data_5ON2
# 
_entry.id   5ON2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ON2         
WWPDB D_1200006069 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5OMW 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ON2 
_pdbx_database_status.recvd_initial_deposition_date   2017-08-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Palencia, A.' 1 0000-0002-1805-319X 
'Cusack, S.'   2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Mol. Biol.' 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            430 
_citation.language                  ? 
_citation.page_first                1 
_citation.page_last                 16 
_citation.title                     'Kinetic Origin of Substrate Specificity in Post-Transfer Editing by Leucyl-tRNA Synthetase.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2017.10.024 
_citation.pdbx_database_id_PubMed   29111343 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dulic, M.'        1 
primary 'Cvetesic, N.'     2 
primary 'Zivkovic, I.'     3 
primary 'Palencia, A.'     4 
primary 'Cusack, S.'       5 
primary 'Bertosa, B.'      6 
primary 'Gruic-Sovulj, I.' 7 
# 
_cell.entry_id           5ON2 
_cell.length_a           159.650 
_cell.length_b           70.620 
_cell.length_c           230.340 
_cell.angle_alpha        90.00 
_cell.angle_beta         104.52 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5ON2 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Leucine--tRNA ligase'                   99485.992 2 6.1.1.4 T252A ? ? 
2 polymer     syn 'tRNA(leu)'                              28052.652 2 ?       ?     ? ? 
3 non-polymer syn 'ZINC ION'                               65.409    2 ?       ?     ? ? 
4 non-polymer syn "5'-O-(L-leucylsulfamoyl)adenosine"      459.477   2 ?       ?     ? ? 
5 non-polymer syn "2'-(L-NORVALYL)AMINO-2'-DEOXYADENOSINE" 365.388   2 ?       ?     ? ? 
6 non-polymer syn 'MAGNESIUM ION'                          24.305    2 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Leucyl-tRNA synthetase,LeuRS' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MGSSHHHHHHSSGLVPRGSHMQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTIGD
VIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFF
TELYKKGLVYKKTSAVNWCPNDQTVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQ
RNWIGRSEGVEITFNVNDYDNTLTVYTTRPDAFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRNTKVAEAEMATMEK
KGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGV
LFNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVVM
DGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLY
FRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYYVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKM
SKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVAALNVDALTENQKA
LRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQDRALMQEALLAVVRMLNPFTPHICFTLWQELKGEG
DIDNAPWPVADEKAMVEDSTLVVVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG
;
;MGSSHHHHHHSSGLVPRGSHMQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTIGD
VIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFF
TELYKKGLVYKKTSAVNWCPNDQTVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQ
RNWIGRSEGVEITFNVNDYDNTLTVYTTRPDAFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRNTKVAEAEMATMEK
KGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGV
LFNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVVM
DGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLY
FRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYYVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKM
SKSKNNGIDPQVMVERYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVAALNVDALTENQKA
LRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQDRALMQEALLAVVRMLNPFTPHICFTLWQELKGEG
DIDNAPWPVADEKAMVEDSTLVVVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG
;
A,D ? 
2 polyribonucleotide no no 
;GCCCGGAUGGUGGAAUCGGUAGACACAAGGGAUUUAAAAUCCCUCGGCGUUCGCGCUGUGCGGGUUCAAGUCCCGCUCCG
GGUACCA
;
;GCCCGGAUGGUGGAAUCGGUAGACACAAGGGAUUUAAAAUCCCUCGGCGUUCGCGCUGUGCGGGUUCAAGUCCCGCUCCG
GGUACCA
;
B,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  GLN n 
1 23  GLU n 
1 24  GLN n 
1 25  TYR n 
1 26  ARG n 
1 27  PRO n 
1 28  GLU n 
1 29  GLU n 
1 30  ILE n 
1 31  GLU n 
1 32  SER n 
1 33  LYS n 
1 34  VAL n 
1 35  GLN n 
1 36  LEU n 
1 37  HIS n 
1 38  TRP n 
1 39  ASP n 
1 40  GLU n 
1 41  LYS n 
1 42  ARG n 
1 43  THR n 
1 44  PHE n 
1 45  GLU n 
1 46  VAL n 
1 47  THR n 
1 48  GLU n 
1 49  ASP n 
1 50  GLU n 
1 51  SER n 
1 52  LYS n 
1 53  GLU n 
1 54  LYS n 
1 55  TYR n 
1 56  TYR n 
1 57  CYS n 
1 58  LEU n 
1 59  SER n 
1 60  MET n 
1 61  LEU n 
1 62  PRO n 
1 63  TYR n 
1 64  PRO n 
1 65  SER n 
1 66  GLY n 
1 67  ARG n 
1 68  LEU n 
1 69  HIS n 
1 70  MET n 
1 71  GLY n 
1 72  HIS n 
1 73  VAL n 
1 74  ARG n 
1 75  ASN n 
1 76  TYR n 
1 77  THR n 
1 78  ILE n 
1 79  GLY n 
1 80  ASP n 
1 81  VAL n 
1 82  ILE n 
1 83  ALA n 
1 84  ARG n 
1 85  TYR n 
1 86  GLN n 
1 87  ARG n 
1 88  MET n 
1 89  LEU n 
1 90  GLY n 
1 91  LYS n 
1 92  ASN n 
1 93  VAL n 
1 94  LEU n 
1 95  GLN n 
1 96  PRO n 
1 97  ILE n 
1 98  GLY n 
1 99  TRP n 
1 100 ASP n 
1 101 ALA n 
1 102 PHE n 
1 103 GLY n 
1 104 LEU n 
1 105 PRO n 
1 106 ALA n 
1 107 GLU n 
1 108 GLY n 
1 109 ALA n 
1 110 ALA n 
1 111 VAL n 
1 112 LYS n 
1 113 ASN n 
1 114 ASN n 
1 115 THR n 
1 116 ALA n 
1 117 PRO n 
1 118 ALA n 
1 119 PRO n 
1 120 TRP n 
1 121 THR n 
1 122 TYR n 
1 123 ASP n 
1 124 ASN n 
1 125 ILE n 
1 126 ALA n 
1 127 TYR n 
1 128 MET n 
1 129 LYS n 
1 130 ASN n 
1 131 GLN n 
1 132 LEU n 
1 133 LYS n 
1 134 MET n 
1 135 LEU n 
1 136 GLY n 
1 137 PHE n 
1 138 GLY n 
1 139 TYR n 
1 140 ASP n 
1 141 TRP n 
1 142 SER n 
1 143 ARG n 
1 144 GLU n 
1 145 LEU n 
1 146 ALA n 
1 147 THR n 
1 148 CYS n 
1 149 THR n 
1 150 PRO n 
1 151 GLU n 
1 152 TYR n 
1 153 TYR n 
1 154 ARG n 
1 155 TRP n 
1 156 GLU n 
1 157 GLN n 
1 158 LYS n 
1 159 PHE n 
1 160 PHE n 
1 161 THR n 
1 162 GLU n 
1 163 LEU n 
1 164 TYR n 
1 165 LYS n 
1 166 LYS n 
1 167 GLY n 
1 168 LEU n 
1 169 VAL n 
1 170 TYR n 
1 171 LYS n 
1 172 LYS n 
1 173 THR n 
1 174 SER n 
1 175 ALA n 
1 176 VAL n 
1 177 ASN n 
1 178 TRP n 
1 179 CYS n 
1 180 PRO n 
1 181 ASN n 
1 182 ASP n 
1 183 GLN n 
1 184 THR n 
1 185 VAL n 
1 186 LEU n 
1 187 ALA n 
1 188 ASN n 
1 189 GLU n 
1 190 GLN n 
1 191 VAL n 
1 192 ILE n 
1 193 ASP n 
1 194 GLY n 
1 195 CYS n 
1 196 CYS n 
1 197 TRP n 
1 198 ARG n 
1 199 CYS n 
1 200 ASP n 
1 201 THR n 
1 202 LYS n 
1 203 VAL n 
1 204 GLU n 
1 205 ARG n 
1 206 LYS n 
1 207 GLU n 
1 208 ILE n 
1 209 PRO n 
1 210 GLN n 
1 211 TRP n 
1 212 PHE n 
1 213 ILE n 
1 214 LYS n 
1 215 ILE n 
1 216 THR n 
1 217 ALA n 
1 218 TYR n 
1 219 ALA n 
1 220 ASP n 
1 221 GLU n 
1 222 LEU n 
1 223 LEU n 
1 224 ASN n 
1 225 ASP n 
1 226 LEU n 
1 227 ASP n 
1 228 LYS n 
1 229 LEU n 
1 230 ASP n 
1 231 HIS n 
1 232 TRP n 
1 233 PRO n 
1 234 ASP n 
1 235 THR n 
1 236 VAL n 
1 237 LYS n 
1 238 THR n 
1 239 MET n 
1 240 GLN n 
1 241 ARG n 
1 242 ASN n 
1 243 TRP n 
1 244 ILE n 
1 245 GLY n 
1 246 ARG n 
1 247 SER n 
1 248 GLU n 
1 249 GLY n 
1 250 VAL n 
1 251 GLU n 
1 252 ILE n 
1 253 THR n 
1 254 PHE n 
1 255 ASN n 
1 256 VAL n 
1 257 ASN n 
1 258 ASP n 
1 259 TYR n 
1 260 ASP n 
1 261 ASN n 
1 262 THR n 
1 263 LEU n 
1 264 THR n 
1 265 VAL n 
1 266 TYR n 
1 267 THR n 
1 268 THR n 
1 269 ARG n 
1 270 PRO n 
1 271 ASP n 
1 272 ALA n 
1 273 PHE n 
1 274 MET n 
1 275 GLY n 
1 276 CYS n 
1 277 THR n 
1 278 TYR n 
1 279 LEU n 
1 280 ALA n 
1 281 VAL n 
1 282 ALA n 
1 283 ALA n 
1 284 GLY n 
1 285 HIS n 
1 286 PRO n 
1 287 LEU n 
1 288 ALA n 
1 289 GLN n 
1 290 LYS n 
1 291 ALA n 
1 292 ALA n 
1 293 GLU n 
1 294 ASN n 
1 295 ASN n 
1 296 PRO n 
1 297 GLU n 
1 298 LEU n 
1 299 ALA n 
1 300 ALA n 
1 301 PHE n 
1 302 ILE n 
1 303 ASP n 
1 304 GLU n 
1 305 CYS n 
1 306 ARG n 
1 307 ASN n 
1 308 THR n 
1 309 LYS n 
1 310 VAL n 
1 311 ALA n 
1 312 GLU n 
1 313 ALA n 
1 314 GLU n 
1 315 MET n 
1 316 ALA n 
1 317 THR n 
1 318 MET n 
1 319 GLU n 
1 320 LYS n 
1 321 LYS n 
1 322 GLY n 
1 323 VAL n 
1 324 ASP n 
1 325 THR n 
1 326 GLY n 
1 327 PHE n 
1 328 LYS n 
1 329 ALA n 
1 330 VAL n 
1 331 HIS n 
1 332 PRO n 
1 333 LEU n 
1 334 THR n 
1 335 GLY n 
1 336 GLU n 
1 337 GLU n 
1 338 ILE n 
1 339 PRO n 
1 340 VAL n 
1 341 TRP n 
1 342 ALA n 
1 343 ALA n 
1 344 ASN n 
1 345 PHE n 
1 346 VAL n 
1 347 LEU n 
1 348 MET n 
1 349 GLU n 
1 350 TYR n 
1 351 GLY n 
1 352 THR n 
1 353 GLY n 
1 354 ALA n 
1 355 VAL n 
1 356 MET n 
1 357 ALA n 
1 358 VAL n 
1 359 PRO n 
1 360 GLY n 
1 361 HIS n 
1 362 ASP n 
1 363 GLN n 
1 364 ARG n 
1 365 ASP n 
1 366 TYR n 
1 367 GLU n 
1 368 PHE n 
1 369 ALA n 
1 370 SER n 
1 371 LYS n 
1 372 TYR n 
1 373 GLY n 
1 374 LEU n 
1 375 ASN n 
1 376 ILE n 
1 377 LYS n 
1 378 PRO n 
1 379 VAL n 
1 380 ILE n 
1 381 LEU n 
1 382 ALA n 
1 383 ALA n 
1 384 ASP n 
1 385 GLY n 
1 386 SER n 
1 387 GLU n 
1 388 PRO n 
1 389 ASP n 
1 390 LEU n 
1 391 SER n 
1 392 GLN n 
1 393 GLN n 
1 394 ALA n 
1 395 LEU n 
1 396 THR n 
1 397 GLU n 
1 398 LYS n 
1 399 GLY n 
1 400 VAL n 
1 401 LEU n 
1 402 PHE n 
1 403 ASN n 
1 404 SER n 
1 405 GLY n 
1 406 GLU n 
1 407 PHE n 
1 408 ASN n 
1 409 GLY n 
1 410 LEU n 
1 411 ASP n 
1 412 HIS n 
1 413 GLU n 
1 414 ALA n 
1 415 ALA n 
1 416 PHE n 
1 417 ASN n 
1 418 ALA n 
1 419 ILE n 
1 420 ALA n 
1 421 ASP n 
1 422 LYS n 
1 423 LEU n 
1 424 THR n 
1 425 ALA n 
1 426 MET n 
1 427 GLY n 
1 428 VAL n 
1 429 GLY n 
1 430 GLU n 
1 431 ARG n 
1 432 LYS n 
1 433 VAL n 
1 434 ASN n 
1 435 TYR n 
1 436 ARG n 
1 437 LEU n 
1 438 ARG n 
1 439 ASP n 
1 440 TRP n 
1 441 GLY n 
1 442 VAL n 
1 443 SER n 
1 444 ARG n 
1 445 GLN n 
1 446 ARG n 
1 447 TYR n 
1 448 TRP n 
1 449 GLY n 
1 450 ALA n 
1 451 PRO n 
1 452 ILE n 
1 453 PRO n 
1 454 MET n 
1 455 VAL n 
1 456 THR n 
1 457 LEU n 
1 458 GLU n 
1 459 ASP n 
1 460 GLY n 
1 461 THR n 
1 462 VAL n 
1 463 MET n 
1 464 PRO n 
1 465 THR n 
1 466 PRO n 
1 467 ASP n 
1 468 ASP n 
1 469 GLN n 
1 470 LEU n 
1 471 PRO n 
1 472 VAL n 
1 473 ILE n 
1 474 LEU n 
1 475 PRO n 
1 476 GLU n 
1 477 ASP n 
1 478 VAL n 
1 479 VAL n 
1 480 MET n 
1 481 ASP n 
1 482 GLY n 
1 483 ILE n 
1 484 THR n 
1 485 SER n 
1 486 PRO n 
1 487 ILE n 
1 488 LYS n 
1 489 ALA n 
1 490 ASP n 
1 491 PRO n 
1 492 GLU n 
1 493 TRP n 
1 494 ALA n 
1 495 LYS n 
1 496 THR n 
1 497 THR n 
1 498 VAL n 
1 499 ASN n 
1 500 GLY n 
1 501 MET n 
1 502 PRO n 
1 503 ALA n 
1 504 LEU n 
1 505 ARG n 
1 506 GLU n 
1 507 THR n 
1 508 ASP n 
1 509 THR n 
1 510 PHE n 
1 511 ASP n 
1 512 THR n 
1 513 PHE n 
1 514 MET n 
1 515 GLU n 
1 516 SER n 
1 517 SER n 
1 518 TRP n 
1 519 TYR n 
1 520 TYR n 
1 521 ALA n 
1 522 ARG n 
1 523 TYR n 
1 524 THR n 
1 525 CYS n 
1 526 PRO n 
1 527 GLN n 
1 528 TYR n 
1 529 LYS n 
1 530 GLU n 
1 531 GLY n 
1 532 MET n 
1 533 LEU n 
1 534 ASP n 
1 535 SER n 
1 536 GLU n 
1 537 ALA n 
1 538 ALA n 
1 539 ASN n 
1 540 TYR n 
1 541 TRP n 
1 542 LEU n 
1 543 PRO n 
1 544 VAL n 
1 545 ASP n 
1 546 ILE n 
1 547 TYR n 
1 548 ILE n 
1 549 GLY n 
1 550 GLY n 
1 551 ILE n 
1 552 GLU n 
1 553 HIS n 
1 554 ALA n 
1 555 ILE n 
1 556 MET n 
1 557 HIS n 
1 558 LEU n 
1 559 LEU n 
1 560 TYR n 
1 561 PHE n 
1 562 ARG n 
1 563 PHE n 
1 564 PHE n 
1 565 HIS n 
1 566 LYS n 
1 567 LEU n 
1 568 MET n 
1 569 ARG n 
1 570 ASP n 
1 571 ALA n 
1 572 GLY n 
1 573 MET n 
1 574 VAL n 
1 575 ASN n 
1 576 SER n 
1 577 ASP n 
1 578 GLU n 
1 579 PRO n 
1 580 ALA n 
1 581 LYS n 
1 582 GLN n 
1 583 LEU n 
1 584 LEU n 
1 585 CYS n 
1 586 GLN n 
1 587 GLY n 
1 588 MET n 
1 589 VAL n 
1 590 LEU n 
1 591 ALA n 
1 592 ASP n 
1 593 ALA n 
1 594 PHE n 
1 595 TYR n 
1 596 TYR n 
1 597 VAL n 
1 598 GLY n 
1 599 GLU n 
1 600 ASN n 
1 601 GLY n 
1 602 GLU n 
1 603 ARG n 
1 604 ASN n 
1 605 TRP n 
1 606 VAL n 
1 607 SER n 
1 608 PRO n 
1 609 VAL n 
1 610 ASP n 
1 611 ALA n 
1 612 ILE n 
1 613 VAL n 
1 614 GLU n 
1 615 ARG n 
1 616 ASP n 
1 617 GLU n 
1 618 LYS n 
1 619 GLY n 
1 620 ARG n 
1 621 ILE n 
1 622 VAL n 
1 623 LYS n 
1 624 ALA n 
1 625 LYS n 
1 626 ASP n 
1 627 ALA n 
1 628 ALA n 
1 629 GLY n 
1 630 HIS n 
1 631 GLU n 
1 632 LEU n 
1 633 VAL n 
1 634 TYR n 
1 635 THR n 
1 636 GLY n 
1 637 MET n 
1 638 SER n 
1 639 LYS n 
1 640 MET n 
1 641 SER n 
1 642 LYS n 
1 643 SER n 
1 644 LYS n 
1 645 ASN n 
1 646 ASN n 
1 647 GLY n 
1 648 ILE n 
1 649 ASP n 
1 650 PRO n 
1 651 GLN n 
1 652 VAL n 
1 653 MET n 
1 654 VAL n 
1 655 GLU n 
1 656 ARG n 
1 657 TYR n 
1 658 GLY n 
1 659 ALA n 
1 660 ASP n 
1 661 THR n 
1 662 VAL n 
1 663 ARG n 
1 664 LEU n 
1 665 PHE n 
1 666 MET n 
1 667 MET n 
1 668 PHE n 
1 669 ALA n 
1 670 SER n 
1 671 PRO n 
1 672 ALA n 
1 673 ASP n 
1 674 MET n 
1 675 THR n 
1 676 LEU n 
1 677 GLU n 
1 678 TRP n 
1 679 GLN n 
1 680 GLU n 
1 681 SER n 
1 682 GLY n 
1 683 VAL n 
1 684 GLU n 
1 685 GLY n 
1 686 ALA n 
1 687 ASN n 
1 688 ARG n 
1 689 PHE n 
1 690 LEU n 
1 691 LYS n 
1 692 ARG n 
1 693 VAL n 
1 694 TRP n 
1 695 LYS n 
1 696 LEU n 
1 697 VAL n 
1 698 TYR n 
1 699 GLU n 
1 700 HIS n 
1 701 THR n 
1 702 ALA n 
1 703 LYS n 
1 704 GLY n 
1 705 ASP n 
1 706 VAL n 
1 707 ALA n 
1 708 ALA n 
1 709 LEU n 
1 710 ASN n 
1 711 VAL n 
1 712 ASP n 
1 713 ALA n 
1 714 LEU n 
1 715 THR n 
1 716 GLU n 
1 717 ASN n 
1 718 GLN n 
1 719 LYS n 
1 720 ALA n 
1 721 LEU n 
1 722 ARG n 
1 723 ARG n 
1 724 ASP n 
1 725 VAL n 
1 726 HIS n 
1 727 LYS n 
1 728 THR n 
1 729 ILE n 
1 730 ALA n 
1 731 LYS n 
1 732 VAL n 
1 733 THR n 
1 734 ASP n 
1 735 ASP n 
1 736 ILE n 
1 737 GLY n 
1 738 ARG n 
1 739 ARG n 
1 740 GLN n 
1 741 THR n 
1 742 PHE n 
1 743 ASN n 
1 744 THR n 
1 745 ALA n 
1 746 ILE n 
1 747 ALA n 
1 748 ALA n 
1 749 ILE n 
1 750 MET n 
1 751 GLU n 
1 752 LEU n 
1 753 MET n 
1 754 ASN n 
1 755 LYS n 
1 756 LEU n 
1 757 ALA n 
1 758 LYS n 
1 759 ALA n 
1 760 PRO n 
1 761 THR n 
1 762 ASP n 
1 763 GLY n 
1 764 GLU n 
1 765 GLN n 
1 766 ASP n 
1 767 ARG n 
1 768 ALA n 
1 769 LEU n 
1 770 MET n 
1 771 GLN n 
1 772 GLU n 
1 773 ALA n 
1 774 LEU n 
1 775 LEU n 
1 776 ALA n 
1 777 VAL n 
1 778 VAL n 
1 779 ARG n 
1 780 MET n 
1 781 LEU n 
1 782 ASN n 
1 783 PRO n 
1 784 PHE n 
1 785 THR n 
1 786 PRO n 
1 787 HIS n 
1 788 ILE n 
1 789 CYS n 
1 790 PHE n 
1 791 THR n 
1 792 LEU n 
1 793 TRP n 
1 794 GLN n 
1 795 GLU n 
1 796 LEU n 
1 797 LYS n 
1 798 GLY n 
1 799 GLU n 
1 800 GLY n 
1 801 ASP n 
1 802 ILE n 
1 803 ASP n 
1 804 ASN n 
1 805 ALA n 
1 806 PRO n 
1 807 TRP n 
1 808 PRO n 
1 809 VAL n 
1 810 ALA n 
1 811 ASP n 
1 812 GLU n 
1 813 LYS n 
1 814 ALA n 
1 815 MET n 
1 816 VAL n 
1 817 GLU n 
1 818 ASP n 
1 819 SER n 
1 820 THR n 
1 821 LEU n 
1 822 VAL n 
1 823 VAL n 
1 824 VAL n 
1 825 GLN n 
1 826 VAL n 
1 827 ASN n 
1 828 GLY n 
1 829 LYS n 
1 830 VAL n 
1 831 ARG n 
1 832 ALA n 
1 833 LYS n 
1 834 ILE n 
1 835 THR n 
1 836 VAL n 
1 837 PRO n 
1 838 VAL n 
1 839 ASP n 
1 840 ALA n 
1 841 THR n 
1 842 GLU n 
1 843 GLU n 
1 844 GLN n 
1 845 VAL n 
1 846 ARG n 
1 847 GLU n 
1 848 ARG n 
1 849 ALA n 
1 850 GLY n 
1 851 GLN n 
1 852 GLU n 
1 853 HIS n 
1 854 LEU n 
1 855 VAL n 
1 856 ALA n 
1 857 LYS n 
1 858 TYR n 
1 859 LEU n 
1 860 ASP n 
1 861 GLY n 
1 862 VAL n 
1 863 THR n 
1 864 VAL n 
1 865 ARG n 
1 866 LYS n 
1 867 VAL n 
1 868 ILE n 
1 869 TYR n 
1 870 VAL n 
1 871 PRO n 
1 872 GLY n 
1 873 LYS n 
1 874 LEU n 
1 875 LEU n 
1 876 ASN n 
1 877 LEU n 
1 878 VAL n 
1 879 VAL n 
1 880 GLY n 
2 1   G   n 
2 2   C   n 
2 3   C   n 
2 4   C   n 
2 5   G   n 
2 6   G   n 
2 7   A   n 
2 8   U   n 
2 9   G   n 
2 10  G   n 
2 11  U   n 
2 12  G   n 
2 13  G   n 
2 14  A   n 
2 15  A   n 
2 16  U   n 
2 17  C   n 
2 18  G   n 
2 19  G   n 
2 20  U   n 
2 21  A   n 
2 22  G   n 
2 23  A   n 
2 24  C   n 
2 25  A   n 
2 26  C   n 
2 27  A   n 
2 28  A   n 
2 29  G   n 
2 30  G   n 
2 31  G   n 
2 32  A   n 
2 33  U   n 
2 34  U   n 
2 35  U   n 
2 36  A   n 
2 37  A   n 
2 38  A   n 
2 39  A   n 
2 40  U   n 
2 41  C   n 
2 42  C   n 
2 43  C   n 
2 44  U   n 
2 45  C   n 
2 46  G   n 
2 47  G   n 
2 48  C   n 
2 49  G   n 
2 50  U   n 
2 51  U   n 
2 52  C   n 
2 53  G   n 
2 54  C   n 
2 55  G   n 
2 56  C   n 
2 57  U   n 
2 58  G   n 
2 59  U   n 
2 60  G   n 
2 61  C   n 
2 62  G   n 
2 63  G   n 
2 64  G   n 
2 65  U   n 
2 66  U   n 
2 67  C   n 
2 68  A   n 
2 69  A   n 
2 70  G   n 
2 71  U   n 
2 72  C   n 
2 73  C   n 
2 74  C   n 
2 75  G   n 
2 76  C   n 
2 77  U   n 
2 78  C   n 
2 79  C   n 
2 80  G   n 
2 81  G   n 
2 82  G   n 
2 83  U   n 
2 84  A   n 
2 85  C   n 
2 86  C   n 
2 87  A   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   880 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'leuS, b0642, JW0637' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli (strain K12)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       87 
_pdbx_entity_src_syn.organism_scientific    'Escherichia coli' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       562 
_pdbx_entity_src_syn.details                'T7 in vitro transcription' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SYL_ECOLI  P07813     ? 1 
;MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVIARYQRMLGKNVLQPIGWD
AFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCP
NDQTVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRSEGVEITFNVNDYD
NTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPV
WAANFVLMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIA
DKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDVVMDGITSPIKADPEWAKTTVNG
MPALRETDTFDTFMESSWYYARYTCPQYKEGMLDSEAANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPA
KQLLCQGMVLADAFYYVGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVERYGAD
TVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVAALNVDALTENQKALRRDVHKTIAKVTDDIGRRQ
TFNTAIAAIMELMNKLAKAPTDGEQDRALMQEALLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDST
LVVVQVNGKVRAKITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG
;
1       
2 GB  LT906474.1 1231762938 ? 2 
;GCCCGGAUGGUGGAAUCGGUAGACACAAGGGAUUUAAAAUCCCUCGGCGUUCGCGCUGUGCGGGUUCAAGUCCCGCUCCG
GGUACCA
;
1919401 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5ON2 A 21 ? 880 ? P07813     1       ? 860     ? 1 860 
2 2 5ON2 B 1  ? 87  ? 1231762938 1919401 ? 1919487 ? 1 76  
3 1 5ON2 D 21 ? 880 ? P07813     1       ? 860     ? 1 860 
4 2 5ON2 E 1  ? 87  ? 1231762938 1919401 ? 1919487 ? 1 76  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5ON2 MET A 1   ? UNP P07813 ?   ?   'initiating methionine' -19 1  
1 5ON2 GLY A 2   ? UNP P07813 ?   ?   'expression tag'        -18 2  
1 5ON2 SER A 3   ? UNP P07813 ?   ?   'expression tag'        -17 3  
1 5ON2 SER A 4   ? UNP P07813 ?   ?   'expression tag'        -16 4  
1 5ON2 HIS A 5   ? UNP P07813 ?   ?   'expression tag'        -15 5  
1 5ON2 HIS A 6   ? UNP P07813 ?   ?   'expression tag'        -14 6  
1 5ON2 HIS A 7   ? UNP P07813 ?   ?   'expression tag'        -13 7  
1 5ON2 HIS A 8   ? UNP P07813 ?   ?   'expression tag'        -12 8  
1 5ON2 HIS A 9   ? UNP P07813 ?   ?   'expression tag'        -11 9  
1 5ON2 HIS A 10  ? UNP P07813 ?   ?   'expression tag'        -10 10 
1 5ON2 SER A 11  ? UNP P07813 ?   ?   'expression tag'        -9  11 
1 5ON2 SER A 12  ? UNP P07813 ?   ?   'expression tag'        -8  12 
1 5ON2 GLY A 13  ? UNP P07813 ?   ?   'expression tag'        -7  13 
1 5ON2 LEU A 14  ? UNP P07813 ?   ?   'expression tag'        -6  14 
1 5ON2 VAL A 15  ? UNP P07813 ?   ?   'expression tag'        -5  15 
1 5ON2 PRO A 16  ? UNP P07813 ?   ?   'expression tag'        -4  16 
1 5ON2 ARG A 17  ? UNP P07813 ?   ?   'expression tag'        -3  17 
1 5ON2 GLY A 18  ? UNP P07813 ?   ?   'expression tag'        -2  18 
1 5ON2 SER A 19  ? UNP P07813 ?   ?   'expression tag'        -1  19 
1 5ON2 HIS A 20  ? UNP P07813 ?   ?   'expression tag'        0   20 
1 5ON2 ALA A 272 ? UNP P07813 THR 252 'engineered mutation'   252 21 
3 5ON2 MET D 1   ? UNP P07813 ?   ?   'initiating methionine' -19 22 
3 5ON2 GLY D 2   ? UNP P07813 ?   ?   'expression tag'        -18 23 
3 5ON2 SER D 3   ? UNP P07813 ?   ?   'expression tag'        -17 24 
3 5ON2 SER D 4   ? UNP P07813 ?   ?   'expression tag'        -16 25 
3 5ON2 HIS D 5   ? UNP P07813 ?   ?   'expression tag'        -15 26 
3 5ON2 HIS D 6   ? UNP P07813 ?   ?   'expression tag'        -14 27 
3 5ON2 HIS D 7   ? UNP P07813 ?   ?   'expression tag'        -13 28 
3 5ON2 HIS D 8   ? UNP P07813 ?   ?   'expression tag'        -12 29 
3 5ON2 HIS D 9   ? UNP P07813 ?   ?   'expression tag'        -11 30 
3 5ON2 HIS D 10  ? UNP P07813 ?   ?   'expression tag'        -10 31 
3 5ON2 SER D 11  ? UNP P07813 ?   ?   'expression tag'        -9  32 
3 5ON2 SER D 12  ? UNP P07813 ?   ?   'expression tag'        -8  33 
3 5ON2 GLY D 13  ? UNP P07813 ?   ?   'expression tag'        -7  34 
3 5ON2 LEU D 14  ? UNP P07813 ?   ?   'expression tag'        -6  35 
3 5ON2 VAL D 15  ? UNP P07813 ?   ?   'expression tag'        -5  36 
3 5ON2 PRO D 16  ? UNP P07813 ?   ?   'expression tag'        -4  37 
3 5ON2 ARG D 17  ? UNP P07813 ?   ?   'expression tag'        -3  38 
3 5ON2 GLY D 18  ? UNP P07813 ?   ?   'expression tag'        -2  39 
3 5ON2 SER D 19  ? UNP P07813 ?   ?   'expression tag'        -1  40 
3 5ON2 HIS D 20  ? UNP P07813 ?   ?   'expression tag'        0   41 
3 5ON2 ALA D 272 ? UNP P07813 THR 252 'engineered mutation'   252 42 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"             ?                               'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                                  ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"              ?                               'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                                 ?                               'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"             ?                               'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                                ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                               'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                               'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                               ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                               'C6 H13 N O2'     131.173 
LSS non-polymer         . "5'-O-(L-leucylsulfamoyl)adenosine"      5-O-N-LEUCYL-SULFAMOYLADENOSINE 'C16 H25 N7 O7 S' 459.477 
LYS 'L-peptide linking' y LYSINE                                   ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                               'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ?                               'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                               'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"               ?                               'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                                   ?                               'C5 H11 N O2'     117.146 
VRT non-polymer         . "2'-(L-NORVALYL)AMINO-2'-DEOXYADENOSINE" ?                               'C15 H23 N7 O4'   365.388 
ZN  non-polymer         . 'ZINC ION'                               ?                               'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ON2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.45 
_exptl_crystal.description                 '2d needles' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BIS-TRIS PH 5.5, 23-25% W/V PEG 3350, AND 200 MM AMMONIUM ACETATE' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8726 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.8726 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ON2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.1 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       45457 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.01 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.99 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.10 
_reflns_shell.d_res_low                   3.21 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4483 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.2 
_reflns_shell.pdbx_Rsym_value             1.0 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.29 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5ON2 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     43264 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            3.10 
_refine.ls_percent_reflns_obs                    99.62 
_refine.ls_R_factor_obs                          0.22757 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22578 
_refine.ls_R_factor_R_free                       0.26316 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  2193 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.906 
_refine.B_iso_mean                               95.831 
_refine.aniso_B[1][1]                            -0.25 
_refine.aniso_B[2][2]                            0.18 
_refine.aniso_B[3][3]                            0.67 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -1.33 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      4AQ7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.526 
_refine.overall_SU_ML                            0.524 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             33.259 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        13676 
_refine_hist.pdbx_number_atoms_nucleic_acid   3538 
_refine_hist.pdbx_number_atoms_ligand         118 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               17332 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        222.98 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.018  ? 18077 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 14535 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.907  1.793  ? 25341 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.899  3.000  ? 33897 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.990  5.000  ? 1720  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.872 24.551 ? 668   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.190 15.000 ? 2380  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.608 15.000 ? 82    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.053  0.200  ? 2742  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.021  ? 17695 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 3765  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.552  9.750  ? 6898  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.552  9.750  ? 6898  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.847  14.625 ? 8612  'X-RAY DIFFRACTION' ? 
r_mcangle_other              2.847  14.625 ? 8613  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.145  10.007 ? 11179 'X-RAY DIFFRACTION' ? 
r_scbond_other               1.145  10.007 ? 11180 'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              2.079  15.017 ? 16730 'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       4.310  .      ? 20286 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         4.310  .      ? 20287 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.100 
_refine_ls_shell.d_res_low                        3.181 
_refine_ls_shell.number_reflns_R_work             3170 
_refine_ls_shell.R_factor_R_work                  0.373 
_refine_ls_shell.percent_reflns_obs               99.91 
_refine_ls_shell.R_factor_R_free                  0.347 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             148 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5ON2 
_struct.title                        
;Quaternary complex of mutant T252A of E. coli leucyl-tRNA synthetase with tRNA(leu), leucyl-adenylate analogue, and post-transfer editing analogue of norvaline in the aminoacylation conformation
;
_struct.pdbx_descriptor              'Leucine--tRNA ligase/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ON2 
_struct_keywords.text            
;reaction catalysed: ATP + L-leucine + tRNA(Leu) = AMP + diphosphate + L-leucyl-tRNA(Leu) protein translation, aminoacyl-tRNA activity, leucine-tRNA ligase, class Ia, TRANSLATION
;
_struct_keywords.pdbx_keywords   TRANSLATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 26  ? ARG A 42  ? ARG A 6   ARG A 22  1 ? 17 
HELX_P HELX_P2  AA2 HIS A 69  ? LEU A 89  ? HIS A 49  LEU A 69  1 ? 21 
HELX_P HELX_P3  AA3 LEU A 104 ? ASN A 114 ? LEU A 84  ASN A 94  1 ? 11 
HELX_P HELX_P4  AA4 ALA A 116 ? GLY A 136 ? ALA A 96  GLY A 116 1 ? 21 
HELX_P HELX_P5  AA5 ASP A 140 ? GLU A 144 ? ASP A 120 GLU A 124 5 ? 5  
HELX_P HELX_P6  AA6 THR A 149 ? LYS A 166 ? THR A 129 LYS A 146 1 ? 18 
HELX_P HELX_P7  AA7 ILE A 215 ? ALA A 217 ? ILE A 195 ALA A 197 5 ? 3  
HELX_P HELX_P8  AA8 TYR A 218 ? ASP A 225 ? TYR A 198 ASP A 205 1 ? 8  
HELX_P HELX_P9  AA9 PRO A 233 ? GLY A 245 ? PRO A 213 GLY A 225 1 ? 13 
HELX_P HELX_P10 AB1 ARG A 269 ? CYS A 276 ? ARG A 249 CYS A 256 5 ? 8  
HELX_P HELX_P11 AB2 HIS A 285 ? ALA A 292 ? HIS A 265 ALA A 272 1 ? 8  
HELX_P HELX_P12 AB3 ASN A 295 ? CYS A 305 ? ASN A 275 CYS A 285 1 ? 11 
HELX_P HELX_P13 AB4 ALA A 311 ? MET A 318 ? ALA A 291 MET A 298 1 ? 8  
HELX_P HELX_P14 AB5 VAL A 358 ? HIS A 361 ? VAL A 338 HIS A 341 5 ? 4  
HELX_P HELX_P15 AB6 ASP A 362 ? GLY A 373 ? ASP A 342 GLY A 353 1 ? 12 
HELX_P HELX_P16 AB7 SER A 404 ? ASN A 408 ? SER A 384 ASN A 388 5 ? 5  
HELX_P HELX_P17 AB8 ASP A 411 ? GLY A 427 ? ASP A 391 GLY A 407 1 ? 17 
HELX_P HELX_P18 AB9 PRO A 466 ? LEU A 470 ? PRO A 446 LEU A 450 5 ? 5  
HELX_P HELX_P19 AC1 SER A 485 ? ASP A 490 ? SER A 465 ASP A 470 1 ? 6  
HELX_P HELX_P20 AC2 THR A 512 ? SER A 517 ? THR A 492 SER A 497 1 ? 6  
HELX_P HELX_P21 AC3 TRP A 518 ? TYR A 523 ? TRP A 498 TYR A 503 1 ? 6  
HELX_P HELX_P22 AC4 ASP A 534 ? LEU A 542 ? ASP A 514 LEU A 522 1 ? 9  
HELX_P HELX_P23 AC5 GLU A 552 ? ALA A 554 ? GLU A 532 ALA A 534 5 ? 3  
HELX_P HELX_P24 AC6 ILE A 555 ? ALA A 571 ? ILE A 535 ALA A 551 1 ? 17 
HELX_P HELX_P25 AC7 PRO A 650 ? GLY A 658 ? PRO A 630 GLY A 638 1 ? 9  
HELX_P HELX_P26 AC8 GLY A 658 ? SER A 670 ? GLY A 638 SER A 650 1 ? 13 
HELX_P HELX_P27 AC9 GLY A 682 ? GLY A 704 ? GLY A 662 GLY A 684 1 ? 23 
HELX_P HELX_P28 AD1 THR A 715 ? ARG A 738 ? THR A 695 ARG A 718 1 ? 24 
HELX_P HELX_P29 AD2 THR A 741 ? ALA A 759 ? THR A 721 ALA A 739 1 ? 19 
HELX_P HELX_P30 AD3 GLY A 763 ? ASN A 782 ? GLY A 743 ASN A 762 1 ? 20 
HELX_P HELX_P31 AD4 THR A 785 ? LEU A 796 ? THR A 765 LEU A 776 1 ? 12 
HELX_P HELX_P32 AD5 THR A 841 ? GLU A 852 ? THR A 821 GLU A 832 1 ? 12 
HELX_P HELX_P33 AD6 GLU A 852 ? ASP A 860 ? GLU A 832 ASP A 840 1 ? 9  
HELX_P HELX_P34 AD7 ARG C 26  ? ARG C 42  ? ARG D 6   ARG D 22  1 ? 17 
HELX_P HELX_P35 AD8 HIS C 69  ? LEU C 89  ? HIS D 49  LEU D 69  1 ? 21 
HELX_P HELX_P36 AD9 GLY C 103 ? ASN C 113 ? GLY D 83  ASN D 93  1 ? 11 
HELX_P HELX_P37 AE1 ALA C 116 ? GLY C 136 ? ALA D 96  GLY D 116 1 ? 21 
HELX_P HELX_P38 AE2 ASP C 140 ? GLU C 144 ? ASP D 120 GLU D 124 5 ? 5  
HELX_P HELX_P39 AE3 THR C 149 ? GLY C 167 ? THR D 129 GLY D 147 1 ? 19 
HELX_P HELX_P40 AE4 ILE C 215 ? ALA C 217 ? ILE D 195 ALA D 197 5 ? 3  
HELX_P HELX_P41 AE5 TYR C 218 ? ASP C 225 ? TYR D 198 ASP D 205 1 ? 8  
HELX_P HELX_P42 AE6 LEU C 226 ? LYS C 228 ? LEU D 206 LYS D 208 5 ? 3  
HELX_P HELX_P43 AE7 PRO C 233 ? GLY C 245 ? PRO D 213 GLY D 225 1 ? 13 
HELX_P HELX_P44 AE8 ARG C 269 ? CYS C 276 ? ARG D 249 CYS D 256 5 ? 8  
HELX_P HELX_P45 AE9 HIS C 285 ? ALA C 291 ? HIS D 265 ALA D 271 1 ? 7  
HELX_P HELX_P46 AF1 ASN C 295 ? CYS C 305 ? ASN D 275 CYS D 285 1 ? 11 
HELX_P HELX_P47 AF2 ALA C 311 ? MET C 318 ? ALA D 291 MET D 298 1 ? 8  
HELX_P HELX_P48 AF3 VAL C 358 ? HIS C 361 ? VAL D 338 HIS D 341 5 ? 4  
HELX_P HELX_P49 AF4 ASP C 362 ? GLY C 373 ? ASP D 342 GLY D 353 1 ? 12 
HELX_P HELX_P50 AF5 SER C 404 ? ASN C 408 ? SER D 384 ASN D 388 5 ? 5  
HELX_P HELX_P51 AF6 ASP C 411 ? GLY C 427 ? ASP D 391 GLY D 407 1 ? 17 
HELX_P HELX_P52 AF7 SER C 485 ? ASP C 490 ? SER D 465 ASP D 470 1 ? 6  
HELX_P HELX_P53 AF8 ASP C 511 ? SER C 517 ? ASP D 491 SER D 497 1 ? 7  
HELX_P HELX_P54 AF9 TRP C 518 ? TYR C 523 ? TRP D 498 TYR D 503 1 ? 6  
HELX_P HELX_P55 AG1 ASP C 534 ? LEU C 542 ? ASP D 514 LEU D 522 1 ? 9  
HELX_P HELX_P56 AG2 GLU C 552 ? ALA C 554 ? GLU D 532 ALA D 534 5 ? 3  
HELX_P HELX_P57 AG3 ILE C 555 ? ALA C 571 ? ILE D 535 ALA D 551 1 ? 17 
HELX_P HELX_P58 AG4 PRO C 650 ? TYR C 657 ? PRO D 630 TYR D 637 1 ? 8  
HELX_P HELX_P59 AG5 GLY C 658 ? SER C 670 ? GLY D 638 SER D 650 1 ? 13 
HELX_P HELX_P60 AG6 GLY C 682 ? ALA C 702 ? GLY D 662 ALA D 682 1 ? 21 
HELX_P HELX_P61 AG7 THR C 715 ? ARG C 738 ? THR D 695 ARG D 718 1 ? 24 
HELX_P HELX_P62 AG8 THR C 741 ? ALA C 759 ? THR D 721 ALA D 739 1 ? 19 
HELX_P HELX_P63 AG9 GLY C 763 ? ASN C 782 ? GLY D 743 ASN D 762 1 ? 20 
HELX_P HELX_P64 AH1 THR C 785 ? LEU C 796 ? THR D 765 LEU D 776 1 ? 12 
HELX_P HELX_P65 AH2 ASP C 801 ? ALA C 805 ? ASP D 781 ALA D 785 5 ? 5  
HELX_P HELX_P66 AH3 GLU C 812 ? VAL C 816 ? GLU D 792 VAL D 796 5 ? 5  
HELX_P HELX_P67 AH4 THR C 841 ? GLU C 852 ? THR D 821 GLU D 832 1 ? 12 
HELX_P HELX_P68 AH5 GLU C 852 ? LEU C 859 ? GLU D 832 LEU D 839 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A CYS 179 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 159 A ZN 900 1_555 ? ? ? ? ? ? ?                       2.352 ? 
metalc2   metalc ? ? A CYS 196 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 176 A ZN 900 1_555 ? ? ? ? ? ? ?                       2.346 ? 
metalc3   metalc ? ? A CYS 199 SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 179 A ZN 900 1_555 ? ? ? ? ? ? ?                       2.351 ? 
metalc4   metalc ? ? B U   8   OP1 ? ? ? 1_555 H MG .  MG ? ? B U   8   B MG 101 1_555 ? ? ? ? ? ? ?                       2.131 ? 
metalc5   metalc ? ? B G   9   OP2 ? ? ? 1_555 H MG .  MG ? ? B G   9   B MG 101 1_555 ? ? ? ? ? ? ?                       2.356 ? 
metalc6   metalc ? ? C CYS 179 SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 159 D ZN 900 1_555 ? ? ? ? ? ? ?                       2.348 ? 
metalc7   metalc ? ? C CYS 196 SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 176 D ZN 900 1_555 ? ? ? ? ? ? ?                       2.343 ? 
metalc8   metalc ? ? C CYS 199 SG  ? ? ? 1_555 I ZN .  ZN ? ? D CYS 179 D ZN 900 1_555 ? ? ? ? ? ? ?                       2.345 ? 
metalc9   metalc ? ? D U   8   OP1 ? ? ? 1_555 L MG .  MG ? ? E U   8   E MG 101 1_555 ? ? ? ? ? ? ?                       2.819 ? 
metalc10  metalc ? ? D G   9   OP2 ? ? ? 1_555 L MG .  MG ? ? E G   9   E MG 101 1_555 ? ? ? ? ? ? ?                       2.115 ? 
hydrog1   hydrog ? ? B G   1   N1  ? ? ? 1_555 B U  83 O2 ? ? B G   1   B U  72  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog2   hydrog ? ? B G   1   O6  ? ? ? 1_555 B U  83 N3 ? ? B G   1   B U  72  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog3   hydrog ? ? B C   2   N3  ? ? ? 1_555 B G  82 N1 ? ? B C   2   B G  71  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog4   hydrog ? ? B C   2   N4  ? ? ? 1_555 B G  82 O6 ? ? B C   2   B G  71  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog5   hydrog ? ? B C   2   O2  ? ? ? 1_555 B G  82 N2 ? ? B C   2   B G  71  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog6   hydrog ? ? B C   3   N3  ? ? ? 1_555 B G  81 N1 ? ? B C   3   B G  70  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog7   hydrog ? ? B C   3   N4  ? ? ? 1_555 B G  81 O6 ? ? B C   3   B G  70  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog8   hydrog ? ? B C   3   O2  ? ? ? 1_555 B G  81 N2 ? ? B C   3   B G  70  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog9   hydrog ? ? B C   4   N3  ? ? ? 1_555 B G  80 N1 ? ? B C   4   B G  69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog10  hydrog ? ? B C   4   N4  ? ? ? 1_555 B G  80 O6 ? ? B C   4   B G  69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog11  hydrog ? ? B C   4   O2  ? ? ? 1_555 B G  80 N2 ? ? B C   4   B G  69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog12  hydrog ? ? B G   5   N1  ? ? ? 1_555 B C  79 N3 ? ? B G   5   B C  68  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog13  hydrog ? ? B G   5   N2  ? ? ? 1_555 B C  79 O2 ? ? B G   5   B C  68  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog14  hydrog ? ? B G   5   O6  ? ? ? 1_555 B C  79 N4 ? ? B G   5   B C  68  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog15  hydrog ? ? B G   6   N1  ? ? ? 1_555 B C  78 N3 ? ? B G   6   B C  67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog16  hydrog ? ? B G   6   N2  ? ? ? 1_555 B C  78 O2 ? ? B G   6   B C  67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog17  hydrog ? ? B G   6   O6  ? ? ? 1_555 B C  78 N4 ? ? B G   6   B C  67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog18  hydrog ? ? B A   7   N1  ? ? ? 1_555 B U  77 N3 ? ? B A   7   B U  66  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog19  hydrog ? ? B A   7   N6  ? ? ? 1_555 B U  77 O4 ? ? B A   7   B U  66  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog20  hydrog ? ? B U   8   N3  ? ? ? 1_555 B A  14 N7 ? ? B U   8   B A  14  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
hydrog21  hydrog ? ? B U   8   O2  ? ? ? 1_555 B A  14 N6 ? ? B U   8   B A  14  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
hydrog22  hydrog ? ? B G   9   N1  ? ? ? 1_555 B G  12 O6 ? ? B G   9   B G  12  1_555 ? ? ? ? ? ? TYPE_6_PAIR             ?     ? 
hydrog23  hydrog ? ? B G   9   N2  ? ? ? 1_555 B G  12 N7 ? ? B G   9   B G  12  1_555 ? ? ? ? ? ? TYPE_6_PAIR             ?     ? 
hydrog24  hydrog ? ? B G   9   O6  ? ? ? 1_555 B C  24 N4 ? ? B G   9   B C  23  1_555 ? ? ? ? ? ? 'G-C PAIR'              ?     ? 
hydrog25  hydrog ? ? B G   10  N1  ? ? ? 1_555 B C  26 N3 ? ? B G   10  B C  25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog26  hydrog ? ? B G   10  N2  ? ? ? 1_555 B C  26 O2 ? ? B G   10  B C  25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog27  hydrog ? ? B G   10  O6  ? ? ? 1_555 B C  26 N4 ? ? B G   10  B C  25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog28  hydrog ? ? B U   11  N3  ? ? ? 1_555 B A  25 N1 ? ? B U   11  B A  24  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog29  hydrog ? ? B U   11  O4  ? ? ? 1_555 B A  25 N6 ? ? B U   11  B A  24  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog30  hydrog ? ? B G   12  N1  ? ? ? 1_555 B C  24 N3 ? ? B G   12  B C  23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog31  hydrog ? ? B G   12  N2  ? ? ? 1_555 B C  24 O2 ? ? B G   12  B C  23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog32  hydrog ? ? B G   12  O6  ? ? ? 1_555 B C  24 N4 ? ? B G   12  B C  23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog33  hydrog ? ? B G   13  O6  ? ? ? 1_555 B G  22 N2 ? ? B G   13  B G  21  1_555 ? ? ? ? ? ? 'G-G MISPAIR'           ?     ? 
hydrog34  hydrog ? ? B G   13  N2  ? ? ? 1_555 B A  23 N7 ? ? B G   13  B A  22  1_555 ? ? ? ? ? ? TYPE_11_PAIR            ?     ? 
hydrog35  hydrog ? ? B G   13  N3  ? ? ? 1_555 B A  23 N6 ? ? B G   13  B A  22  1_555 ? ? ? ? ? ? TYPE_11_PAIR            ?     ? 
hydrog36  hydrog ? ? B A   14  N6  ? ? ? 1_555 B A  21 N3 ? A B A   14  B A  20  1_555 ? ? ? ? ? ? 'A-A MISPAIR'           ?     ? 
hydrog37  hydrog ? ? B A   15  N1  ? ? ? 1_555 B U  59 N3 ? ? B A   15  B U  48  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog38  hydrog ? ? B A   15  N6  ? ? ? 1_555 B U  59 O2 ? ? B A   15  B U  48  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog39  hydrog ? ? B G   18  N1  ? ? ? 1_555 B U  66 O2 ? ? B G   18  B U  55  1_555 ? ? ? ? ? ? 'G-U MISPAIR'           ?     ? 
hydrog40  hydrog ? ? B G   19  N2  ? ? ? 1_555 B C  67 O2 ? ? B G   19  B C  56  1_555 ? ? ? ? ? ? 'G-C PAIR'              ?     ? 
hydrog41  hydrog ? ? B G   22  N7  ? ? ? 1_555 B G  58 N2 ? J B G   21  B G  47  1_555 ? ? ? ? ? ? 'G-G MISPAIR'           ?     ? 
hydrog42  hydrog ? ? B A   27  N6  ? ? ? 1_555 B C  45 O2 ? ? B A   26  B C  44  1_555 ? ? ? ? ? ? 'A-C MISPAIR'           ?     ? 
hydrog43  hydrog ? ? B A   28  N1  ? ? ? 1_555 B U  44 N3 ? ? B A   27  B U  43  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog44  hydrog ? ? B A   28  N6  ? ? ? 1_555 B U  44 O4 ? ? B A   27  B U  43  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog45  hydrog ? ? B G   29  N1  ? ? ? 1_555 B C  43 N3 ? ? B G   28  B C  42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog46  hydrog ? ? B G   29  N2  ? ? ? 1_555 B C  43 O2 ? ? B G   28  B C  42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog47  hydrog ? ? B G   29  O6  ? ? ? 1_555 B C  43 N4 ? ? B G   28  B C  42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog48  hydrog ? ? B G   30  N1  ? ? ? 1_555 B C  42 N3 ? ? B G   29  B C  41  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog49  hydrog ? ? B G   30  N2  ? ? ? 1_555 B C  42 O2 ? ? B G   29  B C  41  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog50  hydrog ? ? B G   30  O6  ? ? ? 1_555 B C  42 N4 ? ? B G   29  B C  41  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog51  hydrog ? ? B G   31  N1  ? ? ? 1_555 B C  41 N3 ? ? B G   30  B C  40  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog52  hydrog ? ? B G   31  N2  ? ? ? 1_555 B C  41 O2 ? ? B G   30  B C  40  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog53  hydrog ? ? B G   31  O6  ? ? ? 1_555 B C  41 N4 ? ? B G   30  B C  40  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog54  hydrog ? ? B A   32  N1  ? ? ? 1_555 B U  40 N3 ? ? B A   31  B U  39  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog55  hydrog ? ? B A   32  N6  ? ? ? 1_555 B U  40 O4 ? ? B A   31  B U  39  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog56  hydrog ? ? B U   33  N3  ? ? ? 1_555 B A  39 N1 ? ? B U   32  B A  38  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog57  hydrog ? ? B U   33  O4  ? ? ? 1_555 B A  39 N6 ? ? B U   32  B A  38  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog58  hydrog ? ? B G   46  N1  ? ? ? 1_555 B U  57 O2 ? I B G   45  B U  47  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog59  hydrog ? ? B G   46  O6  ? ? ? 1_555 B U  57 N3 ? I B G   45  B U  47  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog60  hydrog ? ? B G   47  N1  ? ? ? 1_555 B C  56 N3 ? H B G   46  B C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog61  hydrog ? ? B G   47  N2  ? ? ? 1_555 B C  56 O2 ? H B G   46  B C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog62  hydrog ? ? B G   47  O6  ? ? ? 1_555 B C  56 N4 ? H B G   46  B C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog63  hydrog ? ? B C   48  N3  ? ? ? 1_555 B G  55 N1 ? G B C   47  B G  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog64  hydrog ? ? B C   48  N4  ? ? ? 1_555 B G  55 O6 ? G B C   47  B G  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog65  hydrog ? ? B C   48  O2  ? ? ? 1_555 B G  55 N2 ? G B C   47  B G  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog66  hydrog ? ? B G   49  N1  ? A ? 1_555 B C  54 N3 ? F B G   47  B C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog67  hydrog ? ? B G   49  N2  ? A ? 1_555 B C  54 O2 ? F B G   47  B C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog68  hydrog ? ? B G   49  O6  ? A ? 1_555 B C  54 N4 ? F B G   47  B C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog69  hydrog ? ? B G   60  N1  ? ? ? 1_555 B C  76 N3 ? ? B G   49  B C  65  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog70  hydrog ? ? B G   60  N2  ? ? ? 1_555 B C  76 O2 ? ? B G   49  B C  65  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog71  hydrog ? ? B G   60  O6  ? ? ? 1_555 B C  76 N4 ? ? B G   49  B C  65  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog72  hydrog ? ? B C   61  N3  ? ? ? 1_555 B G  75 N1 ? ? B C   50  B G  64  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog73  hydrog ? ? B C   61  N4  ? ? ? 1_555 B G  75 O6 ? ? B C   50  B G  64  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog74  hydrog ? ? B C   61  O2  ? ? ? 1_555 B G  75 N2 ? ? B C   50  B G  64  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog75  hydrog ? ? B G   62  N1  ? ? ? 1_555 B C  74 N3 ? ? B G   51  B C  63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog76  hydrog ? ? B G   62  N2  ? ? ? 1_555 B C  74 O2 ? ? B G   51  B C  63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog77  hydrog ? ? B G   62  O6  ? ? ? 1_555 B C  74 N4 ? ? B G   51  B C  63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog78  hydrog ? ? B G   63  N1  ? ? ? 1_555 B C  73 N3 ? ? B G   52  B C  62  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog79  hydrog ? ? B G   63  N2  ? ? ? 1_555 B C  73 O2 ? ? B G   52  B C  62  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog80  hydrog ? ? B G   63  O6  ? ? ? 1_555 B C  73 N4 ? ? B G   52  B C  62  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog81  hydrog ? ? B G   64  N1  ? ? ? 1_555 B C  72 N3 ? ? B G   53  B C  61  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog82  hydrog ? ? B G   64  N2  ? ? ? 1_555 B C  72 O2 ? ? B G   53  B C  61  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog83  hydrog ? ? B G   64  O6  ? ? ? 1_555 B C  72 N4 ? ? B G   53  B C  61  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog84  hydrog ? ? B U   65  N3  ? ? ? 1_555 B A  69 N7 ? ? B U   54  B A  58  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
hydrog85  hydrog ? ? B U   65  O2  ? ? ? 1_555 B A  69 N6 ? ? B U   54  B A  58  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
hydrog86  hydrog ? ? D G   1   N1  ? ? ? 1_555 D U  83 O2 ? ? E G   1   E U  72  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog87  hydrog ? ? D G   1   O6  ? ? ? 1_555 D U  83 N3 ? ? E G   1   E U  72  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog88  hydrog ? ? D C   2   N3  ? ? ? 1_555 D G  82 N1 ? ? E C   2   E G  71  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog89  hydrog ? ? D C   2   N4  ? ? ? 1_555 D G  82 O6 ? ? E C   2   E G  71  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog90  hydrog ? ? D C   2   O2  ? ? ? 1_555 D G  82 N2 ? ? E C   2   E G  71  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog91  hydrog ? ? D C   3   N3  ? ? ? 1_555 D G  81 N1 ? ? E C   3   E G  70  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog92  hydrog ? ? D C   3   N4  ? ? ? 1_555 D G  81 O6 ? ? E C   3   E G  70  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog93  hydrog ? ? D C   3   O2  ? ? ? 1_555 D G  81 N2 ? ? E C   3   E G  70  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog94  hydrog ? ? D C   4   N3  ? ? ? 1_555 D G  80 N1 ? ? E C   4   E G  69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog95  hydrog ? ? D C   4   N4  ? ? ? 1_555 D G  80 O6 ? ? E C   4   E G  69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog96  hydrog ? ? D C   4   O2  ? ? ? 1_555 D G  80 N2 ? ? E C   4   E G  69  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog97  hydrog ? ? D G   5   N1  ? ? ? 1_555 D C  79 N3 ? ? E G   5   E C  68  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog98  hydrog ? ? D G   5   N2  ? ? ? 1_555 D C  79 O2 ? ? E G   5   E C  68  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog99  hydrog ? ? D G   5   O6  ? ? ? 1_555 D C  79 N4 ? ? E G   5   E C  68  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog100 hydrog ? ? D G   6   N1  ? ? ? 1_555 D C  78 N3 ? ? E G   6   E C  67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog101 hydrog ? ? D G   6   N2  ? ? ? 1_555 D C  78 O2 ? ? E G   6   E C  67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog102 hydrog ? ? D G   6   O6  ? ? ? 1_555 D C  78 N4 ? ? E G   6   E C  67  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog103 hydrog ? ? D A   7   N1  ? ? ? 1_555 D U  77 N3 ? ? E A   7   E U  66  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog104 hydrog ? ? D A   7   N6  ? ? ? 1_555 D U  77 O4 ? ? E A   7   E U  66  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog105 hydrog ? ? D U   8   N3  ? ? ? 1_555 D A  14 N7 ? ? E U   8   E A  14  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
hydrog106 hydrog ? ? D U   8   O2  ? ? ? 1_555 D A  14 N6 ? ? E U   8   E A  14  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
hydrog107 hydrog ? ? D G   9   N1  ? ? ? 1_555 D G  12 O6 ? ? E G   9   E G  12  1_555 ? ? ? ? ? ? TYPE_6_PAIR             ?     ? 
hydrog108 hydrog ? ? D G   9   N2  ? ? ? 1_555 D G  12 N7 ? ? E G   9   E G  12  1_555 ? ? ? ? ? ? TYPE_6_PAIR             ?     ? 
hydrog109 hydrog ? ? D G   9   O6  ? ? ? 1_555 D C  24 N4 ? ? E G   9   E C  23  1_555 ? ? ? ? ? ? 'G-C PAIR'              ?     ? 
hydrog110 hydrog ? ? D G   10  N1  ? ? ? 1_555 D C  26 N3 ? ? E G   10  E C  25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog111 hydrog ? ? D G   10  N2  ? ? ? 1_555 D C  26 O2 ? ? E G   10  E C  25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog112 hydrog ? ? D G   10  O6  ? ? ? 1_555 D C  26 N4 ? ? E G   10  E C  25  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog113 hydrog ? ? D U   11  N3  ? ? ? 1_555 D A  25 N1 ? ? E U   11  E A  24  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog114 hydrog ? ? D U   11  O4  ? ? ? 1_555 D A  25 N6 ? ? E U   11  E A  24  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog115 hydrog ? ? D G   12  N1  ? ? ? 1_555 D C  24 N3 ? ? E G   12  E C  23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog116 hydrog ? ? D G   12  N2  ? ? ? 1_555 D C  24 O2 ? ? E G   12  E C  23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog117 hydrog ? ? D G   12  O6  ? ? ? 1_555 D C  24 N4 ? ? E G   12  E C  23  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog118 hydrog ? ? D G   13  O6  ? ? ? 1_555 D G  22 N2 ? ? E G   13  E G  21  1_555 ? ? ? ? ? ? 'G-G MISPAIR'           ?     ? 
hydrog119 hydrog ? ? D G   13  N2  ? ? ? 1_555 D A  23 N7 ? ? E G   13  E A  22  1_555 ? ? ? ? ? ? TYPE_11_PAIR            ?     ? 
hydrog120 hydrog ? ? D G   13  N3  ? ? ? 1_555 D A  23 N6 ? ? E G   13  E A  22  1_555 ? ? ? ? ? ? TYPE_11_PAIR            ?     ? 
hydrog121 hydrog ? ? D A   14  N6  ? ? ? 1_555 D A  21 N3 ? A E A   14  E A  20  1_555 ? ? ? ? ? ? 'A-A MISPAIR'           ?     ? 
hydrog122 hydrog ? ? D A   15  N1  ? ? ? 1_555 D U  59 N3 ? ? E A   15  E U  48  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog123 hydrog ? ? D A   15  N6  ? ? ? 1_555 D U  59 O2 ? ? E A   15  E U  48  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     ? 
hydrog124 hydrog ? ? D G   18  N2  ? ? ? 1_555 D U  66 O2 ? ? E G   18  E U  55  1_555 ? ? ? ? ? ? 'G-U MISPAIR'           ?     ? 
hydrog125 hydrog ? ? D G   19  N1  ? ? ? 1_555 D C  67 N3 ? ? E G   19  E C  56  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog126 hydrog ? ? D G   19  N2  ? ? ? 1_555 D C  67 O2 ? ? E G   19  E C  56  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog127 hydrog ? ? D G   19  O6  ? ? ? 1_555 D C  67 N4 ? ? E G   19  E C  56  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog128 hydrog ? ? D G   22  N7  ? ? ? 1_555 D G  58 N2 ? J E G   21  E G  47  1_555 ? ? ? ? ? ? 'G-G MISPAIR'           ?     ? 
hydrog129 hydrog ? ? D A   27  N6  ? ? ? 1_555 D C  45 O2 ? ? E A   26  E C  44  1_555 ? ? ? ? ? ? 'A-C MISPAIR'           ?     ? 
hydrog130 hydrog ? ? D A   28  N1  ? ? ? 1_555 D U  44 N3 ? ? E A   27  E U  43  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog131 hydrog ? ? D A   28  N6  ? ? ? 1_555 D U  44 O4 ? ? E A   27  E U  43  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog132 hydrog ? ? D G   29  N1  ? ? ? 1_555 D C  43 N3 ? ? E G   28  E C  42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog133 hydrog ? ? D G   29  N2  ? ? ? 1_555 D C  43 O2 ? ? E G   28  E C  42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog134 hydrog ? ? D G   29  O6  ? ? ? 1_555 D C  43 N4 ? ? E G   28  E C  42  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog135 hydrog ? ? D G   30  N1  ? ? ? 1_555 D C  42 N3 ? ? E G   29  E C  41  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog136 hydrog ? ? D G   30  N2  ? ? ? 1_555 D C  42 O2 ? ? E G   29  E C  41  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog137 hydrog ? ? D G   30  O6  ? ? ? 1_555 D C  42 N4 ? ? E G   29  E C  41  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog138 hydrog ? ? D G   31  N2  ? ? ? 1_555 D C  41 O2 ? ? E G   30  E C  40  1_555 ? ? ? ? ? ? 'G-C PAIR'              ?     ? 
hydrog139 hydrog ? ? D G   46  N1  ? ? ? 1_555 D U  57 O2 ? I E G   45  E U  47  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog140 hydrog ? ? D G   46  O6  ? ? ? 1_555 D U  57 N3 ? I E G   45  E U  47  1_555 ? ? ? ? ? ? TYPE_28_PAIR            ?     ? 
hydrog141 hydrog ? ? D G   47  N1  ? ? ? 1_555 D C  56 N3 ? H E G   46  E C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog142 hydrog ? ? D G   47  N2  ? ? ? 1_555 D C  56 O2 ? H E G   46  E C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog143 hydrog ? ? D G   47  O6  ? ? ? 1_555 D C  56 N4 ? H E G   46  E C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog144 hydrog ? ? D C   48  N3  ? ? ? 1_555 D G  55 N1 ? G E C   47  E G  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog145 hydrog ? ? D C   48  N4  ? ? ? 1_555 D G  55 O6 ? G E C   47  E G  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog146 hydrog ? ? D C   48  O2  ? ? ? 1_555 D G  55 N2 ? G E C   47  E G  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog147 hydrog ? ? D G   49  N1  ? A ? 1_555 D C  54 N3 ? F E G   47  E C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog148 hydrog ? ? D G   49  N2  ? A ? 1_555 D C  54 O2 ? F E G   47  E C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog149 hydrog ? ? D G   49  O6  ? A ? 1_555 D C  54 N4 ? F E G   47  E C  47  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog150 hydrog ? ? D G   60  N1  ? ? ? 1_555 D C  76 N3 ? ? E G   49  E C  65  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog151 hydrog ? ? D G   60  N2  ? ? ? 1_555 D C  76 O2 ? ? E G   49  E C  65  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog152 hydrog ? ? D G   60  O6  ? ? ? 1_555 D C  76 N4 ? ? E G   49  E C  65  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog153 hydrog ? ? D C   61  N3  ? ? ? 1_555 D G  75 N1 ? ? E C   50  E G  64  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog154 hydrog ? ? D C   61  N4  ? ? ? 1_555 D G  75 O6 ? ? E C   50  E G  64  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog155 hydrog ? ? D C   61  O2  ? ? ? 1_555 D G  75 N2 ? ? E C   50  E G  64  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog156 hydrog ? ? D G   62  N1  ? ? ? 1_555 D C  74 N3 ? ? E G   51  E C  63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog157 hydrog ? ? D G   62  N2  ? ? ? 1_555 D C  74 O2 ? ? E G   51  E C  63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog158 hydrog ? ? D G   62  O6  ? ? ? 1_555 D C  74 N4 ? ? E G   51  E C  63  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog159 hydrog ? ? D G   63  O6  ? ? ? 1_555 D C  73 N4 ? ? E G   52  E C  62  1_555 ? ? ? ? ? ? 'G-C PAIR'              ?     ? 
hydrog160 hydrog ? ? D G   64  N1  ? ? ? 1_555 D C  72 N3 ? ? E G   53  E C  61  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog161 hydrog ? ? D G   64  N2  ? ? ? 1_555 D C  72 O2 ? ? E G   53  E C  61  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog162 hydrog ? ? D G   64  O6  ? ? ? 1_555 D C  72 N4 ? ? E G   53  E C  61  1_555 ? ? ? ? ? ? WATSON-CRICK            ?     ? 
hydrog163 hydrog ? ? D U   65  N3  ? ? ? 1_555 D A  69 N7 ? ? E U   54  E A  58  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
hydrog164 hydrog ? ? D U   65  O2  ? ? ? 1_555 D A  69 N6 ? ? E U   54  E A  58  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 470 A . ? LEU 450 A PRO 471 A ? PRO 451 A 1 -0.03 
2 LEU 542 A . ? LEU 522 A PRO 543 A ? PRO 523 A 1 1.48  
3 LEU 470 C . ? LEU 450 D PRO 471 C ? PRO 451 D 1 -0.12 
4 LEU 542 C . ? LEU 522 D PRO 543 C ? PRO 523 D 1 -0.46 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 8 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 6 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 3 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? parallel      
AA3 5 6 ? anti-parallel 
AA3 6 7 ? parallel      
AA3 7 8 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? parallel      
AA8 3 4 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? parallel      
AB3 5 6 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? parallel      
AB9 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 92  ? LEU A 94  ? ASN A 72  LEU A 74  
AA1 2 LYS A 54  ? SER A 59  ? LYS A 34  SER A 39  
AA1 3 VAL A 544 ? GLY A 550 ? VAL A 524 GLY A 530 
AA1 4 ALA A 580 ? GLN A 586 ? ALA A 560 GLN A 566 
AA2 1 THR A 184 ? VAL A 185 ? THR A 164 VAL A 165 
AA2 2 VAL A 169 ? CYS A 179 ? VAL A 149 CYS A 159 
AA2 3 GLU A 204 ? ILE A 213 ? GLU A 184 ILE A 193 
AA2 4 TRP A 440 ? GLY A 441 ? TRP A 420 GLY A 421 
AA3 1 GLY A 429 ? TYR A 435 ? GLY A 409 TYR A 415 
AA3 2 ARG A 246 ? VAL A 256 ? ARG A 226 VAL A 236 
AA3 3 GLY A 322 ? VAL A 330 ? GLY A 302 VAL A 310 
AA3 4 GLU A 337 ? ALA A 343 ? GLU A 317 ALA A 323 
AA3 5 TYR A 278 ? VAL A 281 ? TYR A 258 VAL A 261 
AA3 6 ALA A 354 ? ALA A 357 ? ALA A 334 ALA A 337 
AA3 7 TYR A 259 ? THR A 267 ? TYR A 239 THR A 247 
AA3 8 ARG A 246 ? VAL A 256 ? ARG A 226 VAL A 236 
AA4 1 SER A 443 ? ARG A 444 ? SER A 423 ARG A 424 
AA4 2 THR A 509 ? PHE A 510 ? THR A 489 PHE A 490 
AA5 1 VAL A 462 ? PRO A 464 ? VAL A 442 PRO A 444 
AA5 2 MET A 454 ? LEU A 457 ? MET A 434 LEU A 437 
AA5 3 MET A 501 ? ARG A 505 ? MET A 481 ARG A 485 
AA5 4 LYS A 495 ? VAL A 498 ? LYS A 475 VAL A 478 
AA6 1 ARG A 603 ? VAL A 606 ? ARG A 583 VAL A 586 
AA6 2 LEU A 590 ? VAL A 597 ? LEU A 570 VAL A 577 
AA6 3 VAL A 633 ? LYS A 639 ? VAL A 613 LYS A 619 
AA7 1 ALA A 611 ? ARG A 615 ? ALA A 591 ARG A 595 
AA7 2 ILE A 621 ? ASP A 626 ? ILE A 601 ASP A 606 
AA8 1 VAL A 830 ? VAL A 836 ? VAL A 810 VAL A 816 
AA8 2 THR A 820 ? VAL A 826 ? THR A 800 VAL A 806 
AA8 3 LEU A 874 ? VAL A 879 ? LEU A 854 VAL A 859 
AA8 4 VAL A 864 ? VAL A 870 ? VAL A 844 VAL A 850 
AA9 1 ASN C 92  ? LEU C 94  ? ASN D 72  LEU D 74  
AA9 2 LYS C 54  ? SER C 59  ? LYS D 34  SER D 39  
AA9 3 VAL C 544 ? GLY C 550 ? VAL D 524 GLY D 530 
AA9 4 ALA C 580 ? GLN C 586 ? ALA D 560 GLN D 566 
AB1 1 VAL C 169 ? ALA C 175 ? VAL D 149 ALA D 155 
AB1 2 GLU C 207 ? ILE C 213 ? GLU D 187 ILE D 193 
AB1 3 TRP C 440 ? GLY C 441 ? TRP D 420 GLY D 421 
AB2 1 TRP C 178 ? CYS C 179 ? TRP D 158 CYS D 159 
AB2 2 THR C 184 ? VAL C 185 ? THR D 164 VAL D 165 
AB3 1 LEU C 263 ? THR C 267 ? LEU D 243 THR D 247 
AB3 2 ARG C 246 ? VAL C 256 ? ARG D 226 VAL D 236 
AB3 3 GLY C 322 ? VAL C 330 ? GLY D 302 VAL D 310 
AB3 4 GLU C 337 ? ALA C 343 ? GLU D 317 ALA D 323 
AB3 5 TYR C 278 ? VAL C 281 ? TYR D 258 VAL D 261 
AB3 6 ALA C 354 ? ALA C 357 ? ALA D 334 ALA D 337 
AB4 1 LEU C 263 ? THR C 267 ? LEU D 243 THR D 247 
AB4 2 ARG C 246 ? VAL C 256 ? ARG D 226 VAL D 236 
AB4 3 GLY C 429 ? TYR C 435 ? GLY D 409 TYR D 415 
AB5 1 VAL C 462 ? PRO C 464 ? VAL D 442 PRO D 444 
AB5 2 MET C 454 ? LEU C 457 ? MET D 434 LEU D 437 
AB5 3 PRO C 502 ? ARG C 505 ? PRO D 482 ARG D 485 
AB5 4 LYS C 495 ? THR C 497 ? LYS D 475 THR D 477 
AB6 1 ARG C 603 ? VAL C 606 ? ARG D 583 VAL D 586 
AB6 2 VAL C 589 ? VAL C 597 ? VAL D 569 VAL D 577 
AB6 3 VAL C 633 ? LYS C 639 ? VAL D 613 LYS D 619 
AB7 1 ARG C 603 ? VAL C 606 ? ARG D 583 VAL D 586 
AB7 2 VAL C 589 ? VAL C 597 ? VAL D 569 VAL D 577 
AB7 3 LEU C 676 ? GLU C 677 ? LEU D 656 GLU D 657 
AB8 1 ILE C 612 ? ARG C 615 ? ILE D 592 ARG D 595 
AB8 2 ILE C 621 ? LYS C 625 ? ILE D 601 LYS D 605 
AB9 1 VAL C 830 ? PRO C 837 ? VAL D 810 PRO D 817 
AB9 2 SER C 819 ? VAL C 826 ? SER D 799 VAL D 806 
AB9 3 LEU C 874 ? VAL C 879 ? LEU D 854 VAL D 859 
AB9 4 VAL C 864 ? VAL C 870 ? VAL D 844 VAL D 850 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 94  ? O LEU A 74  N CYS A 57  ? N CYS A 37  
AA1 2 3 N LEU A 58  ? N LEU A 38  O ILE A 548 ? O ILE A 528 
AA1 3 4 N VAL A 544 ? N VAL A 524 O LYS A 581 ? O LYS A 561 
AA2 1 2 O THR A 184 ? O THR A 164 N CYS A 179 ? N CYS A 159 
AA2 2 3 N LYS A 172 ? N LYS A 152 O GLN A 210 ? O GLN A 190 
AA2 3 4 N ILE A 213 ? N ILE A 193 O TRP A 440 ? O TRP A 420 
AA3 1 2 O LYS A 432 ? O LYS A 412 N GLY A 249 ? N GLY A 229 
AA3 2 3 N ASN A 255 ? N ASN A 235 O VAL A 330 ? O VAL A 310 
AA3 3 4 N ALA A 329 ? N ALA A 309 O ILE A 338 ? O ILE A 318 
AA3 4 5 O TRP A 341 ? O TRP A 321 N VAL A 281 ? N VAL A 261 
AA3 5 6 N ALA A 280 ? N ALA A 260 O VAL A 355 ? O VAL A 335 
AA3 6 7 O ALA A 354 ? O ALA A 334 N TYR A 266 ? N TYR A 246 
AA3 7 8 O VAL A 265 ? O VAL A 245 N ILE A 252 ? N ILE A 232 
AA4 1 2 N ARG A 444 ? N ARG A 424 O THR A 509 ? O THR A 489 
AA5 1 2 O MET A 463 ? O MET A 443 N VAL A 455 ? N VAL A 435 
AA5 2 3 N THR A 456 ? N THR A 436 O LEU A 504 ? O LEU A 484 
AA5 3 4 O ALA A 503 ? O ALA A 483 N THR A 496 ? N THR A 476 
AA6 1 2 O ASN A 604 ? O ASN A 584 N TYR A 596 ? N TYR A 576 
AA6 2 3 N TYR A 595 ? N TYR A 575 O VAL A 633 ? O VAL A 613 
AA7 1 2 N ILE A 612 ? N ILE A 592 O LYS A 625 ? O LYS A 605 
AA8 1 2 O VAL A 836 ? O VAL A 816 N THR A 820 ? N THR A 800 
AA8 2 3 N GLN A 825 ? N GLN A 805 O LEU A 875 ? O LEU A 855 
AA8 3 4 O LEU A 874 ? O LEU A 854 N VAL A 870 ? N VAL A 850 
AA9 1 2 O LEU C 94  ? O LEU D 74  N TYR C 55  ? N TYR D 35  
AA9 2 3 N LEU C 58  ? N LEU D 38  O ILE C 548 ? O ILE D 528 
AA9 3 4 N VAL C 544 ? N VAL D 524 O LYS C 581 ? O LYS D 561 
AB1 1 2 N LYS C 172 ? N LYS D 152 O GLN C 210 ? O GLN D 190 
AB1 2 3 N ILE C 213 ? N ILE D 193 O TRP C 440 ? O TRP D 420 
AB2 1 2 N CYS C 179 ? N CYS D 159 O THR C 184 ? O THR D 164 
AB3 1 2 O THR C 267 ? O THR D 247 N VAL C 250 ? N VAL D 230 
AB3 2 3 N ASN C 255 ? N ASN D 235 O VAL C 330 ? O VAL D 310 
AB3 3 4 N VAL C 323 ? N VAL D 303 O ALA C 342 ? O ALA D 322 
AB3 4 5 O TRP C 341 ? O TRP D 321 N VAL C 281 ? N VAL D 261 
AB3 5 6 N ALA C 280 ? N ALA D 260 O VAL C 355 ? O VAL D 335 
AB4 1 2 O THR C 267 ? O THR D 247 N VAL C 250 ? N VAL D 230 
AB4 2 3 N GLU C 251 ? N GLU D 231 O GLU C 430 ? O GLU D 410 
AB5 1 2 O MET C 463 ? O MET D 443 N VAL C 455 ? N VAL D 435 
AB5 2 3 N THR C 456 ? N THR D 436 O LEU C 504 ? O LEU D 484 
AB5 3 4 O ALA C 503 ? O ALA D 483 N THR C 496 ? N THR D 476 
AB6 1 2 O ASN C 604 ? O ASN D 584 N TYR C 596 ? N TYR D 576 
AB6 2 3 N TYR C 595 ? N TYR D 575 O VAL C 633 ? O VAL D 613 
AB7 1 2 O ASN C 604 ? O ASN D 584 N TYR C 596 ? N TYR D 576 
AB7 2 3 N LEU C 590 ? N LEU D 570 O LEU C 676 ? O LEU D 656 
AB8 1 2 N ILE C 612 ? N ILE D 592 O LYS C 625 ? O LYS D 605 
AB9 1 2 O VAL C 836 ? O VAL D 816 N THR C 820 ? N THR D 800 
AB9 2 3 N GLN C 825 ? N GLN D 805 O LEU C 875 ? O LEU D 855 
AB9 3 4 O LEU C 874 ? O LEU D 854 N VAL C 870 ? N VAL D 850 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  900 ? 5  'binding site for residue ZN A 900'  
AC2 Software A LSS 901 ? 21 'binding site for residue LSS A 901' 
AC3 Software A VRT 902 ? 13 'binding site for residue VRT A 902' 
AC4 Software B MG  101 ? 2  'binding site for residue MG B 101'  
AC5 Software D ZN  900 ? 5  'binding site for residue ZN D 900'  
AC6 Software D LSS 901 ? 21 'binding site for residue LSS D 901' 
AC7 Software D VRT 902 ? 13 'binding site for residue VRT D 902' 
AC8 Software E MG  101 ? 3  'binding site for residue MG E 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  CYS A 179 ? CYS A 159 . ? 1_555 ? 
2  AC1 5  ASP A 182 ? ASP A 162 . ? 1_555 ? 
3  AC1 5  CYS A 196 ? CYS A 176 . ? 1_555 ? 
4  AC1 5  CYS A 199 ? CYS A 179 . ? 1_555 ? 
5  AC1 5  THR A 201 ? THR A 181 . ? 1_555 ? 
6  AC2 21 MET A 60  ? MET A 40  . ? 1_555 ? 
7  AC2 21 LEU A 61  ? LEU A 41  . ? 1_555 ? 
8  AC2 21 PRO A 62  ? PRO A 42  . ? 1_555 ? 
9  AC2 21 TYR A 63  ? TYR A 43  . ? 1_555 ? 
10 AC2 21 HIS A 69  ? HIS A 49  . ? 1_555 ? 
11 AC2 21 GLY A 71  ? GLY A 51  . ? 1_555 ? 
12 AC2 21 HIS A 72  ? HIS A 52  . ? 1_555 ? 
13 AC2 21 ASN A 75  ? ASN A 55  . ? 1_555 ? 
14 AC2 21 TYR A 76  ? TYR A 56  . ? 1_555 ? 
15 AC2 21 ASP A 100 ? ASP A 80  . ? 1_555 ? 
16 AC2 21 GLY A 549 ? GLY A 529 . ? 1_555 ? 
17 AC2 21 GLY A 550 ? GLY A 530 . ? 1_555 ? 
18 AC2 21 GLU A 552 ? GLU A 532 . ? 1_555 ? 
19 AC2 21 HIS A 553 ? HIS A 533 . ? 1_555 ? 
20 AC2 21 HIS A 557 ? HIS A 537 . ? 1_555 ? 
21 AC2 21 GLN A 586 ? GLN A 566 . ? 1_555 ? 
22 AC2 21 GLY A 587 ? GLY A 567 . ? 1_555 ? 
23 AC2 21 MET A 588 ? MET A 568 . ? 1_555 ? 
24 AC2 21 VAL A 589 ? VAL A 569 . ? 1_555 ? 
25 AC2 21 MET A 640 ? MET A 620 . ? 1_555 ? 
26 AC2 21 A   B 87  ? A   B 76  . ? 1_555 ? 
27 AC3 13 THR A 267 ? THR A 247 . ? 1_555 ? 
28 AC3 13 THR A 268 ? THR A 248 . ? 1_555 ? 
29 AC3 13 VAL A 346 ? VAL A 326 . ? 1_555 ? 
30 AC3 13 LEU A 347 ? LEU A 327 . ? 1_555 ? 
31 AC3 13 TYR A 350 ? TYR A 330 . ? 1_555 ? 
32 AC3 13 VAL A 355 ? VAL A 335 . ? 1_555 ? 
33 AC3 13 MET A 356 ? MET A 336 . ? 1_555 ? 
34 AC3 13 ALA A 357 ? ALA A 337 . ? 1_555 ? 
35 AC3 13 VAL A 358 ? VAL A 338 . ? 1_555 ? 
36 AC3 13 HIS A 361 ? HIS A 341 . ? 1_555 ? 
37 AC3 13 ASP A 362 ? ASP A 342 . ? 1_555 ? 
38 AC3 13 ARG A 364 ? ARG A 344 . ? 1_555 ? 
39 AC3 13 ASP A 365 ? ASP A 345 . ? 1_555 ? 
40 AC4 2  U   B 8   ? U   B 8   . ? 1_555 ? 
41 AC4 2  G   B 9   ? G   B 9   . ? 1_555 ? 
42 AC5 5  CYS C 179 ? CYS D 159 . ? 1_555 ? 
43 AC5 5  ASP C 182 ? ASP D 162 . ? 1_555 ? 
44 AC5 5  CYS C 196 ? CYS D 176 . ? 1_555 ? 
45 AC5 5  CYS C 199 ? CYS D 179 . ? 1_555 ? 
46 AC5 5  THR C 201 ? THR D 181 . ? 1_555 ? 
47 AC6 21 MET C 60  ? MET D 40  . ? 1_555 ? 
48 AC6 21 LEU C 61  ? LEU D 41  . ? 1_555 ? 
49 AC6 21 PRO C 62  ? PRO D 42  . ? 1_555 ? 
50 AC6 21 TYR C 63  ? TYR D 43  . ? 1_555 ? 
51 AC6 21 HIS C 69  ? HIS D 49  . ? 1_555 ? 
52 AC6 21 GLY C 71  ? GLY D 51  . ? 1_555 ? 
53 AC6 21 HIS C 72  ? HIS D 52  . ? 1_555 ? 
54 AC6 21 ASN C 75  ? ASN D 55  . ? 1_555 ? 
55 AC6 21 TYR C 76  ? TYR D 56  . ? 1_555 ? 
56 AC6 21 ASP C 100 ? ASP D 80  . ? 1_555 ? 
57 AC6 21 SER C 516 ? SER D 496 . ? 1_555 ? 
58 AC6 21 GLY C 549 ? GLY D 529 . ? 1_555 ? 
59 AC6 21 GLY C 550 ? GLY D 530 . ? 1_555 ? 
60 AC6 21 GLU C 552 ? GLU D 532 . ? 1_555 ? 
61 AC6 21 HIS C 553 ? HIS D 533 . ? 1_555 ? 
62 AC6 21 HIS C 557 ? HIS D 537 . ? 1_555 ? 
63 AC6 21 GLN C 586 ? GLN D 566 . ? 1_555 ? 
64 AC6 21 MET C 588 ? MET D 568 . ? 1_555 ? 
65 AC6 21 VAL C 589 ? VAL D 569 . ? 1_555 ? 
66 AC6 21 MET C 640 ? MET D 620 . ? 1_555 ? 
67 AC6 21 A   D 87  ? A   E 76  . ? 1_555 ? 
68 AC7 13 TYR C 266 ? TYR D 246 . ? 1_555 ? 
69 AC7 13 THR C 267 ? THR D 247 . ? 1_555 ? 
70 AC7 13 THR C 268 ? THR D 248 . ? 1_555 ? 
71 AC7 13 ARG C 269 ? ARG D 249 . ? 1_555 ? 
72 AC7 13 VAL C 346 ? VAL D 326 . ? 1_555 ? 
73 AC7 13 LEU C 347 ? LEU D 327 . ? 1_555 ? 
74 AC7 13 TYR C 350 ? TYR D 330 . ? 1_555 ? 
75 AC7 13 VAL C 355 ? VAL D 335 . ? 1_555 ? 
76 AC7 13 MET C 356 ? MET D 336 . ? 1_555 ? 
77 AC7 13 VAL C 358 ? VAL D 338 . ? 1_555 ? 
78 AC7 13 HIS C 361 ? HIS D 341 . ? 1_555 ? 
79 AC7 13 ARG C 364 ? ARG D 344 . ? 1_555 ? 
80 AC7 13 ASP C 365 ? ASP D 345 . ? 1_555 ? 
81 AC8 3  U   D 8   ? U   E 8   . ? 1_555 ? 
82 AC8 3  G   D 9   ? G   E 9   . ? 1_555 ? 
83 AC8 3  U   D 11  ? U   E 11  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5ON2 
_atom_sites.fract_transf_matrix[1][1]   0.006264 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001622 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014160 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004485 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1 19  ? 11.472  -23.579 56.612  1.00 111.77 ? -1  SER A N     1 
ATOM   2     C  CA    . SER A 1 19  ? 10.656  -23.989 55.424  1.00 111.61 ? -1  SER A CA    1 
ATOM   3     C  C     . SER A 1 19  ? 9.152   -23.968 55.733  1.00 112.93 ? -1  SER A C     1 
ATOM   4     O  O     . SER A 1 19  ? 8.518   -25.018 55.871  1.00 114.56 ? -1  SER A O     1 
ATOM   5     C  CB    . SER A 1 19  ? 11.091  -25.365 54.926  1.00 110.28 ? -1  SER A CB    1 
ATOM   6     N  N     . HIS A 1 20  ? 8.598   -22.760 55.844  1.00 113.04 ? 0   HIS A N     1 
ATOM   7     C  CA    . HIS A 1 20  ? 7.172   -22.566 56.136  1.00 112.69 ? 0   HIS A CA    1 
ATOM   8     C  C     . HIS A 1 20  ? 6.692   -21.189 55.666  1.00 113.05 ? 0   HIS A C     1 
ATOM   9     O  O     . HIS A 1 20  ? 7.356   -20.181 55.923  1.00 114.09 ? 0   HIS A O     1 
ATOM   10    C  CB    . HIS A 1 20  ? 6.916   -22.732 57.626  1.00 111.98 ? 0   HIS A CB    1 
ATOM   11    N  N     . MET A 1 21  ? 5.540   -21.156 54.990  1.00 112.00 ? 1   MET A N     1 
ATOM   12    C  CA    . MET A 1 21  ? 4.982   -19.917 54.435  1.00 110.67 ? 1   MET A CA    1 
ATOM   13    C  C     . MET A 1 21  ? 3.982   -19.289 55.402  1.00 108.00 ? 1   MET A C     1 
ATOM   14    O  O     . MET A 1 21  ? 3.095   -19.976 55.911  1.00 106.61 ? 1   MET A O     1 
ATOM   15    C  CB    . MET A 1 21  ? 4.276   -20.192 53.101  1.00 111.43 ? 1   MET A CB    1 
ATOM   16    C  CG    . MET A 1 21  ? 4.141   -18.964 52.208  1.00 112.66 ? 1   MET A CG    1 
ATOM   17    S  SD    . MET A 1 21  ? 2.797   -19.045 51.002  1.00 112.26 ? 1   MET A SD    1 
ATOM   18    C  CE    . MET A 1 21  ? 3.389   -20.306 49.878  1.00 111.77 ? 1   MET A CE    1 
ATOM   19    N  N     . GLN A 1 22  ? 4.127   -17.986 55.639  1.00 107.24 ? 2   GLN A N     1 
ATOM   20    C  CA    . GLN A 1 22  ? 3.134   -17.215 56.397  1.00 108.28 ? 2   GLN A CA    1 
ATOM   21    C  C     . GLN A 1 22  ? 1.934   -16.884 55.512  1.00 105.66 ? 2   GLN A C     1 
ATOM   22    O  O     . GLN A 1 22  ? 2.030   -16.910 54.282  1.00 104.48 ? 2   GLN A O     1 
ATOM   23    C  CB    . GLN A 1 22  ? 3.742   -15.920 56.962  1.00 110.84 ? 2   GLN A CB    1 
ATOM   24    C  CG    . GLN A 1 22  ? 4.465   -16.092 58.293  1.00 111.96 ? 2   GLN A CG    1 
ATOM   25    C  CD    . GLN A 1 22  ? 3.528   -16.276 59.481  1.00 113.75 ? 2   GLN A CD    1 
ATOM   26    O  OE1   . GLN A 1 22  ? 2.302   -16.259 59.344  1.00 113.65 ? 2   GLN A OE1   1 
ATOM   27    N  NE2   . GLN A 1 22  ? 4.111   -16.454 60.661  1.00 115.74 ? 2   GLN A NE2   1 
ATOM   28    N  N     . GLU A 1 23  ? 0.808   -16.578 56.151  1.00 104.09 ? 3   GLU A N     1 
ATOM   29    C  CA    . GLU A 1 23  ? -0.399  -16.141 55.447  1.00 103.55 ? 3   GLU A CA    1 
ATOM   30    C  C     . GLU A 1 23  ? -0.190  -14.740 54.873  1.00 102.77 ? 3   GLU A C     1 
ATOM   31    O  O     . GLU A 1 23  ? -0.441  -14.506 53.691  1.00 102.86 ? 3   GLU A O     1 
ATOM   32    C  CB    . GLU A 1 23  ? -1.607  -16.148 56.391  1.00 104.41 ? 3   GLU A CB    1 
ATOM   33    C  CG    . GLU A 1 23  ? -2.953  -15.917 55.711  1.00 104.82 ? 3   GLU A CG    1 
ATOM   34    C  CD    . GLU A 1 23  ? -4.087  -15.713 56.700  1.00 104.68 ? 3   GLU A CD    1 
ATOM   35    O  OE1   . GLU A 1 23  ? -4.131  -16.433 57.720  1.00 105.91 ? 3   GLU A OE1   1 
ATOM   36    O  OE2   . GLU A 1 23  ? -4.940  -14.832 56.455  1.00 102.78 ? 3   GLU A OE2   1 
ATOM   37    N  N     . GLN A 1 24  ? 0.274   -13.822 55.720  1.00 102.04 ? 4   GLN A N     1 
ATOM   38    C  CA    . GLN A 1 24  ? 0.505   -12.431 55.330  1.00 101.15 ? 4   GLN A CA    1 
ATOM   39    C  C     . GLN A 1 24  ? 1.804   -12.294 54.528  1.00 98.54  ? 4   GLN A C     1 
ATOM   40    O  O     . GLN A 1 24  ? 2.811   -12.928 54.854  1.00 97.99  ? 4   GLN A O     1 
ATOM   41    C  CB    . GLN A 1 24  ? 0.555   -11.542 56.579  1.00 103.15 ? 4   GLN A CB    1 
ATOM   42    C  CG    . GLN A 1 24  ? 0.458   -10.046 56.310  1.00 105.28 ? 4   GLN A CG    1 
ATOM   43    C  CD    . GLN A 1 24  ? 0.562   -9.218  57.580  1.00 107.14 ? 4   GLN A CD    1 
ATOM   44    O  OE1   . GLN A 1 24  ? 1.438   -8.361  57.707  1.00 107.65 ? 4   GLN A OE1   1 
ATOM   45    N  NE2   . GLN A 1 24  ? -0.330  -9.476  58.532  1.00 107.86 ? 4   GLN A NE2   1 
ATOM   46    N  N     . TYR A 1 25  ? 1.765   -11.472 53.479  1.00 95.81  ? 5   TYR A N     1 
ATOM   47    C  CA    . TYR A 1 25  ? 2.947   -11.157 52.668  1.00 94.13  ? 5   TYR A CA    1 
ATOM   48    C  C     . TYR A 1 25  ? 3.751   -10.056 53.361  1.00 93.75  ? 5   TYR A C     1 
ATOM   49    O  O     . TYR A 1 25  ? 3.285   -8.918  53.459  1.00 94.44  ? 5   TYR A O     1 
ATOM   50    C  CB    . TYR A 1 25  ? 2.528   -10.712 51.256  1.00 93.26  ? 5   TYR A CB    1 
ATOM   51    C  CG    . TYR A 1 25  ? 3.654   -10.180 50.380  1.00 92.16  ? 5   TYR A CG    1 
ATOM   52    C  CD1   . TYR A 1 25  ? 4.797   -10.943 50.130  1.00 91.50  ? 5   TYR A CD1   1 
ATOM   53    C  CD2   . TYR A 1 25  ? 3.567   -8.917  49.784  1.00 90.95  ? 5   TYR A CD2   1 
ATOM   54    C  CE1   . TYR A 1 25  ? 5.824   -10.459 49.325  1.00 90.34  ? 5   TYR A CE1   1 
ATOM   55    C  CE2   . TYR A 1 25  ? 4.587   -8.426  48.978  1.00 89.87  ? 5   TYR A CE2   1 
ATOM   56    C  CZ    . TYR A 1 25  ? 5.713   -9.198  48.751  1.00 89.77  ? 5   TYR A CZ    1 
ATOM   57    O  OH    . TYR A 1 25  ? 6.724   -8.711  47.953  1.00 89.02  ? 5   TYR A OH    1 
ATOM   58    N  N     . ARG A 1 26  ? 4.945   -10.406 53.845  1.00 92.37  ? 6   ARG A N     1 
ATOM   59    C  CA    . ARG A 1 26  ? 5.844   -9.459  54.511  1.00 92.81  ? 6   ARG A CA    1 
ATOM   60    C  C     . ARG A 1 26  ? 7.131   -9.291  53.692  1.00 92.10  ? 6   ARG A C     1 
ATOM   61    O  O     . ARG A 1 26  ? 7.987   -10.177 53.713  1.00 92.60  ? 6   ARG A O     1 
ATOM   62    C  CB    . ARG A 1 26  ? 6.174   -9.943  55.924  1.00 94.54  ? 6   ARG A CB    1 
ATOM   63    C  CG    . ARG A 1 26  ? 4.970   -9.980  56.855  1.00 96.69  ? 6   ARG A CG    1 
ATOM   64    C  CD    . ARG A 1 26  ? 5.379   -9.869  58.315  1.00 98.21  ? 6   ARG A CD    1 
ATOM   65    N  NE    . ARG A 1 26  ? 4.240   -10.036 59.220  1.00 98.96  ? 6   ARG A NE    1 
ATOM   66    C  CZ    . ARG A 1 26  ? 3.688   -11.203 59.567  1.00 99.71  ? 6   ARG A CZ    1 
ATOM   67    N  NH1   . ARG A 1 26  ? 4.148   -12.364 59.094  1.00 99.46  ? 6   ARG A NH1   1 
ATOM   68    N  NH2   . ARG A 1 26  ? 2.651   -11.210 60.402  1.00 100.80 ? 6   ARG A NH2   1 
ATOM   69    N  N     . PRO A 1 27  ? 7.264   -8.164  52.954  1.00 90.55  ? 7   PRO A N     1 
ATOM   70    C  CA    . PRO A 1 27  ? 8.476   -7.915  52.153  1.00 89.36  ? 7   PRO A CA    1 
ATOM   71    C  C     . PRO A 1 27  ? 9.768   -7.796  52.967  1.00 88.99  ? 7   PRO A C     1 
ATOM   72    O  O     . PRO A 1 27  ? 10.782  -8.382  52.586  1.00 87.73  ? 7   PRO A O     1 
ATOM   73    C  CB    . PRO A 1 27  ? 8.174   -6.583  51.451  1.00 89.78  ? 7   PRO A CB    1 
ATOM   74    C  CG    . PRO A 1 27  ? 6.695   -6.464  51.457  1.00 89.94  ? 7   PRO A CG    1 
ATOM   75    C  CD    . PRO A 1 27  ? 6.233   -7.136  52.710  1.00 90.14  ? 7   PRO A CD    1 
ATOM   76    N  N     . GLU A 1 28  ? 9.718   -7.038  54.063  1.00 90.00  ? 8   GLU A N     1 
ATOM   77    C  CA    . GLU A 1 28  ? 10.888  -6.791  54.929  1.00 90.82  ? 8   GLU A CA    1 
ATOM   78    C  C     . GLU A 1 28  ? 11.629  -8.053  55.400  1.00 90.34  ? 8   GLU A C     1 
ATOM   79    O  O     . GLU A 1 28  ? 12.854  -8.036  55.538  1.00 90.05  ? 8   GLU A O     1 
ATOM   80    C  CB    . GLU A 1 28  ? 10.517  -5.905  56.138  1.00 91.52  ? 8   GLU A CB    1 
ATOM   81    C  CG    . GLU A 1 28  ? 9.546   -6.494  57.164  1.00 91.82  ? 8   GLU A CG    1 
ATOM   82    C  CD    . GLU A 1 28  ? 8.088   -6.192  56.863  1.00 92.74  ? 8   GLU A CD    1 
ATOM   83    O  OE1   . GLU A 1 28  ? 7.641   -6.467  55.729  1.00 93.34  ? 8   GLU A OE1   1 
ATOM   84    O  OE2   . GLU A 1 28  ? 7.383   -5.687  57.761  1.00 93.98  ? 8   GLU A OE2   1 
ATOM   85    N  N     . GLU A 1 29  ? 10.884  -9.133  55.631  1.00 90.04  ? 9   GLU A N     1 
ATOM   86    C  CA    . GLU A 1 29  ? 11.460  -10.424 56.029  1.00 90.19  ? 9   GLU A CA    1 
ATOM   87    C  C     . GLU A 1 29  ? 12.036  -11.198 54.837  1.00 88.66  ? 9   GLU A C     1 
ATOM   88    O  O     . GLU A 1 29  ? 13.067  -11.861 54.967  1.00 87.34  ? 9   GLU A O     1 
ATOM   89    C  CB    . GLU A 1 29  ? 10.407  -11.277 56.745  1.00 91.44  ? 9   GLU A CB    1 
ATOM   90    C  CG    . GLU A 1 29  ? 9.870   -10.644 58.025  1.00 92.70  ? 9   GLU A CG    1 
ATOM   91    C  CD    . GLU A 1 29  ? 8.813   -11.483 58.730  1.00 92.99  ? 9   GLU A CD    1 
ATOM   92    O  OE1   . GLU A 1 29  ? 8.440   -12.564 58.221  1.00 93.29  ? 9   GLU A OE1   1 
ATOM   93    O  OE2   . GLU A 1 29  ? 8.349   -11.050 59.806  1.00 92.80  ? 9   GLU A OE2   1 
ATOM   94    N  N     . ILE A 1 30  ? 11.367  -11.106 53.687  1.00 87.88  ? 10  ILE A N     1 
ATOM   95    C  CA    . ILE A 1 30  ? 11.740  -11.860 52.482  1.00 86.72  ? 10  ILE A CA    1 
ATOM   96    C  C     . ILE A 1 30  ? 12.929  -11.240 51.745  1.00 84.97  ? 10  ILE A C     1 
ATOM   97    O  O     . ILE A 1 30  ? 13.932  -11.914 51.506  1.00 84.89  ? 10  ILE A O     1 
ATOM   98    C  CB    . ILE A 1 30  ? 10.547  -11.972 51.495  1.00 86.93  ? 10  ILE A CB    1 
ATOM   99    C  CG1   . ILE A 1 30  ? 9.376   -12.725 52.143  1.00 88.45  ? 10  ILE A CG1   1 
ATOM   100   C  CG2   . ILE A 1 30  ? 10.961  -12.676 50.204  1.00 86.34  ? 10  ILE A CG2   1 
ATOM   101   C  CD1   . ILE A 1 30  ? 8.037   -12.475 51.479  1.00 89.37  ? 10  ILE A CD1   1 
ATOM   102   N  N     . GLU A 1 31  ? 12.803  -9.961  51.393  1.00 83.30  ? 11  GLU A N     1 
ATOM   103   C  CA    . GLU A 1 31  ? 13.681  -9.320  50.396  1.00 81.99  ? 11  GLU A CA    1 
ATOM   104   C  C     . GLU A 1 31  ? 15.160  -9.260  50.786  1.00 81.76  ? 11  GLU A C     1 
ATOM   105   O  O     . GLU A 1 31  ? 16.026  -9.568  49.967  1.00 80.28  ? 11  GLU A O     1 
ATOM   106   C  CB    . GLU A 1 31  ? 13.169  -7.917  50.049  1.00 80.74  ? 11  GLU A CB    1 
ATOM   107   C  CG    . GLU A 1 31  ? 11.816  -7.925  49.351  1.00 79.74  ? 11  GLU A CG    1 
ATOM   108   C  CD    . GLU A 1 31  ? 11.403  -6.571  48.812  1.00 78.59  ? 11  GLU A CD    1 
ATOM   109   O  OE1   . GLU A 1 31  ? 11.924  -5.536  49.283  1.00 76.80  ? 11  GLU A OE1   1 
ATOM   110   O  OE2   . GLU A 1 31  ? 10.541  -6.540  47.911  1.00 78.58  ? 11  GLU A OE2   1 
ATOM   111   N  N     . SER A 1 32  ? 15.439  -8.864  52.027  1.00 83.18  ? 12  SER A N     1 
ATOM   112   C  CA    . SER A 1 32  ? 16.818  -8.790  52.531  1.00 84.37  ? 12  SER A CA    1 
ATOM   113   C  C     . SER A 1 32  ? 17.486  -10.165 52.628  1.00 83.98  ? 12  SER A C     1 
ATOM   114   O  O     . SER A 1 32  ? 18.698  -10.281 52.439  1.00 82.34  ? 12  SER A O     1 
ATOM   115   C  CB    . SER A 1 32  ? 16.860  -8.101  53.899  1.00 85.60  ? 12  SER A CB    1 
ATOM   116   O  OG    . SER A 1 32  ? 16.098  -8.813  54.858  1.00 87.28  ? 12  SER A OG    1 
ATOM   117   N  N     . LYS A 1 33  ? 16.690  -11.193 52.923  1.00 85.79  ? 13  LYS A N     1 
ATOM   118   C  CA    . LYS A 1 33  ? 17.183  -12.571 53.023  1.00 87.09  ? 13  LYS A CA    1 
ATOM   119   C  C     . LYS A 1 33  ? 17.557  -13.158 51.655  1.00 85.75  ? 13  LYS A C     1 
ATOM   120   O  O     . LYS A 1 33  ? 18.549  -13.882 51.544  1.00 86.11  ? 13  LYS A O     1 
ATOM   121   C  CB    . LYS A 1 33  ? 16.143  -13.459 53.719  1.00 89.08  ? 13  LYS A CB    1 
ATOM   122   C  CG    . LYS A 1 33  ? 16.689  -14.792 54.216  1.00 90.97  ? 13  LYS A CG    1 
ATOM   123   C  CD    . LYS A 1 33  ? 15.739  -15.485 55.187  1.00 91.99  ? 13  LYS A CD    1 
ATOM   124   C  CE    . LYS A 1 33  ? 14.515  -16.080 54.499  1.00 92.87  ? 13  LYS A CE    1 
ATOM   125   N  NZ    . LYS A 1 33  ? 14.825  -17.303 53.704  1.00 93.45  ? 13  LYS A NZ    1 
ATOM   126   N  N     . VAL A 1 34  ? 16.767  -12.841 50.628  1.00 84.04  ? 14  VAL A N     1 
ATOM   127   C  CA    . VAL A 1 34  ? 17.037  -13.291 49.253  1.00 82.85  ? 14  VAL A CA    1 
ATOM   128   C  C     . VAL A 1 34  ? 18.195  -12.505 48.624  1.00 82.59  ? 14  VAL A C     1 
ATOM   129   O  O     . VAL A 1 34  ? 18.987  -13.071 47.868  1.00 82.35  ? 14  VAL A O     1 
ATOM   130   C  CB    . VAL A 1 34  ? 15.775  -13.191 48.357  1.00 82.72  ? 14  VAL A CB    1 
ATOM   131   C  CG1   . VAL A 1 34  ? 16.087  -13.563 46.909  1.00 82.02  ? 14  VAL A CG1   1 
ATOM   132   C  CG2   . VAL A 1 34  ? 14.669  -14.092 48.895  1.00 83.93  ? 14  VAL A CG2   1 
ATOM   133   N  N     . GLN A 1 35  ? 18.280  -11.207 48.922  1.00 82.41  ? 15  GLN A N     1 
ATOM   134   C  CA    . GLN A 1 35  ? 19.389  -10.361 48.443  1.00 81.48  ? 15  GLN A CA    1 
ATOM   135   C  C     . GLN A 1 35  ? 20.763  -10.841 48.928  1.00 80.53  ? 15  GLN A C     1 
ATOM   136   O  O     . GLN A 1 35  ? 21.745  -10.749 48.190  1.00 79.37  ? 15  GLN A O     1 
ATOM   137   C  CB    . GLN A 1 35  ? 19.172  -8.896  48.846  1.00 81.28  ? 15  GLN A CB    1 
ATOM   138   C  CG    . GLN A 1 35  ? 18.139  -8.173  47.990  1.00 80.78  ? 15  GLN A CG    1 
ATOM   139   C  CD    . GLN A 1 35  ? 17.659  -6.866  48.596  1.00 80.78  ? 15  GLN A CD    1 
ATOM   140   O  OE1   . GLN A 1 35  ? 18.247  -6.346  49.546  1.00 81.69  ? 15  GLN A OE1   1 
ATOM   141   N  NE2   . GLN A 1 35  ? 16.586  -6.322  48.038  1.00 80.73  ? 15  GLN A NE2   1 
ATOM   142   N  N     . LEU A 1 36  ? 20.819  -11.341 50.162  1.00 80.66  ? 16  LEU A N     1 
ATOM   143   C  CA    . LEU A 1 36  ? 22.036  -11.948 50.713  1.00 80.81  ? 16  LEU A CA    1 
ATOM   144   C  C     . LEU A 1 36  ? 22.409  -13.239 49.976  1.00 80.21  ? 16  LEU A C     1 
ATOM   145   O  O     . LEU A 1 36  ? 23.587  -13.481 49.709  1.00 79.33  ? 16  LEU A O     1 
ATOM   146   C  CB    . LEU A 1 36  ? 21.863  -12.229 52.212  1.00 81.27  ? 16  LEU A CB    1 
ATOM   147   C  CG    . LEU A 1 36  ? 23.037  -12.849 52.982  1.00 81.73  ? 16  LEU A CG    1 
ATOM   148   C  CD1   . LEU A 1 36  ? 24.291  -11.993 52.881  1.00 81.80  ? 16  LEU A CD1   1 
ATOM   149   C  CD2   . LEU A 1 36  ? 22.649  -13.060 54.437  1.00 82.12  ? 16  LEU A CD2   1 
ATOM   150   N  N     . HIS A 1 37  ? 21.403  -14.058 49.662  1.00 80.10  ? 17  HIS A N     1 
ATOM   151   C  CA    . HIS A 1 37  ? 21.601  -15.301 48.905  1.00 80.90  ? 17  HIS A CA    1 
ATOM   152   C  C     . HIS A 1 37  ? 22.230  -15.047 47.529  1.00 82.26  ? 17  HIS A C     1 
ATOM   153   O  O     . HIS A 1 37  ? 23.115  -15.793 47.108  1.00 83.83  ? 17  HIS A O     1 
ATOM   154   C  CB    . HIS A 1 37  ? 20.272  -16.061 48.759  1.00 80.52  ? 17  HIS A CB    1 
ATOM   155   C  CG    . HIS A 1 37  ? 20.361  -17.296 47.916  1.00 80.10  ? 17  HIS A CG    1 
ATOM   156   N  ND1   . HIS A 1 37  ? 20.703  -18.527 48.432  1.00 80.56  ? 17  HIS A ND1   1 
ATOM   157   C  CD2   . HIS A 1 37  ? 20.145  -17.490 46.593  1.00 80.02  ? 17  HIS A CD2   1 
ATOM   158   C  CE1   . HIS A 1 37  ? 20.697  -19.425 47.463  1.00 81.02  ? 17  HIS A CE1   1 
ATOM   159   N  NE2   . HIS A 1 37  ? 20.363  -18.821 46.336  1.00 80.43  ? 17  HIS A NE2   1 
ATOM   160   N  N     . TRP A 1 38  ? 21.770  -14.002 46.840  1.00 83.32  ? 18  TRP A N     1 
ATOM   161   C  CA    . TRP A 1 38  ? 22.345  -13.615 45.545  1.00 83.91  ? 18  TRP A CA    1 
ATOM   162   C  C     . TRP A 1 38  ? 23.799  -13.146 45.670  1.00 86.24  ? 18  TRP A C     1 
ATOM   163   O  O     . TRP A 1 38  ? 24.627  -13.468 44.814  1.00 85.95  ? 18  TRP A O     1 
ATOM   164   C  CB    . TRP A 1 38  ? 21.507  -12.520 44.867  1.00 82.96  ? 18  TRP A CB    1 
ATOM   165   C  CG    . TRP A 1 38  ? 20.149  -12.962 44.383  1.00 81.41  ? 18  TRP A CG    1 
ATOM   166   C  CD1   . TRP A 1 38  ? 19.801  -14.195 43.905  1.00 81.02  ? 18  TRP A CD1   1 
ATOM   167   C  CD2   . TRP A 1 38  ? 18.972  -12.150 44.285  1.00 80.40  ? 18  TRP A CD2   1 
ATOM   168   N  NE1   . TRP A 1 38  ? 18.476  -14.207 43.540  1.00 80.81  ? 18  TRP A NE1   1 
ATOM   169   C  CE2   . TRP A 1 38  ? 17.943  -12.965 43.760  1.00 80.59  ? 18  TRP A CE2   1 
ATOM   170   C  CE3   . TRP A 1 38  ? 18.684  -10.814 44.598  1.00 79.93  ? 18  TRP A CE3   1 
ATOM   171   C  CZ2   . TRP A 1 38  ? 16.644  -12.489 43.542  1.00 80.31  ? 18  TRP A CZ2   1 
ATOM   172   C  CZ3   . TRP A 1 38  ? 17.391  -10.339 44.382  1.00 80.27  ? 18  TRP A CZ3   1 
ATOM   173   C  CH2   . TRP A 1 38  ? 16.387  -11.178 43.859  1.00 80.27  ? 18  TRP A CH2   1 
ATOM   174   N  N     . ASP A 1 39  ? 24.096  -12.387 46.726  1.00 89.56  ? 19  ASP A N     1 
ATOM   175   C  CA    . ASP A 1 39  ? 25.463  -11.925 47.004  1.00 91.51  ? 19  ASP A CA    1 
ATOM   176   C  C     . ASP A 1 39  ? 26.395  -13.080 47.367  1.00 92.90  ? 19  ASP A C     1 
ATOM   177   O  O     . ASP A 1 39  ? 27.493  -13.190 46.816  1.00 92.46  ? 19  ASP A O     1 
ATOM   178   C  CB    . ASP A 1 39  ? 25.477  -10.885 48.137  1.00 92.37  ? 19  ASP A CB    1 
ATOM   179   C  CG    . ASP A 1 39  ? 24.896  -9.543  47.716  1.00 93.56  ? 19  ASP A CG    1 
ATOM   180   O  OD1   . ASP A 1 39  ? 24.085  -9.497  46.766  1.00 94.71  ? 19  ASP A OD1   1 
ATOM   181   O  OD2   . ASP A 1 39  ? 25.251  -8.525  48.348  1.00 93.79  ? 19  ASP A OD2   1 
ATOM   182   N  N     . GLU A 1 40  ? 25.947  -13.934 48.288  1.00 94.96  ? 20  GLU A N     1 
ATOM   183   C  CA    . GLU A 1 40  ? 26.766  -15.043 48.798  1.00 96.93  ? 20  GLU A CA    1 
ATOM   184   C  C     . GLU A 1 40  ? 27.039  -16.136 47.759  1.00 95.12  ? 20  GLU A C     1 
ATOM   185   O  O     . GLU A 1 40  ? 28.160  -16.639 47.676  1.00 96.63  ? 20  GLU A O     1 
ATOM   186   C  CB    . GLU A 1 40  ? 26.135  -15.652 50.058  1.00 99.87  ? 20  GLU A CB    1 
ATOM   187   C  CG    . GLU A 1 40  ? 26.242  -14.751 51.283  1.00 102.83 ? 20  GLU A CG    1 
ATOM   188   C  CD    . GLU A 1 40  ? 25.658  -15.368 52.543  1.00 105.16 ? 20  GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1 40  ? 24.614  -16.053 52.457  1.00 107.22 ? 20  GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1 40  ? 26.240  -15.157 53.629  1.00 106.51 ? 20  GLU A OE2   1 
ATOM   191   N  N     . LYS A 1 41  ? 26.025  -16.493 46.972  1.00 92.98  ? 21  LYS A N     1 
ATOM   192   C  CA    . LYS A 1 41  ? 26.176  -17.514 45.926  1.00 92.76  ? 21  LYS A CA    1 
ATOM   193   C  C     . LYS A 1 41  ? 26.751  -16.986 44.605  1.00 90.21  ? 21  LYS A C     1 
ATOM   194   O  O     . LYS A 1 41  ? 27.060  -17.785 43.720  1.00 88.63  ? 21  LYS A O     1 
ATOM   195   C  CB    . LYS A 1 41  ? 24.836  -18.215 45.661  1.00 95.25  ? 21  LYS A CB    1 
ATOM   196   C  CG    . LYS A 1 41  ? 24.225  -18.915 46.871  1.00 98.16  ? 21  LYS A CG    1 
ATOM   197   C  CD    . LYS A 1 41  ? 25.135  -19.990 47.457  1.00 100.63 ? 21  LYS A CD    1 
ATOM   198   C  CE    . LYS A 1 41  ? 24.422  -20.842 48.498  1.00 101.68 ? 21  LYS A CE    1 
ATOM   199   N  NZ    . LYS A 1 41  ? 23.588  -21.914 47.887  1.00 102.61 ? 21  LYS A NZ    1 
ATOM   200   N  N     . ARG A 1 42  ? 26.890  -15.662 44.473  1.00 89.64  ? 22  ARG A N     1 
ATOM   201   C  CA    . ARG A 1 42  ? 27.455  -15.019 43.274  1.00 89.68  ? 22  ARG A CA    1 
ATOM   202   C  C     . ARG A 1 42  ? 26.645  -15.360 42.017  1.00 87.28  ? 22  ARG A C     1 
ATOM   203   O  O     . ARG A 1 42  ? 27.207  -15.730 40.982  1.00 86.79  ? 22  ARG A O     1 
ATOM   204   C  CB    . ARG A 1 42  ? 28.938  -15.390 43.087  1.00 92.23  ? 22  ARG A CB    1 
ATOM   205   C  CG    . ARG A 1 42  ? 29.823  -15.145 44.302  1.00 95.02  ? 22  ARG A CG    1 
ATOM   206   C  CD    . ARG A 1 42  ? 31.225  -15.696 44.081  1.00 96.44  ? 22  ARG A CD    1 
ATOM   207   N  NE    . ARG A 1 42  ? 32.102  -15.453 45.229  1.00 97.73  ? 22  ARG A NE    1 
ATOM   208   C  CZ    . ARG A 1 42  ? 32.694  -14.291 45.525  1.00 99.11  ? 22  ARG A CZ    1 
ATOM   209   N  NH1   . ARG A 1 42  ? 32.522  -13.205 44.769  1.00 98.56  ? 22  ARG A NH1   1 
ATOM   210   N  NH2   . ARG A 1 42  ? 33.470  -14.210 46.603  1.00 100.64 ? 22  ARG A NH2   1 
ATOM   211   N  N     . THR A 1 43  ? 25.323  -15.220 42.123  1.00 85.22  ? 23  THR A N     1 
ATOM   212   C  CA    . THR A 1 43  ? 24.389  -15.654 41.074  1.00 83.23  ? 23  THR A CA    1 
ATOM   213   C  C     . THR A 1 43  ? 24.567  -14.882 39.765  1.00 82.26  ? 23  THR A C     1 
ATOM   214   O  O     . THR A 1 43  ? 24.571  -15.480 38.685  1.00 81.01  ? 23  THR A O     1 
ATOM   215   C  CB    . THR A 1 43  ? 22.916  -15.520 41.532  1.00 82.16  ? 23  THR A CB    1 
ATOM   216   O  OG1   . THR A 1 43  ? 22.777  -15.996 42.876  1.00 81.51  ? 23  THR A OG1   1 
ATOM   217   C  CG2   . THR A 1 43  ? 21.980  -16.316 40.622  1.00 82.59  ? 23  THR A CG2   1 
ATOM   218   N  N     . PHE A 1 44  ? 24.718  -13.562 39.875  1.00 81.70  ? 24  PHE A N     1 
ATOM   219   C  CA    . PHE A 1 44  ? 24.821  -12.671 38.712  1.00 81.54  ? 24  PHE A CA    1 
ATOM   220   C  C     . PHE A 1 44  ? 26.259  -12.298 38.324  1.00 82.62  ? 24  PHE A C     1 
ATOM   221   O  O     . PHE A 1 44  ? 26.458  -11.468 37.433  1.00 82.10  ? 24  PHE A O     1 
ATOM   222   C  CB    . PHE A 1 44  ? 23.978  -11.417 38.956  1.00 80.43  ? 24  PHE A CB    1 
ATOM   223   C  CG    . PHE A 1 44  ? 22.551  -11.722 39.311  1.00 79.13  ? 24  PHE A CG    1 
ATOM   224   C  CD1   . PHE A 1 44  ? 21.658  -12.154 38.334  1.00 78.37  ? 24  PHE A CD1   1 
ATOM   225   C  CD2   . PHE A 1 44  ? 22.106  -11.616 40.625  1.00 78.57  ? 24  PHE A CD2   1 
ATOM   226   C  CE1   . PHE A 1 44  ? 20.343  -12.454 38.658  1.00 78.31  ? 24  PHE A CE1   1 
ATOM   227   C  CE2   . PHE A 1 44  ? 20.791  -11.913 40.953  1.00 78.37  ? 24  PHE A CE2   1 
ATOM   228   C  CZ    . PHE A 1 44  ? 19.909  -12.332 39.970  1.00 78.19  ? 24  PHE A CZ    1 
ATOM   229   N  N     . GLU A 1 45  ? 27.250  -12.902 38.985  1.00 84.36  ? 25  GLU A N     1 
ATOM   230   C  CA    . GLU A 1 45  ? 28.647  -12.792 38.557  1.00 84.53  ? 25  GLU A CA    1 
ATOM   231   C  C     . GLU A 1 45  ? 28.902  -13.816 37.456  1.00 83.28  ? 25  GLU A C     1 
ATOM   232   O  O     . GLU A 1 45  ? 28.557  -14.989 37.611  1.00 82.84  ? 25  GLU A O     1 
ATOM   233   C  CB    . GLU A 1 45  ? 29.609  -13.015 39.727  1.00 86.40  ? 25  GLU A CB    1 
ATOM   234   C  CG    . GLU A 1 45  ? 29.495  -11.970 40.832  1.00 87.62  ? 25  GLU A CG    1 
ATOM   235   C  CD    . GLU A 1 45  ? 30.547  -12.116 41.923  1.00 88.26  ? 25  GLU A CD    1 
ATOM   236   O  OE1   . GLU A 1 45  ? 31.383  -13.046 41.856  1.00 88.77  ? 25  GLU A OE1   1 
ATOM   237   O  OE2   . GLU A 1 45  ? 30.539  -11.293 42.862  1.00 87.75  ? 25  GLU A OE2   1 
ATOM   238   N  N     . VAL A 1 46  ? 29.500  -13.367 36.351  1.00 83.04  ? 26  VAL A N     1 
ATOM   239   C  CA    . VAL A 1 46  ? 29.700  -14.209 35.164  1.00 83.75  ? 26  VAL A CA    1 
ATOM   240   C  C     . VAL A 1 46  ? 31.100  -14.061 34.570  1.00 83.85  ? 26  VAL A C     1 
ATOM   241   O  O     . VAL A 1 46  ? 31.748  -13.022 34.724  1.00 82.82  ? 26  VAL A O     1 
ATOM   242   C  CB    . VAL A 1 46  ? 28.650  -13.915 34.065  1.00 84.01  ? 26  VAL A CB    1 
ATOM   243   C  CG1   . VAL A 1 46  ? 27.265  -14.352 34.523  1.00 83.95  ? 26  VAL A CG1   1 
ATOM   244   C  CG2   . VAL A 1 46  ? 28.644  -12.441 33.665  1.00 84.29  ? 26  VAL A CG2   1 
ATOM   245   N  N     . THR A 1 47  ? 31.540  -15.117 33.887  1.00 84.82  ? 27  THR A N     1 
ATOM   246   C  CA    . THR A 1 47  ? 32.830  -15.163 33.197  1.00 86.08  ? 27  THR A CA    1 
ATOM   247   C  C     . THR A 1 47  ? 32.590  -15.336 31.697  1.00 85.89  ? 27  THR A C     1 
ATOM   248   O  O     . THR A 1 47  ? 31.448  -15.523 31.264  1.00 85.86  ? 27  THR A O     1 
ATOM   249   C  CB    . THR A 1 47  ? 33.695  -16.330 33.718  1.00 86.82  ? 27  THR A CB    1 
ATOM   250   O  OG1   . THR A 1 47  ? 33.031  -17.575 33.469  1.00 87.51  ? 27  THR A OG1   1 
ATOM   251   C  CG2   . THR A 1 47  ? 33.954  -16.189 35.215  1.00 87.11  ? 27  THR A CG2   1 
ATOM   252   N  N     . GLU A 1 48  ? 33.665  -15.283 30.912  1.00 85.89  ? 28  GLU A N     1 
ATOM   253   C  CA    . GLU A 1 48  ? 33.570  -15.390 29.451  1.00 86.51  ? 28  GLU A CA    1 
ATOM   254   C  C     . GLU A 1 48  ? 33.403  -16.854 29.034  1.00 86.87  ? 28  GLU A C     1 
ATOM   255   O  O     . GLU A 1 48  ? 34.338  -17.488 28.537  1.00 88.54  ? 28  GLU A O     1 
ATOM   256   C  CB    . GLU A 1 48  ? 34.791  -14.756 28.768  1.00 86.56  ? 28  GLU A CB    1 
ATOM   257   C  CG    . GLU A 1 48  ? 34.843  -13.236 28.857  1.00 87.11  ? 28  GLU A CG    1 
ATOM   258   C  CD    . GLU A 1 48  ? 35.378  -12.716 30.182  1.00 87.76  ? 28  GLU A CD    1 
ATOM   259   O  OE1   . GLU A 1 48  ? 36.493  -13.115 30.581  1.00 88.34  ? 28  GLU A OE1   1 
ATOM   260   O  OE2   . GLU A 1 48  ? 34.686  -11.899 30.824  1.00 88.23  ? 28  GLU A OE2   1 
ATOM   261   N  N     . ASP A 1 49  ? 32.193  -17.371 29.236  1.00 86.10  ? 29  ASP A N     1 
ATOM   262   C  CA    . ASP A 1 49  ? 31.895  -18.789 29.038  1.00 85.17  ? 29  ASP A CA    1 
ATOM   263   C  C     . ASP A 1 49  ? 31.659  -19.082 27.555  1.00 85.38  ? 29  ASP A C     1 
ATOM   264   O  O     . ASP A 1 49  ? 30.690  -18.601 26.969  1.00 85.90  ? 29  ASP A O     1 
ATOM   265   C  CB    . ASP A 1 49  ? 30.667  -19.183 29.875  1.00 84.27  ? 29  ASP A CB    1 
ATOM   266   C  CG    . ASP A 1 49  ? 30.427  -20.687 29.920  1.00 83.61  ? 29  ASP A CG    1 
ATOM   267   O  OD1   . ASP A 1 49  ? 31.367  -21.473 29.673  1.00 84.12  ? 29  ASP A OD1   1 
ATOM   268   O  OD2   . ASP A 1 49  ? 29.283  -21.086 30.220  1.00 83.54  ? 29  ASP A OD2   1 
ATOM   269   N  N     . GLU A 1 50  ? 32.550  -19.871 26.958  1.00 85.86  ? 30  GLU A N     1 
ATOM   270   C  CA    . GLU A 1 50  ? 32.458  -20.224 25.534  1.00 86.46  ? 30  GLU A CA    1 
ATOM   271   C  C     . GLU A 1 50  ? 31.253  -21.114 25.195  1.00 85.26  ? 30  GLU A C     1 
ATOM   272   O  O     . GLU A 1 50  ? 30.719  -21.027 24.088  1.00 84.41  ? 30  GLU A O     1 
ATOM   273   C  CB    . GLU A 1 50  ? 33.751  -20.908 25.066  1.00 88.66  ? 30  GLU A CB    1 
ATOM   274   C  CG    . GLU A 1 50  ? 34.970  -19.990 25.015  1.00 90.17  ? 30  GLU A CG    1 
ATOM   275   C  CD    . GLU A 1 50  ? 35.022  -19.093 23.783  1.00 90.95  ? 30  GLU A CD    1 
ATOM   276   O  OE1   . GLU A 1 50  ? 34.053  -19.059 22.993  1.00 92.52  ? 30  GLU A OE1   1 
ATOM   277   O  OE2   . GLU A 1 50  ? 36.052  -18.409 23.604  1.00 90.37  ? 30  GLU A OE2   1 
ATOM   278   N  N     . SER A 1 51  ? 30.838  -21.962 26.140  1.00 84.27  ? 31  SER A N     1 
ATOM   279   C  CA    . SER A 1 51  ? 29.725  -22.899 25.927  1.00 83.72  ? 31  SER A CA    1 
ATOM   280   C  C     . SER A 1 51  ? 28.370  -22.196 25.827  1.00 84.19  ? 31  SER A C     1 
ATOM   281   O  O     . SER A 1 51  ? 27.587  -22.475 24.916  1.00 85.32  ? 31  SER A O     1 
ATOM   282   C  CB    . SER A 1 51  ? 29.680  -23.942 27.050  1.00 82.78  ? 31  SER A CB    1 
ATOM   283   O  OG    . SER A 1 51  ? 29.406  -23.338 28.302  1.00 82.54  ? 31  SER A OG    1 
ATOM   284   N  N     . LYS A 1 52  ? 28.103  -21.296 26.772  1.00 83.62  ? 32  LYS A N     1 
ATOM   285   C  CA    . LYS A 1 52  ? 26.863  -20.511 26.786  1.00 82.69  ? 32  LYS A CA    1 
ATOM   286   C  C     . LYS A 1 52  ? 26.854  -19.429 25.704  1.00 80.69  ? 32  LYS A C     1 
ATOM   287   O  O     . LYS A 1 52  ? 27.906  -19.043 25.185  1.00 78.97  ? 32  LYS A O     1 
ATOM   288   C  CB    . LYS A 1 52  ? 26.660  -19.849 28.156  1.00 84.86  ? 32  LYS A CB    1 
ATOM   289   C  CG    . LYS A 1 52  ? 26.142  -20.774 29.251  1.00 86.49  ? 32  LYS A CG    1 
ATOM   290   C  CD    . LYS A 1 52  ? 24.625  -20.706 29.391  1.00 88.20  ? 32  LYS A CD    1 
ATOM   291   C  CE    . LYS A 1 52  ? 24.150  -21.274 30.720  1.00 89.52  ? 32  LYS A CE    1 
ATOM   292   N  NZ    . LYS A 1 52  ? 22.715  -20.964 30.971  1.00 90.34  ? 32  LYS A NZ    1 
ATOM   293   N  N     . GLU A 1 53  ? 25.653  -18.951 25.380  1.00 80.01  ? 33  GLU A N     1 
ATOM   294   C  CA    . GLU A 1 53  ? 25.458  -17.807 24.485  1.00 78.94  ? 33  GLU A CA    1 
ATOM   295   C  C     . GLU A 1 53  ? 25.454  -16.518 25.312  1.00 76.17  ? 33  GLU A C     1 
ATOM   296   O  O     . GLU A 1 53  ? 24.767  -16.434 26.333  1.00 75.93  ? 33  GLU A O     1 
ATOM   297   C  CB    . GLU A 1 53  ? 24.136  -17.942 23.723  1.00 80.91  ? 33  GLU A CB    1 
ATOM   298   C  CG    . GLU A 1 53  ? 23.893  -16.860 22.675  1.00 82.79  ? 33  GLU A CG    1 
ATOM   299   C  CD    . GLU A 1 53  ? 22.619  -17.077 21.873  1.00 84.70  ? 33  GLU A CD    1 
ATOM   300   O  OE1   . GLU A 1 53  ? 21.624  -17.589 22.434  1.00 85.80  ? 33  GLU A OE1   1 
ATOM   301   O  OE2   . GLU A 1 53  ? 22.609  -16.723 20.674  1.00 85.80  ? 33  GLU A OE2   1 
ATOM   302   N  N     . LYS A 1 54  ? 26.215  -15.523 24.863  1.00 72.88  ? 34  LYS A N     1 
ATOM   303   C  CA    . LYS A 1 54  ? 26.321  -14.241 25.572  1.00 70.91  ? 34  LYS A CA    1 
ATOM   304   C  C     . LYS A 1 54  ? 25.119  -13.329 25.307  1.00 69.79  ? 34  LYS A C     1 
ATOM   305   O  O     . LYS A 1 54  ? 24.514  -13.382 24.231  1.00 69.63  ? 34  LYS A O     1 
ATOM   306   C  CB    . LYS A 1 54  ? 27.623  -13.519 25.189  1.00 70.38  ? 34  LYS A CB    1 
ATOM   307   C  CG    . LYS A 1 54  ? 27.682  -12.983 23.759  1.00 70.72  ? 34  LYS A CG    1 
ATOM   308   C  CD    . LYS A 1 54  ? 27.351  -11.499 23.663  1.00 71.03  ? 34  LYS A CD    1 
ATOM   309   C  CE    . LYS A 1 54  ? 27.215  -11.058 22.215  1.00 71.98  ? 34  LYS A CE    1 
ATOM   310   N  NZ    . LYS A 1 54  ? 27.013  -9.589  22.088  1.00 72.51  ? 34  LYS A NZ    1 
ATOM   311   N  N     . TYR A 1 55  ? 24.791  -12.494 26.295  1.00 67.11  ? 35  TYR A N     1 
ATOM   312   C  CA    . TYR A 1 55  ? 23.867  -11.369 26.111  1.00 64.69  ? 35  TYR A CA    1 
ATOM   313   C  C     . TYR A 1 55  ? 24.292  -10.202 27.005  1.00 63.81  ? 35  TYR A C     1 
ATOM   314   O  O     . TYR A 1 55  ? 24.113  -10.246 28.222  1.00 64.13  ? 35  TYR A O     1 
ATOM   315   C  CB    . TYR A 1 55  ? 22.419  -11.774 26.413  1.00 63.67  ? 35  TYR A CB    1 
ATOM   316   C  CG    . TYR A 1 55  ? 21.393  -10.729 26.006  1.00 62.65  ? 35  TYR A CG    1 
ATOM   317   C  CD1   . TYR A 1 55  ? 21.039  -9.686  26.867  1.00 61.74  ? 35  TYR A CD1   1 
ATOM   318   C  CD2   . TYR A 1 55  ? 20.773  -10.783 24.755  1.00 62.16  ? 35  TYR A CD2   1 
ATOM   319   C  CE1   . TYR A 1 55  ? 20.105  -8.728  26.491  1.00 61.18  ? 35  TYR A CE1   1 
ATOM   320   C  CE2   . TYR A 1 55  ? 19.834  -9.833  24.374  1.00 61.30  ? 35  TYR A CE2   1 
ATOM   321   C  CZ    . TYR A 1 55  ? 19.502  -8.810  25.243  1.00 60.77  ? 35  TYR A CZ    1 
ATOM   322   O  OH    . TYR A 1 55  ? 18.574  -7.872  24.862  1.00 59.97  ? 35  TYR A OH    1 
ATOM   323   N  N     . TYR A 1 56  ? 24.866  -9.169  26.390  1.00 62.52  ? 36  TYR A N     1 
ATOM   324   C  CA    . TYR A 1 56  ? 25.283  -7.964  27.103  1.00 61.76  ? 36  TYR A CA    1 
ATOM   325   C  C     . TYR A 1 56  ? 24.076  -7.019  27.240  1.00 61.66  ? 36  TYR A C     1 
ATOM   326   O  O     . TYR A 1 56  ? 23.636  -6.412  26.259  1.00 60.86  ? 36  TYR A O     1 
ATOM   327   C  CB    . TYR A 1 56  ? 26.438  -7.290  26.345  1.00 61.25  ? 36  TYR A CB    1 
ATOM   328   C  CG    . TYR A 1 56  ? 27.278  -6.272  27.110  1.00 60.74  ? 36  TYR A CG    1 
ATOM   329   C  CD1   . TYR A 1 56  ? 26.809  -5.630  28.265  1.00 60.46  ? 36  TYR A CD1   1 
ATOM   330   C  CD2   . TYR A 1 56  ? 28.545  -5.917  26.642  1.00 60.51  ? 36  TYR A CD2   1 
ATOM   331   C  CE1   . TYR A 1 56  ? 27.584  -4.699  28.933  1.00 60.17  ? 36  TYR A CE1   1 
ATOM   332   C  CE2   . TYR A 1 56  ? 29.323  -4.980  27.307  1.00 59.76  ? 36  TYR A CE2   1 
ATOM   333   C  CZ    . TYR A 1 56  ? 28.835  -4.376  28.450  1.00 59.43  ? 36  TYR A CZ    1 
ATOM   334   O  OH    . TYR A 1 56  ? 29.586  -3.448  29.119  1.00 58.45  ? 36  TYR A OH    1 
ATOM   335   N  N     . CYS A 1 57  ? 23.550  -6.917  28.464  1.00 61.52  ? 37  CYS A N     1 
ATOM   336   C  CA    . CYS A 1 57  ? 22.469  -5.986  28.803  1.00 60.84  ? 37  CYS A CA    1 
ATOM   337   C  C     . CYS A 1 57  ? 23.029  -4.814  29.612  1.00 59.06  ? 37  CYS A C     1 
ATOM   338   O  O     . CYS A 1 57  ? 23.333  -4.960  30.794  1.00 58.51  ? 37  CYS A O     1 
ATOM   339   C  CB    . CYS A 1 57  ? 21.379  -6.709  29.596  1.00 61.76  ? 37  CYS A CB    1 
ATOM   340   S  SG    . CYS A 1 57  ? 19.949  -5.677  29.984  1.00 64.05  ? 37  CYS A SG    1 
ATOM   341   N  N     . LEU A 1 58  ? 23.153  -3.655  28.965  1.00 58.07  ? 38  LEU A N     1 
ATOM   342   C  CA    . LEU A 1 58  ? 23.837  -2.491  29.534  1.00 57.72  ? 38  LEU A CA    1 
ATOM   343   C  C     . LEU A 1 58  ? 22.882  -1.325  29.791  1.00 57.72  ? 38  LEU A C     1 
ATOM   344   O  O     . LEU A 1 58  ? 22.205  -0.860  28.874  1.00 57.20  ? 38  LEU A O     1 
ATOM   345   C  CB    . LEU A 1 58  ? 24.941  -2.034  28.575  1.00 57.56  ? 38  LEU A CB    1 
ATOM   346   C  CG    . LEU A 1 58  ? 25.827  -0.845  28.965  1.00 57.59  ? 38  LEU A CG    1 
ATOM   347   C  CD1   . LEU A 1 58  ? 26.581  -1.101  30.260  1.00 57.95  ? 38  LEU A CD1   1 
ATOM   348   C  CD2   . LEU A 1 58  ? 26.800  -0.539  27.841  1.00 57.39  ? 38  LEU A CD2   1 
ATOM   349   N  N     . SER A 1 59  ? 22.835  -0.864  31.042  1.00 57.53  ? 39  SER A N     1 
ATOM   350   C  CA    . SER A 1 59  ? 22.197  0.407   31.396  1.00 56.69  ? 39  SER A CA    1 
ATOM   351   C  C     . SER A 1 59  ? 23.279  1.478   31.521  1.00 55.81  ? 39  SER A C     1 
ATOM   352   O  O     . SER A 1 59  ? 24.428  1.167   31.847  1.00 55.76  ? 39  SER A O     1 
ATOM   353   C  CB    . SER A 1 59  ? 21.428  0.279   32.711  1.00 56.77  ? 39  SER A CB    1 
ATOM   354   O  OG    . SER A 1 59  ? 20.361  -0.647  32.592  1.00 57.17  ? 39  SER A OG    1 
ATOM   355   N  N     . MET A 1 60  ? 22.916  2.732   31.259  1.00 55.32  ? 40  MET A N     1 
ATOM   356   C  CA    . MET A 1 60  ? 23.874  3.842   31.339  1.00 54.97  ? 40  MET A CA    1 
ATOM   357   C  C     . MET A 1 60  ? 24.220  4.141   32.795  1.00 54.75  ? 40  MET A C     1 
ATOM   358   O  O     . MET A 1 60  ? 23.328  4.286   33.634  1.00 53.11  ? 40  MET A O     1 
ATOM   359   C  CB    . MET A 1 60  ? 23.334  5.100   30.654  1.00 55.03  ? 40  MET A CB    1 
ATOM   360   C  CG    . MET A 1 60  ? 23.190  4.982   29.144  1.00 55.24  ? 40  MET A CG    1 
ATOM   361   S  SD    . MET A 1 60  ? 22.819  6.559   28.346  1.00 55.02  ? 40  MET A SD    1 
ATOM   362   C  CE    . MET A 1 60  ? 22.576  6.040   26.648  1.00 54.59  ? 40  MET A CE    1 
ATOM   363   N  N     . LEU A 1 61  ? 25.519  4.223   33.083  1.00 55.49  ? 41  LEU A N     1 
