  C CB  . MET B 1 554 ? 31.288  -1.244  133.109 1.00 108.81 ? 554 MET B CB  1 
ATOM   8750  C CG  . MET B 1 554 ? 30.483  -2.435  133.608 1.00 118.36 ? 554 MET B CG  1 
ATOM   8751  S SD  . MET B 1 554 ? 29.949  -3.519  132.266 1.00 129.36 ? 554 MET B SD  1 
ATOM   8752  C CE  . MET B 1 554 ? 28.301  -2.899  131.987 1.00 127.51 ? 554 MET B CE  1 
ATOM   8753  N N   . GLU B 1 555 ? 34.149  0.109   132.316 1.00 106.84 ? 555 GLU B N   1 
ATOM   8754  C CA  . GLU B 1 555 ? 34.890  1.248   131.794 1.00 112.00 ? 555 GLU B CA  1 
ATOM   8755  C C   . GLU B 1 555 ? 35.578  0.890   130.474 1.00 118.95 ? 555 GLU B C   1 
ATOM   8756  O O   . GLU B 1 555 ? 35.591  1.679   129.524 1.00 129.57 ? 555 GLU B O   1 
ATOM   8757  C CB  . GLU B 1 555 ? 35.934  1.719   132.812 1.00 112.40 ? 555 GLU B CB  1 
ATOM   8758  C CG  . GLU B 1 555 ? 35.398  2.497   134.012 1.00 129.22 ? 555 GLU B CG  1 
ATOM   8759  C CD  . GLU B 1 555 ? 36.512  2.925   134.952 1.00 146.51 ? 555 GLU B CD  1 
ATOM   8760  O OE1 . GLU B 1 555 ? 36.219  3.389   136.076 1.00 144.60 ? 555 GLU B OE1 1 
ATOM   8761  O OE2 . GLU B 1 555 ? 37.690  2.799   134.556 1.00 155.26 ? 555 GLU B OE2 1 
ATOM   8762  N N   . TYR B 1 556 ? 36.142  -0.311  130.426 1.00 108.55 ? 556 TYR B N   1 
ATOM   8763  C CA  . TYR B 1 556 ? 36.789  -0.815  129.224 1.00 104.13 ? 556 TYR B CA  1 
ATOM   8764  C C   . TYR B 1 556 ? 35.842  -1.504  128.252 1.00 111.78 ? 556 TYR B C   1 
ATOM   8765  O O   . TYR B 1 556 ? 36.273  -1.947  127.189 1.00 114.86 ? 556 TYR B O   1 
ATOM   8766  C CB  . TYR B 1 556 ? 37.914  -1.776  129.608 1.00 96.94  ? 556 TYR B CB  1 
ATOM   8767  C CG  . TYR B 1 556 ? 39.067  -1.091  130.297 1.00 102.31 ? 556 TYR B CG  1 
ATOM   8768  C CD1 . TYR B 1 556 ? 39.920  -0.277  129.576 1.00 102.05 ? 556 TYR B CD1 1 
ATOM   8769  C CD2 . TYR B 1 556 ? 39.308  -1.257  131.657 1.00 102.31 ? 556 TYR B CD2 1 
ATOM   8770  C CE1 . TYR B 1 556 ? 40.971  0.354   130.175 1.00 98.02  ? 556 TYR B CE1 1 
ATOM   8771  C CE2 . TYR B 1 556 ? 40.369  -0.621  132.273 1.00 101.14 ? 556 TYR B CE2 1 
ATOM   8772  C CZ  . TYR B 1 556 ? 41.196  0.186   131.524 1.00 102.62 ? 556 TYR B CZ  1 
ATOM   8773  O OH  . TYR B 1 556 ? 42.253  0.829   132.122 1.00 114.40 ? 556 TYR B OH  1 
ATOM   8774  N N   . ASN B 1 557 ? 34.558  -1.564  128.599 1.00 113.38 ? 557 ASN B N   1 
ATOM   8775  C CA  . ASN B 1 557 ? 33.577  -2.233  127.758 1.00 121.58 ? 557 ASN B CA  1 
ATOM   8776  C C   . ASN B 1 557 ? 34.003  -3.686  127.556 1.00 128.80 ? 557 ASN B C   1 
ATOM   8777  O O   . ASN B 1 557 ? 33.958  -4.210  126.445 1.00 135.00 ? 557 ASN B O   1 
ATOM   8778  C CB  . ASN B 1 557 ? 33.412  -1.513  126.412 1.00 126.70 ? 557 ASN B CB  1 
ATOM   8779  C CG  . ASN B 1 557 ? 32.014  -0.949  126.209 1.00 143.79 ? 557 ASN B CG  1 
ATOM   8780  O OD1 . ASN B 1 557 ? 31.707  0.158   126.649 1.00 155.14 ? 557 ASN B OD1 1 
ATOM   8781  N ND2 . ASN B 1 557 ? 31.167  -1.704  125.519 1.00 140.62 ? 557 ASN B ND2 1 
ATOM   8782  N N   . LEU B 1 558 ? 34.428  -4.324  128.645 1.00 123.64 ? 558 LEU B N   1 
ATOM   8783  C CA  . LEU B 1 558 ? 34.752  -5.743  128.625 1.00 108.92 ? 558 LEU B CA  1 
ATOM   8784  C C   . LEU B 1 558 ? 33.605  -6.467  129.312 1.00 100.49 ? 558 LEU B C   1 
ATOM   8785  O O   . LEU B 1 558 ? 33.822  -7.214  130.269 1.00 110.12 ? 558 LEU B O   1 
ATOM   8786  C CB  . LEU B 1 558 ? 36.071  -6.023  129.366 1.00 106.99 ? 558 LEU B CB  1 
ATOM   8787  C CG  . LEU B 1 558 ? 37.376  -6.220  128.589 1.00 110.21 ? 558 LEU B CG  1 
ATOM   8788  C CD1 . LEU B 1 558 ? 37.133  -7.135  127.415 1.00 120.08 ? 558 LEU B CD1 1 
ATOM   8789  C CD2 . LEU B 1 558 ? 37.938  -4.896  128.123 1.00 111.45 ? 558 LEU B CD2 1 
ATOM   8790  N N   . ILE B 1 559 ? 32.401  -6.264  128.769 1.00 101.34 ? 559 ILE B N   1 
ATOM   8791  C CA  . ILE B 1 559 ? 31.144  -6.757  129.326 1.00 104.04 ? 559 ILE B CA  1 
ATOM   8792  C C   . ILE B 1 559 ? 31.101  -8.263  129.365 1.00 115.04 ? 559 ILE B C   1 
ATOM   8793  O O   . ILE B 1 559 ? 30.804  -8.864  130.401 1.00 122.29 ? 559 ILE B O   1 
ATOM   8794  C CB  . ILE B 1 559 ? 29.943  -6.232  128.501 1.00 102.69 ? 559 ILE B CB  1 
ATOM   8795  C CG1 . ILE B 1 559 ? 28.823  -7.282  128.401 1.00 119.33 ? 559 ILE B CG1 1 
ATOM   8796  C CG2 . ILE B 1 559 ? 30.411  -5.816  127.126 1.00 118.18 ? 559 ILE B CG2 1 
ATOM   8797  C CD1 . ILE B 1 559 ? 27.745  -7.164  129.468 1.00 134.32 ? 559 ILE B CD1 1 
ATOM   8798  N N   . GLN B 1 560 ? 31.508  -8.865  128.257 1.00 118.80 ? 560 GLN B N   1 
ATOM   8799  C CA  . GLN B 1 560 ? 31.395  -10.304 128.086 1.00 114.89 ? 560 GLN B CA  1 
ATOM   8800  C C   . GLN B 1 560 ? 32.177  -11.107 129.130 1.00 101.62 ? 560 GLN B C   1 
ATOM   8801  O O   . GLN B 1 560 ? 31.700  -12.145 129.589 1.00 113.26 ? 560 GLN B O   1 
ATOM   8802  C CB  . GLN B 1 560 ? 31.801  -10.665 126.656 1.00 132.27 ? 560 GLN B CB  1 
ATOM   8803  C CG  . GLN B 1 560 ? 33.128  -10.064 126.203 1.00 155.81 ? 560 GLN B CG  1 
ATOM   8804  C CD  . GLN B 1 560 ? 32.939  -8.757  125.437 1.00 158.61 ? 560 GLN B CD  1 
ATOM   8805  O OE1 . GLN B 1 560 ? 33.210  -7.672  125.953 1.00 153.91 ? 560 GLN B OE1 1 
ATOM   8806  N NE2 . GLN B 1 560 ? 32.500  -8.863  124.189 1.00 153.52 ? 560 GLN B NE2 1 
ATOM   8807  N N   . GLN B 1 561 ? 33.359  -10.630 129.504 1.00 97.55  ? 561 GLN B N   1 
ATOM   8808  C CA  . GLN B 1 561 ? 34.144  -11.263 130.561 1.00 111.67 ? 561 GLN B CA  1 
ATOM   8809  C C   . GLN B 1 561 ? 33.621  -10.952 131.966 1.00 118.23 ? 561 GLN B C   1 
ATOM   8810  O O   . GLN B 1 561 ? 33.775  -11.766 132.880 1.00 134.93 ? 561 GLN B O   1 
ATOM   8811  C CB  . GLN B 1 561 ? 35.620  -10.867 130.459 1.00 120.25 ? 561 GLN B CB  1 
ATOM   8812  C CG  . GLN B 1 561 ? 35.998  -10.013 129.247 1.00 130.87 ? 561 GLN B CG  1 
ATOM   8813  C CD  . GLN B 1 561 ? 35.989  -10.787 127.932 1.00 139.01 ? 561 GLN B CD  1 
ATOM   8814  O OE1 . GLN B 1 561 ? 35.408  -11.868 127.835 1.00 154.99 ? 561 GLN B OE1 1 
ATOM   8815  N NE2 . GLN B 1 561 ? 36.632  -10.230 126.912 1.00 134.53 ? 561 GLN B NE2 1 
ATOM   8816  N N   . CYS B 1 562 ? 33.034  -9.766  132.138 1.00 109.84 ? 562 CYS B N   1 
ATOM   8817  C CA  . CYS B 1 562 ? 32.512  -9.324  133.436 1.00 104.18 ? 562 CYS B CA  1 
ATOM   8818  C C   . CYS B 1 562 ? 31.460  -10.315 133.873 1.00 97.89  ? 562 CYS B C   1 
ATOM   8819  O O   . CYS B 1 562 ? 31.400  -10.724 135.029 1.00 103.96 ? 562 CYS B O   1 
ATOM   8820  C CB  . CYS B 1 562 ? 31.929  -7.911  133.339 1.00 112.74 ? 562 CYS B CB  1 
ATOM   8821  S SG  . CYS B 1 562 ? 31.324  -7.188  134.887 1.00 97.84  ? 562 CYS B SG  1 
ATOM   8822  N N   . THR B 1 563 ? 30.618  -10.681 132.920 1.00 94.88  ? 563 THR B N   1 
ATOM   8823  C CA  . THR B 1 563 ? 29.614  -11.704 133.132 1.00 95.27  ? 563 THR B CA  1 
ATOM   8824  C C   . THR B 1 563 ? 30.264  -13.040 133.508 1.00 103.98 ? 563 THR B C   1 
ATOM   8825  O O   . THR B 1 563 ? 29.857  -13.676 134.479 1.00 111.56 ? 563 THR B O   1 
ATOM   8826  C CB  . THR B 1 563 ? 28.739  -11.886 131.893 1.00 98.10  ? 563 THR B CB  1 
ATOM   8827  O OG1 . THR B 1 563 ? 28.160  -10.627 131.524 1.00 96.84  ? 563 THR B OG1 1 
ATOM   8828  C CG2 . THR B 1 563 ? 27.642  -12.893 132.171 1.00 108.84 ? 563 THR B CG2 1 
ATOM   8829  N N   . ALA B 1 564 ? 31.269  -13.455 132.735 1.00 97.27  ? 564 ALA B N   1 
ATOM   8830  C CA  . ALA B 1 564 ? 31.986  -14.710 132.987 1.00 98.77  ? 564 ALA B CA  1 
ATOM   8831  C C   . ALA B 1 564 ? 32.614  -14.722 134.371 1.00 103.07 ? 564 ALA B C   1 
ATOM   8832  O O   . ALA B 1 564 ? 32.582  -15.729 135.082 1.00 115.71 ? 564 ALA B O   1 
ATOM   8833  C CB  . ALA B 1 564 ? 33.063  -14.941 131.926 1.00 102.16 ? 564 ALA B CB  1 
ATOM   8834  N N   . PHE B 1 565 ? 33.215  -13.594 134.725 1.00 101.72 ? 565 PHE B N   1 
ATOM   8835  C CA  . PHE B 1 565 ? 33.814  -13.382 136.036 1.00 110.99 ? 565 PHE B CA  1 
ATOM   8836  C C   . PHE B 1 565 ? 32.800  -13.461 137.176 1.00 120.59 ? 565 PHE B C   1 
ATOM   8837  O O   . PHE B 1 565 ? 33.065  -14.069 138.212 1.00 130.78 ? 565 PHE B O   1 
ATOM   8838  C CB  . PHE B 1 565 ? 34.530  -12.034 136.036 1.00 110.44 ? 565 PHE B CB  1 
ATOM   8839  C CG  . PHE B 1 565 ? 34.547  -11.354 137.366 1.00 105.38 ? 565 PHE B CG  1 
ATOM   8840  C CD1 . PHE B 1 565 ? 35.349  -11.800 138.403 1.00 108.53 ? 565 PHE B CD1 1 
ATOM   8841  C CD2 . PHE B 1 565 ? 33.733  -10.256 137.579 1.00 105.61 ? 565 PHE B CD2 1 
ATOM   8842  C CE1 . PHE B 1 565 ? 35.331  -11.154 139.628 1.00 109.54 ? 565 PHE B CE1 1 
ATOM   8843  C CE2 . PHE B 1 565 ? 33.712  -9.608  138.790 1.00 107.74 ? 565 PHE B CE2 1 
ATOM   8844  C CZ  . PHE B 1 565 ? 34.512  -10.056 139.820 1.00 107.99 ? 565 PHE B CZ  1 
ATOM   8845  N N   . LEU B 1 566 ? 31.628  -12.872 136.965 1.00 117.51 ? 566 LEU B N   1 
ATOM   8846  C CA  . LEU B 1 566 ? 30.594  -12.857 137.994 1.00 103.81 ? 566 LEU B CA  1 
ATOM   8847  C C   . LEU B 1 566 ? 30.001  -14.248 138.184 1.00 107.92 ? 566 LEU B C   1 
ATOM   8848  O O   . LEU B 1 566 ? 29.675  -14.643 139.303 1.00 108.86 ? 566 LEU B O   1 
ATOM   8849  C CB  . LEU B 1 566 ? 29.496  -11.848 137.649 1.00 102.41 ? 566 LEU B CB  1 
ATOM   8850  C CG  . LEU B 1 566 ? 29.927  -10.381 137.739 1.00 103.73 ? 566 LEU B CG  1 
ATOM   8851  C CD1 . LEU B 1 566 ? 29.034  -9.524  136.865 1.00 102.16 ? 566 LEU B CD1 1 
ATOM   8852  C CD2 . LEU B 1 566 ? 29.915  -9.875  139.172 1.00 105.15 ? 566 LEU B CD2 1 
ATOM   8853  N N   . LEU B 1 567 ? 29.858  -14.988 137.090 1.00 106.52 ? 567 LEU B N   1 
ATOM   8854  C CA  . LEU B 1 567 ? 29.359  -16.356 137.166 1.00 107.92 ? 567 LEU B CA  1 
ATOM   8855  C C   . LEU B 1 567 ? 30.355  -17.265 137.886 1.00 113.25 ? 567 LEU B C   1 
ATOM   8856  O O   . LEU B 1 567 ? 29.960  -18.186 138.602 1.00 119.04 ? 567 LEU B O   1 
ATOM   8857  C CB  . LEU B 1 567 ? 29.068  -16.899 135.767 1.00 106.94 ? 567 LEU B CB  1 
ATOM   8858  C CG  . LEU B 1 567 ? 27.839  -16.286 135.091 1.00 110.04 ? 567 LEU B CG  1 
ATOM   8859  C CD1 . LEU B 1 567 ? 27.949  -16.399 133.583 1.00 119.44 ? 567 LEU B CD1 1 
ATOM   8860  C CD2 . LEU B 1 567 ? 26.564  -16.941 135.597 1.00 113.19 ? 567 LEU B CD2 1 
ATOM   8861  N N   . ASP B 1 568 ? 31.644  -16.998 137.697 1.00 113.21 ? 568 ASP B N   1 
ATOM   8862  C CA  . ASP B 1 568 ? 32.690  -17.746 138.384 1.00 122.92 ? 568 ASP B CA  1 
ATOM   8863  C C   . ASP B 1 568 ? 32.667  -17.468 139.880 1.00 121.98 ? 568 ASP B C   1 
ATOM   8864  O O   . ASP B 1 568 ? 32.867  -18.370 140.694 1.00 125.84 ? 568 ASP B O   1 
ATOM   8865  C CB  . ASP B 1 568 ? 34.068  -17.402 137.821 1.00 131.50 ? 568 ASP B CB  1 
ATOM   8866  C CG  . ASP B 1 568 ? 34.528  -18.388 136.774 1.00 141.23 ? 568 ASP B CG  1 
ATOM   8867  O OD1 . ASP B 1 568 ? 33.736  -18.693 135.858 1.00 141.31 ? 568 ASP B OD1 1 
ATOM   8868  O OD2 . ASP B 1 568 ? 35.676  -18.869 136.873 1.00 143.65 ? 568 ASP B OD2 1 
ATOM   8869  N N   . ALA B 1 569 ? 32.433  -16.207 140.229 1.00 116.72 ? 569 ALA B N   1 
ATOM   8870  C CA  . ALA B 1 569 ? 32.358  -15.777 141.623 1.00 125.97 ? 569 ALA B CA  1 
ATOM   8871  C C   . ALA B 1 569 ? 31.185  -16.415 142.362 1.00 132.66 ? 569 ALA B C   1 
ATOM   8872  O O   . ALA B 1 569 ? 31.244  -16.624 143.573 1.00 126.02 ? 569 ALA B O   1 
ATOM   8873  C CB  . ALA B 1 569 ? 32.265  -14.259 141.698 1.00 131.11 ? 569 ALA B CB  1 
ATOM   8874  N N   . LEU B 1 570 ? 30.124  -16.726 141.625 1.00 137.26 ? 570 LEU B N   1 
ATOM   8875  C CA  . LEU B 1 570 ? 28.947  -17.374 142.199 1.00 132.20 ? 570 LEU B CA  1 
ATOM   8876  C C   . LEU B 1 570 ? 29.213  -18.842 142.504 1.00 141.85 ? 570 LEU B C   1 
ATOM   8877  O O   . LEU B 1 570 ? 28.740  -19.364 143.510 1.00 161.16 ? 570 LEU B O   1 
ATOM   8878  C CB  . LEU B 1 570 ? 27.742  -17.245 141.267 1.00 121.59 ? 570 LEU B CB  1 
ATOM   8879  C CG  . LEU B 1 570 ? 26.994  -15.915 141.344 1.00 120.66 ? 570 LEU B CG  1 
ATOM   8880  C CD1 . LEU B 1 570 ? 26.068  -15.763 140.159 1.00 118.87 ? 570 LEU B CD1 1 
ATOM   8881  C CD2 . LEU B 1 570 ? 26.213  -15.816 142.644 1.00 122.43 ? 570 LEU B CD2 1 
ATOM   8882  N N   . LYS B 1 571 ? 29.969  -19.504 141.634 1.00 131.72 ? 571 LYS B N   1 
ATOM   8883  C CA  . LYS B 1 571 ? 30.323  -20.904 141.844 1.00 132.80 ? 571 LYS B CA  1 
ATOM   8884  C C   . LYS B 1 571 ? 31.203  -21.048 143.080 1.00 148.98 ? 571 LYS B C   1 
ATOM   8885  O O   . LYS B 1 571 ? 31.178  -22.075 143.762 1.00 158.38 ? 571 LYS B O   1 
ATOM   8886  C CB  . LYS B 1 571 ? 31.042  -21.469 140.620 1.00 126.40 ? 571 LYS B CB  1 
ATOM   8887  N N   . ASN B 1 572 ? 31.952  -19.996 143.390 1.00 152.30 ? 572 ASN B N   1 
ATOM   8888  C CA  . ASN B 1 572 ? 32.796  -20.005 144.574 1.00 150.30 ? 572 ASN B CA  1 
ATOM   8889  C C   . ASN B 1 572 ? 32.013  -19.507 145.784 1.00 149.93 ? 572 ASN B C   1 
ATOM   8890  O O   . ASN B 1 572 ? 32.583  -19.175 146.822 1.00 150.15 ? 572 ASN B O   1 
ATOM   8891  C CB  . ASN B 1 572 ? 34.042  -19.148 144.359 1.00 143.53 ? 572 ASN B CB  1 
ATOM   8892  N N   . GLN C 1 3   ? 73.027  -55.687 112.855 1.00 162.95 ? 3   GLN C N   1 
ATOM   8893  C CA  . GLN C 1 3   ? 73.106  -54.328 113.368 1.00 161.14 ? 3   GLN C CA  1 
ATOM   8894  C C   . GLN C 1 3   ? 73.519  -54.337 114.836 1.00 155.27 ? 3   GLN C C   1 
ATOM   8895  O O   . GLN C 1 3   ? 73.492  -55.377 115.493 1.00 150.73 ? 3   GLN C O   1 
ATOM   8896  C CB  . GLN C 1 3   ? 71.767  -53.612 113.193 1.00 163.71 ? 3   GLN C CB  1 
ATOM   8897  C CG  . GLN C 1 3   ? 71.873  -52.276 112.483 1.00 166.88 ? 3   GLN C CG  1 
ATOM   8898  C CD  . GLN C 1 3   ? 71.479  -51.113 113.366 1.00 164.34 ? 3   GLN C CD  1 
ATOM   8899  O OE1 . GLN C 1 3   ? 70.320  -50.984 113.756 1.00 148.78 ? 3   GLN C OE1 1 
ATOM   8900  N NE2 . GLN C 1 3   ? 72.446  -50.265 113.698 1.00 170.02 ? 3   GLN C NE2 1 
ATOM   8901  N N   . ILE C 1 4   ? 73.912  -53.175 115.343 1.00 147.72 ? 4   ILE C N   1 
ATOM   8902  C CA  . ILE C 1 4   ? 74.378  -53.061 116.723 1.00 142.89 ? 4   ILE C CA  1 
ATOM   8903  C C   . ILE C 1 4   ? 73.262  -53.168 117.762 1.00 146.81 ? 4   ILE C C   1 
ATOM   8904  O O   . ILE C 1 4   ? 72.106  -52.833 117.498 1.00 133.68 ? 4   ILE C O   1 
ATOM   8905  C CB  . ILE C 1 4   ? 75.126  -51.741 116.942 1.00 132.23 ? 4   ILE C CB  1 
ATOM   8906  C CG1 . ILE C 1 4   ? 74.229  -50.551 116.603 1.00 129.06 ? 4   ILE C CG1 1 
ATOM   8907  C CG2 . ILE C 1 4   ? 76.402  -51.717 116.111 1.00 139.82 ? 4   ILE C CG2 1 
ATOM   8908  C CD1 . ILE C 1 4   ? 74.444  -49.367 117.519 1.00 129.02 ? 4   ILE C CD1 1 
ATOM   8909  N N   . LEU C 1 5   ? 73.632  -53.654 118.942 1.00 145.78 ? 5   LEU C N   1 
ATOM   8910  C CA  . LEU C 1 5   ? 72.737  -53.739 120.088 1.00 130.69 ? 5   LEU C CA  1 
ATOM   8911  C C   . LEU C 1 5   ? 73.471  -53.243 121.330 1.00 128.44 ? 5   LEU C C   1 
ATOM   8912  O O   . LEU C 1 5   ? 74.694  -53.343 121.406 1.00 130.83 ? 5   LEU C O   1 
ATOM   8913  C CB  . LEU C 1 5   ? 72.226  -55.171 120.290 1.00 133.20 ? 5   LEU C CB  1 
ATOM   8914  C CG  . LEU C 1 5   ? 73.022  -56.326 119.684 1.00 141.85 ? 5   LEU C CG  1 
ATOM   8915  C CD1 . LEU C 1 5   ? 73.415  -57.330 120.753 1.00 145.81 ? 5   LEU C CD1 1 
ATOM   8916  C CD2 . LEU C 1 5   ? 72.198  -56.997 118.602 1.00 146.77 ? 5   LEU C CD2 1 
ATOM   8917  N N   . PRO C 1 6   ? 72.729  -52.703 122.312 1.00 124.48 ? 6   PRO C N   1 
ATOM   8918  C CA  . PRO C 1 6   ? 73.415  -52.134 123.474 1.00 120.98 ? 6   PRO C CA  1 
ATOM   8919  C C   . PRO C 1 6   ? 73.855  -53.185 124.487 1.00 123.39 ? 6   PRO C C   1 
ATOM   8920  O O   . PRO C 1 6   ? 74.501  -52.835 125.471 1.00 121.95 ? 6   PRO C O   1 
ATOM   8921  C CB  . PRO C 1 6   ? 72.353  -51.219 124.078 1.00 119.67 ? 6   PRO C CB  1 
ATOM   8922  C CG  . PRO C 1 6   ? 71.066  -51.904 123.758 1.00 122.85 ? 6   PRO C CG  1 
ATOM   8923  C CD  . PRO C 1 6   ? 71.262  -52.607 122.435 1.00 122.66 ? 6   PRO C CD  1 
ATOM   8924  N N   . ILE C 1 7   ? 73.516  -54.449 124.252 1.00 123.15 ? 7   ILE C N   1 
ATOM   8925  C CA  . ILE C 1 7   ? 73.894  -55.513 125.177 1.00 129.46 ? 7   ILE C CA  1 
ATOM   8926  C C   . ILE C 1 7   ? 74.962  -56.444 124.606 1.00 137.48 ? 7   ILE C C   1 
ATOM   8927  O O   . ILE C 1 7   ? 75.228  -56.452 123.402 1.00 152.08 ? 7   ILE C O   1 
ATOM   8928  C CB  . ILE C 1 7   ? 72.679  -56.353 125.604 1.00 132.51 ? 7   ILE C CB  1 
ATOM   8929  C CG1 . ILE C 1 7   ? 72.025  -57.004 124.389 1.00 153.84 ? 7   ILE C CG1 1 
ATOM   8930  C CG2 . ILE C 1 7   ? 71.680  -55.486 126.353 1.00 123.91 ? 7   ILE C CG2 1 
ATOM   8931  C CD1 . ILE C 1 7   ? 72.029  -58.518 124.448 1.00 164.88 ? 7   ILE C CD1 1 
ATOM   8932  N N   . ARG C 1 8   ? 75.564  -57.233 125.489 1.00 128.71 ? 8   ARG C N   1 
ATOM   8933  C CA  . ARG C 1 8   ? 76.568  -58.215 125.095 1.00 128.06 ? 8   ARG C CA  1 
ATOM   8934  C C   . ARG C 1 8   ? 76.218  -59.580 125.682 1.00 137.37 ? 8   ARG C C   1 
ATOM   8935  O O   . ARG C 1 8   ? 76.550  -59.883 126.832 1.00 149.33 ? 8   ARG C O   1 
ATOM   8936  C CB  . ARG C 1 8   ? 77.963  -57.778 125.552 1.00 127.21 ? 8   ARG C CB  1 
ATOM   8937  C CG  . ARG C 1 8   ? 79.104  -58.531 124.880 1.00 132.85 ? 8   ARG C CG  1 
ATOM   8938  C CD  . ARG C 1 8   ? 80.416  -58.352 125.630 1.00 136.38 ? 8   ARG C CD  1 
ATOM   8939  N NE  . ARG C 1 8   ? 80.833  -56.954 125.711 1.00 154.30 ? 8   ARG C NE  1 
ATOM   8940  C CZ  . ARG C 1 8   ? 81.484  -56.432 126.745 1.00 158.56 ? 8   ARG C CZ  1 
ATOM   8941  N NH1 . ARG C 1 8   ? 81.830  -55.152 126.737 1.00 159.99 ? 8   ARG C NH1 1 
ATOM   8942  N NH2 . ARG C 1 8   ? 81.786  -57.190 127.790 1.00 160.29 ? 8   ARG C NH2 1 
ATOM   8943  N N   . PHE C 1 9   ? 75.551  -60.398 124.876 1.00 134.18 ? 9   PHE C N   1 
ATOM   8944  C CA  . PHE C 1 9   ? 75.129  -61.727 125.280 1.00 132.31 ? 9   PHE C CA  1 
ATOM   8945  C C   . PHE C 1 9   ? 76.360  -62.621 125.110 1.00 137.52 ? 9   PHE C C   1 
ATOM   8946  O O   . PHE C 1 9   ? 77.024  -62.552 124.080 1.00 140.36 ? 9   PHE C O   1 
ATOM   8947  C CB  . PHE C 1 9   ? 73.955  -62.178 124.394 1.00 135.77 ? 9   PHE C CB  1 
ATOM   8948  C CG  . PHE C 1 9   ? 73.407  -63.534 124.721 1.00 138.94 ? 9   PHE C CG  1 
ATOM   8949  C CD1 . PHE C 1 9   ? 73.727  -64.646 123.961 1.00 141.87 ? 9   PHE C CD1 1 
ATOM   8950  C CD2 . PHE C 1 9   ? 72.548  -63.686 125.793 1.00 140.16 ? 9   PHE C CD2 1 
ATOM   8951  C CE1 . PHE C 1 9   ? 73.200  -65.889 124.276 1.00 143.61 ? 9   PHE C CE1 1 
ATOM   8952  C CE2 . PHE C 1 9   ? 72.018  -64.914 126.110 1.00 144.23 ? 9   PHE C CE2 1 
ATOM   8953  C CZ  . PHE C 1 9   ? 72.343  -66.019 125.354 1.00 142.88 ? 9   PHE C CZ  1 
ATOM   8954  N N   . GLN C 1 10  ? 76.676  -63.459 126.095 1.00 136.55 ? 10  GLN C N   1 
ATOM   8955  C CA  . GLN C 1 10  ? 77.894  -64.276 126.011 1.00 138.72 ? 10  GLN C CA  1 
ATOM   8956  C C   . GLN C 1 10  ? 77.731  -65.637 126.680 1.00 143.96 ? 10  GLN C C   1 
ATOM   8957  O O   . GLN C 1 10  ? 77.133  -65.746 127.748 1.00 152.30 ? 10  GLN C O   1 
ATOM   8958  C CB  . GLN C 1 10  ? 79.078  -63.525 126.645 1.00 138.45 ? 10  GLN C CB  1 
ATOM   8959  C CG  . GLN C 1 10  ? 80.344  -63.456 125.794 1.00 147.28 ? 10  GLN C CG  1 
ATOM   8960  C CD  . GLN C 1 10  ? 81.498  -64.259 126.379 1.00 164.41 ? 10  GLN C CD  1 
ATOM   8961  O OE1 . GLN C 1 10  ? 81.420  -65.482 126.496 1.00 174.88 ? 10  GLN C OE1 1 
ATOM   8962  N NE2 . GLN C 1 10  ? 82.576  -63.572 126.744 1.00 168.50 ? 10  GLN C NE2 1 
ATOM   8963  N N   . GLU C 1 11  ? 78.276  -66.674 126.054 1.00 145.48 ? 11  GLU C N   1 
ATOM   8964  C CA  . GLU C 1 11  ? 78.263  -68.008 126.650 1.00 147.50 ? 11  GLU C CA  1 
ATOM   8965  C C   . GLU C 1 11  ? 79.644  -68.343 127.195 1.00 151.78 ? 11  GLU C C   1 
ATOM   8966  O O   . GLU C 1 11  ? 80.598  -68.540 126.435 1.00 168.63 ? 11  GLU C O   1 
ATOM   8967  C CB  . GLU C 1 11  ? 77.822  -69.065 125.640 1.00 151.47 ? 11  GLU C CB  1 
ATOM   8968  C CG  . GLU C 1 11  ? 77.418  -70.384 126.275 1.00 160.95 ? 11  GLU C CG  1 
ATOM   8969  C CD  . GLU C 1 11  ? 77.435  -71.525 125.284 1.00 174.52 ? 11  GLU C CD  1 
ATOM   8970  O OE1 . GLU C 1 11  ? 78.496  -71.756 124.668 1.00 176.20 ? 11  GLU C OE1 1 
ATOM   8971  O OE2 . GLU C 1 11  ? 76.385  -72.179 125.107 1.00 177.79 ? 11  GLU C OE2 1 
ATOM   8972  N N   . HIS C 1 12  ? 79.747  -68.396 128.517 1.00 149.65 ? 12  HIS C N   1 
ATOM   8973  C CA  . HIS C 1 12  ? 81.024  -68.635 129.165 1.00 150.69 ? 12  HIS C CA  1 
ATOM   8974  C C   . HIS C 1 12  ? 81.411  -70.112 129.153 1.00 157.24 ? 12  HIS C C   1 
ATOM   8975  O O   . HIS C 1 12  ? 82.577  -70.435 128.942 1.00 163.35 ? 12  HIS C O   1 
ATOM   8976  C CB  . HIS C 1 12  ? 80.988  -68.086 130.594 1.00 153.05 ? 12  HIS C CB  1 
ATOM   8977  C CG  . HIS C 1 12  ? 81.010  -66.593 130.653 1.00 152.13 ? 12  HIS C CG  1 
ATOM   8978  N ND1 . HIS C 1 12  ? 80.527  -65.805 129.631 1.00 148.58 ? 12  HIS C ND1 1 
ATOM   8979  C CD2 . HIS C 1 12  ? 81.456  -65.735 131.604 1.00 148.68 ? 12  HIS C CD2 1 
ATOM   8980  C CE1 . HIS C 1 12  ? 80.669  -64.534 129.944 1.00 145.96 ? 12  HIS C CE1 1 
ATOM   8981  N NE2 . HIS C 1 12  ? 81.234  -64.464 131.142 1.00 146.01 ? 12  HIS C NE2 1 
ATOM   8982  N N   . LEU C 1 13  ? 80.439  -70.996 129.367 1.00 157.88 ? 13  LEU C N   1 
ATOM   8983  C CA  . LEU C 1 13  ? 80.690  -72.435 129.291 1.00 163.06 ? 13  LEU C CA  1 
ATOM   8984  C C   . LEU C 1 13  ? 79.408  -73.269 129.303 1.00 171.89 ? 13  LEU C C   1 
ATOM   8985  O O   . LEU C 1 13  ? 78.333  -72.785 129.664 1.00 171.64 ? 13  LEU C O   1 
ATOM   8986  C CB  . LEU C 1 13  ? 81.612  -72.901 130.427 1.00 161.88 ? 13  LEU C CB  1 
ATOM   8987  C CG  . LEU C 1 13  ? 81.354  -72.475 131.870 1.00 166.57 ? 13  LEU C CG  1 
ATOM   8988  C CD1 . LEU C 1 13  ? 81.122  -73.695 132.738 1.00 176.80 ? 13  LEU C CD1 1 
ATOM   8989  C CD2 . LEU C 1 13  ? 82.529  -71.669 132.390 1.00 161.62 ? 13  LEU C CD2 1 
ATOM   8990  N N   . GLN C 1 14  ? 79.543  -74.527 128.892 1.00 179.23 ? 14  GLN C N   1 
ATOM   8991  C CA  . GLN C 1 14  ? 78.448  -75.488 128.903 1.00 186.11 ? 14  GLN C CA  1 
ATOM   8992  C C   . GLN C 1 14  ? 78.730  -76.503 130.005 1.00 184.82 ? 14  GLN C C   1 
ATOM   8993  O O   . GLN C 1 14  ? 79.709  -77.245 129.931 1.00 178.94 ? 14  GLN C O   1 
ATOM   8994  C CB  . GLN C 1 14  ? 78.333  -76.183 127.542 1.00 189.44 ? 14  GLN C CB  1 
ATOM   8995  C CG  . GLN C 1 14  ? 77.250  -77.258 127.423 1.00 198.21 ? 14  GLN C CG  1 
ATOM   8996  C CD  . GLN C 1 14  ? 75.840  -76.705 127.519 1.00 205.53 ? 14  GLN C CD  1 
ATOM   8997  O OE1 . GLN C 1 14  ? 75.372  -76.019 126.610 1.00 208.81 ? 14  GLN C OE1 1 
ATOM   8998  N NE2 . GLN C 1 14  ? 75.151  -77.014 128.608 1.00 209.11 ? 14  GLN C NE2 1 
ATOM   8999  N N   . LEU C 1 15  ? 77.862  -76.550 131.012 1.00 188.79 ? 15  LEU C N   1 
ATOM   9000  C CA  . LEU C 1 15  ? 78.073  -77.424 132.166 1.00 195.00 ? 15  LEU C CA  1 
ATOM   9001  C C   . LEU C 1 15  ? 78.015  -78.903 131.811 1.00 205.40 ? 15  LEU C C   1 
ATOM   9002  O O   . LEU C 1 15  ? 78.628  -79.730 132.485 1.00 210.07 ? 15  LEU C O   1 
ATOM   9003  C CB  . LEU C 1 15  ? 77.055  -77.120 133.267 1.00 193.86 ? 15  LEU C CB  1 
ATOM   9004  C CG  . LEU C 1 15  ? 77.140  -75.716 133.866 1.00 190.45 ? 15  LEU C CG  1 
ATOM   9005  C CD1 . LEU C 1 15  ? 75.892  -75.398 134.671 1.00 188.01 ? 15  LEU C CD1 1 
ATOM   9006  C CD2 . LEU C 1 15  ? 78.394  -75.569 134.718 1.00 188.15 ? 15  LEU C CD2 1 
ATOM   9007  N N   . GLN C 1 16  ? 77.277  -79.234 130.756 1.00 206.32 ? 16  GLN C N   1 
ATOM   9008  C CA  . GLN C 1 16  ? 77.182  -80.614 130.291 1.00 203.82 ? 16  GLN C CA  1 
ATOM   9009  C C   . GLN C 1 16  ? 78.552  -81.120 129.845 1.00 203.81 ? 16  GLN C C   1 
ATOM   9010  O O   . GLN C 1 16  ? 78.824  -82.319 129.877 1.00 202.63 ? 16  GLN C O   1 
ATOM   9011  C CB  . GLN C 1 16  ? 76.172  -80.738 129.150 1.00 204.63 ? 16  GLN C CB  1 
ATOM   9012  C CG  . GLN C 1 16  ? 74.807  -80.119 129.448 1.00 211.37 ? 16  GLN C CG  1 
ATOM   9013  C CD  . GLN C 1 16  ? 73.834  -81.081 130.115 1.00 221.24 ? 16  GLN C CD  1 
ATOM   9014  O OE1 . GLN C 1 16  ? 72.750  -81.337 129.591 1.00 230.22 ? 16  GLN C OE1 1 
ATOM   9015  N NE2 . GLN C 1 16  ? 74.206  -81.599 131.281 1.00 221.15 ? 16  GLN C NE2 1 
ATOM   9016  N N   . ASN C 1 17  ? 79.416  -80.200 129.426 1.00 207.69 ? 17  ASN C N   1 
ATOM   9017  C CA  . ASN C 1 17  ? 80.771  -80.558 129.009 1.00 210.43 ? 17  ASN C CA  1 
ATOM   9018  C C   . ASN C 1 17  ? 81.713  -80.774 130.181 1.00 204.43 ? 17  ASN C C   1 
ATOM   9019  O O   . ASN C 1 17  ? 82.913  -80.963 129.999 1.00 199.90 ? 17  ASN C O   1 
ATOM   9020  C CB  . ASN C 1 17  ? 81.338  -79.480 128.096 1.00 212.56 ? 17  ASN C CB  1 
ATOM   9021  C CG  . ASN C 1 17  ? 80.540  -79.328 126.830 1.00 213.30 ? 17  ASN C CG  1 
ATOM   9022  O OD1 . ASN C 1 17  ? 80.593  -78.295 126.169 1.00 211.85 ? 17  ASN C OD1 1 
ATOM   9023  N ND2 . ASN C 1 17  ? 79.800  -80.369 126.472 1.00 215.18 ? 17  ASN C ND2 1 
ATOM   9024  N N   . LEU C 1 18  ? 81.155  -80.773 131.384 1.00 202.70 ? 18  LEU C N   1 
ATOM   9025  C CA  . LEU C 1 18  ? 81.945  -80.962 132.591 1.00 204.36 ? 18  LEU C CA  1 
ATOM   9026  C C   . LEU C 1 18  ? 81.407  -82.110 133.441 1.00 208.28 ? 18  LEU C C   1 
ATOM   9027  O O   . LEU C 1 18  ? 81.636  -82.160 134.648 1.00 209.14 ? 18  LEU C O   1 
ATOM   9028  C CB  . LEU C 1 18  ? 81.993  -79.667 133.404 1.00 199.55 ? 18  LEU C CB  1 
ATOM   9029  C CG  . LEU C 1 18  ? 82.771  -78.514 132.770 1.00 195.11 ? 18  LEU C CG  1 
ATOM   9030  C CD1 . LEU C 1 18  ? 82.408  -77.205 133.440 1.00 189.61 ? 18  LEU C CD1 1 
ATOM   9031  C CD2 . LEU C 1 18  ? 84.265  -78.768 132.878 1.00 196.51 ? 18  LEU C CD2 1 
ATOM   9032  N N   . GLY C 1 19  ? 80.692  -83.029 132.797 1.00 207.11 ? 19  GLY C N   1 
ATOM   9033  C CA  . GLY C 1 19  ? 80.141  -84.202 133.456 1.00 207.40 ? 19  GLY C CA  1 
ATOM   9034  C C   . GLY C 1 19  ? 78.956  -83.930 134.361 1.00 203.76 ? 19  GLY C C   1 
ATOM   9035  O O   . GLY C 1 19  ? 78.495  -84.814 135.085 1.00 200.44 ? 19  GLY C O   1 
ATOM   9036  N N   . ILE C 1 20  ? 78.459  -82.699 134.326 1.00 204.56 ? 20  ILE C N   1 
ATOM   9037  C CA  . ILE C 1 20  ? 77.302  -82.329 135.131 1.00 206.27 ? 20  ILE C CA  1 
ATOM   9038  C C   . ILE C 1 20  ? 76.030  -82.953 134.567 1.00 208.76 ? 20  ILE C C   1 
ATOM   9039  O O   . ILE C 1 20  ? 75.721  -82.792 133.388 1.00 197.61 ? 20  ILE C O   1 
ATOM   9040  C CB  . ILE C 1 20  ? 77.120  -80.809 135.210 1.00 203.26 ? 20  ILE C CB  1 
ATOM   9041  C CG1 . ILE C 1 20  ? 78.374  -80.167 135.794 1.00 197.32 ? 20  ILE C CG1 1 
ATOM   9042  C CG2 . ILE C 1 20  ? 75.885  -80.463 136.030 1.00 205.43 ? 20  ILE C CG2 1 
ATOM   9043  C CD1 . ILE C 1 20  ? 78.752  -80.731 137.141 1.00 197.75 ? 20  ILE C CD1 1 
ATOM   9044  N N   . ASN C 1 21  ? 75.290  -83.655 135.418 1.00 215.98 ? 21  ASN C N   1 
ATOM   9045  C CA  . ASN C 1 21  ? 74.039  -84.296 135.025 1.00 212.92 ? 21  ASN C CA  1 
ATOM   9046  C C   . ASN C 1 21  ? 72.964  -83.258 134.701 1.00 211.27 ? 21  ASN C C   1 
ATOM   9047  O O   . ASN C 1 21  ? 72.716  -82.364 135.510 1.00 204.12 ? 21  ASN C O   1 
ATOM   9048  C CB  . ASN C 1 21  ? 73.558  -85.225 136.143 1.00 209.05 ? 21  ASN C CB  1 
ATOM   9049  C CG  . ASN C 1 21  ? 72.556  -86.258 135.664 1.00 212.42 ? 21  ASN C CG  1 
ATOM   9050  O OD1 . ASN C 1 21  ? 71.541  -85.927 135.052 1.00 213.06 ? 21  ASN C OD1 1 
ATOM   9051  N ND2 . ASN C 1 21  ? 72.834  -87.523 135.956 1.00 217.60 ? 21  ASN C ND2 1 
ATOM   9052  N N   . PRO C 1 22  ? 72.343  -83.353 133.508 1.00 211.84 ? 22  PRO C N   1 
ATOM   9053  C CA  . PRO C 1 22  ? 71.291  -82.405 133.110 1.00 211.78 ? 22  PRO C CA  1 
ATOM   9054  C C   . PRO C 1 22  ? 70.200  -82.241 134.169 1.00 211.16 ? 22  PRO C C   1 
ATOM   9055  O O   . PRO C 1 22  ? 69.655  -81.148 134.322 1.00 209.52 ? 22  PRO C O   1 
ATOM   9056  C CB  . PRO C 1 22  ? 70.715  -83.029 131.828 1.00 207.90 ? 22  PRO C CB  1 
ATOM   9057  C CG  . PRO C 1 22  ? 71.205  -84.444 131.820 1.00 203.71 ? 22  PRO C CG  1 
ATOM   9058  C CD  . PRO C 1 22  ? 72.543  -84.390 132.483 1.00 204.71 ? 22  PRO C CD  1 
ATOM   9059  N N   . ALA C 1 23  ? 69.885  -83.320 134.879 1.00 210.11 ? 23  ALA C N   1 
ATOM   9060  C CA  . ALA C 1 23  ? 68.877  -83.294 135.936 1.00 204.41 ? 23  ALA C CA  1 
ATOM   9061  C C   . ALA C 1 23  ? 69.277  -82.391 137.110 1.00 204.19 ? 23  ALA C C   1 
ATOM   9062  O O   . ALA C 1 23  ? 68.415  -81.830 137.782 1.00 204.29 ? 23  ALA C O   1 
ATOM   9063  C CB  . ALA C 1 23  ? 68.595  -84.709 136.427 1.00 203.08 ? 23  ALA C CB  1 
ATOM   9064  N N   . ASN C 1 24  ? 70.578  -82.250 137.350 1.00 207.39 ? 24  ASN C N   1 
ATOM   9065  C CA  . ASN C 1 24  ? 71.073  -81.419 138.450 1.00 204.37 ? 24  ASN C CA  1 
ATOM   9066  C C   . ASN C 1 24  ? 71.168  -79.940 138.114 1.00 198.40 ? 24  ASN C C   1 
ATOM   9067  O O   . ASN C 1 24  ? 71.582  -79.130 138.944 1.00 196.21 ? 24  ASN C O   1 
ATOM   9068  C CB  . ASN C 1 24  ? 72.443  -81.903 138.921 1.00 198.87 ? 24  ASN C CB  1 
ATOM   9069  C CG  . ASN C 1 24  ? 72.383  -83.241 139.606 1.00 197.26 ? 24  ASN C CG  1 
ATOM   9070  O OD1 . ASN C 1 24  ? 72.947  -84.223 139.131 1.00 194.85 ? 24  ASN C OD1 1 
ATOM   9071  N ND2 . ASN C 1 24  ? 71.727  -83.280 140.759 1.00 203.84 ? 24  ASN C ND2 1 
ATOM   9072  N N   . ILE C 1 25  ? 70.792  -79.586 136.896 1.00 188.72 ? 25  ILE C N   1 
ATOM   9073  C CA  . ILE C 1 25  ? 70.829  -78.191 136.489 1.00 184.53 ? 25  ILE C CA  1 
ATOM   9074  C C   . ILE C 1 25  ? 69.497  -77.519 136.847 1.00 177.41 ? 25  ILE C C   1 
ATOM   9075  O O   . ILE C 1 25  ? 68.608  -77.367 136.006 1.00 182.16 ? 25  ILE C O   1 
ATOM   9076  C CB  . ILE C 1 25  ? 71.138  -78.076 134.993 1.00 192.41 ? 25  ILE C CB  1 
ATOM   9077  C CG1 . ILE C 1 25  ? 72.453  -78.796 134.703 1.00 191.59 ? 25  ILE C CG1 1 
ATOM   9078  C CG2 . ILE C 1 25  ? 71.252  -76.627 134.572 1.00 194.17 ? 25  ILE C CG2 1 
ATOM   9079  C CD1 . ILE C 1 25  ? 72.749  -78.979 133.242 1.00 189.96 ? 25  ILE C CD1 1 
ATOM   9080  N N   . GLY C 1 26  ? 69.375  -77.113 138.111 1.00 166.95 ? 26  GLY C N   1 
ATOM   9081  C CA  . GLY C 1 26  ? 68.155  -76.501 138.615 1.00 163.80 ? 26  GLY C CA  1 
ATOM   9082  C C   . GLY C 1 26  ? 68.303  -75.745 139.928 1.00 167.94 ? 26  GLY C C   1 
ATOM   9083  O O   . GLY C 1 26  ? 69.246  -75.965 140.690 1.00 178.76 ? 26  GLY C O   1 
ATOM   9084  N N   . PHE C 1 27  ? 67.328  -74.880 140.196 1.00 161.90 ? 27  PHE C N   1 
ATOM   9085  C CA  . PHE C 1 27  ? 67.292  -73.997 141.365 1.00 152.50 ? 27  PHE C CA  1 
ATOM   9086  C C   . PHE C 1 27  ? 67.570  -74.784 142.655 1.00 153.50 ? 27  PHE C C   1 
ATOM   9087  O O   . PHE C 1 27  ? 68.271  -74.308 143.549 1.00 155.98 ? 27  PHE C O   1 
ATOM   9088  C CB  . PHE C 1 27  ? 65.922  -73.303 141.418 1.00 153.28 ? 27  PHE C CB  1 
ATOM   9089  C CG  . PHE C 1 27  ? 65.875  -72.044 142.244 1.00 157.40 ? 27  PHE C CG  1 
ATOM   9090  C CD1 . PHE C 1 27  ? 66.017  -70.816 141.617 1.00 164.20 ? 27  PHE C CD1 1 
ATOM   9091  C CD2 . PHE C 1 27  ? 65.638  -72.067 143.608 1.00 154.38 ? 27  PHE C CD2 1 
ATOM   9092  C CE1 . PHE C 1 27  ? 65.961  -69.636 142.328 1.00 156.50 ? 27  PHE C CE1 1 
ATOM   9093  C CE2 . PHE C 1 27  ? 65.580  -70.880 144.330 1.00 151.27 ? 27  PHE C CE2 1 
ATOM   9094  C CZ  . PHE C 1 27  ? 65.742  -69.666 143.686 1.00 146.11 ? 27  PHE C CZ  1 
ATOM   9095  N N   . SER C 1 28  ? 67.015  -75.994 142.728 1.00 163.81 ? 28  SER C N   1 
ATOM   9096  C CA  . SER C 1 28  ? 67.136  -76.880 143.893 1.00 174.10 ? 28  SER C CA  1 
ATOM   9097  C C   . SER C 1 28  ? 68.465  -77.640 144.015 1.00 171.39 ? 28  SER C C   1 
ATOM   9098  O O   . SER C 1 28  ? 68.846  -78.050 145.112 1.00 182.99 ? 28  SER C O   1 
ATOM   9099  C CB  . SER C 1 28  ? 65.980  -77.897 143.879 1.00 177.97 ? 28  SER C CB  1 
ATOM   9100  O OG  . SER C 1 28  ? 64.732  -77.262 144.149 1.00 177.59 ? 28  SER C OG  1 
ATOM   9101  N N   . THR C 1 29  ? 69.145  -77.869 142.894 1.00 158.70 ? 29  THR C N   1 
ATOM   9102  C CA  . THR C 1 29  ? 70.377  -78.659 142.919 1.00 168.11 ? 29  THR C CA  1 
ATOM   9103  C C   . THR C 1 29  ? 71.635  -77.854 142.568 1.00 161.80 ? 29  THR C C   1 
ATOM   9104  O O   . THR C 1 29  ? 72.749  -78.253 142.912 1.00 156.63 ? 29  THR C O   1 
ATOM   9105  C CB  . THR C 1 29  ? 70.294  -79.869 141.955 1.00 185.32 ? 29  THR C CB  1 
ATOM   9106  O OG1 . THR C 1 29  ? 69.646  -79.475 140.737 1.00 182.15 ? 29  THR C OG1 1 
ATOM   9107  C CG2 . THR C 1 29  ? 69.502  -81.010 142.589 1.00 192.41 ? 29  THR C CG2 1 
ATOM   9108  N N   . LEU C 1 30  ? 71.455  -76.741 141.864 1.00 162.20 ? 30  LEU C N   1 
ATOM   9109  C CA  . LEU C 1 30  ? 72.563  -75.874 141.455 1.00 152.62 ? 30  LEU C CA  1 
ATOM   9110  C C   . LEU C 1 30  ? 72.450  -74.496 142.109 1.00 147.44 ? 30  LEU C C   1 
ATOM   9111  O O   . LEU C 1 30  ? 71.381  -73.895 142.089 1.00 155.36 ? 30  LEU C O   1 
ATOM   9112  C CB  . LEU C 1 30  ? 72.589  -75.733 139.933 1.00 159.98 ? 30  LEU C CB  1 
ATOM   9113  C CG  . LEU C 1 30  ? 73.860  -75.241 139.239 1.00 161.29 ? 30  LEU C CG  1 
ATOM   9114  C CD1 . LEU C 1 30  ? 74.009  -75.894 137.878 1.00 162.62 ? 30  LEU C CD1 1 
ATOM   9115  C CD2 . LEU C 1 30  ? 73.830  -73.732 139.089 1.00 157.80 ? 30  LEU C CD2 1 
ATOM   9116  N N   . THR C 1 31  ? 73.535  -73.997 142.700 1.00 142.89 ? 31  THR C N   1 
ATOM   9117  C CA  . THR C 1 31  ? 73.515  -72.663 143.311 1.00 146.53 ? 31  THR C CA  1 
ATOM   9118  C C   . THR C 1 31  ? 74.619  -71.751 142.780 1.00 140.72 ? 31  THR C C   1 
ATOM   9119  O O   . THR C 1 31  ? 75.735  -72.197 142.518 1.00 141.13 ? 31  THR C O   1 
ATOM   9120  C CB  . THR C 1 31  ? 73.653  -72.730 144.840 1.00 144.09 ? 31  THR C CB  1 
ATOM   9121  O OG1 . THR C 1 31  ? 74.941  -73.250 145.180 1.00 139.52 ? 31  THR C OG1 1 
ATOM   9122  C CG2 . THR C 1 31  ? 72.567  -73.614 145.443 1.00 150.88 ? 31  THR C CG2 1 
ATOM   9123  N N   . MET C 1 32  ? 74.301  -70.467 142.640 1.00 137.86 ? 32  MET C N   1 
ATOM   9124  C CA  . MET C 1 32  ? 75.282  -69.474 142.221 1.00 136.57 ? 32  MET C CA  1 
ATOM   9125  C C   . MET C 1 32  ? 75.050  -68.171 142.989 1.00 131.36 ? 32  MET C C   1 
ATOM   9126  O O   . MET C 1 32  ? 74.036  -67.492 142.816 1.00 131.88 ? 32  MET C O   1 
ATOM   9127  C CB  . MET C 1 32  ? 75.218  -69.244 140.711 1.00 138.45 ? 32  MET C CB  1 
ATOM   9128  C CG  . MET C 1 32  ? 76.513  -68.689 140.132 1.00 138.11 ? 32  MET C CG  1 
ATOM   9129  S SD  . MET C 1 32  ? 76.355  -67.939 138.503 1.00 147.41 ? 32  MET C SD  1 
ATOM   9130  C CE  . MET C 1 32  ? 78.072  -67.573 138.122 1.00 151.93 ? 32  MET C CE  1 
ATOM   9131  N N   . GLU C 1 33  ? 76.004  -67.826 143.846 1.00 127.97 ? 33  GLU C N   1 
ATOM   9132  C CA  . GLU C 1 33  ? 75.842  -66.689 144.747 1.00 124.82 ? 33  GLU C CA  1 
ATOM   9133  C C   . GLU C 1 33  ? 76.701  -65.508 144.304 1.00 124.85 ? 33  GLU C C   1 
ATOM   9134  O O   . GLU C 1 33  ? 76.542  -64.395 144.804 1.00 122.23 ? 33  GLU C O   1 
ATOM   9135  C CB  . GLU C 1 33  ? 76.192  -67.094 146.181 1.00 138.88 ? 33  GLU C CB  1 
ATOM   9136  C CG  . GLU C 1 33  ? 75.331  -68.238 146.733 1.00 152.56 ? 33  GLU C CG  1 
ATOM   9137  C CD  . GLU C 1 33  ? 73.884  -67.842 147.003 1.00 148.71 ? 33  GLU C CD  1 
ATOM   9138  O OE1 . GLU C 1 33  ? 73.634  -66.768 147.594 1.00 147.96 ? 33  GLU C OE1 1 
ATOM   9139  O OE2 . GLU C 1 33  ? 72.981  -68.607 146.604 1.00 147.22 ? 33  GLU C OE2 1 
ATOM   9140  N N   . SER C 1 34  ? 77.596  -65.756 143.353 1.00 133.00 ? 34  SER C N   1 
ATOM   9141  C CA  . SER C 1 34  ? 78.465  -64.714 142.817 1.00 123.60 ? 34  SER C CA  1 
ATOM   9142  C C   . SER C 1 34  ? 79.113  -65.204 141.528 1.00 127.89 ? 34  SER C C   1 
ATOM   9143  O O   . SER C 1 34  ? 79.025  -66.383 141.199 1.00 129.57 ? 34  SER C O   1 
ATOM   9144  C CB  . SER C 1 34  ? 79.532  -64.319 143.843 1.00 124.29 ? 34  SER C CB  1 
ATOM   9145  O OG  . SER C 1 34  ? 80.344  -65.428 144.191 1.00 129.97 ? 34  SER C OG  1 
ATOM   9146  N N   . ASP C 1 35  ? 79.756  -64.308 140.789 1.00 131.54 ? 35  ASP C N   1 
ATOM   9147  C CA  . ASP C 1 35  ? 80.430  -64.713 139.557 1.00 136.10 ? 35  ASP C CA  1 
ATOM   9148  C C   . ASP C 1 35  ? 81.690  -65.557 139.812 1.00 131.81 ? 35  ASP C C   1 
ATOM   9149  O O   . ASP C 1 35  ? 82.355  -65.980 138.867 1.00 137.07 ? 35  ASP C O   1 
ATOM   9150  C CB  . ASP C 1 35  ? 80.737  -63.489 138.682 1.00 139.97 ? 35  ASP C CB  1 
ATOM   9151  C CG  . ASP C 1 35  ? 81.629  -62.473 139.364 1.00 139.43 ? 35  ASP C CG  1 
ATOM   9152  O OD1 . ASP C 1 35  ? 82.091  -62.722 140.495 1.00 133.79 ? 35  ASP C OD1 1 
ATOM   9153  O OD2 . ASP C 1 35  ? 81.862  -61.407 138.757 1.00 136.49 ? 35  ASP C OD2 1 
ATOM   9154  N N   . LYS C 1 36  ? 82.023  -65.780 141.083 1.00 129.06 ? 36  LYS C N   1 
ATOM   9155  C CA  . LYS C 1 36  ? 83.229  -66.530 141.448 1.00 130.58 ? 36  LYS C CA  1 
ATOM   9156  C C   . LYS C 1 36  ? 83.077  -68.065 141.395 1.00 136.41 ? 36  LYS C C   1 
ATOM   9157  O O   . LYS C 1 36  ? 83.958  -68.753 140.883 1.00 143.22 ? 36  LYS C O   1 
ATOM   9158  C CB  . LYS C 1 36  ? 83.692  -66.129 142.849 1.00 129.87 ? 36  LYS C CB  1 
ATOM   9159  C CG  . LYS C 1 36  ? 84.004  -64.648 143.017 1.00 137.94 ? 36  LYS C CG  1 
ATOM   9160  C CD  . LYS C 1 36  ? 85.471  -64.357 142.738 1.00 149.42 ? 36  LYS C CD  1 
ATOM   9161  C CE  . LYS C 1 36  ? 85.796  -62.885 142.963 1.00 150.07 ? 36  LYS C CE  1 
ATOM   9162  N NZ  . LYS C 1 36  ? 85.137  -61.995 141.966 1.00 148.61 ? 36  LYS C NZ  1 
ATOM   9163  N N   . PHE C 1 37  ? 81.967  -68.600 141.907 1.00 139.54 ? 37  PHE C N   1 
ATOM   9164  C CA  . PHE C 1 37  ? 81.771  -70.057 141.955 1.00 141.13 ? 37  PHE C CA  1 
ATOM   9165  C C   . PHE C 1 37  ? 80.404  -70.547 141.506 1.00 141.13 ? 37  PHE C C   1 
ATOM   9166  O O   . PHE C 1 37  ? 79.418  -69.813 141.543 1.00 140.78 ? 37  PHE C O   1 
ATOM   9167  C CB  . PHE C 1 37  ? 81.961  -70.614 143.374 1.00 140.37 ? 37  PHE C CB  1 
ATOM   9168  C CG  . PHE C 1 37  ? 83.193  -70.143 144.078 1.00 142.55 ? 37  PHE C CG  1 
ATOM   9169  C CD1 . PHE C 1 37  ? 84.374  -70.854 143.970 1.00 156.97 ? 37  PHE C CD1 1 
ATOM   9170  C CD2 . PHE C 1 37  ? 83.158  -69.026 144.892 1.00 136.12 ? 37  PHE C CD2 1 
ATOM   9171  C CE1 . PHE C 1 37  ? 85.509  -70.442 144.631 1.00 163.76 ? 37  PHE C CE1 1 
ATOM   9172  C CE2 . PHE C 1 37  ? 84.291  -68.605 145.558 1.00 142.07 ? 37  PHE C CE2 1 
ATOM   9173  C CZ  . PHE C 1 37  ? 85.469  -69.315 145.428 1.00 161.23 ? 37  PHE C CZ  1 
ATOM   9174  N N   . ILE C 1 38  ? 80.374  -71.799 141.050 1.00 143.15 ? 38  ILE C N   1 
ATOM   9175  C CA  . ILE C 1 38  ? 79.128  -72.516 140.785 1.00 144.59 ? 38  ILE C CA  1 
ATOM   9176  C C   . ILE C 1 38  ? 79.188  -73.880 141.473 1.00 151.10 ? 38  ILE C C   1 
ATOM   9177  O O   . ILE C 1 38  ? 80.040  -74.702 141.136 1.00 152.94 ? 38  ILE C O   1 
ATOM   9178  C CB  . ILE C 1 38  ? 78.876  -72.738 139.294 1.00 148.02 ? 38  ILE C CB  1 
ATOM   9179  C CG1 . ILE C 1 38  ? 78.662  -71.418 138.562 1.00 147.91 ? 38  ILE C CG1 1 
ATOM   9180  C CG2 . ILE C 1 38  ? 77.684  -73.655 139.093 1.00 152.36 ? 38  ILE C CG2 1 
ATOM   9181  C CD1 . ILE C 1 38  ? 78.688  -71.574 137.060 1.00 152.06 ? 38  ILE C CD1 1 
ATOM   9182  N N   . CYS C 1 39  ? 78.285  -74.140 142.414 1.00 150.70 ? 39  CYS C N   1 
ATOM   9183  C CA  . CYS C 1 39  ? 78.305  -75.414 143.146 1.00 153.54 ? 39  CYS C CA  1 
ATOM   9184  C C   . CYS C 1 39  ? 77.048  -76.272 142.934 1.00 158.37 ? 39  CYS C C   1 
ATOM   9185  O O   . CYS C 1 39  ? 75.925  -75.828 143.185 1.00 162.91 ? 39  CYS C O   1 
ATOM   9186  C CB  . CYS C 1 39  ? 78.527  -75.168 144.641 1.00 151.27 ? 39  CYS C CB  1 
ATOM   9187  S SG  . CYS C 1 39  ? 77.624  -73.773 145.350 1.00 194.44 ? 39  CYS C SG  1 
ATOM   9188  N N   . ILE C 1 40  ? 77.251  -77.505 142.478 1.00 161.88 ? 40  ILE C N   1 
ATOM   9189  C CA  . ILE C 1 40  ? 76.155  -78.417 142.159 1.00 177.63 ? 40  ILE C CA  1 
ATOM   9190  C C   . ILE C 1 40  ? 76.162  -79.605 143.122 1.00 178.27 ? 40  ILE C C   1 
ATOM   9191  O O   . ILE C 1 40  ? 77.220  -80.133 143.460 1.00 174.68 ? 40  ILE C O   1 
ATOM   9192  C CB  . ILE C 1 40  ? 76.243  -78.940 140.706 1.00 188.89 ? 40  ILE C CB  1 
ATOM   9193  C CG1 . ILE C 1 40  ? 76.582  -77.801 139.743 1.00 182.13 ? 40  ILE C CG1 1 
ATOM   9194  C CG2 . ILE C 1 40  ? 74.946  -79.620 140.299 1.00 196.64 ? 40  ILE C CG2 1 
ATOM   9195  C CD1 . ILE C 1 40  ? 78.069  -77.665 139.435 1.00 174.76 ? 40  ILE C CD1 1 
ATOM   9196  N N   . ARG C 1 41  ? 74.974  -80.033 143.543 1.00 177.82 ? 41  ARG C N   1 
ATOM   9197  C CA  . ARG C 1 41  ? 74.833  -81.176 144.442 1.00 177.45 ? 41  ARG C CA  1 
ATOM   9198  C C   . ARG C 1 41  ? 74.372  -82.431 143.706 1.00 177.15 ? 41  ARG C C   1 
ATOM   9199  O O   . ARG C 1 41  ? 73.220  -82.537 143.281 1.00 177.56 ? 41  ARG C O   1 
ATOM   9200  C CB  . ARG C 1 41  ? 73.844  -80.858 145.569 1.00 179.62 ? 41  ARG C CB  1 
ATOM   9201  C CG  . ARG C 1 41  ? 74.224  -79.674 146.444 1.00 170.97 ? 41  ARG C CG  1 
ATOM   9202  C CD  . ARG C 1 41  ? 73.316  -79.546 147.675 1.00 165.60 ? 41  ARG C CD  1 
ATOM   9203  N NE  . ARG C 1 41  ? 71.895  -79.454 147.337 1.00 169.08 ? 41  ARG C NE  1 
ATOM   9204  C CZ  . ARG C 1 41  ? 71.013  -80.442 147.463 1.00 170.32 ? 41  ARG C CZ  1 
ATOM   9205  N NH1 . ARG C 1 41  ? 69.746  -80.241 147.127 1.00 175.19 ? 41  ARG C NH1 1 
ATOM   9206  N NH2 . ARG C 1 41  ? 71.387  -81.621 147.936 1.00 170.53 ? 41  ARG C NH2 1 
ATOM   9207  N N   . ALA C 1 48  ? 76.477  -89.334 148.264 1.00 205.31 ? 48  ALA C N   1 
ATOM   9208  C CA  . ALA C 1 48  ? 76.200  -87.906 148.354 1.00 202.12 ? 48  ALA C CA  1 
ATOM   9209  C C   . ALA C 1 48  ? 77.479  -87.092 148.197 1.00 197.08 ? 48  ALA C C   1 
ATOM   9210  O O   . ALA C 1 48  ? 78.427  -87.258 148.963 1.00 191.57 ? 48  ALA C O   1 
ATOM   9211  C CB  . ALA C 1 48  ? 75.524  -87.579 149.677 1.00 196.09 ? 48  ALA C CB  1 
ATOM   9212  N N   . GLN C 1 49  ? 77.508  -86.222 147.193 1.00 193.21 ? 49  GLN C N   1 
ATOM   9213  C CA  . GLN C 1 49  ? 78.690  -85.406 146.943 1.00 189.93 ? 49  GLN C CA  1 
ATOM   9214  C C   . GLN C 1 49  ? 78.372  -83.976 146.497 1.00 185.53 ? 49  GLN C C   1 
ATOM   9215  O O   . GLN C 1 49  ? 77.244  -83.659 146.123 1.00 187.74 ? 49  GLN C O   1 
ATOM   9216  C CB  . GLN C 1 49  ? 79.584  -86.100 145.916 1.00 200.82 ? 49  GLN C CB  1 
ATOM   9217  C CG  . GLN C 1 49  ? 78.859  -86.551 144.666 1.00 213.95 ? 49  GLN C CG  1 
ATOM   9218  C CD  . GLN C 1 49  ? 79.779  -87.274 143.710 1.00 216.87 ? 49  GLN C CD  1 
ATOM   9219  O OE1 . GLN C 1 49  ? 80.392  -86.656 142.842 1.00 214.98 ? 49  GLN C OE1 1 
ATOM   9220  N NE2 . GLN C 1 49  ? 79.893  -88.588 143.871 1.00 220.61 ? 49  GLN C NE2 1 
ATOM   9221  N N   . VAL C 1 50  ? 79.386  -83.116 146.559 1.00 179.13 ? 50  VAL C N   1 
ATOM   9222  C CA  . VAL C 1 50  ? 79.257  -81.703 146.195 1.00 179.49 ? 50  VAL C CA  1 
ATOM   9223  C C   . VAL C 1 50  ? 80.355  -81.269 145.225 1.00 181.68 ? 50  VAL C C   1 
ATOM   9224  O O   . VAL C 1 50  ? 81.539  -81.450 145.494 1.00 179.34 ? 50  VAL C O   1 
ATOM   9225  C CB  . VAL C 1 50  ? 79.292  -80.795 147.432 1.00 181.39 ? 50  VAL C CB  1 
ATOM   9226  C CG1 . VAL C 1 50  ? 79.535  -79.352 147.026 1.00 176.48 ? 50  VAL C CG1 1 
ATOM   9227  C CG2 . VAL C 1 50  ? 77.996  -80.916 148.214 1.00 185.43 ? 50  VAL C CG2 1 
ATOM   9228  N N   . VAL C 1 51  ? 79.954  -80.691 144.096 1.00 187.44 ? 51  VAL C N   1 
ATOM   9229  C CA  . VAL C 1 51  ? 80.905  -80.244 143.075 1.00 188.03 ? 51  VAL C CA  1 
ATOM   9230  C C   . VAL C 1 51  ? 81.133  -78.733 143.054 1.00 184.94 ? 51  VAL C C   1 
ATOM   9231  O O   . VAL C 1 51  ? 80.188  -77.956 142.947 1.00 188.38 ? 51  VAL C O   1 
ATOM   9232  C CB  . VAL C 1 51  ? 80.452  -80.664 141.675 1.00 187.85 ? 51  VAL C CB  1 
ATOM   9233  C CG1 . VAL C 1 51  ? 81.600  -80.528 140.692 1.00 186.35 ? 51  VAL C CG1 1 
ATOM   9234  C CG2 . VAL C 1 51  ? 79.925  -82.091 141.694 1.00 189.80 ? 51  VAL C CG2 1 
ATOM   9235  N N   . ILE C 1 52  ? 82.398  -78.327 143.141 1.00 177.16 ? 52  ILE C N   1 
ATOM   9236  C CA  . ILE C 1 52  ? 82.746  -76.906 143.127 1.00 172.88 ? 52  ILE C CA  1 
ATOM   9237  C C   . ILE C 1 52  ? 83.508  -76.470 141.878 1.00 175.20 ? 52  ILE C C   1 
ATOM   9238  O O   . ILE C 1 52  ? 84.595  -76.965 141.591 1.00 177.19 ? 52  ILE C O   1 
ATOM   9239  C CB  . ILE C 1 52  ? 83.600  -76.536 144.337 1.00 167.30 ? 52  ILE C CB  1 
ATOM   9240  C CG1 . ILE C 1 52  ? 82.907  -76.964 145.627 1.00 170.81 ? 52  ILE C CG1 1 
ATOM   9241  C CG2 . ILE C 1 52  ? 83.911  -75.047 144.334 1.00 165.19 ? 52  ILE C CG2 1 
ATOM   9242  C CD1 . ILE C 1 52  ? 83.865  -77.294 146.747 1.00 176.59 ? 52  ILE C CD1 1 
ATOM   9243  N N   . ILE C 1 53  ? 82.923  -75.529 141.144 1.00 173.42 ? 53  ILE C N   1 
ATOM   9244  C CA  . ILE C 1 53  ? 83.551  -74.979 139.946 1.00 166.65 ? 53  ILE C CA  1 
ATOM   9245  C C   . ILE C 1 53  ? 84.033  -73.545 140.153 1.00 168.13 ? 53  ILE C C   1 
ATOM   9246  O O   . ILE C 1 53  ? 83.238  -72.614 140.245 1.00 178.56 ? 53  ILE C O   1 
ATOM   9247  C CB  . ILE C 1 53  ? 82.604  -75.011 138.750 1.00 169.00 ? 53  ILE C CB  1 
ATOM   9248  C CG1 . ILE C 1 53  ? 82.235  -76.453 138.417 1.00 171.84 ? 53  ILE C CG1 1 
ATOM   9249  C CG2 . ILE C 1 53  ? 83.248  -74.339 137.547 1.00 169.93 ? 53  ILE C CG2 1 
ATOM   9250  C CD1 . ILE C 1 53  ? 81.133  -76.561 137.395 1.00 176.39 ? 53  ILE C CD1 1 
ATOM   9251  N N   . ASP C 1 54  ? 85.347  -73.381 140.196 1.00 166.38 ? 54  ASP C N   1 
ATOM   9252  C CA  . ASP C 1 54  ? 85.966  -72.072 140.301 1.00 167.43 ? 54  ASP C CA  1 
ATOM   9253  C C   . ASP C 1 54  ? 85.857  -71.402 138.934 1.00 173.87 ? 54  ASP C C   1 
ATOM   9254  O O   . ASP C 1 54  ? 86.106  -72.034 137.915 1.00 184.59 ? 54  ASP C O   1 
ATOM   9255  C CB  . ASP C 1 54  ? 87.422  -72.212 140.744 1.00 167.78 ? 54  ASP C CB  1 
ATOM   9256  C CG  . ASP C 1 54  ? 88.049  -70.890 141.140 1.00 175.69 ? 54  ASP C CG  1 
ATOM   9257  O OD1 . ASP C 1 54  ? 87.431  -69.828 140.918 1.00 177.97 ? 54  ASP C OD1 1 
ATOM   9258  O OD2 . ASP C 1 54  ? 89.166  -70.919 141.698 1.00 179.01 ? 54  ASP C OD2 1 
ATOM   9259  N N   . MET C 1 55  ? 85.390  -70.161 138.888 1.00 167.33 ? 55  MET C N   1 
ATOM   9260  C CA  . MET C 1 55  ? 85.240  -69.490 137.593 1.00 165.13 ? 55  MET C CA  1 
ATOM   9261  C C   . MET C 1 55  ? 86.515  -68.827 137.057 1.00 166.63 ? 55  MET C C   1 
ATOM   9262  O O   . MET C 1 55  ? 86.562  -68.453 135.891 1.00 166.33 ? 55  MET C O   1 
ATOM   9263  C CB  . MET C 1 55  ? 84.096  -68.486 137.644 1.00 162.14 ? 55  MET C CB  1 
ATOM   9264  C CG  . MET C 1 55  ? 82.737  -69.158 137.814 1.00 162.03 ? 55  MET C CG  1 
ATOM   9265  S SD  . MET C 1 55  ? 81.468  -68.569 136.674 1.00 199.14 ? 55  MET C SD  1 
ATOM   9266  C CE  . MET C 1 55  ? 82.171  -69.046 135.099 1.00 164.80 ? 55  MET C CE  1 
ATOM   9267  N N   . ASN C 1 56  ? 87.553  -68.716 137.879 1.00 171.91 ? 56  ASN C N   1 
ATOM   9268  C CA  . ASN C 1 56  ? 88.820  -68.178 137.393 1.00 172.14 ? 56  ASN C CA  1 
ATOM   9269  C C   . ASN C 1 56  ? 89.533  -69.238 136.544 1.00 166.38 ? 56  ASN C C   1 
ATOM   9270  O O   . ASN C 1 56  ? 90.196  -68.911 135.556 1.00 166.92 ? 56  ASN C O   1 
ATOM   9271  C CB  . ASN C 1 56  ? 89.708  -67.717 138.555 1.00 177.45 ? 56  ASN C CB  1 
ATOM   9272  C CG  . ASN C 1 56  ? 89.100  -66.571 139.351 1.00 180.85 ? 56  ASN C CG  1 
ATOM   9273  O OD1 . ASN C 1 56  ? 88.534  -65.633 138.790 1.00 183.18 ? 56  ASN C OD1 1 
ATOM   9274  N ND2 . ASN C 1 56  ? 89.212  -66.653 140.675 1.00 178.48 ? 56  ASN C ND2 1 
ATOM   9275  N N   . ASP C 1 57  ? 89.430  -70.501 136.960 1.00 165.96 ? 57  ASP C N   1 
ATOM   9276  C CA  . ASP C 1 57  ? 89.842  -71.618 136.102 1.00 178.83 ? 57  ASP C CA  1 
ATOM   9277  C C   . ASP C 1 57  ? 88.791  -72.727 136.099 1.00 179.17 ? 57  ASP C C   1 
ATOM   9278  O O   . ASP C 1 57  ? 88.352  -73.198 137.138 1.00 177.10 ? 57  ASP C O   1 
ATOM   9279  C CB  . ASP C 1 57  ? 91.231  -72.185 136.476 1.00 181.35 ? 57  ASP C CB  1 
ATOM   9280  C CG  . ASP C 1 57  ? 91.313  -72.746 137.906 1.00 178.12 ? 57  ASP C CG  1 
ATOM   9281  O OD1 . ASP C 1 57  ? 90.289  -72.817 138.627 1.00 147.34 ? 57  ASP C OD1 1 
ATOM   9282  O OD2 . ASP C 1 57  ? 92.435  -73.135 138.311 1.00 195.20 ? 57  ASP C OD2 1 
ATOM   9283  N N   . PRO C 1 58  ? 88.312  -73.110 134.916 1.00 181.03 ? 58  PRO C N   1 
ATOM   9284  C CA  . PRO C 1 58  ? 87.315  -74.174 134.984 1.00 183.64 ? 58  PRO C CA  1 
ATOM   9285  C C   . PRO C 1 58  ? 87.908  -75.587 134.924 1.00 192.29 ? 58  PRO C C   1 
ATOM   9286  O O   . PRO C 1 58  ? 87.286  -76.515 135.428 1.00 191.92 ? 58  PRO C O   1 
ATOM   9287  C CB  . PRO C 1 58  ? 86.403  -73.875 133.759 1.00 173.36 ? 58  PRO C CB  1 
ATOM   9288  C CG  . PRO C 1 58  ? 86.867  -72.498 133.266 1.00 173.46 ? 58  PRO C CG  1 
ATOM   9289  C CD  . PRO C 1 58  ? 88.313  -72.508 133.585 1.00 178.46 ? 58  PRO C CD  1 
ATOM   9290  N N   . SER C 1 59  ? 89.123  -75.723 134.386 1.00 195.01 ? 59  SER C N   1 
ATOM   9291  C CA  . SER C 1 59  ? 89.761  -77.034 134.120 1.00 195.39 ? 59  SER C CA  1 
ATOM   9292  C C   . SER C 1 59  ? 89.883  -78.023 135.287 1.00 197.84 ? 59  SER C C   1 