ATOM   364   C  CA    . LEU A 1 61  ? 26.008  4.373   34.460  1.00 55.62  ? 41  LEU A CA    1 
ATOM   365   C  C     . LEU A 1 61  ? 25.704  5.772   35.018  1.00 55.08  ? 41  LEU A C     1 
ATOM   366   O  O     . LEU A 1 61  ? 25.792  6.754   34.282  1.00 53.63  ? 41  LEU A O     1 
ATOM   367   C  CB    . LEU A 1 61  ? 27.509  4.041   34.558  1.00 55.91  ? 41  LEU A CB    1 
ATOM   368   C  CG    . LEU A 1 61  ? 28.597  5.078   34.236  1.00 56.57  ? 41  LEU A CG    1 
ATOM   369   C  CD1   . LEU A 1 61  ? 29.966  4.451   34.445  1.00 56.70  ? 41  LEU A CD1   1 
ATOM   370   C  CD2   . LEU A 1 61  ? 28.511  5.645   32.827  1.00 56.83  ? 41  LEU A CD2   1 
ATOM   371   N  N     . PRO A 1 62  ? 25.345  5.867   36.317  1.00 55.91  ? 42  PRO A N     1 
ATOM   372   C  CA    . PRO A 1 62  ? 24.911  7.144   36.879  1.00 56.95  ? 42  PRO A CA    1 
ATOM   373   C  C     . PRO A 1 62  ? 26.051  8.021   37.403  1.00 57.81  ? 42  PRO A C     1 
ATOM   374   O  O     . PRO A 1 62  ? 27.108  7.508   37.778  1.00 57.95  ? 42  PRO A O     1 
ATOM   375   C  CB    . PRO A 1 62  ? 24.027  6.708   38.048  1.00 56.58  ? 42  PRO A CB    1 
ATOM   376   C  CG    . PRO A 1 62  ? 24.648  5.437   38.521  1.00 55.88  ? 42  PRO A CG    1 
ATOM   377   C  CD    . PRO A 1 62  ? 25.384  4.822   37.359  1.00 55.76  ? 42  PRO A CD    1 
ATOM   378   N  N     . TYR A 1 63  ? 25.816  9.334   37.430  1.00 58.75  ? 43  TYR A N     1 
ATOM   379   C  CA    . TYR A 1 63  ? 26.672  10.267  38.156  1.00 59.72  ? 43  TYR A CA    1 
ATOM   380   C  C     . TYR A 1 63  ? 26.258  10.165  39.621  1.00 59.69  ? 43  TYR A C     1 
ATOM   381   O  O     . TYR A 1 63  ? 25.068  10.287  39.924  1.00 60.33  ? 43  TYR A O     1 
ATOM   382   C  CB    . TYR A 1 63  ? 26.495  11.707  37.655  1.00 61.24  ? 43  TYR A CB    1 
ATOM   383   C  CG    . TYR A 1 63  ? 27.260  12.738  38.466  1.00 62.72  ? 43  TYR A CG    1 
ATOM   384   C  CD1   . TYR A 1 63  ? 28.606  13.001  38.208  1.00 63.60  ? 43  TYR A CD1   1 
ATOM   385   C  CD2   . TYR A 1 63  ? 26.640  13.447  39.501  1.00 63.91  ? 43  TYR A CD2   1 
ATOM   386   C  CE1   . TYR A 1 63  ? 29.313  13.937  38.950  1.00 64.11  ? 43  TYR A CE1   1 
ATOM   387   C  CE2   . TYR A 1 63  ? 27.339  14.386  40.251  1.00 64.74  ? 43  TYR A CE2   1 
ATOM   388   C  CZ    . TYR A 1 63  ? 28.676  14.628  39.972  1.00 64.97  ? 43  TYR A CZ    1 
ATOM   389   O  OH    . TYR A 1 63  ? 29.377  15.554  40.707  1.00 65.52  ? 43  TYR A OH    1 
ATOM   390   N  N     . PRO A 1 64  ? 27.225  9.951   40.535  1.00 59.66  ? 44  PRO A N     1 
ATOM   391   C  CA    . PRO A 1 64  ? 26.868  9.795   41.944  1.00 59.64  ? 44  PRO A CA    1 
ATOM   392   C  C     . PRO A 1 64  ? 26.492  11.132  42.597  1.00 59.83  ? 44  PRO A C     1 
ATOM   393   O  O     . PRO A 1 64  ? 27.315  11.761  43.264  1.00 60.60  ? 44  PRO A O     1 
ATOM   394   C  CB    . PRO A 1 64  ? 28.133  9.182   42.552  1.00 59.08  ? 44  PRO A CB    1 
ATOM   395   C  CG    . PRO A 1 64  ? 29.233  9.736   41.722  1.00 59.08  ? 44  PRO A CG    1 
ATOM   396   C  CD    . PRO A 1 64  ? 28.683  9.863   40.330  1.00 59.34  ? 44  PRO A CD    1 
ATOM   397   N  N     . SER A 1 65  ? 25.247  11.554  42.381  1.00 60.33  ? 45  SER A N     1 
ATOM   398   C  CA    . SER A 1 65  ? 24.749  12.837  42.892  1.00 61.48  ? 45  SER A CA    1 
ATOM   399   C  C     . SER A 1 65  ? 24.482  12.815  44.403  1.00 62.44  ? 45  SER A C     1 
ATOM   400   O  O     . SER A 1 65  ? 24.631  13.841  45.070  1.00 63.22  ? 45  SER A O     1 
ATOM   401   C  CB    . SER A 1 65  ? 23.484  13.259  42.141  1.00 61.59  ? 45  SER A CB    1 
ATOM   402   O  OG    . SER A 1 65  ? 22.496  12.247  42.195  1.00 62.55  ? 45  SER A OG    1 
ATOM   403   N  N     . GLY A 1 66  ? 24.087  11.656  44.931  1.00 63.48  ? 46  GLY A N     1 
ATOM   404   C  CA    . GLY A 1 66  ? 23.881  11.473  46.373  1.00 64.49  ? 46  GLY A CA    1 
ATOM   405   C  C     . GLY A 1 66  ? 22.775  10.480  46.661  1.00 65.60  ? 46  GLY A C     1 
ATOM   406   O  O     . GLY A 1 66  ? 23.007  9.439   47.278  1.00 65.37  ? 46  GLY A O     1 
ATOM   407   N  N     . ARG A 1 67  ? 21.569  10.829  46.221  1.00 66.70  ? 47  ARG A N     1 
ATOM   408   C  CA    . ARG A 1 67  ? 20.399  9.962   46.310  1.00 67.41  ? 47  ARG A CA    1 
ATOM   409   C  C     . ARG A 1 67  ? 20.074  9.426   44.921  1.00 65.10  ? 47  ARG A C     1 
ATOM   410   O  O     . ARG A 1 67  ? 20.503  9.997   43.915  1.00 64.82  ? 47  ARG A O     1 
ATOM   411   C  CB    . ARG A 1 67  ? 19.191  10.751  46.827  1.00 71.09  ? 47  ARG A CB    1 
ATOM   412   C  CG    . ARG A 1 67  ? 19.373  11.463  48.166  1.00 74.00  ? 47  ARG A CG    1 
ATOM   413   C  CD    . ARG A 1 67  ? 19.599  10.501  49.326  1.00 76.78  ? 47  ARG A CD    1 
ATOM   414   N  NE    . ARG A 1 67  ? 21.001  10.461  49.754  1.00 79.59  ? 47  ARG A NE    1 
ATOM   415   C  CZ    . ARG A 1 67  ? 21.594  11.346  50.561  1.00 81.87  ? 47  ARG A CZ    1 
ATOM   416   N  NH1   . ARG A 1 67  ? 20.933  12.396  51.056  1.00 82.90  ? 47  ARG A NH1   1 
ATOM   417   N  NH2   . ARG A 1 67  ? 22.879  11.185  50.872  1.00 82.21  ? 47  ARG A NH2   1 
ATOM   418   N  N     . LEU A 1 68  ? 19.323  8.327   44.871  1.00 63.16  ? 48  LEU A N     1 
ATOM   419   C  CA    . LEU A 1 68  ? 18.655  7.902   43.636  1.00 62.22  ? 48  LEU A CA    1 
ATOM   420   C  C     . LEU A 1 68  ? 17.329  8.647   43.515  1.00 62.26  ? 48  LEU A C     1 
ATOM   421   O  O     . LEU A 1 68  ? 16.850  9.255   44.478  1.00 63.29  ? 48  LEU A O     1 
ATOM   422   C  CB    . LEU A 1 68  ? 18.390  6.387   43.622  1.00 61.48  ? 48  LEU A CB    1 
ATOM   423   C  CG    . LEU A 1 68  ? 19.557  5.408   43.444  1.00 60.58  ? 48  LEU A CG    1 
ATOM   424   C  CD1   . LEU A 1 68  ? 19.072  3.976   43.625  1.00 60.12  ? 48  LEU A CD1   1 
ATOM   425   C  CD2   . LEU A 1 68  ? 20.220  5.554   42.084  1.00 60.30  ? 48  LEU A CD2   1 
ATOM   426   N  N     . HIS A 1 69  ? 16.748  8.598   42.321  1.00 61.47  ? 49  HIS A N     1 
ATOM   427   C  CA    . HIS A 1 69  ? 15.396  9.106   42.078  1.00 60.88  ? 49  HIS A CA    1 
ATOM   428   C  C     . HIS A 1 69  ? 14.688  8.221   41.052  1.00 59.63  ? 49  HIS A C     1 
ATOM   429   O  O     . HIS A 1 69  ? 15.314  7.355   40.441  1.00 60.38  ? 49  HIS A O     1 
ATOM   430   C  CB    . HIS A 1 69  ? 15.413  10.583  41.655  1.00 61.04  ? 49  HIS A CB    1 
ATOM   431   C  CG    . HIS A 1 69  ? 16.318  10.883  40.502  1.00 61.47  ? 49  HIS A CG    1 
ATOM   432   N  ND1   . HIS A 1 69  ? 16.074  10.430  39.223  1.00 61.59  ? 49  HIS A ND1   1 
ATOM   433   C  CD2   . HIS A 1 69  ? 17.455  11.613  40.430  1.00 61.91  ? 49  HIS A CD2   1 
ATOM   434   C  CE1   . HIS A 1 69  ? 17.029  10.855  38.417  1.00 61.30  ? 49  HIS A CE1   1 
ATOM   435   N  NE2   . HIS A 1 69  ? 17.878  11.579  39.123  1.00 61.92  ? 49  HIS A NE2   1 
ATOM   436   N  N     . MET A 1 70  ? 13.390  8.443   40.862  1.00 57.74  ? 50  MET A N     1 
ATOM   437   C  CA    . MET A 1 70  ? 12.557  7.522   40.071  1.00 56.37  ? 50  MET A CA    1 
ATOM   438   C  C     . MET A 1 70  ? 12.943  7.450   38.587  1.00 55.58  ? 50  MET A C     1 
ATOM   439   O  O     . MET A 1 70  ? 12.564  6.504   37.897  1.00 56.09  ? 50  MET A O     1 
ATOM   440   C  CB    . MET A 1 70  ? 11.067  7.863   40.214  1.00 55.58  ? 50  MET A CB    1 
ATOM   441   C  CG    . MET A 1 70  ? 10.553  7.972   41.647  1.00 54.93  ? 50  MET A CG    1 
ATOM   442   S  SD    . MET A 1 70  ? 11.122  6.696   42.789  1.00 53.45  ? 50  MET A SD    1 
ATOM   443   C  CE    . MET A 1 70  ? 10.305  5.254   42.113  1.00 54.10  ? 50  MET A CE    1 
ATOM   444   N  N     . GLY A 1 71  ? 13.679  8.451   38.104  1.00 54.27  ? 51  GLY A N     1 
ATOM   445   C  CA    . GLY A 1 71  ? 14.365  8.369   36.816  1.00 53.99  ? 51  GLY A CA    1 
ATOM   446   C  C     . GLY A 1 71  ? 15.378  7.237   36.754  1.00 53.49  ? 51  GLY A C     1 
ATOM   447   O  O     . GLY A 1 71  ? 15.399  6.469   35.785  1.00 52.90  ? 51  GLY A O     1 
ATOM   448   N  N     . HIS A 1 72  ? 16.217  7.138   37.786  1.00 52.69  ? 52  HIS A N     1 
ATOM   449   C  CA    . HIS A 1 72  ? 17.190  6.045   37.901  1.00 51.48  ? 52  HIS A CA    1 
ATOM   450   C  C     . HIS A 1 72  ? 16.485  4.696   38.010  1.00 51.08  ? 52  HIS A C     1 
ATOM   451   O  O     . HIS A 1 72  ? 16.879  3.736   37.350  1.00 51.52  ? 52  HIS A O     1 
ATOM   452   C  CB    . HIS A 1 72  ? 18.106  6.224   39.120  1.00 51.10  ? 52  HIS A CB    1 
ATOM   453   C  CG    . HIS A 1 72  ? 19.086  7.349   38.998  1.00 50.76  ? 52  HIS A CG    1 
ATOM   454   N  ND1   . HIS A 1 72  ? 18.998  8.501   39.749  1.00 50.23  ? 52  HIS A ND1   1 
ATOM   455   C  CD2   . HIS A 1 72  ? 20.195  7.484   38.234  1.00 51.12  ? 52  HIS A CD2   1 
ATOM   456   C  CE1   . HIS A 1 72  ? 20.004  9.301   39.446  1.00 50.57  ? 52  HIS A CE1   1 
ATOM   457   N  NE2   . HIS A 1 72  ? 20.744  8.709   38.527  1.00 51.00  ? 52  HIS A NE2   1 
ATOM   458   N  N     . VAL A 1 73  ? 15.435  4.641   38.827  1.00 50.88  ? 53  VAL A N     1 
ATOM   459   C  CA    . VAL A 1 73  ? 14.745  3.381   39.124  1.00 51.43  ? 53  VAL A CA    1 
ATOM   460   C  C     . VAL A 1 73  ? 14.091  2.800   37.864  1.00 51.97  ? 53  VAL A C     1 
ATOM   461   O  O     . VAL A 1 73  ? 14.112  1.587   37.664  1.00 51.83  ? 53  VAL A O     1 
ATOM   462   C  CB    . VAL A 1 73  ? 13.701  3.537   40.263  1.00 51.42  ? 53  VAL A CB    1 
ATOM   463   C  CG1   . VAL A 1 73  ? 12.998  2.212   40.549  1.00 51.72  ? 53  VAL A CG1   1 
ATOM   464   C  CG2   . VAL A 1 73  ? 14.364  4.044   41.539  1.00 51.28  ? 53  VAL A CG2   1 
ATOM   465   N  N     . ARG A 1 74  ? 13.536  3.664   37.014  1.00 53.07  ? 54  ARG A N     1 
ATOM   466   C  CA    . ARG A 1 74  ? 12.915  3.222   35.756  1.00 54.05  ? 54  ARG A CA    1 
ATOM   467   C  C     . ARG A 1 74  ? 13.944  2.632   34.794  1.00 54.30  ? 54  ARG A C     1 
ATOM   468   O  O     . ARG A 1 74  ? 13.709  1.583   34.198  1.00 54.60  ? 54  ARG A O     1 
ATOM   469   C  CB    . ARG A 1 74  ? 12.182  4.374   35.058  1.00 54.53  ? 54  ARG A CB    1 
ATOM   470   C  CG    . ARG A 1 74  ? 11.039  3.909   34.170  1.00 54.70  ? 54  ARG A CG    1 
ATOM   471   C  CD    . ARG A 1 74  ? 10.526  5.038   33.295  1.00 55.08  ? 54  ARG A CD    1 
ATOM   472   N  NE    . ARG A 1 74  ? 9.338   4.648   32.539  1.00 55.47  ? 54  ARG A NE    1 
ATOM   473   C  CZ    . ARG A 1 74  ? 8.738   5.398   31.613  1.00 56.29  ? 54  ARG A CZ    1 
ATOM   474   N  NH1   . ARG A 1 74  ? 9.204   6.608   31.294  1.00 56.21  ? 54  ARG A NH1   1 
ATOM   475   N  NH2   . ARG A 1 74  ? 7.656   4.933   30.993  1.00 57.01  ? 54  ARG A NH2   1 
ATOM   476   N  N     . ASN A 1 75  ? 15.074  3.322   34.652  1.00 54.51  ? 55  ASN A N     1 
ATOM   477   C  CA    . ASN A 1 75  ? 16.161  2.893   33.765  1.00 54.54  ? 55  ASN A CA    1 
ATOM   478   C  C     . ASN A 1 75  ? 16.705  1.524   34.175  1.00 53.83  ? 55  ASN A C     1 
ATOM   479   O  O     . ASN A 1 75  ? 16.866  0.637   33.331  1.00 53.46  ? 55  ASN A O     1 
ATOM   480   C  CB    . ASN A 1 75  ? 17.298  3.930   33.774  1.00 55.82  ? 55  ASN A CB    1 
ATOM   481   C  CG    . ASN A 1 75  ? 18.179  3.855   32.537  1.00 56.83  ? 55  ASN A CG    1 
ATOM   482   O  OD1   . ASN A 1 75  ? 18.134  4.740   31.681  1.00 57.84  ? 55  ASN A OD1   1 
ATOM   483   N  ND2   . ASN A 1 75  ? 18.986  2.802   32.437  1.00 56.82  ? 55  ASN A ND2   1 
ATOM   484   N  N     . TYR A 1 76  ? 16.962  1.363   35.473  1.00 52.49  ? 56  TYR A N     1 
ATOM   485   C  CA    . TYR A 1 76  ? 17.621  0.168   36.010  1.00 51.38  ? 56  TYR A CA    1 
ATOM   486   C  C     . TYR A 1 76  ? 16.685  -1.003  36.319  1.00 50.60  ? 56  TYR A C     1 
ATOM   487   O  O     . TYR A 1 76  ? 17.160  -2.127  36.491  1.00 50.31  ? 56  TYR A O     1 
ATOM   488   C  CB    . TYR A 1 76  ? 18.443  0.537   37.252  1.00 51.16  ? 56  TYR A CB    1 
ATOM   489   C  CG    . TYR A 1 76  ? 19.496  1.603   36.997  1.00 51.03  ? 56  TYR A CG    1 
ATOM   490   C  CD1   . TYR A 1 76  ? 20.302  1.566   35.854  1.00 51.02  ? 56  TYR A CD1   1 
ATOM   491   C  CD2   . TYR A 1 76  ? 19.698  2.648   37.904  1.00 51.07  ? 56  TYR A CD2   1 
ATOM   492   C  CE1   . TYR A 1 76  ? 21.262  2.537   35.618  1.00 51.41  ? 56  TYR A CE1   1 
ATOM   493   C  CE2   . TYR A 1 76  ? 20.661  3.625   37.674  1.00 51.01  ? 56  TYR A CE2   1 
ATOM   494   C  CZ    . TYR A 1 76  ? 21.440  3.563   36.530  1.00 51.20  ? 56  TYR A CZ    1 
ATOM   495   O  OH    . TYR A 1 76  ? 22.398  4.518   36.285  1.00 50.78  ? 56  TYR A OH    1 
ATOM   496   N  N     . THR A 1 77  ? 15.378  -0.749  36.400  1.00 49.76  ? 57  THR A N     1 
ATOM   497   C  CA    . THR A 1 77  ? 14.385  -1.828  36.439  1.00 49.61  ? 57  THR A CA    1 
ATOM   498   C  C     . THR A 1 77  ? 14.189  -2.398  35.030  1.00 49.96  ? 57  THR A C     1 
ATOM   499   O  O     . THR A 1 77  ? 14.192  -3.616  34.859  1.00 50.56  ? 57  THR A O     1 
ATOM   500   C  CB    . THR A 1 77  ? 13.034  -1.359  37.022  1.00 49.43  ? 57  THR A CB    1 
ATOM   501   O  OG1   . THR A 1 77  ? 13.248  -0.754  38.301  1.00 49.44  ? 57  THR A OG1   1 
ATOM   502   C  CG2   . THR A 1 77  ? 12.072  -2.530  37.197  1.00 49.36  ? 57  THR A CG2   1 
ATOM   503   N  N     . ILE A 1 78  ? 14.033  -1.519  34.034  1.00 49.92  ? 58  ILE A N     1 
ATOM   504   C  CA    . ILE A 1 78  ? 13.897  -1.924  32.620  1.00 49.85  ? 58  ILE A CA    1 
ATOM   505   C  C     . ILE A 1 78  ? 15.040  -2.850  32.187  1.00 50.26  ? 58  ILE A C     1 
ATOM   506   O  O     . ILE A 1 78  ? 14.802  -3.863  31.527  1.00 51.38  ? 58  ILE A O     1 
ATOM   507   C  CB    . ILE A 1 78  ? 13.803  -0.696  31.670  1.00 49.67  ? 58  ILE A CB    1 
ATOM   508   C  CG1   . ILE A 1 78  ? 12.435  -0.017  31.819  1.00 50.04  ? 58  ILE A CG1   1 
ATOM   509   C  CG2   . ILE A 1 78  ? 14.006  -1.093  30.204  1.00 49.35  ? 58  ILE A CG2   1 
ATOM   510   C  CD1   . ILE A 1 78  ? 12.378  1.404   31.296  1.00 50.45  ? 58  ILE A CD1   1 
ATOM   511   N  N     . GLY A 1 79  ? 16.267  -2.496  32.560  1.00 50.66  ? 59  GLY A N     1 
ATOM   512   C  CA    . GLY A 1 79  ? 17.434  -3.331  32.286  1.00 51.40  ? 59  GLY A CA    1 
ATOM   513   C  C     . GLY A 1 79  ? 17.411  -4.659  33.019  1.00 51.71  ? 59  GLY A C     1 
ATOM   514   O  O     . GLY A 1 79  ? 17.663  -5.705  32.418  1.00 52.53  ? 59  GLY A O     1 
ATOM   515   N  N     . ASP A 1 80  ? 17.099  -4.615  34.313  1.00 51.66  ? 60  ASP A N     1 
ATOM   516   C  CA    . ASP A 1 80  ? 17.074  -5.816  35.149  1.00 52.25  ? 60  ASP A CA    1 
ATOM   517   C  C     . ASP A 1 80  ? 15.965  -6.792  34.743  1.00 52.68  ? 60  ASP A C     1 
ATOM   518   O  O     . ASP A 1 80  ? 16.125  -8.005  34.886  1.00 53.71  ? 60  ASP A O     1 
ATOM   519   C  CB    . ASP A 1 80  ? 16.927  -5.438  36.625  1.00 52.89  ? 60  ASP A CB    1 
ATOM   520   C  CG    . ASP A 1 80  ? 17.281  -6.577  37.559  1.00 53.38  ? 60  ASP A CG    1 
ATOM   521   O  OD1   . ASP A 1 80  ? 18.419  -7.088  37.482  1.00 53.54  ? 60  ASP A OD1   1 
ATOM   522   O  OD2   . ASP A 1 80  ? 16.430  -6.955  38.388  1.00 53.82  ? 60  ASP A OD2   1 
ATOM   523   N  N     . VAL A 1 81  ? 14.848  -6.258  34.248  1.00 52.80  ? 61  VAL A N     1 
ATOM   524   C  CA    . VAL A 1 81  ? 13.775  -7.075  33.669  1.00 52.76  ? 61  VAL A CA    1 
ATOM   525   C  C     . VAL A 1 81  ? 14.294  -7.847  32.455  1.00 52.71  ? 61  VAL A C     1 
ATOM   526   O  O     . VAL A 1 81  ? 14.096  -9.059  32.360  1.00 53.11  ? 61  VAL A O     1 
ATOM   527   C  CB    . VAL A 1 81  ? 12.545  -6.208  33.283  1.00 53.06  ? 61  VAL A CB    1 
ATOM   528   C  CG1   . VAL A 1 81  ? 11.572  -6.966  32.381  1.00 53.43  ? 61  VAL A CG1   1 
ATOM   529   C  CG2   . VAL A 1 81  ? 11.821  -5.724  34.534  1.00 53.16  ? 61  VAL A CG2   1 
ATOM   530   N  N     . ILE A 1 82  ? 14.960  -7.141  31.543  1.00 52.78  ? 62  ILE A N     1 
ATOM   531   C  CA    . ILE A 1 82  ? 15.513  -7.751  30.327  1.00 53.07  ? 62  ILE A CA    1 
ATOM   532   C  C     . ILE A 1 82  ? 16.660  -8.715  30.659  1.00 53.77  ? 62  ILE A C     1 
ATOM   533   O  O     . ILE A 1 82  ? 16.770  -9.779  30.049  1.00 53.54  ? 62  ILE A O     1 
ATOM   534   C  CB    . ILE A 1 82  ? 15.973  -6.676  29.309  1.00 52.68  ? 62  ILE A CB    1 
ATOM   535   C  CG1   . ILE A 1 82  ? 14.763  -5.869  28.814  1.00 52.85  ? 62  ILE A CG1   1 
ATOM   536   C  CG2   . ILE A 1 82  ? 16.695  -7.310  28.119  1.00 52.42  ? 62  ILE A CG2   1 
ATOM   537   C  CD1   . ILE A 1 82  ? 15.115  -4.508  28.251  1.00 53.29  ? 62  ILE A CD1   1 
ATOM   538   N  N     . ALA A 1 83  ? 17.498  -8.346  31.626  1.00 55.04  ? 63  ALA A N     1 
ATOM   539   C  CA    . ALA A 1 83  ? 18.606  -9.199  32.063  1.00 55.96  ? 63  ALA A CA    1 
ATOM   540   C  C     . ALA A 1 83  ? 18.123  -10.516 32.678  1.00 56.81  ? 63  ALA A C     1 
ATOM   541   O  O     . ALA A 1 83  ? 18.658  -11.580 32.363  1.00 57.93  ? 63  ALA A O     1 
ATOM   542   C  CB    . ALA A 1 83  ? 19.499  -8.454  33.045  1.00 55.89  ? 63  ALA A CB    1 
ATOM   543   N  N     . ARG A 1 84  ? 17.118  -10.439 33.549  1.00 57.61  ? 64  ARG A N     1 
ATOM   544   C  CA    . ARG A 1 84  ? 16.522  -11.635 34.165  1.00 58.92  ? 64  ARG A CA    1 
ATOM   545   C  C     . ARG A 1 84  ? 15.701  -12.462 33.168  1.00 59.95  ? 64  ARG A C     1 
ATOM   546   O  O     . ARG A 1 84  ? 15.672  -13.689 33.258  1.00 59.44  ? 64  ARG A O     1 
ATOM   547   C  CB    . ARG A 1 84  ? 15.655  -11.258 35.372  1.00 58.75  ? 64  ARG A CB    1 
ATOM   548   C  CG    . ARG A 1 84  ? 16.450  -10.760 36.567  1.00 58.23  ? 64  ARG A CG    1 
ATOM   549   C  CD    . ARG A 1 84  ? 15.549  -10.099 37.594  1.00 58.14  ? 64  ARG A CD    1 
ATOM   550   N  NE    . ARG A 1 84  ? 16.295  -9.661  38.774  1.00 58.49  ? 64  ARG A NE    1 
ATOM   551   C  CZ    . ARG A 1 84  ? 16.713  -10.455 39.762  1.00 59.38  ? 64  ARG A CZ    1 
ATOM   552   N  NH1   . ARG A 1 84  ? 16.467  -11.768 39.758  1.00 60.19  ? 64  ARG A NH1   1 
ATOM   553   N  NH2   . ARG A 1 84  ? 17.384  -9.922  40.781  1.00 59.49  ? 64  ARG A NH2   1 
ATOM   554   N  N     . TYR A 1 85  ? 15.028  -11.785 32.236  1.00 61.50  ? 65  TYR A N     1 
ATOM   555   C  CA    . TYR A 1 85  ? 14.301  -12.456 31.151  1.00 62.35  ? 65  TYR A CA    1 
ATOM   556   C  C     . TYR A 1 85  ? 15.267  -13.248 30.267  1.00 64.01  ? 65  TYR A C     1 
ATOM   557   O  O     . TYR A 1 85  ? 15.055  -14.438 30.024  1.00 65.07  ? 65  TYR A O     1 
ATOM   558   C  CB    . TYR A 1 85  ? 13.501  -11.437 30.317  1.00 61.62  ? 65  TYR A CB    1 
ATOM   559   C  CG    . TYR A 1 85  ? 12.947  -11.973 29.006  1.00 61.45  ? 65  TYR A CG    1 
ATOM   560   C  CD1   . TYR A 1 85  ? 12.001  -13.001 28.989  1.00 61.02  ? 65  TYR A CD1   1 
ATOM   561   C  CD2   . TYR A 1 85  ? 13.365  -11.445 27.780  1.00 61.40  ? 65  TYR A CD2   1 
ATOM   562   C  CE1   . TYR A 1 85  ? 11.494  -13.491 27.790  1.00 60.45  ? 65  TYR A CE1   1 
ATOM   563   C  CE2   . TYR A 1 85  ? 12.861  -11.928 26.578  1.00 61.15  ? 65  TYR A CE2   1 
ATOM   564   C  CZ    . TYR A 1 85  ? 11.926  -12.949 26.589  1.00 60.63  ? 65  TYR A CZ    1 
ATOM   565   O  OH    . TYR A 1 85  ? 11.428  -13.430 25.400  1.00 60.19  ? 65  TYR A OH    1 
ATOM   566   N  N     . GLN A 1 86  ? 16.330  -12.585 29.812  1.00 65.12  ? 66  GLN A N     1 
ATOM   567   C  CA    . GLN A 1 86  ? 17.345  -13.217 28.956  1.00 66.38  ? 66  GLN A CA    1 
ATOM   568   C  C     . GLN A 1 86  ? 18.161  -14.292 29.681  1.00 66.98  ? 66  GLN A C     1 
ATOM   569   O  O     . GLN A 1 86  ? 18.668  -15.215 29.044  1.00 66.54  ? 66  GLN A O     1 
ATOM   570   C  CB    . GLN A 1 86  ? 18.278  -12.161 28.351  1.00 66.84  ? 66  GLN A CB    1 
ATOM   571   C  CG    . GLN A 1 86  ? 17.593  -11.234 27.350  1.00 67.28  ? 66  GLN A CG    1 
ATOM   572   C  CD    . GLN A 1 86  ? 17.404  -11.838 25.964  1.00 66.89  ? 66  GLN A CD    1 
ATOM   573   O  OE1   . GLN A 1 86  ? 17.697  -13.011 25.724  1.00 66.02  ? 66  GLN A OE1   1 
ATOM   574   N  NE2   . GLN A 1 86  ? 16.906  -11.025 25.039  1.00 67.00  ? 66  GLN A NE2   1 
ATOM   575   N  N     . ARG A 1 87  ? 18.289  -14.166 31.000  1.00 69.51  ? 67  ARG A N     1 
ATOM   576   C  CA    . ARG A 1 87  ? 18.894  -15.212 31.830  1.00 72.23  ? 67  ARG A CA    1 
ATOM   577   C  C     . ARG A 1 87  ? 18.037  -16.480 31.820  1.00 71.77  ? 67  ARG A C     1 
ATOM   578   O  O     . ARG A 1 87  ? 18.563  -17.586 31.680  1.00 71.42  ? 67  ARG A O     1 
ATOM   579   C  CB    . ARG A 1 87  ? 19.091  -14.712 33.268  1.00 75.14  ? 67  ARG A CB    1 
ATOM   580   C  CG    . ARG A 1 87  ? 19.662  -15.743 34.233  1.00 77.24  ? 67  ARG A CG    1 
ATOM   581   C  CD    . ARG A 1 87  ? 20.148  -15.103 35.525  1.00 79.79  ? 67  ARG A CD    1 
ATOM   582   N  NE    . ARG A 1 87  ? 21.564  -14.736 35.458  1.00 81.89  ? 67  ARG A NE    1 
ATOM   583   C  CZ    . ARG A 1 87  ? 22.590  -15.583 35.586  1.00 84.11  ? 67  ARG A CZ    1 
ATOM   584   N  NH1   . ARG A 1 87  ? 22.394  -16.889 35.787  1.00 84.83  ? 67  ARG A NH1   1 
ATOM   585   N  NH2   . ARG A 1 87  ? 23.835  -15.120 35.505  1.00 85.42  ? 67  ARG A NH2   1 
ATOM   586   N  N     . MET A 1 88  ? 16.724  -16.306 31.962  1.00 71.76  ? 68  MET A N     1 
ATOM   587   C  CA    . MET A 1 88  ? 15.773  -17.427 31.964  1.00 71.11  ? 68  MET A CA    1 
ATOM   588   C  C     . MET A 1 88  ? 15.605  -18.106 30.594  1.00 71.46  ? 68  MET A C     1 
ATOM   589   O  O     . MET A 1 88  ? 15.158  -19.251 30.533  1.00 72.15  ? 68  MET A O     1 
ATOM   590   C  CB    . MET A 1 88  ? 14.413  -16.974 32.511  1.00 70.00  ? 68  MET A CB    1 
ATOM   591   C  CG    . MET A 1 88  ? 14.454  -16.602 33.987  1.00 69.37  ? 68  MET A CG    1 
ATOM   592   S  SD    . MET A 1 88  ? 13.015  -15.670 34.539  1.00 68.44  ? 68  MET A SD    1 
ATOM   593   C  CE    . MET A 1 88  ? 11.872  -17.003 34.888  1.00 68.82  ? 68  MET A CE    1 
ATOM   594   N  N     . LEU A 1 89  ? 15.963  -17.414 29.510  1.00 71.61  ? 69  LEU A N     1 
ATOM   595   C  CA    . LEU A 1 89  ? 16.023  -18.029 28.171  1.00 72.51  ? 69  LEU A CA    1 
ATOM   596   C  C     . LEU A 1 89  ? 17.246  -18.945 27.951  1.00 74.53  ? 69  LEU A C     1 
ATOM   597   O  O     . LEU A 1 89  ? 17.337  -19.602 26.911  1.00 76.19  ? 69  LEU A O     1 
ATOM   598   C  CB    . LEU A 1 89  ? 15.988  -16.953 27.075  1.00 72.16  ? 69  LEU A CB    1 
ATOM   599   C  CG    . LEU A 1 89  ? 14.700  -16.138 26.922  1.00 72.37  ? 69  LEU A CG    1 
ATOM   600   C  CD1   . LEU A 1 89  ? 14.940  -14.966 25.980  1.00 72.59  ? 69  LEU A CD1   1 
ATOM   601   C  CD2   . LEU A 1 89  ? 13.548  -17.001 26.423  1.00 72.39  ? 69  LEU A CD2   1 
ATOM   602   N  N     . GLY A 1 90  ? 18.183  -18.972 28.904  1.00 75.48  ? 70  GLY A N     1 
ATOM   603   C  CA    . GLY A 1 90  ? 19.325  -19.890 28.871  1.00 75.84  ? 70  GLY A CA    1 
ATOM   604   C  C     . GLY A 1 90  ? 20.545  -19.265 28.224  1.00 76.58  ? 70  GLY A C     1 
ATOM   605   O  O     . GLY A 1 90  ? 21.140  -19.850 27.314  1.00 79.02  ? 70  GLY A O     1 
ATOM   606   N  N     . LYS A 1 91  ? 20.913  -18.078 28.704  1.00 75.49  ? 71  LYS A N     1 
ATOM   607   C  CA    . LYS A 1 91  ? 22.040  -17.308 28.169  1.00 74.07  ? 71  LYS A CA    1 
ATOM   608   C  C     . LYS A 1 91  ? 22.898  -16.762 29.306  1.00 73.30  ? 71  LYS A C     1 
ATOM   609   O  O     . LYS A 1 91  ? 22.404  -16.547 30.416  1.00 73.80  ? 71  LYS A O     1 
ATOM   610   C  CB    . LYS A 1 91  ? 21.530  -16.147 27.312  1.00 73.57  ? 71  LYS A CB    1 
ATOM   611   C  CG    . LYS A 1 91  ? 20.628  -16.569 26.163  1.00 74.07  ? 71  LYS A CG    1 
ATOM   612   C  CD    . LYS A 1 91  ? 20.175  -15.377 25.340  1.00 74.67  ? 71  LYS A CD    1 
ATOM   613   C  CE    . LYS A 1 91  ? 19.141  -15.790 24.305  1.00 75.50  ? 71  LYS A CE    1 
ATOM   614   N  NZ    . LYS A 1 91  ? 18.584  -14.626 23.563  1.00 76.04  ? 71  LYS A NZ    1 
ATOM   615   N  N     . ASN A 1 92  ? 24.180  -16.545 29.020  1.00 72.27  ? 72  ASN A N     1 
ATOM   616   C  CA    . ASN A 1 92  ? 25.113  -15.965 29.986  1.00 72.12  ? 72  ASN A CA    1 
ATOM   617   C  C     . ASN A 1 92  ? 24.998  -14.438 29.905  1.00 71.42  ? 72  ASN A C     1 
ATOM   618   O  O     . ASN A 1 92  ? 25.573  -13.808 29.013  1.00 71.05  ? 72  ASN A O     1 
ATOM   619   C  CB    . ASN A 1 92  ? 26.545  -16.443 29.700  1.00 72.37  ? 72  ASN A CB    1 
ATOM   620   C  CG    . ASN A 1 92  ? 27.502  -16.174 30.850  1.00 72.91  ? 72  ASN A CG    1 
ATOM   621   O  OD1   . ASN A 1 92  ? 27.147  -16.315 32.022  1.00 73.06  ? 72  ASN A OD1   1 
ATOM   622   N  ND2   . ASN A 1 92  ? 28.734  -15.807 30.515  1.00 73.01  ? 72  ASN A ND2   1 
ATOM   623   N  N     . VAL A 1 93  ? 24.237  -13.858 30.835  1.00 70.17  ? 73  VAL A N     1 
ATOM   624   C  CA    . VAL A 1 93  ? 23.859  -12.444 30.779  1.00 69.30  ? 73  VAL A CA    1 
ATOM   625   C  C     . VAL A 1 93  ? 24.779  -11.573 31.629  1.00 68.87  ? 73  VAL A C     1 
ATOM   626   O  O     . VAL A 1 93  ? 24.821  -11.719 32.851  1.00 69.35  ? 73  VAL A O     1 
ATOM   627   C  CB    . VAL A 1 93  ? 22.404  -12.235 31.251  1.00 69.94  ? 73  VAL A CB    1 
ATOM   628   C  CG1   . VAL A 1 93  ? 22.023  -10.756 31.206  1.00 70.19  ? 73  VAL A CG1   1 
ATOM   629   C  CG2   . VAL A 1 93  ? 21.451  -13.068 30.401  1.00 70.43  ? 73  VAL A CG2   1 
ATOM   630   N  N     . LEU A 1 94  ? 25.496  -10.661 30.973  1.00 68.63  ? 74  LEU A N     1 
ATOM   631   C  CA    . LEU A 1 94  ? 26.303  -9.649  31.655  1.00 68.52  ? 74  LEU A CA    1 
ATOM   632   C  C     . LEU A 1 94  ? 25.463  -8.389  31.865  1.00 69.20  ? 74  LEU A C     1 
ATOM   633   O  O     . LEU A 1 94  ? 25.060  -7.745  30.892  1.00 70.30  ? 74  LEU A O     1 
ATOM   634   C  CB    . LEU A 1 94  ? 27.556  -9.314  30.833  1.00 68.17  ? 74  LEU A CB    1 
ATOM   635   C  CG    . LEU A 1 94  ? 28.444  -8.149  31.292  1.00 68.63  ? 74  LEU A CG    1 
ATOM   636   C  CD1   . LEU A 1 94  ? 28.954  -8.354  32.709  1.00 68.62  ? 74  LEU A CD1   1 
ATOM   637   C  CD2   . LEU A 1 94  ? 29.607  -7.962  30.331  1.00 68.98  ? 74  LEU A CD2   1 
ATOM   638   N  N     . GLN A 1 95  ? 25.191  -8.054  33.129  1.00 68.13  ? 75  GLN A N     1 
ATOM   639   C  CA    . GLN A 1 95  ? 24.574  -6.775  33.492  1.00 66.52  ? 75  GLN A CA    1 
ATOM   640   C  C     . GLN A 1 95  ? 25.506  -6.040  34.464  1.00 64.78  ? 75  GLN A C     1 
ATOM   641   O  O     . GLN A 1 95  ? 25.542  -6.366  35.650  1.00 64.45  ? 75  GLN A O     1 
ATOM   642   C  CB    . GLN A 1 95  ? 23.178  -6.973  34.100  1.00 66.77  ? 75  GLN A CB    1 
ATOM   643   C  CG    . GLN A 1 95  ? 22.347  -5.692  34.105  1.00 67.43  ? 75  GLN A CG    1 
ATOM   644   C  CD    . GLN A 1 95  ? 21.012  -5.815  34.823  1.00 68.01  ? 75  GLN A CD    1 
ATOM   645   O  OE1   . GLN A 1 95  ? 20.728  -6.813  35.487  1.00 68.95  ? 75  GLN A OE1   1 
ATOM   646   N  NE2   . GLN A 1 95  ? 20.185  -4.781  34.697  1.00 67.80  ? 75  GLN A NE2   1 
ATOM   647   N  N     . PRO A 1 96  ? 26.285  -5.064  33.958  1.00 63.44  ? 76  PRO A N     1 
ATOM   648   C  CA    . PRO A 1 96  ? 27.229  -4.334  34.807  1.00 62.99  ? 76  PRO A CA    1 
ATOM   649   C  C     . PRO A 1 96  ? 26.646  -3.083  35.464  1.00 61.87  ? 76  PRO A C     1 
ATOM   650   O  O     . PRO A 1 96  ? 25.553  -2.633  35.111  1.00 61.13  ? 76  PRO A O     1 
ATOM   651   C  CB    . PRO A 1 96  ? 28.332  -3.945  33.826  1.00 63.67  ? 76  PRO A CB    1 
ATOM   652   C  CG    . PRO A 1 96  ? 27.622  -3.767  32.528  1.00 63.62  ? 76  PRO A CG    1 
ATOM   653   C  CD    . PRO A 1 96  ? 26.421  -4.672  32.541  1.00 63.36  ? 76  PRO A CD    1 
ATOM   654   N  N     . ILE A 1 97  ? 27.398  -2.541  36.418  1.00 61.15  ? 77  ILE A N     1 
ATOM   655   C  CA    . ILE A 1 97  ? 27.053  -1.297  37.107  1.00 60.62  ? 77  ILE A CA    1 
ATOM   656   C  C     . ILE A 1 97  ? 28.348  -0.597  37.524  1.00 60.35  ? 77  ILE A C     1 
ATOM   657   O  O     . ILE A 1 97  ? 29.260  -1.236  38.050  1.00 60.37  ? 77  ILE A O     1 
ATOM   658   C  CB    . ILE A 1 97  ? 26.125  -1.556  38.328  1.00 60.65  ? 77  ILE A CB    1 
ATOM   659   C  CG1   . ILE A 1 97  ? 25.677  -0.245  38.994  1.00 60.68  ? 77  ILE A CG1   1 
ATOM   660   C  CG2   . ILE A 1 97  ? 26.781  -2.476  39.356  1.00 60.78  ? 77  ILE A CG2   1 
ATOM   661   C  CD1   . ILE A 1 97  ? 24.647  0.529   38.201  1.00 60.97  ? 77  ILE A CD1   1 
ATOM   662   N  N     . GLY A 1 98  ? 28.422  0.708   37.266  1.00 60.20  ? 78  GLY A N     1 
ATOM   663   C  CA    . GLY A 1 98  ? 29.598  1.524   37.597  1.00 59.17  ? 78  GLY A CA    1 
ATOM   664   C  C     . GLY A 1 98  ? 29.200  2.921   38.028  1.00 58.06  ? 78  GLY A C     1 
ATOM   665   O  O     . GLY A 1 98  ? 28.049  3.147   38.402  1.00 57.59  ? 78  GLY A O     1 
ATOM   666   N  N     . TRP A 1 99  ? 30.156  3.850   37.983  1.00 56.92  ? 79  TRP A N     1 
ATOM   667   C  CA    . TRP A 1 99  ? 29.951  5.223   38.463  1.00 56.43  ? 79  TRP A CA    1 
ATOM   668   C  C     . TRP A 1 99  ? 30.707  6.249   37.612  1.00 56.95  ? 79  TRP A C     1 
ATOM   669   O  O     . TRP A 1 99  ? 31.939  6.246   37.585  1.00 57.28  ? 79  TRP A O     1 
ATOM   670   C  CB    . TRP A 1 99  ? 30.395  5.340   39.930  1.00 55.80  ? 79  TRP A CB    1 
ATOM   671   C  CG    . TRP A 1 99  ? 29.763  4.318   40.834  1.00 54.69  ? 79  TRP A CG    1 
ATOM   672   C  CD1   . TRP A 1 99  ? 30.338  3.172   41.304  1.00 54.25  ? 79  TRP A CD1   1 
ATOM   673   C  CD2   . TRP A 1 99  ? 28.427  4.335   41.346  1.00 53.89  ? 79  TRP A CD2   1 
ATOM   674   N  NE1   . TRP A 1 99  ? 29.446  2.481   42.087  1.00 53.98  ? 79  TRP A NE1   1 
ATOM   675   C  CE2   . TRP A 1 99  ? 28.263  3.170   42.127  1.00 53.68  ? 79  TRP A CE2   1 
ATOM   676   C  CE3   . TRP A 1 99  ? 27.349  5.224   41.221  1.00 54.22  ? 79  TRP A CE3   1 
ATOM   677   C  CZ2   . TRP A 1 99  ? 27.067  2.871   42.788  1.00 54.00  ? 79  TRP A CZ2   1 
ATOM   678   C  CZ3   . TRP A 1 99  ? 26.156  4.926   41.878  1.00 54.36  ? 79  TRP A CZ3   1 
ATOM   679   C  CH2   . TRP A 1 99  ? 26.027  3.757   42.651  1.00 54.36  ? 79  TRP A CH2   1 
ATOM   680   N  N     . ASP A 1 100 ? 29.963  7.117   36.921  1.00 57.81  ? 80  ASP A N     1 
ATOM   681   C  CA    . ASP A 1 100 ? 30.536  8.265   36.201  1.00 58.42  ? 80  ASP A CA    1 
ATOM   682   C  C     . ASP A 1 100 ? 30.875  9.330   37.250  1.00 58.61  ? 80  ASP A C     1 
ATOM   683   O  O     . ASP A 1 100 ? 30.116  10.271  37.470  1.00 58.75  ? 80  ASP A O     1 
ATOM   684   C  CB    . ASP A 1 100 ? 29.539  8.791   35.146  1.00 58.75  ? 80  ASP A CB    1 
ATOM   685   C  CG    . ASP A 1 100 ? 30.161  9.794   34.167  1.00 59.06  ? 80  ASP A CG    1 
ATOM   686   O  OD1   . ASP A 1 100 ? 31.148  10.481  34.512  1.00 60.13  ? 80  ASP A OD1   1 
ATOM   687   O  OD2   . ASP A 1 100 ? 29.640  9.901   33.035  1.00 58.17  ? 80  ASP A OD2   1 
ATOM   688   N  N     . ALA A 1 101 ? 32.031  9.167   37.888  1.00 58.89  ? 81  ALA A N     1 
ATOM   689   C  CA    . ALA A 1 101 ? 32.346  9.871   39.137  1.00 59.60  ? 81  ALA A CA    1 
ATOM   690   C  C     . ALA A 1 101 ? 32.789  11.327  38.977  1.00 60.39  ? 81  ALA A C     1 
ATOM   691   O  O     . ALA A 1 101 ? 32.458  12.160  39.828  1.00 60.66  ? 81  ALA A O     1 
ATOM   692   C  CB    . ALA A 1 101 ? 33.387  9.090   39.920  1.00 59.58  ? 81  ALA A CB    1 
ATOM   693   N  N     . PHE A 1 102 ? 33.542  11.631  37.917  1.00 61.16  ? 82  PHE A N     1 
ATOM   694   C  CA    . PHE A 1 102 ? 33.974  13.015  37.644  1.00 62.13  ? 82  PHE A CA    1 
ATOM   695   C  C     . PHE A 1 102 ? 32.800  13.912  37.236  1.00 63.18  ? 82  PHE A C     1 
ATOM   696   O  O     . PHE A 1 102 ? 31.805  13.431  36.682  1.00 63.94  ? 82  PHE A O     1 
ATOM   697   C  CB    . PHE A 1 102 ? 35.050  13.069  36.547  1.00 61.88  ? 82  PHE A CB    1 
ATOM   698   C  CG    . PHE A 1 102 ? 36.435  12.675  37.003  1.00 62.01  ? 82  PHE A CG    1 
ATOM   699   C  CD1   . PHE A 1 102 ? 37.016  13.255  38.132  1.00 62.25  ? 82  PHE A CD1   1 
ATOM   700   C  CD2   . PHE A 1 102 ? 37.190  11.763  36.266  1.00 62.04  ? 82  PHE A CD2   1 
ATOM   701   C  CE1   . PHE A 1 102 ? 38.300  12.905  38.532  1.00 62.42  ? 82  PHE A CE1   1 
ATOM   702   C  CE2   . PHE A 1 102 ? 38.475  11.415  36.658  1.00 62.06  ? 82  PHE A CE2   1 
ATOM   703   C  CZ    . PHE A 1 102 ? 39.031  11.985  37.794  1.00 62.20  ? 82  PHE A CZ    1 
ATOM   704   N  N     . GLY A 1 103 ? 32.932  15.213  37.501  1.00 63.25  ? 83  GLY A N     1 
ATOM   705   C  CA    . GLY A 1 103 ? 31.875  16.183  37.197  1.00 63.94  ? 83  GLY A CA    1 
ATOM   706   C  C     . GLY A 1 103 ? 31.922  17.489  37.970  1.00 64.25  ? 83  GLY A C     1 
ATOM   707   O  O     . GLY A 1 103 ? 32.614  17.611  38.983  1.00 63.44  ? 83  GLY A O     1 
ATOM   708   N  N     . LEU A 1 104 ? 31.157  18.458  37.471  1.00 65.04  ? 84  LEU A N     1 
ATOM   709   C  CA    . LEU A 1 104 ? 31.065  19.802  38.052  1.00 65.97  ? 84  LEU A CA    1 
ATOM   710   C  C     . LEU A 1 104 ? 30.358  19.876  39.415  1.00 65.81  ? 84  LEU A C     1 
ATOM   711   O  O     . LEU A 1 104 ? 30.832  20.595  40.296  1.00 65.14  ? 84  LEU A O     1 
ATOM   712   C  CB    . LEU A 1 104 ? 30.388  20.763  37.057  1.00 67.02  ? 84  LEU A CB    1 
ATOM   713   C  CG    . LEU A 1 104 ? 30.114  22.213  37.476  1.00 68.09  ? 84  LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1 104 ? 31.393  22.930  37.882  1.00 68.50  ? 84  LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1 104 ? 29.421  22.956  36.343  1.00 68.42  ? 84  LEU A CD2   1 
ATOM   716   N  N     . PRO A 1 105 ? 29.222  19.159  39.594  1.00 67.12  ? 85  PRO A N     1 
ATOM   717   C  CA    . PRO A 1 105 ? 28.489  19.252  40.872  1.00 68.24  ? 85  PRO A CA    1 
ATOM   718   C  C     . PRO A 1 105 ? 29.301  18.880  42.120  1.00 69.58  ? 85  PRO A C     1 
ATOM   719   O  O     . PRO A 1 105 ? 29.046  19.423  43.197  1.00 69.47  ? 85  PRO A O     1 
ATOM   720   C  CB    . PRO A 1 105 ? 27.322  18.272  40.689  1.00 67.99  ? 85  PRO A CB    1 
ATOM   721   C  CG    . PRO A 1 105 ? 27.151  18.144  39.219  1.00 67.70  ? 85  PRO A CG    1 
ATOM   722   C  CD    . PRO A 1 105 ? 28.529  18.264  38.646  1.00 67.54  ? 85  PRO A CD    1 
ATOM   723   N  N     . ALA A 1 106 ? 30.262  17.969  41.969  1.00 71.32  ? 86  ALA A N     1 
ATOM   724   C  CA    . ALA A 1 106 ? 31.138  17.565  43.070  1.00 73.19  ? 86  ALA A CA    1 
ATOM   725   C  C     . ALA A 1 106 ? 32.012  18.698  43.613  1.00 74.99  ? 86  ALA A C     1 
ATOM   726   O  O     . ALA A 1 106 ? 32.338  18.700  44.800  1.00 75.94  ? 86  ALA A O     1 
ATOM   727   C  CB    . ALA A 1 106 ? 32.011  16.391  42.646  1.00 73.97  ? 86  ALA A CB    1 
ATOM   728   N  N     . GLU A 1 107 ? 32.387  19.647  42.754  1.00 77.03  ? 87  GLU A N     1 
ATOM   729   C  CA    . GLU A 1 107 ? 33.199  20.797  43.173  1.00 78.31  ? 87  GLU A CA    1 
ATOM   730   C  C     . GLU A 1 107 ? 32.397  21.773  44.029  1.00 79.63  ? 87  GLU A C     1 
ATOM   731   O  O     . GLU A 1 107 ? 32.831  22.141  45.121  1.00 80.25  ? 87  GLU A O     1 
ATOM   732   C  CB    . GLU A 1 107 ? 33.777  21.537  41.963  1.00 78.64  ? 87  GLU A CB    1 
ATOM   733   C  CG    . GLU A 1 107 ? 34.754  20.709  41.142  1.00 78.58  ? 87  GLU A CG    1 
ATOM   734   C  CD    . GLU A 1 107 ? 35.553  21.531  40.144  1.00 78.48  ? 87  GLU A CD    1 
ATOM   735   O  OE1   . GLU A 1 107 ? 35.128  22.649  39.778  1.00 78.72  ? 87  GLU A OE1   1 
ATOM   736   O  OE2   . GLU A 1 107 ? 36.619  21.045  39.718  1.00 78.49  ? 87  GLU A OE2   1 
ATOM   737   N  N     . GLY A 1 108 ? 31.237  22.186  43.522  1.00 80.70  ? 88  GLY A N     1 
ATOM   738   C  CA    . GLY A 1 108 ? 30.353  23.119  44.226  1.00 82.24  ? 88  GLY A CA    1 
ATOM   739   C  C     . GLY A 1 108 ? 29.830  22.597  45.555  1.00 83.51  ? 88  GLY A C     1 
ATOM   740   O  O     . GLY A 1 108 ? 29.768  23.342  46.536  1.00 83.65  ? 88  GLY A O     1 
ATOM   741   N  N     . ALA A 1 109 ? 29.458  21.317  45.583  1.00 83.99  ? 89  ALA A N     1 
ATOM   742   C  CA    . ALA A 1 109 ? 28.990  20.656  46.807  1.00 84.69  ? 89  ALA A CA    1 
ATOM   743   C  C     . ALA A 1 109 ? 30.097  20.509  47.853  1.00 85.22  ? 89  ALA A C     1 
ATOM   744   O  O     . ALA A 1 109 ? 29.836  20.621  49.051  1.00 85.46  ? 89  ALA A O     1 
ATOM   745   C  CB    . ALA A 1 109 ? 28.396  19.293  46.479  1.00 85.06  ? 89  ALA A CB    1 
ATOM   746   N  N     . ALA A 1 110 ? 31.322  20.249  47.396  1.00 86.61  ? 90  ALA A N     1 
ATOM   747   C  CA    . ALA A 1 110 ? 32.489  20.152  48.281  1.00 88.72  ? 90  ALA A CA    1 
ATOM   748   C  C     . ALA A 1 110 ? 32.818  21.485  48.961  1.00 90.61  ? 90  ALA A C     1 
ATOM   749   O  O     . ALA A 1 110 ? 33.154  21.510  50.148  1.00 91.98  ? 90  ALA A O     1 
ATOM   750   C  CB    . ALA A 1 110 ? 33.698  19.643  47.510  1.00 89.16  ? 90  ALA A CB    1 
ATOM   751   N  N     . VAL A 1 111 ? 32.721  22.579  48.205  1.00 91.78  ? 91  VAL A N     1 
ATOM   752   C  CA    . VAL A 1 111 ? 32.940  23.930  48.741  1.00 92.94  ? 91  VAL A CA    1 
ATOM   753   C  C     . VAL A 1 111 ? 31.831  24.312  49.730  1.00 93.73  ? 91  VAL A C     1 
ATOM   754   O  O     . VAL A 1 111 ? 32.113  24.890  50.783  1.00 94.77  ? 91  VAL A O     1 
ATOM   755   C  CB    . VAL A 1 111 ? 33.042  24.987  47.607  1.00 93.85  ? 91  VAL A CB    1 
ATOM   756   C  CG1   . VAL A 1 111 ? 33.069  26.410  48.162  1.00 94.73  ? 91  VAL A CG1   1 
ATOM   757   C  CG2   . VAL A 1 111 ? 34.285  24.746  46.759  1.00 93.77  ? 91  VAL A CG2   1 
ATOM   758   N  N     . LYS A 1 112 ? 30.585  23.979  49.390  1.00 93.60  ? 92  LYS A N     1 
ATOM   759   C  CA    . LYS A 1 112 ? 29.423  24.323  50.221  1.00 93.59  ? 92  LYS A CA    1 
ATOM   760   C  C     . LYS A 1 112 ? 29.408  23.554  51.550  1.00 93.66  ? 92  LYS A C     1 
ATOM   761   O  O     . LYS A 1 112 ? 29.110  24.135  52.593  1.00 95.00  ? 92  LYS A O     1 
ATOM   762   C  CB    . LYS A 1 112 ? 28.115  24.083  49.449  1.00 94.10  ? 92  LYS A CB    1 
ATOM   763   C  CG    . LYS A 1 112 ? 26.961  24.986  49.863  1.00 94.54  ? 92  LYS A CG    1 
ATOM   764   C  CD    . LYS A 1 112 ? 25.734  24.772  48.979  1.00 95.24  ? 92  LYS A CD    1 
ATOM   765   C  CE    . LYS A 1 112 ? 24.986  26.069  48.696  1.00 95.59  ? 92  LYS A CE    1 
ATOM   766   N  NZ    . LYS A 1 112 ? 24.428  26.704  49.922  1.00 96.51  ? 92  LYS A NZ    1 
ATOM   767   N  N     . ASN A 1 113 ? 29.740  22.262  51.503  1.00 93.47  ? 93  ASN A N     1 
ATOM   768   C  CA    . ASN A 1 113 ? 29.746  21.394  52.695  1.00 93.74  ? 93  ASN A CA    1 
ATOM   769   C  C     . ASN A 1 113 ? 31.092  21.320  53.442  1.00 93.35  ? 93  ASN A C     1 
ATOM   770   O  O     . ASN A 1 113 ? 31.192  20.604  54.443  1.00 94.28  ? 93  ASN A O     1 
ATOM   771   C  CB    . ASN A 1 113 ? 29.288  19.974  52.316  1.00 94.13  ? 93  ASN A CB    1 
ATOM   772   C  CG    . ASN A 1 113 ? 27.822  19.912  51.915  1.00 94.43  ? 93  ASN A CG    1 
ATOM   773   O  OD1   . ASN A 1 113 ? 27.170  20.936  51.702  1.00 94.93  ? 93  ASN A OD1   1 
ATOM   774   N  ND2   . ASN A 1 113 ? 27.297  18.698  51.812  1.00 95.14  ? 93  ASN A ND2   1 
ATOM   775   N  N     . ASN A 1 114 ? 32.107  22.048  52.966  1.00 92.56  ? 94  ASN A N     1 
ATOM   776   C  CA    . ASN A 1 114 ? 33.433  22.114  53.609  1.00 92.59  ? 94  ASN A CA    1 
ATOM   777   C  C     . ASN A 1 114 ? 34.150  20.749  53.604  1.00 90.05  ? 94  ASN A C     1 
ATOM   778   O  O     . ASN A 1 114 ? 34.534  20.216  54.651  1.00 89.42  ? 94  ASN A O     1 
ATOM   779   C  CB    . ASN A 1 114 ? 33.327  22.709  55.030  1.00 93.82  ? 94  ASN A CB    1 
ATOM   780   C  CG    . ASN A 1 114 ? 34.670  23.159  55.588  1.00 94.60  ? 94  ASN A CG    1 
ATOM   781   O  OD1   . ASN A 1 114 ? 35.442  23.842  54.915  1.00 96.12  ? 94  ASN A OD1   1 
ATOM   782   N  ND2   . ASN A 1 114 ? 34.948  22.782  56.832  1.00 94.28  ? 94  ASN A ND2   1 
ATOM   783   N  N     . THR A 1 115 ? 34.305  20.197  52.401  1.00 87.07  ? 95  THR A N     1 
ATOM   784   C  CA    . THR A 1 115 ? 35.005  18.924  52.173  1.00 84.89  ? 95  THR A CA    1 
ATOM   785   C  C     . THR A 1 115 ? 35.797  19.046  50.865  1.00 82.38  ? 95  THR A C     1 
ATOM   786   O  O     . THR A 1 115 ? 35.832  20.121  50.263  1.00 82.79  ? 95  THR A O     1 
ATOM   787   C  CB    . THR A 1 115 ? 34.014  17.728  52.077  1.00 85.10  ? 95  THR A CB    1 
ATOM   788   O  OG1   . THR A 1 115 ? 32.720  18.114  52.558  1.00 86.47  ? 95  THR A OG1   1 
ATOM   789   C  CG2   . THR A 1 115 ? 34.510  16.520  52.885  1.00 84.64  ? 95  THR A CG2   1 
ATOM   790   N  N     . ALA A 1 116 ? 36.449  17.959  50.451  1.00 79.67  ? 96  ALA A N     1 
ATOM   791   C  CA    . ALA A 1 116 ? 37.046  17.857  49.114  1.00 76.69  ? 96  ALA A CA    1 
ATOM   792   C  C     . ALA A 1 116 ? 36.076  17.127  48.171  1.00 74.33  ? 96  ALA A C     1 
ATOM   793   O  O     . ALA A 1 116 ? 35.185  16.411  48.641  1.00 73.39  ? 96  ALA A O     1 
ATOM   794   C  CB    . ALA A 1 116 ? 38.379  17.126  49.178  1.00 76.49  ? 96  ALA A CB    1 
ATOM   795   N  N     . PRO A 1 117 ? 36.234  17.310  46.840  1.00 71.80  ? 97  PRO A N     1 
ATOM   796   C  CA    . PRO A 1 117 ? 35.355  16.612  45.887  1.00 70.48  ? 97  PRO A CA    1 
ATOM   797   C  C     . PRO A 1 117 ? 35.479  15.083  45.857  1.00 69.73  ? 97  PRO A C     1 
ATOM   798   O  O     . PRO A 1 117 ? 34.503  14.407  45.525  1.00 69.53  ? 97  PRO A O     1 
ATOM   799   C  CB    . PRO A 1 117 ? 35.773  17.200  44.533  1.00 70.32  ? 97  PRO A CB    1 
ATOM   800   C  CG    . PRO A 1 117 ? 36.331  18.535  44.872  1.00 70.57  ? 97  PRO A CG    1 
ATOM   801   C  CD    . PRO A 1 117 ? 37.080  18.299  46.146  1.00 71.02  ? 97  PRO A CD    1 
ATOM   802   N  N     . ALA A 1 118 ? 36.657  14.551  46.188  1.00 69.27  ? 98  ALA A N     1 
ATOM   803   C  CA    . ALA A 1 118 ? 36.882  13.095  46.195  1.00 68.16  ? 98  ALA A CA    1 
ATOM   804   C  C     . ALA A 1 118 ? 36.044  12.323  47.239  1.00 67.82  ? 98  ALA A C     1 
ATOM   805   O  O     . ALA A 1 118 ? 35.281  11.436  46.854  1.00 67.81  ? 98  ALA A O     1 
ATOM   806   C  CB    . ALA A 1 118 ? 38.370  12.772  46.330  1.00 67.46  ? 98  ALA A CB    1 
ATOM   807   N  N     . PRO A 1 119 ? 36.169  12.654  48.548  1.00 67.17  ? 99  PRO A N     1 
ATOM   808   C  CA    . PRO A 1 119 ? 35.382  11.931  49.564  1.00 66.85  ? 99  PRO A CA    1 
ATOM   809   C  C     . PRO A 1 119 ? 33.864  12.125  49.463  1.00 66.79  ? 99  PRO A C     1 
ATOM   810   O  O     . PRO A 1 119 ? 33.111  11.217  49.823  1.00 66.40  ? 99  PRO A O     1 
ATOM   811   C  CB    . PRO A 1 119 ? 35.906  12.504  50.887  1.00 67.03  ? 99  PRO A CB    1 
ATOM   812   C  CG    . PRO A 1 119 ? 36.429  13.848  50.530  1.00 67.25  ? 99  PRO A CG    1 
ATOM   813   C  CD    . PRO A 1 119 ? 37.045  13.659  49.179  1.00 67.29  ? 99  PRO A CD    1 
ATOM   814   N  N     . TRP A 1 120 ? 33.430  13.297  48.995  1.00 66.98  ? 100 TRP A N     1 
ATOM   815   C  CA    . TRP A 1 120 ? 32.016  13.556  48.694  1.00 67.43  ? 100 TRP A CA    1 
ATOM   816   C  C     . TRP A 1 120 ? 31.498  12.562  47.658  1.00 67.55  ? 100 TRP A C     1 
ATOM   817   O  O     . TRP A 1 120 ? 30.416  11.999  47.821  1.00 68.61  ? 100 TRP A O     1 
ATOM   818   C  CB    . TRP A 1 120 ? 31.834  14.987  48.174  1.00 68.50  ? 100 TRP A CB    1 
ATOM   819   C  CG    . TRP A 1 120 ? 30.402  15.423  47.971  1.00 69.05  ? 100 TRP A CG    1 
ATOM   820   C  CD1   . TRP A 1 120 ? 29.565  15.949  48.913  1.00 69.64  ? 100 TRP A CD1   1 
ATOM   821   C  CD2   . TRP A 1 120 ? 29.658  15.398  46.745  1.00 69.70  ? 100 TRP A CD2   1 
ATOM   822   N  NE1   . TRP A 1 120 ? 28.344  16.243  48.354  1.00 69.87  ? 100 TRP A NE1   1 
ATOM   823   C  CE2   . TRP A 1 120 ? 28.372  15.915  47.025  1.00 69.83  ? 100 TRP A CE2   1 
ATOM   824   C  CE3   . TRP A 1 120 ? 29.950  14.982  45.437  1.00 70.35  ? 100 TRP A CE3   1 
ATOM   825   C  CZ2   . TRP A 1 120 ? 27.376  16.028  46.045  1.00 70.20  ? 100 TRP A CZ2   1 
ATOM   826   C  CZ3   . TRP A 1 120 ? 28.956  15.094  44.459  1.00 70.49  ? 100 TRP A CZ3   1 
ATOM   827   C  CH2   . TRP A 1 120 ? 27.686  15.615  44.772  1.00 70.30  ? 100 TRP A CH2   1 
ATOM   828   N  N     . THR A 1 121 ? 32.289  12.346  46.608  1.00 66.92  ? 101 THR A N     1 
ATOM   829   C  CA    . THR A 1 121 ? 31.947  11.405  45.541  1.00 66.91  ? 101 THR A CA    1 
ATOM   830   C  C     . THR A 1 121 ? 31.936  9.945   46.019  1.00 67.50  ? 101 THR A C     1 
ATOM   831   O  O     . THR A 1 121 ? 31.054  9.182   45.628  1.00 67.72  ? 101 THR A O     1 
ATOM   832   C  CB    . THR A 1 121 ? 32.903  11.562  44.339  1.00 66.97  ? 101 THR A CB    1 
ATOM   833   O  OG1   . THR A 1 121 ? 32.887  12.925  43.896  1.00 67.03  ? 101 THR A OG1   1 
ATOM   834   C  CG2   . THR A 1 121 ? 32.493  10.660  43.181  1.00 67.14  ? 101 THR A CG2   1 
ATOM   835   N  N     . TYR A 1 122 ? 32.901  9.564   46.858  1.00 68.56  ? 102 TYR A N     1 
ATOM   836   C  CA    . TYR A 1 122 ? 32.943  8.205   47.426  1.00 69.37  ? 102 TYR A CA    1 
ATOM   837   C  C     . TYR A 1 122 ? 31.831  7.938   48.455  1.00 70.11  ? 102 TYR A C     1 
ATOM   838   O  O     . TYR A 1 122 ? 31.379  6.797   48.585  1.00 69.58  ? 102 TYR A O     1 
ATOM   839   C  CB    . TYR A 1 122 ? 34.317  7.894   48.037  1.00 69.47  ? 102 TYR A CB    1 
ATOM   840   C  CG    . TYR A 1 122 ? 35.441  7.787   47.020  1.00 69.58  ? 102 TYR A CG    1 
ATOM   841   C  CD1   . TYR A 1 122 ? 35.403  6.830   46.003  1.00 69.36  ? 102 TYR A CD1   1 
ATOM   842   C  CD2   . TYR A 1 122 ? 36.553  8.630   47.084  1.00 70.04  ? 102 TYR A CD2   1 
ATOM   843   C  CE1   . TYR A 1 122 ? 36.431  6.728   45.073  1.00 69.29  ? 102 TYR A CE1   1 
ATOM   844   C  CE2   . TYR A 1 122 ? 37.585  8.535   46.159  1.00 69.35  ? 102 TYR A CE2   1 
ATOM   845   C  CZ    . TYR A 1 122 ? 37.521  7.585   45.157  1.00 68.89  ? 102 TYR A CZ    1 
ATOM   846   O  OH    . TYR A 1 122 ? 38.544  7.494   44.244  1.00 68.32  ? 102 TYR A OH    1 
ATOM   847   N  N     . ASP A 1 123 ? 31.406  8.974   49.183  1.00 71.30  ? 103 ASP A N     1 
ATOM   848   C  CA    . ASP A 1 123 ? 30.230  8.876   50.073  1.00 73.05  ? 103 ASP A CA    1 
ATOM   849   C  C     . ASP A 1 123 ? 28.935  8.645   49.292  1.00 71.57  ? 103 ASP A C     1 
ATOM   850   O  O     . ASP A 1 123 ? 28.103  7.825   49.689  1.00 70.82  ? 103 ASP A O     1 
ATOM   851   C  CB    . ASP A 1 123 ? 30.075  10.131  50.958  1.00 75.93  ? 103 ASP A CB    1 
ATOM   852   C  CG    . ASP A 1 123 ? 30.599  9.925   52.371  1.00 78.25  ? 103 ASP A CG    1 
ATOM   853   O  OD1   . ASP A 1 123 ? 30.046  9.063   53.089  1.00 80.26  ? 103 ASP A OD1   1 
ATOM   854   O  OD2   . ASP A 1 123 ? 31.546  10.636  52.770  1.00 80.00  ? 103 ASP A OD2   1 
ATOM   855   N  N     . ASN A 1 124 ? 28.776  9.379   48.191  1.00 69.85  ? 104 ASN A N     1 
ATOM   856   C  CA    . ASN A 1 124 ? 27.586  9.273   47.338  1.00 69.15  ? 104 ASN A CA    1 
ATOM   857   C  C     . ASN A 1 124 ? 27.537  7.946   46.567  1.00 67.80  ? 104 ASN A C     1 
ATOM   858   O  O     . ASN A 1 124 ? 26.455  7.394   46.351  1.00 67.42  ? 104 ASN A O     1 
ATOM   859   C  CB    . ASN A 1 124 ? 27.514  10.457  46.366  1.00 69.36  ? 104 ASN A CB    1 
ATOM   860   C  CG    . ASN A 1 124 ? 27.372  11.795  47.077  1.00 69.53  ? 104 ASN A CG    1 
ATOM   861   O  OD1   . ASN A 1 124 ? 27.474  11.881  48.303  1.00 69.94  ? 104 ASN A OD1   1 
ATOM   862   N  ND2   . ASN A 1 124 ? 27.136  12.847  46.306  1.00 69.40  ? 104 ASN A ND2   1 
ATOM   863   N  N     . ILE A 1 125 ? 28.704  7.453   46.149  1.00 66.01  ? 105 ILE A N     1 
ATOM   864   C  CA    . ILE A 1 125 ? 28.835  6.110   45.565  1.00 64.74  ? 105 ILE A CA    1 
ATOM   865   C  C     . ILE A 1 125 ? 28.428  5.032   46.577  1.00 64.95  ? 105 ILE A C     1 
ATOM   866   O  O     . ILE A 1 125 ? 27.722  4.087   46.222  1.00 65.11  ? 105 ILE A O     1 
ATOM   867   C  CB    . ILE A 1 125 ? 30.275  5.858   45.038  1.00 64.05  ? 105 ILE A CB    1 
ATOM   868   C  CG1   . ILE A 1 125 ? 30.509  6.660   43.753  1.00 63.44  ? 105 ILE A CG1   1 
ATOM   869   C  CG2   . ILE A 1 125 ? 30.534  4.374   44.770  1.00 64.48  ? 105 ILE A CG2   1 
ATOM   870   C  CD1   . ILE A 1 125 ? 31.968  6.893   43.421  1.00 63.12  ? 105 ILE A CD1   1 
ATOM   871   N  N     . ALA A 1 126 ? 28.874  5.182   47.824  1.00 65.29  ? 106 ALA A N     1 
ATOM   872   C  CA    . ALA A 1 126 ? 28.555  4.230   48.896  1.00 65.24  ? 106 ALA A CA    1 
ATOM   873   C  C     . ALA A 1 126 ? 27.064  4.200   49.237  1.00 64.45  ? 106 ALA A C     1 
ATOM   874   O  O     . ALA A 1 126 ? 26.479  3.122   49.359  1.00 63.94  ? 106 ALA A O     1 
ATOM   875   C  CB    . ALA A 1 126 ? 29.368  4.548   50.142  1.00 66.06  ? 106 ALA A CB    1 
ATOM   876   N  N     . TYR A 1 127 ? 26.464  5.381   49.386  1.00 63.81  ? 107 TYR A N     1 
ATOM   877   C  CA    . TYR A 1 127 ? 25.033  5.506   49.693  1.00 64.08  ? 107 TYR A CA    1 
ATOM   878   C  C     . TYR A 1 127 ? 24.162  4.922   48.578  1.00 63.80  ? 107 TYR A C     1 
ATOM   879   O  O     . TYR A 1 127 ? 23.206  4.194   48.853  1.00 64.36  ? 107 TYR A O     1 
ATOM   880   C  CB    . TYR A 1 127 ? 24.657  6.976   49.932  1.00 64.82  ? 107 TYR A CB    1 
ATOM   881   C  CG    . TYR A 1 127 ? 23.285  7.186   50.550  1.00 65.85  ? 107 TYR A CG    1 
ATOM   882   C  CD1   . TYR A 1 127 ? 22.129  7.157   49.767  1.00 66.61  ? 107 TYR A CD1   1 
ATOM   883   C  CD2   . TYR A 1 127 ? 23.142  7.431   51.918  1.00 66.56  ? 107 TYR A CD2   1 
ATOM   884   C  CE1   . TYR A 1 127 ? 20.874  7.352   50.329  1.00 67.13  ? 107 TYR A CE1   1 
ATOM   885   C  CE2   . TYR A 1 127 ? 21.889  7.631   52.487  1.00 66.84  ? 107 TYR A CE2   1 
ATOM   886   C  CZ    . TYR A 1 127 ? 20.759  7.592   51.687  1.00 67.01  ? 107 TYR A CZ    1 
ATOM   887   O  OH    . TYR A 1 127 ? 19.513  7.787   52.234  1.00 67.43  ? 107 TYR A OH    1 
ATOM   888   N  N     . MET A 1 128 ? 24.495  5.253   47.331  1.00 63.03  ? 108 MET A N     1 
ATOM   889   C  CA    . MET A 1 128 ? 23.739  4.780   46.164  1.00 62.18  ? 108 MET A CA    1 
ATOM   890   C  C     . MET A 1 128 ? 23.954  3.294   45.865  1.00 61.56  ? 108 MET A C     1 
ATOM   891   O  O     . MET A 1 128 ? 23.060  2.640   45.328  1.00 60.52  ? 108 MET A O     1 
ATOM   892   C  CB    . MET A 1 128 ? 24.064  5.625   44.928  1.00 61.90  ? 108 MET A CB    1 
ATOM   893   C  CG    . MET A 1 128 ? 23.531  7.046   45.025  1.00 61.75  ? 108 MET A CG    1 
ATOM   894   S  SD    . MET A 1 128 ? 24.109  8.144   43.720  1.00 61.02  ? 108 MET A SD    1 
ATOM   895   C  CE    . MET A 1 128 ? 23.174  7.556   42.313  1.00 61.03  ? 108 MET A CE    1 
ATOM   896   N  N     . LYS A 1 129 ? 25.130  2.767   46.205  1.00 62.01  ? 109 LYS A N     1 
ATOM   897   C  CA    . LYS A 1 129 ? 25.390  1.326   46.107  1.00 63.71  ? 109 LYS A CA    1 
ATOM   898   C  C     . LYS A 1 129 ? 24.458  0.513   47.012  1.00 65.25  ? 109 LYS A C     1 
ATOM   899   O  O     . LYS A 1 129 ? 24.051  -0.591  46.646  1.00 66.51  ? 109 LYS A O     1 
ATOM   900   C  CB    . LYS A 1 129 ? 26.851  1.015   46.445  1.00 64.19  ? 109 LYS A CB    1 
ATOM   901   C  CG    . LYS A 1 129 ? 27.242  -0.449  46.287  1.00 64.68  ? 109 LYS A CG    1 
ATOM   902   C  CD    . LYS A 1 129 ? 28.753  -0.611  46.257  1.00 65.24  ? 109 LYS A CD    1 
ATOM   903   C  CE    . LYS A 1 129 ? 29.157  -2.071  46.169  1.00 65.51  ? 109 LYS A CE    1 
ATOM   904   N  NZ    . LYS A 1 129 ? 30.634  -2.226  46.252  1.00 66.44  ? 109 LYS A NZ    1 
ATOM   905   N  N     . ASN A 1 130 ? 24.130  1.058   48.184  1.00 66.31  ? 110 ASN A N     1 
ATOM   906   C  CA    . ASN A 1 130 ? 23.170  0.429   49.096  1.00 66.32  ? 110 ASN A CA    1 
ATOM   907   C  C     . ASN A 1 130 ? 21.758  0.441   48.512  1.00 67.00  ? 110 ASN A C     1 
ATOM   908   O  O     . ASN A 1 130 ? 21.087  -0.592  48.499  1.00 67.91  ? 110 ASN A O     1 
ATOM   909   C  CB    . ASN A 1 130 ? 23.174  1.130   50.460  1.00 65.72  ? 110 ASN A CB    1 
ATOM   910   C  CG    . ASN A 1 130 ? 22.353  0.391   51.501  1.00 65.02  ? 110 ASN A CG    1 
ATOM   911   O  OD1   . ASN A 1 130 ? 21.408  0.942   52.067  1.00 64.41  ? 110 ASN A OD1   1 
ATOM   912   N  ND2   . ASN A 1 130 ? 22.705  -0.865  51.751  1.00 64.57  ? 110 ASN A ND2   1 
ATOM   913   N  N     . GLN A 1 131 ? 21.321  1.607   48.031  1.00 67.34  ? 111 GLN A N     1 
ATOM   914   C  CA    . GLN A 1 131 ? 19.973  1.772   47.464  1.00 68.41  ? 111 GLN A CA    1 
ATOM   915   C  C     . GLN A 1 131 ? 19.704  0.852   46.272  1.00 68.91  ? 111 GLN A C     1 
ATOM   916   O  O     . GLN A 1 131 ? 18.602  0.315   46.142  1.00 70.27  ? 111 GLN A O     1 
ATOM   917   C  CB    . GLN A 1 131 ? 19.723  3.224   47.042  1.00 68.63  ? 111 GLN A CB    1 
ATOM   918   C  CG    . GLN A 1 131 ? 19.614  4.208   48.193  1.00 68.80  ? 111 GLN A CG    1 
ATOM   919   C  CD    . GLN A 1 131 ? 19.022  5.537   47.762  1.00 68.51  ? 111 GLN A CD    1 
ATOM   920   O  OE1   . GLN A 1 131 ? 19.414  6.102   46.742  1.00 68.68  ? 111 GLN A OE1   1 
ATOM   921   N  NE2   . GLN A 1 131 ? 18.075  6.044   48.539  1.00 68.56  ? 111 GLN A NE2   1 
ATOM   922   N  N     . LEU A 1 132 ? 20.705  0.688   45.408  1.00 68.75  ? 112 LEU A N     1 
ATOM   923   C  CA    . LEU A 1 132 ? 20.611  -0.230  44.267  1.00 68.53  ? 112 LEU A CA    1 
ATOM   924   C  C     . LEU A 1 132 ? 20.515  -1.689  44.719  1.00 68.50  ? 112 LEU A C     1 
ATOM   925   O  O     . LEU A 1 132 ? 19.711  -2.453  44.179  1.00 68.81  ? 112 LEU A O     1 
ATOM   926   C  CB    . LEU A 1 132 ? 21.806  -0.051  43.321  1.00 68.31  ? 112 LEU A CB    1 
ATOM   927   C  CG    . LEU A 1 132 ? 21.869  1.283   42.568  1.00 68.06  ? 112 LEU A CG    1 
ATOM   928   C  CD1   . LEU A 1 132 ? 23.259  1.515   41.995  1.00 67.95  ? 112 LEU A CD1   1 
ATOM   929   C  CD2   . LEU A 1 132 ? 20.818  1.349   41.469  1.00 68.01  ? 112 LEU A CD2   1 
ATOM   930   N  N     . LYS A 1 133 ? 21.332  -2.061  45.705  1.00 68.20  ? 113 LYS A N     1 
ATOM   931   C  CA    . LYS A 1 133 ? 21.312  -3.420  46.268  1.00 68.67  ? 113 LYS A CA    1 
ATOM   932   C  C     . LYS A 1 133 ? 19.991  -3.772  46.961  1.00 68.28  ? 113 LYS A C     1 
ATOM   933   O  O     . LYS A 1 133 ? 19.555  -4.922  46.898  1.00 68.72  ? 113 LYS A O     1 
ATOM   934   C  CB    . LYS A 1 133 ? 22.485  -3.641  47.234  1.00 69.26  ? 113 LYS A CB    1 
ATOM   935   C  CG    . LYS A 1 133 ? 23.796  -3.960  46.537  1.00 69.82  ? 113 LYS A CG    1 
ATOM   936   C  CD    . LYS A 1 133 ? 24.907  -4.223  47.540  1.00 70.70  ? 113 LYS A CD    1 
ATOM   937   C  CE    . LYS A 1 133 ? 26.144  -4.808  46.873  1.00 71.70  ? 113 LYS A CE    1 
ATOM   938   N  NZ    . LYS A 1 133 ? 26.022  -6.270  46.609  1.00 71.98  ? 113 LYS A NZ    1 
ATOM   939   N  N     . MET A 1 134 ? 19.363  -2.790  47.607  1.00 68.01  ? 114 MET A N     1 
ATOM   940   C  CA    . MET A 1 134 ? 18.048  -2.989  48.240  1.00 67.83  ? 114 MET A CA    1 
ATOM   941   C  C     . MET A 1 134 ? 16.897  -3.096  47.229  1.00 65.97  ? 114 MET A C     1 
ATOM   942   O  O     . MET A 1 134 ? 15.874  -3.720  47.527  1.00 64.64  ? 114 MET A O     1 
ATOM   943   C  CB    . MET A 1 134 ? 17.762  -1.885  49.263  1.00 69.00  ? 114 MET A CB    1 
ATOM   944   C  CG    . MET A 1 134 ? 18.626  -1.991  50.509  1.00 69.81  ? 114 MET A CG    1 
ATOM   945   S  SD    . MET A 1 134 ? 18.208  -0.769  51.763  1.00 72.20  ? 114 MET A SD    1 
ATOM   946   C  CE    . MET A 1 134 ? 16.657  -1.427  52.376  1.00 73.09  ? 114 MET A CE    1 
ATOM   947   N  N     . LEU A 1 135 ? 17.059  -2.484  46.054  1.00 64.28  ? 115 LEU A N     1 
ATOM   948   C  CA    . LEU A 1 135 ? 16.127  -2.679  44.929  1.00 62.86  ? 115 LEU A CA    1 
ATOM   949   C  C     . LEU A 1 135 ? 16.319  -4.031  44.222  1.00 61.83  ? 115 LEU A C     1 
ATOM   950   O  O     . LEU A 1 135 ? 15.457  -4.452  43.452  1.00 61.41  ? 115 LEU A O     1 
ATOM   951   C  CB    . LEU A 1 135 ? 16.233  -1.529  43.918  1.00 62.14  ? 115 LEU A CB    1 
ATOM   952   C  CG    . LEU A 1 135 ? 15.631  -0.198  44.389  1.00 61.67  ? 115 LEU A CG    1 
ATOM   953   C  CD1   . LEU A 1 135 ? 16.169  0.968   43.571  1.00 61.66  ? 115 LEU A CD1   1 
ATOM   954   C  CD2   . LEU A 1 135 ? 14.109  -0.233  44.338  1.00 61.10  ? 115 LEU A CD2   1 
ATOM   955   N  N     . GLY A 1 136 ? 17.451  -4.689  44.463  1.00 61.33  ? 116 GLY A N     1 
ATOM   956   C  CA    . GLY A 1 136 ? 17.651  -6.079  44.059  1.00 61.27  ? 116 GLY A CA    1 
ATOM   957   C  C     . GLY A 1 136 ? 17.895  -6.277  42.577  1.00 60.72  ? 116 GLY A C     1 
ATOM   958   O  O     . GLY A 1 136 ? 17.402  -7.243  41.985  1.00 59.80  ? 116 GLY A O     1 
ATOM   959   N  N     . PHE A 1 137 ? 18.660  -5.366  41.980  1.00 60.21  ? 117 PHE A N     1 
ATOM   960   C  CA    . PHE A 1 137 ? 19.059  -5.492  40.585  1.00 59.73  ? 117 PHE A CA    1 
ATOM   961   C  C     . PHE A 1 137 ? 20.200  -6.499  40.531  1.00 59.80  ? 117 PHE A C     1 
ATOM   962   O  O     . PHE A 1 137 ? 21.211  -6.326  41.218  1.00 59.71  ? 117 PHE A O     1 
ATOM   963   C  CB    . PHE A 1 137 ? 19.521  -4.146  40.011  1.00 59.40  ? 117 PHE A CB    1 
ATOM   964   C  CG    . PHE A 1 137 ? 18.482  -3.050  40.078  1.00 58.59  ? 117 PHE A CG    1 
ATOM   965   C  CD1   . PHE A 1 137 ? 17.200  -3.246  39.567  1.00 57.61  ? 117 PHE A CD1   1 
ATOM   966   C  CD2   . PHE A 1 137 ? 18.794  -1.807  40.630  1.00 58.08  ? 117 PHE A CD2   1 
ATOM   967   C  CE1   . PHE A 1 137 ? 16.249  -2.235  39.624  1.00 57.00  ? 117 PHE A CE1   1 
ATOM   968   C  CE2   . PHE A 1 137 ? 17.846  -0.794  40.687  1.00 57.45  ? 117 PHE A CE2   1 
ATOM   969   C  CZ    . PHE A 1 137 ? 16.572  -1.009  40.184  1.00 56.93  ? 117 PHE A CZ    1 
ATOM   970   N  N     . GLY A 1 138 ? 20.034  -7.554  39.735  1.00 59.64  ? 118 GLY A N     1 
ATOM   971   C  CA    . GLY A 1 138 ? 21.047  -8.599  39.602  1.00 59.41  ? 118 GLY A CA    1 
ATOM   972   C  C     . GLY A 1 138 ? 22.251  -8.164  38.789  1.00 59.33  ? 118 GLY A C     1 
ATOM   973   O  O     . GLY A 1 138 ? 22.423  -8.592  37.644  1.00 58.34  ? 118 GLY A O     1 
ATOM   974   N  N     . TYR A 1 139 ? 23.086  -7.319  39.394  1.00 59.65  ? 119 TYR A N     1 
ATOM   975   C  CA    . TYR A 1 139 ? 24.293  -6.797  38.750  1.00 59.17  ? 119 TYR A CA    1 
ATOM   976   C  C     . TYR A 1 139 ? 25.499  -7.687  39.043  1.00 59.20  ? 119 TYR A C     1 
ATOM   977   O  O     . TYR A 1 139 ? 25.523  -8.416  40.040  1.00 59.12  ? 119 TYR A O     1 
ATOM   978   C  CB    . TYR A 1 139 ? 24.601  -5.364  39.222  1.00 58.55  ? 119 TYR A CB    1 
ATOM   979   C  CG    . TYR A 1 139 ? 23.676  -4.283  38.689  1.00 57.88  ? 119 TYR A CG    1 
ATOM   980   C  CD1   . TYR A 1 139 ? 23.441  -4.147  37.318  1.00 57.92  ? 119 TYR A CD1   1 
ATOM   981   C  CD2   . TYR A 1 139 ? 23.066  -3.365  39.550  1.00 57.32  ? 119 TYR A CD2   1 
ATOM   982   C  CE1   . TYR A 1 139 ? 22.606  -3.155  36.824  1.00 57.63  ? 119 TYR A CE1   1 
ATOM   983   C  CE2   . TYR A 1 139 ? 22.232  -2.365  39.062  1.00 57.09  ? 119 TYR A CE2   1 
ATOM   984   C  CZ    . TYR A 1 139 ? 22.005  -2.267  37.698  1.00 57.19  ? 119 TYR A CZ    1 
ATOM   985   O  OH    . TYR A 1 139 ? 21.184  -1.289  37.194  1.00 56.86  ? 119 TYR A OH    1 
ATOM   986   N  N     . ASP A 1 140 ? 26.493  -7.613  38.160  1.00 59.70  ? 120 ASP A N     1 
ATOM   987   C  CA    . ASP A 1 140 ? 27.799  -8.229  38.379  1.00 59.96  ? 120 ASP A CA    1 
ATOM   988   C  C     . ASP A 1 140 ? 28.657  -7.220  39.149  1.00 59.59  ? 120 ASP A C     1 
ATOM   989   O  O     . ASP A 1 140 ? 29.326  -6.368  38.554  1.00 59.37  ? 120 ASP A O     1 
ATOM   990   C  CB    . ASP A 1 140 ? 28.439  -8.614  37.034  1.00 60.96  ? 120 ASP A CB    1 
ATOM   991   C  CG    . ASP A 1 140 ? 29.630  -9.557  37.185  1.00 62.10  ? 120 ASP A CG    1 
ATOM   992   O  OD1   . ASP A 1 140 ? 30.232  -9.627  38.277  1.00 63.20  ? 120 ASP A OD1   1 
ATOM   993   O  OD2   . ASP A 1 140 ? 29.965  -10.248 36.199  1.00 62.77  ? 120 ASP A OD2   1 
ATOM   994   N  N     . TRP A 1 141 ? 28.617  -7.319  40.478  1.00 59.40  ? 121 TRP A N     1 
ATOM   995   C  CA    . TRP A 1 141 ? 29.330  -6.380  41.360  1.00 59.28  ? 121 TRP A CA    1 
ATOM   996   C  C     . TRP A 1 141 ? 30.854  -6.550  41.362  1.00 61.42  ? 121 TRP A C     1 
ATOM   997   O  O     . TRP A 1 141 ? 31.568  -5.639  41.786  1.00 63.15  ? 121 TRP A O     1 
ATOM   998   C  CB    . TRP A 1 141 ? 28.795  -6.461  42.796  1.00 57.27  ? 121 TRP A CB    1 
ATOM   999   C  CG    . TRP A 1 141 ? 27.439  -5.852  42.955  1.00 55.72  ? 121 TRP A CG    1 
ATOM   1000  C  CD1   . TRP A 1 141 ? 26.259  -6.510  43.150  1.00 55.05  ? 121 TRP A CD1   1 
ATOM   1001  C  CD2   . TRP A 1 141 ? 27.120  -4.456  42.925  1.00 54.60  ? 121 TRP A CD2   1 
ATOM   1002  N  NE1   . TRP A 1 141 ? 25.225  -5.609  43.249  1.00 54.66  ? 121 TRP A NE1   1 
ATOM   1003  C  CE2   . TRP A 1 141 ? 25.725  -4.341  43.113  1.00 54.32  ? 121 TRP A CE2   1 
ATOM   1004  C  CE3   . TRP A 1 141 ? 27.879  -3.290  42.757  1.00 54.09  ? 121 TRP A CE3   1 
ATOM   1005  C  CZ2   . TRP A 1 141 ? 25.070  -3.103  43.139  1.00 53.88  ? 121 TRP A CZ2   1 
ATOM   1006  C  CZ3   . TRP A 1 141 ? 27.229  -2.057  42.783  1.00 53.70  ? 121 TRP A CZ3   1 
ATOM   1007  C  CH2   . TRP A 1 141 ? 25.836  -1.976  42.972  1.00 53.60  ? 121 TRP A CH2   1 
ATOM   1008  N  N     . SER A 1 142 ? 31.348  -7.703  40.904  1.00 62.64  ? 122 SER A N     1 
ATOM   1009  C  CA    . SER A 1 142 ? 32.789  -7.916  40.728  1.00 63.53  ? 122 SER A CA    1 
ATOM   1010  C  C     . SER A 1 142 ? 33.389  -7.087  39.577  1.00 64.60  ? 122 SER A C     1 
ATOM   1011  O  O     . SER A 1 142 ? 34.600  -6.851  39.559  1.00 65.28  ? 122 SER A O     1 
ATOM   1012  C  CB    . SER A 1 142 ? 33.097  -9.404  40.524  1.00 63.60  ? 122 SER A CB    1 
ATOM   1013  O  OG    . SER A 1 142 ? 32.583  -9.876  39.293  1.00 64.20  ? 122 SER A OG    1 
ATOM   1014  N  N     . ARG A 1 143 ? 32.550  -6.652  38.630  1.00 65.35  ? 123 ARG A N     1 
ATOM   1015  C  CA    . ARG A 1 143 ? 32.974  -5.776  37.530  1.00 65.89  ? 123 ARG A CA    1 
ATOM   1016  C  C     . ARG A 1 143 ? 32.598  -4.306  37.773  1.00 65.37  ? 123 ARG A C     1 
ATOM   1017  O  O     . ARG A 1 143 ? 32.260  -3.587  36.827  1.00 64.91  ? 123 ARG A O     1 
ATOM   1018  C  CB    . ARG A 1 143 ? 32.346  -6.242  36.209  1.00 66.96  ? 123 ARG A CB    1 
ATOM   1019  C  CG    . ARG A 1 143 ? 32.607  -7.691  35.828  1.00 68.04  ? 123 ARG A CG    1 
ATOM   1020  C  CD    . ARG A 1 143 ? 31.711  -8.090  34.667  1.00 69.10  ? 123 ARG A CD    1 
ATOM   1021  N  NE    . ARG A 1 143 ? 31.946  -9.462  34.215  1.00 70.14  ? 123 ARG A NE    1 
ATOM   1022  C  CZ    . ARG A 1 143 ? 32.823  -9.839  33.279  1.00 71.45  ? 123 ARG A CZ    1 
ATOM   1023  N  NH1   . ARG A 1 143 ? 33.600  -8.958  32.645  1.00 71.03  ? 123 ARG A NH1   1 
ATOM   1024  N  NH2   . ARG A 1 143 ? 32.927  -11.131 32.971  1.00 72.91  ? 123 ARG A NH2   1 
ATOM   1025  N  N     . GLU A 1 144 ? 32.669  -3.855  39.026  1.00 65.37  ? 124 GLU A N     1 
ATOM   1026  C  CA    . GLU A 1 144 ? 32.316  -2.474  39.373  1.00 65.74  ? 124 GLU A CA    1 
ATOM   1027  C  C     . GLU A 1 144 ? 33.462  -1.520  39.021  1.00 65.16  ? 124 GLU A C     1 
ATOM   1028  O  O     . GLU A 1 144 ? 34.635  -1.880  39.143  1.00 65.78  ? 124 GLU A O     1 
ATOM   1029  C  CB    . GLU A 1 144 ? 31.962  -2.363  40.860  1.00 66.05  ? 124 GLU A CB    1 
ATOM   1030  C  CG    . GLU A 1 144 ? 31.239  -1.074  41.236  1.00 66.42  ? 124 GLU A CG    1 
ATOM   1031  C  CD    . GLU A 1 144 ? 30.915  -0.971  42.718  1.00 66.46  ? 124 GLU A CD    1 
ATOM   1032  O  OE1   . GLU A 1 144 ? 30.911  -2.005  43.420  1.00 66.50  ? 124 GLU A OE1   1 
ATOM   1033  O  OE2   . GLU A 1 144 ? 30.657  0.158   43.186  1.00 66.77  ? 124 GLU A OE2   1 
ATOM   1034  N  N     . LEU A 1 145 ? 33.106  -0.312  38.583  1.00 64.67  ? 125 LEU A N     1 
ATOM   1035  C  CA    . LEU A 1 145 ? 34.076  0.712   38.184  1.00 64.44  ? 125 LEU A CA    1 
ATOM   1036  C  C     . LEU A 1 145 ? 33.716  2.074   38.755  1.00 64.26  ? 125 LEU A C     1 
ATOM   1037  O  O     . LEU A 1 145 ? 32.539  2.437   38.828  1.00 64.62  ? 125 LEU A O     1 
ATOM   1038  C  CB    . LEU A 1 145 ? 34.137  0.834   36.658  1.00 64.38  ? 125 LEU A CB    1 
ATOM   1039  C  CG    . LEU A 1 145 ? 34.776  -0.311  35.873  1.00 64.94  ? 125 LEU A CG    1 
ATOM   1040  C  CD1   . LEU A 1 145 ? 34.556  -0.085  34.386  1.00 65.02  ? 125 LEU A CD1   1 
ATOM   1041  C  CD2   . LEU A 1 145 ? 36.261  -0.445  36.186  1.00 65.14  ? 125 LEU A CD2   1 
ATOM   1042  N  N     . ALA A 1 146 ? 34.747  2.815   39.157  1.00 63.62  ? 126 ALA A N     1 
ATOM   1043  C  CA    . ALA A 1 146 ? 34.639  4.229   39.485  1.00 63.30  ? 126 ALA A CA    1 
ATOM   1044  C  C     . ALA A 1 146 ? 35.586  4.964   38.548  1.00 63.36  ? 126 ALA A C     1 
ATOM   1045  O  O     . ALA A 1 146 ? 36.796  4.734   38.587  1.00 63.89  ? 126 ALA A O     1 
ATOM   1046  C  CB    . ALA A 1 146 ? 35.026  4.469   40.933  1.00 63.57  ? 126 ALA A CB    1 
ATOM   1047  N  N     . THR A 1 147 ? 35.038  5.841   37.709  1.00 63.68  ? 127 THR A N     1 
ATOM   1048  C  CA    . THR A 1 147 ? 35.830  6.538   36.688  1.00 64.29  ? 127 THR A CA    1 
ATOM   1049  C  C     . THR A 1 147 ? 36.813  7.582   37.245  1.00 66.16  ? 127 THR A C     1 
ATOM   1050  O  O     . THR A 1 147 ? 37.715  8.013   36.522  1.00 67.11  ? 127 THR A O     1 
ATOM   1051  C  CB    . THR A 1 147 ? 34.924  7.213   35.637  1.00 63.78  ? 127 THR A CB    1 
ATOM   1052  O  OG1   . THR A 1 147 ? 34.007  8.103   36.285  1.00 64.12  ? 127 THR A OG1   1 
ATOM   1053  C  CG2   . THR A 1 147 ? 34.143  6.172   34.854  1.00 63.94  ? 127 THR A CG2   1 
ATOM   1054  N  N     . CYS A 1 148 ? 36.648  7.979   38.511  1.00 67.39  ? 128 CYS A N     1 
ATOM   1055  C  CA    . CYS A 1 148 ? 37.546  8.944   39.157  1.00 67.38  ? 128 CYS A CA    1 
ATOM   1056  C  C     . CYS A 1 148 ? 38.828  8.327   39.724  1.00 68.08  ? 128 CYS A C     1 
ATOM   1057  O  O     . CYS A 1 148 ? 39.722  9.065   40.140  1.00 68.58  ? 128 CYS A O     1 
ATOM   1058  C  CB    . CYS A 1 148 ? 36.822  9.704   40.270  1.00 67.05  ? 128 CYS A CB    1 
ATOM   1059  S  SG    . CYS A 1 148 ? 36.290  8.666   41.648  1.00 66.93  ? 128 CYS A SG    1 
ATOM   1060  N  N     . THR A 1 149 ? 38.910  6.995   39.765  1.00 68.77  ? 129 THR A N     1 
ATOM   1061  C  CA    . THR A 1 149 ? 40.128  6.307   40.200  1.00 69.74  ? 129 THR A CA    1 
ATOM   1062  C  C     . THR A 1 149 ? 41.145  6.259   39.055  1.00 71.23  ? 129 THR A C     1 
ATOM   1063  O  O     . THR A 1 149 ? 40.752  6.125   37.892  1.00 71.47  ? 129 THR A O     1 
ATOM   1064  C  CB    . THR A 1 149 ? 39.839  4.867   40.672  1.00 69.06  ? 129 THR A CB    1 
ATOM   1065  O  OG1   . THR A 1 149 ? 39.240  4.115   39.609  1.00 68.01  ? 129 THR A OG1   1 
ATOM   1066  C  CG2   . THR A 1 149 ? 38.909  4.872   41.880  1.00 68.93  ? 129 THR A CG2   1 
ATOM   1067  N  N     . PRO A 1 150 ? 42.453  6.350   39.377  1.00 72.63  ? 130 PRO A N     1 
ATOM   1068  C  CA    . PRO A 1 150 ? 43.492  6.287   38.341  1.00 73.36  ? 130 PRO A CA    1 
ATOM   1069  C  C     . PRO A 1 150 ? 43.641  4.917   37.666  1.00 73.93  ? 130 PRO A C     1 
ATOM   1070  O  O     . PRO A 1 150 ? 44.242  4.842   36.596  1.00 74.51  ? 130 PRO A O     1 
ATOM   1071  C  CB    . PRO A 1 150 ? 44.767  6.669   39.098  1.00 73.60  ? 130 PRO A CB    1 
ATOM   1072  C  CG    . PRO A 1 150 ? 44.508  6.248   40.499  1.00 73.92  ? 130 PRO A CG    1 
ATOM   1073  C  CD    . PRO A 1 150 ? 43.039  6.452   40.728  1.00 73.46  ? 130 PRO A CD    1 
ATOM   1074  N  N     . GLU A 1 151 ? 43.106  3.857   38.279  1.00 74.71  ? 131 GLU A N     1 
ATOM   1075  C  CA    . GLU A 1 151 ? 43.008  2.539   37.629  1.00 75.46  ? 131 GLU A CA    1 
ATOM   1076  C  C     . GLU A 1 151 ? 42.220  2.625   36.320  1.00 73.45  ? 131 GLU A C     1 
ATOM   1077  O  O     . GLU A 1 151 ? 42.552  1.938   35.352  1.00 73.53  ? 131 GLU A O     1 
ATOM   1078  C  CB    . GLU A 1 151 ? 42.349  1.494   38.551  1.00 78.38  ? 131 GLU A CB    1 
ATOM   1079  C  CG    . GLU A 1 151 ? 43.277  0.856   39.584  1.00 81.14  ? 131 GLU A CG    1 
ATOM   1080  C  CD    . GLU A 1 151 ? 43.680  1.790   40.720  1.00 83.46  ? 131 GLU A CD    1 
ATOM   1081  O  OE1   . GLU A 1 151 ? 42.845  2.613   41.160  1.00 85.31  ? 131 GLU A OE1   1 
ATOM   1082  O  OE2   . GLU A 1 151 ? 44.839  1.695   41.181  1.00 83.21  ? 131 GLU A OE2   1 
ATOM   1083  N  N     . TYR A 1 152 ? 41.185  3.469   36.303  1.00 71.77  ? 132 TYR A N     1 
ATOM   1084  C  CA    . TYR A 1 152 ? 40.364  3.688   35.113  1.00 70.57  ? 132 TYR A CA    1 
ATOM   1085  C  C     . TYR A 1 152 ? 40.987  4.705   34.153  1.00 69.10  ? 132 TYR A C     1 
ATOM   1086  O  O     . TYR A 1 152 ? 41.285  4.363   33.007  1.00 67.21  ? 132 TYR A O     1 
ATOM   1087  C  CB    . TYR A 1 152 ? 38.948  4.132   35.501  1.00 70.43  ? 132 TYR A CB    1 
ATOM   1088  C  CG    . TYR A 1 152 ? 37.998  4.204   34.324  1.00 69.86  ? 132 TYR A CG    1 
ATOM   1089  C  CD1   . TYR A 1 152 ? 37.396  3.052   33.821  1.00 69.47  ? 132 TYR A CD1   1 
ATOM   1090  C  CD2   . TYR A 1 152 ? 37.713  5.422   33.703  1.00 69.65  ? 132 TYR A CD2   1 
ATOM   1091  C  CE1   . TYR A 1 152 ? 36.533  3.109   32.736  1.00 69.84  ? 132 TYR A CE1   1 
ATOM   1092  C  CE2   . TYR A 1 152 ? 36.852  5.491   32.617  1.00 69.77  ? 132 TYR A CE2   1 
ATOM   1093  C  CZ    . TYR A 1 152 ? 36.263  4.332   32.138  1.00 70.23  ? 132 TYR A CZ    1 
ATOM   1094  O  OH    . TYR A 1 152 ? 35.407  4.392   31.064  1.00 70.89  ? 132 TYR A OH    1 
ATOM   1095  N  N     . TYR A 1 153 ? 41.187  5.942   34.618  1.00 68.93  ? 133 TYR A N     1 
ATOM   1096  C  CA    . TYR A 1 153 ? 41.568  7.050   33.717  1.00 69.49  ? 133 TYR A CA    1 
ATOM   1097  C  C     . TYR A 1 153 ? 43.013  7.032   33.188  1.00 68.58  ? 133 TYR A C     1 
ATOM   1098  O  O     . TYR A 1 153 ? 43.351  7.855   32.336  1.00 67.13  ? 133 TYR A O     1 
ATOM   1099  C  CB    . TYR A 1 153 ? 41.211  8.432   34.308  1.00 70.79  ? 133 TYR A CB    1 
ATOM   1100  C  CG    . TYR A 1 153 ? 42.019  8.914   35.506  1.00 72.21  ? 133 TYR A CG    1 
ATOM   1101  C  CD1   . TYR A 1 153 ? 43.324  9.404   35.359  1.00 72.57  ? 133 TYR A CD1   1 
ATOM   1102  C  CD2   . TYR A 1 153 ? 41.455  8.939   36.783  1.00 73.05  ? 133 TYR A CD2   1 
ATOM   1103  C  CE1   . TYR A 1 153 ? 44.049  9.861   36.453  1.00 72.34  ? 133 TYR A CE1   1 
ATOM   1104  C  CE2   . TYR A 1 153 ? 42.174  9.398   37.879  1.00 73.16  ? 133 TYR A CE2   1 
ATOM   1105  C  CZ    . TYR A 1 153 ? 43.467  9.855   37.711  1.00 72.38  ? 133 TYR A CZ    1 
ATOM   1106  O  OH    . TYR A 1 153 ? 44.162  10.306  38.807  1.00 72.23  ? 133 TYR A OH    1 
ATOM   1107  N  N     . ARG A 1 154 ? 43.858  6.125   33.682  1.00 68.25  ? 134 ARG A N     1 
ATOM   1108  C  CA    . ARG A 1 154 ? 45.197  5.933   33.100  1.00 68.28  ? 134 ARG A CA    1 
ATOM   1109  C  C     . ARG A 1 154 ? 45.164  5.550   31.617  1.00 67.61  ? 134 ARG A C     1 
ATOM   1110  O  O     . ARG A 1 154 ? 46.025  5.976   30.845  1.00 66.95  ? 134 ARG A O     1 
ATOM   1111  C  CB    . ARG A 1 154 ? 46.016  4.895   33.886  1.00 69.13  ? 134 ARG A CB    1 
ATOM   1112  C  CG    . ARG A 1 154 ? 45.483  3.467   33.876  1.00 70.34  ? 134 ARG A CG    1 
ATOM   1113  C  CD    . ARG A 1 154 ? 46.444  2.520   34.580  1.00 71.72  ? 134 ARG A CD    1 
ATOM   1114  N  NE    . ARG A 1 154 ? 47.701  2.354   33.846  1.00 72.64  ? 134 ARG A NE    1 
ATOM   1115  C  CZ    . ARG A 1 154 ? 48.717  1.578   34.232  1.00 73.07  ? 134 ARG A CZ    1 
ATOM   1116  N  NH1   . ARG A 1 154 ? 48.652  0.869   35.359  1.00 74.11  ? 134 ARG A NH1   1 
ATOM   1117  N  NH2   . ARG A 1 154 ? 49.814  1.509   33.481  1.00 73.03  ? 134 ARG A NH2   1 
ATOM   1118  N  N     . TRP A 1 155 ? 44.162  4.761   31.231  1.00 67.86  ? 135 TRP A N     1 
ATOM   1119  C  CA    . TRP A 1 155 ? 44.077  4.202   29.880  1.00 67.27  ? 135 TRP A CA    1 
ATOM   1120  C  C     . TRP A 1 155 ? 43.521  5.190   28.857  1.00 67.06  ? 135 TRP A C     1 
ATOM   1121  O  O     . TRP A 1 155 ? 43.950  5.172   27.704  1.00 67.74  ? 135 TRP A O     1 
ATOM   1122  C  CB    . TRP A 1 155 ? 43.252  2.914   29.881  1.00 66.86  ? 135 TRP A CB    1 
ATOM   1123  C  CG    . TRP A 1 155 ? 43.776  1.890   30.840  1.00 66.90  ? 135 TRP A CG    1 
ATOM   1124  C  CD1   . TRP A 1 155 ? 43.133  1.381   31.931  1.00 66.88  ? 135 TRP A CD1   1 
ATOM   1125  C  CD2   . TRP A 1 155 ? 45.067  1.271   30.808  1.00 67.24  ? 135 TRP A CD2   1 
ATOM   1126  N  NE1   . TRP A 1 155 ? 43.938  0.473   32.575  1.00 67.03  ? 135 TRP A NE1   1 
ATOM   1127  C  CE2   . TRP A 1 155 ? 45.132  0.387   31.908  1.00 67.49  ? 135 TRP A CE2   1 
ATOM   1128  C  CE3   . TRP A 1 155 ? 46.175  1.374   29.954  1.00 67.21  ? 135 TRP A CE3   1 
ATOM   1129  C  CZ2   . TRP A 1 155 ? 46.264  -0.395  32.177  1.00 67.82  ? 135 TRP A CZ2   1 
ATOM   1130  C  CZ3   . TRP A 1 155 ? 47.302  0.597   30.222  1.00 67.15  ? 135 TRP A CZ3   1 
ATOM   1131  C  CH2   . TRP A 1 155 ? 47.335  -0.276  31.325  1.00 67.61  ? 135 TRP A CH2   1 
ATOM   1132  N  N     . GLU A 1 156 ? 42.575  6.038   29.264  1.00 66.99  ? 136 GLU A N     1 
ATOM   1133  C  CA    . GLU A 1 156 ? 42.078  7.109   28.386  1.00 68.35  ? 136 GLU A CA    1 
ATOM   1134  C  C     . GLU A 1 156 ? 43.136  8.196   28.161  1.00 69.46  ? 136 GLU A C     1 
ATOM   1135  O  O     . GLU A 1 156 ? 43.175  8.808   27.091  1.00 70.68  ? 136 GLU A O     1 
ATOM   1136  C  CB    . GLU A 1 156 ? 40.764  7.711   28.907  1.00 68.28  ? 136 GLU A CB    1 
ATOM   1137  C  CG    . GLU A 1 156 ? 40.868  8.598   30.145  1.00 68.06  ? 136 GLU A CG    1 
ATOM   1138  C  CD    . GLU A 1 156 ? 39.540  9.222   30.538  1.00 67.45  ? 136 GLU A CD    1 
ATOM   1139  O  OE1   . GLU A 1 156 ? 38.480  8.668   30.179  1.00 67.98  ? 136 GLU A OE1   1 
ATOM   1140  O  OE2   . GLU A 1 156 ? 39.554  10.270  31.213  1.00 66.58  ? 136 GLU A OE2   1 
ATOM   1141  N  N     . GLN A 1 157 ? 43.972  8.438   29.175  1.00 69.31  ? 137 GLN A N     1 
ATOM   1142  C  CA    . GLN A 1 157 ? 45.156  9.297   29.030  1.00 68.71  ? 137 GLN A CA    1 
ATOM   1143  C  C     . GLN A 1 157 ? 46.142  8.679   28.036  1.00 68.93  ? 137 GLN A C     1 
ATOM   1144  O  O     . GLN A 1 157 ? 46.594  9.347   27.104  1.00 68.58  ? 137 GLN A O     1 
ATOM   1145  C  CB    . GLN A 1 157 ? 45.848  9.524   30.384  1.00 68.19  ? 137 GLN A CB    1 
ATOM   1146  C  CG    . GLN A 1 157 ? 45.115  10.485  31.316  1.00 67.68  ? 137 GLN A CG    1 
ATOM   1147  C  CD    . GLN A 1 157 ? 45.761  10.615  32.691  1.00 66.87  ? 137 GLN A CD    1 
ATOM   1148  O  OE1   . GLN A 1 157 ? 46.506  9.740   33.136  1.00 66.55  ? 137 GLN A OE1   1 
ATOM   1149  N  NE2   . GLN A 1 157 ? 45.466  11.714  33.375  1.00 65.49  ? 137 GLN A NE2   1 
ATOM   1150  N  N     . LYS A 1 158 ? 46.455  7.400   28.241  1.00 69.38  ? 138 LYS A N     1 
ATOM   1151  C  CA    . LYS A 1 158 ? 47.322  6.633   27.337  1.00 70.44  ? 138 LYS A CA    1 
ATOM   1152  C  C     . LYS A 1 158 ? 46.778  6.592   25.906  1.00 70.31  ? 138 LYS A C     1 
ATOM   1153  O  O     . LYS A 1 158 ? 47.551  6.629   24.950  1.00 70.27  ? 138 LYS A O     1 
ATOM   1154  C  CB    . LYS A 1 158 ? 47.506  5.203   27.871  1.00 71.83  ? 138 LYS A CB    1 
ATOM   1155  C  CG    . LYS A 1 158 ? 48.419  4.294   27.052  1.00 72.90  ? 138 LYS A CG    1 
ATOM   1156  C  CD    . LYS A 1 158 ? 49.865  4.764   27.064  1.00 73.78  ? 138 LYS A CD    1 
ATOM   1157  C  CE    . LYS A 1 158 ? 50.775  3.795   26.325  1.00 74.40  ? 138 LYS A CE    1 
ATOM   1158  N  NZ    . LYS A 1 158 ? 50.641  3.898   24.844  1.00 74.67  ? 138 LYS A NZ    1 
ATOM   1159  N  N     . PHE A 1 159 ? 45.456  6.505   25.773  1.00 71.09  ? 139 PHE A N     1 
ATOM   1160  C  CA    . PHE A 1 159 ? 44.793  6.514   24.467  1.00 71.93  ? 139 PHE A CA    1 
ATOM   1161  C  C     . PHE A 1 159 ? 44.845  7.897   23.813  1.00 71.26  ? 139 PHE A C     1 
ATOM   1162  O  O     . PHE A 1 159 ? 45.011  7.997   22.599  1.00 72.44  ? 139 PHE A O     1 
ATOM   1163  C  CB    . PHE A 1 159 ? 43.339  6.045   24.603  1.00 73.07  ? 139 PHE A CB    1 
ATOM   1164  C  CG    . PHE A 1 159 ? 42.685  5.693   23.296  1.00 73.56  ? 139 PHE A CG    1 
ATOM   1165  C  CD1   . PHE A 1 159 ? 43.044  4.532   22.618  1.00 74.07  ? 139 PHE A CD1   1 
ATOM   1166  C  CD2   . PHE A 1 159 ? 41.700  6.510   22.747  1.00 73.71  ? 139 PHE A CD2   1 
ATOM   1167  C  CE1   . PHE A 1 159 ? 42.442  4.196   21.413  1.00 74.18  ? 139 PHE A CE1   1 
ATOM   1168  C  CE2   . PHE A 1 159 ? 41.093  6.179   21.542  1.00 73.86  ? 139 PHE A CE2   1 
ATOM   1169  C  CZ    . PHE A 1 159 ? 41.464  5.021   20.875  1.00 74.14  ? 139 PHE A CZ    1 
ATOM   1170  N  N     . PHE A 1 160 ? 44.703  8.951   24.617  1.00 69.93  ? 140 PHE A N     1 
ATOM   1171  C  CA    . PHE A 1 160 ? 44.769  10.335  24.126  1.00 69.61  ? 140 PHE A CA    1 
ATOM   1172  C  C     . PHE A 1 160 ? 46.123  10.678  23.493  1.00 71.03  ? 140 PHE A C     1 
ATOM   1173  O  O     . PHE A 1 160 ? 46.173  11.400  22.494  1.00 70.91  ? 140 PHE A O     1 
ATOM   1174  C  CB    . PHE A 1 160 ? 44.461  11.320  25.259  1.00 68.38  ? 140 PHE A CB    1 
ATOM   1175  C  CG    . PHE A 1 160 ? 44.331  12.749  24.810  1.00 66.94  ? 140 PHE A CG    1 
ATOM   1176  C  CD1   . PHE A 1 160 ? 43.157  13.199  24.216  1.00 66.55  ? 140 PHE A CD1   1 
ATOM   1177  C  CD2   . PHE A 1 160 ? 45.374  13.651  24.994  1.00 65.92  ? 140 PHE A CD2   1 
ATOM   1178  C  CE1   . PHE A 1 160 ? 43.029  14.518  23.805  1.00 66.08  ? 140 PHE A CE1   1 
ATOM   1179  C  CE2   . PHE A 1 160 ? 45.252  14.971  24.585  1.00 65.45  ? 140 PHE A CE2   1 
ATOM   1180  C  CZ    . PHE A 1 160 ? 44.078  15.405  23.991  1.00 65.53  ? 140 PHE A CZ    1 
ATOM   1181  N  N     . THR A 1 161 ? 47.206  10.163  24.078  1.00 72.30  ? 141 THR A N     1 
ATOM   1182  C  CA    . THR A 1 161 ? 48.553  10.343  23.523  1.00 73.37  ? 141 THR A CA    1 
ATOM   1183  C  C     . THR A 1 161 ? 48.723  9.582   22.207  1.00 74.28  ? 141 THR A C     1 
ATOM   1184  O  O     . THR A 1 161 ? 49.371  10.079  21.283  1.00 75.06  ? 141 THR A O     1 
ATOM   1185  C  CB    . THR A 1 161 ? 49.655  9.897   24.507  1.00 74.10  ? 141 THR A CB    1 
ATOM   1186  O  OG1   . THR A 1 161 ? 49.453  8.527   24.875  1.00 74.98  ? 141 THR A OG1   1 
ATOM   1187  C  CG2   . THR A 1 161 ? 49.652  10.773  25.758  1.00 73.94  ? 141 THR A CG2   1 
ATOM   1188  N  N     . GLU A 1 162 ? 48.145  8.381   22.132  1.00 75.41  ? 142 GLU A N     1 
ATOM   1189  C  CA    . GLU A 1 162 ? 48.103  7.604   20.886  1.00 76.61  ? 142 GLU A CA    1 
ATOM   1190  C  C     . GLU A 1 162 ? 47.300  8.314   19.790  1.00 75.44  ? 142 GLU A C     1 
ATOM   1191  O  O     . GLU A 1 162 ? 47.689  8.276   18.621  1.00 75.00  ? 142 GLU A O     1 
ATOM   1192  C  CB    . GLU A 1 162 ? 47.535  6.199   21.131  1.00 79.40  ? 142 GLU A CB    1 
ATOM   1193  C  CG    . GLU A 1 162 ? 48.442  5.292   21.953  1.00 82.09  ? 142 GLU A CG    1 
ATOM   1194  C  CD    . GLU A 1 162 ? 47.735  4.048   22.479  1.00 85.29  ? 142 GLU A CD    1 
ATOM   1195  O  OE1   . GLU A 1 162 ? 46.758  3.582   21.848  1.00 87.29  ? 142 GLU A OE1   1 
ATOM   1196  O  OE2   . GLU A 1 162 ? 48.164  3.530   23.533  1.00 87.15  ? 142 GLU A OE2   1 
ATOM   1197  N  N     . LEU A 1 163 ? 46.192  8.956   20.170  1.00 74.60  ? 143 LEU A N     1 
ATOM   1198  C  CA    . LEU A 1 163 ? 45.385  9.749   19.228  1.00 74.21  ? 143 LEU A CA    1 
ATOM   1199  C  C     . LEU A 1 163 ? 46.105  11.005  18.725  1.00 74.61  ? 143 LEU A C     1 
ATOM   1200  O  O     . LEU A 1 163 ? 45.853  11.442  17.599  1.00 74.88  ? 143 LEU A O     1 
ATOM   1201  C  CB    . LEU A 1 163 ? 44.033  10.152  19.843  1.00 73.71  ? 143 LEU A CB    1 
ATOM   1202  C  CG    . LEU A 1 163 ? 42.975  9.077   20.128  1.00 73.09  ? 143 LEU A CG    1 
ATOM   1203  C  CD1   . LEU A 1 163 ? 41.655  9.741   20.497  1.00 72.53  ? 143 LEU A CD1   1 
ATOM   1204  C  CD2   . LEU A 1 163 ? 42.778  8.126   18.956  1.00 72.88  ? 143 LEU A CD2   1 
ATOM   1205  N  N     . TYR A 1 164 ? 46.973  11.589  19.555  1.00 74.90  ? 144 TYR A N     1 
ATOM   1206  C  CA    . TYR A 1 164 ? 47.793  12.738  19.141  1.00 74.87  ? 144 TYR A CA    1 
ATOM   1207  C  C     . TYR A 1 164 ? 48.808  12.351  18.064  1.00 74.97  ? 144 TYR A C     1 
ATOM   1208  O  O     . TYR A 1 164 ? 48.971  13.076  17.081  1.00 75.75  ? 144 TYR A O     1 
ATOM   1209  C  CB    . TYR A 1 164 ? 48.521  13.371  20.336  1.00 74.46  ? 144 TYR A CB    1 
ATOM   1210  C  CG    . TYR A 1 164 ? 49.316  14.612  19.974  1.00 74.21  ? 144 TYR A CG    1 
ATOM   1211  C  CD1   . TYR A 1 164 ? 48.728  15.876  20.007  1.00 74.65  ? 144 TYR A CD1   1 
ATOM   1212  C  CD2   . TYR A 1 164 ? 50.655  14.522  19.585  1.00 74.06  ? 144 TYR A CD2   1 
ATOM   1213  C  CE1   . TYR A 1 164 ? 49.450  17.015  19.668  1.00 74.85  ? 144 TYR A CE1   1 
ATOM   1214  C  CE2   . TYR A 1 164 ? 51.385  15.652  19.242  1.00 74.05  ? 144 TYR A CE2   1 
ATOM   1215  C  CZ    . TYR A 1 164 ? 50.780  16.896  19.285  1.00 74.38  ? 144 TYR A CZ    1 
ATOM   1216  O  OH    . TYR A 1 164 ? 51.503  18.018  18.947  1.00 73.69  ? 144 TYR A OH    1 
ATOM   1217  N  N     . LYS A 1 165 ? 49.484  11.219  18.257  1.00 74.88  ? 145 LYS A N     1 
ATOM   1218  C  CA    . LYS A 1 165 ? 50.476  10.725  17.290  1.00 75.82  ? 145 LYS A CA    1 
ATOM   1219  C  C     . LYS A 1 165 ? 49.871  10.308  15.937  1.00 74.64  ? 145 LYS A C     1 
ATOM   1220  O  O     . LYS A 1 165 ? 50.555  10.369  14.914  1.00 75.35  ? 145 LYS A O     1 
ATOM   1221  C  CB    . LYS A 1 165 ? 51.303  9.583   17.898  1.00 77.74  ? 145 LYS A CB    1 
ATOM   1222  C  CG    . LYS A 1 165 ? 52.308  10.064  18.936  1.00 79.39  ? 145 LYS A CG    1 
ATOM   1223  C  CD    . LYS A 1 165 ? 52.948  8.916   19.706  1.00 81.27  ? 145 LYS A CD    1 
ATOM   1224  C  CE    . LYS A 1 165 ? 52.073  8.453   20.861  1.00 82.28  ? 145 LYS A CE    1 
ATOM   1225  N  NZ    . LYS A 1 165 ? 52.698  7.359   21.656  1.00 82.79  ? 145 LYS A NZ    1 
ATOM   1226  N  N     . LYS A 1 166 ? 48.602  9.898   15.933  1.00 73.05  ? 146 LYS A N     1 
ATOM   1227  C  CA    . LYS A 1 166 ? 47.870  9.620   14.685  1.00 72.20  ? 146 LYS A CA    1 
ATOM   1228  C  C     . LYS A 1 166 ? 47.405  10.882  13.932  1.00 71.47  ? 146 LYS A C     1 
ATOM   1229  O  O     . LYS A 1 166 ? 46.973  10.783  12.783  1.00 71.34  ? 146 LYS A O     1 
ATOM   1230  C  CB    . LYS A 1 166 ? 46.659  8.709   14.948  1.00 72.58  ? 146 LYS A CB    1 
ATOM   1231  C  CG    . LYS A 1 166 ? 47.003  7.237   15.115  1.00 73.10  ? 146 LYS A CG    1 
ATOM   1232  C  CD    . LYS A 1 166 ? 45.758  6.361   15.053  1.00 73.34  ? 146 LYS A CD    1 
ATOM   1233  C  CE    . LYS A 1 166 ? 46.108  4.888   14.914  1.00 73.48  ? 146 LYS A CE    1 
ATOM   1234  N  NZ    . LYS A 1 166 ? 44.911  4.052   14.622  1.00 73.39  ? 146 LYS A NZ    1 
ATOM   1235  N  N     . GLY A 1 167 ? 47.479  12.050  14.571  1.00 71.38  ? 147 GLY A N     1 
ATOM   1236  C  CA    . GLY A 1 167 ? 47.025  13.309  13.976  1.00 71.69  ? 147 GLY A CA    1 
ATOM   1237  C  C     . GLY A 1 167 ? 45.540  13.579  14.164  1.00 71.99  ? 147 GLY A C     1 
ATOM   1238  O  O     . GLY A 1 167 ? 44.957  14.376  13.423  1.00 72.06  ? 147 GLY A O     1 
ATOM   1239  N  N     . LEU A 1 168 ? 44.934  12.931  15.163  1.00 71.98  ? 148 LEU A N     1 
ATOM   1240  C  CA    . LEU A 1 168 ? 43.509  13.090  15.470  1.00 71.50  ? 148 LEU A CA    1 
ATOM   1241  C  C     . LEU A 1 168 ? 43.257  14.073  16.622  1.00 71.08  ? 148 LEU A C     1 
ATOM   1242  O  O     . LEU A 1 168 ? 42.121  14.204  17.075  1.00 71.45  ? 148 LEU A O     1 
ATOM   1243  C  CB    . LEU A 1 168 ? 42.887  11.725  15.797  1.00 71.44  ? 148 LEU A CB    1 
ATOM   1244  C  CG    . LEU A 1 168 ? 42.887  10.688  14.667  1.00 71.75  ? 148 LEU A CG    1 
ATOM   1245  C  CD1   . LEU A 1 168 ? 42.529  9.310   15.203  1.00 72.02  ? 148 LEU A CD1   1 
ATOM   1246  C  CD2   . LEU A 1 168 ? 41.935  11.090  13.550  1.00 71.69  ? 148 LEU A CD2   1 
ATOM   1247  N  N     . VAL A 1 169 ? 44.306  14.757  17.086  1.00 70.92  ? 149 VAL A N     1 
ATOM   1248  C  CA    . VAL A 1 169 ? 44.194  15.790  18.119  1.00 70.84  ? 149 VAL A CA    1 
ATOM   1249  C  C     . VAL A 1 169 ? 44.889  17.059  17.624  1.00 70.29  ? 149 VAL A C     1 
ATOM   1250  O  O     . VAL A 1 169 ? 45.934  16.983  16.976  1.00 70.59  ? 149 VAL A O     1 
ATOM   1251  C  CB    . VAL A 1 169 ? 44.830  15.329  19.453  1.00 71.13  ? 149 VAL A CB    1 
ATOM   1252  C  CG1   . VAL A 1 169 ? 44.683  16.389  20.540  1.00 70.95  ? 149 VAL A CG1   1 
ATOM   1253  C  CG2   . VAL A 1 169 ? 44.208  14.017  19.916  1.00 71.35  ? 149 VAL A CG2   1 
ATOM   1254  N  N     . TYR A 1 170 ? 44.302  18.215  17.925  1.00 70.71  ? 150 TYR A N     1 
ATOM   1255  C  CA    . TYR A 1 170 ? 44.901  19.510  17.586  1.00 72.32  ? 150 TYR A CA    1 
ATOM   1256  C  C     . TYR A 1 170 ? 44.391  20.616  18.516  1.00 73.33  ? 150 TYR A C     1 
ATOM   1257  O  O     . TYR A 1 170 ? 43.264  20.546  19.011  1.00 73.46  ? 150 TYR A O     1 
ATOM   1258  C  CB    . TYR A 1 170 ? 44.631  19.867  16.115  1.00 72.04  ? 150 TYR A CB    1 
ATOM   1259  C  CG    . TYR A 1 170 ? 43.208  20.295  15.820  1.00 71.56  ? 150 TYR A CG    1 
ATOM   1260  C  CD1   . TYR A 1 170 ? 42.175  19.360  15.758  1.00 71.34  ? 150 TYR A CD1   1 
ATOM   1261  C  CD2   . TYR A 1 170 ? 42.893  21.639  15.605  1.00 71.74  ? 150 TYR A CD2   1 
ATOM   1262  C  CE1   . TYR A 1 170 ? 40.868  19.750  15.492  1.00 71.10  ? 150 TYR A CE1   1 
ATOM   1263  C  CE2   . TYR A 1 170 ? 41.590  22.038  15.338  1.00 71.71  ? 150 TYR A CE2   1 
ATOM   1264  C  CZ    . TYR A 1 170 ? 40.582  21.091  15.282  1.00 71.05  ? 150 TYR A CZ    1 
ATOM   1265  O  OH    . TYR A 1 170 ? 39.292  21.484  15.017  1.00 69.74  ? 150 TYR A OH    1 
ATOM   1266  N  N     . LYS A 1 171 ? 45.230  21.626  18.742  1.00 74.46  ? 151 LYS A N     1 
ATOM   1267  C  CA    . LYS A 1 171 ? 44.899  22.742  19.626  1.00 76.08  ? 151 LYS A CA    1 
ATOM   1268  C  C     . LYS A 1 171 ? 44.472  23.963  18.817  1.00 77.06  ? 151 LYS A C     1 
ATOM   1269  O  O     . LYS A 1 171 ? 45.088  24.281  17.799  1.00 78.74  ? 151 LYS A O     1 
ATOM   1270  C  CB    . LYS A 1 171 ? 46.101  23.099  20.502  1.00 77.30  ? 151 LYS A CB    1 
ATOM   1271  C  CG    . LYS A 1 171 ? 45.738  23.897  21.746  1.00 77.99  ? 151 LYS A CG    1 
ATOM   1272  C  CD    . LYS A 1 171 ? 46.927  24.073  22.681  1.00 78.49  ? 151 LYS A CD    1 
ATOM   1273  C  CE    . LYS A 1 171 ? 46.476  24.361  24.105  1.00 79.08  ? 151 LYS A CE    1 
ATOM   1274  N  NZ    . LYS A 1 171 ? 47.622  24.550  25.036  1.00 79.68  ? 151 LYS A NZ    1 
ATOM   1275  N  N     . LYS A 1 172 ? 43.413  24.634  19.268  1.00 78.46  ? 152 LYS A N     1 
ATOM   1276  C  CA    . LYS A 1 172 ? 42.982  25.904  18.677  1.00 79.66  ? 152 LYS A CA    1 
ATOM   1277  C  C     . LYS A 1 172 ? 42.184  26.748  19.665  1.00 80.07  ? 152 LYS A C     1 
ATOM   1278  O  O     . LYS A 1 172 ? 41.771  26.268  20.723  1.00 77.35  ? 152 LYS A O     1 
ATOM   1279  C  CB    . LYS A 1 172 ? 42.165  25.678  17.396  1.00 80.34  ? 152 LYS A CB    1 
ATOM   1280  C  CG    . LYS A 1 172 ? 40.809  25.000  17.588  1.00 81.03  ? 152 LYS A CG    1 
ATOM   1281  C  CD    . LYS A 1 172 ? 39.793  25.467  16.554  1.00 81.23  ? 152 LYS A CD    1 
ATOM   1282  C  CE    . LYS A 1 172 ? 38.402  24.924  16.840  1.00 81.77  ? 152 LYS A CE    1 
ATOM   1283  N  NZ    . LYS A 1 172 ? 38.291  23.463  16.574  1.00 82.11  ? 152 LYS A NZ    1 
ATOM   1284  N  N     . THR A 1 173 ? 41.965  28.004  19.290  1.00 83.37  ? 153 THR A N     1 
ATOM   1285  C  CA    . THR A 1 173 ? 41.230  28.956  20.117  1.00 86.00  ? 153 THR A CA    1 
ATOM   1286  C  C     . THR A 1 173 ? 39.726  28.705  19.991  1.00 88.44  ? 153 THR A C     1 
ATOM   1287  O  O     . THR A 1 173 ? 39.225  28.467  18.888  1.00 89.66  ? 153 THR A O     1 
ATOM   1288  C  CB    . THR A 1 173 ? 41.551  30.413  19.715  1.00 85.82  ? 153 THR A CB    1 
ATOM   1289  O  OG1   . THR A 1 173 ? 42.915  30.515  19.286  1.00 86.50  ? 153 THR A OG1   1 
ATOM   1290  C  CG2   . THR A 1 173 ? 41.338  31.342  20.882  1.00 85.66  ? 153 THR A CG2   1 
ATOM   1291  N  N     . SER A 1 174 ? 39.019  28.755  21.122  1.00 90.86  ? 154 SER A N     1 
ATOM   1292  C  CA    . SER A 1 174 ? 37.569  28.520  21.168  1.00 92.49  ? 154 SER A CA    1 
ATOM   1293  C  C     . SER A 1 174 ? 36.907  29.386  22.240  1.00 93.67  ? 154 SER A C     1 
ATOM   1294  O  O     . SER A 1 174 ? 37.498  29.637  23.290  1.00 92.46  ? 154 SER A O     1 
ATOM   1295  C  CB    . SER A 1 174 ? 37.282  27.041  21.441  1.00 92.43  ? 154 SER A CB    1 
ATOM   1296  O  OG    . SER A 1 174 ? 35.903  26.745  21.293  1.00 91.69  ? 154 SER A OG    1 
ATOM   1297  N  N     . ALA A 1 175 ? 35.679  29.829  21.970  1.00 95.91  ? 155 ALA A N     1 
ATOM   1298  C  CA    . ALA A 1 175 ? 34.955  30.736  22.866  1.00 97.79  ? 155 ALA A CA    1 
ATOM   1299  C  C     . ALA A 1 175 ? 34.519  30.029  24.152  1.00 100.16 ? 155 ALA A C     1 
ATOM   1300  O  O     . ALA A 1 175 ? 34.116  28.864  24.119  1.00 100.97 ? 155 ALA A O     1 
ATOM   1301  C  CB    . ALA A 1 175 ? 33.749  31.333  22.156  1.00 97.74  ? 155 ALA A CB    1 
ATOM   1302  N  N     . VAL A 1 176 ? 34.616  30.744  25.275  1.00 102.08 ? 156 VAL A N     1 
ATOM   1303  C  CA    . VAL A 1 176 ? 34.315  30.207  26.609  1.00 103.64 ? 156 VAL A CA    1 
ATOM   1304  C  C     . VAL A 1 176 ? 33.649  31.289  27.472  1.00 107.04 ? 156 VAL A C     1 
ATOM   1305  O  O     . VAL A 1 176 ? 34.001  32.467  27.378  1.00 108.59 ? 156 VAL A O     1 
ATOM   1306  C  CB    . VAL A 1 176 ? 35.608  29.695  27.296  1.00 103.01 ? 156 VAL A CB    1 
ATOM   1307  C  CG1   . VAL A 1 176 ? 35.366  29.326  28.757  1.00 102.66 ? 156 VAL A CG1   1 
ATOM   1308  C  CG2   . VAL A 1 176 ? 36.181  28.504  26.534  1.00 103.52 ? 156 VAL A CG2   1 
ATOM   1309  N  N     . ASN A 1 177 ? 32.693  30.877  28.308  1.00 111.79 ? 157 ASN A N     1 
ATOM   1310  C  CA    . ASN A 1 177 ? 32.043  31.777  29.270  1.00 115.44 ? 157 ASN A CA    1 
ATOM   1311  C  C     . ASN A 1 177 ? 33.018  32.098  30.404  1.00 120.47 ? 157 ASN A C     1 
ATOM   1312  O  O     . ASN A 1 177 ? 33.607  31.189  30.989  1.00 119.53 ? 157 ASN A O     1 
ATOM   1313  C  CB    . ASN A 1 177 ? 30.767  31.148  29.848  1.00 114.33 ? 157 ASN A CB    1 
ATOM   1314  C  CG    . ASN A 1 177 ? 29.686  30.928  28.801  1.00 112.81 ? 157 ASN A CG    1 
ATOM   1315  O  OD1   . ASN A 1 177 ? 29.501  31.742  27.895  1.00 112.17 ? 157 ASN A OD1   1 
ATOM   1316  N  ND2   . ASN A 1 177 ? 28.955  29.827  28.931  1.00 111.02 ? 157 ASN A ND2   1 
ATOM   1317  N  N     . TRP A 1 178 ? 33.168  33.387  30.708  1.00 128.58 ? 158 TRP A N     1 
ATOM   1318  C  CA    . TRP A 1 178 ? 34.201  33.881  31.623  1.00 135.54 ? 158 TRP A CA    1 
ATOM   1319  C  C     . TRP A 1 178 ? 33.664  35.047  32.461  1.00 145.10 ? 158 TRP A C     1 
ATOM   1320  O  O     . TRP A 1 178 ? 33.399  36.122  31.917  1.00 147.28 ? 158 TRP A O     1 
ATOM   1321  C  CB    . TRP A 1 178 ? 35.408  34.329  30.785  1.00 133.96 ? 158 TRP A CB    1 
ATOM   1322  C  CG    . TRP A 1 178 ? 36.580  34.906  31.539  1.00 132.69 ? 158 TRP A CG    1 
ATOM   1323  C  CD1   . TRP A 1 178 ? 36.766  36.213  31.894  1.00 131.97 ? 158 TRP A CD1   1 
ATOM   1324  C  CD2   . TRP A 1 178 ? 37.746  34.202  31.984  1.00 132.40 ? 158 TRP A CD2   1 
ATOM   1325  N  NE1   . TRP A 1 178 ? 37.964  36.362  32.549  1.00 131.66 ? 158 TRP A NE1   1 
ATOM   1326  C  CE2   . TRP A 1 178 ? 38.588  35.145  32.616  1.00 132.20 ? 158 TRP A CE2   1 
ATOM   1327  C  CE3   . TRP A 1 178 ? 38.160  32.864  31.915  1.00 132.94 ? 158 TRP A CE3   1 
ATOM   1328  C  CZ2   . TRP A 1 178 ? 39.822  34.791  33.181  1.00 132.22 ? 158 TRP A CZ2   1 
ATOM   1329  C  CZ3   . TRP A 1 178 ? 39.389  32.511  32.479  1.00 132.56 ? 158 TRP A CZ3   1 
ATOM   1330  C  CH2   . TRP A 1 178 ? 40.203  33.474  33.104  1.00 131.82 ? 158 TRP A CH2   1 
ATOM   1331  N  N     . CYS A 1 179 ? 33.486  34.832  33.769  1.00 155.27 ? 159 CYS A N     1 
ATOM   1332  C  CA    . CYS A 1 179 ? 33.148  35.928  34.688  1.00 162.75 ? 159 CYS A CA    1 
ATOM   1333  C  C     . CYS A 1 179 ? 34.428  36.750  34.903  1.00 162.78 ? 159 CYS A C     1 
ATOM   1334  O  O     . CYS A 1 179 ? 35.402  36.230  35.454  1.00 159.13 ? 159 CYS A O     1 
ATOM   1335  C  CB    . CYS A 1 179 ? 32.585  35.419  36.028  1.00 170.77 ? 159 CYS A CB    1 
ATOM   1336  S  SG    . CYS A 1 179 ? 31.768  36.718  37.004  1.00 180.02 ? 159 CYS A SG    1 
ATOM   1337  N  N     . PRO A 1 180 ? 34.437  38.024  34.451  1.00 163.50 ? 160 PRO A N     1 
ATOM   1338  C  CA    . PRO A 1 180 ? 35.680  38.809  34.392  1.00 161.59 ? 160 PRO A CA    1 
ATOM   1339  C  C     . PRO A 1 180 ? 36.304  39.173  35.749  1.00 160.15 ? 160 PRO A C     1 
ATOM   1340  O  O     . PRO A 1 180 ? 37.529  39.287  35.838  1.00 158.04 ? 160 PRO A O     1 
ATOM   1341  C  CB    . PRO A 1 180 ? 35.258  40.074  33.633  1.00 161.94 ? 160 PRO A CB    1 
ATOM   1342  C  CG    . PRO A 1 180 ? 33.810  40.224  33.933  1.00 162.59 ? 160 PRO A CG    1 
ATOM   1343  C  CD    . PRO A 1 180 ? 33.266  38.830  34.048  1.00 163.35 ? 160 PRO A CD    1 
ATOM   1344  N  N     . ASN A 1 181 ? 35.477  39.350  36.781  1.00 158.72 ? 161 ASN A N     1 
ATOM   1345  C  CA    . ASN A 1 181 ? 35.961  39.731  38.115  1.00 156.12 ? 161 ASN A CA    1 
ATOM   1346  C  C     . ASN A 1 181 ? 36.701  38.583  38.805  1.00 152.68 ? 161 ASN A C     1 
ATOM   1347  O  O     . ASN A 1 181 ? 37.835  38.753  39.256  1.00 150.14 ? 161 ASN A O     1 
ATOM   1348  C  CB    . ASN A 1 181 ? 34.806  40.216  39.000  1.00 156.76 ? 161 ASN A CB    1 
ATOM   1349  C  CG    . ASN A 1 181 ? 34.183  41.505  38.492  1.00 157.46 ? 161 ASN A CG    1 
ATOM   1350  O  OD1   . ASN A 1 181 ? 33.884  41.639  37.306  1.00 157.61 ? 161 ASN A OD1   1 
ATOM   1351  N  ND2   . ASN A 1 181 ? 33.973  42.457  39.395  1.00 158.04 ? 161 ASN A ND2   1 
ATOM   1352  N  N     . ASP A 1 182 ? 36.050  37.423  38.882  1.00 150.23 ? 162 ASP A N     1 
ATOM   1353  C  CA    . ASP A 1 182 ? 36.652  36.219  39.479  1.00 148.31 ? 162 ASP A CA    1 
ATOM   1354  C  C     . ASP A 1 182 ? 37.810  35.643  38.660  1.00 145.02 ? 162 ASP A C     1 
ATOM   1355  O  O     . ASP A 1 182 ? 38.724  35.042  39.229  1.00 141.63 ? 162 ASP A O     1 
ATOM   1356  C  CB    . ASP A 1 182 ? 35.595  35.126  39.682  1.00 149.10 ? 162 ASP A CB    1 
ATOM   1357  C  CG    . ASP A 1 182 ? 34.617  35.460  40.786  1.00 149.44 ? 162 ASP A CG    1 
ATOM   1358  O  OD1   . ASP A 1 182 ? 34.985  35.318  41.972  1.00 149.39 ? 162 ASP A OD1   1 
ATOM   1359  O  OD2   . ASP A 1 182 ? 33.478  35.855  40.467  1.00 149.58 ? 162 ASP A OD2   1 
ATOM   1360  N  N     . GLN A 1 183 ? 37.750  35.820  37.337  1.00 143.31 ? 163 GLN A N     1 
ATOM   1361  C  CA    . GLN A 1 183 ? 38.733  35.280  36.385  1.00 141.25 ? 163 GLN A CA    1 
ATOM   1362  C  C     . GLN A 1 183 ? 38.703  33.746  36.354  1.00 137.54 ? 163 GLN A C     1 
ATOM   1363  O  O     . GLN A 1 183 ? 39.730  33.081  36.533  1.00 135.50 ? 163 GLN A O     1 
ATOM   1364  C  CB    . GLN A 1 183 ? 40.153  35.810  36.661  1.00 141.57 ? 163 GLN A CB    1 
ATOM   1365  C  CG    . GLN A 1 183 ? 40.253  37.327  36.739  1.00 141.32 ? 163 GLN A CG    1 
ATOM   1366  C  CD    . GLN A 1 183 ? 41.667  37.806  37.015  1.00 140.81 ? 163 GLN A CD    1 
ATOM   1367  O  OE1   . GLN A 1 183 ? 42.634  37.294  36.448  1.00 139.66 ? 163 GLN A OE1   1 
ATOM   1368  N  NE2   . GLN A 1 183 ? 41.794  38.798  37.888  1.00 141.01 ? 163 GLN A NE2   1 
ATOM   1369  N  N     . THR A 1 184 ? 37.506  33.206  36.118  1.00 132.76 ? 164 THR A N     1 
ATOM   1370  C  CA    . THR A 1 184 ? 37.260  31.759  36.104  1.00 127.85 ? 164 THR A CA    1 
ATOM   1371  C  C     . THR A 1 184 ? 36.317  31.391  34.961  1.00 122.91 ? 164 THR A C     1 
ATOM   1372  O  O     . THR A 1 184 ? 35.461  32.189  34.572  1.00 124.02 ? 164 THR A O     1 
ATOM   1373  C  CB    . THR A 1 184 ? 36.630  31.289  37.435  1.00 128.65 ? 164 THR A CB    1 
ATOM   1374  O  OG1   . THR A 1 184 ? 37.362  31.839  38.537  1.00 129.67 ? 164 THR A OG1   1 
ATOM   1375  C  CG2   . THR A 1 184 ? 36.630  29.763  37.547  1.00 128.88 ? 164 THR A CG2   1 
ATOM   1376  N  N     . VAL A 1 185 ? 36.481  30.176  34.437  1.00 117.50 ? 165 VAL A N     1 
ATOM   1377  C  CA    . VAL A 1 185 ? 35.603  29.634  33.398  1.00 114.13 ? 165 VAL A CA    1 
ATOM   1378  C  C     . VAL A 1 185 ? 34.356  29.016  34.038  1.00 109.85 ? 165 VAL A C     1 
ATOM   1379  O  O     . VAL A 1 185 ? 34.464  28.092  34.846  1.00 109.35 ? 165 VAL A O     1 
ATOM   1380  C  CB    . VAL A 1 185 ? 36.346  28.593  32.522  1.00 114.43 ? 165 VAL A CB    1 
ATOM   1381  C  CG1   . VAL A 1 185 ? 35.378  27.756  31.685  1.00 115.33 ? 165 VAL A CG1   1 
ATOM   1382  C  CG2   . VAL A 1 185 ? 37.361  29.299  31.631  1.00 114.31 ? 165 VAL A CG2   1 
ATOM   1383  N  N     . LEU A 1 186 ? 33.185  29.532  33.661  1.00 106.15 ? 166 LEU A N     1 
ATOM   1384  C  CA    . LEU A 1 186 ? 31.894  29.009  34.114  1.00 104.27 ? 166 LEU A CA    1 
ATOM   1385  C  C     . LEU A 1 186 ? 31.285  28.086  33.062  1.00 102.75 ? 166 LEU A C     1 
ATOM   1386  O  O     . LEU A 1 186 ? 31.563  28.224  31.868  1.00 101.46 ? 166 LEU A O     1 
ATOM   1387  C  CB    . LEU A 1 186 ? 30.919  30.156  34.388  1.00 103.91 ? 166 LEU A CB    1 
ATOM   1388  C  CG    . LEU A 1 186 ? 31.301  31.175  35.465  1.00 103.56 ? 166 LEU A CG    1 
ATOM   1389  C  CD1   . LEU A 1 186 ? 30.338  32.352  35.421  1.00 104.00 ? 166 LEU A CD1   1 
ATOM   1390  C  CD2   . LEU A 1 186 ? 31.312  30.534  36.845  1.00 103.29 ? 166 LEU A CD2   1 
ATOM   1391  N  N     . ALA A 1 187 ? 30.444  27.158  33.515  1.00 101.94 ? 167 ALA A N     1 
ATOM   1392  C  CA    . ALA A 1 187 ? 29.671  26.296  32.618  1.00 101.70 ? 167 ALA A CA    1 
ATOM   1393  C  C     . ALA A 1 187 ? 28.445  27.041  32.089  1.00 102.95 ? 167 ALA A C     1 
ATOM   1394  O  O     . ALA A 1 187 ? 28.132  28.143  32.550  1.00 103.05 ? 167 ALA A O     1 
ATOM   1395  C  CB    . ALA A 1 187 ? 29.246  25.026  33.338  1.00 101.39 ? 167 ALA A CB    1 
ATOM   1396  N  N     . ASN A 1 188 ? 27.757  26.436  31.122  1.00 104.31 ? 168 ASN A N     1 
ATOM   1397  C  CA    . ASN A 1 188 ? 26.526  27.013  30.559  1.00 105.03 ? 168 ASN A CA    1 
ATOM   1398  C  C     . ASN A 1 188 ? 25.375  27.025  31.573  1.00 105.76 ? 168 ASN A C     1 
ATOM   1399  O  O     . ASN A 1 188 ? 24.584  27.971  31.596  1.00 105.72 ? 168 ASN A O     1 
ATOM   1400  C  CB    . ASN A 1 188 ? 26.099  26.274  29.278  1.00 104.81 ? 168 ASN A CB    1 
ATOM   1401  C  CG    . ASN A 1 188 ? 26.958  26.629  28.074  1.00 104.20 ? 168 ASN A CG    1 
ATOM   1402  O  OD1   . ASN A 1 188 ? 28.062  27.160  28.208  1.00 103.12 ? 168 ASN A OD1   1 
ATOM   1403  N  ND2   . ASN A 1 188 ? 26.448  26.332  26.883  1.00 104.47 ? 168 ASN A ND2   1 
ATOM   1404  N  N     . GLU A 1 189 ? 25.290  25.982  32.400  1.00 107.17 ? 169 GLU A N     1 
ATOM   1405  C  CA    . GLU A 1 189 ? 24.287  25.908  33.473  1.00 108.44 ? 169 GLU A CA    1 
ATOM   1406  C  C     . GLU A 1 189 ? 24.502  26.975  34.555  1.00 108.35 ? 169 GLU A C     1 
ATOM   1407  O  O     . GLU A 1 189 ? 23.532  27.491  35.114  1.00 110.04 ? 169 GLU A O     1 
ATOM   1408  C  CB    . GLU A 1 189 ? 24.283  24.513  34.115  1.00 109.29 ? 169 GLU A CB    1 
ATOM   1409  C  CG    . GLU A 1 189 ? 23.106  24.255  35.052  1.00 110.80 ? 169 GLU A CG    1 
ATOM   1410  C  CD    . GLU A 1 189 ? 23.108  22.862  35.662  1.00 112.45 ? 169 GLU A CD    1 
ATOM   1411  O  OE1   . GLU A 1 189 ? 24.187  22.242  35.778  1.00 114.26 ? 169 GLU A OE1   1 
ATOM   1412  O  OE2   . GLU A 1 189 ? 22.018  22.387  36.044  1.00 113.79 ? 169 GLU A OE2   1 
ATOM   1413  N  N     . GLN A 1 190 ? 25.764  27.299  34.842  1.00 107.28 ? 170 GLN A N     1 
ATOM   1414  C  CA    . GLN A 1 190 ? 26.111  28.278  35.885  1.00 107.14 ? 170 GLN A CA    1 
ATOM   1415  C  C     . GLN A 1 190 ? 25.776  29.736  35.533  1.00 110.27 ? 170 GLN A C     1 
ATOM   1416  O  O     . GLN A 1 190 ? 25.745  30.585  36.425  1.00 111.37 ? 170 GLN A O     1 
ATOM   1417  C  CB    . GLN A 1 190 ? 27.592  28.154  36.266  1.00 104.78 ? 170 GLN A CB    1 
ATOM   1418  C  CG    . GLN A 1 190 ? 27.938  26.827  36.928  1.00 102.99 ? 170 GLN A CG    1 
ATOM   1419  C  CD    . GLN A 1 190 ? 29.407  26.709  37.295  1.00 100.00 ? 170 GLN A CD    1 
ATOM   1420  O  OE1   . GLN A 1 190 ? 30.287  26.964  36.473  1.00 97.13  ? 170 GLN A OE1   1 
ATOM   1421  N  NE2   . GLN A 1 190 ? 29.678  26.305  38.531  1.00 97.93  ? 170 GLN A NE2   1 
ATOM   1422  N  N     . VAL A 1 191 ? 25.545  30.026  34.250  1.00 114.28 ? 171 VAL A N     1 
ATOM   1423  C  CA    . VAL A 1 191 ? 25.056  31.338  33.811  1.00 118.04 ? 171 VAL A CA    1 
ATOM   1424  C  C     . VAL A 1 191 ? 23.524  31.308  33.754  1.00 122.92 ? 171 VAL A C     1 
ATOM   1425  O  O     . VAL A 1 191 ? 22.940  30.337  33.267  1.00 121.55 ? 171 VAL A O     1 
ATOM   1426  C  CB    . VAL A 1 191 ? 25.624  31.719  32.424  1.00 117.66 ? 171 VAL A CB    1 
ATOM   1427  C  CG1   . VAL A 1 191 ? 25.149  33.107  32.002  1.00 118.75 ? 171 VAL A CG1   1 
ATOM   1428  C  CG2   . VAL A 1 191 ? 27.148  31.652  32.434  1.00 116.37 ? 171 VAL A CG2   1 
ATOM   1429  N  N     . ILE A 1 192 ? 22.890  32.377  34.241  1.00 130.80 ? 172 ILE A N     1 
ATOM   1430  C  CA    . ILE A 1 192 ? 21.423  32.477  34.307  1.00 137.95 ? 172 ILE A CA    1 
ATOM   1431  C  C     . ILE A 1 192 ? 20.947  33.932  34.180  1.00 143.96 ? 172 ILE A C     1 
ATOM   1432  O  O     . ILE A 1 192 ? 21.365  34.793  34.956  1.00 143.04 ? 172 ILE A O     1 
ATOM   1433  C  CB    . ILE A 1 192 ? 20.862  31.879  35.624  1.00 139.26 ? 172 ILE A CB    1 
ATOM   1434  C  CG1   . ILE A 1 192 ? 21.784  32.199  36.808  1.00 140.15 ? 172 ILE A CG1   1 