ATOM   9293  O O   . SER C 1 59  ? 89.577  -79.212 135.134 1.00 197.40 ? 59  SER C O   1 
ATOM   9294  C CB  . SER C 1 59  ? 91.178  -76.818 133.577 1.00 191.23 ? 59  SER C CB  1 
ATOM   9295  O OG  . SER C 1 59  ? 91.980  -76.087 134.498 1.00 186.85 ? 59  SER C OG  1 
ATOM   9296  N N   . ASN C 1 60  ? 90.296  -77.545 136.456 1.00 198.74 ? 60  ASN C N   1 
ATOM   9297  C CA  . ASN C 1 60  ? 90.438  -78.439 137.602 1.00 200.30 ? 60  ASN C CA  1 
ATOM   9298  C C   . ASN C 1 60  ? 89.446  -78.035 138.676 1.00 195.31 ? 60  ASN C C   1 
ATOM   9299  O O   . ASN C 1 60  ? 89.709  -77.123 139.455 1.00 189.53 ? 60  ASN C O   1 
ATOM   9300  C CB  . ASN C 1 60  ? 91.884  -78.438 138.126 1.00 197.73 ? 60  ASN C CB  1 
ATOM   9301  C CG  . ASN C 1 60  ? 92.400  -77.043 138.469 1.00 196.36 ? 60  ASN C CG  1 
ATOM   9302  O OD1 . ASN C 1 60  ? 91.996  -76.055 137.866 1.00 203.60 ? 60  ASN C OD1 1 
ATOM   9303  N ND2 . ASN C 1 60  ? 93.302  -76.967 139.447 1.00 189.83 ? 60  ASN C ND2 1 
ATOM   9304  N N   . PRO C 1 61  ? 88.254  -78.658 138.662 1.00 191.58 ? 61  PRO C N   1 
ATOM   9305  C CA  . PRO C 1 61  ? 87.240  -78.361 139.677 1.00 183.87 ? 61  PRO C CA  1 
ATOM   9306  C C   . PRO C 1 61  ? 87.353  -79.312 140.872 1.00 181.22 ? 61  PRO C C   1 
ATOM   9307  O O   . PRO C 1 61  ? 87.833  -80.440 140.690 1.00 183.75 ? 61  PRO C O   1 
ATOM   9308  C CB  . PRO C 1 61  ? 85.923  -78.534 138.918 1.00 186.16 ? 61  PRO C CB  1 
ATOM   9309  C CG  . PRO C 1 61  ? 86.289  -79.178 137.576 1.00 189.54 ? 61  PRO C CG  1 
ATOM   9310  C CD  . PRO C 1 61  ? 87.729  -79.578 137.642 1.00 194.51 ? 61  PRO C CD  1 
ATOM   9311  N N   . ILE C 1 62  ? 86.907  -78.906 142.060 1.00 179.63 ? 62  ILE C N   1 
ATOM   9312  C CA  . ILE C 1 62  ? 87.054  -79.793 143.209 1.00 191.09 ? 62  ILE C CA  1 
ATOM   9313  C C   . ILE C 1 62  ? 85.793  -80.604 143.454 1.00 196.94 ? 62  ILE C C   1 
ATOM   9314  O O   . ILE C 1 62  ? 84.686  -80.080 143.620 1.00 191.93 ? 62  ILE C O   1 
ATOM   9315  C CB  . ILE C 1 62  ? 87.390  -79.074 144.524 1.00 191.14 ? 62  ILE C CB  1 
ATOM   9316  C CG1 . ILE C 1 62  ? 88.353  -77.907 144.320 1.00 184.99 ? 62  ILE C CG1 1 
ATOM   9317  C CG2 . ILE C 1 62  ? 87.947  -80.105 145.517 1.00 191.91 ? 62  ILE C CG2 1 
ATOM   9318  C CD1 . ILE C 1 62  ? 88.362  -76.961 145.500 1.00 176.12 ? 62  ILE C CD1 1 
ATOM   9319  N N   . ARG C 1 63  ? 86.003  -81.908 143.424 1.00 199.86 ? 63  ARG C N   1 
ATOM   9320  C CA  . ARG C 1 63  ? 84.976  -82.890 143.681 1.00 191.95 ? 63  ARG C CA  1 
ATOM   9321  C C   . ARG C 1 63  ? 85.145  -83.360 145.127 1.00 183.32 ? 63  ARG C C   1 
ATOM   9322  O O   . ARG C 1 63  ? 86.243  -83.767 145.515 1.00 181.13 ? 63  ARG C O   1 
ATOM   9323  C CB  . ARG C 1 63  ? 85.088  -84.059 142.690 1.00 193.12 ? 63  ARG C CB  1 
ATOM   9324  C CG  . ARG C 1 63  ? 84.767  -83.708 141.236 1.00 194.97 ? 63  ARG C CG  1 
ATOM   9325  C CD  . ARG C 1 63  ? 84.781  -84.942 140.339 1.00 205.12 ? 63  ARG C CD  1 
ATOM   9326  N NE  . ARG C 1 63  ? 86.015  -85.706 140.487 1.00 214.03 ? 63  ARG C NE  1 
ATOM   9327  C CZ  . ARG C 1 63  ? 87.113  -85.513 139.763 1.00 214.05 ? 63  ARG C CZ  1 
ATOM   9328  N NH1 . ARG C 1 63  ? 88.185  -86.259 139.987 1.00 221.45 ? 63  ARG C NH1 1 
ATOM   9329  N NH2 . ARG C 1 63  ? 87.145  -84.582 138.816 1.00 209.83 ? 63  ARG C NH2 1 
ATOM   9330  N N   . ARG C 1 64  ? 84.089  -83.230 145.937 1.00 185.94 ? 64  ARG C N   1 
ATOM   9331  C CA  . ARG C 1 64  ? 84.154  -83.649 147.343 1.00 188.69 ? 64  ARG C CA  1 
ATOM   9332  C C   . ARG C 1 64  ? 82.903  -84.403 147.821 1.00 187.76 ? 64  ARG C C   1 
ATOM   9333  O O   . ARG C 1 64  ? 81.779  -83.998 147.513 1.00 182.01 ? 64  ARG C O   1 
ATOM   9334  C CB  . ARG C 1 64  ? 84.364  -82.440 148.263 1.00 187.51 ? 64  ARG C CB  1 
ATOM   9335  C CG  . ARG C 1 64  ? 85.670  -81.706 148.046 1.00 193.40 ? 64  ARG C CG  1 
ATOM   9336  C CD  . ARG C 1 64  ? 85.635  -80.299 148.631 1.00 199.60 ? 64  ARG C CD  1 
ATOM   9337  N NE  . ARG C 1 64  ? 86.890  -79.597 148.375 1.00 198.64 ? 64  ARG C NE  1 
ATOM   9338  C CZ  . ARG C 1 64  ? 87.944  -79.555 149.180 1.00 194.73 ? 64  ARG C CZ  1 
ATOM   9339  N NH1 . ARG C 1 64  ? 89.015  -78.869 148.811 1.00 195.87 ? 64  ARG C NH1 1 
ATOM   9340  N NH2 . ARG C 1 64  ? 87.942  -80.199 150.334 1.00 192.56 ? 64  ARG C NH2 1 
ATOM   9341  N N   . PRO C 1 65  ? 83.092  -85.496 148.595 1.00 190.45 ? 65  PRO C N   1 
ATOM   9342  C CA  . PRO C 1 65  ? 81.935  -86.248 149.098 1.00 189.49 ? 65  PRO C CA  1 
ATOM   9343  C C   . PRO C 1 65  ? 81.352  -85.640 150.378 1.00 180.73 ? 65  PRO C C   1 
ATOM   9344  O O   . PRO C 1 65  ? 81.806  -85.970 151.477 1.00 175.01 ? 65  PRO C O   1 
ATOM   9345  C CB  . PRO C 1 65  ? 82.513  -87.641 149.374 1.00 196.60 ? 65  PRO C CB  1 
ATOM   9346  C CG  . PRO C 1 65  ? 83.990  -87.422 149.600 1.00 196.42 ? 65  PRO C CG  1 
ATOM   9347  C CD  . PRO C 1 65  ? 84.358  -86.022 149.138 1.00 193.58 ? 65  PRO C CD  1 
ATOM   9348  N N   . ILE C 1 66  ? 80.354  -84.774 150.229 1.00 181.79 ? 66  ILE C N   1 
ATOM   9349  C CA  . ILE C 1 66  ? 79.732  -84.098 151.364 1.00 181.47 ? 66  ILE C CA  1 
ATOM   9350  C C   . ILE C 1 66  ? 78.218  -84.297 151.306 1.00 179.23 ? 66  ILE C C   1 
ATOM   9351  O O   . ILE C 1 66  ? 77.612  -84.114 150.258 1.00 182.50 ? 66  ILE C O   1 
ATOM   9352  C CB  . ILE C 1 66  ? 80.066  -82.603 151.390 1.00 173.92 ? 66  ILE C CB  1 
ATOM   9353  C CG1 . ILE C 1 66  ? 81.562  -82.411 151.616 1.00 164.00 ? 66  ILE C CG1 1 
ATOM   9354  C CG2 . ILE C 1 66  ? 79.273  -81.898 152.477 1.00 173.79 ? 66  ILE C CG2 1 
ATOM   9355  C CD1 . ILE C 1 66  ? 82.115  -81.153 150.996 1.00 165.21 ? 66  ILE C CD1 1 
ATOM   9356  N N   . SER C 1 67  ? 77.603  -84.649 152.431 1.00 168.23 ? 67  SER C N   1 
ATOM   9357  C CA  . SER C 1 67  ? 76.150  -84.873 152.481 1.00 166.49 ? 67  SER C CA  1 
ATOM   9358  C C   . SER C 1 67  ? 75.315  -83.702 153.022 1.00 157.42 ? 67  SER C C   1 
ATOM   9359  O O   . SER C 1 67  ? 75.312  -83.439 154.223 1.00 150.55 ? 67  SER C O   1 
ATOM   9360  C CB  . SER C 1 67  ? 75.857  -86.118 153.315 1.00 177.10 ? 67  SER C CB  1 
ATOM   9361  O OG  . SER C 1 67  ? 74.556  -86.605 153.044 1.00 190.33 ? 67  SER C OG  1 
ATOM   9362  N N   . ALA C 1 68  ? 74.612  -83.003 152.130 1.00 155.68 ? 68  ALA C N   1 
ATOM   9363  C CA  . ALA C 1 68  ? 73.798  -81.842 152.519 1.00 150.11 ? 68  ALA C CA  1 
ATOM   9364  C C   . ALA C 1 68  ? 72.563  -81.630 151.630 1.00 150.08 ? 68  ALA C C   1 
ATOM   9365  O O   . ALA C 1 68  ? 72.590  -81.947 150.441 1.00 157.50 ? 68  ALA C O   1 
ATOM   9366  C CB  . ALA C 1 68  ? 74.647  -80.588 152.520 1.00 149.79 ? 68  ALA C CB  1 
ATOM   9367  N N   . ASP C 1 69  ? 71.475  -81.111 152.201 1.00 148.00 ? 69  ASP C N   1 
ATOM   9368  C CA  . ASP C 1 69  ? 70.284  -80.816 151.399 1.00 146.95 ? 69  ASP C CA  1 
ATOM   9369  C C   . ASP C 1 69  ? 70.404  -79.452 150.744 1.00 141.65 ? 69  ASP C C   1 
ATOM   9370  O O   . ASP C 1 69  ? 69.531  -79.044 149.981 1.00 143.49 ? 69  ASP C O   1 
ATOM   9371  C CB  . ASP C 1 69  ? 69.011  -80.837 152.239 1.00 142.40 ? 69  ASP C CB  1 
ATOM   9372  C CG  . ASP C 1 69  ? 69.200  -81.515 153.571 1.00 145.48 ? 69  ASP C CG  1 
ATOM   9373  O OD1 . ASP C 1 69  ? 68.840  -80.904 154.598 1.00 145.40 ? 69  ASP C OD1 1 
ATOM   9374  O OD2 . ASP C 1 69  ? 69.691  -82.662 153.597 1.00 150.04 ? 69  ASP C OD2 1 
ATOM   9375  N N   . SER C 1 70  ? 71.487  -78.746 151.050 1.00 128.98 ? 70  SER C N   1 
ATOM   9376  C CA  . SER C 1 70  ? 71.733  -77.435 150.463 1.00 126.54 ? 70  SER C CA  1 
ATOM   9377  C C   . SER C 1 70  ? 73.173  -76.995 150.687 1.00 126.59 ? 70  SER C C   1 
ATOM   9378  O O   . SER C 1 70  ? 73.727  -77.191 151.766 1.00 125.64 ? 70  SER C O   1 
ATOM   9379  C CB  . SER C 1 70  ? 70.774  -76.400 151.047 1.00 129.65 ? 70  SER C CB  1 
ATOM   9380  O OG  . SER C 1 70  ? 70.747  -75.241 150.237 1.00 128.24 ? 70  SER C OG  1 
ATOM   9381  N N   . ALA C 1 71  ? 73.780  -76.411 149.659 1.00 129.69 ? 71  ALA C N   1 
ATOM   9382  C CA  . ALA C 1 71  ? 75.164  -75.957 149.759 1.00 123.05 ? 71  ALA C CA  1 
ATOM   9383  C C   . ALA C 1 71  ? 75.400  -74.650 149.004 1.00 122.13 ? 71  ALA C C   1 
ATOM   9384  O O   . ALA C 1 71  ? 75.256  -74.598 147.783 1.00 127.31 ? 71  ALA C O   1 
ATOM   9385  C CB  . ALA C 1 71  ? 76.104  -77.034 149.247 1.00 126.42 ? 71  ALA C CB  1 
ATOM   9386  N N   . ILE C 1 72  ? 75.756  -73.596 149.733 1.00 116.38 ? 72  ILE C N   1 
ATOM   9387  C CA  . ILE C 1 72  ? 75.992  -72.290 149.119 1.00 114.51 ? 72  ILE C CA  1 
ATOM   9388  C C   . ILE C 1 72  ? 77.356  -71.699 149.498 1.00 116.31 ? 72  ILE C C   1 
ATOM   9389  O O   . ILE C 1 72  ? 77.678  -71.526 150.674 1.00 114.56 ? 72  ILE C O   1 
ATOM   9390  C CB  . ILE C 1 72  ? 74.880  -71.288 149.473 1.00 113.21 ? 72  ILE C CB  1 
ATOM   9391  C CG1 . ILE C 1 72  ? 74.579  -71.309 150.968 1.00 111.18 ? 72  ILE C CG1 1 
ATOM   9392  C CG2 . ILE C 1 72  ? 73.616  -71.600 148.681 1.00 113.89 ? 72  ILE C CG2 1 
ATOM   9393  C CD1 . ILE C 1 72  ? 73.875  -70.058 151.436 1.00 109.97 ? 72  ILE C CD1 1 
ATOM   9394  N N   . MET C 1 73  ? 78.149  -71.407 148.471 1.00 115.98 ? 73  MET C N   1 
ATOM   9395  C CA  . MET C 1 73  ? 79.496  -70.854 148.612 1.00 116.06 ? 73  MET C CA  1 
ATOM   9396  C C   . MET C 1 73  ? 79.525  -69.378 149.004 1.00 123.99 ? 73  MET C C   1 
ATOM   9397  O O   . MET C 1 73  ? 78.566  -68.650 148.779 1.00 141.99 ? 73  MET C O   1 
ATOM   9398  C CB  . MET C 1 73  ? 80.263  -71.024 147.296 1.00 119.73 ? 73  MET C CB  1 
ATOM   9399  C CG  . MET C 1 73  ? 81.753  -71.291 147.449 1.00 133.22 ? 73  MET C CG  1 
ATOM   9400  S SD  . MET C 1 73  ? 82.113  -72.889 148.199 1.00 144.87 ? 73  MET C SD  1 
ATOM   9401  C CE  . MET C 1 73  ? 81.172  -73.963 147.118 1.00 148.80 ? 73  MET C CE  1 
ATOM   9402  N N   . ASN C 1 74  ? 80.652  -68.941 149.560 1.00 114.81 ? 74  ASN C N   1 
ATOM   9403  C CA  . ASN C 1 74  ? 80.848  -67.538 149.898 1.00 110.94 ? 74  ASN C CA  1 
ATOM   9404  C C   . ASN C 1 74  ? 80.954  -66.754 148.599 1.00 114.44 ? 74  ASN C C   1 
ATOM   9405  O O   . ASN C 1 74  ? 81.438  -67.285 147.601 1.00 116.29 ? 74  ASN C O   1 
ATOM   9406  C CB  . ASN C 1 74  ? 82.122  -67.358 150.735 1.00 109.43 ? 74  ASN C CB  1 
ATOM   9407  C CG  . ASN C 1 74  ? 81.980  -66.307 151.819 1.00 114.36 ? 74  ASN C CG  1 
ATOM   9408  O OD1 . ASN C 1 74  ? 82.119  -65.109 151.578 1.00 108.06 ? 74  ASN C OD1 1 
ATOM   9409  N ND2 . ASN C 1 74  ? 81.732  -66.761 153.035 1.00 130.52 ? 74  ASN C ND2 1 
ATOM   9410  N N   . PRO C 1 75  ? 80.470  -65.501 148.587 1.00 111.31 ? 75  PRO C N   1 
ATOM   9411  C CA  . PRO C 1 75  ? 80.594  -64.716 147.354 1.00 111.83 ? 75  PRO C CA  1 
ATOM   9412  C C   . PRO C 1 75  ? 82.046  -64.499 146.913 1.00 125.21 ? 75  PRO C C   1 
ATOM   9413  O O   . PRO C 1 75  ? 82.269  -64.067 145.782 1.00 137.52 ? 75  PRO C O   1 
ATOM   9414  C CB  . PRO C 1 75  ? 79.921  -63.380 147.707 1.00 110.10 ? 75  PRO C CB  1 
ATOM   9415  C CG  . PRO C 1 75  ? 79.838  -63.349 149.193 1.00 111.00 ? 75  PRO C CG  1 
ATOM   9416  C CD  . PRO C 1 75  ? 79.746  -64.770 149.642 1.00 109.78 ? 75  PRO C CD  1 
ATOM   9417  N N   . ALA C 1 76  ? 83.014  -64.799 147.775 1.00 118.28 ? 76  ALA C N   1 
ATOM   9418  C CA  . ALA C 1 76  ? 84.414  -64.654 147.389 1.00 117.43 ? 76  ALA C CA  1 
ATOM   9419  C C   . ALA C 1 76  ? 85.315  -65.747 147.964 1.00 136.53 ? 76  ALA C C   1 
ATOM   9420  O O   . ALA C 1 76  ? 86.055  -66.406 147.234 1.00 140.91 ? 76  ALA C O   1 
ATOM   9421  C CB  . ALA C 1 76  ? 84.924  -63.287 147.808 1.00 114.73 ? 76  ALA C CB  1 
ATOM   9422  N N   . SER C 1 77  ? 85.245  -65.925 149.278 1.00 145.36 ? 77  SER C N   1 
ATOM   9423  C CA  . SER C 1 77  ? 86.075  -66.892 149.990 1.00 147.32 ? 77  SER C CA  1 
ATOM   9424  C C   . SER C 1 77  ? 85.800  -68.345 149.627 1.00 144.58 ? 77  SER C C   1 
ATOM   9425  O O   . SER C 1 77  ? 84.718  -68.686 149.149 1.00 134.80 ? 77  SER C O   1 
ATOM   9426  C CB  . SER C 1 77  ? 85.898  -66.711 151.495 1.00 135.81 ? 77  SER C CB  1 
ATOM   9427  O OG  . SER C 1 77  ? 85.930  -65.334 151.835 1.00 128.86 ? 77  SER C OG  1 
ATOM   9428  N N   . LYS C 1 78  ? 86.794  -69.201 149.857 1.00 145.41 ? 78  LYS C N   1 
ATOM   9429  C CA  . LYS C 1 78  ? 86.631  -70.633 149.638 1.00 142.10 ? 78  LYS C CA  1 
ATOM   9430  C C   . LYS C 1 78  ? 85.973  -71.227 150.876 1.00 125.24 ? 78  LYS C C   1 
ATOM   9431  O O   . LYS C 1 78  ? 86.468  -72.180 151.474 1.00 125.19 ? 78  LYS C O   1 
ATOM   9432  C CB  . LYS C 1 78  ? 87.970  -71.318 149.351 1.00 146.00 ? 78  LYS C CB  1 
ATOM   9433  C CG  . LYS C 1 78  ? 88.601  -70.905 148.031 1.00 150.77 ? 78  LYS C CG  1 
ATOM   9434  C CD  . LYS C 1 78  ? 88.414  -71.986 146.980 1.00 154.86 ? 78  LYS C CD  1 
ATOM   9435  C CE  . LYS C 1 78  ? 89.207  -71.673 145.725 1.00 159.31 ? 78  LYS C CE  1 
ATOM   9436  N NZ  . LYS C 1 78  ? 90.654  -71.974 145.869 1.00 165.75 ? 78  LYS C NZ  1 
ATOM   9437  N N   . VAL C 1 79  ? 84.850  -70.626 151.253 1.00 120.05 ? 79  VAL C N   1 
ATOM   9438  C CA  . VAL C 1 79  ? 84.075  -71.025 152.419 1.00 119.19 ? 79  VAL C CA  1 
ATOM   9439  C C   . VAL C 1 79  ? 82.685  -71.444 151.972 1.00 117.53 ? 79  VAL C C   1 
ATOM   9440  O O   . VAL C 1 79  ? 82.028  -70.724 151.223 1.00 115.60 ? 79  VAL C O   1 
ATOM   9441  C CB  . VAL C 1 79  ? 83.962  -69.883 153.448 1.00 116.75 ? 79  VAL C CB  1 
ATOM   9442  C CG1 . VAL C 1 79  ? 82.912  -70.209 154.495 1.00 121.94 ? 79  VAL C CG1 1 
ATOM   9443  C CG2 . VAL C 1 79  ? 85.312  -69.606 154.086 1.00 124.35 ? 79  VAL C CG2 1 
ATOM   9444  N N   . ILE C 1 80  ? 82.232  -72.604 152.430 1.00 114.76 ? 80  ILE C N   1 
ATOM   9445  C CA  . ILE C 1 80  ? 80.911  -73.081 152.044 1.00 114.20 ? 80  ILE C CA  1 
ATOM   9446  C C   . ILE C 1 80  ? 79.970  -73.164 153.242 1.00 122.01 ? 80  ILE C C   1 
ATOM   9447  O O   . ILE C 1 80  ? 80.407  -73.345 154.380 1.00 124.33 ? 80  ILE C O   1 
ATOM   9448  C CB  . ILE C 1 80  ? 80.986  -74.464 151.368 1.00 118.21 ? 80  ILE C CB  1 
ATOM   9449  C CG1 . ILE C 1 80  ? 79.706  -74.754 150.583 1.00 118.46 ? 80  ILE C CG1 1 
ATOM   9450  C CG2 . ILE C 1 80  ? 81.279  -75.556 152.387 1.00 118.89 ? 80  ILE C CG2 1 
ATOM   9451  C CD1 . ILE C 1 80  ? 79.786  -76.013 149.768 1.00 123.70 ? 80  ILE C CD1 1 
ATOM   9452  N N   . ALA C 1 81  ? 78.677  -73.009 152.983 1.00 123.81 ? 81  ALA C N   1 
ATOM   9453  C CA  . ALA C 1 81  ? 77.664  -73.169 154.017 1.00 109.77 ? 81  ALA C CA  1 
ATOM   9454  C C   . ALA C 1 81  ? 76.725  -74.301 153.619 1.00 113.79 ? 81  ALA C C   1 
ATOM   9455  O O   . ALA C 1 81  ? 76.117  -74.256 152.549 1.00 124.66 ? 81  ALA C O   1 
ATOM   9456  C CB  . ALA C 1 81  ? 76.898  -71.873 154.225 1.00 107.44 ? 81  ALA C CB  1 
ATOM   9457  N N   . LEU C 1 82  ? 76.577  -75.298 154.488 1.00 112.76 ? 82  LEU C N   1 
ATOM   9458  C CA  . LEU C 1 82  ? 75.757  -76.458 154.149 1.00 124.31 ? 82  LEU C CA  1 
ATOM   9459  C C   . LEU C 1 82  ? 74.637  -76.728 155.148 1.00 115.47 ? 82  LEU C C   1 
ATOM   9460  O O   . LEU C 1 82  ? 74.805  -76.588 156.362 1.00 113.92 ? 82  LEU C O   1 
ATOM   9461  C CB  . LEU C 1 82  ? 76.623  -77.718 154.026 1.00 134.10 ? 82  LEU C CB  1 
ATOM   9462  C CG  . LEU C 1 82  ? 78.133  -77.572 153.889 1.00 120.85 ? 82  LEU C CG  1 
ATOM   9463  C CD1 . LEU C 1 82  ? 78.806  -78.301 155.032 1.00 120.97 ? 82  LEU C CD1 1 
ATOM   9464  C CD2 . LEU C 1 82  ? 78.595  -78.134 152.562 1.00 125.17 ? 82  LEU C CD2 1 
ATOM   9465  N N   . LYS C 1 83  ? 73.491  -77.122 154.600 1.00 113.08 ? 83  LYS C N   1 
ATOM   9466  C CA  . LYS C 1 83  ? 72.291  -77.412 155.370 1.00 111.66 ? 83  LYS C CA  1 
ATOM   9467  C C   . LYS C 1 83  ? 71.964  -78.896 155.433 1.00 116.42 ? 83  LYS C C   1 
ATOM   9468  O O   . LYS C 1 83  ? 72.012  -79.595 154.420 1.00 119.04 ? 83  LYS C O   1 
ATOM   9469  C CB  . LYS C 1 83  ? 71.090  -76.676 154.781 1.00 121.93 ? 83  LYS C CB  1 
ATOM   9470  C CG  . LYS C 1 83  ? 69.811  -76.917 155.560 1.00 133.25 ? 83  LYS C CG  1 
ATOM   9471  C CD  . LYS C 1 83  ? 68.579  -76.378 154.854 1.00 134.92 ? 83  LYS C CD  1 
ATOM   9472  C CE  . LYS C 1 83  ? 67.305  -77.001 155.425 1.00 145.45 ? 83  LYS C CE  1 
ATOM   9473  N NZ  . LYS C 1 83  ? 67.037  -78.407 154.995 1.00 152.38 ? 83  LYS C NZ  1 
ATOM   9474  N N   . ALA C 1 84  ? 71.684  -79.395 156.631 1.00 113.71 ? 84  ALA C N   1 
ATOM   9475  C CA  . ALA C 1 84  ? 71.237  -80.779 156.760 1.00 117.94 ? 84  ALA C CA  1 
ATOM   9476  C C   . ALA C 1 84  ? 70.138  -80.916 157.818 1.00 123.61 ? 84  ALA C C   1 
ATOM   9477  O O   . ALA C 1 84  ? 70.443  -81.098 158.999 1.00 130.26 ? 84  ALA C O   1 
ATOM   9478  C CB  . ALA C 1 84  ? 72.411  -81.666 157.096 1.00 117.70 ? 84  ALA C CB  1 
ATOM   9479  N N   . GLY C 1 85  ? 68.871  -80.847 157.412 1.00 115.77 ? 85  GLY C N   1 
ATOM   9480  C CA  . GLY C 1 85  ? 67.790  -81.058 158.358 1.00 111.72 ? 85  GLY C CA  1 
ATOM   9481  C C   . GLY C 1 85  ? 67.808  -80.069 159.519 1.00 120.23 ? 85  GLY C C   1 
ATOM   9482  O O   . GLY C 1 85  ? 67.862  -80.502 160.672 1.00 146.37 ? 85  GLY C O   1 
ATOM   9483  N N   . LYS C 1 86  ? 67.785  -78.766 159.232 1.00 107.18 ? 86  LYS C N   1 
ATOM   9484  C CA  . LYS C 1 86  ? 67.775  -77.713 160.259 1.00 118.90 ? 86  LYS C CA  1 
ATOM   9485  C C   . LYS C 1 86  ? 69.117  -77.620 160.979 1.00 125.41 ? 86  LYS C C   1 
ATOM   9486  O O   . LYS C 1 86  ? 69.287  -76.783 161.864 1.00 99.36  ? 86  LYS C O   1 
ATOM   9487  C CB  . LYS C 1 86  ? 66.670  -77.964 161.285 1.00 116.70 ? 86  LYS C CB  1 
ATOM   9488  C CG  . LYS C 1 86  ? 65.353  -78.350 160.662 1.00 125.08 ? 86  LYS C CG  1 
ATOM   9489  C CD  . LYS C 1 86  ? 64.417  -79.010 161.657 1.00 120.33 ? 86  LYS C CD  1 
ATOM   9490  C CE  . LYS C 1 86  ? 63.904  -78.092 162.757 1.00 128.05 ? 86  LYS C CE  1 
ATOM   9491  N NZ  . LYS C 1 86  ? 64.799  -77.895 163.944 1.00 146.47 ? 86  LYS C NZ  1 
ATOM   9492  N N   . THR C 1 87  ? 70.088  -78.433 160.571 1.00 125.57 ? 87  THR C N   1 
ATOM   9493  C CA  . THR C 1 87  ? 71.416  -78.342 161.171 1.00 110.55 ? 87  THR C CA  1 
ATOM   9494  C C   . THR C 1 87  ? 72.285  -77.627 160.140 1.00 102.49 ? 87  THR C C   1 
ATOM   9495  O O   . THR C 1 87  ? 72.569  -78.145 159.054 1.00 104.08 ? 87  THR C O   1 
ATOM   9496  C CB  . THR C 1 87  ? 71.998  -79.704 161.558 1.00 114.54 ? 87  THR C CB  1 
ATOM   9497  O OG1 . THR C 1 87  ? 71.027  -80.432 162.323 1.00 109.74 ? 87  THR C OG1 1 
ATOM   9498  C CG2 . THR C 1 87  ? 73.271  -79.516 162.389 1.00 126.32 ? 87  THR C CG2 1 
ATOM   9499  N N   . LEU C 1 88  ? 72.708  -76.426 160.505 1.00 101.36 ? 88  LEU C N   1 
ATOM   9500  C CA  . LEU C 1 88  ? 73.472  -75.565 159.621 1.00 102.66 ? 88  LEU C CA  1 
ATOM   9501  C C   . LEU C 1 88  ? 74.949  -75.598 159.980 1.00 109.50 ? 88  LEU C C   1 
ATOM   9502  O O   . LEU C 1 88  ? 75.313  -75.816 161.134 1.00 114.27 ? 88  LEU C O   1 
ATOM   9503  C CB  . LEU C 1 88  ? 72.924  -74.142 159.703 1.00 100.87 ? 88  LEU C CB  1 
ATOM   9504  C CG  . LEU C 1 88  ? 71.656  -73.839 158.895 1.00 100.28 ? 88  LEU C CG  1 
ATOM   9505  C CD1 . LEU C 1 88  ? 70.400  -74.486 159.483 1.00 108.31 ? 88  LEU C CD1 1 
ATOM   9506  C CD2 . LEU C 1 88  ? 71.471  -72.351 158.826 1.00 98.65  ? 88  LEU C CD2 1 
ATOM   9507  N N   . GLN C 1 89  ? 75.804  -75.398 158.986 1.00 112.26 ? 89  GLN C N   1 
ATOM   9508  C CA  . GLN C 1 89  ? 77.236  -75.474 159.225 1.00 108.59 ? 89  GLN C CA  1 
ATOM   9509  C C   . GLN C 1 89  ? 78.055  -74.675 158.218 1.00 109.66 ? 89  GLN C C   1 
ATOM   9510  O O   . GLN C 1 89  ? 78.016  -74.940 157.018 1.00 114.40 ? 89  GLN C O   1 
ATOM   9511  C CB  . GLN C 1 89  ? 77.671  -76.940 159.218 1.00 119.86 ? 89  GLN C CB  1 
ATOM   9512  C CG  . GLN C 1 89  ? 79.166  -77.161 159.201 1.00 141.46 ? 89  GLN C CG  1 
ATOM   9513  C CD  . GLN C 1 89  ? 79.534  -78.561 158.757 1.00 145.34 ? 89  GLN C CD  1 
ATOM   9514  O OE1 . GLN C 1 89  ? 80.564  -78.769 158.118 1.00 141.00 ? 89  GLN C OE1 1 
ATOM   9515  N NE2 . GLN C 1 89  ? 78.691  -79.531 159.094 1.00 155.71 ? 89  GLN C NE2 1 
ATOM   9516  N N   . ILE C 1 90  ? 78.791  -73.689 158.721 1.00 108.72 ? 90  ILE C N   1 
ATOM   9517  C CA  . ILE C 1 90  ? 79.726  -72.934 157.894 1.00 113.49 ? 90  ILE C CA  1 
ATOM   9518  C C   . ILE C 1 90  ? 81.073  -73.650 157.926 1.00 115.25 ? 90  ILE C C   1 
ATOM   9519  O O   . ILE C 1 90  ? 81.712  -73.750 158.971 1.00 116.25 ? 90  ILE C O   1 
ATOM   9520  C CB  . ILE C 1 90  ? 79.877  -71.485 158.365 1.00 113.88 ? 90  ILE C CB  1 
ATOM   9521  C CG1 . ILE C 1 90  ? 78.537  -70.754 158.257 1.00 108.50 ? 90  ILE C CG1 1 
ATOM   9522  C CG2 . ILE C 1 90  ? 80.934  -70.769 157.543 1.00 111.89 ? 90  ILE C CG2 1 
ATOM   9523  C CD1 . ILE C 1 90  ? 78.472  -69.481 159.066 1.00 111.67 ? 90  ILE C CD1 1 
ATOM   9524  N N   . PHE C 1 91  ? 81.504  -74.118 156.762 1.00 115.19 ? 91  PHE C N   1 
ATOM   9525  C CA  . PHE C 1 91  ? 82.664  -74.994 156.647 1.00 118.44 ? 91  PHE C CA  1 
ATOM   9526  C C   . PHE C 1 91  ? 83.775  -74.421 155.762 1.00 123.47 ? 91  PHE C C   1 
ATOM   9527  O O   . PHE C 1 91  ? 83.504  -73.859 154.700 1.00 121.87 ? 91  PHE C O   1 
ATOM   9528  C CB  . PHE C 1 91  ? 82.172  -76.346 156.118 1.00 121.18 ? 91  PHE C CB  1 
ATOM   9529  C CG  . PHE C 1 91  ? 83.247  -77.367 155.906 1.00 129.68 ? 91  PHE C CG  1 
ATOM   9530  C CD1 . PHE C 1 91  ? 83.742  -78.105 156.967 1.00 130.18 ? 91  PHE C CD1 1 
ATOM   9531  C CD2 . PHE C 1 91  ? 83.701  -77.650 154.630 1.00 136.40 ? 91  PHE C CD2 1 
ATOM   9532  C CE1 . PHE C 1 91  ? 84.713  -79.065 156.766 1.00 132.78 ? 91  PHE C CE1 1 
ATOM   9533  C CE2 . PHE C 1 91  ? 84.665  -78.612 154.419 1.00 136.84 ? 91  PHE C CE2 1 
ATOM   9534  C CZ  . PHE C 1 91  ? 85.172  -79.322 155.489 1.00 135.07 ? 91  PHE C CZ  1 
ATOM   9535  N N   . ASN C 1 92  ? 85.024  -74.557 156.206 1.00 135.66 ? 92  ASN C N   1 
ATOM   9536  C CA  . ASN C 1 92  ? 86.168  -74.086 155.423 1.00 137.76 ? 92  ASN C CA  1 
ATOM   9537  C C   . ASN C 1 92  ? 86.649  -75.159 154.458 1.00 134.99 ? 92  ASN C C   1 
ATOM   9538  O O   . ASN C 1 92  ? 87.181  -76.191 154.866 1.00 149.58 ? 92  ASN C O   1 
ATOM   9539  C CB  . ASN C 1 92  ? 87.317  -73.658 156.334 1.00 139.41 ? 92  ASN C CB  1 
ATOM   9540  C CG  . ASN C 1 92  ? 88.276  -72.699 155.652 1.00 149.50 ? 92  ASN C CG  1 
ATOM   9541  O OD1 . ASN C 1 92  ? 88.929  -73.046 154.667 1.00 168.80 ? 92  ASN C OD1 1 
ATOM   9542  N ND2 . ASN C 1 92  ? 88.357  -71.479 156.168 1.00 144.05 ? 92  ASN C ND2 1 
ATOM   9543  N N   . ILE C 1 93  ? 86.471  -74.899 153.171 1.00 131.37 ? 93  ILE C N   1 
ATOM   9544  C CA  . ILE C 1 93  ? 86.812  -75.870 152.140 1.00 135.51 ? 93  ILE C CA  1 
ATOM   9545  C C   . ILE C 1 93  ? 88.308  -76.173 152.092 1.00 143.38 ? 93  ILE C C   1 
ATOM   9546  O O   . ILE C 1 93  ? 88.713  -77.335 152.093 1.00 146.80 ? 93  ILE C O   1 
ATOM   9547  C CB  . ILE C 1 93  ? 86.352  -75.395 150.750 1.00 136.38 ? 93  ILE C CB  1 
ATOM   9548  C CG1 . ILE C 1 93  ? 84.835  -75.522 150.637 1.00 130.34 ? 93  ILE C CG1 1 
ATOM   9549  C CG2 . ILE C 1 93  ? 87.057  -76.181 149.653 1.00 147.54 ? 93  ILE C CG2 1 
ATOM   9550  C CD1 . ILE C 1 93  ? 84.355  -76.952 150.623 1.00 134.25 ? 93  ILE C CD1 1 
ATOM   9551  N N   . GLU C 1 94  ? 89.121  -75.121 152.036 1.00 145.97 ? 94  GLU C N   1 
ATOM   9552  C CA  . GLU C 1 94  ? 90.572  -75.259 151.940 1.00 154.59 ? 94  GLU C CA  1 
ATOM   9553  C C   . GLU C 1 94  ? 91.190  -75.964 153.143 1.00 152.77 ? 94  GLU C C   1 
ATOM   9554  O O   . GLU C 1 94  ? 92.107  -76.770 152.994 1.00 165.17 ? 94  GLU C O   1 
ATOM   9555  C CB  . GLU C 1 94  ? 91.224  -73.883 151.770 1.00 167.09 ? 94  GLU C CB  1 
ATOM   9556  C CG  . GLU C 1 94  ? 92.350  -73.835 150.739 1.00 181.45 ? 94  GLU C CG  1 
ATOM   9557  C CD  . GLU C 1 94  ? 91.859  -73.981 149.310 1.00 191.41 ? 94  GLU C CD  1 
ATOM   9558  O OE1 . GLU C 1 94  ? 92.173  -75.004 148.664 1.00 197.19 ? 94  GLU C OE1 1 
ATOM   9559  O OE2 . GLU C 1 94  ? 91.182  -73.054 148.819 1.00 188.99 ? 94  GLU C OE2 1 
ATOM   9560  N N   . MET C 1 95  ? 90.700  -75.634 154.334 1.00 146.98 ? 95  MET C N   1 
ATOM   9561  C CA  . MET C 1 95  ? 91.232  -76.189 155.577 1.00 149.66 ? 95  MET C CA  1 
ATOM   9562  C C   . MET C 1 95  ? 90.513  -77.437 156.063 1.00 149.70 ? 95  MET C C   1 
ATOM   9563  O O   . MET C 1 95  ? 90.855  -77.974 157.118 1.00 151.03 ? 95  MET C O   1 
ATOM   9564  C CB  . MET C 1 95  ? 91.207  -75.128 156.676 1.00 150.42 ? 95  MET C CB  1 
ATOM   9565  C CG  . MET C 1 95  ? 91.954  -73.882 156.277 1.00 154.02 ? 95  MET C CG  1 
ATOM   9566  S SD  . MET C 1 95  ? 93.696  -74.275 156.038 1.00 199.93 ? 95  MET C SD  1 
ATOM   9567  C CE  . MET C 1 95  ? 93.862  -74.085 154.262 1.00 185.37 ? 95  MET C CE  1 
ATOM   9568  N N   . LYS C 1 96  ? 89.546  -77.907 155.275 1.00 153.85 ? 96  LYS C N   1 
ATOM   9569  C CA  . LYS C 1 96  ? 88.693  -79.054 155.616 1.00 156.36 ? 96  LYS C CA  1 
ATOM   9570  C C   . LYS C 1 96  ? 88.271  -79.071 157.087 1.00 152.80 ? 96  LYS C C   1 
ATOM   9571  O O   . LYS C 1 96  ? 88.219  -80.123 157.718 1.00 158.67 ? 96  LYS C O   1 
ATOM   9572  C CB  . LYS C 1 96  ? 89.374  -80.388 155.241 1.00 160.97 ? 96  LYS C CB  1 
ATOM   9573  C CG  . LYS C 1 96  ? 90.890  -80.493 155.440 1.00 178.04 ? 96  LYS C CG  1 
ATOM   9574  C CD  . LYS C 1 96  ? 91.261  -81.252 156.702 1.00 184.43 ? 96  LYS C CD  1 
ATOM   9575  C CE  . LYS C 1 96  ? 92.761  -81.496 156.760 1.00 182.36 ? 96  LYS C CE  1 
ATOM   9576  N NZ  . LYS C 1 96  ? 93.532  -80.227 156.871 1.00 182.39 ? 96  LYS C NZ  1 
ATOM   9577  N N   . SER C 1 97  ? 87.983  -77.891 157.626 1.00 139.64 ? 97  SER C N   1 
ATOM   9578  C CA  . SER C 1 97  ? 87.595  -77.751 159.026 1.00 142.88 ? 97  SER C CA  1 
ATOM   9579  C C   . SER C 1 97  ? 86.313  -76.932 159.170 1.00 150.34 ? 97  SER C C   1 
ATOM   9580  O O   . SER C 1 97  ? 86.052  -76.034 158.370 1.00 153.55 ? 97  SER C O   1 
ATOM   9581  C CB  . SER C 1 97  ? 88.726  -77.108 159.825 1.00 145.87 ? 97  SER C CB  1 
ATOM   9582  O OG  . SER C 1 97  ? 89.003  -75.806 159.343 1.00 148.65 ? 97  SER C OG  1 
ATOM   9583  N N   . LYS C 1 98  ? 85.503  -77.260 160.174 1.00 154.13 ? 98  LYS C N   1 
ATOM   9584  C CA  . LYS C 1 98  ? 84.253  -76.541 160.424 1.00 145.41 ? 98  LYS C CA  1 
ATOM   9585  C C   . LYS C 1 98  ? 84.480  -75.214 161.144 1.00 128.18 ? 98  LYS C C   1 
ATOM   9586  O O   . LYS C 1 98  ? 85.140  -75.166 162.183 1.00 129.87 ? 98  LYS C O   1 
ATOM   9587  C CB  . LYS C 1 98  ? 83.283  -77.394 161.245 1.00 154.98 ? 98  LYS C CB  1 
ATOM   9588  C CG  . LYS C 1 98  ? 82.971  -78.760 160.660 1.00 167.73 ? 98  LYS C CG  1 
ATOM   9589  C CD  . LYS C 1 98  ? 83.918  -79.798 161.231 1.00 178.08 ? 98  LYS C CD  1 
ATOM   9590  C CE  . LYS C 1 98  ? 84.769  -80.420 160.144 1.00 172.04 ? 98  LYS C CE  1 
ATOM   9591  N NZ  . LYS C 1 98  ? 85.914  -81.173 160.721 1.00 162.81 ? 98  LYS C NZ  1 
ATOM   9592  N N   . MET C 1 99  ? 83.928  -74.141 160.583 1.00 122.32 ? 99  MET C N   1 
ATOM   9593  C CA  . MET C 1 99  ? 84.051  -72.809 161.170 1.00 121.78 ? 99  MET C CA  1 
ATOM   9594  C C   . MET C 1 99  ? 82.967  -72.530 162.207 1.00 123.86 ? 99  MET C C   1 
ATOM   9595  O O   . MET C 1 99  ? 83.264  -72.277 163.374 1.00 128.06 ? 99  MET C O   1 
ATOM   9596  C CB  . MET C 1 99  ? 83.995  -71.735 160.082 1.00 121.93 ? 99  MET C CB  1 
ATOM   9597  C CG  . MET C 1 99  ? 85.098  -71.835 159.050 1.00 124.67 ? 99  MET C CG  1 
ATOM   9598  S SD  . MET C 1 99  ? 84.769  -70.856 157.575 1.00 124.95 ? 99  MET C SD  1 
ATOM   9599  C CE  . MET C 1 99  ? 85.128  -69.199 158.166 1.00 123.83 ? 99  MET C CE  1 
ATOM   9600  N N   . LYS C 1 100 ? 81.712  -72.572 161.771 1.00 121.45 ? 100 LYS C N   1 
ATOM   9601  C CA  . LYS C 1 100 ? 80.578  -72.320 162.654 1.00 113.29 ? 100 LYS C CA  1 
ATOM   9602  C C   . LYS C 1 100 ? 79.520  -73.403 162.499 1.00 113.54 ? 100 LYS C C   1 
ATOM   9603  O O   . LYS C 1 100 ? 79.587  -74.214 161.576 1.00 113.18 ? 100 LYS C O   1 
ATOM   9604  C CB  . LYS C 1 100 ? 79.967  -70.948 162.367 1.00 112.17 ? 100 LYS C CB  1 
ATOM   9605  C CG  . LYS C 1 100 ? 80.755  -69.776 162.924 1.00 113.89 ? 100 LYS C CG  1 
ATOM   9606  C CD  . LYS C 1 100 ? 80.012  -68.474 162.669 1.00 111.71 ? 100 LYS C CD  1 
ATOM   9607  C CE  . LYS C 1 100 ? 79.578  -67.803 163.960 1.00 115.63 ? 100 LYS C CE  1 
ATOM   9608  N NZ  . LYS C 1 100 ? 78.526  -68.571 164.685 1.00 132.00 ? 100 LYS C NZ  1 
ATOM   9609  N N   . ALA C 1 101 ? 78.550  -73.425 163.409 1.00 114.51 ? 101 ALA C N   1 
ATOM   9610  C CA  . ALA C 1 101 ? 77.459  -74.390 163.323 1.00 112.93 ? 101 ALA C CA  1 
ATOM   9611  C C   . ALA C 1 101 ? 76.235  -73.936 164.110 1.00 111.48 ? 101 ALA C C   1 
ATOM   9612  O O   . ALA C 1 101 ? 76.355  -73.259 165.129 1.00 118.67 ? 101 ALA C O   1 
ATOM   9613  C CB  . ALA C 1 101 ? 77.924  -75.751 163.814 1.00 111.95 ? 101 ALA C CB  1 
ATOM   9614  N N   . HIS C 1 102 ? 75.056  -74.320 163.633 1.00 110.19 ? 102 HIS C N   1 
ATOM   9615  C CA  . HIS C 1 102 ? 73.812  -73.991 164.316 1.00 111.73 ? 102 HIS C CA  1 
ATOM   9616  C C   . HIS C 1 102 ? 72.665  -74.921 163.951 1.00 110.95 ? 102 HIS C C   1 
ATOM   9617  O O   . HIS C 1 102 ? 72.488  -75.289 162.789 1.00 116.98 ? 102 HIS C O   1 
ATOM   9618  C CB  . HIS C 1 102 ? 73.402  -72.547 164.024 1.00 107.11 ? 102 HIS C CB  1 
ATOM   9619  C CG  . HIS C 1 102 ? 72.347  -72.019 164.952 1.00 109.51 ? 102 HIS C CG  1 
ATOM   9620  N ND1 . HIS C 1 102 ? 71.018  -71.947 164.607 1.00 119.68 ? 102 HIS C ND1 1 
ATOM   9621  C CD2 . HIS C 1 102 ? 72.429  -71.548 166.222 1.00 109.89 ? 102 HIS C CD2 1 
ATOM   9622  C CE1 . HIS C 1 102 ? 70.322  -71.448 165.613 1.00 114.70 ? 102 HIS C CE1 1 
ATOM   9623  N NE2 . HIS C 1 102 ? 71.160  -71.195 166.606 1.00 108.94 ? 102 HIS C NE2 1 
ATOM   9624  N N   . THR C 1 103 ? 71.898  -75.306 164.965 1.00 110.41 ? 103 THR C N   1 
ATOM   9625  C CA  . THR C 1 103 ? 70.699  -76.107 164.767 1.00 107.31 ? 103 THR C CA  1 
ATOM   9626  C C   . THR C 1 103 ? 69.487  -75.219 165.026 1.00 110.09 ? 103 THR C C   1 
ATOM   9627  O O   . THR C 1 103 ? 69.314  -74.713 166.131 1.00 114.12 ? 103 THR C O   1 
ATOM   9628  C CB  . THR C 1 103 ? 70.649  -77.319 165.700 1.00 109.92 ? 103 THR C CB  1 
ATOM   9629  O OG1 . THR C 1 103 ? 71.779  -78.168 165.463 1.00 110.71 ? 103 THR C OG1 1 
ATOM   9630  C CG2 . THR C 1 103 ? 69.359  -78.102 165.478 1.00 107.01 ? 103 THR C CG2 1 
ATOM   9631  N N   . MET C 1 104 ? 68.642  -75.063 164.012 1.00 108.22 ? 104 MET C N   1 
ATOM   9632  C CA  . MET C 1 104 ? 67.483  -74.176 164.063 1.00 104.89 ? 104 MET C CA  1 
ATOM   9633  C C   . MET C 1 104 ? 66.234  -74.852 164.604 1.00 110.10 ? 104 MET C C   1 
ATOM   9634  O O   . MET C 1 104 ? 66.039  -76.052 164.423 1.00 112.45 ? 104 MET C O   1 
ATOM   9635  C CB  . MET C 1 104 ? 67.172  -73.615 162.673 1.00 100.50 ? 104 MET C CB  1 
ATOM   9636  C CG  . MET C 1 104 ? 68.184  -72.614 162.136 1.00 101.70 ? 104 MET C CG  1 
ATOM   9637  S SD  . MET C 1 104 ? 67.574  -70.915 162.157 1.00 105.73 ? 104 MET C SD  1 
ATOM   9638  C CE  . MET C 1 104 ? 67.296  -70.679 163.905 1.00 162.52 ? 104 MET C CE  1 
ATOM   9639  N N   . THR C 1 105 ? 65.422  -74.086 165.328 1.00 120.91 ? 105 THR C N   1 
ATOM   9640  C CA  . THR C 1 105 ? 64.153  -74.596 165.856 1.00 127.00 ? 105 THR C CA  1 
ATOM   9641  C C   . THR C 1 105 ? 63.161  -74.923 164.745 1.00 126.97 ? 105 THR C C   1 
ATOM   9642  O O   . THR C 1 105 ? 62.738  -76.066 164.604 1.00 112.03 ? 105 THR C O   1 
ATOM   9643  C CB  . THR C 1 105 ? 63.490  -73.615 166.837 1.00 119.89 ? 105 THR C CB  1 
ATOM   9644  O OG1 . THR C 1 105 ? 63.714  -72.267 166.405 1.00 137.73 ? 105 THR C OG1 1 
ATOM   9645  C CG2 . THR C 1 105 ? 64.078  -73.805 168.223 1.00 111.98 ? 105 THR C CG2 1 
ATOM   9646  N N   . ASP C 1 106 ? 62.732  -73.907 164.004 1.00 134.33 ? 106 ASP C N   1 
ATOM   9647  C CA  . ASP C 1 106 ? 61.875  -74.131 162.838 1.00 131.31 ? 106 ASP C CA  1 
ATOM   9648  C C   . ASP C 1 106 ? 62.709  -74.086 161.555 1.00 119.01 ? 106 ASP C C   1 
ATOM   9649  O O   . ASP C 1 106 ? 63.612  -73.260 161.415 1.00 119.78 ? 106 ASP C O   1 
ATOM   9650  C CB  . ASP C 1 106 ? 60.733  -73.120 162.802 1.00 133.66 ? 106 ASP C CB  1 
ATOM   9651  C CG  . ASP C 1 106 ? 61.207  -71.725 163.097 1.00 139.98 ? 106 ASP C CG  1 
ATOM   9652  O OD1 . ASP C 1 106 ? 62.355  -71.589 163.575 1.00 149.04 ? 106 ASP C OD1 1 
ATOM   9653  O OD2 . ASP C 1 106 ? 60.450  -70.765 162.856 1.00 138.58 ? 106 ASP C OD2 1 
ATOM   9654  N N   . ASP C 1 107 ? 62.373  -74.973 160.623 1.00 105.75 ? 107 ASP C N   1 
ATOM   9655  C CA  . ASP C 1 107 ? 63.131  -75.194 159.390 1.00 101.29 ? 107 ASP C CA  1 
ATOM   9656  C C   . ASP C 1 107 ? 63.423  -73.962 158.539 1.00 113.59 ? 107 ASP C C   1 
ATOM   9657  O O   . ASP C 1 107 ? 62.582  -73.078 158.388 1.00 127.28 ? 107 ASP C O   1 
ATOM   9658  C CB  . ASP C 1 107 ? 62.386  -76.207 158.521 1.00 106.37 ? 107 ASP C CB  1 
ATOM   9659  C CG  . ASP C 1 107 ? 63.300  -77.266 157.948 1.00 142.68 ? 107 ASP C CG  1 
ATOM   9660  O OD1 . ASP C 1 107 ? 64.065  -76.957 157.009 1.00 167.50 ? 107 ASP C OD1 1 
ATOM   9661  O OD2 . ASP C 1 107 ? 63.244  -78.416 158.431 1.00 143.82 ? 107 ASP C OD2 1 
ATOM   9662  N N   . VAL C 1 108 ? 64.634  -73.927 157.986 1.00 101.81 ? 108 VAL C N   1 
ATOM   9663  C CA  . VAL C 1 108 ? 65.060  -72.864 157.076 1.00 93.55  ? 108 VAL C CA  1 
ATOM   9664  C C   . VAL C 1 108 ? 64.608  -73.161 155.649 1.00 104.84 ? 108 VAL C C   1 
ATOM   9665  O O   . VAL C 1 108 ? 65.128  -74.061 154.989 1.00 114.88 ? 108 VAL C O   1 
ATOM   9666  C CB  . VAL C 1 108 ? 66.588  -72.670 157.091 1.00 95.99  ? 108 VAL C CB  1 
ATOM   9667  C CG1 . VAL C 1 108 ? 67.021  -71.815 155.908 1.00 94.79  ? 108 VAL C CG1 1 
ATOM   9668  C CG2 . VAL C 1 108 ? 67.024  -72.034 158.396 1.00 107.18 ? 108 VAL C CG2 1 
ATOM   9669  N N   . THR C 1 109 ? 63.630  -72.392 155.186 1.00 110.05 ? 109 THR C N   1 
ATOM   9670  C CA  . THR C 1 109 ? 63.010  -72.596 153.879 1.00 94.72  ? 109 THR C CA  1 
ATOM   9671  C C   . THR C 1 109 ? 63.772  -71.946 152.707 1.00 94.99  ? 109 THR C C   1 
ATOM   9672  O O   . THR C 1 109 ? 63.585  -72.340 151.559 1.00 85.94  ? 109 THR C O   1 
ATOM   9673  C CB  . THR C 1 109 ? 61.549  -72.091 153.892 1.00 89.48  ? 109 THR C CB  1 
ATOM   9674  O OG1 . THR C 1 109 ? 60.806  -72.734 152.850 1.00 97.82  ? 109 THR C OG1 1 
ATOM   9675  C CG2 . THR C 1 109 ? 61.480  -70.577 153.730 1.00 85.93  ? 109 THR C CG2 1 
ATOM   9676  N N   . PHE C 1 110 ? 64.592  -70.937 152.998 1.00 99.53  ? 110 PHE C N   1 
ATOM   9677  C CA  . PHE C 1 110 ? 65.391  -70.231 151.991 1.00 92.82  ? 110 PHE C CA  1 
ATOM   9678  C C   . PHE C 1 110 ? 66.630  -69.605 152.630 1.00 98.32  ? 110 PHE C C   1 
ATOM   9679  O O   . PHE C 1 110 ? 66.551  -69.097 153.744 1.00 102.26 ? 110 PHE C O   1 
ATOM   9680  C CB  . PHE C 1 110 ? 64.534  -69.152 151.307 1.00 78.27  ? 110 PHE C CB  1 
ATOM   9681  C CG  . PHE C 1 110 ? 65.296  -68.257 150.353 1.00 81.55  ? 110 PHE C CG  1 
ATOM   9682  C CD1 . PHE C 1 110 ? 65.432  -68.578 149.013 1.00 83.24  ? 110 PHE C CD1 1 
ATOM   9683  C CD2 . PHE C 1 110 ? 65.849  -67.070 150.808 1.00 92.53  ? 110 PHE C CD2 1 
ATOM   9684  C CE1 . PHE C 1 110 ? 66.121  -67.738 148.152 1.00 78.54  ? 110 PHE C CE1 1 
ATOM   9685  C CE2 . PHE C 1 110 ? 66.541  -66.231 149.959 1.00 79.29  ? 110 PHE C CE2 1 
ATOM   9686  C CZ  . PHE C 1 110 ? 66.677  -66.563 148.628 1.00 77.56  ? 110 PHE C CZ  1 
ATOM   9687  N N   . TRP C 1 111 ? 67.769  -69.628 151.936 1.00 91.91  ? 111 TRP C N   1 
ATOM   9688  C CA  . TRP C 1 111 ? 68.969  -68.956 152.452 1.00 85.14  ? 111 TRP C CA  1 
ATOM   9689  C C   . TRP C 1 111 ? 69.940  -68.492 151.355 1.00 85.09  ? 111 TRP C C   1 
ATOM   9690  O O   . TRP C 1 111 ? 70.077  -69.121 150.307 1.00 92.17  ? 111 TRP C O   1 
ATOM   9691  C CB  . TRP C 1 111 ? 69.691  -69.837 153.489 1.00 81.05  ? 111 TRP C CB  1 
ATOM   9692  C CG  . TRP C 1 111 ? 70.417  -71.076 153.020 1.00 82.66  ? 111 TRP C CG  1 
ATOM   9693  C CD1 . TRP C 1 111 ? 70.286  -71.726 151.826 1.00 84.38  ? 111 TRP C CD1 1 
ATOM   9694  C CD2 . TRP C 1 111 ? 71.384  -71.818 153.777 1.00 86.65  ? 111 TRP C CD2 1 
ATOM   9695  N NE1 . TRP C 1 111 ? 71.122  -72.822 151.792 1.00 85.66  ? 111 TRP C NE1 1 
ATOM   9696  C CE2 . TRP C 1 111 ? 71.804  -72.899 152.979 1.00 87.30  ? 111 TRP C CE2 1 
ATOM   9697  C CE3 . TRP C 1 111 ? 71.937  -71.666 155.052 1.00 85.57  ? 111 TRP C CE3 1 
ATOM   9698  C CZ2 . TRP C 1 111 ? 72.753  -73.822 153.415 1.00 88.69  ? 111 TRP C CZ2 1 
ATOM   9699  C CZ3 . TRP C 1 111 ? 72.873  -72.581 155.484 1.00 88.03  ? 111 TRP C CZ3 1 
ATOM   9700  C CH2 . TRP C 1 111 ? 73.273  -73.646 154.669 1.00 89.33  ? 111 TRP C CH2 1 
ATOM   9701  N N   . LYS C 1 112 ? 70.610  -67.375 151.627 1.00 87.88  ? 112 LYS C N   1 
ATOM   9702  C CA  . LYS C 1 112 ? 71.449  -66.678 150.654 1.00 88.05  ? 112 LYS C CA  1 
ATOM   9703  C C   . LYS C 1 112 ? 72.581  -65.934 151.358 1.00 104.66 ? 112 LYS C C   1 
ATOM   9704  O O   . LYS C 1 112 ? 72.449  -65.582 152.529 1.00 129.62 ? 112 LYS C O   1 
ATOM   9705  C CB  . LYS C 1 112 ? 70.583  -65.694 149.863 1.00 82.24  ? 112 LYS C CB  1 
ATOM   9706  C CG  . LYS C 1 112 ? 71.208  -65.020 148.664 1.00 86.08  ? 112 LYS C CG  1 
ATOM   9707  C CD  . LYS C 1 112 ? 70.299  -63.877 148.231 1.00 88.92  ? 112 LYS C CD  1 
ATOM   9708  C CE  . LYS C 1 112 ? 70.862  -63.084 147.067 1.00 114.61 ? 112 LYS C CE  1 
ATOM   9709  N NZ  . LYS C 1 112 ? 70.907  -63.894 145.818 1.00 137.60 ? 112 LYS C NZ  1 
ATOM   9710  N N   . TRP C 1 113 ? 73.696  -65.706 150.666 1.00 86.99  ? 113 TRP C N   1 
ATOM   9711  C CA  . TRP C 1 113 ? 74.767  -64.899 151.250 1.00 88.87  ? 113 TRP C CA  1 
ATOM   9712  C C   . TRP C 1 113 ? 74.490  -63.425 150.998 1.00 92.29  ? 113 TRP C C   1 
ATOM   9713  O O   . TRP C 1 113 ? 74.497  -62.963 149.858 1.00 91.85  ? 113 TRP C O   1 
ATOM   9714  C CB  . TRP C 1 113 ? 76.142  -65.272 150.687 1.00 94.11  ? 113 TRP C CB  1 
ATOM   9715  C CG  . TRP C 1 113 ? 76.730  -66.542 151.240 1.00 93.01  ? 113 TRP C CG  1 
ATOM   9716  C CD1 . TRP C 1 113 ? 76.568  -67.797 150.739 1.00 94.04  ? 113 TRP C CD1 1 
ATOM   9717  C CD2 . TRP C 1 113 ? 77.588  -66.676 152.385 1.00 93.05  ? 113 TRP C CD2 1 
ATOM   9718  N NE1 . TRP C 1 113 ? 77.266  -68.706 151.495 1.00 94.35  ? 113 TRP C NE1 1 
ATOM   9719  C CE2 . TRP C 1 113 ? 77.898  -68.045 152.514 1.00 96.00  ? 113 TRP C CE2 1 
ATOM   9720  C CE3 . TRP C 1 113 ? 78.118  -65.775 153.316 1.00 94.52  ? 113 TRP C CE3 1 
ATOM   9721  C CZ2 . TRP C 1 113 ? 78.712  -68.536 153.532 1.00 97.03  ? 113 TRP C CZ2 1 
ATOM   9722  C CZ3 . TRP C 1 113 ? 78.926  -66.265 154.329 1.00 96.85  ? 113 TRP C CZ3 1 
ATOM   9723  C CH2 . TRP C 1 113 ? 79.211  -67.634 154.430 1.00 97.86  ? 113 TRP C CH2 1 
ATOM   9724  N N   . ILE C 1 114 ? 74.256  -62.688 152.076 1.00 92.45  ? 114 ILE C N   1 
ATOM   9725  C CA  . ILE C 1 114 ? 73.972  -61.261 151.985 1.00 92.33  ? 114 ILE C CA  1 
ATOM   9726  C C   . ILE C 1 114 ? 75.212  -60.488 151.571 1.00 98.63  ? 114 ILE C C   1 
ATOM   9727  O O   . ILE C 1 114 ? 75.146  -59.569 150.753 1.00 98.28  ? 114 ILE C O   1 
ATOM   9728  C CB  . ILE C 1 114 ? 73.441  -60.705 153.319 1.00 105.23 ? 114 ILE C CB  1 
ATOM   9729  C CG1 . ILE C 1 114 ? 71.967  -61.063 153.472 1.00 102.17 ? 114 ILE C CG1 1 
ATOM   9730  C CG2 . ILE C 1 114 ? 73.624  -59.194 153.391 1.00 123.42 ? 114 ILE C CG2 1 
ATOM   9731  C CD1 . ILE C 1 114 ? 71.204  -61.067 152.164 1.00 99.65  ? 114 ILE C CD1 1 
ATOM   9732  N N   . SER C 1 115 ? 76.344  -60.869 152.146 1.00 103.46 ? 115 SER C N   1 
ATOM   9733  C CA  . SER C 1 115 ? 77.615  -60.249 151.813 1.00 107.49 ? 115 SER C CA  1 
ATOM   9734  C C   . SER C 1 115 ? 78.736  -61.224 152.119 1.00 117.52 ? 115 SER C C   1 
ATOM   9735  O O   . SER C 1 115 ? 78.501  -62.408 152.344 1.00 136.65 ? 115 SER C O   1 
ATOM   9736  C CB  . SER C 1 115 ? 77.813  -58.945 152.590 1.00 114.30 ? 115 SER C CB  1 
ATOM   9737  O OG  . SER C 1 115 ? 77.875  -59.181 153.986 1.00 123.54 ? 115 SER C OG  1 
ATOM   9738  N N   . LEU C 1 116 ? 79.958  -60.719 152.104 1.00 110.31 ? 116 LEU C N   1 
ATOM   9739  C CA  . LEU C 1 116 ? 81.100  -61.493 152.532 1.00 112.95 ? 116 LEU C CA  1 
ATOM   9740  C C   . LEU C 1 116 ? 81.038  -61.512 154.057 1.00 122.56 ? 116 LEU C C   1 
ATOM   9741  O O   . LEU C 1 116 ? 81.030  -60.460 154.689 1.00 128.58 ? 116 LEU C O   1 
ATOM   9742  C CB  . LEU C 1 116 ? 82.380  -60.856 151.979 1.00 128.27 ? 116 LEU C CB  1 
ATOM   9743  C CG  . LEU C 1 116 ? 83.106  -61.560 150.826 1.00 136.80 ? 116 LEU C CG  1 
ATOM   9744  C CD1 . LEU C 1 116 ? 83.778  -60.519 149.973 1.00 128.19 ? 116 LEU C CD1 1 
ATOM   9745  C CD2 . LEU C 1 116 ? 84.174  -62.492 151.377 1.00 143.87 ? 116 LEU C CD2 1 
ATOM   9746  N N   . ASN C 1 117 ? 80.955  -62.720 154.621 1.00 123.26 ? 117 ASN C N   1 
ATOM   9747  C CA  . ASN C 1 117 ? 80.858  -62.989 156.072 1.00 129.77 ? 117 ASN C CA  1 
ATOM   9748  C C   . ASN C 1 117 ? 79.473  -62.740 156.682 1.00 132.12 ? 117 ASN C C   1 
ATOM   9749  O O   . ASN C 1 117 ? 79.360  -62.340 157.842 1.00 142.19 ? 117 ASN C O   1 
ATOM   9750  C CB  . ASN C 1 117 ? 81.921  -62.209 156.853 1.00 132.63 ? 117 ASN C CB  1 
ATOM   9751  C CG  . ASN C 1 117 ? 83.267  -62.241 156.171 1.00 153.82 ? 117 ASN C CG  1 
ATOM   9752  O OD1 . ASN C 1 117 ? 83.489  -63.037 155.256 1.00 164.33 ? 117 ASN C OD1 1 
ATOM   9753  N ND2 . ASN C 1 117 ? 84.171  -61.375 156.600 1.00 156.21 ? 117 ASN C ND2 1 
ATOM   9754  N N   . THR C 1 118 ? 78.425  -62.962 155.893 1.00 115.27 ? 118 THR C N   1 
ATOM   9755  C CA  . THR C 1 118 ? 77.053  -62.872 156.394 1.00 116.10 ? 118 THR C CA  1 
ATOM   9756  C C   . THR C 1 118 ? 76.069  -63.646 155.517 1.00 105.54 ? 118 THR C C   1 
ATOM   9757  O O   . THR C 1 118 ? 75.929  -63.356 154.330 1.00 100.08 ? 118 THR C O   1 
ATOM   9758  C CB  . THR C 1 118 ? 76.560  -61.413 156.494 1.00 125.12 ? 118 THR C CB  1 
ATOM   9759  O OG1 . THR C 1 118 ? 77.660  -60.506 156.358 1.00 143.22 ? 118 THR C OG1 1 
ATOM   9760  C CG2 . THR C 1 118 ? 75.872  -61.182 157.830 1.00 106.34 ? 118 THR C CG2 1 
ATOM   9761  N N   . VAL C 1 119 ? 75.387  -64.624 156.112 1.00 106.72 ? 119 VAL C N   1 
ATOM   9762  C CA  . VAL C 1 119 ? 74.390  -65.414 155.395 1.00 100.71 ? 119 VAL C CA  1 
ATOM   9763  C C   . VAL C 1 119 ? 72.989  -65.272 156.000 1.00 103.52 ? 119 VAL C C   1 
ATOM   9764  O O   . VAL C 1 119 ? 72.786  -65.510 157.185 1.00 108.32 ? 119 VAL C O   1 
ATOM   9765  C CB  . VAL C 1 119 ? 74.776  -66.898 155.344 1.00 97.14  ? 119 VAL C CB  1 
ATOM   9766  C CG1 . VAL C 1 119 ? 75.134  -67.424 156.731 1.00 102.30 ? 119 VAL C CG1 1 
ATOM   9767  C CG2 . VAL C 1 119 ? 73.644  -67.703 154.734 1.00 97.21  ? 119 VAL C CG2 1 
ATOM   9768  N N   . ALA C 1 120 ? 72.019  -64.909 155.166 1.00 88.08  ? 120 ALA C N   1 
ATOM   9769  C CA  . ALA C 1 120 ? 70.642  -64.731 155.624 1.00 90.95  ? 120 ALA C CA  1 
ATOM   9770  C C   . ALA C 1 120 ? 69.811  -66.014 155.593 1.00 95.71  ? 120 ALA C C   1 
ATOM   9771  O O   . ALA C 1 120 ? 69.888  -66.796 154.650 1.00 86.71  ? 120 ALA C O   1 
ATOM   9772  C CB  . ALA C 1 120 ? 69.962  -63.657 154.804 1.00 85.32  ? 120 ALA C CB  1 
ATOM   9773  N N   . LEU C 1 121 ? 69.014  -66.210 156.641 1.00 95.57  ? 121 LEU C N   1 
ATOM   9774  C CA  . LEU C 1 121 ? 68.188  -67.405 156.780 1.00 83.61  ? 121 LEU C CA  1 
ATOM   9775  C C   . LEU C 1 121 ? 66.704  -67.060 156.855 1.00 83.67  ? 121 LEU C C   1 
ATOM   9776  O O   . LEU C 1 121 ? 66.304  -66.166 157.600 1.00 93.20  ? 121 LEU C O   1 
ATOM   9777  C CB  . LEU C 1 121 ? 68.584  -68.196 158.026 1.00 91.22  ? 121 LEU C CB  1 
ATOM   9778  C CG  . LEU C 1 121 ? 70.075  -68.330 158.315 1.00 87.53  ? 121 LEU C CG  1 
ATOM   9779  C CD1 . LEU C 1 121 ? 70.301  -68.870 159.719 1.00 89.00  ? 121 LEU C CD1 1 
ATOM   9780  C CD2 . LEU C 1 121 ? 70.754  -69.201 157.276 1.00 88.44  ? 121 LEU C CD2 1 
ATOM   9781  N N   . VAL C 1 122 ? 65.888  -67.767 156.080 1.00 87.99  ? 122 VAL C N   1 
ATOM   9782  C CA  . VAL C 1 122 ? 64.452  -67.515 156.079 1.00 83.06  ? 122 VAL C CA  1 
ATOM   9783  C C   . VAL C 1 122 ? 63.663  -68.737 156.533 1.00 82.05  ? 122 VAL C C   1 
ATOM   9784  O O   . VAL C 1 122 ? 63.679  -69.782 155.884 1.00 81.13  ? 122 VAL C O   1 
ATOM   9785  C CB  . VAL C 1 122 ? 63.944  -67.093 154.696 1.00 86.96  ? 122 VAL C CB  1 
ATOM   9786  C CG1 . VAL C 1 122 ? 62.482  -66.691 154.784 1.00 107.61 ? 122 VAL C CG1 1 
ATOM   9787  C CG2 . VAL C 1 122 ? 64.782  -65.948 154.141 1.00 79.70  ? 122 VAL C CG2 1 
ATOM   9788  N N   . THR C 1 123 ? 62.970  -68.588 157.654 1.00 83.62  ? 123 THR C N   1 
ATOM   9789  C CA  . THR C 1 123 ? 62.062  -69.613 158.147 1.00 97.38  ? 123 THR C CA  1 
ATOM   9790  C C   . THR C 1 123 ? 60.652  -69.200 157.752 1.00 103.48 ? 123 THR C C   1 
ATOM   9791  O O   . THR C 1 123 ? 60.463  -68.157 157.130 1.00 110.67 ? 123 THR C O   1 
ATOM   9792  C CB  . THR C 1 123 ? 62.152  -69.790 159.671 1.00 105.61 ? 123 THR C CB  1 
ATOM   9793  O OG1 . THR C 1 123 ? 61.912  -68.533 160.317 1.00 100.30 ? 123 THR C OG1 1 
ATOM   9794  C CG2 . THR C 1 123 ? 63.532  -70.305 160.060 1.00 110.93 ? 123 THR C CG2 1 
ATOM   9795  N N   . ASP C 1 124 ? 59.661  -70.012 158.093 1.00 100.80 ? 124 ASP C N   1 
ATOM   9796  C CA  . ASP C 1 124 ? 58.291  -69.661 157.743 1.00 85.69  ? 124 ASP C CA  1 
ATOM   9797  C C   . ASP C 1 124 ? 57.782  -68.466 158.535 1.00 83.48  ? 124 ASP C C   1 
ATOM   9798  O O   . ASP C 1 124 ? 56.778  -67.862 158.171 1.00 97.93  ? 124 ASP C O   1 
ATOM   9799  C CB  . ASP C 1 124 ? 57.350  -70.846 157.960 1.00 89.32  ? 124 ASP C CB  1 
ATOM   9800  C CG  . ASP C 1 124 ? 57.851  -72.116 157.312 1.00 115.83 ? 124 ASP C CG  1 
ATOM   9801  O OD1 . ASP C 1 124 ? 57.206  -72.574 156.347 1.00 102.78 ? 124 ASP C OD1 1 
ATOM   9802  O OD2 . ASP C 1 124 ? 58.897  -72.643 157.744 1.00 143.53 ? 124 ASP C OD2 1 
ATOM   9803  N N   . ASN C 1 125 ? 58.480  -68.110 159.607 1.00 83.69  ? 125 ASN C N   1 
ATOM   9804  C CA  . ASN C 1 125 ? 58.000  -67.049 160.483 1.00 90.59  ? 125 ASN C CA  1 
ATOM   9805  C C   . ASN C 1 125 ? 58.879  -65.802 160.562 1.00 86.86  ? 125 ASN C C   1 
ATOM   9806  O O   . ASN C 1 125 ? 58.379  -64.715 160.847 1.00 88.18  ? 125 ASN C O   1 
ATOM   9807  C CB  . ASN C 1 125 ? 57.786  -67.609 161.891 1.00 99.38  ? 125 ASN C CB  1 
ATOM   9808  C CG  . ASN C 1 125 ? 57.002  -68.906 161.886 1.00 116.52 ? 125 ASN C CG  1 
ATOM   9809  O OD1 . ASN C 1 125 ? 55.773  -68.902 161.793 1.00 122.65 ? 125 ASN C OD1 1 
ATOM   9810  N ND2 . ASN C 1 125 ? 57.709  -70.025 161.978 1.00 115.55 ? 125 ASN C ND2 1 
ATOM   9811  N N   . ALA C 1 126 ? 60.177  -65.941 160.312 1.00 85.22  ? 126 ALA C N   1 
ATOM   9812  C CA  . ALA C 1 126 ? 61.063  -64.785 160.418 1.00 80.72  ? 126 ALA C CA  1 
ATOM   9813  C C   . ALA C 1 126 ? 62.312  -64.878 159.544 1.00 82.32  ? 126 ALA C C   1 
ATOM   9814  O O   . ALA C 1 126 ? 62.574  -65.900 158.914 1.00 81.38  ? 126 ALA C O   1 
ATOM   9815  C CB  . ALA C 1 126 ? 61.467  -64.577 161.870 1.00 97.70  ? 126 ALA C CB  1 
ATOM   9816  N N   . VAL C 1 127 ? 63.073  -63.787 159.514 1.00 81.69  ? 127 VAL C N   1 
ATOM   9817  C CA  . VAL C 1 127 ? 64.312  -63.704 158.744 1.00 86.89  ? 127 VAL C CA  1 
ATOM   9818  C C   . VAL C 1 127 ? 65.514  -63.441 159.648 1.00 93.66  ? 127 VAL C C   1 
ATOM   9819  O O   . VAL C 1 127 ? 65.485  -62.538 160.481 1.00 87.10  ? 127 VAL C O   1 
ATOM   9820  C CB  . VAL C 1 127 ? 64.235  -62.605 157.679 1.00 83.19  ? 127 VAL C CB  1 
ATOM   9821  C CG1 . VAL C 1 127 ? 65.587  -62.415 157.014 1.00 83.17  ? 127 VAL C CG1 1 
ATOM   9822  C CG2 . VAL C 1 127 ? 63.172  -62.948 156.655 1.00 90.21  ? 127 VAL C CG2 1 
ATOM   9823  N N   . TYR C 1 128 ? 66.576  -64.217 159.465 1.00 105.30 ? 128 TYR C N   1 
ATOM   9824  C CA  . TYR C 1 128 ? 67.753  -64.103 160.320 1.00 104.96 ? 128 TYR C CA  1 
ATOM   9825  C C   . TYR C 1 128 ? 69.033  -63.741 159.569 1.00 100.51 ? 128 TYR C C   1 
ATOM   9826  O O   . TYR C 1 128 ? 69.168  -64.018 158.380 1.00 89.03  ? 128 TYR C O   1 
ATOM   9827  C CB  . TYR C 1 128 ? 67.980  -65.413 161.076 1.00 96.82  ? 128 TYR C CB  1 
ATOM   9828  C CG  . TYR C 1 128 ? 66.779  -65.920 161.838 1.00 89.51  ? 128 TYR C CG  1 
ATOM   9829  C CD1 . TYR C 1 128 ? 66.564  -65.555 163.160 1.00 91.86  ? 128 TYR C CD1 1 
ATOM   9830  C CD2 . TYR C 1 128 ? 65.874  -66.792 161.244 1.00 96.25  ? 128 TYR C CD2 1 
ATOM   9831  C CE1 . TYR C 1 128 ? 65.469  -66.029 163.865 1.00 103.67 ? 128 TYR C CE1 1 
ATOM   9832  C CE2 . TYR C 1 128 ? 64.779  -67.271 161.941 1.00 113.44 ? 128 TYR C CE2 1 
ATOM   9833  C CZ  . TYR C 1 128 ? 64.582  -66.887 163.250 1.00 118.48 ? 128 TYR C CZ  1 
ATOM   9834  O OH  . TYR C 1 128 ? 63.494  -67.365 163.943 1.00 123.22 ? 128 TYR C OH  1 
ATOM   9835  N N   . HIS C 1 129 ? 69.964  -63.112 160.281 1.00 102.86 ? 129 HIS C N   1 