ATOM   1435  C  CG2   . ILE A 1 192 ? 20.680  30.369  35.504  1.00 139.03 ? 172 ILE A CG2   1 
ATOM   1436  C  CD1   . ILE A 1 192 ? 21.150  31.985  38.165  1.00 141.13 ? 172 ILE A CD1   1 
ATOM   1437  N  N     . ASP A 1 193 ? 20.068  34.185  33.205  1.00 152.28 ? 173 ASP A N     1 
ATOM   1438  C  CA    . ASP A 1 193 ? 19.508  35.521  32.931  1.00 157.57 ? 173 ASP A CA    1 
ATOM   1439  C  C     . ASP A 1 193 ? 20.588  36.584  32.672  1.00 163.04 ? 173 ASP A C     1 
ATOM   1440  O  O     . ASP A 1 193 ? 20.518  37.699  33.200  1.00 165.14 ? 173 ASP A O     1 
ATOM   1441  C  CB    . ASP A 1 193 ? 18.564  35.966  34.066  1.00 157.33 ? 173 ASP A CB    1 
ATOM   1442  C  CG    . ASP A 1 193 ? 17.440  34.970  34.334  1.00 158.20 ? 173 ASP A CG    1 
ATOM   1443  O  OD1   . ASP A 1 193 ? 17.228  34.046  33.518  1.00 159.82 ? 173 ASP A OD1   1 
ATOM   1444  O  OD2   . ASP A 1 193 ? 16.758  35.120  35.370  1.00 158.34 ? 173 ASP A OD2   1 
ATOM   1445  N  N     . GLY A 1 194 ? 21.583  36.226  31.859  1.00 168.21 ? 174 GLY A N     1 
ATOM   1446  C  CA    . GLY A 1 194 ? 22.692  37.123  31.520  1.00 172.25 ? 174 GLY A CA    1 
ATOM   1447  C  C     . GLY A 1 194 ? 23.841  37.062  32.512  1.00 177.20 ? 174 GLY A C     1 
ATOM   1448  O  O     . GLY A 1 194 ? 24.941  36.623  32.166  1.00 177.87 ? 174 GLY A O     1 
ATOM   1449  N  N     . CYS A 1 195 ? 23.585  37.509  33.742  1.00 182.76 ? 175 CYS A N     1 
ATOM   1450  C  CA    . CYS A 1 195 ? 24.603  37.545  34.802  1.00 185.23 ? 175 CYS A CA    1 
ATOM   1451  C  C     . CYS A 1 195 ? 24.967  36.155  35.338  1.00 189.20 ? 175 CYS A C     1 
ATOM   1452  O  O     . CYS A 1 195 ? 24.285  35.164  35.062  1.00 189.93 ? 175 CYS A O     1 
ATOM   1453  C  CB    . CYS A 1 195 ? 24.142  38.443  35.962  1.00 184.12 ? 175 CYS A CB    1 
ATOM   1454  S  SG    . CYS A 1 195 ? 24.047  40.201  35.554  1.00 183.40 ? 175 CYS A SG    1 
ATOM   1455  N  N     . CYS A 1 196 ? 26.051  36.111  36.108  1.00 193.63 ? 176 CYS A N     1 
ATOM   1456  C  CA    . CYS A 1 196 ? 26.563  34.876  36.721  1.00 198.03 ? 176 CYS A CA    1 
ATOM   1457  C  C     . CYS A 1 196 ? 25.824  34.590  38.039  1.00 200.97 ? 176 CYS A C     1 
ATOM   1458  O  O     . CYS A 1 196 ? 25.455  35.517  38.761  1.00 202.79 ? 176 CYS A O     1 
ATOM   1459  C  CB    . CYS A 1 196 ? 28.095  34.974  36.893  1.00 199.37 ? 176 CYS A CB    1 
ATOM   1460  S  SG    . CYS A 1 196 ? 28.826  34.462  38.464  1.00 202.63 ? 176 CYS A SG    1 
ATOM   1461  N  N     . TRP A 1 197 ? 25.600  33.307  38.335  1.00 202.71 ? 177 TRP A N     1 
ATOM   1462  C  CA    . TRP A 1 197 ? 24.736  32.894  39.464  1.00 202.77 ? 177 TRP A CA    1 
ATOM   1463  C  C     . TRP A 1 197 ? 25.294  33.144  40.879  1.00 202.84 ? 177 TRP A C     1 
ATOM   1464  O  O     . TRP A 1 197 ? 24.536  33.094  41.851  1.00 200.92 ? 177 TRP A O     1 
ATOM   1465  C  CB    . TRP A 1 197 ? 24.287  31.426  39.303  1.00 203.42 ? 177 TRP A CB    1 
ATOM   1466  C  CG    . TRP A 1 197 ? 25.291  30.354  39.674  1.00 205.37 ? 177 TRP A CG    1 
ATOM   1467  C  CD1   . TRP A 1 197 ? 26.654  30.412  39.558  1.00 205.98 ? 177 TRP A CD1   1 
ATOM   1468  C  CD2   . TRP A 1 197 ? 24.990  29.046  40.181  1.00 205.33 ? 177 TRP A CD2   1 
ATOM   1469  N  NE1   . TRP A 1 197 ? 27.217  29.232  39.984  1.00 205.89 ? 177 TRP A NE1   1 
ATOM   1470  C  CE2   . TRP A 1 197 ? 26.220  28.375  40.369  1.00 205.32 ? 177 TRP A CE2   1 
ATOM   1471  C  CE3   . TRP A 1 197 ? 23.798  28.379  40.504  1.00 203.93 ? 177 TRP A CE3   1 
ATOM   1472  C  CZ2   . TRP A 1 197 ? 26.295  27.066  40.866  1.00 203.93 ? 177 TRP A CZ2   1 
ATOM   1473  C  CZ3   . TRP A 1 197 ? 23.872  27.075  41.000  1.00 203.24 ? 177 TRP A CZ3   1 
ATOM   1474  C  CH2   . TRP A 1 197 ? 25.115  26.435  41.175  1.00 203.37 ? 177 TRP A CH2   1 
ATOM   1475  N  N     . ARG A 1 198 ? 26.598  33.403  40.989  1.00 202.96 ? 178 ARG A N     1 
ATOM   1476  C  CA    . ARG A 1 198 ? 27.219  33.801  42.259  1.00 200.99 ? 178 ARG A CA    1 
ATOM   1477  C  C     . ARG A 1 198 ? 27.100  35.313  42.483  1.00 201.65 ? 178 ARG A C     1 
ATOM   1478  O  O     . ARG A 1 198 ? 26.475  35.758  43.448  1.00 202.92 ? 178 ARG A O     1 
ATOM   1479  C  CB    . ARG A 1 198 ? 28.704  33.418  42.287  1.00 198.39 ? 178 ARG A CB    1 
ATOM   1480  C  CG    . ARG A 1 198 ? 29.009  31.932  42.231  1.00 195.21 ? 178 ARG A CG    1 
ATOM   1481  C  CD    . ARG A 1 198 ? 30.517  31.730  42.220  1.00 192.51 ? 178 ARG A CD    1 
ATOM   1482  N  NE    . ARG A 1 198 ? 30.916  30.326  42.123  1.00 190.68 ? 178 ARG A NE    1 
ATOM   1483  C  CZ    . ARG A 1 198 ? 32.179  29.895  42.075  1.00 188.90 ? 178 ARG A CZ    1 
ATOM   1484  N  NH1   . ARG A 1 198 ? 33.201  30.751  42.114  1.00 188.60 ? 178 ARG A NH1   1 
ATOM   1485  N  NH2   . ARG A 1 198 ? 32.426  28.591  41.986  1.00 188.34 ? 178 ARG A NH2   1 
ATOM   1486  N  N     . CYS A 1 199 ? 27.696  36.081  41.568  1.00 201.10 ? 179 CYS A N     1 
ATOM   1487  C  CA    . CYS A 1 199 ? 27.918  37.527  41.725  1.00 199.36 ? 179 CYS A CA    1 
ATOM   1488  C  C     . CYS A 1 199 ? 27.153  38.359  40.694  1.00 198.56 ? 179 CYS A C     1 
ATOM   1489  O  O     . CYS A 1 199 ? 26.882  37.890  39.588  1.00 200.60 ? 179 CYS A O     1 
ATOM   1490  C  CB    . CYS A 1 199 ? 29.423  37.839  41.627  1.00 198.81 ? 179 CYS A CB    1 
ATOM   1491  S  SG    . CYS A 1 199 ? 30.493  36.441  41.187  1.00 200.04 ? 179 CYS A SG    1 
ATOM   1492  N  N     . ASP A 1 200 ? 26.831  39.602  41.058  1.00 195.97 ? 180 ASP A N     1 
ATOM   1493  C  CA    . ASP A 1 200 ? 26.161  40.543  40.148  1.00 193.36 ? 180 ASP A CA    1 
ATOM   1494  C  C     . ASP A 1 200 ? 27.177  41.218  39.219  1.00 192.55 ? 180 ASP A C     1 
ATOM   1495  O  O     . ASP A 1 200 ? 27.501  42.400  39.378  1.00 191.75 ? 180 ASP A O     1 
ATOM   1496  C  CB    . ASP A 1 200 ? 25.358  41.592  40.934  1.00 191.58 ? 180 ASP A CB    1 
ATOM   1497  C  CG    . ASP A 1 200 ? 24.150  40.999  41.642  1.00 190.19 ? 180 ASP A CG    1 
ATOM   1498  O  OD1   . ASP A 1 200 ? 24.226  39.839  42.103  1.00 188.83 ? 180 ASP A OD1   1 
ATOM   1499  O  OD2   . ASP A 1 200 ? 23.120  41.699  41.741  1.00 189.27 ? 180 ASP A OD2   1 
ATOM   1500  N  N     . THR A 1 201 ? 27.678  40.440  38.259  1.00 191.00 ? 181 THR A N     1 
ATOM   1501  C  CA    . THR A 1 201 ? 28.632  40.903  37.243  1.00 187.17 ? 181 THR A CA    1 
ATOM   1502  C  C     . THR A 1 201 ? 28.403  40.109  35.954  1.00 182.34 ? 181 THR A C     1 
ATOM   1503  O  O     . THR A 1 201 ? 28.237  38.886  35.997  1.00 185.31 ? 181 THR A O     1 
ATOM   1504  C  CB    . THR A 1 201 ? 30.099  40.717  37.693  1.00 186.82 ? 181 THR A CB    1 
ATOM   1505  O  OG1   . THR A 1 201 ? 30.304  39.371  38.140  1.00 188.99 ? 181 THR A OG1   1 
ATOM   1506  C  CG2   . THR A 1 201 ? 30.455  41.680  38.819  1.00 185.17 ? 181 THR A CG2   1 
ATOM   1507  N  N     . LYS A 1 202 ? 28.402  40.804  34.818  1.00 172.51 ? 182 LYS A N     1 
ATOM   1508  C  CA    . LYS A 1 202 ? 28.025  40.200  33.535  1.00 164.10 ? 182 LYS A CA    1 
ATOM   1509  C  C     . LYS A 1 202 ? 29.124  39.291  32.977  1.00 157.06 ? 182 LYS A C     1 
ATOM   1510  O  O     . LYS A 1 202 ? 30.311  39.618  33.051  1.00 153.49 ? 182 LYS A O     1 
ATOM   1511  C  CB    . LYS A 1 202 ? 27.651  41.283  32.516  1.00 162.68 ? 182 LYS A CB    1 
ATOM   1512  C  CG    . LYS A 1 202 ? 26.368  42.022  32.867  1.00 161.52 ? 182 LYS A CG    1 
ATOM   1513  C  CD    . LYS A 1 202 ? 26.216  43.317  32.086  1.00 160.38 ? 182 LYS A CD    1 
ATOM   1514  C  CE    . LYS A 1 202 ? 24.992  44.093  32.549  1.00 159.55 ? 182 LYS A CE    1 
ATOM   1515  N  NZ    . LYS A 1 202 ? 24.949  45.470  31.985  1.00 158.79 ? 182 LYS A NZ    1 
ATOM   1516  N  N     . VAL A 1 203 ? 28.704  38.154  32.421  1.00 150.80 ? 183 VAL A N     1 
ATOM   1517  C  CA    . VAL A 1 203 ? 29.613  37.152  31.857  1.00 145.07 ? 183 VAL A CA    1 
ATOM   1518  C  C     . VAL A 1 203 ? 29.984  37.573  30.435  1.00 138.25 ? 183 VAL A C     1 
ATOM   1519  O  O     . VAL A 1 203 ? 29.159  38.155  29.725  1.00 138.96 ? 183 VAL A O     1 
ATOM   1520  C  CB    . VAL A 1 203 ? 28.968  35.740  31.850  1.00 145.44 ? 183 VAL A CB    1 
ATOM   1521  C  CG1   . VAL A 1 203 ? 29.924  34.698  31.279  1.00 145.34 ? 183 VAL A CG1   1 
ATOM   1522  C  CG2   . VAL A 1 203 ? 28.534  35.341  33.257  1.00 145.90 ? 183 VAL A CG2   1 
ATOM   1523  N  N     . GLU A 1 204 ? 31.218  37.272  30.029  1.00 130.28 ? 184 GLU A N     1 
ATOM   1524  C  CA    . GLU A 1 204 ? 31.742  37.669  28.716  1.00 126.67 ? 184 GLU A CA    1 
ATOM   1525  C  C     . GLU A 1 204 ? 32.359  36.491  27.963  1.00 123.77 ? 184 GLU A C     1 
ATOM   1526  O  O     . GLU A 1 204 ? 32.846  35.537  28.576  1.00 122.21 ? 184 GLU A O     1 
ATOM   1527  C  CB    . GLU A 1 204 ? 32.779  38.793  28.867  1.00 125.72 ? 184 GLU A CB    1 
ATOM   1528  C  CG    . GLU A 1 204 ? 33.930  38.491  29.820  1.00 124.39 ? 184 GLU A CG    1 
ATOM   1529  C  CD    . GLU A 1 204 ? 35.022  39.545  29.784  1.00 122.91 ? 184 GLU A CD    1 
ATOM   1530  O  OE1   . GLU A 1 204 ? 34.696  40.749  29.852  1.00 122.94 ? 184 GLU A OE1   1 
ATOM   1531  O  OE2   . GLU A 1 204 ? 36.212  39.171  29.701  1.00 120.24 ? 184 GLU A OE2   1 
ATOM   1532  N  N     . ARG A 1 205 ? 32.330  36.571  26.632  1.00 121.78 ? 185 ARG A N     1 
ATOM   1533  C  CA    . ARG A 1 205 ? 33.035  35.618  25.775  1.00 119.93 ? 185 ARG A CA    1 
ATOM   1534  C  C     . ARG A 1 205 ? 34.528  35.893  25.879  1.00 116.92 ? 185 ARG A C     1 
ATOM   1535  O  O     . ARG A 1 205 ? 34.950  37.051  25.813  1.00 117.29 ? 185 ARG A O     1 
ATOM   1536  C  CB    . ARG A 1 205 ? 32.617  35.765  24.307  1.00 122.24 ? 185 ARG A CB    1 
ATOM   1537  C  CG    . ARG A 1 205 ? 31.158  35.459  24.008  1.00 124.55 ? 185 ARG A CG    1 
ATOM   1538  C  CD    . ARG A 1 205 ? 30.803  35.782  22.560  1.00 125.94 ? 185 ARG A CD    1 
ATOM   1539  N  NE    . ARG A 1 205 ? 31.211  34.725  21.629  1.00 126.81 ? 185 ARG A NE    1 
ATOM   1540  C  CZ    . ARG A 1 205 ? 30.508  33.626  21.337  1.00 126.57 ? 185 ARG A CZ    1 
ATOM   1541  N  NH1   . ARG A 1 205 ? 29.320  33.381  21.897  1.00 125.55 ? 185 ARG A NH1   1 
ATOM   1542  N  NH2   . ARG A 1 205 ? 31.005  32.748  20.466  1.00 126.45 ? 185 ARG A NH2   1 
ATOM   1543  N  N     . LYS A 1 206 ? 35.317  34.834  26.048  1.00 113.36 ? 186 LYS A N     1 
ATOM   1544  C  CA    . LYS A 1 206 ? 36.774  34.937  26.038  1.00 110.63 ? 186 LYS A CA    1 
ATOM   1545  C  C     . LYS A 1 206 ? 37.372  33.837  25.167  1.00 106.14 ? 186 LYS A C     1 
ATOM   1546  O  O     . LYS A 1 206 ? 37.162  32.649  25.417  1.00 105.92 ? 186 LYS A O     1 
ATOM   1547  C  CB    . LYS A 1 206 ? 37.336  34.861  27.458  1.00 112.45 ? 186 LYS A CB    1 
ATOM   1548  C  CG    . LYS A 1 206 ? 38.844  35.059  27.532  1.00 113.75 ? 186 LYS A CG    1 
ATOM   1549  C  CD    . LYS A 1 206 ? 39.271  35.648  28.867  1.00 115.66 ? 186 LYS A CD    1 
ATOM   1550  C  CE    . LYS A 1 206 ? 40.765  35.496  29.103  1.00 117.80 ? 186 LYS A CE    1 
ATOM   1551  N  NZ    . LYS A 1 206 ? 41.148  34.122  29.534  1.00 119.83 ? 186 LYS A NZ    1 
ATOM   1552  N  N     . GLU A 1 207 ? 38.105  34.254  24.136  1.00 101.57 ? 187 GLU A N     1 
ATOM   1553  C  CA    . GLU A 1 207 ? 38.829  33.341  23.258  1.00 97.58  ? 187 GLU A CA    1 
ATOM   1554  C  C     . GLU A 1 207 ? 40.013  32.755  24.026  1.00 93.74  ? 187 GLU A C     1 
ATOM   1555  O  O     . GLU A 1 207 ? 40.815  33.501  24.589  1.00 94.70  ? 187 GLU A O     1 
ATOM   1556  C  CB    . GLU A 1 207 ? 39.312  34.088  22.008  1.00 98.25  ? 187 GLU A CB    1 
ATOM   1557  C  CG    . GLU A 1 207 ? 38.199  34.560  21.078  1.00 98.48  ? 187 GLU A CG    1 
ATOM   1558  C  CD    . GLU A 1 207 ? 37.437  33.426  20.406  1.00 98.78  ? 187 GLU A CD    1 
ATOM   1559  O  OE1   . GLU A 1 207 ? 37.975  32.302  20.297  1.00 98.50  ? 187 GLU A OE1   1 
ATOM   1560  O  OE2   . GLU A 1 207 ? 36.289  33.662  19.977  1.00 99.69  ? 187 GLU A OE2   1 
ATOM   1561  N  N     . ILE A 1 208 ? 40.108  31.426  24.052  1.00 89.51  ? 188 ILE A N     1 
ATOM   1562  C  CA    . ILE A 1 208 ? 41.098  30.716  24.873  1.00 88.03  ? 188 ILE A CA    1 
ATOM   1563  C  C     . ILE A 1 208 ? 41.541  29.422  24.162  1.00 85.50  ? 188 ILE A C     1 
ATOM   1564  O  O     . ILE A 1 208 ? 40.694  28.699  23.628  1.00 85.37  ? 188 ILE A O     1 
ATOM   1565  C  CB    . ILE A 1 208 ? 40.524  30.436  26.292  1.00 89.36  ? 188 ILE A CB    1 
ATOM   1566  C  CG1   . ILE A 1 208 ? 41.599  29.895  27.243  1.00 90.74  ? 188 ILE A CG1   1 
ATOM   1567  C  CG2   . ILE A 1 208 ? 39.330  29.489  26.244  1.00 90.28  ? 188 ILE A CG2   1 
ATOM   1568  C  CD1   . ILE A 1 208 ? 41.140  29.786  28.683  1.00 91.00  ? 188 ILE A CD1   1 
ATOM   1569  N  N     . PRO A 1 209 ? 42.865  29.135  24.132  1.00 82.37  ? 189 PRO A N     1 
ATOM   1570  C  CA    . PRO A 1 209 ? 43.335  27.927  23.440  1.00 80.46  ? 189 PRO A CA    1 
ATOM   1571  C  C     . PRO A 1 209 ? 42.987  26.645  24.195  1.00 78.98  ? 189 PRO A C     1 
ATOM   1572  O  O     . PRO A 1 209 ? 43.193  26.571  25.409  1.00 79.32  ? 189 PRO A O     1 
ATOM   1573  C  CB    . PRO A 1 209 ? 44.851  28.130  23.372  1.00 80.00  ? 189 PRO A CB    1 
ATOM   1574  C  CG    . PRO A 1 209 ? 45.163  28.983  24.546  1.00 80.39  ? 189 PRO A CG    1 
ATOM   1575  C  CD    . PRO A 1 209 ? 43.997  29.918  24.669  1.00 81.45  ? 189 PRO A CD    1 
ATOM   1576  N  N     . GLN A 1 210 ? 42.456  25.658  23.472  1.00 77.38  ? 190 GLN A N     1 
ATOM   1577  C  CA    . GLN A 1 210 ? 41.984  24.396  24.055  1.00 75.77  ? 190 GLN A CA    1 
ATOM   1578  C  C     . GLN A 1 210 ? 42.223  23.220  23.108  1.00 73.67  ? 190 GLN A C     1 
ATOM   1579  O  O     . GLN A 1 210 ? 42.358  23.409  21.899  1.00 73.63  ? 190 GLN A O     1 
ATOM   1580  C  CB    . GLN A 1 210 ? 40.492  24.500  24.378  1.00 75.90  ? 190 GLN A CB    1 
ATOM   1581  C  CG    . GLN A 1 210 ? 40.179  25.346  25.602  1.00 76.18  ? 190 GLN A CG    1 
ATOM   1582  C  CD    . GLN A 1 210 ? 38.695  25.463  25.867  1.00 76.20  ? 190 GLN A CD    1 
ATOM   1583  O  OE1   . GLN A 1 210 ? 38.206  25.029  26.907  1.00 77.05  ? 190 GLN A OE1   1 
ATOM   1584  N  NE2   . GLN A 1 210 ? 37.968  26.051  24.924  1.00 76.02  ? 190 GLN A NE2   1 
ATOM   1585  N  N     . TRP A 1 211 ? 42.267  22.014  23.671  1.00 71.89  ? 191 TRP A N     1 
ATOM   1586  C  CA    . TRP A 1 211 ? 42.484  20.785  22.898  1.00 71.48  ? 191 TRP A CA    1 
ATOM   1587  C  C     . TRP A 1 211 ? 41.183  20.283  22.271  1.00 70.24  ? 191 TRP A C     1 
ATOM   1588  O  O     . TRP A 1 211 ? 40.123  20.345  22.897  1.00 70.08  ? 191 TRP A O     1 
ATOM   1589  C  CB    . TRP A 1 211 ? 43.080  19.687  23.784  1.00 72.32  ? 191 TRP A CB    1 
ATOM   1590  C  CG    . TRP A 1 211 ? 44.442  20.019  24.314  1.00 73.18  ? 191 TRP A CG    1 
ATOM   1591  C  CD1   . TRP A 1 211 ? 44.763  20.401  25.588  1.00 73.18  ? 191 TRP A CD1   1 
ATOM   1592  C  CD2   . TRP A 1 211 ? 45.669  20.002  23.580  1.00 73.05  ? 191 TRP A CD2   1 
ATOM   1593  N  NE1   . TRP A 1 211 ? 46.115  20.620  25.691  1.00 72.98  ? 191 TRP A NE1   1 
ATOM   1594  C  CE2   . TRP A 1 211 ? 46.696  20.383  24.474  1.00 73.33  ? 191 TRP A CE2   1 
ATOM   1595  C  CE3   . TRP A 1 211 ? 46.003  19.700  22.252  1.00 73.08  ? 191 TRP A CE3   1 
ATOM   1596  C  CZ2   . TRP A 1 211 ? 48.036  20.470  24.081  1.00 74.27  ? 191 TRP A CZ2   1 
ATOM   1597  C  CZ3   . TRP A 1 211 ? 47.337  19.786  21.862  1.00 73.64  ? 191 TRP A CZ3   1 
ATOM   1598  C  CH2   . TRP A 1 211 ? 48.336  20.169  22.775  1.00 74.40  ? 191 TRP A CH2   1 
ATOM   1599  N  N     . PHE A 1 212 ? 41.284  19.782  21.038  1.00 69.13  ? 192 PHE A N     1 
ATOM   1600  C  CA    . PHE A 1 212 ? 40.146  19.242  20.287  1.00 68.03  ? 192 PHE A CA    1 
ATOM   1601  C  C     . PHE A 1 212 ? 40.494  17.888  19.681  1.00 67.80  ? 192 PHE A C     1 
ATOM   1602  O  O     . PHE A 1 212 ? 41.660  17.615  19.405  1.00 67.80  ? 192 PHE A O     1 
ATOM   1603  C  CB    . PHE A 1 212 ? 39.750  20.205  19.165  1.00 67.71  ? 192 PHE A CB    1 
ATOM   1604  C  CG    . PHE A 1 212 ? 38.935  21.376  19.629  1.00 67.61  ? 192 PHE A CG    1 
ATOM   1605  C  CD1   . PHE A 1 212 ? 39.549  22.488  20.192  1.00 67.75  ? 192 PHE A CD1   1 
ATOM   1606  C  CD2   . PHE A 1 212 ? 37.552  21.374  19.494  1.00 67.79  ? 192 PHE A CD2   1 
ATOM   1607  C  CE1   . PHE A 1 212 ? 38.799  23.575  20.620  1.00 67.92  ? 192 PHE A CE1   1 
ATOM   1608  C  CE2   . PHE A 1 212 ? 36.795  22.455  19.921  1.00 68.39  ? 192 PHE A CE2   1 
ATOM   1609  C  CZ    . PHE A 1 212 ? 37.419  23.559  20.484  1.00 68.11  ? 192 PHE A CZ    1 
ATOM   1610  N  N     . ILE A 1 213 ? 39.474  17.052  19.477  1.00 68.21  ? 193 ILE A N     1 
ATOM   1611  C  CA    . ILE A 1 213 ? 39.615  15.760  18.793  1.00 68.40  ? 193 ILE A CA    1 
ATOM   1612  C  C     . ILE A 1 213 ? 38.818  15.813  17.490  1.00 70.80  ? 193 ILE A C     1 
ATOM   1613  O  O     . ILE A 1 213 ? 37.678  16.283  17.479  1.00 71.55  ? 193 ILE A O     1 
ATOM   1614  C  CB    . ILE A 1 213 ? 39.124  14.587  19.672  1.00 66.59  ? 193 ILE A CB    1 
ATOM   1615  C  CG1   . ILE A 1 213 ? 39.965  14.500  20.951  1.00 66.31  ? 193 ILE A CG1   1 
ATOM   1616  C  CG2   . ILE A 1 213 ? 39.200  13.266  18.908  1.00 65.96  ? 193 ILE A CG2   1 
ATOM   1617  C  CD1   . ILE A 1 213 ? 39.376  13.622  22.031  1.00 65.86  ? 193 ILE A CD1   1 
ATOM   1618  N  N     . LYS A 1 214 ? 39.415  15.324  16.402  1.00 73.43  ? 194 LYS A N     1 
ATOM   1619  C  CA    . LYS A 1 214 ? 38.788  15.395  15.078  1.00 75.72  ? 194 LYS A CA    1 
ATOM   1620  C  C     . LYS A 1 214 ? 37.712  14.324  14.892  1.00 75.62  ? 194 LYS A C     1 
ATOM   1621  O  O     . LYS A 1 214 ? 37.968  13.255  14.329  1.00 76.27  ? 194 LYS A O     1 
ATOM   1622  C  CB    . LYS A 1 214 ? 39.835  15.315  13.957  1.00 78.86  ? 194 LYS A CB    1 
ATOM   1623  C  CG    . LYS A 1 214 ? 40.666  16.580  13.795  1.00 81.64  ? 194 LYS A CG    1 
ATOM   1624  C  CD    . LYS A 1 214 ? 41.386  16.619  12.454  1.00 83.75  ? 194 LYS A CD    1 
ATOM   1625  C  CE    . LYS A 1 214 ? 42.102  17.945  12.244  1.00 85.26  ? 194 LYS A CE    1 
ATOM   1626  N  NZ    . LYS A 1 214 ? 42.778  18.015  10.919  1.00 85.95  ? 194 LYS A NZ    1 
ATOM   1627  N  N     . ILE A 1 215 ? 36.512  14.623  15.388  1.00 74.84  ? 195 ILE A N     1 
ATOM   1628  C  CA    . ILE A 1 215 ? 35.320  13.801  15.131  1.00 73.25  ? 195 ILE A CA    1 
ATOM   1629  C  C     . ILE A 1 215 ? 34.811  13.973  13.690  1.00 72.53  ? 195 ILE A C     1 
ATOM   1630  O  O     . ILE A 1 215 ? 34.173  13.068  13.147  1.00 73.15  ? 195 ILE A O     1 
ATOM   1631  C  CB    . ILE A 1 215 ? 34.183  14.088  16.153  1.00 72.49  ? 195 ILE A CB    1 
ATOM   1632  C  CG1   . ILE A 1 215 ? 33.118  12.983  16.108  1.00 71.76  ? 195 ILE A CG1   1 
ATOM   1633  C  CG2   . ILE A 1 215 ? 33.547  15.458  15.922  1.00 72.97  ? 195 ILE A CG2   1 
ATOM   1634  C  CD1   . ILE A 1 215 ? 32.165  13.007  17.282  1.00 71.81  ? 195 ILE A CD1   1 
ATOM   1635  N  N     . THR A 1 216 ? 35.100  15.125  13.078  1.00 70.94  ? 196 THR A N     1 
ATOM   1636  C  CA    . THR A 1 216 ? 34.733  15.393  11.679  1.00 70.24  ? 196 THR A CA    1 
ATOM   1637  C  C     . THR A 1 216 ? 35.417  14.457  10.669  1.00 70.27  ? 196 THR A C     1 
ATOM   1638  O  O     . THR A 1 216 ? 34.905  14.259  9.565   1.00 69.06  ? 196 THR A O     1 
ATOM   1639  C  CB    . THR A 1 216 ? 35.037  16.853  11.283  1.00 70.08  ? 196 THR A CB    1 
ATOM   1640  O  OG1   . THR A 1 216 ? 36.390  17.177  11.624  1.00 70.15  ? 196 THR A OG1   1 
ATOM   1641  C  CG2   . THR A 1 216 ? 34.094  17.808  11.996  1.00 70.30  ? 196 THR A CG2   1 
ATOM   1642  N  N     . ALA A 1 217 ? 36.571  13.901  11.045  1.00 70.91  ? 197 ALA A N     1 
ATOM   1643  C  CA    . ALA A 1 217 ? 37.236  12.850  10.263  1.00 71.40  ? 197 ALA A CA    1 
ATOM   1644  C  C     . ALA A 1 217 ? 36.347  11.615  10.071  1.00 72.06  ? 197 ALA A C     1 
ATOM   1645  O  O     . ALA A 1 217 ? 36.392  10.973  9.019   1.00 73.36  ? 197 ALA A O     1 
ATOM   1646  C  CB    . ALA A 1 217 ? 38.547  12.449  10.924  1.00 71.19  ? 197 ALA A CB    1 
ATOM   1647  N  N     . TYR A 1 218 ? 35.546  11.301  11.090  1.00 72.31  ? 198 TYR A N     1 
ATOM   1648  C  CA    . TYR A 1 218 ? 34.571  10.208  11.046  1.00 72.27  ? 198 TYR A CA    1 
ATOM   1649  C  C     . TYR A 1 218 ? 33.134  10.739  10.863  1.00 72.15  ? 198 TYR A C     1 
ATOM   1650  O  O     . TYR A 1 218 ? 32.185  10.155  11.388  1.00 72.16  ? 198 TYR A O     1 
ATOM   1651  C  CB    . TYR A 1 218 ? 34.667  9.375   12.338  1.00 71.96  ? 198 TYR A CB    1 
ATOM   1652  C  CG    . TYR A 1 218 ? 35.986  8.649   12.545  1.00 71.58  ? 198 TYR A CG    1 
ATOM   1653  C  CD1   . TYR A 1 218 ? 37.153  9.347   12.868  1.00 71.40  ? 198 TYR A CD1   1 
ATOM   1654  C  CD2   . TYR A 1 218 ? 36.062  7.256   12.444  1.00 71.64  ? 198 TYR A CD2   1 
ATOM   1655  C  CE1   . TYR A 1 218 ? 38.355  8.683   13.070  1.00 71.56  ? 198 TYR A CE1   1 
ATOM   1656  C  CE2   . TYR A 1 218 ? 37.261  6.584   12.644  1.00 71.55  ? 198 TYR A CE2   1 
ATOM   1657  C  CZ    . TYR A 1 218 ? 38.404  7.302   12.956  1.00 71.64  ? 198 TYR A CZ    1 
ATOM   1658  O  OH    . TYR A 1 218 ? 39.596  6.647   13.157  1.00 71.05  ? 198 TYR A OH    1 
ATOM   1659  N  N     . ALA A 1 219 ? 32.969  11.829  10.110  1.00 72.31  ? 199 ALA A N     1 
ATOM   1660  C  CA    . ALA A 1 219 ? 31.647  12.442  9.910   1.00 72.62  ? 199 ALA A CA    1 
ATOM   1661  C  C     . ALA A 1 219 ? 30.762  11.591  9.000   1.00 73.54  ? 199 ALA A C     1 
ATOM   1662  O  O     . ALA A 1 219 ? 29.594  11.351  9.316   1.00 73.67  ? 199 ALA A O     1 
ATOM   1663  C  CB    . ALA A 1 219 ? 31.784  13.849  9.346   1.00 72.43  ? 199 ALA A CB    1 
ATOM   1664  N  N     . ASP A 1 220 ? 31.325  11.144  7.876   1.00 74.37  ? 200 ASP A N     1 
ATOM   1665  C  CA    . ASP A 1 220 ? 30.619  10.265  6.936   1.00 74.73  ? 200 ASP A CA    1 
ATOM   1666  C  C     . ASP A 1 220 ? 30.321  8.896   7.537   1.00 73.35  ? 200 ASP A C     1 
ATOM   1667  O  O     . ASP A 1 220 ? 29.212  8.387   7.384   1.00 73.75  ? 200 ASP A O     1 
ATOM   1668  C  CB    . ASP A 1 220 ? 31.422  10.072  5.638   1.00 76.83  ? 200 ASP A CB    1 
ATOM   1669  C  CG    . ASP A 1 220 ? 31.467  11.322  4.769   1.00 78.22  ? 200 ASP A CG    1 
ATOM   1670  O  OD1   . ASP A 1 220 ? 30.645  12.245  4.964   1.00 78.95  ? 200 ASP A OD1   1 
ATOM   1671  O  OD2   . ASP A 1 220 ? 32.330  11.377  3.868   1.00 79.73  ? 200 ASP A OD2   1 
ATOM   1672  N  N     . GLU A 1 221 ? 31.306  8.307   8.214   1.00 72.20  ? 201 GLU A N     1 
ATOM   1673  C  CA    . GLU A 1 221 ? 31.153  6.968   8.793   1.00 72.32  ? 201 GLU A CA    1 
ATOM   1674  C  C     . GLU A 1 221 ? 30.087  6.922   9.892   1.00 72.76  ? 201 GLU A C     1 
ATOM   1675  O  O     . GLU A 1 221 ? 29.329  5.955   9.974   1.00 74.36  ? 201 GLU A O     1 
ATOM   1676  C  CB    . GLU A 1 221 ? 32.488  6.444   9.329   1.00 71.88  ? 201 GLU A CB    1 
ATOM   1677  C  CG    . GLU A 1 221 ? 32.488  4.949   9.624   1.00 71.58  ? 201 GLU A CG    1 
ATOM   1678  C  CD    . GLU A 1 221 ? 33.815  4.444   10.160  1.00 72.43  ? 201 GLU A CD    1 
ATOM   1679  O  OE1   . GLU A 1 221 ? 34.868  5.046   9.856   1.00 73.56  ? 201 GLU A OE1   1 
ATOM   1680  O  OE2   . GLU A 1 221 ? 33.808  3.430   10.887  1.00 72.78  ? 201 GLU A OE2   1 
ATOM   1681  N  N     . LEU A 1 222 ? 30.039  7.959   10.730  1.00 71.94  ? 202 LEU A N     1 
ATOM   1682  C  CA    . LEU A 1 222 ? 28.978  8.097   11.739  1.00 70.81  ? 202 LEU A CA    1 
ATOM   1683  C  C     . LEU A 1 222 ? 27.605  8.301   11.092  1.00 70.65  ? 202 LEU A C     1 
ATOM   1684  O  O     . LEU A 1 222 ? 26.610  7.766   11.576  1.00 70.51  ? 202 LEU A O     1 
ATOM   1685  C  CB    . LEU A 1 222 ? 29.275  9.251   12.708  1.00 70.40  ? 202 LEU A CB    1 
ATOM   1686  C  CG    . LEU A 1 222 ? 30.393  9.030   13.735  1.00 70.01  ? 202 LEU A CG    1 
ATOM   1687  C  CD1   . LEU A 1 222 ? 30.805  10.346  14.378  1.00 69.57  ? 202 LEU A CD1   1 
ATOM   1688  C  CD2   . LEU A 1 222 ? 29.979  8.027   14.801  1.00 70.29  ? 202 LEU A CD2   1 
ATOM   1689  N  N     . LEU A 1 223 ? 27.564  9.070   10.004  1.00 70.96  ? 203 LEU A N     1 
ATOM   1690  C  CA    . LEU A 1 223 ? 26.322  9.335   9.274   1.00 70.76  ? 203 LEU A CA    1 
ATOM   1691  C  C     . LEU A 1 223 ? 25.828  8.120   8.479   1.00 71.33  ? 203 LEU A C     1 
ATOM   1692  O  O     . LEU A 1 223 ? 24.642  7.788   8.529   1.00 72.77  ? 203 LEU A O     1 
ATOM   1693  C  CB    . LEU A 1 223 ? 26.508  10.533  8.335   1.00 70.14  ? 203 LEU A CB    1 
ATOM   1694  C  CG    . LEU A 1 223 ? 25.284  11.059  7.578   1.00 70.84  ? 203 LEU A CG    1 
ATOM   1695  C  CD1   . LEU A 1 223 ? 24.172  11.479  8.524   1.00 71.30  ? 203 LEU A CD1   1 
ATOM   1696  C  CD2   . LEU A 1 223 ? 25.682  12.228  6.698   1.00 71.34  ? 203 LEU A CD2   1 
ATOM   1697  N  N     . ASN A 1 224 ? 26.735  7.469   7.752   1.00 71.55  ? 204 ASN A N     1 
ATOM   1698  C  CA    . ASN A 1 224 ? 26.379  6.343   6.875   1.00 72.21  ? 204 ASN A CA    1 
ATOM   1699  C  C     . ASN A 1 224 ? 25.991  5.070   7.634   1.00 72.83  ? 204 ASN A C     1 
ATOM   1700  O  O     . ASN A 1 224 ? 25.048  4.381   7.234   1.00 73.01  ? 204 ASN A O     1 
ATOM   1701  C  CB    . ASN A 1 224 ? 27.517  6.032   5.887   1.00 71.75  ? 204 ASN A CB    1 
ATOM   1702  C  CG    . ASN A 1 224 ? 27.701  7.118   4.836   1.00 71.07  ? 204 ASN A CG    1 
ATOM   1703  O  OD1   . ASN A 1 224 ? 26.732  7.688   4.329   1.00 69.88  ? 204 ASN A OD1   1 
ATOM   1704  N  ND2   . ASN A 1 224 ? 28.952  7.400   4.494   1.00 71.43  ? 204 ASN A ND2   1 
ATOM   1705  N  N     . ASP A 1 225 ? 26.702  4.766   8.721   1.00 73.76  ? 205 ASP A N     1 
ATOM   1706  C  CA    . ASP A 1 225 ? 26.433  3.550   9.514   1.00 74.65  ? 205 ASP A CA    1 
ATOM   1707  C  C     . ASP A 1 225 ? 25.094  3.555   10.278  1.00 73.80  ? 205 ASP A C     1 
ATOM   1708  O  O     . ASP A 1 225 ? 24.683  2.513   10.795  1.00 73.57  ? 205 ASP A O     1 
ATOM   1709  C  CB    . ASP A 1 225 ? 27.594  3.247   10.481  1.00 75.07  ? 205 ASP A CB    1 
ATOM   1710  C  CG    . ASP A 1 225 ? 28.857  2.775   9.763   1.00 75.53  ? 205 ASP A CG    1 
ATOM   1711  O  OD1   . ASP A 1 225 ? 29.018  3.058   8.555   1.00 77.03  ? 205 ASP A OD1   1 
ATOM   1712  O  OD2   . ASP A 1 225 ? 29.697  2.117   10.412  1.00 75.22  ? 205 ASP A OD2   1 
ATOM   1713  N  N     . LEU A 1 226 ? 24.424  4.709   10.354  1.00 72.33  ? 206 LEU A N     1 
ATOM   1714  C  CA    . LEU A 1 226 ? 23.045  4.780   10.856  1.00 72.67  ? 206 LEU A CA    1 
ATOM   1715  C  C     . LEU A 1 226 ? 22.075  3.897   10.061  1.00 75.67  ? 206 LEU A C     1 
ATOM   1716  O  O     . LEU A 1 226 ? 21.108  3.381   10.623  1.00 76.69  ? 206 LEU A O     1 
ATOM   1717  C  CB    . LEU A 1 226 ? 22.537  6.227   10.859  1.00 70.85  ? 206 LEU A CB    1 
ATOM   1718  C  CG    . LEU A 1 226 ? 23.160  7.164   11.898  1.00 69.71  ? 206 LEU A CG    1 
ATOM   1719  C  CD1   . LEU A 1 226 ? 22.887  8.619   11.548  1.00 69.74  ? 206 LEU A CD1   1 
ATOM   1720  C  CD2   . LEU A 1 226 ? 22.656  6.858   13.300  1.00 69.05  ? 206 LEU A CD2   1 
ATOM   1721  N  N     . ASP A 1 227 ? 22.334  3.731   8.763   1.00 79.61  ? 207 ASP A N     1 
ATOM   1722  C  CA    . ASP A 1 227 ? 21.547  2.825   7.914   1.00 82.65  ? 207 ASP A CA    1 
ATOM   1723  C  C     . ASP A 1 227 ? 21.625  1.363   8.369   1.00 83.82  ? 207 ASP A C     1 
ATOM   1724  O  O     . ASP A 1 227 ? 20.627  0.644   8.309   1.00 86.84  ? 207 ASP A O     1 
ATOM   1725  C  CB    . ASP A 1 227 ? 21.983  2.936   6.445   1.00 84.09  ? 207 ASP A CB    1 
ATOM   1726  C  CG    . ASP A 1 227 ? 21.601  4.271   5.814   1.00 85.83  ? 207 ASP A CG    1 
ATOM   1727  O  OD1   . ASP A 1 227 ? 21.375  5.256   6.553   1.00 86.36  ? 207 ASP A OD1   1 
ATOM   1728  O  OD2   . ASP A 1 227 ? 21.532  4.334   4.568   1.00 87.12  ? 207 ASP A OD2   1 
ATOM   1729  N  N     . LYS A 1 228 ? 22.804  0.932   8.817   1.00 84.62  ? 208 LYS A N     1 
ATOM   1730  C  CA    . LYS A 1 228 ? 23.001  -0.436  9.318   1.00 85.36  ? 208 LYS A CA    1 
ATOM   1731  C  C     . LYS A 1 228 ? 22.335  -0.708  10.674  1.00 82.85  ? 208 LYS A C     1 
ATOM   1732  O  O     . LYS A 1 228 ? 22.008  -1.858  10.975  1.00 81.90  ? 208 LYS A O     1 
ATOM   1733  C  CB    . LYS A 1 228 ? 24.496  -0.775  9.395   1.00 88.60  ? 208 LYS A CB    1 
ATOM   1734  C  CG    . LYS A 1 228 ? 25.181  -0.822  8.034   1.00 91.14  ? 208 LYS A CG    1 
ATOM   1735  C  CD    . LYS A 1 228 ? 26.555  -1.489  8.075   1.00 92.83  ? 208 LYS A CD    1 
ATOM   1736  C  CE    . LYS A 1 228 ? 27.651  -0.592  8.645   1.00 93.65  ? 208 LYS A CE    1 
ATOM   1737  N  NZ    . LYS A 1 228 ? 27.776  -0.627  10.131  1.00 93.78  ? 208 LYS A NZ    1 
ATOM   1738  N  N     . LEU A 1 229 ? 22.142  0.334   11.485  1.00 81.52  ? 209 LEU A N     1 
ATOM   1739  C  CA    . LEU A 1 229 ? 21.477  0.202   12.790  1.00 81.36  ? 209 LEU A CA    1 
ATOM   1740  C  C     . LEU A 1 229 ? 19.956  0.127   12.636  1.00 80.69  ? 209 LEU A C     1 
ATOM   1741  O  O     . LEU A 1 229 ? 19.243  1.100   12.894  1.00 79.50  ? 209 LEU A O     1 
ATOM   1742  C  CB    . LEU A 1 229 ? 21.859  1.366   13.713  1.00 81.22  ? 209 LEU A CB    1 
ATOM   1743  C  CG    . LEU A 1 229 ? 23.343  1.494   14.063  1.00 81.69  ? 209 LEU A CG    1 
ATOM   1744  C  CD1   . LEU A 1 229 ? 23.605  2.820   14.760  1.00 82.17  ? 209 LEU A CD1   1 
ATOM   1745  C  CD2   . LEU A 1 229 ? 23.810  0.328   14.923  1.00 81.64  ? 209 LEU A CD2   1 
ATOM   1746  N  N     . ASP A 1 230 ? 19.473  -1.041  12.219  1.00 80.86  ? 210 ASP A N     1 
ATOM   1747  C  CA    . ASP A 1 230 ? 18.033  -1.271  12.020  1.00 80.45  ? 210 ASP A CA    1 
ATOM   1748  C  C     . ASP A 1 230 ? 17.237  -1.326  13.337  1.00 78.78  ? 210 ASP A C     1 
ATOM   1749  O  O     . ASP A 1 230 ? 16.080  -0.899  13.374  1.00 78.30  ? 210 ASP A O     1 
ATOM   1750  C  CB    . ASP A 1 230 ? 17.776  -2.529  11.162  1.00 81.60  ? 210 ASP A CB    1 
ATOM   1751  C  CG    . ASP A 1 230 ? 18.315  -3.813  11.793  1.00 83.23  ? 210 ASP A CG    1 
ATOM   1752  O  OD1   . ASP A 1 230 ? 19.384  -3.770  12.439  1.00 85.08  ? 210 ASP A OD1   1 
ATOM   1753  O  OD2   . ASP A 1 230 ? 17.675  -4.873  11.622  1.00 83.94  ? 210 ASP A OD2   1 
ATOM   1754  N  N     . HIS A 1 231 ? 17.864  -1.827  14.407  1.00 77.25  ? 211 HIS A N     1 
ATOM   1755  C  CA    . HIS A 1 231 ? 17.225  -1.935  15.733  1.00 75.37  ? 211 HIS A CA    1 
ATOM   1756  C  C     . HIS A 1 231 ? 17.437  -0.718  16.663  1.00 73.03  ? 211 HIS A C     1 
ATOM   1757  O  O     . HIS A 1 231 ? 17.145  -0.794  17.858  1.00 71.83  ? 211 HIS A O     1 
ATOM   1758  C  CB    . HIS A 1 231 ? 17.677  -3.229  16.427  1.00 75.66  ? 211 HIS A CB    1 
ATOM   1759  C  CG    . HIS A 1 231 ? 17.244  -4.472  15.715  1.00 76.34  ? 211 HIS A CG    1 
ATOM   1760  N  ND1   . HIS A 1 231 ? 15.968  -4.981  15.818  1.00 76.61  ? 211 HIS A ND1   1 
ATOM   1761  C  CD2   . HIS A 1 231 ? 17.915  -5.305  14.885  1.00 77.35  ? 211 HIS A CD2   1 
ATOM   1762  C  CE1   . HIS A 1 231 ? 15.871  -6.075  15.084  1.00 77.13  ? 211 HIS A CE1   1 
ATOM   1763  N  NE2   . HIS A 1 231 ? 17.039  -6.294  14.507  1.00 77.67  ? 211 HIS A NE2   1 
ATOM   1764  N  N     . TRP A 1 232 ? 17.944  0.391   16.119  1.00 71.40  ? 212 TRP A N     1 
ATOM   1765  C  CA    . TRP A 1 232 ? 17.890  1.695   16.792  1.00 70.22  ? 212 TRP A CA    1 
ATOM   1766  C  C     . TRP A 1 232 ? 16.609  2.415   16.365  1.00 70.32  ? 212 TRP A C     1 
ATOM   1767  O  O     . TRP A 1 232 ? 16.187  2.276   15.213  1.00 70.89  ? 212 TRP A O     1 
ATOM   1768  C  CB    . TRP A 1 232 ? 19.100  2.560   16.423  1.00 69.89  ? 212 TRP A CB    1 
ATOM   1769  C  CG    . TRP A 1 232 ? 20.330  2.269   17.212  1.00 69.19  ? 212 TRP A CG    1 
ATOM   1770  C  CD1   . TRP A 1 232 ? 20.808  1.043   17.565  1.00 69.39  ? 212 TRP A CD1   1 
ATOM   1771  C  CD2   . TRP A 1 232 ? 21.257  3.228   17.730  1.00 68.17  ? 212 TRP A CD2   1 
ATOM   1772  N  NE1   . TRP A 1 232 ? 21.974  1.177   18.283  1.00 69.35  ? 212 TRP A NE1   1 
ATOM   1773  C  CE2   . TRP A 1 232 ? 22.273  2.509   18.396  1.00 68.35  ? 212 TRP A CE2   1 
ATOM   1774  C  CE3   . TRP A 1 232 ? 21.327  4.627   17.697  1.00 67.48  ? 212 TRP A CE3   1 
ATOM   1775  C  CZ2   . TRP A 1 232 ? 23.348  3.141   19.027  1.00 68.19  ? 212 TRP A CZ2   1 
ATOM   1776  C  CZ3   . TRP A 1 232 ? 22.396  5.257   18.324  1.00 67.57  ? 212 TRP A CZ3   1 
ATOM   1777  C  CH2   . TRP A 1 232 ? 23.391  4.513   18.981  1.00 68.19  ? 212 TRP A CH2   1 
ATOM   1778  N  N     . PRO A 1 233 ? 15.993  3.200   17.276  1.00 70.23  ? 213 PRO A N     1 
ATOM   1779  C  CA    . PRO A 1 233 ? 14.771  3.926   16.920  1.00 70.50  ? 213 PRO A CA    1 
ATOM   1780  C  C     . PRO A 1 233 ? 15.041  5.081   15.955  1.00 71.39  ? 213 PRO A C     1 
ATOM   1781  O  O     . PRO A 1 233 ? 16.110  5.692   16.008  1.00 72.83  ? 213 PRO A O     1 
ATOM   1782  C  CB    . PRO A 1 233 ? 14.276  4.455   18.269  1.00 70.07  ? 213 PRO A CB    1 
ATOM   1783  C  CG    . PRO A 1 233 ? 15.513  4.622   19.074  1.00 69.74  ? 213 PRO A CG    1 
ATOM   1784  C  CD    . PRO A 1 233 ? 16.420  3.500   18.656  1.00 70.17  ? 213 PRO A CD    1 
ATOM   1785  N  N     . ASP A 1 234 ? 14.068  5.373   15.094  1.00 71.95  ? 214 ASP A N     1 
ATOM   1786  C  CA    . ASP A 1 234 ? 14.206  6.430   14.082  1.00 72.13  ? 214 ASP A CA    1 
ATOM   1787  C  C     . ASP A 1 234 ? 14.253  7.843   14.677  1.00 70.38  ? 214 ASP A C     1 
ATOM   1788  O  O     . ASP A 1 234 ? 14.779  8.759   14.045  1.00 70.46  ? 214 ASP A O     1 
ATOM   1789  C  CB    . ASP A 1 234 ? 13.077  6.336   13.048  1.00 74.18  ? 214 ASP A CB    1 
ATOM   1790  C  CG    . ASP A 1 234 ? 13.139  5.055   12.226  1.00 75.64  ? 214 ASP A CG    1 
ATOM   1791  O  OD1   . ASP A 1 234 ? 14.211  4.756   11.657  1.00 76.28  ? 214 ASP A OD1   1 
ATOM   1792  O  OD2   . ASP A 1 234 ? 12.110  4.352   12.141  1.00 77.17  ? 214 ASP A OD2   1 
ATOM   1793  N  N     . THR A 1 235 ? 13.701  8.013   15.880  1.00 69.00  ? 215 THR A N     1 
ATOM   1794  C  CA    . THR A 1 235 ? 13.790  9.278   16.621  1.00 68.44  ? 215 THR A CA    1 
ATOM   1795  C  C     . THR A 1 235 ? 15.241  9.701   16.874  1.00 67.22  ? 215 THR A C     1 
ATOM   1796  O  O     . THR A 1 235 ? 15.608  10.852  16.630  1.00 66.51  ? 215 THR A O     1 
ATOM   1797  C  CB    . THR A 1 235 ? 13.059  9.190   17.983  1.00 68.84  ? 215 THR A CB    1 
ATOM   1798  O  OG1   . THR A 1 235 ? 13.467  8.006   18.682  1.00 67.78  ? 215 THR A OG1   1 
ATOM   1799  C  CG2   . THR A 1 235 ? 11.550  9.158   17.785  1.00 69.29  ? 215 THR A CG2   1 
ATOM   1800  N  N     . VAL A 1 236 ? 16.053  8.756   17.346  1.00 66.23  ? 216 VAL A N     1 
ATOM   1801  C  CA    . VAL A 1 236 ? 17.460  9.006   17.678  1.00 65.16  ? 216 VAL A CA    1 
ATOM   1802  C  C     . VAL A 1 236 ? 18.322  9.118   16.417  1.00 63.96  ? 216 VAL A C     1 
ATOM   1803  O  O     . VAL A 1 236 ? 19.178  10.002  16.331  1.00 64.00  ? 216 VAL A O     1 
ATOM   1804  C  CB    . VAL A 1 236 ? 18.029  7.910   18.617  1.00 65.54  ? 216 VAL A CB    1 
ATOM   1805  C  CG1   . VAL A 1 236 ? 19.520  8.118   18.880  1.00 65.78  ? 216 VAL A CG1   1 
ATOM   1806  C  CG2   . VAL A 1 236 ? 17.261  7.887   19.934  1.00 65.60  ? 216 VAL A CG2   1 
ATOM   1807  N  N     . LYS A 1 237 ? 18.099  8.224   15.453  1.00 62.39  ? 217 LYS A N     1 
ATOM   1808  C  CA    . LYS A 1 237 ? 18.889  8.203   14.215  1.00 61.77  ? 217 LYS A CA    1 
ATOM   1809  C  C     . LYS A 1 237 ? 18.728  9.481   13.387  1.00 61.23  ? 217 LYS A C     1 
ATOM   1810  O  O     . LYS A 1 237 ? 19.720  10.044  12.921  1.00 60.28  ? 217 LYS A O     1 
ATOM   1811  C  CB    . LYS A 1 237 ? 18.546  6.974   13.368  1.00 61.38  ? 217 LYS A CB    1 
ATOM   1812  C  CG    . LYS A 1 237 ? 18.996  5.668   14.003  1.00 62.06  ? 217 LYS A CG    1 
ATOM   1813  C  CD    . LYS A 1 237 ? 18.903  4.494   13.043  1.00 62.78  ? 217 LYS A CD    1 
ATOM   1814  C  CE    . LYS A 1 237 ? 17.465  4.164   12.682  1.00 63.52  ? 217 LYS A CE    1 
ATOM   1815  N  NZ    . LYS A 1 237 ? 17.342  2.814   12.067  1.00 63.86  ? 217 LYS A NZ    1 
ATOM   1816  N  N     . THR A 1 238 ? 17.486  9.935   13.225  1.00 61.30  ? 218 THR A N     1 
ATOM   1817  C  CA    . THR A 1 238 ? 17.192  11.174  12.493  1.00 61.39  ? 218 THR A CA    1 
ATOM   1818  C  C     . THR A 1 238 ? 17.745  12.416  13.207  1.00 61.40  ? 218 THR A C     1 
ATOM   1819  O  O     . THR A 1 238 ? 18.164  13.373  12.546  1.00 61.01  ? 218 THR A O     1 
ATOM   1820  C  CB    . THR A 1 238 ? 15.676  11.338  12.250  1.00 61.52  ? 218 THR A CB    1 
ATOM   1821  O  OG1   . THR A 1 238 ? 15.165  10.157  11.619  1.00 62.05  ? 218 THR A OG1   1 
ATOM   1822  C  CG2   . THR A 1 238 ? 15.379  12.546  11.358  1.00 61.60  ? 218 THR A CG2   1 
ATOM   1823  N  N     . MET A 1 239 ? 17.741  12.400  14.542  1.00 60.68  ? 219 MET A N     1 
ATOM   1824  C  CA    . MET A 1 239 ? 18.385  13.462  15.329  1.00 59.81  ? 219 MET A CA    1 
ATOM   1825  C  C     . MET A 1 239 ? 19.889  13.524  15.058  1.00 58.89  ? 219 MET A C     1 
ATOM   1826  O  O     . MET A 1 239 ? 20.433  14.611  14.846  1.00 57.86  ? 219 MET A O     1 
ATOM   1827  C  CB    . MET A 1 239 ? 18.120  13.298  16.837  1.00 60.29  ? 219 MET A CB    1 
ATOM   1828  C  CG    . MET A 1 239 ? 16.843  13.972  17.320  1.00 60.87  ? 219 MET A CG    1 
ATOM   1829  S  SD    . MET A 1 239 ? 16.711  14.087  19.115  1.00 61.12  ? 219 MET A SD    1 
ATOM   1830  C  CE    . MET A 1 239 ? 16.182  12.425  19.521  1.00 61.26  ? 219 MET A CE    1 
ATOM   1831  N  N     . GLN A 1 240 ? 20.545  12.362  15.051  1.00 58.24  ? 220 GLN A N     1 
ATOM   1832  C  CA    . GLN A 1 240 ? 21.983  12.284  14.760  1.00 58.05  ? 220 GLN A CA    1 
ATOM   1833  C  C     . GLN A 1 240 ? 22.331  12.672  13.318  1.00 59.11  ? 220 GLN A C     1 
ATOM   1834  O  O     . GLN A 1 240 ? 23.382  13.268  13.088  1.00 60.69  ? 220 GLN A O     1 
ATOM   1835  C  CB    . GLN A 1 240 ? 22.550  10.897  15.092  1.00 57.32  ? 220 GLN A CB    1 
ATOM   1836  C  CG    . GLN A 1 240 ? 22.632  10.614  16.590  1.00 57.33  ? 220 GLN A CG    1 
ATOM   1837  C  CD    . GLN A 1 240 ? 23.578  9.478   16.962  1.00 57.24  ? 220 GLN A CD    1 
ATOM   1838  O  OE1   . GLN A 1 240 ? 24.382  9.015   16.149  1.00 57.33  ? 220 GLN A OE1   1 
ATOM   1839  N  NE2   . GLN A 1 240 ? 23.492  9.031   18.211  1.00 56.32  ? 220 GLN A NE2   1 
ATOM   1840  N  N     . ARG A 1 241 ? 21.465  12.339  12.358  1.00 59.75  ? 221 ARG A N     1 
ATOM   1841  C  CA    . ARG A 1 241 ? 21.640  12.796  10.969  1.00 60.16  ? 221 ARG A CA    1 
ATOM   1842  C  C     . ARG A 1 241 ? 21.584  14.321  10.866  1.00 60.01  ? 221 ARG A C     1 
ATOM   1843  O  O     . ARG A 1 241 ? 22.442  14.933  10.230  1.00 59.90  ? 221 ARG A O     1 
ATOM   1844  C  CB    . ARG A 1 241 ? 20.580  12.197  10.036  1.00 61.25  ? 221 ARG A CB    1 
ATOM   1845  C  CG    . ARG A 1 241 ? 20.736  10.711  9.765   1.00 62.31  ? 221 ARG A CG    1 
ATOM   1846  C  CD    . ARG A 1 241 ? 20.058  10.300  8.466   1.00 63.05  ? 221 ARG A CD    1 
ATOM   1847  N  NE    . ARG A 1 241 ? 19.910  8.847   8.369   1.00 63.99  ? 221 ARG A NE    1 
ATOM   1848  C  CZ    . ARG A 1 241 ? 18.967  8.118   8.975   1.00 64.88  ? 221 ARG A CZ    1 
ATOM   1849  N  NH1   . ARG A 1 241 ? 18.042  8.684   9.755   1.00 64.95  ? 221 ARG A NH1   1 
ATOM   1850  N  NH2   . ARG A 1 241 ? 18.950  6.797   8.803   1.00 65.56  ? 221 ARG A NH2   1 
ATOM   1851  N  N     . ASN A 1 242 ? 20.571  14.918  11.491  1.00 60.82  ? 222 ASN A N     1 
ATOM   1852  C  CA    . ASN A 1 242 ? 20.377  16.374  11.461  1.00 62.04  ? 222 ASN A CA    1 
ATOM   1853  C  C     . ASN A 1 242 ? 21.456  17.135  12.243  1.00 62.41  ? 222 ASN A C     1 
ATOM   1854  O  O     . ASN A 1 242 ? 21.797  18.266  11.890  1.00 62.43  ? 222 ASN A O     1 
ATOM   1855  C  CB    . ASN A 1 242 ? 18.982  16.749  11.985  1.00 62.60  ? 222 ASN A CB    1 
ATOM   1856  C  CG    . ASN A 1 242 ? 17.859  16.264  11.078  1.00 62.61  ? 222 ASN A CG    1 
ATOM   1857  O  OD1   . ASN A 1 242 ? 18.033  15.335  10.288  1.00 62.63  ? 222 ASN A OD1   1 
ATOM   1858  N  ND2   . ASN A 1 242 ? 16.696  16.892  11.195  1.00 62.81  ? 222 ASN A ND2   1 
ATOM   1859  N  N     . TRP A 1 243 ? 21.977  16.514  13.302  1.00 62.84  ? 223 TRP A N     1 
ATOM   1860  C  CA    . TRP A 1 243 ? 23.081  17.077  14.089  1.00 63.19  ? 223 TRP A CA    1 
ATOM   1861  C  C     . TRP A 1 243 ? 24.381  17.118  13.287  1.00 63.67  ? 223 TRP A C     1 
ATOM   1862  O  O     . TRP A 1 243 ? 25.083  18.134  13.291  1.00 63.22  ? 223 TRP A O     1 
ATOM   1863  C  CB    . TRP A 1 243 ? 23.283  16.255  15.366  1.00 63.20  ? 223 TRP A CB    1 
ATOM   1864  C  CG    . TRP A 1 243 ? 24.390  16.722  16.279  1.00 63.08  ? 223 TRP A CG    1 
ATOM   1865  C  CD1   . TRP A 1 243 ? 25.677  16.266  16.306  1.00 62.86  ? 223 TRP A CD1   1 
ATOM   1866  C  CD2   . TRP A 1 243 ? 24.293  17.706  17.317  1.00 62.75  ? 223 TRP A CD2   1 
ATOM   1867  N  NE1   . TRP A 1 243 ? 26.388  16.909  17.290  1.00 62.64  ? 223 TRP A NE1   1 
ATOM   1868  C  CE2   . TRP A 1 243 ? 25.561  17.793  17.930  1.00 62.46  ? 223 TRP A CE2   1 
ATOM   1869  C  CE3   . TRP A 1 243 ? 23.251  18.509  17.802  1.00 63.00  ? 223 TRP A CE3   1 
ATOM   1870  C  CZ2   . TRP A 1 243 ? 25.824  18.664  18.989  1.00 62.37  ? 223 TRP A CZ2   1 
ATOM   1871  C  CZ3   . TRP A 1 243 ? 23.514  19.380  18.859  1.00 63.07  ? 223 TRP A CZ3   1 
ATOM   1872  C  CH2   . TRP A 1 243 ? 24.793  19.450  19.438  1.00 62.49  ? 223 TRP A CH2   1 
ATOM   1873  N  N     . ILE A 1 244 ? 24.692  16.008  12.614  1.00 64.07  ? 224 ILE A N     1 
ATOM   1874  C  CA    . ILE A 1 244 ? 25.887  15.904  11.771  1.00 64.12  ? 224 ILE A CA    1 
ATOM   1875  C  C     . ILE A 1 244 ? 25.753  16.846  10.578  1.00 65.89  ? 224 ILE A C     1 
ATOM   1876  O  O     . ILE A 1 244 ? 26.627  17.679  10.342  1.00 66.25  ? 224 ILE A O     1 
ATOM   1877  C  CB    . ILE A 1 244 ? 26.135  14.451  11.293  1.00 62.82  ? 224 ILE A CB    1 
ATOM   1878  C  CG1   . ILE A 1 244 ? 26.512  13.556  12.480  1.00 61.75  ? 224 ILE A CG1   1 
ATOM   1879  C  CG2   . ILE A 1 244 ? 27.243  14.398  10.241  1.00 63.38  ? 224 ILE A CG2   1 
ATOM   1880  C  CD1   . ILE A 1 244 ? 26.302  12.078  12.226  1.00 61.73  ? 224 ILE A CD1   1 
ATOM   1881  N  N     . GLY A 1 245 ? 24.661  16.690  9.834   1.00 69.12  ? 225 GLY A N     1 
ATOM   1882  C  CA    . GLY A 1 245 ? 24.297  17.609  8.757   1.00 71.92  ? 225 GLY A CA    1 
ATOM   1883  C  C     . GLY A 1 245 ? 25.299  17.705  7.623   1.00 74.15  ? 225 GLY A C     1 
ATOM   1884  O  O     . GLY A 1 245 ? 25.826  18.786  7.351   1.00 73.46  ? 225 GLY A O     1 
ATOM   1885  N  N     . ARG A 1 246 ? 25.563  16.576  6.968   1.00 78.02  ? 226 ARG A N     1 
ATOM   1886  C  CA    . ARG A 1 246 ? 26.424  16.551  5.783   1.00 81.46  ? 226 ARG A CA    1 
ATOM   1887  C  C     . ARG A 1 246 ? 25.767  17.369  4.679   1.00 83.16  ? 226 ARG A C     1 
ATOM   1888  O  O     . ARG A 1 246 ? 24.556  17.278  4.469   1.00 84.43  ? 226 ARG A O     1 
ATOM   1889  C  CB    . ARG A 1 246 ? 26.667  15.116  5.307   1.00 83.65  ? 226 ARG A CB    1 
ATOM   1890  C  CG    . ARG A 1 246 ? 27.601  14.986  4.111   1.00 85.03  ? 226 ARG A CG    1 
ATOM   1891  C  CD    . ARG A 1 246 ? 27.835  13.528  3.742   1.00 86.74  ? 226 ARG A CD    1 
ATOM   1892  N  NE    . ARG A 1 246 ? 29.036  13.356  2.924   1.00 88.93  ? 226 ARG A NE    1 
ATOM   1893  C  CZ    . ARG A 1 246 ? 29.139  13.642  1.623   1.00 91.28  ? 226 ARG A CZ    1 
ATOM   1894  N  NH1   . ARG A 1 246 ? 28.114  14.146  0.932   1.00 91.67  ? 226 ARG A NH1   1 
ATOM   1895  N  NH2   . ARG A 1 246 ? 30.300  13.433  1.002   1.00 92.37  ? 226 ARG A NH2   1 
ATOM   1896  N  N     . SER A 1 247 ? 26.575  18.162  3.983   1.00 85.41  ? 227 SER A N     1 
ATOM   1897  C  CA    . SER A 1 247 ? 26.066  19.166  3.056   1.00 86.68  ? 227 SER A CA    1 
ATOM   1898  C  C     . SER A 1 247 ? 27.083  19.457  1.957   1.00 88.92  ? 227 SER A C     1 
ATOM   1899  O  O     . SER A 1 247 ? 28.212  19.859  2.248   1.00 90.69  ? 227 SER A O     1 
ATOM   1900  C  CB    . SER A 1 247 ? 25.752  20.446  3.831   1.00 86.13  ? 227 SER A CB    1 
ATOM   1901  O  OG    . SER A 1 247 ? 25.110  21.396  3.009   1.00 85.56  ? 227 SER A OG    1 
ATOM   1902  N  N     . GLU A 1 248 ? 26.680  19.245  0.703   1.00 91.48  ? 228 GLU A N     1 
ATOM   1903  C  CA    . GLU A 1 248 ? 27.531  19.523  -0.457  1.00 93.27  ? 228 GLU A CA    1 
ATOM   1904  C  C     . GLU A 1 248 ? 27.248  20.924  -0.999  1.00 94.30  ? 228 GLU A C     1 
ATOM   1905  O  O     . GLU A 1 248 ? 26.109  21.239  -1.358  1.00 92.85  ? 228 GLU A O     1 
ATOM   1906  C  CB    . GLU A 1 248 ? 27.319  18.471  -1.546  1.00 94.09  ? 228 GLU A CB    1 
ATOM   1907  C  CG    . GLU A 1 248 ? 27.808  17.089  -1.139  1.00 95.73  ? 228 GLU A CG    1 
ATOM   1908  C  CD    . GLU A 1 248 ? 27.627  16.039  -2.221  1.00 97.84  ? 228 GLU A CD    1 
ATOM   1909  O  OE1   . GLU A 1 248 ? 27.729  16.376  -3.421  1.00 99.80  ? 228 GLU A OE1   1 
ATOM   1910  O  OE2   . GLU A 1 248 ? 27.393  14.865  -1.866  1.00 99.43  ? 228 GLU A OE2   1 
ATOM   1911  N  N     . GLY A 1 249 ? 28.290  21.755  -1.046  1.00 95.86  ? 229 GLY A N     1 
ATOM   1912  C  CA    . GLY A 1 249 ? 28.175  23.150  -1.480  1.00 96.42  ? 229 GLY A CA    1 
ATOM   1913  C  C     . GLY A 1 249 ? 29.487  23.724  -1.984  1.00 96.90  ? 229 GLY A C     1 
ATOM   1914  O  O     . GLY A 1 249 ? 30.415  22.977  -2.306  1.00 96.50  ? 229 GLY A O     1 
ATOM   1915  N  N     . VAL A 1 250 ? 29.557  25.054  -2.038  1.00 97.63  ? 230 VAL A N     1 
ATOM   1916  C  CA    . VAL A 1 250 ? 30.690  25.779  -2.626  1.00 98.39  ? 230 VAL A CA    1 
ATOM   1917  C  C     . VAL A 1 250 ? 31.194  26.860  -1.665  1.00 98.89  ? 230 VAL A C     1 
ATOM   1918  O  O     . VAL A 1 250 ? 30.393  27.601  -1.095  1.00 99.03  ? 230 VAL A O     1 
ATOM   1919  C  CB    . VAL A 1 250 ? 30.284  26.441  -3.967  1.00 98.61  ? 230 VAL A CB    1 
ATOM   1920  C  CG1   . VAL A 1 250 ? 31.445  27.229  -4.572  1.00 98.72  ? 230 VAL A CG1   1 
ATOM   1921  C  CG2   . VAL A 1 250 ? 29.776  25.390  -4.950  1.00 98.83  ? 230 VAL A CG2   1 
ATOM   1922  N  N     . GLU A 1 251 ? 32.517  26.940  -1.494  1.00 100.30 ? 231 GLU A N     1 
ATOM   1923  C  CA    . GLU A 1 251 ? 33.154  28.034  -0.751  1.00 101.08 ? 231 GLU A CA    1 
ATOM   1924  C  C     . GLU A 1 251 ? 33.603  29.127  -1.723  1.00 101.84 ? 231 GLU A C     1 
ATOM   1925  O  O     . GLU A 1 251 ? 34.605  28.959  -2.416  1.00 101.03 ? 231 GLU A O     1 
ATOM   1926  C  CB    . GLU A 1 251 ? 34.358  27.543  0.065   1.00 102.55 ? 231 GLU A CB    1 
ATOM   1927  C  CG    . GLU A 1 251 ? 33.995  26.842  1.369   1.00 104.40 ? 231 GLU A CG    1 
ATOM   1928  C  CD    . GLU A 1 251 ? 35.152  26.762  2.356   1.00 105.90 ? 231 GLU A CD    1 
ATOM   1929  O  OE1   . GLU A 1 251 ? 36.324  26.901  1.942   1.00 107.03 ? 231 GLU A OE1   1 
ATOM   1930  O  OE2   . GLU A 1 251 ? 34.885  26.552  3.559   1.00 106.69 ? 231 GLU A OE2   1 
ATOM   1931  N  N     . ILE A 1 252 ? 32.868  30.240  -1.759  1.00 103.58 ? 232 ILE A N     1 
ATOM   1932  C  CA    . ILE A 1 252 ? 33.123  31.338  -2.703  1.00 105.03 ? 232 ILE A CA    1 
ATOM   1933  C  C     . ILE A 1 252 ? 34.023  32.397  -2.060  1.00 105.60 ? 232 ILE A C     1 
ATOM   1934  O  O     . ILE A 1 252 ? 33.728  32.873  -0.964  1.00 105.11 ? 232 ILE A O     1 
ATOM   1935  C  CB    . ILE A 1 252 ? 31.809  32.016  -3.164  1.00 104.71 ? 232 ILE A CB    1 
ATOM   1936  C  CG1   . ILE A 1 252 ? 30.811  30.976  -3.699  1.00 104.46 ? 232 ILE A CG1   1 
ATOM   1937  C  CG2   . ILE A 1 252 ? 32.095  33.064  -4.238  1.00 104.88 ? 232 ILE A CG2   1 
ATOM   1938  C  CD1   . ILE A 1 252 ? 29.402  31.499  -3.881  1.00 103.89 ? 232 ILE A CD1   1 
ATOM   1939  N  N     . THR A 1 253 ? 35.097  32.773  -2.757  1.00 107.42 ? 233 THR A N     1 
ATOM   1940  C  CA    . THR A 1 253 ? 36.064  33.764  -2.266  1.00 109.50 ? 233 THR A CA    1 
ATOM   1941  C  C     . THR A 1 253 ? 35.783  35.146  -2.863  1.00 111.04 ? 233 THR A C     1 
ATOM   1942  O  O     . THR A 1 253 ? 35.324  35.257  -4.002  1.00 110.06 ? 233 THR A O     1 
ATOM   1943  C  CB    . THR A 1 253 ? 37.512  33.345  -2.602  1.00 110.58 ? 233 THR A CB    1 
ATOM   1944  O  OG1   . THR A 1 253 ? 37.712  31.972  -2.242  1.00 112.55 ? 233 THR A OG1   1 
ATOM   1945  C  CG2   . THR A 1 253 ? 38.529  34.210  -1.854  1.00 110.29 ? 233 THR A CG2   1 
ATOM   1946  N  N     . PHE A 1 254 ? 36.072  36.186  -2.076  1.00 114.29 ? 234 PHE A N     1 
ATOM   1947  C  CA    . PHE A 1 254 ? 35.854  37.587  -2.457  1.00 116.43 ? 234 PHE A CA    1 
ATOM   1948  C  C     . PHE A 1 254 ? 37.145  38.400  -2.343  1.00 119.39 ? 234 PHE A C     1 
ATOM   1949  O  O     . PHE A 1 254 ? 38.152  37.921  -1.815  1.00 121.57 ? 234 PHE A O     1 
ATOM   1950  C  CB    . PHE A 1 254 ? 34.792  38.218  -1.547  1.00 115.42 ? 234 PHE A CB    1 
ATOM   1951  C  CG    . PHE A 1 254 ? 33.392  37.744  -1.816  1.00 113.39 ? 234 PHE A CG    1 
ATOM   1952  C  CD1   . PHE A 1 254 ? 32.977  36.485  -1.394  1.00 112.75 ? 234 PHE A CD1   1 
ATOM   1953  C  CD2   . PHE A 1 254 ? 32.477  38.564  -2.473  1.00 112.06 ? 234 PHE A CD2   1 
ATOM   1954  C  CE1   . PHE A 1 254 ? 31.684  36.047  -1.634  1.00 112.34 ? 234 PHE A CE1   1 
ATOM   1955  C  CE2   . PHE A 1 254 ? 31.181  38.131  -2.714  1.00 112.19 ? 234 PHE A CE2   1 
ATOM   1956  C  CZ    . PHE A 1 254 ? 30.785  36.871  -2.294  1.00 112.45 ? 234 PHE A CZ    1 
ATOM   1957  N  N     . ASN A 1 255 ? 37.095  39.630  -2.853  1.00 121.49 ? 235 ASN A N     1 
ATOM   1958  C  CA    . ASN A 1 255 ? 38.151  40.629  -2.665  1.00 122.57 ? 235 ASN A CA    1 
ATOM   1959  C  C     . ASN A 1 255 ? 37.531  41.921  -2.137  1.00 124.58 ? 235 ASN A C     1 
ATOM   1960  O  O     . ASN A 1 255 ? 36.380  42.237  -2.452  1.00 124.94 ? 235 ASN A O     1 
ATOM   1961  C  CB    . ASN A 1 255 ? 38.888  40.895  -3.982  1.00 122.29 ? 235 ASN A CB    1 
ATOM   1962  C  CG    . ASN A 1 255 ? 39.819  39.761  -4.373  1.00 121.56 ? 235 ASN A CG    1 
ATOM   1963  O  OD1   . ASN A 1 255 ? 40.664  39.335  -3.585  1.00 119.94 ? 235 ASN A OD1   1 
ATOM   1964  N  ND2   . ASN A 1 255 ? 39.678  39.276  -5.602  1.00 122.43 ? 235 ASN A ND2   1 
ATOM   1965  N  N     . VAL A 1 256 ? 38.303  42.658  -1.339  1.00 127.38 ? 236 VAL A N     1 
ATOM   1966  C  CA    . VAL A 1 256 ? 37.848  43.896  -0.692  1.00 128.82 ? 236 VAL A CA    1 
ATOM   1967  C  C     . VAL A 1 256 ? 38.758  45.052  -1.127  1.00 131.54 ? 236 VAL A C     1 
ATOM   1968  O  O     . VAL A 1 256 ? 39.942  44.844  -1.411  1.00 131.16 ? 236 VAL A O     1 
ATOM   1969  C  CB    . VAL A 1 256 ? 37.844  43.742  0.848   1.00 127.64 ? 236 VAL A CB    1 
ATOM   1970  C  CG1   . VAL A 1 256 ? 37.250  44.972  1.528   1.00 126.89 ? 236 VAL A CG1   1 
ATOM   1971  C  CG2   . VAL A 1 256 ? 37.079  42.486  1.259   1.00 126.90 ? 236 VAL A CG2   1 
ATOM   1972  N  N     . ASN A 1 257 ? 38.195  46.262  -1.175  1.00 133.92 ? 237 ASN A N     1 
ATOM   1973  C  CA    . ASN A 1 257 ? 38.892  47.441  -1.716  1.00 135.82 ? 237 ASN A CA    1 
ATOM   1974  C  C     . ASN A 1 257 ? 40.055  47.919  -0.837  1.00 138.52 ? 237 ASN A C     1 
ATOM   1975  O  O     . ASN A 1 257 ? 41.213  47.868  -1.264  1.00 139.29 ? 237 ASN A O     1 
ATOM   1976  C  CB    . ASN A 1 257 ? 37.907  48.598  -1.952  1.00 134.45 ? 237 ASN A CB    1 
ATOM   1977  C  CG    . ASN A 1 257 ? 36.858  48.277  -3.007  1.00 133.49 ? 237 ASN A CG    1 
ATOM   1978  O  OD1   . ASN A 1 257 ? 37.142  47.621  -4.011  1.00 132.76 ? 237 ASN A OD1   1 
ATOM   1979  N  ND2   . ASN A 1 257 ? 35.638  48.753  -2.786  1.00 132.52 ? 237 ASN A ND2   1 
ATOM   1980  N  N     . ASP A 1 258 ? 39.743  48.374  0.378   1.00 139.40 ? 238 ASP A N     1 
ATOM   1981  C  CA    . ASP A 1 258 ? 40.746  48.906  1.315   1.00 139.82 ? 238 ASP A CA    1 
ATOM   1982  C  C     . ASP A 1 258 ? 41.052  47.890  2.421   1.00 140.70 ? 238 ASP A C     1 
ATOM   1983  O  O     . ASP A 1 258 ? 41.002  48.213  3.612   1.00 140.39 ? 238 ASP A O     1 
ATOM   1984  C  CB    . ASP A 1 258 ? 40.258  50.231  1.921   1.00 139.22 ? 238 ASP A CB    1 
ATOM   1985  C  CG    . ASP A 1 258 ? 39.969  51.295  0.872   1.00 139.85 ? 238 ASP A CG    1 
ATOM   1986  O  OD1   . ASP A 1 258 ? 40.441  51.170  -0.279  1.00 139.33 ? 238 ASP A OD1   1 
ATOM   1987  O  OD2   . ASP A 1 258 ? 39.266  52.270  1.210   1.00 140.63 ? 238 ASP A OD2   1 
ATOM   1988  N  N     . TYR A 1 259 ? 41.381  46.664  2.015   1.00 141.80 ? 239 TYR A N     1 
ATOM   1989  C  CA    . TYR A 1 259 ? 41.623  45.560  2.948   1.00 141.74 ? 239 TYR A CA    1 
ATOM   1990  C  C     . TYR A 1 259 ? 42.334  44.416  2.218   1.00 141.51 ? 239 TYR A C     1 
ATOM   1991  O  O     . TYR A 1 259 ? 41.883  43.980  1.155   1.00 142.22 ? 239 TYR A O     1 
ATOM   1992  C  CB    . TYR A 1 259 ? 40.293  45.083  3.548   1.00 142.58 ? 239 TYR A CB    1 
ATOM   1993  C  CG    . TYR A 1 259 ? 40.412  44.114  4.707   1.00 144.02 ? 239 TYR A CG    1 
ATOM   1994  C  CD1   . TYR A 1 259 ? 41.106  44.463  5.867   1.00 144.81 ? 239 TYR A CD1   1 
ATOM   1995  C  CD2   . TYR A 1 259 ? 39.800  42.859  4.661   1.00 144.12 ? 239 TYR A CD2   1 
ATOM   1996  C  CE1   . TYR A 1 259 ? 41.207  43.582  6.937   1.00 144.51 ? 239 TYR A CE1   1 
ATOM   1997  C  CE2   . TYR A 1 259 ? 39.893  41.973  5.725   1.00 143.90 ? 239 TYR A CE2   1 
ATOM   1998  C  CZ    . TYR A 1 259 ? 40.598  42.337  6.860   1.00 143.95 ? 239 TYR A CZ    1 
ATOM   1999  O  OH    . TYR A 1 259 ? 40.693  41.460  7.917   1.00 143.58 ? 239 TYR A OH    1 
ATOM   2000  N  N     . ASP A 1 260 ? 43.442  43.942  2.789   1.00 139.90 ? 240 ASP A N     1 
ATOM   2001  C  CA    . ASP A 1 260 ? 44.311  42.954  2.132   1.00 137.35 ? 240 ASP A CA    1 
ATOM   2002  C  C     . ASP A 1 260 ? 43.759  41.530  2.192   1.00 134.10 ? 240 ASP A C     1 
ATOM   2003  O  O     . ASP A 1 260 ? 43.825  40.798  1.200   1.00 134.29 ? 240 ASP A O     1 
ATOM   2004  C  CB    . ASP A 1 260 ? 45.716  42.977  2.749   1.00 137.87 ? 240 ASP A CB    1 
ATOM   2005  C  CG    . ASP A 1 260 ? 46.421  44.308  2.551   1.00 138.68 ? 240 ASP A CG    1 
ATOM   2006  O  OD1   . ASP A 1 260 ? 46.522  44.766  1.393   1.00 139.12 ? 240 ASP A OD1   1 
ATOM   2007  O  OD2   . ASP A 1 260 ? 46.883  44.892  3.554   1.00 138.48 ? 240 ASP A OD2   1 
ATOM   2008  N  N     . ASN A 1 261 ? 43.224  41.143  3.350   1.00 129.22 ? 241 ASN A N     1 
ATOM   2009  C  CA    . ASN A 1 261 ? 42.761  39.769  3.577   1.00 124.91 ? 241 ASN A CA    1 
ATOM   2010  C  C     . ASN A 1 261 ? 41.433  39.486  2.870   1.00 121.49 ? 241 ASN A C     1 
ATOM   2011  O  O     . ASN A 1 261 ? 40.484  40.261  2.990   1.00 120.28 ? 241 ASN A O     1 
ATOM   2012  C  CB    . ASN A 1 261 ? 42.625  39.480  5.078   1.00 123.82 ? 241 ASN A CB    1 
ATOM   2013  C  CG    . ASN A 1 261 ? 43.948  39.575  5.821   1.00 122.95 ? 241 ASN A CG    1 
ATOM   2014  O  OD1   . ASN A 1 261 ? 44.954  40.037  5.279   1.00 122.17 ? 241 ASN A OD1   1 
ATOM   2015  N  ND2   . ASN A 1 261 ? 43.948  39.140  7.075   1.00 122.01 ? 241 ASN A ND2   1 
ATOM   2016  N  N     . THR A 1 262 ? 41.379  38.370  2.141   1.00 118.25 ? 242 THR A N     1 
ATOM   2017  C  CA    . THR A 1 262 ? 40.181  37.962  1.402   1.00 116.16 ? 242 THR A CA    1 
ATOM   2018  C  C     . THR A 1 262 ? 39.109  37.373  2.320   1.00 115.56 ? 242 THR A C     1 
ATOM   2019  O  O     . THR A 1 262 ? 39.407  36.920  3.428   1.00 114.90 ? 242 THR A O     1 
ATOM   2020  C  CB    . THR A 1 262 ? 40.518  36.916  0.319   1.00 114.67 ? 242 THR A CB    1 
ATOM   2021  O  OG1   . THR A 1 262 ? 41.200  35.804  0.912   1.00 113.53 ? 242 THR A OG1   1 
ATOM   2022  C  CG2   . THR A 1 262 ? 41.396  37.527  -0.759  1.00 114.27 ? 242 THR A CG2   1 
ATOM   2023  N  N     . LEU A 1 263 ? 37.866  37.386  1.834   1.00 114.51 ? 243 LEU A N     1 
ATOM   2024  C  CA    . LEU A 1 263 ? 36.714  36.803  2.532   1.00 112.85 ? 243 LEU A CA    1 
ATOM   2025  C  C     . LEU A 1 263 ? 36.192  35.591  1.767   1.00 110.21 ? 243 LEU A C     1 
ATOM   2026  O  O     . LEU A 1 263 ? 35.771  35.723  0.617   1.00 112.35 ? 243 LEU A O     1 
ATOM   2027  C  CB    . LEU A 1 263 ? 35.588  37.837  2.691   1.00 113.75 ? 243 LEU A CB    1 
ATOM   2028  C  CG    . LEU A 1 263 ? 35.393  38.415  4.094   1.00 114.87 ? 243 LEU A CG    1 
ATOM   2029  C  CD1   . LEU A 1 263 ? 36.634  39.160  4.566   1.00 116.02 ? 243 LEU A CD1   1 
ATOM   2030  C  CD2   . LEU A 1 263 ? 34.171  39.320  4.119   1.00 114.35 ? 243 LEU A CD2   1 
ATOM   2031  N  N     . THR A 1 264 ? 36.226  34.422  2.406   1.00 106.19 ? 244 THR A N     1 
ATOM   2032  C  CA    . THR A 1 264 ? 35.637  33.201  1.856   1.00 103.59 ? 244 THR A CA    1 
ATOM   2033  C  C     . THR A 1 264 ? 34.315  32.919  2.576   1.00 102.53 ? 244 THR A C     1 
ATOM   2034  O  O     . THR A 1 264 ? 34.241  33.037  3.800   1.00 103.79 ? 244 THR A O     1 
ATOM   2035  C  CB    . THR A 1 264 ? 36.594  32.001  2.006   1.00 102.35 ? 244 THR A CB    1 
ATOM   2036  O  OG1   . THR A 1 264 ? 37.886  32.350  1.491   1.00 100.09 ? 244 THR A OG1   1 
ATOM   2037  C  CG2   . THR A 1 264 ? 36.070  30.779  1.251   1.00 102.13 ? 244 THR A CG2   1 
ATOM   2038  N  N     . VAL A 1 265 ? 33.280  32.565  1.810   1.00 100.95 ? 245 VAL A N     1 
ATOM   2039  C  CA    . VAL A 1 265 ? 31.947  32.249  2.352   1.00 99.87  ? 245 VAL A CA    1 
ATOM   2040  C  C     . VAL A 1 265 ? 31.475  30.896  1.827   1.00 99.53  ? 245 VAL A C     1 
ATOM   2041  O  O     . VAL A 1 265 ? 31.812  30.523  0.706   1.00 99.92  ? 245 VAL A O     1 
ATOM   2042  C  CB    . VAL A 1 265 ? 30.896  33.336  2.004   1.00 99.74  ? 245 VAL A CB    1 
ATOM   2043  C  CG1   . VAL A 1 265 ? 31.408  34.716  2.385   1.00 100.70 ? 245 VAL A CG1   1 
ATOM   2044  C  CG2   . VAL A 1 265 ? 30.493  33.306  0.530   1.00 99.49  ? 245 VAL A CG2   1 
ATOM   2045  N  N     . TYR A 1 266 ? 30.693  30.178  2.634   1.00 99.02  ? 246 TYR A N     1 
ATOM   2046  C  CA    . TYR A 1 266 ? 30.107  28.896  2.226   1.00 98.41  ? 246 TYR A CA    1 
ATOM   2047  C  C     . TYR A 1 266 ? 28.630  29.058  1.859   1.00 98.10  ? 246 TYR A C     1 
ATOM   2048  O  O     . TYR A 1 266 ? 27.926  29.897  2.431   1.00 99.11  ? 246 TYR A O     1 
ATOM   2049  C  CB    . TYR A 1 266 ? 30.259  27.849  3.334   1.00 98.19  ? 246 TYR A CB    1 
ATOM   2050  C  CG    . TYR A 1 266 ? 29.772  26.470  2.930   1.00 96.96  ? 246 TYR A CG    1 
ATOM   2051  C  CD1   . TYR A 1 266 ? 30.492  25.694  2.020   1.00 95.80  ? 246 TYR A CD1   1 
ATOM   2052  C  CD2   . TYR A 1 266 ? 28.581  25.947  3.441   1.00 95.99  ? 246 TYR A CD2   1 
ATOM   2053  C  CE1   . TYR A 1 266 ? 30.048  24.436  1.638   1.00 94.76  ? 246 TYR A CE1   1 
ATOM   2054  C  CE2   . TYR A 1 266 ? 28.129  24.689  3.065   1.00 94.84  ? 246 TYR A CE2   1 
ATOM   2055  C  CZ    . TYR A 1 266 ? 28.864  23.940  2.162   1.00 94.05  ? 246 TYR A CZ    1 
ATOM   2056  O  OH    . TYR A 1 266 ? 28.424  22.693  1.790   1.00 93.80  ? 246 TYR A OH    1 
ATOM   2057  N  N     . THR A 1 267 ? 28.177  28.245  0.904   1.00 96.53  ? 247 THR A N     1 
ATOM   2058  C  CA    . THR A 1 267 ? 26.778  28.231  0.474   1.00 94.72  ? 247 THR A CA    1 
ATOM   2059  C  C     . THR A 1 267 ? 26.401  26.894  -0.170  1.00 95.04  ? 247 THR A C     1 
ATOM   2060  O  O     . THR A 1 267 ? 27.223  26.267  -0.843  1.00 95.72  ? 247 THR A O     1 
ATOM   2061  C  CB    . THR A 1 267 ? 26.484  29.374  -0.523  1.00 92.84  ? 247 THR A CB    1 
ATOM   2062  O  OG1   . THR A 1 267 ? 25.078  29.427  -0.797  1.00 90.91  ? 247 THR A OG1   1 
ATOM   2063  C  CG2   . THR A 1 267 ? 27.264  29.189  -1.836  1.00 92.52  ? 247 THR A CG2   1 
ATOM   2064  N  N     . THR A 1 268 ? 25.155  26.475  0.046   1.00 95.02  ? 248 THR A N     1 
ATOM   2065  C  CA    . THR A 1 268 ? 24.573  25.314  -0.633  1.00 94.57  ? 248 THR A CA    1 
ATOM   2066  C  C     . THR A 1 268 ? 23.767  25.719  -1.869  1.00 94.28  ? 248 THR A C     1 
ATOM   2067  O  O     . THR A 1 268 ? 23.321  24.851  -2.623  1.00 94.10  ? 248 THR A O     1 
ATOM   2068  C  CB    . THR A 1 268 ? 23.647  24.527  0.311   1.00 94.47  ? 248 THR A CB    1 
ATOM   2069  O  OG1   . THR A 1 268 ? 22.684  25.414  0.894   1.00 96.04  ? 248 THR A OG1   1 
ATOM   2070  C  CG2   . THR A 1 268 ? 24.450  23.873  1.408   1.00 94.24  ? 248 THR A CG2   1 
ATOM   2071  N  N     . ARG A 1 269 ? 23.591  27.028  -2.074  1.00 94.30  ? 249 ARG A N     1 
ATOM   2072  C  CA    . ARG A 1 269 ? 22.816  27.573  -3.187  1.00 94.20  ? 249 ARG A CA    1 
ATOM   2073  C  C     . ARG A 1 269 ? 23.676  28.519  -4.045  1.00 94.64  ? 249 ARG A C     1 
ATOM   2074  O  O     . ARG A 1 269 ? 23.446  29.734  -4.053  1.00 93.09  ? 249 ARG A O     1 
ATOM   2075  C  CB    . ARG A 1 269 ? 21.592  28.321  -2.640  1.00 93.58  ? 249 ARG A CB    1 
ATOM   2076  C  CG    . ARG A 1 269 ? 20.584  27.451  -1.897  1.00 92.50  ? 249 ARG A CG    1 
ATOM   2077  C  CD    . ARG A 1 269 ? 19.790  26.538  -2.823  1.00 91.58  ? 249 ARG A CD    1 
ATOM   2078  N  NE    . ARG A 1 269 ? 19.157  27.262  -3.930  1.00 91.48  ? 249 ARG A NE    1 
ATOM   2079  C  CZ    . ARG A 1 269 ? 18.081  28.049  -3.830  1.00 91.14  ? 249 ARG A CZ    1 
ATOM   2080  N  NH1   . ARG A 1 269 ? 17.462  28.243  -2.665  1.00 92.10  ? 249 ARG A NH1   1 
ATOM   2081  N  NH2   . ARG A 1 269 ? 17.612  28.652  -4.921  1.00 90.07  ? 249 ARG A NH2   1 
ATOM   2082  N  N     . PRO A 1 270 ? 24.677  27.967  -4.769  1.00 96.19  ? 250 PRO A N     1 
ATOM   2083  C  CA    . PRO A 1 270 ? 25.459  28.787  -5.706  1.00 96.77  ? 250 PRO A CA    1 
ATOM   2084  C  C     . PRO A 1 270 ? 24.661  29.272  -6.926  1.00 97.61  ? 250 PRO A C     1 
ATOM   2085  O  O     . PRO A 1 270 ? 25.071  30.238  -7.569  1.00 97.69  ? 250 PRO A O     1 
ATOM   2086  C  CB    . PRO A 1 270 ? 26.598  27.851  -6.133  1.00 95.96  ? 250 PRO A CB    1 
ATOM   2087  C  CG    . PRO A 1 270 ? 26.062  26.483  -5.931  1.00 95.98  ? 250 PRO A CG    1 
ATOM   2088  C  CD    . PRO A 1 270 ? 25.166  26.575  -4.732  1.00 96.37  ? 250 PRO A CD    1 
ATOM   2089  N  N     . ASP A 1 271 ? 23.554  28.596  -7.245  1.00 99.09  ? 251 ASP A N     1 
ATOM   2090  C  CA    . ASP A 1 271 ? 22.621  29.051  -8.289  1.00 100.91 ? 251 ASP A CA    1 
ATOM   2091  C  C     . ASP A 1 271 ? 22.111  30.485  -8.077  1.00 102.28 ? 251 ASP A C     1 
ATOM   2092  O  O     . ASP A 1 271 ? 21.989  31.244  -9.040  1.00 104.37 ? 251 ASP A O     1 
ATOM   2093  C  CB    . ASP A 1 271 ? 21.437  28.077  -8.447  1.00 101.86 ? 251 ASP A CB    1 
ATOM   2094  C  CG    . ASP A 1 271 ? 20.607  27.927  -7.177  1.00 101.62 ? 251 ASP A CG    1 
ATOM   2095  O  OD1   . ASP A 1 271 ? 21.199  27.822  -6.081  1.00 101.43 ? 251 ASP A OD1   1 
ATOM   2096  O  OD2   . ASP A 1 271 ? 19.362  27.898  -7.279  1.00 101.68 ? 251 ASP A OD2   1 
ATOM   2097  N  N     . ALA A 1 272 ? 21.856  30.859  -6.821  1.00 102.92 ? 252 ALA A N     1 
ATOM   2098  C  CA    . ALA A 1 272 ? 21.370  32.204  -6.474  1.00 103.33 ? 252 ALA A CA    1 
ATOM   2099  C  C     . ALA A 1 272 ? 22.490  33.217  -6.163  1.00 102.48 ? 252 ALA A C     1 
ATOM   2100  O  O     . ALA A 1 272 ? 22.232  34.244  -5.530  1.00 102.83 ? 252 ALA A O     1 
ATOM   2101  C  CB    . ALA A 1 272 ? 20.405  32.111  -5.297  1.00 103.96 ? 252 ALA A CB    1 
ATOM   2102  N  N     . PHE A 1 273 ? 23.714  32.944  -6.621  1.00 101.71 ? 253 PHE A N     1 
ATOM   2103  C  CA    . PHE A 1 273 ? 24.872  33.806  -6.349  1.00 101.37 ? 253 PHE A CA    1 
ATOM   2104  C  C     . PHE A 1 273 ? 24.792  35.155  -7.073  1.00 101.14 ? 253 PHE A C     1 
ATOM   2105  O  O     . PHE A 1 273 ? 25.265  36.168  -6.552  1.00 99.35  ? 253 PHE A O     1 
ATOM   2106  C  CB    . PHE A 1 273 ? 26.171  33.062  -6.712  1.00 101.19 ? 253 PHE A CB    1 
ATOM   2107  C  CG    . PHE A 1 273 ? 27.433  33.853  -6.471  1.00 100.85 ? 253 PHE A CG    1 
ATOM   2108  C  CD1   . PHE A 1 273 ? 27.642  34.531  -5.270  1.00 99.81  ? 253 PHE A CD1   1 
ATOM   2109  C  CD2   . PHE A 1 273 ? 28.432  33.895  -7.440  1.00 100.99 ? 253 PHE A CD2   1 
ATOM   2110  C  CE1   . PHE A 1 273 ? 28.806  35.249  -5.055  1.00 98.57  ? 253 PHE A CE1   1 
ATOM   2111  C  CE2   . PHE A 1 273 ? 29.601  34.610  -7.227  1.00 100.15 ? 253 PHE A CE2   1 
ATOM   2112  C  CZ    . PHE A 1 273 ? 29.786  35.289  -6.033  1.00 99.44  ? 253 PHE A CZ    1 
ATOM   2113  N  N     . MET A 1 274 ? 24.182  35.168  -8.259  1.00 102.67 ? 254 MET A N     1 
ATOM   2114  C  CA    . MET A 1 274 ? 23.990  36.407  -9.028  1.00 103.75 ? 254 MET A CA    1 
ATOM   2115  C  C     . MET A 1 274 ? 22.940  37.357  -8.427  1.00 104.09 ? 254 MET A C     1 
ATOM   2116  O  O     . MET A 1 274 ? 22.891  38.531  -8.804  1.00 104.18 ? 254 MET A O     1 
ATOM   2117  C  CB    . MET A 1 274 ? 23.641  36.085  -10.488 1.00 103.38 ? 254 MET A CB    1 
ATOM   2118  C  CG    . MET A 1 274 ? 24.750  35.368  -11.251 1.00 103.24 ? 254 MET A CG    1 
ATOM   2119  S  SD    . MET A 1 274 ? 26.216  36.375  -11.552 1.00 102.12 ? 254 MET A SD    1 
ATOM   2120  C  CE    . MET A 1 274 ? 25.599  37.557  -12.749 1.00 102.71 ? 254 MET A CE    1 
ATOM   2121  N  N     . GLY A 1 275 ? 22.107  36.852  -7.510  1.00 103.32 ? 255 GLY A N     1 
ATOM   2122  C  CA    . GLY A 1 275 ? 21.196  37.684  -6.713  1.00 101.64 ? 255 GLY A CA    1 
ATOM   2123  C  C     . GLY A 1 275 ? 21.705  38.025  -5.317  1.00 100.78 ? 255 GLY A C     1 
ATOM   2124  O  O     . GLY A 1 275 ? 20.904  38.319  -4.425  1.00 99.63  ? 255 GLY A O     1 
ATOM   2125  N  N     . CYS A 1 276 ? 23.027  37.991  -5.125  1.00 100.94 ? 256 CYS A N     1 
ATOM   2126  C  CA    . CYS A 1 276 ? 23.656  38.326  -3.845  1.00 100.64 ? 256 CYS A CA    1 
ATOM   2127  C  C     . CYS A 1 276 ? 23.880  39.838  -3.759  1.00 99.77  ? 256 CYS A C     1 
ATOM   2128  O  O     . CYS A 1 276 ? 24.815  40.368  -4.365  1.00 99.09  ? 256 CYS A O     1 
ATOM   2129  C  CB    . CYS A 1 276 ? 24.989  37.582  -3.695  1.00 100.76 ? 256 CYS A CB    1 
ATOM   2130  S  SG    . CYS A 1 276 ? 25.895  37.956  -2.177  1.00 101.07 ? 256 CYS A SG    1 
ATOM   2131  N  N     . THR A 1 277 ? 23.016  40.519  -3.006  1.00 99.30  ? 257 THR A N     1 
ATOM   2132  C  CA    . THR A 1 277 ? 23.064  41.981  -2.865  1.00 98.90  ? 257 THR A CA    1 
ATOM   2133  C  C     . THR A 1 277 ? 23.997  42.465  -1.745  1.00 99.00  ? 257 THR A C     1 
ATOM   2134  O  O     . THR A 1 277 ? 24.508  43.583  -1.820  1.00 98.58  ? 257 THR A O     1 
ATOM   2135  C  CB    . THR A 1 277 ? 21.654  42.567  -2.641  1.00 98.11  ? 257 THR A CB    1 
ATOM   2136  O  OG1   . THR A 1 277 ? 21.014  41.892  -1.553  1.00 97.78  ? 257 THR A OG1   1 
ATOM   2137  C  CG2   . THR A 1 277 ? 20.807  42.409  -3.896  1.00 97.48  ? 257 THR A CG2   1 
ATOM   2138  N  N     . TYR A 1 278 ? 24.204  41.640  -0.715  1.00 98.78  ? 258 TYR A N     1 
ATOM   2139  C  CA    . TYR A 1 278 ? 25.131  41.965  0.381   1.00 98.61  ? 258 TYR A CA    1 
ATOM   2140  C  C     . TYR A 1 278 ? 25.709  40.716  1.051   1.00 99.52  ? 258 TYR A C     1 
ATOM   2141  O  O     . TYR A 1 278 ? 25.260  39.599  0.791   1.00 101.06 ? 258 TYR A O     1 
ATOM   2142  C  CB    . TYR A 1 278 ? 24.435  42.848  1.426   1.00 97.78  ? 258 TYR A CB    1 
ATOM   2143  C  CG    . TYR A 1 278 ? 23.302  42.178  2.178   1.00 96.64  ? 258 TYR A CG    1 
ATOM   2144  C  CD1   . TYR A 1 278 ? 22.014  42.143  1.647   1.00 96.16  ? 258 TYR A CD1   1 
ATOM   2145  C  CD2   . TYR A 1 278 ? 23.514  41.593  3.430   1.00 95.62  ? 258 TYR A CD2   1 
ATOM   2146  C  CE1   . TYR A 1 278 ? 20.969  41.537  2.332   1.00 95.76  ? 258 TYR A CE1   1 
ATOM   2147  C  CE2   . TYR A 1 278 ? 22.476  40.984  4.124   1.00 95.46  ? 258 TYR A CE2   1 
ATOM   2148  C  CZ    . TYR A 1 278 ? 21.205  40.958  3.571   1.00 95.49  ? 258 TYR A CZ    1 
ATOM   2149  O  OH    . TYR A 1 278 ? 20.170  40.358  4.249   1.00 95.51  ? 258 TYR A OH    1 
ATOM   2150  N  N     . LEU A 1 279 ? 26.706  40.928  1.910   1.00 102.09 ? 259 LEU A N     1 
ATOM   2151  C  CA    . LEU A 1 279 ? 27.333  39.861  2.695   1.00 105.48 ? 259 LEU A CA    1 
ATOM   2152  C  C     . LEU A 1 279 ? 27.154  40.136  4.187   1.00 107.28 ? 259 LEU A C     1 
ATOM   2153  O  O     . LEU A 1 279 ? 27.359  41.266  4.636   1.00 108.72 ? 259 LEU A O     1 
ATOM   2154  C  CB    . LEU A 1 279 ? 28.830  39.769  2.381   1.00 106.71 ? 259 LEU A CB    1 
ATOM   2155  C  CG    . LEU A 1 279 ? 29.257  39.658  0.915   1.00 107.36 ? 259 LEU A CG    1 
ATOM   2156  C  CD1   . LEU A 1 279 ? 30.775  39.602  0.821   1.00 107.57 ? 259 LEU A CD1   1 
ATOM   2157  C  CD2   . LEU A 1 279 ? 28.637  38.445  0.239   1.00 107.22 ? 259 LEU A CD2   1 
ATOM   2158  N  N     . ALA A 1 280 ? 26.776  39.103  4.943   1.00 108.62 ? 260 ALA A N     1 
ATOM   2159  C  CA    . ALA A 1 280 ? 26.694  39.174  6.405   1.00 109.00 ? 260 ALA A CA    1 
ATOM   2160  C  C     . ALA A 1 280 ? 27.912  38.486  7.026   1.00 109.43 ? 260 ALA A C     1 
ATOM   2161  O  O     . ALA A 1 280 ? 28.362  37.447  6.537   1.00 108.53 ? 260 ALA A O     1 
ATOM   2162  C  CB    . ALA A 1 280 ? 25.407  38.533  6.897   1.00 109.64 ? 260 ALA A CB    1 
ATOM   2163  N  N     . VAL A 1 281 ? 28.426  39.074  8.107   1.00 110.56 ? 261 VAL A N     1 
ATOM   2164  C  CA    . VAL A 1 281 ? 29.664  38.636  8.761   1.00 112.17 ? 261 VAL A CA    1 
ATOM   2165  C  C     . VAL A 1 281 ? 29.404  38.419  10.256  1.00 114.15 ? 261 VAL A C     1 
ATOM   2166  O  O     . VAL A 1 281 ? 28.623  39.152  10.869  1.00 114.40 ? 261 VAL A O     1 
ATOM   2167  C  CB    . VAL A 1 281 ? 30.793  39.674  8.512   1.00 112.10 ? 261 VAL A CB    1 
ATOM   2168  C  CG1   . VAL A 1 281 ? 31.975  39.502  9.462   1.00 112.34 ? 261 VAL A CG1   1 
ATOM   2169  C  CG2   . VAL A 1 281 ? 31.262  39.589  7.067   1.00 112.89 ? 261 VAL A CG2   1 
ATOM   2170  N  N     . ALA A 1 282 ? 30.062  37.409  10.828  1.00 115.98 ? 262 ALA A N     1 
ATOM   2171  C  CA    . ALA A 1 282 ? 29.948  37.096  12.257  1.00 116.83 ? 262 ALA A CA    1 
ATOM   2172  C  C     . ALA A 1 282 ? 30.636  38.153  13.121  1.00 119.18 ? 262 ALA A C     1 
ATOM   2173  O  O     . ALA A 1 282 ? 31.466  38.924  12.635  1.00 120.25 ? 262 ALA A O     1 
ATOM   2174  C  CB    . ALA A 1 282 ? 30.531  35.721  12.546  1.00 116.70 ? 262 ALA A CB    1 
ATOM   2175  N  N     . ALA A 1 283 ? 30.292  38.169  14.407  1.00 121.52 ? 263 ALA A N     1 
ATOM   2176  C  CA    . ALA A 1 283 ? 30.793  39.180  15.349  1.00 123.51 ? 263 ALA A CA    1 
ATOM   2177  C  C     . ALA A 1 283 ? 32.313  39.139  15.538  1.00 125.45 ? 263 ALA A C     1 
ATOM   2178  O  O     . ALA A 1 283 ? 32.961  40.188  15.563  1.00 126.92 ? 263 ALA A O     1 
ATOM   2179  C  CB    . ALA A 1 283 ? 30.095  39.038  16.694  1.00 124.16 ? 263 ALA A CB    1 
ATOM   2180  N  N     . GLY A 1 284 ? 32.868  37.931  15.657  1.00 125.98 ? 264 GLY A N     1 
ATOM   2181  C  CA    . GLY A 1 284 ? 34.308  37.731  15.863  1.00 126.15 ? 264 GLY A CA    1 
ATOM   2182  C  C     . GLY A 1 284 ? 35.062  37.392  14.590  1.00 126.92 ? 264 GLY A C     1 
ATOM   2183  O  O     . GLY A 1 284 ? 35.778  36.391  14.538  1.00 126.69 ? 264 GLY A O     1 
ATOM   2184  N  N     . HIS A 1 285 ? 34.905  38.238  13.572  1.00 128.92 ? 265 HIS A N     1 
ATOM   2185  C  CA    . HIS A 1 285 ? 35.564  38.073  12.275  1.00 131.67 ? 265 HIS A CA    1 
ATOM   2186  C  C     . HIS A 1 285 ? 36.668  39.137  12.169  1.00 134.36 ? 265 HIS A C     1 
ATOM   2187  O  O     . HIS A 1 285 ? 36.458  40.273  12.604  1.00 133.53 ? 265 HIS A O     1 
ATOM   2188  C  CB    . HIS A 1 285 ? 34.530  38.247  11.155  1.00 132.03 ? 265 HIS A CB    1 
ATOM   2189  C  CG    . HIS A 1 285 ? 34.852  37.495  9.900   1.00 132.76 ? 265 HIS A CG    1 
ATOM   2190  N  ND1   . HIS A 1 285 ? 35.392  38.101  8.785   1.00 133.94 ? 265 HIS A ND1   1 
ATOM   2191  C  CD2   . HIS A 1 285 ? 34.700  36.188  9.580   1.00 132.65 ? 265 HIS A CD2   1 
ATOM   2192  C  CE1   . HIS A 1 285 ? 35.563  37.199  7.835   1.00 133.26 ? 265 HIS A CE1   1 
ATOM   2193  N  NE2   . HIS A 1 285 ? 35.152  36.030  8.292   1.00 133.03 ? 265 HIS A NE2   1 
ATOM   2194  N  N     . PRO A 1 286 ? 37.845  38.782  11.601  1.00 139.05 ? 266 PRO A N     1 
ATOM   2195  C  CA    . PRO A 1 286 ? 38.967  39.740  11.536  1.00 141.47 ? 266 PRO A CA    1 
ATOM   2196  C  C     . PRO A 1 286 ? 38.747  40.991  10.662  1.00 144.14 ? 266 PRO A C     1 
ATOM   2197  O  O     . PRO A 1 286 ? 39.453  41.987  10.851  1.00 143.42 ? 266 PRO A O     1 
ATOM   2198  C  CB    . PRO A 1 286 ? 40.126  38.894  10.987  1.00 140.87 ? 266 PRO A CB    1 
ATOM   2199  C  CG    . PRO A 1 286 ? 39.476  37.766  10.271  1.00 140.36 ? 266 PRO A CG    1 
ATOM   2200  C  CD    . PRO A 1 286 ? 38.228  37.468  11.046  1.00 139.83 ? 266 PRO A CD    1 
ATOM   2201  N  N     . LEU A 1 287 ? 37.803  40.937  9.720   1.00 146.75 ? 267 LEU A N     1 
ATOM   2202  C  CA    . LEU A 1 287 ? 37.421  42.112  8.923   1.00 148.04 ? 267 LEU A CA    1 
ATOM   2203  C  C     . LEU A 1 287 ? 36.717  43.179  9.770   1.00 150.60 ? 267 LEU A C     1 
ATOM   2204  O  O     . LEU A 1 287 ? 36.933  44.375  9.562   1.00 152.01 ? 267 LEU A O     1 
ATOM   2205  C  CB    . LEU A 1 287 ? 36.534  41.701  7.737   1.00 146.56 ? 267 LEU A CB    1 
ATOM   2206  C  CG    . LEU A 1 287 ? 36.058  42.823  6.793   1.00 146.08 ? 267 LEU A CG    1 
ATOM   2207  C  CD1   . LEU A 1 287 ? 36.166  42.427  5.327   1.00 146.65 ? 267 LEU A CD1   1 
ATOM   2208  C  CD2   . LEU A 1 287 ? 34.634  43.270  7.106   1.00 145.68 ? 267 LEU A CD2   1 
ATOM   2209  N  N     . ALA A 1 288 ? 35.875  42.741  10.707  1.00 151.74 ? 268 ALA A N     1 
ATOM   2210  C  CA    . ALA A 1 288 ? 35.146  43.649  11.604  1.00 153.76 ? 268 ALA A CA    1 
ATOM   2211  C  C     . ALA A 1 288 ? 36.053  44.447  12.553  1.00 157.26 ? 268 ALA A C     1 
ATOM   2212  O  O     . ALA A 1 288 ? 35.708  45.567  12.941  1.00 156.87 ? 268 ALA A O     1 
ATOM   2213  C  CB    . ALA A 1 288 ? 34.109  42.874  12.405  1.00 153.27 ? 268 ALA A CB    1 
ATOM   2214  N  N     . GLN A 1 289 ? 37.199  43.871  12.921  1.00 162.10 ? 269 GLN A N     1 
ATOM   2215  C  CA    . GLN A 1 289 ? 38.169  44.535  13.805  1.00 165.16 ? 269 GLN A CA    1 
ATOM   2216  C  C     . GLN A 1 289 ? 38.868  45.712  13.117  1.00 166.69 ? 269 GLN A C     1 
ATOM   2217  O  O     . GLN A 1 289 ? 39.116  46.741  13.748  1.00 166.49 ? 269 GLN A O     1 
ATOM   2218  C  CB    . GLN A 1 289 ? 39.222  43.536  14.310  1.00 166.84 ? 269 GLN A CB    1 
ATOM   2219  C  CG    . GLN A 1 289 ? 38.674  42.387  15.153  1.00 168.05 ? 269 GLN A CG    1 
ATOM   2220  C  CD    . GLN A 1 289 ? 38.058  42.839  16.466  1.00 169.11 ? 269 GLN A CD    1 
ATOM   2221  O  OE1   . GLN A 1 289 ? 36.913  42.508  16.772  1.00 170.14 ? 269 GLN A OE1   1 
ATOM   2222  N  NE2   . GLN A 1 289 ? 38.816  43.600  17.249  1.00 169.66 ? 269 GLN A NE2   1 
ATOM   2223  N  N     . LYS A 1 290 ? 39.190  45.544  11.834  1.00 169.37 ? 270 LYS A N     1 
ATOM   2224  C  CA    . LYS A 1 290 ? 39.785  46.607  11.013  1.00 172.52 ? 270 LYS A CA    1 
ATOM   2225  C  C     . LYS A 1 290 ? 38.848  47.814  10.880  1.00 176.47 ? 270 LYS A C     1 
ATOM   2226  O  O     . LYS A 1 290 ? 39.283  48.959  11.025  1.00 179.58 ? 270 LYS A O     1 
ATOM   2227  C  CB    . LYS A 1 290 ? 40.145  46.056  9.623   1.00 172.20 ? 270 LYS A CB    1 
ATOM   2228  C  CG    . LYS A 1 290 ? 40.786  47.044  8.653   1.00 172.03 ? 270 LYS A CG    1 
ATOM   2229  C  CD    . LYS A 1 290 ? 42.161  47.502  9.107   1.00 171.59 ? 270 LYS A CD    1 
ATOM   2230  C  CE    . LYS A 1 290 ? 42.810  48.386  8.054   1.00 171.69 ? 270 LYS A CE    1 
ATOM   2231  N  NZ    . LYS A 1 290 ? 44.208  48.754  8.406   1.00 172.41 ? 270 LYS A NZ    1 
ATOM   2232  N  N     . ALA A 1 291 ? 37.573  47.544  10.602  1.00 177.44 ? 271 ALA A N     1 
ATOM   2233  C  CA    . ALA A 1 291 ? 36.559  48.594  10.426  1.00 176.23 ? 271 ALA A CA    1 
ATOM   2234  C  C     . ALA A 1 291 ? 36.185  49.317  11.725  1.00 174.68 ? 271 ALA A C     1 
ATOM   2235  O  O     . ALA A 1 291 ? 35.822  50.494  11.695  1.00 175.53 ? 271 ALA A O     1 
ATOM   2236  C  CB    . ALA A 1 291 ? 35.308  48.012  9.782   1.00 176.74 ? 271 ALA A CB    1 
ATOM   2237  N  N     . ALA A 1 292 ? 36.273  48.613  12.855  1.00 171.99 ? 272 ALA A N     1 
ATOM   2238  C  CA    . ALA A 1 292 ? 35.893  49.169  14.161  1.00 171.34 ? 272 ALA A CA    1 
ATOM   2239  C  C     . ALA A 1 292 ? 36.877  50.192  14.748  1.00 171.59 ? 272 ALA A C     1 
ATOM   2240  O  O     . ALA A 1 292 ? 36.545  50.859  15.730  1.00 170.40 ? 272 ALA A O     1 
ATOM   2241  C  CB    . ALA A 1 292 ? 35.668  48.041  15.156  1.00 170.22 ? 272 ALA A CB    1 
ATOM   2242  N  N     . GLU A 1 293 ? 38.075  50.311  14.170  1.00 172.26 ? 273 GLU A N     1 
ATOM   2243  C  CA    . GLU A 1 293 ? 39.063  51.303  14.616  1.00 173.20 ? 273 GLU A CA    1 
ATOM   2244  C  C     . GLU A 1 293 ? 38.573  52.733  14.378  1.00 172.60 ? 273 GLU A C     1 
ATOM   2245  O  O     . GLU A 1 293 ? 38.554  53.548  15.303  1.00 173.67 ? 273 GLU A O     1 
ATOM   2246  C  CB    . GLU A 1 293 ? 40.410  51.087  13.914  1.00 175.49 ? 273 GLU A CB    1 
ATOM   2247  C  CG    . GLU A 1 293 ? 41.122  49.799  14.311  1.00 176.60 ? 273 GLU A CG    1 
ATOM   2248  C  CD    . GLU A 1 293 ? 42.332  49.487  13.444  1.00 177.43 ? 273 GLU A CD    1 
ATOM   2249  O  OE1   . GLU A 1 293 ? 42.888  50.413  12.813  1.00 178.67 ? 273 GLU A OE1   1 
ATOM   2250  O  OE2   . GLU A 1 293 ? 42.734  48.305  13.398  1.00 176.81 ? 273 GLU A OE2   1 
ATOM   2251  N  N     . ASN A 1 294 ? 38.171  53.019  13.141  1.00 171.92 ? 274 ASN A N     1 
ATOM   2252  C  CA    . ASN A 1 294 ? 37.655  54.341  12.760  1.00 171.81 ? 274 ASN A CA    1 
ATOM   2253  C  C     . ASN A 1 294 ? 36.182  54.518  13.137  1.00 170.80 ? 274 ASN A C     1 
ATOM   2254  O  O     . ASN A 1 294 ? 35.801  55.551  13.691  1.00 171.59 ? 274 ASN A O     1 
ATOM   2255  C  CB    . ASN A 1 294 ? 37.833  54.578  11.255  1.00 171.94 ? 274 ASN A CB    1 
ATOM   2256  C  CG    . ASN A 1 294 ? 39.292  54.609  10.834  1.00 172.44 ? 274 ASN A CG    1 
ATOM   2257  O  OD1   . ASN A 1 294 ? 39.718  53.831  9.980   1.00 172.22 ? 274 ASN A OD1   1 
ATOM   2258  N  ND2   . ASN A 1 294 ? 40.065  55.508  11.433  1.00 173.47 ? 274 ASN A ND2   1 
ATOM   2259  N  N     . ASN A 1 295 ? 35.365  53.509  12.832  1.00 168.87 ? 275 ASN A N     1 
ATOM   2260  C  CA    . ASN A 1 295 ? 33.917  53.564  13.066  1.00 168.37 ? 275 ASN A CA    1 
ATOM   2261  C  C     . ASN A 1 295 ? 33.604  53.393  14.564  1.00 168.93 ? 275 ASN A C     1 
ATOM   2262  O  O     . ASN A 1 295 ? 33.962  52.366  15.147  1.00 167.62 ? 275 ASN A O     1 
ATOM   2263  C  CB    . ASN A 1 295 ? 33.211  52.475  12.242  1.00 167.49 ? 275 ASN A CB    1 
ATOM   2264  C  CG    . ASN A 1 295 ? 31.719  52.727  12.071  1.00 166.12 ? 275 ASN A CG    1 
ATOM   2265  O  OD1   . ASN A 1 295 ? 31.031  53.160  12.997  1.00 164.48 ? 275 ASN A OD1   1 
ATOM   2266  N  ND2   . ASN A 1 295 ? 31.209  52.440  10.878  1.00 164.52 ? 275 ASN A ND2   1 
ATOM   2267  N  N     . PRO A 1 296 ? 32.939  54.392  15.189  1.00 170.87 ? 276 PRO A N     1 
ATOM   2268  C  CA    . PRO A 1 296 ? 32.615  54.301  16.622  1.00 171.10 ? 276 PRO A CA    1 
ATOM   2269  C  C     . PRO A 1 296 ? 31.395  53.428  16.962  1.00 171.51 ? 276 PRO A C     1 
ATOM   2270  O  O     . PRO A 1 296 ? 31.408  52.752  17.993  1.00 168.10 ? 276 PRO A O     1 
ATOM   2271  C  CB    . PRO A 1 296 ? 32.363  55.760  17.014  1.00 170.74 ? 276 PRO A CB    1 
ATOM   2272  C  CG    . PRO A 1 296 ? 31.858  56.398  15.771  1.00 170.80 ? 276 PRO A CG    1 
ATOM   2273  C  CD    . PRO A 1 296 ? 32.519  55.690  14.621  1.00 171.04 ? 276 PRO A CD    1 
ATOM   2274  N  N     . GLU A 1 297 ? 30.359  53.450  16.119  1.00 173.31 ? 277 GLU A N     1 
ATOM   2275  C  CA    . GLU A 1 297 ? 29.146  52.644  16.345  1.00 172.89 ? 277 GLU A CA    1 
ATOM   2276  C  C     . GLU A 1 297 ? 29.391  51.148  16.119  1.00 175.03 ? 277 GLU A C     1 
ATOM   2277  O  O     . GLU A 1 297 ? 28.828  50.313  16.831  1.00 173.47 ? 277 GLU A O     1 
ATOM   2278  C  CB    . GLU A 1 297 ? 27.993  53.124  15.451  1.00 170.37 ? 277 GLU A CB    1 
ATOM   2279  C  CG    . GLU A 1 297 ? 26.620  52.612  15.876  1.00 167.47 ? 277 GLU A CG    1 
ATOM   2280  C  CD    . GLU A 1 297 ? 25.521  52.931  14.875  1.00 165.76 ? 277 GLU A CD    1 
ATOM   2281  O  OE1   . GLU A 1 297 ? 25.601  53.979  14.198  1.00 165.27 ? 277 GLU A OE1   1 
ATOM   2282  O  OE2   . GLU A 1 297 ? 24.567  52.132  14.773  1.00 162.69 ? 277 GLU A OE2   1 
ATOM   2283  N  N     . LEU A 1 298 ? 30.213  50.819  15.121  1.00 177.14 ? 278 LEU A N     1 
ATOM   2284  C  CA    . LEU A 1 298 ? 30.594  49.429  14.842  1.00 178.98 ? 278 LEU A CA    1 
ATOM   2285  C  C     . LEU A 1 298 ? 31.435  48.826  15.971  1.00 181.29 ? 278 LEU A C     1 
ATOM   2286  O  O     . LEU A 1 298 ? 31.326  47.631  16.253  1.00 179.96 ? 278 LEU A O     1 
ATOM   2287  C  CB    . LEU A 1 298 ? 31.362  49.337  13.519  1.00 179.79 ? 278 LEU A CB    1 
ATOM   2288  C  CG    . LEU A 1 298 ? 31.678  47.941  12.970  1.00 180.57 ? 278 LEU A CG    1 
ATOM   2289  C  CD1   . LEU A 1 298 ? 30.410  47.192  12.587  1.00 181.01 ? 278 LEU A CD1   1 
ATOM   2290  C  CD2   . LEU A 1 298 ? 32.610  48.062  11.777  1.00 180.71 ? 278 LEU A CD2   1 
ATOM   2291  N  N     . ALA A 1 299 ? 32.275  49.652  16.597  1.00 184.95 ? 279 ALA A N     1 
ATOM   2292  C  CA    . ALA A 1 299 ? 33.039  49.251  17.785  1.00 186.28 ? 279 ALA A CA    1 
ATOM   2293  C  C     . ALA A 1 299 ? 32.124  48.910  18.962  1.00 187.46 ? 279 ALA A C     1 
ATOM   2294  O  O     . ALA A 1 299 ? 32.379  47.946  19.687  1.00 189.07 ? 279 ALA A O     1 
ATOM   2295  C  CB    . ALA A 1 299 ? 34.017  50.346  18.185  1.00 185.77 ? 279 ALA A CB    1 
ATOM   2296  N  N     . ALA A 1 300 ? 31.069  49.705  19.145  1.00 187.04 ? 280 ALA A N     1 
ATOM   2297  C  CA    . ALA A 1 300 ? 30.062  49.454  20.183  1.00 185.47 ? 280 ALA A CA    1 
ATOM   2298  C  C     . ALA A 1 300 ? 29.279  48.158  19.949  1.00 183.24 ? 280 ALA A C     1 
ATOM   2299  O  O     . ALA A 1 300 ? 28.887  47.492  20.909  1.00 179.18 ? 280 ALA A O     1 
ATOM   2300  C  CB    . ALA A 1 300 ? 29.104  50.634  20.290  1.00 185.72 ? 280 ALA A CB    1 
ATOM   2301  N  N     . PHE A 1 301 ? 29.054  47.811  18.681  1.00 183.24 ? 281 PHE A N     1 
ATOM   2302  C  CA    . PHE A 1 301 ? 28.366  46.568  18.313  1.00 184.44 ? 281 PHE A CA    1 
ATOM   2303  C  C     . PHE A 1 301 ? 29.195  45.310  18.608  1.00 185.02 ? 281 PHE A C     1 
ATOM   2304  O  O     . PHE A 1 301 ? 28.642  44.302  19.049  1.00 183.69 ? 281 PHE A O     1 
ATOM   2305  C  CB    . PHE A 1 301 ? 27.966  46.594  16.834  1.00 184.79 ? 281 PHE A CB    1 
ATOM   2306  C  CG    . PHE A 1 301 ? 27.090  45.442  16.421  1.00 184.86 ? 281 PHE A CG    1 
ATOM   2307  C  CD1   . PHE A 1 301 ? 25.740  45.422  16.762  1.00 184.05 ? 281 PHE A CD1   1 
ATOM   2308  C  CD2   . PHE A 1 301 ? 27.612  44.374  15.696  1.00 184.25 ? 281 PHE A CD2   1 
ATOM   2309  C  CE1   . PHE A 1 301 ? 24.927  44.361  16.386  1.00 182.88 ? 281 PHE A CE1   1 
ATOM   2310  C  CE2   . PHE A 1 301 ? 26.804  43.310  15.317  1.00 183.51 ? 281 PHE A CE2   1 
ATOM   2311  C  CZ    . PHE A 1 301 ? 25.460  43.303  15.662  1.00 182.92 ? 281 PHE A CZ    1 
ATOM   2312  N  N     . ILE A 1 302 ? 30.506  45.372  18.364  1.00 185.27 ? 282 ILE A N     1 
ATOM   2313  C  CA    . ILE A 1 302 ? 31.412  44.238  18.624  1.00 183.68 ? 282 ILE A CA    1 
ATOM   2314  C  C     . ILE A 1 302 ? 31.570  43.989  20.130  1.00 185.49 ? 282 ILE A C     1 
ATOM   2315  O  O     . ILE A 1 302 ? 31.587  42.837  20.568  1.00 183.43 ? 282 ILE A O     1 
ATOM   2316  C  CB    . ILE A 1 302 ? 32.798  44.438  17.955  1.00 181.29 ? 282 ILE A CB    1 
ATOM   2317  C  CG1   . ILE A 1 302 ? 32.652  44.453  16.427  1.00 180.82 ? 282 ILE A CG1   1 
ATOM   2318  C  CG2   . ILE A 1 302 ? 33.778  43.336  18.363  1.00 180.17 ? 282 ILE A CG2   1 
ATOM   2319  C  CD1   . ILE A 1 302 ? 33.846  45.026  15.695  1.00 181.06 ? 282 ILE A CD1   1 
ATOM   2320  N  N     . ASP A 1 303 ? 31.688  45.066  20.909  1.00 188.36 ? 283 ASP A N     1 
ATOM   2321  C  CA    . ASP A 1 303 ? 31.735  44.971  22.378  1.00 188.51 ? 283 ASP A CA    1 
ATOM   2322  C  C     . ASP A 1 303 ? 30.389  44.556  22.996  1.00 187.71 ? 283 ASP A C     1 
ATOM   2323  O  O     . ASP A 1 303 ? 30.366  43.990  24.091  1.00 187.94 ? 283 ASP A O     1 
ATOM   2324  C  CB    . ASP A 1 303 ? 32.221  46.290  22.997  1.00 189.48 ? 283 ASP A CB    1 
ATOM   2325  C  CG    . ASP A 1 303 ? 33.688  46.575  22.699  1.00 189.44 ? 283 ASP A CG    1 
ATOM   2326  O  OD1   . ASP A 1 303 ? 34.538  45.699  22.964  1.00 187.53 ? 283 ASP A OD1   1 
ATOM   2327  O  OD2   . ASP A 1 303 ? 33.996  47.683  22.209  1.00 190.16 ? 283 ASP A OD2   1 
ATOM   2328  N  N     . GLU A 1 304 ? 29.282  44.846  22.307  1.00 185.76 ? 284 GLU A N     1 
ATOM   2329  C  CA    . GLU A 1 304 ? 27.959  44.325  22.687  1.00 183.32 ? 284 GLU A CA    1 
ATOM   2330  C  C     . GLU A 1 304 ? 27.867  42.807  22.474  1.00 181.86 ? 284 GLU A C     1 
ATOM   2331  O  O     . GLU A 1 304 ? 27.198  42.113  23.243  1.00 178.21 ? 284 GLU A O     1 
ATOM   2332  C  CB    . GLU A 1 304 ? 26.847  45.035  21.902  1.00 182.67 ? 284 GLU A CB    1 
ATOM   2333  C  CG    . GLU A 1 304 ? 25.437  44.788  22.426  1.00 181.94 ? 284 GLU A CG    1 
ATOM   2334  C  CD    . GLU A 1 304 ? 24.353  45.389  21.545  1.00 181.31 ? 284 GLU A CD    1 
ATOM   2335  O  OE1   . GLU A 1 304 ? 24.663  46.242  20.683  1.00 180.99 ? 284 GLU A OE1   1 
ATOM   2336  O  OE2   . GLU A 1 304 ? 23.177  45.006  21.717  1.00 180.18 ? 284 GLU A OE2   1 
ATOM   2337  N  N     . CYS A 1 305 ? 28.536  42.304  21.433  1.00 182.44 ? 285 CYS A N     1 
ATOM   2338  C  CA    . CYS A 1 305 ? 28.591  40.860  21.147  1.00 182.84 ? 285 CYS A CA    1 
ATOM   2339  C  C     . CYS A 1 305 ? 29.421  40.024  22.142  1.00 180.97 ? 285 CYS A C     1 
ATOM   2340  O  O     . CYS A 1 305 ? 29.398  38.793  22.067  1.00 179.57 ? 285 CYS A O     1 
ATOM   2341  C  CB    . CYS A 1 305 ? 29.090  40.611  19.716  1.00 184.30 ? 285 CYS A CB    1 
ATOM   2342  S  SG    . CYS A 1 305 ? 27.974  41.225  18.433  1.00 187.61 ? 285 CYS A SG    1 
ATOM   2343  N  N     . ARG A 1 306 ? 30.152  40.673  23.053  1.00 179.04 ? 286 ARG A N     1 
ATOM   2344  C  CA    . ARG A 1 306 ? 30.761  39.983  24.203  1.00 175.54 ? 286 ARG A CA    1 
ATOM   2345  C  C     . ARG A 1 306 ? 29.704  39.384  25.141  1.00 173.76 ? 286 ARG A C     1 
ATOM   2346  O  O     . ARG A 1 306 ? 29.918  38.316  25.714  1.00 172.72 ? 286 ARG A O     1 
ATOM   2347  C  CB    . ARG A 1 306 ? 31.659  40.929  25.009  1.00 174.48 ? 286 ARG A CB    1 
ATOM   2348  C  CG    . ARG A 1 306 ? 32.910  41.403  24.288  1.00 173.48 ? 286 ARG A CG    1 
ATOM   2349  C  CD    . ARG A 1 306 ? 33.761  42.258  25.213  1.00 173.74 ? 286 ARG A CD    1 
ATOM   2350  N  NE    . ARG A 1 306 ? 34.909  42.861  24.535  1.00 174.09 ? 286 ARG A NE    1 
ATOM   2351  C  CZ    . ARG A 1 306 ? 35.804  43.666  25.114  1.00 174.89 ? 286 ARG A CZ    1 
ATOM   2352  N  NH1   . ARG A 1 306 ? 35.707  43.988  26.405  1.00 175.99 ? 286 ARG A NH1   1 
ATOM   2353  N  NH2   . ARG A 1 306 ? 36.809  44.158  24.394  1.00 174.88 ? 286 ARG A NH2   1 
ATOM   2354  N  N     . ASN A 1 307 ? 28.574  40.078  25.292  1.00 172.89 ? 287 ASN A N     1 
ATOM   2355  C  CA    . ASN A 1 307 ? 27.456  39.602  26.124  1.00 171.45 ? 287 ASN A CA    1 
ATOM   2356  C  C     . ASN A 1 307 ? 26.676  38.424  25.515  1.00 170.03 ? 287 ASN A C     1 
ATOM   2357  O  O     . ASN A 1 307 ? 25.892  37.784  26.219  1.00 169.26 ? 287 ASN A O     1 
ATOM   2358  C  CB    . ASN A 1 307 ? 26.482  40.751  26.432  1.00 171.53 ? 287 ASN A CB    1 
ATOM   2359  C  CG    . ASN A 1 307 ? 27.112  41.850  27.273  1.00 171.17 ? 287 ASN A CG    1 
ATOM   2360  O  OD1   . ASN A 1 307 ? 27.112  43.018  26.885  1.00 171.35 ? 287 ASN A OD1   1 
ATOM   2361  N  ND2   . ASN A 1 307 ? 27.651  41.481  28.431  1.00 170.16 ? 287 ASN A ND2   1 
ATOM   2362  N  N     . THR A 1 308 ? 26.869  38.160  24.220  1.00 169.11 ? 288 THR A N     1 
ATOM   2363  C  CA    . THR A 1 308 ? 26.305  36.980  23.553  1.00 168.49 ? 288 THR A CA    1 
ATOM   2364  C  C     . THR A 1 308 ? 26.802  35.687  24.211  1.00 167.51 ? 288 THR A C     1 
ATOM   2365  O  O     . THR A 1 308 ? 28.006  35.455  24.298  1.00 167.68 ? 288 THR A O     1 
ATOM   2366  C  CB    . THR A 1 308 ? 26.682  36.950  22.053  1.00 168.48 ? 288 THR A CB    1 
ATOM   2367  O  OG1   . THR A 1 308 ? 26.380  38.217  21.453  1.00 166.76 ? 288 THR A OG1   1 
ATOM   2368  C  CG2   . THR A 1 308 ? 25.925  35.855  21.309  1.00 168.59 ? 288 THR A CG2   1 
ATOM   2369  N  N     . LYS A 1 309 ? 25.866  34.858  24.669  1.00 165.69 ? 289 LYS A N     1 
ATOM   2370  C  CA    . LYS A 1 309 ? 26.193  33.618  25.378  1.00 164.32 ? 289 LYS A CA    1 
ATOM   2371  C  C     . LYS A 1 309 ? 26.645  32.526  24.405  1.00 165.35 ? 289 LYS A C     1 
ATOM   2372  O  O     . LYS A 1 309 ? 26.277  32.548  23.226  1.00 166.76 ? 289 LYS A O     1 
ATOM   2373  C  CB    . LYS A 1 309 ? 24.976  33.146  26.179  1.00 162.81 ? 289 LYS A CB    1 
ATOM   2374  C  CG    . LYS A 1 309 ? 25.263  32.049  27.190  1.00 160.76 ? 289 LYS A CG    1 
ATOM   2375  C  CD    . LYS A 1 309 ? 24.069  31.825  28.103  1.00 158.86 ? 289 LYS A CD    1 
ATOM   2376  C  CE    . LYS A 1 309 ? 24.317  30.683  29.075  1.00 156.20 ? 289 LYS A CE    1 
ATOM   2377  N  NZ    . LYS A 1 309 ? 24.248  29.345  28.426  1.00 154.97 ? 289 LYS A NZ    1 
ATOM   2378  N  N     . VAL A 1 310 ? 27.442  31.579  24.906  1.00 164.12 ? 290 VAL A N     1 
ATOM   2379  C  CA    . VAL A 1 310 ? 27.913  30.435  24.112  1.00 162.60 ? 290 VAL A CA    1 
ATOM   2380  C  C     . VAL A 1 310 ? 26.833  29.345  24.136  1.00 162.15 ? 290 VAL A C     1 
ATOM   2381  O  O     . VAL A 1 310 ? 26.927  28.359  24.873  1.00 162.32 ? 290 VAL A O     1 
ATOM   2382  C  CB    . VAL A 1 310 ? 29.284  29.901  24.611  1.00 160.42 ? 290 VAL A CB    1 
ATOM   2383  C  CG1   . VAL A 1 310 ? 29.785  28.764  23.722  1.00 159.20 ? 290 VAL A CG1   1 
ATOM   2384  C  CG2   . VAL A 1 310 ? 30.314  31.026  24.648  1.00 159.65 ? 290 VAL A CG2   1 
ATOM   2385  N  N     . ALA A 1 311 ? 25.798  29.560  23.326  1.00 161.22 ? 291 ALA A N     1 
ATOM   2386  C  CA    . ALA A 1 311 ? 24.660  28.645  23.218  1.00 160.07 ? 291 ALA A CA    1 
ATOM   2387  C  C     . ALA A 1 311 ? 23.816  29.025  22.003  1.00 160.67 ? 291 ALA A C     1 
ATOM   2388  O  O     . ALA A 1 311 ? 23.498  30.201  21.817  1.00 161.40 ? 291 ALA A O     1 
ATOM   2389  C  CB    . ALA A 1 311 ? 23.811  28.693  24.481  1.00 159.14 ? 291 ALA A CB    1 
ATOM   2390  N  N     . GLU A 1 312 ? 23.448  28.034  21.191  1.00 160.60 ? 292 GLU A N     1 
ATOM   2391  C  CA    . GLU A 1 312 ? 22.656  28.276  19.975  1.00 160.41 ? 292 GLU A CA    1 
ATOM   2392  C  C     . GLU A 1 312 ? 21.200  28.680  20.269  1.00 162.35 ? 292 GLU A C     1 
ATOM   2393  O  O     . GLU A 1 312 ? 20.533  29.251  19.401  1.00 163.54 ? 292 GLU A O     1 
ATOM   2394  C  CB    . GLU A 1 312 ? 22.688  27.052  19.050  1.00 158.77 ? 292 GLU A CB    1 
ATOM   2395  C  CG    . GLU A 1 312 ? 22.315  27.354  17.604  1.00 157.59 ? 292 GLU A CG    1 
ATOM   2396  C  CD    . GLU A 1 312 ? 22.596  26.198  16.662  1.00 156.04 ? 292 GLU A CD    1 
ATOM   2397  O  OE1   . GLU A 1 312 ? 22.393  25.032  17.061  1.00 155.02 ? 292 GLU A OE1   1 
ATOM   2398  O  OE2   . GLU A 1 312 ? 23.013  26.458  15.514  1.00 154.76 ? 292 GLU A OE2   1 
ATOM   2399  N  N     . ALA A 1 313 ? 20.713  28.381  21.477  1.00 163.30 ? 293 ALA A N     1 
ATOM   2400  C  CA    . ALA A 1 313 ? 19.375  28.795  21.914  1.00 164.04 ? 293 ALA A CA    1 
ATOM   2401  C  C     . ALA A 1 313 ? 19.226  30.317  21.940  1.00 164.50 ? 293 ALA A C     1 
ATOM   2402  O  O     . ALA A 1 313 ? 18.347  30.867  21.276  1.00 167.19 ? 293 ALA A O     1 
ATOM   2403  C  CB    . ALA A 1 313 ? 19.062  28.214  23.287  1.00 163.96 ? 293 ALA A CB    1 
ATOM   2404  N  N     . GLU A 1 314 ? 20.098  30.986  22.693  1.00 162.50 ? 294 GLU A N     1 
ATOM   2405  C  CA    . GLU A 1 314 ? 20.073  32.452  22.800  1.00 161.27 ? 294 GLU A CA    1 
ATOM   2406  C  C     . GLU A 1 314 ? 20.591  33.187  21.553  1.00 162.57 ? 294 GLU A C     1 
ATOM   2407  O  O     . GLU A 1 314 ? 20.332  34.380  21.403  1.00 163.70 ? 294 GLU A O     1 
ATOM   2408  C  CB    . GLU A 1 314 ? 20.851  32.920  24.034  1.00 158.97 ? 294 GLU A CB    1 
ATOM   2409  C  CG    . GLU A 1 314 ? 20.234  32.477  25.353  1.00 157.91 ? 294 GLU A CG    1 
ATOM   2410  C  CD    . GLU A 1 314 ? 20.712  33.293  26.542  1.00 156.99 ? 294 GLU A CD    1 
ATOM   2411  O  OE1   . GLU A 1 314 ? 21.862  33.781  26.522  1.00 154.88 ? 294 GLU A OE1   1 
ATOM   2412  O  OE2   . GLU A 1 314 ? 19.931  33.445  27.505  1.00 157.18 ? 294 GLU A OE2   1 
ATOM   2413  N  N     . MET A 1 315 ? 21.323  32.490  20.681  1.00 164.59 ? 295 MET A N     1 
ATOM   2414  C  CA    . MET A 1 315 ? 21.830  33.074  19.426  1.00 165.86 ? 295 MET A CA    1 
ATOM   2415  C  C     . MET A 1 315 ? 20.714  33.422  18.437  1.00 163.72 ? 295 MET A C     1 
ATOM   2416  O  O     . MET A 1 315 ? 20.652  34.548  17.936  1.00 162.07 ? 295 MET A O     1 
ATOM   2417  C  CB    . MET A 1 315 ? 22.831  32.120  18.751  1.00 168.68 ? 295 MET A CB    1 
ATOM   2418  C  CG    . MET A 1 315 ? 24.211  32.090  19.400  1.00 170.10 ? 295 MET A CG    1 
ATOM   2419  S  SD    . MET A 1 315 ? 25.486  32.998  18.499  1.00 172.39 ? 295 MET A SD    1 
ATOM   2420  C  CE    . MET A 1 315 ? 24.701  34.589  18.250  1.00 172.68 ? 295 MET A CE    1 
ATOM   2421  N  N     . ALA A 1 316 ? 19.844  32.451  18.163  1.00 162.02 ? 296 ALA A N     1 
ATOM   2422  C  CA    . ALA A 1 316 ? 18.766  32.606  17.178  1.00 160.28 ? 296 ALA A CA    1 
ATOM   2423  C  C     . ALA A 1 316 ? 17.521  33.303  17.739  1.00 159.96 ? 296 ALA A C     1 
ATOM   2424  O  O     . ALA A 1 316 ? 16.862  34.056  17.018  1.00 160.19 ? 296 ALA A O     1 
ATOM   2425  C  CB    . ALA A 1 316 ? 18.390  31.250  16.601  1.00 159.49 ? 296 ALA A CB    1 
ATOM   2426  N  N     . THR A 1 317 ? 17.203  33.043  19.010  1.00 159.14 ? 297 THR A N     1 
ATOM   2427  C  CA    . THR A 1 317 ? 15.999  33.590  19.662  1.00 157.74 ? 297 THR A CA    1 
ATOM   2428  C  C     . THR A 1 317 ? 15.986  35.123  19.747  1.00 158.16 ? 297 THR A C     1 
ATOM   2429  O  O     . THR A 1 317 ? 14.925  35.736  19.605  1.00 158.32 ? 297 THR A O     1 
ATOM   2430  C  CB    . THR A 1 317 ? 15.811  33.003  21.082  1.00 155.68 ? 297 THR A CB    1 
ATOM   2431  O  OG1   . THR A 1 317 ? 15.826  31.572  21.015  1.00 154.95 ? 297 THR A OG1   1 
ATOM   2432  C  CG2   . THR A 1 317 ? 14.489  33.455  21.708  1.00 154.86 ? 297 THR A CG2   1 
ATOM   2433  N  N     . MET A 1 318 ? 17.152  35.731  19.977  1.00 158.36 ? 298 MET A N     1 
ATOM   2434  C  CA    . MET A 1 318 ? 17.264  37.197  20.024  1.00 158.63 ? 298 MET A CA    1 
ATOM   2435  C  C     . MET A 1 318 ? 17.016  37.833  18.654  1.00 157.75 ? 298 MET A C     1 
ATOM   2436  O  O     . MET A 1 318 ? 17.114  37.165  17.619  1.00 156.21 ? 298 MET A O     1 
ATOM   2437  C  CB    . MET A 1 318 ? 18.628  37.643  20.583  1.00 160.39 ? 298 MET A CB    1 
ATOM   2438  C  CG    . MET A 1 318 ? 19.845  37.347  19.709  1.00 162.22 ? 298 MET A CG    1 
ATOM   2439  S  SD    . MET A 1 318 ? 21.314  38.257  20.230  1.00 163.15 ? 298 MET A SD    1 
ATOM   2440  C  CE    . MET A 1 318 ? 21.562  37.633  21.891  1.00 163.09 ? 298 MET A CE    1 
ATOM   2441  N  N     . GLU A 1 319 ? 16.702  39.128  18.665  1.00 157.53 ? 299 GLU A N     1 
ATOM   2442  C  CA    . GLU A 1 319 ? 16.419  39.874  17.438  1.00 155.72 ? 299 GLU A CA    1 
ATOM   2443  C  C     . GLU A 1 319 ? 17.686  40.008  16.594  1.00 151.98 ? 299 GLU A C     1 
ATOM   2444  O  O     . GLU A 1 319 ? 18.759  40.321  17.116  1.00 151.33 ? 299 GLU A O     1 
ATOM   2445  C  CB    . GLU A 1 319 ? 15.846  41.259  17.758  1.00 157.49 ? 299 GLU A CB    1 
ATOM   2446  C  CG    . GLU A 1 319 ? 15.243  41.973  16.555  1.00 158.91 ? 299 GLU A CG    1 
ATOM   2447  C  CD    . GLU A 1 319 ? 14.573  43.290  16.910  1.00 159.41 ? 299 GLU A CD    1 
ATOM   2448  O  OE1   . GLU A 1 319 ? 15.070  44.001  17.811  1.00 160.99 ? 299 GLU A OE1   1 
ATOM   2449  O  OE2   . GLU A 1 319 ? 13.548  43.621  16.278  1.00 158.53 ? 299 GLU A OE2   1 
ATOM   2450  N  N     . LYS A 1 320 ? 17.546  39.768  15.293  1.00 147.28 ? 300 LYS A N     1 
ATOM   2451  C  CA    . LYS A 1 320 ? 18.684  39.728  14.375  1.00 145.16 ? 300 LYS A CA    1 
ATOM   2452  C  C     . LYS A 1 320 ? 19.149  41.143  14.032  1.00 142.90 ? 300 LYS A C     1 
ATOM   2453  O  O     . LYS A 1 320 ? 18.689  41.743  13.058  1.00 143.10 ? 300 LYS A O     1 
ATOM   2454  C  CB    . LYS A 1 320 ? 18.314  38.943  13.112  1.00 145.80 ? 300 LYS A CB    1 
ATOM   2455  C  CG    . LYS A 1 320 ? 18.025  37.470  13.380  1.00 145.99 ? 300 LYS A CG    1 
ATOM   2456  C  CD    . LYS A 1 320 ? 16.941  36.911  12.473  1.00 145.50 ? 300 LYS A CD    1 
ATOM   2457  C  CE    . LYS A 1 320 ? 16.581  35.489  12.869  1.00 145.10 ? 300 LYS A CE    1 
ATOM   2458  N  NZ    . LYS A 1 320 ? 15.398  34.984  12.120  1.00 144.93 ? 300 LYS A NZ    1 
ATOM   2459  N  N     . LYS A 1 321 ? 20.056  41.664  14.857  1.00 141.11 ? 301 LYS A N     1 
ATOM   2460  C  CA    . LYS A 1 321 ? 20.601  43.014  14.692  1.00 140.14 ? 301 LYS A CA    1 
ATOM   2461  C  C     . LYS A 1 321 ? 21.819  43.019  13.771  1.00 137.20 ? 301 LYS A C     1 
ATOM   2462  O  O     . LYS A 1 321 ? 22.354  41.964  13.420  1.00 136.28 ? 301 LYS A O     1 
ATOM   2463  C  CB    . LYS A 1 321 ? 20.983  43.606  16.052  1.00 142.16 ? 301 LYS A CB    1 
ATOM   2464  C  CG    . LYS A 1 321 ? 19.810  43.780  17.001  1.00 143.71 ? 301 LYS A CG    1 
ATOM   2465  C  CD    . LYS A 1 321 ? 20.254  44.380  18.324  1.00 145.10 ? 301 LYS A CD    1 
ATOM   2466  C  CE    . LYS A 1 321 ? 19.083  44.539  19.279  1.00 146.34 ? 301 LYS A CE    1 
ATOM   2467  N  NZ    . LYS A 1 321 ? 19.510  45.078  20.599  1.00 147.17 ? 301 LYS A NZ    1 
ATOM   2468  N  N     . GLY A 1 322 ? 22.248  44.217  13.385  1.00 134.56 ? 302 GLY A N     1 
ATOM   2469  C  CA    . GLY A 1 322 ? 23.424  44.381  12.535  1.00 133.22 ? 302 GLY A CA    1 
ATOM   2470  C  C     . GLY A 1 322 ? 23.793  45.830  12.280  1.00 132.64 ? 302 GLY A C     1 
ATOM   2471  O  O     . GLY A 1 322 ? 22.959  46.727  12.421  1.00 132.82 ? 302 GLY A O     1 
ATOM   2472  N  N     . VAL A 1 323 ? 25.056  46.051  11.918  1.00 131.71 ? 303 VAL A N     1 
ATOM   2473  C  CA    . VAL A 1 323 ? 25.571  47.379  11.563  1.00 131.79 ? 303 VAL A CA    1 
ATOM   2474  C  C     . VAL A 1 323 ? 26.440  47.245  10.314  1.00 130.15 ? 303 VAL A C     1 
ATOM   2475  O  O     . VAL A 1 323 ? 27.138  46.240  10.149  1.00 130.13 ? 303 VAL A O     1 
ATOM   2476  C  CB    . VAL A 1 323 ? 26.412  48.000  12.707  1.00 134.07 ? 303 VAL A CB    1 
ATOM   2477  C  CG1   . VAL A 1 323 ? 26.766  49.452  12.396  1.00 135.48 ? 303 VAL A CG1   1 
ATOM   2478  C  CG2   . VAL A 1 323 ? 25.677  47.908  14.040  1.00 134.45 ? 303 VAL A CG2   1 
ATOM   2479  N  N     . ASP A 1 324 ? 26.393  48.252  9.441   1.00 128.64 ? 304 ASP A N     1 
ATOM   2480  C  CA    . ASP A 1 324 ? 27.217  48.269  8.229   1.00 129.16 ? 304 ASP A CA    1 
ATOM   2481  C  C     . ASP A 1 324 ? 28.688  48.458  8.607   1.00 129.55 ? 304 ASP A C     1 
ATOM   2482  O  O     . ASP A 1 324 ? 29.017  49.326  9.419   1.00 131.09 ? 304 ASP A O     1 
ATOM   2483  C  CB    . ASP A 1 324 ? 26.764  49.385  7.275   1.00 129.03 ? 304 ASP A CB    1 
ATOM   2484  C  CG    . ASP A 1 324 ? 27.559  49.413  5.968   1.00 129.67 ? 304 ASP A CG    1 
ATOM   2485  O  OD1   . ASP A 1 324 ? 27.944  48.336  5.462   1.00 129.61 ? 304 ASP A OD1   1 
ATOM   2486  O  OD2   . ASP A 1 324 ? 27.793  50.520  5.442   1.00 130.51 ? 304 ASP A OD2   1 
ATOM   2487  N  N     . THR A 1 325 ? 29.559  47.642  8.015   1.00 129.46 ? 305 THR A N     1 
ATOM   2488  C  CA    . THR A 1 325 ? 30.990  47.663  8.333   1.00 129.40 ? 305 THR A CA    1 
ATOM   2489  C  C     . THR A 1 325 ? 31.691  48.857  7.687   1.00 129.33 ? 305 THR A C     1 
ATOM   2490  O  O     . THR A 1 325 ? 32.512  49.517  8.326   1.00 129.59 ? 305 THR A O     1 
ATOM   2491  C  CB    . THR A 1 325 ? 31.703  46.368  7.886   1.00 128.73 ? 305 THR A CB    1 
ATOM   2492  O  OG1   . THR A 1 325 ? 31.629  46.237  6.461   1.00 129.27 ? 305 THR A OG1   1 
ATOM   2493  C  CG2   . THR A 1 325 ? 31.076  45.144  8.552   1.00 127.72 ? 305 THR A CG2   1 
ATOM   2494  N  N     . GLY A 1 326 ? 31.361  49.122  6.422   1.00 129.23 ? 306 GLY A N     1 
ATOM   2495  C  CA    . GLY A 1 326 ? 31.974  50.202  5.649   1.00 130.51 ? 306 GLY A CA    1 
ATOM   2496  C  C     . GLY A 1 326 ? 32.724  49.667  4.447   1.00 131.75 ? 306 GLY A C     1 
ATOM   2497  O  O     . GLY A 1 326 ? 32.626  50.228  3.354   1.00 133.62 ? 306 GLY A O     1 
ATOM   2498  N  N     . PHE A 1 327 ? 33.476  48.583  4.650   1.00 132.72 ? 307 PHE A N     1 
ATOM   2499  C  CA    . PHE A 1 327 ? 34.231  47.943  3.569   1.00 133.14 ? 307 PHE A CA    1 
ATOM   2500  C  C     . PHE A 1 327 ? 33.295  47.275  2.562   1.00 129.17 ? 307 PHE A C     1 
ATOM   2501  O  O     . PHE A 1 327 ? 32.324  46.618  2.946   1.00 126.93 ? 307 PHE A O     1 
ATOM   2502  C  CB    . PHE A 1 327 ? 35.227  46.915  4.122   1.00 137.31 ? 307 PHE A CB    1 
ATOM   2503  C  CG    . PHE A 1 327 ? 36.354  47.524  4.914   1.00 141.25 ? 307 PHE A CG    1 
ATOM   2504  C  CD1   . PHE A 1 327 ? 37.247  48.407  4.310   1.00 143.84 ? 307 PHE A CD1   1 
ATOM   2505  C  CD2   . PHE A 1 327 ? 36.535  47.210  6.259   1.00 142.53 ? 307 PHE A CD2   1 