ATOM   9836  C CA  . HIS C 1 129 ? 71.289  -62.824 159.744 1.00 97.18  ? 129 HIS C CA  1 
ATOM   9837  C C   . HIS C 1 129 ? 72.366  -63.539 160.553 1.00 105.58 ? 129 HIS C C   1 
ATOM   9838  O O   . HIS C 1 129 ? 72.565  -63.246 161.727 1.00 120.01 ? 129 HIS C O   1 
ATOM   9839  C CB  . HIS C 1 129 ? 71.554  -61.318 159.733 1.00 93.59  ? 129 HIS C CB  1 
ATOM   9840  C CG  . HIS C 1 129 ? 70.901  -60.594 158.598 1.00 93.62  ? 129 HIS C CG  1 
ATOM   9841  N ND1 . HIS C 1 129 ? 71.221  -59.302 158.252 1.00 95.04  ? 129 HIS C ND1 1 
ATOM   9842  C CD2 . HIS C 1 129 ? 69.945  -60.991 157.722 1.00 92.62  ? 129 HIS C CD2 1 
ATOM   9843  C CE1 . HIS C 1 129 ? 70.494  -58.926 157.217 1.00 93.16  ? 129 HIS C CE1 1 
ATOM   9844  N NE2 . HIS C 1 129 ? 69.708  -59.935 156.876 1.00 92.94  ? 129 HIS C NE2 1 
ATOM   9845  N N   . TRP C 1 130 ? 73.070  -64.464 159.911 1.00 102.78 ? 130 TRP C N   1 
ATOM   9846  C CA  . TRP C 1 130 ? 74.085  -65.266 160.587 1.00 101.58 ? 130 TRP C CA  1 
ATOM   9847  C C   . TRP C 1 130 ? 75.476  -64.896 160.081 1.00 110.41 ? 130 TRP C C   1 
ATOM   9848  O O   . TRP C 1 130 ? 75.801  -65.120 158.918 1.00 111.78 ? 130 TRP C O   1 
ATOM   9849  C CB  . TRP C 1 130 ? 73.794  -66.760 160.376 1.00 98.69  ? 130 TRP C CB  1 
ATOM   9850  C CG  . TRP C 1 130 ? 74.594  -67.706 161.222 1.00 100.97 ? 130 TRP C CG  1 
ATOM   9851  C CD1 . TRP C 1 130 ? 75.144  -67.456 162.446 1.00 104.59 ? 130 TRP C CD1 1 
ATOM   9852  C CD2 . TRP C 1 130 ? 74.873  -69.081 160.931 1.00 101.12 ? 130 TRP C CD2 1 
ATOM   9853  N NE1 . TRP C 1 130 ? 75.774  -68.582 162.920 1.00 105.76 ? 130 TRP C NE1 1 
ATOM   9854  C CE2 . TRP C 1 130 ? 75.620  -69.594 162.009 1.00 105.42 ? 130 TRP C CE2 1 
ATOM   9855  C CE3 . TRP C 1 130 ? 74.574  -69.925 159.856 1.00 100.58 ? 130 TRP C CE3 1 
ATOM   9856  C CZ2 . TRP C 1 130 ? 76.075  -70.912 162.044 1.00 105.91 ? 130 TRP C CZ2 1 
ATOM   9857  C CZ3 . TRP C 1 130 ? 75.025  -71.232 159.892 1.00 102.39 ? 130 TRP C CZ3 1 
ATOM   9858  C CH2 . TRP C 1 130 ? 75.767  -71.712 160.979 1.00 104.82 ? 130 TRP C CH2 1 
ATOM   9859  N N   . SER C 1 131 ? 76.295  -64.329 160.962 1.00 114.31 ? 131 SER C N   1 
ATOM   9860  C CA  . SER C 1 131 ? 77.635  -63.904 160.579 1.00 117.91 ? 131 SER C CA  1 
ATOM   9861  C C   . SER C 1 131 ? 78.614  -65.065 160.545 1.00 119.52 ? 131 SER C C   1 
ATOM   9862  O O   . SER C 1 131 ? 78.619  -65.922 161.427 1.00 124.77 ? 131 SER C O   1 
ATOM   9863  C CB  . SER C 1 131 ? 78.157  -62.825 161.529 1.00 120.98 ? 131 SER C CB  1 
ATOM   9864  O OG  . SER C 1 131 ? 79.407  -62.323 161.086 1.00 120.91 ? 131 SER C OG  1 
ATOM   9865  N N   . MET C 1 132 ? 79.448  -65.069 159.513 1.00 116.21 ? 132 MET C N   1 
ATOM   9866  C CA  . MET C 1 132 ? 80.478  -66.086 159.331 1.00 119.28 ? 132 MET C CA  1 
ATOM   9867  C C   . MET C 1 132 ? 81.630  -65.906 160.317 1.00 133.90 ? 132 MET C C   1 
ATOM   9868  O O   . MET C 1 132 ? 82.281  -66.869 160.717 1.00 128.61 ? 132 MET C O   1 
ATOM   9869  C CB  . MET C 1 132 ? 80.994  -66.036 157.896 1.00 116.64 ? 132 MET C CB  1 
ATOM   9870  C CG  . MET C 1 132 ? 82.024  -67.085 157.530 1.00 125.82 ? 132 MET C CG  1 
ATOM   9871  S SD  . MET C 1 132 ? 82.976  -66.549 156.097 1.00 124.03 ? 132 MET C SD  1 
ATOM   9872  C CE  . MET C 1 132 ? 84.333  -65.694 156.887 1.00 152.98 ? 132 MET C CE  1 
ATOM   9873  N N   . GLU C 1 133 ? 81.866  -64.661 160.712 1.00 141.70 ? 133 GLU C N   1 
ATOM   9874  C CA  . GLU C 1 133 ? 82.950  -64.327 161.629 1.00 131.85 ? 133 GLU C CA  1 
ATOM   9875  C C   . GLU C 1 133 ? 82.589  -64.504 163.107 1.00 135.83 ? 133 GLU C C   1 
ATOM   9876  O O   . GLU C 1 133 ? 81.443  -64.288 163.511 1.00 149.95 ? 133 GLU C O   1 
ATOM   9877  C CB  . GLU C 1 133 ? 83.403  -62.889 161.375 1.00 125.70 ? 133 GLU C CB  1 
ATOM   9878  C CG  . GLU C 1 133 ? 84.188  -62.710 160.089 1.00 133.30 ? 133 GLU C CG  1 
ATOM   9879  C CD  . GLU C 1 133 ? 84.576  -61.266 159.858 1.00 148.81 ? 133 GLU C CD  1 
ATOM   9880  O OE1 . GLU C 1 133 ? 83.819  -60.378 160.303 1.00 147.39 ? 133 GLU C OE1 1 
ATOM   9881  O OE2 . GLU C 1 133 ? 85.633  -61.016 159.240 1.00 169.38 ? 133 GLU C OE2 1 
ATOM   9882  N N   . GLY C 1 134 ? 83.578  -64.915 163.900 1.00 130.64 ? 134 GLY C N   1 
ATOM   9883  C CA  . GLY C 1 134 ? 83.431  -65.052 165.341 1.00 129.87 ? 134 GLY C CA  1 
ATOM   9884  C C   . GLY C 1 134 ? 82.525  -66.167 165.832 1.00 130.35 ? 134 GLY C C   1 
ATOM   9885  O O   . GLY C 1 134 ? 82.380  -67.194 165.174 1.00 128.37 ? 134 GLY C O   1 
ATOM   9886  N N   . GLU C 1 135 ? 81.921  -65.956 167.002 1.00 136.51 ? 135 GLU C N   1 
ATOM   9887  C CA  . GLU C 1 135 ? 81.002  -66.924 167.614 1.00 144.65 ? 135 GLU C CA  1 
ATOM   9888  C C   . GLU C 1 135 ? 79.633  -66.293 167.904 1.00 145.92 ? 135 GLU C C   1 
ATOM   9889  O O   . GLU C 1 135 ? 79.187  -66.217 169.049 1.00 164.46 ? 135 GLU C O   1 
ATOM   9890  C CB  . GLU C 1 135 ? 81.627  -67.517 168.888 1.00 151.30 ? 135 GLU C CB  1 
ATOM   9891  C CG  . GLU C 1 135 ? 80.821  -68.634 169.559 1.00 171.40 ? 135 GLU C CG  1 
ATOM   9892  C CD  . GLU C 1 135 ? 79.890  -69.365 168.607 1.00 186.65 ? 135 GLU C CD  1 
ATOM   9893  O OE1 . GLU C 1 135 ? 78.667  -69.111 168.657 1.00 173.69 ? 135 GLU C OE1 1 
ATOM   9894  O OE2 . GLU C 1 135 ? 80.373  -70.208 167.824 1.00 199.27 ? 135 GLU C OE2 1 
ATOM   9895  N N   . SER C 1 136 ? 78.987  -65.823 166.842 1.00 124.44 ? 136 SER C N   1 
ATOM   9896  C CA  . SER C 1 136 ? 77.684  -65.187 166.948 1.00 120.14 ? 136 SER C CA  1 
ATOM   9897  C C   . SER C 1 136 ? 76.569  -66.057 166.356 1.00 125.56 ? 136 SER C C   1 
ATOM   9898  O O   . SER C 1 136 ? 76.670  -66.513 165.220 1.00 120.53 ? 136 SER C O   1 
ATOM   9899  C CB  . SER C 1 136 ? 77.715  -63.813 166.267 1.00 121.41 ? 136 SER C CB  1 
ATOM   9900  O OG  . SER C 1 136 ? 78.135  -63.910 164.918 1.00 130.01 ? 136 SER C OG  1 
ATOM   9901  N N   . GLN C 1 137 ? 75.518  -66.288 167.141 1.00 139.08 ? 137 GLN C N   1 
ATOM   9902  C CA  . GLN C 1 137 ? 74.363  -67.075 166.709 1.00 135.90 ? 137 GLN C CA  1 
ATOM   9903  C C   . GLN C 1 137 ? 73.545  -66.275 165.694 1.00 125.98 ? 137 GLN C C   1 
ATOM   9904  O O   . GLN C 1 137 ? 73.684  -65.054 165.633 1.00 132.90 ? 137 GLN C O   1 
ATOM   9905  C CB  . GLN C 1 137 ? 73.502  -67.452 167.917 1.00 140.07 ? 137 GLN C CB  1 
ATOM   9906  C CG  . GLN C 1 137 ? 73.199  -68.929 168.054 1.00 143.85 ? 137 GLN C CG  1 
ATOM   9907  C CD  . GLN C 1 137 ? 74.406  -69.766 168.432 1.00 150.54 ? 137 GLN C CD  1 
ATOM   9908  O OE1 . GLN C 1 137 ? 75.390  -69.838 167.696 1.00 161.66 ? 137 GLN C OE1 1 
ATOM   9909  N NE2 . GLN C 1 137 ? 74.337  -70.402 169.596 1.00 143.17 ? 137 GLN C NE2 1 
ATOM   9910  N N   . PRO C 1 138 ? 72.710  -66.953 164.876 1.00 108.71 ? 138 PRO C N   1 
ATOM   9911  C CA  . PRO C 1 138 ? 71.873  -66.211 163.923 1.00 102.63 ? 138 PRO C CA  1 
ATOM   9912  C C   . PRO C 1 138 ? 70.962  -65.190 164.597 1.00 103.52 ? 138 PRO C C   1 
ATOM   9913  O O   . PRO C 1 138 ? 70.230  -65.522 165.528 1.00 110.00 ? 138 PRO C O   1 
ATOM   9914  C CB  . PRO C 1 138 ? 71.049  -67.315 163.247 1.00 101.93 ? 138 PRO C CB  1 
ATOM   9915  C CG  . PRO C 1 138 ? 71.868  -68.543 163.413 1.00 105.70 ? 138 PRO C CG  1 
ATOM   9916  C CD  . PRO C 1 138 ? 72.509  -68.407 164.750 1.00 105.73 ? 138 PRO C CD  1 
ATOM   9917  N N   . VAL C 1 139 ? 71.000  -63.958 164.102 1.00 99.86  ? 139 VAL C N   1 
ATOM   9918  C CA  . VAL C 1 139 ? 70.249  -62.861 164.705 1.00 99.99  ? 139 VAL C CA  1 
ATOM   9919  C C   . VAL C 1 139 ? 68.961  -62.550 163.949 1.00 117.86 ? 139 VAL C C   1 
ATOM   9920  O O   . VAL C 1 139 ? 68.982  -62.310 162.744 1.00 119.56 ? 139 VAL C O   1 
ATOM   9921  C CB  . VAL C 1 139 ? 71.093  -61.585 164.776 1.00 102.77 ? 139 VAL C CB  1 
ATOM   9922  C CG1 . VAL C 1 139 ? 70.393  -60.550 165.638 1.00 103.57 ? 139 VAL C CG1 1 
ATOM   9923  C CG2 . VAL C 1 139 ? 72.477  -61.893 165.323 1.00 104.93 ? 139 VAL C CG2 1 
ATOM   9924  N N   . LYS C 1 140 ? 67.843  -62.551 164.670 1.00 116.22 ? 140 LYS C N   1 
ATOM   9925  C CA  . LYS C 1 140 ? 66.544  -62.235 164.083 1.00 97.28  ? 140 LYS C CA  1 
ATOM   9926  C C   . LYS C 1 140 ? 66.470  -60.782 163.621 1.00 108.21 ? 140 LYS C C   1 
ATOM   9927  O O   . LYS C 1 140 ? 66.745  -59.855 164.390 1.00 111.95 ? 140 LYS C O   1 
ATOM   9928  C CB  . LYS C 1 140 ? 65.426  -62.532 165.083 1.00 98.68  ? 140 LYS C CB  1 
ATOM   9929  C CG  . LYS C 1 140 ? 64.023  -62.497 164.492 1.00 92.80  ? 140 LYS C CG  1 
ATOM   9930  C CD  . LYS C 1 140 ? 62.992  -62.998 165.499 1.00 95.02  ? 140 LYS C CD  1 
ATOM   9931  C CE  . LYS C 1 140 ? 61.616  -62.407 165.240 1.00 95.88  ? 140 LYS C CE  1 
ATOM   9932  N NZ  . LYS C 1 140 ? 60.599  -62.923 166.198 1.00 101.80 ? 140 LYS C NZ  1 
ATOM   9933  N N   . MET C 1 141 ? 66.089  -60.594 162.360 1.00 116.10 ? 141 MET C N   1 
ATOM   9934  C CA  . MET C 1 141 ? 66.026  -59.263 161.767 1.00 109.01 ? 141 MET C CA  1 
ATOM   9935  C C   . MET C 1 141 ? 64.610  -58.703 161.780 1.00 97.07  ? 141 MET C C   1 
ATOM   9936  O O   . MET C 1 141 ? 64.395  -57.551 162.164 1.00 108.95 ? 141 MET C O   1 
ATOM   9937  C CB  . MET C 1 141 ? 66.573  -59.291 160.338 1.00 105.54 ? 141 MET C CB  1 
ATOM   9938  C CG  . MET C 1 141 ? 68.059  -59.625 160.267 1.00 95.59  ? 141 MET C CG  1 
ATOM   9939  S SD  . MET C 1 141 ? 69.096  -58.288 160.887 1.00 99.79  ? 141 MET C SD  1 
ATOM   9940  C CE  . MET C 1 141 ? 69.906  -59.102 162.270 1.00 110.68 ? 141 MET C CE  1 
ATOM   9941  N N   . PHE C 1 142 ? 63.648  -59.520 161.365 1.00 98.35  ? 142 PHE C N   1 
ATOM   9942  C CA  . PHE C 1 142 ? 62.252  -59.105 161.360 1.00 98.99  ? 142 PHE C CA  1 
ATOM   9943  C C   . PHE C 1 142 ? 61.331  -60.314 161.236 1.00 104.82 ? 142 PHE C C   1 
ATOM   9944  O O   . PHE C 1 142 ? 61.756  -61.390 160.814 1.00 116.27 ? 142 PHE C O   1 
ATOM   9945  C CB  . PHE C 1 142 ? 61.978  -58.092 160.237 1.00 87.65  ? 142 PHE C CB  1 
ATOM   9946  C CG  . PHE C 1 142 ? 62.238  -58.615 158.849 1.00 96.77  ? 142 PHE C CG  1 
ATOM   9947  C CD1 . PHE C 1 142 ? 63.491  -58.494 158.270 1.00 99.02  ? 142 PHE C CD1 1 
ATOM   9948  C CD2 . PHE C 1 142 ? 61.219  -59.191 158.111 1.00 99.23  ? 142 PHE C CD2 1 
ATOM   9949  C CE1 . PHE C 1 142 ? 63.727  -58.959 156.990 1.00 87.76  ? 142 PHE C CE1 1 
ATOM   9950  C CE2 . PHE C 1 142 ? 61.447  -59.658 156.832 1.00 94.17  ? 142 PHE C CE2 1 
ATOM   9951  C CZ  . PHE C 1 142 ? 62.702  -59.540 156.269 1.00 85.75  ? 142 PHE C CZ  1 
ATOM   9952  N N   . ASP C 1 143 ? 60.071  -60.134 161.618 1.00 97.48  ? 143 ASP C N   1 
ATOM   9953  C CA  . ASP C 1 143 ? 59.086  -61.202 161.515 1.00 88.52  ? 143 ASP C CA  1 
ATOM   9954  C C   . ASP C 1 143 ? 58.424  -61.172 160.146 1.00 88.49  ? 143 ASP C C   1 
ATOM   9955  O O   . ASP C 1 143 ? 58.135  -60.104 159.611 1.00 96.23  ? 143 ASP C O   1 
ATOM   9956  C CB  . ASP C 1 143 ? 58.025  -61.072 162.614 1.00 93.22  ? 143 ASP C CB  1 
ATOM   9957  C CG  . ASP C 1 143 ? 58.457  -61.701 163.923 1.00 97.27  ? 143 ASP C CG  1 
ATOM   9958  O OD1 . ASP C 1 143 ? 58.561  -62.943 163.977 1.00 97.18  ? 143 ASP C OD1 1 
ATOM   9959  O OD2 . ASP C 1 143 ? 58.686  -60.958 164.901 1.00 107.67 ? 143 ASP C OD2 1 
ATOM   9960  N N   . ARG C 1 144 ? 58.195  -62.351 159.578 1.00 91.06  ? 144 ARG C N   1 
ATOM   9961  C CA  . ARG C 1 144 ? 57.552  -62.460 158.272 1.00 91.03  ? 144 ARG C CA  1 
ATOM   9962  C C   . ARG C 1 144 ? 56.120  -61.932 158.310 1.00 91.63  ? 144 ARG C C   1 
ATOM   9963  O O   . ARG C 1 144 ? 55.338  -62.277 159.198 1.00 99.72  ? 144 ARG C O   1 
ATOM   9964  C CB  . ARG C 1 144 ? 57.585  -63.910 157.775 1.00 86.20  ? 144 ARG C CB  1 
ATOM   9965  C CG  . ARG C 1 144 ? 58.793  -64.201 156.899 1.00 86.43  ? 144 ARG C CG  1 
ATOM   9966  C CD  . ARG C 1 144 ? 58.783  -65.616 156.355 1.00 87.59  ? 144 ARG C CD  1 
ATOM   9967  N NE  . ARG C 1 144 ? 57.676  -65.859 155.440 1.00 92.39  ? 144 ARG C NE  1 
ATOM   9968  C CZ  . ARG C 1 144 ? 57.576  -66.936 154.670 1.00 109.32 ? 144 ARG C CZ  1 
ATOM   9969  N NH1 . ARG C 1 144 ? 56.535  -67.085 153.864 1.00 121.74 ? 144 ARG C NH1 1 
ATOM   9970  N NH2 . ARG C 1 144 ? 58.521  -67.865 154.712 1.00 107.63 ? 144 ARG C NH2 1 
ATOM   9971  N N   . HIS C 1 145 ? 55.795  -61.087 157.337 1.00 88.01  ? 145 HIS C N   1 
ATOM   9972  C CA  . HIS C 1 145 ? 54.473  -60.487 157.229 1.00 86.54  ? 145 HIS C CA  1 
ATOM   9973  C C   . HIS C 1 145 ? 53.441  -61.523 156.808 1.00 84.02  ? 145 HIS C C   1 
ATOM   9974  O O   . HIS C 1 145 ? 53.767  -62.481 156.112 1.00 80.69  ? 145 HIS C O   1 
ATOM   9975  C CB  . HIS C 1 145 ? 54.507  -59.326 156.229 1.00 86.41  ? 145 HIS C CB  1 
ATOM   9976  C CG  . HIS C 1 145 ? 53.329  -58.407 156.321 1.00 95.71  ? 145 HIS C CG  1 
ATOM   9977  N ND1 . HIS C 1 145 ? 52.084  -58.734 155.836 1.00 97.73  ? 145 HIS C ND1 1 
ATOM   9978  C CD2 . HIS C 1 145 ? 53.211  -57.156 156.835 1.00 101.81 ? 145 HIS C CD2 1 
ATOM   9979  C CE1 . HIS C 1 145 ? 51.246  -57.735 156.047 1.00 97.86  ? 145 HIS C CE1 1 
ATOM   9980  N NE2 . HIS C 1 145 ? 51.910  -56.764 156.655 1.00 104.73 ? 145 HIS C NE2 1 
ATOM   9981  N N   . SER C 1 146 ? 52.199  -61.334 157.246 1.00 79.76  ? 146 SER C N   1 
ATOM   9982  C CA  . SER C 1 146 ? 51.108  -62.253 156.912 1.00 84.47  ? 146 SER C CA  1 
ATOM   9983  C C   . SER C 1 146 ? 50.839  -62.332 155.407 1.00 99.12  ? 146 SER C C   1 
ATOM   9984  O O   . SER C 1 146 ? 50.372  -63.352 154.907 1.00 118.13 ? 146 SER C O   1 
ATOM   9985  C CB  . SER C 1 146 ? 49.826  -61.845 157.636 1.00 92.89  ? 146 SER C CB  1 
ATOM   9986  O OG  . SER C 1 146 ? 49.464  -60.511 157.324 1.00 109.15 ? 146 SER C OG  1 
ATOM   9987  N N   . SER C 1 147 ? 51.140  -61.255 154.688 1.00 86.56  ? 147 SER C N   1 
ATOM   9988  C CA  . SER C 1 147 ? 50.942  -61.210 153.240 1.00 75.32  ? 147 SER C CA  1 
ATOM   9989  C C   . SER C 1 147 ? 51.813  -62.225 152.505 1.00 81.29  ? 147 SER C C   1 
ATOM   9990  O O   . SER C 1 147 ? 51.463  -62.677 151.415 1.00 92.53  ? 147 SER C O   1 
ATOM   9991  C CB  . SER C 1 147 ? 51.226  -59.807 152.708 1.00 75.44  ? 147 SER C CB  1 
ATOM   9992  O OG  . SER C 1 147 ? 52.611  -59.517 152.760 1.00 93.12  ? 147 SER C OG  1 
ATOM   9993  N N   . LEU C 1 148 ? 52.945  -62.582 153.103 1.00 93.88  ? 148 LEU C N   1 
ATOM   9994  C CA  . LEU C 1 148 ? 53.862  -63.545 152.501 1.00 89.94  ? 148 LEU C CA  1 
ATOM   9995  C C   . LEU C 1 148 ? 53.599  -64.975 152.965 1.00 91.78  ? 148 LEU C C   1 
ATOM   9996  O O   . LEU C 1 148 ? 54.319  -65.899 152.585 1.00 89.77  ? 148 LEU C O   1 
ATOM   9997  C CB  . LEU C 1 148 ? 55.309  -63.160 152.799 1.00 78.41  ? 148 LEU C CB  1 
ATOM   9998  C CG  . LEU C 1 148 ? 55.910  -62.201 151.776 1.00 73.58  ? 148 LEU C CG  1 
ATOM   9999  C CD1 . LEU C 1 148 ? 55.755  -60.765 152.233 1.00 73.31  ? 148 LEU C CD1 1 
ATOM   10000 C CD2 . LEU C 1 148 ? 57.367  -62.534 151.546 1.00 89.47  ? 148 LEU C CD2 1 
ATOM   10001 N N   . ALA C 1 149 ? 52.587  -65.151 153.808 1.00 82.15  ? 149 ALA C N   1 
ATOM   10002 C CA  . ALA C 1 149 ? 52.228  -66.485 154.282 1.00 84.09  ? 149 ALA C CA  1 
ATOM   10003 C C   . ALA C 1 149 ? 51.710  -67.364 153.150 1.00 95.90  ? 149 ALA C C   1 
ATOM   10004 O O   . ALA C 1 149 ? 50.819  -66.974 152.397 1.00 109.54 ? 149 ALA C O   1 
ATOM   10005 C CB  . ALA C 1 149 ? 51.194  -66.397 155.389 1.00 95.77  ? 149 ALA C CB  1 
ATOM   10006 N N   . GLY C 1 150 ? 52.294  -68.549 153.032 1.00 100.90 ? 150 GLY C N   1 
ATOM   10007 C CA  . GLY C 1 150 ? 51.918  -69.493 151.999 1.00 100.79 ? 150 GLY C CA  1 
ATOM   10008 C C   . GLY C 1 150 ? 52.654  -69.223 150.704 1.00 92.33  ? 150 GLY C C   1 
ATOM   10009 O O   . GLY C 1 150 ? 52.567  -70.011 149.763 1.00 87.36  ? 150 GLY C O   1 
ATOM   10010 N N   . CYS C 1 151 ? 53.369  -68.103 150.648 1.00 98.08  ? 151 CYS C N   1 
ATOM   10011 C CA  . CYS C 1 151 ? 54.153  -67.774 149.467 1.00 83.39  ? 151 CYS C CA  1 
ATOM   10012 C C   . CYS C 1 151 ? 55.470  -68.526 149.532 1.00 79.89  ? 151 CYS C C   1 
ATOM   10013 O O   . CYS C 1 151 ? 56.014  -68.743 150.614 1.00 87.79  ? 151 CYS C O   1 
ATOM   10014 C CB  . CYS C 1 151 ? 54.390  -66.266 149.363 1.00 78.39  ? 151 CYS C CB  1 
ATOM   10015 S SG  . CYS C 1 151 ? 52.891  -65.317 149.002 1.00 153.90 ? 151 CYS C SG  1 
ATOM   10016 N N   . GLN C 1 152 ? 55.973  -68.927 148.372 1.00 87.11  ? 152 GLN C N   1 
ATOM   10017 C CA  . GLN C 1 152 ? 57.287  -69.549 148.277 1.00 85.55  ? 152 GLN C CA  1 
ATOM   10018 C C   . GLN C 1 152 ? 58.341  -68.479 148.046 1.00 80.43  ? 152 GLN C C   1 
ATOM   10019 O O   . GLN C 1 152 ? 58.301  -67.771 147.037 1.00 74.26  ? 152 GLN C O   1 
ATOM   10020 C CB  . GLN C 1 152 ? 57.327  -70.600 147.168 1.00 90.31  ? 152 GLN C CB  1 
ATOM   10021 C CG  . GLN C 1 152 ? 56.850  -71.978 147.607 1.00 114.50 ? 152 GLN C CG  1 
ATOM   10022 C CD  . GLN C 1 152 ? 55.441  -71.956 148.167 1.00 138.74 ? 152 GLN C CD  1 
ATOM   10023 O OE1 . GLN C 1 152 ? 54.465  -71.878 147.420 1.00 141.91 ? 152 GLN C OE1 1 
ATOM   10024 N NE2 . GLN C 1 152 ? 55.327  -72.026 149.488 1.00 146.22 ? 152 GLN C NE2 1 
ATOM   10025 N N   . ILE C 1 153 ? 59.283  -68.375 148.982 1.00 84.21  ? 153 ILE C N   1 
ATOM   10026 C CA  . ILE C 1 153 ? 60.325  -67.352 148.930 1.00 78.71  ? 153 ILE C CA  1 
ATOM   10027 C C   . ILE C 1 153 ? 61.287  -67.568 147.778 1.00 83.44  ? 153 ILE C C   1 
ATOM   10028 O O   . ILE C 1 153 ? 61.933  -68.609 147.668 1.00 86.95  ? 153 ILE C O   1 
ATOM   10029 C CB  . ILE C 1 153 ? 61.145  -67.311 150.223 1.00 79.42  ? 153 ILE C CB  1 
ATOM   10030 C CG1 . ILE C 1 153 ? 60.225  -67.086 151.418 1.00 72.29  ? 153 ILE C CG1 1 
ATOM   10031 C CG2 . ILE C 1 153 ? 62.207  -66.227 150.134 1.00 73.85  ? 153 ILE C CG2 1 
ATOM   10032 C CD1 . ILE C 1 153 ? 59.350  -65.874 151.275 1.00 69.04  ? 153 ILE C CD1 1 
ATOM   10033 N N   . ILE C 1 154 ? 61.400  -66.544 146.941 1.00 85.47  ? 154 ILE C N   1 
ATOM   10034 C CA  . ILE C 1 154 ? 62.192  -66.633 145.727 1.00 75.46  ? 154 ILE C CA  1 
ATOM   10035 C C   . ILE C 1 154 ? 63.495  -65.836 145.848 1.00 74.06  ? 154 ILE C C   1 
ATOM   10036 O O   . ILE C 1 154 ? 64.477  -66.149 145.173 1.00 78.73  ? 154 ILE C O   1 
ATOM   10037 C CB  . ILE C 1 154 ? 61.351  -66.174 144.499 1.00 71.16  ? 154 ILE C CB  1 
ATOM   10038 C CG1 . ILE C 1 154 ? 61.687  -67.008 143.254 1.00 117.39 ? 154 ILE C CG1 1 
ATOM   10039 C CG2 . ILE C 1 154 ? 61.477  -64.680 144.248 1.00 69.63  ? 154 ILE C CG2 1 
ATOM   10040 C CD1 . ILE C 1 154 ? 62.993  -66.638 142.562 1.00 130.67 ? 154 ILE C CD1 1 
ATOM   10041 N N   . ASN C 1 155 ? 63.503  -64.813 146.704 1.00 69.43  ? 155 ASN C N   1 
ATOM   10042 C CA  . ASN C 1 155 ? 64.707  -64.009 146.924 1.00 71.05  ? 155 ASN C CA  1 
ATOM   10043 C C   . ASN C 1 155 ? 64.697  -63.163 148.206 1.00 76.74  ? 155 ASN C C   1 
ATOM   10044 O O   . ASN C 1 155 ? 63.643  -62.910 148.791 1.00 90.31  ? 155 ASN C O   1 
ATOM   10045 C CB  . ASN C 1 155 ? 64.945  -63.085 145.731 1.00 77.78  ? 155 ASN C CB  1 
ATOM   10046 C CG  . ASN C 1 155 ? 66.396  -62.696 145.585 1.00 97.87  ? 155 ASN C CG  1 
ATOM   10047 O OD1 . ASN C 1 155 ? 66.749  -61.530 145.741 1.00 123.96 ? 155 ASN C OD1 1 
ATOM   10048 N ND2 . ASN C 1 155 ? 67.249  -63.672 145.288 1.00 101.45 ? 155 ASN C ND2 1 
ATOM   10049 N N   . TYR C 1 156 ? 65.888  -62.729 148.621 1.00 83.17  ? 156 TYR C N   1 
ATOM   10050 C CA  . TYR C 1 156 ? 66.075  -61.817 149.755 1.00 92.03  ? 156 TYR C CA  1 
ATOM   10051 C C   . TYR C 1 156 ? 67.214  -60.828 149.480 1.00 91.80  ? 156 TYR C C   1 
ATOM   10052 O O   . TYR C 1 156 ? 68.344  -61.232 149.211 1.00 94.46  ? 156 TYR C O   1 
ATOM   10053 C CB  . TYR C 1 156 ? 66.355  -62.587 151.046 1.00 87.38  ? 156 TYR C CB  1 
ATOM   10054 C CG  . TYR C 1 156 ? 66.591  -61.682 152.240 1.00 81.93  ? 156 TYR C CG  1 
ATOM   10055 C CD1 . TYR C 1 156 ? 65.541  -60.999 152.838 1.00 84.31  ? 156 TYR C CD1 1 
ATOM   10056 C CD2 . TYR C 1 156 ? 67.862  -61.521 152.776 1.00 83.28  ? 156 TYR C CD2 1 
ATOM   10057 C CE1 . TYR C 1 156 ? 65.751  -60.173 153.929 1.00 85.07  ? 156 TYR C CE1 1 
ATOM   10058 C CE2 . TYR C 1 156 ? 68.083  -60.699 153.867 1.00 91.91  ? 156 TYR C CE2 1 
ATOM   10059 C CZ  . TYR C 1 156 ? 67.023  -60.027 154.441 1.00 93.33  ? 156 TYR C CZ  1 
ATOM   10060 O OH  . TYR C 1 156 ? 67.235  -59.208 155.528 1.00 92.73  ? 156 TYR C OH  1 
ATOM   10061 N N   . ARG C 1 157 ? 66.908  -59.535 149.560 1.00 85.43  ? 157 ARG C N   1 
ATOM   10062 C CA  . ARG C 1 157 ? 67.867  -58.480 149.228 1.00 74.97  ? 157 ARG C CA  1 
ATOM   10063 C C   . ARG C 1 157 ? 67.974  -57.394 150.304 1.00 78.85  ? 157 ARG C C   1 
ATOM   10064 O O   . ARG C 1 157 ? 67.065  -57.217 151.111 1.00 85.24  ? 157 ARG C O   1 
ATOM   10065 C CB  . ARG C 1 157 ? 67.474  -57.838 147.900 1.00 74.75  ? 157 ARG C CB  1 
ATOM   10066 C CG  . ARG C 1 157 ? 67.981  -58.564 146.669 1.00 90.06  ? 157 ARG C CG  1 
ATOM   10067 C CD  . ARG C 1 157 ? 67.318  -57.997 145.430 1.00 106.01 ? 157 ARG C CD  1 
ATOM   10068 N NE  . ARG C 1 157 ? 68.036  -58.328 144.204 1.00 114.08 ? 157 ARG C NE  1 
ATOM   10069 C CZ  . ARG C 1 157 ? 69.050  -57.616 143.724 1.00 109.27 ? 157 ARG C CZ  1 
ATOM   10070 N NH1 . ARG C 1 157 ? 69.648  -57.985 142.599 1.00 107.67 ? 157 ARG C NH1 1 
ATOM   10071 N NH2 . ARG C 1 157 ? 69.463  -56.533 144.368 1.00 119.90 ? 157 ARG C NH2 1 
ATOM   10072 N N   . THR C 1 158 ? 69.099  -56.677 150.316 1.00 80.41  ? 158 THR C N   1 
ATOM   10073 C CA  . THR C 1 158 ? 69.340  -55.570 151.252 1.00 83.92  ? 158 THR C CA  1 
ATOM   10074 C C   . THR C 1 158 ? 70.058  -54.432 150.517 1.00 86.44  ? 158 THR C C   1 
ATOM   10075 O O   . THR C 1 158 ? 70.731  -54.684 149.526 1.00 86.40  ? 158 THR C O   1 
ATOM   10076 C CB  . THR C 1 158 ? 70.208  -55.998 152.468 1.00 100.77 ? 158 THR C CB  1 
ATOM   10077 O OG1 . THR C 1 158 ? 71.591  -55.971 152.096 1.00 99.50  ? 158 THR C OG1 1 
ATOM   10078 C CG2 . THR C 1 158 ? 69.861  -57.408 152.947 1.00 99.94  ? 158 THR C CG2 1 
ATOM   10079 N N   . ASP C 1 159 ? 69.944  -53.188 150.978 1.00 91.72  ? 159 ASP C N   1 
ATOM   10080 C CA  . ASP C 1 159 ? 70.731  -52.132 150.338 1.00 101.34 ? 159 ASP C CA  1 
ATOM   10081 C C   . ASP C 1 159 ? 72.169  -52.249 150.818 1.00 105.83 ? 159 ASP C C   1 
ATOM   10082 O O   . ASP C 1 159 ? 72.500  -53.110 151.640 1.00 119.12 ? 159 ASP C O   1 
ATOM   10083 C CB  . ASP C 1 159 ? 70.228  -50.724 150.637 1.00 118.89 ? 159 ASP C CB  1 
ATOM   10084 C CG  . ASP C 1 159 ? 70.502  -50.303 152.058 1.00 129.70 ? 159 ASP C CG  1 
ATOM   10085 O OD1 . ASP C 1 159 ? 69.948  -50.947 152.966 1.00 130.24 ? 159 ASP C OD1 1 
ATOM   10086 O OD2 . ASP C 1 159 ? 71.275  -49.338 152.266 1.00 133.05 ? 159 ASP C OD2 1 
ATOM   10087 N N   . ALA C 1 160 ? 73.015  -51.371 150.294 1.00 99.66  ? 160 ALA C N   1 
ATOM   10088 C CA  . ALA C 1 160 ? 74.427  -51.332 150.648 1.00 97.95  ? 160 ALA C CA  1 
ATOM   10089 C C   . ALA C 1 160 ? 74.642  -51.177 152.154 1.00 104.59 ? 160 ALA C C   1 
ATOM   10090 O O   . ALA C 1 160 ? 75.316  -51.993 152.778 1.00 117.84 ? 160 ALA C O   1 
ATOM   10091 C CB  . ALA C 1 160 ? 75.113  -50.196 149.901 1.00 101.86 ? 160 ALA C CB  1 
ATOM   10092 N N   . LYS C 1 161 ? 74.060  -50.131 152.730 1.00 100.86 ? 161 LYS C N   1 
ATOM   10093 C CA  . LYS C 1 161 ? 74.185  -49.858 154.161 1.00 102.19 ? 161 LYS C CA  1 
ATOM   10094 C C   . LYS C 1 161 ? 73.451  -50.869 155.055 1.00 108.54 ? 161 LYS C C   1 
ATOM   10095 O O   . LYS C 1 161 ? 73.585  -50.836 156.279 1.00 125.04 ? 161 LYS C O   1 
ATOM   10096 C CB  . LYS C 1 161 ? 73.697  -48.439 154.458 1.00 105.71 ? 161 LYS C CB  1 
ATOM   10097 C CG  . LYS C 1 161 ? 74.664  -47.345 154.006 1.00 125.48 ? 161 LYS C CG  1 
ATOM   10098 C CD  . LYS C 1 161 ? 74.222  -46.718 152.695 1.00 134.59 ? 161 LYS C CD  1 
ATOM   10099 C CE  . LYS C 1 161 ? 75.290  -45.787 152.125 1.00 137.53 ? 161 LYS C CE  1 
ATOM   10100 N NZ  . LYS C 1 161 ? 76.434  -46.512 151.504 1.00 132.44 ? 161 LYS C NZ  1 
ATOM   10101 N N   . GLN C 1 162 ? 72.677  -51.754 154.431 1.00 103.92 ? 162 GLN C N   1 
ATOM   10102 C CA  . GLN C 1 162 ? 71.885  -52.770 155.132 1.00 95.79  ? 162 GLN C CA  1 
ATOM   10103 C C   . GLN C 1 162 ? 70.897  -52.166 156.122 1.00 100.97 ? 162 GLN C C   1 
ATOM   10104 O O   . GLN C 1 162 ? 70.664  -52.714 157.199 1.00 106.96 ? 162 GLN C O   1 
ATOM   10105 C CB  . GLN C 1 162 ? 72.778  -53.783 155.856 1.00 96.96  ? 162 GLN C CB  1 
ATOM   10106 C CG  . GLN C 1 162 ? 73.519  -54.731 154.923 1.00 100.00 ? 162 GLN C CG  1 
ATOM   10107 C CD  . GLN C 1 162 ? 74.132  -55.911 155.660 1.00 114.67 ? 162 GLN C CD  1 