ATOM   2506  C  CE1   . PHE A 1 327 ? 38.288  48.973  5.033   1.00 144.62 ? 307 PHE A CE1   1 
ATOM   2507  C  CE2   . PHE A 1 327 ? 37.579  47.772  6.985   1.00 143.52 ? 307 PHE A CE2   1 
ATOM   2508  C  CZ    . PHE A 1 327 ? 38.455  48.654  6.371   1.00 143.94 ? 307 PHE A CZ    1 
ATOM   2509  N  N     . LYS A 1 328 ? 33.607  47.456  1.279   1.00 125.44 ? 308 LYS A N     1 
ATOM   2510  C  CA    . LYS A 1 328 ? 32.777  46.980  0.174   1.00 122.55 ? 308 LYS A CA    1 
ATOM   2511  C  C     . LYS A 1 328 ? 33.450  45.796  -0.514  1.00 120.44 ? 308 LYS A C     1 
ATOM   2512  O  O     . LYS A 1 328 ? 34.508  45.953  -1.129  1.00 120.24 ? 308 LYS A O     1 
ATOM   2513  C  CB    . LYS A 1 328 ? 32.562  48.107  -0.839  1.00 122.13 ? 308 LYS A CB    1 
ATOM   2514  C  CG    . LYS A 1 328 ? 31.746  49.283  -0.320  1.00 121.53 ? 308 LYS A CG    1 
ATOM   2515  C  CD    . LYS A 1 328 ? 30.252  49.009  -0.393  1.00 121.16 ? 308 LYS A CD    1 
ATOM   2516  C  CE    . LYS A 1 328 ? 29.444  50.061  0.352   1.00 120.80 ? 308 LYS A CE    1 
ATOM   2517  N  NZ    . LYS A 1 328 ? 29.566  49.952  1.834   1.00 120.70 ? 308 LYS A NZ    1 
ATOM   2518  N  N     . ALA A 1 329 ? 32.837  44.618  -0.403  1.00 117.97 ? 309 ALA A N     1 
ATOM   2519  C  CA    . ALA A 1 329 ? 33.330  43.413  -1.074  1.00 116.05 ? 309 ALA A CA    1 
ATOM   2520  C  C     . ALA A 1 329 ? 32.946  43.445  -2.551  1.00 114.35 ? 309 ALA A C     1 
ATOM   2521  O  O     . ALA A 1 329 ? 31.851  43.891  -2.900  1.00 112.13 ? 309 ALA A O     1 
ATOM   2522  C  CB    . ALA A 1 329 ? 32.769  42.166  -0.409  1.00 116.10 ? 309 ALA A CB    1 
ATOM   2523  N  N     . VAL A 1 330 ? 33.851  42.972  -3.407  1.00 114.02 ? 310 VAL A N     1 
ATOM   2524  C  CA    . VAL A 1 330 ? 33.636  42.955  -4.856  1.00 112.88 ? 310 VAL A CA    1 
ATOM   2525  C  C     . VAL A 1 330 ? 33.012  41.616  -5.254  1.00 112.05 ? 310 VAL A C     1 
ATOM   2526  O  O     . VAL A 1 330 ? 33.597  40.557  -5.010  1.00 112.11 ? 310 VAL A O     1 
ATOM   2527  C  CB    . VAL A 1 330 ? 34.955  43.165  -5.641  1.00 112.52 ? 310 VAL A CB    1 
ATOM   2528  C  CG1   . VAL A 1 330 ? 34.687  43.273  -7.141  1.00 111.68 ? 310 VAL A CG1   1 
ATOM   2529  C  CG2   . VAL A 1 330 ? 35.686  44.408  -5.143  1.00 112.72 ? 310 VAL A CG2   1 
ATOM   2530  N  N     . HIS A 1 331 ? 31.827  41.676  -5.861  1.00 110.35 ? 311 HIS A N     1 
ATOM   2531  C  CA    . HIS A 1 331 ? 31.158  40.494  -6.404  1.00 109.58 ? 311 HIS A CA    1 
ATOM   2532  C  C     . HIS A 1 331 ? 31.905  40.091  -7.688  1.00 108.91 ? 311 HIS A C     1 
ATOM   2533  O  O     . HIS A 1 331 ? 31.877  40.841  -8.664  1.00 113.51 ? 311 HIS A O     1 
ATOM   2534  C  CB    . HIS A 1 331 ? 29.685  40.816  -6.698  1.00 110.24 ? 311 HIS A CB    1 
ATOM   2535  C  CG    . HIS A 1 331 ? 28.815  39.610  -6.879  1.00 110.95 ? 311 HIS A CG    1 
ATOM   2536  N  ND1   . HIS A 1 331 ? 28.962  38.731  -7.930  1.00 110.69 ? 311 HIS A ND1   1 
ATOM   2537  C  CD2   . HIS A 1 331 ? 27.769  39.151  -6.151  1.00 111.26 ? 311 HIS A CD2   1 
ATOM   2538  C  CE1   . HIS A 1 331 ? 28.055  37.776  -7.835  1.00 110.62 ? 311 HIS A CE1   1 
ATOM   2539  N  NE2   . HIS A 1 331 ? 27.317  38.008  -6.764  1.00 110.63 ? 311 HIS A NE2   1 
ATOM   2540  N  N     . PRO A 1 332 ? 32.588  38.923  -7.689  1.00 105.34 ? 312 PRO A N     1 
ATOM   2541  C  CA    . PRO A 1 332 ? 33.508  38.570  -8.787  1.00 104.00 ? 312 PRO A CA    1 
ATOM   2542  C  C     . PRO A 1 332 ? 32.879  38.437  -10.183 1.00 104.06 ? 312 PRO A C     1 
ATOM   2543  O  O     . PRO A 1 332 ? 33.539  38.762  -11.173 1.00 104.79 ? 312 PRO A O     1 
ATOM   2544  C  CB    . PRO A 1 332 ? 34.106  37.231  -8.332  1.00 103.83 ? 312 PRO A CB    1 
ATOM   2545  C  CG    . PRO A 1 332 ? 33.098  36.662  -7.402  1.00 104.12 ? 312 PRO A CG    1 
ATOM   2546  C  CD    . PRO A 1 332 ? 32.499  37.839  -6.693  1.00 104.45 ? 312 PRO A CD    1 
ATOM   2547  N  N     . LEU A 1 333 ? 31.630  37.970  -10.258 1.00 103.27 ? 313 LEU A N     1 
ATOM   2548  C  CA    . LEU A 1 333 ? 30.949  37.759  -11.544 1.00 102.41 ? 313 LEU A CA    1 
ATOM   2549  C  C     . LEU A 1 333 ? 30.371  39.049  -12.130 1.00 101.36 ? 313 LEU A C     1 
ATOM   2550  O  O     . LEU A 1 333 ? 30.705  39.422  -13.255 1.00 101.11 ? 313 LEU A O     1 
ATOM   2551  C  CB    . LEU A 1 333 ? 29.840  36.710  -11.402 1.00 102.86 ? 313 LEU A CB    1 
ATOM   2552  C  CG    . LEU A 1 333 ? 30.272  35.303  -10.975 1.00 103.06 ? 313 LEU A CG    1 
ATOM   2553  C  CD1   . LEU A 1 333 ? 29.051  34.420  -10.779 1.00 103.02 ? 313 LEU A CD1   1 
ATOM   2554  C  CD2   . LEU A 1 333 ? 31.218  34.677  -11.989 1.00 103.58 ? 313 LEU A CD2   1 
ATOM   2555  N  N     . THR A 1 334 ? 29.499  39.715  -11.373 1.00 101.07 ? 314 THR A N     1 
ATOM   2556  C  CA    . THR A 1 334 ? 28.888  40.982  -11.807 1.00 101.59 ? 314 THR A CA    1 
ATOM   2557  C  C     . THR A 1 334 ? 29.861  42.168  -11.781 1.00 102.44 ? 314 THR A C     1 
ATOM   2558  O  O     . THR A 1 334 ? 29.656  43.147  -12.500 1.00 101.92 ? 314 THR A O     1 
ATOM   2559  C  CB    . THR A 1 334 ? 27.653  41.351  -10.952 1.00 100.79 ? 314 THR A CB    1 
ATOM   2560  O  OG1   . THR A 1 334 ? 28.017  41.417  -9.569  1.00 98.98  ? 314 THR A OG1   1 
ATOM   2561  C  CG2   . THR A 1 334 ? 26.543  40.329  -11.133 1.00 101.24 ? 314 THR A CG2   1 
ATOM   2562  N  N     . GLY A 1 335 ? 30.903  42.079  -10.952 1.00 103.97 ? 315 GLY A N     1 
ATOM   2563  C  CA    . GLY A 1 335 ? 31.881  43.157  -10.792 1.00 104.21 ? 315 GLY A CA    1 
ATOM   2564  C  C     . GLY A 1 335 ? 31.399  44.315  -9.931  1.00 105.08 ? 315 GLY A C     1 
ATOM   2565  O  O     . GLY A 1 335 ? 31.999  45.391  -9.957  1.00 106.05 ? 315 GLY A O     1 
ATOM   2566  N  N     . GLU A 1 336 ? 30.337  44.094  -9.153  1.00 106.55 ? 316 GLU A N     1 
ATOM   2567  C  CA    . GLU A 1 336 ? 29.700  45.149  -8.363  1.00 107.59 ? 316 GLU A CA    1 
ATOM   2568  C  C     . GLU A 1 336 ? 30.207  45.148  -6.921  1.00 107.93 ? 316 GLU A C     1 
ATOM   2569  O  O     . GLU A 1 336 ? 30.456  44.088  -6.339  1.00 107.10 ? 316 GLU A O     1 
ATOM   2570  C  CB    . GLU A 1 336 ? 28.179  44.967  -8.372  1.00 108.19 ? 316 GLU A CB    1 
ATOM   2571  C  CG    . GLU A 1 336 ? 27.396  46.178  -7.875  1.00 108.03 ? 316 GLU A CG    1 
ATOM   2572  C  CD    . GLU A 1 336 ? 25.912  45.905  -7.715  1.00 108.05 ? 316 GLU A CD    1 
ATOM   2573  O  OE1   . GLU A 1 336 ? 25.381  45.003  -8.400  1.00 108.40 ? 316 GLU A OE1   1 
ATOM   2574  O  OE2   . GLU A 1 336 ? 25.271  46.602  -6.901  1.00 108.36 ? 316 GLU A OE2   1 
ATOM   2575  N  N     . GLU A 1 337 ? 30.347  46.346  -6.355  1.00 108.91 ? 317 GLU A N     1 
ATOM   2576  C  CA    . GLU A 1 337 ? 30.671  46.517  -4.941  1.00 109.39 ? 317 GLU A CA    1 
ATOM   2577  C  C     . GLU A 1 337 ? 29.418  46.262  -4.108  1.00 109.63 ? 317 GLU A C     1 
ATOM   2578  O  O     . GLU A 1 337 ? 28.370  46.857  -4.374  1.00 109.90 ? 317 GLU A O     1 
ATOM   2579  C  CB    . GLU A 1 337 ? 31.190  47.933  -4.672  1.00 109.72 ? 317 GLU A CB    1 
ATOM   2580  C  CG    . GLU A 1 337 ? 32.493  48.268  -5.389  1.00 109.21 ? 317 GLU A CG    1 
ATOM   2581  C  CD    . GLU A 1 337 ? 33.064  49.625  -5.008  1.00 108.10 ? 317 GLU A CD    1 
ATOM   2582  O  OE1   . GLU A 1 337 ? 32.344  50.448  -4.402  1.00 107.06 ? 317 GLU A OE1   1 
ATOM   2583  O  OE2   . GLU A 1 337 ? 34.247  49.873  -5.324  1.00 107.92 ? 317 GLU A OE2   1 
ATOM   2584  N  N     . ILE A 1 338 ? 29.529  45.382  -3.110  1.00 109.77 ? 318 ILE A N     1 
ATOM   2585  C  CA    . ILE A 1 338 ? 28.411  45.061  -2.208  1.00 110.62 ? 318 ILE A CA    1 
ATOM   2586  C  C     . ILE A 1 338 ? 28.815  45.299  -0.746  1.00 109.18 ? 318 ILE A C     1 
ATOM   2587  O  O     . ILE A 1 338 ? 29.955  45.014  -0.371  1.00 108.21 ? 318 ILE A O     1 
ATOM   2588  C  CB    . ILE A 1 338 ? 27.879  43.614  -2.407  1.00 112.50 ? 318 ILE A CB    1 
ATOM   2589  C  CG1   . ILE A 1 338 ? 29.011  42.575  -2.382  1.00 111.60 ? 318 ILE A CG1   1 
ATOM   2590  C  CG2   . ILE A 1 338 ? 27.115  43.513  -3.722  1.00 113.35 ? 318 ILE A CG2   1 
ATOM   2591  C  CD1   . ILE A 1 338 ? 28.530  41.142  -2.289  1.00 109.95 ? 318 ILE A CD1   1 
ATOM   2592  N  N     . PRO A 1 339 ? 27.883  45.826  0.081   1.00 108.59 ? 319 PRO A N     1 
ATOM   2593  C  CA    . PRO A 1 339 ? 28.230  46.186  1.456   1.00 108.29 ? 319 PRO A CA    1 
ATOM   2594  C  C     . PRO A 1 339 ? 28.350  44.979  2.382   1.00 107.85 ? 319 PRO A C     1 
ATOM   2595  O  O     . PRO A 1 339 ? 27.424  44.174  2.467   1.00 107.89 ? 319 PRO A O     1 
ATOM   2596  C  CB    . PRO A 1 339 ? 27.061  47.077  1.885   1.00 107.64 ? 319 PRO A CB    1 
ATOM   2597  C  CG    . PRO A 1 339 ? 25.902  46.568  1.107   1.00 107.09 ? 319 PRO A CG    1 
ATOM   2598  C  CD    . PRO A 1 339 ? 26.457  46.086  -0.204  1.00 108.00 ? 319 PRO A CD    1 
ATOM   2599  N  N     . VAL A 1 340 ? 29.489  44.861  3.059   1.00 107.99 ? 320 VAL A N     1 
ATOM   2600  C  CA    . VAL A 1 340 ? 29.676  43.853  4.100   1.00 108.53 ? 320 VAL A CA    1 
ATOM   2601  C  C     . VAL A 1 340 ? 29.021  44.388  5.379   1.00 110.19 ? 320 VAL A C     1 
ATOM   2602  O  O     . VAL A 1 340 ? 29.142  45.575  5.693   1.00 111.28 ? 320 VAL A O     1 
ATOM   2603  C  CB    . VAL A 1 340 ? 31.172  43.538  4.330   1.00 108.07 ? 320 VAL A CB    1 
ATOM   2604  C  CG1   . VAL A 1 340 ? 31.348  42.519  5.450   1.00 107.66 ? 320 VAL A CG1   1 
ATOM   2605  C  CG2   . VAL A 1 340 ? 31.814  43.031  3.043   1.00 107.78 ? 320 VAL A CG2   1 
ATOM   2606  N  N     . TRP A 1 341 ? 28.326  43.508  6.099   1.00 111.84 ? 321 TRP A N     1 
ATOM   2607  C  CA    . TRP A 1 341 ? 27.571  43.868  7.304   1.00 113.16 ? 321 TRP A CA    1 
ATOM   2608  C  C     . TRP A 1 341 ? 27.938  42.948  8.466   1.00 115.66 ? 321 TRP A C     1 
ATOM   2609  O  O     . TRP A 1 341 ? 28.106  41.744  8.275   1.00 117.20 ? 321 TRP A O     1 
ATOM   2610  C  CB    . TRP A 1 341 ? 26.065  43.751  7.035   1.00 113.04 ? 321 TRP A CB    1 
ATOM   2611  C  CG    . TRP A 1 341 ? 25.426  44.996  6.506   1.00 112.63 ? 321 TRP A CG    1 
ATOM   2612  C  CD1   . TRP A 1 341 ? 25.573  45.530  5.260   1.00 112.64 ? 321 TRP A CD1   1 
ATOM   2613  C  CD2   . TRP A 1 341 ? 24.519  45.853  7.208   1.00 112.56 ? 321 TRP A CD2   1 
ATOM   2614  N  NE1   . TRP A 1 341 ? 24.821  46.674  5.143   1.00 113.03 ? 321 TRP A NE1   1 
ATOM   2615  C  CE2   . TRP A 1 341 ? 24.163  46.896  6.324   1.00 113.31 ? 321 TRP A CE2   1 
ATOM   2616  C  CE3   . TRP A 1 341 ? 23.974  45.844  8.500   1.00 112.68 ? 321 TRP A CE3   1 
ATOM   2617  C  CZ2   . TRP A 1 341 ? 23.284  47.925  6.691   1.00 114.25 ? 321 TRP A CZ2   1 
ATOM   2618  C  CZ3   . TRP A 1 341 ? 23.101  46.869  8.867   1.00 112.87 ? 321 TRP A CZ3   1 
ATOM   2619  C  CH2   . TRP A 1 341 ? 22.766  47.894  7.963   1.00 113.83 ? 321 TRP A CH2   1 
ATOM   2620  N  N     . ALA A 1 342 ? 28.052  43.522  9.664   1.00 118.40 ? 322 ALA A N     1 
ATOM   2621  C  CA    . ALA A 1 342 ? 28.176  42.739  10.897  1.00 120.01 ? 322 ALA A CA    1 
ATOM   2622  C  C     . ALA A 1 342 ? 26.789  42.255  11.324  1.00 120.88 ? 322 ALA A C     1 
ATOM   2623  O  O     . ALA A 1 342 ? 25.786  42.922  11.057  1.00 118.66 ? 322 ALA A O     1 
ATOM   2624  C  CB    . ALA A 1 342 ? 28.813  43.571  11.999  1.00 120.48 ? 322 ALA A CB    1 
ATOM   2625  N  N     . ALA A 1 343 ? 26.740  41.095  11.978  1.00 123.42 ? 323 ALA A N     1 
ATOM   2626  C  CA    . ALA A 1 343 ? 25.472  40.492  12.409  1.00 125.66 ? 323 ALA A CA    1 
ATOM   2627  C  C     . ALA A 1 343 ? 25.662  39.495  13.552  1.00 128.43 ? 323 ALA A C     1 
ATOM   2628  O  O     . ALA A 1 343 ? 26.754  38.951  13.738  1.00 132.30 ? 323 ALA A O     1 
ATOM   2629  C  CB    . ALA A 1 343 ? 24.790  39.814  11.231  1.00 125.19 ? 323 ALA A CB    1 
ATOM   2630  N  N     . ASN A 1 344 ? 24.581  39.258  14.297  1.00 129.26 ? 324 ASN A N     1 
ATOM   2631  C  CA    . ASN A 1 344 ? 24.592  38.373  15.475  1.00 129.85 ? 324 ASN A CA    1 
ATOM   2632  C  C     . ASN A 1 344 ? 23.696  37.130  15.303  1.00 128.09 ? 324 ASN A C     1 
ATOM   2633  O  O     . ASN A 1 344 ? 23.156  36.605  16.282  1.00 128.74 ? 324 ASN A O     1 
ATOM   2634  C  CB    . ASN A 1 344 ? 24.217  39.167  16.742  1.00 131.78 ? 324 ASN A CB    1 
ATOM   2635  C  CG    . ASN A 1 344 ? 22.800  39.724  16.704  1.00 133.83 ? 324 ASN A CG    1 
ATOM   2636  O  OD1   . ASN A 1 344 ? 22.217  39.918  15.635  1.00 136.21 ? 324 ASN A OD1   1 
ATOM   2637  N  ND2   . ASN A 1 344 ? 22.244  39.991  17.878  1.00 135.72 ? 324 ASN A ND2   1 
ATOM   2638  N  N     . PHE A 1 345 ? 23.547  36.674  14.057  1.00 125.05 ? 325 PHE A N     1 
ATOM   2639  C  CA    . PHE A 1 345 ? 22.880  35.399  13.741  1.00 122.16 ? 325 PHE A CA    1 
ATOM   2640  C  C     . PHE A 1 345 ? 23.713  34.505  12.804  1.00 118.88 ? 325 PHE A C     1 
ATOM   2641  O  O     . PHE A 1 345 ? 23.202  33.512  12.280  1.00 116.85 ? 325 PHE A O     1 
ATOM   2642  C  CB    . PHE A 1 345 ? 21.488  35.662  13.139  1.00 122.35 ? 325 PHE A CB    1 
ATOM   2643  C  CG    . PHE A 1 345 ? 21.517  36.313  11.780  1.00 123.00 ? 325 PHE A CG    1 
ATOM   2644  C  CD1   . PHE A 1 345 ? 21.614  37.696  11.657  1.00 123.90 ? 325 PHE A CD1   1 
ATOM   2645  C  CD2   . PHE A 1 345 ? 21.435  35.545  10.619  1.00 122.21 ? 325 PHE A CD2   1 
ATOM   2646  C  CE1   . PHE A 1 345 ? 21.639  38.298  10.407  1.00 124.08 ? 325 PHE A CE1   1 
ATOM   2647  C  CE2   . PHE A 1 345 ? 21.461  36.142  9.366   1.00 122.28 ? 325 PHE A CE2   1 
ATOM   2648  C  CZ    . PHE A 1 345 ? 21.563  37.521  9.259   1.00 123.05 ? 325 PHE A CZ    1 
ATOM   2649  N  N     . VAL A 1 346 ? 24.991  34.845  12.623  1.00 116.58 ? 326 VAL A N     1 
ATOM   2650  C  CA    . VAL A 1 346 ? 25.882  34.159  11.692  1.00 114.83 ? 326 VAL A CA    1 
ATOM   2651  C  C     . VAL A 1 346 ? 26.960  33.483  12.533  1.00 113.37 ? 326 VAL A C     1 
ATOM   2652  O  O     . VAL A 1 346 ? 27.774  34.159  13.164  1.00 114.57 ? 326 VAL A O     1 
ATOM   2653  C  CB    . VAL A 1 346 ? 26.513  35.151  10.688  1.00 114.92 ? 326 VAL A CB    1 
ATOM   2654  C  CG1   . VAL A 1 346 ? 27.361  34.426  9.651   1.00 115.78 ? 326 VAL A CG1   1 
ATOM   2655  C  CG2   . VAL A 1 346 ? 25.430  35.964  9.992   1.00 114.44 ? 326 VAL A CG2   1 
ATOM   2656  N  N     . LEU A 1 347 ? 26.953  32.151  12.539  1.00 111.62 ? 327 LEU A N     1 
ATOM   2657  C  CA    . LEU A 1 347 ? 27.841  31.366  13.401  1.00 111.01 ? 327 LEU A CA    1 
ATOM   2658  C  C     . LEU A 1 347 ? 29.293  31.442  12.927  1.00 111.14 ? 327 LEU A C     1 
ATOM   2659  O  O     . LEU A 1 347 ? 29.557  31.450  11.722  1.00 110.85 ? 327 LEU A O     1 
ATOM   2660  C  CB    . LEU A 1 347 ? 27.382  29.904  13.452  1.00 110.62 ? 327 LEU A CB    1 
ATOM   2661  C  CG    . LEU A 1 347 ? 25.988  29.638  14.034  1.00 110.34 ? 327 LEU A CG    1 
ATOM   2662  C  CD1   . LEU A 1 347 ? 25.532  28.221  13.718  1.00 109.76 ? 327 LEU A CD1   1 
ATOM   2663  C  CD2   . LEU A 1 347 ? 25.962  29.886  15.536  1.00 111.17 ? 327 LEU A CD2   1 
ATOM   2664  N  N     . MET A 1 348 ? 30.223  31.497  13.880  1.00 111.88 ? 328 MET A N     1 
ATOM   2665  C  CA    . MET A 1 348 ? 31.655  31.594  13.573  1.00 112.47 ? 328 MET A CA    1 
ATOM   2666  C  C     . MET A 1 348 ? 32.223  30.245  13.145  1.00 114.31 ? 328 MET A C     1 
ATOM   2667  O  O     . MET A 1 348 ? 32.825  30.131  12.074  1.00 113.75 ? 328 MET A O     1 
ATOM   2668  C  CB    . MET A 1 348 ? 32.458  32.140  14.772  1.00 111.78 ? 328 MET A CB    1 
ATOM   2669  C  CG    . MET A 1 348 ? 32.972  33.562  14.593  1.00 112.18 ? 328 MET A CG    1 
ATOM   2670  S  SD    . MET A 1 348 ? 34.147  33.754  13.233  1.00 112.83 ? 328 MET A SD    1 
ATOM   2671  C  CE    . MET A 1 348 ? 35.499  32.699  13.756  1.00 112.15 ? 328 MET A CE    1 
ATOM   2672  N  N     . GLU A 1 349 ? 32.025  29.233  13.989  1.00 116.35 ? 329 GLU A N     1 
ATOM   2673  C  CA    . GLU A 1 349 ? 32.626  27.911  13.781  1.00 117.72 ? 329 GLU A CA    1 
ATOM   2674  C  C     . GLU A 1 349 ? 31.972  27.103  12.650  1.00 116.05 ? 329 GLU A C     1 
ATOM   2675  O  O     . GLU A 1 349 ? 32.663  26.341  11.967  1.00 115.00 ? 329 GLU A O     1 
ATOM   2676  C  CB    . GLU A 1 349 ? 32.633  27.109  15.087  1.00 119.63 ? 329 GLU A CB    1 
ATOM   2677  C  CG    . GLU A 1 349 ? 33.466  27.750  16.191  1.00 121.40 ? 329 GLU A CG    1 
ATOM   2678  C  CD    . GLU A 1 349 ? 33.583  26.882  17.433  1.00 122.55 ? 329 GLU A CD    1 
ATOM   2679  O  OE1   . GLU A 1 349 ? 32.544  26.397  17.928  1.00 123.27 ? 329 GLU A OE1   1 
ATOM   2680  O  OE2   . GLU A 1 349 ? 34.717  26.694  17.926  1.00 122.29 ? 329 GLU A OE2   1 
ATOM   2681  N  N     . TYR A 1 350 ? 30.660  27.260  12.456  1.00 113.31 ? 330 TYR A N     1 
ATOM   2682  C  CA    . TYR A 1 350 ? 29.975  26.674  11.294  1.00 111.31 ? 330 TYR A CA    1 
ATOM   2683  C  C     . TYR A 1 350 ? 30.302  27.488  10.042  1.00 109.03 ? 330 TYR A C     1 
ATOM   2684  O  O     . TYR A 1 350 ? 30.201  28.717  10.053  1.00 107.37 ? 330 TYR A O     1 
ATOM   2685  C  CB    . TYR A 1 350 ? 28.457  26.618  11.497  1.00 111.26 ? 330 TYR A CB    1 
ATOM   2686  C  CG    . TYR A 1 350 ? 27.713  26.038  10.308  1.00 110.74 ? 330 TYR A CG    1 
ATOM   2687  C  CD1   . TYR A 1 350 ? 27.880  24.702  9.944   1.00 111.11 ? 330 TYR A CD1   1 
ATOM   2688  C  CD2   . TYR A 1 350 ? 26.853  26.825  9.536   1.00 109.99 ? 330 TYR A CD2   1 
ATOM   2689  C  CE1   . TYR A 1 350 ? 27.211  24.163  8.854   1.00 110.45 ? 330 TYR A CE1   1 
ATOM   2690  C  CE2   . TYR A 1 350 ? 26.179  26.293  8.443   1.00 109.56 ? 330 TYR A CE2   1 
ATOM   2691  C  CZ    . TYR A 1 350 ? 26.362  24.962  8.107   1.00 109.35 ? 330 TYR A CZ    1 
ATOM   2692  O  OH    . TYR A 1 350 ? 25.703  24.421  7.030   1.00 108.51 ? 330 TYR A OH    1 
ATOM   2693  N  N     . GLY A 1 351 ? 30.682  26.796  8.969   1.00 107.64 ? 331 GLY A N     1 
ATOM   2694  C  CA    . GLY A 1 351 ? 31.137  27.445  7.741   1.00 106.72 ? 331 GLY A CA    1 
ATOM   2695  C  C     . GLY A 1 351 ? 32.477  28.129  7.942   1.00 106.18 ? 331 GLY A C     1 
ATOM   2696  O  O     . GLY A 1 351 ? 33.279  27.705  8.778   1.00 107.48 ? 331 GLY A O     1 
ATOM   2697  N  N     . THR A 1 352 ? 32.716  29.187  7.171   1.00 104.65 ? 332 THR A N     1 
ATOM   2698  C  CA    . THR A 1 352 ? 33.921  30.008  7.308   1.00 102.82 ? 332 THR A CA    1 
ATOM   2699  C  C     . THR A 1 352 ? 33.753  31.050  8.408   1.00 103.07 ? 332 THR A C     1 
ATOM   2700  O  O     . THR A 1 352 ? 34.639  31.225  9.246   1.00 103.80 ? 332 THR A O     1 
ATOM   2701  C  CB    . THR A 1 352 ? 34.243  30.747  6.000   1.00 101.44 ? 332 THR A CB    1 
ATOM   2702  O  OG1   . THR A 1 352 ? 33.099  31.506  5.589   1.00 99.77  ? 332 THR A OG1   1 
ATOM   2703  C  CG2   . THR A 1 352 ? 34.619  29.760  4.906   1.00 101.78 ? 332 THR A CG2   1 
ATOM   2704  N  N     . GLY A 1 353 ? 32.609  31.733  8.392   1.00 104.39 ? 333 GLY A N     1 
ATOM   2705  C  CA    . GLY A 1 353 ? 32.335  32.858  9.291   1.00 105.16 ? 333 GLY A CA    1 
ATOM   2706  C  C     . GLY A 1 353 ? 31.407  33.876  8.652   1.00 105.67 ? 333 GLY A C     1 
ATOM   2707  O  O     . GLY A 1 353 ? 30.513  34.407  9.311   1.00 104.25 ? 333 GLY A O     1 
ATOM   2708  N  N     . ALA A 1 354 ? 31.639  34.149  7.367   1.00 107.76 ? 334 ALA A N     1 
ATOM   2709  C  CA    . ALA A 1 354 ? 30.798  35.037  6.562   1.00 108.67 ? 334 ALA A CA    1 
ATOM   2710  C  C     . ALA A 1 354 ? 29.926  34.233  5.594   1.00 108.58 ? 334 ALA A C     1 
ATOM   2711  O  O     . ALA A 1 354 ? 30.192  33.054  5.335   1.00 107.83 ? 334 ALA A O     1 
ATOM   2712  C  CB    . ALA A 1 354 ? 31.672  36.019  5.798   1.00 109.66 ? 334 ALA A CB    1 
ATOM   2713  N  N     . VAL A 1 355 ? 28.891  34.887  5.068   1.00 108.42 ? 335 VAL A N     1 
ATOM   2714  C  CA    . VAL A 1 355 ? 27.927  34.266  4.146   1.00 109.05 ? 335 VAL A CA    1 
ATOM   2715  C  C     . VAL A 1 355 ? 27.639  35.160  2.943   1.00 110.99 ? 335 VAL A C     1 
ATOM   2716  O  O     . VAL A 1 355 ? 27.969  36.349  2.949   1.00 112.70 ? 335 VAL A O     1 
ATOM   2717  C  CB    . VAL A 1 355 ? 26.590  33.927  4.846   1.00 108.86 ? 335 VAL A CB    1 
ATOM   2718  C  CG1   . VAL A 1 355 ? 26.802  32.853  5.896   1.00 110.44 ? 335 VAL A CG1   1 
ATOM   2719  C  CG2   . VAL A 1 355 ? 25.945  35.156  5.476   1.00 107.79 ? 335 VAL A CG2   1 
ATOM   2720  N  N     . MET A 1 356 ? 27.018  34.572  1.922   1.00 112.39 ? 336 MET A N     1 
ATOM   2721  C  CA    . MET A 1 356 ? 26.512  35.321  0.763   1.00 113.84 ? 336 MET A CA    1 
ATOM   2722  C  C     . MET A 1 356 ? 24.996  35.488  0.895   1.00 112.77 ? 336 MET A C     1 
ATOM   2723  O  O     . MET A 1 356 ? 24.216  34.669  0.404   1.00 113.43 ? 336 MET A O     1 
ATOM   2724  C  CB    . MET A 1 356 ? 26.896  34.661  -0.573  1.00 115.96 ? 336 MET A CB    1 
ATOM   2725  C  CG    . MET A 1 356 ? 26.656  33.160  -0.687  1.00 118.31 ? 336 MET A CG    1 
ATOM   2726  S  SD    . MET A 1 356 ? 26.272  32.650  -2.372  1.00 121.22 ? 336 MET A SD    1 
ATOM   2727  C  CE    . MET A 1 356 ? 24.595  33.244  -2.544  1.00 118.84 ? 336 MET A CE    1 
ATOM   2728  N  N     . ALA A 1 357 ? 24.594  36.562  1.571   1.00 111.71 ? 337 ALA A N     1 
ATOM   2729  C  CA    . ALA A 1 357 ? 23.187  36.812  1.880   1.00 112.04 ? 337 ALA A CA    1 
ATOM   2730  C  C     . ALA A 1 357 ? 22.381  37.175  0.630   1.00 112.17 ? 337 ALA A C     1 
ATOM   2731  O  O     . ALA A 1 357 ? 22.589  38.235  0.037   1.00 113.51 ? 337 ALA A O     1 
ATOM   2732  C  CB    . ALA A 1 357 ? 23.065  37.912  2.924   1.00 112.58 ? 337 ALA A CB    1 
ATOM   2733  N  N     . VAL A 1 358 ? 21.479  36.275  0.238   1.00 112.56 ? 338 VAL A N     1 
ATOM   2734  C  CA    . VAL A 1 358 ? 20.543  36.494  -0.862  1.00 112.61 ? 338 VAL A CA    1 
ATOM   2735  C  C     . VAL A 1 358 ? 19.168  36.706  -0.222  1.00 113.33 ? 338 VAL A C     1 
ATOM   2736  O  O     . VAL A 1 358 ? 18.498  35.733  0.136   1.00 113.12 ? 338 VAL A O     1 
ATOM   2737  C  CB    . VAL A 1 358 ? 20.514  35.287  -1.829  1.00 112.39 ? 338 VAL A CB    1 
ATOM   2738  C  CG1   . VAL A 1 358 ? 19.475  35.487  -2.928  1.00 112.52 ? 338 VAL A CG1   1 
ATOM   2739  C  CG2   . VAL A 1 358 ? 21.888  35.065  -2.438  1.00 112.14 ? 338 VAL A CG2   1 
ATOM   2740  N  N     . PRO A 1 359 ? 18.750  37.978  -0.058  1.00 114.02 ? 339 PRO A N     1 
ATOM   2741  C  CA    . PRO A 1 359 ? 17.516  38.264  0.682   1.00 113.79 ? 339 PRO A CA    1 
ATOM   2742  C  C     . PRO A 1 359 ? 16.233  37.847  -0.037  1.00 112.68 ? 339 PRO A C     1 
ATOM   2743  O  O     . PRO A 1 359 ? 15.254  37.511  0.624   1.00 112.89 ? 339 PRO A O     1 
ATOM   2744  C  CB    . PRO A 1 359 ? 17.566  39.783  0.865   1.00 114.49 ? 339 PRO A CB    1 
ATOM   2745  C  CG    . PRO A 1 359 ? 18.324  40.266  -0.316  1.00 115.17 ? 339 PRO A CG    1 
ATOM   2746  C  CD    . PRO A 1 359 ? 19.348  39.209  -0.611  1.00 114.49 ? 339 PRO A CD    1 
ATOM   2747  N  N     . GLY A 1 360 ? 16.242  37.861  -1.369  1.00 112.72 ? 340 GLY A N     1 
ATOM   2748  C  CA    . GLY A 1 360 ? 15.078  37.464  -2.158  1.00 114.69 ? 340 GLY A CA    1 
ATOM   2749  C  C     . GLY A 1 360 ? 14.653  36.005  -2.051  1.00 115.77 ? 340 GLY A C     1 
ATOM   2750  O  O     . GLY A 1 360 ? 13.483  35.692  -2.291  1.00 114.63 ? 340 GLY A O     1 
ATOM   2751  N  N     . HIS A 1 361 ? 15.590  35.116  -1.705  1.00 116.97 ? 341 HIS A N     1 
ATOM   2752  C  CA    . HIS A 1 361 ? 15.328  33.667  -1.631  1.00 117.34 ? 341 HIS A CA    1 
ATOM   2753  C  C     . HIS A 1 361 ? 15.900  33.033  -0.357  1.00 116.84 ? 341 HIS A C     1 
ATOM   2754  O  O     . HIS A 1 361 ? 16.513  31.962  -0.395  1.00 116.32 ? 341 HIS A O     1 
ATOM   2755  C  CB    . HIS A 1 361 ? 15.870  32.981  -2.891  1.00 117.74 ? 341 HIS A CB    1 
ATOM   2756  C  CG    . HIS A 1 361 ? 15.361  33.590  -4.159  1.00 118.04 ? 341 HIS A CG    1 
ATOM   2757  N  ND1   . HIS A 1 361 ? 14.181  33.197  -4.751  1.00 118.99 ? 341 HIS A ND1   1 
ATOM   2758  C  CD2   . HIS A 1 361 ? 15.846  34.600  -4.918  1.00 117.83 ? 341 HIS A CD2   1 
ATOM   2759  C  CE1   . HIS A 1 361 ? 13.970  33.926  -5.832  1.00 118.62 ? 341 HIS A CE1   1 
ATOM   2760  N  NE2   . HIS A 1 361 ? 14.965  34.785  -5.954  1.00 118.24 ? 341 HIS A NE2   1 
ATOM   2761  N  N     . ASP A 1 362 ? 15.686  33.711  0.769   1.00 116.82 ? 342 ASP A N     1 
ATOM   2762  C  CA    . ASP A 1 362 ? 16.031  33.194  2.093   1.00 117.06 ? 342 ASP A CA    1 
ATOM   2763  C  C     . ASP A 1 362 ? 15.249  33.998  3.132   1.00 117.65 ? 342 ASP A C     1 
ATOM   2764  O  O     . ASP A 1 362 ? 15.365  35.224  3.179   1.00 117.47 ? 342 ASP A O     1 
ATOM   2765  C  CB    . ASP A 1 362 ? 17.538  33.318  2.345   1.00 117.04 ? 342 ASP A CB    1 
ATOM   2766  C  CG    . ASP A 1 362 ? 18.029  32.406  3.459   1.00 117.01 ? 342 ASP A CG    1 
ATOM   2767  O  OD1   . ASP A 1 362 ? 17.813  31.178  3.371   1.00 116.91 ? 342 ASP A OD1   1 
ATOM   2768  O  OD2   . ASP A 1 362 ? 18.651  32.913  4.415   1.00 117.60 ? 342 ASP A OD2   1 
ATOM   2769  N  N     . GLN A 1 363 ? 14.452  33.310  3.950   1.00 119.27 ? 343 GLN A N     1 
ATOM   2770  C  CA    . GLN A 1 363 ? 13.543  33.973  4.896   1.00 120.97 ? 343 GLN A CA    1 
ATOM   2771  C  C     . GLN A 1 363 ? 14.280  34.690  6.035   1.00 121.96 ? 343 GLN A C     1 
ATOM   2772  O  O     . GLN A 1 363 ? 13.794  35.699  6.551   1.00 122.58 ? 343 GLN A O     1 
ATOM   2773  C  CB    . GLN A 1 363 ? 12.533  32.965  5.470   1.00 121.12 ? 343 GLN A CB    1 
ATOM   2774  C  CG    . GLN A 1 363 ? 11.293  33.590  6.105   1.00 121.15 ? 343 GLN A CG    1 
ATOM   2775  C  CD    . GLN A 1 363 ? 10.429  34.358  5.114   1.00 120.86 ? 343 GLN A CD    1 
ATOM   2776  O  OE1   . GLN A 1 363 ? 10.295  33.971  3.952   1.00 120.27 ? 343 GLN A OE1   1 
ATOM   2777  N  NE2   . GLN A 1 363 ? 9.836   35.453  5.575   1.00 121.10 ? 343 GLN A NE2   1 
ATOM   2778  N  N     . ARG A 1 364 ? 15.445  34.167  6.416   1.00 122.98 ? 344 ARG A N     1 
ATOM   2779  C  CA    . ARG A 1 364 ? 16.292  34.786  7.440   1.00 124.01 ? 344 ARG A CA    1 
ATOM   2780  C  C     . ARG A 1 364 ? 16.932  36.085  6.931   1.00 123.11 ? 344 ARG A C     1 
ATOM   2781  O  O     . ARG A 1 364 ? 16.960  37.088  7.648   1.00 121.05 ? 344 ARG A O     1 
ATOM   2782  C  CB    . ARG A 1 364 ? 17.376  33.798  7.886   1.00 126.36 ? 344 ARG A CB    1 
ATOM   2783  C  CG    . ARG A 1 364 ? 18.095  34.168  9.174   1.00 127.86 ? 344 ARG A CG    1 
ATOM   2784  C  CD    . ARG A 1 364 ? 19.025  33.043  9.609   1.00 129.09 ? 344 ARG A CD    1 
ATOM   2785  N  NE    . ARG A 1 364 ? 20.074  32.791  8.618   1.00 131.19 ? 344 ARG A NE    1 
ATOM   2786  C  CZ    . ARG A 1 364 ? 20.918  31.757  8.628   1.00 131.43 ? 344 ARG A CZ    1 
ATOM   2787  N  NH1   . ARG A 1 364 ? 20.871  30.832  9.589   1.00 130.88 ? 344 ARG A NH1   1 
ATOM   2788  N  NH2   . ARG A 1 364 ? 21.824  31.644  7.659   1.00 131.75 ? 344 ARG A NH2   1 
ATOM   2789  N  N     . ASP A 1 365 ? 17.433  36.054  5.695   1.00 123.79 ? 345 ASP A N     1 
ATOM   2790  C  CA    . ASP A 1 365 ? 18.057  37.226  5.058   1.00 122.69 ? 345 ASP A CA    1 
ATOM   2791  C  C     . ASP A 1 365 ? 17.038  38.288  4.617   1.00 123.85 ? 345 ASP A C     1 
ATOM   2792  O  O     . ASP A 1 365 ? 17.371  39.475  4.563   1.00 122.83 ? 345 ASP A O     1 
ATOM   2793  C  CB    . ASP A 1 365 ? 18.899  36.807  3.842   1.00 119.54 ? 345 ASP A CB    1 
ATOM   2794  C  CG    . ASP A 1 365 ? 20.021  35.834  4.194   1.00 117.39 ? 345 ASP A CG    1 
ATOM   2795  O  OD1   . ASP A 1 365 ? 20.491  35.826  5.352   1.00 116.58 ? 345 ASP A OD1   1 
ATOM   2796  O  OD2   . ASP A 1 365 ? 20.436  35.075  3.294   1.00 114.60 ? 345 ASP A OD2   1 
ATOM   2797  N  N     . TYR A 1 366 ? 15.816  37.859  4.287   1.00 126.32 ? 346 TYR A N     1 
ATOM   2798  C  CA    . TYR A 1 366 ? 14.728  38.771  3.895   1.00 127.94 ? 346 TYR A CA    1 
ATOM   2799  C  C     . TYR A 1 366 ? 14.331  39.715  5.031   1.00 128.85 ? 346 TYR A C     1 
ATOM   2800  O  O     . TYR A 1 366 ? 14.138  40.913  4.812   1.00 127.78 ? 346 TYR A O     1 
ATOM   2801  C  CB    . TYR A 1 366 ? 13.495  37.977  3.439   1.00 128.71 ? 346 TYR A CB    1 
ATOM   2802  C  CG    . TYR A 1 366 ? 12.390  38.827  2.841   1.00 129.55 ? 346 TYR A CG    1 
ATOM   2803  C  CD1   . TYR A 1 366 ? 12.425  39.210  1.497   1.00 129.69 ? 346 TYR A CD1   1 
ATOM   2804  C  CD2   . TYR A 1 366 ? 11.306  39.246  3.615   1.00 130.14 ? 346 TYR A CD2   1 
ATOM   2805  C  CE1   . TYR A 1 366 ? 11.416  39.987  0.944   1.00 129.48 ? 346 TYR A CE1   1 
ATOM   2806  C  CE2   . TYR A 1 366 ? 10.293  40.025  3.070   1.00 130.45 ? 346 TYR A CE2   1 
ATOM   2807  C  CZ    . TYR A 1 366 ? 10.352  40.392  1.735   1.00 130.04 ? 346 TYR A CZ    1 
ATOM   2808  O  OH    . TYR A 1 366 ? 9.353   41.161  1.188   1.00 129.87 ? 346 TYR A OH    1 
ATOM   2809  N  N     . GLU A 1 367 ? 14.202  39.158  6.234   1.00 131.11 ? 347 GLU A N     1 
ATOM   2810  C  CA    . GLU A 1 367 ? 13.881  39.937  7.437   1.00 132.37 ? 347 GLU A CA    1 
ATOM   2811  C  C     . GLU A 1 367 ? 15.006  40.905  7.828   1.00 132.60 ? 347 GLU A C     1 
ATOM   2812  O  O     . GLU A 1 367 ? 14.738  41.971  8.386   1.00 133.61 ? 347 GLU A O     1 
ATOM   2813  C  CB    . GLU A 1 367 ? 13.554  39.002  8.608   1.00 132.69 ? 347 GLU A CB    1 
ATOM   2814  C  CG    . GLU A 1 367 ? 12.263  38.212  8.418   1.00 132.68 ? 347 GLU A CG    1 
ATOM   2815  C  CD    . GLU A 1 367 ? 12.072  37.090  9.428   1.00 133.15 ? 347 GLU A CD    1 
ATOM   2816  O  OE1   . GLU A 1 367 ? 12.913  36.926  10.340  1.00 133.79 ? 347 GLU A OE1   1 
ATOM   2817  O  OE2   . GLU A 1 367 ? 11.065  36.360  9.307   1.00 132.67 ? 347 GLU A OE2   1 
ATOM   2818  N  N     . PHE A 1 368 ? 16.253  40.528  7.536   1.00 131.27 ? 348 PHE A N     1 
ATOM   2819  C  CA    . PHE A 1 368 ? 17.409  41.408  7.738   1.00 129.83 ? 348 PHE A CA    1 
ATOM   2820  C  C     . PHE A 1 368 ? 17.428  42.549  6.719   1.00 130.69 ? 348 PHE A C     1 
ATOM   2821  O  O     . PHE A 1 368 ? 17.645  43.705  7.086   1.00 132.70 ? 348 PHE A O     1 
ATOM   2822  C  CB    . PHE A 1 368 ? 18.714  40.611  7.650   1.00 128.51 ? 348 PHE A CB    1 
ATOM   2823  C  CG    . PHE A 1 368 ? 19.918  41.366  8.138   1.00 127.85 ? 348 PHE A CG    1 
ATOM   2824  C  CD1   . PHE A 1 368 ? 20.195  41.448  9.499   1.00 127.46 ? 348 PHE A CD1   1 
ATOM   2825  C  CD2   . PHE A 1 368 ? 20.778  41.997  7.242   1.00 127.99 ? 348 PHE A CD2   1 
ATOM   2826  C  CE1   . PHE A 1 368 ? 21.307  42.142  9.958   1.00 128.15 ? 348 PHE A CE1   1 
ATOM   2827  C  CE2   . PHE A 1 368 ? 21.890  42.693  7.694   1.00 128.48 ? 348 PHE A CE2   1 
ATOM   2828  C  CZ    . PHE A 1 368 ? 22.155  42.766  9.055   1.00 128.35 ? 348 PHE A CZ    1 
ATOM   2829  N  N     . ALA A 1 369 ? 17.206  42.216  5.448   1.00 130.70 ? 349 ALA A N     1 
ATOM   2830  C  CA    . ALA A 1 369 ? 17.177  43.209  4.365   1.00 130.96 ? 349 ALA A CA    1 
ATOM   2831  C  C     . ALA A 1 369 ? 15.977  44.162  4.454   1.00 131.53 ? 349 ALA A C     1 
ATOM   2832  O  O     . ALA A 1 369 ? 16.106  45.350  4.145   1.00 132.54 ? 349 ALA A O     1 
ATOM   2833  C  CB    . ALA A 1 369 ? 17.198  42.516  3.010   1.00 130.68 ? 349 ALA A CB    1 
ATOM   2834  N  N     . SER A 1 370 ? 14.821  43.640  4.866   1.00 130.83 ? 350 SER A N     1 
ATOM   2835  C  CA    . SER A 1 370 ? 13.611  44.455  5.051   1.00 129.76 ? 350 SER A CA    1 
ATOM   2836  C  C     . SER A 1 370 ? 13.714  45.425  6.235   1.00 128.40 ? 350 SER A C     1 
ATOM   2837  O  O     . SER A 1 370 ? 13.178  46.533  6.171   1.00 127.37 ? 350 SER A O     1 
ATOM   2838  C  CB    . SER A 1 370 ? 12.379  43.560  5.229   1.00 130.19 ? 350 SER A CB    1 
ATOM   2839  O  OG    . SER A 1 370 ? 12.142  42.781  4.069   1.00 130.25 ? 350 SER A OG    1 
ATOM   2840  N  N     . LYS A 1 371 ? 14.392  45.002  7.305   1.00 127.80 ? 351 LYS A N     1 
ATOM   2841  C  CA    . LYS A 1 371 ? 14.589  45.836  8.497   1.00 127.08 ? 351 LYS A CA    1 
ATOM   2842  C  C     . LYS A 1 371 ? 15.503  47.026  8.204   1.00 126.44 ? 351 LYS A C     1 
ATOM   2843  O  O     . LYS A 1 371 ? 15.120  48.176  8.425   1.00 127.96 ? 351 LYS A O     1 
ATOM   2844  C  CB    . LYS A 1 371 ? 15.170  45.001  9.649   1.00 127.05 ? 351 LYS A CB    1 
ATOM   2845  C  CG    . LYS A 1 371 ? 15.314  45.742  10.973  1.00 127.02 ? 351 LYS A CG    1 
ATOM   2846  C  CD    . LYS A 1 371 ? 15.871  44.838  12.059  1.00 126.97 ? 351 LYS A CD    1 
ATOM   2847  C  CE    . LYS A 1 371 ? 16.218  45.626  13.312  1.00 126.61 ? 351 LYS A CE    1 
ATOM   2848  N  NZ    . LYS A 1 371 ? 16.858  44.772  14.348  1.00 126.18 ? 351 LYS A NZ    1 
ATOM   2849  N  N     . TYR A 1 372 ? 16.703  46.733  7.705   1.00 124.57 ? 352 TYR A N     1 
ATOM   2850  C  CA    . TYR A 1 372 ? 17.720  47.759  7.426   1.00 123.59 ? 352 TYR A CA    1 
ATOM   2851  C  C     . TYR A 1 372 ? 17.617  48.401  6.033   1.00 123.20 ? 352 TYR A C     1 
ATOM   2852  O  O     . TYR A 1 372 ? 18.387  49.312  5.718   1.00 122.08 ? 352 TYR A O     1 
ATOM   2853  C  CB    . TYR A 1 372 ? 19.121  47.180  7.656   1.00 122.83 ? 352 TYR A CB    1 
ATOM   2854  C  CG    . TYR A 1 372 ? 19.380  46.863  9.109   1.00 122.94 ? 352 TYR A CG    1 
ATOM   2855  C  CD1   . TYR A 1 372 ? 19.891  47.833  9.972   1.00 124.18 ? 352 TYR A CD1   1 
ATOM   2856  C  CD2   . TYR A 1 372 ? 19.090  45.603  9.633   1.00 121.88 ? 352 TYR A CD2   1 
ATOM   2857  C  CE1   . TYR A 1 372 ? 20.119  47.553  11.312  1.00 124.69 ? 352 TYR A CE1   1 
ATOM   2858  C  CE2   . TYR A 1 372 ? 19.316  45.312  10.971  1.00 122.84 ? 352 TYR A CE2   1 
ATOM   2859  C  CZ    . TYR A 1 372 ? 19.830  46.289  11.807  1.00 124.11 ? 352 TYR A CZ    1 
ATOM   2860  O  OH    . TYR A 1 372 ? 20.057  46.007  13.134  1.00 124.70 ? 352 TYR A OH    1 
ATOM   2861  N  N     . GLY A 1 373 ? 16.675  47.937  5.210   1.00 124.15 ? 353 GLY A N     1 
ATOM   2862  C  CA    . GLY A 1 373 ? 16.400  48.553  3.912   1.00 125.24 ? 353 GLY A CA    1 
ATOM   2863  C  C     . GLY A 1 373 ? 17.474  48.301  2.870   1.00 126.17 ? 353 GLY A C     1 
ATOM   2864  O  O     . GLY A 1 373 ? 17.852  49.215  2.133   1.00 125.80 ? 353 GLY A O     1 
ATOM   2865  N  N     . LEU A 1 374 ? 17.960  47.062  2.812   1.00 127.36 ? 354 LEU A N     1 
ATOM   2866  C  CA    . LEU A 1 374 ? 18.967  46.652  1.831   1.00 127.72 ? 354 LEU A CA    1 
ATOM   2867  C  C     . LEU A 1 374 ? 18.296  46.233  0.526   1.00 127.25 ? 354 LEU A C     1 
ATOM   2868  O  O     . LEU A 1 374 ? 17.084  46.000  0.485   1.00 126.41 ? 354 LEU A O     1 
ATOM   2869  C  CB    . LEU A 1 374 ? 19.820  45.503  2.379   1.00 127.94 ? 354 LEU A CB    1 
ATOM   2870  C  CG    . LEU A 1 374 ? 20.636  45.825  3.637   1.00 128.75 ? 354 LEU A CG    1 
ATOM   2871  C  CD1   . LEU A 1 374 ? 21.169  44.557  4.288   1.00 129.20 ? 354 LEU A CD1   1 
ATOM   2872  C  CD2   . LEU A 1 374 ? 21.777  46.780  3.317   1.00 128.52 ? 354 LEU A CD2   1 
ATOM   2873  N  N     . ASN A 1 375 ? 19.097  46.139  -0.533  1.00 126.80 ? 355 ASN A N     1 
ATOM   2874  C  CA    . ASN A 1 375 ? 18.591  45.823  -1.870  1.00 126.49 ? 355 ASN A CA    1 
ATOM   2875  C  C     . ASN A 1 375 ? 18.128  44.364  -1.944  1.00 125.09 ? 355 ASN A C     1 
ATOM   2876  O  O     . ASN A 1 375 ? 18.799  43.472  -1.420  1.00 123.80 ? 355 ASN A O     1 
ATOM   2877  C  CB    . ASN A 1 375 ? 19.667  46.095  -2.928  1.00 127.46 ? 355 ASN A CB    1 
ATOM   2878  C  CG    . ASN A 1 375 ? 19.114  46.098  -4.344  1.00 128.49 ? 355 ASN A CG    1 
ATOM   2879  O  OD1   . ASN A 1 375 ? 18.129  46.775  -4.637  1.00 129.09 ? 355 ASN A OD1   1 
ATOM   2880  N  ND2   . ASN A 1 375 ? 19.755  45.346  -5.232  1.00 129.33 ? 355 ASN A ND2   1 
ATOM   2881  N  N     . ILE A 1 376 ? 16.980  44.145  -2.588  1.00 123.87 ? 356 ILE A N     1 
ATOM   2882  C  CA    . ILE A 1 376 ? 16.373  42.817  -2.733  1.00 122.53 ? 356 ILE A CA    1 
ATOM   2883  C  C     . ILE A 1 376 ? 16.304  42.463  -4.223  1.00 121.35 ? 356 ILE A C     1 
ATOM   2884  O  O     . ILE A 1 376 ? 15.398  42.909  -4.930  1.00 120.14 ? 356 ILE A O     1 
ATOM   2885  C  CB    . ILE A 1 376 ? 14.964  42.767  -2.084  1.00 121.42 ? 356 ILE A CB    1 
ATOM   2886  C  CG1   . ILE A 1 376 ? 15.062  43.032  -0.573  1.00 120.73 ? 356 ILE A CG1   1 
ATOM   2887  C  CG2   . ILE A 1 376 ? 14.291  41.418  -2.340  1.00 120.49 ? 356 ILE A CG2   1 
ATOM   2888  C  CD1   . ILE A 1 376 ? 13.762  43.468  0.069   1.00 120.32 ? 356 ILE A CD1   1 
ATOM   2889  N  N     . LYS A 1 377 ? 17.269  41.662  -4.681  1.00 120.24 ? 357 LYS A N     1 
ATOM   2890  C  CA    . LYS A 1 377 ? 17.397  41.274  -6.090  1.00 120.04 ? 357 LYS A CA    1 
ATOM   2891  C  C     . LYS A 1 377 ? 16.829  39.861  -6.324  1.00 119.95 ? 357 LYS A C     1 
ATOM   2892  O  O     . LYS A 1 377 ? 17.360  38.897  -5.764  1.00 120.54 ? 357 LYS A O     1 
ATOM   2893  C  CB    . LYS A 1 377 ? 18.873  41.319  -6.504  1.00 119.58 ? 357 LYS A CB    1 
ATOM   2894  C  CG    . LYS A 1 377 ? 19.131  41.064  -7.982  1.00 119.25 ? 357 LYS A CG    1 
ATOM   2895  C  CD    . LYS A 1 377 ? 20.587  41.304  -8.344  1.00 118.99 ? 357 LYS A CD    1 
ATOM   2896  C  CE    . LYS A 1 377 ? 20.885  40.852  -9.764  1.00 119.32 ? 357 LYS A CE    1 
ATOM   2897  N  NZ    . LYS A 1 377 ? 22.326  40.991  -10.112 1.00 119.29 ? 357 LYS A NZ    1 
ATOM   2898  N  N     . PRO A 1 378 ? 15.752  39.730  -7.143  1.00 118.48 ? 358 PRO A N     1 
ATOM   2899  C  CA    . PRO A 1 378 ? 15.267  38.394  -7.517  1.00 117.38 ? 358 PRO A CA    1 
ATOM   2900  C  C     . PRO A 1 378 ? 16.018  37.818  -8.721  1.00 117.53 ? 358 PRO A C     1 
ATOM   2901  O  O     . PRO A 1 378 ? 16.185  38.517  -9.725  1.00 116.93 ? 358 PRO A O     1 
ATOM   2902  C  CB    . PRO A 1 378 ? 13.788  38.630  -7.876  1.00 116.43 ? 358 PRO A CB    1 
ATOM   2903  C  CG    . PRO A 1 378 ? 13.572  40.107  -7.879  1.00 116.02 ? 358 PRO A CG    1 
ATOM   2904  C  CD    . PRO A 1 378 ? 14.899  40.783  -7.722  1.00 117.25 ? 358 PRO A CD    1 
ATOM   2905  N  N     . VAL A 1 379 ? 16.463  36.564  -8.606  1.00 118.08 ? 359 VAL A N     1 
ATOM   2906  C  CA    . VAL A 1 379 ? 17.132  35.843  -9.711  1.00 119.07 ? 359 VAL A CA    1 
ATOM   2907  C  C     . VAL A 1 379 ? 16.539  34.472  -10.098 1.00 120.53 ? 359 VAL A C     1 
ATOM   2908  O  O     . VAL A 1 379 ? 16.792  33.998  -11.206 1.00 121.82 ? 359 VAL A O     1 
ATOM   2909  C  CB    . VAL A 1 379 ? 18.652  35.681  -9.452  1.00 118.12 ? 359 VAL A CB    1 
ATOM   2910  C  CG1   . VAL A 1 379 ? 19.354  37.028  -9.558  1.00 117.78 ? 359 VAL A CG1   1 
ATOM   2911  C  CG2   . VAL A 1 379 ? 18.929  35.036  -8.099  1.00 118.34 ? 359 VAL A CG2   1 
ATOM   2912  N  N     . ILE A 1 380 ? 15.767  33.842  -9.210  1.00 120.25 ? 360 ILE A N     1 
ATOM   2913  C  CA    . ILE A 1 380 ? 15.166  32.528  -9.470  1.00 119.02 ? 360 ILE A CA    1 
ATOM   2914  C  C     . ILE A 1 380 ? 13.698  32.715  -9.864  1.00 118.15 ? 360 ILE A C     1 
ATOM   2915  O  O     . ILE A 1 380 ? 12.938  33.362  -9.139  1.00 117.70 ? 360 ILE A O     1 
ATOM   2916  C  CB    . ILE A 1 380 ? 15.241  31.596  -8.230  1.00 119.81 ? 360 ILE A CB    1 
ATOM   2917  C  CG1   . ILE A 1 380 ? 16.633  31.623  -7.572  1.00 120.11 ? 360 ILE A CG1   1 
ATOM   2918  C  CG2   . ILE A 1 380 ? 14.862  30.165  -8.601  1.00 120.66 ? 360 ILE A CG2   1 
ATOM   2919  C  CD1   . ILE A 1 380 ? 17.767  31.129  -8.448  1.00 120.35 ? 360 ILE A CD1   1 
ATOM   2920  N  N     . LEU A 1 381 ? 13.311  32.152  -11.010 1.00 116.86 ? 361 LEU A N     1 
ATOM   2921  C  CA    . LEU A 1 381 ? 11.914  32.163  -11.461 1.00 114.63 ? 361 LEU A CA    1 
ATOM   2922  C  C     . LEU A 1 381 ? 11.062  31.215  -10.620 1.00 112.96 ? 361 LEU A C     1 
ATOM   2923  O  O     . LEU A 1 381 ? 11.578  30.286  -9.996  1.00 113.46 ? 361 LEU A O     1 
ATOM   2924  C  CB    . LEU A 1 381 ? 11.806  31.759  -12.941 1.00 114.66 ? 361 LEU A CB    1 
ATOM   2925  C  CG    . LEU A 1 381 ? 12.412  32.690  -13.998 1.00 114.90 ? 361 LEU A CG    1 
ATOM   2926  C  CD1   . LEU A 1 381 ? 12.469  32.008  -15.358 1.00 113.99 ? 361 LEU A CD1   1 
ATOM   2927  C  CD2   . LEU A 1 381 ? 11.628  33.992  -14.090 1.00 115.48 ? 361 LEU A CD2   1 
ATOM   2928  N  N     . ALA A 1 382 ? 9.753   31.455  -10.623 1.00 112.48 ? 362 ALA A N     1 
ATOM   2929  C  CA    . ALA A 1 382 ? 8.790   30.584  -9.943  1.00 112.43 ? 362 ALA A CA    1 
ATOM   2930  C  C     . ALA A 1 382 ? 8.570   29.288  -10.739 1.00 112.20 ? 362 ALA A C     1 
ATOM   2931  O  O     . ALA A 1 382 ? 9.165   29.096  -11.804 1.00 113.62 ? 362 ALA A O     1 
ATOM   2932  C  CB    . ALA A 1 382 ? 7.473   31.322  -9.739  1.00 112.65 ? 362 ALA A CB    1 
ATOM   2933  N  N     . ALA A 1 383 ? 7.724   28.401  -10.213 1.00 111.26 ? 363 ALA A N     1 
ATOM   2934  C  CA    . ALA A 1 383 ? 7.409   27.122  -10.867 1.00 111.17 ? 363 ALA A CA    1 
ATOM   2935  C  C     . ALA A 1 383 ? 6.815   27.282  -12.273 1.00 111.60 ? 363 ALA A C     1 
ATOM   2936  O  O     . ALA A 1 383 ? 7.152   26.515  -13.178 1.00 110.48 ? 363 ALA A O     1 
ATOM   2937  C  CB    . ALA A 1 383 ? 6.469   26.300  -9.994  1.00 111.08 ? 363 ALA A CB    1 
ATOM   2938  N  N     . ASP A 1 384 ? 5.950   28.284  -12.448 1.00 112.87 ? 364 ASP A N     1 
ATOM   2939  C  CA    . ASP A 1 384 ? 5.281   28.533  -13.739 1.00 113.85 ? 364 ASP A CA    1 
ATOM   2940  C  C     . ASP A 1 384 ? 6.145   29.214  -14.820 1.00 112.82 ? 364 ASP A C     1 
ATOM   2941  O  O     . ASP A 1 384 ? 5.708   29.325  -15.968 1.00 111.28 ? 364 ASP A O     1 
ATOM   2942  C  CB    . ASP A 1 384 ? 3.966   29.317  -13.534 1.00 115.00 ? 364 ASP A CB    1 
ATOM   2943  C  CG    . ASP A 1 384 ? 4.187   30.762  -13.093 1.00 116.28 ? 364 ASP A CG    1 
ATOM   2944  O  OD1   . ASP A 1 384 ? 5.168   31.035  -12.370 1.00 117.64 ? 364 ASP A OD1   1 
ATOM   2945  O  OD2   . ASP A 1 384 ? 3.362   31.625  -13.464 1.00 116.54 ? 364 ASP A OD2   1 
ATOM   2946  N  N     . GLY A 1 385 ? 7.346   29.669  -14.459 1.00 113.28 ? 365 GLY A N     1 
ATOM   2947  C  CA    . GLY A 1 385 ? 8.227   30.396  -15.379 1.00 114.10 ? 365 GLY A CA    1 
ATOM   2948  C  C     . GLY A 1 385 ? 8.029   31.905  -15.361 1.00 115.08 ? 365 GLY A C     1 
ATOM   2949  O  O     . GLY A 1 385 ? 8.574   32.609  -16.213 1.00 114.52 ? 365 GLY A O     1 
ATOM   2950  N  N     . SER A 1 386 ? 7.260   32.399  -14.387 1.00 116.91 ? 366 SER A N     1 
ATOM   2951  C  CA    . SER A 1 386 ? 6.995   33.827  -14.216 1.00 119.75 ? 366 SER A CA    1 
ATOM   2952  C  C     . SER A 1 386 ? 7.929   34.398  -13.152 1.00 121.68 ? 366 SER A C     1 
ATOM   2953  O  O     . SER A 1 386 ? 8.424   33.659  -12.296 1.00 123.88 ? 366 SER A O     1 
ATOM   2954  C  CB    . SER A 1 386 ? 5.537   34.039  -13.800 1.00 120.61 ? 366 SER A CB    1 
ATOM   2955  O  OG    . SER A 1 386 ? 5.202   35.415  -13.765 1.00 123.01 ? 366 SER A OG    1 
ATOM   2956  N  N     . GLU A 1 387 ? 8.161   35.710  -13.207 1.00 122.70 ? 367 GLU A N     1 
ATOM   2957  C  CA    . GLU A 1 387 ? 9.044   36.389  -12.248 1.00 122.43 ? 367 GLU A CA    1 
ATOM   2958  C  C     . GLU A 1 387 ? 8.389   36.462  -10.862 1.00 121.12 ? 367 GLU A C     1 
ATOM   2959  O  O     . GLU A 1 387 ? 7.169   36.620  -10.768 1.00 120.16 ? 367 GLU A O     1 
ATOM   2960  C  CB    . GLU A 1 387 ? 9.407   37.795  -12.737 1.00 123.56 ? 367 GLU A CB    1 
ATOM   2961  C  CG    . GLU A 1 387 ? 10.218  37.807  -14.026 1.00 124.38 ? 367 GLU A CG    1 
ATOM   2962  C  CD    . GLU A 1 387 ? 10.718  39.189  -14.417 1.00 124.45 ? 367 GLU A CD    1 
ATOM   2963  O  OE1   . GLU A 1 387 ? 10.226  40.198  -13.867 1.00 125.69 ? 367 GLU A OE1   1 
ATOM   2964  O  OE2   . GLU A 1 387 ? 11.613  39.265  -15.286 1.00 123.55 ? 367 GLU A OE2   1 
ATOM   2965  N  N     . PRO A 1 388 ? 9.196   36.357  -9.785  1.00 120.35 ? 368 PRO A N     1 
ATOM   2966  C  CA    . PRO A 1 388 ? 8.634   36.223  -8.440  1.00 120.32 ? 368 PRO A CA    1 
ATOM   2967  C  C     . PRO A 1 388 ? 8.079   37.525  -7.857  1.00 120.59 ? 368 PRO A C     1 
ATOM   2968  O  O     . PRO A 1 388 ? 8.478   38.617  -8.273  1.00 119.65 ? 368 PRO A O     1 
ATOM   2969  C  CB    . PRO A 1 388 ? 9.831   35.736  -7.620  1.00 120.12 ? 368 PRO A CB    1 
ATOM   2970  C  CG    . PRO A 1 388 ? 11.003  36.367  -8.284  1.00 120.06 ? 368 PRO A CG    1 
ATOM   2971  C  CD    . PRO A 1 388 ? 10.669  36.452  -9.749  1.00 119.93 ? 368 PRO A CD    1 
ATOM   2972  N  N     . ASP A 1 389 ? 7.163   37.382  -6.900  1.00 121.14 ? 369 ASP A N     1 
ATOM   2973  C  CA    . ASP A 1 389 ? 6.558   38.503  -6.181  1.00 122.21 ? 369 ASP A CA    1 
ATOM   2974  C  C     . ASP A 1 389 ? 7.129   38.532  -4.760  1.00 121.90 ? 369 ASP A C     1 
ATOM   2975  O  O     . ASP A 1 389 ? 6.683   37.778  -3.892  1.00 122.61 ? 369 ASP A O     1 
ATOM   2976  C  CB    . ASP A 1 389 ? 5.030   38.337  -6.162  1.00 123.33 ? 369 ASP A CB    1 
ATOM   2977  C  CG    . ASP A 1 389 ? 4.316   39.481  -5.454  1.00 124.26 ? 369 ASP A CG    1 
ATOM   2978  O  OD1   . ASP A 1 389 ? 4.668   40.656  -5.696  1.00 126.07 ? 369 ASP A OD1   1 
ATOM   2979  O  OD2   . ASP A 1 389 ? 3.388   39.202  -4.664  1.00 123.54 ? 369 ASP A OD2   1 
ATOM   2980  N  N     . LEU A 1 390 ? 8.115   39.404  -4.537  1.00 120.79 ? 370 LEU A N     1 
ATOM   2981  C  CA    . LEU A 1 390 ? 8.838   39.482  -3.260  1.00 120.58 ? 370 LEU A CA    1 
ATOM   2982  C  C     . LEU A 1 390 ? 8.503   40.760  -2.477  1.00 120.31 ? 370 LEU A C     1 
ATOM   2983  O  O     . LEU A 1 390 ? 9.399   41.463  -1.998  1.00 119.41 ? 370 LEU A O     1 
ATOM   2984  C  CB    . LEU A 1 390 ? 10.349  39.381  -3.509  1.00 120.83 ? 370 LEU A CB    1 
ATOM   2985  C  CG    . LEU A 1 390 ? 10.840  38.192  -4.342  1.00 120.72 ? 370 LEU A CG    1 
ATOM   2986  C  CD1   . LEU A 1 390 ? 12.346  38.283  -4.523  1.00 121.53 ? 370 LEU A CD1   1 
ATOM   2987  C  CD2   . LEU A 1 390 ? 10.456  36.863  -3.707  1.00 120.25 ? 370 LEU A CD2   1 
ATOM   2988  N  N     . SER A 1 391 ? 7.206   41.043  -2.347  1.00 120.61 ? 371 SER A N     1 
ATOM   2989  C  CA    . SER A 1 391 ? 6.712   42.152  -1.522  1.00 121.04 ? 371 SER A CA    1 
ATOM   2990  C  C     . SER A 1 391 ? 6.460   41.705  -0.079  1.00 123.06 ? 371 SER A C     1 
ATOM   2991  O  O     . SER A 1 391 ? 6.762   42.444  0.860   1.00 122.99 ? 371 SER A O     1 
ATOM   2992  C  CB    . SER A 1 391 ? 5.427   42.736  -2.117  1.00 119.00 ? 371 SER A CB    1 
ATOM   2993  O  OG    . SER A 1 391 ? 4.386   41.775  -2.143  1.00 117.62 ? 371 SER A OG    1 
ATOM   2994  N  N     . GLN A 1 392 ? 5.909   40.499  0.083   1.00 125.17 ? 372 GLN A N     1 
ATOM   2995  C  CA    . GLN A 1 392 ? 5.572   39.943  1.398   1.00 126.22 ? 372 GLN A CA    1 
ATOM   2996  C  C     . GLN A 1 392 ? 6.702   39.090  1.977   1.00 125.54 ? 372 GLN A C     1 
ATOM   2997  O  O     . GLN A 1 392 ? 7.132   39.317  3.110   1.00 125.78 ? 372 GLN A O     1 
ATOM   2998  C  CB    . GLN A 1 392 ? 4.298   39.093  1.304   1.00 127.78 ? 372 GLN A CB    1 
ATOM   2999  C  CG    . GLN A 1 392 ? 3.080   39.820  0.745   1.00 129.10 ? 372 GLN A CG    1 
ATOM   3000  C  CD    . GLN A 1 392 ? 2.642   40.999  1.598   1.00 130.69 ? 372 GLN A CD    1 
ATOM   3001  O  OE1   . GLN A 1 392 ? 2.598   40.911  2.825   1.00 132.45 ? 372 GLN A OE1   1 
ATOM   3002  N  NE2   . GLN A 1 392 ? 2.311   42.110  0.948   1.00 131.07 ? 372 GLN A NE2   1 
ATOM   3003  N  N     . GLN A 1 393 ? 7.167   38.113  1.198   1.00 124.75 ? 373 GLN A N     1 
ATOM   3004  C  CA    . GLN A 1 393 ? 8.153   37.128  1.666   1.00 124.50 ? 373 GLN A CA    1 
ATOM   3005  C  C     . GLN A 1 393 ? 9.109   36.672  0.559   1.00 124.35 ? 373 GLN A C     1 
ATOM   3006  O  O     . GLN A 1 393 ? 8.920   36.997  -0.617  1.00 125.26 ? 373 GLN A O     1 
ATOM   3007  C  CB    . GLN A 1 393 ? 7.433   35.914  2.270   1.00 124.38 ? 373 GLN A CB    1 
ATOM   3008  C  CG    . GLN A 1 393 ? 6.465   35.207  1.322   1.00 123.67 ? 373 GLN A CG    1 
ATOM   3009  C  CD    . GLN A 1 393 ? 5.784   34.000  1.944   1.00 123.80 ? 373 GLN A CD    1 
ATOM   3010  O  OE1   . GLN A 1 393 ? 6.167   33.529  3.016   1.00 124.92 ? 373 GLN A OE1   1 
ATOM   3011  N  NE2   . GLN A 1 393 ? 4.765   33.488  1.264   1.00 124.06 ? 373 GLN A NE2   1 
ATOM   3012  N  N     . ALA A 1 394 ? 10.133  35.918  0.957   1.00 122.61 ? 374 ALA A N     1 
ATOM   3013  C  CA    . ALA A 1 394 ? 11.111  35.345  0.027   1.00 119.94 ? 374 ALA A CA    1 
ATOM   3014  C  C     . ALA A 1 394 ? 10.566  34.093  -0.659  1.00 117.62 ? 374 ALA A C     1 
ATOM   3015  O  O     . ALA A 1 394 ? 9.588   33.497  -0.201  1.00 115.34 ? 374 ALA A O     1 
ATOM   3016  C  CB    . ALA A 1 394 ? 12.405  35.017  0.758   1.00 119.55 ? 374 ALA A CB    1 
ATOM   3017  N  N     . LEU A 1 395 ? 11.215  33.709  -1.758  1.00 117.15 ? 375 LEU A N     1 
ATOM   3018  C  CA    . LEU A 1 395 ? 10.889  32.490  -2.499  1.00 117.73 ? 375 LEU A CA    1 
ATOM   3019  C  C     . LEU A 1 395 ? 12.003  31.460  -2.292  1.00 119.21 ? 375 LEU A C     1 
ATOM   3020  O  O     . LEU A 1 395 ? 12.980  31.418  -3.045  1.00 120.10 ? 375 LEU A O     1 
ATOM   3021  C  CB    . LEU A 1 395 ? 10.693  32.809  -3.987  1.00 117.72 ? 375 LEU A CB    1 
ATOM   3022  C  CG    . LEU A 1 395 ? 10.322  31.656  -4.929  1.00 117.90 ? 375 LEU A CG    1 
ATOM   3023  C  CD1   . LEU A 1 395 ? 8.999   31.018  -4.531  1.00 117.65 ? 375 LEU A CD1   1 
ATOM   3024  C  CD2   . LEU A 1 395 ? 10.262  32.150  -6.366  1.00 118.03 ? 375 LEU A CD2   1 
ATOM   3025  N  N     . THR A 1 396 ? 11.843  30.639  -1.255  1.00 120.16 ? 376 THR A N     1 
ATOM   3026  C  CA    . THR A 1 396 ? 12.828  29.605  -0.902  1.00 120.13 ? 376 THR A CA    1 
ATOM   3027  C  C     . THR A 1 396 ? 12.989  28.476  -1.939  1.00 120.46 ? 376 THR A C     1 
ATOM   3028  O  O     . THR A 1 396 ? 14.044  27.840  -1.987  1.00 120.41 ? 376 THR A O     1 
ATOM   3029  C  CB    . THR A 1 396 ? 12.537  28.990  0.495   1.00 120.12 ? 376 THR A CB    1 
ATOM   3030  O  OG1   . THR A 1 396 ? 13.645  28.179  0.908   1.00 121.90 ? 376 THR A OG1   1 
ATOM   3031  C  CG2   . THR A 1 396 ? 11.255  28.141  0.503   1.00 119.85 ? 376 THR A CG2   1 
ATOM   3032  N  N     . GLU A 1 397 ? 11.961  28.235  -2.757  1.00 121.64 ? 377 GLU A N     1 
ATOM   3033  C  CA    . GLU A 1 397 ? 11.984  27.144  -3.748  1.00 121.89 ? 377 GLU A CA    1 
ATOM   3034  C  C     . GLU A 1 397 ? 13.023  27.354  -4.857  1.00 119.06 ? 377 GLU A C     1 
ATOM   3035  O  O     . GLU A 1 397 ? 13.453  28.481  -5.123  1.00 118.39 ? 377 GLU A O     1 
ATOM   3036  C  CB    . GLU A 1 397 ? 10.595  26.925  -4.380  1.00 124.19 ? 377 GLU A CB    1 
ATOM   3037  C  CG    . GLU A 1 397 ? 9.577   26.223  -3.484  1.00 126.14 ? 377 GLU A CG    1 
ATOM   3038  C  CD    . GLU A 1 397 ? 8.729   27.174  -2.651  1.00 128.52 ? 377 GLU A CD    1 
ATOM   3039  O  OE1   . GLU A 1 397 ? 9.247   28.221  -2.206  1.00 131.07 ? 377 GLU A OE1   1 
ATOM   3040  O  OE2   . GLU A 1 397 ? 7.537   26.868  -2.435  1.00 128.61 ? 377 GLU A OE2   1 
ATOM   3041  N  N     . LYS A 1 398 ? 13.405  26.245  -5.491  1.00 115.92 ? 378 LYS A N     1 
ATOM   3042  C  CA    . LYS A 1 398 ? 14.424  26.219  -6.544  1.00 113.96 ? 378 LYS A CA    1 
ATOM   3043  C  C     . LYS A 1 398 ? 13.762  26.162  -7.919  1.00 115.04 ? 378 LYS A C     1 
ATOM   3044  O  O     . LYS A 1 398 ? 12.716  25.529  -8.083  1.00 115.64 ? 378 LYS A O     1 
ATOM   3045  C  CB    . LYS A 1 398 ? 15.328  24.998  -6.361  1.00 110.94 ? 378 LYS A CB    1 
ATOM   3046  C  CG    . LYS A 1 398 ? 16.073  24.969  -5.033  1.00 108.84 ? 378 LYS A CG    1 
ATOM   3047  C  CD    . LYS A 1 398 ? 16.508  23.563  -4.654  1.00 107.15 ? 378 LYS A CD    1 
ATOM   3048  C  CE    . LYS A 1 398 ? 17.169  23.545  -3.287  1.00 105.98 ? 378 LYS A CE    1 
ATOM   3049  N  NZ    . LYS A 1 398 ? 17.473  22.162  -2.831  1.00 105.94 ? 378 LYS A NZ    1 
ATOM   3050  N  N     . GLY A 1 399 ? 14.376  26.820  -8.901  1.00 115.92 ? 379 GLY A N     1 
ATOM   3051  C  CA    . GLY A 1 399 ? 13.815  26.893  -10.253 1.00 117.06 ? 379 GLY A CA    1 
ATOM   3052  C  C     . GLY A 1 399 ? 14.773  27.428  -11.303 1.00 118.21 ? 379 GLY A C     1 
ATOM   3053  O  O     . GLY A 1 399 ? 15.995  27.331  -11.151 1.00 119.47 ? 379 GLY A O     1 
ATOM   3054  N  N     . VAL A 1 400 ? 14.206  27.997  -12.367 1.00 117.78 ? 380 VAL A N     1 
ATOM   3055  C  CA    . VAL A 1 400 ? 14.974  28.473  -13.523 1.00 117.41 ? 380 VAL A CA    1 
ATOM   3056  C  C     . VAL A 1 400 ? 15.526  29.874  -13.250 1.00 117.37 ? 380 VAL A C     1 
ATOM   3057  O  O     . VAL A 1 400 ? 14.859  30.692  -12.615 1.00 115.81 ? 380 VAL A O     1 
ATOM   3058  C  CB    . VAL A 1 400 ? 14.110  28.483  -14.809 1.00 117.67 ? 380 VAL A CB    1 
ATOM   3059  C  CG1   . VAL A 1 400 ? 14.910  28.979  -16.011 1.00 117.85 ? 380 VAL A CG1   1 
ATOM   3060  C  CG2   . VAL A 1 400 ? 13.555  27.092  -15.086 1.00 117.83 ? 380 VAL A CG2   1 
ATOM   3061  N  N     . LEU A 1 401 ? 16.736  30.145  -13.742 1.00 119.04 ? 381 LEU A N     1 
ATOM   3062  C  CA    . LEU A 1 401 ? 17.412  31.431  -13.511 1.00 119.04 ? 381 LEU A CA    1 
ATOM   3063  C  C     . LEU A 1 401 ? 16.985  32.523  -14.495 1.00 119.65 ? 381 LEU A C     1 
ATOM   3064  O  O     . LEU A 1 401 ? 16.664  32.248  -15.653 1.00 121.75 ? 381 LEU A O     1 
ATOM   3065  C  CB    . LEU A 1 401 ? 18.942  31.277  -13.574 1.00 118.37 ? 381 LEU A CB    1 
ATOM   3066  C  CG    . LEU A 1 401 ? 19.690  30.876  -12.299 1.00 117.53 ? 381 LEU A CG    1 
ATOM   3067  C  CD1   . LEU A 1 401 ? 21.117  30.485  -12.642 1.00 117.79 ? 381 LEU A CD1   1 
ATOM   3068  C  CD2   . LEU A 1 401 ? 19.693  32.002  -11.275 1.00 117.24 ? 381 LEU A CD2   1 
ATOM   3069  N  N     . PHE A 1 402 ? 16.991  33.761  -14.005 1.00 118.46 ? 382 PHE A N     1 
ATOM   3070  C  CA    . PHE A 1 402 ? 16.842  34.957  -14.838 1.00 117.26 ? 382 PHE A CA    1 
ATOM   3071  C  C     . PHE A 1 402 ? 17.521  36.134  -14.133 1.00 117.83 ? 382 PHE A C     1 
ATOM   3072  O  O     . PHE A 1 402 ? 17.849  36.037  -12.950 1.00 117.44 ? 382 PHE A O     1 
ATOM   3073  C  CB    . PHE A 1 402 ? 15.362  35.256  -15.113 1.00 116.55 ? 382 PHE A CB    1 
ATOM   3074  C  CG    . PHE A 1 402 ? 14.667  36.004  -14.005 1.00 116.46 ? 382 PHE A CG    1 
ATOM   3075  C  CD1   . PHE A 1 402 ? 14.380  35.377  -12.796 1.00 116.47 ? 382 PHE A CD1   1 
ATOM   3076  C  CD2   . PHE A 1 402 ? 14.297  37.337  -14.169 1.00 116.62 ? 382 PHE A CD2   1 
ATOM   3077  C  CE1   . PHE A 1 402 ? 13.738  36.063  -11.774 1.00 116.25 ? 382 PHE A CE1   1 
ATOM   3078  C  CE2   . PHE A 1 402 ? 13.657  38.027  -13.149 1.00 116.62 ? 382 PHE A CE2   1 
ATOM   3079  C  CZ    . PHE A 1 402 ? 13.376  37.390  -11.951 1.00 116.33 ? 382 PHE A CZ    1 
ATOM   3080  N  N     . ASN A 1 403 ? 17.735  37.232  -14.858 1.00 119.46 ? 383 ASN A N     1 
ATOM   3081  C  CA    . ASN A 1 403 ? 18.392  38.432  -14.311 1.00 119.75 ? 383 ASN A CA    1 
ATOM   3082  C  C     . ASN A 1 403 ? 19.778  38.090  -13.722 1.00 118.40 ? 383 ASN A C     1 
ATOM   3083  O  O     . ASN A 1 403 ? 20.151  38.563  -12.642 1.00 118.07 ? 383 ASN A O     1 
ATOM   3084  C  CB    . ASN A 1 403 ? 17.472  39.095  -13.263 1.00 119.87 ? 383 ASN A CB    1 
ATOM   3085  C  CG    . ASN A 1 403 ? 17.775  40.571  -13.040 1.00 120.20 ? 383 ASN A CG    1 
ATOM   3086  O  OD1   . ASN A 1 403 ? 18.776  41.107  -13.519 1.00 121.97 ? 383 ASN A OD1   1 
ATOM   3087  N  ND2   . ASN A 1 403 ? 16.898  41.237  -12.298 1.00 119.96 ? 383 ASN A ND2   1 
ATOM   3088  N  N     . SER A 1 404 ? 20.526  37.261  -14.453 1.00 116.09 ? 384 SER A N     1 
ATOM   3089  C  CA    . SER A 1 404 ? 21.800  36.698  -13.988 1.00 114.04 ? 384 SER A CA    1 
ATOM   3090  C  C     . SER A 1 404 ? 22.840  36.575  -15.118 1.00 111.38 ? 384 SER A C     1 
ATOM   3091  O  O     . SER A 1 404 ? 23.674  35.664  -15.107 1.00 109.55 ? 384 SER A O     1 
ATOM   3092  C  CB    . SER A 1 404 ? 21.545  35.326  -13.342 1.00 114.45 ? 384 SER A CB    1 
ATOM   3093  O  OG    . SER A 1 404 ? 20.682  35.432  -12.223 1.00 114.73 ? 384 SER A OG    1 
ATOM   3094  N  N     . GLY A 1 405 ? 22.793  37.500  -16.079 1.00 110.23 ? 385 GLY A N     1 
ATOM   3095  C  CA    . GLY A 1 405 ? 23.750  37.543  -17.189 1.00 109.38 ? 385 GLY A CA    1 
ATOM   3096  C  C     . GLY A 1 405 ? 23.760  36.299  -18.063 1.00 107.06 ? 385 GLY A C     1 
ATOM   3097  O  O     . GLY A 1 405 ? 22.743  35.947  -18.663 1.00 106.57 ? 385 GLY A O     1 
ATOM   3098  N  N     . GLU A 1 406 ? 24.915  35.635  -18.124 1.00 106.03 ? 386 GLU A N     1 
ATOM   3099  C  CA    . GLU A 1 406 ? 25.089  34.422  -18.937 1.00 106.12 ? 386 GLU A CA    1 
ATOM   3100  C  C     . GLU A 1 406 ? 24.379  33.177  -18.387 1.00 106.93 ? 386 GLU A C     1 
ATOM   3101  O  O     . GLU A 1 406 ? 24.124  32.235  -19.142 1.00 108.11 ? 386 GLU A O     1 
ATOM   3102  C  CB    . GLU A 1 406 ? 26.581  34.116  -19.150 1.00 104.86 ? 386 GLU A CB    1 
ATOM   3103  C  CG    . GLU A 1 406 ? 27.341  33.623  -17.924 1.00 104.13 ? 386 GLU A CG    1 
ATOM   3104  C  CD    . GLU A 1 406 ? 28.828  33.480  -18.184 1.00 104.90 ? 386 GLU A CD    1 
ATOM   3105  O  OE1   . GLU A 1 406 ? 29.197  32.870  -19.209 1.00 105.52 ? 386 GLU A OE1   1 
ATOM   3106  O  OE2   . GLU A 1 406 ? 29.628  33.971  -17.362 1.00 106.35 ? 386 GLU A OE2   1 
ATOM   3107  N  N     . PHE A 1 407 ? 24.058  33.174  -17.091 1.00 106.76 ? 387 PHE A N     1 
ATOM   3108  C  CA    . PHE A 1 407 ? 23.447  32.009  -16.434 1.00 106.28 ? 387 PHE A CA    1 
ATOM   3109  C  C     . PHE A 1 407 ? 21.907  31.961  -16.503 1.00 106.49 ? 387 PHE A C     1 
ATOM   3110  O  O     . PHE A 1 407 ? 21.288  31.158  -15.799 1.00 108.07 ? 387 PHE A O     1 
ATOM   3111  C  CB    . PHE A 1 407 ? 23.914  31.937  -14.972 1.00 105.67 ? 387 PHE A CB    1 
ATOM   3112  C  CG    . PHE A 1 407 ? 25.411  31.889  -14.814 1.00 106.04 ? 387 PHE A CG    1 
ATOM   3113  C  CD1   . PHE A 1 407 ? 26.119  30.730  -15.124 1.00 106.33 ? 387 PHE A CD1   1 
ATOM   3114  C  CD2   . PHE A 1 407 ? 26.118  33.001  -14.356 1.00 106.01 ? 387 PHE A CD2   1 
ATOM   3115  C  CE1   . PHE A 1 407 ? 27.501  30.679  -14.982 1.00 105.59 ? 387 PHE A CE1   1 
ATOM   3116  C  CE2   . PHE A 1 407 ? 27.499  32.955  -14.211 1.00 105.68 ? 387 PHE A CE2   1 
ATOM   3117  C  CZ    . PHE A 1 407 ? 28.191  31.793  -14.525 1.00 105.53 ? 387 PHE A CZ    1 
ATOM   3118  N  N     . ASN A 1 408 ? 21.291  32.794  -17.348 1.00 105.52 ? 388 ASN A N     1 
ATOM   3119  C  CA    . ASN A 1 408 ? 19.831  32.793  -17.524 1.00 105.05 ? 388 ASN A CA    1 
ATOM   3120  C  C     . ASN A 1 408 ? 19.349  31.556  -18.277 1.00 104.27 ? 388 ASN A C     1 
ATOM   3121  O  O     . ASN A 1 408 ? 20.053  31.031  -19.143 1.00 102.76 ? 388 ASN A O     1 
ATOM   3122  C  CB    . ASN A 1 408 ? 19.364  34.048  -18.273 1.00 105.14 ? 388 ASN A CB    1 
ATOM   3123  C  CG    . ASN A 1 408 ? 19.556  35.318  -17.470 1.00 104.55 ? 388 ASN A CG    1 
ATOM   3124  O  OD1   . ASN A 1 408 ? 20.234  35.327  -16.443 1.00 103.41 ? 388 ASN A OD1   1 
ATOM   3125  N  ND2   . ASN A 1 408 ? 18.954  36.405  -17.936 1.00 105.43 ? 388 ASN A ND2   1 
ATOM   3126  N  N     . GLY A 1 409 ? 18.146  31.098  -17.928 1.00 104.15 ? 389 GLY A N     1 
ATOM   3127  C  CA    . GLY A 1 409 ? 17.525  29.935  -18.565 1.00 106.08 ? 389 GLY A CA    1 
ATOM   3128  C  C     . GLY A 1 409 ? 17.850  28.577  -17.956 1.00 107.37 ? 389 GLY A C     1 
ATOM   3129  O  O     . GLY A 1 409 ? 17.125  27.609  -18.203 1.00 108.88 ? 389 GLY A O     1 
ATOM   3130  N  N     . LEU A 1 410 ? 18.916  28.496  -17.156 1.00 106.43 ? 390 LEU A N     1 
ATOM   3131  C  CA    . LEU A 1 410 ? 19.388  27.220  -16.615 1.00 106.37 ? 390 LEU A CA    1 
ATOM   3132  C  C     . LEU A 1 410 ? 18.564  26.779  -15.407 1.00 105.71 ? 390 LEU A C     1 
ATOM   3133  O  O     . LEU A 1 410 ? 18.120  27.609  -14.614 1.00 103.53 ? 390 LEU A O     1 
ATOM   3134  C  CB    . LEU A 1 410 ? 20.868  27.316  -16.224 1.00 107.05 ? 390 LEU A CB    1 
ATOM   3135  C  CG    . LEU A 1 410 ? 21.857  27.628  -17.354 1.00 107.50 ? 390 LEU A CG    1 
ATOM   3136  C  CD1   . LEU A 1 410 ? 23.223  27.990  -16.786 1.00 106.80 ? 390 LEU A CD1   1 
ATOM   3137  C  CD2   . LEU A 1 410 ? 21.971  26.461  -18.325 1.00 107.35 ? 390 LEU A CD2   1 
ATOM   3138  N  N     . ASP A 1 411 ? 18.373  25.465  -15.284 1.00 107.35 ? 391 ASP A N     1 
ATOM   3139  C  CA    . ASP A 1 411 ? 17.687  24.854  -14.131 1.00 108.68 ? 391 ASP A CA    1 
ATOM   3140  C  C     . ASP A 1 411 ? 18.623  24.755  -12.915 1.00 109.58 ? 391 ASP A C     1 
ATOM   3141  O  O     . ASP A 1 411 ? 19.804  25.090  -13.012 1.00 111.49 ? 391 ASP A O     1 
ATOM   3142  C  CB    . ASP A 1 411 ? 17.098  23.476  -14.508 1.00 109.33 ? 391 ASP A CB    1 
ATOM   3143  C  CG    . ASP A 1 411 ? 18.146  22.487  -15.019 1.00 110.56 ? 391 ASP A CG    1 
ATOM   3144  O  OD1   . ASP A 1 411 ? 19.038  22.086  -14.242 1.00 112.42 ? 391 ASP A OD1   1 
ATOM   3145  O  OD2   . ASP A 1 411 ? 18.064  22.099  -16.203 1.00 110.92 ? 391 ASP A OD2   1 
ATOM   3146  N  N     . HIS A 1 412 ? 18.089  24.299  -11.780 1.00 110.53 ? 392 HIS A N     1 
ATOM   3147  C  CA    . HIS A 1 412 ? 18.856  24.185  -10.525 1.00 111.79 ? 392 HIS A CA    1 
ATOM   3148  C  C     . HIS A 1 412 ? 20.112  23.307  -10.633 1.00 110.67 ? 392 HIS A C     1 
ATOM   3149  O  O     . HIS A 1 412 ? 21.167  23.677  -10.115 1.00 109.07 ? 392 HIS A O     1 
ATOM   3150  C  CB    . HIS A 1 412 ? 17.960  23.668  -9.388  1.00 114.15 ? 392 HIS A CB    1 
ATOM   3151  C  CG    . HIS A 1 412 ? 18.699  23.381  -8.117  1.00 116.57 ? 392 HIS A CG    1 
ATOM   3152  N  ND1   . HIS A 1 412 ? 19.179  24.377  -7.293  1.00 117.65 ? 392 HIS A ND1   1 
ATOM   3153  C  CD2   . HIS A 1 412 ? 19.050  22.210  -7.535  1.00 117.71 ? 392 HIS A CD2   1 
ATOM   3154  C  CE1   . HIS A 1 412 ? 19.790  23.831  -6.256  1.00 117.97 ? 392 HIS A CE1   1 
ATOM   3155  N  NE2   . HIS A 1 412 ? 19.725  22.517  -6.378  1.00 117.68 ? 392 HIS A NE2   1 
ATOM   3156  N  N     . GLU A 1 413 ? 19.991  22.157  -11.293 1.00 111.72 ? 393 GLU A N     1 
ATOM   3157  C  CA    . GLU A 1 413 ? 21.122  21.231  -11.471 1.00 112.98 ? 393 GLU A CA    1 
ATOM   3158  C  C     . GLU A 1 413 ? 22.231  21.837  -12.333 1.00 111.44 ? 393 GLU A C     1 
ATOM   3159  O  O     . GLU A 1 413 ? 23.414  21.703  -12.010 1.00 110.60 ? 393 GLU A O     1 
ATOM   3160  C  CB    . GLU A 1 413 ? 20.656  19.904  -12.086 1.00 115.98 ? 393 GLU A CB    1 
ATOM   3161  C  CG    . GLU A 1 413 ? 19.747  19.072  -11.190 1.00 118.61 ? 393 GLU A CG    1 
ATOM   3162  C  CD    . GLU A 1 413 ? 20.485  18.418  -10.033 1.00 120.88 ? 393 GLU A CD    1 
ATOM   3163  O  OE1   . GLU A 1 413 ? 21.468  17.689  -10.286 1.00 121.13 ? 393 GLU A OE1   1 
ATOM   3164  O  OE2   . GLU A 1 413 ? 20.074  18.625  -8.870  1.00 123.69 ? 393 GLU A OE2   1 
ATOM   3165  N  N     . ALA A 1 414 ? 21.839  22.498  -13.421 1.00 110.99 ? 394 ALA A N     1 
ATOM   3166  C  CA    . ALA A 1 414 ? 22.782  23.180  -14.315 1.00 110.97 ? 394 ALA A CA    1 
ATOM   3167  C  C     . ALA A 1 414 ? 23.385  24.435  -13.675 1.00 109.59 ? 394 ALA A C     1 
ATOM   3168  O  O     . ALA A 1 414 ? 24.588  24.671  -13.793 1.00 109.04 ? 394 ALA A O     1 
ATOM   3169  C  CB    . ALA A 1 414 ? 22.103  23.536  -15.631 1.00 111.77 ? 394 ALA A CB    1 
ATOM   3170  N  N     . ALA A 1 415 ? 22.546  25.229  -13.009 1.00 108.17 ? 395 ALA A N     1 
ATOM   3171  C  CA    . ALA A 1 415 ? 22.980  26.465  -12.335 1.00 106.24 ? 395 ALA A CA    1 
ATOM   3172  C  C     . ALA A 1 415 ? 23.938  26.222  -11.163 1.00 105.54 ? 395 ALA A C     1 
ATOM   3173  O  O     . ALA A 1 415 ? 24.792  27.065  -10.877 1.00 104.12 ? 395 ALA A O     1 
ATOM   3174  C  CB    . ALA A 1 415 ? 21.772  27.254  -11.857 1.00 105.84 ? 395 ALA A CB    1 
ATOM   3175  N  N     . PHE A 1 416 ? 23.777  25.086  -10.483 1.00 105.62 ? 396 PHE A N     1 
ATOM   3176  C  CA    . PHE A 1 416 ? 24.702  24.657  -9.428  1.00 105.19 ? 396 PHE A CA    1 
ATOM   3177  C  C     . PHE A 1 416 ? 26.090  24.379  -10.006 1.00 104.75 ? 396 PHE A C     1 
ATOM   3178  O  O     . PHE A 1 416 ? 27.093  24.874  -9.490  1.00 104.93 ? 396 PHE A O     1 
ATOM   3179  C  CB    . PHE A 1 416 ? 24.168  23.400  -8.723  1.00 105.20 ? 396 PHE A CB    1 
ATOM   3180  C  CG    . PHE A 1 416 ? 24.938  23.014  -7.487  1.00 103.49 ? 396 PHE A CG    1 
ATOM   3181  C  CD1   . PHE A 1 416 ? 26.018  22.138  -7.563  1.00 102.79 ? 396 PHE A CD1   1 
ATOM   3182  C  CD2   . PHE A 1 416 ? 24.572  23.514  -6.243  1.00 102.61 ? 396 PHE A CD2   1 
ATOM   3183  C  CE1   . PHE A 1 416 ? 26.725  21.780  -6.424  1.00 102.39 ? 396 PHE A CE1   1 
ATOM   3184  C  CE2   . PHE A 1 416 ? 25.275  23.160  -5.100  1.00 102.48 ? 396 PHE A CE2   1 
ATOM   3185  C  CZ    . PHE A 1 416 ? 26.353  22.291  -5.190  1.00 102.62 ? 396 PHE A CZ    1 
ATOM   3186  N  N     . ASN A 1 417 ? 26.126  23.592  -11.081 1.00 103.33 ? 397 ASN A N     1 
ATOM   3187  C  CA    . ASN A 1 417 ? 27.380  23.198  -11.731 1.00 103.42 ? 397 ASN A CA    1 
ATOM   3188  C  C     . ASN A 1 417 ? 28.037  24.346  -12.506 1.00 104.06 ? 397 ASN A C     1 
ATOM   3189  O  O     . ASN A 1 417 ? 29.257  24.504  -12.451 1.00 104.46 ? 397 ASN A O     1 
ATOM   3190  C  CB    . ASN A 1 417 ? 27.151  22.011  -12.680 1.00 103.17 ? 397 ASN A CB    1 
ATOM   3191  C  CG    . ASN A 1 417 ? 26.647  20.767  -11.964 1.00 102.11 ? 397 ASN A CG    1 
ATOM   3192  O  OD1   . ASN A 1 417 ? 26.811  20.614  -10.754 1.00 101.51 ? 397 ASN A OD1   1 
ATOM   3193  N  ND2   . ASN A 1 417 ? 26.031  19.866  -12.720 1.00 102.10 ? 397 ASN A ND2   1 
ATOM   3194  N  N     . ALA A 1 418 ? 27.230  25.135  -13.218 1.00 103.79 ? 398 ALA A N     1 
ATOM   3195  C  CA    . ALA A 1 418 ? 27.731  26.219  -14.080 1.00 103.24 ? 398 ALA A CA    1 
ATOM   3196  C  C     . ALA A 1 418 ? 28.527  27.274  -13.314 1.00 102.24 ? 398 ALA A C     1 
ATOM   3197  O  O     . ALA A 1 418 ? 29.649  27.611  -13.699 1.00 102.44 ? 398 ALA A O     1 
ATOM   3198  C  CB    . ALA A 1 418 ? 26.578  26.880  -14.823 1.00 103.75 ? 398 ALA A CB    1 
ATOM   3199  N  N     . ILE A 1 419 ? 27.936  27.785  -12.237 1.00 100.47 ? 399 ILE A N     1 
ATOM   3200  C  CA    . ILE A 1 419 ? 28.578  28.801  -11.393 1.00 100.22 ? 399 ILE A CA    1 
ATOM   3201  C  C     . ILE A 1 419 ? 29.733  28.202  -10.572 1.00 99.47  ? 399 ILE A C     1 
ATOM   3202  O  O     . ILE A 1 419 ? 30.700  28.901  -10.264 1.00 99.53  ? 399 ILE A O     1 
ATOM   3203  C  CB    . ILE A 1 419 ? 27.537  29.526  -10.498 1.00 100.54 ? 399 ILE A CB    1 
ATOM   3204  C  CG1   . ILE A 1 419 ? 26.554  30.311  -11.381 1.00 101.03 ? 399 ILE A CG1   1 
ATOM   3205  C  CG2   . ILE A 1 419 ? 28.212  30.480  -9.512  1.00 100.31 ? 399 ILE A CG2   1 
ATOM   3206  C  CD1   . ILE A 1 419 ? 25.257  30.692  -10.701 1.00 101.09 ? 399 ILE A CD1   1 
ATOM   3207  N  N     . ALA A 1 420 ? 29.639  26.915  -10.235 1.00 99.03  ? 400 ALA A N     1 
ATOM   3208  C  CA    . ALA A 1 420 ? 30.735  26.202  -9.568  1.00 99.87  ? 400 ALA A CA    1 
ATOM   3209  C  C     . ALA A 1 420 ? 31.940  26.009  -10.494 1.00 99.10  ? 400 ALA A C     1 
ATOM   3210  O  O     . ALA A 1 420 ? 33.078  26.265  -10.093 1.00 98.26  ? 400 ALA A O     1 
ATOM   3211  C  CB    . ALA A 1 420 ? 30.255  24.859  -9.040  1.00 101.41 ? 400 ALA A CB    1 
ATOM   3212  N  N     . ASP A 1 421 ? 31.681  25.557  -11.723 1.00 99.01  ? 401 ASP A N     1 
ATOM   3213  C  CA    . ASP A 1 421 ? 32.727  25.408  -12.751 1.00 99.06  ? 401 ASP A CA    1 
ATOM   3214  C  C     . ASP A 1 421 ? 33.354  26.751  -13.145 1.00 99.27  ? 401 ASP A C     1 
ATOM   3215  O  O     . ASP A 1 421 ? 34.547  26.809  -13.454 1.00 97.62  ? 401 ASP A O     1 
ATOM   3216  C  CB    . ASP A 1 421 ? 32.175  24.719  -14.012 1.00 98.78  ? 401 ASP A CB    1 
ATOM   3217  C  CG    . ASP A 1 421 ? 31.791  23.261  -13.781 1.00 98.21  ? 401 ASP A CG    1 
ATOM   3218  O  OD1   . ASP A 1 421 ? 32.460  22.568  -12.985 1.00 99.20  ? 401 ASP A OD1   1 
ATOM   3219  O  OD2   . ASP A 1 421 ? 30.813  22.803  -14.411 1.00 96.58  ? 401 ASP A OD2   1 
ATOM   3220  N  N     . LYS A 1 422 ? 32.545  27.812  -13.139 1.00 100.07 ? 402 LYS A N     1 
ATOM   3221  C  CA    . LYS A 1 422 ? 33.014  29.177  -13.415 1.00 99.90  ? 402 LYS A CA    1 
ATOM   3222  C  C     . LYS A 1 422 ? 33.983  29.662  -12.336 1.00 99.69  ? 402 LYS A C     1 
ATOM   3223  O  O     . LYS A 1 422 ? 35.071  30.149  -12.649 1.00 100.32 ? 402 LYS A O     1 
ATOM   3224  C  CB    . LYS A 1 422 ? 31.824  30.144  -13.509 1.00 99.71  ? 402 LYS A CB    1 
ATOM   3225  C  CG    . LYS A 1 422 ? 32.151  31.530  -14.053 1.00 99.50  ? 402 LYS A CG    1 
ATOM   3226  C  CD    . LYS A 1 422 ? 32.351  31.510  -15.560 1.00 99.27  ? 402 LYS A CD    1 
ATOM   3227  C  CE    . LYS A 1 422 ? 32.498  32.914  -16.118 1.00 98.70  ? 402 LYS A CE    1 
ATOM   3228  N  NZ    . LYS A 1 422 ? 32.456  32.912  -17.604 1.00 98.63  ? 402 LYS A NZ    1 
ATOM   3229  N  N     . LEU A 1 423 ? 33.574  29.526  -11.075 1.00 99.23  ? 403 LEU A N     1 
ATOM   3230  C  CA    . LEU A 1 423 ? 34.385  29.964  -9.931  1.00 98.59  ? 403 LEU A CA    1 
ATOM   3231  C  C     . LEU A 1 423 ? 35.619  29.084  -9.689  1.00 99.39  ? 403 LEU A C     1 
ATOM   3232  O  O     . LEU A 1 423 ? 36.610  29.558  -9.130  1.00 101.66 ? 403 LEU A O     1 
ATOM   3233  C  CB    . LEU A 1 423 ? 33.525  30.053  -8.664  1.00 97.54  ? 403 LEU A CB    1 
ATOM   3234  C  CG    . LEU A 1 423 ? 32.419  31.118  -8.702  1.00 96.68  ? 403 LEU A CG    1 
ATOM   3235  C  CD1   . LEU A 1 423 ? 31.368  30.851  -7.636  1.00 96.72  ? 403 LEU A CD1   1 
ATOM   3236  C  CD2   . LEU A 1 423 ? 32.988  32.521  -8.543  1.00 96.58  ? 403 LEU A CD2   1 
ATOM   3237  N  N     . THR A 1 424 ? 35.559  27.816  -10.101 1.00 99.05  ? 404 THR A N     1 
ATOM   3238  C  CA    . THR A 1 424 ? 36.745  26.950  -10.133 1.00 99.78  ? 404 THR A CA    1 
ATOM   3239  C  C     . THR A 1 424 ? 37.697  27.363  -11.264 1.00 101.31 ? 404 THR A C     1 
ATOM   3240  O  O     . THR A 1 424 ? 38.916  27.357  -11.081 1.00 102.27 ? 404 THR A O     1 
ATOM   3241  C  CB    . THR A 1 424 ? 36.365  25.462  -10.300 1.00 99.57  ? 404 THR A CB    1 
ATOM   3242  O  OG1   . THR A 1 424 ? 35.396  25.100  -9.309  1.00 100.32 ? 404 THR A OG1   1 
ATOM   3243  C  CG2   . THR A 1 424 ? 37.590  24.555  -10.151 1.00 98.77  ? 404 THR A CG2   1 
ATOM   3244  N  N     . ALA A 1 425 ? 37.134  27.714  -12.424 1.00 101.86 ? 405 ALA A N     1 
ATOM   3245  C  CA    . ALA A 1 425 ? 37.915  28.184  -13.579 1.00 100.55 ? 405 ALA A CA    1 
ATOM   3246  C  C     . ALA A 1 425 ? 38.561  29.551  -13.337 1.00 99.44  ? 405 ALA A C     1 
ATOM   3247  O  O     . ALA A 1 425 ? 39.712  29.768  -13.717 1.00 99.33  ? 405 ALA A O     1 
ATOM   3248  C  CB    . ALA A 1 425 ? 37.044  28.233  -14.827 1.00 100.89 ? 405 ALA A CB    1 
ATOM   3249  N  N     . MET A 1 426 ? 37.812  30.466  -12.721 1.00 99.37  ? 406 MET A N     1 
ATOM   3250  C  CA    . MET A 1 426 ? 38.348  31.773  -12.303 1.00 100.58 ? 406 MET A CA    1 
ATOM   3251  C  C     . MET A 1 426 ? 39.419  31.649  -11.211 1.00 102.58 ? 406 MET A C     1 
ATOM   3252  O  O     . MET A 1 426 ? 40.341  32.466  -11.151 1.00 103.37 ? 406 MET A O     1 
ATOM   3253  C  CB    . MET A 1 426 ? 37.223  32.700  -11.818 1.00 98.94  ? 406 MET A CB    1 
ATOM   3254  C  CG    . MET A 1 426 ? 36.336  33.234  -12.933 1.00 97.75  ? 406 MET A CG    1 
ATOM   3255  S  SD    . MET A 1 426 ? 34.843  34.059  -12.342 1.00 95.14  ? 406 MET A SD    1 
ATOM   3256  C  CE    . MET A 1 426 ? 35.532  35.372  -11.338 1.00 94.82  ? 406 MET A CE    1 
ATOM   3257  N  N     . GLY A 1 427 ? 39.284  30.637  -10.352 1.00 104.26 ? 407 GLY A N     1 
ATOM   3258  C  CA    . GLY A 1 427 ? 40.244  30.371  -9.281  1.00 105.33 ? 407 GLY A CA    1 
ATOM   3259  C  C     . GLY A 1 427 ? 39.967  31.170  -8.020  1.00 107.12 ? 407 GLY A C     1 
ATOM   3260  O  O     . GLY A 1 427 ? 40.900  31.616  -7.350  1.00 108.48 ? 407 GLY A O     1 
ATOM   3261  N  N     . VAL A 1 428 ? 38.683  31.351  -7.707  1.00 108.84 ? 408 VAL A N     1 
ATOM   3262  C  CA    . VAL A 1 428 ? 38.236  32.011  -6.472  1.00 109.05 ? 408 VAL A CA    1 
ATOM   3263  C  C     . VAL A 1 428 ? 37.004  31.279  -5.913  1.00 108.98 ? 408 VAL A C     1 
ATOM   3264  O  O     . VAL A 1 428 ? 36.029  31.900  -5.481  1.00 110.89 ? 408 VAL A O     1 
ATOM   3265  C  CB    . VAL A 1 428 ? 37.948  33.524  -6.694  1.00 109.76 ? 408 VAL A CB    1 
ATOM   3266  C  CG1   . VAL A 1 428 ? 39.247  34.300  -6.860  1.00 110.04 ? 408 VAL A CG1   1 
ATOM   3267  C  CG2   . VAL A 1 428 ? 37.033  33.753  -7.894  1.00 109.61 ? 408 VAL A CG2   1 
ATOM   3268  N  N     . GLY A 1 429 ? 37.067  29.947  -5.919  1.00 107.65 ? 409 GLY A N     1 
ATOM   3269  C  CA    . GLY A 1 429 ? 35.947  29.115  -5.483  1.00 105.81 ? 409 GLY A CA    1 
ATOM   3270  C  C     . GLY A 1 429 ? 36.193  27.629  -5.681  1.00 104.78 ? 409 GLY A C     1 
ATOM   3271  O  O     . GLY A 1 429 ? 36.913  27.232  -6.600  1.00 104.37 ? 409 GLY A O     1 
ATOM   3272  N  N     . GLU A 1 430 ? 35.592  26.812  -4.816  1.00 103.85 ? 410 GLU A N     1 
ATOM   3273  C  CA    . GLU A 1 430 ? 35.751  25.354  -4.874  1.00 104.10 ? 410 GLU A CA    1 
ATOM   3274  C  C     . GLU A 1 430 ? 34.593  24.614  -4.205  1.00 102.07 ? 410 GLU A C     1 
ATOM   3275  O  O     . GLU A 1 430 ? 34.013  25.105  -3.236  1.00 101.39 ? 410 GLU A O     1 
ATOM   3276  C  CB    . GLU A 1 430 ? 37.076  24.935  -4.225  1.00 105.98 ? 410 GLU A CB    1 
ATOM   3277  C  CG    . GLU A 1 430 ? 37.278  25.439  -2.798  1.00 107.44 ? 410 GLU A CG    1 
ATOM   3278  C  CD    . GLU A 1 430 ? 38.513  24.863  -2.120  1.00 109.06 ? 410 GLU A CD    1 
ATOM   3279  O  OE1   . GLU A 1 430 ? 39.344  24.217  -2.796  1.00 109.77 ? 410 GLU A OE1   1 
ATOM   3280  O  OE2   . GLU A 1 430 ? 38.653  25.062  -0.895  1.00 109.59 ? 410 GLU A OE2   1 
ATOM   3281  N  N     . ARG A 1 431 ? 34.284  23.424  -4.721  1.00 100.88 ? 411 ARG A N     1 
ATOM   3282  C  CA    . ARG A 1 431 ? 33.243  22.565  -4.152  1.00 100.58 ? 411 ARG A CA    1 
ATOM   3283  C  C     . ARG A 1 431 ? 33.770  21.941  -2.863  1.00 101.63 ? 411 ARG A C     1 
ATOM   3284  O  O     . ARG A 1 431 ? 34.930  21.522  -2.812  1.00 103.83 ? 411 ARG A O     1 
ATOM   3285  C  CB    . ARG A 1 431 ? 32.860  21.451  -5.130  1.00 100.48 ? 411 ARG A CB    1 
ATOM   3286  C  CG    . ARG A 1 431 ? 32.321  21.919  -6.476  1.00 100.74 ? 411 ARG A CG    1 
ATOM   3287  C  CD    . ARG A 1 431 ? 32.259  20.768  -7.471  1.00 101.42 ? 411 ARG A CD    1 
ATOM   3288  N  NE    . ARG A 1 431 ? 32.119  21.228  -8.854  1.00 101.48 ? 411 ARG A NE    1 
ATOM   3289  C  CZ    . ARG A 1 431 ? 30.979  21.605  -9.440  1.00 100.96 ? 411 ARG A CZ    1 
ATOM   3290  N  NH1   . ARG A 1 431 ? 29.818  21.606  -8.782  1.00 100.39 ? 411 ARG A NH1   1 
ATOM   3291  N  NH2   . ARG A 1 431 ? 31.003  22.001  -10.711 1.00 100.67 ? 411 ARG A NH2   1 
ATOM   3292  N  N     . LYS A 1 432 ? 32.926  21.874  -1.832  1.00 101.32 ? 412 LYS A N     1 
ATOM   3293  C  CA    . LYS A 1 432 ? 33.338  21.349  -0.523  1.00 100.02 ? 412 LYS A CA    1 
ATOM   3294  C  C     . LYS A 1 432 ? 32.191  20.675  0.234   1.00 96.47  ? 412 LYS A C     1 
ATOM   3295  O  O     . LYS A 1 432 ? 31.055  21.154  0.214   1.00 94.38  ? 412 LYS A O     1 
ATOM   3296  C  CB    . LYS A 1 432 ? 33.928  22.475  0.333   1.00 102.23 ? 412 LYS A CB    1 
ATOM   3297  C  CG    . LYS A 1 432 ? 34.646  21.993  1.590   1.00 104.00 ? 412 LYS A CG    1 
ATOM   3298  C  CD    . LYS A 1 432 ? 35.364  23.124  2.315   1.00 104.65 ? 412 LYS A CD    1 
ATOM   3299  C  CE    . LYS A 1 432 ? 36.692  23.491  1.664   1.00 105.25 ? 412 LYS A CE    1 
ATOM   3300  N  NZ    . LYS A 1 432 ? 37.742  22.445  1.828   1.00 105.39 ? 412 LYS A NZ    1 
ATOM   3301  N  N     . VAL A 1 433 ? 32.517  19.568  0.904   1.00 93.38  ? 413 VAL A N     1 
ATOM   3302  C  CA    . VAL A 1 433 ? 31.582  18.836  1.758   1.00 91.70  ? 413 VAL A CA    1 
ATOM   3303  C  C     . VAL A 1 433 ? 31.679  19.398  3.181   1.00 88.96  ? 413 VAL A C     1 
ATOM   3304  O  O     . VAL A 1 433 ? 32.563  19.009  3.949   1.00 89.55  ? 413 VAL A O     1 
ATOM   3305  C  CB    . VAL A 1 433 ? 31.891  17.315  1.752   1.00 92.41  ? 413 VAL A CB    1 
ATOM   3306  C  CG1   . VAL A 1 433 ? 30.943  16.553  2.674   1.00 92.24  ? 413 VAL A CG1   1 
ATOM   3307  C  CG2   . VAL A 1 433 ? 31.816  16.763  0.333   1.00 92.89  ? 413 VAL A CG2   1 
ATOM   3308  N  N     . ASN A 1 434 ? 30.773  20.317  3.519   1.00 85.11  ? 414 ASN A N     1 
ATOM   3309  C  CA    . ASN A 1 434 ? 30.719  20.922  4.853   1.00 82.72  ? 414 ASN A CA    1 
ATOM   3310  C  C     . ASN A 1 434 ? 29.775  20.131  5.757   1.00 81.05  ? 414 ASN A C     1 
ATOM   3311  O  O     . ASN A 1 434 ? 28.736  19.649  5.303   1.00 81.12  ? 414 ASN A O     1 
ATOM   3312  C  CB    . ASN A 1 434 ? 30.253  22.376  4.756   1.00 83.23  ? 414 ASN A CB    1 
ATOM   3313  C  CG    . ASN A 1 434 ? 30.413  23.135  6.061   1.00 84.30  ? 414 ASN A CG    1 
ATOM   3314  O  OD1   . ASN A 1 434 ? 29.536  23.102  6.924   1.00 85.27  ? 414 ASN A OD1   1 
ATOM   3315  N  ND2   . ASN A 1 434 ? 31.530  23.840  6.203   1.00 85.35  ? 414 ASN A ND2   1 
ATOM   3316  N  N     . TYR A 1 435 ? 30.148  20.008  7.032   1.00 79.92  ? 415 TYR A N     1 
ATOM   3317  C  CA    . TYR A 1 435 ? 29.307  19.381  8.055   1.00 78.72  ? 415 TYR A CA    1 
ATOM   3318  C  C     . TYR A 1 435 ? 28.899  20.418  9.097   1.00 78.57  ? 415 TYR A C     1 
ATOM   3319  O  O     . TYR A 1 435 ? 29.657  21.348  9.390   1.00 78.76  ? 415 TYR A O     1 
ATOM   3320  C  CB    . TYR A 1 435 ? 30.051  18.242  8.757   1.00 77.78  ? 415 TYR A CB    1 
ATOM   3321  C  CG    . TYR A 1 435 ? 30.631  17.208  7.822   1.00 77.65  ? 415 TYR A CG    1 
ATOM   3322  C  CD1   . TYR A 1 435 ? 29.838  16.188  7.297   1.00 77.50  ? 415 TYR A CD1   1 
ATOM   3323  C  CD2   . TYR A 1 435 ? 31.979  17.245  7.464   1.00 78.29  ? 415 TYR A CD2   1 
ATOM   3324  C  CE1   . TYR A 1 435 ? 30.371  15.236  6.438   1.00 78.09  ? 415 TYR A CE1   1 
ATOM   3325  C  CE2   . TYR A 1 435 ? 32.522  16.298  6.606   1.00 78.37  ? 415 TYR A CE2   1 
ATOM   3326  C  CZ    . TYR A 1 435 ? 31.716  15.297  6.095   1.00 78.27  ? 415 TYR A CZ    1 
ATOM   3327  O  OH    . TYR A 1 435 ? 32.260  14.362  5.245   1.00 77.79  ? 415 TYR A OH    1 
ATOM   3328  N  N     . ARG A 1 436 ? 27.700  20.250  9.649   1.00 78.62  ? 416 ARG A N     1 
ATOM   3329  C  CA    . ARG A 1 436 ? 27.270  21.002  10.828  1.00 77.88  ? 416 ARG A CA    1 
ATOM   3330  C  C     . ARG A 1 436 ? 28.111  20.591  12.040  1.00 75.22  ? 416 ARG A C     1 
ATOM   3331  O  O     . ARG A 1 436 ? 28.453  21.434  12.871  1.00 74.67  ? 416 ARG A O     1 
ATOM   3332  C  CB    . ARG A 1 436 ? 25.778  20.768  11.103  1.00 80.02  ? 416 ARG A CB    1 
ATOM   3333  C  CG    . ARG A 1 436 ? 25.210  21.544  12.286  1.00 81.79  ? 416 ARG A CG    1 
ATOM   3334  C  CD    . ARG A 1 436 ? 23.809  21.082  12.670  1.00 82.76  ? 416 ARG A CD    1 
ATOM   3335  N  NE    . ARG A 1 436 ? 23.656  20.989  14.123  1.00 83.23  ? 416 ARG A NE    1 
ATOM   3336  C  CZ    . ARG A 1 436 ? 23.576  22.026  14.960  1.00 84.62  ? 416 ARG A CZ    1 
ATOM   3337  N  NH1   . ARG A 1 436 ? 23.635  23.285  14.521  1.00 85.82  ? 416 ARG A NH1   1 
ATOM   3338  N  NH2   . ARG A 1 436 ? 23.439  21.801  16.263  1.00 85.02  ? 416 ARG A NH2   1 
ATOM   3339  N  N     . LEU A 1 437 ? 28.432  19.298  12.128  1.00 73.15  ? 417 LEU A N     1 
ATOM   3340  C  CA    . LEU A 1 437 ? 29.251  18.745  13.213  1.00 72.22  ? 417 LEU A CA    1 
ATOM   3341  C  C     . LEU A 1 437 ? 30.576  19.489  13.387  1.00 72.01  ? 417 LEU A C     1 
ATOM   3342  O  O     . LEU A 1 437 ? 31.402  19.517  12.473  1.00 72.85  ? 417 LEU A O     1 
ATOM   3343  C  CB    . LEU A 1 437 ? 29.532  17.257  12.955  1.00 71.30  ? 417 LEU A CB    1 
ATOM   3344  C  CG    . LEU A 1 437 ? 30.400  16.468  13.942  1.00 71.04  ? 417 LEU A CG    1 
ATOM   3345  C  CD1   . LEU A 1 437 ? 29.868  16.570  15.363  1.00 71.53  ? 417 LEU A CD1   1 
ATOM   3346  C  CD2   . LEU A 1 437 ? 30.481  15.013  13.503  1.00 70.62  ? 417 LEU A CD2   1 
ATOM   3347  N  N     . ARG A 1 438 ? 30.750  20.104  14.556  1.00 71.34  ? 418 ARG A N     1 
ATOM   3348  C  CA    . ARG A 1 438 ? 32.025  20.696  14.961  1.00 71.29  ? 418 ARG A CA    1 
ATOM   3349  C  C     . ARG A 1 438 ? 32.888  19.650  15.658  1.00 70.06  ? 418 ARG A C     1 
ATOM   3350  O  O     . ARG A 1 438 ? 32.401  18.581  16.042  1.00 69.32  ? 418 ARG A O     1 
ATOM   3351  C  CB    . ARG A 1 438 ? 31.801  21.873  15.910  1.00 72.35  ? 418 ARG A CB    1 
ATOM   3352  C  CG    . ARG A 1 438 ? 30.873  22.948  15.371  1.00 73.94  ? 418 ARG A CG    1 
ATOM   3353  C  CD    . ARG A 1 438 ? 31.076  24.264  16.102  1.00 75.62  ? 418 ARG A CD    1 
ATOM   3354  N  NE    . ARG A 1 438 ? 30.818  24.166  17.542  1.00 77.13  ? 418 ARG A NE    1 
ATOM   3355  C  CZ    . ARG A 1 438 ? 29.631  24.316  18.140  1.00 77.88  ? 418 ARG A CZ    1 
ATOM   3356  N  NH1   . ARG A 1 438 ? 28.518  24.572  17.446  1.00 78.22  ? 418 ARG A NH1   1 
ATOM   3357  N  NH2   . ARG A 1 438 ? 29.556  24.203  19.465  1.00 78.08  ? 418 ARG A NH2   1 
ATOM   3358  N  N     . ASP A 1 439 ? 34.167  19.976  15.830  1.00 68.73  ? 419 ASP A N     1 
ATOM   3359  C  CA    . ASP A 1 439 ? 35.114  19.081  16.500  1.00 67.37  ? 419 ASP A CA    1 
ATOM   3360  C  C     . ASP A 1 439 ? 34.932  19.109  18.020  1.00 65.43  ? 419 ASP A C     1 
ATOM   3361  O  O     . ASP A 1 439 ? 34.515  20.116  18.594  1.00 64.75  ? 419 ASP A O     1 
ATOM   3362  C  CB    . ASP A 1 439 ? 36.559  19.419  16.108  1.00 67.61  ? 419 ASP A CB    1 
ATOM   3363  C  CG    . ASP A 1 439 ? 36.859  19.094  14.649  1.00 67.44  ? 419 ASP A CG    1 
ATOM   3364  O  OD1   . ASP A 1 439 ? 36.570  17.959  14.214  1.00 66.34  ? 419 ASP A OD1   1 
ATOM   3365  O  OD2   . ASP A 1 439 ? 37.387  19.971  13.934  1.00 68.03  ? 419 ASP A OD2   1 
ATOM   3366  N  N     . TRP A 1 440 ? 35.264  17.987  18.652  1.00 64.01  ? 420 TRP A N     1 
ATOM   3367  C  CA    . TRP A 1 440 ? 34.972  17.740  20.065  1.00 63.35  ? 420 TRP A CA    1 
ATOM   3368  C  C     . TRP A 1 440 ? 36.037  18.369  20.971  1.00 63.62  ? 420 TRP A C     1 
ATOM   3369  O  O     . TRP A 1 440 ? 37.123  17.813  21.136  1.00 64.50  ? 420 TRP A O     1 
ATOM   3370  C  CB    . TRP A 1 440 ? 34.860  16.222  20.289  1.00 62.55  ? 420 TRP A CB    1 
ATOM   3371  C  CG    . TRP A 1 440 ? 34.579  15.759  21.690  1.00 61.92  ? 420 TRP A CG    1 
ATOM   3372  C  CD1   . TRP A 1 440 ? 34.088  16.496  22.732  1.00 62.19  ? 420 TRP A CD1   1 
ATOM   3373  C  CD2   . TRP A 1 440 ? 34.739  14.425  22.185  1.00 61.74  ? 420 TRP A CD2   1 
ATOM   3374  N  NE1   . TRP A 1 440 ? 33.957  15.709  23.851  1.00 62.25  ? 420 TRP A NE1   1 
ATOM   3375  C  CE2   . TRP A 1 440 ? 34.346  14.432  23.542  1.00 62.16  ? 420 TRP A CE2   1 
ATOM   3376  C  CE3   . TRP A 1 440 ? 35.184  13.224  21.613  1.00 61.35  ? 420 TRP A CE3   1 
ATOM   3377  C  CZ2   . TRP A 1 440 ? 34.386  13.280  24.341  1.00 62.26  ? 420 TRP A CZ2   1 
ATOM   3378  C  CZ3   . TRP A 1 440 ? 35.225  12.079  22.406  1.00 61.81  ? 420 TRP A CZ3   1 
ATOM   3379  C  CH2   . TRP A 1 440 ? 34.826  12.117  23.758  1.00 62.23  ? 420 TRP A CH2   1 
ATOM   3380  N  N     . GLY A 1 441 ? 35.709  19.525  21.552  1.00 63.41  ? 421 GLY A N     1 
ATOM   3381  C  CA    . GLY A 1 441 ? 36.599  20.233  22.480  1.00 62.86  ? 421 GLY A CA    1 
ATOM   3382  C  C     . GLY A 1 441 ? 36.595  19.602  23.862  1.00 62.50  ? 421 GLY A C     1 
ATOM   3383  O  O     . GLY A 1 441 ? 35.578  19.638  24.556  1.00 61.88  ? 421 GLY A O     1 
ATOM   3384  N  N     . VAL A 1 442 ? 37.742  19.051  24.266  1.00 63.09  ? 422 VAL A N     1 
ATOM   3385  C  CA    . VAL A 1 442 ? 37.846  18.217  25.480  1.00 63.46  ? 422 VAL A CA    1 
ATOM   3386  C  C     . VAL A 1 442 ? 38.547  18.868  26.683  1.00 63.67  ? 422 VAL A C     1 
ATOM   3387  O  O     . VAL A 1 442 ? 38.561  18.285  27.770  1.00 63.05  ? 422 VAL A O     1 
ATOM   3388  C  CB    . VAL A 1 442 ? 38.512  16.848  25.176  1.00 63.29  ? 422 VAL A CB    1 
ATOM   3389  C  CG1   . VAL A 1 442 ? 37.659  16.057  24.196  1.00 63.53  ? 422 VAL A CG1   1 
ATOM   3390  C  CG2   . VAL A 1 442 ? 39.935  17.003  24.641  1.00 63.33  ? 422 VAL A CG2   1 
ATOM   3391  N  N     . SER A 1 443 ? 39.117  20.061  26.499  1.00 64.50  ? 423 SER A N     1 
ATOM   3392  C  CA    . SER A 1 443 ? 39.751  20.792  27.597  1.00 65.16  ? 423 SER A CA    1 
ATOM   3393  C  C     . SER A 1 443 ? 38.703  21.409  28.509  1.00 65.98  ? 423 SER A C     1 
ATOM   3394  O  O     . SER A 1 443 ? 37.776  22.073  28.040  1.00 65.35  ? 423 SER A O     1 
ATOM   3395  C  CB    . SER A 1 443 ? 40.656  21.909  27.076  1.00 65.52  ? 423 SER A CB    1 
ATOM   3396  O  OG    . SER A 1 443 ? 41.695  21.398  26.268  1.00 65.78  ? 423 SER A OG    1 
ATOM   3397  N  N     . ARG A 1 444 ? 38.854  21.171  29.808  1.00 67.33  ? 424 ARG A N     1 
ATOM   3398  C  CA    . ARG A 1 444 ? 38.099  21.876  30.836  1.00 68.21  ? 424 ARG A CA    1 
ATOM   3399  C  C     . ARG A 1 444 ? 39.092  22.428  31.844  1.00 68.12  ? 424 ARG A C     1 
ATOM   3400  O  O     . ARG A 1 444 ? 40.130  21.811  32.095  1.00 68.68  ? 424 ARG A O     1 
ATOM   3401  C  CB    . ARG A 1 444 ? 37.111  20.936  31.529  1.00 68.91  ? 424 ARG A CB    1 
ATOM   3402  C  CG    . ARG A 1 444 ? 36.047  20.346  30.615  1.00 69.84  ? 424 ARG A CG    1 
ATOM   3403  C  CD    . ARG A 1 444 ? 35.077  21.405  30.113  1.00 70.68  ? 424 ARG A CD    1 
ATOM   3404  N  NE    . ARG A 1 444 ? 33.993  20.826  29.320  1.00 71.63  ? 424 ARG A NE    1 
ATOM   3405  C  CZ    . ARG A 1 444 ? 34.095  20.405  28.056  1.00 72.47  ? 424 ARG A CZ    1 
ATOM   3406  N  NH1   . ARG A 1 444 ? 35.245  20.476  27.384  1.00 72.81  ? 424 ARG A NH1   1 
ATOM   3407  N  NH2   . ARG A 1 444 ? 33.024  19.899  27.451  1.00 73.22  ? 424 ARG A NH2   1 
ATOM   3408  N  N     . GLN A 1 445 ? 38.766  23.581  32.423  1.00 68.07  ? 425 GLN A N     1 
ATOM   3409  C  CA    . GLN A 1 445 ? 39.635  24.232  33.411  1.00 69.07  ? 425 GLN A CA    1 
ATOM   3410  C  C     . GLN A 1 445 ? 38.967  24.152  34.787  1.00 68.29  ? 425 GLN A C     1 
ATOM   3411  O  O     . GLN A 1 445 ? 38.619  25.161  35.406  1.00 68.82  ? 425 GLN A O     1 
ATOM   3412  C  CB    . GLN A 1 445 ? 40.051  25.669  33.003  1.00 70.57  ? 425 GLN A CB    1 
ATOM   3413  C  CG    . GLN A 1 445 ? 39.166  26.404  31.996  1.00 71.14  ? 425 GLN A CG    1 
ATOM   3414  C  CD    . GLN A 1 445 ? 39.391  26.005  30.537  1.00 71.55  ? 425 GLN A CD    1 
ATOM   3415  O  OE1   . GLN A 1 445 ? 38.756  26.559  29.639  1.00 71.78  ? 425 GLN A OE1   1 
ATOM   3416  N  NE2   . GLN A 1 445 ? 40.291  25.054  30.293  1.00 71.36  ? 425 GLN A NE2   1 
ATOM   3417  N  N     . ARG A 1 446 ? 38.784  22.909  35.230  1.00 67.17  ? 426 ARG A N     1 
ATOM   3418  C  CA    . ARG A 1 446 ? 38.279  22.587  36.560  1.00 66.74  ? 426 ARG A CA    1 
ATOM   3419  C  C     . ARG A 1 446 ? 39.200  21.541  37.186  1.00 65.34  ? 426 ARG A C     1 
ATOM   3420  O  O     . ARG A 1 446 ? 40.074  20.983  36.513  1.00 64.25  ? 426 ARG A O     1 
ATOM   3421  C  CB    . ARG A 1 446 ? 36.846  22.039  36.496  1.00 68.38  ? 426 ARG A CB    1 
ATOM   3422  C  CG    . ARG A 1 446 ? 35.941  22.676  35.448  1.00 69.87  ? 426 ARG A CG    1 
ATOM   3423  C  CD    . ARG A 1 446 ? 34.468  22.542  35.819  1.00 71.15  ? 426 ARG A CD    1 
ATOM   3424  N  NE    . ARG A 1 446 ? 33.582  22.543  34.647  1.00 72.50  ? 426 ARG A NE    1 
ATOM   3425  C  CZ    . ARG A 1 446 ? 33.084  21.462  34.032  1.00 73.54  ? 426 ARG A CZ    1 
ATOM   3426  N  NH1   . ARG A 1 446 ? 33.362  20.221  34.444  1.00 74.28  ? 426 ARG A NH1   1 
ATOM   3427  N  NH2   . ARG A 1 446 ? 32.287  21.623  32.976  1.00 73.29  ? 426 ARG A NH2   1 
ATOM   3428  N  N     . TYR A 1 447 ? 38.987  21.276  38.472  1.00 64.07  ? 427 TYR A N     1 
ATOM   3429  C  CA    . TYR A 1 447 ? 39.800  20.313  39.222  1.00 62.87  ? 427 TYR A CA    1 
ATOM   3430  C  C     . TYR A 1 447 ? 39.323  18.881  39.019  1.00 62.41  ? 427 TYR A C     1 
ATOM   3431  O  O     . TYR A 1 447 ? 40.092  18.033  38.565  1.00 62.51  ? 427 TYR A O     1 
ATOM   3432  C  CB    . TYR A 1 447 ? 39.815  20.655  40.720  1.00 62.08  ? 427 TYR A CB    1 
ATOM   3433  C  CG    . TYR A 1 447 ? 40.148  19.489  41.633  1.00 60.82  ? 427 TYR A CG    1 
ATOM   3434  C  CD1   . TYR A 1 447 ? 41.444  18.978  41.713  1.00 59.83  ? 427 TYR A CD1   1 
ATOM   3435  C  CD2   . TYR A 1 447 ? 39.159  18.895  42.413  1.00 60.57  ? 427 TYR A CD2   1 
ATOM   3436  C  CE1   . TYR A 1 447 ? 41.743  17.910  42.548  1.00 59.73  ? 427 TYR A CE1   1 
ATOM   3437  C  CE2   . TYR A 1 447 ? 39.447  17.829  43.250  1.00 60.89  ? 427 TYR A CE2   1 
ATOM   3438  C  CZ    . TYR A 1 447 ? 40.737  17.339  43.315  1.00 60.51  ? 427 TYR A CZ    1 
ATOM   3439  O  OH    . TYR A 1 447 ? 41.003  16.282  44.152  1.00 61.29  ? 427 TYR A OH    1 
ATOM   3440  N  N     . TRP A 1 448 ? 38.064  18.618  39.366  1.00 62.21  ? 428 TRP A N     1 
ATOM   3441  C  CA    . TRP A 1 448 ? 37.551  17.247  39.449  1.00 62.23  ? 428 TRP A CA    1 
ATOM   3442  C  C     . TRP A 1 448 ? 37.318  16.652  38.055  1.00 62.27  ? 428 TRP A C     1 
ATOM   3443  O  O     . TRP A 1 448 ? 36.202  16.636  37.530  1.00 63.20  ? 428 TRP A O     1 
ATOM   3444  C  CB    . TRP A 1 448 ? 36.298  17.185  40.339  1.00 62.17  ? 428 TRP A CB    1 
ATOM   3445  C  CG    . TRP A 1 448 ? 35.896  15.795  40.765  1.00 61.75  ? 428 TRP A CG    1 
ATOM   3446  C  CD1   . TRP A 1 448 ? 34.674  15.214  40.597  1.00 61.95  ? 428 TRP A CD1   1 
ATOM   3447  C  CD2   . TRP A 1 448 ? 36.713  14.820  41.433  1.00 61.63  ? 428 TRP A CD2   1 
ATOM   3448  N  NE1   . TRP A 1 448 ? 34.675  13.940  41.112  1.00 61.92  ? 428 TRP A NE1   1 
ATOM   3449  C  CE2   . TRP A 1 448 ? 35.913  13.671  41.630  1.00 61.83  ? 428 TRP A CE2   1 
ATOM   3450  C  CE3   . TRP A 1 448 ? 38.043  14.801  41.881  1.00 61.87  ? 428 TRP A CE3   1 
ATOM   3451  C  CZ2   . TRP A 1 448 ? 36.398  12.515  42.257  1.00 62.07  ? 428 TRP A CZ2   1 
ATOM   3452  C  CZ3   . TRP A 1 448 ? 38.527  13.649  42.503  1.00 62.07  ? 428 TRP A CZ3   1 
ATOM   3453  C  CH2   . TRP A 1 448 ? 37.703  12.523  42.683  1.00 62.19  ? 428 TRP A CH2   1 
ATOM   3454  N  N     . GLY A 1 449 ? 38.415  16.169  37.477  1.00 62.10  ? 429 GLY A N     1 
ATOM   3455  C  CA    . GLY A 1 449 ? 38.448  15.586  36.136  1.00 62.14  ? 429 GLY A CA    1 
ATOM   3456  C  C     . GLY A 1 449 ? 39.787  14.901  35.908  1.00 62.43  ? 429 GLY A C     1 
ATOM   3457  O  O     . GLY A 1 449 ? 40.755  15.174  36.623  1.00 61.69  ? 429 GLY A O     1 
ATOM   3458  N  N     . ALA A 1 450 ? 39.846  14.010  34.921  1.00 63.33  ? 430 ALA A N     1 
ATOM   3459  C  CA    . ALA A 1 450 ? 41.102  13.342  34.563  1.00 63.70  ? 430 ALA A CA    1 
ATOM   3460  C  C     . ALA A 1 450 ? 42.043  14.355  33.893  1.00 64.19  ? 430 ALA A C     1 
ATOM   3461  O  O     . ALA A 1 450 ? 41.646  14.979  32.907  1.00 64.14  ? 430 ALA A O     1 
ATOM   3462  C  CB    . ALA A 1 450 ? 40.837  12.167  33.635  1.00 63.84  ? 430 ALA A CB    1 
ATOM   3463  N  N     . PRO A 1 451 ? 43.272  14.547  34.431  1.00 64.25  ? 431 PRO A N     1 
ATOM   3464  C  CA    . PRO A 1 451 ? 44.197  15.513  33.810  1.00 63.56  ? 431 PRO A CA    1 
ATOM   3465  C  C     . PRO A 1 451 ? 44.635  15.131  32.396  1.00 63.42  ? 431 PRO A C     1 
ATOM   3466  O  O     . PRO A 1 451 ? 44.852  13.953  32.115  1.00 62.31  ? 431 PRO A O     1 
ATOM   3467  C  CB    . PRO A 1 451 ? 45.406  15.510  34.755  1.00 63.64  ? 431 PRO A CB    1 
ATOM   3468  C  CG    . PRO A 1 451 ? 44.880  15.015  36.052  1.00 63.93  ? 431 PRO A CG    1 
ATOM   3469  C  CD    . PRO A 1 451 ? 43.827  14.013  35.690  1.00 64.09  ? 431 PRO A CD    1 
ATOM   3470  N  N     . ILE A 1 452 ? 44.767  16.133  31.528  1.00 64.59  ? 432 ILE A N     1 
ATOM   3471  C  CA    . ILE A 1 452 ? 45.123  15.920  30.124  1.00 66.31  ? 432 ILE A CA    1 
ATOM   3472  C  C     . ILE A 1 452 ? 46.636  15.683  30.034  1.00 69.17  ? 432 ILE A C     1 
ATOM   3473  O  O     . ILE A 1 452 ? 47.408  16.491  30.556  1.00 70.22  ? 432 ILE A O     1 
ATOM   3474  C  CB    . ILE A 1 452 ? 44.707  17.129  29.251  1.00 65.65  ? 432 ILE A CB    1 
ATOM   3475  C  CG1   . ILE A 1 452 ? 43.185  17.308  29.297  1.00 65.61  ? 432 ILE A CG1   1 
ATOM   3476  C  CG2   . ILE A 1 452 ? 45.154  16.944  27.804  1.00 65.92  ? 432 ILE A CG2   1 
ATOM   3477  C  CD1   . ILE A 1 452 ? 42.697  18.653  28.810  1.00 66.13  ? 432 ILE A CD1   1 
ATOM   3478  N  N     . PRO A 1 453 ? 47.068  14.578  29.381  1.00 71.56  ? 433 PRO A N     1 
ATOM   3479  C  CA    . PRO A 1 453 ? 48.495  14.255  29.330  1.00 73.30  ? 433 PRO A CA    1 
ATOM   3480  C  C     . PRO A 1 453 ? 49.231  14.987  28.198  1.00 75.57  ? 433 PRO A C     1 
ATOM   3481  O  O     . PRO A 1 453 ? 49.509  14.410  27.142  1.00 76.12  ? 433 PRO A O     1 
ATOM   3482  C  CB    . PRO A 1 453 ? 48.487  12.739  29.126  1.00 72.80  ? 433 PRO A CB    1 
ATOM   3483  C  CG    . PRO A 1 453 ? 47.274  12.501  28.297  1.00 72.52  ? 433 PRO A CG    1 
ATOM   3484  C  CD    . PRO A 1 453 ? 46.268  13.560  28.669  1.00 71.88  ? 433 PRO A CD    1 
ATOM   3485  N  N     . MET A 1 454 ? 49.534  16.260  28.442  1.00 78.83  ? 434 MET A N     1 
ATOM   3486  C  CA    . MET A 1 454 ? 50.324  17.088  27.526  1.00 81.11  ? 434 MET A CA    1 
ATOM   3487  C  C     . MET A 1 454 ? 51.313  17.930  28.330  1.00 83.86  ? 434 MET A C     1 
ATOM   3488  O  O     . MET A 1 454 ? 51.008  18.361  29.447  1.00 83.78  ? 434 MET A O     1 
ATOM   3489  C  CB    . MET A 1 454 ? 49.410  17.991  26.692  1.00 81.17  ? 434 MET A CB    1 
ATOM   3490  C  CG    . MET A 1 454 ? 48.639  17.266  25.598  1.00 80.64  ? 434 MET A CG    1 
ATOM   3491  S  SD    . MET A 1 454 ? 49.672  16.808  24.194  1.00 79.92  ? 434 MET A SD    1 
ATOM   3492  C  CE    . MET A 1 454 ? 48.682  15.513  23.458  1.00 79.95  ? 434 MET A CE    1 
ATOM   3493  N  N     . VAL A 1 455 ? 52.492  18.156  27.749  1.00 85.52  ? 435 VAL A N     1 
ATOM   3494  C  CA    . VAL A 1 455 ? 53.620  18.768  28.452  1.00 86.73  ? 435 VAL A CA    1 
ATOM   3495  C  C     . VAL A 1 455 ? 54.214  19.902  27.624  1.00 87.35  ? 435 VAL A C     1 
ATOM   3496  O  O     . VAL A 1 455 ? 54.689  19.668  26.513  1.00 88.08  ? 435 VAL A O     1 
ATOM   3497  C  CB    . VAL A 1 455 ? 54.723  17.722  28.745  1.00 88.32  ? 435 VAL A CB    1 
ATOM   3498  C  CG1   . VAL A 1 455 ? 55.886  18.351  29.505  1.00 89.60  ? 435 VAL A CG1   1 
ATOM   3499  C  CG2   . VAL A 1 455 ? 54.153  16.546  29.530  1.00 89.08  ? 435 VAL A CG2   1 
ATOM   3500  N  N     . THR A 1 456 ? 54.183  21.118  28.172  1.00 88.60  ? 436 THR A N     1 
ATOM   3501  C  CA    . THR A 1 456 ? 54.867  22.272  27.582  1.00 89.26  ? 436 THR A CA    1 
ATOM   3502  C  C     . THR A 1 456 ? 56.273  22.359  28.180  1.00 89.25  ? 436 THR A C     1 
ATOM   3503  O  O     . THR A 1 456 ? 56.426  22.547  29.390  1.00 88.41  ? 436 THR A O     1 
ATOM   3504  C  CB    . THR A 1 456 ? 54.108  23.591  27.856  1.00 89.47  ? 436 THR A CB    1 
ATOM   3505  O  OG1   . THR A 1 456 ? 52.721  23.431  27.529  1.00 89.49  ? 436 THR A OG1   1 
ATOM   3506  C  CG2   . THR A 1 456 ? 54.690  24.741  27.031  1.00 89.04  ? 436 THR A CG2   1 
ATOM   3507  N  N     . LEU A 1 457 ? 57.291  22.214  27.332  1.00 89.98  ? 437 LEU A N     1 
ATOM   3508  C  CA    . LEU A 1 457 ? 58.689  22.231  27.775  1.00 91.38  ? 437 LEU A CA    1 
ATOM   3509  C  C     . LEU A 1 457 ? 59.195  23.658  27.989  1.00 92.91  ? 437 LEU A C     1 
ATOM   3510  O  O     . LEU A 1 457 ? 58.511  24.631  27.657  1.00 94.13  ? 437 LEU A O     1 
ATOM   3511  C  CB    . LEU A 1 457 ? 59.586  21.515  26.753  1.00 91.41  ? 437 LEU A CB    1 
ATOM   3512  C  CG    . LEU A 1 457 ? 59.232  20.071  26.374  1.00 91.67  ? 437 LEU A CG    1 
ATOM   3513  C  CD1   . LEU A 1 457 ? 60.202  19.535  25.334  1.00 91.16  ? 437 LEU A CD1   1 
ATOM   3514  C  CD2   . LEU A 1 457 ? 59.227  19.162  27.591  1.00 92.11  ? 437 LEU A CD2   1 
ATOM   3515  N  N     . GLU A 1 458 ? 60.400  23.766  28.549  1.00 93.49  ? 438 GLU A N     1 
ATOM   3516  C  CA    . GLU A 1 458 ? 61.094  25.052  28.706  1.00 92.82  ? 438 GLU A CA    1 
ATOM   3517  C  C     . GLU A 1 458 ? 61.532  25.636  27.353  1.00 91.48  ? 438 GLU A C     1 
ATOM   3518  O  O     . GLU A 1 458 ? 61.712  26.849  27.230  1.00 89.83  ? 438 GLU A O     1 
ATOM   3519  C  CB    . GLU A 1 458 ? 62.304  24.892  29.632  1.00 94.46  ? 438 GLU A CB    1 
ATOM   3520  C  CG    . GLU A 1 458 ? 62.903  26.201  30.127  1.00 95.99  ? 438 GLU A CG    1 
ATOM   3521  C  CD    . GLU A 1 458 ? 63.932  26.001  31.228  1.00 97.00  ? 438 GLU A CD    1 
ATOM   3522  O  OE1   . GLU A 1 458 ? 64.648  24.975  31.210  1.00 96.27  ? 438 GLU A OE1   1 
ATOM   3523  O  OE2   . GLU A 1 458 ? 64.031  26.878  32.114  1.00 98.69  ? 438 GLU A OE2   1 
ATOM   3524  N  N     . ASP A 1 459 ? 61.718  24.763  26.359  1.00 91.18  ? 439 ASP A N     1 
ATOM   3525  C  CA    . ASP A 1 459 ? 61.913  25.159  24.954  1.00 92.32  ? 439 ASP A CA    1 
ATOM   3526  C  C     . ASP A 1 459 ? 60.833  26.103  24.418  1.00 93.13  ? 439 ASP A C     1 
ATOM   3527  O  O     . ASP A 1 459 ? 61.138  27.049  23.687  1.00 93.54  ? 439 ASP A O     1 
ATOM   3528  C  CB    . ASP A 1 459 ? 61.924  23.916  24.050  1.00 92.96  ? 439 ASP A CB    1 
ATOM   3529  C  CG    . ASP A 1 459 ? 63.243  23.170  24.082  1.00 94.51  ? 439 ASP A CG    1 
ATOM   3530  O  OD1   . ASP A 1 459 ? 64.291  23.794  23.818  1.00 98.65  ? 439 ASP A OD1   1 
ATOM   3531  O  OD2   . ASP A 1 459 ? 63.230  21.949  24.344  1.00 94.55  ? 439 ASP A OD2   1 
ATOM   3532  N  N     . GLY A 1 460 ? 59.580  25.825  24.780  1.00 92.99  ? 440 GLY A N     1 
ATOM   3533  C  CA    . GLY A 1 460 ? 58.407  26.450  24.165  1.00 92.03  ? 440 GLY A CA    1 
ATOM   3534  C  C     . GLY A 1 460 ? 57.563  25.425  23.424  1.00 90.76  ? 440 GLY A C     1 
ATOM   3535  O  O     . GLY A 1 460 ? 56.375  25.651  23.188  1.00 91.29  ? 440 GLY A O     1 
ATOM   3536  N  N     . THR A 1 461 ? 58.177  24.297  23.060  1.00 88.63  ? 441 THR A N     1 
ATOM   3537  C  CA    . THR A 1 461 ? 57.501  23.222  22.341  1.00 87.89  ? 441 THR A CA    1 
ATOM   3538  C  C     . THR A 1 461 ? 56.590  22.413  23.260  1.00 87.50  ? 441 THR A C     1 
ATOM   3539  O  O     . THR A 1 461 ? 56.959  22.111  24.397  1.00 86.96  ? 441 THR A O     1 
ATOM   3540  C  CB    . THR A 1 461 ? 58.519  22.252  21.713  1.00 88.50  ? 441 THR A CB    1 
ATOM   3541  O  OG1   . THR A 1 461 ? 59.419  21.779  22.723  1.00 86.55  ? 441 THR A OG1   1 
ATOM   3542  C  CG2   . THR A 1 461 ? 59.314  22.946  20.618  1.00 89.77  ? 441 THR A CG2   1 
ATOM   3543  N  N     . VAL A 1 462 ? 55.410  22.064  22.748  1.00 87.62  ? 442 VAL A N     1 
ATOM   3544  C  CA    . VAL A 1 462 ? 54.448  21.209  23.446  1.00 86.69  ? 442 VAL A CA    1 
ATOM   3545  C  C     . VAL A 1 462 ? 54.515  19.800  22.848  1.00 85.67  ? 442 VAL A C     1 
ATOM   3546  O  O     . VAL A 1 462 ? 54.718  19.642  21.642  1.00 85.96  ? 442 VAL A O     1 
ATOM   3547  C  CB    . VAL A 1 462 ? 53.007  21.761  23.328  1.00 87.12  ? 442 VAL A CB    1 
ATOM   3548  C  CG1   . VAL A 1 462 ? 52.037  20.937  24.173  1.00 87.96  ? 442 VAL A CG1   1 
ATOM   3549  C  CG2   . VAL A 1 462 ? 52.956  23.230  23.739  1.00 86.93  ? 442 VAL A CG2   1 
ATOM   3550  N  N     . MET A 1 463 ? 54.349  18.787  23.697  1.00 85.16  ? 443 MET A N     1 
ATOM   3551  C  CA    . MET A 1 463 ? 54.355  17.383  23.266  1.00 84.65  ? 443 MET A CA    1 
ATOM   3552  C  C     . MET A 1 463 ? 53.595  16.504  24.268  1.00 82.23  ? 443 MET A C     1 
ATOM   3553  O  O     . MET A 1 463 ? 53.318  16.953  25.384  1.00 83.14  ? 443 MET A O     1 
ATOM   3554  C  CB    . MET A 1 463 ? 55.796  16.887  23.088  1.00 86.73  ? 443 MET A CB    1 
ATOM   3555  C  CG    . MET A 1 463 ? 56.709  17.118  24.285  1.00 88.85  ? 443 MET A CG    1 
ATOM   3556  S  SD    . MET A 1 463 ? 58.281  16.245  24.132  1.00 92.15  ? 443 MET A SD    1 
ATOM   3557  C  CE    . MET A 1 463 ? 57.786  14.562  24.502  1.00 91.36  ? 443 MET A CE    1 
ATOM   3558  N  N     . PRO A 1 464 ? 53.247  15.256  23.879  1.00 79.50  ? 444 PRO A N     1 
ATOM   3559  C  CA    . PRO A 1 464 ? 52.528  14.383  24.817  1.00 79.15  ? 444 PRO A CA    1 
ATOM   3560  C  C     . PRO A 1 464 ? 53.364  13.960  26.020  1.00 78.63  ? 444 PRO A C     1 
ATOM   3561  O  O     . PRO A 1 464 ? 54.594  13.915  25.931  1.00 78.49  ? 444 PRO A O     1 
ATOM   3562  C  CB    . PRO A 1 464 ? 52.179  13.150  23.967  1.00 79.24  ? 444 PRO A CB    1 
ATOM   3563  C  CG    . PRO A 1 464 ? 52.318  13.588  22.555  1.00 79.55  ? 444 PRO A CG    1 
ATOM   3564  C  CD    . PRO A 1 464 ? 53.406  14.612  22.562  1.00 79.58  ? 444 PRO A CD    1 
ATOM   3565  N  N     . THR A 1 465 ? 52.690  13.657  27.129  1.00 78.44  ? 445 THR A N     1 
ATOM   3566  C  CA    . THR A 1 465 ? 53.346  13.104  28.312  1.00 78.77  ? 445 THR A CA    1 
ATOM   3567  C  C     . THR A 1 465 ? 53.858  11.706  27.948  1.00 79.83  ? 445 THR A C     1 
ATOM   3568  O  O     . THR A 1 465 ? 53.102  10.912  27.381  1.00 79.98  ? 445 THR A O     1 
ATOM   3569  C  CB    . THR A 1 465 ? 52.380  13.002  29.515  1.00 77.98  ? 445 THR A CB    1 
ATOM   3570  O  OG1   . THR A 1 465 ? 51.754  14.269  29.746  1.00 76.42  ? 445 THR A OG1   1 
ATOM   3571  C  CG2   . THR A 1 465 ? 53.117  12.581  30.784  1.00 77.84  ? 445 THR A CG2   1 
ATOM   3572  N  N     . PRO A 1 466 ? 55.141  11.405  28.249  1.00 81.77  ? 446 PRO A N     1 
ATOM   3573  C  CA    . PRO A 1 466 ? 55.675  10.086  27.881  1.00 82.85  ? 446 PRO A CA    1 
ATOM   3574  C  C     . PRO A 1 466 ? 55.047  8.936   28.677  1.00 83.86  ? 446 PRO A C     1 
ATOM   3575  O  O     . PRO A 1 466 ? 54.442  9.160   29.728  1.00 84.49  ? 446 PRO A O     1 
ATOM   3576  C  CB    . PRO A 1 466 ? 57.177  10.216  28.166  1.00 82.58  ? 446 PRO A CB    1 