ATOM   10108 O OE1 . GLN C 1 162 ? 73.616  -56.345 156.691 1.00 131.20 ? 162 GLN C OE1 1 
ATOM   10109 N NE2 . GLN C 1 162 ? 75.218  -56.453 155.120 1.00 119.93 ? 162 GLN C NE2 1 
ATOM   10110 N N   . LYS C 1 163 ? 70.321  -51.030 155.758 1.00 98.97  ? 163 LYS C N   1 
ATOM   10111 C CA  . LYS C 1 163 ? 69.310  -50.397 156.591 1.00 102.78 ? 163 LYS C CA  1 
ATOM   10112 C C   . LYS C 1 163 ? 67.932  -50.774 156.059 1.00 103.98 ? 163 LYS C C   1 
ATOM   10113 O O   . LYS C 1 163 ? 66.919  -50.586 156.731 1.00 95.30  ? 163 LYS C O   1 
ATOM   10114 C CB  . LYS C 1 163 ? 69.493  -48.885 156.620 1.00 112.39 ? 163 LYS C CB  1 
ATOM   10115 C CG  . LYS C 1 163 ? 70.828  -48.437 157.206 1.00 127.26 ? 163 LYS C CG  1 
ATOM   10116 C CD  . LYS C 1 163 ? 70.704  -48.022 158.671 1.00 132.30 ? 163 LYS C CD  1 
ATOM   10117 C CE  . LYS C 1 163 ? 71.001  -49.169 159.627 1.00 126.13 ? 163 LYS C CE  1 
ATOM   10118 N NZ  . LYS C 1 163 ? 72.457  -49.475 159.664 1.00 124.72 ? 163 LYS C NZ  1 
ATOM   10119 N N   . TRP C 1 164 ? 67.902  -51.291 154.835 1.00 110.11 ? 164 TRP C N   1 
ATOM   10120 C CA  . TRP C 1 164 ? 66.656  -51.754 154.232 1.00 104.74 ? 164 TRP C CA  1 
ATOM   10121 C C   . TRP C 1 164 ? 66.752  -53.203 153.766 1.00 92.81  ? 164 TRP C C   1 
ATOM   10122 O O   . TRP C 1 164 ? 67.636  -53.565 152.993 1.00 84.02  ? 164 TRP C O   1 
ATOM   10123 C CB  . TRP C 1 164 ? 66.241  -50.858 153.068 1.00 97.60  ? 164 TRP C CB  1 
ATOM   10124 C CG  . TRP C 1 164 ? 65.279  -49.797 153.478 1.00 101.29 ? 164 TRP C CG  1 
ATOM   10125 C CD1 . TRP C 1 164 ? 63.926  -49.926 153.624 1.00 108.67 ? 164 TRP C CD1 1 
ATOM   10126 C CD2 . TRP C 1 164 ? 65.590  -48.439 153.797 1.00 98.35  ? 164 TRP C CD2 1 
ATOM   10127 N NE1 . TRP C 1 164 ? 63.377  -48.728 154.014 1.00 95.40  ? 164 TRP C NE1 1 
ATOM   10128 C CE2 . TRP C 1 164 ? 64.377  -47.799 154.125 1.00 107.33 ? 164 TRP C CE2 1 
ATOM   10129 C CE3 . TRP C 1 164 ? 66.775  -47.701 153.838 1.00 105.66 ? 164 TRP C CE3 1 
ATOM   10130 C CZ2 . TRP C 1 164 ? 64.318  -46.458 154.488 1.00 123.26 ? 164 TRP C CZ2 1 
ATOM   10131 C CZ3 . TRP C 1 164 ? 66.714  -46.373 154.197 1.00 130.77 ? 164 TRP C CZ3 1 
ATOM   10132 C CH2 . TRP C 1 164 ? 65.496  -45.765 154.522 1.00 136.73 ? 164 TRP C CH2 1 
ATOM   10133 N N   . LEU C 1 165 ? 65.816  -54.020 154.234 1.00 95.52  ? 165 LEU C N   1 
ATOM   10134 C CA  . LEU C 1 165 ? 65.798  -55.446 153.931 1.00 86.68  ? 165 LEU C CA  1 
ATOM   10135 C C   . LEU C 1 165 ? 64.545  -55.801 153.134 1.00 85.85  ? 165 LEU C C   1 
ATOM   10136 O O   . LEU C 1 165 ? 63.482  -55.222 153.354 1.00 104.55 ? 165 LEU C O   1 
ATOM   10137 C CB  . LEU C 1 165 ? 65.845  -56.254 155.224 1.00 80.34  ? 165 LEU C CB  1 
ATOM   10138 C CG  . LEU C 1 165 ? 66.800  -55.733 156.298 1.00 84.92  ? 165 LEU C CG  1 
ATOM   10139 C CD1 . LEU C 1 165 ? 66.536  -56.433 157.617 1.00 86.88  ? 165 LEU C CD1 1 
ATOM   10140 C CD2 . LEU C 1 165 ? 68.251  -55.905 155.876 1.00 90.11  ? 165 LEU C CD2 1 
ATOM   10141 N N   . LEU C 1 166 ? 64.662  -56.745 152.204 1.00 75.14  ? 166 LEU C N   1 
ATOM   10142 C CA  . LEU C 1 166 ? 63.524  -57.087 151.349 1.00 83.24  ? 166 LEU C CA  1 
ATOM   10143 C C   . LEU C 1 166 ? 63.369  -58.579 151.059 1.00 94.29  ? 166 LEU C C   1 
ATOM   10144 O O   . LEU C 1 166 ? 64.254  -59.209 150.482 1.00 101.49 ? 166 LEU C O   1 
ATOM   10145 C CB  . LEU C 1 166 ? 63.613  -56.329 150.027 1.00 72.66  ? 166 LEU C CB  1 
ATOM   10146 C CG  . LEU C 1 166 ? 62.442  -56.598 149.088 1.00 73.49  ? 166 LEU C CG  1 
ATOM   10147 C CD1 . LEU C 1 166 ? 61.253  -55.720 149.445 1.00 79.56  ? 166 LEU C CD1 1 
ATOM   10148 C CD2 . LEU C 1 166 ? 62.859  -56.364 147.658 1.00 74.72  ? 166 LEU C CD2 1 
ATOM   10149 N N   . LEU C 1 167 ? 62.229  -59.130 151.468 1.00 79.16  ? 167 LEU C N   1 
ATOM   10150 C CA  . LEU C 1 167 ? 61.899  -60.533 151.227 1.00 69.98  ? 167 LEU C CA  1 
ATOM   10151 C C   . LEU C 1 167 ? 60.836  -60.659 150.135 1.00 72.53  ? 167 LEU C C   1 
ATOM   10152 O O   . LEU C 1 167 ? 59.786  -60.025 150.207 1.00 99.97  ? 167 LEU C O   1 
ATOM   10153 C CB  . LEU C 1 167 ? 61.410  -61.194 152.517 1.00 69.89  ? 167 LEU C CB  1 
ATOM   10154 C CG  . LEU C 1 167 ? 61.193  -62.707 152.495 1.00 82.03  ? 167 LEU C CG  1 
ATOM   10155 C CD1 . LEU C 1 167 ? 62.523  -63.438 152.459 1.00 95.93  ? 167 LEU C CD1 1 
ATOM   10156 C CD2 . LEU C 1 167 ? 60.379  -63.152 153.695 1.00 87.11  ? 167 LEU C CD2 1 
ATOM   10157 N N   . THR C 1 168 ? 61.109  -61.475 149.121 1.00 70.85  ? 168 THR C N   1 
ATOM   10158 C CA  . THR C 1 168 ? 60.164  -61.664 148.021 1.00 70.99  ? 168 THR C CA  1 
ATOM   10159 C C   . THR C 1 168 ? 59.635  -63.093 147.931 1.00 73.91  ? 168 THR C C   1 
ATOM   10160 O O   . THR C 1 168 ? 60.404  -64.056 147.974 1.00 73.50  ? 168 THR C O   1 
ATOM   10161 C CB  . THR C 1 168 ? 60.794  -61.297 146.667 1.00 81.64  ? 168 THR C CB  1 
ATOM   10162 O OG1 . THR C 1 168 ? 61.468  -60.038 146.778 1.00 109.44 ? 168 THR C OG1 1 
ATOM   10163 C CG2 . THR C 1 168 ? 59.720  -61.197 145.592 1.00 77.36  ? 168 THR C CG2 1 
ATOM   10164 N N   . GLY C 1 169 ? 58.315  -63.219 147.815 1.00 81.09  ? 169 GLY C N   1 
ATOM   10165 C CA  . GLY C 1 169 ? 57.666  -64.512 147.676 1.00 83.28  ? 169 GLY C CA  1 
ATOM   10166 C C   . GLY C 1 169 ? 56.587  -64.508 146.606 1.00 85.99  ? 169 GLY C C   1 
ATOM   10167 O O   . GLY C 1 169 ? 55.943  -63.485 146.376 1.00 101.29 ? 169 GLY C O   1 
ATOM   10168 N N   . ILE C 1 170 ? 56.386  -65.642 145.941 1.00 76.53  ? 170 ILE C N   1 
ATOM   10169 C CA  . ILE C 1 170 ? 55.348  -65.731 144.914 1.00 79.86  ? 170 ILE C CA  1 
ATOM   10170 C C   . ILE C 1 170 ? 54.368  -66.881 145.174 1.00 88.31  ? 170 ILE C C   1 
ATOM   10171 O O   . ILE C 1 170 ? 54.727  -67.896 145.769 1.00 84.42  ? 170 ILE C O   1 
ATOM   10172 C CB  . ILE C 1 170 ? 55.968  -65.874 143.508 1.00 81.24  ? 170 ILE C CB  1 
ATOM   10173 C CG1 . ILE C 1 170 ? 57.093  -66.909 143.505 1.00 79.44  ? 170 ILE C CG1 1 
ATOM   10174 C CG2 . ILE C 1 170 ? 56.512  -64.537 143.035 1.00 87.88  ? 170 ILE C CG2 1 
ATOM   10175 C CD1 . ILE C 1 170 ? 56.992  -67.904 142.367 1.00 87.95  ? 170 ILE C CD1 1 
ATOM   10176 N N   . SER C 1 171 ? 53.129  -66.707 144.721 1.00 92.34  ? 171 SER C N   1 
ATOM   10177 C CA  . SER C 1 171 ? 52.074  -67.692 144.942 1.00 90.45  ? 171 SER C CA  1 
ATOM   10178 C C   . SER C 1 171 ? 51.041  -67.646 143.818 1.00 95.79  ? 171 SER C C   1 
ATOM   10179 O O   . SER C 1 171 ? 50.881  -66.620 143.159 1.00 107.70 ? 171 SER C O   1 
ATOM   10180 C CB  . SER C 1 171 ? 51.395  -67.460 146.296 1.00 107.38 ? 171 SER C CB  1 
ATOM   10181 O OG  . SER C 1 171 ? 50.805  -66.173 146.362 1.00 120.43 ? 171 SER C OG  1 
ATOM   10182 N N   . ALA C 1 172 ? 50.361  -68.765 143.587 1.00 101.10 ? 172 ALA C N   1 
ATOM   10183 C CA  . ALA C 1 172 ? 49.342  -68.843 142.540 1.00 104.91 ? 172 ALA C CA  1 
ATOM   10184 C C   . ALA C 1 172 ? 47.959  -68.409 143.037 1.00 122.72 ? 172 ALA C C   1 
ATOM   10185 O O   . ALA C 1 172 ? 47.308  -69.121 143.801 1.00 131.28 ? 172 ALA C O   1 
ATOM   10186 C CB  . ALA C 1 172 ? 49.279  -70.250 141.976 1.00 95.11  ? 172 ALA C CB  1 
ATOM   10187 N N   . GLN C 1 173 ? 47.514  -67.238 142.592 1.00 126.45 ? 173 GLN C N   1 
ATOM   10188 C CA  . GLN C 1 173 ? 46.219  -66.701 143.003 1.00 120.90 ? 173 GLN C CA  1 
ATOM   10189 C C   . GLN C 1 173 ? 45.353  -66.294 141.810 1.00 117.47 ? 173 GLN C C   1 
ATOM   10190 O O   . GLN C 1 173 ? 45.662  -65.322 141.118 1.00 105.07 ? 173 GLN C O   1 
ATOM   10191 C CB  . GLN C 1 173 ? 46.413  -65.495 143.929 1.00 116.24 ? 173 GLN C CB  1 
ATOM   10192 C CG  . GLN C 1 173 ? 47.324  -65.728 145.132 1.00 124.63 ? 173 GLN C CG  1 
ATOM   10193 C CD  . GLN C 1 173 ? 46.680  -66.590 146.200 1.00 145.34 ? 173 GLN C CD  1 
ATOM   10194 O OE1 . GLN C 1 173 ? 45.672  -66.207 146.792 1.00 164.07 ? 173 GLN C OE1 1 
ATOM   10195 N NE2 . GLN C 1 173 ? 47.272  -67.749 146.468 1.00 151.05 ? 173 GLN C NE2 1 
ATOM   10196 N N   . GLN C 1 174 ? 44.276  -67.046 141.575 1.00 121.68 ? 174 GLN C N   1 
ATOM   10197 C CA  . GLN C 1 174 ? 43.315  -66.742 140.510 1.00 120.24 ? 174 GLN C CA  1 
ATOM   10198 C C   . GLN C 1 174 ? 43.941  -66.726 139.117 1.00 115.90 ? 174 GLN C C   1 
ATOM   10199 O O   . GLN C 1 174 ? 43.877  -65.719 138.413 1.00 111.92 ? 174 GLN C O   1 
ATOM   10200 C CB  . GLN C 1 174 ? 42.621  -65.402 140.779 1.00 124.69 ? 174 GLN C CB  1 
ATOM   10201 C CG  . GLN C 1 174 ? 41.917  -65.326 142.123 1.00 143.49 ? 174 GLN C CG  1 
ATOM   10202 C CD  . GLN C 1 174 ? 40.765  -66.306 142.226 1.00 163.00 ? 174 GLN C CD  1 
ATOM   10203 O OE1 . GLN C 1 174 ? 39.870  -66.318 141.380 1.00 161.76 ? 174 GLN C OE1 1 
ATOM   10204 N NE2 . GLN C 1 174 ? 40.778  -67.130 143.268 1.00 168.38 ? 174 GLN C NE2 1 
ATOM   10205 N N   . ASN C 1 175 ? 44.553  -67.848 138.743 1.00 109.15 ? 175 ASN C N   1 
ATOM   10206 C CA  . ASN C 1 175 ? 45.214  -68.029 137.445 1.00 104.83 ? 175 ASN C CA  1 
ATOM   10207 C C   . ASN C 1 175 ? 46.344  -67.034 137.185 1.00 100.57 ? 175 ASN C C   1 
ATOM   10208 O O   . ASN C 1 175 ? 46.648  -66.689 136.049 1.00 106.25 ? 175 ASN C O   1 
ATOM   10209 C CB  . ASN C 1 175 ? 44.184  -67.953 136.313 1.00 115.29 ? 175 ASN C CB  1 
ATOM   10210 C CG  . ASN C 1 175 ? 42.930  -68.752 136.616 1.00 133.64 ? 175 ASN C CG  1 
ATOM   10211 O OD1 . ASN C 1 175 ? 43.010  -69.909 137.025 1.00 147.40 ? 175 ASN C OD1 1 
ATOM   10212 N ND2 . ASN C 1 175 ? 41.767  -68.151 136.387 1.00 130.42 ? 175 ASN C ND2 1 
ATOM   10213 N N   . ARG C 1 176 ? 46.965  -66.587 138.268 1.00 94.96  ? 176 ARG C N   1 
ATOM   10214 C CA  . ARG C 1 176 ? 48.085  -65.648 138.232 1.00 91.83  ? 176 ARG C CA  1 
ATOM   10215 C C   . ARG C 1 176 ? 49.165  -65.936 139.252 1.00 89.59  ? 176 ARG C C   1 
ATOM   10216 O O   . ARG C 1 176 ? 48.871  -66.281 140.394 1.00 95.99  ? 176 ARG C O   1 
ATOM   10217 C CB  . ARG C 1 176 ? 47.606  -64.213 138.453 1.00 95.61  ? 176 ARG C CB  1 
ATOM   10218 C CG  . ARG C 1 176 ? 47.261  -63.416 137.211 1.00 124.92 ? 176 ARG C CG  1 
ATOM   10219 C CD  . ARG C 1 176 ? 48.296  -62.289 137.088 1.00 154.56 ? 176 ARG C CD  1 
ATOM   10220 N NE  . ARG C 1 176 ? 47.813  -61.103 136.384 1.00 168.08 ? 176 ARG C NE  1 
ATOM   10221 C CZ  . ARG C 1 176 ? 47.389  -59.998 136.991 1.00 160.10 ? 176 ARG C CZ  1 
ATOM   10222 N NH1 . ARG C 1 176 ? 46.978  -58.958 136.277 1.00 150.63 ? 176 ARG C NH1 1 
ATOM   10223 N NH2 . ARG C 1 176 ? 47.353  -59.940 138.316 1.00 157.49 ? 176 ARG C NH2 1 
ATOM   10224 N N   . VAL C 1 177 ? 50.417  -65.822 138.827 1.00 87.76  ? 177 VAL C N   1 
ATOM   10225 C CA  . VAL C 1 177 ? 51.507  -65.898 139.781 1.00 83.53  ? 177 VAL C CA  1 
ATOM   10226 C C   . VAL C 1 177 ? 51.604  -64.523 140.424 1.00 83.57  ? 177 VAL C C   1 
ATOM   10227 O O   . VAL C 1 177 ? 51.915  -63.541 139.752 1.00 98.60  ? 177 VAL C O   1 
ATOM   10228 C CB  . VAL C 1 177 ? 52.843  -66.261 139.135 1.00 86.84  ? 177 VAL C CB  1 
ATOM   10229 C CG1 . VAL C 1 177 ? 53.972  -66.078 140.133 1.00 91.33  ? 177 VAL C CG1 1 
ATOM   10230 C CG2 . VAL C 1 177 ? 52.801  -67.686 138.608 1.00 86.71  ? 177 VAL C CG2 1 
ATOM   10231 N N   . VAL C 1 178 ? 51.346  -64.451 141.725 1.00 79.98  ? 178 VAL C N   1 
ATOM   10232 C CA  . VAL C 1 178 ? 51.312  -63.167 142.417 1.00 78.88  ? 178 VAL C CA  1 
ATOM   10233 C C   . VAL C 1 178 ? 52.530  -62.933 143.297 1.00 82.15  ? 178 VAL C C   1 
ATOM   10234 O O   . VAL C 1 178 ? 52.840  -63.741 144.169 1.00 99.47  ? 178 VAL C O   1 
ATOM   10235 C CB  . VAL C 1 178 ? 50.053  -63.034 143.285 1.00 88.91  ? 178 VAL C CB  1 
ATOM   10236 C CG1 . VAL C 1 178 ? 49.965  -61.637 143.867 1.00 97.62  ? 178 VAL C CG1 1 
ATOM   10237 C CG2 . VAL C 1 178 ? 48.818  -63.360 142.471 1.00 104.92 ? 178 VAL C CG2 1 
ATOM   10238 N N   . GLY C 1 179 ? 53.208  -61.814 143.068 1.00 75.88  ? 179 GLY C N   1 
ATOM   10239 C CA  . GLY C 1 179 ? 54.399  -61.485 143.826 1.00 74.23  ? 179 GLY C CA  1 
ATOM   10240 C C   . GLY C 1 179 ? 54.124  -60.692 145.089 1.00 74.88  ? 179 GLY C C   1 
ATOM   10241 O O   . GLY C 1 179 ? 53.475  -59.648 145.055 1.00 82.81  ? 179 GLY C O   1 
ATOM   10242 N N   . ALA C 1 180 ? 54.629  -61.189 146.212 1.00 72.26  ? 180 ALA C N   1 
ATOM   10243 C CA  . ALA C 1 180 ? 54.453  -60.510 147.489 1.00 71.53  ? 180 ALA C CA  1 
ATOM   10244 C C   . ALA C 1 180 ? 55.802  -60.146 148.090 1.00 75.49  ? 180 ALA C C   1 
ATOM   10245 O O   . ALA C 1 180 ? 56.678  -60.999 148.228 1.00 71.85  ? 180 ALA C O   1 
ATOM   10246 C CB  . ALA C 1 180 ? 53.659  -61.378 148.451 1.00 72.24  ? 180 ALA C CB  1 
ATOM   10247 N N   . MET C 1 181 ? 55.970  -58.878 148.448 1.00 70.95  ? 181 MET C N   1 
ATOM   10248 C CA  . MET C 1 181 ? 57.223  -58.430 149.039 1.00 70.99  ? 181 MET C CA  1 
ATOM   10249 C C   . MET C 1 181 ? 57.012  -57.764 150.393 1.00 78.45  ? 181 MET C C   1 
ATOM   10250 O O   . MET C 1 181 ? 55.952  -57.207 150.673 1.00 88.54  ? 181 MET C O   1 
ATOM   10251 C CB  . MET C 1 181 ? 57.946  -57.468 148.093 1.00 72.31  ? 181 MET C CB  1 
ATOM   10252 C CG  . MET C 1 181 ? 58.170  -58.027 146.697 1.00 74.31  ? 181 MET C CG  1 
ATOM   10253 S SD  . MET C 1 181 ? 59.309  -57.027 145.721 1.00 100.77 ? 181 MET C SD  1 
ATOM   10254 C CE  . MET C 1 181 ? 58.568  -55.408 145.873 1.00 75.81  ? 181 MET C CE  1 
ATOM   10255 N N   . GLN C 1 182 ? 58.036  -57.842 151.235 1.00 89.87  ? 182 GLN C N   1 
ATOM   10256 C CA  . GLN C 1 182 ? 58.023  -57.190 152.536 1.00 78.15  ? 182 GLN C CA  1 
ATOM   10257 C C   . GLN C 1 182 ? 59.257  -56.310 152.652 1.00 84.89  ? 182 GLN C C   1 
ATOM   10258 O O   . GLN C 1 182 ? 60.379  -56.809 152.734 1.00 83.76  ? 182 GLN C O   1 
ATOM   10259 C CB  . GLN C 1 182 ? 57.992  -58.221 153.665 1.00 74.80  ? 182 GLN C CB  1 
ATOM   10260 C CG  . GLN C 1 182 ? 57.920  -57.625 155.060 1.00 79.40  ? 182 GLN C CG  1 
ATOM   10261 C CD  . GLN C 1 182 ? 57.982  -58.681 156.148 1.00 88.71  ? 182 GLN C CD  1 
ATOM   10262 O OE1 . GLN C 1 182 ? 57.949  -59.878 155.869 1.00 82.98  ? 182 GLN C OE1 1 
ATOM   10263 N NE2 . GLN C 1 182 ? 58.071  -58.240 157.398 1.00 96.21  ? 182 GLN C NE2 1 
ATOM   10264 N N   . LEU C 1 183 ? 59.050  -54.999 152.660 1.00 85.80  ? 183 LEU C N   1 
ATOM   10265 C CA  . LEU C 1 183 ? 60.159  -54.070 152.793 1.00 75.75  ? 183 LEU C CA  1 
ATOM   10266 C C   . LEU C 1 183 ? 60.281  -53.659 154.253 1.00 87.52  ? 183 LEU C C   1 
ATOM   10267 O O   . LEU C 1 183 ? 59.428  -52.955 154.787 1.00 103.15 ? 183 LEU C O   1 
ATOM   10268 C CB  . LEU C 1 183 ? 59.963  -52.852 151.891 1.00 75.58  ? 183 LEU C CB  1 
ATOM   10269 C CG  . LEU C 1 183 ? 61.091  -51.819 151.898 1.00 85.11  ? 183 LEU C CG  1 
ATOM   10270 C CD1 . LEU C 1 183 ? 62.358  -52.388 151.268 1.00 91.24  ? 183 LEU C CD1 1 
ATOM   10271 C CD2 . LEU C 1 183 ? 60.646  -50.568 151.167 1.00 79.44  ? 183 LEU C CD2 1 
ATOM   10272 N N   . TYR C 1 184 ? 61.363  -54.097 154.886 1.00 80.05  ? 184 TYR C N   1 
ATOM   10273 C CA  . TYR C 1 184 ? 61.592  -53.842 156.302 1.00 81.83  ? 184 TYR C CA  1 
ATOM   10274 C C   . TYR C 1 184 ? 62.657  -52.790 156.539 1.00 87.04  ? 184 TYR C C   1 
ATOM   10275 O O   . TYR C 1 184 ? 63.745  -52.836 155.971 1.00 85.91  ? 184 TYR C O   1 
ATOM   10276 C CB  . TYR C 1 184 ? 61.970  -55.133 157.027 1.00 82.22  ? 184 TYR C CB  1 
ATOM   10277 C CG  . TYR C 1 184 ? 62.256  -54.939 158.503 1.00 84.85  ? 184 TYR C CG  1 
ATOM   10278 C CD1 . TYR C 1 184 ? 61.224  -54.802 159.422 1.00 87.98  ? 184 TYR C CD1 1 
ATOM   10279 C CD2 . TYR C 1 184 ? 63.561  -54.915 158.978 1.00 97.74  ? 184 TYR C CD2 1 
ATOM   10280 C CE1 . TYR C 1 184 ? 61.484  -54.629 160.770 1.00 102.87 ? 184 TYR C CE1 1 
ATOM   10281 C CE2 . TYR C 1 184 ? 63.830  -54.744 160.322 1.00 96.62  ? 184 TYR C CE2 1 
ATOM   10282 C CZ  . TYR C 1 184 ? 62.788  -54.604 161.214 1.00 92.92  ? 184 TYR C CZ  1 
ATOM   10283 O OH  . TYR C 1 184 ? 63.054  -54.436 162.553 1.00 96.53  ? 184 TYR C OH  1 
ATOM   10284 N N   . SER C 1 185 ? 62.317  -51.829 157.388 1.00 96.76  ? 185 SER C N   1 
ATOM   10285 C CA  . SER C 1 185 ? 63.241  -50.768 157.767 1.00 111.70 ? 185 SER C CA  1 
ATOM   10286 C C   . SER C 1 185 ? 63.933  -51.050 159.095 1.00 110.53 ? 185 SER C C   1 
ATOM   10287 O O   . SER C 1 185 ? 63.283  -51.279 160.109 1.00 100.82 ? 185 SER C O   1 
ATOM   10288 C CB  . SER C 1 185 ? 62.504  -49.438 157.850 1.00 122.65 ? 185 SER C CB  1 
ATOM   10289 O OG  . SER C 1 185 ? 63.408  -48.382 158.114 1.00 127.67 ? 185 SER C OG  1 
ATOM   10290 N N   . VAL C 1 186 ? 65.259  -51.080 159.069 1.00 118.81 ? 186 VAL C N   1 
ATOM   10291 C CA  . VAL C 1 186 ? 66.028  -51.325 160.279 1.00 125.19 ? 186 VAL C CA  1 
ATOM   10292 C C   . VAL C 1 186 ? 65.892  -50.154 161.251 1.00 130.11 ? 186 VAL C C   1 
ATOM   10293 O O   . VAL C 1 186 ? 65.636  -50.349 162.439 1.00 128.77 ? 186 VAL C O   1 
ATOM   10294 C CB  . VAL C 1 186 ? 67.521  -51.560 159.970 1.00 107.11 ? 186 VAL C CB  1 
ATOM   10295 C CG1 . VAL C 1 186 ? 68.300  -51.732 161.264 1.00 104.61 ? 186 VAL C CG1 1 
ATOM   10296 C CG2 . VAL C 1 186 ? 67.684  -52.785 159.083 1.00 100.24 ? 186 VAL C CG2 1 
ATOM   10297 N N   . ASP C 1 187 ? 66.078  -48.937 160.745 1.00 128.85 ? 187 ASP C N   1 
ATOM   10298 C CA  . ASP C 1 187 ? 65.978  -47.737 161.575 1.00 121.16 ? 187 ASP C CA  1 
ATOM   10299 C C   . ASP C 1 187 ? 64.584  -47.481 162.137 1.00 111.32 ? 187 ASP C C   1 
ATOM   10300 O O   . ASP C 1 187 ? 64.425  -47.270 163.337 1.00 130.86 ? 187 ASP C O   1 
ATOM   10301 C CB  . ASP C 1 187 ? 66.435  -46.508 160.788 1.00 124.73 ? 187 ASP C CB  1 
ATOM   10302 C CG  . ASP C 1 187 ? 67.925  -46.500 160.546 1.00 133.76 ? 187 ASP C CG  1 
ATOM   10303 O OD1 . ASP C 1 187 ? 68.639  -47.265 161.231 1.00 136.10 ? 187 ASP C OD1 1 
ATOM   10304 O OD2 . ASP C 1 187 ? 68.387  -45.726 159.683 1.00 143.91 ? 187 ASP C OD2 1 
ATOM   10305 N N   . ARG C 1 188 ? 63.581  -47.483 161.266 1.00 103.84 ? 188 ARG C N   1 
ATOM   10306 C CA  . ARG C 1 188 ? 62.199  -47.238 161.675 1.00 105.41 ? 188 ARG C CA  1 
ATOM   10307 C C   . ARG C 1 188 ? 61.532  -48.476 162.287 1.00 107.05 ? 188 ARG C C   1 
ATOM   10308 O O   . ARG C 1 188 ? 60.455  -48.382 162.877 1.00 105.60 ? 188 ARG C O   1 
ATOM   10309 C CB  . ARG C 1 188 ? 61.387  -46.729 160.479 1.00 104.77 ? 188 ARG C CB  1 
ATOM   10310 C CG  . ARG C 1 188 ? 61.542  -45.230 160.231 1.00 114.20 ? 188 ARG C CG  1 
ATOM   10311 C CD  . ARG C 1 188 ? 61.503  -44.869 158.751 1.00 135.83 ? 188 ARG C CD  1 
ATOM   10312 N NE  . ARG C 1 188 ? 62.807  -44.411 158.273 1.00 153.91 ? 188 ARG C NE  1 
ATOM   10313 C CZ  . ARG C 1 188 ? 62.993  -43.352 157.491 1.00 155.28 ? 188 ARG C CZ  1 
ATOM   10314 N NH1 . ARG C 1 188 ? 64.219  -43.018 157.111 1.00 157.53 ? 188 ARG C NH1 1 
ATOM   10315 N NH2 . ARG C 1 188 ? 61.957  -42.627 157.090 1.00 148.90 ? 188 ARG C NH2 1 
ATOM   10316 N N   . LYS C 1 189 ? 62.181  -49.629 162.142 1.00 106.01 ? 189 LYS C N   1 
ATOM   10317 C CA  . LYS C 1 189 ? 61.691  -50.914 162.670 1.00 104.46 ? 189 LYS C CA  1 
ATOM   10318 C C   . LYS C 1 189 ? 60.276  -51.304 162.235 1.00 107.38 ? 189 LYS C C   1 
ATOM   10319 O O   . LYS C 1 189 ? 59.518  -51.872 163.018 1.00 110.37 ? 189 LYS C O   1 
ATOM   10320 C CB  . LYS C 1 189 ? 61.764  -50.924 164.198 1.00 115.82 ? 189 LYS C CB  1 
ATOM   10321 C CG  . LYS C 1 189 ? 62.739  -51.965 164.736 1.00 135.09 ? 189 LYS C CG  1 
ATOM   10322 C CD  . LYS C 1 189 ? 62.184  -52.689 165.953 1.00 146.88 ? 189 LYS C CD  1 
ATOM   10323 C CE  . LYS C 1 189 ? 62.930  -53.995 166.198 1.00 156.88 ? 189 LYS C CE  1 
ATOM   10324 N NZ  . LYS C 1 189 ? 62.602  -55.044 165.189 1.00 166.75 ? 189 LYS C NZ  1 
ATOM   10325 N N   . VAL C 1 190 ? 59.918  -50.989 160.994 1.00 110.00 ? 190 VAL C N   1 
ATOM   10326 C CA  . VAL C 1 190 ? 58.589  -51.315 160.468 1.00 100.99 ? 190 VAL C CA  1 
ATOM   10327 C C   . VAL C 1 190 ? 58.626  -51.939 159.073 1.00 107.74 ? 190 VAL C C   1 
ATOM   10328 O O   . VAL C 1 190 ? 59.557  -51.715 158.302 1.00 100.52 ? 190 VAL C O   1 
ATOM   10329 C CB  . VAL C 1 190 ? 57.681  -50.080 160.428 1.00 97.92  ? 190 VAL C CB  1 
ATOM   10330 C CG1 . VAL C 1 190 ? 57.275  -49.668 161.839 1.00 104.54 ? 190 VAL C CG1 1 
ATOM   10331 C CG2 . VAL C 1 190 ? 58.360  -48.946 159.679 1.00 104.51 ? 190 VAL C CG2 1 
ATOM   10332 N N   . SER C 1 191 ? 57.605  -52.734 158.764 1.00 112.75 ? 191 SER C N   1 
ATOM   10333 C CA  . SER C 1 191 ? 57.502  -53.401 157.468 1.00 103.29 ? 191 SER C CA  1 
ATOM   10334 C C   . SER C 1 191 ? 56.384  -52.843 156.585 1.00 101.10 ? 191 SER C C   1 
ATOM   10335 O O   . SER C 1 191 ? 55.341  -52.414 157.075 1.00 108.72 ? 191 SER C O   1 
ATOM   10336 C CB  . SER C 1 191 ? 57.290  -54.901 157.662 1.00 88.69  ? 191 SER C CB  1 
ATOM   10337 O OG  . SER C 1 191 ? 58.432  -55.497 158.249 1.00 92.78  ? 191 SER C OG  1 
ATOM   10338 N N   . GLN C 1 192 ? 56.628  -52.836 155.277 1.00 87.69  ? 192 GLN C N   1 
ATOM   10339 C CA  . GLN C 1 192 ? 55.634  -52.413 154.293 1.00 86.49  ? 192 GLN C CA  1 
ATOM   10340 C C   . GLN C 1 192 ? 55.386  -53.539 153.288 1.00 86.58  ? 192 GLN C C   1 
ATOM   10341 O O   . GLN C 1 192 ? 56.308  -53.948 152.581 1.00 85.03  ? 192 GLN C O   1 
ATOM   10342 C CB  . GLN C 1 192 ? 56.103  -51.150 153.560 1.00 93.88  ? 192 GLN C CB  1 
ATOM   10343 C CG  . GLN C 1 192 ? 55.425  -49.844 153.978 1.00 125.94 ? 192 GLN C CG  1 
ATOM   10344 C CD  . GLN C 1 192 ? 53.961  -49.767 153.572 1.00 151.38 ? 192 GLN C CD  1 
ATOM   10345 O OE1 . GLN C 1 192 ? 53.603  -50.054 152.428 1.00 156.89 ? 192 GLN C OE1 1 
ATOM   10346 N NE2 . GLN C 1 192 ? 53.112  -49.345 154.504 1.00 150.58 ? 192 GLN C NE2 1 
ATOM   10347 N N   . PRO C 1 193 ? 54.143  -54.049 153.216 1.00 89.80  ? 193 PRO C N   1 
ATOM   10348 C CA  . PRO C 1 193 ? 53.882  -55.074 152.199 1.00 89.43  ? 193 PRO C CA  1 
ATOM   10349 C C   . PRO C 1 193 ? 53.711  -54.461 150.812 1.00 91.80  ? 193 PRO C C   1 
ATOM   10350 O O   . PRO C 1 193 ? 52.963  -53.499 150.648 1.00 98.03  ? 193 PRO C O   1 
ATOM   10351 C CB  . PRO C 1 193 ? 52.585  -55.737 152.680 1.00 85.45  ? 193 PRO C CB  1 
ATOM   10352 C CG  . PRO C 1 193 ? 51.977  -54.791 153.685 1.00 88.59  ? 193 PRO C CG  1 
ATOM   10353 C CD  . PRO C 1 193 ? 52.914  -53.633 153.911 1.00 86.46  ? 193 PRO C CD  1 
ATOM   10354 N N   . ILE C 1 194 ? 54.401  -55.022 149.824 1.00 95.08  ? 194 ILE C N   1 
ATOM   10355 C CA  . ILE C 1 194 ? 54.379  -54.491 148.464 1.00 95.83  ? 194 ILE C CA  1 
ATOM   10356 C C   . ILE C 1 194 ? 54.127  -55.597 147.441 1.00 107.27 ? 194 ILE C C   1 
ATOM   10357 O O   . ILE C 1 194 ? 54.702  -56.674 147.546 1.00 101.61 ? 194 ILE C O   1 
ATOM   10358 C CB  . ILE C 1 194 ? 55.712  -53.786 148.129 1.00 81.98  ? 194 ILE C CB  1 
ATOM   10359 C CG1 . ILE C 1 194 ? 55.993  -52.661 149.127 1.00 82.74  ? 194 ILE C CG1 1 
ATOM   10360 C CG2 . ILE C 1 194 ? 55.704  -53.256 146.706 1.00 88.07  ? 194 ILE C CG2 1 
ATOM   10361 C CD1 . ILE C 1 194 ? 57.415  -52.146 149.087 1.00 86.67  ? 194 ILE C CD1 1 
ATOM   10362 N N   . GLU C 1 195 ? 53.276  -55.342 146.452 1.00 105.06 ? 195 GLU C N   1 
ATOM   10363 C CA  . GLU C 1 195 ? 53.077  -56.325 145.393 1.00 91.81  ? 195 GLU C CA  1 
ATOM   10364 C C   . GLU C 1 195 ? 54.164  -56.151 144.339 1.00 93.10  ? 195 GLU C C   1 
ATOM   10365 O O   . GLU C 1 195 ? 54.148  -55.189 143.570 1.00 90.44  ? 195 GLU C O   1 
ATOM   10366 C CB  . GLU C 1 195 ? 51.694  -56.201 144.752 1.00 92.31  ? 195 GLU C CB  1 
ATOM   10367 C CG  . GLU C 1 195 ? 51.333  -57.401 143.877 1.00 102.97 ? 195 GLU C CG  1 
ATOM   10368 C CD  . GLU C 1 195 ? 50.190  -57.113 142.926 1.00 125.28 ? 195 GLU C CD  1 
ATOM   10369 O OE1 . GLU C 1 195 ? 49.719  -55.956 142.886 1.00 123.64 ? 195 GLU C OE1 1 
ATOM   10370 O OE2 . GLU C 1 195 ? 49.756  -58.049 142.220 1.00 146.21 ? 195 GLU C OE2 1 
ATOM   10371 N N   . GLY C 1 196 ? 55.109  -57.086 144.313 1.00 88.86  ? 196 GLY C N   1 
ATOM   10372 C CA  . GLY C 1 196 ? 56.223  -57.026 143.384 1.00 78.24  ? 196 GLY C CA  1 
ATOM   10373 C C   . GLY C 1 196 ? 56.755  -58.397 143.014 1.00 87.11  ? 196 GLY C C   1 
ATOM   10374 O O   . GLY C 1 196 ? 56.714  -59.326 143.816 1.00 97.92  ? 196 GLY C O   1 
ATOM   10375 N N   . HIS C 1 197 ? 57.252  -58.522 141.787 1.00 86.82  ? 197 HIS C N   1 
ATOM   10376 C CA  . HIS C 1 197 ? 57.795  -59.787 141.300 1.00 73.24  ? 197 HIS C CA  1 
ATOM   10377 C C   . HIS C 1 197 ? 59.314  -59.847 141.390 1.00 77.47  ? 197 HIS C C   1 
ATOM   10378 O O   . HIS C 1 197 ? 59.876  -60.883 141.735 1.00 88.83  ? 197 HIS C O   1 
ATOM   10379 C CB  . HIS C 1 197 ? 57.348  -60.033 139.856 1.00 74.24  ? 197 HIS C CB  1 
ATOM   10380 C CG  . HIS C 1 197 ? 55.991  -60.659 139.743 1.00 82.13  ? 197 HIS C CG  1 
ATOM   10381 N ND1 . HIS C 1 197 ? 54.874  -59.953 139.365 1.00 84.00  ? 197 HIS C ND1 1 
ATOM   10382 C CD2 . HIS C 1 197 ? 55.577  -61.935 139.951 1.00 85.48  ? 197 HIS C CD2 1 
ATOM   10383 C CE1 . HIS C 1 197 ? 53.824  -60.755 139.351 1.00 98.20  ? 197 HIS C CE1 1 
ATOM   10384 N NE2 . HIS C 1 197 ? 54.227  -61.966 139.702 1.00 91.22  ? 197 HIS C NE2 1 
ATOM   10385 N N   . ALA C 1 198 ? 59.973  -58.743 141.065 1.00 80.48  ? 198 ALA C N   1 
ATOM   10386 C CA  . ALA C 1 198 ? 61.429  -58.689 141.109 1.00 73.65  ? 198 ALA C CA  1 
ATOM   10387 C C   . ALA C 1 198 ? 61.868  -57.310 141.562 1.00 78.70  ? 198 ALA C C   1 
ATOM   10388 O O   . ALA C 1 198 ? 61.286  -56.305 141.156 1.00 76.23  ? 198 ALA C O   1 
ATOM   10389 C CB  . ALA C 1 198 ? 62.025  -59.024 139.753 1.00 74.94  ? 198 ALA C CB  1 
ATOM   10390 N N   . ALA C 1 199 ? 62.889  -57.253 142.408 1.00 82.76  ? 199 ALA C N   1 
ATOM   10391 C CA  . ALA C 1 199 ? 63.323  -55.971 142.938 1.00 84.52  ? 199 ALA C CA  1 
ATOM   10392 C C   . ALA C 1 199 ? 64.824  -55.892 143.154 1.00 83.86  ? 199 ALA C C   1 
ATOM   10393 O O   . ALA C 1 199 ? 65.530  -56.897 143.082 1.00 90.63  ? 199 ALA C O   1 
ATOM   10394 C CB  . ALA C 1 199 ? 62.600  -55.682 144.233 1.00 80.86  ? 199 ALA C CB  1 
ATOM   10395 N N   . SER C 1 200 ? 65.301  -54.678 143.413 1.00 78.01  ? 200 SER C N   1 
ATOM   10396 C CA  . SER C 1 200 ? 66.718  -54.432 143.636 1.00 81.22  ? 200 SER C CA  1 
ATOM   10397 C C   . SER C 1 200 ? 66.945  -53.047 144.235 1.00 86.50  ? 200 SER C C   1 
ATOM   10398 O O   . SER C 1 200 ? 66.139  -52.138 144.037 1.00 87.38  ? 200 SER C O   1 
ATOM   10399 C CB  . SER C 1 200 ? 67.496  -54.572 142.327 1.00 86.40  ? 200 SER C CB  1 
ATOM   10400 O OG  . SER C 1 200 ? 68.876  -54.333 142.530 1.00 88.39  ? 200 SER C OG  1 
ATOM   10401 N N   . PHE C 1 201 ? 68.044  -52.894 144.969 1.00 85.34  ? 201 PHE C N   1 
ATOM   10402 C CA  . PHE C 1 201 ? 68.411  -51.602 145.540 1.00 88.59  ? 201 PHE C CA  1 
ATOM   10403 C C   . PHE C 1 201 ? 69.544  -50.968 144.741 1.00 106.59 ? 201 PHE C C   1 
ATOM   10404 O O   . PHE C 1 201 ? 70.371  -51.668 144.157 1.00 112.80 ? 201 PHE C O   1 
ATOM   10405 C CB  . PHE C 1 201 ? 68.831  -51.744 147.003 1.00 85.03  ? 201 PHE C CB  1 
ATOM   10406 C CG  . PHE C 1 201 ? 67.718  -52.165 147.922 1.00 90.24  ? 201 PHE C CG  1 
ATOM   10407 C CD1 . PHE C 1 201 ? 66.839  -51.231 148.446 1.00 87.85  ? 201 PHE C CD1 1 
ATOM   10408 C CD2 . PHE C 1 201 ? 67.562  -53.494 148.275 1.00 92.08  ? 201 PHE C CD2 1 
ATOM   10409 C CE1 . PHE C 1 201 ? 65.819  -51.616 149.295 1.00 84.67  ? 201 PHE C CE1 1 
ATOM   10410 C CE2 . PHE C 1 201 ? 66.546  -53.887 149.125 1.00 83.82  ? 201 PHE C CE2 1 
ATOM   10411 C CZ  . PHE C 1 201 ? 65.673  -52.947 149.636 1.00 82.75  ? 201 PHE C CZ  1 
ATOM   10412 N N   . ALA C 1 202 ? 69.580  -49.639 144.710 1.00 108.55 ? 202 ALA C N   1 
ATOM   10413 C CA  . ALA C 1 202 ? 70.632  -48.943 143.976 1.00 104.19 ? 202 ALA C CA  1 
ATOM   10414 C C   . ALA C 1 202 ? 71.064  -47.622 144.612 1.00 109.25 ? 202 ALA C C   1 
ATOM   10415 O O   . ALA C 1 202 ? 70.252  -46.888 145.179 1.00 116.03 ? 202 ALA C O   1 
ATOM   10416 C CB  . ALA C 1 202 ? 70.188  -48.703 142.542 1.00 102.41 ? 202 ALA C CB  1 
ATOM   10417 N N   . GLN C 1 203 ? 72.356  -47.333 144.493 1.00 106.64 ? 203 GLN C N   1 
ATOM   10418 C CA  . GLN C 1 203 ? 72.926  -46.071 144.942 1.00 111.44 ? 203 GLN C CA  1 
ATOM   10419 C C   . GLN C 1 203 ? 73.063  -45.144 143.734 1.00 112.26 ? 203 GLN C C   1 
ATOM   10420 O O   . GLN C 1 203 ? 73.747  -45.469 142.763 1.00 125.74 ? 203 GLN C O   1 
ATOM   10421 C CB  . GLN C 1 203 ? 74.287  -46.292 145.608 1.00 117.27 ? 203 GLN C CB  1 
ATOM   10422 C CG  . GLN C 1 203 ? 74.264  -47.128 146.893 1.00 120.07 ? 203 GLN C CG  1 
ATOM   10423 C CD  . GLN C 1 203 ? 73.529  -46.443 148.035 1.00 117.73 ? 203 GLN C CD  1 
ATOM   10424 O OE1 . GLN C 1 203 ? 73.579  -45.220 148.175 1.00 123.18 ? 203 GLN C OE1 1 
ATOM   10425 N NE2 . GLN C 1 203 ? 72.852  -47.231 148.864 1.00 109.59 ? 203 GLN C NE2 1 
ATOM   10426 N N   . PHE C 1 204 ? 72.429  -43.979 143.808 1.00 110.19 ? 204 PHE C N   1 
ATOM   10427 C CA  . PHE C 1 204 ? 72.402  -43.040 142.688 1.00 112.97 ? 204 PHE C CA  1 
ATOM   10428 C C   . PHE C 1 204 ? 72.494  -41.587 143.136 1.00 123.47 ? 204 PHE C C   1 
ATOM   10429 O O   . PHE C 1 204 ? 71.651  -41.109 143.895 1.00 118.65 ? 204 PHE C O   1 
ATOM   10430 C CB  . PHE C 1 204 ? 71.123  -43.258 141.871 1.00 111.24 ? 204 PHE C CB  1 
ATOM   10431 C CG  . PHE C 1 204 ? 70.920  -42.256 140.762 1.00 113.57 ? 204 PHE C CG  1 
ATOM   10432 C CD1 . PHE C 1 204 ? 71.542  -42.416 139.536 1.00 121.94 ? 204 PHE C CD1 1 
ATOM   10433 C CD2 . PHE C 1 204 ? 70.067  -41.179 140.937 1.00 115.48 ? 204 PHE C CD2 1 
ATOM   10434 C CE1 . PHE C 1 204 ? 71.347  -41.501 138.520 1.00 134.48 ? 204 PHE C CE1 1 
ATOM   10435 C CE2 . PHE C 1 204 ? 69.862  -40.260 139.925 1.00 121.87 ? 204 PHE C CE2 1 
ATOM   10436 C CZ  . PHE C 1 204 ? 70.504  -40.422 138.711 1.00 134.30 ? 204 PHE C CZ  1 
ATOM   10437 N N   . LYS C 1 205 ? 73.518  -40.887 142.659 1.00 135.68 ? 205 LYS C N   1 
ATOM   10438 C CA  . LYS C 1 205 ? 73.676  -39.471 142.964 1.00 140.90 ? 205 LYS C CA  1 
ATOM   10439 C C   . LYS C 1 205 ? 73.035  -38.631 141.860 1.00 142.23 ? 205 LYS C C   1 
ATOM   10440 O O   . LYS C 1 205 ? 73.452  -38.678 140.703 1.00 145.65 ? 205 LYS C O   1 
ATOM   10441 C CB  . LYS C 1 205 ? 75.149  -39.099 143.135 1.00 138.23 ? 205 LYS C CB  1 
ATOM   10442 C CG  . LYS C 1 205 ? 75.362  -37.816 143.935 1.00 145.74 ? 205 LYS C CG  1 
ATOM   10443 C CD  . LYS C 1 205 ? 76.837  -37.475 144.106 1.00 153.49 ? 205 LYS C CD  1 
ATOM   10444 C CE  . LYS C 1 205 ? 77.439  -38.187 145.306 1.00 157.03 ? 205 LYS C CE  1 
ATOM   10445 N NZ  . LYS C 1 205 ? 78.812  -37.698 145.606 1.00 161.49 ? 205 LYS C NZ  1 
ATOM   10446 N N   . MET C 1 206 ? 72.021  -37.858 142.231 1.00 132.17 ? 206 MET C N   1 
ATOM   10447 C CA  . MET C 1 206 ? 71.277  -37.026 141.289 1.00 129.72 ? 206 MET C CA  1 
ATOM   10448 C C   . MET C 1 206 ? 72.113  -35.882 140.722 1.00 135.53 ? 206 MET C C   1 
ATOM   10449 O O   . MET C 1 206 ? 73.224  -35.625 141.183 1.00 142.28 ? 206 MET C O   1 
ATOM   10450 C CB  . MET C 1 206 ? 70.033  -36.460 141.975 1.00 134.62 ? 206 MET C CB  1 
ATOM   10451 C CG  . MET C 1 206 ? 68.947  -37.484 142.245 1.00 134.60 ? 206 MET C CG  1 
ATOM   10452 S SD  . MET C 1 206 ? 67.653  -36.833 143.312 1.00 128.72 ? 206 MET C SD  1 
ATOM   10453 C CE  . MET C 1 206 ? 66.754  -35.787 142.170 1.00 127.89 ? 206 MET C CE  1 
ATOM   10454 N N   . GLU C 1 207 ? 71.572  -35.209 139.709 1.00 139.51 ? 207 GLU C N   1 
ATOM   10455 C CA  . GLU C 1 207 ? 72.223  -34.041 139.128 1.00 150.44 ? 207 GLU C CA  1 
ATOM   10456 C C   . GLU C 1 207 ? 72.116  -32.876 140.102 1.00 157.93 ? 207 GLU C C   1 
ATOM   10457 O O   . GLU C 1 207 ? 71.019  -32.407 140.401 1.00 159.75 ? 207 GLU C O   1 
ATOM   10458 C CB  . GLU C 1 207 ? 71.589  -33.669 137.785 1.00 155.55 ? 207 GLU C CB  1 
ATOM   10459 C CG  . GLU C 1 207 ? 72.311  -32.569 137.014 1.00 166.35 ? 207 GLU C CG  1 
ATOM   10460 C CD  . GLU C 1 207 ? 73.494  -33.073 136.210 1.00 179.54 ? 207 GLU C CD  1 
ATOM   10461 O OE1 . GLU C 1 207 ? 73.566  -32.748 135.006 1.00 185.70 ? 207 GLU C OE1 1 
ATOM   10462 O OE2 . GLU C 1 207 ? 74.350  -33.787 136.773 1.00 184.97 ? 207 GLU C OE2 1 
ATOM   10463 N N   . GLY C 1 208 ? 73.261  -32.405 140.584 1.00 159.44 ? 208 GLY C N   1 
ATOM   10464 C CA  . GLY C 1 208 ? 73.310  -31.315 141.544 1.00 159.45 ? 208 GLY C CA  1 
ATOM   10465 C C   . GLY C 1 208 ? 72.969  -31.725 142.966 1.00 155.56 ? 208 GLY C C   1 
ATOM   10466 O O   . GLY C 1 208 ? 72.405  -30.943 143.731 1.00 153.55 ? 208 GLY C O   1 
ATOM   10467 N N   . ASN C 1 209 ? 73.304  -32.963 143.318 1.00 158.50 ? 209 ASN C N   1 
ATOM   10468 C CA  . ASN C 1 209 ? 73.065  -33.481 144.662 1.00 160.92 ? 209 ASN C CA  1 
ATOM   10469 C C   . ASN C 1 209 ? 74.359  -33.839 145.385 1.00 157.42 ? 209 ASN C C   1 
ATOM   10470 O O   . ASN C 1 209 ? 75.250  -34.455 144.804 1.00 149.03 ? 209 ASN C O   1 
ATOM   10471 C CB  . ASN C 1 209 ? 72.142  -34.695 144.611 1.00 157.18 ? 209 ASN C CB  1 
ATOM   10472 C CG  . ASN C 1 209 ? 70.795  -34.420 145.243 1.00 150.97 ? 209 ASN C CG  1 
ATOM   10473 O OD1 . ASN C 1 209 ? 70.321  -33.283 145.253 1.00 148.90 ? 209 ASN C OD1 1 
ATOM   10474 N ND2 . ASN C 1 209 ? 70.173  -35.458 145.782 1.00 142.95 ? 209 ASN C ND2 1 
ATOM   10475 N N   . ALA C 1 210 ? 74.456  -33.442 146.651 1.00 160.60 ? 210 ALA C N   1 
ATOM   10476 C CA  . ALA C 1 210 ? 75.653  -33.685 147.453 1.00 159.01 ? 210 ALA C CA  1 
ATOM   10477 C C   . ALA C 1 210 ? 75.960  -35.167 147.699 1.00 158.64 ? 210 ALA C C   1 
ATOM   10478 O O   . ALA C 1 210 ? 77.077  -35.621 147.452 1.00 158.14 ? 210 ALA C O   1 
ATOM   10479 C CB  . ALA C 1 210 ? 75.534  -32.956 148.783 1.00 156.69 ? 210 ALA C CB  1 
ATOM   10480 N N   . GLU C 1 211 ? 74.969  -35.914 148.180 1.00 157.64 ? 211 GLU C N   1 
ATOM   10481 C CA  . GLU C 1 211 ? 75.164  -37.321 148.537 1.00 157.65 ? 211 GLU C CA  1 
ATOM   10482 C C   . GLU C 1 211 ? 74.392  -38.289 147.644 1.00 146.33 ? 211 GLU C C   1 
ATOM   10483 O O   . GLU C 1 211 ? 73.486  -37.894 146.916 1.00 140.43 ? 211 GLU C O   1 
ATOM   10484 C CB  . GLU C 1 211 ? 74.767  -37.550 149.999 1.00 168.81 ? 211 GLU C CB  1 
ATOM   10485 C CG  . GLU C 1 211 ? 75.660  -36.837 151.008 1.00 184.34 ? 211 GLU C CG  1 
ATOM   10486 C CD  . GLU C 1 211 ? 76.998  -37.534 151.181 1.00 188.95 ? 211 GLU C CD  1 
ATOM   10487 O OE1 . GLU C 1 211 ? 78.046  -36.885 150.980 1.00 184.74 ? 211 GLU C OE1 1 
ATOM   10488 O OE2 . GLU C 1 211 ? 77.006  -38.734 151.535 1.00 190.45 ? 211 GLU C OE2 1 
ATOM   10489 N N   . GLU C 1 212 ? 74.770  -39.563 147.705 1.00 145.09 ? 212 GLU C N   1 
ATOM   10490 C CA  . GLU C 1 212 ? 74.101  -40.610 146.941 1.00 144.45 ? 212 GLU C CA  1 
ATOM   10491 C C   . GLU C 1 212 ? 72.735  -40.940 147.524 1.00 141.37 ? 212 GLU C C   1 
ATOM   10492 O O   . GLU C 1 212 ? 72.586  -41.074 148.736 1.00 144.55 ? 212 GLU C O   1 
ATOM   10493 C CB  . GLU C 1 212 ? 74.954  -41.878 146.900 1.00 148.16 ? 212 GLU C CB  1 
ATOM   10494 C CG  . GLU C 1 212 ? 76.183  -41.787 146.021 1.00 155.69 ? 212 GLU C CG  1 
ATOM   10495 C CD  . GLU C 1 212 ? 76.915  -43.107 145.934 1.00 158.62 ? 212 GLU C CD  1 
ATOM   10496 O OE1 . GLU C 1 212 ? 77.025  -43.790 146.974 1.00 163.51 ? 212 GLU C OE1 1 
ATOM   10497 O OE2 . GLU C 1 212 ? 77.378  -43.466 144.831 1.00 156.05 ? 212 GLU C OE2 1 
ATOM   10498 N N   . SER C 1 213 ? 71.735  -41.061 146.658 1.00 133.71 ? 213 SER C N   1 
ATOM   10499 C CA  . SER C 1 213 ? 70.397  -41.438 147.095 1.00 121.05 ? 213 SER C CA  1 
ATOM   10500 C C   . SER C 1 213 ? 70.234  -42.947 147.018 1.00 114.45 ? 213 SER C C   1 
ATOM   10501 O O   . SER C 1 213 ? 70.674  -43.578 146.061 1.00 119.57 ? 213 SER C O   1 
ATOM   10502 C CB  . SER C 1 213 ? 69.325  -40.752 146.245 1.00 117.59 ? 213 SER C CB  1 
ATOM   10503 O OG  . SER C 1 213 ? 69.486  -39.345 146.254 1.00 122.07 ? 213 SER C OG  1 
ATOM   10504 N N   . THR C 1 214 ? 69.587  -43.528 148.021 1.00 107.41 ? 214 THR C N   1 
ATOM   10505 C CA  . THR C 1 214 ? 69.335  -44.964 148.005 1.00 108.66 ? 214 THR C CA  1 
ATOM   10506 C C   . THR C 1 214 ? 67.982  -45.242 147.372 1.00 103.28 ? 214 THR C C   1 
ATOM   10507 O O   . THR C 1 214 ? 66.941  -44.915 147.941 1.00 99.13  ? 214 THR C O   1 
ATOM   10508 C CB  . THR C 1 214 ? 69.364  -45.576 149.409 1.00 116.02 ? 214 THR C CB  1 
ATOM   10509 O OG1 . THR C 1 214 ? 70.633  -45.321 150.024 1.00 123.96 ? 214 THR C OG1 1 
ATOM   10510 C CG2 . THR C 1 214 ? 69.146  -47.078 149.324 1.00 105.79 ? 214 THR C CG2 1 
ATOM   10511 N N   . LEU C 1 215 ? 68.010  -45.871 146.203 1.00 103.02 ? 215 LEU C N   1 
ATOM   10512 C CA  . LEU C 1 215 ? 66.802  -46.147 145.440 1.00 93.62  ? 215 LEU C CA  1 
ATOM   10513 C C   . LEU C 1 215 ? 66.320  -47.588 145.573 1.00 90.14  ? 215 LEU C C   1 
ATOM   10514 O O   . LEU C 1 215 ? 67.114  -48.527 145.604 1.00 100.95 ? 215 LEU C O   1 
ATOM   10515 C CB  . LEU C 1 215 ? 67.029  -45.829 143.961 1.00 92.58  ? 215 LEU C CB  1 
ATOM   10516 C CG  . LEU C 1 215 ? 67.516  -44.428 143.592 1.00 96.93  ? 215 LEU C CG  1 
ATOM   10517 C CD1 . LEU C 1 215 ? 67.584  -44.274 142.084 1.00 97.44  ? 215 LEU C CD1 1 
ATOM   10518 C CD2 . LEU C 1 215 ? 66.609  -43.366 144.187 1.00 98.36  ? 215 LEU C CD2 1 
ATOM   10519 N N   . PHE C 1 216 ? 65.004  -47.746 145.651 1.00 89.79  ? 216 PHE C N   1 
ATOM   10520 C CA  . PHE C 1 216 ? 64.381  -49.060 145.671 1.00 93.82  ? 216 PHE C CA  1 
ATOM   10521 C C   . PHE C 1 216 ? 63.626  -49.249 144.362 1.00 95.29  ? 216 PHE C C   1 
ATOM   10522 O O   . PHE C 1 216 ? 62.676  -48.521 144.074 1.00 90.04  ? 216 PHE C O   1 
ATOM   10523 C CB  . PHE C 1 216 ? 63.442  -49.199 146.870 1.00 87.90  ? 216 PHE C CB  1 
ATOM   10524 C CG  . PHE C 1 216 ? 62.621  -50.464 146.865 1.00 81.24  ? 216 PHE C CG  1 
ATOM   10525 C CD1 . PHE C 1 216 ? 63.221  -51.704 146.728 1.00 83.90  ? 216 PHE C CD1 1 
ATOM   10526 C CD2 . PHE C 1 216 ? 61.242  -50.405 147.002 1.00 80.62  ? 216 PHE C CD2 1 
ATOM   10527 C CE1 . PHE C 1 216 ? 62.461  -52.862 146.724 1.00 79.67  ? 216 PHE C CE1 1 
ATOM   10528 C CE2 . PHE C 1 216 ? 60.476  -51.556 147.001 1.00 80.67  ? 216 PHE C CE2 1 
ATOM   10529 C CZ  . PHE C 1 216 ? 61.085  -52.787 146.860 1.00 78.63  ? 216 PHE C CZ  1 
ATOM   10530 N N   . CYS C 1 217 ? 64.062  -50.215 143.562 1.00 98.44  ? 217 CYS C N   1 
ATOM   10531 C CA  . CYS C 1 217 ? 63.426  -50.461 142.276 1.00 93.68  ? 217 CYS C CA  1 
ATOM   10532 C C   . CYS C 1 217 ? 62.777  -51.830 142.230 1.00 92.44  ? 217 CYS C C   1 
ATOM   10533 O O   . CYS C 1 217 ? 63.429  -52.838 142.496 1.00 105.70 ? 217 CYS C O   1 
ATOM   10534 C CB  . CYS C 1 217 ? 64.445  -50.342 141.144 1.00 88.33  ? 217 CYS C CB  1 
ATOM   10535 S SG  . CYS C 1 217 ? 65.321  -48.770 141.110 1.00 211.13 ? 217 CYS C SG  1 
ATOM   10536 N N   . PHE C 1 218 ? 61.500  -51.875 141.872 1.00 79.59  ? 218 PHE C N   1 
ATOM   10537 C CA  . PHE C 1 218 ? 60.835  -53.162 141.743 1.00 77.81  ? 218 PHE C CA  1 
ATOM   10538 C C   . PHE C 1 218 ? 59.912  -53.201 140.534 1.00 80.38  ? 218 PHE C C   1 
ATOM   10539 O O   . PHE C 1 218 ? 59.332  -52.193 140.132 1.00 102.62 ? 218 PHE C O   1 
ATOM   10540 C CB  . PHE C 1 218 ? 60.078  -53.514 143.033 1.00 78.64  ? 218 PHE C CB  1 
ATOM   10541 C CG  . PHE C 1 218 ? 58.803  -52.745 143.243 1.00 82.50  ? 218 PHE C CG  1 
ATOM   10542 C CD1 . PHE C 1 218 ? 58.814  -51.523 143.892 1.00 87.95  ? 218 PHE C CD1 1 
ATOM   10543 C CD2 . PHE C 1 218 ? 57.588  -53.270 142.837 1.00 78.66  ? 218 PHE C CD2 1 
ATOM   10544 C CE1 . PHE C 1 218 ? 57.641  -50.826 144.108 1.00 87.18  ? 218 PHE C CE1 1 
ATOM   10545 C CE2 . PHE C 1 218 ? 56.412  -52.578 143.044 1.00 81.28  ? 218 PHE C CE2 1 
ATOM   10546 C CZ  . PHE C 1 218 ? 56.437  -51.352 143.681 1.00 86.65  ? 218 PHE C CZ  1 
ATOM   10547 N N   . ALA C 1 219 ? 59.802  -54.386 139.953 1.00 77.48  ? 219 ALA C N   1 
ATOM   10548 C CA  . ALA C 1 219 ? 58.960  -54.600 138.792 1.00 77.71  ? 219 ALA C CA  1 
ATOM   10549 C C   . ALA C 1 219 ? 57.888  -55.608 139.144 1.00 84.10  ? 219 ALA C C   1 
ATOM   10550 O O   . ALA C 1 219 ? 58.099  -56.494 139.974 1.00 84.55  ? 219 ALA C O   1 
ATOM   10551 C CB  . ALA C 1 219 ? 59.780  -55.078 137.610 1.00 88.13  ? 219 ALA C CB  1 
ATOM   10552 N N   . VAL C 1 220 ? 56.728  -55.462 138.520 1.00 87.74  ? 220 VAL C N   1 
ATOM   10553 C CA  . VAL C 1 220 ? 55.609  -56.328 138.833 1.00 83.27  ? 220 VAL C CA  1 
ATOM   10554 C C   . VAL C 1 220 ? 54.624  -56.388 137.677 1.00 84.24  ? 220 VAL C C   1 
ATOM   10555 O O   . VAL C 1 220 ? 54.512  -55.448 136.890 1.00 92.11  ? 220 VAL C O   1 
ATOM   10556 C CB  . VAL C 1 220 ? 54.885  -55.839 140.112 1.00 76.45  ? 220 VAL C CB  1 
ATOM   10557 C CG1 . VAL C 1 220 ? 54.267  -54.462 139.879 1.00 76.73  ? 220 VAL C CG1 1 
ATOM   10558 C CG2 . VAL C 1 220 ? 53.835  -56.840 140.572 1.00 76.27  ? 220 VAL C CG2 1 
ATOM   10559 N N   . ARG C 1 221 ? 53.929  -57.512 137.564 1.00 76.00  ? 221 ARG C N   1 
ATOM   10560 C CA  . ARG C 1 221 ? 52.789  -57.600 136.673 1.00 77.66  ? 221 ARG C CA  1 
ATOM   10561 C C   . ARG C 1 221 ? 51.579  -57.886 137.547 1.00 87.05  ? 221 ARG C C   1 
ATOM   10562 O O   . ARG C 1 221 ? 51.158  -59.030 137.708 1.00 95.30  ? 221 ARG C O   1 
ATOM   10563 C CB  . ARG C 1 221 ? 52.979  -58.676 135.603 1.00 79.34  ? 221 ARG C CB  1 
ATOM   10564 C CG  . ARG C 1 221 ? 52.205  -58.360 134.333 1.00 81.22  ? 221 ARG C CG  1 
ATOM   10565 C CD  . ARG C 1 221 ? 51.860  -59.595 133.513 1.00 81.65  ? 221 ARG C CD  1 
ATOM   10566 N NE  . ARG C 1 221 ? 51.146  -59.224 132.293 1.00 84.19  ? 221 ARG C NE  1 
ATOM   10567 C CZ  . ARG C 1 221 ? 51.136  -59.933 131.169 1.00 94.48  ? 221 ARG C CZ  1 
ATOM   10568 N NH1 . ARG C 1 221 ? 50.442  -59.503 130.124 1.00 104.46 ? 221 ARG C NH1 1 
ATOM   10569 N NH2 . ARG C 1 221 ? 51.831  -61.057 131.079 1.00 104.75 ? 221 ARG C NH2 1 
ATOM   10570 N N   . GLY C 1 222 ? 51.035  -56.818 138.120 1.00 82.78  ? 222 GLY C N   1 
ATOM   10571 C CA  . GLY C 1 222 ? 49.965  -56.908 139.091 1.00 91.40  ? 222 GLY C CA  1 
ATOM   10572 C C   . GLY C 1 222 ? 48.645  -56.301 138.666 1.00 98.01  ? 222 GLY C C   1 
ATOM   10573 O O   . GLY C 1 222 ? 48.191  -56.471 137.536 1.00 82.99  ? 222 GLY C O   1 
ATOM   10574 N N   . GLN C 1 223 ? 48.032  -55.596 139.610 1.00 105.60 ? 223 GLN C N   1 
ATOM   10575 C CA  . GLN C 1 223 ? 46.709  -55.005 139.461 1.00 96.45  ? 223 GLN C CA  1 
ATOM   10576 C C   . GLN C 1 223 ? 46.647  -53.925 138.387 1.00 84.45  ? 223 GLN C C   1 
ATOM   10577 O O   . GLN C 1 223 ? 45.643  -53.789 137.690 1.00 84.93  ? 223 GLN C O   1 
ATOM   10578 C CB  . GLN C 1 223 ? 46.275  -54.417 140.798 1.00 99.69  ? 223 GLN C CB  1 
ATOM   10579 C CG  . GLN C 1 223 ? 46.300  -55.431 141.930 1.00 117.33 ? 223 GLN C CG  1 
ATOM   10580 C CD  . GLN C 1 223 ? 45.012  -56.219 142.058 1.00 148.20 ? 223 GLN C CD  1 
ATOM   10581 O OE1 . GLN C 1 223 ? 44.575  -56.883 141.116 1.00 157.52 ? 223 GLN C OE1 1 
ATOM   10582 N NE2 . GLN C 1 223 ? 44.405  -56.162 143.237 1.00 156.04 ? 223 GLN C NE2 1 
ATOM   10583 N N   . ALA C 1 224 ? 47.719  -53.154 138.261 1.00 84.67  ? 224 ALA C N   1 
ATOM   10584 C CA  . ALA C 1 224 ? 47.783  -52.120 137.242 1.00 94.63  ? 224 ALA C CA  1 
ATOM   10585 C C   . ALA C 1 224 ? 48.715  -52.555 136.121 1.00 97.99  ? 224 ALA C C   1 
ATOM   10586 O O   . ALA C 1 224 ? 49.496  -51.760 135.600 1.00 109.12 ? 224 ALA C O   1 
ATOM   10587 C CB  . ALA C 1 224 ? 48.246  -50.803 137.844 1.00 104.50 ? 224 ALA C CB  1 
ATOM   10588 N N   . GLY C 1 225 ? 48.607  -53.825 135.746 1.00 91.74  ? 225 GLY C N   1 
ATOM   10589 C CA  . GLY C 1 225 ? 49.432  -54.411 134.705 1.00 81.23  ? 225 GLY C CA  1 
ATOM   10590 C C   . GLY C 1 225 ? 50.918  -54.414 135.014 1.00 84.46  ? 225 GLY C C   1 
ATOM   10591 O O   . GLY C 1 225 ? 51.326  -54.358 136.176 1.00 87.84  ? 225 GLY C O   1 
ATOM   10592 N N   . GLY C 1 226 ? 51.729  -54.479 133.963 1.00 85.32  ? 226 GLY C N   1 
ATOM   10593 C CA  . GLY C 1 226 ? 53.175  -54.461 134.093 1.00 79.52  ? 226 GLY C CA  1 
ATOM   10594 C C   . GLY C 1 226 ? 53.716  -53.083 134.422 1.00 81.75  ? 226 GLY C C   1 
ATOM   10595 O O   . GLY C 1 226 ? 53.534  -52.138 133.656 1.00 91.19  ? 226 GLY C O   1 
ATOM   10596 N N   . LYS C 1 227 ? 54.380  -52.965 135.566 1.00 77.82  ? 227 LYS C N   1 
ATOM   10597 C CA  . LYS C 1 227 ? 54.911  -51.677 136.001 1.00 78.30  ? 227 LYS C CA  1 
ATOM   10598 C C   . LYS C 1 227 ? 56.318  -51.764 136.582 1.00 77.52  ? 227 LYS C C   1 
ATOM   10599 O O   . LYS C 1 227 ? 56.692  -52.764 137.194 1.00 75.95  ? 227 LYS C O   1 
ATOM   10600 C CB  . LYS C 1 227 ? 53.986  -51.041 137.043 1.00 76.42  ? 227 LYS C CB  1 
ATOM   10601 C CG  . LYS C 1 227 ? 52.666  -50.499 136.510 1.00 85.27  ? 227 LYS C CG  1 
ATOM   10602 C CD  . LYS C 1 227 ? 52.855  -49.132 135.869 1.00 96.33  ? 227 LYS C CD  1 
ATOM   10603 C CE  . LYS C 1 227 ? 51.537  -48.576 135.338 1.00 101.60 ? 227 LYS C CE  1 
ATOM   10604 N NZ  . LYS C 1 227 ? 51.012  -49.328 134.163 1.00 103.44 ? 227 LYS C NZ  1 
ATOM   10605 N N   . LEU C 1 228 ? 57.095  -50.707 136.372 1.00 81.46  ? 228 LEU C N   1 
ATOM   10606 C CA  . LEU C 1 228 ? 58.413  -50.581 136.984 1.00 85.72  ? 228 LEU C CA  1 
ATOM   10607 C C   . LEU C 1 228 ? 58.458  -49.342 137.865 1.00 85.71  ? 228 LEU C C   1 
ATOM   10608 O O   . LEU C 1 228 ? 58.181  -48.232 137.411 1.00 85.20  ? 228 LEU C O   1 
ATOM   10609 C CB  . LEU C 1 228 ? 59.517  -50.513 135.932 1.00 89.21  ? 228 LEU C CB  1 
ATOM   10610 C CG  . LEU C 1 228 ? 60.911  -50.347 136.543 1.00 89.04  ? 228 LEU C CG  1 
ATOM   10611 C CD1 . LEU C 1 228 ? 61.531  -51.679 136.966 1.00 103.32 ? 228 LEU C CD1 1 
ATOM   10612 C CD2 . LEU C 1 228 ? 61.813  -49.605 135.574 1.00 81.36  ? 228 LEU C CD2 1 
ATOM   10613 N N   . HIS C 1 229 ? 58.799  -49.538 139.130 1.00 86.25  ? 229 HIS C N   1 
ATOM   10614 C CA  . HIS C 1 229 ? 58.830  -48.440 140.081 1.00 81.59  ? 229 HIS C CA  1 
ATOM   10615 C C   . HIS C 1 229 ? 60.234  -48.129 140.564 1.00 87.99  ? 229 HIS C C   1 
ATOM   10616 O O   . HIS C 1 229 ? 60.986  -49.026 140.928 1.00 82.66  ? 229 HIS C O   1 
ATOM   10617 C CB  . HIS C 1 229 ? 57.942  -48.757 141.288 1.00 79.32  ? 229 HIS C CB  1 
ATOM   10618 C CG  . HIS C 1 229 ? 56.492  -48.943 140.946 1.00 80.37  ? 229 HIS C CG  1 
ATOM   10619 N ND1 . HIS C 1 229 ? 55.948  -50.167 140.647 1.00 80.28  ? 229 HIS C ND1 1 
ATOM   10620 C CD2 . HIS C 1 229 ? 55.477  -48.047 140.863 1.00 82.87  ? 229 HIS C CD2 1 
ATOM   10621 C CE1 . HIS C 1 229 ? 54.655  -50.029 140.388 1.00 87.39  ? 229 HIS C CE1 1 
ATOM   10622 N NE2 . HIS C 1 229 ? 54.350  -48.749 140.514 1.00 92.99  ? 229 HIS C NE2 1 
ATOM   10623 N N   . ILE C 1 230 ? 60.582  -46.848 140.538 1.00 92.67  ? 230 ILE C N   1 
ATOM   10624 C CA  . ILE C 1 230 ? 61.868  -46.384 141.044 1.00 91.29  ? 230 ILE C CA  1 
ATOM   10625 C C   . ILE C 1 230 ? 61.615  -45.298 142.082 1.00 92.67  ? 230 ILE C C   1 
ATOM   10626 O O   . ILE C 1 230 ? 61.313  -44.155 141.748 1.00 114.97 ? 230 ILE C O   1 
ATOM   10627 C CB  . ILE C 1 230 ? 62.770  -45.849 139.917 1.00 87.60  ? 230 ILE C CB  1 
ATOM   10628 C CG1 . ILE C 1 230 ? 62.953  -46.917 138.840 1.00 87.12  ? 230 ILE C CG1 1 
ATOM   10629 C CG2 . ILE C 1 230 ? 64.121  -45.433 140.460 1.00 88.97  ? 230 ILE C CG2 1 
ATOM   10630 C CD1 . ILE C 1 230 ? 63.190  -46.357 137.451 1.00 91.71  ? 230 ILE C CD1 1 
ATOM   10631 N N   . ILE C 1 231 ? 61.755  -45.661 143.350 1.00 87.17  ? 231 ILE C N   1 
ATOM   10632 C CA  . ILE C 1 231 ? 61.439  -44.754 144.449 1.00 88.67  ? 231 ILE C CA  1 
ATOM   10633 C C   . ILE C 1 231 ? 62.607  -44.651 145.424 1.00 103.15 ? 231 ILE C C   1 
ATOM   10634 O O   . ILE C 1 231 ? 63.388  -45.592 145.564 1.00 116.97 ? 231 ILE C O   1 
ATOM   10635 C CB  . ILE C 1 231 ? 60.173  -45.210 145.207 1.00 98.34  ? 231 ILE C CB  1 
ATOM   10636 C CG1 . ILE C 1 231 ? 60.427  -46.532 145.931 1.00 103.20 ? 231 ILE C CG1 1 
ATOM   10637 C CG2 . ILE C 1 231 ? 58.996  -45.361 144.248 1.00 113.36 ? 231 ILE C CG2 1 
ATOM   10638 C CD1 . ILE C 1 231 ? 60.351  -46.422 147.440 1.00 119.65 ? 231 ILE C CD1 1 
ATOM   10639 N N   . GLU C 1 232 ? 62.736  -43.507 146.088 1.00 105.04 ? 232 GLU C N   1 
ATOM   10640 C CA  . GLU C 1 232 ? 63.792  -43.333 147.077 1.00 107.84 ? 232 GLU C CA  1 
ATOM   10641 C C   . GLU C 1 232 ? 63.290  -43.799 148.441 1.00 101.33 ? 232 GLU C C   1 
ATOM   10642 O O   . GLU C 1 232 ? 62.209  -43.401 148.878 1.00 95.53  ? 232 GLU C O   1 
ATOM   10643 C CB  . GLU C 1 232 ? 64.234  -41.869 147.143 1.00 111.91 ? 232 GLU C CB  1 
ATOM   10644 C CG  . GLU C 1 232 ? 65.404  -41.585 148.068 1.00 110.78 ? 232 GLU C CG  1 
ATOM   10645 C CD  . GLU C 1 232 ? 65.654  -40.098 148.232 1.00 119.26 ? 232 GLU C CD  1 
ATOM   10646 O OE1 . GLU C 1 232 ? 64.674  -39.359 148.467 1.00 140.67 ? 232 GLU C OE1 1 
ATOM   10647 O OE2 . GLU C 1 232 ? 66.816  -39.664 148.080 1.00 114.79 ? 232 GLU C OE2 1 
ATOM   10648 N N   . VAL C 1 233 ? 64.071  -44.636 149.117 1.00 103.01 ? 233 VAL C N   1 
ATOM   10649 C CA  . VAL C 1 233 ? 63.661  -45.124 150.427 1.00 94.50  ? 233 VAL C CA  1 
ATOM   10650 C C   . VAL C 1 233 ? 64.280  -44.309 151.556 1.00 100.93 ? 233 VAL C C   1 