ATOM   3577  C  CG    . PRO A 1 466 ? 57.289  11.305  29.173  1.00 82.18  ? 446 PRO A CG    1 
ATOM   3578  C  CD    . PRO A 1 466 ? 56.166  12.255  28.886  1.00 81.84  ? 446 PRO A CD    1 
ATOM   3579  N  N     . ASP A 1 467 ? 55.208  7.720   28.162  1.00 85.54  ? 447 ASP A N     1 
ATOM   3580  C  CA    . ASP A 1 467 ? 54.495  6.542   28.674  1.00 87.31  ? 447 ASP A CA    1 
ATOM   3581  C  C     . ASP A 1 467 ? 54.870  6.160   30.110  1.00 87.16  ? 447 ASP A C     1 
ATOM   3582  O  O     . ASP A 1 467 ? 54.016  5.692   30.865  1.00 88.25  ? 447 ASP A O     1 
ATOM   3583  C  CB    . ASP A 1 467 ? 54.709  5.338   27.743  1.00 89.40  ? 447 ASP A CB    1 
ATOM   3584  C  CG    . ASP A 1 467 ? 54.142  5.559   26.342  1.00 90.49  ? 447 ASP A CG    1 
ATOM   3585  O  OD1   . ASP A 1 467 ? 53.707  6.690   26.029  1.00 92.03  ? 447 ASP A OD1   1 
ATOM   3586  O  OD2   . ASP A 1 467 ? 54.136  4.594   25.549  1.00 90.86  ? 447 ASP A OD2   1 
ATOM   3587  N  N     . ASP A 1 468 ? 56.137  6.356   30.475  1.00 86.38  ? 448 ASP A N     1 
ATOM   3588  C  CA    . ASP A 1 468 ? 56.608  6.075   31.841  1.00 85.39  ? 448 ASP A CA    1 
ATOM   3589  C  C     . ASP A 1 468 ? 55.963  6.966   32.918  1.00 83.40  ? 448 ASP A C     1 
ATOM   3590  O  O     . ASP A 1 468 ? 55.764  6.518   34.049  1.00 83.90  ? 448 ASP A O     1 
ATOM   3591  C  CB    . ASP A 1 468 ? 58.147  6.150   31.926  1.00 86.06  ? 448 ASP A CB    1 
ATOM   3592  C  CG    . ASP A 1 468 ? 58.695  7.553   31.685  1.00 86.58  ? 448 ASP A CG    1 
ATOM   3593  O  OD1   . ASP A 1 468 ? 58.084  8.319   30.912  1.00 87.83  ? 448 ASP A OD1   1 
ATOM   3594  O  OD2   . ASP A 1 468 ? 59.750  7.885   32.264  1.00 87.14  ? 448 ASP A OD2   1 
ATOM   3595  N  N     . GLN A 1 469 ? 55.635  8.211   32.559  1.00 80.52  ? 449 GLN A N     1 
ATOM   3596  C  CA    . GLN A 1 469 ? 55.024  9.173   33.493  1.00 78.87  ? 449 GLN A CA    1 
ATOM   3597  C  C     . GLN A 1 469 ? 53.494  9.071   33.619  1.00 76.11  ? 449 GLN A C     1 
ATOM   3598  O  O     . GLN A 1 469 ? 52.910  9.702   34.505  1.00 74.48  ? 449 GLN A O     1 
ATOM   3599  C  CB    . GLN A 1 469 ? 55.418  10.606  33.115  1.00 79.06  ? 449 GLN A CB    1 
ATOM   3600  C  CG    . GLN A 1 469 ? 56.908  10.879  33.244  1.00 79.05  ? 449 GLN A CG    1 
ATOM   3601  C  CD    . GLN A 1 469 ? 57.272  12.324  32.960  1.00 78.92  ? 449 GLN A CD    1 
ATOM   3602  O  OE1   . GLN A 1 469 ? 56.654  13.251  33.487  1.00 78.07  ? 449 GLN A OE1   1 
ATOM   3603  N  NE2   . GLN A 1 469 ? 58.290  12.523  32.130  1.00 79.76  ? 449 GLN A NE2   1 
ATOM   3604  N  N     . LEU A 1 470 ? 52.850  8.298   32.743  1.00 73.88  ? 450 LEU A N     1 
ATOM   3605  C  CA    . LEU A 1 470 ? 51.413  8.031   32.862  1.00 72.51  ? 450 LEU A CA    1 
ATOM   3606  C  C     . LEU A 1 470 ? 51.171  6.990   33.966  1.00 71.84  ? 450 LEU A C     1 
ATOM   3607  O  O     . LEU A 1 470 ? 51.970  6.063   34.102  1.00 72.43  ? 450 LEU A O     1 
ATOM   3608  C  CB    . LEU A 1 470 ? 50.837  7.525   31.537  1.00 71.43  ? 450 LEU A CB    1 
ATOM   3609  C  CG    . LEU A 1 470 ? 50.902  8.493   30.351  1.00 70.91  ? 450 LEU A CG    1 
ATOM   3610  C  CD1   . LEU A 1 470 ? 50.569  7.770   29.055  1.00 70.67  ? 450 LEU A CD1   1 
ATOM   3611  C  CD2   . LEU A 1 470 ? 49.970  9.680   30.553  1.00 70.75  ? 450 LEU A CD2   1 
ATOM   3612  N  N     . PRO A 1 471 ? 50.096  7.111   34.752  1.00 71.19  ? 451 PRO A N     1 
ATOM   3613  C  CA    . PRO A 1 471 ? 49.095  8.181   34.654  1.00 71.45  ? 451 PRO A CA    1 
ATOM   3614  C  C     . PRO A 1 471 ? 49.528  9.484   35.325  1.00 71.97  ? 451 PRO A C     1 
ATOM   3615  O  O     . PRO A 1 471 ? 50.265  9.456   36.314  1.00 74.28  ? 451 PRO A O     1 
ATOM   3616  C  CB    . PRO A 1 471 ? 47.896  7.600   35.407  1.00 71.16  ? 451 PRO A CB    1 
ATOM   3617  C  CG    . PRO A 1 471 ? 48.486  6.644   36.384  1.00 70.93  ? 451 PRO A CG    1 
ATOM   3618  C  CD    . PRO A 1 471 ? 49.697  6.066   35.712  1.00 71.04  ? 451 PRO A CD    1 
ATOM   3619  N  N     . VAL A 1 472 ? 49.065  10.609  34.780  1.00 70.60  ? 452 VAL A N     1 
ATOM   3620  C  CA    . VAL A 1 472 ? 49.192  11.907  35.441  1.00 69.38  ? 452 VAL A CA    1 
ATOM   3621  C  C     . VAL A 1 472 ? 48.075  11.955  36.484  1.00 68.08  ? 452 VAL A C     1 
ATOM   3622  O  O     . VAL A 1 472 ? 46.940  12.331  36.176  1.00 67.51  ? 452 VAL A O     1 
ATOM   3623  C  CB    . VAL A 1 472 ? 49.084  13.084  34.443  1.00 69.58  ? 452 VAL A CB    1 
ATOM   3624  C  CG1   . VAL A 1 472 ? 49.165  14.424  35.170  1.00 69.24  ? 452 VAL A CG1   1 
ATOM   3625  C  CG2   . VAL A 1 472 ? 50.177  12.983  33.384  1.00 69.92  ? 452 VAL A CG2   1 
ATOM   3626  N  N     . ILE A 1 473 ? 48.407  11.554  37.711  1.00 66.61  ? 453 ILE A N     1 
ATOM   3627  C  CA    . ILE A 1 473 ? 47.412  11.355  38.767  1.00 65.73  ? 453 ILE A CA    1 
ATOM   3628  C  C     . ILE A 1 473 ? 46.911  12.691  39.322  1.00 66.29  ? 453 ILE A C     1 
ATOM   3629  O  O     . ILE A 1 473 ? 47.706  13.586  39.616  1.00 66.66  ? 453 ILE A O     1 
ATOM   3630  C  CB    . ILE A 1 473 ? 47.969  10.477  39.916  1.00 64.47  ? 453 ILE A CB    1 
ATOM   3631  C  CG1   . ILE A 1 473 ? 48.294  9.070   39.395  1.00 64.45  ? 453 ILE A CG1   1 
ATOM   3632  C  CG2   . ILE A 1 473 ? 46.973  10.385  41.074  1.00 64.42  ? 453 ILE A CG2   1 
ATOM   3633  C  CD1   . ILE A 1 473 ? 49.198  8.260   40.302  1.00 65.07  ? 453 ILE A CD1   1 
ATOM   3634  N  N     . LEU A 1 474 ? 45.590  12.810  39.455  1.00 66.45  ? 454 LEU A N     1 
ATOM   3635  C  CA    . LEU A 1 474 ? 44.969  13.950  40.124  1.00 67.29  ? 454 LEU A CA    1 
ATOM   3636  C  C     . LEU A 1 474 ? 45.042  13.704  41.632  1.00 68.76  ? 454 LEU A C     1 
ATOM   3637  O  O     . LEU A 1 474 ? 44.688  12.612  42.085  1.00 69.46  ? 454 LEU A O     1 
ATOM   3638  C  CB    . LEU A 1 474 ? 43.507  14.095  39.694  1.00 67.06  ? 454 LEU A CB    1 
ATOM   3639  C  CG    . LEU A 1 474 ? 42.813  15.419  40.039  1.00 66.67  ? 454 LEU A CG    1 
ATOM   3640  C  CD1   . LEU A 1 474 ? 43.170  16.496  39.026  1.00 66.39  ? 454 LEU A CD1   1 
ATOM   3641  C  CD2   . LEU A 1 474 ? 41.304  15.244  40.109  1.00 66.82  ? 454 LEU A CD2   1 
ATOM   3642  N  N     . PRO A 1 475 ? 45.499  14.706  42.414  1.00 70.31  ? 455 PRO A N     1 
ATOM   3643  C  CA    . PRO A 1 475 ? 45.569  14.522  43.864  1.00 70.98  ? 455 PRO A CA    1 
ATOM   3644  C  C     . PRO A 1 475 ? 44.195  14.667  44.512  1.00 71.73  ? 455 PRO A C     1 
ATOM   3645  O  O     . PRO A 1 475 ? 43.525  15.677  44.303  1.00 72.24  ? 455 PRO A O     1 
ATOM   3646  C  CB    . PRO A 1 475 ? 46.504  15.648  44.313  1.00 70.99  ? 455 PRO A CB    1 
ATOM   3647  C  CG    . PRO A 1 475 ? 46.299  16.728  43.309  1.00 70.75  ? 455 PRO A CG    1 
ATOM   3648  C  CD    . PRO A 1 475 ? 45.949  16.053  42.011  1.00 70.46  ? 455 PRO A CD    1 
ATOM   3649  N  N     . GLU A 1 476 ? 43.784  13.658  45.278  1.00 72.95  ? 456 GLU A N     1 
ATOM   3650  C  CA    . GLU A 1 476 ? 42.498  13.682  45.981  1.00 74.62  ? 456 GLU A CA    1 
ATOM   3651  C  C     . GLU A 1 476 ? 42.555  14.510  47.269  1.00 77.18  ? 456 GLU A C     1 
ATOM   3652  O  O     . GLU A 1 476 ? 41.583  15.184  47.615  1.00 76.00  ? 456 GLU A O     1 
ATOM   3653  C  CB    . GLU A 1 476 ? 42.029  12.257  46.289  1.00 74.15  ? 456 GLU A CB    1 
ATOM   3654  C  CG    . GLU A 1 476 ? 41.828  11.402  45.043  1.00 73.35  ? 456 GLU A CG    1 
ATOM   3655  C  CD    . GLU A 1 476 ? 40.978  10.167  45.288  1.00 72.50  ? 456 GLU A CD    1 
ATOM   3656  O  OE1   . GLU A 1 476 ? 40.962  9.657   46.429  1.00 71.60  ? 456 GLU A OE1   1 
ATOM   3657  O  OE2   . GLU A 1 476 ? 40.324  9.702   44.329  1.00 71.46  ? 456 GLU A OE2   1 
ATOM   3658  N  N     . ASP A 1 477 ? 43.692  14.448  47.966  1.00 81.83  ? 457 ASP A N     1 
ATOM   3659  C  CA    . ASP A 1 477 ? 43.917  15.201  49.207  1.00 85.44  ? 457 ASP A CA    1 
ATOM   3660  C  C     . ASP A 1 477 ? 44.215  16.682  48.915  1.00 86.45  ? 457 ASP A C     1 
ATOM   3661  O  O     . ASP A 1 477 ? 45.371  17.063  48.703  1.00 85.40  ? 457 ASP A O     1 
ATOM   3662  C  CB    . ASP A 1 477 ? 45.065  14.554  50.006  1.00 87.66  ? 457 ASP A CB    1 
ATOM   3663  C  CG    . ASP A 1 477 ? 45.343  15.253  51.332  1.00 90.20  ? 457 ASP A CG    1 
ATOM   3664  O  OD1   . ASP A 1 477 ? 44.384  15.695  52.003  1.00 93.34  ? 457 ASP A OD1   1 
ATOM   3665  O  OD2   . ASP A 1 477 ? 46.532  15.348  51.708  1.00 91.37  ? 457 ASP A OD2   1 
ATOM   3666  N  N     . VAL A 1 478 ? 43.161  17.502  48.902  1.00 88.47  ? 458 VAL A N     1 
ATOM   3667  C  CA    . VAL A 1 478 ? 43.261  18.944  48.619  1.00 89.96  ? 458 VAL A CA    1 
ATOM   3668  C  C     . VAL A 1 478 ? 42.219  19.755  49.398  1.00 90.54  ? 458 VAL A C     1 
ATOM   3669  O  O     . VAL A 1 478 ? 41.318  19.191  50.025  1.00 89.09  ? 458 VAL A O     1 
ATOM   3670  C  CB    . VAL A 1 478 ? 43.092  19.252  47.104  1.00 91.51  ? 458 VAL A CB    1 
ATOM   3671  C  CG1   . VAL A 1 478 ? 44.282  18.740  46.303  1.00 92.53  ? 458 VAL A CG1   1 
ATOM   3672  C  CG2   . VAL A 1 478 ? 41.790  18.678  46.552  1.00 91.78  ? 458 VAL A CG2   1 
ATOM   3673  N  N     . VAL A 1 479 ? 42.367  21.080  49.347  1.00 92.33  ? 459 VAL A N     1 
ATOM   3674  C  CA    . VAL A 1 479 ? 41.363  22.031  49.847  1.00 93.41  ? 459 VAL A CA    1 
ATOM   3675  C  C     . VAL A 1 479 ? 41.074  23.063  48.759  1.00 94.18  ? 459 VAL A C     1 
ATOM   3676  O  O     . VAL A 1 479 ? 41.996  23.531  48.086  1.00 93.53  ? 459 VAL A O     1 
ATOM   3677  C  CB    . VAL A 1 479 ? 41.796  22.745  51.154  1.00 93.69  ? 459 VAL A CB    1 
ATOM   3678  C  CG1   . VAL A 1 479 ? 41.683  21.795  52.337  1.00 94.36  ? 459 VAL A CG1   1 
ATOM   3679  C  CG2   . VAL A 1 479 ? 43.207  23.321  51.058  1.00 93.38  ? 459 VAL A CG2   1 
ATOM   3680  N  N     . MET A 1 480 ? 39.796  23.408  48.593  1.00 95.98  ? 460 MET A N     1 
ATOM   3681  C  CA    . MET A 1 480 ? 39.346  24.274  47.500  1.00 97.28  ? 460 MET A CA    1 
ATOM   3682  C  C     . MET A 1 480 ? 38.750  25.577  48.025  1.00 98.22  ? 460 MET A C     1 
ATOM   3683  O  O     . MET A 1 480 ? 37.849  25.556  48.865  1.00 99.24  ? 460 MET A O     1 
ATOM   3684  C  CB    . MET A 1 480 ? 38.298  23.552  46.649  1.00 96.90  ? 460 MET A CB    1 
ATOM   3685  C  CG    . MET A 1 480 ? 38.699  22.153  46.205  1.00 96.50  ? 460 MET A CG    1 
ATOM   3686  S  SD    . MET A 1 480 ? 38.039  21.698  44.590  1.00 97.33  ? 460 MET A SD    1 
ATOM   3687  C  CE    . MET A 1 480 ? 36.313  22.144  44.760  1.00 97.37  ? 460 MET A CE    1 
ATOM   3688  N  N     . ASP A 1 481 ? 39.261  26.704  47.530  1.00 99.07  ? 461 ASP A N     1 
ATOM   3689  C  CA    . ASP A 1 481 ? 38.664  28.017  47.805  1.00 100.51 ? 461 ASP A CA    1 
ATOM   3690  C  C     . ASP A 1 481 ? 37.350  28.222  47.035  1.00 100.78 ? 461 ASP A C     1 
ATOM   3691  O  O     . ASP A 1 481 ? 36.468  28.944  47.502  1.00 99.84  ? 461 ASP A O     1 
ATOM   3692  C  CB    . ASP A 1 481 ? 39.656  29.159  47.509  1.00 100.73 ? 461 ASP A CB    1 
ATOM   3693  C  CG    . ASP A 1 481 ? 39.987  29.298  46.030  1.00 101.38 ? 461 ASP A CG    1 
ATOM   3694  O  OD1   . ASP A 1 481 ? 40.045  28.269  45.324  1.00 101.96 ? 461 ASP A OD1   1 
ATOM   3695  O  OD2   . ASP A 1 481 ? 40.195  30.442  45.577  1.00 102.12 ? 461 ASP A OD2   1 
ATOM   3696  N  N     . GLY A 1 482 ? 37.234  27.590  45.864  1.00 102.75 ? 462 GLY A N     1 
ATOM   3697  C  CA    . GLY A 1 482 ? 36.033  27.675  45.026  1.00 105.63 ? 462 GLY A CA    1 
ATOM   3698  C  C     . GLY A 1 482 ? 36.279  28.394  43.712  1.00 107.86 ? 462 GLY A C     1 
ATOM   3699  O  O     . GLY A 1 482 ? 35.747  27.993  42.674  1.00 107.76 ? 462 GLY A O     1 
ATOM   3700  N  N     . ILE A 1 483 ? 37.085  29.456  43.761  1.00 109.90 ? 463 ILE A N     1 
ATOM   3701  C  CA    . ILE A 1 483 ? 37.405  30.261  42.580  1.00 110.09 ? 463 ILE A CA    1 
ATOM   3702  C  C     . ILE A 1 483 ? 38.345  29.484  41.648  1.00 107.28 ? 463 ILE A C     1 
ATOM   3703  O  O     . ILE A 1 483 ? 37.941  29.085  40.554  1.00 108.94 ? 463 ILE A O     1 
ATOM   3704  C  CB    . ILE A 1 483 ? 38.009  31.639  42.975  1.00 112.17 ? 463 ILE A CB    1 
ATOM   3705  C  CG1   . ILE A 1 483 ? 36.991  32.461  43.783  1.00 113.07 ? 463 ILE A CG1   1 
ATOM   3706  C  CG2   . ILE A 1 483 ? 38.434  32.430  41.740  1.00 113.06 ? 463 ILE A CG2   1 
ATOM   3707  C  CD1   . ILE A 1 483 ? 37.609  33.556  44.629  1.00 113.65 ? 463 ILE A CD1   1 
ATOM   3708  N  N     . THR A 1 484 ? 39.579  29.253  42.098  1.00 102.17 ? 464 THR A N     1 
ATOM   3709  C  CA    . THR A 1 484 ? 40.621  28.624  41.275  1.00 98.49  ? 464 THR A CA    1 
ATOM   3710  C  C     . THR A 1 484 ? 40.829  27.156  41.670  1.00 94.68  ? 464 THR A C     1 
ATOM   3711  O  O     . THR A 1 484 ? 40.583  26.772  42.816  1.00 92.92  ? 464 THR A O     1 
ATOM   3712  C  CB    . THR A 1 484 ? 41.957  29.393  41.401  1.00 98.44  ? 464 THR A CB    1 
ATOM   3713  O  OG1   . THR A 1 484 ? 41.711  30.804  41.340  1.00 98.19  ? 464 THR A OG1   1 
ATOM   3714  C  CG2   . THR A 1 484 ? 42.929  29.012  40.285  1.00 98.45  ? 464 THR A CG2   1 
ATOM   3715  N  N     . SER A 1 485 ? 41.273  26.347  40.708  1.00 90.69  ? 465 SER A N     1 
ATOM   3716  C  CA    . SER A 1 485 ? 41.588  24.931  40.941  1.00 87.70  ? 465 SER A CA    1 
ATOM   3717  C  C     . SER A 1 485 ? 42.860  24.776  41.789  1.00 86.93  ? 465 SER A C     1 
ATOM   3718  O  O     . SER A 1 485 ? 43.803  25.547  41.610  1.00 88.34  ? 465 SER A O     1 
ATOM   3719  C  CB    . SER A 1 485 ? 41.779  24.204  39.605  1.00 86.13  ? 465 SER A CB    1 
ATOM   3720  O  OG    . SER A 1 485 ? 42.286  22.896  39.789  1.00 84.47  ? 465 SER A OG    1 
ATOM   3721  N  N     . PRO A 1 486 ? 42.896  23.781  42.706  1.00 86.28  ? 466 PRO A N     1 
ATOM   3722  C  CA    . PRO A 1 486 ? 44.122  23.548  43.489  1.00 86.60  ? 466 PRO A CA    1 
ATOM   3723  C  C     . PRO A 1 486 ? 45.350  23.139  42.666  1.00 86.34  ? 466 PRO A C     1 
ATOM   3724  O  O     . PRO A 1 486 ? 46.456  23.577  42.984  1.00 88.14  ? 466 PRO A O     1 
ATOM   3725  C  CB    . PRO A 1 486 ? 43.723  22.428  44.467  1.00 86.23  ? 466 PRO A CB    1 
ATOM   3726  C  CG    . PRO A 1 486 ? 42.470  21.845  43.923  1.00 86.14  ? 466 PRO A CG    1 
ATOM   3727  C  CD    . PRO A 1 486 ? 41.779  22.966  43.213  1.00 86.14  ? 466 PRO A CD    1 
ATOM   3728  N  N     . ILE A 1 487 ? 45.163  22.312  41.637  1.00 86.33  ? 467 ILE A N     1 
ATOM   3729  C  CA    . ILE A 1 487 ? 46.271  21.945  40.731  1.00 87.62  ? 467 ILE A CA    1 
ATOM   3730  C  C     . ILE A 1 487 ? 46.780  23.118  39.875  1.00 87.63  ? 467 ILE A C     1 
ATOM   3731  O  O     . ILE A 1 487 ? 47.932  23.107  39.440  1.00 87.82  ? 467 ILE A O     1 
ATOM   3732  C  CB    . ILE A 1 487 ? 45.943  20.728  39.823  1.00 87.93  ? 467 ILE A CB    1 
ATOM   3733  C  CG1   . ILE A 1 487 ? 44.714  20.977  38.934  1.00 88.65  ? 467 ILE A CG1   1 
ATOM   3734  C  CG2   . ILE A 1 487 ? 45.743  19.481  40.673  1.00 87.72  ? 467 ILE A CG2   1 
ATOM   3735  C  CD1   . ILE A 1 487 ? 44.655  20.074  37.722  1.00 88.46  ? 467 ILE A CD1   1 
ATOM   3736  N  N     . LYS A 1 488 ? 45.921  24.108  39.632  1.00 88.48  ? 468 LYS A N     1 
ATOM   3737  C  CA    . LYS A 1 488 ? 46.320  25.357  38.969  1.00 90.23  ? 468 LYS A CA    1 
ATOM   3738  C  C     . LYS A 1 488 ? 46.936  26.360  39.949  1.00 89.89  ? 468 LYS A C     1 
ATOM   3739  O  O     . LYS A 1 488 ? 47.892  27.057  39.602  1.00 88.63  ? 468 LYS A O     1 
ATOM   3740  C  CB    . LYS A 1 488 ? 45.121  26.004  38.267  1.00 91.90  ? 468 LYS A CB    1 
ATOM   3741  C  CG    . LYS A 1 488 ? 44.538  25.170  37.138  1.00 93.00  ? 468 LYS A CG    1 
ATOM   3742  C  CD    . LYS A 1 488 ? 43.336  25.852  36.502  1.00 93.39  ? 468 LYS A CD    1 
ATOM   3743  C  CE    . LYS A 1 488 ? 42.649  24.950  35.489  1.00 93.41  ? 468 LYS A CE    1 
ATOM   3744  N  NZ    . LYS A 1 488 ? 43.450  24.775  34.245  1.00 93.22  ? 468 LYS A NZ    1 
ATOM   3745  N  N     . ALA A 1 489 ? 46.379  26.431  41.160  1.00 90.83  ? 469 ALA A N     1 
ATOM   3746  C  CA    . ALA A 1 489 ? 46.825  27.384  42.186  1.00 91.74  ? 469 ALA A CA    1 
ATOM   3747  C  C     . ALA A 1 489 ? 48.240  27.095  42.684  1.00 92.50  ? 469 ALA A C     1 
ATOM   3748  O  O     . ALA A 1 489 ? 49.058  28.008  42.787  1.00 93.87  ? 469 ALA A O     1 
ATOM   3749  C  CB    . ALA A 1 489 ? 45.851  27.398  43.357  1.00 91.60  ? 469 ALA A CB    1 
ATOM   3750  N  N     . ASP A 1 490 ? 48.512  25.829  43.000  1.00 92.93  ? 470 ASP A N     1 
ATOM   3751  C  CA    . ASP A 1 490 ? 49.857  25.386  43.380  1.00 93.96  ? 470 ASP A CA    1 
ATOM   3752  C  C     . ASP A 1 490 ? 50.708  25.242  42.114  1.00 95.91  ? 470 ASP A C     1 
ATOM   3753  O  O     . ASP A 1 490 ? 50.416  24.382  41.280  1.00 99.27  ? 470 ASP A O     1 
ATOM   3754  C  CB    . ASP A 1 490 ? 49.794  24.047  44.131  1.00 93.19  ? 470 ASP A CB    1 
ATOM   3755  C  CG    . ASP A 1 490 ? 51.173  23.484  44.470  1.00 92.76  ? 470 ASP A CG    1 
ATOM   3756  O  OD1   . ASP A 1 490 ? 52.115  24.268  44.720  1.00 92.10  ? 470 ASP A OD1   1 
ATOM   3757  O  OD2   . ASP A 1 490 ? 51.312  22.243  44.492  1.00 92.57  ? 470 ASP A OD2   1 
ATOM   3758  N  N     . PRO A 1 491 ? 51.764  26.070  41.966  1.00 97.02  ? 471 PRO A N     1 
ATOM   3759  C  CA    . PRO A 1 491 ? 52.611  25.955  40.775  1.00 97.41  ? 471 PRO A CA    1 
ATOM   3760  C  C     . PRO A 1 491 ? 53.592  24.771  40.809  1.00 95.91  ? 471 PRO A C     1 
ATOM   3761  O  O     . PRO A 1 491 ? 54.134  24.406  39.764  1.00 94.78  ? 471 PRO A O     1 
ATOM   3762  C  CB    . PRO A 1 491 ? 53.365  27.286  40.760  1.00 98.82  ? 471 PRO A CB    1 
ATOM   3763  C  CG    . PRO A 1 491 ? 53.483  27.657  42.196  1.00 99.37  ? 471 PRO A CG    1 
ATOM   3764  C  CD    . PRO A 1 491 ? 52.272  27.100  42.895  1.00 98.31  ? 471 PRO A CD    1 
ATOM   3765  N  N     . GLU A 1 492 ? 53.820  24.190  41.989  1.00 95.04  ? 472 GLU A N     1 
ATOM   3766  C  CA    . GLU A 1 492 ? 54.724  23.043  42.137  1.00 95.72  ? 472 GLU A CA    1 
ATOM   3767  C  C     . GLU A 1 492 ? 54.191  21.749  41.507  1.00 94.00  ? 472 GLU A C     1 
ATOM   3768  O  O     . GLU A 1 492 ? 54.984  20.883  41.129  1.00 93.28  ? 472 GLU A O     1 
ATOM   3769  C  CB    . GLU A 1 492 ? 55.045  22.796  43.619  1.00 97.51  ? 472 GLU A CB    1 
ATOM   3770  C  CG    . GLU A 1 492 ? 55.840  23.911  44.293  1.00 98.86  ? 472 GLU A CG    1 
ATOM   3771  C  CD    . GLU A 1 492 ? 57.264  24.046  43.773  1.00 99.90  ? 472 GLU A CD    1 
ATOM   3772  O  OE1   . GLU A 1 492 ? 57.887  23.020  43.424  1.00 100.81 ? 472 GLU A OE1   1 
ATOM   3773  O  OE2   . GLU A 1 492 ? 57.770  25.188  43.721  1.00 100.77 ? 472 GLU A OE2   1 
ATOM   3774  N  N     . TRP A 1 493 ? 52.866  21.618  41.400  1.00 91.86  ? 473 TRP A N     1 
ATOM   3775  C  CA    . TRP A 1 493 ? 52.246  20.416  40.827  1.00 90.89  ? 473 TRP A CA    1 
ATOM   3776  C  C     . TRP A 1 493 ? 52.576  20.230  39.347  1.00 89.86  ? 473 TRP A C     1 
ATOM   3777  O  O     . TRP A 1 493 ? 52.921  19.126  38.922  1.00 89.85  ? 473 TRP A O     1 
ATOM   3778  C  CB    . TRP A 1 493 ? 50.722  20.439  41.006  1.00 91.31  ? 473 TRP A CB    1 
ATOM   3779  C  CG    . TRP A 1 493 ? 50.061  19.154  40.580  1.00 91.78  ? 473 TRP A CG    1 
ATOM   3780  C  CD1   . TRP A 1 493 ? 49.879  18.035  41.340  1.00 92.49  ? 473 TRP A CD1   1 
ATOM   3781  C  CD2   . TRP A 1 493 ? 49.514  18.855  39.289  1.00 91.53  ? 473 TRP A CD2   1 
ATOM   3782  N  NE1   . TRP A 1 493 ? 49.249  17.058  40.606  1.00 92.36  ? 473 TRP A NE1   1 
ATOM   3783  C  CE2   . TRP A 1 493 ? 49.013  17.534  39.344  1.00 91.66  ? 473 TRP A CE2   1 
ATOM   3784  C  CE3   . TRP A 1 493 ? 49.399  19.574  38.091  1.00 91.89  ? 473 TRP A CE3   1 
ATOM   3785  C  CZ2   . TRP A 1 493 ? 48.402  16.916  38.245  1.00 91.50  ? 473 TRP A CZ2   1 
ATOM   3786  C  CZ3   . TRP A 1 493 ? 48.790  18.959  36.996  1.00 91.94  ? 473 TRP A CZ3   1 
ATOM   3787  C  CH2   . TRP A 1 493 ? 48.299  17.642  37.084  1.00 91.63  ? 473 TRP A CH2   1 
ATOM   3788  N  N     . ALA A 1 494 ? 52.462  21.309  38.574  1.00 88.72  ? 474 ALA A N     1 
ATOM   3789  C  CA    . ALA A 1 494 ? 52.708  21.274  37.125  1.00 87.28  ? 474 ALA A CA    1 
ATOM   3790  C  C     . ALA A 1 494 ? 54.139  20.871  36.734  1.00 86.39  ? 474 ALA A C     1 
ATOM   3791  O  O     . ALA A 1 494 ? 54.343  20.314  35.655  1.00 86.30  ? 474 ALA A O     1 
ATOM   3792  C  CB    . ALA A 1 494 ? 52.355  22.617  36.500  1.00 86.75  ? 474 ALA A CB    1 
ATOM   3793  N  N     . LYS A 1 495 ? 55.112  21.152  37.603  1.00 85.88  ? 475 LYS A N     1 
ATOM   3794  C  CA    . LYS A 1 495 ? 56.527  20.855  37.335  1.00 85.54  ? 475 LYS A CA    1 
ATOM   3795  C  C     . LYS A 1 495 ? 56.817  19.377  37.058  1.00 85.13  ? 475 LYS A C     1 
ATOM   3796  O  O     . LYS A 1 495 ? 56.286  18.493  37.730  1.00 85.57  ? 475 LYS A O     1 
ATOM   3797  C  CB    . LYS A 1 495 ? 57.406  21.309  38.504  1.00 85.67  ? 475 LYS A CB    1 
ATOM   3798  C  CG    . LYS A 1 495 ? 57.587  22.811  38.616  1.00 85.56  ? 475 LYS A CG    1 
ATOM   3799  C  CD    . LYS A 1 495 ? 58.505  23.139  39.779  1.00 85.96  ? 475 LYS A CD    1 
ATOM   3800  C  CE    . LYS A 1 495 ? 58.970  24.583  39.746  1.00 86.39  ? 475 LYS A CE    1 
ATOM   3801  N  NZ    . LYS A 1 495 ? 59.965  24.857  40.820  1.00 86.52  ? 475 LYS A NZ    1 
ATOM   3802  N  N     . THR A 1 496 ? 57.668  19.135  36.063  1.00 85.37  ? 476 THR A N     1 
ATOM   3803  C  CA    . THR A 1 496 ? 58.171  17.796  35.744  1.00 86.18  ? 476 THR A CA    1 
ATOM   3804  C  C     . THR A 1 496 ? 59.447  17.918  34.899  1.00 86.23  ? 476 THR A C     1 
ATOM   3805  O  O     . THR A 1 496 ? 59.893  19.030  34.607  1.00 86.31  ? 476 THR A O     1 
ATOM   3806  C  CB    . THR A 1 496 ? 57.104  16.934  35.023  1.00 87.22  ? 476 THR A CB    1 
ATOM   3807  O  OG1   . THR A 1 496 ? 57.609  15.608  34.814  1.00 85.96  ? 476 THR A OG1   1 
ATOM   3808  C  CG2   . THR A 1 496 ? 56.695  17.542  33.675  1.00 87.82  ? 476 THR A CG2   1 
ATOM   3809  N  N     . THR A 1 497 ? 60.022  16.780  34.511  1.00 87.41  ? 477 THR A N     1 
ATOM   3810  C  CA    . THR A 1 497 ? 61.274  16.752  33.743  1.00 89.24  ? 477 THR A CA    1 
ATOM   3811  C  C     . THR A 1 497 ? 61.170  15.794  32.548  1.00 90.74  ? 477 THR A C     1 
ATOM   3812  O  O     . THR A 1 497 ? 61.167  14.573  32.720  1.00 91.32  ? 477 THR A O     1 
ATOM   3813  C  CB    . THR A 1 497 ? 62.500  16.415  34.641  1.00 89.60  ? 477 THR A CB    1 
ATOM   3814  O  OG1   . THR A 1 497 ? 63.610  16.011  33.829  1.00 90.36  ? 477 THR A OG1   1 
ATOM   3815  C  CG2   . THR A 1 497 ? 62.191  15.313  35.663  1.00 89.70  ? 477 THR A CG2   1 
ATOM   3816  N  N     . VAL A 1 498 ? 61.076  16.367  31.344  1.00 92.46  ? 478 VAL A N     1 
ATOM   3817  C  CA    . VAL A 1 498 ? 61.001  15.608  30.089  1.00 93.98  ? 478 VAL A CA    1 
ATOM   3818  C  C     . VAL A 1 498 ? 62.172  16.008  29.186  1.00 94.20  ? 478 VAL A C     1 
ATOM   3819  O  O     . VAL A 1 498 ? 62.496  17.193  29.072  1.00 92.42  ? 478 VAL A O     1 
ATOM   3820  C  CB    . VAL A 1 498 ? 59.667  15.867  29.349  1.00 94.88  ? 478 VAL A CB    1 
ATOM   3821  C  CG1   . VAL A 1 498 ? 59.548  14.988  28.105  1.00 94.81  ? 478 VAL A CG1   1 
ATOM   3822  C  CG2   . VAL A 1 498 ? 58.482  15.643  30.282  1.00 95.14  ? 478 VAL A CG2   1 
ATOM   3823  N  N     . ASN A 1 499 ? 62.788  15.008  28.550  1.00 95.56  ? 479 ASN A N     1 
ATOM   3824  C  CA    . ASN A 1 499 ? 63.962  15.186  27.677  1.00 97.10  ? 479 ASN A CA    1 
ATOM   3825  C  C     . ASN A 1 499 ? 65.134  15.911  28.357  1.00 97.15  ? 479 ASN A C     1 
ATOM   3826  O  O     . ASN A 1 499 ? 65.837  16.705  27.726  1.00 98.86  ? 479 ASN A O     1 
ATOM   3827  C  CB    . ASN A 1 499 ? 63.567  15.890  26.365  1.00 98.45  ? 479 ASN A CB    1 
ATOM   3828  C  CG    . ASN A 1 499 ? 62.555  15.101  25.551  1.00 100.07 ? 479 ASN A CG    1 
ATOM   3829  O  OD1   . ASN A 1 499 ? 62.260  13.941  25.845  1.00 101.48 ? 479 ASN A OD1   1 
ATOM   3830  N  ND2   . ASN A 1 499 ? 62.022  15.731  24.510  1.00 101.16 ? 479 ASN A ND2   1 
ATOM   3831  N  N     . GLY A 1 500 ? 65.342  15.622  29.641  1.00 96.48  ? 480 GLY A N     1 
ATOM   3832  C  CA    . GLY A 1 500 ? 66.443  16.203  30.409  1.00 96.87  ? 480 GLY A CA    1 
ATOM   3833  C  C     . GLY A 1 500 ? 66.397  17.713  30.587  1.00 96.44  ? 480 GLY A C     1 
ATOM   3834  O  O     . GLY A 1 500 ? 67.437  18.374  30.529  1.00 97.60  ? 480 GLY A O     1 
ATOM   3835  N  N     . MET A 1 501 ? 65.198  18.258  30.793  1.00 94.86  ? 481 MET A N     1 
ATOM   3836  C  CA    . MET A 1 501 ? 65.030  19.682  31.108  1.00 94.20  ? 481 MET A CA    1 
ATOM   3837  C  C     . MET A 1 501 ? 63.689  19.949  31.805  1.00 92.69  ? 481 MET A C     1 
ATOM   3838  O  O     . MET A 1 501 ? 62.774  19.131  31.695  1.00 91.98  ? 481 MET A O     1 
ATOM   3839  C  CB    . MET A 1 501 ? 65.144  20.543  29.843  1.00 94.74  ? 481 MET A CB    1 
ATOM   3840  C  CG    . MET A 1 501 ? 64.174  20.189  28.723  1.00 95.55  ? 481 MET A CG    1 
ATOM   3841  S  SD    . MET A 1 501 ? 63.981  21.529  27.527  1.00 95.53  ? 481 MET A SD    1 
ATOM   3842  C  CE    . MET A 1 501 ? 65.608  21.563  26.779  1.00 95.33  ? 481 MET A CE    1 
ATOM   3843  N  N     . PRO A 1 502 ? 63.571  21.090  32.522  1.00 91.66  ? 482 PRO A N     1 
ATOM   3844  C  CA    . PRO A 1 502 ? 62.300  21.488  33.144  1.00 90.60  ? 482 PRO A CA    1 
ATOM   3845  C  C     . PRO A 1 502 ? 61.123  21.570  32.169  1.00 88.98  ? 482 PRO A C     1 
ATOM   3846  O  O     . PRO A 1 502 ? 61.309  21.924  31.003  1.00 88.08  ? 482 PRO A O     1 
ATOM   3847  C  CB    . PRO A 1 502 ? 62.607  22.879  33.707  1.00 91.53  ? 482 PRO A CB    1 
ATOM   3848  C  CG    . PRO A 1 502 ? 64.063  22.852  33.995  1.00 91.70  ? 482 PRO A CG    1 
ATOM   3849  C  CD    . PRO A 1 502 ? 64.678  21.973  32.944  1.00 92.13  ? 482 PRO A CD    1 
ATOM   3850  N  N     . ALA A 1 503 ? 59.930  21.236  32.658  1.00 88.37  ? 483 ALA A N     1 
ATOM   3851  C  CA    . ALA A 1 503 ? 58.708  21.260  31.849  1.00 87.18  ? 483 ALA A CA    1 
ATOM   3852  C  C     . ALA A 1 503 ? 57.463  21.400  32.724  1.00 86.29  ? 483 ALA A C     1 
ATOM   3853  O  O     . ALA A 1 503 ? 57.471  21.013  33.896  1.00 85.85  ? 483 ALA A O     1 
ATOM   3854  C  CB    . ALA A 1 503 ? 58.615  20.004  30.997  1.00 86.07  ? 483 ALA A CB    1 
ATOM   3855  N  N     . LEU A 1 504 ? 56.402  21.955  32.138  1.00 85.00  ? 484 LEU A N     1 
ATOM   3856  C  CA    . LEU A 1 504 ? 55.140  22.206  32.836  1.00 84.45  ? 484 LEU A CA    1 
ATOM   3857  C  C     . LEU A 1 504 ? 54.002  21.448  32.153  1.00 84.52  ? 484 LEU A C     1 
ATOM   3858  O  O     . LEU A 1 504 ? 53.629  21.774  31.022  1.00 85.68  ? 484 LEU A O     1 
ATOM   3859  C  CB    . LEU A 1 504 ? 54.840  23.706  32.849  1.00 84.10  ? 484 LEU A CB    1 
ATOM   3860  C  CG    . LEU A 1 504 ? 55.836  24.581  33.616  1.00 84.24  ? 484 LEU A CG    1 
ATOM   3861  C  CD1   . LEU A 1 504 ? 55.651  26.047  33.253  1.00 84.49  ? 484 LEU A CD1   1 
ATOM   3862  C  CD2   . LEU A 1 504 ? 55.704  24.377  35.120  1.00 84.25  ? 484 LEU A CD2   1 
ATOM   3863  N  N     . ARG A 1 505 ? 53.461  20.438  32.837  1.00 83.25  ? 485 ARG A N     1 
ATOM   3864  C  CA    . ARG A 1 505 ? 52.358  19.633  32.293  1.00 81.95  ? 485 ARG A CA    1 
ATOM   3865  C  C     . ARG A 1 505 ? 51.016  20.366  32.356  1.00 80.74  ? 485 ARG A C     1 
ATOM   3866  O  O     . ARG A 1 505 ? 50.850  21.328  33.111  1.00 78.90  ? 485 ARG A O     1 
ATOM   3867  C  CB    . ARG A 1 505 ? 52.278  18.251  32.960  1.00 82.51  ? 485 ARG A CB    1 
ATOM   3868  C  CG    . ARG A 1 505 ? 51.857  18.225  34.426  1.00 82.80  ? 485 ARG A CG    1 
ATOM   3869  C  CD    . ARG A 1 505 ? 52.435  17.004  35.133  1.00 83.05  ? 485 ARG A CD    1 
ATOM   3870  N  NE    . ARG A 1 505 ? 52.152  16.988  36.569  1.00 84.21  ? 485 ARG A NE    1 
ATOM   3871  C  CZ    . ARG A 1 505 ? 52.626  16.087  37.435  1.00 84.60  ? 485 ARG A CZ    1 
ATOM   3872  N  NH1   . ARG A 1 505 ? 53.425  15.096  37.032  1.00 84.76  ? 485 ARG A NH1   1 
ATOM   3873  N  NH2   . ARG A 1 505 ? 52.298  16.174  38.723  1.00 84.17  ? 485 ARG A NH2   1 
ATOM   3874  N  N     . GLU A 1 506 ? 50.075  19.889  31.543  1.00 80.02  ? 486 GLU A N     1 
ATOM   3875  C  CA    . GLU A 1 506 ? 48.786  20.552  31.320  1.00 78.62  ? 486 GLU A CA    1 
ATOM   3876  C  C     . GLU A 1 506 ? 47.880  20.451  32.551  1.00 78.18  ? 486 GLU A C     1 
ATOM   3877  O  O     . GLU A 1 506 ? 47.579  19.349  33.013  1.00 79.68  ? 486 GLU A O     1 
ATOM   3878  C  CB    . GLU A 1 506 ? 48.099  19.931  30.092  1.00 77.57  ? 486 GLU A CB    1 
ATOM   3879  C  CG    . GLU A 1 506 ? 46.774  20.554  29.665  1.00 77.43  ? 486 GLU A CG    1 
ATOM   3880  C  CD    . GLU A 1 506 ? 46.916  21.971  29.142  1.00 77.10  ? 486 GLU A CD    1 
ATOM   3881  O  OE1   . GLU A 1 506 ? 47.706  22.186  28.197  1.00 76.31  ? 486 GLU A OE1   1 
ATOM   3882  O  OE2   . GLU A 1 506 ? 46.223  22.869  29.663  1.00 77.44  ? 486 GLU A OE2   1 
ATOM   3883  N  N     . THR A 1 507 ? 47.453  21.605  33.069  1.00 76.68  ? 487 THR A N     1 
ATOM   3884  C  CA    . THR A 1 507 ? 46.560  21.673  34.234  1.00 75.08  ? 487 THR A CA    1 
ATOM   3885  C  C     . THR A 1 507 ? 45.075  21.507  33.879  1.00 73.09  ? 487 THR A C     1 
ATOM   3886  O  O     . THR A 1 507 ? 44.263  21.226  34.762  1.00 72.93  ? 487 THR A O     1 
ATOM   3887  C  CB    . THR A 1 507 ? 46.734  22.997  35.008  1.00 75.02  ? 487 THR A CB    1 
ATOM   3888  O  OG1   . THR A 1 507 ? 46.409  24.105  34.159  1.00 75.28  ? 487 THR A OG1   1 
ATOM   3889  C  CG2   . THR A 1 507 ? 48.161  23.145  35.508  1.00 75.27  ? 487 THR A CG2   1 
ATOM   3890  N  N     . ASP A 1 508 ? 44.719  21.708  32.608  1.00 70.99  ? 488 ASP A N     1 
ATOM   3891  C  CA    . ASP A 1 508 ? 43.365  21.411  32.124  1.00 69.74  ? 488 ASP A CA    1 
ATOM   3892  C  C     . ASP A 1 508 ? 43.025  19.933  32.303  1.00 68.37  ? 488 ASP A C     1 
ATOM   3893  O  O     . ASP A 1 508 ? 43.883  19.065  32.124  1.00 68.26  ? 488 ASP A O     1 
ATOM   3894  C  CB    . ASP A 1 508 ? 43.205  21.778  30.638  1.00 70.35  ? 488 ASP A CB    1 
ATOM   3895  C  CG    . ASP A 1 508 ? 43.112  23.278  30.396  1.00 71.12  ? 488 ASP A CG    1 
ATOM   3896  O  OD1   . ASP A 1 508 ? 43.175  24.070  31.361  1.00 73.21  ? 488 ASP A OD1   1 
ATOM   3897  O  OD2   . ASP A 1 508 ? 42.973  23.669  29.217  1.00 70.63  ? 488 ASP A OD2   1 
ATOM   3898  N  N     . THR A 1 509 ? 41.769  19.667  32.658  1.00 67.25  ? 489 THR A N     1 
ATOM   3899  C  CA    . THR A 1 509 ? 41.253  18.310  32.842  1.00 66.36  ? 489 THR A CA    1 
ATOM   3900  C  C     . THR A 1 509 ? 40.255  17.965  31.738  1.00 66.51  ? 489 THR A C     1 
ATOM   3901  O  O     . THR A 1 509 ? 39.768  18.851  31.029  1.00 66.20  ? 489 THR A O     1 
ATOM   3902  C  CB    . THR A 1 509 ? 40.576  18.160  34.216  1.00 65.39  ? 489 THR A CB    1 
ATOM   3903  O  OG1   . THR A 1 509 ? 39.635  19.222  34.411  1.00 64.90  ? 489 THR A OG1   1 
ATOM   3904  C  CG2   . THR A 1 509 ? 41.613  18.205  35.321  1.00 65.30  ? 489 THR A CG2   1 
ATOM   3905  N  N     . PHE A 1 510 ? 39.958  16.673  31.603  1.00 66.77  ? 490 PHE A N     1 
ATOM   3906  C  CA    . PHE A 1 510 ? 39.091  16.176  30.526  1.00 66.40  ? 490 PHE A CA    1 
ATOM   3907  C  C     . PHE A 1 510 ? 37.614  16.474  30.761  1.00 66.25  ? 490 PHE A C     1 
ATOM   3908  O  O     . PHE A 1 510 ? 37.169  16.663  31.895  1.00 66.67  ? 490 PHE A O     1 
ATOM   3909  C  CB    . PHE A 1 510 ? 39.251  14.656  30.322  1.00 66.24  ? 490 PHE A CB    1 
ATOM   3910  C  CG    . PHE A 1 510 ? 40.436  14.264  29.479  1.00 65.90  ? 490 PHE A CG    1 
ATOM   3911  C  CD1   . PHE A 1 510 ? 40.581  14.751  28.180  1.00 65.53  ? 490 PHE A CD1   1 
ATOM   3912  C  CD2   . PHE A 1 510 ? 41.392  13.374  29.967  1.00 65.70  ? 490 PHE A CD2   1 
ATOM   3913  C  CE1   . PHE A 1 510 ? 41.666  14.380  27.398  1.00 65.50  ? 490 PHE A CE1   1 
ATOM   3914  C  CE2   . PHE A 1 510 ? 42.476  12.999  29.188  1.00 65.95  ? 490 PHE A CE2   1 
ATOM   3915  C  CZ    . PHE A 1 510 ? 42.614  13.503  27.903  1.00 65.97  ? 490 PHE A CZ    1 
ATOM   3916  N  N     . ASP A 1 511 ? 36.873  16.505  29.657  1.00 66.23  ? 491 ASP A N     1 
ATOM   3917  C  CA    . ASP A 1 511 ? 35.412  16.518  29.664  1.00 66.62  ? 491 ASP A CA    1 
ATOM   3918  C  C     . ASP A 1 511 ? 34.920  15.164  30.183  1.00 66.64  ? 491 ASP A C     1 
ATOM   3919  O  O     . ASP A 1 511 ? 35.499  14.131  29.850  1.00 67.57  ? 491 ASP A O     1 
ATOM   3920  C  CB    . ASP A 1 511 ? 34.915  16.771  28.231  1.00 66.86  ? 491 ASP A CB    1 
ATOM   3921  C  CG    . ASP A 1 511 ? 33.402  16.823  28.113  1.00 67.05  ? 491 ASP A CG    1 
ATOM   3922  O  OD1   . ASP A 1 511 ? 32.710  17.148  29.104  1.00 67.97  ? 491 ASP A OD1   1 
ATOM   3923  O  OD2   . ASP A 1 511 ? 32.909  16.555  26.996  1.00 65.70  ? 491 ASP A OD2   1 
ATOM   3924  N  N     . THR A 1 512 ? 33.860  15.165  30.990  1.00 67.04  ? 492 THR A N     1 
ATOM   3925  C  CA    . THR A 1 512 ? 33.348  13.925  31.602  1.00 68.04  ? 492 THR A CA    1 
ATOM   3926  C  C     . THR A 1 512 ? 32.746  12.917  30.612  1.00 67.60  ? 492 THR A C     1 
ATOM   3927  O  O     . THR A 1 512 ? 32.580  11.747  30.957  1.00 68.10  ? 492 THR A O     1 
ATOM   3928  C  CB    . THR A 1 512 ? 32.300  14.209  32.696  1.00 69.34  ? 492 THR A CB    1 
ATOM   3929  O  OG1   . THR A 1 512 ? 31.266  15.050  32.171  1.00 72.00  ? 492 THR A OG1   1 
ATOM   3930  C  CG2   . THR A 1 512 ? 32.948  14.879  33.886  1.00 69.18  ? 492 THR A CG2   1 
ATOM   3931  N  N     . PHE A 1 513 ? 32.407  13.369  29.404  1.00 67.19  ? 493 PHE A N     1 
ATOM   3932  C  CA    . PHE A 1 513 ? 32.023  12.462  28.314  1.00 66.98  ? 493 PHE A CA    1 
ATOM   3933  C  C     . PHE A 1 513 ? 33.162  11.535  27.861  1.00 66.40  ? 493 PHE A C     1 
ATOM   3934  O  O     . PHE A 1 513 ? 32.901  10.484  27.274  1.00 66.83  ? 493 PHE A O     1 
ATOM   3935  C  CB    . PHE A 1 513 ? 31.482  13.244  27.110  1.00 67.06  ? 493 PHE A CB    1 
ATOM   3936  C  CG    . PHE A 1 513 ? 30.095  13.790  27.312  1.00 66.58  ? 493 PHE A CG    1 
ATOM   3937  C  CD1   . PHE A 1 513 ? 28.985  12.957  27.204  1.00 66.20  ? 493 PHE A CD1   1 
ATOM   3938  C  CD2   . PHE A 1 513 ? 29.893  15.137  27.602  1.00 66.66  ? 493 PHE A CD2   1 
ATOM   3939  C  CE1   . PHE A 1 513 ? 27.703  13.456  27.387  1.00 66.03  ? 493 PHE A CE1   1 
ATOM   3940  C  CE2   . PHE A 1 513 ? 28.613  15.639  27.785  1.00 67.19  ? 493 PHE A CE2   1 
ATOM   3941  C  CZ    . PHE A 1 513 ? 27.517  14.797  27.676  1.00 66.88  ? 493 PHE A CZ    1 
ATOM   3942  N  N     . MET A 1 514 ? 34.409  11.937  28.116  1.00 66.32  ? 494 MET A N     1 
ATOM   3943  C  CA    . MET A 1 514 ? 35.586  11.103  27.844  1.00 67.13  ? 494 MET A CA    1 
ATOM   3944  C  C     . MET A 1 514 ? 35.502  9.754   28.560  1.00 66.98  ? 494 MET A C     1 
ATOM   3945  O  O     . MET A 1 514 ? 35.727  8.715   27.943  1.00 67.32  ? 494 MET A O     1 
ATOM   3946  C  CB    . MET A 1 514 ? 36.872  11.834  28.267  1.00 67.87  ? 494 MET A CB    1 
ATOM   3947  C  CG    . MET A 1 514 ? 38.178  11.193  27.809  1.00 68.56  ? 494 MET A CG    1 
ATOM   3948  S  SD    . MET A 1 514 ? 38.417  11.160  26.021  1.00 70.17  ? 494 MET A SD    1 
ATOM   3949  C  CE    . MET A 1 514 ? 38.604  12.900  25.655  1.00 69.57  ? 494 MET A CE    1 
ATOM   3950  N  N     . GLU A 1 515 ? 35.166  9.782   29.850  1.00 66.33  ? 495 GLU A N     1 
ATOM   3951  C  CA    . GLU A 1 515 ? 35.079  8.561   30.666  1.00 65.57  ? 495 GLU A CA    1 
ATOM   3952  C  C     . GLU A 1 515 ? 33.877  7.693   30.284  1.00 64.35  ? 495 GLU A C     1 
ATOM   3953  O  O     . GLU A 1 515 ? 33.964  6.465   30.321  1.00 63.86  ? 495 GLU A O     1 
ATOM   3954  C  CB    . GLU A 1 515 ? 35.019  8.893   32.164  1.00 66.30  ? 495 GLU A CB    1 
ATOM   3955  C  CG    . GLU A 1 515 ? 36.279  9.548   32.726  1.00 67.38  ? 495 GLU A CG    1 
ATOM   3956  C  CD    . GLU A 1 515 ? 36.217  11.066  32.753  1.00 68.38  ? 495 GLU A CD    1 
ATOM   3957  O  OE1   . GLU A 1 515 ? 35.274  11.609  33.367  1.00 68.78  ? 495 GLU A OE1   1 
ATOM   3958  O  OE2   . GLU A 1 515 ? 37.119  11.715  32.180  1.00 68.94  ? 495 GLU A OE2   1 
ATOM   3959  N  N     . SER A 1 516 ? 32.768  8.335   29.915  1.00 63.59  ? 496 SER A N     1 
ATOM   3960  C  CA    . SER A 1 516 ? 31.545  7.630   29.514  1.00 62.64  ? 496 SER A CA    1 
ATOM   3961  C  C     . SER A 1 516 ? 31.555  7.103   28.071  1.00 61.32  ? 496 SER A C     1 
ATOM   3962  O  O     . SER A 1 516 ? 30.621  6.409   27.676  1.00 62.18  ? 496 SER A O     1 
ATOM   3963  C  CB    . SER A 1 516 ? 30.322  8.535   29.713  1.00 63.16  ? 496 SER A CB    1 
ATOM   3964  O  OG    . SER A 1 516 ? 30.238  9.524   28.701  1.00 64.10  ? 496 SER A OG    1 
ATOM   3965  N  N     . SER A 1 517 ? 32.580  7.434   27.286  1.00 59.28  ? 497 SER A N     1 
ATOM   3966  C  CA    . SER A 1 517 ? 32.672  6.967   25.898  1.00 57.61  ? 497 SER A CA    1 
ATOM   3967  C  C     . SER A 1 517 ? 33.355  5.599   25.724  1.00 56.31  ? 497 SER A C     1 
ATOM   3968  O  O     . SER A 1 517 ? 33.426  5.103   24.604  1.00 56.57  ? 497 SER A O     1 
ATOM   3969  C  CB    . SER A 1 517 ? 33.364  8.024   25.032  1.00 57.45  ? 497 SER A CB    1 
ATOM   3970  O  OG    . SER A 1 517 ? 32.571  9.196   24.948  1.00 57.23  ? 497 SER A OG    1 
ATOM   3971  N  N     . TRP A 1 518 ? 33.862  5.000   26.804  1.00 55.56  ? 498 TRP A N     1 
ATOM   3972  C  CA    . TRP A 1 518 ? 34.426  3.635   26.742  1.00 55.73  ? 498 TRP A CA    1 
ATOM   3973  C  C     . TRP A 1 518 ? 34.231  2.743   27.992  1.00 56.45  ? 498 TRP A C     1 
ATOM   3974  O  O     . TRP A 1 518 ? 34.827  1.664   28.068  1.00 56.65  ? 498 TRP A O     1 
ATOM   3975  C  CB    . TRP A 1 518 ? 35.917  3.717   26.387  1.00 55.66  ? 498 TRP A CB    1 
ATOM   3976  C  CG    . TRP A 1 518 ? 36.748  4.375   27.443  1.00 55.49  ? 498 TRP A CG    1 
ATOM   3977  C  CD1   . TRP A 1 518 ? 36.793  5.703   27.733  1.00 55.58  ? 498 TRP A CD1   1 
ATOM   3978  C  CD2   . TRP A 1 518 ? 37.651  3.734   28.348  1.00 55.18  ? 498 TRP A CD2   1 
ATOM   3979  N  NE1   . TRP A 1 518 ? 37.665  5.936   28.767  1.00 55.51  ? 498 TRP A NE1   1 
ATOM   3980  C  CE2   . TRP A 1 518 ? 38.208  4.743   29.164  1.00 55.24  ? 498 TRP A CE2   1 
ATOM   3981  C  CE3   . TRP A 1 518 ? 38.045  2.405   28.550  1.00 55.09  ? 498 TRP A CE3   1 
ATOM   3982  C  CZ2   . TRP A 1 518 ? 39.139  4.465   30.169  1.00 55.12  ? 498 TRP A CZ2   1 
ATOM   3983  C  CZ3   . TRP A 1 518 ? 38.972  2.129   29.549  1.00 54.88  ? 498 TRP A CZ3   1 
ATOM   3984  C  CH2   . TRP A 1 518 ? 39.507  3.155   30.347  1.00 55.07  ? 498 TRP A CH2   1 
ATOM   3985  N  N     . TYR A 1 519 ? 33.403  3.173   28.948  1.00 57.23  ? 499 TYR A N     1 
ATOM   3986  C  CA    . TYR A 1 519 ? 33.090  2.373   30.151  1.00 57.60  ? 499 TYR A CA    1 
ATOM   3987  C  C     . TYR A 1 519 ? 32.452  1.014   29.816  1.00 58.26  ? 499 TYR A C     1 
ATOM   3988  O  O     . TYR A 1 519 ? 32.698  0.022   30.507  1.00 58.45  ? 499 TYR A O     1 
ATOM   3989  C  CB    . TYR A 1 519 ? 32.181  3.159   31.120  1.00 57.54  ? 499 TYR A CB    1 
ATOM   3990  C  CG    . TYR A 1 519 ? 30.722  3.220   30.699  1.00 57.63  ? 499 TYR A CG    1 
ATOM   3991  C  CD1   . TYR A 1 519 ? 30.300  4.097   29.710  1.00 57.36  ? 499 TYR A CD1   1 
ATOM   3992  C  CD2   . TYR A 1 519 ? 29.772  2.384   31.278  1.00 57.46  ? 499 TYR A CD2   1 
ATOM   3993  C  CE1   . TYR A 1 519 ? 28.977  4.151   29.308  1.00 57.45  ? 499 TYR A CE1   1 
ATOM   3994  C  CE2   . TYR A 1 519 ? 28.441  2.426   30.886  1.00 57.24  ? 499 TYR A CE2   1 
ATOM   3995  C  CZ    . TYR A 1 519 ? 28.051  3.313   29.899  1.00 57.40  ? 499 TYR A CZ    1 
ATOM   3996  O  OH    . TYR A 1 519 ? 26.742  3.373   29.497  1.00 57.83  ? 499 TYR A OH    1 
ATOM   3997  N  N     . TYR A 1 520 ? 31.626  0.993   28.768  1.00 59.12  ? 500 TYR A N     1 
ATOM   3998  C  CA    . TYR A 1 520 ? 30.992  -0.234  28.260  1.00 59.81  ? 500 TYR A CA    1 
ATOM   3999  C  C     . TYR A 1 520 ? 32.010  -1.307  27.852  1.00 60.75  ? 500 TYR A C     1 
ATOM   4000  O  O     . TYR A 1 520 ? 31.783  -2.495  28.070  1.00 60.89  ? 500 TYR A O     1 
ATOM   4001  C  CB    . TYR A 1 520 ? 30.058  0.083   27.078  1.00 59.24  ? 500 TYR A CB    1 
ATOM   4002  C  CG    . TYR A 1 520 ? 30.773  0.402   25.783  1.00 59.06  ? 500 TYR A CG    1 
ATOM   4003  C  CD1   . TYR A 1 520 ? 31.274  1.680   25.530  1.00 59.09  ? 500 TYR A CD1   1 
ATOM   4004  C  CD2   . TYR A 1 520 ? 30.970  -0.584  24.815  1.00 59.71  ? 500 TYR A CD2   1 
ATOM   4005  C  CE1   . TYR A 1 520 ? 31.935  1.969   24.347  1.00 59.23  ? 500 TYR A CE1   1 
ATOM   4006  C  CE2   . TYR A 1 520 ? 31.635  -0.304  23.630  1.00 60.20  ? 500 TYR A CE2   1 
ATOM   4007  C  CZ    . TYR A 1 520 ? 32.115  0.975   23.402  1.00 59.83  ? 500 TYR A CZ    1 
ATOM   4008  O  OH    . TYR A 1 520 ? 32.776  1.263   22.235  1.00 59.51  ? 500 TYR A OH    1 
ATOM   4009  N  N     . ALA A 1 521 ? 33.123  -0.878  27.259  1.00 62.56  ? 501 ALA A N     1 
ATOM   4010  C  CA    . ALA A 1 521 ? 34.193  -1.787  26.855  1.00 64.22  ? 501 ALA A CA    1 
ATOM   4011  C  C     . ALA A 1 521 ? 34.972  -2.282  28.073  1.00 64.95  ? 501 ALA A C     1 
ATOM   4012  O  O     . ALA A 1 521 ? 35.238  -3.477  28.197  1.00 65.30  ? 501 ALA A O     1 
ATOM   4013  C  CB    . ALA A 1 521 ? 35.129  -1.101  25.868  1.00 64.70  ? 501 ALA A CB    1 
ATOM   4014  N  N     . ARG A 1 522 ? 35.317  -1.356  28.968  1.00 64.87  ? 502 ARG A N     1 
ATOM   4015  C  CA    . ARG A 1 522 ? 36.105  -1.667  30.167  1.00 65.22  ? 502 ARG A CA    1 
ATOM   4016  C  C     . ARG A 1 522 ? 35.390  -2.602  31.164  1.00 64.48  ? 502 ARG A C     1 
ATOM   4017  O  O     . ARG A 1 522 ? 36.054  -3.271  31.959  1.00 63.43  ? 502 ARG A O     1 
ATOM   4018  C  CB    . ARG A 1 522 ? 36.543  -0.360  30.854  1.00 66.11  ? 502 ARG A CB    1 
ATOM   4019  C  CG    . ARG A 1 522 ? 37.506  -0.494  32.034  1.00 67.11  ? 502 ARG A CG    1 
ATOM   4020  C  CD    . ARG A 1 522 ? 38.803  -1.213  31.684  1.00 67.42  ? 502 ARG A CD    1 
ATOM   4021  N  NE    . ARG A 1 522 ? 39.739  -1.238  32.809  1.00 67.80  ? 502 ARG A NE    1 
ATOM   4022  C  CZ    . ARG A 1 522 ? 40.959  -1.781  32.782  1.00 67.87  ? 502 ARG A CZ    1 
ATOM   4023  N  NH1   . ARG A 1 522 ? 41.429  -2.360  31.678  1.00 68.21  ? 502 ARG A NH1   1 
ATOM   4024  N  NH2   . ARG A 1 522 ? 41.720  -1.743  33.873  1.00 68.11  ? 502 ARG A NH2   1 
ATOM   4025  N  N     . TYR A 1 523 ? 34.055  -2.661  31.116  1.00 64.26  ? 503 TYR A N     1 
ATOM   4026  C  CA    . TYR A 1 523 ? 33.289  -3.642  31.912  1.00 64.56  ? 503 TYR A CA    1 
ATOM   4027  C  C     . TYR A 1 523 ? 33.638  -5.108  31.606  1.00 65.67  ? 503 TYR A C     1 
ATOM   4028  O  O     . TYR A 1 523 ? 33.476  -5.966  32.473  1.00 66.46  ? 503 TYR A O     1 
ATOM   4029  C  CB    . TYR A 1 523 ? 31.771  -3.471  31.721  1.00 63.41  ? 503 TYR A CB    1 
ATOM   4030  C  CG    . TYR A 1 523 ? 31.083  -2.362  32.504  1.00 61.93  ? 503 TYR A CG    1 
ATOM   4031  C  CD1   . TYR A 1 523 ? 31.401  -2.089  33.842  1.00 61.25  ? 503 TYR A CD1   1 
ATOM   4032  C  CD2   . TYR A 1 523 ? 30.053  -1.624  31.918  1.00 61.17  ? 503 TYR A CD2   1 
ATOM   4033  C  CE1   . TYR A 1 523 ? 30.740  -1.089  34.548  1.00 60.82  ? 503 TYR A CE1   1 
ATOM   4034  C  CE2   . TYR A 1 523 ? 29.384  -0.635  32.619  1.00 60.90  ? 503 TYR A CE2   1 
ATOM   4035  C  CZ    . TYR A 1 523 ? 29.730  -0.363  33.927  1.00 60.46  ? 503 TYR A CZ    1 
ATOM   4036  O  OH    . TYR A 1 523 ? 29.057  0.629   34.598  1.00 58.87  ? 503 TYR A OH    1 
ATOM   4037  N  N     . THR A 1 524 ? 34.092  -5.392  30.383  1.00 67.04  ? 504 THR A N     1 
ATOM   4038  C  CA    . THR A 1 524 ? 34.482  -6.757  29.988  1.00 68.32  ? 504 THR A CA    1 
ATOM   4039  C  C     . THR A 1 524 ? 35.770  -7.248  30.666  1.00 69.80  ? 504 THR A C     1 
ATOM   4040  O  O     . THR A 1 524 ? 35.988  -8.457  30.774  1.00 70.09  ? 504 THR A O     1 
ATOM   4041  C  CB    . THR A 1 524 ? 34.672  -6.886  28.458  1.00 68.13  ? 504 THR A CB    1 
ATOM   4042  O  OG1   . THR A 1 524 ? 35.733  -6.029  28.017  1.00 67.59  ? 504 THR A OG1   1 
ATOM   4043  C  CG2   . THR A 1 524 ? 33.388  -6.536  27.715  1.00 68.08  ? 504 THR A CG2   1 
ATOM   4044  N  N     . CYS A 1 525 ? 36.615  -6.312  31.104  1.00 71.14  ? 505 CYS A N     1 
ATOM   4045  C  CA    . CYS A 1 525 ? 37.904  -6.628  31.719  1.00 72.06  ? 505 CYS A CA    1 
ATOM   4046  C  C     . CYS A 1 525 ? 38.354  -5.475  32.640  1.00 72.66  ? 505 CYS A C     1 
ATOM   4047  O  O     . CYS A 1 525 ? 39.351  -4.800  32.363  1.00 72.95  ? 505 CYS A O     1 
ATOM   4048  C  CB    . CYS A 1 525 ? 38.927  -6.887  30.611  1.00 72.91  ? 505 CYS A CB    1 
ATOM   4049  S  SG    . CYS A 1 525 ? 38.924  -5.619  29.318  1.00 75.22  ? 505 CYS A SG    1 
ATOM   4050  N  N     . PRO A 1 526 ? 37.614  -5.248  33.745  1.00 72.60  ? 506 PRO A N     1 
ATOM   4051  C  CA    . PRO A 1 526 ? 37.844  -4.066  34.588  1.00 73.19  ? 506 PRO A CA    1 
ATOM   4052  C  C     . PRO A 1 526 ? 39.105  -4.096  35.473  1.00 73.64  ? 506 PRO A C     1 
ATOM   4053  O  O     . PRO A 1 526 ? 39.588  -3.029  35.865  1.00 72.43  ? 506 PRO A O     1 
ATOM   4054  C  CB    . PRO A 1 526 ? 36.575  -3.994  35.445  1.00 72.82  ? 506 PRO A CB    1 
ATOM   4055  C  CG    . PRO A 1 526 ? 36.057  -5.386  35.499  1.00 71.94  ? 506 PRO A CG    1 
ATOM   4056  C  CD    . PRO A 1 526 ? 36.567  -6.128  34.298  1.00 71.90  ? 506 PRO A CD    1 
ATOM   4057  N  N     . GLN A 1 527 ? 39.620  -5.293  35.776  1.00 74.23  ? 507 GLN A N     1 
ATOM   4058  C  CA    . GLN A 1 527 ? 40.838  -5.464  36.587  1.00 74.37  ? 507 GLN A CA    1 
ATOM   4059  C  C     . GLN A 1 527 ? 42.088  -5.777  35.747  1.00 74.62  ? 507 GLN A C     1 
ATOM   4060  O  O     . GLN A 1 527 ? 43.108  -6.208  36.290  1.00 73.86  ? 507 GLN A O     1 
ATOM   4061  C  CB    . GLN A 1 527 ? 40.625  -6.580  37.623  1.00 74.39  ? 507 GLN A CB    1 
ATOM   4062  C  CG    . GLN A 1 527 ? 39.370  -6.439  38.476  1.00 74.58  ? 507 GLN A CG    1 
ATOM   4063  C  CD    . GLN A 1 527 ? 39.339  -5.148  39.273  1.00 75.10  ? 507 GLN A CD    1 
ATOM   4064  O  OE1   . GLN A 1 527 ? 40.304  -4.806  39.958  1.00 76.00  ? 507 GLN A OE1   1 
ATOM   4065  N  NE2   . GLN A 1 527 ? 38.229  -4.423  39.186  1.00 75.22  ? 507 GLN A NE2   1 
ATOM   4066  N  N     . TYR A 1 528 ? 42.015  -5.541  34.437  1.00 76.41  ? 508 TYR A N     1 
ATOM   4067  C  CA    . TYR A 1 528 ? 43.102  -5.857  33.511  1.00 77.97  ? 508 TYR A CA    1 
ATOM   4068  C  C     . TYR A 1 528 ? 44.183  -4.780  33.599  1.00 78.97  ? 508 TYR A C     1 
ATOM   4069  O  O     . TYR A 1 528 ? 43.981  -3.651  33.146  1.00 79.64  ? 508 TYR A O     1 
ATOM   4070  C  CB    . TYR A 1 528 ? 42.543  -5.966  32.088  1.00 79.14  ? 508 TYR A CB    1 
ATOM   4071  C  CG    . TYR A 1 528 ? 43.513  -6.462  31.036  1.00 79.83  ? 508 TYR A CG    1 
ATOM   4072  C  CD1   . TYR A 1 528 ? 44.129  -7.710  31.157  1.00 80.45  ? 508 TYR A CD1   1 
ATOM   4073  C  CD2   . TYR A 1 528 ? 43.785  -5.702  29.896  1.00 80.58  ? 508 TYR A CD2   1 
ATOM   4074  C  CE1   . TYR A 1 528 ? 45.008  -8.174  30.186  1.00 80.65  ? 508 TYR A CE1   1 
ATOM   4075  C  CE2   . TYR A 1 528 ? 44.661  -6.157  28.921  1.00 81.37  ? 508 TYR A CE2   1 
ATOM   4076  C  CZ    . TYR A 1 528 ? 45.268  -7.393  29.068  1.00 81.20  ? 508 TYR A CZ    1 
ATOM   4077  O  OH    . TYR A 1 528 ? 46.136  -7.841  28.101  1.00 81.80  ? 508 TYR A OH    1 
ATOM   4078  N  N     . LYS A 1 529 ? 45.324  -5.139  34.188  1.00 80.31  ? 509 LYS A N     1 
ATOM   4079  C  CA    . LYS A 1 529 ? 46.416  -4.192  34.456  1.00 81.01  ? 509 LYS A CA    1 
ATOM   4080  C  C     . LYS A 1 529 ? 47.370  -3.973  33.274  1.00 80.19  ? 509 LYS A C     1 
ATOM   4081  O  O     . LYS A 1 529 ? 48.138  -3.009  33.278  1.00 77.54  ? 509 LYS A O     1 
ATOM   4082  C  CB    . LYS A 1 529 ? 47.236  -4.663  35.665  1.00 82.30  ? 509 LYS A CB    1 
ATOM   4083  C  CG    . LYS A 1 529 ? 46.451  -4.798  36.963  1.00 83.45  ? 509 LYS A CG    1 
ATOM   4084  C  CD    . LYS A 1 529 ? 46.080  -3.445  37.547  1.00 84.87  ? 509 LYS A CD    1 
ATOM   4085  C  CE    . LYS A 1 529 ? 45.482  -3.590  38.937  1.00 86.21  ? 509 LYS A CE    1 
ATOM   4086  N  NZ    . LYS A 1 529 ? 45.211  -2.272  39.575  1.00 86.82  ? 509 LYS A NZ    1 
ATOM   4087  N  N     . GLU A 1 530 ? 47.316  -4.847  32.269  1.00 82.04  ? 510 GLU A N     1 
ATOM   4088  C  CA    . GLU A 1 530 ? 48.329  -4.876  31.205  1.00 84.27  ? 510 GLU A CA    1 
ATOM   4089  C  C     . GLU A 1 530 ? 48.049  -3.874  30.079  1.00 82.47  ? 510 GLU A C     1 
ATOM   4090  O  O     . GLU A 1 530 ? 48.984  -3.406  29.428  1.00 82.47  ? 510 GLU A O     1 
ATOM   4091  C  CB    . GLU A 1 530 ? 48.479  -6.292  30.615  1.00 87.86  ? 510 GLU A CB    1 
ATOM   4092  C  CG    . GLU A 1 530 ? 48.498  -7.448  31.620  1.00 90.54  ? 510 GLU A CG    1 
ATOM   4093  C  CD    . GLU A 1 530 ? 49.445  -7.234  32.792  1.00 93.17  ? 510 GLU A CD    1 
ATOM   4094  O  OE1   . GLU A 1 530 ? 50.559  -6.702  32.587  1.00 95.27  ? 510 GLU A OE1   1 
ATOM   4095  O  OE2   . GLU A 1 530 ? 49.074  -7.610  33.925  1.00 95.17  ? 510 GLU A OE2   1 
ATOM   4096  N  N     . GLY A 1 531 ? 46.775  -3.560  29.845  1.00 81.35  ? 511 GLY A N     1 
ATOM   4097  C  CA    . GLY A 1 531 ? 46.384  -2.598  28.809  1.00 80.57  ? 511 GLY A CA    1 
ATOM   4098  C  C     . GLY A 1 531 ? 45.005  -2.002  29.029  1.00 79.74  ? 511 GLY A C     1 
ATOM   4099  O  O     . GLY A 1 531 ? 44.391  -2.203  30.079  1.00 79.65  ? 511 GLY A O     1 
ATOM   4100  N  N     . MET A 1 532 ? 44.527  -1.265  28.027  1.00 78.78  ? 512 MET A N     1 
ATOM   4101  C  CA    . MET A 1 532 ? 43.207  -0.624  28.073  1.00 77.51  ? 512 MET A CA    1 
ATOM   4102  C  C     . MET A 1 532 ? 42.082  -1.656  28.022  1.00 78.00  ? 512 MET A C     1 
ATOM   4103  O  O     . MET A 1 532 ? 41.128  -1.571  28.798  1.00 78.25  ? 512 MET A O     1 
ATOM   4104  C  CB    . MET A 1 532 ? 43.061  0.374   26.917  1.00 76.56  ? 512 MET A CB    1 
ATOM   4105  C  CG    . MET A 1 532 ? 41.772  1.184   26.925  1.00 75.82  ? 512 MET A CG    1 
ATOM   4106  S  SD    . MET A 1 532 ? 41.879  2.651   25.880  1.00 74.81  ? 512 MET A SD    1 
ATOM   4107  C  CE    . MET A 1 532 ? 40.328  3.457   26.266  1.00 75.13  ? 512 MET A CE    1 
ATOM   4108  N  N     . LEU A 1 533 ? 42.202  -2.618  27.106  1.00 78.40  ? 513 LEU A N     1 
ATOM   4109  C  CA    . LEU A 1 533 ? 41.227  -3.699  26.956  1.00 78.32  ? 513 LEU A CA    1 
ATOM   4110  C  C     . LEU A 1 533 ? 41.909  -5.039  26.678  1.00 79.55  ? 513 LEU A C     1 
ATOM   4111  O  O     . LEU A 1 533 ? 42.859  -5.107  25.894  1.00 80.93  ? 513 LEU A O     1 
ATOM   4112  C  CB    . LEU A 1 533 ? 40.262  -3.383  25.809  1.00 77.46  ? 513 LEU A CB    1 
ATOM   4113  C  CG    . LEU A 1 533 ? 39.327  -2.185  25.983  1.00 77.15  ? 513 LEU A CG    1 
ATOM   4114  C  CD1   . LEU A 1 533 ? 38.637  -1.858  24.668  1.00 77.13  ? 513 LEU A CD1   1 
ATOM   4115  C  CD2   . LEU A 1 533 ? 38.303  -2.446  27.078  1.00 76.94  ? 513 LEU A CD2   1 
ATOM   4116  N  N     . ASP A 1 534 ? 41.418  -6.091  27.332  1.00 80.31  ? 514 ASP A N     1 
ATOM   4117  C  CA    . ASP A 1 534 ? 41.779  -7.470  27.007  1.00 81.38  ? 514 ASP A CA    1 
ATOM   4118  C  C     . ASP A 1 534 ? 40.848  -7.924  25.881  1.00 82.24  ? 514 ASP A C     1 
ATOM   4119  O  O     . ASP A 1 534 ? 39.685  -8.244  26.128  1.00 82.84  ? 514 ASP A O     1 
ATOM   4120  C  CB    . ASP A 1 534 ? 41.632  -8.368  28.247  1.00 82.16  ? 514 ASP A CB    1 
ATOM   4121  C  CG    . ASP A 1 534 ? 41.912  -9.839  27.959  1.00 83.31  ? 514 ASP A CG    1 
ATOM   4122  O  OD1   . ASP A 1 534 ? 42.780  -10.144 27.113  1.00 84.95  ? 514 ASP A OD1   1 
ATOM   4123  O  OD2   . ASP A 1 534 ? 41.264  -10.695 28.595  1.00 84.13  ? 514 ASP A OD2   1 
ATOM   4124  N  N     . SER A 1 535 ? 41.366  -7.940  24.651  1.00 84.01  ? 515 SER A N     1 
ATOM   4125  C  CA    . SER A 1 535 ? 40.552  -8.181  23.445  1.00 85.67  ? 515 SER A CA    1 
ATOM   4126  C  C     . SER A 1 535 ? 39.841  -9.543  23.395  1.00 88.80  ? 515 SER A C     1 
ATOM   4127  O  O     . SER A 1 535 ? 38.788  -9.661  22.762  1.00 89.22  ? 515 SER A O     1 
ATOM   4128  C  CB    . SER A 1 535 ? 41.398  -7.994  22.180  1.00 84.73  ? 515 SER A CB    1 
ATOM   4129  O  OG    . SER A 1 535 ? 41.849  -6.656  22.069  1.00 83.90  ? 515 SER A OG    1 
ATOM   4130  N  N     . GLU A 1 536 ? 40.417  -10.560 24.040  1.00 91.37  ? 516 GLU A N     1 
ATOM   4131  C  CA    . GLU A 1 536 ? 39.744  -11.860 24.213  1.00 93.73  ? 516 GLU A CA    1 
ATOM   4132  C  C     . GLU A 1 536 ? 38.409  -11.696 24.940  1.00 93.31  ? 516 GLU A C     1 
ATOM   4133  O  O     . GLU A 1 536 ? 37.380  -12.203 24.487  1.00 94.25  ? 516 GLU A O     1 
ATOM   4134  C  CB    . GLU A 1 536 ? 40.631  -12.867 24.971  1.00 96.81  ? 516 GLU A CB    1 
ATOM   4135  C  CG    . GLU A 1 536 ? 41.385  -13.847 24.081  1.00 98.68  ? 516 GLU A CG    1 
ATOM   4136  C  CD    . GLU A 1 536 ? 42.305  -13.166 23.085  1.00 100.98 ? 516 GLU A CD    1 
ATOM   4137  O  OE1   . GLU A 1 536 ? 43.104  -12.300 23.503  1.00 104.10 ? 516 GLU A OE1   1 
ATOM   4138  O  OE2   . GLU A 1 536 ? 42.235  -13.504 21.883  1.00 101.11 ? 516 GLU A OE2   1 
ATOM   4139  N  N     . ALA A 1 537 ? 38.441  -10.979 26.062  1.00 91.82  ? 517 ALA A N     1 
ATOM   4140  C  CA    . ALA A 1 537 ? 37.239  -10.699 26.850  1.00 89.96  ? 517 ALA A CA    1 
ATOM   4141  C  C     . ALA A 1 537 ? 36.305  -9.705  26.159  1.00 87.56  ? 517 ALA A C     1 
ATOM   4142  O  O     . ALA A 1 537 ? 35.086  -9.878  26.197  1.00 89.25  ? 517 ALA A O     1 
ATOM   4143  C  CB    . ALA A 1 537 ? 37.617  -10.187 28.233  1.00 90.67  ? 517 ALA A CB    1 
ATOM   4144  N  N     . ALA A 1 538 ? 36.878  -8.674  25.535  1.00 83.66  ? 518 ALA A N     1 
ATOM   4145  C  CA    . ALA A 1 538 ? 36.099  -7.604  24.904  1.00 80.33  ? 518 ALA A CA    1 
ATOM   4146  C  C     . ALA A 1 538 ? 35.252  -8.111  23.741  1.00 77.73  ? 518 ALA A C     1 
ATOM   4147  O  O     . ALA A 1 538 ? 34.040  -7.902  23.720  1.00 78.11  ? 518 ALA A O     1 
ATOM   4148  C  CB    . ALA A 1 538 ? 37.016  -6.485  24.434  1.00 80.20  ? 518 ALA A CB    1 
ATOM   4149  N  N     . ASN A 1 539 ? 35.893  -8.788  22.792  1.00 75.22  ? 519 ASN A N     1 
ATOM   4150  C  CA    . ASN A 1 539 ? 35.204  -9.291  21.593  1.00 74.08  ? 519 ASN A CA    1 
ATOM   4151  C  C     . ASN A 1 539 ? 34.246  -10.460 21.851  1.00 72.92  ? 519 ASN A C     1 
ATOM   4152  O  O     . ASN A 1 539 ? 33.400  -10.752 21.002  1.00 73.99  ? 519 ASN A O     1 
ATOM   4153  C  CB    . ASN A 1 539 ? 36.216  -9.669  20.503  1.00 73.68  ? 519 ASN A CB    1 
ATOM   4154  C  CG    . ASN A 1 539 ? 36.911  -8.457  19.909  1.00 73.32  ? 519 ASN A CG    1 
ATOM   4155  O  OD1   . ASN A 1 539 ? 36.268  -7.463  19.569  1.00 72.12  ? 519 ASN A OD1   1 
ATOM   4156  N  ND2   . ASN A 1 539 ? 38.229  -8.536  19.774  1.00 74.50  ? 519 ASN A ND2   1 
ATOM   4157  N  N     . TYR A 1 540 ? 34.381  -11.130 22.997  1.00 70.71  ? 520 TYR A N     1 
ATOM   4158  C  CA    . TYR A 1 540 ? 33.395  -12.126 23.432  1.00 69.27  ? 520 TYR A CA    1 
ATOM   4159  C  C     . TYR A 1 540 ? 32.048  -11.462 23.731  1.00 68.20  ? 520 TYR A C     1 
ATOM   4160  O  O     . TYR A 1 540 ? 31.014  -11.911 23.238  1.00 69.39  ? 520 TYR A O     1 
ATOM   4161  C  CB    . TYR A 1 540 ? 33.889  -12.897 24.664  1.00 69.49  ? 520 TYR A CB    1 
ATOM   4162  C  CG    . TYR A 1 540 ? 32.834  -13.782 25.296  1.00 70.32  ? 520 TYR A CG    1 
ATOM   4163  C  CD1   . TYR A 1 540 ? 32.527  -15.033 24.759  1.00 71.09  ? 520 TYR A CD1   1 
ATOM   4164  C  CD2   . TYR A 1 540 ? 32.131  -13.362 26.426  1.00 71.00  ? 520 TYR A CD2   1 
ATOM   4165  C  CE1   . TYR A 1 540 ? 31.555  -15.843 25.336  1.00 71.21  ? 520 TYR A CE1   1 
ATOM   4166  C  CE2   . TYR A 1 540 ? 31.157  -14.162 27.004  1.00 71.27  ? 520 TYR A CE2   1 
ATOM   4167  C  CZ    . TYR A 1 540 ? 30.874  -15.400 26.461  1.00 71.12  ? 520 TYR A CZ    1 
ATOM   4168  O  OH    . TYR A 1 540 ? 29.907  -16.179 27.048  1.00 71.21  ? 520 TYR A OH    1 
ATOM   4169  N  N     . TRP A 1 541 ? 32.078  -10.403 24.540  1.00 66.85  ? 521 TRP A N     1 
ATOM   4170  C  CA    . TRP A 1 541 ? 30.865  -9.682  24.949  1.00 65.41  ? 521 TRP A CA    1 
ATOM   4171  C  C     . TRP A 1 541 ? 30.371  -8.699  23.888  1.00 64.04  ? 521 TRP A C     1 
ATOM   4172  O  O     . TRP A 1 541 ? 29.185  -8.685  23.561  1.00 62.85  ? 521 TRP A O     1 
ATOM   4173  C  CB    . TRP A 1 541 ? 31.102  -8.922  26.255  1.00 65.44  ? 521 TRP A CB    1 
ATOM   4174  C  CG    . TRP A 1 541 ? 31.300  -9.801  27.441  1.00 66.16  ? 521 TRP A CG    1 
ATOM   4175  C  CD1   . TRP A 1 541 ? 32.434  -9.927  28.190  1.00 66.82  ? 521 TRP A CD1   1 
ATOM   4176  C  CD2   . TRP A 1 541 ? 30.333  -10.677 28.027  1.00 67.06  ? 521 TRP A CD2   1 
ATOM   4177  N  NE1   . TRP A 1 541 ? 32.234  -10.828 29.209  1.00 67.19  ? 521 TRP A NE1   1 
ATOM   4178  C  CE2   . TRP A 1 541 ? 30.952  -11.305 29.132  1.00 67.19  ? 521 TRP A CE2   1 
ATOM   4179  C  CE3   . TRP A 1 541 ? 29.002  -10.993 27.725  1.00 67.82  ? 521 TRP A CE3   1 
ATOM   4180  C  CZ2   . TRP A 1 541 ? 30.283  -12.233 29.941  1.00 67.37  ? 521 TRP A CZ2   1 
ATOM   4181  C  CZ3   . TRP A 1 541 ? 28.335  -11.918 28.528  1.00 68.21  ? 521 TRP A CZ3   1 
ATOM   4182  C  CH2   . TRP A 1 541 ? 28.980  -12.528 29.622  1.00 68.06  ? 521 TRP A CH2   1 
ATOM   4183  N  N     . LEU A 1 542 ? 31.277  -7.872  23.369  1.00 63.93  ? 522 LEU A N     1 
ATOM   4184  C  CA    . LEU A 1 542 ? 30.911  -6.819  22.413  1.00 64.45  ? 522 LEU A CA    1 
ATOM   4185  C  C     . LEU A 1 542 ? 30.499  -7.414  21.055  1.00 65.18  ? 522 LEU A C     1 
ATOM   4186  O  O     . LEU A 1 542 ? 31.034  -8.454  20.663  1.00 66.06  ? 522 LEU A O     1 
ATOM   4187  C  CB    . LEU A 1 542 ? 32.068  -5.829  22.220  1.00 63.89  ? 522 LEU A CB    1 
ATOM   4188  C  CG    . LEU A 1 542 ? 32.518  -5.030  23.449  1.00 63.24  ? 522 LEU A CG    1 
ATOM   4189  C  CD1   . LEU A 1 542 ? 33.806  -4.281  23.145  1.00 63.31  ? 522 LEU A CD1   1 
ATOM   4190  C  CD2   . LEU A 1 542 ? 31.440  -4.064  23.918  1.00 63.19  ? 522 LEU A CD2   1 
ATOM   4191  N  N     . PRO A 1 543 ? 29.568  -6.782  20.329  1.00 65.61  ? 523 PRO A N     1 
ATOM   4192  C  CA    . PRO A 1 543 ? 28.913  -5.527  20.710  1.00 65.75  ? 523 PRO A CA    1 
ATOM   4193  C  C     . PRO A 1 543 ? 27.791  -5.708  21.737  1.00 65.90  ? 523 PRO A C     1 
ATOM   4194  O  O     . PRO A 1 543 ? 27.419  -6.837  22.063  1.00 66.77  ? 523 PRO A O     1 
ATOM   4195  C  CB    . PRO A 1 543 ? 28.338  -5.034  19.382  1.00 65.90  ? 523 PRO A CB    1 
ATOM   4196  C  CG    . PRO A 1 543 ? 28.026  -6.285  18.630  1.00 65.99  ? 523 PRO A CG    1 
ATOM   4197  C  CD    . PRO A 1 543 ? 28.973  -7.356  19.108  1.00 65.88  ? 523 PRO A CD    1 
ATOM   4198  N  N     . VAL A 1 544 ? 27.270  -4.590  22.235  1.00 66.07  ? 524 VAL A N     1 
ATOM   4199  C  CA    . VAL A 1 544 ? 26.205  -4.592  23.238  1.00 66.09  ? 524 VAL A CA    1 
ATOM   4200  C  C     . VAL A 1 544 ? 24.884  -4.968  22.561  1.00 66.32  ? 524 VAL A C     1 
ATOM   4201  O  O     . VAL A 1 544 ? 24.554  -4.428  21.504  1.00 67.11  ? 524 VAL A O     1 
ATOM   4202  C  CB    . VAL A 1 544 ? 26.077  -3.215  23.937  1.00 66.03  ? 524 VAL A CB    1 
ATOM   4203  C  CG1   . VAL A 1 544 ? 24.914  -3.208  24.926  1.00 66.31  ? 524 VAL A CG1   1 
ATOM   4204  C  CG2   . VAL A 1 544 ? 27.377  -2.852  24.646  1.00 65.89  ? 524 VAL A CG2   1 
ATOM   4205  N  N     . ASP A 1 545 ? 24.137  -5.885  23.176  1.00 65.68  ? 525 ASP A N     1 
ATOM   4206  C  CA    . ASP A 1 545 ? 22.881  -6.381  22.602  1.00 65.06  ? 525 ASP A CA    1 
ATOM   4207  C  C     . ASP A 1 545 ? 21.766  -5.355  22.781  1.00 64.61  ? 525 ASP A C     1 
ATOM   4208  O  O     . ASP A 1 545 ? 21.157  -4.919  21.801  1.00 65.41  ? 525 ASP A O     1 
ATOM   4209  C  CB    . ASP A 1 545 ? 22.479  -7.719  23.229  1.00 64.65  ? 525 ASP A CB    1 
ATOM   4210  C  CG    . ASP A 1 545 ? 23.503  -8.811  22.978  1.00 64.48  ? 525 ASP A CG    1 
ATOM   4211  O  OD1   . ASP A 1 545 ? 24.650  -8.672  23.451  1.00 63.06  ? 525 ASP A OD1   1 
ATOM   4212  O  OD2   . ASP A 1 545 ? 23.162  -9.810  22.312  1.00 65.60  ? 525 ASP A OD2   1 
ATOM   4213  N  N     . ILE A 1 546 ? 21.521  -4.973  24.035  1.00 63.21  ? 526 ILE A N     1 
ATOM   4214  C  CA    . ILE A 1 546 ? 20.532  -3.945  24.387  1.00 62.05  ? 526 ILE A CA    1 
ATOM   4215  C  C     . ILE A 1 546 ? 21.240  -2.861  25.204  1.00 60.36  ? 526 ILE A C     1 
ATOM   4216  O  O     . ILE A 1 546 ? 21.972  -3.170  26.147  1.00 59.83  ? 526 ILE A O     1 
ATOM   4217  C  CB    . ILE A 1 546 ? 19.296  -4.538  25.135  1.00 62.82  ? 526 ILE A CB    1 
ATOM   4218  C  CG1   . ILE A 1 546 ? 18.211  -3.476  25.371  1.00 63.04  ? 526 ILE A CG1   1 
ATOM   4219  C  CG2   . ILE A 1 546 ? 19.668  -5.208  26.457  1.00 63.10  ? 526 ILE A CG2   1 
ATOM   4220  C  CD1   . ILE A 1 546 ? 17.400  -3.150  24.138  1.00 63.43  ? 526 ILE A CD1   1 
ATOM   4221  N  N     . TYR A 1 547 ? 21.039  -1.601  24.813  1.00 59.13  ? 527 TYR A N     1 
ATOM   4222  C  CA    . TYR A 1 547 ? 21.630  -0.452  25.501  1.00 58.34  ? 527 TYR A CA    1 
ATOM   4223  C  C     . TYR A 1 547 ? 20.507  0.490   25.917  1.00 58.65  ? 527 TYR A C     1 
ATOM   4224  O  O     . TYR A 1 547 ? 19.788  1.016   25.066  1.00 58.96  ? 527 TYR A O     1 
ATOM   4225  C  CB    . TYR A 1 547 ? 22.644  0.256   24.591  1.00 57.51  ? 527 TYR A CB    1 
ATOM   4226  C  CG    . TYR A 1 547 ? 23.517  1.317   25.253  1.00 56.80  ? 527 TYR A CG    1 
ATOM   4227  C  CD1   . TYR A 1 547 ? 23.944  1.198   26.582  1.00 56.80  ? 527 TYR A CD1   1 
ATOM   4228  C  CD2   . TYR A 1 547 ? 23.958  2.426   24.528  1.00 56.18  ? 527 TYR A CD2   1 
ATOM   4229  C  CE1   . TYR A 1 547 ? 24.751  2.161   27.168  1.00 56.31  ? 527 TYR A CE1   1 
ATOM   4230  C  CE2   . TYR A 1 547 ? 24.769  3.392   25.111  1.00 55.82  ? 527 TYR A CE2   1 
ATOM   4231  C  CZ    . TYR A 1 547 ? 25.162  3.256   26.429  1.00 55.77  ? 527 TYR A CZ    1 
ATOM   4232  O  OH    . TYR A 1 547 ? 25.966  4.209   27.008  1.00 54.68  ? 527 TYR A OH    1 
ATOM   4233  N  N     . ILE A 1 548 ? 20.361  0.686   27.229  1.00 58.46  ? 528 ILE A N     1 
ATOM   4234  C  CA    . ILE A 1 548 ? 19.196  1.358   27.809  1.00 57.42  ? 528 ILE A CA    1 
ATOM   4235  C  C     . ILE A 1 548 ? 19.627  2.653   28.495  1.00 57.26  ? 528 ILE A C     1 
ATOM   4236  O  O     . ILE A 1 548 ? 20.415  2.634   29.440  1.00 56.78  ? 528 ILE A O     1 
ATOM   4237  C  CB    . ILE A 1 548 ? 18.469  0.445   28.825  1.00 56.63  ? 528 ILE A CB    1 
ATOM   4238  C  CG1   . ILE A 1 548 ? 18.104  -0.901  28.181  1.00 56.01  ? 528 ILE A CG1   1 
ATOM   4239  C  CG2   . ILE A 1 548 ? 17.209  1.124   29.360  1.00 56.51  ? 528 ILE A CG2   1 
ATOM   4240  C  CD1   . ILE A 1 548 ? 17.919  -2.024  29.172  1.00 55.46  ? 528 ILE A CD1   1 
ATOM   4241  N  N     . GLY A 1 549 ? 19.101  3.772   28.006  1.00 57.86  ? 529 GLY A N     1 
ATOM   4242  C  CA    . GLY A 1 549 ? 19.383  5.087   28.573  1.00 58.44  ? 529 GLY A CA    1 
ATOM   4243  C  C     . GLY A 1 549 ? 18.259  6.068   28.319  1.00 59.28  ? 529 GLY A C     1 
ATOM   4244  O  O     . GLY A 1 549 ? 17.221  5.707   27.767  1.00 59.56  ? 529 GLY A O     1 
ATOM   4245  N  N     . GLY A 1 550 ? 18.469  7.315   28.726  1.00 60.04  ? 530 GLY A N     1 
ATOM   4246  C  CA    . GLY A 1 550 ? 17.504  8.379   28.476  1.00 60.86  ? 530 GLY A CA    1 
ATOM   4247  C  C     . GLY A 1 550 ? 17.548  8.867   27.043  1.00 61.10  ? 530 GLY A C     1 
ATOM   4248  O  O     . GLY A 1 550 ? 18.568  8.735   26.366  1.00 61.34  ? 530 GLY A O     1 
ATOM   4249  N  N     . ILE A 1 551 ? 16.432  9.430   26.585  1.00 61.66  ? 531 ILE A N     1 
ATOM   4250  C  CA    . ILE A 1 551 ? 16.372  10.121  25.291  1.00 61.88  ? 531 ILE A CA    1 
ATOM   4251  C  C     . ILE A 1 551 ? 17.216  11.411  25.315  1.00 61.25  ? 531 ILE A C     1 
ATOM   4252  O  O     . ILE A 1 551 ? 17.653  11.888  24.268  1.00 60.60  ? 531 ILE A O     1 
ATOM   4253  C  CB    . ILE A 1 551 ? 14.903  10.405  24.872  1.00 62.61  ? 531 ILE A CB    1 
ATOM   4254  C  CG1   . ILE A 1 551 ? 14.788  10.679  23.365  1.00 62.55  ? 531 ILE A CG1   1 
ATOM   4255  C  CG2   . ILE A 1 551 ? 14.295  11.545  25.689  1.00 63.77  ? 531 ILE A CG2   1 
ATOM   4256  C  CD1   . ILE A 1 551 ? 14.925  9.446   22.498  1.00 62.74  ? 531 ILE A CD1   1 
ATOM   4257  N  N     . GLU A 1 552 ? 17.428  11.967  26.510  1.00 61.47  ? 532 GLU A N     1 
ATOM   4258  C  CA    . GLU A 1 552 ? 18.394  13.058  26.734  1.00 62.46  ? 532 GLU A CA    1 
ATOM   4259  C  C     . GLU A 1 552 ? 19.774  12.835  26.102  1.00 63.08  ? 532 GLU A C     1 
ATOM   4260  O  O     . GLU A 1 552 ? 20.394  13.786  25.623  1.00 63.28  ? 532 GLU A O     1 
ATOM   4261  C  CB    . GLU A 1 552 ? 18.561  13.344  28.238  1.00 63.05  ? 532 GLU A CB    1 
ATOM   4262  C  CG    . GLU A 1 552 ? 19.000  12.153  29.090  1.00 63.60  ? 532 GLU A CG    1 
ATOM   4263  C  CD    . GLU A 1 552 ? 19.374  12.534  30.512  1.00 64.27  ? 532 GLU A CD    1 
ATOM   4264  O  OE1   . GLU A 1 552 ? 19.075  13.669  30.936  1.00 65.84  ? 532 GLU A OE1   1 
ATOM   4265  O  OE2   . GLU A 1 552 ? 19.973  11.691  31.212  1.00 64.53  ? 532 GLU A OE2   1 
ATOM   4266  N  N     . HIS A 1 553 ? 20.235  11.582  26.097  1.00 64.30  ? 533 HIS A N     1 
ATOM   4267  C  CA    . HIS A 1 553 ? 21.529  11.204  25.515  1.00 64.69  ? 533 HIS A CA    1 
ATOM   4268  C  C     . HIS A 1 553 ? 21.429  10.724  24.056  1.00 65.48  ? 533 HIS A C     1 
ATOM   4269  O  O     . HIS A 1 553 ? 22.263  9.935   23.607  1.00 65.31  ? 533 HIS A O     1 
ATOM   4270  C  CB    . HIS A 1 553 ? 22.177  10.108  26.372  1.00 64.21  ? 533 HIS A CB    1 
ATOM   4271  C  CG    . HIS A 1 553 ? 22.434  10.520  27.786  1.00 63.92  ? 533 HIS A CG    1 
ATOM   4272  N  ND1   . HIS A 1 553 ? 23.228  11.597  28.112  1.00 63.88  ? 533 HIS A ND1   1 
ATOM   4273  C  CD2   . HIS A 1 553 ? 22.013  9.992   28.959  1.00 64.21  ? 533 HIS A CD2   1 
ATOM   4274  C  CE1   . HIS A 1 553 ? 23.278  11.721  29.426  1.00 64.49  ? 533 HIS A CE1   1 
ATOM   4275  N  NE2   . HIS A 1 553 ? 22.550  10.759  29.964  1.00 64.42  ? 533 HIS A NE2   1 
ATOM   4276  N  N     . ALA A 1 554 ? 20.433  11.207  23.311  1.00 66.14  ? 534 ALA A N     1 
ATOM   4277  C  CA    . ALA A 1 554 ? 20.235  10.785  21.920  1.00 67.27  ? 534 ALA A CA    1 
ATOM   4278  C  C     . ALA A 1 554 ? 21.394  11.203  21.016  1.00 67.59  ? 534 ALA A C     1 
ATOM   4279  O  O     . ALA A 1 554 ? 21.833  10.425  20.165  1.00 67.27  ? 534 ALA A O     1 
ATOM   4280  C  CB    . ALA A 1 554 ? 18.924  11.336  21.374  1.00 68.07  ? 534 ALA A CB    1 
ATOM   4281  N  N     . ILE A 1 555 ? 21.889  12.422  21.222  1.00 67.87  ? 535 ILE A N     1 
ATOM   4282  C  CA    . ILE A 1 555 ? 22.880  13.033  20.340  1.00 68.82  ? 535 ILE A CA    1 
ATOM   4283  C  C     . ILE A 1 555 ? 24.272  13.078  20.979  1.00 69.62  ? 535 ILE A C     1 
ATOM   4284  O  O     . ILE A 1 555 ? 25.181  12.399  20.507  1.00 70.61  ? 535 ILE A O     1 
ATOM   4285  C  CB    . ILE A 1 555 ? 22.430  14.449  19.931  1.00 69.16  ? 535 ILE A CB    1 
ATOM   4286  C  CG1   . ILE A 1 555 ? 21.153  14.378  19.080  1.00 70.03  ? 535 ILE A CG1   1 
ATOM   4287  C  CG2   . ILE A 1 555 ? 23.526  15.160  19.158  1.00 68.82  ? 535 ILE A CG2   1 
ATOM   4288  C  CD1   . ILE A 1 555 ? 20.372  15.678  19.023  1.00 70.81  ? 535 ILE A CD1   1 
ATOM   4289  N  N     . MET A 1 556 ? 24.429  13.877  22.037  1.00 69.51  ? 536 MET A N     1 
ATOM   4290  C  CA    . MET A 1 556 ? 25.747  14.144  22.651  1.00 68.60  ? 536 MET A CA    1 
ATOM   4291  C  C     . MET A 1 556 ? 26.543  12.881  22.998  1.00 66.40  ? 536 MET A C     1 
ATOM   4292  O  O     . MET A 1 556 ? 27.573  12.609  22.376  1.00 65.61  ? 536 MET A O     1 
ATOM   4293  C  CB    . MET A 1 556 ? 25.602  15.020  23.906  1.00 69.97  ? 536 MET A CB    1 
ATOM   4294  C  CG    . MET A 1 556 ? 25.414  16.503  23.626  1.00 71.69  ? 536 MET A CG    1 
ATOM   4295  S  SD    . MET A 1 556 ? 26.962  17.431  23.582  1.00 73.64  ? 536 MET A SD    1 
ATOM   4296  C  CE    . MET A 1 556 ? 27.509  17.161  21.898  1.00 74.65  ? 536 MET A CE    1 
ATOM   4297  N  N     . HIS A 1 557 ? 26.057  12.115  23.975  1.00 63.80  ? 537 HIS A N     1 
ATOM   4298  C  CA    . HIS A 1 557 ? 26.760  10.912  24.435  1.00 62.79  ? 537 HIS A CA    1 
ATOM   4299  C  C     . HIS A 1 557 ? 26.782  9.816   23.373  1.00 62.68  ? 537 HIS A C     1 
ATOM   4300  O  O     . HIS A 1 557 ? 27.842  9.267   23.086  1.00 64.66  ? 537 HIS A O     1 
ATOM   4301  C  CB    . HIS A 1 557 ? 26.163  10.366  25.742  1.00 61.30  ? 537 HIS A CB    1 
ATOM   4302  C  CG    . HIS A 1 557 ? 26.489  8.928   26.001  1.00 59.65  ? 537 HIS A CG    1 
ATOM   4303  N  ND1   . HIS A 1 557 ? 27.783  8.460   26.084  1.00 58.43  ? 537 HIS A ND1   1 
ATOM   4304  C  CD2   . HIS A 1 557 ? 25.687  7.853   26.185  1.00 59.38  ? 537 HIS A CD2   1 
ATOM   4305  C  CE1   . HIS A 1 557 ? 27.762  7.158   26.308  1.00 58.55  ? 537 HIS A CE1   1 
ATOM   4306  N  NE2   . HIS A 1 557 ? 26.503  6.766   26.376  1.00 58.92  ? 537 HIS A NE2   1 
ATOM   4307  N  N     . LEU A 1 558 ? 25.622  9.501   22.801  1.00 62.06  ? 538 LEU A N     1 
ATOM   4308  C  CA    . LEU A 1 558 ? 25.518  8.389   21.844  1.00 62.40  ? 538 LEU A CA    1 
ATOM   4309  C  C     . LEU A 1 558 ? 26.334  8.572   20.550  1.00 62.75  ? 538 LEU A C     1 
ATOM   4310  O  O     . LEU A 1 558 ? 26.690  7.580   19.908  1.00 63.48  ? 538 LEU A O     1 
ATOM   4311  C  CB    . LEU A 1 558 ? 24.051  8.060   21.518  1.00 62.54  ? 538 LEU A CB    1 
ATOM   4312  C  CG    . LEU A 1 558 ? 23.310  7.177   22.531  1.00 62.60  ? 538 LEU A CG    1 
ATOM   4313  C  CD1   . LEU A 1 558 ? 21.835  7.090   22.177  1.00 63.45  ? 538 LEU A CD1   1 
ATOM   4314  C  CD2   . LEU A 1 558 ? 23.902  5.779   22.604  1.00 62.56  ? 538 LEU A CD2   1 
ATOM   4315  N  N     . LEU A 1 559 ? 26.632  9.818   20.174  1.00 61.12  ? 539 LEU A N     1 
ATOM   4316  C  CA    . LEU A 1 559 ? 27.522  10.089  19.040  1.00 59.35  ? 539 LEU A CA    1 
ATOM   4317  C  C     . LEU A 1 559 ? 28.999  9.923   19.426  1.00 58.14  ? 539 LEU A C     1 
ATOM   4318  O  O     . LEU A 1 559 ? 29.782  9.411   18.626  1.00 57.46  ? 539 LEU A O     1 
ATOM   4319  C  CB    . LEU A 1 559 ? 27.265  11.483  18.462  1.00 59.35  ? 539 LEU A CB    1 
ATOM   4320  C  CG    . LEU A 1 559 ? 27.866  11.797  17.089  1.00 59.85  ? 539 LEU A CG    1 
ATOM   4321  C  CD1   . LEU A 1 559 ? 27.220  10.956  15.998  1.00 59.87  ? 539 LEU A CD1   1 
ATOM   4322  C  CD2   . LEU A 1 559 ? 27.710  13.278  16.778  1.00 60.23  ? 539 LEU A CD2   1 
ATOM   4323  N  N     . TYR A 1 560 ? 29.375  10.356  20.634  1.00 57.15  ? 540 TYR A N     1 
ATOM   4324  C  CA    . TYR A 1 560 ? 30.728  10.108  21.168  1.00 56.69  ? 540 TYR A CA    1 
ATOM   4325  C  C     . TYR A 1 560 ? 30.951  8.610   21.393  1.00 56.86  ? 540 TYR A C     1 
ATOM   4326  O  O     . TYR A 1 560 ? 31.974  8.057   20.997  1.00 57.52  ? 540 TYR A O     1 
ATOM   4327  C  CB    . TYR A 1 560 ? 30.962  10.827  22.506  1.00 56.41  ? 540 TYR A CB    1 
ATOM   4328  C  CG    . TYR A 1 560 ? 30.843  12.343  22.514  1.00 56.18  ? 540 TYR A CG    1 
ATOM   4329  C  CD1   . TYR A 1 560 ? 31.251  13.122  21.425  1.00 56.20  ? 540 TYR A CD1   1 
ATOM   4330  C  CD2   . TYR A 1 560 ? 30.365  13.005  23.647  1.00 55.77  ? 540 TYR A CD2   1 
ATOM   4331  C  CE1   . TYR A 1 560 ? 31.150  14.508  21.458  1.00 56.21  ? 540 TYR A CE1   1 
ATOM   4332  C  CE2   . TYR A 1 560 ? 30.262  14.388  23.688  1.00 55.75  ? 540 TYR A CE2   1 
ATOM   4333  C  CZ    . TYR A 1 560 ? 30.655  15.137  22.595  1.00 55.94  ? 540 TYR A CZ    1 
ATOM   4334  O  OH    . TYR A 1 560 ? 30.554  16.509  22.644  1.00 55.76  ? 540 TYR A OH    1 
ATOM   4335  N  N     . PHE A 1 561 ? 29.984  7.993   22.068  1.00 57.21  ? 541 PHE A N     1 
ATOM   4336  C  CA    . PHE A 1 561 ? 29.889  6.540   22.296  1.00 57.34  ? 541 PHE A CA    1 
ATOM   4337  C  C     . PHE A 1 561 ? 30.253  5.700   21.069  1.00 57.92  ? 541 PHE A C     1 
ATOM   4338  O  O     . PHE A 1 561 ? 31.064  4.776   21.160  1.00 57.73  ? 541 PHE A O     1 
ATOM   4339  C  CB    . PHE A 1 561 ? 28.451  6.245   22.745  1.00 57.04  ? 541 PHE A CB    1 
ATOM   4340  C  CG    . PHE A 1 561 ? 28.098  4.790   22.842  1.00 56.74  ? 541 PHE A CG    1 
ATOM   4341  C  CD1   . PHE A 1 561 ? 28.832  3.924   23.642  1.00 56.83  ? 541 PHE A CD1   1 
ATOM   4342  C  CD2   . PHE A 1 561 ? 26.981  4.298   22.170  1.00 56.53  ? 541 PHE A CD2   1 
ATOM   4343  C  CE1   . PHE A 1 561 ? 28.474  2.585   23.739  1.00 57.33  ? 541 PHE A CE1   1 
ATOM   4344  C  CE2   . PHE A 1 561 ? 26.620  2.967   22.270  1.00 56.90  ? 541 PHE A CE2   1 
ATOM   4345  C  CZ    . PHE A 1 561 ? 27.367  2.108   23.055  1.00 57.20  ? 541 PHE A CZ    1 
ATOM   4346  N  N     . ARG A 1 562 ? 29.651  6.037   19.932  1.00 58.18  ? 542 ARG A N     1 
ATOM   4347  C  CA    . ARG A 1 562 ? 29.932  5.353   18.666  1.00 58.26  ? 542 ARG A CA    1 
ATOM   4348  C  C     . ARG A 1 562 ? 31.283  5.760   18.085  1.00 57.91  ? 542 ARG A C     1 
ATOM   4349  O  O     . ARG A 1 562 ? 32.061  4.905   17.660  1.00 58.81  ? 542 ARG A O     1 
ATOM   4350  C  CB    . ARG A 1 562 ? 28.842  5.651   17.642  1.00 58.61  ? 542 ARG A CB    1 
ATOM   4351  C  CG    . ARG A 1 562 ? 27.490  5.028   17.956  1.00 58.49  ? 542 ARG A CG    1 
ATOM   4352  C  CD    . ARG A 1 562 ? 26.442  5.549   16.986  1.00 58.27  ? 542 ARG A CD    1 
ATOM   4353  N  NE    . ARG A 1 562 ? 26.800  5.218   15.604  1.00 57.29  ? 542 ARG A NE    1 
ATOM   4354  C  CZ    . ARG A 1 562 ? 26.424  5.888   14.514  1.00 57.06  ? 542 ARG A CZ    1 
ATOM   4355  N  NH1   . ARG A 1 562 ? 25.652  6.975   14.589  1.00 56.92  ? 542 ARG A NH1   1 
ATOM   4356  N  NH2   . ARG A 1 562 ? 26.838  5.463   13.321  1.00 57.24  ? 542 ARG A NH2   1 
ATOM   4357  N  N     . PHE A 1 563 ? 31.536  7.068   18.047  1.00 56.99  ? 543 PHE A N     1 
ATOM   4358  C  CA    . PHE A 1 563 ? 32.814  7.627   17.581  1.00 56.30  ? 543 PHE A CA    1 
ATOM   4359  C  C     . PHE A 1 563 ? 34.021  6.975   18.257  1.00 56.31  ? 543 PHE A C     1 
ATOM   4360  O  O     . PHE A 1 563 ? 34.984  6.609   17.586  1.00 55.94  ? 543 PHE A O     1 
ATOM   4361  C  CB    . PHE A 1 563 ? 32.835  9.144   17.811  1.00 56.11  ? 543 PHE A CB    1 
ATOM   4362  C  CG    . PHE A 1 563 ? 34.184  9.779   17.617  1.00 56.19  ? 543 PHE A CG    1 
ATOM   4363  C  CD1   . PHE A 1 563 ? 34.873  9.629   16.418  1.00 56.72  ? 543 PHE A CD1   1 
ATOM   4364  C  CD2   . PHE A 1 563 ? 34.759  10.548  18.626  1.00 56.51  ? 543 PHE A CD2   1 
ATOM   4365  C  CE1   . PHE A 1 563 ? 36.115  10.220  16.236  1.00 56.94  ? 543 PHE A CE1   1 
ATOM   4366  C  CE2   . PHE A 1 563 ? 35.999  11.143  18.446  1.00 56.80  ? 543 PHE A CE2   1 
ATOM   4367  C  CZ    . PHE A 1 563 ? 36.676  10.981  17.248  1.00 56.84  ? 543 PHE A CZ    1 
ATOM   4368  N  N     . PHE A 1 564 ? 33.944  6.822   19.577  1.00 56.89  ? 544 PHE A N     1 
ATOM   4369  C  CA    . PHE A 1 564 ? 35.030  6.233   20.367  1.00 57.48  ? 544 PHE A CA    1 
ATOM   4370  C  C     . PHE A 1 564 ? 35.235  4.748   20.042  1.00 58.69  ? 544 PHE A C     1 
ATOM   4371  O  O     . PHE A 1 564 ? 36.371  4.271   20.029  1.00 58.55  ? 544 PHE A O     1 
ATOM   4372  C  CB    . PHE A 1 564 ? 34.763  6.414   21.868  1.00 57.35  ? 544 PHE A CB    1 
ATOM   4373  C  CG    . PHE A 1 564 ? 36.006  6.607   22.693  1.00 57.50  ? 544 PHE A CG    1 
ATOM   4374  C  CD1   . PHE A 1 564 ? 36.730  5.513   23.160  1.00 57.86  ? 544 PHE A CD1   1 
ATOM   4375  C  CD2   . PHE A 1 564 ? 36.449  7.890   23.016  1.00 57.05  ? 544 PHE A CD2   1 
ATOM   4376  C  CE1   . PHE A 1 564 ? 37.875  5.694   23.927  1.00 57.87  ? 544 PHE A CE1   1 
ATOM   4377  C  CE2   . PHE A 1 564 ? 37.591  8.076   23.781  1.00 57.24  ? 544 PHE A CE2   1 
ATOM   4378  C  CZ    . PHE A 1 564 ? 38.305  6.977   24.238  1.00 57.87  ? 544 PHE A CZ    1 
ATOM   4379  N  N     . HIS A 1 565 ? 34.138  4.031   19.782  1.00 60.37  ? 545 HIS A N     1 
ATOM   4380  C  CA    . HIS A 1 565 ? 34.196  2.623   19.357  1.00 61.24  ? 545 HIS A CA    1 
ATOM   4381  C  C     . HIS A 1 565 ? 34.960  2.442   18.045  1.00 62.67  ? 545 HIS A C     1 
ATOM   4382  O  O     . HIS A 1 565 ? 35.697  1.467   17.882  1.00 63.96  ? 545 HIS A O     1 
ATOM   4383  C  CB    . HIS A 1 565 ? 32.790  2.037   19.191  1.00 61.07  ? 545 HIS A CB    1 
ATOM   4384  C  CG    . HIS A 1 565 ? 32.778  0.554   18.987  1.00 60.93  ? 545 HIS A CG    1 
ATOM   4385  N  ND1   . HIS A 1 565 ? 32.837  -0.343  20.031  1.00 61.18  ? 545 HIS A ND1   1 
ATOM   4386  C  CD2   . HIS A 1 565 ? 32.722  -0.189  17.856  1.00 60.65  ? 545 HIS A CD2   1 
ATOM   4387  C  CE1   . HIS A 1 565 ? 32.815  -1.574  19.553  1.00 61.19  ? 545 HIS A CE1   1 
ATOM   4388  N  NE2   . HIS A 1 565 ? 32.745  -1.509  18.236  1.00 60.71  ? 545 HIS A NE2   1 
ATOM   4389  N  N     . LYS A 1 566 ? 34.765  3.376   17.117  1.00 63.51  ? 546 LYS A N     1 
ATOM   4390  C  CA    . LYS A 1 566 ? 35.456  3.355   15.825  1.00 64.54  ? 546 LYS A CA    1 
ATOM   4391  C  C     . LYS A 1 566 ? 36.949  3.678   15.953  1.00 65.60  ? 546 LYS A C     1 
ATOM   4392  O  O     . LYS A 1 566 ? 37.763  3.132   15.206  1.00 67.33  ? 546 LYS A O     1 
ATOM   4393  C  CB    . LYS A 1 566 ? 34.774  4.307   14.837  1.00 64.63  ? 546 LYS A CB    1 
ATOM   4394  C  CG    . LYS A 1 566 ? 33.362  3.870   14.470  1.00 64.36  ? 546 LYS A CG    1 
ATOM   4395  C  CD    . LYS A 1 566 ? 32.584  4.957   13.750  1.00 64.14  ? 546 LYS A CD    1 
ATOM   4396  C  CE    . LYS A 1 566 ? 31.114  4.588   13.622  1.00 64.21  ? 546 LYS A CE    1 
ATOM   4397  N  NZ    . LYS A 1 566 ? 30.898  3.303   12.897  1.00 64.39  ? 546 LYS A NZ    1 
ATOM   4398  N  N     . LEU A 1 567 ? 37.302  4.558   16.893  1.00 65.82  ? 547 LEU A N     1 
ATOM   4399  C  CA    . LEU A 1 567 ? 38.708  4.841   17.212  1.00 65.63  ? 547 LEU A CA    1 
ATOM   4400  C  C     . LEU A 1 567 ? 39.403  3.622   17.825  1.00 65.86  ? 547 LEU A C     1 
ATOM   4401  O  O     . LEU A 1 567 ? 40.538  3.308   17.462  1.00 66.59  ? 547 LEU A O     1 
ATOM   4402  C  CB    . LEU A 1 567 ? 38.832  6.029   18.173  1.00 65.71  ? 547 LEU A CB    1 
ATOM   4403  C  CG    . LEU A 1 567 ? 38.385  7.417   17.699  1.00 65.77  ? 547 LEU A CG    1 
ATOM   4404  C  CD1   . LEU A 1 567 ? 38.444  8.395   18.866  1.00 65.60  ? 547 LEU A CD1   1 
ATOM   4405  C  CD2   . LEU A 1 567 ? 39.224  7.916   16.530  1.00 65.65  ? 547 LEU A CD2   1 
ATOM   4406  N  N     . MET A 1 568 ? 38.722  2.953   18.756  1.00 65.92  ? 548 MET A N     1 
ATOM   4407  C  CA    . MET A 1 568 ? 39.236  1.719   19.367  1.00 66.81  ? 548 MET A CA    1 
ATOM   4408  C  C     . MET A 1 568 ? 39.339  0.568   18.362  1.00 67.26  ? 548 MET A C     1 
ATOM   4409  O  O     . MET A 1 568 ? 40.242  -0.266  18.467  1.00 67.86  ? 548 MET A O     1 
ATOM   4410  C  CB    . MET A 1 568 ? 38.369  1.290   20.558  1.00 67.32  ? 548 MET A CB    1 
ATOM   4411  C  CG    . MET A 1 568 ? 38.504  2.189   21.778  1.00 67.66  ? 548 MET A CG    1 
ATOM   4412  S  SD    . MET A 1 568 ? 37.657  1.534   23.229  1.00 68.59  ? 548 MET A SD    1 
ATOM   4413  C  CE    . MET A 1 568 ? 35.948  1.593   22.696  1.00 68.96  ? 548 MET A CE    1 
ATOM   4414  N  N     . ARG A 1 569 ? 38.419  0.525   17.397  1.00 67.83  ? 549 ARG A N     1 
ATOM   4415  C  CA    . ARG A 1 569 ? 38.465  -0.463  16.311  1.00 68.01  ? 549 ARG A CA    1 
ATOM   4416  C  C     . ARG A 1 569 ? 39.706  -0.270  15.438  1.00 68.04  ? 549 ARG A C     1 
ATOM   4417  O  O     . ARG A 1 569 ? 40.405  -1.240  15.135  1.00 68.28  ? 549 ARG A O     1 
ATOM   4418  C  CB    . ARG A 1 569 ? 37.202  -0.371  15.448  1.00 67.59  ? 549 ARG A CB    1 
ATOM   4419  C  CG    . ARG A 1 569 ? 37.091  -1.419  14.340  1.00 67.03  ? 549 ARG A CG    1 
ATOM   4420  C  CD    . ARG A 1 569 ? 36.132  -0.963  13.254  1.00 66.62  ? 549 ARG A CD    1 
ATOM   4421  N  NE    . ARG A 1 569 ? 36.610  0.255   12.596  1.00 66.06  ? 549 ARG A NE    1 
ATOM   4422  C  CZ    . ARG A 1 569 ? 35.863  1.101   11.882  1.00 65.86  ? 549 ARG A CZ    1 
ATOM   4423  N  NH1   . ARG A 1 569 ? 34.558  0.895   11.693  1.00 65.72  ? 549 ARG A NH1   1 
ATOM   4424  N  NH2   . ARG A 1 569 ? 36.434  2.177   11.346  1.00 66.01  ? 549 ARG A NH2   1 
ATOM   4425  N  N     . ASP A 1 570 ? 39.981  0.977   15.056  1.00 67.28  ? 550 ASP A N     1 
ATOM   4426  C  CA    . ASP A 1 570 ? 41.156  1.305   14.232  1.00 67.05  ? 550 ASP A CA    1 
ATOM   4427  C  C     . ASP A 1 570 ? 42.492  1.110   14.961  1.00 69.00  ? 550 ASP A C     1 
ATOM   4428  O  O     . ASP A 1 570 ? 43.534  1.015   14.314  1.00 70.77  ? 550 ASP A O     1 
ATOM   4429  C  CB    . ASP A 1 570 ? 41.054  2.734   13.686  1.00 65.13  ? 550 ASP A CB    1 
ATOM   4430  C  CG    . ASP A 1 570 ? 39.865  2.927   12.754  1.00 64.57  ? 550 ASP A CG    1 
ATOM   4431  O  OD1   . ASP A 1 570 ? 39.318  1.928   12.238  1.00 63.49  ? 550 ASP A OD1   1 
ATOM   4432  O  OD2   . ASP A 1 570 ? 39.472  4.089   12.536  1.00 64.90  ? 550 ASP A OD2   1 
ATOM   4433  N  N     . ALA A 1 571 ? 42.456  1.057   16.294  1.00 70.95  ? 551 ALA A N     1 
ATOM   4434  C  CA    . ALA A 1 571 ? 43.607  0.643   17.108  1.00 71.95  ? 551 ALA A CA    1 
ATOM   4435  C  C     . ALA A 1 571 ? 43.737  -0.886  17.270  1.00 72.84  ? 551 ALA A C     1 
ATOM   4436  O  O     . ALA A 1 571 ? 44.623  -1.354  17.990  1.00 73.72  ? 551 ALA A O     1 
ATOM   4437  C  CB    . ALA A 1 571 ? 43.534  1.309   18.477  1.00 72.13  ? 551 ALA A CB    1 
ATOM   4438  N  N     . GLY A 1 572 ? 42.869  -1.658  16.611  1.00 72.65  ? 552 GLY A N     1 
ATOM   4439  C  CA    . GLY A 1 572 ? 42.898  -3.118  16.685  1.00 72.81  ? 552 GLY A CA    1 
ATOM   4440  C  C     . GLY A 1 572 ? 42.441  -3.705  18.010  1.00 72.63  ? 552 GLY A C     1 
ATOM   4441  O  O     . GLY A 1 572 ? 42.777  -4.848  18.323  1.00 74.12  ? 552 GLY A O     1 
ATOM   4442  N  N     . MET A 1 573 ? 41.668  -2.938  18.780  1.00 71.45  ? 553 MET A N     1 
ATOM   4443  C  CA    . MET A 1 573 ? 41.202  -3.369  20.100  1.00 70.47  ? 553 MET A CA    1 
ATOM   4444  C  C     . MET A 1 573 ? 39.914  -4.186  20.000  1.00 69.61  ? 553 MET A C     1 
ATOM   4445  O  O     . MET A 1 573 ? 39.774  -5.194  20.694  1.00 70.13  ? 553 MET A O     1 
ATOM   4446  C  CB    . MET A 1 573 ? 40.993  -2.163  21.023  1.00 71.03  ? 553 MET A CB    1 
ATOM   4447  C  CG    . MET A 1 573 ? 42.224  -1.279  21.183  1.00 71.24  ? 553 MET A CG    1 
ATOM   4448  S  SD    . MET A 1 573 ? 41.957  0.138   22.270  1.00 71.18  ? 553 MET A SD    1 
ATOM   4449  C  CE    . MET A 1 573 ? 43.593  0.867   22.290  1.00 71.52  ? 553 MET A CE    1 
ATOM   4450  N  N     . VAL A 1 574 ? 38.989  -3.754  19.136  1.00 68.67  ? 554 VAL A N     1 
ATOM   4451  C  CA    . VAL A 1 574 ? 37.680  -4.410  18.965  1.00 67.91  ? 554 VAL A CA    1 
ATOM   4452  C  C     . VAL A 1 574 ? 37.340  -4.670  17.492  1.00 68.03  ? 554 VAL A C     1 
ATOM   4453  O  O     . VAL A 1 574 ? 37.810  -3.955  16.604  1.00 66.98  ? 554 VAL A O     1 
ATOM   4454  C  CB    . VAL A 1 574 ? 36.539  -3.601  19.632  1.00 67.38  ? 554 VAL A CB    1 
ATOM   4455  C  CG1   . VAL A 1 574 ? 36.692  -3.619  21.146  1.00 67.12  ? 554 VAL A CG1   1 
ATOM   4456  C  CG2   . VAL A 1 574 ? 36.484  -2.164  19.118  1.00 67.07  ? 554 VAL A CG2   1 
ATOM   4457  N  N     . ASN A 1 575 ? 36.508  -5.688  17.255  1.00 68.82  ? 555 ASN A N     1 
ATOM   4458  C  CA    . ASN A 1 575 ? 36.152  -6.139  15.899  1.00 69.43  ? 555 ASN A CA    1 
ATOM   4459  C  C     . ASN A 1 575 ? 34.995  -5.354  15.285  1.00 69.95  ? 555 ASN A C     1 
ATOM   4460  O  O     . ASN A 1 575 ? 35.096  -4.875  14.152  1.00 71.47  ? 555 ASN A O     1 
ATOM   4461  C  CB    . ASN A 1 575 ? 35.762  -7.626  15.904  1.00 69.71  ? 555 ASN A CB    1 
ATOM   4462  C  CG    . ASN A 1 575 ? 36.882  -8.541  16.371  1.00 70.79  ? 555 ASN A CG    1 
ATOM   4463  O  OD1   . ASN A 1 575 ? 36.622  -9.655  16.825  1.00 72.07  ? 555 ASN A OD1   1 
ATOM   4464  N  ND2   . ASN A 1 575 ? 38.127  -8.089  16.255  1.00 71.66  ? 555 ASN A ND2   1 
ATOM   4465  N  N     . SER A 1 576 ? 33.897  -5.248  16.031  1.00 69.25  ? 556 SER A N     1 
ATOM   4466  C  CA    . SER A 1 576 ? 32.640  -4.688  15.519  1.00 68.87  ? 556 SER A CA    1 
ATOM   4467  C  C     . SER A 1 576 ? 32.750  -3.215  15.115  1.00 67.67  ? 556 SER A C     1 
ATOM   4468  O  O     . SER A 1 576 ? 33.462  -2.440  15.754  1.00 67.79  ? 556 SER A O     1 
ATOM   4469  C  CB    . SER A 1 576 ? 31.529  -4.855  16.561  1.00 69.96  ? 556 SER A CB    1 
ATOM   4470  O  OG    . SER A 1 576 ? 31.921  -4.322  17.817  1.00 70.35  ? 556 SER A OG    1 
ATOM   4471  N  N     . ASP A 1 577 ? 32.041  -2.845  14.050  1.00 66.61  ? 557 ASP A N     1 
ATOM   4472  C  CA    . ASP A 1 577 ? 32.016  -1.461  13.563  1.00 66.63  ? 557 ASP A CA    1 
ATOM   4473  C  C     . ASP A 1 577 ? 31.133  -0.552  14.422  1.00 66.43  ? 557 ASP A C     1 
ATOM   4474  O  O     . ASP A 1 577 ? 31.382  0.654   14.493  1.00 66.60  ? 557 ASP A O     1 
ATOM   4475  C  CB    . ASP A 1 577 ? 31.549  -1.402  12.100  1.00 66.86  ? 557 ASP A CB    1 
ATOM   4476  C  CG    . ASP A 1 577 ? 32.498  -2.115  11.142  1.00 66.79  ? 557 ASP A CG    1 
ATOM   4477  O  OD1   . ASP A 1 577 ? 33.703  -2.239  11.448  1.00 66.79  ? 557 ASP A OD1   1 
ATOM   4478  O  OD2   . ASP A 1 577 ? 32.032  -2.548  10.068  1.00 66.87  ? 557 ASP A OD2   1 
ATOM   4479  N  N     . GLU A 1 578 ? 30.100  -1.122  15.049  1.00 65.97  ? 558 GLU A N     1 
ATOM   4480  C  CA    . GLU A 1 578 ? 29.228  -0.389  15.973  1.00 65.90  ? 558 GLU A CA    1 
ATOM   4481  C  C     . GLU A 1 578 ? 29.263  -1.004  17.376  1.00 65.74  ? 558 GLU A C     1 
ATOM   4482  O  O     . GLU A 1 578 ? 29.495  -2.207  17.518  1.00 64.71  ? 558 GLU A O     1 
ATOM   4483  C  CB    . GLU A 1 578 ? 27.790  -0.378  15.450  1.00 66.08  ? 558 GLU A CB    1 
ATOM   4484  C  CG    . GLU A 1 578 ? 27.587  0.462   14.197  1.00 66.50  ? 558 GLU A CG    1 
ATOM   4485  C  CD    . GLU A 1 578 ? 27.781  1.953   14.430  1.00 66.61  ? 558 GLU A CD    1 
ATOM   4486  O  OE1   . GLU A 1 578 ? 27.343  2.468   15.482  1.00 66.05  ? 558 GLU A OE1   1 
ATOM   4487  O  OE2   . GLU A 1 578 ? 28.366  2.621   13.553  1.00 66.82  ? 558 GLU A OE2   1 
ATOM   4488  N  N     . PRO A 1 579 ? 29.027  -0.179  18.417  1.00 66.42  ? 559 PRO A N     1 
ATOM   4489  C  CA    . PRO A 1 579 ? 29.074  -0.666  19.795  1.00 66.56  ? 559 PRO A CA    1 
ATOM   4490  C  C     . PRO A 1 579 ? 27.779  -1.324  20.294  1.00 66.60  ? 559 PRO A C     1 
ATOM   4491  O  O     . PRO A 1 579 ? 27.857  -2.253  21.099  1.00 66.87  ? 559 PRO A O     1 
ATOM   4492  C  CB    . PRO A 1 579 ? 29.358  0.608   20.589  1.00 66.49  ? 559 PRO A CB    1 
ATOM   4493  C  CG    . PRO A 1 579 ? 28.642  1.663   19.822  1.00 66.49  ? 559 PRO A CG    1 
ATOM   4494  C  CD    . PRO A 1 579 ? 28.771  1.276   18.374  1.00 66.67  ? 559 PRO A CD    1 
ATOM   4495  N  N     . ALA A 1 580 ? 26.617  -0.854  19.832  1.00 66.44  ? 560 ALA A N     1 
ATOM   4496  C  CA    . ALA A 1 580 ? 25.318  -1.316  20.335  1.00 66.60  ? 560 ALA A CA    1 
ATOM   4497  C  C     . ALA A 1 580 ? 24.399  -1.776  19.203  1.00 67.10  ? 560 ALA A C     1 
ATOM   4498  O  O     . ALA A 1 580 ? 24.234  -1.066  18.206  1.00 66.53  ? 560 ALA A O     1 
ATOM   4499  C  CB    . ALA A 1 580 ? 24.649  -0.204  21.125  1.00 67.24  ? 560 ALA A CB    1 
ATOM   4500  N  N     . LYS A 1 581 ? 23.794  -2.954  19.372  1.00 67.37  ? 561 LYS A N     1 
ATOM   4501  C  CA    . LYS A 1 581 ? 22.850  -3.508  18.394  1.00 67.13  ? 561 LYS A CA    1 
ATOM   4502  C  C     . LYS A 1 581 ? 21.477  -2.855  18.517  1.00 65.33  ? 561 LYS A C     1 
ATOM   4503  O  O     . LYS A 1 581 ? 20.953  -2.327  17.536  1.00 64.34  ? 561 LYS A O     1 
ATOM   4504  C  CB    . LYS A 1 581 ? 22.709  -5.024  18.560  1.00 68.63  ? 561 LYS A CB    1 
ATOM   4505  C  CG    . LYS A 1 581 ? 23.964  -5.812  18.222  1.00 70.60  ? 561 LYS A CG    1 
ATOM   4506  C  CD    . LYS A 1 581 ? 23.652  -7.289  18.035  1.00 72.38  ? 561 LYS A CD    1 
ATOM   4507  C  CE    . LYS A 1 581 ? 24.905  -8.101  17.742  1.00 73.98  ? 561 LYS A CE    1 
ATOM   4508  N  NZ    . LYS A 1 581 ? 24.583  -9.478  17.270  1.00 74.95  ? 561 LYS A NZ    1 
ATOM   4509  N  N     . GLN A 1 582 ? 20.904  -2.910  19.721  1.00 64.57  ? 562 GLN A N     1 
ATOM   4510  C  CA    . GLN A 1 582 ? 19.584  -2.334  20.008  1.00 64.53  ? 562 GLN A CA    1 
ATOM   4511  C  C     . GLN A 1 582 ? 19.690  -1.193  21.023  1.00 63.70  ? 562 GLN A C     1 
ATOM   4512  O  O     . GLN A 1 582 ? 20.356  -1.332  22.050  1.00 63.56  ? 562 GLN A O     1 
ATOM   4513  C  CB    . GLN A 1 582 ? 18.637  -3.414  20.545  1.00 65.02  ? 562 GLN A CB    1 
ATOM   4514  C  CG    . GLN A 1 582 ? 17.165  -3.014  20.540  1.00 65.39  ? 562 GLN A CG    1 
ATOM   4515  C  CD    . GLN A 1 582 ? 16.236  -4.105  21.049  1.00 65.46  ? 562 GLN A CD    1 
ATOM   4516  O  OE1   . GLN A 1 582 ? 16.667  -5.209  21.386  1.00 65.31  ? 562 GLN A OE1   1 
ATOM   4517  N  NE2   . GLN A 1 582 ? 14.948  -3.792  21.113  1.00 66.15  ? 562 GLN A NE2   1 
ATOM   4518  N  N     . LEU A 1 583 ? 19.029  -0.073  20.721  1.00 62.97  ? 563 LEU A N     1 
ATOM   4519  C  CA    . LEU A 1 583 ? 18.931  1.076   21.624  1.00 61.89  ? 563 LEU A CA    1 
ATOM   4520  C  C     . LEU A 1 583 ? 17.498  1.179   22.137  1.00 60.92  ? 563 LEU A C     1 
ATOM   4521  O  O     . LEU A 1 583 ? 16.553  1.138   21.346  1.00 59.62  ? 563 LEU A O     1 
ATOM   4522  C  CB    . LEU A 1 583 ? 19.319  2.363   20.888  1.00 62.17  ? 563 LEU A CB    1 
ATOM   4523  C  CG    . LEU A 1 583 ? 19.242  3.700   21.637  1.00 62.21  ? 563 LEU A CG    1 
ATOM   4524  C  CD1   . LEU A 1 583 ? 20.128  3.702   22.872  1.00 62.38  ? 563 LEU A CD1   1 
ATOM   4525  C  CD2   . LEU A 1 583 ? 19.628  4.843   20.711  1.00 62.09  ? 563 LEU A CD2   1 
ATOM   4526  N  N     . LEU A 1 584 ? 17.348  1.304   23.457  1.00 60.72  ? 564 LEU A N     1 
ATOM   4527  C  CA    . LEU A 1 584 ? 16.044  1.492   24.099  1.00 60.47  ? 564 LEU A CA    1 
ATOM   4528  C  C     . LEU A 1 584 ? 16.056  2.790   24.901  1.00 59.91  ? 564 LEU A C     1 
ATOM   4529  O  O     . LEU A 1 584 ? 16.445  2.807   26.070  1.00 58.42  ? 564 LEU A O     1 
ATOM   4530  C  CB    . LEU A 1 584 ? 15.706  0.296   24.997  1.00 60.35  ? 564 LEU A CB    1 
ATOM   4531  C  CG    . LEU A 1 584 ? 14.406  0.341   25.814  1.00 60.46  ? 564 LEU A CG    1 
ATOM   4532  C  CD1   . LEU A 1 584 ? 13.186  0.572   24.933  1.00 60.33  ? 564 LEU A CD1   1 
ATOM   4533  C  CD2   . LEU A 1 584 ? 14.256  -0.947  26.608  1.00 61.02  ? 564 LEU A CD2   1 
ATOM   4534  N  N     . CYS A 1 585 ? 15.634  3.876   24.256  1.00 60.81  ? 565 CYS A N     1 
ATOM   4535  C  CA    . CYS A 1 585 ? 15.570  5.186   24.901  1.00 61.53  ? 565 CYS A CA    1 
ATOM   4536  C  C     . CYS A 1 585 ? 14.272  5.323   25.687  1.00 61.77  ? 565 CYS A C     1 
ATOM   4537  O  O     . CYS A 1 585 ? 13.224  5.650   25.125  1.00 61.57  ? 565 CYS A O     1 
ATOM   4538  C  CB    . CYS A 1 585 ? 15.721  6.325   23.886  1.00 62.03  ? 565 CYS A CB    1 
ATOM   4539  S  SG    . CYS A 1 585 ? 17.441  6.645   23.432  1.00 62.15  ? 565 CYS A SG    1 
ATOM   4540  N  N     . GLN A 1 586 ? 14.355  5.040   26.986  1.00 62.44  ? 566 GLN A N     1 
ATOM   4541  C  CA    . GLN A 1 586 ? 13.237  5.247   27.916  1.00 62.74  ? 566 GLN A CA    1 
ATOM   4542  C  C     . GLN A 1 586 ? 12.870  6.725   28.047  1.00 63.35  ? 566 GLN A C     1 
ATOM   4543  O  O     . GLN A 1 586 ? 13.725  7.599   27.895  1.00 64.62  ? 566 GLN A O     1 
ATOM   4544  C  CB    . GLN A 1 586 ? 13.562  4.691   29.308  1.00 62.70  ? 566 GLN A CB    1 
ATOM   4545  C  CG    . GLN A 1 586 ? 14.894  5.175   29.885  1.00 63.67  ? 566 GLN A CG    1 
ATOM   4546  C  CD    . GLN A 1 586 ? 14.860  5.498   31.366  1.00 65.04  ? 566 GLN A CD    1 
ATOM   4547  O  OE1   . GLN A 1 586 ? 13.979  5.055   32.104  1.00 66.48  ? 566 GLN A OE1   1 
ATOM   4548  N  NE2   . GLN A 1 586 ? 15.838  6.278   31.811  1.00 65.34  ? 566 GLN A NE2   1 
ATOM   4549  N  N     . GLY A 1 587 ? 11.600  6.991   28.340  1.00 64.29  ? 567 GLY A N     1 
ATOM   4550  C  CA    . GLY A 1 587 ? 11.112  8.358   28.520  1.00 65.49  ? 567 GLY A CA    1 
ATOM   4551  C  C     . GLY A 1 587 ? 11.565  8.958   29.838  1.00 66.65  ? 567 GLY A C     1 
ATOM   4552  O  O     . GLY A 1 587 ? 11.799  8.234   30.808  1.00 67.66  ? 567 GLY A O     1 
ATOM   4553  N  N     . MET A 1 588 ? 11.692  10.284  29.867  1.00 67.90  ? 568 MET A N     1 
ATOM   4554  C  CA    . MET A 1 588 ? 12.120  11.005  31.067  1.00 68.40  ? 568 MET A CA    1 
ATOM   4555  C  C     . MET A 1 588 ? 11.018  10.985  32.120  1.00 66.62  ? 568 MET A C     1 
ATOM   4556  O  O     . MET A 1 588 ? 9.851   11.217  31.804  1.00 67.86  ? 568 MET A O     1 
ATOM   4557  C  CB    . MET A 1 588 ? 12.468  12.462  30.738  1.00 70.86  ? 568 MET A CB    1 
ATOM   4558  C  CG    . MET A 1 588 ? 13.633  12.660  29.777  1.00 72.90  ? 568 MET A CG    1 
ATOM   4559  S  SD    . MET A 1 588 ? 15.257  12.412  30.521  1.00 76.83  ? 568 MET A SD    1 
ATOM   4560  C  CE    . MET A 1 588 ? 15.587  10.701  30.107  1.00 76.12  ? 568 MET A CE    1 
ATOM   4561  N  N     . VAL A 1 589 ? 11.397  10.702  33.363  1.00 64.77  ? 569 VAL A N     1 
ATOM   4562  C  CA    . VAL A 1 589 ? 10.492  10.768  34.504  1.00 64.56  ? 569 VAL A CA    1 
ATOM   4563  C  C     . VAL A 1 589 ? 10.409  12.236  34.924  1.00 64.82  ? 569 VAL A C     1 
ATOM   4564  O  O     . VAL A 1 589 ? 11.370  12.780  35.475  1.00 65.75  ? 569 VAL A O     1 
ATOM   4565  C  CB    . VAL A 1 589 ? 10.987  9.882   35.671  1.00 64.18  ? 569 VAL A CB    1 
ATOM   4566  C  CG1   . VAL A 1 589 ? 10.110  10.058  36.906  1.00 64.72  ? 569 VAL A CG1   1 
ATOM   4567  C  CG2   . VAL A 1 589 ? 11.021  8.421   35.243  1.00 63.84  ? 569 VAL A CG2   1 
ATOM   4568  N  N     . LEU A 1 590 ? 9.265   12.868  34.654  1.00 64.36  ? 570 LEU A N     1 
ATOM   4569  C  CA    . LEU A 1 590 ? 9.096   14.311  34.853  1.00 63.87  ? 570 LEU A CA    1 
ATOM   4570  C  C     . LEU A 1 590 ? 8.551   14.654  36.239  1.00 64.26  ? 570 LEU A C     1 
ATOM   4571  O  O     . LEU A 1 590 ? 7.845   13.854  36.857  1.00 64.01  ? 570 LEU A O     1 
ATOM   4572  C  CB    . LEU A 1 590 ? 8.167   14.893  33.783  1.00 63.54  ? 570 LEU A CB    1 
ATOM   4573  C  CG    . LEU A 1 590 ? 8.528   14.620  32.320  1.00 63.58  ? 570 LEU A CG    1 
ATOM   4574  C  CD1   . LEU A 1 590 ? 7.440   15.156  31.403  1.00 64.07  ? 570 LEU A CD1   1 
ATOM   4575  C  CD2   . LEU A 1 590 ? 9.874   15.227  31.960  1.00 63.73  ? 570 LEU A CD2   1 
ATOM   4576  N  N     . ALA A 1 591 ? 8.899   15.849  36.713  1.00 65.30  ? 571 ALA A N     1 
ATOM   4577  C  CA    . ALA A 1 591 ? 8.378   16.404  37.968  1.00 66.08  ? 571 ALA A CA    1 
ATOM   4578  C  C     . ALA A 1 591 ? 8.434   17.933  37.948  1.00 66.95  ? 571 ALA A C     1 
ATOM   4579  O  O     . ALA A 1 591 ? 9.242   18.518  37.223  1.00 67.51  ? 571 ALA A O     1 
ATOM   4580  C  CB    . ALA A 1 591 ? 9.168   15.867  39.149  1.00 65.75  ? 571 ALA A CB    1 
ATOM   4581  N  N     . ASP A 1 592 ? 7.576   18.570  38.746  1.00 68.17  ? 572 ASP A N     1 
ATOM   4582  C  CA    . ASP A 1 592 ? 7.548   20.037  38.851  1.00 69.29  ? 572 ASP A CA    1 
ATOM   4583  C  C     . ASP A 1 592 ? 8.838   20.563  39.472  1.00 72.14  ? 572 ASP A C     1 
ATOM   4584  O  O     . ASP A 1 592 ? 9.483   19.866  40.254  1.00 73.58  ? 572 ASP A O     1 
ATOM   4585  C  CB    . ASP A 1 592 ? 6.350   20.512  39.686  1.00 68.11  ? 572 ASP A CB    1 
ATOM   4586  C  CG    . ASP A 1 592 ? 5.015   20.321  38.980  1.00 67.05  ? 572 ASP A CG    1 
ATOM   4587  O  OD1   . ASP A 1 592 ? 4.967   20.358  37.732  1.00 65.76  ? 572 ASP A OD1   1 
ATOM   4588  O  OD2   . ASP A 1 592 ? 4.000   20.151  39.686  1.00 67.10  ? 572 ASP A OD2   1 
ATOM   4589  N  N     . ALA A 1 593 ? 9.201   21.794  39.118  1.00 75.32  ? 573 ALA A N     1 
ATOM   4590  C  CA    . ALA A 1 593 ? 10.450  22.408  39.571  1.00 78.53  ? 573 ALA A CA    1 
ATOM   4591  C  C     . ALA A 1 593 ? 10.238  23.876  39.941  1.00 81.04  ? 573 ALA A C     1 
ATOM   4592  O  O     . ALA A 1 593 ? 9.874   24.688  39.088  1.00 81.00  ? 573 ALA A O     1 
ATOM   4593  C  CB    . ALA A 1 593 ? 11.511  22.279  38.490  1.00 79.49  ? 573 ALA A CB    1 
ATOM   4594  N  N     . PHE A 1 594 ? 10.472  24.198  41.215  1.00 84.32  ? 574 PHE A N     1 
ATOM   4595  C  CA    . PHE A 1 594 ? 10.305  25.552  41.748  1.00 86.52  ? 574 PHE A CA    1 
ATOM   4596  C  C     . PHE A 1 594 ? 11.644  26.109  42.221  1.00 89.42  ? 574 PHE A C     1 
ATOM   4597  O  O     . PHE A 1 594 ? 12.566  25.349  42.526  1.00 89.73  ? 574 PHE A O     1 
ATOM   4598  C  CB    . PHE A 1 594 ? 9.330   25.541  42.929  1.00 85.83  ? 574 PHE A CB    1 
ATOM   4599  C  CG    . PHE A 1 594 ? 8.031   24.843  42.642  1.00 85.12  ? 574 PHE A CG    1 
ATOM   4600  C  CD1   . PHE A 1 594 ? 6.980   25.523  42.035  1.00 85.53  ? 574 PHE A CD1   1 
ATOM   4601  C  CD2   . PHE A 1 594 ? 7.853   23.506  42.985  1.00 84.59  ? 574 PHE A CD2   1 
ATOM   4602  C  CE1   . PHE A 1 594 ? 5.776   24.882  41.774  1.00 85.76  ? 574 PHE A CE1   1 
ATOM   4603  C  CE2   . PHE A 1 594 ? 6.653   22.860  42.726  1.00 85.01  ? 574 PHE A CE2   1 
ATOM   4604  C  CZ    . PHE A 1 594 ? 5.613   23.548  42.119  1.00 85.58  ? 574 PHE A CZ    1 
ATOM   4605  N  N     . TYR A 1 595 ? 11.741  27.437  42.276  1.00 92.79  ? 575 TYR A N     1 
ATOM   4606  C  CA    . TYR A 1 595 ? 12.893  28.118  42.880  1.00 95.36  ? 575 TYR A CA    1 
ATOM   4607  C  C     . TYR A 1 595 ? 12.547  29.546  43.304  1.00 99.82  ? 575 TYR A C     1 
ATOM   4608  O  O     . TYR A 1 595 ? 11.572  30.124  42.819  1.00 100.60 ? 575 TYR A O     1 
ATOM   4609  C  CB    . TYR A 1 595 ? 14.098  28.126  41.923  1.00 94.04  ? 575 TYR A CB    1 
ATOM   4610  C  CG    . TYR A 1 595 ? 14.027  29.147  40.803  1.00 93.07  ? 575 TYR A CG    1 
ATOM   4611  C  CD1   . TYR A 1 595 ? 13.360  28.863  39.610  1.00 93.20  ? 575 TYR A CD1   1 
ATOM   4612  C  CD2   . TYR A 1 595 ? 14.639  30.397  40.930  1.00 92.69  ? 575 TYR A CD2   1 
ATOM   4613  C  CE1   . TYR A 1 595 ? 13.299  29.795  38.582  1.00 92.63  ? 575 TYR A CE1   1 
ATOM   4614  C  CE2   . TYR A 1 595 ? 14.578  31.335  39.908  1.00 93.11  ? 575 TYR A CE2   1 
ATOM   4615  C  CZ    . TYR A 1 595 ? 13.908  31.029  38.736  1.00 92.56  ? 575 TYR A CZ    1 
ATOM   4616  O  OH    . TYR A 1 595 ? 13.844  31.951  37.717  1.00 92.49  ? 575 TYR A OH    1 
ATOM   4617  N  N     . TYR A 1 596 ? 13.351  30.096  44.215  1.00 105.17 ? 576 TYR A N     1 
ATOM   4618  C  CA    . TYR A 1 596 ? 13.298  31.519  44.575  1.00 108.18 ? 576 TYR A CA    1 
ATOM   4619  C  C     . TYR A 1 596 ? 14.701  32.115  44.489  1.00 111.76 ? 576 TYR A C     1 
ATOM   4620  O  O     . TYR A 1 596 ? 15.693  31.424  44.740  1.00 113.02 ? 576 TYR A O     1 
ATOM   4621  C  CB    . TYR A 1 596 ? 12.696  31.727  45.976  1.00 107.49 ? 576 TYR A CB    1 
ATOM   4622  C  CG    . TYR A 1 596 ? 13.553  31.243  47.131  1.00 106.91 ? 576 TYR A CG    1 
ATOM   4623  C  CD1   . TYR A 1 596 ? 13.529  29.908  47.528  1.00 107.40 ? 576 TYR A CD1   1 
ATOM   4624  C  CD2   . TYR A 1 596 ? 14.377  32.123  47.838  1.00 106.43 ? 576 TYR A CD2   1 
ATOM   4625  C  CE1   . TYR A 1 596 ? 14.306  29.455  48.585  1.00 106.83 ? 576 TYR A CE1   1 
ATOM   4626  C  CE2   . TYR A 1 596 ? 15.159  31.680  48.898  1.00 106.74 ? 576 TYR A CE2   1 
ATOM   4627  C  CZ    . TYR A 1 596 ? 15.119  30.344  49.268  1.00 106.29 ? 576 TYR A CZ    1 
ATOM   4628  O  OH    . TYR A 1 596 ? 15.887  29.892  50.315  1.00 105.90 ? 576 TYR A OH    1 
ATOM   4629  N  N     . VAL A 1 597 ? 14.775  33.396  44.134  1.00 116.28 ? 577 VAL A N     1 
ATOM   4630  C  CA    . VAL A 1 597 ? 16.054  34.096  44.012  1.00 119.27 ? 577 VAL A CA    1 
ATOM   4631  C  C     . VAL A 1 597 ? 16.558  34.436  45.416  1.00 123.50 ? 577 VAL A C     1 
ATOM   4632  O  O     . VAL A 1 597 ? 15.799  34.931  46.253  1.00 123.74 ? 577 VAL A O     1 
ATOM   4633  C  CB    . VAL A 1 597 ? 15.933  35.378  43.151  1.00 118.32 ? 577 VAL A CB    1 
ATOM   4634  C  CG1   . VAL A 1 597 ? 17.264  36.126  43.093  1.00 117.80 ? 577 VAL A CG1   1 
ATOM   4635  C  CG2   . VAL A 1 597 ? 15.454  35.032  41.744  1.00 117.37 ? 577 VAL A CG2   1 
ATOM   4636  N  N     . GLY A 1 598 ? 17.838  34.161  45.663  1.00 128.45 ? 578 GLY A N     1 
ATOM   4637  C  CA    . GLY A 1 598 ? 18.463  34.416  46.960  1.00 132.07 ? 578 GLY A CA    1 
ATOM   4638  C  C     . GLY A 1 598 ? 18.758  35.888  47.184  1.00 135.08 ? 578 GLY A C     1 
ATOM   4639  O  O     . GLY A 1 598 ? 18.519  36.723  46.306  1.00 136.66 ? 578 GLY A O     1 
ATOM   4640  N  N     . GLU A 1 599 ? 19.295  36.201  48.360  1.00 137.20 ? 579 GLU A N     1 
ATOM   4641  C  CA    . GLU A 1 599 ? 19.572  37.590  48.742  1.00 138.49 ? 579 GLU A CA    1 
ATOM   4642  C  C     . GLU A 1 599 ? 20.705  38.238  47.933  1.00 137.61 ? 579 GLU A C     1 
ATOM   4643  O  O     . GLU A 1 599 ? 20.758  39.466  47.835  1.00 136.84 ? 579 GLU A O     1 
ATOM   4644  C  CB    . GLU A 1 599 ? 19.863  37.694  50.243  1.00 140.46 ? 579 GLU A CB    1 
ATOM   4645  C  CG    . GLU A 1 599 ? 18.693  37.261  51.117  1.00 142.19 ? 579 GLU A CG    1 
ATOM   4646  C  CD    . GLU A 1 599 ? 18.762  37.822  52.526  1.00 144.19 ? 579 GLU A CD    1 
ATOM   4647  O  OE1   . GLU A 1 599 ? 18.688  39.061  52.679  1.00 144.53 ? 579 GLU A OE1   1 
ATOM   4648  O  OE2   . GLU A 1 599 ? 18.875  37.026  53.482  1.00 146.81 ? 579 GLU A OE2   1 
ATOM   4649  N  N     . ASN A 1 600 ? 21.597  37.420  47.364  1.00 137.30 ? 580 ASN A N     1 
ATOM   4650  C  CA    . ASN A 1 600 ? 22.666  37.899  46.476  1.00 137.77 ? 580 ASN A CA    1 
ATOM   4651  C  C     . ASN A 1 600 ? 22.552  37.290  45.061  1.00 134.78 ? 580 ASN A C     1 
ATOM   4652  O  O     . ASN A 1 600 ? 23.563  37.043  44.395  1.00 131.67 ? 580 ASN A O     1 
ATOM   4653  C  CB    . ASN A 1 600 ? 24.035  37.591  47.107  1.00 140.11 ? 580 ASN A CB    1 
ATOM   4654  C  CG    . ASN A 1 600 ? 25.132  38.536  46.633  1.00 141.24 ? 580 ASN A CG    1 
ATOM   4655  O  OD1   . ASN A 1 600 ? 25.051  39.749  46.830  1.00 141.31 ? 580 ASN A OD1   1 
ATOM   4656  N  ND2   . ASN A 1 600 ? 26.170  37.978  46.019  1.00 141.55 ? 580 ASN A ND2   1 
ATOM   4657  N  N     . GLY A 1 601 ? 21.319  37.073  44.602  1.00 133.39 ? 581 GLY A N     1 
ATOM   4658  C  CA    . GLY A 1 601 ? 21.059  36.555  43.255  1.00 132.17 ? 581 GLY A CA    1 
ATOM   4659  C  C     . GLY A 1 601 ? 21.500  35.119  43.024  1.00 130.96 ? 581 GLY A C     1 
ATOM   4660  O  O     . GLY A 1 601 ? 22.080  34.810  41.981  1.00 130.20 ? 581 GLY A O     1 
ATOM   4661  N  N     . GLU A 1 602 ? 21.216  34.249  43.995  1.00 130.02 ? 582 GLU A N     1 
ATOM   4662  C  CA    . GLU A 1 602 ? 21.579  32.827  43.936  1.00 127.91 ? 582 GLU A CA    1 
ATOM   4663  C  C     . GLU A 1 602 ? 20.313  31.970  43.872  1.00 124.01 ? 582 GLU A C     1 
ATOM   4664  O  O     . GLU A 1 602 ? 19.454  32.068  44.753  1.00 123.30 ? 582 GLU A O     1 
ATOM   4665  C  CB    . GLU A 1 602 ? 22.410  32.452  45.167  1.00 128.46 ? 582 GLU A CB    1 
ATOM   4666  C  CG    . GLU A 1 602 ? 23.063  31.078  45.098  1.00 128.73 ? 582 GLU A CG    1 
ATOM   4667  C  CD    . GLU A 1 602 ? 23.869  30.748  46.342  1.00 129.16 ? 582 GLU A CD    1 
ATOM   4668  O  OE1   . GLU A 1 602 ? 24.687  31.590  46.768  1.00 130.20 ? 582 GLU A OE1   1 
ATOM   4669  O  OE2   . GLU A 1 602 ? 23.691  29.641  46.892  1.00 128.97 ? 582 GLU A OE2   1 
ATOM   4670  N  N     . ARG A 1 603 ? 20.203  31.134  42.837  1.00 117.67 ? 583 ARG A N     1 
ATOM   4671  C  CA    . ARG A 1 603 ? 19.004  30.311  42.622  1.00 112.20 ? 583 ARG A CA    1 
ATOM   4672  C  C     . ARG A 1 603 ? 18.907  29.145  43.608  1.00 109.05 ? 583 ARG A C     1 
ATOM   4673  O  O     . ARG A 1 603 ? 19.652  28.169  43.495  1.00 109.76 ? 583 ARG A O     1 
ATOM   4674  C  CB    . ARG A 1 603 ? 18.950  29.774  41.185  1.00 110.45 ? 583 ARG A CB    1 
ATOM   4675  C  CG    . ARG A 1 603 ? 18.436  30.779  40.171  1.00 109.82 ? 583 ARG A CG    1 
ATOM   4676  C  CD    . ARG A 1 603 ? 18.191  30.128  38.819  1.00 109.59 ? 583 ARG A CD    1 
ATOM   4677  N  NE    . ARG A 1 603 ? 17.389  30.977  37.938  1.00 109.81 ? 583 ARG A NE    1 
ATOM   4678  C  CZ    . ARG A 1 603 ? 16.955  30.630  36.724  1.00 110.08 ? 583 ARG A CZ    1 
ATOM   4679  N  NH1   . ARG A 1 603 ? 17.240  29.434  36.205  1.00 110.32 ? 583 ARG A NH1   1 
ATOM   4680  N  NH2   . ARG A 1 603 ? 16.227  31.492  36.017  1.00 110.05 ? 583 ARG A NH2   1 
ATOM   4681  N  N     . ASN A 1 604 ? 17.987  29.263  44.566  1.00 105.97 ? 584 ASN A N     1 
ATOM   4682  C  CA    . ASN A 1 604 ? 17.669  28.186  45.506  1.00 104.38 ? 584 ASN A CA    1 
ATOM   4683  C  C     . ASN A 1 604 ? 16.441  27.428  45.009  1.00 99.42  ? 584 ASN A C     1 
ATOM   4684  O  O     . ASN A 1 604 ? 15.324  27.940  45.083  1.00 98.15  ? 584 ASN A O     1 
ATOM   4685  C  CB    . ASN A 1 604 ? 17.395  28.749  46.908  1.00 107.31 ? 584 ASN A CB    1 
ATOM   4686  C  CG    . ASN A 1 604 ? 18.608  29.431  47.521  1.00 109.74 ? 584 ASN A CG    1 
ATOM   4687  O  OD1   . ASN A 1 604 ? 19.753  29.045  47.274  1.00 111.76 ? 584 ASN A OD1   1 
ATOM   4688  N  ND2   . ASN A 1 604 ? 18.357  30.449  48.340  1.00 111.17 ? 584 ASN A ND2   1 
ATOM   4689  N  N     . TRP A 1 605 ? 16.651  26.214  44.502  1.00 95.26  ? 585 TRP A N     1 
ATOM   4690  C  CA    . TRP A 1 605 ? 15.557  25.377  44.009  1.00 92.16  ? 585 TRP A CA    1 
ATOM   4691  C  C     . TRP A 1 605 ? 14.861  24.666  45.169  1.00 91.25  ? 585 TRP A C     1 
ATOM   4692  O  O     . TRP A 1 605 ? 15.494  23.901  45.896  1.00 89.43  ? 585 TRP A O     1 
ATOM   4693  C  CB    . TRP A 1 605 ? 16.071  24.341  43.008  1.00 89.97  ? 585 TRP A CB    1 
ATOM   4694  C  CG    . TRP A 1 605 ? 16.637  24.934  41.756  1.00 88.21  ? 585 TRP A CG    1 
ATOM   4695  C  CD1   . TRP A 1 605 ? 17.886  25.458  41.591  1.00 87.73  ? 585 TRP A CD1   1 
ATOM   4696  C  CD2   . TRP A 1 605 ? 15.980  25.054  40.489  1.00 88.04  ? 585 TRP A CD2   1 
ATOM   4697  N  NE1   . TRP A 1 605 ? 18.048  25.901  40.300  1.00 87.88  ? 585 TRP A NE1   1 
ATOM   4698  C  CE2   . TRP A 1 605 ? 16.894  25.665  39.601  1.00 88.02  ? 585 TRP A CE2   1 
ATOM   4699  C  CE3   . TRP A 1 605 ? 14.707  24.704  40.015  1.00 87.89  ? 585 TRP A CE3   1 
ATOM   4700  C  CZ2   . TRP A 1 605 ? 16.576  25.938  38.263  1.00 87.91  ? 585 TRP A CZ2   1 
ATOM   4701  C  CZ3   . TRP A 1 605 ? 14.389  24.975  38.682  1.00 87.60  ? 585 TRP A CZ3   1 
ATOM   4702  C  CH2   . TRP A 1 605 ? 15.323  25.587  37.824  1.00 87.55  ? 585 TRP A CH2   1 
ATOM   4703  N  N     . VAL A 1 606 ? 13.561  24.918  45.326  1.00 92.23  ? 586 VAL A N     1 
ATOM   4704  C  CA    . VAL A 1 606 ? 12.755  24.308  46.388  1.00 93.79  ? 586 VAL A CA    1 
ATOM   4705  C  C     . VAL A 1 606 ? 12.102  23.033  45.853  1.00 95.17  ? 586 VAL A C     1 
ATOM   4706  O  O     . VAL A 1 606 ? 11.717  22.969  44.681  1.00 96.33  ? 586 VAL A O     1 
ATOM   4707  C  CB    . VAL A 1 606 ? 11.659  25.273  46.901  1.00 94.51  ? 586 VAL A CB    1 
ATOM   4708  C  CG1   . VAL A 1 606 ? 10.944  24.691  48.119  1.00 95.13  ? 586 VAL A CG1   1 
ATOM   4709  C  CG2   . VAL A 1 606 ? 12.259  26.631  47.242  1.00 94.42  ? 586 VAL A CG2   1 
ATOM   4710  N  N     . SER A 1 607 ? 11.971  22.030  46.720  1.00 95.42  ? 587 SER A N     1 
ATOM   4711  C  CA    . SER A 1 607 ? 11.362  20.750  46.350  1.00 95.55  ? 587 SER A CA    1 
ATOM   4712  C  C     . SER A 1 607 ? 9.833   20.875  46.250  1.00 95.82  ? 587 SER A C     1 
ATOM   4713  O  O     . SER A 1 607 ? 9.240   21.687  46.963  1.00 95.31  ? 587 SER A O     1 
ATOM   4714  C  CB    . SER A 1 607 ? 11.736  19.673  47.372  1.00 95.42  ? 587 SER A CB    1 
ATOM   4715  O  OG    . SER A 1 607 ? 11.355  18.385  46.923  1.00 96.52  ? 587 SER A OG    1 
ATOM   4716  N  N     . PRO A 1 608 ? 9.190   20.085  45.359  1.00 97.68  ? 588 PRO A N     1 
ATOM   4717  C  CA    . PRO A 1 608 ? 7.718   20.035  45.298  1.00 99.17  ? 588 PRO A CA    1 
ATOM   4718  C  C     . PRO A 1 608 ? 7.009   19.654  46.607  1.00 100.98 ? 588 PRO A C     1 
ATOM   4719  O  O     . PRO A 1 608 ? 5.886   20.105  46.840  1.00 102.10 ? 588 PRO A O     1 
ATOM   4720  C  CB    . PRO A 1 608 ? 7.454   18.968  44.233  1.00 99.12  ? 588 PRO A CB    1 
ATOM   4721  C  CG    . PRO A 1 608 ? 8.624   19.063  43.328  1.00 98.47  ? 588 PRO A CG    1 
ATOM   4722  C  CD    . PRO A 1 608 ? 9.795   19.370  44.217  1.00 98.50  ? 588 PRO A CD    1 
ATOM   4723  N  N     . VAL A 1 609 ? 7.655   18.834  47.437  1.00 103.80 ? 589 VAL A N     1 
ATOM   4724  C  CA    . VAL A 1 609 ? 7.104   18.436  48.742  1.00 105.65 ? 589 VAL A CA    1 
ATOM   4725  C  C     . VAL A 1 609 ? 7.006   19.642  49.688  1.00 107.56 ? 589 VAL A C     1 
ATOM   4726  O  O     . VAL A 1 609 ? 6.025   19.778  50.422  1.00 108.66 ? 589 VAL A O     1 
ATOM   4727  C  CB    . VAL A 1 609 ? 7.940   17.301  49.395  1.00 105.54 ? 589 VAL A CB    1 
ATOM   4728  C  CG1   . VAL A 1 609 ? 7.451   16.988  50.808  1.00 105.40 ? 589 VAL A CG1   1 
ATOM   4729  C  CG2   . VAL A 1 609 ? 7.902   16.043  48.531  1.00 106.08 ? 589 VAL A CG2   1 
ATOM   4730  N  N     . ASP A 1 610 ? 8.018   20.510  49.655  1.00 110.06 ? 590 ASP A N     1 
ATOM   4731  C  CA    . ASP A 1 610 ? 8.057   21.715  50.496  1.00 111.89 ? 590 ASP A CA    1 
ATOM   4732  C  C     . ASP A 1 610 ? 7.086   22.807  50.035  1.00 112.33 ? 590 ASP A C     1 
ATOM   4733  O  O     . ASP A 1 610 ? 6.503   23.508  50.865  1.00 113.72 ? 590 ASP A O     1 
ATOM   4734  C  CB    . ASP A 1 610 ? 9.477   22.301  50.537  1.00 113.36 ? 590 ASP A CB    1 
ATOM   4735  C  CG    . ASP A 1 610 ? 10.503  21.339  51.125  1.00 114.89 ? 590 ASP A CG    1 
ATOM   4736  O  OD1   . ASP A 1 610 ? 10.169  20.157  51.361  1.00 116.25 ? 590 ASP A OD1   1 
ATOM   4737  O  OD2   . ASP A 1 610 ? 11.654  21.774  51.344  1.00 115.39 ? 590 ASP A OD2   1 
ATOM   4738  N  N     . ALA A 1 611 ? 6.921   22.950  48.720  1.00 112.07 ? 591 ALA A N     1 
ATOM   4739  C  CA    . ALA A 1 611 ? 6.152   24.056  48.142  1.00 112.74 ? 591 ALA A CA    1 
ATOM   4740  C  C     . ALA A 1 611 ? 4.637   23.842  48.221  1.00 114.53 ? 591 ALA A C     1 
ATOM   4741  O  O     . ALA A 1 611 ? 4.127   22.825  47.747  1.00 113.64 ? 591 ALA A O     1 
ATOM   4742  C  CB    . ALA A 1 611 ? 6.567   24.280  46.695  1.00 112.53 ? 591 ALA A CB    1 
ATOM   4743  N  N     . ILE A 1 612 ? 3.934   24.807  48.820  1.00 117.14 ? 592 ILE A N     1 
ATOM   4744  C  CA    . ILE A 1 612 ? 2.466   24.845  48.824  1.00 118.48 ? 592 ILE A CA    1 
ATOM   4745  C  C     . ILE A 1 612 ? 2.000   25.542  47.543  1.00 116.73 ? 592 ILE A C     1 
ATOM   4746  O  O     . ILE A 1 612 ? 2.530   26.593  47.176  1.00 112.74 ? 592 ILE A O     1 
ATOM   4747  C  CB    . ILE A 1 612 ? 1.909   25.576  50.070  1.00 121.25 ? 592 ILE A CB    1 
ATOM   4748  C  CG1   . ILE A 1 612 ? 2.366   24.866  51.355  1.00 122.24 ? 592 ILE A CG1   1 
ATOM   4749  C  CG2   . ILE A 1 612 ? 0.382   25.639  50.018  1.00 121.54 ? 592 ILE A CG2   1 
ATOM   4750  C  CD1   . ILE A 1 612 ? 2.213   25.688  52.619  1.00 122.19 ? 592 ILE A CD1   1 
ATOM   4751  N  N     . VAL A 1 613 ? 0.995   24.959  46.887  1.00 118.48 ? 593 VAL A N     1 
ATOM   4752  C  CA    . VAL A 1 613 ? 0.596   25.344  45.529  1.00 119.85 ? 593 VAL A CA    1 
ATOM   4753  C  C     . VAL A 1 613 ? -0.911  25.610  45.439  1.00 120.92 ? 593 VAL A C     1 
ATOM   4754  O  O     . VAL A 1 613 ? -1.709  24.917  46.074  1.00 121.41 ? 593 VAL A O     1 
ATOM   4755  C  CB    . VAL A 1 613 ? 0.974   24.232  44.519  1.00 119.84 ? 593 VAL A CB    1 
ATOM   4756  C  CG1   . VAL A 1 613 ? 0.601   24.629  43.093  1.00 120.21 ? 593 VAL A CG1   1 
ATOM   4757  C  CG2   . VAL A 1 613 ? 2.461   23.902  44.616  1.00 119.80 ? 593 VAL A CG2   1 
ATOM   4758  N  N     . GLU A 1 614 ? -1.278  26.619  44.644  1.00 122.00 ? 594 GLU A N     1 
ATOM   4759  C  CA    . GLU A 1 614 ? -2.672  26.939  44.326  1.00 123.88 ? 594 GLU A CA    1 
ATOM   4760  C  C     . GLU A 1 614 ? -2.885  26.728  42.825  1.00 123.90 ? 594 GLU A C     1 
ATOM   4761  O  O     . GLU A 1 614 ? -2.231  27.382  42.008  1.00 121.87 ? 594 GLU A O     1 
ATOM   4762  C  CB    . GLU A 1 614 ? -2.984  28.386  44.714  1.00 125.22 ? 594 GLU A CB    1 
ATOM   4763  C  CG    . GLU A 1 614 ? -4.461  28.753  44.658  1.00 126.42 ? 594 GLU A CG    1 
ATOM   4764  C  CD    . GLU A 1 614 ? -4.717  30.221  44.952  1.00 127.76 ? 594 GLU A CD    1 
ATOM   4765  O  OE1   . GLU A 1 614 ? -4.108  30.764  45.899  1.00 128.73 ? 594 GLU A OE1   1 
ATOM   4766  O  OE2   . GLU A 1 614 ? -5.538  30.834  44.238  1.00 128.46 ? 594 GLU A OE2   1 
ATOM   4767  N  N     . ARG A 1 615 ? -3.804  25.827  42.474  1.00 124.84 ? 595 ARG A N     1 
ATOM   4768  C  CA    . ARG A 1 615 ? -3.975  25.361  41.090  1.00 125.57 ? 595 ARG A CA    1 
ATOM   4769  C  C     . ARG A 1 615 ? -5.114  26.051  40.331  1.00 126.68 ? 595 ARG A C     1 
ATOM   4770  O  O     . ARG A 1 615 ? -5.944  26.754  40.912  1.00 124.20 ? 595 ARG A O     1 
ATOM   4771  C  CB    . ARG A 1 615 ? -4.185  23.839  41.069  1.00 125.17 ? 595 ARG A CB    1 
ATOM   4772  C  CG    . ARG A 1 615 ? -2.929  23.036  41.369  1.00 124.27 ? 595 ARG A CG    1 
ATOM   4773  C  CD    . ARG A 1 615 ? -3.148  21.550  41.129  1.00 123.54 ? 595 ARG A CD    1 
ATOM   4774  N  NE    . ARG A 1 615 ? -1.912  20.777  41.271  1.00 122.97 ? 595 ARG A NE    1 
ATOM   4775  C  CZ    . ARG A 1 615 ? -0.929  20.708  40.368  1.00 121.81 ? 595 ARG A CZ    1 
ATOM   4776  N  NH1   . ARG A 1 615 ? -0.994  21.373  39.214  1.00 120.74 ? 595 ARG A NH1   1 
ATOM   4777  N  NH2   . ARG A 1 615 ? 0.144   19.963  40.624  1.00 121.99 ? 595 ARG A NH2   1 
ATOM   4778  N  N     . ASP A 1 616 ? -5.118  25.824  39.018  1.00 130.54 ? 596 ASP A N     1 
ATOM   4779  C  CA    . ASP A 1 616 ? -6.149  26.303  38.095  1.00 133.29 ? 596 ASP A CA    1 
ATOM   4780  C  C     . ASP A 1 616 ? -7.282  25.267  38.042  1.00 137.99 ? 596 ASP A C     1 
ATOM   4781  O  O     . ASP A 1 616 ? -7.137  24.157  38.563  1.00 138.19 ? 596 ASP A O     1 
ATOM   4782  C  CB    . ASP A 1 616 ? -5.519  26.486  36.699  1.00 131.52 ? 596 ASP A CB    1 
ATOM   4783  C  CG    . ASP A 1 616 ? -6.258  27.488  35.825  1.00 130.33 ? 596 ASP A CG    1 
ATOM   4784  O  OD1   . ASP A 1 616 ? -7.480  27.682  35.995  1.00 131.33 ? 596 ASP A OD1   1 
ATOM   4785  O  OD2   . ASP A 1 616 ? -5.601  28.078  34.942  1.00 128.56 ? 596 ASP A OD2   1 
ATOM   4786  N  N     . GLU A 1 617 ? -8.407  25.637  37.428  1.00 143.36 ? 597 GLU A N     1 
ATOM   4787  C  CA    . GLU A 1 617 ? -9.507  24.694  37.165  1.00 147.19 ? 597 GLU A CA    1 
ATOM   4788  C  C     . GLU A 1 617 ? -9.121  23.598  36.163  1.00 149.34 ? 597 GLU A C     1 
ATOM   4789  O  O     . GLU A 1 617 ? -9.569  22.455  36.289  1.00 149.69 ? 597 GLU A O     1 
ATOM   4790  C  CB    . GLU A 1 617 ? -10.752 25.428  36.653  1.00 148.99 ? 597 GLU A CB    1 
ATOM   4791  C  CG    . GLU A 1 617 ? -11.416 26.327  37.685  1.00 150.50 ? 597 GLU A CG    1 
ATOM   4792  C  CD    . GLU A 1 617 ? -12.804 26.787  37.268  1.00 151.39 ? 597 GLU A CD    1 
ATOM   4793  O  OE1   . GLU A 1 617 ? -13.079 26.864  36.051  1.00 152.07 ? 597 GLU A OE1   1 
ATOM   4794  O  OE2   . GLU A 1 617 ? -13.625 27.077  38.164  1.00 151.78 ? 597 GLU A OE2   1 
ATOM   4795  N  N     . LYS A 1 618 ? -8.305  23.959  35.171  1.00 150.44 ? 598 LYS A N     1 
ATOM   4796  C  CA    . LYS A 1 618 ? -7.804  23.000  34.175  1.00 150.55 ? 598 LYS A CA    1 
ATOM   4797  C  C     . LYS A 1 618 ? -6.815  21.986  34.769  1.00 151.67 ? 598 LYS A C     1 
ATOM   4798  O  O     . LYS A 1 618 ? -6.792  20.827  34.345  1.00 152.82 ? 598 LYS A O     1 
ATOM   4799  C  CB    . LYS A 1 618 ? -7.149  23.724  32.984  1.00 148.64 ? 598 LYS A CB    1 
ATOM   4800  C  CG    . LYS A 1 618 ? -8.125  24.230  31.931  1.00 147.79 ? 598 LYS A CG    1 
ATOM   4801  C  CD    . LYS A 1 618 ? -8.943  25.417  32.413  1.00 146.75 ? 598 LYS A CD    1 
ATOM   4802  C  CE    . LYS A 1 618 ? -9.794  25.988  31.292  1.00 146.01 ? 598 LYS A CE    1 
ATOM   4803  N  NZ    . LYS A 1 618 ? -10.559 27.185  31.734  1.00 146.32 ? 598 LYS A NZ    1 
ATOM   4804  N  N     . GLY A 1 619 ? -6.019  22.425  35.747  1.00 150.82 ? 599 GLY A N     1 
ATOM   4805  C  CA    . GLY A 1 619 ? -4.953  21.607  36.341  1.00 149.52 ? 599 GLY A CA    1 
ATOM   4806  C  C     . GLY A 1 619 ? -3.597  22.292  36.459  1.00 148.26 ? 599 GLY A C     1 
ATOM   4807  O  O     . GLY A 1 619 ? -2.726  21.802  37.180  1.00 148.83 ? 599 GLY A O     1 
ATOM   4808  N  N     . ARG A 1 620 ? -3.411  23.413  35.757  1.00 146.07 ? 600 ARG A N     1 
ATOM   4809  C  CA    . ARG A 1 620 ? -2.137  24.146  35.758  1.00 144.55 ? 600 ARG A CA    1 
ATOM   4810  C  C     . ARG A 1 620 ? -1.884  24.857  37.089  1.00 141.94 ? 600 ARG A C     1 
ATOM   4811  O  O     . ARG A 1 620 ? -2.821  25.149  37.834  1.00 143.11 ? 600 ARG A O     1 
ATOM   4812  C  CB    . ARG A 1 620 ? -2.110  25.175  34.621  1.00 145.30 ? 600 ARG A CB    1 
ATOM   4813  C  CG    . ARG A 1 620 ? -2.189  24.578  33.222  1.00 145.78 ? 600 ARG A CG    1 
ATOM   4814  C  CD    . ARG A 1 620 ? -2.480  25.648  32.182  1.00 146.08 ? 600 ARG A CD    1 
ATOM   4815  N  NE    . ARG A 1 620 ? -1.407  26.639  32.090  1.00 146.70 ? 600 ARG A NE    1 
ATOM   4816  C  CZ    . ARG A 1 620 ? -1.435  27.733  31.324  1.00 147.28 ? 600 ARG A CZ    1 
ATOM   4817  N  NH1   . ARG A 1 620 ? -2.490  28.013  30.557  1.00 147.57 ? 600 ARG A NH1   1 
ATOM   4818  N  NH2   . ARG A 1 620 ? -0.393  28.562  31.326  1.00 147.13 ? 600 ARG A NH2   1 
ATOM   4819  N  N     . ILE A 1 621 ? -0.611  25.133  37.373  1.00 137.29 ? 601 ILE A N     1 
ATOM   4820  C  CA    . ILE A 1 621 ? -0.204  25.829  38.600  1.00 133.94 ? 601 ILE A CA    1 
ATOM   4821  C  C     . ILE A 1 621 ? -0.260  27.345  38.378  1.00 131.66 ? 601 ILE A C     1 
ATOM   4822  O  O     . ILE A 1 621 ? 0.141   27.836  37.320  1.00 132.25 ? 601 ILE A O     1 
ATOM   4823  C  CB    . ILE A 1 621 ? 1.205   25.378  39.066  1.00 132.81 ? 601 ILE A CB    1 
ATOM   4824  C  CG1   . ILE A 1 621 ? 1.153   23.896  39.469  1.00 133.23 ? 601 ILE A CG1   1 
ATOM   4825  C  CG2   . ILE A 1 621 ? 1.712   26.245  40.220  1.00 132.31 ? 601 ILE A CG2   1 
ATOM   4826  C  CD1   . ILE A 1 621 ? 2.482   23.286  39.866  1.00 132.86 ? 601 ILE A CD1   1 
ATOM   4827  N  N     . VAL A 1 622 ? -0.756  28.068  39.386  1.00 128.50 ? 602 VAL A N     1 
ATOM   4828  C  CA    . VAL A 1 622 ? -0.940  29.524  39.323  1.00 125.10 ? 602 VAL A CA    1 
ATOM   4829  C  C     . VAL A 1 622 ? 0.031   30.228  40.278  1.00 121.47 ? 602 VAL A C     1 
ATOM   4830  O  O     . VAL A 1 622 ? 0.874   31.012  39.837  1.00 118.23 ? 602 VAL A O     1 
ATOM   4831  C  CB    . VAL A 1 622 ? -2.403  29.916  39.647  1.00 126.06 ? 602 VAL A CB    1 
ATOM   4832  C  CG1   . VAL A 1 622 ? -2.614  31.417  39.485  1.00 126.32 ? 602 VAL A CG1   1 
ATOM   4833  C  CG2   . VAL A 1 622 ? -3.370  29.138  38.759  1.00 126.94 ? 602 VAL A CG2   1 
ATOM   4834  N  N     . LYS A 1 623 ? -0.098  29.944  41.575  1.00 119.42 ? 603 LYS A N     1 
ATOM   4835  C  CA    . LYS A 1 623 ? 0.786   30.490  42.613  1.00 118.31 ? 603 LYS A CA    1 
ATOM   4836  C  C     . LYS A 1 623 ? 1.653   29.380  43.202  1.00 119.69 ? 603 LYS A C     1 
ATOM   4837  O  O     . LYS A 1 623 ? 1.402   28.194  42.969  1.00 120.63 ? 603 LYS A O     1 
ATOM   4838  C  CB    . LYS A 1 623 ? -0.034  31.137  43.730  1.00 116.56 ? 603 LYS A CB    1 
ATOM   4839  C  CG    . LYS A 1 623 ? -0.864  32.333  43.296  1.00 114.90 ? 603 LYS A CG    1 
ATOM   4840  C  CD    . LYS A 1 623 ? -1.556  32.970  44.490  1.00 113.98 ? 603 LYS A CD    1 
ATOM   4841  C  CE    . LYS A 1 623 ? -2.474  34.105  44.071  1.00 113.26 ? 603 LYS A CE    1 
ATOM   4842  N  NZ    . LYS A 1 623 ? -3.161  34.719  45.241  1.00 112.98 ? 603 LYS A NZ    1 
ATOM   4843  N  N     . ALA A 1 624 ? 2.667   29.773  43.971  1.00 121.16 ? 604 ALA A N     1 
ATOM   4844  C  CA    . ALA A 1 624 ? 3.581   28.818  44.601  1.00 123.43 ? 604 ALA A CA    1 
ATOM   4845  C  C     . ALA A 1 624 ? 4.317   29.423  45.799  1.00 126.42 ? 604 ALA A C     1 
ATOM   4846  O  O     . ALA A 1 624 ? 5.286   30.168  45.630  1.00 124.42 ? 604 ALA A O     1 
ATOM   4847  C  CB    . ALA A 1 624 ? 4.576   28.294  43.576  1.00 123.60 ? 604 ALA A CB    1 
ATOM   4848  N  N     . LYS A 1 625 ? 3.835   29.103  47.000  1.00 132.19 ? 605 LYS A N     1 
ATOM   4849  C  CA    . LYS A 1 625 ? 4.506   29.451  48.256  1.00 136.48 ? 605 LYS A CA    1 
ATOM   4850  C  C     . LYS A 1 625 ? 5.293   28.240  48.767  1.00 138.83 ? 605 LYS A C     1 
ATOM   4851  O  O     . LYS A 1 625 ? 5.291   27.183  48.134  1.00 140.70 ? 605 LYS A O     1 
ATOM   4852  C  CB    . LYS A 1 625 ? 3.477   29.892  49.304  1.00 139.37 ? 605 LYS A CB    1 
ATOM   4853  C  CG    . LYS A 1 625 ? 2.707   31.150  48.937  1.00 141.13 ? 605 LYS A CG    1 
ATOM   4854  C  CD    . LYS A 1 625 ? 1.774   31.568  50.064  1.00 142.47 ? 605 LYS A CD    1 
ATOM   4855  C  CE    . LYS A 1 625 ? 0.971   32.811  49.709  1.00 142.76 ? 605 LYS A CE    1 
ATOM   4856  N  NZ    . LYS A 1 625 ? 1.806   34.044  49.654  1.00 143.03 ? 605 LYS A NZ    1 
ATOM   4857  N  N     . ASP A 1 626 ? 5.975   28.411  49.899  1.00 141.09 ? 606 ASP A N     1 
ATOM   4858  C  CA    . ASP A 1 626 ? 6.637   27.306  50.610  1.00 141.90 ? 606 ASP A CA    1 
ATOM   4859  C  C     . ASP A 1 626 ? 6.433   27.439  52.122  1.00 144.91 ? 606 ASP A C     1 
ATOM   4860  O  O     . ASP A 1 626 ? 5.894   28.445  52.595  1.00 146.02 ? 606 ASP A O     1 
ATOM   4861  C  CB    . ASP A 1 626 ? 8.132   27.232  50.256  1.00 139.76 ? 606 ASP A CB    1 
ATOM   4862  C  CG    . ASP A 1 626 ? 8.859   28.548  50.473  1.00 137.89 ? 606 ASP A CG    1 
ATOM   4863  O  OD1   . ASP A 1 626 ? 8.365   29.590  49.996  1.00 135.09 ? 606 ASP A OD1   1 
ATOM   4864  O  OD2   . ASP A 1 626 ? 9.932   28.539  51.113  1.00 137.86 ? 606 ASP A OD2   1 
ATOM   4865  N  N     . ALA A 1 627 ? 6.854   26.413  52.865  1.00 147.10 ? 607 ALA A N     1 
ATOM   4866  C  CA    . ALA A 1 627 ? 6.705   26.364  54.331  1.00 147.76 ? 607 ALA A CA    1 
ATOM   4867  C  C     . ALA A 1 627 ? 7.293   27.578  55.062  1.00 148.58 ? 607 ALA A C     1 
ATOM   4868  O  O     . ALA A 1 627 ? 6.764   27.993  56.097  1.00 150.08 ? 607 ALA A O     1 
ATOM   4869  C  CB    . ALA A 1 627 ? 7.317   25.080  54.880  1.00 146.93 ? 607 ALA A CB    1 
ATOM   4870  N  N     . ALA A 1 628 ? 8.377   28.136  54.523  1.00 147.03 ? 608 ALA A N     1 
ATOM   4871  C  CA    . ALA A 1 628 ? 8.993   29.350  55.063  1.00 144.59 ? 608 ALA A CA    1 
ATOM   4872  C  C     . ALA A 1 628 ? 8.171   30.595  54.728  1.00 142.79 ? 608 ALA A C     1 
ATOM   4873  O  O     . ALA A 1 628 ? 7.753   31.326  55.628  1.00 145.63 ? 608 ALA A O     1 
ATOM   4874  C  CB    . ALA A 1 628 ? 10.408  29.499  54.532  1.00 144.11 ? 608 ALA A CB    1 
ATOM   4875  N  N     . GLY A 1 629 ? 7.950   30.820  53.432  1.00 138.65 ? 609 GLY A N     1 
ATOM   4876  C  CA    . GLY A 1 629 ? 7.199   31.975  52.932  1.00 136.47 ? 609 GLY A CA    1 
ATOM   4877  C  C     . GLY A 1 629 ? 7.988   32.777  51.914  1.00 135.46 ? 609 GLY A C     1 
ATOM   4878  O  O     . GLY A 1 629 ? 8.469   33.871  52.216  1.00 132.77 ? 609 GLY A O     1 
ATOM   4879  N  N     . HIS A 1 630 ? 8.126   32.216  50.712  1.00 136.21 ? 610 HIS A N     1 
ATOM   4880  C  CA    . HIS A 1 630 ? 8.758   32.890  49.567  1.00 134.99 ? 610 HIS A CA    1 
ATOM   4881  C  C     . HIS A 1 630 ? 7.890   32.710  48.324  1.00 130.88 ? 610 HIS A C     1 
ATOM   4882  O  O     . HIS A 1 630 ? 7.253   31.669  48.154  1.00 130.72 ? 610 HIS A O     1 
ATOM   4883  C  CB    . HIS A 1 630 ? 10.149  32.312  49.273  1.00 137.37 ? 610 HIS A CB    1 
ATOM   4884  C  CG    . HIS A 1 630 ? 11.035  32.201  50.473  1.00 140.43 ? 610 HIS A CG    1 
ATOM   4885  N  ND1   . HIS A 1 630 ? 11.444  30.987  50.982  1.00 142.47 ? 610 HIS A ND1   1 
ATOM   4886  C  CD2   . HIS A 1 630 ? 11.594  33.148  51.262  1.00 142.89 ? 610 HIS A CD2   1 
ATOM   4887  C  CE1   . HIS A 1 630 ? 12.217  31.191  52.033  1.00 144.26 ? 610 HIS A CE1   1 
ATOM   4888  N  NE2   . HIS A 1 630 ? 12.323  32.493  52.226  1.00 145.76 ? 610 HIS A NE2   1 
ATOM   4889  N  N     . GLU A 1 631 ? 7.880   33.721  47.454  1.00 125.48 ? 611 GLU A N     1 
ATOM   4890  C  CA    . GLU A 1 631 ? 7.165   33.639  46.179  1.00 121.89 ? 611 GLU A CA    1 
ATOM   4891  C  C     . GLU A 1 631 ? 8.016   32.856  45.176  1.00 116.62 ? 611 GLU A C     1 
ATOM   4892  O  O     . GLU A 1 631 ? 8.969   33.393  44.602  1.00 113.70 ? 611 GLU A O     1 
ATOM   4893  C  CB    . GLU A 1 631 ? 6.826   35.039  45.648  1.00 123.66 ? 611 GLU A CB    1 
ATOM   4894  C  CG    . GLU A 1 631 ? 5.911   35.034  44.429  1.00 125.73 ? 611 GLU A CG    1 
ATOM   4895  C  CD    . GLU A 1 631 ? 5.227   36.370  44.186  1.00 127.45 ? 611 GLU A CD    1 
ATOM   4896  O  OE1   . GLU A 1 631 ? 5.876   37.422  44.368  1.00 130.28 ? 611 GLU A OE1   1 
ATOM   4897  O  OE2   . GLU A 1 631 ? 4.035   36.369  43.807  1.00 126.86 ? 611 GLU A OE2   1 
ATOM   4898  N  N     . LEU A 1 632 ? 7.667   31.583  44.983  1.00 111.71 ? 612 LEU A N     1 
ATOM   4899  C  CA    . LEU A 1 632 ? 8.444   30.673  44.136  1.00 106.82 ? 612 LEU A CA    1 
ATOM   4900  C  C     . LEU A 1 632 ? 8.133   30.880  42.656  1.00 103.41 ? 612 LEU A C     1 
ATOM   4901  O  O     . LEU A 1 632 ? 7.033   31.305  42.295  1.00 103.94 ? 612 LEU A O     1 
ATOM   4902  C  CB    . LEU A 1 632 ? 8.173   29.211  44.510  1.00 105.73 ? 612 LEU A CB    1 
ATOM   4903  C  CG    . LEU A 1 632 ? 8.327   28.790  45.975  1.00 105.26 ? 612 LEU A CG    1 
ATOM   4904  C  CD1   . LEU A 1 632 ? 7.977   27.318  46.119  1.00 105.12 ? 612 LEU A CD1   1 
ATOM   4905  C  CD2   . LEU A 1 632 ? 9.732   29.062  46.491  1.00 104.86 ? 612 LEU A CD2   1 
ATOM   4906  N  N     . VAL A 1 633 ? 9.114   30.559  41.815  1.00 99.63  ? 613 VAL A N     1 
ATOM   4907  C  CA    . VAL A 1 633 ? 9.012   30.688  40.362  1.00 97.70  ? 613 VAL A CA    1 
ATOM   4908  C  C     . VAL A 1 633 ? 8.859   29.288  39.762  1.00 95.71  ? 613 VAL A C     1 
ATOM   4909  O  O     . VAL A 1 633 ? 9.812   28.506  39.750  1.00 96.45  ? 613 VAL A O     1 
ATOM   4910  C  CB    . VAL A 1 633 ? 10.264  31.383  39.776  1.00 97.89  ? 613 VAL A CB    1 
ATOM   4911  C  CG1   . VAL A 1 633 ? 10.124  31.582  38.268  1.00 97.97  ? 613 VAL A CG1   1 
ATOM   4912  C  CG2   . VAL A 1 633 ? 10.514  32.715  40.476  1.00 97.98  ? 613 VAL A CG2   1 
ATOM   4913  N  N     . TYR A 1 634 ? 7.658   28.981  39.271  1.00 92.88  ? 614 TYR A N     1 
ATOM   4914  C  CA    . TYR A 1 634 ? 7.354   27.664  38.703  1.00 90.10  ? 614 TYR A CA    1 
ATOM   4915  C  C     . TYR A 1 634 ? 7.905   27.555  37.281  1.00 88.26  ? 614 TYR A C     1 
ATOM   4916  O  O     . TYR A 1 634 ? 7.524   28.341  36.410  1.00 87.18  ? 614 TYR A O     1 
ATOM   4917  C  CB    . TYR A 1 634 ? 5.840   27.417  38.714  1.00 89.83  ? 614 TYR A CB    1 
ATOM   4918  C  CG    . TYR A 1 634 ? 5.401   26.117  38.070  1.00 89.87  ? 614 TYR A CG    1 
ATOM   4919  C  CD1   . TYR A 1 634 ? 5.993   24.903  38.423  1.00 90.04  ? 614 TYR A CD1   1 
ATOM   4920  C  CD2   . TYR A 1 634 ? 4.380   26.096  37.115  1.00 90.09  ? 614 TYR A CD2   1 
ATOM   4921  C  CE1   . TYR A 1 634 ? 5.591   23.711  37.837  1.00 90.47  ? 614 TYR A CE1   1 
ATOM   4922  C  CE2   . TYR A 1 634 ? 3.971   24.908  36.525  1.00 90.22  ? 614 TYR A CE2   1 
ATOM   4923  C  CZ    . TYR A 1 634 ? 4.576   23.718  36.891  1.00 90.22  ? 614 TYR A CZ    1 
ATOM   4924  O  OH    . TYR A 1 634 ? 4.175   22.539  36.309  1.00 90.47  ? 614 TYR A OH    1 
ATOM   4925  N  N     . THR A 1 635 ? 8.786   26.575  37.058  1.00 86.89  ? 615 THR A N     1 
ATOM   4926  C  CA    . THR A 1 635 ? 9.439   26.356  35.758  1.00 85.71  ? 615 THR A CA    1 
ATOM   4927  C  C     . THR A 1 635 ? 8.912   25.105  35.037  1.00 85.19  ? 615 THR A C     1 
ATOM   4928  O  O     . THR A 1 635 ? 9.676   24.398  34.371  1.00 85.24  ? 615 THR A O     1 
ATOM   4929  C  CB    . THR A 1 635 ? 10.974  26.241  35.919  1.00 85.14  ? 615 THR A CB    1 
ATOM   4930  O  OG1   . THR A 1 635 ? 11.300  25.071  36.678  1.00 84.09  ? 615 THR A OG1   1 
ATOM   4931  C  CG2   . THR A 1 635 ? 11.538  27.464  36.616  1.00 85.46  ? 615 THR A CG2   1 
ATOM   4932  N  N     . GLY A 1 636 ? 7.612   24.837  35.166  1.00 85.04  ? 616 GLY A N     1 
ATOM   4933  C  CA    . GLY A 1 636 ? 6.973   23.711  34.482  1.00 84.51  ? 616 GLY A CA    1 
ATOM   4934  C  C     . GLY A 1 636 ? 7.410   22.339  34.969  1.00 83.50  ? 616 GLY A C     1 
ATOM   4935  O  O     . GLY A 1 636 ? 8.138   22.215  35.961  1.00 82.68  ? 616 GLY A O     1 
ATOM   4936  N  N     . MET A 1 637 ? 6.950   21.307  34.264  1.00 82.52  ? 617 MET A N     1 
ATOM   4937  C  CA    . MET A 1 637 ? 7.482   19.953  34.428  1.00 81.57  ? 617 MET A CA    1 
ATOM   4938  C  C     . MET A 1 637 ? 8.914   19.922  33.900  1.00 80.57  ? 617 MET A C     1 
ATOM   4939  O  O     . MET A 1 637 ? 9.267   20.683  33.001  1.00 81.95  ? 617 MET A O     1 
ATOM   4940  C  CB    . MET A 1 637 ? 6.629   18.927  33.668  1.00 81.91  ? 617 MET A CB    1 
ATOM   4941  C  CG    . MET A 1 637 ? 5.285   18.624  34.309  1.00 82.54  ? 617 MET A CG    1 
ATOM   4942  S  SD    . MET A 1 637 ? 5.406   17.432  35.658  1.00 83.58  ? 617 MET A SD    1 
ATOM   4943  C  CE    . MET A 1 637 ? 3.739   17.475  36.311  1.00 84.28  ? 617 MET A CE    1 
ATOM   4944  N  N     . SER A 1 638 ? 9.739   19.062  34.480  1.00 78.92  ? 618 SER A N     1 
ATOM   4945  C  CA    . SER A 1 638 ? 11.098  18.838  33.986  1.00 78.70  ? 618 SER A CA    1 
ATOM   4946  C  C     . SER A 1 638 ? 11.642  17.512  34.494  1.00 77.11  ? 618 SER A C     1 
ATOM   4947  O  O     . SER A 1 638 ? 11.112  16.947  35.454  1.00 77.31  ? 618 SER A O     1 
ATOM   4948  C  CB    . SER A 1 638 ? 12.031  19.980  34.406  1.00 80.16  ? 618 SER A CB    1 
ATOM   4949  O  OG    . SER A 1 638 ? 12.100  20.101  35.817  1.00 81.66  ? 618 SER A OG    1 
ATOM   4950  N  N     . LYS A 1 639 ? 12.698  17.025  33.846  1.00 74.82  ? 619 LYS A N     1 
ATOM   4951  C  CA    . LYS A 1 639 ? 13.333  15.765  34.239  1.00 73.92  ? 619 LYS A CA    1 
ATOM   4952  C  C     . LYS A 1 639 ? 13.829  15.831  35.688  1.00 71.60  ? 619 LYS A C     1 
ATOM   4953  O  O     . LYS A 1 639 ? 14.372  16.854  36.115  1.00 71.59  ? 619 LYS A O     1 
ATOM   4954  C  CB    . LYS A 1 639 ? 14.482  15.395  33.280  1.00 74.64  ? 619 LYS A CB    1 
ATOM   4955  C  CG    . LYS A 1 639 ? 15.692  16.324  33.304  1.00 75.30  ? 619 LYS A CG    1 
ATOM   4956  C  CD    . LYS A 1 639 ? 16.749  15.905  32.297  1.00 75.29  ? 619 LYS A CD    1 
ATOM   4957  C  CE    . LYS A 1 639 ? 17.990  16.777  32.418  1.00 75.35  ? 619 LYS A CE    1 
ATOM   4958  N  NZ    . LYS A 1 639 ? 19.118  16.290  31.577  1.00 75.24  ? 619 LYS A NZ    1 
ATOM   4959  N  N     . MET A 1 640 ? 13.590  14.762  36.447  1.00 69.02  ? 620 MET A N     1 
ATOM   4960  C  CA    . MET A 1 640 ? 14.139  14.629  37.797  1.00 68.59  ? 620 MET A CA    1 
ATOM   4961  C  C     . MET A 1 640 ? 15.661  14.720  37.780  1.00 68.94  ? 620 MET A C     1 
ATOM   4962  O  O     . MET A 1 640 ? 16.322  14.026  37.004  1.00 69.24  ? 620 MET A O     1 
ATOM   4963  C  CB    . MET A 1 640 ? 13.728  13.299  38.439  1.00 67.38  ? 620 MET A CB    1 
ATOM   4964  C  CG    . MET A 1 640 ? 12.287  13.244  38.909  1.00 66.37  ? 620 MET A CG    1 
ATOM   4965  S  SD    . MET A 1 640 ? 12.004  11.850  40.014  1.00 64.61  ? 620 MET A SD    1 
ATOM   4966  C  CE    . MET A 1 640 ? 10.234  11.962  40.256  1.00 65.12  ? 620 MET A CE    1 
ATOM   4967  N  N     . SER A 1 641 ? 16.197  15.592  38.631  1.00 68.77  ? 621 SER A N     1 
ATOM   4968  C  CA    . SER A 1 641 ? 17.636  15.717  38.828  1.00 69.41  ? 621 SER A CA    1 
ATOM   4969  C  C     . SER A 1 641 ? 17.928  16.497  40.103  1.00 69.79  ? 621 SER A C     1 
ATOM   4970  O  O     . SER A 1 641 ? 17.086  17.261  40.580  1.00 68.53  ? 621 SER A O     1 
ATOM   4971  C  CB    . SER A 1 641 ? 18.288  16.416  37.635  1.00 69.96  ? 621 SER A CB    1 
ATOM   4972  O  OG    . SER A 1 641 ? 17.659  17.656  37.374  1.00 71.95  ? 621 SER A OG    1 
ATOM   4973  N  N     . LYS A 1 642 ? 19.128  16.301  40.642  1.00 72.04  ? 622 LYS A N     1 
ATOM   4974  C  CA    . LYS A 1 642 ? 19.579  17.018  41.835  1.00 73.81  ? 622 LYS A CA    1 
ATOM   4975  C  C     . LYS A 1 642 ? 19.811  18.513  41.560  1.00 75.02  ? 622 LYS A C     1 
ATOM   4976  O  O     . LYS A 1 642 ? 19.741  19.326  42.485  1.00 75.73  ? 622 LYS A O     1 
ATOM   4977  C  CB    . LYS A 1 642 ? 20.853  16.362  42.395  1.00 74.77  ? 622 LYS A CB    1 
ATOM   4978  C  CG    . LYS A 1 642 ? 21.334  16.875  43.750  1.00 75.89  ? 622 LYS A CG    1 
ATOM   4979  C  CD    . LYS A 1 642 ? 20.287  16.730  44.843  1.00 76.76  ? 622 LYS A CD    1 
ATOM   4980  C  CE    . LYS A 1 642 ? 20.850  17.103  46.203  1.00 77.81  ? 622 LYS A CE    1 
ATOM   4981  N  NZ    . LYS A 1 642 ? 19.774  17.228  47.225  1.00 78.86  ? 622 LYS A NZ    1 
ATOM   4982  N  N     . SER A 1 643 ? 20.072  18.863  40.296  1.00 76.43  ? 623 SER A N     1 
ATOM   4983  C  CA    . SER A 1 643 ? 20.232  20.259  39.863  1.00 77.16  ? 623 SER A CA    1 
ATOM   4984  C  C     . SER A 1 643 ? 19.012  21.115  40.192  1.00 77.48  ? 623 SER A C     1 
ATOM   4985  O  O     . SER A 1 643 ? 19.132  22.147  40.856  1.00 77.63  ? 623 SER A O     1 
ATOM   4986  C  CB    . SER A 1 643 ? 20.493  20.324  38.353  1.00 77.13  ? 623 SER A CB    1 
ATOM   4987  O  OG    . SER A 1 643 ? 21.570  19.485  37.979  1.00 77.90  ? 623 SER A OG    1 
ATOM   4988  N  N     . LYS A 1 644 ? 17.846  20.668  39.730  1.00 78.14  ? 624 LYS A N     1 
ATOM   4989  C  CA    . LYS A 1 644 ? 16.578  21.372  39.950  1.00 79.10  ? 624 LYS A CA    1 
ATOM   4990  C  C     . LYS A 1 644 ? 15.873  20.969  41.255  1.00 78.16  ? 624 LYS A C     1 
ATOM   4991  O  O     . LYS A 1 644 ? 14.820  21.523  41.581  1.00 77.87  ? 624 LYS A O     1 
ATOM   4992  C  CB    . LYS A 1 644 ? 15.645  21.158  38.754  1.00 80.97  ? 624 LYS A CB    1 
ATOM   4993  C  CG    . LYS A 1 644 ? 16.233  21.649  37.440  1.00 83.41  ? 624 LYS A CG    1 
ATOM   4994  C  CD    . LYS A 1 644 ? 15.245  21.550  36.290  1.00 85.29  ? 624 LYS A CD    1 
ATOM   4995  C  CE    . LYS A 1 644 ? 15.825  22.171  35.028  1.00 86.96  ? 624 LYS A CE    1 
ATOM   4996  N  NZ    . LYS A 1 644 ? 14.844  22.223  33.909  1.00 87.85  ? 624 LYS A NZ    1 
ATOM   4997  N  N     . ASN A 1 645 ? 16.441  19.998  41.976  1.00 77.06  ? 625 ASN A N     1 
ATOM   4998  C  CA    . ASN A 1 645 ? 16.001  19.617  43.324  1.00 76.31  ? 625 ASN A CA    1 
ATOM   4999  C  C     . ASN A 1 645 ? 14.545  19.125  43.348  1.00 74.69  ? 625 ASN A C     1 
ATOM   5000  O  O     . ASN A 1 645 ? 13.772  19.471  44.242  1.00 74.58  ? 625 ASN A O     1 
ATOM   5001  C  CB    . ASN A 1 645 ? 16.224  20.787  44.301  1.00 77.41  ? 625 ASN A CB    1 
ATOM   5002  C  CG    . ASN A 1 645 ? 16.167  20.364  45.762  1.00 78.85  ? 625 ASN A CG    1 
ATOM   5003  O  OD1   . ASN A 1 645 ? 16.494  19.229  46.114  1.00 80.96  ? 625 ASN A OD1   1 
ATOM   5004  N  ND2   . ASN A 1 645 ? 15.749  21.285  46.622  1.00 79.79  ? 625 ASN A ND2   1 
ATOM   5005  N  N     . ASN A 1 646 ? 14.194  18.306  42.357  1.00 73.58  ? 626 ASN A N     1 
ATOM   5006  C  CA    . ASN A 1 646 ? 12.840  17.755  42.213  1.00 72.31  ? 626 ASN A CA    1 
ATOM   5007  C  C     . ASN A 1 646 ? 12.814  16.217  42.161  1.00 72.98  ? 626 ASN A C     1 
ATOM   5008  O  O     . ASN A 1 646 ? 11.802  15.625  41.779  1.00 74.16  ? 626 ASN A O     1 
ATOM   5009  C  CB    . ASN A 1 646 ? 12.155  18.356  40.974  1.00 71.05  ? 626 ASN A CB    1 
ATOM   5010  C  CG    . ASN A 1 646 ? 12.855  17.999  39.672  1.00 70.49  ? 626 ASN A CG    1 
ATOM   5011  O  OD1   . ASN A 1 646 ? 14.048  17.692  39.651  1.00 70.49  ? 626 ASN A OD1   1 
ATOM   5012  N  ND2   . ASN A 1 646 ? 12.112  18.047  38.573  1.00 70.32  ? 626 ASN A ND2   1 
ATOM   5013  N  N     . GLY A 1 647 ? 13.913  15.575  42.561  1.00 73.16  ? 627 GLY A N     1 
ATOM   5014  C  CA    . GLY A 1 647 ? 13.995  14.118  42.586  1.00 73.11  ? 627 GLY A CA    1 
ATOM   5015  C  C     . GLY A 1 647 ? 13.271  13.551  43.793  1.00 73.19  ? 627 GLY A C     1 
ATOM   5016  O  O     . GLY A 1 647 ? 13.271  14.163  44.864  1.00 73.12  ? 627 GLY A O     1 
ATOM   5017  N  N     . ILE A 1 648 ? 12.655  12.382  43.611  1.00 73.23  ? 628 ILE A N     1 
ATOM   5018  C  CA    . ILE A 1 648 ? 11.921  11.691  44.673  1.00 72.93  ? 628 ILE A CA    1 
ATOM   5019  C  C     . ILE A 1 648 ? 12.675  10.409  45.032  1.00 72.42  ? 628 ILE A C     1 
ATOM   5020  O  O     . ILE A 1 648 ? 12.834  9.526   44.191  1.00 70.98  ? 628 ILE A O     1 
ATOM   5021  C  CB    . ILE A 1 648 ? 10.473  11.355  44.236  1.00 72.83  ? 628 ILE A CB    1 
ATOM   5022  C  CG1   . ILE A 1 648 ? 9.731   12.617  43.753  1.00 73.30  ? 628 ILE A CG1   1 
ATOM   5023  C  CG2   . ILE A 1 648 ? 9.704   10.672  45.364  1.00 72.80  ? 628 ILE A CG2   1 
ATOM   5024  C  CD1   . ILE A 1 648 ? 9.607   13.737  44.771  1.00 73.33  ? 628 ILE A CD1   1 
ATOM   5025  N  N     . ASP A 1 649 ? 13.124  10.318  46.284  1.00 73.34  ? 629 ASP A N     1 
ATOM   5026  C  CA    . ASP A 1 649 ? 13.921  9.186   46.768  1.00 74.21  ? 629 ASP A CA    1 
ATOM   5027  C  C     . ASP A 1 649 ? 13.030  7.937   46.899  1.00 75.83  ? 629 ASP A C     1 
ATOM   5028  O  O     . ASP A 1 649 ? 12.015  7.986   47.601  1.00 77.67  ? 629 ASP A O     1 
ATOM   5029  C  CB    . ASP A 1 649 ? 14.554  9.540   48.129  1.00 74.10  ? 629 ASP A CB    1 
ATOM   5030  C  CG    . ASP A 1 649 ? 15.761  8.673   48.481  1.00 73.74  ? 629 ASP A CG    1 
ATOM   5031  O  OD1   . ASP A 1 649 ? 15.871  7.528   48.000  1.00 73.98  ? 629 ASP A OD1   1 
ATOM   5032  O  OD2   . ASP A 1 649 ? 16.610  9.148   49.267  1.00 73.27  ? 629 ASP A OD2   1 
ATOM   5033  N  N     . PRO A 1 650 ? 13.395  6.819   46.227  1.00 75.61  ? 630 PRO A N     1 
ATOM   5034  C  CA    . PRO A 1 650 ? 12.581  5.596   46.348  1.00 75.84  ? 630 PRO A CA    1 
ATOM   5035  C  C     . PRO A 1 650 ? 12.628  4.895   47.716  1.00 77.59  ? 630 PRO A C     1 
ATOM   5036  O  O     . PRO A 1 650 ? 11.726  4.113   48.016  1.00 78.99  ? 630 PRO A O     1 
ATOM   5037  C  CB    . PRO A 1 650 ? 13.171  4.675   45.272  1.00 75.16  ? 630 PRO A CB    1 
ATOM   5038  C  CG    . PRO A 1 650 ? 14.565  5.150   45.095  1.00 75.00  ? 630 PRO A CG    1 
ATOM   5039  C  CD    . PRO A 1 650 ? 14.484  6.637   45.247  1.00 75.21  ? 630 PRO A CD    1 
ATOM   5040  N  N     . GLN A 1 651 ? 13.649  5.181   48.528  1.00 79.57  ? 631 GLN A N     1 
ATOM   5041  C  CA    . GLN A 1 651 ? 13.884  4.476   49.804  1.00 80.86  ? 631 GLN A CA    1 
ATOM   5042  C  C     . GLN A 1 651 ? 12.730  4.554   50.821  1.00 80.53  ? 631 GLN A C     1 
ATOM   5043  O  O     . GLN A 1 651 ? 12.592  3.664   51.661  1.00 78.84  ? 631 GLN A O     1 
ATOM   5044  C  CB    . GLN A 1 651 ? 15.184  4.978   50.460  1.00 82.13  ? 631 GLN A CB    1 
ATOM   5045  C  CG    . GLN A 1 651 ? 15.837  4.004   51.435  1.00 83.03  ? 631 GLN A CG    1 
ATOM   5046  C  CD    . GLN A 1 651 ? 16.333  2.724   50.775  1.00 83.50  ? 631 GLN A CD    1 
ATOM   5047  O  OE1   . GLN A 1 651 ? 16.716  2.713   49.602  1.00 83.29  ? 631 GLN A OE1   1 
ATOM   5048  N  NE2   . GLN A 1 651 ? 16.327  1.635   51.533  1.00 83.08  ? 631 GLN A NE2   1 
ATOM   5049  N  N     . VAL A 1 652 ? 11.914  5.606   50.744  1.00 81.48  ? 632 VAL A N     1 
ATOM   5050  C  CA    . VAL A 1 652 ? 10.726  5.738   51.596  1.00 82.05  ? 632 VAL A CA    1 
ATOM   5051  C  C     . VAL A 1 652 ? 9.679   4.692   51.204  1.00 81.02  ? 632 VAL A C     1 
ATOM   5052  O  O     . VAL A 1 652 ? 9.159   3.982   52.064  1.00 80.97  ? 632 VAL A O     1 
ATOM   5053  C  CB    . VAL A 1 652 ? 10.110  7.158   51.516  1.00 83.96  ? 632 VAL A CB    1 
ATOM   5054  C  CG1   . VAL A 1 652 ? 8.803   7.238   52.303  1.00 84.22  ? 632 VAL A CG1   1 
ATOM   5055  C  CG2   . VAL A 1 652 ? 11.102  8.201   52.025  1.00 84.83  ? 632 VAL A CG2   1 
ATOM   5056  N  N     . MET A 1 653 ? 9.379   4.612   49.909  1.00 80.53  ? 633 MET A N     1 
ATOM   5057  C  CA    . MET A 1 653 ? 8.430   3.624   49.380  1.00 81.07  ? 633 MET A CA    1 
ATOM   5058  C  C     . MET A 1 653 ? 8.937   2.182   49.492  1.00 80.57  ? 633 MET A C     1 
ATOM   5059  O  O     . MET A 1 653 ? 8.142   1.264   49.708  1.00 80.36  ? 633 MET A O     1 
ATOM   5060  C  CB    . MET A 1 653 ? 8.092   3.927   47.918  1.00 82.51  ? 633 MET A CB    1 
ATOM   5061  C  CG    . MET A 1 653 ? 7.265   5.186   47.717  1.00 83.79  ? 633 MET A CG    1 
ATOM   5062  S  SD    . MET A 1 653 ? 7.346   5.807   46.025  1.00 86.12  ? 633 MET A SD    1 
ATOM   5063  C  CE    . MET A 1 653 ? 6.850   4.364   45.089  1.00 85.67  ? 633 MET A CE    1 
ATOM   5064  N  N     . VAL A 1 654 ? 10.247  1.988   49.332  1.00 80.15  ? 634 VAL A N     1 
ATOM   5065  C  CA    . VAL A 1 654 ? 10.868  0.660   49.459  1.00 79.85  ? 634 VAL A CA    1 
ATOM   5066  C  C     . VAL A 1 654 ? 10.725  0.121   50.887  1.00 80.58  ? 634 VAL A C     1 
ATOM   5067  O  O     . VAL A 1 654 ? 10.372  -1.042  51.076  1.00 81.51  ? 634 VAL A O     1 
ATOM   5068  C  CB    . VAL A 1 654 ? 12.358  0.678   49.020  1.00 79.04  ? 634 VAL A CB    1 
ATOM   5069  C  CG1   . VAL A 1 654 ? 13.086  -0.607  49.411  1.00 78.58  ? 634 VAL A CG1   1 
ATOM   5070  C  CG2   . VAL A 1 654 ? 12.462  0.893   47.515  1.00 78.70  ? 634 VAL A CG2   1 
ATOM   5071  N  N     . GLU A 1 655 ? 10.994  0.967   51.878  1.00 81.48  ? 635 GLU A N     1 
ATOM   5072  C  CA    . GLU A 1 655 ? 10.828  0.592   53.290  1.00 81.20  ? 635 GLU A CA    1 
ATOM   5073  C  C     . GLU A 1 655 ? 9.361   0.352   53.672  1.00 80.08  ? 635 GLU A C     1 
ATOM   5074  O  O     . GLU A 1 655 ? 9.077   -0.502  54.511  1.00 80.10  ? 635 GLU A O     1 
ATOM   5075  C  CB    . GLU A 1 655 ? 11.458  1.651   54.207  1.00 82.25  ? 635 GLU A CB    1 
ATOM   5076  C  CG    . GLU A 1 655 ? 12.985  1.659   54.161  1.00 82.97  ? 635 GLU A CG    1 
ATOM   5077  C  CD    . GLU A 1 655 ? 13.620  2.888   54.799  1.00 83.08  ? 635 GLU A CD    1 
ATOM   5078  O  OE1   . GLU A 1 655 ? 12.904  3.714   55.406  1.00 84.03  ? 635 GLU A OE1   1 
ATOM   5079  O  OE2   . GLU A 1 655 ? 14.858  3.027   54.695  1.00 82.25  ? 635 GLU A OE2   1 
ATOM   5080  N  N     . ARG A 1 656 ? 8.444   1.095   53.053  1.00 80.10  ? 636 ARG A N     1 
ATOM   5081  C  CA    . ARG A 1 656 ? 7.006   0.949   53.303  1.00 80.50  ? 636 ARG A CA    1 
ATOM   5082  C  C     . ARG A 1 656 ? 6.441   -0.293  52.609  1.00 79.09  ? 636 ARG A C     1 
ATOM   5083  O  O     . ARG A 1 656 ? 5.960   -1.211  53.274  1.00 79.32  ? 636 ARG A O     1 
ATOM   5084  C  CB    . ARG A 1 656 ? 6.258   2.207   52.834  1.00 83.45  ? 636 ARG A CB    1 
ATOM   5085  C  CG    . ARG A 1 656 ? 4.768   2.263   53.170  1.00 85.81  ? 636 ARG A CG    1 
ATOM   5086  C  CD    . ARG A 1 656 ? 4.478   3.108   54.403  1.00 89.38  ? 636 ARG A CD    1 
ATOM   5087  N  NE    . ARG A 1 656 ? 4.993   2.505   55.633  1.00 92.61  ? 636 ARG A NE    1 
ATOM   5088  C  CZ    . ARG A 1 656 ? 4.954   3.076   56.839  1.00 94.82  ? 636 ARG A CZ    1 
ATOM   5089  N  NH1   . ARG A 1 656 ? 4.416   4.285   57.018  1.00 94.41  ? 636 ARG A NH1   1 
ATOM   5090  N  NH2   . ARG A 1 656 ? 5.459   2.426   57.887  1.00 96.36  ? 636 ARG A NH2   1 
ATOM   5091  N  N     . TYR A 1 657 ? 6.512   -0.312  51.277  1.00 77.69  ? 637 TYR A N     1 
ATOM   5092  C  CA    . TYR A 1 657 ? 5.827   -1.317  50.448  1.00 75.90  ? 637 TYR A CA    1 
ATOM   5093  C  C     . TYR A 1 657 ? 6.710   -2.470  49.955  1.00 73.36  ? 637 TYR A C     1 
ATOM   5094  O  O     . TYR A 1 657 ? 6.199   -3.562  49.700  1.00 72.79  ? 637 TYR A O     1 
ATOM   5095  C  CB    . TYR A 1 657 ? 5.179   -0.638  49.239  1.00 77.35  ? 637 TYR A CB    1 
ATOM   5096  C  CG    . TYR A 1 657 ? 4.110   0.372   49.600  1.00 79.48  ? 637 TYR A CG    1 
ATOM   5097  C  CD1   . TYR A 1 657 ? 2.897   -0.038  50.153  1.00 80.71  ? 637 TYR A CD1   1 
ATOM   5098  C  CD2   . TYR A 1 657 ? 4.304   1.739   49.383  1.00 80.55  ? 637 TYR A CD2   1 
ATOM   5099  C  CE1   . TYR A 1 657 ? 1.911   0.881   50.487  1.00 81.59  ? 637 TYR A CE1   1 
ATOM   5100  C  CE2   . TYR A 1 657 ? 3.322   2.666   49.711  1.00 80.98  ? 637 TYR A CE2   1 
ATOM   5101  C  CZ    . TYR A 1 657 ? 2.128   2.233   50.263  1.00 81.39  ? 637 TYR A CZ    1 
ATOM   5102  O  OH    . TYR A 1 657 ? 1.150   3.144   50.592  1.00 81.84  ? 637 TYR A OH    1 
ATOM   5103  N  N     . GLY A 1 658 ? 8.011   -2.223  49.798  1.00 71.34  ? 638 GLY A N     1 
ATOM   5104  C  CA    . GLY A 1 658 ? 8.956   -3.229  49.297  1.00 70.51  ? 638 GLY A CA    1 
ATOM   5105  C  C     . GLY A 1 658 ? 9.457   -2.894  47.903  1.00 69.83  ? 638 GLY A C     1 
ATOM   5106  O  O     . GLY A 1 658 ? 8.790   -2.182  47.149  1.00 69.86  ? 638 GLY A O     1 
ATOM   5107  N  N     . ALA A 1 659 ? 10.640  -3.408  47.570  1.00 68.92  ? 639 ALA A N     1 
ATOM   5108  C  CA    . ALA A 1 659 ? 11.265  -3.211  46.254  1.00 68.35  ? 639 ALA A CA    1 
ATOM   5109  C  C     . ALA A 1 659 ? 10.394  -3.684  45.087  1.00 67.25  ? 639 ALA A C     1 
ATOM   5110  O  O     . ALA A 1 659 ? 10.186  -2.939  44.131  1.00 67.33  ? 639 ALA A O     1 
ATOM   5111  C  CB    . ALA A 1 659 ? 12.619  -3.906  46.206  1.00 68.75  ? 639 ALA A CB    1 
ATOM   5112  N  N     . ASP A 1 660 ? 9.894   -4.916  45.180  1.00 66.49  ? 640 ASP A N     1 
ATOM   5113  C  CA    . ASP A 1 660 ? 9.028   -5.512  44.144  1.00 66.15  ? 640 ASP A CA    1 
ATOM   5114  C  C     . ASP A 1 660 ? 7.812   -4.648  43.804  1.00 65.60  ? 640 ASP A C     1 
ATOM   5115  O  O     . ASP A 1 660 ? 7.459   -4.499  42.631  1.00 66.35  ? 640 ASP A O     1 
ATOM   5116  C  CB    . ASP A 1 660 ? 8.542   -6.904  44.577  1.00 66.89  ? 640 ASP A CB    1 
ATOM   5117  C  CG    . ASP A 1 660 ? 9.625   -7.972  44.486  1.00 67.80  ? 640 ASP A CG    1 
ATOM   5118  O  OD1   . ASP A 1 660 ? 10.794  -7.650  44.182  1.00 68.42  ? 640 ASP A OD1   1 
ATOM   5119  O  OD2   . ASP A 1 660 ? 9.294   -9.153  44.720  1.00 68.62  ? 640 ASP A OD2   1 
ATOM   5120  N  N     . THR A 1 661 ? 7.180   -4.095  44.836  1.00 64.28  ? 641 THR A N     1 
ATOM   5121  C  CA    . THR A 1 661 ? 6.038   -3.195  44.673  1.00 62.62  ? 641 THR A CA    1 
ATOM   5122  C  C     . THR A 1 661 ? 6.421   -1.929  43.899  1.00 61.65  ? 641 THR A C     1 
ATOM   5123  O  O     . THR A 1 661 ? 5.714   -1.528  42.972  1.00 60.64  ? 641 THR A O     1 
ATOM   5124  C  CB    . THR A 1 661 ? 5.453   -2.791  46.042  1.00 62.52  ? 641 THR A CB    1 
ATOM   5125  O  OG1   . THR A 1 661 ? 5.358   -3.946  46.888  1.00 61.79  ? 641 THR A OG1   1 
ATOM   5126  C  CG2   . THR A 1 661 ? 4.076   -2.165  45.879  1.00 62.75  ? 641 THR A CG2   1 
ATOM   5127  N  N     . VAL A 1 662 ? 7.542   -1.317  44.283  1.00 60.90  ? 642 VAL A N     1 
ATOM   5128  C  CA    . VAL A 1 662 ? 8.044   -0.108  43.620  1.00 60.73  ? 642 VAL A CA    1 
ATOM   5129  C  C     . VAL A 1 662 ? 8.486   -0.423  42.190  1.00 60.34  ? 642 VAL A C     1 
ATOM   5130  O  O     . VAL A 1 662 ? 8.194   0.345   41.276  1.00 62.35  ? 642 VAL A O     1 
ATOM   5131  C  CB    . VAL A 1 662 ? 9.206   0.549   44.410  1.00 61.24  ? 642 VAL A CB    1 
ATOM   5132  C  CG1   . VAL A 1 662 ? 9.827   1.709   43.630  1.00 61.33  ? 642 VAL A CG1   1 
ATOM   5133  C  CG2   . VAL A 1 662 ? 8.718   1.031   45.771  1.00 61.44  ? 642 VAL A CG2   1 
ATOM   5134  N  N     . ARG A 1 663 ? 9.182   -1.545  42.009  1.00 59.10  ? 643 ARG A N     1 
ATOM   5135  C  CA    . ARG A 1 663 ? 9.608   -2.001  40.679  1.00 58.92  ? 643 ARG A CA    1 
ATOM   5136  C  C     . ARG A 1 663 ? 8.425   -2.230  39.740  1.00 59.61  ? 643 ARG A C     1 
ATOM   5137  O  O     . ARG A 1 663 ? 8.417   -1.721  38.618  1.00 59.75  ? 643 ARG A O     1 
ATOM   5138  C  CB    . ARG A 1 663 ? 10.417  -3.297  40.779  1.00 58.08  ? 643 ARG A CB    1 
ATOM   5139  C  CG    . ARG A 1 663 ? 11.807  -3.134  41.370  1.00 57.29  ? 643 ARG A CG    1 
ATOM   5140  C  CD    . ARG A 1 663 ? 12.364  -4.477  41.812  1.00 56.67  ? 643 ARG A CD    1 
ATOM   5141  N  NE    . ARG A 1 663 ? 12.627  -5.351  40.664  1.00 55.98  ? 643 ARG A NE    1 
ATOM   5142  C  CZ    . ARG A 1 663 ? 13.820  -5.813  40.273  1.00 55.61  ? 643 ARG A CZ    1 
ATOM   5143  N  NH1   . ARG A 1 663 ? 14.948  -5.529  40.932  1.00 55.59  ? 643 ARG A NH1   1 
ATOM   5144  N  NH2   . ARG A 1 663 ? 13.884  -6.593  39.197  1.00 55.54  ? 643 ARG A NH2   1 
ATOM   5145  N  N     . LEU A 1 664 ? 7.436   -2.990  40.209  1.00 59.97  ? 644 LEU A N     1 
ATOM   5146  C  CA    . LEU A 1 664 ? 6.244   -3.318  39.415  1.00 60.74  ? 644 LEU A CA    1 
ATOM   5147  C  C     . LEU A 1 664 ? 5.443   -2.075  39.017  1.00 61.36  ? 644 LEU A C     1 
ATOM   5148  O  O     . LEU A 1 664 ? 4.932   -2.001  37.899  1.00 60.94  ? 644 LEU A O     1 
ATOM   5149  C  CB    . LEU A 1 664 ? 5.338   -4.293  40.178  1.00 61.39  ? 644 LEU A CB    1 
ATOM   5150  C  CG    . LEU A 1 664 ? 4.141   -4.890  39.422  1.00 61.82  ? 644 LEU A CG    1 
ATOM   5151  C  CD1   . LEU A 1 664 ? 4.602   -5.887  38.368  1.00 61.83  ? 644 LEU A CD1   1 
ATOM   5152  C  CD2   . LEU A 1 664 ? 3.166   -5.550  40.385  1.00 61.59  ? 644 LEU A CD2   1 
ATOM   5153  N  N     . PHE A 1 665 ? 5.336   -1.114  39.933  1.00 62.88  ? 645 PHE A N     1 
ATOM   5154  C  CA    . PHE A 1 665 ? 4.607   0.132   39.676  1.00 64.32  ? 645 PHE A CA    1 
ATOM   5155  C  C     . PHE A 1 665 ? 5.266   0.979   38.584  1.00 65.04  ? 645 PHE A C     1 
ATOM   5156  O  O     . PHE A 1 665 ? 4.572   1.524   37.722  1.00 66.15  ? 645 PHE A O     1 
ATOM   5157  C  CB    . PHE A 1 665 ? 4.451   0.951   40.968  1.00 65.01  ? 645 PHE A CB    1 
ATOM   5158  C  CG    . PHE A 1 665 ? 3.831   2.308   40.758  1.00 65.44  ? 645 PHE A CG    1 
ATOM   5159  C  CD1   . PHE A 1 665 ? 2.631   2.440   40.060  1.00 65.79  ? 645 PHE A CD1   1 
ATOM   5160  C  CD2   . PHE A 1 665 ? 4.444   3.455   41.253  1.00 65.55  ? 645 PHE A CD2   1 
ATOM   5161  C  CE1   . PHE A 1 665 ? 2.062   3.686   39.855  1.00 66.24  ? 645 PHE A CE1   1 
ATOM   5162  C  CE2   . PHE A 1 665 ? 3.874   4.705   41.055  1.00 66.28  ? 645 PHE A CE2   1 
ATOM   5163  C  CZ    . PHE A 1 665 ? 2.681   4.820   40.357  1.00 66.64  ? 645 PHE A CZ    1 
ATOM   5164  N  N     . MET A 1 666 ? 6.593   1.094   38.634  1.00 64.97  ? 646 MET A N     1 
ATOM   5165  C  CA    . MET A 1 666 ? 7.358   1.800   37.598  1.00 65.66  ? 646 MET A CA    1 
ATOM   5166  C  C     . MET A 1 666 ? 7.143   1.200   36.205  1.00 65.87  ? 646 MET A C     1 
ATOM   5167  O  O     . MET A 1 666 ? 7.008   1.937   35.228  1.00 67.37  ? 646 MET A O     1 
ATOM   5168  C  CB    . MET A 1 666 ? 8.859   1.788   37.924  1.00 66.12  ? 646 MET A CB    1 
ATOM   5169  C  CG    . MET A 1 666 ? 9.291   2.680   39.083  1.00 66.09  ? 646 MET A CG    1 
ATOM   5170  S  SD    . MET A 1 666 ? 8.952   4.444   38.920  1.00 66.57  ? 646 MET A SD    1 
ATOM   5171  C  CE    . MET A 1 666 ? 9.406   4.754   37.219  1.00 66.16  ? 646 MET A CE    1 
ATOM   5172  N  N     . MET A 1 667 ? 7.113   -0.129  36.122  1.00 65.04  ? 647 MET A N     1 
ATOM   5173  C  CA    . MET A 1 667 ? 6.909   -0.824  34.849  1.00 65.07  ? 647 MET A CA    1 
ATOM   5174  C  C     . MET A 1 667 ? 5.452   -0.793  34.387  1.00 65.65  ? 647 MET A C     1 
ATOM   5175  O  O     . MET A 1 667 ? 5.192   -0.761  33.182  1.00 67.31  ? 647 MET A O     1 
ATOM   5176  C  CB    . MET A 1 667 ? 7.395   -2.275  34.943  1.00 65.11  ? 647 MET A CB    1 
ATOM   5177  C  CG    . MET A 1 667 ? 8.869   -2.446  35.292  1.00 65.12  ? 647 MET A CG    1 
ATOM   5178  S  SD    . MET A 1 667 ? 10.028  -1.626  34.175  1.00 66.30  ? 647 MET A SD    1 
ATOM   5179  C  CE    . MET A 1 667 ? 10.173  -0.002  34.923  1.00 65.96  ? 647 MET A CE    1 
ATOM   5180  N  N     . PHE A 1 668 ? 4.512   -0.805  35.333  1.00 66.16  ? 648 PHE A N     1 
ATOM   5181  C  CA    . PHE A 1 668 ? 3.072   -0.812  35.019  1.00 66.81  ? 648 PHE A CA    1 
ATOM   5182  C  C     . PHE A 1 668 ? 2.508   0.561   34.616  1.00 66.83  ? 648 PHE A C     1 
ATOM   5183  O  O     . PHE A 1 668 ? 1.532   0.628   33.865  1.00 67.25  ? 648 PHE A O     1 
ATOM   5184  C  CB    . PHE A 1 668 ? 2.280   -1.375  36.210  1.00 66.66  ? 648 PHE A CB    1 
ATOM   5185  C  CG    . PHE A 1 668 ? 0.824   -1.614  35.917  1.00 65.97  ? 648 PHE A CG    1 
ATOM   5186  C  CD1   . PHE A 1 668 ? 0.430   -2.678  35.113  1.00 65.63  ? 648 PHE A CD1   1 
ATOM   5187  C  CD2   . PHE A 1 668 ? -0.155  -0.776  36.441  1.00 66.06  ? 648 PHE A CD2   1 
ATOM   5188  C  CE1   . PHE A 1 668 ? -0.910  -2.904  34.836  1.00 65.15  ? 648 PHE A CE1   1 
ATOM   5189  C  CE2   . PHE A 1 668 ? -1.498  -0.998  36.169  1.00 65.67  ? 648 PHE A CE2   1 
ATOM   5190  C  CZ    . PHE A 1 668 ? -1.876  -2.062  35.365  1.00 65.08  ? 648 PHE A CZ    1 
ATOM   5191  N  N     . ALA A 1 669 ? 3.114   1.642   35.109  1.00 66.75  ? 649 ALA A N     1 
ATOM   5192  C  CA    . ALA A 1 669 ? 2.593   3.002   34.903  1.00 67.18  ? 649 ALA A CA    1 
ATOM   5193  C  C     . ALA A 1 669 ? 2.537   3.449   33.437  1.00 66.54  ? 649 ALA A C     1 
ATOM   5194  O  O     . ALA A 1 669 ? 1.624   4.177   33.047  1.00 66.26  ? 649 ALA A O     1 
ATOM   5195  C  CB    . ALA A 1 669 ? 3.400   4.004   35.720  1.00 67.89  ? 649 ALA A CB    1 
ATOM   5196  N  N     . SER A 1 670 ? 3.516   3.027   32.640  1.00 66.65  ? 650 SER A N     1 
ATOM   5197  C  CA    . SER A 1 670 ? 3.594   3.410   31.224  1.00 66.89  ? 650 SER A CA    1 
ATOM   5198  C  C     . SER A 1 670 ? 4.569   2.482   30.487  1.00 67.66  ? 650 SER A C     1 
ATOM   5199  O  O     . SER A 1 670 ? 5.387   1.819   31.134  1.00 69.23  ? 650 SER A O     1 
ATOM   5200  C  CB    . SER A 1 670 ? 4.063   4.870   31.104  1.00 66.85  ? 650 SER A CB    1 
ATOM   5201  O  OG    . SER A 1 670 ? 3.241   5.612   30.224  1.00 67.35  ? 650 SER A OG    1 
ATOM   5202  N  N     . PRO A 1 671 ? 4.492   2.425   29.138  1.00 67.42  ? 651 PRO A N     1 
ATOM   5203  C  CA    . PRO A 1 671 ? 5.496   1.648   28.402  1.00 67.49  ? 651 PRO A CA    1 
ATOM   5204  C  C     . PRO A 1 671 ? 6.846   2.364   28.403  1.00 67.98  ? 651 PRO A C     1 
ATOM   5205  O  O     . PRO A 1 671 ? 6.888   3.595   28.487  1.00 67.72  ? 651 PRO A O     1 
ATOM   5206  C  CB    . PRO A 1 671 ? 4.910   1.552   26.992  1.00 67.40  ? 651 PRO A CB    1 
ATOM   5207  C  CG    . PRO A 1 671 ? 4.050   2.755   26.857  1.00 67.62  ? 651 PRO A CG    1 
ATOM   5208  C  CD    . PRO A 1 671 ? 3.538   3.088   28.230  1.00 67.60  ? 651 PRO A CD    1 
ATOM   5209  N  N     . ALA A 1 672 ? 7.926   1.589   28.311  1.00 68.68  ? 652 ALA A N     1 
ATOM   5210  C  CA    . ALA A 1 672 ? 9.294   2.088   28.521  1.00 69.61  ? 652 ALA A CA    1 
ATOM   5211  C  C     . ALA A 1 672 ? 9.604   3.404   27.805  1.00 70.31  ? 652 ALA A C     1 
ATOM   5212  O  O     . ALA A 1 672 ? 10.073  4.355   28.429  1.00 71.09  ? 652 ALA A O     1 
ATOM   5213  C  CB    . ALA A 1 672 ? 10.305  1.024   28.114  1.00 70.10  ? 652 ALA A CB    1 
ATOM   5214  N  N     . ASP A 1 673 ? 9.306   3.455   26.509  1.00 71.26  ? 653 ASP A N     1 
ATOM   5215  C  CA    . ASP A 1 673 ? 9.653   4.610   25.660  1.00 72.45  ? 653 ASP A CA    1 
ATOM   5216  C  C     . ASP A 1 673 ? 8.872   5.918   25.907  1.00 73.50  ? 653 ASP A C     1 
ATOM   5217  O  O     . ASP A 1 673 ? 9.284   6.969   25.414  1.00 73.57  ? 653 ASP A O     1 
ATOM   5218  C  CB    . ASP A 1 673 ? 9.551   4.233   24.172  1.00 72.96  ? 653 ASP A CB    1 
ATOM   5219  C  CG    . ASP A 1 673 ? 8.135   3.873   23.746  1.00 73.83  ? 653 ASP A CG    1 
ATOM   5220  O  OD1   . ASP A 1 673 ? 7.496   3.057   24.444  1.00 74.92  ? 653 ASP A OD1   1 
ATOM   5221  O  OD2   . ASP A 1 673 ? 7.668   4.394   22.711  1.00 74.66  ? 653 ASP A OD2   1 
ATOM   5222  N  N     . MET A 1 674 ? 7.769   5.858   26.657  1.00 75.38  ? 654 MET A N     1 
ATOM   5223  C  CA    . MET A 1 674 ? 6.878   7.014   26.857  1.00 76.82  ? 654 MET A CA    1 
ATOM   5224  C  C     . MET A 1 674 ? 7.327   7.887   28.035  1.00 75.93  ? 654 MET A C     1 
ATOM   5225  O  O     . MET A 1 674 ? 7.725   7.362   29.076  1.00 75.45  ? 654 MET A O     1 
ATOM   5226  C  CB    . MET A 1 674 ? 5.449   6.514   27.095  1.00 78.87  ? 654 MET A CB    1 
ATOM   5227  C  CG    . MET A 1 674 ? 4.356   7.521   26.794  1.00 80.21  ? 654 MET A CG    1 
ATOM   5228  S  SD    . MET A 1 674 ? 2.730   6.762   26.978  1.00 82.62  ? 654 MET A SD    1 
ATOM   5229  C  CE    . MET A 1 674 ? 1.676   8.032   26.281  1.00 83.80  ? 654 MET A CE    1 
ATOM   5230  N  N     . THR A 1 675 ? 7.249   9.211   27.870  1.00 75.63  ? 655 THR A N     1 
ATOM   5231  C  CA    . THR A 1 675 ? 7.657   10.164  28.916  1.00 75.95  ? 655 THR A CA    1 
ATOM   5232  C  C     . THR A 1 675 ? 6.589   10.277  30.009  1.00 75.91  ? 655 THR A C     1 
ATOM   5233  O  O     . THR A 1 675 ? 5.504   10.804  29.768  1.00 75.62  ? 655 THR A O     1 
ATOM   5234  C  CB    . THR A 1 675 ? 7.935   11.571  28.344  1.00 75.89  ? 655 THR A CB    1 
ATOM   5235  O  OG1   . THR A 1 675 ? 6.749   12.093  27.734  1.00 76.90  ? 655 THR A OG1   1 
ATOM   5236  C  CG2   . THR A 1 675 ? 9.046   11.523  27.308  1.00 76.56  ? 655 THR A CG2   1 
ATOM   5237  N  N     . LEU A 1 676 ? 6.916   9.797   31.208  1.00 77.56  ? 656 LEU A N     1 
ATOM   5238  C  CA    . LEU A 1 676 ? 5.972   9.729   32.327  1.00 79.17  ? 656 LEU A CA    1 
ATOM   5239  C  C     . LEU A 1 676 ? 6.098   10.941  33.254  1.00 80.11  ? 656 LEU A C     1 
ATOM   5240  O  O     . LEU A 1 676 ? 7.206   11.316  33.637  1.00 79.93  ? 656 LEU A O     1 
ATOM   5241  C  CB    . LEU A 1 676 ? 6.219   8.445   33.130  1.00 80.20  ? 656 LEU A CB    1 
ATOM   5242  C  CG    . LEU A 1 676 ? 5.353   8.163   34.365  1.00 81.27  ? 656 LEU A CG    1 
ATOM   5243  C  CD1   . LEU A 1 676 ? 3.881   8.055   33.996  1.00 82.21  ? 656 LEU A CD1   1 
ATOM   5244  C  CD2   . LEU A 1 676 ? 5.829   6.893   35.055  1.00 81.35  ? 656 LEU A CD2   1 
ATOM   5245  N  N     . GLU A 1 677 ? 4.961   11.542  33.608  1.00 81.55  ? 657 GLU A N     1 
ATOM   5246  C  CA    . GLU A 1 677 ? 4.891   12.494  34.721  1.00 81.72  ? 657 GLU A CA    1 
ATOM   5247  C  C     . GLU A 1 677 ? 4.733   11.679  36.001  1.00 82.11  ? 657 GLU A C     1 
ATOM   5248  O  O     . GLU A 1 677 ? 3.808   10.872  36.110  1.00 82.75  ? 657 GLU A O     1 
ATOM   5249  C  CB    . GLU A 1 677 ? 3.711   13.457  34.563  1.00 82.23  ? 657 GLU A CB    1 
ATOM   5250  C  CG    . GLU A 1 677 ? 3.841   14.414  33.387  1.00 83.08  ? 657 GLU A CG    1 
ATOM   5251  C  CD    . GLU A 1 677 ? 2.587   15.238  33.144  1.00 83.34  ? 657 GLU A CD    1 
ATOM   5252  O  OE1   . GLU A 1 677 ? 1.891   15.584  34.122  1.00 83.32  ? 657 GLU A OE1   1 
ATOM   5253  O  OE2   . GLU A 1 677 ? 2.300   15.546  31.967  1.00 83.96  ? 657 GLU A OE2   1 
ATOM   5254  N  N     . TRP A 1 678 ? 5.634   11.889  36.959  1.00 83.08  ? 658 TRP A N     1 
ATOM   5255  C  CA    . TRP A 1 678 ? 5.660   11.095  38.190  1.00 84.91  ? 658 TRP A CA    1 
ATOM   5256  C  C     . TRP A 1 678 ? 4.472   11.416  39.100  1.00 89.49  ? 658 TRP A C     1 
ATOM   5257  O  O     . TRP A 1 678 ? 4.074   12.576  39.223  1.00 91.22  ? 658 TRP A O     1 
ATOM   5258  C  CB    . TRP A 1 678 ? 6.978   11.311  38.945  1.00 83.20  ? 658 TRP A CB    1 
ATOM   5259  C  CG    . TRP A 1 678 ? 7.020   10.634  40.278  1.00 82.00  ? 658 TRP A CG    1 
ATOM   5260  C  CD1   . TRP A 1 678 ? 7.134   11.233  41.496  1.00 82.83  ? 658 TRP A CD1   1 
ATOM   5261  C  CD2   . TRP A 1 678 ? 6.915   9.230   40.528  1.00 81.17  ? 658 TRP A CD2   1 
ATOM   5262  N  NE1   . TRP A 1 678 ? 7.123   10.288  42.494  1.00 82.65  ? 658 TRP A NE1   1 
ATOM   5263  C  CE2   . TRP A 1 678 ? 6.986   9.049   41.928  1.00 81.58  ? 658 TRP A CE2   1 
ATOM   5264  C  CE3   . TRP A 1 678 ? 6.771   8.103   39.706  1.00 81.28  ? 658 TRP A CE3   1 
ATOM   5265  C  CZ2   . TRP A 1 678 ? 6.922   7.786   42.527  1.00 81.59  ? 658 TRP A CZ2   1 
ATOM   5266  C  CZ3   . TRP A 1 678 ? 6.707   6.845   40.302  1.00 81.32  ? 658 TRP A CZ3   1 
ATOM   5267  C  CH2   . TRP A 1 678 ? 6.785   6.699   41.701  1.00 81.68  ? 658 TRP A CH2   1 
ATOM   5268  N  N     . GLN A 1 679 ? 3.913   10.376  39.720  1.00 94.99  ? 659 GLN A N     1 
ATOM   5269  C  CA    . GLN A 1 679 ? 2.805   10.513  40.670  1.00 98.24  ? 659 GLN A CA    1 
ATOM   5270  C  C     . GLN A 1 679 ? 2.793   9.367   41.686  1.00 100.33 ? 659 GLN A C     1 
ATOM   5271  O  O     . GLN A 1 679 ? 3.171   8.238   41.363  1.00 101.32 ? 659 GLN A O     1 
ATOM   5272  C  CB    . GLN A 1 679 ? 1.470   10.568  39.924  1.00 99.70  ? 659 GLN A CB    1 
ATOM   5273  C  CG    . GLN A 1 679 ? 1.241   9.421   38.946  1.00 101.26 ? 659 GLN A CG    1 
ATOM   5274  C  CD    . GLN A 1 679 ? -0.160  9.416   38.367  1.00 104.02 ? 659 GLN A CD    1 
ATOM   5275  O  OE1   . GLN A 1 679 ? -0.832  8.383   38.350  1.00 105.26 ? 659 GLN A OE1   1 
ATOM   5276  N  NE2   . GLN A 1 679 ? -0.611  10.573  37.892  1.00 105.99 ? 659 GLN A NE2   1 
ATOM   5277  N  N     . GLU A 1 680 ? 2.350   9.666   42.907  1.00 102.42 ? 660 GLU A N     1 
ATOM   5278  C  CA    . GLU A 1 680 ? 2.283   8.673   43.986  1.00 103.77 ? 660 GLU A CA    1 
ATOM   5279  C  C     . GLU A 1 680 ? 1.075   7.738   43.840  1.00 104.09 ? 660 GLU A C     1 
ATOM   5280  O  O     . GLU A 1 680 ? 1.171   6.551   44.164  1.00 102.31 ? 660 GLU A O     1 
ATOM   5281  C  CB    . GLU A 1 680 ? 2.245   9.374   45.352  1.00 104.78 ? 660 GLU A CB    1 
ATOM   5282  C  CG    . GLU A 1 680 ? 2.521   8.472   46.555  1.00 105.09 ? 660 GLU A CG    1 
ATOM   5283  C  CD    . GLU A 1 680 ? 3.919   7.868   46.566  1.00 105.09 ? 660 GLU A CD    1 
ATOM   5284  O  OE1   . GLU A 1 680 ? 4.848   8.457   45.970  1.00 104.98 ? 660 GLU A OE1   1 
ATOM   5285  O  OE2   . GLU A 1 680 ? 4.090   6.796   47.184  1.00 104.54 ? 660 GLU A OE2   1 
ATOM   5286  N  N     . SER A 1 681 ? -0.052  8.279   43.368  1.00 104.47 ? 661 SER A N     1 
ATOM   5287  C  CA    . SER A 1 681 ? -1.285  7.506   43.176  1.00 104.08 ? 661 SER A CA    1 
ATOM   5288  C  C     . SER A 1 681 ? -1.098  6.391   42.145  1.00 104.21 ? 661 SER A C     1 
ATOM   5289  O  O     . SER A 1 681 ? -0.906  6.666   40.958  1.00 104.52 ? 661 SER A O     1 
ATOM   5290  C  CB    . SER A 1 681 ? -2.430  8.422   42.733  1.00 103.98 ? 661 SER A CB    1 
ATOM   5291  O  OG    . SER A 1 681 ? -2.673  9.433   43.694  1.00 104.79 ? 661 SER A OG    1 
ATOM   5292  N  N     . GLY A 1 682 ? -1.162  5.142   42.611  1.00 103.78 ? 662 GLY A N     1 
ATOM   5293  C  CA    . GLY A 1 682 ? -0.907  3.962   41.778  1.00 102.69 ? 662 GLY A CA    1 
ATOM   5294  C  C     . GLY A 1 682 ? -0.107  2.869   42.475  1.00 101.83 ? 662 GLY A C     1 
ATOM   5295  O  O     . GLY A 1 682 ? -0.254  1.691   42.144  1.00 101.66 ? 662 GLY A O     1 
ATOM   5296  N  N     . VAL A 1 683 ? 0.745   3.262   43.427  1.00 100.39 ? 663 VAL A N     1 
ATOM   5297  C  CA    . VAL A 1 683 ? 1.573   2.316   44.206  1.00 100.05 ? 663 VAL A CA    1 
ATOM   5298  C  C     . VAL A 1 683 ? 0.773   1.254   44.972  1.00 99.49  ? 663 VAL A C     1 
ATOM   5299  O  O     . VAL A 1 683 ? 1.245   0.128   45.143  1.00 100.33 ? 663 VAL A O     1 
ATOM   5300  C  CB    . VAL A 1 683 ? 2.517   3.027   45.221  1.00 100.96 ? 663 VAL A CB    1 
ATOM   5301  C  CG1   . VAL A 1 683 ? 3.557   3.881   44.502  1.00 101.82 ? 663 VAL A CG1   1 
ATOM   5302  C  CG2   . VAL A 1 683 ? 1.741   3.842   46.261  1.00 101.49 ? 663 VAL A CG2   1 
ATOM   5303  N  N     . GLU A 1 684 ? -0.422  1.623   45.433  1.00 98.89  ? 664 GLU A N     1 
ATOM   5304  C  CA    . GLU A 1 684 ? -1.270  0.729   46.232  1.00 97.25  ? 664 GLU A CA    1 
ATOM   5305  C  C     . GLU A 1 684 ? -1.801  -0.460  45.421  1.00 94.40  ? 664 GLU A C     1 
ATOM   5306  O  O     . GLU A 1 684 ? -2.008  -1.541  45.976  1.00 94.67  ? 664 GLU A O     1 
ATOM   5307  C  CB    . GLU A 1 684 ? -2.441  1.507   46.857  1.00 98.29  ? 664 GLU A CB    1 
ATOM   5308  C  CG    . GLU A 1 684 ? -2.958  0.923   48.167  1.00 98.91  ? 664 GLU A CG    1 
ATOM   5309  C  CD    . GLU A 1 684 ? -2.167  1.371   49.390  1.00 98.76  ? 664 GLU A CD    1 
ATOM   5310  O  OE1   . GLU A 1 684 ? -0.950  1.634   49.274  1.00 98.32  ? 664 GLU A OE1   1 
ATOM   5311  O  OE2   . GLU A 1 684 ? -2.769  1.457   50.480  1.00 98.62  ? 664 GLU A OE2   1 
ATOM   5312  N  N     . GLY A 1 685 ? -2.020  -0.253  44.121  1.00 91.84  ? 665 GLY A N     1 
ATOM   5313  C  CA    . GLY A 1 685 ? -2.458  -1.317  43.212  1.00 90.89  ? 665 GLY A CA    1 
ATOM   5314  C  C     . GLY A 1 685 ? -1.464  -2.449  43.024  1.00 89.61  ? 665 GLY A C     1 
ATOM   5315  O  O     . GLY A 1 685 ? -1.861  -3.605  42.852  1.00 89.26  ? 665 GLY A O     1 
ATOM   5316  N  N     . ALA A 1 686 ? -0.174  -2.112  43.041  1.00 87.85  ? 666 ALA A N     1 
ATOM   5317  C  CA    . ALA A 1 686 ? 0.899   -3.104  42.939  1.00 86.36  ? 666 ALA A CA    1 
ATOM   5318  C  C     . ALA A 1 686 ? 0.995   -3.966  44.198  1.00 85.10  ? 666 ALA A C     1 
ATOM   5319  O  O     . ALA A 1 686 ? 1.150   -5.186  44.103  1.00 84.11  ? 666 ALA A O     1 
ATOM   5320  C  CB    . ALA A 1 686 ? 2.231   -2.419  42.668  1.00 86.37  ? 666 ALA A CB    1 
ATOM   5321  N  N     . ASN A 1 687 ? 0.903   -3.327  45.366  1.00 84.06  ? 667 ASN A N     1 
ATOM   5322  C  CA    . ASN A 1 687 ? 0.956   -4.032  46.655  1.00 83.47  ? 667 ASN A CA    1 
ATOM   5323  C  C     . ASN A 1 687 ? -0.249  -4.952  46.845  1.00 83.39  ? 667 ASN A C     1 
ATOM   5324  O  O     . ASN A 1 687 ? -0.105  -6.068  47.348  1.00 83.57  ? 667 ASN A O     1 
ATOM   5325  C  CB    . ASN A 1 687 ? 1.029   -3.040  47.825  1.00 82.87  ? 667 ASN A CB    1 
ATOM   5326  C  CG    . ASN A 1 687 ? 1.415   -3.706  49.137  1.00 81.95  ? 667 ASN A CG    1 
ATOM   5327  O  OD1   . ASN A 1 687 ? 0.721   -3.560  50.143  1.00 81.89  ? 667 ASN A OD1   1 
ATOM   5328  N  ND2   . ASN A 1 687 ? 2.524   -4.439  49.132  1.00 80.21  ? 667 ASN A ND2   1 
ATOM   5329  N  N     . ARG A 1 688 ? -1.429  -4.470  46.454  1.00 82.88  ? 668 ARG A N     1 
ATOM   5330  C  CA    . ARG A 1 688 ? -2.645  -5.290  46.458  1.00 82.91  ? 668 ARG A CA    1 
ATOM   5331  C  C     . ARG A 1 688 ? -2.538  -6.495  45.519  1.00 82.30  ? 668 ARG A C     1 
ATOM   5332  O  O     . ARG A 1 688 ? -2.982  -7.589  45.872  1.00 84.40  ? 668 ARG A O     1 
ATOM   5333  C  CB    . ARG A 1 688 ? -3.890  -4.457  46.105  1.00 83.08  ? 668 ARG A CB    1 
ATOM   5334  C  CG    . ARG A 1 688 ? -4.451  -3.649  47.271  1.00 83.52  ? 668 ARG A CG    1 
ATOM   5335  C  CD    . ARG A 1 688 ? -5.933  -3.341  47.101  1.00 84.15  ? 668 ARG A CD    1 
ATOM   5336  N  NE    . ARG A 1 688 ? -6.173  -2.173  46.251  1.00 84.35  ? 668 ARG A NE    1 
ATOM   5337  C  CZ    . ARG A 1 688 ? -6.191  -0.900  46.661  1.00 85.55  ? 668 ARG A CZ    1 
ATOM   5338  N  NH1   . ARG A 1 688 ? -5.973  -0.567  47.935  1.00 86.42  ? 668 ARG A NH1   1 
ATOM   5339  N  NH2   . ARG A 1 688 ? -6.429  0.066   45.777  1.00 86.08  ? 668 ARG A NH2   1 
ATOM   5340  N  N     . PHE A 1 689 ? -1.949  -6.295  44.338  1.00 79.96  ? 669 PHE A N     1 
ATOM   5341  C  CA    . PHE A 1 689 ? -1.778  -7.380  43.363  1.00 78.76  ? 669 PHE A CA    1 
ATOM   5342  C  C     . PHE A 1 689 ? -0.844  -8.481  43.870  1.00 79.48  ? 669 PHE A C     1 
ATOM   5343  O  O     . PHE A 1 689 ? -1.140  -9.665  43.702  1.00 80.96  ? 669 PHE A O     1 
ATOM   5344  C  CB    . PHE A 1 689 ? -1.275  -6.844  42.016  1.00 77.38  ? 669 PHE A CB    1 
ATOM   5345  C  CG    . PHE A 1 689 ? -1.004  -7.922  40.996  1.00 76.00  ? 669 PHE A CG    1 
ATOM   5346  C  CD1   . PHE A 1 689 ? -2.014  -8.798  40.604  1.00 75.67  ? 669 PHE A CD1   1 
ATOM   5347  C  CD2   . PHE A 1 689 ? 0.261   -8.070  40.432  1.00 75.37  ? 669 PHE A CD2   1 
ATOM   5348  C  CE1   . PHE A 1 689 ? -1.770  -9.797  39.670  1.00 75.03  ? 669 PHE A CE1   1 
ATOM   5349  C  CE2   . PHE A 1 689 ? 0.510   -9.066  39.496  1.00 75.12  ? 669 PHE A CE2   1 
ATOM   5350  C  CZ    . PHE A 1 689 ? -0.507  -9.930  39.114  1.00 74.96  ? 669 PHE A CZ    1 
ATOM   5351  N  N     . LEU A 1 690 ? 0.275   -8.092  44.480  1.00 79.61  ? 670 LEU A N     1 
ATOM   5352  C  CA    . LEU A 1 690 ? 1.228   -9.062  45.038  1.00 79.72  ? 670 LEU A CA    1 
ATOM   5353  C  C     . LEU A 1 690 ? 0.653   -9.844  46.221  1.00 80.36  ? 670 LEU A C     1 
ATOM   5354  O  O     . LEU A 1 690 ? 0.997   -11.012 46.410  1.00 81.74  ? 670 LEU A O     1 
ATOM   5355  C  CB    . LEU A 1 690 ? 2.541   -8.379  45.442  1.00 79.32  ? 670 LEU A CB    1 
ATOM   5356  C  CG    . LEU A 1 690 ? 3.392   -7.830  44.293  1.00 78.91  ? 670 LEU A CG    1 
ATOM   5357  C  CD1   . LEU A 1 690 ? 4.554   -7.021  44.847  1.00 79.53  ? 670 LEU A CD1   1 
ATOM   5358  C  CD2   . LEU A 1 690 ? 3.895   -8.947  43.388  1.00 78.07  ? 670 LEU A CD2   1 
ATOM   5359  N  N     . LYS A 1 691 ? -0.210  -9.202  47.010  1.00 80.48  ? 671 LYS A N     1 
ATOM   5360  C  CA    . LYS A 1 691 ? -0.950  -9.896  48.074  1.00 80.48  ? 671 LYS A CA    1 
ATOM   5361  C  C     . LYS A 1 691 ? -1.945  -10.921 47.516  1.00 78.96  ? 671 LYS A C     1 
ATOM   5362  O  O     . LYS A 1 691 ? -2.127  -11.986 48.110  1.00 80.39  ? 671 LYS A O     1 
ATOM   5363  C  CB    . LYS A 1 691 ? -1.668  -8.899  48.993  1.00 81.97  ? 671 LYS A CB    1 
ATOM   5364  C  CG    . LYS A 1 691 ? -0.741  -8.196  49.970  1.00 83.17  ? 671 LYS A CG    1 
ATOM   5365  C  CD    . LYS A 1 691 ? -1.508  -7.281  50.908  1.00 84.59  ? 671 LYS A CD    1 
ATOM   5366  C  CE    . LYS A 1 691 ? -0.613  -6.756  52.018  1.00 85.97  ? 671 LYS A CE    1 
ATOM   5367  N  NZ    . LYS A 1 691 ? -1.367  -5.920  52.993  1.00 87.05  ? 671 LYS A NZ    1 
ATOM   5368  N  N     . ARG A 1 692 ? -2.580  -10.598 46.387  1.00 75.84  ? 672 ARG A N     1 
ATOM   5369  C  CA    . ARG A 1 692 ? -3.469  -11.544 45.694  1.00 73.77  ? 672 ARG A CA    1 
ATOM   5370  C  C     . ARG A 1 692 ? -2.718  -12.755 45.129  1.00 72.31  ? 672 ARG A C     1 
ATOM   5371  O  O     . ARG A 1 692 ? -3.237  -13.870 45.166  1.00 73.29  ? 672 ARG A O     1 
ATOM   5372  C  CB    . ARG A 1 692 ? -4.270  -10.856 44.577  1.00 73.56  ? 672 ARG A CB    1 
ATOM   5373  C  CG    . ARG A 1 692 ? -5.396  -9.960  45.075  1.00 73.67  ? 672 ARG A CG    1 
ATOM   5374  C  CD    . ARG A 1 692 ? -6.484  -9.778  44.026  1.00 73.63  ? 672 ARG A CD    1 
ATOM   5375  N  NE    . ARG A 1 692 ? -5.976  -9.185  42.788  1.00 73.25  ? 672 ARG A NE    1 
ATOM   5376  C  CZ    . ARG A 1 692 ? -5.691  -7.892  42.606  1.00 73.41  ? 672 ARG A CZ    1 
ATOM   5377  N  NH1   . ARG A 1 692 ? -5.843  -6.999  43.586  1.00 73.74  ? 672 ARG A NH1   1 
ATOM   5378  N  NH2   . ARG A 1 692 ? -5.239  -7.484  41.423  1.00 73.47  ? 672 ARG A NH2   1 
ATOM   5379  N  N     . VAL A 1 693 ? -1.513  -12.531 44.605  1.00 71.46  ? 673 VAL A N     1 
ATOM   5380  C  CA    . VAL A 1 693 ? -0.658  -13.623 44.111  1.00 71.50  ? 673 VAL A CA    1 
ATOM   5381  C  C     . VAL A 1 693 ? -0.179  -14.504 45.269  1.00 71.76  ? 673 VAL A C     1 
ATOM   5382  O  O     . VAL A 1 693 ? -0.184  -15.730 45.159  1.00 70.15  ? 673 VAL A O     1 
ATOM   5383  C  CB    . VAL A 1 693 ? 0.544   -13.086 43.290  1.00 71.35  ? 673 VAL A CB    1 
ATOM   5384  C  CG1   . VAL A 1 693 ? 1.550   -14.189 42.972  1.00 71.21  ? 673 VAL A CG1   1 
ATOM   5385  C  CG2   . VAL A 1 693 ? 0.055   -12.446 41.998  1.00 71.51  ? 673 VAL A CG2   1 
ATOM   5386  N  N     . TRP A 1 694 ? 0.229   -13.870 46.367  1.00 74.01  ? 674 TRP A N     1 
ATOM   5387  C  CA    . TRP A 1 694 ? 0.675   -14.576 47.573  1.00 76.05  ? 674 TRP A CA    1 
ATOM   5388  C  C     . TRP A 1 694 ? -0.453  -15.396 48.211  1.00 78.03  ? 674 TRP A C     1 
ATOM   5389  O  O     . TRP A 1 694 ? -0.223  -16.521 48.660  1.00 79.38  ? 674 TRP A O     1 
ATOM   5390  C  CB    . TRP A 1 694 ? 1.242   -13.572 48.585  1.00 75.90  ? 674 TRP A CB    1 
ATOM   5391  C  CG    . TRP A 1 694 ? 1.875   -14.181 49.807  1.00 75.60  ? 674 TRP A CG    1 
ATOM   5392  C  CD1   . TRP A 1 694 ? 1.263   -14.447 50.997  1.00 75.62  ? 674 TRP A CD1   1 
ATOM   5393  C  CD2   . TRP A 1 694 ? 3.244   -14.573 49.965  1.00 75.25  ? 674 TRP A CD2   1 
ATOM   5394  N  NE1   . TRP A 1 694 ? 2.161   -14.990 51.884  1.00 75.78  ? 674 TRP A NE1   1 
ATOM   5395  C  CE2   . TRP A 1 694 ? 3.386   -15.078 51.277  1.00 75.28  ? 674 TRP A CE2   1 
ATOM   5396  C  CE3   . TRP A 1 694 ? 4.366   -14.551 49.123  1.00 75.11  ? 674 TRP A CE3   1 
ATOM   5397  C  CZ2   . TRP A 1 694 ? 4.606   -15.558 51.771  1.00 75.05  ? 674 TRP A CZ2   1 
ATOM   5398  C  CZ3   . TRP A 1 694 ? 5.582   -15.029 49.614  1.00 75.03  ? 674 TRP A CZ3   1 
ATOM   5399  C  CH2   . TRP A 1 694 ? 5.689   -15.527 50.927  1.00 74.91  ? 674 TRP A CH2   1 
ATOM   5400  N  N     . LYS A 1 695 ? -1.659  -14.830 48.243  1.00 79.83  ? 675 LYS A N     1 
ATOM   5401  C  CA    . LYS A 1 695 ? -2.833  -15.511 48.802  1.00 82.19  ? 675 LYS A CA    1 
ATOM   5402  C  C     . LYS A 1 695 ? -3.239  -16.753 47.997  1.00 83.62  ? 675 LYS A C     1 
ATOM   5403  O  O     . LYS A 1 695 ? -3.620  -17.765 48.585  1.00 86.59  ? 675 LYS A O     1 
ATOM   5404  C  CB    . LYS A 1 695 ? -4.021  -14.544 48.903  1.00 83.28  ? 675 LYS A CB    1 
ATOM   5405  C  CG    . LYS A 1 695 ? -5.243  -15.106 49.619  1.00 84.30  ? 675 LYS A CG    1 
ATOM   5406  C  CD    . LYS A 1 695 ? -6.397  -14.116 49.617  1.00 85.77  ? 675 LYS A CD    1 
ATOM   5407  C  CE    . LYS A 1 695 ? -7.712  -14.801 49.958  1.00 86.97  ? 675 LYS A CE    1 
ATOM   5408  N  NZ    . LYS A 1 695 ? -8.861  -13.856 49.948  1.00 88.07  ? 675 LYS A NZ    1 
ATOM   5409  N  N     . LEU A 1 696 ? -3.166  -16.670 46.667  1.00 83.41  ? 676 LEU A N     1 
ATOM   5410  C  CA    . LEU A 1 696 ? -3.566  -17.782 45.794  1.00 82.99  ? 676 LEU A CA    1 
ATOM   5411  C  C     . LEU A 1 696 ? -2.631  -18.992 45.899  1.00 82.99  ? 676 LEU A C     1 
ATOM   5412  O  O     . LEU A 1 696 ? -3.091  -20.132 45.824  1.00 84.34  ? 676 LEU A O     1 
ATOM   5413  C  CB    . LEU A 1 696 ? -3.666  -17.319 44.333  1.00 83.65  ? 676 LEU A CB    1 
ATOM   5414  C  CG    . LEU A 1 696 ? -4.195  -18.320 43.294  1.00 84.60  ? 676 LEU A CG    1 
ATOM   5415  C  CD1   . LEU A 1 696 ? -5.585  -18.829 43.651  1.00 85.38  ? 676 LEU A CD1   1 
ATOM   5416  C  CD2   . LEU A 1 696 ? -4.205  -17.689 41.909  1.00 84.72  ? 676 LEU A CD2   1 
ATOM   5417  N  N     . VAL A 1 697 ? -1.332  -18.742 46.070  1.00 82.41  ? 677 VAL A N     1 
ATOM   5418  C  CA    . VAL A 1 697 ? -0.344  -19.818 46.236  1.00 82.55  ? 677 VAL A CA    1 
ATOM   5419  C  C     . VAL A 1 697 ? -0.416  -20.424 47.648  1.00 83.97  ? 677 VAL A C     1 
ATOM   5420  O  O     . VAL A 1 697 ? -0.273  -21.639 47.806  1.00 83.37  ? 677 VAL A O     1 
ATOM   5421  C  CB    . VAL A 1 697 ? 1.093   -19.331 45.914  1.00 81.68  ? 677 VAL A CB    1 
ATOM   5422  C  CG1   . VAL A 1 697 ? 2.122   -20.429 46.170  1.00 81.69  ? 677 VAL A CG1   1 
ATOM   5423  C  CG2   . VAL A 1 697 ? 1.183   -18.863 44.466  1.00 81.36  ? 677 VAL A CG2   1 
ATOM   5424  N  N     . TYR A 1 698 ? -0.638  -19.579 48.659  1.00 86.31  ? 678 TYR A N     1 
ATOM   5425  C  CA    . TYR A 1 698 ? -0.816  -20.021 50.056  1.00 88.42  ? 678 TYR A CA    1 
ATOM   5426  C  C     . TYR A 1 698 ? -1.956  -21.035 50.210  1.00 88.71  ? 678 TYR A C     1 
ATOM   5427  O  O     . TYR A 1 698 ? -1.780  -22.085 50.831  1.00 90.39  ? 678 TYR A O     1 
ATOM   5428  C  CB    . TYR A 1 698 ? -1.068  -18.808 50.968  1.00 89.90  ? 678 TYR A CB    1 
ATOM   5429  C  CG    . TYR A 1 698 ? -1.401  -19.140 52.414  1.00 91.29  ? 678 TYR A CG    1 
ATOM   5430  C  CD1   . TYR A 1 698 ? -0.398  -19.483 53.324  1.00 92.24  ? 678 TYR A CD1   1 
ATOM   5431  C  CD2   . TYR A 1 698 ? -2.719  -19.094 52.878  1.00 92.09  ? 678 TYR A CD2   1 
ATOM   5432  C  CE1   . TYR A 1 698 ? -0.699  -19.781 54.648  1.00 92.27  ? 678 TYR A CE1   1 
ATOM   5433  C  CE2   . TYR A 1 698 ? -3.029  -19.390 54.200  1.00 92.46  ? 678 TYR A CE2   1 
ATOM   5434  C  CZ    . TYR A 1 698 ? -2.016  -19.732 55.081  1.00 92.39  ? 678 TYR A CZ    1 
ATOM   5435  O  OH    . TYR A 1 698 ? -2.319  -20.025 56.390  1.00 92.75  ? 678 TYR A OH    1 
ATOM   5436  N  N     . GLU A 1 699 ? -3.113  -20.702 49.644  1.00 88.18  ? 679 GLU A N     1 
ATOM   5437  C  CA    . GLU A 1 699 ? -4.292  -21.578 49.671  1.00 87.05  ? 679 GLU A CA    1 
ATOM   5438  C  C     . GLU A 1 699 ? -4.094  -22.847 48.834  1.00 86.46  ? 679 GLU A C     1 
ATOM   5439  O  O     . GLU A 1 699 ? -4.618  -23.905 49.181  1.00 86.51  ? 679 GLU A O     1 
ATOM   5440  C  CB    . GLU A 1 699 ? -5.535  -20.820 49.186  1.00 86.59  ? 679 GLU A CB    1 
ATOM   5441  C  CG    . GLU A 1 699 ? -5.963  -19.680 50.106  1.00 86.52  ? 679 GLU A CG    1 
ATOM   5442  C  CD    . GLU A 1 699 ? -7.047  -18.785 49.519  1.00 86.83  ? 679 GLU A CD    1 
ATOM   5443  O  OE1   . GLU A 1 699 ? -7.327  -18.864 48.303  1.00 86.74  ? 679 GLU A OE1   1 
ATOM   5444  O  OE2   . GLU A 1 699 ? -7.621  -17.985 50.287  1.00 87.08  ? 679 GLU A OE2   1 
ATOM   5445  N  N     . HIS A 1 700 ? -3.343  -22.730 47.738  1.00 86.91  ? 680 HIS A N     1 
ATOM   5446  C  CA    . HIS A 1 700 ? -3.047  -23.862 46.853  1.00 88.35  ? 680 HIS A CA    1 
ATOM   5447  C  C     . HIS A 1 700 ? -2.098  -24.883 47.488  1.00 90.90  ? 680 HIS A C     1 
ATOM   5448  O  O     . HIS A 1 700 ? -2.368  -26.086 47.458  1.00 91.99  ? 680 HIS A O     1 
ATOM   5449  C  CB    . HIS A 1 700 ? -2.454  -23.362 45.529  1.00 87.23  ? 680 HIS A CB    1 
ATOM   5450  C  CG    . HIS A 1 700 ? -1.969  -24.456 44.630  1.00 86.12  ? 680 HIS A CG    1 
ATOM   5451  N  ND1   . HIS A 1 700 ? -2.807  -25.156 43.790  1.00 85.18  ? 680 HIS A ND1   1 
ATOM   5452  C  CD2   . HIS A 1 700 ? -0.731  -24.972 44.443  1.00 85.04  ? 680 HIS A CD2   1 
ATOM   5453  C  CE1   . HIS A 1 700 ? -2.106  -26.056 43.124  1.00 84.84  ? 680 HIS A CE1   1 
ATOM   5454  N  NE2   . HIS A 1 700 ? -0.844  -25.966 43.502  1.00 84.29  ? 680 HIS A NE2   1 
ATOM   5455  N  N     . THR A 1 701 ? -0.984  -24.401 48.035  1.00 93.86  ? 681 THR A N     1 
ATOM   5456  C  CA    . THR A 1 701 ? 0.039   -25.271 48.634  1.00 96.29  ? 681 THR A CA    1 
ATOM   5457  C  C     . THR A 1 701 ? -0.398  -25.915 49.958  1.00 97.72  ? 681 THR A C     1 
ATOM   5458  O  O     . THR A 1 701 ? 0.028   -27.029 50.272  1.00 97.42  ? 681 THR A O     1 
ATOM   5459  C  CB    . THR A 1 701 ? 1.360   -24.509 48.870  1.00 96.74  ? 681 THR A CB    1 
ATOM   5460  O  OG1   . THR A 1 701 ? 1.104   -23.320 49.628  1.00 97.46  ? 681 THR A OG1   1 
ATOM   5461  C  CG2   . THR A 1 701 ? 2.011   -24.138 47.542  1.00 96.40  ? 681 THR A CG2   1 
ATOM   5462  N  N     . ALA A 1 702 ? -1.236  -25.213 50.725  1.00 99.19  ? 682 ALA A N     1 
ATOM   5463  C  CA    . ALA A 1 702 ? -1.745  -25.715 52.011  1.00 100.16 ? 682 ALA A CA    1 
ATOM   5464  C  C     . ALA A 1 702 ? -2.583  -26.993 51.891  1.00 102.35 ? 682 ALA A C     1 
ATOM   5465  O  O     . ALA A 1 702 ? -2.616  -27.798 52.825  1.00 104.44 ? 682 ALA A O     1 
ATOM   5466  C  CB    . ALA A 1 702 ? -2.551  -24.632 52.717  1.00 99.77  ? 682 ALA A CB    1 
ATOM   5467  N  N     . LYS A 1 703 ? -3.256  -27.170 50.753  1.00 104.08 ? 683 LYS A N     1 
ATOM   5468  C  CA    . LYS A 1 703 ? -4.049  -28.379 50.481  1.00 104.49 ? 683 LYS A CA    1 
ATOM   5469  C  C     . LYS A 1 703 ? -3.176  -29.629 50.314  1.00 104.85 ? 683 LYS A C     1 
ATOM   5470  O  O     . LYS A 1 703 ? -3.563  -30.713 50.755  1.00 106.64 ? 683 LYS A O     1 
ATOM   5471  C  CB    . LYS A 1 703 ? -4.931  -28.183 49.242  1.00 104.34 ? 683 LYS A CB    1 
ATOM   5472  C  CG    . LYS A 1 703 ? -6.020  -27.133 49.420  1.00 104.92 ? 683 LYS A CG    1 
ATOM   5473  C  CD    . LYS A 1 703 ? -6.519  -26.603 48.085  1.00 105.90 ? 683 LYS A CD    1 
ATOM   5474  C  CE    . LYS A 1 703 ? -7.519  -25.473 48.277  1.00 106.85 ? 683 LYS A CE    1 
ATOM   5475  N  NZ    . LYS A 1 703 ? -7.804  -24.758 47.002  1.00 108.01 ? 683 LYS A NZ    1 
ATOM   5476  N  N     . GLY A 1 704 ? -2.015  -29.472 49.673  1.00 103.31 ? 684 GLY A N     1 
ATOM   5477  C  CA    . GLY A 1 704 ? -1.016  -30.543 49.564  1.00 102.96 ? 684 GLY A CA    1 
ATOM   5478  C  C     . GLY A 1 704 ? -0.372  -30.619 48.194  1.00 103.50 ? 684 GLY A C     1 
ATOM   5479  O  O     . GLY A 1 704 ? -0.460  -29.676 47.404  1.00 103.63 ? 684 GLY A O     1 
ATOM   5480  N  N     . ASP A 1 705 ? 0.272   -31.753 47.916  1.00 105.02 ? 685 ASP A N     1 
ATOM   5481  C  CA    . ASP A 1 705 ? 0.895   -32.012 46.609  1.00 106.26 ? 685 ASP A CA    1 
ATOM   5482  C  C     . ASP A 1 705 ? -0.161  -32.249 45.526  1.00 105.73 ? 685 ASP A C     1 
ATOM   5483  O  O     . ASP A 1 705 ? -1.339  -32.457 45.830  1.00 105.43 ? 685 ASP A O     1 
ATOM   5484  C  CB    . ASP A 1 705 ? 1.843   -33.220 46.683  1.00 106.86 ? 685 ASP A CB    1 
ATOM   5485  C  CG    . ASP A 1 705 ? 3.063   -32.962 47.556  1.00 107.64 ? 685 ASP A CG    1 
ATOM   5486  O  OD1   . ASP A 1 705 ? 3.771   -31.958 47.324  1.00 107.28 ? 685 ASP A OD1   1 
ATOM   5487  O  OD2   . ASP A 1 705 ? 3.325   -33.775 48.468  1.00 108.00 ? 685 ASP A OD2   1 
ATOM   5488  N  N     . VAL A 1 706 ? 0.277   -32.224 44.267  1.00 105.50 ? 686 VAL A N     1 
ATOM   5489  C  CA    . VAL A 1 706 ? -0.623  -32.333 43.109  1.00 106.10 ? 686 VAL A CA    1 
ATOM   5490  C  C     . VAL A 1 706 ? -0.308  -33.553 42.245  1.00 107.12 ? 686 VAL A C     1 
ATOM   5491  O  O     . VAL A 1 706 ? 0.816   -34.062 42.249  1.00 105.43 ? 686 VAL A O     1 
ATOM   5492  C  CB    . VAL A 1 706 ? -0.601  -31.060 42.224  1.00 106.46 ? 686 VAL A CB    1 
ATOM   5493  C  CG1   . VAL A 1 706 ? -1.006  -29.836 43.034  1.00 106.96 ? 686 VAL A CG1   1 
ATOM   5494  C  CG2   . VAL A 1 706 ? 0.758   -30.840 41.566  1.00 106.36 ? 686 VAL A CG2   1 
ATOM   5495  N  N     . ALA A 1 707 ? -1.318  -33.994 41.496  1.00 109.46 ? 687 ALA A N     1 
ATOM   5496  C  CA    . ALA A 1 707 ? -1.204  -35.133 40.583  1.00 109.99 ? 687 ALA A CA    1 
ATOM   5497  C  C     . ALA A 1 707 ? -0.629  -34.701 39.236  1.00 110.28 ? 687 ALA A C     1 
ATOM   5498  O  O     . ALA A 1 707 ? -0.467  -33.505 38.972  1.00 110.29 ? 687 ALA A O     1 
ATOM   5499  C  CB    . ALA A 1 707 ? -2.568  -35.780 40.384  1.00 110.59 ? 687 ALA A CB    1 
ATOM   5500  N  N     . ALA A 1 708 ? -0.323  -35.685 38.392  1.00 110.90 ? 688 ALA A N     1 
ATOM   5501  C  CA    . ALA A 1 708 ? 0.119   -35.432 37.019  1.00 111.58 ? 688 ALA A CA    1 
ATOM   5502  C  C     . ALA A 1 708 ? -1.067  -34.959 36.181  1.00 113.48 ? 688 ALA A C     1 
ATOM   5503  O  O     . ALA A 1 708 ? -2.171  -35.497 36.305  1.00 115.04 ? 688 ALA A O     1 
ATOM   5504  C  CB    . ALA A 1 708 ? 0.728   -36.688 36.415  1.00 110.34 ? 688 ALA A CB    1 
ATOM   5505  N  N     . LEU A 1 709 ? -0.834  -33.956 35.335  1.00 114.91 ? 689 LEU A N     1 
ATOM   5506  C  CA    . LEU A 1 709 ? -1.905  -33.315 34.565  1.00 115.88 ? 689 LEU A CA    1 
ATOM   5507  C  C     . LEU A 1 709 ? -2.322  -34.162 33.361  1.00 118.78 ? 689 LEU A C     1 
ATOM   5508  O  O     . LEU A 1 709 ? -1.504  -34.440 32.479  1.00 117.23 ? 689 LEU A O     1 
ATOM   5509  C  CB    . LEU A 1 709 ? -1.466  -31.920 34.094  1.00 114.26 ? 689 LEU A CB    1 
ATOM   5510  C  CG    . LEU A 1 709 ? -2.480  -31.050 33.336  1.00 112.78 ? 689 LEU A CG    1 
ATOM   5511  C  CD1   . LEU A 1 709 ? -3.724  -30.772 34.167  1.00 111.56 ? 689 LEU A CD1   1 
ATOM   5512  C  CD2   . LEU A 1 709 ? -1.827  -29.745 32.909  1.00 112.95 ? 689 LEU A CD2   1 
ATOM   5513  N  N     . ASN A 1 710 ? -3.594  -34.566 33.337  1.00 122.35 ? 690 ASN A N     1 
ATOM   5514  C  CA    . ASN A 1 710 ? -4.186  -35.237 32.181  1.00 125.13 ? 690 ASN A CA    1 
ATOM   5515  C  C     . ASN A 1 710 ? -4.589  -34.164 31.167  1.00 126.37 ? 690 ASN A C     1 
ATOM   5516  O  O     . ASN A 1 710 ? -5.460  -33.334 31.447  1.00 126.93 ? 690 ASN A O     1 
ATOM   5517  C  CB    . ASN A 1 710 ? -5.399  -36.077 32.606  1.00 126.85 ? 690 ASN A CB    1 
ATOM   5518  C  CG    . ASN A 1 710 ? -5.803  -37.106 31.560  1.00 128.32 ? 690 ASN A CG    1 
ATOM   5519  O  OD1   . ASN A 1 710 ? -5.935  -36.795 30.376  1.00 129.73 ? 690 ASN A OD1   1 
ATOM   5520  N  ND2   . ASN A 1 710 ? -6.016  -38.341 32.002  1.00 128.91 ? 690 ASN A ND2   1 
ATOM   5521  N  N     . VAL A 1 711 ? -3.952  -34.189 29.996  1.00 125.95 ? 691 VAL A N     1 
ATOM   5522  C  CA    . VAL A 1 711 ? -4.156  -33.164 28.963  1.00 125.53 ? 691 VAL A CA    1 
ATOM   5523  C  C     . VAL A 1 711 ? -5.524  -33.316 28.293  1.00 124.16 ? 691 VAL A C     1 
ATOM   5524  O  O     . VAL A 1 711 ? -6.243  -32.329 28.120  1.00 122.78 ? 691 VAL A O     1 
ATOM   5525  C  CB    . VAL A 1 711 ? -3.032  -33.199 27.892  1.00 125.78 ? 691 VAL A CB    1 
ATOM   5526  C  CG1   . VAL A 1 711 ? -3.303  -32.201 26.765  1.00 125.35 ? 691 VAL A CG1   1 
ATOM   5527  C  CG2   . VAL A 1 711 ? -1.676  -32.920 28.533  1.00 125.72 ? 691 VAL A CG2   1 
ATOM   5528  N  N     . ASP A 1 712 ? -5.875  -34.554 27.943  1.00 123.01 ? 692 ASP A N     1 
ATOM   5529  C  CA    . ASP A 1 712 ? -7.106  -34.856 27.192  1.00 121.86 ? 692 ASP A CA    1 
ATOM   5530  C  C     . ASP A 1 712 ? -8.175  -35.495 28.090  1.00 119.61 ? 692 ASP A C     1 
ATOM   5531  O  O     . ASP A 1 712 ? -8.652  -36.603 27.833  1.00 117.24 ? 692 ASP A O     1 
ATOM   5532  C  CB    . ASP A 1 712 ? -6.801  -35.710 25.940  1.00 122.21 ? 692 ASP A CB    1 
ATOM   5533  C  CG    . ASP A 1 712 ? -5.891  -36.907 26.224  1.00 123.11 ? 692 ASP A CG    1 
ATOM   5534  O  OD1   . ASP A 1 712 ? -5.729  -37.293 27.402  1.00 122.63 ? 692 ASP A OD1   1 
ATOM   5535  O  OD2   . ASP A 1 712 ? -5.327  -37.458 25.256  1.00 124.72 ? 692 ASP A OD2   1 
ATOM   5536  N  N     . ALA A 1 713 ? -8.533  -34.775 29.152  1.00 119.68 ? 693 ALA A N     1 
ATOM   5537  C  CA    . ALA A 1 713 ? -9.608  -35.180 30.066  1.00 120.15 ? 693 ALA A CA    1 
ATOM   5538  C  C     . ALA A 1 713 ? -10.132 -33.974 30.860  1.00 118.99 ? 693 ALA A C     1 
ATOM   5539  O  O     . ALA A 1 713 ? -10.262 -34.029 32.087  1.00 119.39 ? 693 ALA A O     1 
ATOM   5540  C  CB    . ALA A 1 713 ? -9.119  -36.278 31.004  1.00 120.81 ? 693 ALA A CB    1 
ATOM   5541  N  N     . LEU A 1 714 ? -10.442 -32.896 30.139  1.00 117.52 ? 694 LEU A N     1 
ATOM   5542  C  CA    . LEU A 1 714 ? -10.828 -31.615 30.735  1.00 117.83 ? 694 LEU A CA    1 
ATOM   5543  C  C     . LEU A 1 714 ? -12.200 -31.170 30.245  1.00 115.01 ? 694 LEU A C     1 
ATOM   5544  O  O     . LEU A 1 714 ? -12.597 -31.482 29.120  1.00 114.54 ? 694 LEU A O     1 
ATOM   5545  C  CB    . LEU A 1 714 ? -9.800  -30.539 30.371  1.00 120.99 ? 694 LEU A CB    1 
ATOM   5546  C  CG    . LEU A 1 714 ? -8.351  -30.762 30.814  1.00 122.98 ? 694 LEU A CG    1 
ATOM   5547  C  CD1   . LEU A 1 714 ? -7.418  -29.794 30.101  1.00 123.08 ? 694 LEU A CD1   1 
ATOM   5548  C  CD2   . LEU A 1 714 ? -8.218  -30.620 32.323  1.00 123.67 ? 694 LEU A CD2   1 
ATOM   5549  N  N     . THR A 1 715 ? -12.909 -30.426 31.092  1.00 113.22 ? 695 THR A N     1 
ATOM   5550  C  CA    . THR A 1 715 ? -14.182 -29.804 30.716  1.00 113.97 ? 695 THR A CA    1 
ATOM   5551  C  C     . THR A 1 715 ? -13.928 -28.562 29.852  1.00 114.78 ? 695 THR A C     1 
ATOM   5552  O  O     . THR A 1 715 ? -12.777 -28.161 29.651  1.00 115.09 ? 695 THR A O     1 
ATOM   5553  C  CB    . THR A 1 715 ? -15.008 -29.418 31.963  1.00 113.74 ? 695 THR A CB    1 
ATOM   5554  O  OG1   . THR A 1 715 ? -14.251 -28.529 32.792  1.00 114.06 ? 695 THR A OG1   1 
ATOM   5555  C  CG2   . THR A 1 715 ? -15.382 -30.657 32.766  1.00 113.71 ? 695 THR A CG2   1 
ATOM   5556  N  N     . GLU A 1 716 ? -15.002 -27.964 29.338  1.00 116.05 ? 696 GLU A N     1 
ATOM   5557  C  CA    . GLU A 1 716 ? -14.899 -26.760 28.499  1.00 116.48 ? 696 GLU A CA    1 
ATOM   5558  C  C     . GLU A 1 716 ? -14.427 -25.525 29.277  1.00 114.99 ? 696 GLU A C     1 
ATOM   5559  O  O     . GLU A 1 716 ? -13.736 -24.674 28.713  1.00 116.54 ? 696 GLU A O     1 
ATOM   5560  C  CB    . GLU A 1 716 ? -16.232 -26.469 27.794  1.00 118.65 ? 696 GLU A CB    1 
ATOM   5561  C  CG    . GLU A 1 716 ? -16.652 -27.530 26.782  1.00 119.91 ? 696 GLU A CG    1 
ATOM   5562  C  CD    . GLU A 1 716 ? -15.737 -27.594 25.569  1.00 120.96 ? 696 GLU A CD    1 
ATOM   5563  O  OE1   . GLU A 1 716 ? -15.586 -26.564 24.876  1.00 121.43 ? 696 GLU A OE1   1 
ATOM   5564  O  OE2   . GLU A 1 716 ? -15.171 -28.676 25.303  1.00 121.57 ? 696 GLU A OE2   1 
ATOM   5565  N  N     . ASN A 1 717 ? -14.803 -25.427 30.554  1.00 112.22 ? 697 ASN A N     1 
ATOM   5566  C  CA    . ASN A 1 717 ? -14.274 -24.382 31.448  1.00 109.90 ? 697 ASN A CA    1 
ATOM   5567  C  C     . ASN A 1 717 ? -12.777 -24.566 31.715  1.00 108.40 ? 697 ASN A C     1 
ATOM   5568  O  O     . ASN A 1 717 ? -12.020 -23.593 31.704  1.00 108.54 ? 697 ASN A O     1 
ATOM   5569  C  CB    . ASN A 1 717 ? -15.032 -24.359 32.784  1.00 109.17 ? 697 ASN A CB    1 
ATOM   5570  C  CG    . ASN A 1 717 ? -16.442 -23.810 32.655  1.00 108.81 ? 697 ASN A CG    1 
ATOM   5571  O  OD1   . ASN A 1 717 ? -16.683 -22.838 31.939  1.00 108.32 ? 697 ASN A OD1   1 
ATOM   5572  N  ND2   . ASN A 1 717 ? -17.380 -24.422 33.368  1.00 109.28 ? 697 ASN A ND2   1 
ATOM   5573  N  N     . GLN A 1 718 ? -12.367 -25.810 31.961  1.00 106.26 ? 698 GLN A N     1 
ATOM   5574  C  CA    . GLN A 1 718 ? -10.954 -26.152 32.188  1.00 104.61 ? 698 GLN A CA    1 
ATOM   5575  C  C     . GLN A 1 718 ? -10.089 -26.007 30.930  1.00 103.24 ? 698 GLN A C     1 
ATOM   5576  O  O     . GLN A 1 718 ? -8.923  -25.617 31.023  1.00 104.55 ? 698 GLN A O     1 
ATOM   5577  C  CB    . GLN A 1 718 ? -10.827 -27.577 32.737  1.00 104.34 ? 698 GLN A CB    1 
ATOM   5578  C  CG    . GLN A 1 718 ? -11.393 -27.754 34.138  1.00 103.85 ? 698 GLN A CG    1 
ATOM   5579  C  CD    . GLN A 1 718 ? -11.527 -29.210 34.551  1.00 103.25 ? 698 GLN A CD    1 
ATOM   5580  O  OE1   . GLN A 1 718 ? -10.885 -30.096 33.984  1.00 101.63 ? 698 GLN A OE1   1 
ATOM   5581  N  NE2   . GLN A 1 718 ? -12.365 -29.462 35.549  1.00 103.16 ? 698 GLN A NE2   1 
ATOM   5582  N  N     . LYS A 1 719 ? -10.656 -26.333 29.768  1.00 101.19 ? 699 LYS A N     1 
ATOM   5583  C  CA    . LYS A 1 719 ? -9.968  -26.160 28.482  1.00 100.08 ? 699 LYS A CA    1 
ATOM   5584  C  C     . LYS A 1 719 ? -9.812  -24.677 28.124  1.00 96.08  ? 699 LYS A C     1 
ATOM   5585  O  O     . LYS A 1 719 ? -8.768  -24.266 27.613  1.00 93.88  ? 699 LYS A O     1 
ATOM   5586  C  CB    . LYS A 1 719 ? -10.724 -26.891 27.364  1.00 103.21 ? 699 LYS A CB    1 
ATOM   5587  C  CG    . LYS A 1 719 ? -9.941  -27.044 26.066  1.00 105.19 ? 699 LYS A CG    1 
ATOM   5588  C  CD    . LYS A 1 719 ? -10.835 -27.506 24.925  1.00 106.53 ? 699 LYS A CD    1 
ATOM   5589  C  CE    . LYS A 1 719 ? -10.093 -27.498 23.598  1.00 107.43 ? 699 LYS A CE    1 
ATOM   5590  N  NZ    . LYS A 1 719 ? -11.007 -27.738 22.448  1.00 108.12 ? 699 LYS A NZ    1 
ATOM   5591  N  N     . ALA A 1 720 ? -10.858 -23.892 28.382  1.00 93.02  ? 700 ALA A N     1 
ATOM   5592  C  CA    . ALA A 1 720 ? -10.839 -22.445 28.140  1.00 91.39  ? 700 ALA A CA    1 
ATOM   5593  C  C     . ALA A 1 720 ? -9.882  -21.705 29.079  1.00 90.02  ? 700 ALA A C     1 
ATOM   5594  O  O     . ALA A 1 720 ? -9.213  -20.757 28.661  1.00 90.16  ? 700 ALA A O     1 
ATOM   5595  C  CB    . ALA A 1 720 ? -12.243 -21.868 28.262  1.00 91.28  ? 700 ALA A CB    1 
ATOM   5596  N  N     . LEU A 1 721 ? -9.831  -22.135 30.341  1.00 88.04  ? 701 LEU A N     1 
ATOM   5597  C  CA    . LEU A 1 721 ? -8.890  -21.583 31.321  1.00 86.39  ? 701 LEU A CA    1 
ATOM   5598  C  C     . LEU A 1 721 ? -7.446  -21.857 30.912  1.00 85.16  ? 701 LEU A C     1 
ATOM   5599  O  O     . LEU A 1 721 ? -6.612  -20.954 30.944  1.00 86.30  ? 701 LEU A O     1 
ATOM   5600  C  CB    . LEU A 1 721 ? -9.155  -22.165 32.717  1.00 86.64  ? 701 LEU A CB    1 
ATOM   5601  C  CG    . LEU A 1 721 ? -8.254  -21.725 33.880  1.00 86.12  ? 701 LEU A CG    1 
ATOM   5602  C  CD1   . LEU A 1 721 ? -8.210  -20.210 34.013  1.00 86.39  ? 701 LEU A CD1   1 
ATOM   5603  C  CD2   . LEU A 1 721 ? -8.729  -22.359 35.178  1.00 85.83  ? 701 LEU A CD2   1 
ATOM   5604  N  N     . ARG A 1 722 ? -7.166  -23.101 30.526  1.00 83.83  ? 702 ARG A N     1 
ATOM   5605  C  CA    . ARG A 1 722 ? -5.827  -23.499 30.075  1.00 83.59  ? 702 ARG A CA    1 
ATOM   5606  C  C     . ARG A 1 722 ? -5.410  -22.831 28.755  1.00 83.54  ? 702 ARG A C     1 
ATOM   5607  O  O     . ARG A 1 722 ? -4.215  -22.653 28.511  1.00 82.57  ? 702 ARG A O     1 
ATOM   5608  C  CB    . ARG A 1 722 ? -5.732  -25.024 29.948  1.00 83.37  ? 702 ARG A CB    1 
ATOM   5609  C  CG    . ARG A 1 722 ? -4.314  -25.547 29.781  1.00 82.71  ? 702 ARG A CG    1 
ATOM   5610  C  CD    . ARG A 1 722 ? -4.230  -27.036 30.065  1.00 82.73  ? 702 ARG A CD    1 
ATOM   5611  N  NE    . ARG A 1 722 ? -2.858  -27.533 29.960  1.00 82.88  ? 702 ARG A NE    1 
ATOM   5612  C  CZ    . ARG A 1 722 ? -2.232  -27.855 28.825  1.00 83.31  ? 702 ARG A CZ    1 
ATOM   5613  N  NH1   . ARG A 1 722 ? -2.832  -27.742 27.638  1.00 83.31  ? 702 ARG A NH1   1 
ATOM   5614  N  NH2   . ARG A 1 722 ? -0.977  -28.297 28.876  1.00 83.60  ? 702 ARG A NH2   1 
ATOM   5615  N  N     . ARG A 1 723 ? -6.383  -22.470 27.915  1.00 83.81  ? 703 ARG A N     1 
ATOM   5616  C  CA    . ARG A 1 723 ? -6.116  -21.657 26.718  1.00 84.03  ? 703 ARG A CA    1 
ATOM   5617  C  C     . ARG A 1 723 ? -5.602  -20.269 27.116  1.00 82.57  ? 703 ARG A C     1 
ATOM   5618  O  O     . ARG A 1 723 ? -4.617  -19.783 26.559  1.00 81.54  ? 703 ARG A O     1 
ATOM   5619  C  CB    . ARG A 1 723 ? -7.370  -21.515 25.838  1.00 85.39  ? 703 ARG A CB    1 
ATOM   5620  C  CG    . ARG A 1 723 ? -7.066  -21.122 24.394  1.00 86.33  ? 703 ARG A CG    1 
ATOM   5621  C  CD    . ARG A 1 723 ? -8.244  -20.486 23.667  1.00 86.72  ? 703 ARG A CD    1 
ATOM   5622  N  NE    . ARG A 1 723 ? -9.498  -21.223 23.848  1.00 87.28  ? 703 ARG A NE    1 
ATOM   5623  C  CZ    . ARG A 1 723 ? -10.491 -20.897 24.683  1.00 88.53  ? 703 ARG A CZ    1 
ATOM   5624  N  NH1   . ARG A 1 723 ? -10.431 -19.818 25.468  1.00 89.08  ? 703 ARG A NH1   1 
ATOM   5625  N  NH2   . ARG A 1 723 ? -11.574 -21.670 24.737  1.00 89.25  ? 703 ARG A NH2   1 
ATOM   5626  N  N     . ASP A 1 724 ? -6.267  -19.653 28.092  1.00 81.40  ? 704 ASP A N     1 
ATOM   5627  C  CA    . ASP A 1 724 ? -5.887  -18.323 28.588  1.00 80.66  ? 704 ASP A CA    1 
ATOM   5628  C  C     . ASP A 1 724 ? -4.544  -18.313 29.334  1.00 78.27  ? 704 ASP A C     1 
ATOM   5629  O  O     . ASP A 1 724 ? -3.870  -17.283 29.369  1.00 77.78  ? 704 ASP A O     1 
ATOM   5630  C  CB    . ASP A 1 724 ? -6.990  -17.746 29.491  1.00 81.61  ? 704 ASP A CB    1 
ATOM   5631  C  CG    . ASP A 1 724 ? -8.327  -17.575 28.768  1.00 82.59  ? 704 ASP A CG    1 
ATOM   5632  O  OD1   . ASP A 1 724 ? -8.394  -17.794 27.536  1.00 82.61  ? 704 ASP A OD1   1 
ATOM   5633  O  OD2   . ASP A 1 724 ? -9.319  -17.225 29.442  1.00 83.03  ? 704 ASP A OD2   1 
ATOM   5634  N  N     . VAL A 1 725 ? -4.165  -19.447 29.929  1.00 76.00  ? 705 VAL A N     1 
ATOM   5635  C  CA    . VAL A 1 725 ? -2.854  -19.598 30.575  1.00 74.56  ? 705 VAL A CA    1 
ATOM   5636  C  C     . VAL A 1 725 ? -1.740  -19.547 29.528  1.00 72.44  ? 705 VAL A C     1 
ATOM   5637  O  O     . VAL A 1 725 ? -0.804  -18.757 29.654  1.00 71.87  ? 705 VAL A O     1 
ATOM   5638  C  CB    . VAL A 1 725 ? -2.758  -20.914 31.397  1.00 75.53  ? 705 VAL A CB    1 
ATOM   5639  C  CG1   . VAL A 1 725 ? -1.328  -21.188 31.865  1.00 75.94  ? 705 VAL A CG1   1 
ATOM   5640  C  CG2   . VAL A 1 725 ? -3.694  -20.868 32.601  1.00 75.67  ? 705 VAL A CG2   1 
ATOM   5641  N  N     . HIS A 1 726 ? -1.850  -20.389 28.503  1.00 71.08  ? 706 HIS A N     1 
ATOM   5642  C  CA    . HIS A 1 726 ? -0.836  -20.462 27.442  1.00 70.43  ? 706 HIS A CA    1 
ATOM   5643  C  C     . HIS A 1 726 ? -0.867  -19.267 26.473  1.00 68.92  ? 706 HIS A C     1 
ATOM   5644  O  O     . HIS A 1 726 ? 0.163   -18.930 25.888  1.00 68.51  ? 706 HIS A O     1 
ATOM   5645  C  CB    . HIS A 1 726 ? -0.929  -21.794 26.682  1.00 70.45  ? 706 HIS A CB    1 
ATOM   5646  C  CG    . HIS A 1 726 ? -0.499  -22.980 27.492  1.00 70.35  ? 706 HIS A CG    1 
ATOM   5647  N  ND1   . HIS A 1 726 ? 0.814   -23.200 27.851  1.00 70.67  ? 706 HIS A ND1   1 
ATOM   5648  C  CD2   . HIS A 1 726 ? -1.207  -24.008 28.018  1.00 70.67  ? 706 HIS A CD2   1 
ATOM   5649  C  CE1   . HIS A 1 726 ? 0.896   -24.312 28.559  1.00 70.27  ? 706 HIS A CE1   1 
ATOM   5650  N  NE2   . HIS A 1 726 ? -0.316  -24.822 28.675  1.00 69.72  ? 706 HIS A NE2   1 
ATOM   5651  N  N     . LYS A 1 727 ? -2.031  -18.636 26.306  1.00 67.80  ? 707 LYS A N     1 
ATOM   5652  C  CA    . LYS A 1 727 ? -2.136  -17.400 25.508  1.00 67.60  ? 707 LYS A CA    1 
ATOM   5653  C  C     . LYS A 1 727 ? -1.433  -16.205 26.167  1.00 66.22  ? 707 LYS A C     1 
ATOM   5654  O  O     . LYS A 1 727 ? -0.868  -15.362 25.466  1.00 65.18  ? 707 LYS A O     1 
ATOM   5655  C  CB    . LYS A 1 727 ? -3.601  -17.051 25.203  1.00 68.59  ? 707 LYS A CB    1 
ATOM   5656  C  CG    . LYS A 1 727 ? -4.194  -17.843 24.044  1.00 68.79  ? 707 LYS A CG    1 
ATOM   5657  C  CD    . LYS A 1 727 ? -5.673  -17.543 23.839  1.00 68.97  ? 707 LYS A CD    1 
ATOM   5658  C  CE    . LYS A 1 727 ? -5.893  -16.195 23.167  1.00 68.74  ? 707 LYS A CE    1 
ATOM   5659  N  NZ    . LYS A 1 727 ? -7.331  -15.936 22.884  1.00 68.59  ? 707 LYS A NZ    1 
ATOM   5660  N  N     . THR A 1 728 ? -1.483  -16.133 27.499  1.00 65.49  ? 708 THR A N     1 
ATOM   5661  C  CA    . THR A 1 728 ? -0.750  -15.112 28.264  1.00 64.79  ? 708 THR A CA    1 
ATOM   5662  C  C     . THR A 1 728 ? 0.769   -15.304 28.151  1.00 65.33  ? 708 THR A C     1 
ATOM   5663  O  O     . THR A 1 728 ? 1.511   -14.322 28.096  1.00 66.00  ? 708 THR A O     1 
ATOM   5664  C  CB    . THR A 1 728 ? -1.156  -15.114 29.758  1.00 63.96  ? 708 THR A CB    1 
ATOM   5665  O  OG1   . THR A 1 728 ? -2.579  -15.003 29.875  1.00 63.30  ? 708 THR A OG1   1 
ATOM   5666  C  CG2   . THR A 1 728 ? -0.510  -13.953 30.514  1.00 63.85  ? 708 THR A CG2   1 
ATOM   5667  N  N     . ILE A 1 729 ? 1.219   -16.560 28.116  1.00 65.71  ? 709 ILE A N     1 
ATOM   5668  C  CA    . ILE A 1 729 ? 2.643   -16.883 27.926  1.00 66.25  ? 709 ILE A CA    1 
ATOM   5669  C  C     . ILE A 1 729 ? 3.141   -16.396 26.557  1.00 66.80  ? 709 ILE A C     1 
ATOM   5670  O  O     . ILE A 1 729 ? 4.264   -15.905 26.445  1.00 67.30  ? 709 ILE A O     1 
ATOM   5671  C  CB    . ILE A 1 729 ? 2.924   -18.401 28.112  1.00 66.37  ? 709 ILE A CB    1 
ATOM   5672  C  CG1   . ILE A 1 729 ? 2.693   -18.807 29.576  1.00 67.28  ? 709 ILE A CG1   1 
ATOM   5673  C  CG2   . ILE A 1 729 ? 4.354   -18.758 27.707  1.00 66.17  ? 709 ILE A CG2   1 
ATOM   5674  C  CD1   . ILE A 1 729 ? 2.536   -20.298 29.802  1.00 67.12  ? 709 ILE A CD1   1 
ATOM   5675  N  N     . ALA A 1 730 ? 2.304   -16.530 25.529  1.00 67.54  ? 710 ALA A N     1 
ATOM   5676  C  CA    . ALA A 1 730 ? 2.624   -16.024 24.191  1.00 68.16  ? 710 ALA A CA    1 
ATOM   5677  C  C     . ALA A 1 730 ? 2.688   -14.492 24.148  1.00 68.68  ? 710 ALA A C     1 
ATOM   5678  O  O     . ALA A 1 730 ? 3.597   -13.928 23.535  1.00 69.95  ? 710 ALA A O     1 
ATOM   5679  C  CB    . ALA A 1 730 ? 1.613   -16.537 23.175  1.00 68.57  ? 710 ALA A CB    1 
ATOM   5680  N  N     . LYS A 1 731 ? 1.729   -13.833 24.800  1.00 68.61  ? 711 LYS A N     1 
ATOM   5681  C  CA    . LYS A 1 731 ? 1.665   -12.366 24.826  1.00 68.71  ? 711 LYS A CA    1 
ATOM   5682  C  C     . LYS A 1 731 ? 2.790   -11.749 25.664  1.00 68.40  ? 711 LYS A C     1 
ATOM   5683  O  O     . LYS A 1 731 ? 3.455   -10.814 25.214  1.00 70.03  ? 711 LYS A O     1 
ATOM   5684  C  CB    . LYS A 1 731 ? 0.301   -11.890 25.341  1.00 69.25  ? 711 LYS A CB    1 
ATOM   5685  C  CG    . LYS A 1 731 ? 0.133   -10.376 25.362  1.00 69.79  ? 711 LYS A CG    1 
ATOM   5686  C  CD    . LYS A 1 731 ? -1.324  -9.965  25.498  1.00 70.70  ? 711 LYS A CD    1 
ATOM   5687  C  CE    . LYS A 1 731 ? -1.451  -8.493  25.864  1.00 72.01  ? 711 LYS A CE    1 
ATOM   5688  N  NZ    . LYS A 1 731 ? -0.746  -7.591  24.909  1.00 72.24  ? 711 LYS A NZ    1 
ATOM   5689  N  N     . VAL A 1 732 ? 2.993   -12.274 26.873  1.00 66.48  ? 712 VAL A N     1 
ATOM   5690  C  CA    . VAL A 1 732 ? 4.033   -11.773 27.787  1.00 65.45  ? 712 VAL A CA    1 
ATOM   5691  C  C     . VAL A 1 732 ? 5.445   -11.969 27.205  1.00 65.35  ? 712 VAL A C     1 
ATOM   5692  O  O     . VAL A 1 732 ? 6.320   -11.122 27.408  1.00 63.83  ? 712 VAL A O     1 
ATOM   5693  C  CB    . VAL A 1 732 ? 3.903   -12.408 29.198  1.00 65.03  ? 712 VAL A CB    1 
ATOM   5694  C  CG1   . VAL A 1 732 ? 5.104   -12.087 30.084  1.00 65.22  ? 712 VAL A CG1   1 
ATOM   5695  C  CG2   . VAL A 1 732 ? 2.630   -11.923 29.878  1.00 64.99  ? 712 VAL A CG2   1 
ATOM   5696  N  N     . THR A 1 733 ? 5.656   -13.071 26.483  1.00 65.99  ? 713 THR A N     1 
ATOM   5697  C  CA    . THR A 1 733 ? 6.914   -13.305 25.760  1.00 66.43  ? 713 THR A CA    1 
ATOM   5698  C  C     . THR A 1 733 ? 7.141   -12.255 24.665  1.00 66.06  ? 713 THR A C     1 
ATOM   5699  O  O     . THR A 1 733 ? 8.258   -11.756 24.512  1.00 66.78  ? 713 THR A O     1 
ATOM   5700  C  CB    . THR A 1 733 ? 6.965   -14.724 25.141  1.00 66.75  ? 713 THR A CB    1 
ATOM   5701  O  OG1   . THR A 1 733 ? 6.852   -15.706 26.179  1.00 67.42  ? 713 THR A OG1   1 
ATOM   5702  C  CG2   . THR A 1 733 ? 8.277   -14.958 24.384  1.00 66.79  ? 713 THR A CG2   1 
ATOM   5703  N  N     . ASP A 1 734 ? 6.088   -11.924 23.919  1.00 65.38  ? 714 ASP A N     1 
ATOM   5704  C  CA    . ASP A 1 734 ? 6.177   -10.925 22.846  1.00 65.38  ? 714 ASP A CA    1 
ATOM   5705  C  C     . ASP A 1 734 ? 6.337   -9.497  23.377  1.00 64.66  ? 714 ASP A C     1 
ATOM   5706  O  O     . ASP A 1 734 ? 7.114   -8.714  22.825  1.00 63.90  ? 714 ASP A O     1 
ATOM   5707  C  CB    . ASP A 1 734 ? 4.945   -10.999 21.936  1.00 65.66  ? 714 ASP A CB    1 
ATOM   5708  C  CG    . ASP A 1 734 ? 5.080   -10.128 20.693  1.00 66.00  ? 714 ASP A CG    1 
ATOM   5709  O  OD1   . ASP A 1 734 ? 6.103   -10.244 19.984  1.00 65.75  ? 714 ASP A OD1   1 
ATOM   5710  O  OD2   . ASP A 1 734 ? 4.160   -9.328  20.421  1.00 66.55  ? 714 ASP A OD2   1 
ATOM   5711  N  N     . ASP A 1 735 ? 5.597   -9.168  24.435  1.00 64.46  ? 715 ASP A N     1 
ATOM   5712  C  CA    . ASP A 1 735 ? 5.610   -7.818  25.017  1.00 64.63  ? 715 ASP A CA    1 
ATOM   5713  C  C     . ASP A 1 735 ? 6.938   -7.464  25.700  1.00 64.39  ? 715 ASP A C     1 
ATOM   5714  O  O     . ASP A 1 735 ? 7.409   -6.330  25.586  1.00 64.02  ? 715 ASP A O     1 
ATOM   5715  C  CB    . ASP A 1 735 ? 4.443   -7.641  26.003  1.00 64.63  ? 715 ASP A CB    1 
ATOM   5716  C  CG    . ASP A 1 735 ? 3.079   -7.607  25.314  1.00 64.87  ? 715 ASP A CG    1 
ATOM   5717  O  OD1   . ASP A 1 735 ? 2.983   -7.971  24.119  1.00 65.26  ? 715 ASP A OD1   1 
ATOM   5718  O  OD2   . ASP A 1 735 ? 2.092   -7.218  25.976  1.00 63.81  ? 715 ASP A OD2   1 