ATOM   10651 O O   . VAL C 1 233 ? 65.497  -44.139 151.641 1.00 104.11 ? 233 VAL C O   1 
ATOM   10652 C CB  . VAL C 1 233 ? 64.001  -46.620 150.621 1.00 94.42  ? 233 VAL C CB  1 
ATOM   10653 C CG1 . VAL C 1 233 ? 62.961  -47.489 149.944 1.00 92.24  ? 233 VAL C CG1 1 
ATOM   10654 C CG2 . VAL C 1 233 ? 65.401  -46.932 150.126 1.00 94.46  ? 233 VAL C CG2 1 
ATOM   10655 N N   . GLY C 1 234 ? 63.405  -43.822 152.429 1.00 101.85 ? 234 GLY C N   1 
ATOM   10656 C CA  . GLY C 1 234 ? 63.780  -43.033 153.586 1.00 114.09 ? 234 GLY C CA  1 
ATOM   10657 C C   . GLY C 1 234 ? 64.099  -41.571 153.338 1.00 124.78 ? 234 GLY C C   1 
ATOM   10658 O O   . GLY C 1 234 ? 64.023  -41.073 152.215 1.00 121.68 ? 234 GLY C O   1 
ATOM   10659 N N   . THR C 1 235 ? 64.447  -40.888 154.424 1.00 131.92 ? 235 THR C N   1 
ATOM   10660 C CA  . THR C 1 235 ? 64.746  -39.459 154.420 1.00 130.99 ? 235 THR C CA  1 
ATOM   10661 C C   . THR C 1 235 ? 65.991  -39.120 153.609 1.00 130.29 ? 235 THR C C   1 
ATOM   10662 O O   . THR C 1 235 ? 67.048  -39.715 153.813 1.00 132.36 ? 235 THR C O   1 
ATOM   10663 C CB  . THR C 1 235 ? 64.933  -38.929 155.856 1.00 130.29 ? 235 THR C CB  1 
ATOM   10664 O OG1 . THR C 1 235 ? 63.876  -39.415 156.691 1.00 142.27 ? 235 THR C OG1 1 
ATOM   10665 C CG2 . THR C 1 235 ? 64.943  -37.401 155.879 1.00 128.41 ? 235 THR C CG2 1 
ATOM   10666 N N   . PRO C 1 236 ? 65.873  -38.146 152.691 1.00 127.56 ? 236 PRO C N   1 
ATOM   10667 C CA  . PRO C 1 236 ? 67.041  -37.743 151.903 1.00 130.96 ? 236 PRO C CA  1 
ATOM   10668 C C   . PRO C 1 236 ? 68.091  -37.066 152.771 1.00 135.73 ? 236 PRO C C   1 
ATOM   10669 O O   . PRO C 1 236 ? 67.731  -36.398 153.743 1.00 136.29 ? 236 PRO C O   1 
ATOM   10670 C CB  . PRO C 1 236 ? 66.466  -36.755 150.879 1.00 127.16 ? 236 PRO C CB  1 
ATOM   10671 C CG  . PRO C 1 236 ? 64.973  -36.827 151.018 1.00 126.61 ? 236 PRO C CG  1 
ATOM   10672 C CD  . PRO C 1 236 ? 64.688  -37.327 152.387 1.00 125.53 ? 236 PRO C CD  1 
ATOM   10673 N N   . PRO C 1 237 ? 69.375  -37.239 152.427 1.00 137.68 ? 237 PRO C N   1 
ATOM   10674 C CA  . PRO C 1 237 ? 70.452  -36.612 153.199 1.00 144.94 ? 237 PRO C CA  1 
ATOM   10675 C C   . PRO C 1 237 ? 70.351  -35.093 153.223 1.00 153.48 ? 237 PRO C C   1 
ATOM   10676 O O   . PRO C 1 237 ? 69.678  -34.495 152.384 1.00 157.53 ? 237 PRO C O   1 
ATOM   10677 C CB  . PRO C 1 237 ? 71.719  -37.058 152.461 1.00 144.73 ? 237 PRO C CB  1 
ATOM   10678 C CG  . PRO C 1 237 ? 71.312  -38.269 151.689 1.00 139.25 ? 237 PRO C CG  1 
ATOM   10679 C CD  . PRO C 1 237 ? 69.892  -38.021 151.293 1.00 135.63 ? 237 PRO C CD  1 
ATOM   10680 N N   . THR C 1 238 ? 71.021  -34.483 154.194 1.00 153.25 ? 238 THR C N   1 
ATOM   10681 C CA  . THR C 1 238 ? 71.030  -33.034 154.334 1.00 153.96 ? 238 THR C CA  1 
ATOM   10682 C C   . THR C 1 238 ? 71.670  -32.369 153.128 1.00 151.66 ? 238 THR C C   1 
ATOM   10683 O O   . THR C 1 238 ? 72.803  -32.679 152.763 1.00 151.64 ? 238 THR C O   1 
ATOM   10684 C CB  . THR C 1 238 ? 71.774  -32.589 155.593 1.00 160.81 ? 238 THR C CB  1 
ATOM   10685 O OG1 . THR C 1 238 ? 71.364  -33.400 156.701 1.00 164.61 ? 238 THR C OG1 1 
ATOM   10686 C CG2 . THR C 1 238 ? 71.460  -31.132 155.892 1.00 162.09 ? 238 THR C CG2 1 
ATOM   10687 N N   . GLY C 1 239 ? 70.941  -31.435 152.534 1.00 155.45 ? 239 GLY C N   1 
ATOM   10688 C CA  . GLY C 1 239 ? 71.398  -30.729 151.356 1.00 162.08 ? 239 GLY C CA  1 
ATOM   10689 C C   . GLY C 1 239 ? 71.187  -31.531 150.090 1.00 165.06 ? 239 GLY C C   1 
ATOM   10690 O O   . GLY C 1 239 ? 71.856  -31.308 149.080 1.00 166.88 ? 239 GLY C O   1 
ATOM   10691 N N   . ASN C 1 240 ? 70.250  -32.473 150.141 1.00 163.75 ? 240 ASN C N   1 
ATOM   10692 C CA  . ASN C 1 240 ? 69.915  -33.266 148.963 1.00 157.01 ? 240 ASN C CA  1 
ATOM   10693 C C   . ASN C 1 240 ? 68.482  -33.018 148.509 1.00 151.69 ? 240 ASN C C   1 
ATOM   10694 O O   . ASN C 1 240 ? 67.577  -32.933 149.337 1.00 142.61 ? 240 ASN C O   1 
ATOM   10695 C CB  . ASN C 1 240 ? 70.105  -34.762 149.254 1.00 153.85 ? 240 ASN C CB  1 
ATOM   10696 C CG  . ASN C 1 240 ? 71.499  -35.256 148.937 1.00 156.67 ? 240 ASN C CG  1 
ATOM   10697 O OD1 . ASN C 1 240 ? 72.495  -34.615 149.268 1.00 164.15 ? 240 ASN C OD1 1 
ATOM   10698 N ND2 . ASN C 1 240 ? 71.574  -36.417 148.298 1.00 149.47 ? 240 ASN C ND2 1 
ATOM   10699 N N   . GLN C 1 241 ? 68.281  -32.904 147.199 1.00 155.25 ? 241 GLN C N   1 
ATOM   10700 C CA  . GLN C 1 241 ? 66.942  -32.770 146.645 1.00 148.43 ? 241 GLN C CA  1 
ATOM   10701 C C   . GLN C 1 241 ? 66.346  -34.168 146.670 1.00 135.42 ? 241 GLN C C   1 
ATOM   10702 O O   . GLN C 1 241 ? 67.087  -35.144 146.562 1.00 133.30 ? 241 GLN C O   1 
ATOM   10703 C CB  . GLN C 1 241 ? 66.961  -32.209 145.218 1.00 154.88 ? 241 GLN C CB  1 
ATOM   10704 C CG  . GLN C 1 241 ? 67.105  -30.695 145.107 1.00 161.38 ? 241 GLN C CG  1 
ATOM   10705 C CD  . GLN C 1 241 ? 66.100  -29.914 145.941 1.00 164.98 ? 241 GLN C CD  1 
ATOM   10706 O OE1 . GLN C 1 241 ? 64.905  -30.199 145.928 1.00 168.64 ? 241 GLN C OE1 1 
ATOM   10707 N NE2 . GLN C 1 241 ? 66.587  -28.903 146.655 1.00 167.44 ? 241 GLN C NE2 1 
ATOM   10708 N N   . PRO C 1 242 ? 65.016  -34.290 146.797 1.00 132.85 ? 242 PRO C N   1 
ATOM   10709 C CA  . PRO C 1 242 ? 64.572  -35.686 146.802 1.00 136.05 ? 242 PRO C CA  1 
ATOM   10710 C C   . PRO C 1 242 ? 64.389  -36.259 145.397 1.00 125.46 ? 242 PRO C C   1 
ATOM   10711 O O   . PRO C 1 242 ? 64.131  -35.519 144.447 1.00 125.58 ? 242 PRO C O   1 
ATOM   10712 C CB  . PRO C 1 242 ? 63.239  -35.618 147.544 1.00 137.33 ? 242 PRO C CB  1 
ATOM   10713 C CG  . PRO C 1 242 ? 62.712  -34.252 147.223 1.00 134.88 ? 242 PRO C CG  1 
ATOM   10714 C CD  . PRO C 1 242 ? 63.904  -33.343 146.996 1.00 133.26 ? 242 PRO C CD  1 
ATOM   10715 N N   . PHE C 1 243 ? 64.489  -37.580 145.285 1.00 120.75 ? 243 PHE C N   1 
ATOM   10716 C CA  . PHE C 1 243 ? 64.314  -38.273 144.010 1.00 122.94 ? 243 PHE C CA  1 
ATOM   10717 C C   . PHE C 1 243 ? 62.834  -38.375 143.660 1.00 124.70 ? 243 PHE C C   1 
ATOM   10718 O O   . PHE C 1 243 ? 62.063  -38.976 144.410 1.00 114.96 ? 243 PHE C O   1 
ATOM   10719 C CB  . PHE C 1 243 ? 64.952  -39.666 144.060 1.00 123.98 ? 243 PHE C CB  1 
ATOM   10720 C CG  . PHE C 1 243 ? 64.936  -40.397 142.738 1.00 116.80 ? 243 PHE C CG  1 
ATOM   10721 C CD1 . PHE C 1 243 ? 65.981  -40.251 141.840 1.00 116.08 ? 243 PHE C CD1 1 
ATOM   10722 C CD2 . PHE C 1 243 ? 63.882  -41.231 142.396 1.00 117.02 ? 243 PHE C CD2 1 
ATOM   10723 C CE1 . PHE C 1 243 ? 65.976  -40.919 140.626 1.00 116.04 ? 243 PHE C CE1 1 
ATOM   10724 C CE2 . PHE C 1 243 ? 63.870  -41.902 141.184 1.00 121.02 ? 243 PHE C CE2 1 
ATOM   10725 C CZ  . PHE C 1 243 ? 64.919  -41.746 140.298 1.00 122.31 ? 243 PHE C CZ  1 
ATOM   10726 N N   . PRO C 1 244 ? 62.432  -37.804 142.513 1.00 122.53 ? 244 PRO C N   1 
ATOM   10727 C CA  . PRO C 1 244 ? 61.025  -37.896 142.110 1.00 125.86 ? 244 PRO C CA  1 
ATOM   10728 C C   . PRO C 1 244 ? 60.653  -39.329 141.742 1.00 121.49 ? 244 PRO C C   1 
ATOM   10729 O O   . PRO C 1 244 ? 61.245  -39.904 140.826 1.00 113.82 ? 244 PRO C O   1 
ATOM   10730 C CB  . PRO C 1 244 ? 60.938  -36.967 140.895 1.00 124.99 ? 244 PRO C CB  1 
ATOM   10731 C CG  . PRO C 1 244 ? 62.327  -36.905 140.358 1.00 117.08 ? 244 PRO C CG  1 
ATOM   10732 C CD  . PRO C 1 244 ? 63.264  -37.113 141.513 1.00 113.23 ? 244 PRO C CD  1 
ATOM   10733 N N   . LYS C 1 245 ? 59.698  -39.891 142.480 1.00 116.24 ? 245 LYS C N   1 
ATOM   10734 C CA  . LYS C 1 245 ? 59.222  -41.252 142.258 1.00 105.39 ? 245 LYS C CA  1 
ATOM   10735 C C   . LYS C 1 245 ? 58.900  -41.511 140.797 1.00 104.52 ? 245 LYS C C   1 
ATOM   10736 O O   . LYS C 1 245 ? 58.273  -40.683 140.135 1.00 113.94 ? 245 LYS C O   1 
ATOM   10737 C CB  . LYS C 1 245 ? 57.988  -41.535 143.112 1.00 114.49 ? 245 LYS C CB  1 
ATOM   10738 C CG  . LYS C 1 245 ? 58.280  -41.703 144.588 1.00 134.98 ? 245 LYS C CG  1 
ATOM   10739 C CD  . LYS C 1 245 ? 56.992  -41.924 145.359 1.00 138.47 ? 245 LYS C CD  1 
ATOM   10740 C CE  . LYS C 1 245 ? 57.149  -41.603 146.834 1.00 136.59 ? 245 LYS C CE  1 
ATOM   10741 N NZ  . LYS C 1 245 ? 57.521  -42.796 147.642 1.00 138.29 ? 245 LYS C NZ  1 
ATOM   10742 N N   . LYS C 1 246 ? 59.330  -42.665 140.300 1.00 99.21  ? 246 LYS C N   1 
ATOM   10743 C CA  . LYS C 1 246 ? 59.054  -43.049 138.925 1.00 95.14  ? 246 LYS C CA  1 
ATOM   10744 C C   . LYS C 1 246 ? 58.154  -44.272 138.856 1.00 103.58 ? 246 LYS C C   1 
ATOM   10745 O O   . LYS C 1 246 ? 58.238  -45.175 139.690 1.00 119.11 ? 246 LYS C O   1 
ATOM   10746 C CB  . LYS C 1 246 ? 60.352  -43.334 138.165 1.00 95.92  ? 246 LYS C CB  1 
ATOM   10747 C CG  . LYS C 1 246 ? 61.370  -42.209 138.161 1.00 101.03 ? 246 LYS C CG  1 
ATOM   10748 C CD  . LYS C 1 246 ? 60.823  -40.972 137.468 1.00 107.14 ? 246 LYS C CD  1 
ATOM   10749 C CE  . LYS C 1 246 ? 61.945  -40.007 137.117 1.00 116.35 ? 246 LYS C CE  1 
ATOM   10750 N NZ  . LYS C 1 246 ? 62.777  -39.654 138.296 1.00 116.18 ? 246 LYS C NZ  1 
ATOM   10751 N N   . ALA C 1 247 ? 57.290  -44.286 137.850 1.00 94.76  ? 247 ALA C N   1 
ATOM   10752 C CA  . ALA C 1 247 ? 56.421  -45.420 137.598 1.00 93.71  ? 247 ALA C CA  1 
ATOM   10753 C C   . ALA C 1 247 ? 56.194  -45.526 136.100 1.00 107.29 ? 247 ALA C C   1 
ATOM   10754 O O   . ALA C 1 247 ? 55.507  -44.700 135.501 1.00 127.84 ? 247 ALA C O   1 
ATOM   10755 C CB  . ALA C 1 247 ? 55.107  -45.275 138.340 1.00 93.99  ? 247 ALA C CB  1 
ATOM   10756 N N   . VAL C 1 248 ? 56.774  -46.558 135.501 1.00 98.08  ? 248 VAL C N   1 
ATOM   10757 C CA  . VAL C 1 248 ? 56.699  -46.747 134.060 1.00 95.09  ? 248 VAL C CA  1 
ATOM   10758 C C   . VAL C 1 248 ? 56.128  -48.109 133.717 1.00 97.87  ? 248 VAL C C   1 
ATOM   10759 O O   . VAL C 1 248 ? 56.137  -49.026 134.535 1.00 99.02  ? 248 VAL C O   1 
ATOM   10760 C CB  . VAL C 1 248 ? 58.077  -46.597 133.402 1.00 96.84  ? 248 VAL C CB  1 
ATOM   10761 C CG1 . VAL C 1 248 ? 58.626  -45.205 133.660 1.00 97.78  ? 248 VAL C CG1 1 
ATOM   10762 C CG2 . VAL C 1 248 ? 59.027  -47.651 133.934 1.00 95.31  ? 248 VAL C CG2 1 
ATOM   10763 N N   . ASP C 1 249 ? 55.643  -48.241 132.491 1.00 95.58  ? 249 ASP C N   1 
ATOM   10764 C CA  . ASP C 1 249 ? 55.067  -49.496 132.045 1.00 95.36  ? 249 ASP C CA  1 
ATOM   10765 C C   . ASP C 1 249 ? 56.141  -50.510 131.702 1.00 97.19  ? 249 ASP C C   1 
ATOM   10766 O O   . ASP C 1 249 ? 57.218  -50.159 131.222 1.00 111.18 ? 249 ASP C O   1 
ATOM   10767 C CB  . ASP C 1 249 ? 54.180  -49.271 130.818 1.00 111.49 ? 249 ASP C CB  1 
ATOM   10768 C CG  . ASP C 1 249 ? 52.815  -48.730 131.178 1.00 129.58 ? 249 ASP C CG  1 
ATOM   10769 O OD1 . ASP C 1 249 ? 52.729  -47.878 132.089 1.00 128.31 ? 249 ASP C OD1 1 
ATOM   10770 O OD2 . ASP C 1 249 ? 51.824  -49.162 130.554 1.00 132.24 ? 249 ASP C OD2 1 
ATOM   10771 N N   . VAL C 1 250 ? 55.829  -51.774 131.956 1.00 95.02  ? 250 VAL C N   1 
ATOM   10772 C CA  . VAL C 1 250 ? 56.682  -52.881 131.552 1.00 96.77  ? 250 VAL C CA  1 
ATOM   10773 C C   . VAL C 1 250 ? 55.927  -53.639 130.479 1.00 107.66 ? 250 VAL C C   1 
ATOM   10774 O O   . VAL C 1 250 ? 54.840  -54.155 130.734 1.00 100.25 ? 250 VAL C O   1 
ATOM   10775 C CB  . VAL C 1 250 ? 57.021  -53.820 132.711 1.00 95.63  ? 250 VAL C CB  1 
ATOM   10776 C CG1 . VAL C 1 250 ? 57.796  -55.018 132.192 1.00 95.64  ? 250 VAL C CG1 1 
ATOM   10777 C CG2 . VAL C 1 250 ? 57.813  -53.086 133.773 1.00 94.57  ? 250 VAL C CG2 1 
ATOM   10778 N N   . PHE C 1 251 ? 56.504  -53.740 129.289 1.00 131.75 ? 251 PHE C N   1 
ATOM   10779 C CA  . PHE C 1 251 ? 55.753  -54.321 128.190 1.00 127.12 ? 251 PHE C CA  1 
ATOM   10780 C C   . PHE C 1 251 ? 55.780  -55.847 128.138 1.00 114.49 ? 251 PHE C C   1 
ATOM   10781 O O   . PHE C 1 251 ? 56.840  -56.477 128.122 1.00 106.24 ? 251 PHE C O   1 
ATOM   10782 C CB  . PHE C 1 251 ? 56.243  -53.761 126.849 1.00 134.64 ? 251 PHE C CB  1 
ATOM   10783 C CG  . PHE C 1 251 ? 55.499  -54.311 125.666 1.00 137.83 ? 251 PHE C CG  1 
ATOM   10784 C CD1 . PHE C 1 251 ? 54.153  -54.034 125.497 1.00 136.60 ? 251 PHE C CD1 1 
ATOM   10785 C CD2 . PHE C 1 251 ? 56.137  -55.111 124.731 1.00 138.36 ? 251 PHE C CD2 1 
ATOM   10786 C CE1 . PHE C 1 251 ? 53.453  -54.542 124.419 1.00 141.19 ? 251 PHE C CE1 1 
ATOM   10787 C CE2 . PHE C 1 251 ? 55.443  -55.622 123.648 1.00 145.85 ? 251 PHE C CE2 1 
ATOM   10788 C CZ  . PHE C 1 251 ? 54.100  -55.336 123.491 1.00 150.31 ? 251 PHE C CZ  1 
ATOM   10789 N N   . PHE C 1 252 ? 54.581  -56.419 128.112 1.00 110.57 ? 252 PHE C N   1 
ATOM   10790 C CA  . PHE C 1 252 ? 54.383  -57.846 127.910 1.00 118.15 ? 252 PHE C CA  1 
ATOM   10791 C C   . PHE C 1 252 ? 53.448  -57.979 126.716 1.00 129.55 ? 252 PHE C C   1 
ATOM   10792 O O   . PHE C 1 252 ? 52.303  -57.521 126.776 1.00 129.45 ? 252 PHE C O   1 
ATOM   10793 C CB  . PHE C 1 252 ? 53.773  -58.532 129.138 1.00 114.94 ? 252 PHE C CB  1 
ATOM   10794 C CG  . PHE C 1 252 ? 54.677  -58.577 130.340 1.00 103.05 ? 252 PHE C CG  1 
ATOM   10795 C CD1 . PHE C 1 252 ? 55.655  -59.551 130.465 1.00 107.60 ? 252 PHE C CD1 1 
ATOM   10796 C CD2 . PHE C 1 252 ? 54.541  -57.641 131.347 1.00 101.21 ? 252 PHE C CD2 1 
ATOM   10797 C CE1 . PHE C 1 252 ? 56.477  -59.591 131.583 1.00 101.17 ? 252 PHE C CE1 1 
ATOM   10798 C CE2 . PHE C 1 252 ? 55.357  -57.670 132.458 1.00 100.72 ? 252 PHE C CE2 1 
ATOM   10799 C CZ  . PHE C 1 252 ? 56.326  -58.644 132.579 1.00 99.11  ? 252 PHE C CZ  1 
ATOM   10800 N N   . PRO C 1 253 ? 53.929  -58.594 125.625 1.00 128.75 ? 253 PRO C N   1 
ATOM   10801 C CA  . PRO C 1 253 ? 53.101  -58.766 124.425 1.00 127.28 ? 253 PRO C CA  1 
ATOM   10802 C C   . PRO C 1 253 ? 51.833  -59.569 124.712 1.00 128.07 ? 253 PRO C C   1 
ATOM   10803 O O   . PRO C 1 253 ? 51.788  -60.282 125.715 1.00 125.83 ? 253 PRO C O   1 
ATOM   10804 C CB  . PRO C 1 253 ? 54.029  -59.518 123.459 1.00 125.06 ? 253 PRO C CB  1 
ATOM   10805 C CG  . PRO C 1 253 ? 55.078  -60.127 124.312 1.00 119.34 ? 253 PRO C CG  1 
ATOM   10806 C CD  . PRO C 1 253 ? 55.257  -59.213 125.481 1.00 114.47 ? 253 PRO C CD  1 
ATOM   10807 N N   . PRO C 1 254 ? 50.819  -59.459 123.837 1.00 134.99 ? 254 PRO C N   1 
ATOM   10808 C CA  . PRO C 1 254 ? 49.549  -60.163 124.049 1.00 136.51 ? 254 PRO C CA  1 
ATOM   10809 C C   . PRO C 1 254 ? 49.711  -61.681 124.070 1.00 137.22 ? 254 PRO C C   1 
ATOM   10810 O O   . PRO C 1 254 ? 48.979  -62.367 124.783 1.00 133.41 ? 254 PRO C O   1 
ATOM   10811 C CB  . PRO C 1 254 ? 48.700  -59.717 122.852 1.00 133.93 ? 254 PRO C CB  1 
ATOM   10812 C CG  . PRO C 1 254 ? 49.697  -59.313 121.815 1.00 138.77 ? 254 PRO C CG  1 
ATOM   10813 C CD  . PRO C 1 254 ? 50.801  -58.669 122.593 1.00 140.76 ? 254 PRO C CD  1 
ATOM   10814 N N   . GLU C 1 255 ? 50.655  -62.197 123.291 1.00 134.58 ? 255 GLU C N   1 
ATOM   10815 C CA  . GLU C 1 255 ? 50.922  -63.631 123.269 1.00 130.87 ? 255 GLU C CA  1 
ATOM   10816 C C   . GLU C 1 255 ? 51.580  -64.094 124.565 1.00 121.66 ? 255 GLU C C   1 
ATOM   10817 O O   . GLU C 1 255 ? 51.401  -65.237 124.988 1.00 121.21 ? 255 GLU C O   1 
ATOM   10818 C CB  . GLU C 1 255 ? 51.793  -63.997 122.071 1.00 143.15 ? 255 GLU C CB  1 
ATOM   10819 C CG  . GLU C 1 255 ? 53.085  -63.207 121.980 1.00 152.35 ? 255 GLU C CG  1 
ATOM   10820 C CD  . GLU C 1 255 ? 54.308  -64.072 122.208 1.00 166.55 ? 255 GLU C CD  1 
ATOM   10821 O OE1 . GLU C 1 255 ? 54.510  -64.540 123.349 1.00 170.69 ? 255 GLU C OE1 1 
ATOM   10822 O OE2 . GLU C 1 255 ? 55.069  -64.283 121.241 1.00 163.42 ? 255 GLU C OE2 1 
ATOM   10823 N N   . ALA C 1 256 ? 52.322  -63.194 125.205 1.00 123.41 ? 256 ALA C N   1 
ATOM   10824 C CA  . ALA C 1 256 ? 53.060  -63.533 126.416 1.00 117.80 ? 256 ALA C CA  1 
ATOM   10825 C C   . ALA C 1 256 ? 52.224  -63.403 127.688 1.00 127.30 ? 256 ALA C C   1 
ATOM   10826 O O   . ALA C 1 256 ? 52.649  -62.781 128.661 1.00 130.15 ? 256 ALA C O   1 
ATOM   10827 C CB  . ALA C 1 256 ? 54.310  -62.675 126.527 1.00 116.18 ? 256 ALA C CB  1 
ATOM   10828 N N   . GLN C 1 257 ? 51.029  -63.987 127.669 1.00 134.34 ? 257 GLN C N   1 
ATOM   10829 C CA  . GLN C 1 257 ? 50.191  -64.056 128.860 1.00 119.91 ? 257 GLN C CA  1 
ATOM   10830 C C   . GLN C 1 257 ? 50.921  -64.992 129.828 1.00 116.32 ? 257 GLN C C   1 
ATOM   10831 O O   . GLN C 1 257 ? 51.801  -65.733 129.420 1.00 139.85 ? 257 GLN C O   1 
ATOM   10832 C CB  . GLN C 1 257 ? 48.791  -64.569 128.522 1.00 122.38 ? 257 GLN C CB  1 
ATOM   10833 C CG  . GLN C 1 257 ? 47.870  -63.532 127.896 1.00 131.25 ? 257 GLN C CG  1 
ATOM   10834 C CD  . GLN C 1 257 ? 46.564  -64.137 127.411 1.00 139.69 ? 257 GLN C CD  1 
ATOM   10835 O OE1 . GLN C 1 257 ? 46.473  -64.599 126.272 1.00 135.23 ? 257 GLN C OE1 1 
ATOM   10836 N NE2 . GLN C 1 257 ? 45.553  -64.149 128.272 1.00 143.78 ? 257 GLN C NE2 1 
ATOM   10837 N N   . ASN C 1 258 ? 50.554  -64.963 131.105 1.00 102.02 ? 258 ASN C N   1 
ATOM   10838 C CA  . ASN C 1 258 ? 51.253  -65.715 132.168 1.00 121.44 ? 258 ASN C CA  1 
ATOM   10839 C C   . ASN C 1 258 ? 52.757  -65.452 132.268 1.00 112.35 ? 258 ASN C C   1 
ATOM   10840 O O   . ASN C 1 258 ? 53.489  -66.281 132.798 1.00 109.41 ? 258 ASN C O   1 
ATOM   10841 C CB  . ASN C 1 258 ? 51.052  -67.226 132.066 1.00 136.44 ? 258 ASN C CB  1 
ATOM   10842 C CG  . ASN C 1 258 ? 49.625  -67.639 132.273 1.00 142.05 ? 258 ASN C CG  1 
ATOM   10843 O OD1 . ASN C 1 258 ? 48.854  -66.892 132.854 1.00 141.45 ? 258 ASN C OD1 1 
ATOM   10844 N ND2 . ASN C 1 258 ? 49.306  -68.891 131.948 1.00 140.42 ? 258 ASN C ND2 1 
ATOM   10845 N N   . ASP C 1 259 ? 53.226  -64.340 131.715 1.00 105.67 ? 259 ASP C N   1 
ATOM   10846 C CA  . ASP C 1 259 ? 54.616  -63.941 131.904 1.00 101.32 ? 259 ASP C CA  1 
ATOM   10847 C C   . ASP C 1 259 ? 54.731  -62.878 132.995 1.00 93.74  ? 259 ASP C C   1 
ATOM   10848 O O   . ASP C 1 259 ? 53.796  -62.117 133.223 1.00 96.51  ? 259 ASP C O   1 
ATOM   10849 C CB  . ASP C 1 259 ? 55.209  -63.428 130.598 1.00 103.79 ? 259 ASP C CB  1 
ATOM   10850 C CG  . ASP C 1 259 ? 56.714  -63.332 130.654 1.00 108.69 ? 259 ASP C CG  1 
ATOM   10851 O OD1 . ASP C 1 259 ? 57.316  -63.940 131.567 1.00 105.30 ? 259 ASP C OD1 1 
ATOM   10852 O OD2 . ASP C 1 259 ? 57.296  -62.649 129.790 1.00 117.50 ? 259 ASP C OD2 1 
ATOM   10853 N N   . PHE C 1 260 ? 55.873  -62.840 133.673 1.00 86.28  ? 260 PHE C N   1 
ATOM   10854 C CA  . PHE C 1 260 ? 56.081  -61.878 134.746 1.00 83.22  ? 260 PHE C CA  1 
ATOM   10855 C C   . PHE C 1 260 ? 57.567  -61.685 135.025 1.00 88.17  ? 260 PHE C C   1 
ATOM   10856 O O   . PHE C 1 260 ? 58.379  -62.524 134.640 1.00 99.29  ? 260 PHE C O   1 
ATOM   10857 C CB  . PHE C 1 260 ? 55.343  -62.330 136.008 1.00 83.67  ? 260 PHE C CB  1 
ATOM   10858 C CG  . PHE C 1 260 ? 55.623  -63.748 136.396 1.00 88.36  ? 260 PHE C CG  1 
ATOM   10859 C CD1 . PHE C 1 260 ? 54.842  -64.776 135.898 1.00 93.46  ? 260 PHE C CD1 1 
ATOM   10860 C CD2 . PHE C 1 260 ? 56.666  -64.057 137.249 1.00 82.93  ? 260 PHE C CD2 1 
ATOM   10861 C CE1 . PHE C 1 260 ? 55.094  -66.086 136.243 1.00 87.04  ? 260 PHE C CE1 1 
ATOM   10862 C CE2 . PHE C 1 260 ? 56.925  -65.365 137.601 1.00 84.85  ? 260 PHE C CE2 1 
ATOM   10863 C CZ  . PHE C 1 260 ? 56.134  -66.383 137.100 1.00 85.36  ? 260 PHE C CZ  1 
ATOM   10864 N N   . PRO C 1 261 ? 57.934  -60.569 135.680 1.00 78.19  ? 261 PRO C N   1 
ATOM   10865 C CA  . PRO C 1 261 ? 59.356  -60.388 135.994 1.00 77.34  ? 261 PRO C CA  1 
ATOM   10866 C C   . PRO C 1 261 ? 59.883  -61.457 136.950 1.00 94.28  ? 261 PRO C C   1 
ATOM   10867 O O   . PRO C 1 261 ? 59.252  -61.768 137.961 1.00 112.14 ? 261 PRO C O   1 
ATOM   10868 C CB  . PRO C 1 261 ? 59.406  -58.995 136.636 1.00 77.27  ? 261 PRO C CB  1 
ATOM   10869 C CG  . PRO C 1 261 ? 58.111  -58.338 136.255 1.00 80.14  ? 261 PRO C CG  1 
ATOM   10870 C CD  . PRO C 1 261 ? 57.116  -59.435 136.145 1.00 85.05  ? 261 PRO C CD  1 
ATOM   10871 N N   . VAL C 1 262 ? 61.049  -62.003 136.621 1.00 90.40  ? 262 VAL C N   1 
ATOM   10872 C CA  . VAL C 1 262 ? 61.636  -63.091 137.392 1.00 77.39  ? 262 VAL C CA  1 
ATOM   10873 C C   . VAL C 1 262 ? 62.918  -62.657 138.103 1.00 79.45  ? 262 VAL C C   1 
ATOM   10874 O O   . VAL C 1 262 ? 63.191  -63.095 139.222 1.00 84.51  ? 262 VAL C O   1 
ATOM   10875 C CB  . VAL C 1 262 ? 61.914  -64.325 136.490 1.00 91.15  ? 262 VAL C CB  1 
ATOM   10876 C CG1 . VAL C 1 262 ? 63.201  -65.040 136.887 1.00 81.23  ? 262 VAL C CG1 1 
ATOM   10877 C CG2 . VAL C 1 262 ? 60.736  -65.283 136.540 1.00 96.66  ? 262 VAL C CG2 1 
ATOM   10878 N N   . ALA C 1 263 ? 63.698  -61.792 137.465 1.00 78.32  ? 263 ALA C N   1 
ATOM   10879 C CA  . ALA C 1 263 ? 64.949  -61.338 138.062 1.00 78.60  ? 263 ALA C CA  1 
ATOM   10880 C C   . ALA C 1 263 ? 65.250  -59.881 137.720 1.00 82.48  ? 263 ALA C C   1 
ATOM   10881 O O   . ALA C 1 263 ? 64.813  -59.374 136.687 1.00 104.95 ? 263 ALA C O   1 
ATOM   10882 C CB  . ALA C 1 263 ? 66.095  -62.228 137.617 1.00 108.51 ? 263 ALA C CB  1 
ATOM   10883 N N   . MET C 1 264 ? 65.986  -59.206 138.599 1.00 80.52  ? 264 MET C N   1 
ATOM   10884 C CA  . MET C 1 264 ? 66.384  -57.821 138.357 1.00 81.30  ? 264 MET C CA  1 
ATOM   10885 C C   . MET C 1 264 ? 67.746  -57.484 138.954 1.00 87.41  ? 264 MET C C   1 
ATOM   10886 O O   . MET C 1 264 ? 67.997  -57.715 140.136 1.00 112.44 ? 264 MET C O   1 
ATOM   10887 C CB  . MET C 1 264 ? 65.345  -56.850 138.913 1.00 81.58  ? 264 MET C CB  1 
ATOM   10888 C CG  . MET C 1 264 ? 65.697  -55.389 138.657 1.00 84.43  ? 264 MET C CG  1 
ATOM   10889 S SD  . MET C 1 264 ? 64.795  -54.207 139.672 1.00 110.14 ? 264 MET C SD  1 
ATOM   10890 C CE  . MET C 1 264 ? 63.161  -54.303 138.936 1.00 83.59  ? 264 MET C CE  1 
ATOM   10891 N N   . GLN C 1 265 ? 68.625  -56.944 138.119 1.00 84.83  ? 265 GLN C N   1 
ATOM   10892 C CA  . GLN C 1 265 ? 69.933  -56.487 138.566 1.00 86.01  ? 265 GLN C CA  1 
ATOM   10893 C C   . GLN C 1 265 ? 70.185  -55.079 138.046 1.00 90.85  ? 265 GLN C C   1 
ATOM   10894 O O   . GLN C 1 265 ? 69.986  -54.802 136.865 1.00 92.30  ? 265 GLN C O   1 
ATOM   10895 C CB  . GLN C 1 265 ? 71.034  -57.435 138.093 1.00 92.09  ? 265 GLN C CB  1 
ATOM   10896 C CG  . GLN C 1 265 ? 72.425  -57.054 138.566 1.00 100.87 ? 265 GLN C CG  1 
ATOM   10897 C CD  . GLN C 1 265 ? 72.572  -57.133 140.074 1.00 124.47 ? 265 GLN C CD  1 
ATOM   10898 O OE1 . GLN C 1 265 ? 72.193  -58.125 140.697 1.00 129.63 ? 265 GLN C OE1 1 
ATOM   10899 N NE2 . GLN C 1 265 ? 73.124  -56.082 140.669 1.00 141.75 ? 265 GLN C NE2 1 
ATOM   10900 N N   . ILE C 1 266 ? 70.612  -54.184 138.929 1.00 90.18  ? 266 ILE C N   1 
ATOM   10901 C CA  . ILE C 1 266 ? 70.895  -52.809 138.531 1.00 92.09  ? 266 ILE C CA  1 
ATOM   10902 C C   . ILE C 1 266 ? 72.397  -52.561 138.434 1.00 102.70 ? 266 ILE C C   1 
ATOM   10903 O O   . ILE C 1 266 ? 73.144  -52.826 139.374 1.00 112.50 ? 266 ILE C O   1 
ATOM   10904 C CB  . ILE C 1 266 ? 70.279  -51.800 139.508 1.00 95.70  ? 266 ILE C CB  1 
ATOM   10905 C CG1 . ILE C 1 266 ? 68.764  -51.986 139.582 1.00 99.78  ? 266 ILE C CG1 1 
ATOM   10906 C CG2 . ILE C 1 266 ? 70.619  -50.376 139.091 1.00 95.09  ? 266 ILE C CG2 1 
ATOM   10907 C CD1 . ILE C 1 266 ? 68.136  -51.333 140.793 1.00 95.59  ? 266 ILE C CD1 1 
ATOM   10908 N N   . SER C 1 267 ? 72.827  -52.036 137.292 1.00 115.92 ? 267 SER C N   1 
ATOM   10909 C CA  . SER C 1 267 ? 74.232  -51.729 137.062 1.00 114.10 ? 267 SER C CA  1 
ATOM   10910 C C   . SER C 1 267 ? 74.563  -50.303 137.483 1.00 118.54 ? 267 SER C C   1 
ATOM   10911 O O   . SER C 1 267 ? 74.167  -49.350 136.825 1.00 122.24 ? 267 SER C O   1 
ATOM   10912 C CB  . SER C 1 267 ? 74.585  -51.935 135.590 1.00 107.96 ? 267 SER C CB  1 
ATOM   10913 O OG  . SER C 1 267 ? 75.798  -51.284 135.259 1.00 114.90 ? 267 SER C OG  1 
ATOM   10914 N N   . GLU C 1 268 ? 75.308  -50.165 138.576 1.00 115.03 ? 268 GLU C N   1 
ATOM   10915 C CA  . GLU C 1 268 ? 75.672  -48.853 139.108 1.00 121.11 ? 268 GLU C CA  1 
ATOM   10916 C C   . GLU C 1 268 ? 76.595  -48.065 138.173 1.00 131.30 ? 268 GLU C C   1 
ATOM   10917 O O   . GLU C 1 268 ? 76.514  -46.839 138.103 1.00 136.82 ? 268 GLU C O   1 
ATOM   10918 C CB  . GLU C 1 268 ? 76.345  -49.025 140.467 1.00 133.10 ? 268 GLU C CB  1 
ATOM   10919 C CG  . GLU C 1 268 ? 75.566  -49.913 141.436 1.00 145.90 ? 268 GLU C CG  1 
ATOM   10920 C CD  . GLU C 1 268 ? 74.768  -49.121 142.450 1.00 153.87 ? 268 GLU C CD  1 
ATOM   10921 O OE1 . GLU C 1 268 ? 73.559  -49.394 142.601 1.00 154.66 ? 268 GLU C OE1 1 
ATOM   10922 O OE2 . GLU C 1 268 ? 75.354  -48.235 143.109 1.00 153.71 ? 268 GLU C OE2 1 
ATOM   10923 N N