ATOM   5719  N  N     . ILE A 1 736 ? 7.530   -8.429  26.404  1.00 64.62  ? 716 ILE A N     1 
ATOM   5720  C  CA    . ILE A 1 736 ? 8.841   -8.244  27.040  1.00 64.49  ? 716 ILE A CA    1 
ATOM   5721  C  C     . ILE A 1 736 ? 9.968   -8.314  26.001  1.00 64.97  ? 716 ILE A C     1 
ATOM   5722  O  O     . ILE A 1 736 ? 10.849  -7.453  25.980  1.00 64.97  ? 716 ILE A O     1 
ATOM   5723  C  CB    . ILE A 1 736 ? 9.079   -9.275  28.177  1.00 63.98  ? 716 ILE A CB    1 
ATOM   5724  C  CG1   . ILE A 1 736 ? 8.107   -9.013  29.335  1.00 63.71  ? 716 ILE A CG1   1 
ATOM   5725  C  CG2   . ILE A 1 736 ? 10.518  -9.215  28.688  1.00 64.31  ? 716 ILE A CG2   1 
ATOM   5726  C  CD1   . ILE A 1 736 ? 8.020   -10.136 30.349  1.00 63.77  ? 716 ILE A CD1   1 
ATOM   5727  N  N     . GLY A 1 737 ? 9.931   -9.338  25.150  1.00 65.91  ? 717 GLY A N     1 
ATOM   5728  C  CA    . GLY A 1 737 ? 10.997  -9.592  24.182  1.00 67.46  ? 717 GLY A CA    1 
ATOM   5729  C  C     . GLY A 1 737 ? 11.090  -8.575  23.059  1.00 69.02  ? 717 GLY A C     1 
ATOM   5730  O  O     . GLY A 1 737 ? 12.076  -7.845  22.960  1.00 71.06  ? 717 GLY A O     1 
ATOM   5731  N  N     . ARG A 1 738 ? 10.058  -8.528  22.220  1.00 70.40  ? 718 ARG A N     1 
ATOM   5732  C  CA    . ARG A 1 738 ? 10.053  -7.680  21.023  1.00 71.39  ? 718 ARG A CA    1 
ATOM   5733  C  C     . ARG A 1 738 ? 9.711   -6.219  21.329  1.00 72.45  ? 718 ARG A C     1 
ATOM   5734  O  O     . ARG A 1 738 ? 10.446  -5.310  20.935  1.00 74.34  ? 718 ARG A O     1 
ATOM   5735  C  CB    . ARG A 1 738 ? 9.064   -8.233  19.990  1.00 71.45  ? 718 ARG A CB    1 
ATOM   5736  C  CG    . ARG A 1 738 ? 9.100   -7.536  18.634  1.00 71.41  ? 718 ARG A CG    1 
ATOM   5737  C  CD    . ARG A 1 738 ? 8.227   -8.249  17.611  1.00 71.53  ? 718 ARG A CD    1 
ATOM   5738  N  NE    . ARG A 1 738 ? 6.818   -8.292  18.010  1.00 71.12  ? 718 ARG A NE    1 
ATOM   5739  C  CZ    . ARG A 1 738 ? 5.956   -7.275  17.934  1.00 70.89  ? 718 ARG A CZ    1 
ATOM   5740  N  NH1   . ARG A 1 738 ? 6.324   -6.080  17.471  1.00 71.44  ? 718 ARG A NH1   1 
ATOM   5741  N  NH2   . ARG A 1 738 ? 4.700   -7.453  18.334  1.00 71.26  ? 718 ARG A NH2   1 
ATOM   5742  N  N     . ARG A 1 739 ? 8.600   -6.006  22.031  1.00 71.99  ? 719 ARG A N     1 
ATOM   5743  C  CA    . ARG A 1 739 ? 7.981   -4.677  22.152  1.00 71.76  ? 719 ARG A CA    1 
ATOM   5744  C  C     . ARG A 1 739 ? 8.543   -3.796  23.274  1.00 70.57  ? 719 ARG A C     1 
ATOM   5745  O  O     . ARG A 1 739 ? 8.561   -2.571  23.140  1.00 69.57  ? 719 ARG A O     1 
ATOM   5746  C  CB    . ARG A 1 739 ? 6.468   -4.821  22.357  1.00 72.49  ? 719 ARG A CB    1 
ATOM   5747  C  CG    . ARG A 1 739 ? 5.748   -5.644  21.296  1.00 73.30  ? 719 ARG A CG    1 
ATOM   5748  C  CD    . ARG A 1 739 ? 4.281   -5.831  21.652  1.00 73.74  ? 719 ARG A CD    1 
ATOM   5749  N  NE    . ARG A 1 739 ? 3.523   -4.581  21.552  1.00 74.47  ? 719 ARG A NE    1 
ATOM   5750  C  CZ    . ARG A 1 739 ? 2.283   -4.390  22.010  1.00 74.41  ? 719 ARG A CZ    1 
ATOM   5751  N  NH1   . ARG A 1 739 ? 1.612   -5.363  22.629  1.00 74.97  ? 719 ARG A NH1   1 
ATOM   5752  N  NH2   . ARG A 1 739 ? 1.704   -3.201  21.851  1.00 74.13  ? 719 ARG A NH2   1 
ATOM   5753  N  N     . GLN A 1 740 ? 8.982   -4.418  24.370  1.00 70.36  ? 720 GLN A N     1 
ATOM   5754  C  CA    . GLN A 1 740 ? 9.318   -3.719  25.623  1.00 70.81  ? 720 GLN A CA    1 
ATOM   5755  C  C     . GLN A 1 740 ? 8.143   -2.880  26.161  1.00 71.03  ? 720 GLN A C     1 
ATOM   5756  O  O     . GLN A 1 740 ? 8.337   -1.781  26.693  1.00 72.46  ? 720 GLN A O     1 
ATOM   5757  C  CB    . GLN A 1 740 ? 10.596  -2.870  25.483  1.00 71.09  ? 720 GLN A CB    1 
ATOM   5758  C  CG    . GLN A 1 740 ? 11.855  -3.673  25.177  1.00 71.30  ? 720 GLN A CG    1 
ATOM   5759  C  CD    . GLN A 1 740 ? 12.100  -3.881  23.692  1.00 70.89  ? 720 GLN A CD    1 
ATOM   5760  O  OE1   . GLN A 1 740 ? 12.048  -2.938  22.902  1.00 70.39  ? 720 GLN A OE1   1 
ATOM   5761  N  NE2   . GLN A 1 740 ? 12.388  -5.120  23.311  1.00 70.28  ? 720 GLN A NE2   1 
ATOM   5762  N  N     . THR A 1 741 ? 6.930   -3.417  26.016  1.00 70.00  ? 721 THR A N     1 
ATOM   5763  C  CA    . THR A 1 741 ? 5.717   -2.817  26.562  1.00 68.33  ? 721 THR A CA    1 
ATOM   5764  C  C     . THR A 1 741 ? 5.338   -3.615  27.800  1.00 67.81  ? 721 THR A C     1 
ATOM   5765  O  O     . THR A 1 741 ? 4.427   -4.444  27.769  1.00 68.30  ? 721 THR A O     1 
ATOM   5766  C  CB    . THR A 1 741 ? 4.563   -2.842  25.542  1.00 67.60  ? 721 THR A CB    1 
ATOM   5767  O  OG1   . THR A 1 741 ? 4.378   -4.177  25.054  1.00 66.45  ? 721 THR A OG1   1 
ATOM   5768  C  CG2   . THR A 1 741 ? 4.863   -1.915  24.375  1.00 68.12  ? 721 THR A CG2   1 
ATOM   5769  N  N     . PHE A 1 742 ? 6.054   -3.355  28.889  1.00 67.34  ? 722 PHE A N     1 
ATOM   5770  C  CA    . PHE A 1 742 ? 5.907   -4.130  30.126  1.00 67.25  ? 722 PHE A CA    1 
ATOM   5771  C  C     . PHE A 1 742 ? 4.560   -3.903  30.815  1.00 66.75  ? 722 PHE A C     1 
ATOM   5772  O  O     . PHE A 1 742 ? 4.060   -4.798  31.498  1.00 66.26  ? 722 PHE A O     1 
ATOM   5773  C  CB    . PHE A 1 742 ? 7.042   -3.818  31.112  1.00 67.95  ? 722 PHE A CB    1 
ATOM   5774  C  CG    . PHE A 1 742 ? 8.431   -4.002  30.540  1.00 68.62  ? 722 PHE A CG    1 
ATOM   5775  C  CD1   . PHE A 1 742 ? 8.761   -5.127  29.781  1.00 68.96  ? 722 PHE A CD1   1 
ATOM   5776  C  CD2   . PHE A 1 742 ? 9.419   -3.048  30.772  1.00 68.97  ? 722 PHE A CD2   1 
ATOM   5777  C  CE1   . PHE A 1 742 ? 10.040  -5.285  29.260  1.00 68.70  ? 722 PHE A CE1   1 
ATOM   5778  C  CE2   . PHE A 1 742 ? 10.697  -3.207  30.254  1.00 69.04  ? 722 PHE A CE2   1 
ATOM   5779  C  CZ    . PHE A 1 742 ? 11.008  -4.325  29.498  1.00 68.62  ? 722 PHE A CZ    1 
ATOM   5780  N  N     . ASN A 1 743 ? 3.990   -2.709  30.640  1.00 66.78  ? 723 ASN A N     1 
ATOM   5781  C  CA    . ASN A 1 743 ? 2.663   -2.380  31.179  1.00 67.37  ? 723 ASN A CA    1 
ATOM   5782  C  C     . ASN A 1 743 ? 1.547   -3.300  30.659  1.00 68.59  ? 723 ASN A C     1 
ATOM   5783  O  O     . ASN A 1 743 ? 0.662   -3.686  31.427  1.00 69.12  ? 723 ASN A O     1 
ATOM   5784  C  CB    . ASN A 1 743 ? 2.311   -0.902  30.920  1.00 67.39  ? 723 ASN A CB    1 
ATOM   5785  C  CG    . ASN A 1 743 ? 2.198   -0.563  29.439  1.00 67.70  ? 723 ASN A CG    1 
ATOM   5786  O  OD1   . ASN A 1 743 ? 2.851   -1.179  28.594  1.00 67.32  ? 723 ASN A OD1   1 
ATOM   5787  N  ND2   . ASN A 1 743 ? 1.366   0.424   29.121  1.00 67.68  ? 723 ASN A ND2   1 
ATOM   5788  N  N     . THR A 1 744 ? 1.603   -3.655  29.373  1.00 68.91  ? 724 THR A N     1 
ATOM   5789  C  CA    . THR A 1 744 ? 0.622   -4.564  28.762  1.00 69.75  ? 724 THR A CA    1 
ATOM   5790  C  C     . THR A 1 744 ? 0.889   -6.036  29.108  1.00 70.00  ? 724 THR A C     1 
ATOM   5791  O  O     . THR A 1 744 ? -0.047  -6.839  29.168  1.00 71.08  ? 724 THR A O     1 
ATOM   5792  C  CB    . THR A 1 744 ? 0.575   -4.409  27.228  1.00 69.88  ? 724 THR A CB    1 
ATOM   5793  O  OG1   . THR A 1 744 ? 1.884   -4.605  26.680  1.00 71.07  ? 724 THR A OG1   1 
ATOM   5794  C  CG2   . THR A 1 744 ? 0.069   -3.029  26.847  1.00 69.65  ? 724 THR A CG2   1 
ATOM   5795  N  N     . ALA A 1 745 ? 2.159   -6.384  29.314  1.00 69.46  ? 725 ALA A N     1 
ATOM   5796  C  CA    . ALA A 1 745 ? 2.544   -7.722  29.774  1.00 69.15  ? 725 ALA A CA    1 
ATOM   5797  C  C     . ALA A 1 745 ? 2.040   -7.981  31.190  1.00 68.49  ? 725 ALA A C     1 
ATOM   5798  O  O     . ALA A 1 745 ? 1.481   -9.041  31.469  1.00 67.79  ? 725 ALA A O     1 
ATOM   5799  C  CB    . ALA A 1 745 ? 4.055   -7.890  29.724  1.00 69.89  ? 725 ALA A CB    1 
ATOM   5800  N  N     . ILE A 1 746 ? 2.248   -7.004  32.071  1.00 68.53  ? 726 ILE A N     1 
ATOM   5801  C  CA    . ILE A 1 746 ? 1.778   -7.080  33.459  1.00 69.24  ? 726 ILE A CA    1 
ATOM   5802  C  C     . ILE A 1 746 ? 0.246   -7.089  33.502  1.00 70.32  ? 726 ILE A C     1 
ATOM   5803  O  O     . ILE A 1 746 ? -0.345  -7.858  34.264  1.00 72.10  ? 726 ILE A O     1 
ATOM   5804  C  CB    . ILE A 1 746 ? 2.351   -5.926  34.324  1.00 68.84  ? 726 ILE A CB    1 
ATOM   5805  C  CG1   . ILE A 1 746 ? 3.872   -6.071  34.465  1.00 69.37  ? 726 ILE A CG1   1 
ATOM   5806  C  CG2   . ILE A 1 746 ? 1.714   -5.902  35.715  1.00 68.45  ? 726 ILE A CG2   1 
ATOM   5807  C  CD1   . ILE A 1 746 ? 4.584   -4.777  34.793  1.00 70.20  ? 726 ILE A CD1   1 
ATOM   5808  N  N     . ALA A 1 747 ? -0.382  -6.245  32.681  1.00 69.95  ? 727 ALA A N     1 
ATOM   5809  C  CA    . ALA A 1 747 ? -1.846  -6.197  32.565  1.00 69.93  ? 727 ALA A CA    1 
ATOM   5810  C  C     . ALA A 1 747 ? -2.450  -7.527  32.103  1.00 70.08  ? 727 ALA A C     1 
ATOM   5811  O  O     . ALA A 1 747 ? -3.509  -7.931  32.587  1.00 69.53  ? 727 ALA A O     1 
ATOM   5812  C  CB    . ALA A 1 747 ? -2.265  -5.080  31.621  1.00 69.99  ? 727 ALA A CB    1 
ATOM   5813  N  N     . ALA A 1 748 ? -1.773  -8.194  31.169  1.00 70.42  ? 728 ALA A N     1 
ATOM   5814  C  CA    . ALA A 1 748 ? -2.186  -9.520  30.698  1.00 70.94  ? 728 ALA A CA    1 
ATOM   5815  C  C     . ALA A 1 748 ? -2.143  -10.578 31.806  1.00 70.98  ? 728 ALA A C     1 
ATOM   5816  O  O     . ALA A 1 748 ? -3.015  -11.446 31.868  1.00 72.28  ? 728 ALA A O     1 
ATOM   5817  C  CB    . ALA A 1 748 ? -1.324  -9.957  29.523  1.00 70.86  ? 728 ALA A CB    1 
ATOM   5818  N  N     . ILE A 1 749 ? -1.133  -10.496 32.673  1.00 70.47  ? 729 ILE A N     1 
ATOM   5819  C  CA    . ILE A 1 749 ? -0.990  -11.426 33.802  1.00 70.74  ? 729 ILE A CA    1 
ATOM   5820  C  C     . ILE A 1 749 ? -2.025  -11.130 34.901  1.00 71.53  ? 729 ILE A C     1 
ATOM   5821  O  O     . ILE A 1 749 ? -2.469  -12.049 35.593  1.00 73.38  ? 729 ILE A O     1 
ATOM   5822  C  CB    . ILE A 1 749 ? 0.446   -11.408 34.388  1.00 70.31  ? 729 ILE A CB    1 
ATOM   5823  C  CG1   . ILE A 1 749 ? 1.476   -11.806 33.317  1.00 70.02  ? 729 ILE A CG1   1 
ATOM   5824  C  CG2   . ILE A 1 749 ? 0.568   -12.363 35.575  1.00 70.19  ? 729 ILE A CG2   1 
ATOM   5825  C  CD1   . ILE A 1 749 ? 2.884   -11.325 33.601  1.00 69.29  ? 729 ILE A CD1   1 
ATOM   5826  N  N     . MET A 1 750 ? -2.402  -9.859  35.062  1.00 71.25  ? 730 MET A N     1 
ATOM   5827  C  CA    . MET A 1 750 ? -3.471  -9.477  36.000  1.00 71.18  ? 730 MET A CA    1 
ATOM   5828  C  C     . MET A 1 750 ? -4.831  -10.071 35.614  1.00 72.21  ? 730 MET A C     1 
ATOM   5829  O  O     . MET A 1 750 ? -5.606  -10.455 36.491  1.00 72.06  ? 730 MET A O     1 
ATOM   5830  C  CB    . MET A 1 750 ? -3.587  -7.952  36.120  1.00 70.28  ? 730 MET A CB    1 
ATOM   5831  C  CG    . MET A 1 750 ? -2.502  -7.311  36.969  1.00 69.24  ? 730 MET A CG    1 
ATOM   5832  S  SD    . MET A 1 750 ? -2.737  -5.534  37.148  1.00 67.97  ? 730 MET A SD    1 
ATOM   5833  C  CE    . MET A 1 750 ? -1.435  -5.130  38.308  1.00 68.73  ? 730 MET A CE    1 
ATOM   5834  N  N     . GLU A 1 751 ? -5.114  -10.133 34.311  1.00 73.26  ? 731 GLU A N     1 
ATOM   5835  C  CA    . GLU A 1 751 ? -6.333  -10.777 33.800  1.00 74.29  ? 731 GLU A CA    1 
ATOM   5836  C  C     . GLU A 1 751 ? -6.371  -12.265 34.141  1.00 73.79  ? 731 GLU A C     1 
ATOM   5837  O  O     . GLU A 1 751 ? -7.392  -12.769 34.610  1.00 74.82  ? 731 GLU A O     1 
ATOM   5838  C  CB    . GLU A 1 751 ? -6.452  -10.608 32.281  1.00 76.39  ? 731 GLU A CB    1 
ATOM   5839  C  CG    . GLU A 1 751 ? -6.760  -9.189  31.828  1.00 78.14  ? 731 GLU A CG    1 
ATOM   5840  C  CD    . GLU A 1 751 ? -6.812  -9.038  30.316  1.00 79.84  ? 731 GLU A CD    1 
ATOM   5841  O  OE1   . GLU A 1 751 ? -5.993  -9.665  29.610  1.00 81.69  ? 731 GLU A OE1   1 
ATOM   5842  O  OE2   . GLU A 1 751 ? -7.674  -8.278  29.827  1.00 81.57  ? 731 GLU A OE2   1 
ATOM   5843  N  N     . LEU A 1 752 ? -5.254  -12.951 33.896  1.00 72.30  ? 732 LEU A N     1 
ATOM   5844  C  CA    . LEU A 1 752 ? -5.122  -14.387 34.175  1.00 70.95  ? 732 LEU A CA    1 
ATOM   5845  C  C     . LEU A 1 752 ? -5.276  -14.709 35.661  1.00 71.91  ? 732 LEU A C     1 
ATOM   5846  O  O     . LEU A 1 752 ? -5.924  -15.693 36.014  1.00 72.76  ? 732 LEU A O     1 
ATOM   5847  C  CB    . LEU A 1 752 ? -3.771  -14.907 33.667  1.00 69.51  ? 732 LEU A CB    1 
ATOM   5848  C  CG    . LEU A 1 752 ? -3.452  -16.397 33.840  1.00 68.64  ? 732 LEU A CG    1 
ATOM   5849  C  CD1   . LEU A 1 752 ? -4.497  -17.266 33.161  1.00 68.59  ? 732 LEU A CD1   1 
ATOM   5850  C  CD2   . LEU A 1 752 ? -2.066  -16.704 33.296  1.00 68.59  ? 732 LEU A CD2   1 
ATOM   5851  N  N     . MET A 1 753 ? -4.676  -13.884 36.517  1.00 73.68  ? 733 MET A N     1 
ATOM   5852  C  CA    . MET A 1 753 ? -4.806  -14.036 37.974  1.00 75.34  ? 733 MET A CA    1 
ATOM   5853  C  C     . MET A 1 753 ? -6.246  -13.872 38.467  1.00 77.40  ? 733 MET A C     1 
ATOM   5854  O  O     . MET A 1 753 ? -6.646  -14.537 39.423  1.00 78.49  ? 733 MET A O     1 
ATOM   5855  C  CB    . MET A 1 753 ? -3.891  -13.051 38.718  1.00 75.80  ? 733 MET A CB    1 
ATOM   5856  C  CG    . MET A 1 753 ? -2.450  -13.518 38.870  1.00 76.31  ? 733 MET A CG    1 
ATOM   5857  S  SD    . MET A 1 753 ? -2.238  -15.007 39.875  1.00 76.19  ? 733 MET A SD    1 
ATOM   5858  C  CE    . MET A 1 753 ? -3.028  -14.526 41.409  1.00 75.65  ? 733 MET A CE    1 
ATOM   5859  N  N     . ASN A 1 754 ? -7.009  -12.989 37.823  1.00 79.80  ? 734 ASN A N     1 
ATOM   5860  C  CA    . ASN A 1 754 ? -8.433  -12.815 38.137  1.00 81.78  ? 734 ASN A CA    1 
ATOM   5861  C  C     . ASN A 1 754 ? -9.276  -14.020 37.700  1.00 84.18  ? 734 ASN A C     1 
ATOM   5862  O  O     . ASN A 1 754 ? -10.217 -14.399 38.401  1.00 86.71  ? 734 ASN A O     1 
ATOM   5863  C  CB    . ASN A 1 754 ? -8.979  -11.527 37.505  1.00 81.27  ? 734 ASN A CB    1 
ATOM   5864  C  CG    . ASN A 1 754 ? -8.367  -10.271 38.104  1.00 80.83  ? 734 ASN A CG    1 
ATOM   5865  O  OD1   . ASN A 1 754 ? -7.524  -10.333 39.002  1.00 79.81  ? 734 ASN A OD1   1 
ATOM   5866  N  ND2   . ASN A 1 754 ? -8.790  -9.117  37.602  1.00 81.16  ? 734 ASN A ND2   1 
ATOM   5867  N  N     . LYS A 1 755 ? -8.937  -14.610 36.552  1.00 84.86  ? 735 LYS A N     1 
ATOM   5868  C  CA    . LYS A 1 755 ? -9.594  -15.837 36.070  1.00 84.89  ? 735 LYS A CA    1 
ATOM   5869  C  C     . LYS A 1 755 ? -9.252  -17.066 36.921  1.00 84.00  ? 735 LYS A C     1 
ATOM   5870  O  O     . LYS A 1 755 ? -10.125 -17.895 37.186  1.00 86.18  ? 735 LYS A O     1 
ATOM   5871  C  CB    . LYS A 1 755 ? -9.245  -16.103 34.600  1.00 86.04  ? 735 LYS A CB    1 
ATOM   5872  C  CG    . LYS A 1 755 ? -9.843  -15.086 33.643  1.00 87.63  ? 735 LYS A CG    1 
ATOM   5873  C  CD    . LYS A 1 755 ? -9.444  -15.350 32.201  1.00 88.44  ? 735 LYS A CD    1 
ATOM   5874  C  CE    . LYS A 1 755 ? -10.079 -14.329 31.267  1.00 89.52  ? 735 LYS A CE    1 
ATOM   5875  N  NZ    . LYS A 1 755 ? -9.700  -14.541 29.842  1.00 89.88  ? 735 LYS A NZ    1 
ATOM   5876  N  N     . LEU A 1 756 ? -7.990  -17.182 37.334  1.00 81.69  ? 736 LEU A N     1 
ATOM   5877  C  CA    . LEU A 1 756 ? -7.549  -18.268 38.223  1.00 81.17  ? 736 LEU A CA    1 
ATOM   5878  C  C     . LEU A 1 756 ? -8.198  -18.212 39.613  1.00 81.96  ? 736 LEU A C     1 
ATOM   5879  O  O     . LEU A 1 756 ? -8.447  -19.253 40.222  1.00 81.70  ? 736 LEU A O     1 
ATOM   5880  C  CB    . LEU A 1 756 ? -6.021  -18.268 38.366  1.00 80.22  ? 736 LEU A CB    1 
ATOM   5881  C  CG    . LEU A 1 756 ? -5.222  -18.684 37.125  1.00 79.55  ? 736 LEU A CG    1 
ATOM   5882  C  CD1   . LEU A 1 756 ? -3.781  -18.201 37.217  1.00 79.26  ? 736 LEU A CD1   1 
ATOM   5883  C  CD2   . LEU A 1 756 ? -5.264  -20.190 36.919  1.00 79.34  ? 736 LEU A CD2   1 
ATOM   5884  N  N     . ALA A 1 757 ? -8.460  -17.002 40.107  1.00 83.97  ? 737 ALA A N     1 
ATOM   5885  C  CA    . ALA A 1 757 ? -9.128  -16.809 41.398  1.00 86.45  ? 737 ALA A CA    1 
ATOM   5886  C  C     . ALA A 1 757 ? -10.556 -17.349 41.386  1.00 89.43  ? 737 ALA A C     1 
ATOM   5887  O  O     . ALA A 1 757 ? -10.971 -18.033 42.323  1.00 89.53  ? 737 ALA A O     1 
ATOM   5888  C  CB    . ALA A 1 757 ? -9.130  -15.336 41.781  1.00 86.46  ? 737 ALA A CB    1 
ATOM   5889  N  N     . LYS A 1 758 ? -11.294 -17.035 40.322  1.00 94.10  ? 738 LYS A N     1 
ATOM   5890  C  CA    . LYS A 1 758 ? -12.675 -17.503 40.152  1.00 98.21  ? 738 LYS A CA    1 
ATOM   5891  C  C     . LYS A 1 758 ? -12.784 -19.007 39.855  1.00 100.98 ? 738 LYS A C     1 
ATOM   5892  O  O     . LYS A 1 758 ? -13.798 -19.626 40.185  1.00 100.66 ? 738 LYS A O     1 
ATOM   5893  C  CB    . LYS A 1 758 ? -13.381 -16.711 39.044  1.00 99.07  ? 738 LYS A CB    1 
ATOM   5894  C  CG    . LYS A 1 758 ? -13.558 -15.232 39.353  1.00 100.60 ? 738 LYS A CG    1 
ATOM   5895  C  CD    . LYS A 1 758 ? -14.350 -14.531 38.259  1.00 102.37 ? 738 LYS A CD    1 
ATOM   5896  C  CE    . LYS A 1 758 ? -14.510 -13.043 38.535  1.00 103.39 ? 738 LYS A CE    1 
ATOM   5897  N  NZ    . LYS A 1 758 ? -13.250 -12.274 38.326  1.00 103.56 ? 738 LYS A NZ    1 
ATOM   5898  N  N     . ALA A 1 759 ? -11.754 -19.583 39.232  1.00 104.92 ? 739 ALA A N     1 
ATOM   5899  C  CA    . ALA A 1 759 ? -11.744 -21.009 38.880  1.00 108.59 ? 739 ALA A CA    1 
ATOM   5900  C  C     . ALA A 1 759 ? -11.712 -21.898 40.134  1.00 111.51 ? 739 ALA A C     1 
ATOM   5901  O  O     . ALA A 1 759 ? -10.782 -21.774 40.936  1.00 112.62 ? 739 ALA A O     1 
ATOM   5902  C  CB    . ALA A 1 759 ? -10.548 -21.324 37.993  1.00 108.73 ? 739 ALA A CB    1 
ATOM   5903  N  N     . PRO A 1 760 ? -12.722 -22.785 40.315  1.00 114.36 ? 740 PRO A N     1 
ATOM   5904  C  CA    . PRO A 1 760 ? -12.693 -23.693 41.475  1.00 115.22 ? 740 PRO A CA    1 
ATOM   5905  C  C     . PRO A 1 760 ? -11.581 -24.746 41.393  1.00 115.35 ? 740 PRO A C     1 
ATOM   5906  O  O     . PRO A 1 760 ? -11.412 -25.375 40.346  1.00 112.50 ? 740 PRO A O     1 
ATOM   5907  C  CB    . PRO A 1 760 ? -14.073 -24.372 41.438  1.00 115.48 ? 740 PRO A CB    1 
ATOM   5908  C  CG    . PRO A 1 760 ? -14.917 -23.522 40.557  1.00 115.01 ? 740 PRO A CG    1 
ATOM   5909  C  CD    . PRO A 1 760 ? -13.979 -22.927 39.555  1.00 114.63 ? 740 PRO A CD    1 
ATOM   5910  N  N     . THR A 1 761 ? -10.848 -24.923 42.494  1.00 117.71 ? 741 THR A N     1 
ATOM   5911  C  CA    . THR A 1 761 ? -9.735  -25.879 42.578  1.00 119.94 ? 741 THR A CA    1 
ATOM   5912  C  C     . THR A 1 761 ? -10.063 -27.003 43.570  1.00 121.65 ? 741 THR A C     1 
ATOM   5913  O  O     . THR A 1 761 ? -9.284  -27.296 44.484  1.00 120.77 ? 741 THR A O     1 
ATOM   5914  C  CB    . THR A 1 761 ? -8.423  -25.172 42.979  1.00 120.48 ? 741 THR A CB    1 
ATOM   5915  O  OG1   . THR A 1 761 ? -8.566  -24.573 44.273  1.00 121.84 ? 741 THR A OG1   1 
ATOM   5916  C  CG2   . THR A 1 761 ? -8.061  -24.098 41.966  1.00 120.61 ? 741 THR A CG2   1 
ATOM   5917  N  N     . ASP A 1 762 ? -11.219 -27.633 43.363  1.00 123.24 ? 742 ASP A N     1 
ATOM   5918  C  CA    . ASP A 1 762 ? -11.720 -28.689 44.248  1.00 121.51 ? 742 ASP A CA    1 
ATOM   5919  C  C     . ASP A 1 762 ? -11.184 -30.057 43.830  1.00 119.08 ? 742 ASP A C     1 
ATOM   5920  O  O     . ASP A 1 762 ? -10.553 -30.752 44.629  1.00 117.69 ? 742 ASP A O     1 
ATOM   5921  C  CB    . ASP A 1 762 ? -13.253 -28.703 44.250  1.00 122.16 ? 742 ASP A CB    1 
ATOM   5922  C  CG    . ASP A 1 762 ? -13.850 -27.394 44.745  1.00 123.71 ? 742 ASP A CG    1 
ATOM   5923  O  OD1   . ASP A 1 762 ? -13.440 -26.321 44.250  1.00 123.89 ? 742 ASP A OD1   1 
ATOM   5924  O  OD2   . ASP A 1 762 ? -14.733 -27.436 45.627  1.00 125.33 ? 742 ASP A OD2   1 
ATOM   5925  N  N     . GLY A 1 763 ? -11.434 -30.428 42.575  1.00 117.31 ? 743 GLY A N     1 
ATOM   5926  C  CA    . GLY A 1 763 ? -10.987 -31.712 42.027  1.00 117.01 ? 743 GLY A CA    1 
ATOM   5927  C  C     . GLY A 1 763 ? -9.493  -31.767 41.754  1.00 116.68 ? 743 GLY A C     1 
ATOM   5928  O  O     . GLY A 1 763 ? -8.799  -30.753 41.844  1.00 118.08 ? 743 GLY A O     1 
ATOM   5929  N  N     . GLU A 1 764 ? -9.004  -32.959 41.416  1.00 116.99 ? 744 GLU A N     1 
ATOM   5930  C  CA    . GLU A 1 764 ? -7.573  -33.177 41.152  1.00 118.11 ? 744 GLU A CA    1 
ATOM   5931  C  C     . GLU A 1 764 ? -7.094  -32.565 39.831  1.00 117.77 ? 744 GLU A C     1 
ATOM   5932  O  O     . GLU A 1 764 ? -5.949  -32.114 39.742  1.00 118.44 ? 744 GLU A O     1 
ATOM   5933  C  CB    . GLU A 1 764 ? -7.230  -34.670 41.174  1.00 119.76 ? 744 GLU A CB    1 
ATOM   5934  C  CG    . GLU A 1 764 ? -7.380  -35.321 42.542  1.00 121.02 ? 744 GLU A CG    1 
ATOM   5935  C  CD    . GLU A 1 764 ? -6.603  -36.620 42.673  1.00 122.38 ? 744 GLU A CD    1 
ATOM   5936  O  OE1   . GLU A 1 764 ? -6.429  -37.331 41.658  1.00 123.45 ? 744 GLU A OE1   1 
ATOM   5937  O  OE2   . GLU A 1 764 ? -6.166  -36.933 43.801  1.00 123.02 ? 744 GLU A OE2   1 
ATOM   5938  N  N     . GLN A 1 765 ? -7.956  -32.571 38.813  1.00 115.82 ? 745 GLN A N     1 
ATOM   5939  C  CA    . GLN A 1 765 ? -7.634  -31.960 37.514  1.00 114.18 ? 745 GLN A CA    1 
ATOM   5940  C  C     . GLN A 1 765 ? -7.526  -30.431 37.572  1.00 114.03 ? 745 GLN A C     1 
ATOM   5941  O  O     . GLN A 1 765 ? -6.725  -29.842 36.843  1.00 115.32 ? 745 GLN A O     1 
ATOM   5942  C  CB    . GLN A 1 765 ? -8.652  -32.377 36.442  1.00 112.68 ? 745 GLN A CB    1 
ATOM   5943  C  CG    . GLN A 1 765 ? -8.454  -33.795 35.927  1.00 111.37 ? 745 GLN A CG    1 
ATOM   5944  C  CD    . GLN A 1 765 ? -7.266  -33.920 34.989  1.00 109.37 ? 745 GLN A CD    1 
ATOM   5945  O  OE1   . GLN A 1 765 ? -6.240  -34.502 35.341  1.00 107.63 ? 745 GLN A OE1   1 
ATOM   5946  N  NE2   . GLN A 1 765 ? -7.395  -33.359 33.794  1.00 107.71 ? 745 GLN A NE2   1 
ATOM   5947  N  N     . ASP A 1 766 ? -8.324  -29.798 38.432  1.00 112.34 ? 746 ASP A N     1 
ATOM   5948  C  CA    . ASP A 1 766 ? -8.268  -28.342 38.618  1.00 111.25 ? 746 ASP A CA    1 
ATOM   5949  C  C     . ASP A 1 766 ? -6.997  -27.916 39.359  1.00 108.65 ? 746 ASP A C     1 
ATOM   5950  O  O     . ASP A 1 766 ? -6.352  -26.939 38.975  1.00 108.11 ? 746 ASP A O     1 
ATOM   5951  C  CB    . ASP A 1 766 ? -9.497  -27.834 39.379  1.00 112.44 ? 746 ASP A CB    1 
ATOM   5952  C  CG    . ASP A 1 766 ? -10.803 -28.089 38.638  1.00 113.53 ? 746 ASP A CG    1 
ATOM   5953  O  OD1   . ASP A 1 766 ? -10.862 -27.858 37.412  1.00 114.45 ? 746 ASP A OD1   1 
ATOM   5954  O  OD2   . ASP A 1 766 ? -11.779 -28.508 39.294  1.00 114.56 ? 746 ASP A OD2   1 
ATOM   5955  N  N     . ARG A 1 767 ? -6.652  -28.645 40.421  1.00 106.19 ? 747 ARG A N     1 
ATOM   5956  C  CA    . ARG A 1 767 ? -5.413  -28.400 41.174  1.00 103.84 ? 747 ARG A CA    1 
ATOM   5957  C  C     . ARG A 1 767 ? -4.155  -28.747 40.369  1.00 100.45 ? 747 ARG A C     1 
ATOM   5958  O  O     . ARG A 1 767 ? -3.103  -28.145 40.580  1.00 100.58 ? 747 ARG A O     1 
ATOM   5959  C  CB    . ARG A 1 767 ? -5.416  -29.162 42.507  1.00 104.66 ? 747 ARG A CB    1 
ATOM   5960  C  CG    . ARG A 1 767 ? -6.447  -28.645 43.502  1.00 105.24 ? 747 ARG A CG    1 
ATOM   5961  C  CD    . ARG A 1 767 ? -6.267  -29.223 44.900  1.00 105.23 ? 747 ARG A CD    1 
ATOM   5962  N  NE    . ARG A 1 767 ? -5.042  -28.743 45.554  1.00 105.62 ? 747 ARG A NE    1 
ATOM   5963  C  CZ    . ARG A 1 767 ? -3.891  -29.416 45.680  1.00 105.37 ? 747 ARG A CZ    1 
ATOM   5964  N  NH1   . ARG A 1 767 ? -3.736  -30.653 45.200  1.00 104.98 ? 747 ARG A NH1   1 
ATOM   5965  N  NH2   . ARG A 1 767 ? -2.866  -28.837 46.303  1.00 104.98 ? 747 ARG A NH2   1 
ATOM   5966  N  N     . ALA A 1 768 ? -4.263  -29.716 39.461  1.00 97.11  ? 748 ALA A N     1 
ATOM   5967  C  CA    . ALA A 1 768 ? -3.185  -30.011 38.511  1.00 95.74  ? 748 ALA A CA    1 
ATOM   5968  C  C     . ALA A 1 768 ? -2.987  -28.856 37.522  1.00 93.25  ? 748 ALA A C     1 
ATOM   5969  O  O     . ALA A 1 768 ? -1.852  -28.512 37.181  1.00 90.58  ? 748 ALA A O     1 
ATOM   5970  C  CB    . ALA A 1 768 ? -3.472  -31.306 37.765  1.00 96.74  ? 748 ALA A CB    1 
ATOM   5971  N  N     . LEU A 1 769 ? -4.098  -28.272 37.069  1.00 91.80  ? 749 LEU A N     1 
ATOM   5972  C  CA    . LEU A 1 769 ? -4.080  -27.087 36.201  1.00 90.24  ? 749 LEU A CA    1 
ATOM   5973  C  C     . LEU A 1 769 ? -3.561  -25.843 36.932  1.00 88.10  ? 749 LEU A C     1 
ATOM   5974  O  O     . LEU A 1 769 ? -2.820  -25.046 36.353  1.00 88.66  ? 749 LEU A O     1 
ATOM   5975  C  CB    . LEU A 1 769 ? -5.483  -26.819 35.633  1.00 90.58  ? 749 LEU A CB    1 
ATOM   5976  C  CG    . LEU A 1 769 ? -5.695  -25.604 34.722  1.00 91.36  ? 749 LEU A CG    1 
ATOM   5977  C  CD1   . LEU A 1 769 ? -4.724  -25.618 33.552  1.00 92.18  ? 749 LEU A CD1   1 
ATOM   5978  C  CD2   . LEU A 1 769 ? -7.134  -25.569 34.230  1.00 91.27  ? 749 LEU A CD2   1 
ATOM   5979  N  N     . MET A 1 770 ? -3.959  -25.684 38.195  1.00 85.48  ? 750 MET A N     1 
ATOM   5980  C  CA    . MET A 1 770 ? -3.522  -24.554 39.028  1.00 83.23  ? 750 MET A CA    1 
ATOM   5981  C  C     . MET A 1 770 ? -2.012  -24.572 39.318  1.00 81.36  ? 750 MET A C     1 
ATOM   5982  O  O     . MET A 1 770 ? -1.404  -23.511 39.475  1.00 80.30  ? 750 MET A O     1 
ATOM   5983  C  CB    . MET A 1 770 ? -4.320  -24.530 40.343  1.00 83.00  ? 750 MET A CB    1 
ATOM   5984  C  CG    . MET A 1 770 ? -4.079  -23.326 41.248  1.00 82.73  ? 750 MET A CG    1 
ATOM   5985  S  SD    . MET A 1 770 ? -4.418  -21.723 40.492  1.00 82.27  ? 750 MET A SD    1 
ATOM   5986  C  CE    . MET A 1 770 ? -6.207  -21.721 40.429  1.00 81.91  ? 750 MET A CE    1 
ATOM   5987  N  N     . GLN A 1 771 ? -1.418  -25.765 39.392  1.00 79.49  ? 751 GLN A N     1 
ATOM   5988  C  CA    . GLN A 1 771 ? 0.037   -25.909 39.539  1.00 78.44  ? 751 GLN A CA    1 
ATOM   5989  C  C     . GLN A 1 771 ? 0.764   -25.344 38.321  1.00 78.88  ? 751 GLN A C     1 
ATOM   5990  O  O     . GLN A 1 771 ? 1.689   -24.544 38.466  1.00 80.25  ? 751 GLN A O     1 
ATOM   5991  C  CB    . GLN A 1 771 ? 0.427   -27.381 39.733  1.00 77.40  ? 751 GLN A CB    1 
ATOM   5992  C  CG    . GLN A 1 771 ? 1.905   -27.623 40.051  1.00 76.40  ? 751 GLN A CG    1 
ATOM   5993  C  CD    . GLN A 1 771 ? 2.312   -27.210 41.458  1.00 75.88  ? 751 GLN A CD    1 
ATOM   5994  O  OE1   . GLN A 1 771 ? 1.480   -26.833 42.287  1.00 75.24  ? 751 GLN A OE1   1 
ATOM   5995  N  NE2   . GLN A 1 771 ? 3.608   -27.284 41.734  1.00 75.26  ? 751 GLN A NE2   1 
ATOM   5996  N  N     . GLU A 1 772 ? 0.344   -25.771 37.130  1.00 78.39  ? 752 GLU A N     1 
ATOM   5997  C  CA    . GLU A 1 772 ? 0.927   -25.286 35.874  1.00 77.75  ? 752 GLU A CA    1 
ATOM   5998  C  C     . GLU A 1 772 ? 0.736   -23.778 35.701  1.00 77.11  ? 752 GLU A C     1 
ATOM   5999  O  O     . GLU A 1 772 ? 1.638   -23.087 35.219  1.00 76.96  ? 752 GLU A O     1 
ATOM   6000  C  CB    . GLU A 1 772 ? 0.325   -26.024 34.672  1.00 77.75  ? 752 GLU A CB    1 
ATOM   6001  C  CG    . GLU A 1 772 ? 1.059   -25.777 33.360  1.00 78.00  ? 752 GLU A CG    1 
ATOM   6002  C  CD    . GLU A 1 772 ? 0.454   -26.528 32.190  1.00 77.42  ? 752 GLU A CD    1 
ATOM   6003  O  OE1   . GLU A 1 772 ? -0.782  -26.474 32.016  1.00 77.75  ? 752 GLU A OE1   1 
ATOM   6004  O  OE2   . GLU A 1 772 ? 1.220   -27.162 31.435  1.00 76.33  ? 752 GLU A OE2   1 
ATOM   6005  N  N     . ALA A 1 773 ? -0.439  -23.284 36.094  1.00 76.53  ? 753 ALA A N     1 
ATOM   6006  C  CA    . ALA A 1 773 ? -0.760  -21.859 36.016  1.00 76.76  ? 753 ALA A CA    1 
ATOM   6007  C  C     . ALA A 1 773 ? 0.136   -21.029 36.931  1.00 76.94  ? 753 ALA A C     1 
ATOM   6008  O  O     . ALA A 1 773 ? 0.781   -20.084 36.478  1.00 77.42  ? 753 ALA A O     1 
ATOM   6009  C  CB    . ALA A 1 773 ? -2.223  -21.626 36.365  1.00 76.81  ? 753 ALA A CB    1 
ATOM   6010  N  N     . LEU A 1 774 ? 0.179   -21.398 38.210  1.00 76.43  ? 754 LEU A N     1 
ATOM   6011  C  CA    . LEU A 1 774 ? 0.972   -20.663 39.206  1.00 76.26  ? 754 LEU A CA    1 
ATOM   6012  C  C     . LEU A 1 774 ? 2.480   -20.733 38.953  1.00 75.75  ? 754 LEU A C     1 
ATOM   6013  O  O     . LEU A 1 774 ? 3.186   -19.753 39.188  1.00 75.55  ? 754 LEU A O     1 
ATOM   6014  C  CB    . LEU A 1 774 ? 0.649   -21.146 40.624  1.00 76.56  ? 754 LEU A CB    1 
ATOM   6015  C  CG    . LEU A 1 774 ? -0.758  -20.808 41.127  1.00 77.05  ? 754 LEU A CG    1 
ATOM   6016  C  CD1   . LEU A 1 774 ? -1.060  -21.586 42.400  1.00 78.12  ? 754 LEU A CD1   1 
ATOM   6017  C  CD2   . LEU A 1 774 ? -0.929  -19.313 41.357  1.00 76.60  ? 754 LEU A CD2   1 
ATOM   6018  N  N     . LEU A 1 775 ? 2.967   -21.880 38.479  1.00 76.34  ? 755 LEU A N     1 
ATOM   6019  C  CA    . LEU A 1 775 ? 4.370   -22.011 38.057  1.00 76.76  ? 755 LEU A CA    1 
ATOM   6020  C  C     . LEU A 1 775 ? 4.692   -21.135 36.843  1.00 75.60  ? 755 LEU A C     1 
ATOM   6021  O  O     . LEU A 1 775 ? 5.804   -20.615 36.734  1.00 75.07  ? 755 LEU A O     1 
ATOM   6022  C  CB    . LEU A 1 775 ? 4.728   -23.471 37.753  1.00 77.81  ? 755 LEU A CB    1 
ATOM   6023  C  CG    . LEU A 1 775 ? 4.857   -24.407 38.960  1.00 78.77  ? 755 LEU A CG    1 
ATOM   6024  C  CD1   . LEU A 1 775 ? 4.871   -25.860 38.506  1.00 79.88  ? 755 LEU A CD1   1 
ATOM   6025  C  CD2   . LEU A 1 775 ? 6.103   -24.097 39.779  1.00 78.86  ? 755 LEU A CD2   1 
ATOM   6026  N  N     . ALA A 1 776 ? 3.728   -20.982 35.937  1.00 74.48  ? 756 ALA A N     1 
ATOM   6027  C  CA    . ALA A 1 776 ? 3.870   -20.074 34.797  1.00 74.67  ? 756 ALA A CA    1 
ATOM   6028  C  C     . ALA A 1 776 ? 3.824   -18.603 35.225  1.00 74.22  ? 756 ALA A C     1 
ATOM   6029  O  O     . ALA A 1 776 ? 4.674   -17.812 34.813  1.00 75.54  ? 756 ALA A O     1 
ATOM   6030  C  CB    . ALA A 1 776 ? 2.796   -20.354 33.754  1.00 74.85  ? 756 ALA A CB    1 
ATOM   6031  N  N     . VAL A 1 777 ? 2.841   -18.249 36.054  1.00 72.42  ? 757 VAL A N     1 
ATOM   6032  C  CA    . VAL A 1 777 ? 2.634   -16.856 36.489  1.00 71.36  ? 757 VAL A CA    1 
ATOM   6033  C  C     . VAL A 1 777 ? 3.784   -16.337 37.366  1.00 69.91  ? 757 VAL A C     1 
ATOM   6034  O  O     . VAL A 1 777 ? 4.181   -15.177 37.236  1.00 70.30  ? 757 VAL A O     1 
ATOM   6035  C  CB    . VAL A 1 777 ? 1.267   -16.681 37.207  1.00 72.06  ? 757 VAL A CB    1 
ATOM   6036  C  CG1   . VAL A 1 777 ? 1.137   -15.308 37.866  1.00 72.66  ? 757 VAL A CG1   1 
ATOM   6037  C  CG2   . VAL A 1 777 ? 0.122   -16.884 36.221  1.00 72.21  ? 757 VAL A CG2   1 
ATOM   6038  N  N     . VAL A 1 778 ? 4.305   -17.188 38.249  1.00 68.20  ? 758 VAL A N     1 
ATOM   6039  C  CA    . VAL A 1 778 ? 5.452   -16.832 39.099  1.00 67.05  ? 758 VAL A CA    1 
ATOM   6040  C  C     . VAL A 1 778 ? 6.730   -16.619 38.270  1.00 66.52  ? 758 VAL A C     1 
ATOM   6041  O  O     . VAL A 1 778 ? 7.528   -15.734 38.587  1.00 66.30  ? 758 VAL A O     1 
ATOM   6042  C  CB    . VAL A 1 778 ? 5.664   -17.875 40.228  1.00 66.90  ? 758 VAL A CB    1 
ATOM   6043  C  CG1   . VAL A 1 778 ? 7.001   -17.693 40.938  1.00 66.93  ? 758 VAL A CG1   1 
ATOM   6044  C  CG2   . VAL A 1 778 ? 4.531   -17.777 41.242  1.00 67.44  ? 758 VAL A CG2   1 
ATOM   6045  N  N     . ARG A 1 779 ? 6.916   -17.412 37.215  1.00 66.11  ? 759 ARG A N     1 
ATOM   6046  C  CA    . ARG A 1 779 ? 8.048   -17.218 36.293  1.00 66.17  ? 759 ARG A CA    1 
ATOM   6047  C  C     . ARG A 1 779 ? 7.915   -15.948 35.445  1.00 65.18  ? 759 ARG A C     1 
ATOM   6048  O  O     . ARG A 1 779 ? 8.900   -15.239 35.236  1.00 64.36  ? 759 ARG A O     1 
ATOM   6049  C  CB    . ARG A 1 779 ? 8.239   -18.437 35.386  1.00 66.83  ? 759 ARG A CB    1 
ATOM   6050  C  CG    . ARG A 1 779 ? 8.895   -19.618 36.082  1.00 67.67  ? 759 ARG A CG    1 
ATOM   6051  C  CD    . ARG A 1 779 ? 9.066   -20.789 35.131  1.00 68.53  ? 759 ARG A CD    1 
ATOM   6052  N  NE    . ARG A 1 779 ? 7.783   -21.381 34.748  1.00 69.42  ? 759 ARG A NE    1 
ATOM   6053  C  CZ    . ARG A 1 779 ? 7.613   -22.313 33.808  1.00 69.94  ? 759 ARG A CZ    1 
ATOM   6054  N  NH1   . ARG A 1 779 ? 8.646   -22.795 33.114  1.00 69.80  ? 759 ARG A NH1   1 
ATOM   6055  N  NH2   . ARG A 1 779 ? 6.388   -22.770 33.555  1.00 70.56  ? 759 ARG A NH2   1 
ATOM   6056  N  N     . MET A 1 780 ? 6.705   -15.666 34.963  1.00 65.01  ? 760 MET A N     1 
ATOM   6057  C  CA    . MET A 1 780 ? 6.445   -14.450 34.177  1.00 65.20  ? 760 MET A CA    1 
ATOM   6058  C  C     . MET A 1 780 ? 6.602   -13.155 34.989  1.00 64.52  ? 760 MET A C     1 
ATOM   6059  O  O     . MET A 1 780 ? 6.954   -12.117 34.424  1.00 64.93  ? 760 MET A O     1 
ATOM   6060  C  CB    . MET A 1 780 ? 5.055   -14.503 33.525  1.00 66.13  ? 760 MET A CB    1 
ATOM   6061  C  CG    . MET A 1 780 ? 4.970   -15.457 32.341  1.00 66.94  ? 760 MET A CG    1 
ATOM   6062  S  SD    . MET A 1 780 ? 3.374   -15.422 31.496  1.00 68.40  ? 760 MET A SD    1 
ATOM   6063  C  CE    . MET A 1 780 ? 2.308   -16.174 32.724  1.00 68.19  ? 760 MET A CE    1 
ATOM   6064  N  N     . LEU A 1 781 ? 6.343   -13.219 36.297  1.00 63.35  ? 761 LEU A N     1 
ATOM   6065  C  CA    . LEU A 1 781 ? 6.522   -12.067 37.202  1.00 62.91  ? 761 LEU A CA    1 
ATOM   6066  C  C     . LEU A 1 781 ? 7.954   -11.902 37.739  1.00 62.97  ? 761 LEU A C     1 
ATOM   6067  O  O     . LEU A 1 781 ? 8.294   -10.827 38.240  1.00 64.25  ? 761 LEU A O     1 
ATOM   6068  C  CB    . LEU A 1 781 ? 5.528   -12.136 38.380  1.00 62.90  ? 761 LEU A CB    1 
ATOM   6069  C  CG    . LEU A 1 781 ? 4.235   -11.310 38.305  1.00 63.16  ? 761 LEU A CG    1 
ATOM   6070  C  CD1   . LEU A 1 781 ? 3.590   -11.336 36.927  1.00 63.48  ? 761 LEU A CD1   1 
ATOM   6071  C  CD2   . LEU A 1 781 ? 3.252   -11.793 39.363  1.00 63.31  ? 761 LEU A CD2   1 
ATOM   6072  N  N     . ASN A 1 782 ? 8.779   -12.949 37.637  1.00 61.60  ? 762 ASN A N     1 
ATOM   6073  C  CA    . ASN A 1 782 ? 10.150  -12.940 38.179  1.00 60.53  ? 762 ASN A CA    1 
ATOM   6074  C  C     . ASN A 1 782 ? 11.045  -11.797 37.667  1.00 59.85  ? 762 ASN A C     1 
ATOM   6075  O  O     . ASN A 1 782 ? 11.772  -11.202 38.461  1.00 60.53  ? 762 ASN A O     1 
ATOM   6076  C  CB    . ASN A 1 782 ? 10.831  -14.302 37.952  1.00 60.55  ? 762 ASN A CB    1 
ATOM   6077  C  CG    . ASN A 1 782 ? 12.230  -14.368 38.541  1.00 60.34  ? 762 ASN A CG    1 
ATOM   6078  O  OD1   . ASN A 1 782 ? 12.442  -14.032 39.706  1.00 59.96  ? 762 ASN A OD1   1 
ATOM   6079  N  ND2   . ASN A 1 782 ? 13.193  -14.805 37.736  1.00 60.40  ? 762 ASN A ND2   1 
ATOM   6080  N  N     . PRO A 1 783 ? 11.005  -11.487 36.353  1.00 59.29  ? 763 PRO A N     1 
ATOM   6081  C  CA    . PRO A 1 783 ? 11.757  -10.317 35.868  1.00 59.40  ? 763 PRO A CA    1 
ATOM   6082  C  C     . PRO A 1 783 ? 11.399  -8.991  36.560  1.00 59.35  ? 763 PRO A C     1 
ATOM   6083  O  O     . PRO A 1 783 ? 12.295  -8.202  36.870  1.00 60.09  ? 763 PRO A O     1 
ATOM   6084  C  CB    . PRO A 1 783 ? 11.387  -10.257 34.384  1.00 59.24  ? 763 PRO A CB    1 
ATOM   6085  C  CG    . PRO A 1 783 ? 11.099  -11.668 34.022  1.00 59.28  ? 763 PRO A CG    1 
ATOM   6086  C  CD    . PRO A 1 783 ? 10.439  -12.263 35.232  1.00 59.19  ? 763 PRO A CD    1 
ATOM   6087  N  N     . PHE A 1 784 ? 10.108  -8.770  36.806  1.00 58.13  ? 764 PHE A N     1 
ATOM   6088  C  CA    . PHE A 1 784 ? 9.626   -7.526  37.414  1.00 57.08  ? 764 PHE A CA    1 
ATOM   6089  C  C     . PHE A 1 784 ? 9.798   -7.553  38.929  1.00 57.29  ? 764 PHE A C     1 
ATOM   6090  O  O     . PHE A 1 784 ? 10.373  -6.632  39.511  1.00 57.19  ? 764 PHE A O     1 
ATOM   6091  C  CB    . PHE A 1 784 ? 8.150   -7.288  37.072  1.00 56.42  ? 764 PHE A CB    1 
ATOM   6092  C  CG    . PHE A 1 784 ? 7.848   -7.353  35.602  1.00 55.45  ? 764 PHE A CG    1 
ATOM   6093  C  CD1   . PHE A 1 784 ? 8.364   -6.402  34.737  1.00 55.33  ? 764 PHE A CD1   1 
ATOM   6094  C  CD2   . PHE A 1 784 ? 7.052   -8.369  35.080  1.00 55.28  ? 764 PHE A CD2   1 
ATOM   6095  C  CE1   . PHE A 1 784 ? 8.094   -6.458  33.380  1.00 55.35  ? 764 PHE A CE1   1 
ATOM   6096  C  CE2   . PHE A 1 784 ? 6.777   -8.431  33.722  1.00 54.94  ? 764 PHE A CE2   1 
ATOM   6097  C  CZ    . PHE A 1 784 ? 7.300   -7.473  32.870  1.00 55.18  ? 764 PHE A CZ    1 
ATOM   6098  N  N     . THR A 1 785 ? 9.295   -8.618  39.550  1.00 57.82  ? 765 THR A N     1 
ATOM   6099  C  CA    . THR A 1 785 ? 9.269   -8.769  41.005  1.00 58.25  ? 765 THR A CA    1 
ATOM   6100  C  C     . THR A 1 785 ? 10.050  -10.024 41.406  1.00 59.31  ? 765 THR A C     1 
ATOM   6101  O  O     . THR A 1 785 ? 9.452   -11.047 41.740  1.00 59.05  ? 765 THR A O     1 
ATOM   6102  C  CB    . THR A 1 785 ? 7.815   -8.872  41.502  1.00 58.03  ? 765 THR A CB    1 
ATOM   6103  O  OG1   . THR A 1 785 ? 7.177   -10.009 40.906  1.00 57.33  ? 765 THR A OG1   1 
ATOM   6104  C  CG2   . THR A 1 785 ? 7.042   -7.613  41.134  1.00 58.07  ? 765 THR A CG2   1 
ATOM   6105  N  N     . PRO A 1 786 ? 11.395  -9.952  41.373  1.00 60.87  ? 766 PRO A N     1 
ATOM   6106  C  CA    . PRO A 1 786 ? 12.217  -11.153 41.574  1.00 61.82  ? 766 PRO A CA    1 
ATOM   6107  C  C     . PRO A 1 786 ? 12.236  -11.734 42.991  1.00 62.40  ? 766 PRO A C     1 
ATOM   6108  O  O     . PRO A 1 786 ? 12.456  -12.938 43.142  1.00 62.29  ? 766 PRO A O     1 
ATOM   6109  C  CB    . PRO A 1 786 ? 13.620  -10.681 41.175  1.00 62.25  ? 766 PRO A CB    1 
ATOM   6110  C  CG    . PRO A 1 786 ? 13.616  -9.220  41.466  1.00 62.07  ? 766 PRO A CG    1 
ATOM   6111  C  CD    . PRO A 1 786 ? 12.225  -8.753  41.149  1.00 61.33  ? 766 PRO A CD    1 
ATOM   6112  N  N     . HIS A 1 787 ? 12.005  -10.902 44.005  1.00 63.29  ? 767 HIS A N     1 
ATOM   6113  C  CA    . HIS A 1 787 ? 12.134  -11.328 45.402  1.00 65.19  ? 767 HIS A CA    1 
ATOM   6114  C  C     . HIS A 1 787 ? 10.981  -12.242 45.819  1.00 66.63  ? 767 HIS A C     1 
ATOM   6115  O  O     . HIS A 1 787 ? 11.210  -13.333 46.348  1.00 66.03  ? 767 HIS A O     1 
ATOM   6116  C  CB    . HIS A 1 787 ? 12.204  -10.119 46.340  1.00 65.82  ? 767 HIS A CB    1 
ATOM   6117  C  CG    . HIS A 1 787 ? 13.338  -9.184  46.047  1.00 66.39  ? 767 HIS A CG    1 
ATOM   6118  N  ND1   . HIS A 1 787 ? 13.213  -8.112  45.189  1.00 66.38  ? 767 HIS A ND1   1 
ATOM   6119  C  CD2   . HIS A 1 787 ? 14.613  -9.154  46.503  1.00 66.77  ? 767 HIS A CD2   1 
ATOM   6120  C  CE1   . HIS A 1 787 ? 14.362  -7.465  45.126  1.00 66.35  ? 767 HIS A CE1   1 
ATOM   6121  N  NE2   . HIS A 1 787 ? 15.229  -8.077  45.912  1.00 66.33  ? 767 HIS A NE2   1 
ATOM   6122  N  N     . ILE A 1 788 ? 9.752   -11.782 45.584  1.00 68.50  ? 768 ILE A N     1 
ATOM   6123  C  CA    . ILE A 1 788 ? 8.538   -12.565 45.874  1.00 68.85  ? 768 ILE A CA    1 
ATOM   6124  C  C     . ILE A 1 788 ? 8.488   -13.883 45.088  1.00 70.12  ? 768 ILE A C     1 
ATOM   6125  O  O     . ILE A 1 788 ? 8.075   -14.911 45.627  1.00 71.23  ? 768 ILE A O     1 
ATOM   6126  C  CB    . ILE A 1 788 ? 7.239   -11.734 45.640  1.00 68.08  ? 768 ILE A CB    1 
ATOM   6127  C  CG1   . ILE A 1 788 ? 6.016   -12.443 46.237  1.00 67.35  ? 768 ILE A CG1   1 
ATOM   6128  C  CG2   . ILE A 1 788 ? 7.007   -11.436 44.160  1.00 68.00  ? 768 ILE A CG2   1 
ATOM   6129  C  CD1   . ILE A 1 788 ? 4.744   -11.624 46.179  1.00 67.05  ? 768 ILE A CD1   1 
ATOM   6130  N  N     . CYS A 1 789 ? 8.923   -13.848 43.830  1.00 70.82  ? 769 CYS A N     1 
ATOM   6131  C  CA    . CYS A 1 789 ? 8.877   -15.022 42.958  1.00 71.89  ? 769 CYS A CA    1 
ATOM   6132  C  C     . CYS A 1 789 ? 9.916   -16.087 43.324  1.00 73.40  ? 769 CYS A C     1 
ATOM   6133  O  O     . CYS A 1 789 ? 9.667   -17.275 43.135  1.00 74.70  ? 769 CYS A O     1 
ATOM   6134  C  CB    . CYS A 1 789 ? 9.027   -14.598 41.498  1.00 71.86  ? 769 CYS A CB    1 
ATOM   6135  S  SG    . CYS A 1 789 ? 7.678   -13.528 40.952  1.00 71.83  ? 769 CYS A SG    1 
ATOM   6136  N  N     . PHE A 1 790 ? 11.067  -15.662 43.846  1.00 74.90  ? 770 PHE A N     1 
ATOM   6137  C  CA    . PHE A 1 790 ? 12.086  -16.587 44.372  1.00 75.70  ? 770 PHE A CA    1 
ATOM   6138  C  C     . PHE A 1 790 ? 11.542  -17.440 45.523  1.00 77.04  ? 770 PHE A C     1 
ATOM   6139  O  O     . PHE A 1 790 ? 11.832  -18.637 45.600  1.00 77.18  ? 770 PHE A O     1 
ATOM   6140  C  CB    . PHE A 1 790 ? 13.328  -15.812 44.839  1.00 75.18  ? 770 PHE A CB    1 
ATOM   6141  C  CG    . PHE A 1 790 ? 14.525  -16.682 45.121  1.00 73.84  ? 770 PHE A CG    1 
ATOM   6142  C  CD1   . PHE A 1 790 ? 14.741  -17.208 46.391  1.00 72.98  ? 770 PHE A CD1   1 
ATOM   6143  C  CD2   . PHE A 1 790 ? 15.446  -16.965 44.117  1.00 73.30  ? 770 PHE A CD2   1 
ATOM   6144  C  CE1   . PHE A 1 790 ? 15.847  -18.006 46.651  1.00 72.73  ? 770 PHE A CE1   1 
ATOM   6145  C  CE2   . PHE A 1 790 ? 16.553  -17.762 44.372  1.00 72.76  ? 770 PHE A CE2   1 
ATOM   6146  C  CZ    . PHE A 1 790 ? 16.753  -18.284 45.641  1.00 72.64  ? 770 PHE A CZ    1 
ATOM   6147  N  N     . THR A 1 791 ? 10.762  -16.814 46.405  1.00 78.53  ? 771 THR A N     1 
ATOM   6148  C  CA    . THR A 1 791 ? 10.141  -17.497 47.543  1.00 79.47  ? 771 THR A CA    1 
ATOM   6149  C  C     . THR A 1 791 ? 9.008   -18.418 47.092  1.00 79.49  ? 771 THR A C     1 
ATOM   6150  O  O     . THR A 1 791 ? 8.945   -19.576 47.510  1.00 80.23  ? 771 THR A O     1 
ATOM   6151  C  CB    . THR A 1 791 ? 9.589   -16.487 48.572  1.00 80.25  ? 771 THR A CB    1 
ATOM   6152  O  OG1   . THR A 1 791 ? 10.590  -15.506 48.867  1.00 81.24  ? 771 THR A OG1   1 
ATOM   6153  C  CG2   . THR A 1 791 ? 9.174   -17.184 49.869  1.00 80.78  ? 771 THR A CG2   1 
ATOM   6154  N  N     . LEU A 1 792 ? 8.119   -17.896 46.248  1.00 78.87  ? 772 LEU A N     1 
ATOM   6155  C  CA    . LEU A 1 792 ? 6.982   -18.668 45.731  1.00 78.79  ? 772 LEU A CA    1 
ATOM   6156  C  C     . LEU A 1 792 ? 7.402   -19.856 44.853  1.00 79.15  ? 772 LEU A C     1 
ATOM   6157  O  O     . LEU A 1 792 ? 6.686   -20.856 44.785  1.00 81.44  ? 772 LEU A O     1 
ATOM   6158  C  CB    . LEU A 1 792 ? 6.015   -17.760 44.959  1.00 78.00  ? 772 LEU A CB    1 
ATOM   6159  C  CG    . LEU A 1 792 ? 5.280   -16.694 45.779  1.00 77.69  ? 772 LEU A CG    1 
ATOM   6160  C  CD1   . LEU A 1 792 ? 4.627   -15.675 44.857  1.00 77.78  ? 772 LEU A CD1   1 
ATOM   6161  C  CD2   . LEU A 1 792 ? 4.246   -17.315 46.707  1.00 77.97  ? 772 LEU A CD2   1 
ATOM   6162  N  N     . TRP A 1 793 ? 8.550   -19.744 44.187  1.00 78.77  ? 773 TRP A N     1 
ATOM   6163  C  CA    . TRP A 1 793 ? 9.111   -20.848 43.401  1.00 79.28  ? 773 TRP A CA    1 
ATOM   6164  C  C     . TRP A 1 793 ? 9.492   -22.047 44.276  1.00 80.88  ? 773 TRP A C     1 
ATOM   6165  O  O     . TRP A 1 793 ? 9.308   -23.197 43.870  1.00 82.12  ? 773 TRP A O     1 
ATOM   6166  C  CB    . TRP A 1 793 ? 10.332  -20.367 42.615  1.00 78.18  ? 773 TRP A CB    1 
ATOM   6167  C  CG    . TRP A 1 793 ? 10.880  -21.367 41.662  1.00 77.00  ? 773 TRP A CG    1 
ATOM   6168  C  CD1   . TRP A 1 793 ? 12.051  -22.047 41.780  1.00 76.84  ? 773 TRP A CD1   1 
ATOM   6169  C  CD2   . TRP A 1 793 ? 10.283  -21.799 40.437  1.00 76.62  ? 773 TRP A CD2   1 
ATOM   6170  N  NE1   . TRP A 1 793 ? 12.227  -22.882 40.703  1.00 76.90  ? 773 TRP A NE1   1 
ATOM   6171  C  CE2   . TRP A 1 793 ? 11.155  -22.748 39.861  1.00 76.56  ? 773 TRP A CE2   1 
ATOM   6172  C  CE3   . TRP A 1 793 ? 9.094   -21.475 39.767  1.00 76.44  ? 773 TRP A CE3   1 
ATOM   6173  C  CZ2   . TRP A 1 793 ? 10.877  -23.383 38.644  1.00 76.27  ? 773 TRP A CZ2   1 
ATOM   6174  C  CZ3   . TRP A 1 793 ? 8.817   -22.106 38.555  1.00 76.49  ? 773 TRP A CZ3   1 
ATOM   6175  C  CH2   . TRP A 1 793 ? 9.708   -23.049 38.007  1.00 76.61  ? 773 TRP A CH2   1 
ATOM   6176  N  N     . GLN A 1 794 ? 10.024  -21.769 45.465  1.00 81.96  ? 774 GLN A N     1 
ATOM   6177  C  CA    . GLN A 1 794 ? 10.359  -22.814 46.441  1.00 83.28  ? 774 GLN A CA    1 
ATOM   6178  C  C     . GLN A 1 794 ? 9.114   -23.453 47.067  1.00 83.66  ? 774 GLN A C     1 
ATOM   6179  O  O     . GLN A 1 794 ? 9.103   -24.658 47.328  1.00 83.09  ? 774 GLN A O     1 
ATOM   6180  C  CB    . GLN A 1 794 ? 11.262  -22.254 47.544  1.00 83.94  ? 774 GLN A CB    1 
ATOM   6181  C  CG    . GLN A 1 794 ? 12.630  -21.800 47.059  1.00 84.15  ? 774 GLN A CG    1 
ATOM   6182  C  CD    . GLN A 1 794 ? 13.457  -21.166 48.159  1.00 85.13  ? 774 GLN A CD    1 
ATOM   6183  O  OE1   . GLN A 1 794 ? 13.912  -20.032 48.029  1.00 86.98  ? 774 GLN A OE1   1 
ATOM   6184  N  NE2   . GLN A 1 794 ? 13.648  -21.892 49.255  1.00 85.77  ? 774 GLN A NE2   1 
ATOM   6185  N  N     . GLU A 1 795 ? 8.075   -22.649 47.293  1.00 84.84  ? 775 GLU A N     1 
ATOM   6186  C  CA    . GLU A 1 795 ? 6.814   -23.127 47.881  1.00 85.73  ? 775 GLU A CA    1 
ATOM   6187  C  C     . GLU A 1 795 ? 5.988   -23.969 46.902  1.00 85.63  ? 775 GLU A C     1 
ATOM   6188  O  O     . GLU A 1 795 ? 5.327   -24.924 47.314  1.00 85.45  ? 775 GLU A O     1 
ATOM   6189  C  CB    . GLU A 1 795 ? 5.983   -21.947 48.397  1.00 87.16  ? 775 GLU A CB    1 
ATOM   6190  C  CG    . GLU A 1 795 ? 6.649   -21.171 49.533  1.00 89.65  ? 775 GLU A CG    1 
ATOM   6191  C  CD    . GLU A 1 795 ? 6.642   -21.902 50.868  1.00 91.47  ? 775 GLU A CD    1 
ATOM   6192  O  OE1   . GLU A 1 795 ? 5.958   -22.940 51.003  1.00 93.42  ? 775 GLU A OE1   1 
ATOM   6193  O  OE2   . GLU A 1 795 ? 7.323   -21.422 51.801  1.00 92.47  ? 775 GLU A OE2   1 
ATOM   6194  N  N     . LEU A 1 796 ? 6.026   -23.608 45.617  1.00 85.74  ? 776 LEU A N     1 
ATOM   6195  C  CA    . LEU A 1 796 ? 5.445   -24.433 44.543  1.00 85.53  ? 776 LEU A CA    1 
ATOM   6196  C  C     . LEU A 1 796 ? 6.315   -25.649 44.173  1.00 87.13  ? 776 LEU A C     1 
ATOM   6197  O  O     . LEU A 1 796 ? 5.881   -26.496 43.389  1.00 88.44  ? 776 LEU A O     1 
ATOM   6198  C  CB    . LEU A 1 796 ? 5.185   -23.588 43.288  1.00 83.87  ? 776 LEU A CB    1 
ATOM   6199  C  CG    . LEU A 1 796 ? 4.134   -22.480 43.406  1.00 83.32  ? 776 LEU A CG    1 
ATOM   6200  C  CD1   . LEU A 1 796 ? 4.203   -21.556 42.200  1.00 83.39  ? 776 LEU A CD1   1 
ATOM   6201  C  CD2   . LEU A 1 796 ? 2.732   -23.055 43.555  1.00 83.14  ? 776 LEU A CD2   1 
ATOM   6202  N  N     . LYS A 1 797 ? 7.539   -25.704 44.705  1.00 87.87  ? 777 LYS A N     1 
ATOM   6203  C  CA    . LYS A 1 797 ? 8.433   -26.869 44.622  1.00 88.51  ? 777 LYS A CA    1 
ATOM   6204  C  C     . LYS A 1 797 ? 8.954   -27.083 43.202  1.00 88.33  ? 777 LYS A C     1 
ATOM   6205  O  O     . LYS A 1 797 ? 8.812   -28.163 42.624  1.00 87.49  ? 777 LYS A O     1 
ATOM   6206  C  CB    . LYS A 1 797 ? 7.774   -28.138 45.194  1.00 89.37  ? 777 LYS A CB    1 
ATOM   6207  C  CG    . LYS A 1 797 ? 7.218   -27.950 46.599  1.00 90.31  ? 777 LYS A CG    1 
ATOM   6208  C  CD    . LYS A 1 797 ? 6.999   -29.270 47.321  1.00 90.32  ? 777 LYS A CD    1 
ATOM   6209  C  CE    . LYS A 1 797 ? 6.598   -29.038 48.769  1.00 90.39  ? 777 LYS A CE    1 
ATOM   6210  N  NZ    . LYS A 1 797 ? 6.547   -30.303 49.550  1.00 90.92  ? 777 LYS A NZ    1 
ATOM   6211  N  N     . GLY A 1 798 ? 9.564   -26.030 42.662  1.00 89.32  ? 778 GLY A N     1 
ATOM   6212  C  CA    . GLY A 1 798 ? 10.165  -26.052 41.331  1.00 90.57  ? 778 GLY A CA    1 
ATOM   6213  C  C     . GLY A 1 798 ? 11.615  -26.498 41.360  1.00 92.18  ? 778 GLY A C     1 
ATOM   6214  O  O     . GLY A 1 798 ? 12.207  -26.661 42.431  1.00 91.85  ? 778 GLY A O     1 
ATOM   6215  N  N     . GLU A 1 799 ? 12.186  -26.679 40.172  1.00 94.31  ? 779 GLU A N     1 
ATOM   6216  C  CA    . GLU A 1 799 ? 13.547  -27.199 40.022  1.00 95.93  ? 779 GLU A CA    1 
ATOM   6217  C  C     . GLU A 1 799 ? 14.598  -26.112 40.265  1.00 95.06  ? 779 GLU A C     1 
ATOM   6218  O  O     . GLU A 1 799 ? 14.854  -25.277 39.392  1.00 95.27  ? 779 GLU A O     1 
ATOM   6219  C  CB    . GLU A 1 799 ? 13.729  -27.815 38.630  1.00 98.33  ? 779 GLU A CB    1 
ATOM   6220  C  CG    . GLU A 1 799 ? 12.808  -28.999 38.364  1.00 101.20 ? 779 GLU A CG    1 
ATOM   6221  C  CD    . GLU A 1 799 ? 12.923  -29.543 36.950  1.00 103.64 ? 779 GLU A CD    1 
ATOM   6222  O  OE1   . GLU A 1 799 ? 12.885  -28.745 35.989  1.00 105.16 ? 779 GLU A OE1   1 
ATOM   6223  O  OE2   . GLU A 1 799 ? 13.034  -30.778 36.798  1.00 105.40 ? 779 GLU A OE2   1 
ATOM   6224  N  N     . GLY A 1 800 ? 15.193  -26.128 41.458  1.00 93.49  ? 780 GLY A N     1 
ATOM   6225  C  CA    . GLY A 1 800 ? 16.289  -25.220 41.806  1.00 92.30  ? 780 GLY A CA    1 
ATOM   6226  C  C     . GLY A 1 800 ? 15.837  -23.795 42.069  1.00 90.13  ? 780 GLY A C     1 
ATOM   6227  O  O     . GLY A 1 800 ? 14.713  -23.570 42.519  1.00 89.36  ? 780 GLY A O     1 
ATOM   6228  N  N     . ASP A 1 801 ? 16.726  -22.840 41.798  1.00 87.42  ? 781 ASP A N     1 
ATOM   6229  C  CA    . ASP A 1 801 ? 16.421  -21.410 41.929  1.00 85.10  ? 781 ASP A CA    1 
ATOM   6230  C  C     . ASP A 1 801 ? 15.670  -20.909 40.696  1.00 82.84  ? 781 ASP A C     1 
ATOM   6231  O  O     . ASP A 1 801 ? 15.929  -21.369 39.580  1.00 82.14  ? 781 ASP A O     1 
ATOM   6232  C  CB    . ASP A 1 801 ? 17.709  -20.595 42.115  1.00 85.02  ? 781 ASP A CB    1 
ATOM   6233  C  CG    . ASP A 1 801 ? 18.423  -20.899 43.428  1.00 84.21  ? 781 ASP A CG    1 
ATOM   6234  O  OD1   . ASP A 1 801 ? 18.100  -21.919 44.074  1.00 84.71  ? 781 ASP A OD1   1 
ATOM   6235  O  OD2   . ASP A 1 801 ? 19.317  -20.114 43.814  1.00 81.78  ? 781 ASP A OD2   1 
ATOM   6236  N  N     . ILE A 1 802 ? 14.752  -19.962 40.904  1.00 80.17  ? 782 ILE A N     1 
ATOM   6237  C  CA    . ILE A 1 802 ? 13.970  -19.365 39.807  1.00 78.63  ? 782 ILE A CA    1 
ATOM   6238  C  C     . ILE A 1 802 ? 14.829  -18.568 38.815  1.00 78.23  ? 782 ILE A C     1 
ATOM   6239  O  O     . ILE A 1 802 ? 14.475  -18.466 37.639  1.00 78.35  ? 782 ILE A O     1 
ATOM   6240  C  CB    . ILE A 1 802 ? 12.814  -18.469 40.331  1.00 77.98  ? 782 ILE A CB    1 
ATOM   6241  C  CG1   . ILE A 1 802 ? 11.785  -18.205 39.221  1.00 78.27  ? 782 ILE A CG1   1 
ATOM   6242  C  CG2   . ILE A 1 802 ? 13.338  -17.154 40.901  1.00 77.66  ? 782 ILE A CG2   1 
ATOM   6243  C  CD1   . ILE A 1 802 ? 10.518  -17.533 39.697  1.00 78.73  ? 782 ILE A CD1   1 
ATOM   6244  N  N     . ASP A 1 803 ? 15.948  -18.018 39.291  1.00 78.29  ? 783 ASP A N     1 
ATOM   6245  C  CA    . ASP A 1 803 ? 16.844  -17.195 38.464  1.00 78.06  ? 783 ASP A CA    1 
ATOM   6246  C  C     . ASP A 1 803 ? 17.357  -17.941 37.230  1.00 77.65  ? 783 ASP A C     1 
ATOM   6247  O  O     . ASP A 1 803 ? 17.346  -17.395 36.126  1.00 76.19  ? 783 ASP A O     1 
ATOM   6248  C  CB    . ASP A 1 803 ? 18.032  -16.691 39.294  1.00 77.52  ? 783 ASP A CB    1 
ATOM   6249  C  CG    . ASP A 1 803 ? 17.608  -15.768 40.425  1.00 77.42  ? 783 ASP A CG    1 
ATOM   6250  O  OD1   . ASP A 1 803 ? 16.950  -14.741 40.148  1.00 77.82  ? 783 ASP A OD1   1 
ATOM   6251  O  OD2   . ASP A 1 803 ? 17.931  -16.074 41.592  1.00 76.30  ? 783 ASP A OD2   1 
ATOM   6252  N  N     . ASN A 1 804 ? 17.784  -19.189 37.431  1.00 78.29  ? 784 ASN A N     1 
ATOM   6253  C  CA    . ASN A 1 804 ? 18.299  -20.050 36.355  1.00 78.04  ? 784 ASN A CA    1 
ATOM   6254  C  C     . ASN A 1 804 ? 17.246  -20.984 35.734  1.00 77.02  ? 784 ASN A C     1 
ATOM   6255  O  O     . ASN A 1 804 ? 17.556  -21.716 34.791  1.00 75.44  ? 784 ASN A O     1 
ATOM   6256  C  CB    . ASN A 1 804 ? 19.472  -20.883 36.882  1.00 78.55  ? 784 ASN A CB    1 
ATOM   6257  C  CG    . ASN A 1 804 ? 20.589  -20.025 37.453  1.00 79.18  ? 784 ASN A CG    1 
ATOM   6258  O  OD1   . ASN A 1 804 ? 20.932  -18.978 36.899  1.00 79.24  ? 784 ASN A OD1   1 
ATOM   6259  N  ND2   . ASN A 1 804 ? 21.162  -20.466 38.567  1.00 80.13  ? 784 ASN A ND2   1 
ATOM   6260  N  N     . ALA A 1 805 ? 16.018  -20.957 36.258  1.00 76.86  ? 785 ALA A N     1 
ATOM   6261  C  CA    . ALA A 1 805 ? 14.908  -21.767 35.741  1.00 76.31  ? 785 ALA A CA    1 
ATOM   6262  C  C     . ALA A 1 805 ? 14.477  -21.302 34.343  1.00 75.58  ? 785 ALA A C     1 
ATOM   6263  O  O     . ALA A 1 805 ? 14.616  -20.118 34.021  1.00 76.24  ? 785 ALA A O     1 
ATOM   6264  C  CB    . ALA A 1 805 ? 13.727  -21.709 36.701  1.00 76.27  ? 785 ALA A CB    1 
ATOM   6265  N  N     . PRO A 1 806 ? 13.942  -22.226 33.514  1.00 74.07  ? 786 PRO A N     1 
ATOM   6266  C  CA    . PRO A 1 806 ? 13.648  -21.890 32.119  1.00 72.81  ? 786 PRO A CA    1 
ATOM   6267  C  C     . PRO A 1 806 ? 12.389  -21.035 31.951  1.00 71.61  ? 786 PRO A C     1 
ATOM   6268  O  O     . PRO A 1 806 ? 11.467  -21.128 32.764  1.00 70.97  ? 786 PRO A O     1 
ATOM   6269  C  CB    . PRO A 1 806 ? 13.461  -23.261 31.467  1.00 73.23  ? 786 PRO A CB    1 
ATOM   6270  C  CG    . PRO A 1 806 ? 12.924  -24.117 32.560  1.00 73.46  ? 786 PRO A CG    1 
ATOM   6271  C  CD    . PRO A 1 806 ? 13.503  -23.596 33.847  1.00 73.50  ? 786 PRO A CD    1 
ATOM   6272  N  N     . TRP A 1 807 ? 12.365  -20.214 30.901  1.00 70.66  ? 787 TRP A N     1 
ATOM   6273  C  CA    . TRP A 1 807 ? 11.208  -19.373 30.584  1.00 70.26  ? 787 TRP A CA    1 
ATOM   6274  C  C     . TRP A 1 807 ? 10.098  -20.244 29.986  1.00 71.60  ? 787 TRP A C     1 
ATOM   6275  O  O     . TRP A 1 807 ? 10.393  -21.129 29.177  1.00 72.01  ? 787 TRP A O     1 
ATOM   6276  C  CB    . TRP A 1 807 ? 11.601  -18.271 29.595  1.00 68.88  ? 787 TRP A CB    1 
ATOM   6277  C  CG    . TRP A 1 807 ? 10.532  -17.243 29.370  1.00 67.96  ? 787 TRP A CG    1 
ATOM   6278  C  CD1   . TRP A 1 807 ? 9.680   -17.161 28.304  1.00 67.38  ? 787 TRP A CD1   1 
ATOM   6279  C  CD2   . TRP A 1 807 ? 10.199  -16.151 30.233  1.00 67.48  ? 787 TRP A CD2   1 
ATOM   6280  N  NE1   . TRP A 1 807 ? 8.838   -16.086 28.451  1.00 66.67  ? 787 TRP A NE1   1 
ATOM   6281  C  CE2   . TRP A 1 807 ? 9.131   -15.451 29.629  1.00 67.03  ? 787 TRP A CE2   1 
ATOM   6282  C  CE3   . TRP A 1 807 ? 10.694  -15.701 31.466  1.00 67.39  ? 787 TRP A CE3   1 
ATOM   6283  C  CZ2   . TRP A 1 807 ? 8.554   -14.316 30.210  1.00 67.46  ? 787 TRP A CZ2   1 
ATOM   6284  C  CZ3   . TRP A 1 807 ? 10.117  -14.571 32.047  1.00 67.46  ? 787 TRP A CZ3   1 
ATOM   6285  C  CH2   . TRP A 1 807 ? 9.058   -13.893 31.416  1.00 67.53  ? 787 TRP A CH2   1 
ATOM   6286  N  N     . PRO A 1 808 ? 8.824   -20.008 30.378  1.00 72.73  ? 788 PRO A N     1 
ATOM   6287  C  CA    . PRO A 1 808 ? 7.741   -20.850 29.853  1.00 73.64  ? 788 PRO A CA    1 
ATOM   6288  C  C     . PRO A 1 808 ? 7.495   -20.677 28.353  1.00 74.13  ? 788 PRO A C     1 
ATOM   6289  O  O     . PRO A 1 808 ? 7.426   -19.547 27.865  1.00 74.24  ? 788 PRO A O     1 
ATOM   6290  C  CB    . PRO A 1 808 ? 6.513   -20.391 30.654  1.00 73.49  ? 788 PRO A CB    1 
ATOM   6291  C  CG    . PRO A 1 808 ? 6.850   -19.022 31.126  1.00 73.32  ? 788 PRO A CG    1 
ATOM   6292  C  CD    . PRO A 1 808 ? 8.321   -19.073 31.403  1.00 72.94  ? 788 PRO A CD    1 
ATOM   6293  N  N     . VAL A 1 809 ? 7.383   -21.801 27.646  1.00 75.63  ? 789 VAL A N     1 
ATOM   6294  C  CA    . VAL A 1 809 ? 7.053   -21.825 26.223  1.00 77.43  ? 789 VAL A CA    1 
ATOM   6295  C  C     . VAL A 1 809 ? 5.593   -22.254 26.094  1.00 78.71  ? 789 VAL A C     1 
ATOM   6296  O  O     . VAL A 1 809 ? 5.184   -23.260 26.679  1.00 79.02  ? 789 VAL A O     1 
ATOM   6297  C  CB    . VAL A 1 809 ? 7.955   -22.815 25.448  1.00 78.27  ? 789 VAL A CB    1 
ATOM   6298  C  CG1   . VAL A 1 809 ? 7.710   -22.713 23.945  1.00 78.70  ? 789 VAL A CG1   1 
ATOM   6299  C  CG2   . VAL A 1 809 ? 9.426   -22.565 25.766  1.00 78.66  ? 789 VAL A CG2   1 
ATOM   6300  N  N     . ALA A 1 810 ? 4.816   -21.487 25.331  1.00 80.44  ? 790 ALA A N     1 
ATOM   6301  C  CA    . ALA A 1 810 ? 3.387   -21.753 25.158  1.00 81.97  ? 790 ALA A CA    1 
ATOM   6302  C  C     . ALA A 1 810 ? 3.153   -22.998 24.305  1.00 84.34  ? 790 ALA A C     1 
ATOM   6303  O  O     . ALA A 1 810 ? 3.926   -23.290 23.389  1.00 84.82  ? 790 ALA A O     1 
ATOM   6304  C  CB    . ALA A 1 810 ? 2.693   -20.551 24.537  1.00 82.15  ? 790 ALA A CB    1 
ATOM   6305  N  N     . ASP A 1 811 ? 2.076   -23.714 24.618  1.00 86.98  ? 791 ASP A N     1 
ATOM   6306  C  CA    . ASP A 1 811 ? 1.713   -24.955 23.941  1.00 88.46  ? 791 ASP A CA    1 
ATOM   6307  C  C     . ASP A 1 811 ? 0.734   -24.618 22.817  1.00 89.77  ? 791 ASP A C     1 
ATOM   6308  O  O     . ASP A 1 811 ? -0.415  -24.261 23.082  1.00 91.51  ? 791 ASP A O     1 
ATOM   6309  C  CB    . ASP A 1 811 ? 1.082   -25.927 24.949  1.00 88.79  ? 791 ASP A CB    1 
ATOM   6310  C  CG    . ASP A 1 811 ? 1.043   -27.364 24.448  1.00 89.02  ? 791 ASP A CG    1 
ATOM   6311  O  OD1   . ASP A 1 811 ? 0.811   -27.592 23.242  1.00 89.87  ? 791 ASP A OD1   1 
ATOM   6312  O  OD2   . ASP A 1 811 ? 1.236   -28.277 25.279  1.00 89.13  ? 791 ASP A OD2   1 
ATOM   6313  N  N     . GLU A 1 812 ? 1.193   -24.735 21.569  1.00 90.53  ? 792 GLU A N     1 
ATOM   6314  C  CA    . GLU A 1 812 ? 0.376   -24.394 20.390  1.00 92.12  ? 792 GLU A CA    1 
ATOM   6315  C  C     . GLU A 1 812 ? -0.936  -25.180 20.289  1.00 91.69  ? 792 GLU A C     1 
ATOM   6316  O  O     . GLU A 1 812 ? -1.927  -24.662 19.770  1.00 91.84  ? 792 GLU A O     1 
ATOM   6317  C  CB    . GLU A 1 812 ? 1.183   -24.578 19.095  1.00 93.99  ? 792 GLU A CB    1 
ATOM   6318  C  CG    . GLU A 1 812 ? 2.283   -23.543 18.883  1.00 95.97  ? 792 GLU A CG    1 
ATOM   6319  C  CD    . GLU A 1 812 ? 1.759   -22.133 18.648  1.00 98.03  ? 792 GLU A CD    1 
ATOM   6320  O  OE1   . GLU A 1 812 ? 0.671   -21.975 18.050  1.00 99.44  ? 792 GLU A OE1   1 
ATOM   6321  O  OE2   . GLU A 1 812 ? 2.444   -21.173 19.061  1.00 99.45  ? 792 GLU A OE2   1 
ATOM   6322  N  N     . LYS A 1 813 ? -0.930  -26.420 20.780  1.00 90.88  ? 793 LYS A N     1 
ATOM   6323  C  CA    . LYS A 1 813 ? -2.138  -27.250 20.831  1.00 90.69  ? 793 LYS A CA    1 
ATOM   6324  C  C     . LYS A 1 813 ? -3.166  -26.703 21.826  1.00 88.07  ? 793 LYS A C     1 
ATOM   6325  O  O     . LYS A 1 813 ? -4.370  -26.758 21.566  1.00 88.89  ? 793 LYS A O     1 
ATOM   6326  C  CB    . LYS A 1 813 ? -1.788  -28.700 21.188  1.00 92.52  ? 793 LYS A CB    1 
ATOM   6327  C  CG    . LYS A 1 813 ? -0.946  -29.411 20.141  1.00 94.18  ? 793 LYS A CG    1 
ATOM   6328  C  CD    . LYS A 1 813 ? -0.441  -30.751 20.648  1.00 95.88  ? 793 LYS A CD    1 
ATOM   6329  C  CE    . LYS A 1 813 ? 0.472   -31.415 19.630  1.00 97.33  ? 793 LYS A CE    1 
ATOM   6330  N  NZ    . LYS A 1 813 ? 1.038   -32.698 20.131  1.00 98.12  ? 793 LYS A NZ    1 
ATOM   6331  N  N     . ALA A 1 814 ? -2.687  -26.179 22.954  1.00 84.74  ? 794 ALA A N     1 
ATOM   6332  C  CA    . ALA A 1 814 ? -3.557  -25.596 23.982  1.00 83.03  ? 794 ALA A CA    1 
ATOM   6333  C  C     . ALA A 1 814 ? -4.261  -24.306 23.542  1.00 81.77  ? 794 ALA A C     1 
ATOM   6334  O  O     . ALA A 1 814 ? -5.352  -24.011 24.028  1.00 79.90  ? 794 ALA A O     1 
ATOM   6335  C  CB    . ALA A 1 814 ? -2.766  -25.344 25.259  1.00 82.44  ? 794 ALA A CB    1 
ATOM   6336  N  N     . MET A 1 815 ? -3.644  -23.558 22.624  1.00 81.55  ? 795 MET A N     1 
ATOM   6337  C  CA    . MET A 1 815 ? -4.139  -22.236 22.206  1.00 82.42  ? 795 MET A CA    1 
ATOM   6338  C  C     . MET A 1 815 ? -5.088  -22.239 20.992  1.00 84.04  ? 795 MET A C     1 
ATOM   6339  O  O     . MET A 1 815 ? -5.450  -21.166 20.499  1.00 83.84  ? 795 MET A O     1 
ATOM   6340  C  CB    . MET A 1 815 ? -2.945  -21.313 21.911  1.00 81.52  ? 795 MET A CB    1 
ATOM   6341  C  CG    . MET A 1 815 ? -2.003  -21.115 23.091  1.00 80.46  ? 795 MET A CG    1 
ATOM   6342  S  SD    . MET A 1 815 ? -0.773  -19.822 22.829  1.00 78.92  ? 795 MET A SD    1 
ATOM   6343  C  CE    . MET A 1 815 ? 0.090   -20.427 21.380  1.00 79.04  ? 795 MET A CE    1 
ATOM   6344  N  N     . VAL A 1 816 ? -5.512  -23.417 20.528  1.00 86.33  ? 796 VAL A N     1 
ATOM   6345  C  CA    . VAL A 1 816 ? -6.339  -23.523 19.316  1.00 88.08  ? 796 VAL A CA    1 
ATOM   6346  C  C     . VAL A 1 816 ? -7.776  -23.070 19.605  1.00 88.92  ? 796 VAL A C     1 
ATOM   6347  O  O     . VAL A 1 816 ? -8.381  -23.496 20.593  1.00 88.30  ? 796 VAL A O     1 
ATOM   6348  C  CB    . VAL A 1 816 ? -6.344  -24.964 18.741  1.00 88.90  ? 796 VAL A CB    1 
ATOM   6349  C  CG1   . VAL A 1 816 ? -7.258  -25.066 17.520  1.00 89.41  ? 796 VAL A CG1   1 
ATOM   6350  C  CG2   . VAL A 1 816 ? -4.928  -25.402 18.382  1.00 88.83  ? 796 VAL A CG2   1 
ATOM   6351  N  N     . GLU A 1 817 ? -8.303  -22.209 18.732  1.00 90.57  ? 797 GLU A N     1 
ATOM   6352  C  CA    . GLU A 1 817 ? -9.657  -21.656 18.863  1.00 91.40  ? 797 GLU A CA    1 
ATOM   6353  C  C     . GLU A 1 817 ? -10.653 -22.459 18.027  1.00 91.59  ? 797 GLU A C     1 
ATOM   6354  O  O     . GLU A 1 817 ? -10.308 -22.962 16.956  1.00 92.33  ? 797 GLU A O     1 
ATOM   6355  C  CB    . GLU A 1 817 ? -9.687  -20.191 18.403  1.00 91.43  ? 797 GLU A CB    1 
ATOM   6356  C  CG    . GLU A 1 817 ? -8.819  -19.233 19.217  1.00 91.35  ? 797 GLU A CG    1 
ATOM   6357  C  CD    . GLU A 1 817 ? -9.366  -18.920 20.604  1.00 90.97  ? 797 GLU A CD    1 
ATOM   6358  O  OE1   . GLU A 1 817 ? -10.501 -19.328 20.935  1.00 90.34  ? 797 GLU A OE1   1 
ATOM   6359  O  OE2   . GLU A 1 817 ? -8.648  -18.247 21.373  1.00 90.61  ? 797 GLU A OE2   1 
ATOM   6360  N  N     . ASP A 1 818 ? -11.883 -22.572 18.527  1.00 92.36  ? 798 ASP A N     1 
ATOM   6361  C  CA    . ASP A 1 818 ? -12.999 -23.173 17.775  1.00 93.02  ? 798 ASP A CA    1 
ATOM   6362  C  C     . ASP A 1 818 ? -13.974 -22.129 17.201  1.00 92.63  ? 798 ASP A C     1 
ATOM   6363  O  O     . ASP A 1 818 ? -14.876 -22.487 16.442  1.00 95.32  ? 798 ASP A O     1 
ATOM   6364  C  CB    . ASP A 1 818 ? -13.752 -24.207 18.634  1.00 93.93  ? 798 ASP A CB    1 
ATOM   6365  C  CG    . ASP A 1 818 ? -14.383 -23.603 19.884  1.00 95.20  ? 798 ASP A CG    1 
ATOM   6366  O  OD1   . ASP A 1 818 ? -15.449 -22.959 19.773  1.00 96.48  ? 798 ASP A OD1   1 
ATOM   6367  O  OD2   . ASP A 1 818 ? -13.816 -23.791 20.982  1.00 95.04  ? 798 ASP A OD2   1 
ATOM   6368  N  N     . SER A 1 819 ? -13.797 -20.857 17.565  1.00 90.57  ? 799 SER A N     1 
ATOM   6369  C  CA    . SER A 1 819 ? -14.637 -19.767 17.057  1.00 89.58  ? 799 SER A CA    1 
ATOM   6370  C  C     . SER A 1 819 ? -13.954 -18.406 17.231  1.00 89.17  ? 799 SER A C     1 
ATOM   6371  O  O     . SER A 1 819 ? -12.893 -18.309 17.853  1.00 91.13  ? 799 SER A O     1 
ATOM   6372  C  CB    . SER A 1 819 ? -15.996 -19.773 17.767  1.00 89.11  ? 799 SER A CB    1 
ATOM   6373  O  OG    . SER A 1 819 ? -15.845 -19.632 19.168  1.00 88.48  ? 799 SER A OG    1 
ATOM   6374  N  N     . THR A 1 820 ? -14.566 -17.366 16.667  1.00 87.69  ? 800 THR A N     1 
ATOM   6375  C  CA    . THR A 1 820 ? -14.066 -15.991 16.782  1.00 86.17  ? 800 THR A CA    1 
ATOM   6376  C  C     . THR A 1 820 ? -15.217 -14.984 16.778  1.00 85.04  ? 800 THR A C     1 
ATOM   6377  O  O     . THR A 1 820 ? -16.234 -15.197 16.112  1.00 85.48  ? 800 THR A O     1 
ATOM   6378  C  CB    . THR A 1 820 ? -13.073 -15.650 15.645  1.00 86.14  ? 800 THR A CB    1 
ATOM   6379  O  OG1   . THR A 1 820 ? -12.645 -14.287 15.767  1.00 86.50  ? 800 THR A OG1   1 
ATOM   6380  C  CG2   . THR A 1 820 ? -13.699 -15.867 14.259  1.00 86.05  ? 800 THR A CG2   1 
ATOM   6381  N  N     . LEU A 1 821 ? -15.044 -13.888 17.516  1.00 83.18  ? 801 LEU A N     1 
ATOM   6382  C  CA    . LEU A 1 821 ? -16.053 -12.829 17.581  1.00 81.63  ? 801 LEU A CA    1 
ATOM   6383  C  C     . LEU A 1 821 ? -16.013 -11.977 16.313  1.00 80.95  ? 801 LEU A C     1 
ATOM   6384  O  O     . LEU A 1 821 ? -14.932 -11.647 15.816  1.00 82.70  ? 801 LEU A O     1 
ATOM   6385  C  CB    . LEU A 1 821 ? -15.836 -11.950 18.818  1.00 80.07  ? 801 LEU A CB    1 
ATOM   6386  C  CG    . LEU A 1 821 ? -16.968 -10.967 19.165  1.00 78.47  ? 801 LEU A CG    1 
ATOM   6387  C  CD1   . LEU A 1 821 ? -17.151 -10.868 20.672  1.00 77.91  ? 801 LEU A CD1   1 
ATOM   6388  C  CD2   . LEU A 1 821 ? -16.751 -9.579  18.571  1.00 78.24  ? 801 LEU A CD2   1 
ATOM   6389  N  N     . VAL A 1 822 ? -17.196 -11.633 15.801  1.00 78.70  ? 802 VAL A N     1 
ATOM   6390  C  CA    . VAL A 1 822 ? -17.344 -10.763 14.632  1.00 77.41  ? 802 VAL A CA    1 
ATOM   6391  C  C     . VAL A 1 822 ? -18.277 -9.608  14.995  1.00 78.16  ? 802 VAL A C     1 
ATOM   6392  O  O     . VAL A 1 822 ? -19.373 -9.829  15.516  1.00 79.13  ? 802 VAL A O     1 
ATOM   6393  C  CB    . VAL A 1 822 ? -17.916 -11.527 13.413  1.00 75.38  ? 802 VAL A CB    1 
ATOM   6394  C  CG1   . VAL A 1 822 ? -18.046 -10.606 12.203  1.00 74.46  ? 802 VAL A CG1   1 
ATOM   6395  C  CG2   . VAL A 1 822 ? -17.045 -12.733 13.080  1.00 74.89  ? 802 VAL A CG2   1 
ATOM   6396  N  N     . VAL A 1 823 ? -17.832 -8.383  14.718  1.00 78.50  ? 803 VAL A N     1 
ATOM   6397  C  CA    . VAL A 1 823 ? -18.632 -7.180  14.947  1.00 78.72  ? 803 VAL A CA    1 
ATOM   6398  C  C     . VAL A 1 823 ? -19.484 -6.920  13.702  1.00 79.08  ? 803 VAL A C     1 
ATOM   6399  O  O     . VAL A 1 823 ? -19.032 -7.151  12.576  1.00 78.67  ? 803 VAL A O     1 
ATOM   6400  C  CB    . VAL A 1 823 ? -17.736 -5.957  15.257  1.00 78.74  ? 803 VAL A CB    1 
ATOM   6401  C  CG1   . VAL A 1 823 ? -18.578 -4.711  15.522  1.00 78.73  ? 803 VAL A CG1   1 
ATOM   6402  C  CG2   . VAL A 1 823 ? -16.828 -6.250  16.446  1.00 78.96  ? 803 VAL A CG2   1 
ATOM   6403  N  N     . VAL A 1 824 ? -20.715 -6.455  13.917  1.00 78.92  ? 804 VAL A N     1 
ATOM   6404  C  CA    . VAL A 1 824 ? -21.646 -6.128  12.835  1.00 78.70  ? 804 VAL A CA    1 
ATOM   6405  C  C     . VAL A 1 824 ? -21.902 -4.624  12.853  1.00 78.50  ? 804 VAL A C     1 
ATOM   6406  O  O     . VAL A 1 824 ? -22.391 -4.092  13.853  1.00 77.90  ? 804 VAL A O     1 
ATOM   6407  C  CB    . VAL A 1 824 ? -22.990 -6.878  12.985  1.00 79.40  ? 804 VAL A CB    1 
ATOM   6408  C  CG1   . VAL A 1 824 ? -23.922 -6.562  11.817  1.00 79.92  ? 804 VAL A CG1   1 
ATOM   6409  C  CG2   . VAL A 1 824 ? -22.758 -8.382  13.094  1.00 79.47  ? 804 VAL A CG2   1 
ATOM   6410  N  N     . GLN A 1 825 ? -21.566 -3.953  11.750  1.00 78.81  ? 805 GLN A N     1 
ATOM   6411  C  CA    . GLN A 1 825 ? -21.793 -2.514  11.586  1.00 79.11  ? 805 GLN A CA    1 
ATOM   6412  C  C     . GLN A 1 825 ? -22.822 -2.246  10.488  1.00 79.64  ? 805 GLN A C     1 
ATOM   6413  O  O     . GLN A 1 825 ? -22.978 -3.047  9.561   1.00 79.43  ? 805 GLN A O     1 
ATOM   6414  C  CB    . GLN A 1 825 ? -20.482 -1.796  11.244  1.00 79.04  ? 805 GLN A CB    1 
ATOM   6415  C  CG    . GLN A 1 825 ? -19.547 -1.574  12.424  1.00 77.98  ? 805 GLN A CG    1 
ATOM   6416  C  CD    . GLN A 1 825 ? -18.288 -0.810  12.042  1.00 76.54  ? 805 GLN A CD    1 
ATOM   6417  O  OE1   . GLN A 1 825 ? -17.734 -0.996  10.957  1.00 74.68  ? 805 GLN A OE1   1 
ATOM   6418  N  NE2   . GLN A 1 825 ? -17.826 0.051   12.941  1.00 76.25  ? 805 GLN A NE2   1 
ATOM   6419  N  N     . VAL A 1 826 ? -23.519 -1.116  10.612  1.00 81.01  ? 806 VAL A N     1 
ATOM   6420  C  CA    . VAL A 1 826 ? -24.452 -0.620  9.594   1.00 81.85  ? 806 VAL A CA    1 
ATOM   6421  C  C     . VAL A 1 826 ? -24.132 0.861   9.353   1.00 83.01  ? 806 VAL A C     1 
ATOM   6422  O  O     . VAL A 1 826 ? -24.460 1.709   10.186  1.00 82.87  ? 806 VAL A O     1 
ATOM   6423  C  CB    . VAL A 1 826 ? -25.926 -0.798  10.032  1.00 81.44  ? 806 VAL A CB    1 
ATOM   6424  C  CG1   . VAL A 1 826 ? -26.879 -0.222  8.987   1.00 81.72  ? 806 VAL A CG1   1 
ATOM   6425  C  CG2   . VAL A 1 826 ? -26.232 -2.271  10.282  1.00 81.10  ? 806 VAL A CG2   1 
ATOM   6426  N  N     . ASN A 1 827 ? -23.495 1.148   8.214   1.00 84.61  ? 807 ASN A N     1 
ATOM   6427  C  CA    . ASN A 1 827 ? -22.917 2.470   7.898   1.00 85.51  ? 807 ASN A CA    1 
ATOM   6428  C  C     . ASN A 1 827 ? -21.826 2.887   8.904   1.00 87.20  ? 807 ASN A C     1 
ATOM   6429  O  O     . ASN A 1 827 ? -21.785 4.034   9.362   1.00 86.56  ? 807 ASN A O     1 
ATOM   6430  C  CB    . ASN A 1 827 ? -24.003 3.558   7.769   1.00 84.56  ? 807 ASN A CB    1 
ATOM   6431  C  CG    . ASN A 1 827 ? -25.076 3.208   6.749   1.00 83.41  ? 807 ASN A CG    1 
ATOM   6432  O  OD1   . ASN A 1 827 ? -24.852 2.416   5.835   1.00 82.76  ? 807 ASN A OD1   1 
ATOM   6433  N  ND2   . ASN A 1 827 ? -26.247 3.814   6.898   1.00 83.12  ? 807 ASN A ND2   1 
ATOM   6434  N  N     . GLY A 1 828 ? -20.949 1.939   9.236   1.00 88.68  ? 808 GLY A N     1 
ATOM   6435  C  CA    . GLY A 1 828 ? -19.801 2.188   10.111  1.00 89.94  ? 808 GLY A CA    1 
ATOM   6436  C  C     . GLY A 1 828 ? -20.122 2.459   11.573  1.00 90.84  ? 808 GLY A C     1 
ATOM   6437  O  O     . GLY A 1 828 ? -19.377 3.180   12.241  1.00 93.49  ? 808 GLY A O     1 
ATOM   6438  N  N     . LYS A 1 829 ? -21.221 1.887   12.067  1.00 89.93  ? 809 LYS A N     1 
ATOM   6439  C  CA    . LYS A 1 829 ? -21.644 2.046   13.464  1.00 89.90  ? 809 LYS A CA    1 
ATOM   6440  C  C     . LYS A 1 829 ? -22.146 0.703   13.992  1.00 88.17  ? 809 LYS A C     1 
ATOM   6441  O  O     . LYS A 1 829 ? -23.027 0.092   13.388  1.00 88.05  ? 809 LYS A O     1 
ATOM   6442  C  CB    . LYS A 1 829 ? -22.743 3.105   13.576  1.00 92.03  ? 809 LYS A CB    1 
ATOM   6443  C  CG    . LYS A 1 829 ? -22.292 4.504   13.184  1.00 93.76  ? 809 LYS A CG    1 
ATOM   6444  C  CD    . LYS A 1 829 ? -23.386 5.536   13.404  1.00 95.11  ? 809 LYS A CD    1 
ATOM   6445  C  CE    . LYS A 1 829 ? -22.945 6.915   12.937  1.00 95.95  ? 809 LYS A CE    1 
ATOM   6446  N  NZ    . LYS A 1 829 ? -24.034 7.924   13.053  1.00 96.24  ? 809 LYS A NZ    1 
ATOM   6447  N  N     . VAL A 1 830 ? -21.597 0.264   15.125  1.00 86.35  ? 810 VAL A N     1 
ATOM   6448  C  CA    . VAL A 1 830 ? -21.812 -1.100  15.620  1.00 85.30  ? 810 VAL A CA    1 
ATOM   6449  C  C     . VAL A 1 830 ? -23.216 -1.259  16.203  1.00 84.25  ? 810 VAL A C     1 
ATOM   6450  O  O     . VAL A 1 830 ? -23.611 -0.504  17.092  1.00 85.17  ? 810 VAL A O     1 
ATOM   6451  C  CB    . VAL A 1 830 ? -20.765 -1.498  16.689  1.00 85.65  ? 810 VAL A CB    1 
ATOM   6452  C  CG1   . VAL A 1 830 ? -21.030 -2.908  17.218  1.00 86.26  ? 810 VAL A CG1   1 
ATOM   6453  C  CG2   . VAL A 1 830 ? -19.356 -1.401  16.118  1.00 85.94  ? 810 VAL A CG2   1 
ATOM   6454  N  N     . ARG A 1 831 ? -23.954 -2.243  15.689  1.00 83.06  ? 811 ARG A N     1 
ATOM   6455  C  CA    . ARG A 1 831 ? -25.309 -2.560  16.160  1.00 82.77  ? 811 ARG A CA    1 
ATOM   6456  C  C     . ARG A 1 831 ? -25.413 -3.898  16.902  1.00 83.15  ? 811 ARG A C     1 
ATOM   6457  O  O     . ARG A 1 831 ? -26.250 -4.035  17.797  1.00 82.52  ? 811 ARG A O     1 
ATOM   6458  C  CB    . ARG A 1 831 ? -26.291 -2.530  14.981  1.00 81.65  ? 811 ARG A CB    1 
ATOM   6459  C  CG    . ARG A 1 831 ? -26.293 -1.226  14.186  1.00 80.54  ? 811 ARG A CG    1 
ATOM   6460  C  CD    . ARG A 1 831 ? -26.563 -0.013  15.069  1.00 79.82  ? 811 ARG A CD    1 
ATOM   6461  N  NE    . ARG A 1 831 ? -26.728 1.226   14.311  1.00 78.62  ? 811 ARG A NE    1 
ATOM   6462  C  CZ    . ARG A 1 831 ? -27.001 2.417   14.848  1.00 77.21  ? 811 ARG A CZ    1 
ATOM   6463  N  NH1   . ARG A 1 831 ? -27.151 2.557   16.166  1.00 76.55  ? 811 ARG A NH1   1 
ATOM   6464  N  NH2   . ARG A 1 831 ? -27.128 3.482   14.062  1.00 77.24  ? 811 ARG A NH2   1 
ATOM   6465  N  N     . ALA A 1 832 ? -24.583 -4.877  16.532  1.00 83.88  ? 812 ALA A N     1 
ATOM   6466  C  CA    . ALA A 1 832 ? -24.561 -6.178  17.209  1.00 84.81  ? 812 ALA A CA    1 
ATOM   6467  C  C     . ALA A 1 832 ? -23.188 -6.845  17.146  1.00 85.08  ? 812 ALA A C     1 
ATOM   6468  O  O     . ALA A 1 832 ? -22.329 -6.454  16.352  1.00 85.17  ? 812 ALA A O     1 
ATOM   6469  C  CB    . ALA A 1 832 ? -25.615 -7.094  16.608  1.00 85.23  ? 812 ALA A CB    1 
ATOM   6470  N  N     . LYS A 1 833 ? -23.003 -7.849  18.002  1.00 85.78  ? 813 LYS A N     1 
ATOM   6471  C  CA    . LYS A 1 833 ? -21.777 -8.653  18.060  1.00 86.02  ? 813 LYS A CA    1 
ATOM   6472  C  C     . LYS A 1 833 ? -22.153 -10.132 18.124  1.00 85.18  ? 813 LYS A C     1 
ATOM   6473  O  O     . LYS A 1 833 ? -23.074 -10.504 18.857  1.00 85.24  ? 813 LYS A O     1 
ATOM   6474  C  CB    . LYS A 1 833 ? -20.948 -8.275  19.288  1.00 86.44  ? 813 LYS A CB    1 
ATOM   6475  C  CG    . LYS A 1 833 ? -20.597 -6.798  19.378  1.00 87.21  ? 813 LYS A CG    1 
ATOM   6476  C  CD    . LYS A 1 833 ? -19.814 -6.494  20.642  1.00 88.38  ? 813 LYS A CD    1 
ATOM   6477  C  CE    . LYS A 1 833 ? -19.748 -5.000  20.908  1.00 88.81  ? 813 LYS A CE    1 
ATOM   6478  N  NZ    . LYS A 1 833 ? -19.046 -4.703  22.187  1.00 89.71  ? 813 LYS A NZ    1 
ATOM   6479  N  N     . ILE A 1 834 ? -21.432 -10.968 17.374  1.00 83.52  ? 814 ILE A N     1 
ATOM   6480  C  CA    . ILE A 1 834 ? -21.767 -12.394 17.235  1.00 83.40  ? 814 ILE A CA    1 
ATOM   6481  C  C     . ILE A 1 834 ? -20.535 -13.300 17.290  1.00 84.25  ? 814 ILE A C     1 
ATOM   6482  O  O     . ILE A 1 834 ? -19.455 -12.918 16.839  1.00 85.16  ? 814 ILE A O     1 
ATOM   6483  C  CB    . ILE A 1 834 ? -22.535 -12.673 15.919  1.00 82.20  ? 814 ILE A CB    1 
ATOM   6484  C  CG1   . ILE A 1 834 ? -21.841 -12.018 14.716  1.00 81.34  ? 814 ILE A CG1   1 
ATOM   6485  C  CG2   . ILE A 1 834 ? -23.968 -12.172 16.027  1.00 82.62  ? 814 ILE A CG2   1 
ATOM   6486  C  CD1   . ILE A 1 834 ? -22.297 -12.559 13.378  1.00 81.31  ? 814 ILE A CD1   1 
ATOM   6487  N  N     . THR A 1 835 ? -20.714 -14.495 17.853  1.00 85.13  ? 815 THR A N     1 
ATOM   6488  C  CA    . THR A 1 835 ? -19.695 -15.542 17.823  1.00 87.15  ? 815 THR A CA    1 
ATOM   6489  C  C     . THR A 1 835 ? -19.933 -16.401 16.585  1.00 89.16  ? 815 THR A C     1 
ATOM   6490  O  O     . THR A 1 835 ? -21.054 -16.855 16.348  1.00 90.31  ? 815 THR A O     1 
ATOM   6491  C  CB    . THR A 1 835 ? -19.754 -16.433 19.079  1.00 87.46  ? 815 THR A CB    1 
ATOM   6492  O  OG1   . THR A 1 835 ? -19.680 -15.615 20.253  1.00 87.63  ? 815 THR A OG1   1 
ATOM   6493  C  CG2   . THR A 1 835 ? -18.604 -17.443 19.095  1.00 87.26  ? 815 THR A CG2   1 
ATOM   6494  N  N     . VAL A 1 836 ? -18.879 -16.610 15.800  1.00 91.92  ? 816 VAL A N     1 
ATOM   6495  C  CA    . VAL A 1 836 ? -18.944 -17.400 14.567  1.00 94.89  ? 816 VAL A CA    1 
ATOM   6496  C  C     . VAL A 1 836 ? -17.738 -18.345 14.531  1.00 98.15  ? 816 VAL A C     1 
ATOM   6497  O  O     . VAL A 1 836 ? -16.651 -17.959 14.968  1.00 99.50  ? 816 VAL A O     1 
ATOM   6498  C  CB    . VAL A 1 836 ? -18.919 -16.489 13.314  1.00 94.88  ? 816 VAL A CB    1 
ATOM   6499  C  CG1   . VAL A 1 836 ? -19.153 -17.299 12.042  1.00 95.78  ? 816 VAL A CG1   1 
ATOM   6500  C  CG2   . VAL A 1 836 ? -19.962 -15.382 13.428  1.00 94.76  ? 816 VAL A CG2   1 
ATOM   6501  N  N     . PRO A 1 837 ? -17.921 -19.586 14.022  1.00 101.69 ? 817 PRO A N     1 
ATOM   6502  C  CA    . PRO A 1 837 ? -16.783 -20.487 13.781  1.00 104.37 ? 817 PRO A CA    1 
ATOM   6503  C  C     . PRO A 1 837 ? -15.662 -19.864 12.940  1.00 107.14 ? 817 PRO A C     1 
ATOM   6504  O  O     . PRO A 1 837 ? -15.922 -18.985 12.114  1.00 107.09 ? 817 PRO A O     1 
ATOM   6505  C  CB    . PRO A 1 837 ? -17.425 -21.656 13.033  1.00 103.95 ? 817 PRO A CB    1 
ATOM   6506  C  CG    . PRO A 1 837 ? -18.808 -21.715 13.577  1.00 102.91 ? 817 PRO A CG    1 
ATOM   6507  C  CD    . PRO A 1 837 ? -19.207 -20.294 13.863  1.00 102.10 ? 817 PRO A CD    1 
ATOM   6508  N  N     . VAL A 1 838 ? -14.433 -20.333 13.152  1.00 110.67 ? 818 VAL A N     1 
ATOM   6509  C  CA    . VAL A 1 838 ? -13.245 -19.735 12.529  1.00 114.13 ? 818 VAL A CA    1 
ATOM   6510  C  C     . VAL A 1 838 ? -13.266 -19.971 11.018  1.00 117.26 ? 818 VAL A C     1 
ATOM   6511  O  O     . VAL A 1 838 ? -13.145 -19.025 10.236  1.00 116.70 ? 818 VAL A O     1 
ATOM   6512  C  CB    . VAL A 1 838 ? -11.931 -20.282 13.146  1.00 114.64 ? 818 VAL A CB    1 
ATOM   6513  C  CG1   . VAL A 1 838 ? -10.706 -19.724 12.421  1.00 114.45 ? 818 VAL A CG1   1 
ATOM   6514  C  CG2   . VAL A 1 838 ? -11.864 -19.954 14.635  1.00 115.12 ? 818 VAL A CG2   1 
ATOM   6515  N  N     . ASP A 1 839 ? -13.421 -21.234 10.626  1.00 121.56 ? 819 ASP A N     1 
ATOM   6516  C  CA    . ASP A 1 839 ? -13.599 -21.606 9.214   1.00 123.51 ? 819 ASP A CA    1 
ATOM   6517  C  C     . ASP A 1 839 ? -15.046 -21.340 8.761   1.00 125.06 ? 819 ASP A C     1 
ATOM   6518  O  O     . ASP A 1 839 ? -15.862 -22.260 8.656   1.00 126.16 ? 819 ASP A O     1 
ATOM   6519  C  CB    . ASP A 1 839 ? -13.161 -23.066 8.942   1.00 123.84 ? 819 ASP A CB    1 
ATOM   6520  C  CG    . ASP A 1 839 ? -13.862 -24.096 9.837   1.00 123.47 ? 819 ASP A CG    1 
ATOM   6521  O  OD1   . ASP A 1 839 ? -14.456 -23.716 10.871  1.00 122.56 ? 819 ASP A OD1   1 
ATOM   6522  O  OD2   . ASP A 1 839 ? -13.806 -25.297 9.500   1.00 122.81 ? 819 ASP A OD2   1 
ATOM   6523  N  N     . ALA A 1 840 ? -15.344 -20.065 8.498   1.00 125.15 ? 820 ALA A N     1 
ATOM   6524  C  CA    . ALA A 1 840 ? -16.693 -19.623 8.121   1.00 123.66 ? 820 ALA A CA    1 
ATOM   6525  C  C     . ALA A 1 840 ? -16.648 -18.591 6.994   1.00 121.70 ? 820 ALA A C     1 
ATOM   6526  O  O     . ALA A 1 840 ? -15.873 -17.634 7.053   1.00 119.83 ? 820 ALA A O     1 
ATOM   6527  C  CB    . ALA A 1 840 ? -17.413 -19.046 9.329   1.00 123.69 ? 820 ALA A CB    1 
ATOM   6528  N  N     . THR A 1 841 ? -17.496 -18.788 5.984   1.00 120.66 ? 821 THR A N     1 
ATOM   6529  C  CA    . THR A 1 841 ? -17.534 -17.921 4.802   1.00 120.25 ? 821 THR A CA    1 
ATOM   6530  C  C     . THR A 1 841 ? -18.242 -16.596 5.090   1.00 118.75 ? 821 THR A C     1 
ATOM   6531  O  O     . THR A 1 841 ? -18.862 -16.430 6.142   1.00 119.16 ? 821 THR A O     1 
ATOM   6532  C  CB    . THR A 1 841 ? -18.241 -18.620 3.619   1.00 120.30 ? 821 THR A CB    1 
ATOM   6533  O  OG1   . THR A 1 841 ? -19.568 -19.005 4.004   1.00 119.58 ? 821 THR A OG1   1 
ATOM   6534  C  CG2   . THR A 1 841 ? -17.467 -19.857 3.184   1.00 120.57 ? 821 THR A CG2   1 
ATOM   6535  N  N     . GLU A 1 842 ? -18.140 -15.662 4.144   1.00 116.35 ? 822 GLU A N     1 
ATOM   6536  C  CA    . GLU A 1 842 ? -18.827 -14.364 4.230   1.00 114.28 ? 822 GLU A CA    1 
ATOM   6537  C  C     . GLU A 1 842 ? -20.353 -14.504 4.210   1.00 114.28 ? 822 GLU A C     1 
ATOM   6538  O  O     . GLU A 1 842 ? -21.057 -13.715 4.843   1.00 112.25 ? 822 GLU A O     1 
ATOM   6539  C  CB    . GLU A 1 842 ? -18.378 -13.442 3.088   1.00 111.70 ? 822 GLU A CB    1 
ATOM   6540  C  CG    . GLU A 1 842 ? -18.901 -12.011 3.189   1.00 110.17 ? 822 GLU A CG    1 
ATOM   6541  C  CD    . GLU A 1 842 ? -18.399 -11.102 2.080   1.00 108.63 ? 822 GLU A CD    1 
ATOM   6542  O  OE1   . GLU A 1 842 ? -17.275 -11.312 1.577   1.00 107.94 ? 822 GLU A OE1   1 
ATOM   6543  O  OE2   . GLU A 1 842 ? -19.135 -10.161 1.714   1.00 106.86 ? 822 GLU A OE2   1 
ATOM   6544  N  N     . GLU A 1 843 ? -20.850 -15.507 3.489   1.00 116.33 ? 823 GLU A N     1 
ATOM   6545  C  CA    . GLU A 1 843 ? -22.293 -15.737 3.344   1.00 118.23 ? 823 GLU A CA    1 
ATOM   6546  C  C     . GLU A 1 843 ? -22.919 -16.236 4.650   1.00 116.40 ? 823 GLU A C     1 
ATOM   6547  O  O     . GLU A 1 843 ? -24.049 -15.868 4.977   1.00 117.25 ? 823 GLU A O     1 
ATOM   6548  C  CB    . GLU A 1 843 ? -22.586 -16.722 2.199   1.00 121.49 ? 823 GLU A CB    1 
ATOM   6549  C  CG    . GLU A 1 843 ? -22.496 -16.118 0.797   1.00 124.81 ? 823 GLU A CG    1 
ATOM   6550  C  CD    . GLU A 1 843 ? -21.119 -15.574 0.438   1.00 126.91 ? 823 GLU A CD    1 
ATOM   6551  O  OE1   . GLU A 1 843 ? -20.102 -16.120 0.920   1.00 128.23 ? 823 GLU A OE1   1 
ATOM   6552  O  OE2   . GLU A 1 843 ? -21.050 -14.593 -0.333  1.00 127.30 ? 823 GLU A OE2   1 
ATOM   6553  N  N     . GLN A 1 844 ? -22.182 -17.071 5.383   1.00 113.37 ? 824 GLN A N     1 
ATOM   6554  C  CA    . GLN A 1 844 ? -22.609 -17.552 6.704   1.00 111.73 ? 824 GLN A CA    1 
ATOM   6555  C  C     . GLN A 1 844 ? -22.649 -16.439 7.758   1.00 110.84 ? 824 GLN A C     1 
ATOM   6556  O  O     . GLN A 1 844 ? -23.520 -16.446 8.632   1.00 111.49 ? 824 GLN A O     1 
ATOM   6557  C  CB    . GLN A 1 844 ? -21.698 -18.687 7.186   1.00 111.53 ? 824 GLN A CB    1 
ATOM   6558  C  CG    . GLN A 1 844 ? -21.821 -19.966 6.371   1.00 112.20 ? 824 GLN A CG    1 
ATOM   6559  C  CD    . GLN A 1 844 ? -20.745 -20.984 6.703   1.00 112.57 ? 824 GLN A CD    1 
ATOM   6560  O  OE1   . GLN A 1 844 ? -19.553 -20.682 6.652   1.00 112.01 ? 824 GLN A OE1   1 
ATOM   6561  N  NE2   . GLN A 1 844 ? -21.160 -22.203 7.033   1.00 112.51 ? 824 GLN A NE2   1 
ATOM   6562  N  N     . VAL A 1 845 ? -21.710 -15.494 7.671   1.00 108.53 ? 825 VAL A N     1 
ATOM   6563  C  CA    . VAL A 1 845 ? -21.645 -14.356 8.601   1.00 107.12 ? 825 VAL A CA    1 
ATOM   6564  C  C     . VAL A 1 845 ? -22.778 -13.358 8.329   1.00 106.76 ? 825 VAL A C     1 
ATOM   6565  O  O     . VAL A 1 845 ? -23.394 -12.852 9.271   1.00 106.34 ? 825 VAL A O     1 
ATOM   6566  C  CB    . VAL A 1 845 ? -20.266 -13.649 8.548   1.00 105.71 ? 825 VAL A CB    1 
ATOM   6567  C  CG1   . VAL A 1 845 ? -20.247 -12.392 9.413   1.00 105.61 ? 825 VAL A CG1   1 
ATOM   6568  C  CG2   . VAL A 1 845 ? -19.164 -14.595 9.005   1.00 105.43 ? 825 VAL A CG2   1 
ATOM   6569  N  N     . ARG A 1 846 ? -23.037 -13.073 7.052   1.00 105.77 ? 826 ARG A N     1 
ATOM   6570  C  CA    . ARG A 1 846 ? -24.174 -12.229 6.649   1.00 105.25 ? 826 ARG A CA    1 
ATOM   6571  C  C     . ARG A 1 846 ? -25.520 -12.799 7.101   1.00 104.19 ? 826 ARG A C     1 
ATOM   6572  O  O     . ARG A 1 846 ? -26.395 -12.050 7.537   1.00 103.84 ? 826 ARG A O     1 
ATOM   6573  C  CB    . ARG A 1 846 ? -24.208 -12.027 5.128   1.00 106.88 ? 826 ARG A CB    1 
ATOM   6574  C  CG    . ARG A 1 846 ? -23.208 -11.010 4.599   1.00 108.07 ? 826 ARG A CG    1 
ATOM   6575  C  CD    . ARG A 1 846 ? -23.577 -10.550 3.196   1.00 108.56 ? 826 ARG A CD    1 
ATOM   6576  N  NE    . ARG A 1 846 ? -24.771 -9.701  3.187   1.00 109.46 ? 826 ARG A NE    1 
ATOM   6577  C  CZ    . ARG A 1 846 ? -25.328 -9.168  2.097   1.00 111.08 ? 826 ARG A CZ    1 
ATOM   6578  N  NH1   . ARG A 1 846 ? -24.813 -9.381  0.885   1.00 110.82 ? 826 ARG A NH1   1 
ATOM   6579  N  NH2   . ARG A 1 846 ? -26.416 -8.409  2.219   1.00 112.08 ? 826 ARG A NH2   1 
ATOM   6580  N  N     . GLU A 1 847 ? -25.674 -14.119 6.983   1.00 104.18 ? 827 GLU A N     1 
ATOM   6581  C  CA    . GLU A 1 847 ? -26.911 -14.805 7.375   1.00 104.56 ? 827 GLU A CA    1 
ATOM   6582  C  C     . GLU A 1 847 ? -27.134 -14.698 8.886   1.00 102.33 ? 827 GLU A C     1 
ATOM   6583  O  O     . GLU A 1 847 ? -28.238 -14.375 9.331   1.00 101.98 ? 827 GLU A O     1 
ATOM   6584  C  CB    . GLU A 1 847 ? -26.880 -16.279 6.931   1.00 106.72 ? 827 GLU A CB    1 
ATOM   6585  C  CG    . GLU A 1 847 ? -28.248 -16.948 6.801   1.00 108.69 ? 827 GLU A CG    1 
ATOM   6586  C  CD    . GLU A 1 847 ? -28.814 -17.449 8.121   1.00 110.77 ? 827 GLU A CD    1 
ATOM   6587  O  OE1   . GLU A 1 847 ? -29.965 -17.088 8.450   1.00 112.34 ? 827 GLU A OE1   1 
ATOM   6588  O  OE2   . GLU A 1 847 ? -28.114 -18.201 8.833   1.00 112.10 ? 827 GLU A OE2   1 
ATOM   6589  N  N     . ARG A 1 848 ? -26.080 -14.965 9.656   1.00 99.29  ? 828 ARG A N     1 
ATOM   6590  C  CA    . ARG A 1 848 ? -26.111 -14.825 11.116  1.00 96.55  ? 828 ARG A CA    1 
ATOM   6591  C  C     . ARG A 1 848 ? -26.321 -13.366 11.545  1.00 95.16  ? 828 ARG A C     1 
ATOM   6592  O  O     . ARG A 1 848 ? -27.048 -13.104 12.504  1.00 95.00  ? 828 ARG A O     1 
ATOM   6593  C  CB    . ARG A 1 848 ? -24.819 -15.392 11.728  1.00 95.54  ? 828 ARG A CB    1 
ATOM   6594  C  CG    . ARG A 1 848 ? -24.713 -15.332 13.250  1.00 95.51  ? 828 ARG A CG    1 
ATOM   6595  C  CD    . ARG A 1 848 ? -25.698 -16.252 13.955  1.00 94.72  ? 828 ARG A CD    1 
ATOM   6596  N  NE    . ARG A 1 848 ? -25.697 -16.028 15.403  1.00 94.66  ? 828 ARG A NE    1 
ATOM   6597  C  CZ    . ARG A 1 848 ? -26.308 -15.019 16.033  1.00 95.02  ? 828 ARG A CZ    1 
ATOM   6598  N  NH1   . ARG A 1 848 ? -26.997 -14.093 15.362  1.00 95.17  ? 828 ARG A NH1   1 
ATOM   6599  N  NH2   . ARG A 1 848 ? -26.228 -14.931 17.359  1.00 95.05  ? 828 ARG A NH2   1 
ATOM   6600  N  N     . ALA A 1 849 ? -25.685 -12.432 10.838  1.00 94.84  ? 829 ALA A N     1 
ATOM   6601  C  CA    . ALA A 1 849 ? -25.814 -10.996 11.130  1.00 95.04  ? 829 ALA A CA    1 
ATOM   6602  C  C     . ALA A 1 849 ? -27.231 -10.461 10.900  1.00 95.03  ? 829 ALA A C     1 
ATOM   6603  O  O     . ALA A 1 849 ? -27.674 -9.555  11.610  1.00 94.24  ? 829 ALA A O     1 
ATOM   6604  C  CB    . ALA A 1 849 ? -24.812 -10.196 10.309  1.00 95.12  ? 829 ALA A CB    1 
ATOM   6605  N  N     . GLY A 1 850 ? -27.927 -11.014 9.907   1.00 96.03  ? 830 GLY A N     1 
ATOM   6606  C  CA    . GLY A 1 850 ? -29.321 -10.659 9.629   1.00 96.32  ? 830 GLY A CA    1 
ATOM   6607  C  C     . GLY A 1 850 ? -30.304 -11.067 10.716  1.00 96.71  ? 830 GLY A C     1 
ATOM   6608  O  O     . GLY A 1 850 ? -31.308 -10.383 10.930  1.00 95.05  ? 830 GLY A O     1 
ATOM   6609  N  N     . GLN A 1 851 ? -30.014 -12.174 11.403  1.00 97.92  ? 831 GLN A N     1 
ATOM   6610  C  CA    . GLN A 1 851 ? -30.866 -12.681 12.492  1.00 97.98  ? 831 GLN A CA    1 
ATOM   6611  C  C     . GLN A 1 851 ? -30.938 -11.753 13.716  1.00 97.08  ? 831 GLN A C     1 
ATOM   6612  O  O     . GLN A 1 851 ? -31.906 -11.819 14.478  1.00 98.43  ? 831 GLN A O     1 
ATOM   6613  C  CB    . GLN A 1 851 ? -30.406 -14.077 12.940  1.00 99.20  ? 831 GLN A CB    1 
ATOM   6614  C  CG    . GLN A 1 851 ? -30.593 -15.172 11.897  1.00 100.86 ? 831 GLN A CG    1 
ATOM   6615  C  CD    . GLN A 1 851 ? -29.905 -16.475 12.277  1.00 102.57 ? 831 GLN A CD    1 
ATOM   6616  O  OE1   . GLN A 1 851 ? -29.747 -16.792 13.458  1.00 104.56 ? 831 GLN A OE1   1 
ATOM   6617  N  NE2   . GLN A 1 851 ? -29.496 -17.241 11.273  1.00 101.10 ? 831 GLN A NE2   1 
ATOM   6618  N  N     . GLU A 1 852 ? -29.921 -10.909 13.907  1.00 95.12  ? 832 GLU A N     1 
ATOM   6619  C  CA    . GLU A 1 852 ? -29.914 -9.926  14.999  1.00 93.64  ? 832 GLU A CA    1 
ATOM   6620  C  C     . GLU A 1 852 ? -30.951 -8.833  14.737  1.00 92.45  ? 832 GLU A C     1 
ATOM   6621  O  O     . GLU A 1 852 ? -31.050 -8.327  13.619  1.00 92.38  ? 832 GLU A O     1 
ATOM   6622  C  CB    . GLU A 1 852 ? -28.526 -9.295  15.158  1.00 92.76  ? 832 GLU A CB    1 
ATOM   6623  C  CG    . GLU A 1 852 ? -27.423 -10.267 15.568  1.00 92.88  ? 832 GLU A CG    1 
ATOM   6624  C  CD    . GLU A 1 852 ? -27.590 -10.815 16.977  1.00 93.06  ? 832 GLU A CD    1 
ATOM   6625  O  OE1   . GLU A 1 852 ? -27.887 -10.027 17.901  1.00 93.56  ? 832 GLU A OE1   1 
ATOM   6626  O  OE2   . GLU A 1 852 ? -27.410 -12.039 17.163  1.00 91.71  ? 832 GLU A OE2   1 
ATOM   6627  N  N     . HIS A 1 853 ? -31.716 -8.478  15.770  1.00 91.88  ? 833 HIS A N     1 
ATOM   6628  C  CA    . HIS A 1 853 ? -32.834 -7.533  15.627  1.00 92.38  ? 833 HIS A CA    1 
ATOM   6629  C  C     . HIS A 1 853 ? -32.385 -6.078  15.431  1.00 92.42  ? 833 HIS A C     1 
ATOM   6630  O  O     . HIS A 1 853 ? -33.011 -5.339  14.667  1.00 93.33  ? 833 HIS A O     1 
ATOM   6631  C  CB    . HIS A 1 853 ? -33.829 -7.660  16.797  1.00 92.84  ? 833 HIS A CB    1 
ATOM   6632  C  CG    . HIS A 1 853 ? -33.343 -7.078  18.090  1.00 93.18  ? 833 HIS A CG    1 
ATOM   6633  N  ND1   . HIS A 1 853 ? -32.545 -7.778  18.970  1.00 93.50  ? 833 HIS A ND1   1 
ATOM   6634  C  CD2   . HIS A 1 853 ? -33.560 -5.869  18.659  1.00 92.79  ? 833 HIS A CD2   1 
ATOM   6635  C  CE1   . HIS A 1 853 ? -32.282 -7.020  20.020  1.00 93.14  ? 833 HIS A CE1   1 
ATOM   6636  N  NE2   . HIS A 1 853 ? -32.887 -5.858  19.857  1.00 92.88  ? 833 HIS A NE2   1 
ATOM   6637  N  N     . LEU A 1 854 ? -31.310 -5.676  16.111  1.00 91.90  ? 834 LEU A N     1 
ATOM   6638  C  CA    . LEU A 1 854 ? -30.730 -4.335  15.931  1.00 91.66  ? 834 LEU A CA    1 
ATOM   6639  C  C     . LEU A 1 854 ? -30.098 -4.132  14.547  1.00 91.43  ? 834 LEU A C     1 
ATOM   6640  O  O     . LEU A 1 854 ? -30.005 -2.999  14.076  1.00 90.72  ? 834 LEU A O     1 
ATOM   6641  C  CB    . LEU A 1 854 ? -29.696 -4.033  17.024  1.00 91.52  ? 834 LEU A CB    1 
ATOM   6642  C  CG    . LEU A 1 854 ? -30.234 -3.877  18.450  1.00 91.14  ? 834 LEU A CG    1 
ATOM   6643  C  CD1   . LEU A 1 854 ? -29.096 -3.915  19.460  1.00 91.81  ? 834 LEU A CD1   1 
ATOM   6644  C  CD2   . LEU A 1 854 ? -31.039 -2.594  18.604  1.00 90.47  ? 834 LEU A CD2   1 
ATOM   6645  N  N     . VAL A 1 855 ? -29.666 -5.222  13.909  1.00 91.66  ? 835 VAL A N     1 
ATOM   6646  C  CA    . VAL A 1 855 ? -29.132 -5.177  12.541  1.00 91.58  ? 835 VAL A CA    1 
ATOM   6647  C  C     . VAL A 1 855 ? -30.277 -4.989  11.546  1.00 91.54  ? 835 VAL A C     1 
ATOM   6648  O  O     . VAL A 1 855 ? -30.252 -4.059  10.736  1.00 92.12  ? 835 VAL A O     1 
ATOM   6649  C  CB    . VAL A 1 855 ? -28.332 -6.459  12.193  1.00 91.20  ? 835 VAL A CB    1 
ATOM   6650  C  CG1   . VAL A 1 855 ? -27.902 -6.468  10.727  1.00 90.55  ? 835 VAL A CG1   1 
ATOM   6651  C  CG2   . VAL A 1 855 ? -27.114 -6.588  13.102  1.00 91.81  ? 835 VAL A CG2   1 
ATOM   6652  N  N     . ALA A 1 856 ? -31.274 -5.870  11.624  1.00 91.44  ? 836 ALA A N     1 
ATOM   6653  C  CA    . ALA A 1 856 ? -32.435 -5.843  10.720  1.00 91.01  ? 836 ALA A CA    1 
ATOM   6654  C  C     . ALA A 1 856 ? -33.313 -4.592  10.862  1.00 90.22  ? 836 ALA A C     1 
ATOM   6655  O  O     . ALA A 1 856 ? -34.027 -4.236  9.923   1.00 88.26  ? 836 ALA A O     1 
ATOM   6656  C  CB    . ALA A 1 856 ? -33.280 -7.096  10.909  1.00 91.17  ? 836 ALA A CB    1 
ATOM   6657  N  N     . LYS A 1 857 ? -33.266 -3.946  12.029  1.00 90.40  ? 837 LYS A N     1 
ATOM   6658  C  CA    . LYS A 1 857 ? -33.970 -2.680  12.270  1.00 91.58  ? 837 LYS A CA    1 
ATOM   6659  C  C     . LYS A 1 857 ? -33.603 -1.606  11.239  1.00 93.13  ? 837 LYS A C     1 
ATOM   6660  O  O     . LYS A 1 857 ? -34.488 -0.981  10.651  1.00 95.08  ? 837 LYS A O     1 
ATOM   6661  C  CB    . LYS A 1 857 ? -33.666 -2.172  13.687  1.00 91.40  ? 837 LYS A CB    1 
ATOM   6662  C  CG    . LYS A 1 857 ? -34.377 -0.887  14.087  1.00 92.10  ? 837 LYS A CG    1 
ATOM   6663  C  CD    . LYS A 1 857 ? -34.041 -0.513  15.520  1.00 93.13  ? 837 LYS A CD    1 
ATOM   6664  C  CE    . LYS A 1 857 ? -34.487 0.900   15.851  1.00 93.62  ? 837 LYS A CE    1 
ATOM   6665  N  NZ    . LYS A 1 857 ? -34.032 1.314   17.207  1.00 94.16  ? 837 LYS A NZ    1 
ATOM   6666  N  N     . TYR A 1 858 ? -32.302 -1.407  11.027  1.00 93.13  ? 838 TYR A N     1 
ATOM   6667  C  CA    . TYR A 1 858 ? -31.804 -0.389  10.089  1.00 92.75  ? 838 TYR A CA    1 
ATOM   6668  C  C     . TYR A 1 858 ? -31.777 -0.834  8.618   1.00 95.68  ? 838 TYR A C     1 
ATOM   6669  O  O     . TYR A 1 858 ? -31.691 0.014   7.728   1.00 96.69  ? 838 TYR A O     1 
ATOM   6670  C  CB    . TYR A 1 858 ? -30.415 0.093   10.517  1.00 90.31  ? 838 TYR A CB    1 
ATOM   6671  C  CG    . TYR A 1 858 ? -30.415 0.776   11.866  1.00 88.53  ? 838 TYR A CG    1 
ATOM   6672  C  CD1   . TYR A 1 858 ? -30.905 2.075   12.012  1.00 87.86  ? 838 TYR A CD1   1 
ATOM   6673  C  CD2   . TYR A 1 858 ? -29.936 0.124   13.001  1.00 87.84  ? 838 TYR A CD2   1 
ATOM   6674  C  CE1   . TYR A 1 858 ? -30.913 2.705   13.250  1.00 87.27  ? 838 TYR A CE1   1 
ATOM   6675  C  CE2   . TYR A 1 858 ? -29.939 0.746   14.244  1.00 87.23  ? 838 TYR A CE2   1 
ATOM   6676  C  CZ    . TYR A 1 858 ? -30.428 2.036   14.364  1.00 86.78  ? 838 TYR A CZ    1 
ATOM   6677  O  OH    . TYR A 1 858 ? -30.431 2.653   15.593  1.00 85.01  ? 838 TYR A OH    1 
ATOM   6678  N  N     . LEU A 1 859 ? -31.844 -2.144  8.367   1.00 98.02  ? 839 LEU A N     1 
ATOM   6679  C  CA    . LEU A 1 859 ? -31.889 -2.683  6.997   1.00 99.51  ? 839 LEU A CA    1 
ATOM   6680  C  C     . LEU A 1 859 ? -33.267 -2.592  6.321   1.00 101.52 ? 839 LEU A C     1 
ATOM   6681  O  O     . LEU A 1 859 ? -33.342 -2.614  5.092   1.00 102.77 ? 839 LEU A O     1 
ATOM   6682  C  CB    . LEU A 1 859 ? -31.405 -4.141  6.969   1.00 99.38  ? 839 LEU A CB    1 
ATOM   6683  C  CG    . LEU A 1 859 ? -29.935 -4.396  7.314   1.00 99.01  ? 839 LEU A CG    1 
ATOM   6684  C  CD1   . LEU A 1 859 ? -29.679 -5.889  7.466   1.00 98.80  ? 839 LEU A CD1   1 
ATOM   6685  C  CD2   . LEU A 1 859 ? -29.005 -3.797  6.269   1.00 99.51  ? 839 LEU A CD2   1 
ATOM   6686  N  N     . ASP A 1 860 ? -34.345 -2.511  7.105   1.00 103.01 ? 840 ASP A N     1 
ATOM   6687  C  CA    . ASP A 1 860 ? -35.704 -2.425  6.544   1.00 103.93 ? 840 ASP A CA    1 
ATOM   6688  C  C     . ASP A 1 860 ? -35.979 -1.055  5.924   1.00 102.60 ? 840 ASP A C     1 
ATOM   6689  O  O     . ASP A 1 860 ? -35.607 -0.024  6.486   1.00 100.70 ? 840 ASP A O     1 
ATOM   6690  C  CB    . ASP A 1 860 ? -36.769 -2.744  7.604   1.00 106.04 ? 840 ASP A CB    1 
ATOM   6691  C  CG    . ASP A 1 860 ? -36.908 -4.236  7.870   1.00 107.66 ? 840 ASP A CG    1 
ATOM   6692  O  OD1   . ASP A 1 860 ? -35.917 -4.983  7.706   1.00 108.49 ? 840 ASP A OD1   1 
ATOM   6693  O  OD2   . ASP A 1 860 ? -38.021 -4.662  8.245   1.00 108.25 ? 840 ASP A OD2   1 
ATOM   6694  N  N     . GLY A 1 861 ? -36.635 -1.067  4.764   1.00 103.35 ? 841 GLY A N     1 
ATOM   6695  C  CA    . GLY A 1 861 ? -36.918 0.147   3.996   1.00 104.14 ? 841 GLY A CA    1 
ATOM   6696  C  C     . GLY A 1 861 ? -35.778 0.650   3.121   1.00 104.23 ? 841 GLY A C     1 
ATOM   6697  O  O     . GLY A 1 861 ? -35.917 1.692   2.482   1.00 103.91 ? 841 GLY A O     1 
ATOM   6698  N  N     . VAL A 1 862 ? -34.669 -0.090  3.065   1.00 105.13 ? 842 VAL A N     1 
ATOM   6699  C  CA    . VAL A 1 862 ? -33.452 0.356   2.374   1.00 106.08 ? 842 VAL A CA    1 
ATOM   6700  C  C     . VAL A 1 862 ? -32.671 -0.828  1.805   1.00 106.03 ? 842 VAL A C     1 
ATOM   6701  O  O     . VAL A 1 862 ? -32.829 -1.963  2.257   1.00 104.08 ? 842 VAL A O     1 
ATOM   6702  C  CB    . VAL A 1 862 ? -32.533 1.189   3.305   1.00 106.49 ? 842 VAL A CB    1 
ATOM   6703  C  CG1   . VAL A 1 862 ? -33.019 2.629   3.408   1.00 106.60 ? 842 VAL A CG1   1 
ATOM   6704  C  CG2   . VAL A 1 862 ? -32.431 0.559   4.690   1.00 106.17 ? 842 VAL A CG2   1 
ATOM   6705  N  N     . THR A 1 863 ? -31.826 -0.541  0.817   1.00 108.05 ? 843 THR A N     1 
ATOM   6706  C  CA    . THR A 1 863 ? -31.098 -1.567  0.066   1.00 110.53 ? 843 THR A CA    1 
ATOM   6707  C  C     . THR A 1 863 ? -29.635 -1.655  0.508   1.00 111.53 ? 843 THR A C     1 
ATOM   6708  O  O     . THR A 1 863 ? -29.037 -0.652  0.908   1.00 111.56 ? 843 THR A O     1 
ATOM   6709  C  CB    . THR A 1 863 ? -31.148 -1.273  -1.451  1.00 111.84 ? 843 THR A CB    1 
ATOM   6710  O  OG1   . THR A 1 863 ? -32.466 -0.842  -1.818  1.00 111.40 ? 843 THR A OG1   1 
ATOM   6711  C  CG2   . THR A 1 863 ? -30.776 -2.512  -2.269  1.00 112.51 ? 843 THR A CG2   1 
ATOM   6712  N  N     . VAL A 1 864 ? -29.072 -2.861  0.428   1.00 112.31 ? 844 VAL A N     1 
ATOM   6713  C  CA    . VAL A 1 864 ? -27.657 -3.098  0.715   1.00 113.27 ? 844 VAL A CA    1 
ATOM   6714  C  C     . VAL A 1 864 ? -26.848 -2.762  -0.539  1.00 113.94 ? 844 VAL A C     1 
ATOM   6715  O  O     . VAL A 1 864 ? -26.813 -3.548  -1.490  1.00 113.20 ? 844 VAL A O     1 
ATOM   6716  C  CB    . VAL A 1 864 ? -27.403 -4.564  1.145   1.00 114.35 ? 844 VAL A CB    1 
ATOM   6717  C  CG1   . VAL A 1 864 ? -25.914 -4.818  1.379   1.00 114.87 ? 844 VAL A CG1   1 
ATOM   6718  C  CG2   . VAL A 1 864 ? -28.210 -4.898  2.394   1.00 114.58 ? 844 VAL A CG2   1 
ATOM   6719  N  N     . ARG A 1 865 ? -26.210 -1.591  -0.537  1.00 115.47 ? 845 ARG A N     1 
ATOM   6720  C  CA    . ARG A 1 865 ? -25.424 -1.126  -1.685  1.00 117.29 ? 845 ARG A CA    1 
ATOM   6721  C  C     . ARG A 1 865 ? -24.081 -1.841  -1.767  1.00 118.93 ? 845 ARG A C     1 
ATOM   6722  O  O     . ARG A 1 865 ? -23.772 -2.473  -2.780  1.00 121.02 ? 845 ARG A O     1 
ATOM   6723  C  CB    . ARG A 1 865 ? -25.201 0.387   -1.616  1.00 117.55 ? 845 ARG A CB    1 
ATOM   6724  C  CG    . ARG A 1 865 ? -26.476 1.201   -1.743  1.00 118.53 ? 845 ARG A CG    1 
ATOM   6725  C  CD    . ARG A 1 865 ? -26.184 2.689   -1.673  1.00 119.96 ? 845 ARG A CD    1 
ATOM   6726  N  NE    . ARG A 1 865 ? -27.398 3.497   -1.785  1.00 121.60 ? 845 ARG A NE    1 
ATOM   6727  C  CZ    . ARG A 1 865 ? -27.447 4.827   -1.684  1.00 123.68 ? 845 ARG A CZ    1 
ATOM   6728  N  NH1   . ARG A 1 865 ? -26.343 5.544   -1.463  1.00 125.16 ? 845 ARG A NH1   1 
ATOM   6729  N  NH2   . ARG A 1 865 ? -28.616 5.452   -1.801  1.00 124.03 ? 845 ARG A NH2   1 
ATOM   6730  N  N     . LYS A 1 866 ? -23.294 -1.732  -0.696  1.00 119.53 ? 846 LYS A N     1 
ATOM   6731  C  CA    . LYS A 1 866 ? -21.960 -2.337  -0.618  1.00 118.81 ? 846 LYS A CA    1 
ATOM   6732  C  C     . LYS A 1 866 ? -21.790 -3.097  0.697   1.00 114.21 ? 846 LYS A C     1 
ATOM   6733  O  O     . LYS A 1 866 ? -22.340 -2.698  1.727   1.00 111.87 ? 846 LYS A O     1 
ATOM   6734  C  CB    . LYS A 1 866 ? -20.882 -1.255  -0.746  1.00 121.72 ? 846 LYS A CB    1 
ATOM   6735  C  CG    . LYS A 1 866 ? -19.506 -1.781  -1.137  1.00 124.00 ? 846 LYS A CG    1 
ATOM   6736  C  CD    . LYS A 1 866 ? -18.423 -0.719  -1.002  1.00 125.39 ? 846 LYS A CD    1 
ATOM   6737  C  CE    . LYS A 1 866 ? -18.555 0.378   -2.047  1.00 126.62 ? 846 LYS A CE    1 
ATOM   6738  N  NZ    . LYS A 1 866 ? -17.434 1.355   -1.962  1.00 127.35 ? 846 LYS A NZ    1 
ATOM   6739  N  N     . VAL A 1 867 ? -21.027 -4.189  0.644   1.00 110.63 ? 847 VAL A N     1 
ATOM   6740  C  CA    . VAL A 1 867 ? -20.716 -5.012  1.815   1.00 108.72 ? 847 VAL A CA    1 
ATOM   6741  C  C     . VAL A 1 867 ? -19.198 -5.109  1.956   1.00 105.64 ? 847 VAL A C     1 
ATOM   6742  O  O     . VAL A 1 867 ? -18.502 -5.407  0.984   1.00 106.31 ? 847 VAL A O     1 
ATOM   6743  C  CB    . VAL A 1 867 ? -21.311 -6.433  1.690   1.00 109.57 ? 847 VAL A CB    1 
ATOM   6744  C  CG1   . VAL A 1 867 ? -21.026 -7.256  2.947   1.00 109.65 ? 847 VAL A CG1   1 
ATOM   6745  C  CG2   . VAL A 1 867 ? -22.810 -6.364  1.417   1.00 110.02 ? 847 VAL A CG2   1 
ATOM   6746  N  N     . ILE A 1 868 ? -18.702 -4.862  3.169   1.00 101.96 ? 848 ILE A N     1 
ATOM   6747  C  CA    . ILE A 1 868 ? -17.275 -4.935  3.483   1.00 99.90  ? 848 ILE A CA    1 
ATOM   6748  C  C     . ILE A 1 868 ? -17.097 -5.939  4.617   1.00 97.65  ? 848 ILE A C     1 
ATOM   6749  O  O     . ILE A 1 868 ? -17.689 -5.773  5.683   1.00 97.72  ? 848 ILE A O     1 
ATOM   6750  C  CB    . ILE A 1 868 ? -16.718 -3.559  3.922   1.00 100.44 ? 848 ILE A CB    1 
ATOM   6751  C  CG1   . ILE A 1 868 ? -17.043 -2.469  2.884   1.00 100.76 ? 848 ILE A CG1   1 
ATOM   6752  C  CG2   . ILE A 1 868 ? -15.214 -3.638  4.180   1.00 100.70 ? 848 ILE A CG2   1 
ATOM   6753  C  CD1   . ILE A 1 868 ? -16.378 -2.640  1.531   1.00 101.37 ? 848 ILE A CD1   1 
ATOM   6754  N  N     . TYR A 1 869 ? -16.283 -6.970  4.381   1.00 96.16  ? 849 TYR A N     1 
ATOM   6755  C  CA    . TYR A 1 869 ? -16.075 -8.055  5.343   1.00 95.34  ? 849 TYR A CA    1 
ATOM   6756  C  C     . TYR A 1 869 ? -14.583 -8.305  5.575   1.00 94.42  ? 849 TYR A C     1 
ATOM   6757  O  O     . TYR A 1 869 ? -13.852 -8.629  4.637   1.00 93.75  ? 849 TYR A O     1 
ATOM   6758  C  CB    . TYR A 1 869 ? -16.757 -9.334  4.840   1.00 94.74  ? 849 TYR A CB    1 
ATOM   6759  C  CG    . TYR A 1 869 ? -16.502 -10.559 5.698   1.00 95.06  ? 849 TYR A CG    1 
ATOM   6760  C  CD1   . TYR A 1 869 ? -17.015 -10.649 6.993   1.00 94.77  ? 849 TYR A CD1   1 
ATOM   6761  C  CD2   . TYR A 1 869 ? -15.748 -11.632 5.213   1.00 96.01  ? 849 TYR A CD2   1 
ATOM   6762  C  CE1   . TYR A 1 869 ? -16.781 -11.770 7.783   1.00 95.02  ? 849 TYR A CE1   1 
ATOM   6763  C  CE2   . TYR A 1 869 ? -15.511 -12.756 5.994   1.00 96.01  ? 849 TYR A CE2   1 
ATOM   6764  C  CZ    . TYR A 1 869 ? -16.028 -12.822 7.276   1.00 95.36  ? 849 TYR A CZ    1 
ATOM   6765  O  OH    . TYR A 1 869 ? -15.791 -13.937 8.048   1.00 94.75  ? 849 TYR A OH    1 
ATOM   6766  N  N     . VAL A 1 870 ? -14.148 -8.139  6.826   1.00 93.86  ? 850 VAL A N     1 
ATOM   6767  C  CA    . VAL A 1 870 ? -12.801 -8.511  7.264   1.00 94.43  ? 850 VAL A CA    1 
ATOM   6768  C  C     . VAL A 1 870 ? -12.906 -9.905  7.901   1.00 95.41  ? 850 VAL A C     1 
ATOM   6769  O  O     . VAL A 1 870 ? -13.627 -10.063 8.888   1.00 95.80  ? 850 VAL A O     1 
ATOM   6770  C  CB    . VAL A 1 870 ? -12.231 -7.506  8.291   1.00 94.10  ? 850 VAL A CB    1 
ATOM   6771  C  CG1   . VAL A 1 870 ? -10.768 -7.817  8.597   1.00 94.13  ? 850 VAL A CG1   1 
ATOM   6772  C  CG2   . VAL A 1 870 ? -12.369 -6.075  7.781   1.00 93.70  ? 850 VAL A CG2   1 
ATOM   6773  N  N     . PRO A 1 871 ? -12.212 -10.920 7.333   1.00 96.40  ? 851 PRO A N     1 
ATOM   6774  C  CA    . PRO A 1 871 ? -12.272 -12.305 7.838   1.00 96.95  ? 851 PRO A CA    1 
ATOM   6775  C  C     . PRO A 1 871 ? -12.047 -12.486 9.351   1.00 95.94  ? 851 PRO A C     1 
ATOM   6776  O  O     . PRO A 1 871 ? -10.967 -12.183 9.865   1.00 95.25  ? 851 PRO A O     1 
ATOM   6777  C  CB    . PRO A 1 871 ? -11.166 -13.007 7.045   1.00 98.76  ? 851 PRO A CB    1 
ATOM   6778  C  CG    . PRO A 1 871 ? -11.144 -12.286 5.746   1.00 98.87  ? 851 PRO A CG    1 
ATOM   6779  C  CD    . PRO A 1 871 ? -11.475 -10.852 6.054   1.00 97.49  ? 851 PRO A CD    1 
ATOM   6780  N  N     . GLY A 1 872 ? -13.083 -12.963 10.042  1.00 95.00  ? 852 GLY A N     1 
ATOM   6781  C  CA    . GLY A 1 872 ? -13.022 -13.249 11.477  1.00 93.94  ? 852 GLY A CA    1 
ATOM   6782  C  C     . GLY A 1 872 ? -12.970 -12.046 12.408  1.00 92.69  ? 852 GLY A C     1 
ATOM   6783  O  O     . GLY A 1 872 ? -12.709 -12.210 13.602  1.00 91.96  ? 852 GLY A O     1 
ATOM   6784  N  N     . LYS A 1 873 ? -13.251 -10.853 11.879  1.00 92.53  ? 853 LYS A N     1 
ATOM   6785  C  CA    . LYS A 1 873 ? -13.056 -9.589  12.602  1.00 93.81  ? 853 LYS A CA    1 
ATOM   6786  C  C     . LYS A 1 873 ? -14.298 -8.691  12.590  1.00 92.87  ? 853 LYS A C     1 
ATOM   6787  O  O     . LYS A 1 873 ? -14.847 -8.384  13.650  1.00 93.59  ? 853 LYS A O     1 
ATOM   6788  C  CB    . LYS A 1 873 ? -11.853 -8.824  12.018  1.00 95.90  ? 853 LYS A CB    1 
ATOM   6789  C  CG    . LYS A 1 873 ? -10.621 -8.775  12.914  1.00 97.26  ? 853 LYS A CG    1 
ATOM   6790  C  CD    . LYS A 1 873 ? -9.937  -10.125 13.050  1.00 98.02  ? 853 LYS A CD    1 
ATOM   6791  C  CE    . LYS A 1 873 ? -8.657  -10.008 13.862  1.00 98.45  ? 853 LYS A CE    1 
ATOM   6792  N  NZ    . LYS A 1 873 ? -7.974  -11.319 14.031  1.00 99.35  ? 853 LYS A NZ    1 
ATOM   6793  N  N     . LEU A 1 874 ? -14.725 -8.271  11.397  1.00 91.44  ? 854 LEU A N     1 
ATOM   6794  C  CA    . LEU A 1 874 ? -15.750 -7.231  11.249  1.00 90.43  ? 854 LEU A CA    1 
ATOM   6795  C  C     . LEU A 1 874 ? -16.533 -7.352  9.935   1.00 89.54  ? 854 LEU A C     1 
ATOM   6796  O  O     . LEU A 1 874 ? -15.976 -7.739  8.904   1.00 88.86  ? 854 LEU A O     1 
ATOM   6797  C  CB    . LEU A 1 874 ? -15.074 -5.855  11.331  1.00 90.35  ? 854 LEU A CB    1 
ATOM   6798  C  CG    . LEU A 1 874 ? -15.864 -4.569  11.050  1.00 90.58  ? 854 LEU A CG    1 
ATOM   6799  C  CD1   . LEU A 1 874 ? -16.937 -4.325  12.096  1.00 90.94  ? 854 LEU A CD1   1 
ATOM   6800  C  CD2   . LEU A 1 874 ? -14.920 -3.382  10.995  1.00 91.03  ? 854 LEU A CD2   1 
ATOM   6801  N  N     . LEU A 1 875 ? -17.825 -7.020  9.997   1.00 88.18  ? 855 LEU A N     1 
ATOM   6802  C  CA    . LEU A 1 875 ? -18.687 -6.880  8.819   1.00 86.79  ? 855 LEU A CA    1 
ATOM   6803  C  C     . LEU A 1 875 ? -19.375 -5.518  8.882   1.00 86.05  ? 855 LEU A C     1 
ATOM   6804  O  O     . LEU A 1 875 ? -20.086 -5.231  9.847   1.00 84.20  ? 855 LEU A O     1 
ATOM   6805  C  CB    . LEU A 1 875 ? -19.746 -7.989  8.785   1.00 87.02  ? 855 LEU A CB    1 
ATOM   6806  C  CG    . LEU A 1 875 ? -20.738 -7.995  7.608   1.00 86.34  ? 855 LEU A CG    1 
ATOM   6807  C  CD1   . LEU A 1 875 ? -20.057 -8.459  6.330   1.00 86.53  ? 855 LEU A CD1   1 
ATOM   6808  C  CD2   . LEU A 1 875 ? -21.949 -8.867  7.906   1.00 85.58  ? 855 LEU A CD2   1 
ATOM   6809  N  N     . ASN A 1 876 ? -19.161 -4.691  7.858   1.00 86.38  ? 856 ASN A N     1 
ATOM   6810  C  CA    . ASN A 1 876 ? -19.831 -3.395  7.731   1.00 87.32  ? 856 ASN A CA    1 
ATOM   6811  C  C     . ASN A 1 876 ? -20.755 -3.405  6.516   1.00 88.06  ? 856 ASN A C     1 
ATOM   6812  O  O     . ASN A 1 876 ? -20.305 -3.646  5.394   1.00 90.09  ? 856 ASN A O     1 
ATOM   6813  C  CB    . ASN A 1 876 ? -18.800 -2.267  7.597   1.00 87.30  ? 856 ASN A CB    1 
ATOM   6814  C  CG    . ASN A 1 876 ? -19.440 -0.888  7.489   1.00 87.09  ? 856 ASN A CG    1 
ATOM   6815  O  OD1   . ASN A 1 876 ? -20.453 -0.602  8.131   1.00 85.24  ? 856 ASN A OD1   1 
ATOM   6816  N  ND2   . ASN A 1 876 ? -18.844 -0.024  6.676   1.00 88.52  ? 856 ASN A ND2   1 
ATOM   6817  N  N     . LEU A 1 877 ? -22.040 -3.144  6.752   1.00 88.55  ? 857 LEU A N     1 
ATOM   6818  C  CA    . LEU A 1 877 ? -23.036 -3.040  5.688   1.00 89.63  ? 857 LEU A CA    1 
ATOM   6819  C  C     . LEU A 1 877 ? -23.271 -1.565  5.357   1.00 91.54  ? 857 LEU A C     1 
ATOM   6820  O  O     . LEU A 1 877 ? -23.730 -0.803  6.211   1.00 90.56  ? 857 LEU A O     1 
ATOM   6821  C  CB    . LEU A 1 877 ? -24.350 -3.697  6.123   1.00 88.56  ? 857 LEU A CB    1 
ATOM   6822  C  CG    . LEU A 1 877 ? -24.282 -5.173  6.534   1.00 87.94  ? 857 LEU A CG    1 
ATOM   6823  C  CD1   . LEU A 1 877 ? -25.613 -5.631  7.111   1.00 87.51  ? 857 LEU A CD1   1 
ATOM   6824  C  CD2   . LEU A 1 877 ? -23.877 -6.053  5.360   1.00 87.85  ? 857 LEU A CD2   1 
ATOM   6825  N  N     . VAL A 1 878 ? -22.937 -1.167  4.127   1.00 93.41  ? 858 VAL A N     1 
ATOM   6826  C  CA    . VAL A 1 878 ? -23.214 0.187   3.636   1.00 93.86  ? 858 VAL A CA    1 
ATOM   6827  C  C     . VAL A 1 878 ? -24.641 0.198   3.088   1.00 94.99  ? 858 VAL A C     1 
ATOM   6828  O  O     . VAL A 1 878 ? -24.990 -0.630  2.240   1.00 95.07  ? 858 VAL A O     1 
ATOM   6829  C  CB    . VAL A 1 878 ? -22.211 0.628   2.546   1.00 93.95  ? 858 VAL A CB    1 
ATOM   6830  C  CG1   . VAL A 1 878 ? -22.518 2.045   2.067   1.00 94.00  ? 858 VAL A CG1   1 
ATOM   6831  C  CG2   . VAL A 1 878 ? -20.782 0.540   3.073   1.00 93.73  ? 858 VAL A CG2   1 
ATOM   6832  N  N     . VAL A 1 879 ? -25.448 1.144   3.570   1.00 95.59  ? 859 VAL A N     1 
ATOM   6833  C  CA    . VAL A 1 879 ? -26.895 1.157   3.343   1.00 95.71  ? 859 VAL A CA    1 
ATOM   6834  C  C     . VAL A 1 879 ? -27.348 2.522   2.824   1.00 96.84  ? 859 VAL A C     1 
ATOM   6835  O  O     . VAL A 1 879 ? -26.909 3.561   3.324   1.00 95.28  ? 859 VAL A O     1 
ATOM   6836  C  CB    . VAL A 1 879 ? -27.658 0.828   4.646   1.00 95.25  ? 859 VAL A CB    1 
ATOM   6837  C  CG1   . VAL A 1 879 ? -29.164 0.829   4.413   1.00 95.61  ? 859 VAL A CG1   1 
ATOM   6838  C  CG2   . VAL A 1 879 ? -27.208 -0.518  5.207   1.00 95.45  ? 859 VAL A CG2   1 
ATOM   6839  N  N     . GLY A 1 880 ? -28.238 2.504   1.831   1.00 99.68  ? 860 GLY A N     1 
ATOM   6840  C  CA    . GLY A 1 880 ? -28.785 3.721   1.232   1.00 102.29 ? 860 GLY A CA    1 
ATOM   6841  C  C     . GLY A 1 880 ? -29.951 4.283   2.023   1.00 104.32 ? 860 GLY A C     1 
ATOM   6842  O  O     . GLY A 1 880 ? -31.075 4.376   1.524   1.00 103.69 ? 860 GLY A O     1 
ATOM   6843  O  OXT   . GLY A 1 880 ? -29.801 4.661   3.185   1.00 107.22 ? 860 GLY A OXT   1 
ATOM   6844  O  OP3   . G   B 2 1   ? 8.732   30.292  17.860  1.00 92.39  ? 1   G   B OP3   1 
ATOM   6845  P  P     . G   B 2 1   ? 9.824   29.602  18.596  1.00 92.82  ? 1   G   B P     1 
ATOM   6846  O  OP1   . G   B 2 1   ? 9.479   28.157  18.647  1.00 91.70  ? 1   G   B OP1   1 
ATOM   6847  O  OP2   . G   B 2 1   ? 10.073  30.341  19.862  1.00 91.68  ? 1   G   B OP2   1 
ATOM   6848  O  "O5'" . G   B 2 1   ? 11.112  29.759  17.670  1.00 88.40  ? 1   G   B "O5'" 1 
ATOM   6849  C  "C5'" . G   B 2 1   ? 11.159  30.715  16.592  1.00 84.04  ? 1   G   B "C5'" 1 
ATOM   6850  C  "C4'" . G   B 2 1   ? 12.543  30.758  15.985  1.00 81.38  ? 1   G   B "C4'" 1 
ATOM   6851  O  "O4'" . G   B 2 1   ? 13.509  31.131  17.004  1.00 80.65  ? 1   G   B "O4'" 1 
ATOM   6852  C  "C3'" . G   B 2 1   ? 13.052  29.445  15.405  1.00 79.49  ? 1   G   B "C3'" 1 
ATOM   6853  O  "O3'" . G   B 2 1   ? 12.637  29.310  14.049  1.00 77.25  ? 1   G   B "O3'" 1 
ATOM   6854  C  "C2'" . G   B 2 1   ? 14.564  29.588  15.540  1.00 79.48  ? 1   G   B "C2'" 1 
ATOM   6855  O  "O2'" . G   B 2 1   ? 15.179  30.292  14.479  1.00 78.93  ? 1   G   B "O2'" 1 
ATOM   6856  C  "C1'" . G   B 2 1   ? 14.689  30.357  16.858  1.00 79.54  ? 1   G   B "C1'" 1 
ATOM   6857  N  N9    . G   B 2 1   ? 14.849  29.528  18.052  1.00 78.29  ? 1   G   B N9    1 
ATOM   6858  C  C8    . G   B 2 1   ? 14.070  29.554  19.185  1.00 77.75  ? 1   G   B C8    1 
ATOM   6859  N  N7    . G   B 2 1   ? 14.465  28.708  20.098  1.00 77.26  ? 1   G   B N7    1 
ATOM   6860  C  C5    . G   B 2 1   ? 15.578  28.094  19.540  1.00 76.57  ? 1   G   B C5    1 
ATOM   6861  C  C6    . G   B 2 1   ? 16.433  27.088  20.065  1.00 75.40  ? 1   G   B C6    1 
ATOM   6862  O  O6    . G   B 2 1   ? 16.370  26.518  21.161  1.00 73.63  ? 1   G   B O6    1 
ATOM   6863  N  N1    . G   B 2 1   ? 17.440  26.752  19.166  1.00 75.41  ? 1   G   B N1    1 
ATOM   6864  C  C2    . G   B 2 1   ? 17.609  27.313  17.922  1.00 75.76  ? 1   G   B C2    1 
ATOM   6865  N  N2    . G   B 2 1   ? 18.643  26.857  17.200  1.00 75.37  ? 1   G   B N2    1 
ATOM   6866  N  N3    . G   B 2 1   ? 16.821  28.254  17.424  1.00 76.76  ? 1   G   B N3    1 
ATOM   6867  C  C4    . G   B 2 1   ? 15.833  28.594  18.281  1.00 77.17  ? 1   G   B C4    1 
ATOM   6868  P  P     . C   B 2 2   ? 11.867  27.991  13.562  1.00 75.22  ? 2   C   B P     1 
ATOM   6869  O  OP1   . C   B 2 2   ? 11.442  28.202  12.154  1.00 74.27  ? 2   C   B OP1   1 
ATOM   6870  O  OP2   . C   B 2 2   ? 10.853  27.639  14.589  1.00 75.38  ? 2   C   B OP2   1 
ATOM   6871  O  "O5'" . C   B 2 2   ? 13.013  26.885  13.564  1.00 72.63  ? 2   C   B "O5'" 1 
ATOM   6872  C  "C5'" . C   B 2 2   ? 14.091  26.946  12.612  1.00 69.77  ? 2   C   B "C5'" 1 
ATOM   6873  C  "C4'" . C   B 2 2   ? 15.209  26.001  12.990  1.00 67.59  ? 2   C   B "C4'" 1 
ATOM   6874  O  "O4'" . C   B 2 2   ? 15.819  26.412  14.244  1.00 66.67  ? 2   C   B "O4'" 1 
ATOM   6875  C  "C3'" . C   B 2 2   ? 14.834  24.548  13.235  1.00 65.85  ? 2   C   B "C3'" 1 
ATOM   6876  O  "O3'" . C   B 2 2   ? 14.639  23.829  12.020  1.00 65.61  ? 2   C   B "O3'" 1 
ATOM   6877  C  "C2'" . C   B 2 2   ? 16.040  24.063  14.025  1.00 65.32  ? 2   C   B "C2'" 1 
ATOM   6878  O  "O2'" . C   B 2 2   ? 17.171  23.777  13.228  1.00 64.42  ? 2   C   B "O2'" 1 
ATOM   6879  C  "C1'" . C   B 2 2   ? 16.293  25.266  14.937  1.00 65.66  ? 2   C   B "C1'" 1 
ATOM   6880  N  N1    . C   B 2 2   ? 15.594  25.165  16.234  1.00 65.90  ? 2   C   B N1    1 
ATOM   6881  C  C2    . C   B 2 2   ? 16.116  24.312  17.214  1.00 65.93  ? 2   C   B C2    1 
ATOM   6882  O  O2    . C   B 2 2   ? 17.151  23.675  16.967  1.00 65.69  ? 2   C   B O2    1 
ATOM   6883  N  N3    . C   B 2 2   ? 15.480  24.204  18.405  1.00 66.02  ? 2   C   B N3    1 
ATOM   6884  C  C4    . C   B 2 2   ? 14.364  24.903  18.631  1.00 66.34  ? 2   C   B C4    1 
ATOM   6885  N  N4    . C   B 2 2   ? 13.772  24.770  19.820  1.00 66.65  ? 2   C   B N4    1 
ATOM   6886  C  C5    . C   B 2 2   ? 13.810  25.777  17.650  1.00 66.21  ? 2   C   B C5    1 
ATOM   6887  C  C6    . C   B 2 2   ? 14.448  25.873  16.476  1.00 66.09  ? 2   C   B C6    1 
ATOM   6888  P  P     . C   B 2 3   ? 13.473  22.730  11.899  1.00 64.72  ? 3   C   B P     1 
ATOM   6889  O  OP1   . C   B 2 3   ? 13.310  22.392  10.461  1.00 64.61  ? 3   C   B OP1   1 
ATOM   6890  O  OP2   . C   B 2 3   ? 12.299  23.201  12.679  1.00 63.34  ? 3   C   B OP2   1 
ATOM   6891  O  "O5'" . C   B 2 3   ? 14.093  21.460  12.633  1.00 64.61  ? 3   C   B "O5'" 1 
ATOM   6892  C  "C5'" . C   B 2 3   ? 15.263  20.800  12.116  1.00 64.83  ? 3   C   B "C5'" 1 
ATOM   6893  C  "C4'" . C   B 2 3   ? 15.765  19.747  13.081  1.00 64.94  ? 3   C   B "C4'" 1 
ATOM   6894  O  "O4'" . C   B 2 3   ? 16.273  20.373  14.291  1.00 64.89  ? 3   C   B "O4'" 1 
ATOM   6895  C  "C3'" . C   B 2 3   ? 14.745  18.742  13.594  1.00 64.77  ? 3   C   B "C3'" 1 
ATOM   6896  O  "O3'" . C   B 2 3   ? 14.464  17.722  12.643  1.00 66.02  ? 3   C   B "O3'" 1 
ATOM   6897  C  "C2'" . C   B 2 3   ? 15.438  18.227  14.848  1.00 63.87  ? 3   C   B "C2'" 1 
ATOM   6898  O  "O2'" . C   B 2 3   ? 16.476  17.300  14.608  1.00 63.48  ? 3   C   B "O2'" 1 
ATOM   6899  C  "C1'" . C   B 2 3   ? 16.031  19.521  15.403  1.00 63.45  ? 3   C   B "C1'" 1 
ATOM   6900  N  N1    . C   B 2 3   ? 15.129  20.210  16.346  1.00 62.38  ? 3   C   B N1    1 
ATOM   6901  C  C2    . C   B 2 3   ? 15.097  19.781  17.677  1.00 61.05  ? 3   C   B C2    1 
ATOM   6902  O  O2    . C   B 2 3   ? 15.829  18.841  18.023  1.00 60.10  ? 3   C   B O2    1 
ATOM   6903  N  N3    . C   B 2 3   ? 14.269  20.400  18.552  1.00 61.22  ? 3   C   B N3    1 
ATOM   6904  C  C4    . C   B 2 3   ? 13.492  21.405  18.138  1.00 61.95  ? 3   C   B C4    1 
ATOM   6905  N  N4    . C   B 2 3   ? 12.691  21.987  19.034  1.00 62.11  ? 3   C   B N4    1 
ATOM   6906  C  C5    . C   B 2 3   ? 13.501  21.857  16.787  1.00 62.21  ? 3   C   B C5    1 
ATOM   6907  C  C6    . C   B 2 3   ? 14.321  21.233  15.932  1.00 62.53  ? 3   C   B C6    1 
ATOM   6908  P  P     . C   B 2 4   ? 13.041  16.990  12.651  1.00 65.64  ? 4   C   B P     1 
ATOM   6909  O  OP1   . C   B 2 4   ? 13.030  15.998  11.546  1.00 65.67  ? 4   C   B OP1   1 
ATOM   6910  O  OP2   . C   B 2 4   ? 11.983  18.029  12.723  1.00 64.42  ? 4   C   B OP2   1 
ATOM   6911  O  "O5'" . C   B 2 4   ? 13.048  16.220  14.043  1.00 65.50  ? 4   C   B "O5'" 1 
ATOM   6912  C  "C5'" . C   B 2 4   ? 13.890  15.074  14.251  1.00 66.46  ? 4   C   B "C5'" 1 
ATOM   6913  C  "C4'" . C   B 2 4   ? 13.626  14.465  15.607  1.00 66.52  ? 4   C   B "C4'" 1 
ATOM   6914  O  "O4'" . C   B 2 4   ? 14.007  15.389  16.663  1.00 65.76  ? 4   C   B "O4'" 1 
ATOM   6915  C  "C3'" . C   B 2 4   ? 12.176  14.147  15.926  1.00 67.28  ? 4   C   B "C3'" 1 
ATOM   6916  O  "O3'" . C   B 2 4   ? 11.721  12.981  15.246  1.00 69.07  ? 4   C   B "O3'" 1 
ATOM   6917  C  "C2'" . C   B 2 4   ? 12.229  14.029  17.443  1.00 66.68  ? 4   C   B "C2'" 1 
ATOM   6918  O  "O2'" . C   B 2 4   ? 12.736  12.798  17.918  1.00 67.54  ? 4   C   B "O2'" 1 
ATOM   6919  C  "C1'" . C   B 2 4   ? 13.173  15.181  17.795  1.00 65.43  ? 4   C   B "C1'" 1 
ATOM   6920  N  N1    . C   B 2 4   ? 12.445  16.430  18.095  1.00 64.38  ? 4   C   B N1    1 
ATOM   6921  C  C2    . C   B 2 4   ? 11.975  16.638  19.398  1.00 63.67  ? 4   C   B C2    1 
ATOM   6922  O  O2    . C   B 2 4   ? 12.210  15.783  20.266  1.00 63.64  ? 4   C   B O2    1 
ATOM   6923  N  N3    . C   B 2 4   ? 11.290  17.771  19.681  1.00 63.03  ? 4   C   B N3    1 
ATOM   6924  C  C4    . C   B 2 4   ? 11.056  18.668  18.719  1.00 63.31  ? 4   C   B C4    1 
ATOM   6925  N  N4    . C   B 2 4   ? 10.376  19.770  19.041  1.00 63.38  ? 4   C   B N4    1 
ATOM   6926  C  C5    . C   B 2 4   ? 11.510  18.473  17.382  1.00 64.15  ? 4   C   B C5    1 
ATOM   6927  C  C6    . C   B 2 4   ? 12.188  17.349  17.115  1.00 64.54  ? 4   C   B C6    1 
ATOM   6928  P  P     . G   B 2 5   ? 10.155  12.641  15.192  1.00 70.21  ? 5   G   B P     1 
ATOM   6929  O  OP1   . G   B 2 5   ? 9.960   11.534  14.219  1.00 69.61  ? 5   G   B OP1   1 
ATOM   6930  O  OP2   . G   B 2 5   ? 9.403   13.913  15.020  1.00 68.29  ? 5   G   B OP2   1 
ATOM   6931  O  "O5'" . G   B 2 5   ? 9.874   12.082  16.656  1.00 68.28  ? 5   G   B "O5'" 1 
ATOM   6932  C  "C5'" . G   B 2 5   ? 8.565   12.138  17.244  1.00 67.03  ? 5   G   B "C5'" 1 
ATOM   6933  C  "C4'" . G   B 2 5   ? 8.669   11.931  18.734  1.00 66.23  ? 5   G   B "C4'" 1 
ATOM   6934  O  "O4'" . G   B 2 5   ? 9.578   12.915  19.305  1.00 65.24  ? 5   G   B "O4'" 1 
ATOM   6935  C  "C3'" . G   B 2 5   ? 7.368   12.088  19.505  1.00 65.62  ? 5   G   B "C3'" 1 
ATOM   6936  O  "O3'" . G   B 2 5   ? 6.668   10.851  19.535  1.00 65.67  ? 5   G   B "O3'" 1 
ATOM   6937  C  "C2'" . G   B 2 5   ? 7.863   12.565  20.863  1.00 64.87  ? 5   G   B "C2'" 1 
ATOM   6938  O  "O2'" . G   B 2 5   ? 8.365   11.532  21.686  1.00 64.58  ? 5   G   B "O2'" 1 
ATOM   6939  C  "C1'" . G   B 2 5   ? 8.979   13.515  20.438  1.00 64.64  ? 5   G   B "C1'" 1 
ATOM   6940  N  N9    . G   B 2 5   ? 8.501   14.842  20.058  1.00 64.78  ? 5   G   B N9    1 
ATOM   6941  C  C8    . G   B 2 5   ? 8.577   15.433  18.819  1.00 65.56  ? 5   G   B C8    1 
ATOM   6942  N  N7    . G   B 2 5   ? 8.058   16.630  18.790  1.00 65.10  ? 5   G   B N7    1 
ATOM   6943  C  C5    . G   B 2 5   ? 7.612   16.844  20.086  1.00 65.18  ? 5   G   B C5    1 
ATOM   6944  C  C6    . G   B 2 5   ? 6.961   17.967  20.661  1.00 65.87  ? 5   G   B C6    1 
ATOM   6945  O  O6    . G   B 2 5   ? 6.640   19.032  20.121  1.00 66.31  ? 5   G   B O6    1 
ATOM   6946  N  N1    . G   B 2 5   ? 6.684   17.763  22.010  1.00 66.02  ? 5   G   B N1    1 
ATOM   6947  C  C2    . G   B 2 5   ? 6.991   16.624  22.716  1.00 65.42  ? 5   G   B C2    1 
ATOM   6948  N  N2    . G   B 2 5   ? 6.642   16.615  24.011  1.00 64.94  ? 5   G   B N2    1 
ATOM   6949  N  N3    . G   B 2 5   ? 7.598   15.571  22.191  1.00 65.46  ? 5   G   B N3    1 
ATOM   6950  C  C4    . G   B 2 5   ? 7.878   15.749  20.882  1.00 65.27  ? 5   G   B C4    1 
ATOM   6951  P  P     . G   B 2 6   ? 5.124   10.787  19.119  1.00 65.94  ? 6   G   B P     1 
ATOM   6952  O  OP1   . G   B 2 6   ? 4.757   9.357   18.963  1.00 66.87  ? 6   G   B OP1   1 
ATOM   6953  O  OP2   . G   B 2 6   ? 4.901   11.724  17.990  1.00 66.05  ? 6   G   B OP2   1 
ATOM   6954  O  "O5'" . G   B 2 6   ? 4.390   11.365  20.409  1.00 65.93  ? 6   G   B "O5'" 1 
ATOM   6955  C  "C5'" . G   B 2 6   ? 4.456   10.660  21.663  1.00 66.65  ? 6   G   B "C5'" 1 
ATOM   6956  C  "C4'" . G   B 2 6   ? 4.097   11.575  22.809  1.00 66.67  ? 6   G   B "C4'" 1 
ATOM   6957  O  "O4'" . G   B 2 6   ? 4.908   12.779  22.754  1.00 67.02  ? 6   G   B "O4'" 1 
ATOM   6958  C  "C3'" . G   B 2 6   ? 2.667   12.088  22.829  1.00 66.81  ? 6   G   B "C3'" 1 
ATOM   6959  O  "O3'" . G   B 2 6   ? 1.792   11.115  23.389  1.00 66.39  ? 6   G   B "O3'" 1 
ATOM   6960  C  "C2'" . G   B 2 6   ? 2.797   13.343  23.681  1.00 67.15  ? 6   G   B "C2'" 1 
ATOM   6961  O  "O2'" . G   B 2 6   ? 2.813   13.100  25.073  1.00 67.74  ? 6   G   B "O2'" 1 
ATOM   6962  C  "C1'" . G   B 2 6   ? 4.149   13.886  23.213  1.00 66.95  ? 6   G   B "C1'" 1 
ATOM   6963  N  N9    . G   B 2 6   ? 4.045   14.864  22.132  1.00 66.74  ? 6   G   B N9    1 
ATOM   6964  C  C8    . G   B 2 6   ? 4.521   14.751  20.847  1.00 67.49  ? 6   G   B C8    1 
ATOM   6965  N  N7    . G   B 2 6   ? 4.270   15.803  20.115  1.00 67.69  ? 6   G   B N7    1 
ATOM   6966  C  C5    . G   B 2 6   ? 3.588   16.661  20.967  1.00 66.74  ? 6   G   B C5    1 
ATOM   6967  C  C6    . G   B 2 6   ? 3.058   17.958  20.737  1.00 66.78  ? 6   G   B C6    1 
ATOM   6968  O  O6    . G   B 2 6   ? 3.086   18.630  19.698  1.00 66.68  ? 6   G   B O6    1 
ATOM   6969  N  N1    . G   B 2 6   ? 2.445   18.470  21.877  1.00 66.36  ? 6   G   B N1    1 
ATOM   6970  C  C2    . G   B 2 6   ? 2.349   17.817  23.083  1.00 66.09  ? 6   G   B C2    1 
ATOM   6971  N  N2    . G   B 2 6   ? 1.720   18.475  24.068  1.00 66.71  ? 6   G   B N2    1 
ATOM   6972  N  N3    . G   B 2 6   ? 2.844   16.611  23.311  1.00 65.25  ? 6   G   B N3    1 
ATOM   6973  C  C4    . G   B 2 6   ? 3.444   16.096  22.217  1.00 65.91  ? 6   G   B C4    1 
ATOM   6974  P  P     . A   B 2 7   ? 0.308   10.926  22.817  1.00 65.74  ? 7   A   B P     1 
ATOM   6975  O  OP1   . A   B 2 7   ? -0.172  9.584   23.233  1.00 67.03  ? 7   A   B OP1   1 
ATOM   6976  O  OP2   . A   B 2 7   ? 0.305   11.288  21.376  1.00 64.71  ? 7   A   B OP2   1 
ATOM   6977  O  "O5'" . A   B 2 7   ? -0.527  12.025  23.611  1.00 67.30  ? 7   A   B "O5'" 1 
ATOM   6978  C  "C5'" . A   B 2 7   ? -0.577  12.041  25.050  1.00 68.90  ? 7   A   B "C5'" 1 
ATOM   6979  C  "C4'" . A   B 2 7   ? -1.233  13.315  25.529  1.00 70.04  ? 7   A   B "C4'" 1 
ATOM   6980  O  "O4'" . A   B 2 7   ? -0.638  14.446  24.834  1.00 70.21  ? 7   A   B "O4'" 1 
ATOM   6981  C  "C3'" . A   B 2 7   ? -2.742  13.406  25.294  1.00 70.20  ? 7   A   B "C3'" 1 
ATOM   6982  O  "O3'" . A   B 2 7   ? -3.428  14.000  26.393  1.00 70.41  ? 7   A   B "O3'" 1 
ATOM   6983  C  "C2'" . A   B 2 7   ? -2.851  14.258  24.033  1.00 70.38  ? 7   A   B "C2'" 1 
ATOM   6984  O  "O2'" . A   B 2 7   ? -4.045  15.007  23.948  1.00 70.71  ? 7   A   B "O2'" 1 
ATOM   6985  C  "C1'" . A   B 2 7   ? -1.645  15.185  24.176  1.00 70.54  ? 7   A   B "C1'" 1 
ATOM   6986  N  N9    . A   B 2 7   ? -1.119  15.640  22.889  1.00 70.13  ? 7   A   B N9    1 
ATOM   6987  C  C8    . A   B 2 7   ? -0.533  14.883  21.905  1.00 70.30  ? 7   A   B C8    1 
ATOM   6988  N  N7    . A   B 2 7   ? -0.172  15.573  20.851  1.00 71.00  ? 7   A   B N7    1 
ATOM   6989  C  C5    . A   B 2 7   ? -0.549  16.873  21.159  1.00 70.81  ? 7   A   B C5    1 
ATOM   6990  C  C6    . A   B 2 7   ? -0.441  18.083  20.450  1.00 71.30  ? 7   A   B C6    1 
ATOM   6991  N  N6    . A   B 2 7   ? 0.103   18.182  19.235  1.00 71.96  ? 7   A   B N6    1 
ATOM   6992  N  N1    . A   B 2 7   ? -0.914  19.202  21.042  1.00 71.33  ? 7   A   B N1    1 
ATOM   6993  C  C2    . A   B 2 7   ? -1.462  19.101  22.261  1.00 70.91  ? 7   A   B C2    1 
ATOM   6994  N  N3    . A   B 2 7   ? -1.619  18.022  23.027  1.00 69.57  ? 7   A   B N3    1 
ATOM   6995  C  C4    . A   B 2 7   ? -1.136  16.928  22.411  1.00 70.00  ? 7   A   B C4    1 
ATOM   6996  P  P     . U   B 2 8   ? -4.121  13.076  27.502  1.00 71.55  ? 8   U   B P     1 
ATOM   6997  O  OP1   . U   B 2 8   ? -4.893  13.953  28.420  1.00 71.83  ? 8   U   B OP1   1 
ATOM   6998  O  OP2   . U   B 2 8   ? -3.087  12.163  28.052  1.00 71.63  ? 8   U   B OP2   1 
ATOM   6999  O  "O5'" . U   B 2 8   ? -5.144  12.199  26.654  1.00 71.06  ? 8   U   B "O5'" 1 
ATOM   7000  C  "C5'" . U   B 2 8   ? -6.166  12.807  25.843  1.00 70.81  ? 8   U   B "C5'" 1 
ATOM   7001  C  "C4'" . U   B 2 8   ? -7.187  11.772  25.438  1.00 70.40  ? 8   U   B "C4'" 1 
ATOM   7002  O  "O4'" . U   B 2 8   ? -6.513  10.673  24.778  1.00 69.49  ? 8   U   B "O4'" 1 
ATOM   7003  C  "C3'" . U   B 2 8   ? -7.960  11.127  26.579  1.00 70.73  ? 8   U   B "C3'" 1 
ATOM   7004  O  "O3'" . U   B 2 8   ? -9.102  11.918  26.906  1.00 72.86  ? 8   U   B "O3'" 1 
ATOM   7005  C  "C2'" . U   B 2 8   ? -8.356  9.769   26.001  1.00 69.84  ? 8   U   B "C2'" 1 
ATOM   7006  O  "O2'" . U   B 2 8   ? -9.589  9.770   25.308  1.00 69.13  ? 8   U   B "O2'" 1 
ATOM   7007  C  "C1'" . U   B 2 8   ? -7.195  9.463   25.049  1.00 69.31  ? 8   U   B "C1'" 1 
ATOM   7008  N  N1    . U   B 2 8   ? -6.228  8.470   25.550  1.00 68.93  ? 8   U   B N1    1 
ATOM   7009  C  C2    . U   B 2 8   ? -6.616  7.140   25.548  1.00 68.43  ? 8   U   B C2    1 
ATOM   7010  O  O2    . U   B 2 8   ? -7.714  6.770   25.170  1.00 68.04  ? 8   U   B O2    1 
ATOM   7011  N  N3    . U   B 2 8   ? -5.670  6.262   26.014  1.00 67.71  ? 8   U   B N3    1 
ATOM   7012  C  C4    . U   B 2 8   ? -4.400  6.562   26.463  1.00 68.08  ? 8   U   B C4    1 
ATOM   7013  O  O4    . U   B 2 8   ? -3.665  5.654   26.851  1.00 67.95  ? 8   U   B O4    1 
ATOM   7014  C  C5    . U   B 2 8   ? -4.070  7.954   26.427  1.00 68.69  ? 8   U   B C5    1 
ATOM   7015  C  C6    . U   B 2 8   ? -4.970  8.839   25.980  1.00 68.79  ? 8   U   B C6    1 
ATOM   7016  P  P     . G   B 2 9   ? -9.220  12.643  28.336  1.00 74.70  ? 9   G   B P     1 
ATOM   7017  O  OP1   . G   B 2 9   ? -10.341 13.615  28.266  1.00 74.60  ? 9   G   B OP1   1 
ATOM   7018  O  OP2   . G   B 2 9   ? -7.869  13.113  28.738  1.00 74.06  ? 9   G   B OP2   1 
ATOM   7019  O  "O5'" . G   B 2 9   ? -9.662  11.457  29.304  1.00 75.55  ? 9   G   B "O5'" 1 
ATOM   7020  C  "C5'" . G   B 2 9   ? -10.093 11.717  30.655  1.00 75.92  ? 9   G   B "C5'" 1 
ATOM   7021  C  "C4'" . G   B 2 9   ? -11.573 11.449  30.795  1.00 75.92  ? 9   G   B "C4'" 1 
ATOM   7022  O  "O4'" . G   B 2 9   ? -11.846 10.078  30.395  1.00 75.07  ? 9   G   B "O4'" 1 
ATOM   7023  C  "C3'" . G   B 2 9   ? -12.140 11.608  32.206  1.00 77.19  ? 9   G   B "C3'" 1 
ATOM   7024  O  "O3'" . G   B 2 9   ? -13.403 12.268  32.209  1.00 79.80  ? 9   G   B "O3'" 1 
ATOM   7025  C  "C2'" . G   B 2 9   ? -12.254 10.169  32.700  1.00 77.01  ? 9   G   B "C2'" 1 
ATOM   7026  O  "O2'" . G   B 2 9   ? -13.243 9.950   33.686  1.00 78.63  ? 9   G   B "O2'" 1 
ATOM   7027  C  "C1'" . G   B 2 9   ? -12.592 9.434   31.404  1.00 75.60  ? 9   G   B "C1'" 1 
ATOM   7028  N  N9    . G   B 2 9   ? -12.256 8.013   31.397  1.00 74.97  ? 9   G   B N9    1 
ATOM   7029  C  C8    . G   B 2 9   ? -13.114 6.970   31.142  1.00 74.97  ? 9   G   B C8    1 
ATOM   7030  N  N7    . G   B 2 9   ? -12.533 5.803   31.200  1.00 75.32  ? 9   G   B N7    1 
ATOM   7031  C  C5    . G   B 2 9   ? -11.211 6.091   31.509  1.00 75.00  ? 9   G   B C5    1 
ATOM   7032  C  C6    . G   B 2 9   ? -10.101 5.226   31.701  1.00 74.38  ? 9   G   B C6    1 
ATOM   7033  O  O6    . G   B 2 9   ? -10.066 3.991   31.635  1.00 73.37  ? 9   G   B O6    1 
ATOM   7034  N  N1    . G   B 2 9   ? -8.943  5.937   31.998  1.00 74.87  ? 9   G   B N1    1 
ATOM   7035  C  C2    . G   B 2 9   ? -8.859  7.306   32.096  1.00 75.11  ? 9   G   B C2    1 
ATOM   7036  N  N2    . G   B 2 9   ? -7.651  7.808   32.393  1.00 74.66  ? 9   G   B N2    1 
ATOM   7037  N  N3    . G   B 2 9   ? -9.886  8.123   31.918  1.00 75.42  ? 9   G   B N3    1 
ATOM   7038  C  C4    . G   B 2 9   ? -11.023 7.452   31.631  1.00 75.20  ? 9   G   B C4    1 
ATOM   7039  P  P     . G   B 2 10  ? -13.489 13.864  32.359  1.00 81.58  ? 10  G   B P     1 
ATOM   7040  O  OP1   . G   B 2 10  ? -14.907 14.226  32.612  1.00 82.74  ? 10  G   B OP1   1 
ATOM   7041  O  OP2   . G   B 2 10  ? -12.767 14.475  31.213  1.00 81.64  ? 10  G   B OP2   1 
ATOM   7042  O  "O5'" . G   B 2 10  ? -12.671 14.159  33.693  1.00 79.07  ? 10  G   B "O5'" 1 
ATOM   7043  C  "C5'" . G   B 2 10  ? -13.102 13.631  34.958  1.00 78.24  ? 10  G   B "C5'" 1 
ATOM   7044  C  "C4'" . G   B 2 10  ? -12.114 14.005  36.036  1.00 78.66  ? 10  G   B "C4'" 1 
ATOM   7045  O  "O4'" . G   B 2 10  ? -12.613 13.562  37.331  1.00 78.79  ? 10  G   B "O4'" 1 
ATOM   7046  C  "C3'" . G   B 2 10  ? -10.726 13.389  35.892  1.00 78.72  ? 10  G   B "C3'" 1 
ATOM   7047  O  "O3'" . G   B 2 10  ? -9.849  14.243  35.160  1.00 78.98  ? 10  G   B "O3'" 1 
ATOM   7048  C  "C2'" . G   B 2 10  ? -10.304 13.189  37.343  1.00 78.33  ? 10  G   B "C2'" 1 
ATOM   7049  O  "O2'" . G   B 2 10  ? -9.774  14.346  37.957  1.00 77.92  ? 10  G   B "O2'" 1 
ATOM   7050  C  "C1'" . G   B 2 10  ? -11.631 12.773  37.976  1.00 78.61  ? 10  G   B "C1'" 1 
ATOM   7051  N  N9    . G   B 2 10  ? -11.959 11.365  37.764  1.00 79.56  ? 10  G   B N9    1 
ATOM   7052  C  C8    . G   B 2 10  ? -13.071 10.857  37.134  1.00 80.41  ? 10  G   B C8    1 
ATOM   7053  N  N7    . G   B 2 10  ? -13.081 9.553   37.085  1.00 80.53  ? 10  G   B N7    1 
ATOM   7054  C  C5    . G   B 2 10  ? -11.906 9.176   37.721  1.00 80.29  ? 10  G   B C5    1 
ATOM   7055  C  C6    . G   B 2 10  ? -11.369 7.885   37.971  1.00 80.15  ? 10  G   B C6    1 
ATOM   7056  O  O6    . G   B 2 10  ? -11.846 6.782   37.678  1.00 81.19  ? 10  G   B O6    1 
ATOM   7057  N  N1    . G   B 2 10  ? -10.155 7.958   38.648  1.00 78.88  ? 10  G   B N1    1 
ATOM   7058  C  C2    . G   B 2 10  ? -9.532  9.122   39.029  1.00 78.48  ? 10  G   B C2    1 
ATOM   7059  N  N2    . G   B 2 10  ? -8.360  8.988   39.667  1.00 78.61  ? 10  G   B N2    1 
ATOM   7060  N  N3    . G   B 2 10  ? -10.022 10.331  38.801  1.00 79.16  ? 10  G   B N3    1 
ATOM   7061  C  C4    . G   B 2 10  ? -11.203 10.283  38.147  1.00 79.99  ? 10  G   B C4    1 
ATOM   7062  P  P     . U   B 2 11  ? -8.556  13.638  34.423  1.00 77.72  ? 11  U   B P     1 
ATOM   7063  O  OP1   . U   B 2 11  ? -7.763  14.775  33.886  1.00 78.75  ? 11  U   B OP1   1 
ATOM   7064  O  OP2   . U   B 2 11  ? -9.006  12.568  33.500  1.00 75.96  ? 11  U   B OP2   1 
ATOM   7065  O  "O5'" . U   B 2 11  ? -7.776  12.918  35.610  1.00 74.37  ? 11  U   B "O5'" 1 
ATOM   7066  C  "C5'" . U   B 2 11  ? -6.539  13.417  36.147  1.00 73.04  ? 11  U   B "C5'" 1 
ATOM   7067  C  "C4'" . U   B 2 11  ? -5.673  12.264  36.593  1.00 71.72  ? 11  U   B "C4'" 1 
ATOM   7068  O  "O4'" . U   B 2 11  ? -6.465  11.311  37.352  1.00 72.29  ? 11  U   B "O4'" 1 
ATOM   7069  C  "C3'" . U   B 2 11  ? -5.071  11.426  35.479  1.00 70.14  ? 11  U   B "C3'" 1 
ATOM   7070  O  "O3'" . U   B 2 11  ? -3.929  12.053  34.904  1.00 67.00  ? 11  U   B "O3'" 1 
ATOM   7071  C  "C2'" . U   B 2 11  ? -4.755  10.127  36.207  1.00 70.57  ? 11  U   B "C2'" 1 
ATOM   7072  O  "O2'" . U   B 2 11  ? -3.560  10.157  36.959  1.00 70.07  ? 11  U   B "O2'" 1 
ATOM   7073  C  "C1'" . U   B 2 11  ? -5.967  9.999   37.133  1.00 71.62  ? 11  U   B "C1'" 1 
ATOM   7074  N  N1    . U   B 2 11  ? -7.040  9.158   36.574  1.00 72.64  ? 11  U   B N1    1 
ATOM   7075  C  C2    . U   B 2 11  ? -6.856  7.787   36.616  1.00 73.10  ? 11  U   B C2    1 
ATOM   7076  O  O2    . U   B 2 11  ? -5.861  7.266   37.092  1.00 74.25  ? 11  U   B O2    1 
ATOM   7077  N  N3    . U   B 2 11  ? -7.881  7.050   36.077  1.00 72.36  ? 11  U   B N3    1 
ATOM   7078  C  C4    . U   B 2 11  ? -9.045  7.526   35.510  1.00 72.48  ? 11  U   B C4    1 
ATOM   7079  O  O4    . U   B 2 11  ? -9.875  6.729   35.070  1.00 72.20  ? 11  U   B O4    1 
ATOM   7080  C  C5    . U   B 2 11  ? -9.161  8.952   35.501  1.00 73.12  ? 11  U   B C5    1 
ATOM   7081  C  C6    . U   B 2 11  ? -8.177  9.702   36.015  1.00 72.85  ? 11  U   B C6    1 
ATOM   7082  P  P     . G   B 2 12  ? -3.412  11.617  33.452  1.00 63.44  ? 12  G   B P     1 
ATOM   7083  O  OP1   . G   B 2 12  ? -2.377  12.593  33.024  1.00 63.88  ? 12  G   B OP1   1 
ATOM   7084  O  OP2   . G   B 2 12  ? -4.593  11.374  32.585  1.00 63.81  ? 12  G   B OP2   1 
ATOM   7085  O  "O5'" . G   B 2 12  ? -2.710  10.218  33.734  1.00 61.43  ? 12  G   B "O5'" 1 
ATOM   7086  C  "C5'" . G   B 2 12  ? -1.442  10.161  34.400  1.00 61.02  ? 12  G   B "C5'" 1 
ATOM   7087  C  "C4'" . G   B 2 12  ? -0.975  8.733   34.533  1.00 60.66  ? 12  G   B "C4'" 1 
ATOM   7088  O  "O4'" . G   B 2 12  ? -1.962  7.936   35.247  1.00 60.71  ? 12  G   B "O4'" 1 
ATOM   7089  C  "C3'" . G   B 2 12  ? -0.788  7.957   33.241  1.00 60.20  ? 12  G   B "C3'" 1 
ATOM   7090  O  "O3'" . G   B 2 12  ? 0.358   8.345   32.488  1.00 60.33  ? 12  G   B "O3'" 1 
ATOM   7091  C  "C2'" . G   B 2 12  ? -0.754  6.533   33.776  1.00 60.45  ? 12  G   B "C2'" 1 
ATOM   7092  O  "O2'" . G   B 2 12  ? 0.469   6.185   34.393  1.00 59.82  ? 12  G   B "O2'" 1 
ATOM   7093  C  "C1'" . G   B 2 12  ? -1.894  6.589   34.794  1.00 60.83  ? 12  G   B "C1'" 1 
ATOM   7094  N  N9    . G   B 2 12  ? -3.183  6.221   34.212  1.00 60.92  ? 12  G   B N9    1 
ATOM   7095  C  C8    . G   B 2 12  ? -4.137  7.062   33.690  1.00 61.34  ? 12  G   B C8    1 
ATOM   7096  N  N7    . G   B 2 12  ? -5.180  6.429   33.227  1.00 60.87  ? 12  G   B N7    1 
ATOM   7097  C  C5    . G   B 2 12  ? -4.895  5.089   33.447  1.00 60.61  ? 12  G   B C5    1 
ATOM   7098  C  C6    . G   B 2 12  ? -5.656  3.927   33.153  1.00 61.38  ? 12  G   B C6    1 
ATOM   7099  O  O6    . G   B 2 12  ? -6.771  3.848   32.623  1.00 61.39  ? 12  G   B O6    1 
ATOM   7100  N  N1    . G   B 2 12  ? -4.993  2.768   33.547  1.00 61.77  ? 12  G   B N1    1 
ATOM   7101  C  C2    . G   B 2 12  ? -3.755  2.730   34.145  1.00 61.85  ? 12  G   B C2    1 
ATOM   7102  N  N2    . G   B 2 12  ? -3.278  1.514   34.450  1.00 61.83  ? 12  G   B N2    1 
ATOM   7103  N  N3    . G   B 2 12  ? -3.036  3.807   34.421  1.00 61.32  ? 12  G   B N3    1 
ATOM   7104  C  C4    . G   B 2 12  ? -3.663  4.943   34.049  1.00 60.61  ? 12  G   B C4    1 
ATOM   7105  P  P     . G   B 2 13  ? 0.388   8.108   30.899  1.00 60.23  ? 13  G   B P     1 
ATOM   7106  O  OP1   . G   B 2 13  ? 1.740   8.475   30.406  1.00 61.40  ? 13  G   B OP1   1 
ATOM   7107  O  OP2   . G   B 2 13  ? -0.808  8.761   30.307  1.00 58.86  ? 13  G   B OP2   1 
ATOM   7108  O  "O5'" . G   B 2 13  ? 0.233   6.527   30.786  1.00 59.12  ? 13  G   B "O5'" 1 
ATOM   7109  C  "C5'" . G   B 2 13  ? -0.258  5.887   29.597  1.00 57.74  ? 13  G   B "C5'" 1 
ATOM   7110  C  "C4'" . G   B 2 13  ? -0.742  4.498   29.934  1.00 57.27  ? 13  G   B "C4'" 1 
ATOM   7111  O  "O4'" . G   B 2 13  ? -1.731  4.575   30.997  1.00 57.89  ? 13  G   B "O4'" 1 
ATOM   7112  C  "C3'" . G   B 2 13  ? -1.401  3.741   28.788  1.00 56.51  ? 13  G   B "C3'" 1 
ATOM   7113  O  "O3'" . G   B 2 13  ? -0.437  2.895   28.170  1.00 56.47  ? 13  G   B "O3'" 1 
ATOM   7114  C  "C2'" . G   B 2 13  ? -2.516  2.966   29.482  1.00 56.51  ? 13  G   B "C2'" 1 
ATOM   7115  O  "O2'" . G   B 2 13  ? -2.080  1.749   30.050  1.00 54.80  ? 13  G   B "O2'" 1 
ATOM   7116  C  "C1'" . G   B 2 13  ? -2.924  3.938   30.589  1.00 58.02  ? 13  G   B "C1'" 1 
ATOM   7117  N  N9    . G   B 2 13  ? -3.893  4.966   30.209  1.00 59.69  ? 13  G   B N9    1 
ATOM   7118  C  C8    . G   B 2 13  ? -3.721  6.329   30.271  1.00 60.19  ? 13  G   B C8    1 
ATOM   7119  N  N7    . G   B 2 13  ? -4.772  6.996   29.879  1.00 59.92  ? 13  G   B N7    1 
ATOM   7120  C  C5    . G   B 2 13  ? -5.700  6.017   29.553  1.00 60.27  ? 13  G   B C5    1 
ATOM   7121  C  C6    . G   B 2 13  ? -7.029  6.136   29.065  1.00 60.78  ? 13  G   B C6    1 
ATOM   7122  O  O6    . G   B 2 13  ? -7.672  7.164   28.822  1.00 61.99  ? 13  G   B O6    1 
ATOM   7123  N  N1    . G   B 2 13  ? -7.613  4.889   28.864  1.00 60.44  ? 13  G   B N1    1 
ATOM   7124  C  C2    . G   B 2 13  ? -7.000  3.682   29.099  1.00 60.05  ? 13  G   B C2    1 
ATOM   7125  N  N2    . G   B 2 13  ? -7.729  2.585   28.843  1.00 60.02  ? 13  G   B N2    1 
ATOM   7126  N  N3    . G   B 2 13  ? -5.763  3.558   29.555  1.00 59.81  ? 13  G   B N3    1 
ATOM   7127  C  C4    . G   B 2 13  ? -5.176  4.758   29.757  1.00 59.96  ? 13  G   B C4    1 
ATOM   7128  P  P     . A   B 2 14  ? -0.547  2.534   26.618  1.00 56.24  ? 14  A   B P     1 
ATOM   7129  O  OP1   . A   B 2 14  ? 0.667   1.769   26.240  1.00 56.14  ? 14  A   B OP1   1 
ATOM   7130  O  OP2   . A   B 2 14  ? -0.891  3.773   25.875  1.00 55.87  ? 14  A   B OP2   1 
ATOM   7131  O  "O5'" . A   B 2 14  ? -1.786  1.534   26.576  1.00 59.12  ? 14  A   B "O5'" 1 
ATOM   7132  C  "C5'" . A   B 2 14  ? -1.659  0.184   27.061  1.00 61.21  ? 14  A   B "C5'" 1 
ATOM   7133  C  "C4'" . A   B 2 14  ? -2.927  -0.595  26.803  1.00 62.31  ? 14  A   B "C4'" 1 
ATOM   7134  O  "O4'" . A   B 2 14  ? -4.071  0.127   27.322  1.00 62.49  ? 14  A   B "O4'" 1 
ATOM   7135  C  "C3'" . A   B 2 14  ? -3.273  -0.821  25.338  1.00 63.44  ? 14  A   B "C3'" 1 
ATOM   7136  O  "O3'" . A   B 2 14  ? -2.517  -1.906  24.808  1.00 64.60  ? 14  A   B "O3'" 1 
ATOM   7137  C  "C2'" . A   B 2 14  ? -4.771  -1.099  25.398  1.00 63.83  ? 14  A   B "C2'" 1 
ATOM   7138  O  "O2'" . A   B 2 14  ? -5.101  -2.449  25.657  1.00 64.08  ? 14  A   B "O2'" 1 
ATOM   7139  C  "C1'" . A   B 2 14  ? -5.217  -0.195  26.552  1.00 63.75  ? 14  A   B "C1'" 1 
ATOM   7140  N  N9    . A   B 2 14  ? -5.865  1.048   26.129  1.00 64.63  ? 14  A   B N9    1 
ATOM   7141  C  C8    . A   B 2 14  ? -5.457  2.343   26.341  1.00 65.43  ? 14  A   B C8    1 
ATOM   7142  N  N7    . A   B 2 14  ? -6.272  3.241   25.842  1.00 66.25  ? 14  A   B N7    1 
ATOM   7143  C  C5    . A   B 2 14  ? -7.287  2.488   25.268  1.00 65.82  ? 14  A   B C5    1 
ATOM   7144  C  C6    . A   B 2 14  ? -8.457  2.849   24.577  1.00 65.88  ? 14  A   B C6    1 
ATOM   7145  N  N6    . A   B 2 14  ? -8.814  4.112   24.334  1.00 66.77  ? 14  A   B N6    1 
ATOM   7146  N  N1    . A   B 2 14  ? -9.257  1.854   24.132  1.00 65.07  ? 14  A   B N1    1 
ATOM   7147  C  C2    . A   B 2 14  ? -8.897  0.586   24.374  1.00 64.80  ? 14  A   B C2    1 
ATOM   7148  N  N3    . A   B 2 14  ? -7.824  0.122   25.014  1.00 64.77  ? 14  A   B N3    1 
ATOM   7149  C  C4    . A   B 2 14  ? -7.051  1.136   25.442  1.00 65.13  ? 14  A   B C4    1 
ATOM   7150  P  P     . A   B 2 15  ? -1.796  -1.769  23.387  1.00 65.56  ? 15  A   B P     1 
ATOM   7151  O  OP1   . A   B 2 15  ? -1.042  -3.023  23.137  1.00 65.74  ? 15  A   B OP1   1 
ATOM   7152  O  OP2   . A   B 2 15  ? -1.088  -0.464  23.350  1.00 63.67  ? 15  A   B OP2   1 
ATOM   7153  O  "O5'" . A   B 2 15  ? -3.019  -1.720  22.366  1.00 68.26  ? 15  A   B "O5'" 1 
ATOM   7154  C  "C5'" . A   B 2 15  ? -3.861  -2.872  22.166  1.00 71.05  ? 15  A   B "C5'" 1 
ATOM   7155  C  "C4'" . A   B 2 15  ? -5.117  -2.497  21.409  1.00 73.16  ? 15  A   B "C4'" 1 
ATOM   7156  O  "O4'" . A   B 2 15  ? -5.918  -1.584  22.204  1.00 73.96  ? 15  A   B "O4'" 1 
ATOM   7157  C  "C3'" . A   B 2 15  ? -4.915  -1.763  20.088  1.00 74.94  ? 15  A   B "C3'" 1 
ATOM   7158  O  "O3'" . A   B 2 15  ? -4.636  -2.656  19.017  1.00 78.80  ? 15  A   B "O3'" 1 
ATOM   7159  C  "C2'" . A   B 2 15  ? -6.253  -1.055  19.908  1.00 74.36  ? 15  A   B "C2'" 1 
ATOM   7160  O  "O2'" . A   B 2 15  ? -7.256  -1.862  19.325  1.00 74.39  ? 15  A   B "O2'" 1 
ATOM   7161  C  "C1'" . A   B 2 15  ? -6.607  -0.686  21.350  1.00 73.88  ? 15  A   B "C1'" 1 
ATOM   7162  N  N9    . A   B 2 15  ? -6.236  0.684   21.711  1.00 73.98  ? 15  A   B N9    1 
ATOM   7163  C  C8    . A   B 2 15  ? -5.097  1.123   22.342  1.00 74.25  ? 15  A   B C8    1 
ATOM   7164  N  N7    . A   B 2 15  ? -5.062  2.421   22.524  1.00 74.13  ? 15  A   B N7    1 
ATOM   7165  C  C5    . A   B 2 15  ? -6.254  2.868   21.971  1.00 74.01  ? 15  A   B C5    1 
ATOM   7166  C  C6    . A   B 2 15  ? -6.816  4.152   21.844  1.00 73.40  ? 15  A   B C6    1 
ATOM   7167  N  N6    . A   B 2 15  ? -6.227  5.266   22.285  1.00 73.02  ? 15  A   B N6    1 
ATOM   7168  N  N1    . A   B 2 15  ? -8.024  4.252   21.245  1.00 73.44  ? 15  A   B N1    1 
ATOM   7169  C  C2    . A   B 2 15  ? -8.617  3.133   20.806  1.00 73.95  ? 15  A   B C2    1 
ATOM   7170  N  N3    . A   B 2 15  ? -8.188  1.872   20.866  1.00 73.92  ? 15  A   B N3    1 
ATOM   7171  C  C4    . A   B 2 15  ? -6.987  1.808   21.468  1.00 73.95  ? 15  A   B C4    1 
ATOM   7172  P  P     . U   B 2 16  ? -3.703  -2.180  17.810  1.00 82.90  ? 16  U   B P     1 
ATOM   7173  O  OP1   . U   B 2 16  ? -4.075  -0.781  17.470  1.00 81.21  ? 16  U   B OP1   1 
ATOM   7174  O  OP2   . U   B 2 16  ? -3.742  -3.229  16.760  1.00 82.84  ? 16  U   B OP2   1 
ATOM   7175  O  "O5'" . U   B 2 16  ? -2.251  -2.184  18.466  1.00 85.67  ? 16  U   B "O5'" 1 
ATOM   7176  C  "C5'" . U   B 2 16  ? -1.168  -1.403  17.924  1.00 88.45  ? 16  U   B "C5'" 1 
ATOM   7177  C  "C4'" . U   B 2 16  ? 0.028   -2.283  17.637  1.00 90.12  ? 16  U   B "C4'" 1 
ATOM   7178  O  "O4'" . U   B 2 16  ? 0.256   -3.184  18.757  1.00 88.05  ? 16  U   B "O4'" 1 
ATOM   7179  C  "C3'" . U   B 2 16  ? -0.084  -3.165  16.394  1.00 92.46  ? 16  U   B "C3'" 1 
ATOM   7180  O  "O3'" . U   B 2 16  ? 1.138   -3.185  15.661  1.00 101.77 ? 16  U   B "O3'" 1 
ATOM   7181  C  "C2'" . U   B 2 16  ? -0.405  -4.539  16.974  1.00 89.37  ? 16  U   B "C2'" 1 
ATOM   7182  O  "O2'" . U   B 2 16  ? -0.017  -5.620  16.151  1.00 88.12  ? 16  U   B "O2'" 1 
ATOM   7183  C  "C1'" . U   B 2 16  ? 0.391   -4.504  18.276  1.00 87.07  ? 16  U   B "C1'" 1 
ATOM   7184  N  N1    . U   B 2 16  ? -0.097  -5.429  19.313  1.00 85.34  ? 16  U   B N1    1 
ATOM   7185  C  C2    . U   B 2 16  ? 0.734   -6.463  19.710  1.00 84.28  ? 16  U   B C2    1 
ATOM   7186  O  O2    . U   B 2 16  ? 1.845   -6.641  19.241  1.00 83.34  ? 16  U   B O2    1 
ATOM   7187  N  N3    . U   B 2 16  ? 0.212   -7.280  20.683  1.00 84.07  ? 16  U   B N3    1 
ATOM   7188  C  C4    . U   B 2 16  ? -1.024  -7.177  21.286  1.00 84.37  ? 16  U   B C4    1 
ATOM   7189  O  O4    . U   B 2 16  ? -1.348  -7.995  22.149  1.00 85.60  ? 16  U   B O4    1 
ATOM   7190  C  C5    . U   B 2 16  ? -1.823  -6.083  20.823  1.00 83.97  ? 16  U   B C5    1 
ATOM   7191  C  C6    . U   B 2 16  ? -1.344  -5.266  19.877  1.00 84.30  ? 16  U   B C6    1 
ATOM   7192  P  P     . C   B 2 17  ? 1.519   -1.980  14.669  1.00 110.41 ? 17  C   B P     1 
ATOM   7193  O  OP1   . C   B 2 17  ? 2.982   -1.743  14.780  1.00 111.32 ? 17  C   B OP1   1 
ATOM   7194  O  OP2   . C   B 2 17  ? 0.575   -0.856  14.902  1.00 108.87 ? 17  C   B OP2   1 
ATOM   7195  O  "O5'" . C   B 2 17  ? 1.220   -2.594  13.230  1.00 117.52 ? 17  C   B "O5'" 1 
ATOM   7196  C  "C5'" . C   B 2 17  ? 1.571   -1.876  12.031  1.00 124.98 ? 17  C   B "C5'" 1 
ATOM   7197  C  "C4'" . C   B 2 17  ? 0.547   -2.116  10.945  1.00 130.15 ? 17  C   B "C4'" 1 
ATOM   7198  O  "O4'" . C   B 2 17  ? 0.650   -3.486  10.478  1.00 135.49 ? 17  C   B "O4'" 1 
ATOM   7199  C  "C3'" . C   B 2 17  ? -0.918  -1.893  11.337  1.00 131.95 ? 17  C   B "C3'" 1 
ATOM   7200  O  "O3'" . C   B 2 17  ? -1.571  -0.988  10.449  1.00 126.35 ? 17  C   B "O3'" 1 
ATOM   7201  C  "C2'" . C   B 2 17  ? -1.535  -3.294  11.290  1.00 135.31 ? 17  C   B "C2'" 1 
ATOM   7202  O  "O2'" . C   B 2 17  ? -2.889  -3.322  10.884  1.00 135.37 ? 17  C   B "O2'" 1 
ATOM   7203  C  "C1'" . C   B 2 17  ? -0.645  -3.997  10.266  1.00 138.25 ? 17  C   B "C1'" 1 
ATOM   7204  N  N1    . C   B 2 17  ? -0.605  -5.471  10.375  1.00 142.02 ? 17  C   B N1    1 
ATOM   7205  C  C2    . C   B 2 17  ? 0.022   -6.073  11.477  1.00 143.30 ? 17  C   B C2    1 
ATOM   7206  O  O2    . C   B 2 17  ? 0.534   -5.352  12.347  1.00 142.32 ? 17  C   B O2    1 
ATOM   7207  N  N3    . C   B 2 17  ? 0.053   -7.424  11.563  1.00 144.57 ? 17  C   B N3    1 
ATOM   7208  C  C4    . C   B 2 17  ? -0.510  -8.167  10.606  1.00 145.75 ? 17  C   B C4    1 
ATOM   7209  N  N4    . C   B 2 17  ? -0.456  -9.495  10.733  1.00 146.56 ? 17  C   B N4    1 
ATOM   7210  C  C5    . C   B 2 17  ? -1.153  -7.581  9.476   1.00 144.33 ? 17  C   B C5    1 
ATOM   7211  C  C6    . C   B 2 17  ? -1.177  -6.243  9.401   1.00 143.11 ? 17  C   B C6    1 
ATOM   7212  P  P     . G   B 2 18  ? -1.345  0.597   10.588  1.00 123.11 ? 18  G   B P     1 
ATOM   7213  O  OP1   . G   B 2 18  ? -0.966  1.121   9.250   1.00 123.85 ? 18  G   B OP1   1 
ATOM   7214  O  OP2   . G   B 2 18  ? -0.450  0.846   11.749  1.00 122.64 ? 18  G   B OP2   1 
ATOM   7215  O  "O5'" . G   B 2 18  ? -2.791  1.133   10.990  1.00 117.11 ? 18  G   B "O5'" 1 
ATOM   7216  C  "C5'" . G   B 2 18  ? -3.608  1.873   10.061  1.00 110.88 ? 18  G   B "C5'" 1 
ATOM   7217  C  "C4'" . G   B 2 18  ? -5.059  1.787   10.466  1.00 106.38 ? 18  G   B "C4'" 1 
ATOM   7218  O  "O4'" . G   B 2 18  ? -5.841  2.695   9.641   1.00 103.93 ? 18  G   B "O4'" 1 
ATOM   7219  C  "C3'" . G   B 2 18  ? -5.703  0.415   10.294  1.00 103.57 ? 18  G   B "C3'" 1 
ATOM   7220  O  "O3'" . G   B 2 18  ? -6.697  0.205   11.290  1.00 100.95 ? 18  G   B "O3'" 1 
ATOM   7221  C  "C2'" . G   B 2 18  ? -6.347  0.527   8.919   1.00 102.20 ? 18  G   B "C2'" 1 
ATOM   7222  O  "O2'" . G   B 2 18  ? -7.405  -0.382  8.690   1.00 102.67 ? 18  G   B "O2'" 1 
ATOM   7223  C  "C1'" . G   B 2 18  ? -6.845  1.969   8.960   1.00 100.92 ? 18  G   B "C1'" 1 
ATOM   7224  N  N9    . G   B 2 18  ? -7.068  2.592   7.658   1.00 97.76  ? 18  G   B N9    1 
ATOM   7225  C  C8    . G   B 2 18  ? -6.337  2.416   6.507   1.00 96.84  ? 18  G   B C8    1 
ATOM   7226  N  N7    . G   B 2 18  ? -6.788  3.117   5.503   1.00 96.23  ? 18  G   B N7    1 
ATOM   7227  C  C5    . G   B 2 18  ? -7.880  3.799   6.022   1.00 95.45  ? 18  G   B C5    1 
ATOM   7228  C  C6    . G   B 2 18  ? -8.772  4.715   5.402   1.00 95.18  ? 18  G   B C6    1 
ATOM   7229  O  O6    . G   B 2 18  ? -8.774  5.119   4.233   1.00 95.38  ? 18  G   B O6    1 
ATOM   7230  N  N1    . G   B 2 18  ? -9.740  5.169   6.294   1.00 94.59  ? 18  G   B N1    1 
ATOM   7231  C  C2    . G   B 2 18  ? -9.839  4.790   7.612   1.00 93.79  ? 18  G   B C2    1 
ATOM   7232  N  N2    . G   B 2 18  ? -10.840 5.342   8.315   1.00 92.87  ? 18  G   B N2    1 
ATOM   7233  N  N3    . G   B 2 18  ? -9.012  3.941   8.201   1.00 94.22  ? 18  G   B N3    1 
ATOM   7234  C  C4    . G   B 2 18  ? -8.065  3.487   7.352   1.00 95.54  ? 18  G   B C4    1 
ATOM   7235  P  P     . G   B 2 19  ? -6.591  -1.031  12.299  1.00 99.13  ? 19  G   B P     1 
ATOM   7236  O  OP1   . G   B 2 19  ? -5.794  -0.599  13.475  1.00 100.21 ? 19  G   B OP1   1 
ATOM   7237  O  OP2   . G   B 2 19  ? -6.178  -2.232  11.526  1.00 98.08  ? 19  G   B OP2   1 
ATOM   7238  O  "O5'" . G   B 2 19  ? -8.100  -1.246  12.758  1.00 94.82  ? 19  G   B "O5'" 1 
ATOM   7239  C  "C5'" . G   B 2 19  ? -8.889  -0.165  13.289  1.00 90.33  ? 19  G   B "C5'" 1 
ATOM   7240  C  "C4'" . G   B 2 19  ? -10.355 -0.520  13.225  1.00 87.91  ? 19  G   B "C4'" 1 
ATOM   7241  O  "O4'" . G   B 2 19  ? -10.765 -0.610  11.833  1.00 87.60  ? 19  G   B "O4'" 1 
ATOM   7242  C  "C3'" . G   B 2 19  ? -10.735 -1.849  13.874  1.00 86.06  ? 19  G   B "C3'" 1 
ATOM   7243  O  "O3'" . G   B 2 19  ? -11.944 -1.733  14.613  1.00 83.77  ? 19  G   B "O3'" 1 
ATOM   7244  C  "C2'" . G   B 2 19  ? -10.867 -2.796  12.684  1.00 86.16  ? 19  G   B "C2'" 1 
ATOM   7245  O  "O2'" . G   B 2 19  ? -11.750 -3.879  12.898  1.00 85.81  ? 19  G   B "O2'" 1 
ATOM   7246  C  "C1'" . G   B 2 19  ? -11.395 -1.853  11.604  1.00 86.83  ? 19  G   B "C1'" 1 
ATOM   7247  N  N9    . G   B 2 19  ? -11.113 -2.262  10.230  1.00 87.56  ? 19  G   B N9    1 
ATOM   7248  C  C8    . G   B 2 19  ? -9.996  -2.914  9.763   1.00 88.84  ? 19  G   B C8    1 
ATOM   7249  N  N7    . G   B 2 19  ? -10.033 -3.135  8.477   1.00 89.55  ? 19  G   B N7    1 
ATOM   7250  C  C5    . G   B 2 19  ? -11.242 -2.590  8.068   1.00 88.98  ? 19  G   B C5    1 
ATOM   7251  C  C6    . G   B 2 19  ? -11.832 -2.524  6.778   1.00 89.45  ? 19  G   B C6    1 
ATOM   7252  O  O6    . G   B 2 19  ? -11.389 -2.950  5.704   1.00 90.03  ? 19  G   B O6    1 
ATOM   7253  N  N1    . G   B 2 19  ? -13.068 -1.883  6.812   1.00 88.94  ? 19  G   B N1    1 
ATOM   7254  C  C2    . G   B 2 19  ? -13.661 -1.372  7.942   1.00 88.97  ? 19  G   B C2    1 
ATOM   7255  N  N2    . G   B 2 19  ? -14.857 -0.789  7.774   1.00 89.13  ? 19  G   B N2    1 
ATOM   7256  N  N3    . G   B 2 19  ? -13.118 -1.422  9.149   1.00 88.13  ? 19  G   B N3    1 
ATOM   7257  C  C4    . G   B 2 19  ? -11.919 -2.045  9.138   1.00 87.86  ? 19  G   B C4    1 
ATOM   7258  P  P     . U   B 2 20  ? -11.911 -1.254  16.139  1.00 82.11  ? 20  U   B P     1 
ATOM   7259  O  OP1   . U   B 2 20  ? -11.879 0.232   16.161  1.00 81.44  ? 20  U   B OP1   1 
ATOM   7260  O  OP2   . U   B 2 20  ? -10.859 -2.026  16.846  1.00 81.85  ? 20  U   B OP2   1 
ATOM   7261  O  "O5'" . U   B 2 20  ? -13.319 -1.747  16.695  1.00 80.39  ? 20  U   B "O5'" 1 
ATOM   7262  C  "C5'" . U   B 2 20  ? -14.552 -1.326  16.085  1.00 77.56  ? 20  U   B "C5'" 1 
ATOM   7263  C  "C4'" . U   B 2 20  ? -15.675 -1.398  17.091  1.00 75.66  ? 20  U   B "C4'" 1 
ATOM   7264  O  "O4'" . U   B 2 20  ? -15.892 -2.786  17.468  1.00 74.52  ? 20  U   B "O4'" 1 
ATOM   7265  C  "C3'" . U   B 2 20  ? -15.444 -0.634  18.391  1.00 74.82  ? 20  U   B "C3'" 1 
ATOM   7266  O  "O3'" . U   B 2 20  ? -16.640 -0.004  18.835  1.00 74.15  ? 20  U   B "O3'" 1 
ATOM   7267  C  "C2'" . U   B 2 20  ? -14.991 -1.723  19.358  1.00 74.16  ? 20  U   B "C2'" 1 
ATOM   7268  O  "O2'" . U   B 2 20  ? -15.250 -1.436  20.717  1.00 73.97  ? 20  U   B "O2'" 1 
ATOM   7269  C  "C1'" . U   B 2 20  ? -15.814 -2.914  18.874  1.00 74.29  ? 20  U   B "C1'" 1 
ATOM   7270  N  N1    . U   B 2 20  ? -15.213 -4.218  19.195  1.00 74.72  ? 20  U   B N1    1 
ATOM   7271  C  C2    . U   B 2 20  ? -15.730 -4.924  20.268  1.00 75.66  ? 20  U   B C2    1 
ATOM   7272  O  O2    . U   B 2 20  ? -16.654 -4.514  20.949  1.00 76.45  ? 20  U   B O2    1 
ATOM   7273  N  N3    . U   B 2 20  ? -15.122 -6.130  20.512  1.00 75.38  ? 20  U   B N3    1 
ATOM   7274  C  C4    . U   B 2 20  ? -14.073 -6.694  19.816  1.00 74.81  ? 20  U   B C4    1 
ATOM   7275  O  O4    . U   B 2 20  ? -13.636 -7.793  20.161  1.00 74.29  ? 20  U   B O4    1 
ATOM   7276  C  C5    . U   B 2 20  ? -13.592 -5.903  18.723  1.00 75.10  ? 20  U   B C5    1 
ATOM   7277  C  C6    . U   B 2 20  ? -14.162 -4.721  18.458  1.00 75.04  ? 20  U   B C6    1 
ATOM   7278  P  P     . A   B 2 21  A -16.949 1.507   18.420  1.00 74.32  ? 20  A   B P     1 
ATOM   7279  O  OP1   . A   B 2 21  A -18.259 1.883   19.007  1.00 74.83  ? 20  A   B OP1   1 
ATOM   7280  O  OP2   . A   B 2 21  A -16.736 1.632   16.954  1.00 73.60  ? 20  A   B OP2   1 
ATOM   7281  O  "O5'" . A   B 2 21  A -15.811 2.328   19.175  1.00 73.55  ? 20  A   B "O5'" 1 
ATOM   7282  C  "C5'" . A   B 2 21  A -15.785 2.419   20.614  1.00 72.72  ? 20  A   B "C5'" 1 
ATOM   7283  C  "C4'" . A   B 2 21  A -14.395 2.135   21.133  1.00 72.48  ? 20  A   B "C4'" 1 
ATOM   7284  O  "O4'" . A   B 2 21  A -13.490 3.181   20.685  1.00 73.03  ? 20  A   B "O4'" 1 
ATOM   7285  C  "C3'" . A   B 2 21  A -14.261 2.084   22.653  1.00 72.50  ? 20  A   B "C3'" 1 
ATOM   7286  O  "O3'" . A   B 2 21  A -14.449 0.743   23.107  1.00 71.57  ? 20  A   B "O3'" 1 
ATOM   7287  C  "C2'" . A   B 2 21  A -12.842 2.594   22.888  1.00 72.82  ? 20  A   B "C2'" 1 
ATOM   7288  O  "O2'" . A   B 2 21  A -11.843 1.599   22.785  1.00 73.29  ? 20  A   B "O2'" 1 
ATOM   7289  C  "C1'" . A   B 2 21  A -12.684 3.618   21.764  1.00 73.14  ? 20  A   B "C1'" 1 
ATOM   7290  N  N9    . A   B 2 21  A -13.076 4.987   22.114  1.00 74.09  ? 20  A   B N9    1 
ATOM   7291  C  C8    . A   B 2 21  A -14.100 5.733   21.582  1.00 75.01  ? 20  A   B C8    1 
ATOM   7292  N  N7    . A   B 2 21  A -14.195 6.938   22.090  1.00 74.82  ? 20  A   B N7    1 
ATOM   7293  C  C5    . A   B 2 21  A -13.160 6.994   23.013  1.00 73.99  ? 20  A   B C5    1 
ATOM   7294  C  C6    . A   B 2 21  A -12.725 8.007   23.887  1.00 73.39  ? 20  A   B C6    1 
ATOM   7295  N  N6    . A   B 2 21  A -13.303 9.206   23.976  1.00 74.12  ? 20  A   B N6    1 
ATOM   7296  N  N1    . A   B 2 21  A -11.660 7.741   24.676  1.00 72.34  ? 20  A   B N1    1 
ATOM   7297  C  C2    . A   B 2 21  A -11.079 6.538   24.585  1.00 72.76  ? 20  A   B C2    1 
ATOM   7298  N  N3    . A   B 2 21  A -11.398 5.504   23.806  1.00 74.05  ? 20  A   B N3    1 
ATOM   7299  C  C4    . A   B 2 21  A -12.458 5.801   23.034  1.00 74.03  ? 20  A   B C4    1 
ATOM   7300  P  P     . G   B 2 22  ? -14.990 0.445   24.590  1.00 69.38  ? 21  G   B P     1 
ATOM   7301  O  OP1   . G   B 2 22  ? -15.016 -1.028  24.780  1.00 68.80  ? 21  G   B OP1   1 
ATOM   7302  O  OP2   . G   B 2 22  ? -16.232 1.233   24.801  1.00 68.74  ? 21  G   B OP2   1 
ATOM   7303  O  "O5'" . G   B 2 22  ? -13.855 1.063   25.521  1.00 68.51  ? 21  G   B "O5'" 1 
ATOM   7304  C  "C5'" . G   B 2 22  ? -12.651 0.337   25.834  1.00 67.80  ? 21  G   B "C5'" 1 
ATOM   7305  C  "C4'" . G   B 2 22  ? -11.787 1.156   26.762  1.00 67.73  ? 21  G   B "C4'" 1 
ATOM   7306  O  "O4'" . G   B 2 22  ? -11.761 2.525   26.301  1.00 68.18  ? 21  G   B "O4'" 1 
ATOM   7307  C  "C3'" . G   B 2 22  ? -12.274 1.219   28.201  1.00 67.80  ? 21  G   B "C3'" 1 
ATOM   7308  O  "O3'" . G   B 2 22  ? -11.662 0.133   28.886  1.00 67.19  ? 21  G   B "O3'" 1 
ATOM   7309  C  "C2'" . G   B 2 22  ? -11.790 2.584   28.698  1.00 68.43  ? 21  G   B "C2'" 1 
ATOM   7310  O  "O2'" . G   B 2 22  ? -10.563 2.546   29.400  1.00 67.97  ? 21  G   B "O2'" 1 
ATOM   7311  C  "C1'" . G   B 2 22  ? -11.658 3.398   27.406  1.00 69.71  ? 21  G   B "C1'" 1 
ATOM   7312  N  N9    . G   B 2 22  ? -12.659 4.448   27.242  1.00 71.87  ? 21  G   B N9    1 
ATOM   7313  C  C8    . G   B 2 22  ? -13.952 4.296   26.803  1.00 73.59  ? 21  G   B C8    1 
ATOM   7314  N  N7    . G   B 2 22  ? -14.604 5.425   26.728  1.00 74.34  ? 21  G   B N7    1 
ATOM   7315  C  C5    . G   B 2 22  ? -13.683 6.381   27.132  1.00 74.04  ? 21  G   B C5    1 
ATOM   7316  C  C6    . G   B 2 22  ? -13.814 7.789   27.256  1.00 74.51  ? 21  G   B C6    1 
ATOM   7317  O  O6    . G   B 2 22  ? -14.802 8.494   27.021  1.00 74.97  ? 21  G   B O6    1 
ATOM   7318  N  N1    . G   B 2 22  ? -12.633 8.377   27.700  1.00 75.03  ? 21  G   B N1    1 
ATOM   7319  C  C2    . G   B 2 22  ? -11.473 7.698   27.988  1.00 74.72  ? 21  G   B C2    1 
ATOM   7320  N  N2    . G   B 2 22  ? -10.437 8.442   28.404  1.00 74.67  ? 21  G   B N2    1 
ATOM   7321  N  N3    . G   B 2 22  ? -11.339 6.385   27.877  1.00 74.27  ? 21  G   B N3    1 
ATOM   7322  C  C4    . G   B 2 22  ? -12.476 5.795   27.450  1.00 73.38  ? 21  G   B C4    1 
ATOM   7323  P  P     . A   B 2 23  ? -12.218 -0.376  30.294  1.00 66.53  ? 22  A   B P     1 
ATOM   7324  O  OP1   . A   B 2 23  ? -13.695 -0.486  30.198  1.00 67.08  ? 22  A   B OP1   1 
ATOM   7325  O  OP2   . A   B 2 23  ? -11.610 0.461   31.361  1.00 65.77  ? 22  A   B OP2   1 
ATOM   7326  O  "O5'" . A   B 2 23  ? -11.619 -1.849  30.383  1.00 64.98  ? 22  A   B "O5'" 1 
ATOM   7327  C  "C5'" . A   B 2 23  ? -12.030 -2.871  29.452  1.00 64.53  ? 22  A   B "C5'" 1 
ATOM   7328  C  "C4'" . A   B 2 23  ? -10.863 -3.749  29.056  1.00 64.13  ? 22  A   B "C4'" 1 
ATOM   7329  O  "O4'" . A   B 2 23  ? -9.934  -2.993  28.235  1.00 63.84  ? 22  A   B "O4'" 1 
ATOM   7330  C  "C3'" . A   B 2 23  ? -10.010 -4.297  30.196  1.00 64.15  ? 22  A   B "C3'" 1 
ATOM   7331  O  "O3'" . A   B 2 23  ? -10.569 -5.476  30.768  1.00 64.44  ? 22  A   B "O3'" 1 
ATOM   7332  C  "C2'" . A   B 2 23  ? -8.686  -4.573  29.496  1.00 64.30  ? 22  A   B "C2'" 1 
ATOM   7333  O  "O2'" . A   B 2 23  ? -8.641  -5.806  28.808  1.00 64.17  ? 22  A   B "O2'" 1 
ATOM   7334  C  "C1'" . A   B 2 23  ? -8.604  -3.395  28.523  1.00 64.42  ? 22  A   B "C1'" 1 
ATOM   7335  N  N9    . A   B 2 23  ? -7.872  -2.243  29.053  1.00 64.65  ? 22  A   B N9    1 
ATOM   7336  C  C8    . A   B 2 23  ? -8.352  -0.984  29.321  1.00 64.69  ? 22  A   B C8    1 
ATOM   7337  N  N7    . A   B 2 23  ? -7.445  -0.160  29.785  1.00 64.71  ? 22  A   B N7    1 
ATOM   7338  C  C5    . A   B 2 23  ? -6.291  -0.928  29.835  1.00 64.73  ? 22  A   B C5    1 
ATOM   7339  C  C6    . A   B 2 23  ? -4.975  -0.634  30.233  1.00 64.63  ? 22  A   B C6    1 
ATOM   7340  N  N6    . A   B 2 23  ? -4.590  0.560   30.690  1.00 64.87  ? 22  A   B N6    1 
ATOM   7341  N  N1    . A   B 2 23  ? -4.058  -1.623  30.152  1.00 64.78  ? 22  A   B N1    1 
ATOM   7342  C  C2    . A   B 2 23  ? -4.445  -2.821  29.694  1.00 64.98  ? 22  A   B C2    1 
ATOM   7343  N  N3    . A   B 2 23  ? -5.650  -3.217  29.284  1.00 65.32  ? 22  A   B N3    1 
ATOM   7344  C  C4    . A   B 2 23  ? -6.538  -2.212  29.382  1.00 65.00  ? 22  A   B C4    1 
ATOM   7345  P  P     . C   B 2 24  ? -10.690 -5.623  32.361  1.00 64.02  ? 23  C   B P     1 
ATOM   7346  O  OP1   . C   B 2 24  ? -10.943 -7.053  32.672  1.00 64.44  ? 23  C   B OP1   1 
ATOM   7347  O  OP2   . C   B 2 24  ? -11.626 -4.581  32.854  1.00 63.40  ? 23  C   B OP2   1 
ATOM   7348  O  "O5'" . C   B 2 24  ? -9.232  -5.242  32.875  1.00 64.57  ? 23  C   B "O5'" 1 
ATOM   7349  C  "C5'" . C   B 2 24  ? -8.129  -6.149  32.714  1.00 65.18  ? 23  C   B "C5'" 1 
ATOM   7350  C  "C4'" . C   B 2 24  ? -6.848  -5.528  33.217  1.00 64.95  ? 23  C   B "C4'" 1 
ATOM   7351  O  "O4'" . C   B 2 24  ? -6.465  -4.412  32.369  1.00 65.91  ? 23  C   B "O4'" 1 
ATOM   7352  C  "C3'" . C   B 2 24  ? -6.896  -4.925  34.611  1.00 64.34  ? 23  C   B "C3'" 1 
ATOM   7353  O  "O3'" . C   B 2 24  ? -6.801  -5.922  35.621  1.00 63.33  ? 23  C   B "O3'" 1 
ATOM   7354  C  "C2'" . C   B 2 24  ? -5.701  -3.982  34.574  1.00 65.21  ? 23  C   B "C2'" 1 
ATOM   7355  O  "O2'" . C   B 2 24  ? -4.462  -4.623  34.798  1.00 64.96  ? 23  C   B "O2'" 1 
ATOM   7356  C  "C1'" . C   B 2 24  ? -5.798  -3.431  33.149  1.00 66.43  ? 23  C   B "C1'" 1 
ATOM   7357  N  N1    . C   B 2 24  ? -6.548  -2.161  33.067  1.00 68.39  ? 23  C   B N1    1 
ATOM   7358  C  C2    . C   B 2 24  ? -5.882  -0.964  33.362  1.00 69.98  ? 23  C   B C2    1 
ATOM   7359  O  O2    . C   B 2 24  ? -4.680  -1.004  33.664  1.00 71.00  ? 23  C   B O2    1 
ATOM   7360  N  N3    . C   B 2 24  ? -6.562  0.205   33.295  1.00 71.01  ? 23  C   B N3    1 
ATOM   7361  C  C4    . C   B 2 24  ? -7.856  0.207   32.964  1.00 71.35  ? 23  C   B C4    1 
ATOM   7362  N  N4    . C   B 2 24  ? -8.488  1.382   32.913  1.00 71.58  ? 23  C   B N4    1 
ATOM   7363  C  C5    . C   B 2 24  ? -8.561  -0.998  32.673  1.00 70.67  ? 23  C   B C5    1 
ATOM   7364  C  C6    . C   B 2 24  ? -7.875  -2.148  32.737  1.00 69.47  ? 23  C   B C6    1 
ATOM   7365  P  P     . A   B 2 25  ? -7.309  -5.610  37.109  1.00 63.62  ? 24  A   B P     1 
ATOM   7366  O  OP1   . A   B 2 25  ? -7.057  -6.814  37.941  1.00 64.03  ? 24  A   B OP1   1 
ATOM   7367  O  OP2   . A   B 2 25  ? -8.685  -5.058  37.021  1.00 63.23  ? 24  A   B OP2   1 
ATOM   7368  O  "O5'" . A   B 2 25  ? -6.308  -4.472  37.597  1.00 63.17  ? 24  A   B "O5'" 1 
ATOM   7369  C  "C5'" . A   B 2 25  ? -6.743  -3.409  38.462  1.00 64.17  ? 24  A   B "C5'" 1 
ATOM   7370  C  "C4'" . A   B 2 25  ? -5.671  -2.353  38.551  1.00 65.45  ? 24  A   B "C4'" 1 
ATOM   7371  O  "O4'" . A   B 2 25  ? -5.507  -1.720  37.253  1.00 66.63  ? 24  A   B "O4'" 1 
ATOM   7372  C  "C3'" . A   B 2 25  ? -5.954  -1.202  39.509  1.00 67.08  ? 24  A   B "C3'" 1 
ATOM   7373  O  "O3'" . A   B 2 25  ? -5.600  -1.548  40.844  1.00 69.10  ? 24  A   B "O3'" 1 
ATOM   7374  C  "C2'" . A   B 2 25  ? -5.100  -0.090  38.916  1.00 67.42  ? 24  A   B "C2'" 1 
ATOM   7375  O  "O2'" . A   B 2 25  ? -3.727  -0.174  39.240  1.00 67.76  ? 24  A   B "O2'" 1 
ATOM   7376  C  "C1'" . A   B 2 25  ? -5.308  -0.325  37.420  1.00 67.58  ? 24  A   B "C1'" 1 
ATOM   7377  N  N9    . A   B 2 25  ? -6.465  0.386   36.870  1.00 68.01  ? 24  A   B N9    1 
ATOM   7378  C  C8    . A   B 2 25  ? -7.678  -0.126  36.476  1.00 67.82  ? 24  A   B C8    1 
ATOM   7379  N  N7    . A   B 2 25  ? -8.512  0.780   36.026  1.00 67.29  ? 24  A   B N7    1 
ATOM   7380  C  C5    . A   B 2 25  ? -7.800  1.968   36.126  1.00 67.25  ? 24  A   B C5    1 
ATOM   7381  C  C6    . A   B 2 25  ? -8.128  3.298   35.807  1.00 67.41  ? 24  A   B C6    1 
ATOM   7382  N  N6    . A   B 2 25  ? -9.306  3.669   35.300  1.00 67.90  ? 24  A   B N6    1 
ATOM   7383  N  N1    . A   B 2 25  ? -7.193  4.247   36.033  1.00 67.95  ? 24  A   B N1    1 
ATOM   7384  C  C2    . A   B 2 25  ? -6.011  3.875   36.543  1.00 68.21  ? 24  A   B C2    1 
ATOM   7385  N  N3    . A   B 2 25  ? -5.586  2.658   36.883  1.00 68.08  ? 24  A   B N3    1 
ATOM   7386  C  C4    . A   B 2 25  ? -6.538  1.739   36.645  1.00 67.83  ? 24  A   B C4    1 
ATOM   7387  P  P     . C   B 2 26  ? -6.505  -1.058  42.074  1.00 70.65  ? 25  C   B P     1 
ATOM   7388  O  OP1   . C   B 2 26  ? -5.962  -1.669  43.313  1.00 69.72  ? 25  C   B OP1   1 
ATOM   7389  O  OP2   . C   B 2 26  ? -7.930  -1.279  41.718  1.00 70.31  ? 25  C   B OP2   1 
ATOM   7390  O  "O5'" . C   B 2 26  ? -6.217  0.509   42.126  1.00 71.91  ? 25  C   B "O5'" 1 
ATOM   7391  C  "C5'" . C   B 2 26  ? -4.894  0.996   42.415  1.00 74.19  ? 25  C   B "C5'" 1 
ATOM   7392  C  "C4'" . C   B 2 26  ? -4.791  2.484   42.176  1.00 76.23  ? 25  C   B "C4'" 1 
ATOM   7393  O  "O4'" . C   B 2 26  ? -5.116  2.795   40.797  1.00 76.22  ? 25  C   B "O4'" 1 
ATOM   7394  C  "C3'" . C   B 2 26  ? -5.728  3.376   42.972  1.00 78.09  ? 25  C   B "C3'" 1 
ATOM   7395  O  "O3'" . C   B 2 26  ? -5.270  3.567   44.306  1.00 81.78  ? 25  C   B "O3'" 1 
ATOM   7396  C  "C2'" . C   B 2 26  ? -5.702  4.659   42.150  1.00 77.28  ? 25  C   B "C2'" 1 
ATOM   7397  O  "O2'" . C   B 2 26  ? -4.594  5.496   42.413  1.00 77.50  ? 25  C   B "O2'" 1 
ATOM   7398  C  "C1'" . C   B 2 26  ? -5.651  4.107   40.722  1.00 75.88  ? 25  C   B "C1'" 1 
ATOM   7399  N  N1    . C   B 2 26  ? -6.975  4.050   40.070  1.00 74.37  ? 25  C   B N1    1 
ATOM   7400  C  C2    . C   B 2 26  ? -7.536  5.241   39.590  1.00 73.93  ? 25  C   B C2    1 
ATOM   7401  O  O2    . C   B 2 26  ? -6.903  6.299   39.721  1.00 72.74  ? 25  C   B O2    1 
ATOM   7402  N  N3    . C   B 2 26  ? -8.753  5.207   38.998  1.00 73.91  ? 25  C   B N3    1 
ATOM   7403  C  C4    . C   B 2 26  ? -9.405  4.047   38.878  1.00 73.10  ? 25  C   B C4    1 
ATOM   7404  N  N4    . C   B 2 26  ? -10.602 4.060   38.287  1.00 73.93  ? 25  C   B N4    1 
ATOM   7405  C  C5    . C   B 2 26  ? -8.860  2.822   39.362  1.00 72.73  ? 25  C   B C5    1 
ATOM   7406  C  C6    . C   B 2 26  ? -7.655  2.869   39.948  1.00 73.14  ? 25  C   B C6    1 
ATOM   7407  P  P     . A   B 2 27  ? -6.320  3.836   45.484  1.00 86.19  ? 26  A   B P     1 
ATOM   7408  O  OP1   . A   B 2 27  ? -5.551  4.154   46.713  1.00 86.17  ? 26  A   B OP1   1 
ATOM   7409  O  OP2   . A   B 2 27  ? -7.291  2.711   45.502  1.00 85.39  ? 26  A   B OP2   1 
ATOM   7410  O  "O5'" . A   B 2 27  ? -7.091  5.140   44.988  1.00 88.36  ? 26  A   B "O5'" 1 
ATOM   7411  C  "C5'" . A   B 2 27  ? -6.563  6.456   45.244  1.00 91.08  ? 26  A   B "C5'" 1 
ATOM   7412  C  "C4'" . A   B 2 27  ? -7.483  7.524   44.697  1.00 92.92  ? 26  A   B "C4'" 1 
ATOM   7413  O  "O4'" . A   B 2 27  ? -7.757  7.277   43.294  1.00 92.57  ? 26  A   B "O4'" 1 
ATOM   7414  C  "C3'" . A   B 2 27  ? -8.872  7.608   45.318  1.00 95.08  ? 26  A   B "C3'" 1 
ATOM   7415  O  "O3'" . A   B 2 27  ? -8.888  8.276   46.576  1.00 98.01  ? 26  A   B "O3'" 1 
ATOM   7416  C  "C2'" . A   B 2 27  ? -9.640  8.374   44.247  1.00 94.20  ? 26  A   B "C2'" 1 
ATOM   7417  O  "O2'" . A   B 2 27  ? -9.484  9.778   44.297  1.00 92.75  ? 26  A   B "O2'" 1 
ATOM   7418  C  "C1'" . A   B 2 27  ? -9.037  7.794   42.965  1.00 92.64  ? 26  A   B "C1'" 1 
ATOM   7419  N  N9    . A   B 2 27  ? -9.847  6.721   42.387  1.00 92.03  ? 26  A   B N9    1 
ATOM   7420  C  C8    . A   B 2 27  ? -9.623  5.366   42.410  1.00 91.41  ? 26  A   B C8    1 
ATOM   7421  N  N7    . A   B 2 27  ? -10.553 4.666   41.806  1.00 91.01  ? 26  A   B N7    1 
ATOM   7422  C  C5    . A   B 2 27  ? -11.451 5.624   41.357  1.00 91.70  ? 26  A   B C5    1 
ATOM   7423  C  C6    . A   B 2 27  ? -12.657 5.527   40.639  1.00 91.96  ? 26  A   B C6    1 
ATOM   7424  N  N6    . A   B 2 27  ? -13.185 4.371   40.231  1.00 91.97  ? 26  A   B N6    1 
ATOM   7425  N  N1    . A   B 2 27  ? -13.314 6.674   40.356  1.00 92.37  ? 26  A   B N1    1 
ATOM   7426  C  C2    . A   B 2 27  ? -12.786 7.835   40.770  1.00 93.12  ? 26  A   B C2    1 
ATOM   7427  N  N3    . A   B 2 27  ? -11.657 8.054   41.445  1.00 92.67  ? 26  A   B N3    1 
ATOM   7428  C  C4    . A   B 2 27  ? -11.031 6.893   41.712  1.00 92.08  ? 26  A   B C4    1 
ATOM   7429  P  P     . A   B 2 28  ? -10.035 7.945   47.647  1.00 101.34 ? 27  A   B P     1 
ATOM   7430  O  OP1   . A   B 2 28  ? -9.863  8.868   48.797  1.00 102.58 ? 27  A   B OP1   1 
ATOM   7431  O  OP2   . A   B 2 28  ? -10.036 6.479   47.883  1.00 101.94 ? 27  A   B OP2   1 
ATOM   7432  O  "O5'" . A   B 2 28  ? -11.379 8.324   46.877  1.00 103.07 ? 27  A   B "O5'" 1 
ATOM   7433  C  "C5'" . A   B 2 28  ? -11.834 9.689   46.813  1.00 106.77 ? 27  A   B "C5'" 1 
ATOM   7434  C  "C4'" . A   B 2 28  ? -13.079 9.816   45.961  1.00 109.62 ? 27  A   B "C4'" 1 
ATOM   7435  O  "O4'" . A   B 2 28  ? -12.901 9.149   44.682  1.00 110.30 ? 27  A   B "O4'" 1 
ATOM   7436  C  "C3'" . A   B 2 28  ? -14.354 9.189   46.510  1.00 112.15 ? 27  A   B "C3'" 1 
ATOM   7437  O  "O3'" . A   B 2 28  ? -14.929 9.971   47.554  1.00 116.81 ? 27  A   B "O3'" 1 
ATOM   7438  C  "C2'" . A   B 2 28  ? -15.204 9.108   45.248  1.00 111.12 ? 27  A   B "C2'" 1 
ATOM   7439  O  "O2'" . A   B 2 28  ? -15.807 10.329  44.869  1.00 109.40 ? 27  A   B "O2'" 1 
ATOM   7440  C  "C1'" . A   B 2 28  ? -14.157 8.668   44.221  1.00 110.44 ? 27  A   B "C1'" 1 
ATOM   7441  N  N9    . A   B 2 28  ? -14.078 7.213   44.075  1.00 110.23 ? 27  A   B N9    1 
ATOM   7442  C  C8    . A   B 2 28  ? -13.202 6.343   44.679  1.00 108.97 ? 27  A   B C8    1 
ATOM   7443  N  N7    . A   B 2 28  ? -13.394 5.088   44.351  1.00 108.53 ? 27  A   B N7    1 
ATOM   7444  C  C5    . A   B 2 28  ? -14.473 5.133   43.480  1.00 108.85 ? 27  A   B C5    1 
ATOM   7445  C  C6    . A   B 2 28  ? -15.165 4.129   42.778  1.00 109.05 ? 27  A   B C6    1 
ATOM   7446  N  N6    . A   B 2 28  ? -14.859 2.831   42.849  1.00 108.64 ? 27  A   B N6    1 
ATOM   7447  N  N1    . A   B 2 28  ? -16.195 4.509   41.988  1.00 110.37 ? 27  A   B N1    1 
ATOM   7448  C  C2    . A   B 2 28  ? -16.501 5.812   41.917  1.00 110.72 ? 27  A   B C2    1 
ATOM   7449  N  N3    . A   B 2 28  ? -15.925 6.848   42.527  1.00 110.25 ? 27  A   B N3    1 
ATOM   7450  C  C4    . A   B 2 28  ? -14.906 6.435   43.302  1.00 109.92 ? 27  A   B C4    1 
ATOM   7451  P  P     . G   B 2 29  ? -15.585 9.263   48.840  1.00 118.87 ? 28  G   B P     1 
ATOM   7452  O  OP1   . G   B 2 29  ? -15.847 10.312  49.857  1.00 120.23 ? 28  G   B OP1   1 
ATOM   7453  O  OP2   . G   B 2 29  ? -14.756 8.085   49.205  1.00 119.51 ? 28  G   B OP2   1 
ATOM   7454  O  "O5'" . G   B 2 29  ? -16.993 8.762   48.293  1.00 118.77 ? 28  G   B "O5'" 1 
ATOM   7455  C  "C5'" . G   B 2 29  ? -18.011 9.713   47.939  1.00 122.27 ? 28  G   B "C5'" 1 
ATOM   7456  C  "C4'" . G   B 2 29  ? -19.117 9.048   47.157  1.00 125.52 ? 28  G   B "C4'" 1 
ATOM   7457  O  "O4'" . G   B 2 29  ? -18.580 8.404   45.969  1.00 124.96 ? 28  G   B "O4'" 1 
ATOM   7458  C  "C3'" . G   B 2 29  ? -19.865 7.925   47.857  1.00 128.27 ? 28  G   B "C3'" 1 
ATOM   7459  O  "O3'" . G   B 2 29  ? -20.798 8.413   48.817  1.00 134.44 ? 28  G   B "O3'" 1 
ATOM   7460  C  "C2'" . G   B 2 29  ? -20.508 7.221   46.671  1.00 126.32 ? 28  G   B "C2'" 1 
ATOM   7461  O  "O2'" . G   B 2 29  ? -21.660 7.868   46.172  1.00 128.22 ? 28  G   B "O2'" 1 
ATOM   7462  C  "C1'" . G   B 2 29  ? -19.363 7.260   45.658  1.00 123.15 ? 28  G   B "C1'" 1 
ATOM   7463  N  N9    . G   B 2 29  ? -18.511 6.075   45.718  1.00 119.45 ? 28  G   B N9    1 
ATOM   7464  C  C8    . G   B 2 29  ? -17.238 5.981   46.230  1.00 117.26 ? 28  G   B C8    1 
ATOM   7465  N  N7    . G   B 2 29  ? -16.739 4.778   46.143  1.00 115.67 ? 28  G   B N7    1 
ATOM   7466  C  C5    . G   B 2 29  ? -17.745 4.031   45.546  1.00 115.82 ? 28  G   B C5    1 
ATOM   7467  C  C6    . G   B 2 29  ? -17.784 2.655   45.195  1.00 114.68 ? 28  G   B C6    1 
ATOM   7468  O  O6    . G   B 2 29  ? -16.910 1.794   45.351  1.00 113.37 ? 28  G   B O6    1 
ATOM   7469  N  N1    . G   B 2 29  ? -19.000 2.310   44.611  1.00 114.80 ? 28  G   B N1    1 
ATOM   7470  C  C2    . G   B 2 29  ? -20.044 3.177   44.389  1.00 115.99 ? 28  G   B C2    1 
ATOM   7471  N  N2    . G   B 2 29  ? -21.137 2.656   43.811  1.00 116.00 ? 28  G   B N2    1 
ATOM   7472  N  N3    . G   B 2 29  ? -20.018 4.461   44.709  1.00 116.93 ? 28  G   B N3    1 
ATOM   7473  C  C4    . G   B 2 29  ? -18.846 4.817   45.279  1.00 117.42 ? 28  G   B C4    1 
ATOM   7474  P  P     . G   B 2 30  ? -20.963 7.679   50.235  1.00 139.26 ? 29  G   B P     1 
ATOM   7475  O  OP1   . G   B 2 30  ? -21.810 8.541   51.099  1.00 142.28 ? 29  G   B OP1   1 
ATOM   7476  O  OP2   . G   B 2 30  ? -19.617 7.267   50.712  1.00 136.61 ? 29  G   B OP2   1 
ATOM   7477  O  "O5'" . G   B 2 30  ? -21.800 6.373   49.869  1.00 138.53 ? 29  G   B "O5'" 1 
ATOM   7478  C  "C5'" . G   B 2 30  ? -23.191 6.471   49.512  1.00 139.55 ? 29  G   B "C5'" 1 
ATOM   7479  C  "C4'" . G   B 2 30  ? -23.666 5.197   48.854  1.00 140.60 ? 29  G   B "C4'" 1 
ATOM   7480  O  "O4'" . G   B 2 30  ? -22.780 4.842   47.758  1.00 139.66 ? 29  G   B "O4'" 1 
ATOM   7481  C  "C3'" . G   B 2 30  ? -23.678 3.951   49.723  1.00 142.90 ? 29  G   B "C3'" 1 
ATOM   7482  O  "O3'" . G   B 2 30  ? -24.800 3.893   50.599  1.00 147.19 ? 29  G   B "O3'" 1 
ATOM   7483  C  "C2'" . G   B 2 30  ? -23.688 2.852   48.670  1.00 142.24 ? 29  G   B "C2'" 1 
ATOM   7484  O  "O2'" . G   B 2 30  ? -24.957 2.603   48.101  1.00 141.75 ? 29  G   B "O2'" 1 
ATOM   7485  C  "C1'" . G   B 2 30  ? -22.720 3.428   47.636  1.00 141.38 ? 29  G   B "C1'" 1 
ATOM   7486  N  N9    . G   B 2 30  ? -21.341 2.993   47.842  1.00 142.47 ? 29  G   B N9    1 
ATOM   7487  C  C8    . G   B 2 30  ? -20.283 3.739   48.307  1.00 142.74 ? 29  G   B C8    1 
ATOM   7488  N  N7    . G   B 2 30  ? -19.173 3.058   48.388  1.00 142.62 ? 29  G   B N7    1 
ATOM   7489  C  C5    . G   B 2 30  ? -19.518 1.784   47.958  1.00 143.08 ? 29  G   B C5    1 
ATOM   7490  C  C6    . G   B 2 30  ? -18.727 0.611   47.826  1.00 143.49 ? 29  G   B C6    1 
ATOM   7491  O  O6    . G   B 2 30  ? -17.525 0.459   48.075  1.00 143.53 ? 29  G   B O6    1 
ATOM   7492  N  N1    . G   B 2 30  ? -19.478 -0.462  47.353  1.00 143.69 ? 29  G   B N1    1 
ATOM   7493  C  C2    . G   B 2 30  ? -20.817 -0.414  47.044  1.00 143.57 ? 29  G   B C2    1 
ATOM   7494  N  N2    . G   B 2 30  ? -21.366 -1.556  46.602  1.00 143.01 ? 29  G   B N2    1 
ATOM   7495  N  N3    . G   B 2 30  ? -21.563 0.673   47.160  1.00 142.97 ? 29  G   B N3    1 
ATOM   7496  C  C4    . G   B 2 30  ? -20.853 1.728   47.618  1.00 142.98 ? 29  G   B C4    1 
ATOM   7497  P  P     . G   B 2 31  ? -24.708 3.068   51.971  1.00 151.40 ? 30  G   B P     1 
ATOM   7498  O  OP1   . G   B 2 31  ? -26.014 3.196   52.668  1.00 152.47 ? 30  G   B OP1   1 
ATOM   7499  O  OP2   . G   B 2 31  ? -23.462 3.469   52.673  1.00 149.59 ? 30  G   B OP2   1 
ATOM   7500  O  "O5'" . G   B 2 31  ? -24.528 1.563   51.478  1.00 153.34 ? 30  G   B "O5'" 1 
ATOM   7501  C  "C5'" . G   B 2 31  ? -25.671 0.758   51.128  1.00 156.70 ? 30  G   B "C5'" 1 
ATOM   7502  C  "C4'" . G   B 2 31  ? -25.242 -0.613  50.660  1.00 159.51 ? 30  G   B "C4'" 1 
ATOM   7503  O  "O4'" . G   B 2 31  ? -24.124 -0.505  49.739  1.00 161.30 ? 30  G   B "O4'" 1 
ATOM   7504  C  "C3'" . G   B 2 31  ? -24.718 -1.560  51.727  1.00 162.44 ? 30  G   B "C3'" 1 
ATOM   7505  O  "O3'" . G   B 2 31  ? -25.739 -2.152  52.527  1.00 163.22 ? 30  G   B "O3'" 1 
ATOM   7506  C  "C2'" . G   B 2 31  ? -23.973 -2.584  50.880  1.00 163.59 ? 30  G   B "C2'" 1 
ATOM   7507  O  "O2'" . G   B 2 31  ? -24.798 -3.569  50.291  1.00 165.21 ? 30  G   B "O2'" 1 
ATOM   7508  C  "C1'" . G   B 2 31  ? -23.342 -1.689  49.810  1.00 162.25 ? 30  G   B "C1'" 1 
ATOM   7509  N  N9    . G   B 2 31  ? -21.959 -1.332  50.117  1.00 161.01 ? 30  G   B N9    1 
ATOM   7510  C  C8    . G   B 2 31  ? -21.466 -0.101  50.481  1.00 161.30 ? 30  G   B C8    1 
ATOM   7511  N  N7    . G   B 2 31  ? -20.179 -0.110  50.701  1.00 159.58 ? 30  G   B N7    1 
ATOM   7512  C  C5    . G   B 2 31  ? -19.800 -1.426  50.475  1.00 157.87 ? 30  G   B C5    1 
ATOM   7513  C  C6    . G   B 2 31  ? -18.523 -2.044  50.558  1.00 155.86 ? 30  G   B C6    1 
ATOM   7514  O  O6    . G   B 2 31  ? -17.437 -1.533  50.857  1.00 156.64 ? 30  G   B O6    1 
ATOM   7515  N  N1    . G   B 2 31  ? -18.589 -3.399  50.248  1.00 153.41 ? 30  G   B N1    1 
ATOM   7516  C  C2    . G   B 2 31  ? -19.735 -4.076  49.904  1.00 153.48 ? 30  G   B C2    1 
ATOM   7517  N  N2    . G   B 2 31  ? -19.596 -5.384  49.638  1.00 153.14 ? 30  G   B N2    1 
ATOM   7518  N  N3    . G   B 2 31  ? -20.929 -3.511  49.821  1.00 154.90 ? 30  G   B N3    1 
ATOM   7519  C  C4    . G   B 2 31  ? -20.888 -2.194  50.117  1.00 157.97 ? 30  G   B C4    1 
ATOM   7520  P  P     . A   B 2 32  ? -25.396 -2.700  53.999  1.00 163.69 ? 31  A   B P     1 
ATOM   7521  O  OP1   . A   B 2 32  ? -26.635 -3.288  54.570  1.00 164.92 ? 31  A   B OP1   1 
ATOM   7522  O  OP2   . A   B 2 32  ? -24.689 -1.624  54.741  1.00 161.88 ? 31  A   B OP2   1 
ATOM   7523  O  "O5'" . A   B 2 32  ? -24.357 -3.876  53.722  1.00 161.73 ? 31  A   B "O5'" 1 
ATOM   7524  C  "C5'" . A   B 2 32  ? -24.805 -5.175  53.289  1.00 161.22 ? 31  A   B "C5'" 1 
ATOM   7525  C  "C4'" . A   B 2 32  ? -23.633 -6.087  53.006  1.00 161.06 ? 31  A   B "C4'" 1 
ATOM   7526  O  "O4'" . A   B 2 32  ? -22.574 -5.352  52.346  1.00 160.71 ? 31  A   B "O4'" 1 
ATOM   7527  C  "C3'" . A   B 2 32  ? -22.948 -6.691  54.226  1.00 161.66 ? 31  A   B "C3'" 1 
ATOM   7528  O  "O3'" . A   B 2 32  ? -23.665 -7.836  54.683  1.00 163.64 ? 31  A   B "O3'" 1 
ATOM   7529  C  "C2'" . A   B 2 32  ? -21.568 -7.056  53.683  1.00 161.31 ? 31  A   B "C2'" 1 
ATOM   7530  O  "O2'" . A   B 2 32  ? -21.485 -8.345  53.107  1.00 160.42 ? 31  A   B "O2'" 1 
ATOM   7531  C  "C1'" . A   B 2 32  ? -21.329 -5.966  52.631  1.00 161.63 ? 31  A   B "C1'" 1 
ATOM   7532  N  N9    . A   B 2 32  ? -20.379 -4.935  53.055  1.00 163.52 ? 31  A   B N9    1 
ATOM   7533  C  C8    . A   B 2 32  ? -20.614 -3.608  53.324  1.00 164.54 ? 31  A   B C8    1 
ATOM   7534  N  N7    . A   B 2 32  ? -19.541 -2.944  53.681  1.00 164.59 ? 31  A   B N7    1 
ATOM   7535  C  C5    . A   B 2 32  ? -18.532 -3.895  53.643  1.00 163.14 ? 31  A   B C5    1 
ATOM   7536  C  C6    . A   B 2 32  ? -17.153 -3.825  53.916  1.00 161.78 ? 31  A   B C6    1 
ATOM   7537  N  N6    . A   B 2 32  ? -16.529 -2.708  54.297  1.00 161.85 ? 31  A   B N6    1 
ATOM   7538  N  N1    . A   B 2 32  ? -16.427 -4.958  53.782  1.00 160.76 ? 31  A   B N1    1 
ATOM   7539  C  C2    . A   B 2 32  ? -17.054 -6.080  53.400  1.00 160.48 ? 31  A   B C2    1 
ATOM   7540  N  N3    . A   B 2 32  ? -18.342 -6.270  53.116  1.00 161.40 ? 31  A   B N3    1 
ATOM   7541  C  C4    . A   B 2 32  ? -19.033 -5.126  53.257  1.00 163.10 ? 31  A   B C4    1 
ATOM   7542  P  P     . U   B 2 33  ? -24.284 -7.893  56.167  1.00 163.73 ? 32  U   B P     1 
ATOM   7543  O  OP1   . U   B 2 33  ? -25.499 -8.745  56.121  1.00 163.71 ? 32  U   B OP1   1 
ATOM   7544  O  OP2   . U   B 2 33  ? -24.383 -6.508  56.696  1.00 162.60 ? 32  U   B OP2   1 
ATOM   7545  O  "O5'" . U   B 2 33  ? -23.175 -8.690  56.987  1.00 166.78 ? 32  U   B "O5'" 1 
ATOM   7546  C  "C5'" . U   B 2 33  ? -21.959 -8.049  57.416  1.00 170.32 ? 32  U   B "C5'" 1 
ATOM   7547  C  "C4'" . U   B 2 33  ? -20.790 -9.000  57.296  1.00 173.87 ? 32  U   B "C4'" 1 
ATOM   7548  O  "O4'" . U   B 2 33  ? -19.883 -8.532  56.257  1.00 175.09 ? 32  U   B "O4'" 1 
ATOM   7549  C  "C3'" . U   B 2 33  ? -19.926 -9.150  58.542  1.00 176.83 ? 32  U   B "C3'" 1 
ATOM   7550  O  "O3'" . U   B 2 33  ? -20.423 -10.160 59.416  1.00 181.67 ? 32  U   B "O3'" 1 
ATOM   7551  C  "C2'" . U   B 2 33  ? -18.575 -9.527  57.950  1.00 176.89 ? 32  U   B "C2'" 1 
ATOM   7552  O  "O2'" . U   B 2 33  ? -18.456 -10.893 57.604  1.00 175.47 ? 32  U   B "O2'" 1 
ATOM   7553  C  "C1'" . U   B 2 33  ? -18.541 -8.646  56.702  1.00 177.68 ? 32  U   B "C1'" 1 
ATOM   7554  N  N1    . U   B 2 33  ? -18.000 -7.296  56.942  1.00 180.59 ? 32  U   B N1    1 
ATOM   7555  C  C2    . U   B 2 33  ? -16.639 -7.184  57.171  1.00 182.33 ? 32  U   B C2    1 
ATOM   7556  O  O2    . U   B 2 33  ? -15.886 -8.143  57.180  1.00 181.73 ? 32  U   B O2    1 
ATOM   7557  N  N3    . U   B 2 33  ? -16.195 -5.904  57.394  1.00 183.07 ? 32  U   B N3    1 
ATOM   7558  C  C4    . U   B 2 33  ? -16.949 -4.748  57.411  1.00 181.94 ? 32  U   B C4    1 
ATOM   7559  O  O4    . U   B 2 33  ? -16.398 -3.667  57.624  1.00 180.59 ? 32  U   B O4    1 
ATOM   7560  C  C5    . U   B 2 33  ? -18.345 -4.945  57.163  1.00 181.47 ? 32  U   B C5    1 
ATOM   7561  C  C6    . U   B 2 33  ? -18.812 -6.180  56.944  1.00 181.29 ? 32  U   B C6    1 
ATOM   7562  P  P     . U   B 2 34  ? -20.820 -9.803  60.928  1.00 186.67 ? 33  U   B P     1 
ATOM   7563  O  OP1   . U   B 2 34  ? -20.932 -11.074 61.687  1.00 187.16 ? 33  U   B OP1   1 
ATOM   7564  O  OP2   . U   B 2 34  ? -21.969 -8.863  60.892  1.00 186.80 ? 33  U   B OP2   1 
ATOM   7565  O  "O5'" . U   B 2 34  ? -19.547 -9.012  61.466  1.00 190.46 ? 33  U   B "O5'" 1 
ATOM   7566  C  "C5'" . U   B 2 34  ? -18.256 -9.641  61.556  1.00 195.34 ? 33  U   B "C5'" 1 
ATOM   7567  C  "C4'" . U   B 2 34  ? -17.165 -8.600  61.654  1.00 199.44 ? 33  U   B "C4'" 1 
ATOM   7568  O  "O4'" . U   B 2 34  ? -17.370 -7.559  60.666  1.00 201.50 ? 33  U   B "O4'" 1 
ATOM   7569  C  "C3'" . U   B 2 34  ? -17.093 -7.837  62.965  1.00 202.48 ? 33  U   B "C3'" 1 
ATOM   7570  O  "O3'" . U   B 2 34  ? -16.471 -8.655  63.953  1.00 206.23 ? 33  U   B "O3'" 1 
ATOM   7571  C  "C2'" . U   B 2 34  ? -16.307 -6.589  62.567  1.00 202.30 ? 33  U   B "C2'" 1 
ATOM   7572  O  "O2'" . U   B 2 34  ? -14.902 -6.748  62.603  1.00 200.87 ? 33  U   B "O2'" 1 
ATOM   7573  C  "C1'" . U   B 2 34  ? -16.795 -6.349  61.133  1.00 202.75 ? 33  U   B "C1'" 1 
ATOM   7574  N  N1    . U   B 2 34  ? -17.792 -5.269  61.010  1.00 204.11 ? 33  U   B N1    1 
ATOM   7575  C  C2    . U   B 2 34  ? -17.328 -3.988  60.759  1.00 204.55 ? 33  U   B C2    1 
ATOM   7576  O  O2    . U   B 2 34  ? -16.144 -3.722  60.641  1.00 205.47 ? 33  U   B O2    1 
ATOM   7577  N  N3    . U   B 2 34  ? -18.306 -3.030  60.656  1.00 203.83 ? 33  U   B N3    1 
ATOM   7578  C  C4    . U   B 2 34  ? -19.669 -3.210  60.774  1.00 202.42 ? 33  U   B C4    1 
ATOM   7579  O  O4    . U   B 2 34  ? -20.422 -2.242  60.655  1.00 200.58 ? 33  U   B O4    1 
ATOM   7580  C  C5    . U   B 2 34  ? -20.070 -4.560  61.033  1.00 202.62 ? 33  U   B C5    1 
ATOM   7581  C  C6    . U   B 2 34  ? -19.142 -5.520  61.141  1.00 203.83 ? 33  U   B C6    1 
ATOM   7582  P  P     . U   B 2 35  ? -16.117 -8.073  65.407  1.00 209.68 ? 34  U   B P     1 
ATOM   7583  O  OP1   . U   B 2 35  ? -14.805 -7.384  65.312  1.00 210.11 ? 34  U   B OP1   1 
ATOM   7584  O  OP2   . U   B 2 35  ? -16.288 -9.174  66.389  1.00 208.93 ? 34  U   B OP2   1 
ATOM   7585  O  "O5'" . U   B 2 35  ? -17.219 -6.943  65.643  1.00 209.99 ? 34  U   B "O5'" 1 
ATOM   7586  C  "C5'" . U   B 2 35  ? -18.463 -7.192  66.338  1.00 208.56 ? 34  U   B "C5'" 1 
ATOM   7587  C  "C4'" . U   B 2 35  ? -18.900 -5.977  67.135  1.00 207.51 ? 34  U   B "C4'" 1 
ATOM   7588  O  "O4'" . U   B 2 35  ? -18.365 -6.060  68.483  1.00 206.86 ? 34  U   B "O4'" 1 
ATOM   7589  C  "C3'" . U   B 2 35  ? -18.502 -4.612  66.575  1.00 206.82 ? 34  U   B "C3'" 1 
ATOM   7590  O  "O3'" . U   B 2 35  ? -19.631 -4.026  65.924  1.00 208.19 ? 34  U   B "O3'" 1 
ATOM   7591  C  "C2'" . U   B 2 35  ? -18.101 -3.804  67.809  1.00 205.64 ? 34  U   B "C2'" 1 
ATOM   7592  O  "O2'" . U   B 2 35  ? -19.148 -3.041  68.375  1.00 205.70 ? 34  U   B "O2'" 1 
ATOM   7593  C  "C1'" . U   B 2 35  ? -17.634 -4.889  68.786  1.00 204.37 ? 34  U   B "C1'" 1 
ATOM   7594  N  N1    . U   B 2 35  ? -16.194 -5.209  68.768  1.00 200.56 ? 34  U   B N1    1 
ATOM   7595  C  C2    . U   B 2 35  ? -15.301 -4.208  69.113  1.00 197.19 ? 34  U   B C2    1 
ATOM   7596  O  O2    . U   B 2 35  ? -15.650 -3.075  69.399  1.00 194.77 ? 34  U   B O2    1 
ATOM   7597  N  N3    . U   B 2 35  ? -13.979 -4.581  69.092  1.00 195.71 ? 34  U   B N3    1 
ATOM   7598  C  C4    . U   B 2 35  ? -13.467 -5.826  68.789  1.00 195.07 ? 34  U   B C4    1 
ATOM   7599  O  O4    . U   B 2 35  ? -12.248 -6.003  68.816  1.00 193.46 ? 34  U   B O4    1 
ATOM   7600  C  C5    . U   B 2 35  ? -14.452 -6.812  68.462  1.00 195.76 ? 34  U   B C5    1 
ATOM   7601  C  C6    . U   B 2 35  ? -15.749 -6.482  68.472  1.00 198.33 ? 34  U   B C6    1 
ATOM   7602  P  P     . A   B 2 36  ? -19.489 -3.297  64.498  1.00 209.91 ? 35  A   B P     1 
ATOM   7603  O  OP1   . A   B 2 36  ? -20.831 -3.268  63.863  1.00 210.52 ? 35  A   B OP1   1 
ATOM   7604  O  OP2   . A   B 2 36  ? -18.348 -3.902  63.769  1.00 210.07 ? 35  A   B OP2   1 
ATOM   7605  O  "O5'" . A   B 2 36  ? -19.107 -1.801  64.887  1.00 211.93 ? 35  A   B "O5'" 1 
ATOM   7606  C  "C5'" . A   B 2 36  ? -19.050 -0.770  63.881  1.00 213.76 ? 35  A   B "C5'" 1 
ATOM   7607  C  "C4'" . A   B 2 36  ? -18.162 0.371   64.327  1.00 215.43 ? 35  A   B "C4'" 1 
ATOM   7608  O  "O4'" . A   B 2 36  ? -17.533 0.041   65.596  1.00 215.75 ? 35  A   B "O4'" 1 
ATOM   7609  C  "C3'" . A   B 2 36  ? -17.006 0.719   63.394  1.00 216.35 ? 35  A   B "C3'" 1 
ATOM   7610  O  "O3'" . A   B 2 36  ? -17.420 1.605   62.356  1.00 215.85 ? 35  A   B "O3'" 1 
ATOM   7611  C  "C2'" . A   B 2 36  ? -16.002 1.361   64.345  1.00 216.11 ? 35  A   B "C2'" 1 
ATOM   7612  O  "O2'" . A   B 2 36  ? -16.221 2.737   64.588  1.00 215.90 ? 35  A   B "O2'" 1 
ATOM   7613  C  "C1'" . A   B 2 36  ? -16.205 0.535   65.617  1.00 214.08 ? 35  A   B "C1'" 1 
ATOM   7614  N  N9    . A   B 2 36  ? -15.286 -0.600  65.733  1.00 210.19 ? 35  A   B N9    1 
ATOM   7615  C  C8    . A   B 2 36  ? -15.525 -1.924  65.454  1.00 208.04 ? 35  A   B C8    1 
ATOM   7616  N  N7    . A   B 2 36  ? -14.490 -2.702  65.662  1.00 207.21 ? 35  A   B N7    1 
ATOM   7617  C  C5    . A   B 2 36  ? -13.503 -1.834  66.106  1.00 206.30 ? 35  A   B C5    1 
ATOM   7618  C  C6    . A   B 2 36  ? -12.167 -2.039  66.497  1.00 204.48 ? 35  A   B C6    1 
ATOM   7619  N  N6    . A   B 2 36  ? -11.572 -3.235  66.501  1.00 203.33 ? 35  A   B N6    1 
ATOM   7620  N  N1    . A   B 2 36  ? -11.453 -0.960  66.888  1.00 203.15 ? 35  A   B N1    1 
ATOM   7621  C  C2    . A   B 2 36  ? -12.051 0.240   66.883  1.00 203.77 ? 35  A   B C2    1 
ATOM   7622  N  N3    . A   B 2 36  ? -13.298 0.559   66.538  1.00 205.25 ? 35  A   B N3    1 
ATOM   7623  C  C4    . A   B 2 36  ? -13.980 -0.536  66.155  1.00 207.10 ? 35  A   B C4    1 
ATOM   7624  P  P     . A   B 2 37  ? -16.716 1.548   60.915  1.00 214.58 ? 36  A   B P     1 
ATOM   7625  O  OP1   . A   B 2 37  ? -17.061 2.796   60.186  1.00 216.35 ? 36  A   B OP1   1 
ATOM   7626  O  OP2   . A   B 2 37  ? -17.032 0.232   60.303  1.00 213.80 ? 36  A   B OP2   1 
ATOM   7627  O  "O5'" . A   B 2 37  ? -15.164 1.561   61.276  1.00 210.36 ? 36  A   B "O5'" 1 
ATOM   7628  C  "C5'" . A   B 2 37  ? -14.245 2.502   60.684  1.00 206.17 ? 36  A   B "C5'" 1 
ATOM   7629  C  "C4'" . A   B 2 37  ? -12.866 2.341   61.287  1.00 203.93 ? 36  A   B "C4'" 1 
ATOM   7630  O  "O4'" . A   B 2 37  ? -12.954 1.566   62.512  1.00 203.84 ? 36  A   B "O4'" 1 
ATOM   7631  C  "C3'" . A   B 2 37  ? -11.843 1.608   60.423  1.00 201.26 ? 36  A   B "C3'" 1 
ATOM   7632  O  "O3'" . A   B 2 37  ? -11.195 2.525   59.543  1.00 196.68 ? 36  A   B "O3'" 1 
ATOM   7633  C  "C2'" . A   B 2 37  ? -10.885 1.031   61.462  1.00 201.33 ? 36  A   B "C2'" 1 
ATOM   7634  O  "O2'" . A   B 2 37  ? -9.861  1.918   61.866  1.00 200.02 ? 36  A   B "O2'" 1 
ATOM   7635  C  "C1'" . A   B 2 37  ? -11.828 0.713   62.625  1.00 201.98 ? 36  A   B "C1'" 1 
ATOM   7636  N  N9    . A   B 2 37  ? -12.293 -0.677  62.662  1.00 201.56 ? 36  A   B N9    1 
ATOM   7637  C  C8    . A   B 2 37  ? -13.542 -1.171  62.373  1.00 201.09 ? 36  A   B C8    1 
ATOM   7638  N  N7    . A   B 2 37  ? -13.640 -2.471  62.512  1.00 200.94 ? 36  A   B N7    1 
ATOM   7639  C  C5    . A   B 2 37  ? -12.374 -2.860  62.925  1.00 200.53 ? 36  A   B C5    1 
ATOM   7640  C  C6    . A   B 2 37  ? -11.826 -4.116  63.243  1.00 198.50 ? 36  A   B C6    1 
ATOM   7641  N  N6    . A   B 2 37  ? -12.515 -5.259  63.193  1.00 196.74 ? 36  A   B N6    1 
ATOM   7642  N  N1    . A   B 2 37  ? -10.529 -4.158  63.621  1.00 198.53 ? 36  A   B N1    1 
ATOM   7643  C  C2    . A   B 2 37  ? -9.838  -3.011  63.672  1.00 199.26 ? 36  A   B C2    1 
ATOM   7644  N  N3    . A   B 2 37  ? -10.242 -1.771  63.396  1.00 200.02 ? 36  A   B N3    1 
ATOM   7645  C  C4    . A   B 2 37  ? -11.535 -1.764  63.025  1.00 201.14 ? 36  A   B C4    1 
ATOM   7646  P  P     . A   B 2 38  ? -10.908 2.134   58.012  1.00 191.24 ? 37  A   B P     1 
ATOM   7647  O  OP1   . A   B 2 38  ? -10.365 3.336   57.326  1.00 189.22 ? 37  A   B OP1   1 
ATOM   7648  O  OP2   . A   B 2 38  ? -12.118 1.468   57.466  1.00 192.30 ? 37  A   B OP2   1 
ATOM   7649  O  "O5'" . A   B 2 38  ? -9.736  1.060   58.124  1.00 184.24 ? 37  A   B "O5'" 1 
ATOM   7650  C  "C5'" . A   B 2 38  ? -8.370  1.468   58.331  1.00 177.64 ? 37  A   B "C5'" 1 
ATOM   7651  C  "C4'" . A   B 2 38  ? -7.513  0.285   58.720  1.00 173.89 ? 37  A   B "C4'" 1 
ATOM   7652  O  "O4'" . A   B 2 38  ? -8.149  -0.445  59.800  1.00 173.57 ? 37  A   B "O4'" 1 
ATOM   7653  C  "C3'" . A   B 2 38  ? -7.287  -0.764  57.636  1.00 171.07 ? 37  A   B "C3'" 1 
ATOM   7654  O  "O3'" . A   B 2 38  ? -6.217  -0.402  56.765  1.00 167.85 ? 37  A   B "O3'" 1 
ATOM   7655  C  "C2'" . A   B 2 38  ? -6.957  -2.011  58.452  1.00 170.97 ? 37  A   B "C2'" 1 
ATOM   7656  O  "O2'" . A   B 2 38  ? -5.593  -2.144  58.801  1.00 168.97 ? 37  A   B "O2'" 1 
ATOM   7657  C  "C1'" . A   B 2 38  ? -7.832  -1.823  59.695  1.00 172.23 ? 37  A   B "C1'" 1 
ATOM   7658  N  N9    . A   B 2 38  ? -9.079  -2.591  59.656  1.00 173.26 ? 37  A   B N9    1 
ATOM   7659  C  C8    . A   B 2 38  ? -10.346 -2.148  59.363  1.00 173.08 ? 37  A   B C8    1 
ATOM   7660  N  N7    . A   B 2 38  ? -11.259 -3.087  59.414  1.00 172.96 ? 37  A   B N7    1 
ATOM   7661  C  C5    . A   B 2 38  ? -10.547 -4.226  59.759  1.00 173.13 ? 37  A   B C5    1 
ATOM   7662  C  C6    . A   B 2 38  ? -10.940 -5.561  59.971  1.00 172.47 ? 37  A   B C6    1 
ATOM   7663  N  N6    . A   B 2 38  ? -12.200 -5.988  59.860  1.00 172.13 ? 37  A   B N6    1 
ATOM   7664  N  N1    . A   B 2 38  ? -9.981  -6.453  60.305  1.00 171.58 ? 37  A   B N1    1 
ATOM   7665  C  C2    . A   B 2 38  ? -8.716  -6.024  60.416  1.00 170.50 ? 37  A   B C2    1 
ATOM   7666  N  N3    . A   B 2 38  ? -8.224  -4.798  60.242  1.00 170.96 ? 37  A   B N3    1 
ATOM   7667  C  C4    . A   B 2 38  ? -9.203  -3.936  59.911  1.00 172.80 ? 37  A   B C4    1 
ATOM   7668  P  P     . A   B 2 39  ? -6.314  -0.692  55.188  1.00 163.64 ? 38  A   B P     1 
ATOM   7669  O  OP1   . A   B 2 39  ? -4.992  -0.391  54.582  1.00 163.57 ? 38  A   B OP1   1 
ATOM   7670  O  OP2   . A   B 2 39  ? -7.529  -0.011  54.669  1.00 162.92 ? 38  A   B OP2   1 
ATOM   7671  O  "O5'" . A   B 2 39  ? -6.551  -2.266  55.116  1.00 160.33 ? 38  A   B "O5'" 1 
ATOM   7672  C  "C5'" . A   B 2 39  ? -5.472  -3.204  55.298  1.00 157.08 ? 38  A   B "C5'" 1 
ATOM   7673  C  "C4'" . A   B 2 39  ? -5.996  -4.625  55.337  1.00 154.98 ? 38  A   B "C4'" 1 
ATOM   7674  O  "O4'" . A   B 2 39  ? -6.890  -4.791  56.471  1.00 155.32 ? 38  A   B "O4'" 1 
ATOM   7675  C  "C3'" . A   B 2 39  ? -6.810  -5.084  54.130  1.00 153.01 ? 38  A   B "C3'" 1 
ATOM   7676  O  "O3'" . A   B 2 39  ? -5.970  -5.539  53.072  1.00 149.27 ? 38  A   B "O3'" 1 
ATOM   7677  C  "C2'" . A   B 2 39  ? -7.656  -6.203  54.725  1.00 153.81 ? 38  A   B "C2'" 1 
ATOM   7678  O  "O2'" . A   B 2 39  ? -7.000  -7.452  54.820  1.00 153.57 ? 38  A   B "O2'" 1 
ATOM   7679  C  "C1'" . A   B 2 39  ? -7.962  -5.650  56.117  1.00 154.67 ? 38  A   B "C1'" 1 
ATOM   7680  N  N9    . A   B 2 39  ? -9.209  -4.886  56.169  1.00 155.62 ? 38  A   B N9    1 
ATOM   7681  C  C8    . A   B 2 39  ? -9.376  -3.532  56.007  1.00 156.19 ? 38  A   B C8    1 
ATOM   7682  N  N7    . A   B 2 39  ? -10.622 -3.137  56.099  1.00 156.48 ? 38  A   B N7    1 
ATOM   7683  C  C5    . A   B 2 39  ? -11.326 -4.310  56.331  1.00 156.65 ? 38  A   B C5    1 
ATOM   7684  C  C6    . A   B 2 39  ? -12.694 -4.567  56.523  1.00 155.85 ? 38  A   B C6    1 
ATOM   7685  N  N6    . A   B 2 39  ? -13.632 -3.618  56.505  1.00 155.17 ? 38  A   B N6    1 
ATOM   7686  N  N1    . A   B 2 39  ? -13.070 -5.849  56.730  1.00 154.88 ? 38  A   B N1    1 
ATOM   7687  C  C2    . A   B 2 39  ? -12.125 -6.800  56.745  1.00 154.28 ? 38  A   B C2    1 
ATOM   7688  N  N3    . A   B 2 39  ? -10.807 -6.681  56.580  1.00 154.58 ? 38  A   B N3    1 
ATOM   7689  C  C4    . A   B 2 39  ? -10.469 -5.396  56.374  1.00 156.05 ? 38  A   B C4    1 
ATOM   7690  P  P     . U   B 2 40  ? -6.501  -5.542  51.557  1.00 144.40 ? 39  U   B P     1 
ATOM   7691  O  OP1   . U   B 2 40  ? -5.440  -6.133  50.702  1.00 144.85 ? 39  U   B OP1   1 
ATOM   7692  O  OP2   . U   B 2 40  ? -7.019  -4.185  51.245  1.00 142.56 ? 39  U   B OP2   1 
ATOM   7693  O  "O5'" . U   B 2 40  ? -7.736  -6.548  51.608  1.00 141.07 ? 39  U   B "O5'" 1 
ATOM   7694  C  "C5'" . U   B 2 40  ? -7.546  -7.975  51.562  1.00 137.74 ? 39  U   B "C5'" 1 
ATOM   7695  C  "C4'" . U   B 2 40  ? -8.871  -8.693  51.693  1.00 136.36 ? 39  U   B "C4'" 1 
ATOM   7696  O  "O4'" . U   B 2 40  ? -9.611  -8.179  52.828  1.00 136.18 ? 39  U   B "O4'" 1 
ATOM   7697  C  "C3'" . U   B 2 40  ? -9.832  -8.525  50.529  1.00 135.46 ? 39  U   B "C3'" 1 
ATOM   7698  O  "O3'" . U   B 2 40  ? -9.470  -9.381  49.449  1.00 134.98 ? 39  U   B "O3'" 1 
ATOM   7699  C  "C2'" . U   B 2 40  ? -11.176 -8.865  51.167  1.00 134.90 ? 39  U   B "C2'" 1 
ATOM   7700  O  "O2'" . U   B 2 40  ? -11.482 -10.244 51.211  1.00 131.81 ? 39  U   B "O2'" 1 
ATOM   7701  C  "C1'" . U   B 2 40  ? -11.002 -8.315  52.586  1.00 136.29 ? 39  U   B "C1'" 1 
ATOM   7702  N  N1    . U   B 2 40  ? -11.649 -7.007  52.790  1.00 138.26 ? 39  U   B N1    1 
ATOM   7703  C  C2    . U   B 2 40  ? -12.895 -6.988  53.394  1.00 139.95 ? 39  U   B C2    1 
ATOM   7704  O  O2    . U   B 2 40  ? -13.467 -7.998  53.770  1.00 141.00 ? 39  U   B O2    1 
ATOM   7705  N  N3    . U   B 2 40  ? -13.443 -5.738  53.547  1.00 140.42 ? 39  U   B N3    1 
ATOM   7706  C  C4    . U   B 2 40  ? -12.894 -4.532  53.161  1.00 139.18 ? 39  U   B C4    1 
ATOM   7707  O  O4    . U   B 2 40  ? -13.514 -3.489  53.372  1.00 138.00 ? 39  U   B O4    1 
ATOM   7708  C  C5    . U   B 2 40  ? -11.609 -4.635  52.540  1.00 138.40 ? 39  U   B C5    1 
ATOM   7709  C  C6    . U   B 2 40  ? -11.046 -5.839  52.375  1.00 138.42 ? 39  U   B C6    1 
ATOM   7710  P  P     . C   B 2 41  ? -9.892  -9.011  47.950  1.00 132.21 ? 40  C   B P     1 
ATOM   7711  O  OP1   . C   B 2 41  ? -9.332  -10.048 47.047  1.00 133.18 ? 40  C   B OP1   1 
ATOM   7712  O  OP2   . C   B 2 41  ? -9.565  -7.582  47.712  1.00 131.35 ? 40  C   B OP2   1 
ATOM   7713  O  "O5'" . C   B 2 41  ? -11.475 -9.170  47.981  1.00 133.86 ? 40  C   B "O5'" 1 
ATOM   7714  C  "C5'" . C   B 2 41  ? -12.084 -10.473 48.007  1.00 136.75 ? 40  C   B "C5'" 1 
ATOM   7715  C  "C4'" . C   B 2 41  ? -13.581 -10.349 48.154  1.00 139.16 ? 40  C   B "C4'" 1 
ATOM   7716  O  "O4'" . C   B 2 41  ? -13.904 -9.493  49.277  1.00 141.83 ? 40  C   B "O4'" 1 
ATOM   7717  C  "C3'" . C   B 2 41  ? -14.297 -9.695  46.986  1.00 140.21 ? 40  C   B "C3'" 1 
ATOM   7718  O  "O3'" . C   B 2 41  ? -14.446 -10.636 45.926  1.00 139.25 ? 40  C   B "O3'" 1 
ATOM   7719  C  "C2'" . C   B 2 41  ? -15.604 -9.226  47.624  1.00 141.32 ? 40  C   B "C2'" 1 
ATOM   7720  O  "O2'" . C   B 2 41  ? -16.632 -10.196 47.626  1.00 140.73 ? 40  C   B "O2'" 1 
ATOM   7721  C  "C1'" . C   B 2 41  ? -15.163 -8.882  49.053  1.00 143.45 ? 40  C   B "C1'" 1 
ATOM   7722  N  N1    . C   B 2 41  ? -15.035 -7.431  49.305  1.00 146.81 ? 40  C   B N1    1 
ATOM   7723  C  C2    . C   B 2 41  ? -16.030 -6.779  50.047  1.00 148.95 ? 40  C   B C2    1 
ATOM   7724  O  O2    . C   B 2 41  ? -16.989 -7.437  50.476  1.00 150.91 ? 40  C   B O2    1 
ATOM   7725  N  N3    . C   B 2 41  ? -15.919 -5.449  50.276  1.00 149.34 ? 40  C   B N3    1 
ATOM   7726  C  C4    . C   B 2 41  ? -14.871 -4.774  49.794  1.00 148.57 ? 40  C   B C4    1 
ATOM   7727  N  N4    . C   B 2 41  ? -14.802 -3.464  50.045  1.00 148.99 ? 40  C   B N4    1 
ATOM   7728  C  C5    . C   B 2 41  ? -13.847 -5.412  49.035  1.00 148.07 ? 40  C   B C5    1 
ATOM   7729  C  C6    . C   B 2 41  ? -13.970 -6.728  48.814  1.00 147.85 ? 40  C   B C6    1 
ATOM   7730  P  P     . C   B 2 42  ? -14.784 -10.137 44.441  1.00 136.61 ? 41  C   B P     1 
ATOM   7731  O  OP1   . C   B 2 42  ? -14.700 -11.309 43.533  1.00 135.69 ? 41  C   B OP1   1 
ATOM   7732  O  OP2   . C   B 2 42  ? -13.966 -8.930  44.155  1.00 134.98 ? 41  C   B OP2   1 
ATOM   7733  O  "O5'" . C   B 2 42  ? -16.314 -9.718  44.560  1.00 134.44 ? 41  C   B "O5'" 1 
ATOM   7734  C  "C5'" . C   B 2 42  ? -16.882 -8.718  43.703  1.00 132.57 ? 41  C   B "C5'" 1 
ATOM   7735  C  "C4'" . C   B 2 42  ? -18.266 -8.368  44.184  1.00 132.97 ? 41  C   B "C4'" 1 
ATOM   7736  O  "O4'" . C   B 2 42  ? -18.219 -7.970  45.583  1.00 134.08 ? 41  C   B "O4'" 1 
ATOM   7737  C  "C3'" . C   B 2 42  ? -18.927 -7.204  43.466  1.00 133.53 ? 41  C   B "C3'" 1 
ATOM   7738  O  "O3'" . C   B 2 42  ? -19.535 -7.679  42.270  1.00 132.30 ? 41  C   B "O3'" 1 
ATOM   7739  C  "C2'" . C   B 2 42  ? -19.908 -6.703  44.517  1.00 135.30 ? 41  C   B "C2'" 1 
ATOM   7740  O  "O2'" . C   B 2 42  ? -21.101 -7.457  44.590  1.00 135.61 ? 41  C   B "O2'" 1 
ATOM   7741  C  "C1'" . C   B 2 42  ? -19.080 -6.862  45.794  1.00 136.67 ? 41  C   B "C1'" 1 
ATOM   7742  N  N1    . C   B 2 42  ? -18.262 -5.677  46.136  1.00 139.36 ? 41  C   B N1    1 
ATOM   7743  C  C2    . C   B 2 42  ? -18.906 -4.534  46.627  1.00 140.60 ? 41  C   B C2    1 
ATOM   7744  O  O2    . C   B 2 42  ? -20.139 -4.548  46.759  1.00 142.33 ? 41  C   B O2    1 
ATOM   7745  N  N3    . C   B 2 42  ? -18.168 -3.444  46.946  1.00 140.22 ? 41  C   B N3    1 
ATOM   7746  C  C4    . C   B 2 42  ? -16.842 -3.467  46.790  1.00 140.57 ? 41  C   B C4    1 
ATOM   7747  N  N4    . C   B 2 42  ? -16.154 -2.370  47.116  1.00 140.58 ? 41  C   B N4    1 
ATOM   7748  C  C5    . C   B 2 42  ? -16.161 -4.617  46.293  1.00 140.74 ? 41  C   B C5    1 
ATOM   7749  C  C6    . C   B 2 42  ? -16.902 -5.690  45.982  1.00 140.81 ? 41  C   B C6    1 
ATOM   7750  P  P     . C   B 2 43  ? -19.238 -6.966  40.866  1.00 131.83 ? 42  C   B P     1 
ATOM   7751  O  OP1   . C   B 2 43  ? -19.672 -7.886  39.785  1.00 132.30 ? 42  C   B OP1   1 
ATOM   7752  O  OP2   . C   B 2 43  ? -17.840 -6.463  40.881  1.00 129.74 ? 42  C   B OP2   1 
ATOM   7753  O  "O5'" . C   B 2 43  ? -20.239 -5.730  40.879  1.00 130.75 ? 42  C   B "O5'" 1 
ATOM   7754  C  "C5'" . C   B 2 43  ? -21.650 -5.925  41.081  1.00 130.34 ? 42  C   B "C5'" 1 
ATOM   7755  C  "C4'" . C   B 2 43  ? -22.315 -4.618  41.438  1.00 131.27 ? 42  C   B "C4'" 1 
ATOM   7756  O  "O4'" . C   B 2 43  ? -21.901 -4.195  42.763  1.00 132.02 ? 42  C   B "O4'" 1 
ATOM   7757  C  "C3'" . C   B 2 43  ? -21.975 -3.430  40.554  1.00 132.21 ? 42  C   B "C3'" 1 
ATOM   7758  O  "O3'" . C   B 2 43  ? -22.706 -3.496  39.332  1.00 133.25 ? 42  C   B "O3'" 1 
ATOM   7759  C  "C2'" . C   B 2 43  ? -22.346 -2.260  41.458  1.00 132.28 ? 42  C   B "C2'" 1 
ATOM   7760  O  "O2'" . C   B 2 43  ? -23.725 -1.949  41.466  1.00 131.42 ? 42  C   B "O2'" 1 
ATOM   7761  C  "C1'" . C   B 2 43  ? -21.883 -2.776  42.823  1.00 132.97 ? 42  C   B "C1'" 1 
ATOM   7762  N  N1    . C   B 2 43  ? -20.525 -2.328  43.197  1.00 135.45 ? 42  C   B N1    1 
ATOM   7763  C  C2    . C   B 2 43  ? -20.362 -1.025  43.684  1.00 136.98 ? 42  C   B C2    1 
ATOM   7764  O  O2    . C   B 2 43  ? -21.358 -0.294  43.790  1.00 137.39 ? 42  C   B O2    1 
ATOM   7765  N  N3    . C   B 2 43  ? -19.124 -0.599  44.033  1.00 137.45 ? 42  C   B N3    1 
ATOM   7766  C  C4    . C   B 2 43  ? -18.076 -1.417  43.905  1.00 137.19 ? 42  C   B C4    1 
ATOM   7767  N  N4    . C   B 2 43  ? -16.875 -0.955  44.258  1.00 137.02 ? 42  C   B N4    1 
ATOM   7768  C  C5    . C   B 2 43  ? -18.214 -2.746  43.408  1.00 136.72 ? 42  C   B C5    1 
ATOM   7769  C  C6    . C   B 2 43  ? -19.444 -3.156  43.067  1.00 136.30 ? 42  C   B C6    1 
ATOM   7770  P  P     . U   B 2 44  ? -22.011 -3.097  37.941  1.00 132.00 ? 43  U   B P     1 
ATOM   7771  O  OP1   . U   B 2 44  ? -22.901 -3.540  36.839  1.00 133.06 ? 43  U   B OP1   1 
ATOM   7772  O  OP2   . U   B 2 44  ? -20.598 -3.557  37.970  1.00 131.82 ? 43  U   B OP2   1 
ATOM   7773  O  "O5'" . U   B 2 44  ? -22.029 -1.506  37.978  1.00 127.10 ? 43  U   B "O5'" 1 
ATOM   7774  C  "C5'" . U   B 2 44  ? -23.274 -0.787  38.029  1.00 123.99 ? 43  U   B "C5'" 1 
ATOM   7775  C  "C4'" . U   B 2 44  ? -23.028 0.664   38.360  1.00 121.98 ? 43  U   B "C4'" 1 
ATOM   7776  O  "O4'" . U   B 2 44  ? -22.464 0.775   39.689  1.00 120.50 ? 43  U   B "O4'" 1 
ATOM   7777  C  "C3'" . U   B 2 44  ? -22.021 1.384   37.479  1.00 121.26 ? 43  U   B "C3'" 1 
ATOM   7778  O  "O3'" . U   B 2 44  ? -22.633 1.784   36.257  1.00 121.90 ? 43  U   B "O3'" 1 
ATOM   7779  C  "C2'" . U   B 2 44  ? -21.593 2.555   38.360  1.00 120.16 ? 43  U   B "C2'" 1 
ATOM   7780  O  "O2'" . U   B 2 44  ? -22.408 3.706   38.260  1.00 120.44 ? 43  U   B "O2'" 1 
ATOM   7781  C  "C1'" . U   B 2 44  ? -21.670 1.946   39.764  1.00 118.96 ? 43  U   B "C1'" 1 
ATOM   7782  N  N1    . U   B 2 44  ? -20.353 1.591   40.320  1.00 116.95 ? 43  U   B N1    1 
ATOM   7783  C  C2    . U   B 2 44  ? -19.659 2.577   41.000  1.00 116.67 ? 43  U   B C2    1 
ATOM   7784  O  O2    . U   B 2 44  ? -20.096 3.704   41.163  1.00 118.32 ? 43  U   B O2    1 
ATOM   7785  N  N3    . U   B 2 44  ? -18.439 2.187   41.493  1.00 115.42 ? 43  U   B N3    1 
ATOM   7786  C  C4    . U   B 2 44  ? -17.847 0.947   41.375  1.00 113.89 ? 43  U   B C4    1 
ATOM   7787  O  O4    . U   B 2 44  ? -16.737 0.754   41.873  1.00 112.48 ? 43  U   B O4    1 
ATOM   7788  C  C5    . U   B 2 44  ? -18.621 -0.015  40.650  1.00 114.22 ? 43  U   B C5    1 
ATOM   7789  C  C6    . U   B 2 44  ? -19.816 0.332   40.155  1.00 115.01 ? 43  U   B C6    1 
ATOM   7790  P  P     . C   B 2 45  ? -21.827 1.681   34.877  1.00 121.19 ? 44  C   B P     1 
ATOM   7791  O  OP1   . C   B 2 45  ? -22.739 2.101   33.782  1.00 123.40 ? 44  C   B OP1   1 
ATOM   7792  O  OP2   . C   B 2 45  ? -21.175 0.347   34.816  1.00 120.24 ? 44  C   B OP2   1 
ATOM   7793  O  "O5'" . C   B 2 45  ? -20.708 2.804   35.035  1.00 116.91 ? 44  C   B "O5'" 1 
ATOM   7794  C  "C5'" . C   B 2 45  ? -21.058 4.200   35.030  1.00 113.03 ? 44  C   B "C5'" 1 
ATOM   7795  C  "C4'" . C   B 2 45  ? -19.883 5.049   35.457  1.00 110.44 ? 44  C   B "C4'" 1 
ATOM   7796  O  "O4'" . C   B 2 45  ? -19.494 4.712   36.812  1.00 107.53 ? 44  C   B "O4'" 1 
ATOM   7797  C  "C3'" . C   B 2 45  ? -18.601 4.874   34.660  1.00 109.47 ? 44  C   B "C3'" 1 
ATOM   7798  O  "O3'" . C   B 2 45  ? -18.656 5.590   33.430  1.00 110.37 ? 44  C   B "O3'" 1 
ATOM   7799  C  "C2'" . C   B 2 45  ? -17.549 5.410   35.627  1.00 107.79 ? 44  C   B "C2'" 1 
ATOM   7800  O  "O2'" . C   B 2 45  ? -17.381 6.813   35.603  1.00 106.56 ? 44  C   B "O2'" 1 
ATOM   7801  C  "C1'" . C   B 2 45  ? -18.109 4.962   36.981  1.00 106.89 ? 44  C   B "C1'" 1 
ATOM   7802  N  N1    . C   B 2 45  ? -17.465 3.740   37.502  1.00 106.66 ? 44  C   B N1    1 
ATOM   7803  C  C2    . C   B 2 45  ? -16.434 3.866   38.443  1.00 106.47 ? 44  C   B C2    1 
ATOM   7804  O  O2    . C   B 2 45  ? -16.102 5.000   38.824  1.00 106.16 ? 44  C   B O2    1 
ATOM   7805  N  N3    . C   B 2 45  ? -15.831 2.750   38.917  1.00 106.01 ? 44  C   B N3    1 
ATOM   7806  C  C4    . C   B 2 45  ? -16.213 1.548   38.479  1.00 106.11 ? 44  C   B C4    1 
ATOM   7807  N  N4    . C   B 2 45  ? -15.593 0.474   38.975  1.00 106.03 ? 44  C   B N4    1 
ATOM   7808  C  C5    . C   B 2 45  ? -17.255 1.391   37.518  1.00 105.98 ? 44  C   B C5    1 
ATOM   7809  C  C6    . C   B 2 45  ? -17.843 2.503   37.056  1.00 106.30 ? 44  C   B C6    1 
ATOM   7810  P  P     . G   B 2 46  ? -17.746 5.140   32.188  1.00 109.97 ? 45  G   B P     1 
ATOM   7811  O  OP1   . G   B 2 46  ? -18.610 4.418   31.219  1.00 109.33 ? 45  G   B OP1   1 
ATOM   7812  O  OP2   . G   B 2 46  ? -16.523 4.483   32.718  1.00 109.83 ? 45  G   B OP2   1 
ATOM   7813  O  "O5'" . G   B 2 46  ? -17.320 6.532   31.541  1.00 107.43 ? 45  G   B "O5'" 1 
ATOM   7814  C  "C5'" . G   B 2 46  ? -16.683 7.546   32.340  1.00 103.69 ? 45  G   B "C5'" 1 
ATOM   7815  C  "C4'" . G   B 2 46  ? -16.520 8.824   31.555  1.00 101.11 ? 45  G   B "C4'" 1 
ATOM   7816  O  "O4'" . G   B 2 46  ? -16.139 8.531   30.185  1.00 98.83  ? 45  G   B "O4'" 1 
ATOM   7817  C  "C3'" . G   B 2 46  ? -17.768 9.674   31.403  1.00 100.33 ? 45  G   B "C3'" 1 
ATOM   7818  O  "O3'" . G   B 2 46  ? -18.038 10.426  32.580  1.00 101.89 ? 45  G   B "O3'" 1 
ATOM   7819  C  "C2'" . G   B 2 46  ? -17.403 10.541  30.205  1.00 98.80  ? 45  G   B "C2'" 1 
ATOM   7820  O  "O2'" . G   B 2 46  ? -16.579 11.644  30.519  1.00 98.97  ? 45  G   B "O2'" 1 
ATOM   7821  C  "C1'" . G   B 2 46  ? -16.652 9.537   29.327  1.00 97.22  ? 45  G   B "C1'" 1 
ATOM   7822  N  N9    . G   B 2 46  ? -17.497 8.909   28.316  1.00 95.66  ? 45  G   B N9    1 
ATOM   7823  C  C8    . G   B 2 46  ? -17.888 7.592   28.243  1.00 95.06  ? 45  G   B C8    1 
ATOM   7824  N  N7    . G   B 2 46  ? -18.647 7.340   27.212  1.00 94.71  ? 45  G   B N7    1 
ATOM   7825  C  C5    . G   B 2 46  ? -18.765 8.562   26.565  1.00 94.64  ? 45  G   B C5    1 
ATOM   7826  C  C6    . G   B 2 46  ? -19.473 8.915   25.385  1.00 94.45  ? 45  G   B C6    1 
ATOM   7827  O  O6    . G   B 2 46  ? -20.152 8.190   24.648  1.00 94.57  ? 45  G   B O6    1 
ATOM   7828  N  N1    . G   B 2 46  ? -19.322 10.265  25.081  1.00 95.02  ? 45  G   B N1    1 
ATOM   7829  C  C2    . G   B 2 46  ? -18.592 11.164  25.822  1.00 95.57  ? 45  G   B C2    1 
ATOM   7830  N  N2    . G   B 2 46  ? -18.569 12.427  25.369  1.00 96.23  ? 45  G   B N2    1 
ATOM   7831  N  N3    . G   B 2 46  ? -17.930 10.848  26.923  1.00 94.74  ? 45  G   B N3    1 
ATOM   7832  C  C4    . G   B 2 46  ? -18.059 9.540   27.233  1.00 94.89  ? 45  G   B C4    1 
ATOM   7833  P  P     . G   B 2 47  ? -19.547 10.778  32.972  1.00 102.19 ? 46  G   B P     1 
ATOM   7834  O  OP1   . G   B 2 47  ? -19.517 11.595  34.212  1.00 103.83 ? 46  G   B OP1   1 
ATOM   7835  O  OP2   . G   B 2 47  ? -20.333 9.518   32.948  1.00 101.63 ? 46  G   B OP2   1 
ATOM   7836  O  "O5'" . G   B 2 47  ? -20.024 11.705  31.767  1.00 101.37 ? 46  G   B "O5'" 1 
ATOM   7837  C  "C5'" . G   B 2 47  ? -19.581 13.073  31.672  1.00 102.22 ? 46  G   B "C5'" 1 
ATOM   7838  C  "C4'" . G   B 2 47  ? -20.151 13.741  30.443  1.00 103.13 ? 46  G   B "C4'" 1 
ATOM   7839  O  "O4'" . G   B 2 47  ? -19.827 12.970  29.258  1.00 102.84 ? 46  G   B "O4'" 1 
ATOM   7840  C  "C3'" . G   B 2 47  ? -21.665 13.867  30.389  1.00 103.90 ? 46  G   B "C3'" 1 
ATOM   7841  O  "O3'" . G   B 2 47  ? -22.115 14.956  31.189  1.00 105.03 ? 46  G   B "O3'" 1 
ATOM   7842  C  "C2'" . G   B 2 47  ? -21.911 14.064  28.896  1.00 103.39 ? 46  G   B "C2'" 1 
ATOM   7843  O  "O2'" . G   B 2 47  ? -21.758 15.394  28.444  1.00 103.78 ? 46  G   B "O2'" 1 
ATOM   7844  C  "C1'" . G   B 2 47  ? -20.840 13.156  28.283  1.00 102.61 ? 46  G   B "C1'" 1 
ATOM   7845  N  N9    . G   B 2 47  ? -21.346 11.849  27.876  1.00 101.63 ? 46  G   B N9    1 
ATOM   7846  C  C8    . G   B 2 47  ? -21.138 10.639  28.496  1.00 101.43 ? 46  G   B C8    1 
ATOM   7847  N  N7    . G   B 2 47  ? -21.723 9.644   27.887  1.00 101.46 ? 46  G   B N7    1 
ATOM   7848  C  C5    . G   B 2 47  ? -22.356 10.231  26.800  1.00 101.08 ? 46  G   B C5    1 
ATOM   7849  C  C6    . G   B 2 47  ? -23.150 9.651   25.775  1.00 101.61 ? 46  G   B C6    1 
ATOM   7850  O  O6    . G   B 2 47  ? -23.463 8.464   25.620  1.00 102.47 ? 46  G   B O6    1 
ATOM   7851  N  N1    . G   B 2 47  ? -23.597 10.609  24.870  1.00 102.05 ? 46  G   B N1    1 
ATOM   7852  C  C2    . G   B 2 47  ? -23.319 11.954  24.941  1.00 101.67 ? 46  G   B C2    1 
ATOM   7853  N  N2    . G   B 2 47  ? -23.841 12.721  23.973  1.00 101.73 ? 46  G   B N2    1 
ATOM   7854  N  N3    . G   B 2 47  ? -22.578 12.505  25.890  1.00 101.30 ? 46  G   B N3    1 
ATOM   7855  C  C4    . G   B 2 47  ? -22.134 11.591  26.780  1.00 100.97 ? 46  G   B C4    1 
ATOM   7856  P  P     . C   B 2 48  ? -23.569 14.923  31.861  1.00 105.81 ? 47  C   B P     1 
ATOM   7857  O  OP1   . C   B 2 48  ? -23.705 16.128  32.717  1.00 107.18 ? 47  C   B OP1   1 
ATOM   7858  O  OP2   . C   B 2 48  ? -23.777 13.578  32.455  1.00 105.41 ? 47  C   B OP2   1 
ATOM   7859  O  "O5'" . C   B 2 48  ? -24.545 15.086  30.612  1.00 107.60 ? 47  C   B "O5'" 1 
ATOM   7860  C  "C5'" . C   B 2 48  ? -24.688 16.355  29.947  1.00 110.12 ? 47  C   B "C5'" 1 
ATOM   7861  C  "C4'" . C   B 2 48  ? -25.540 16.220  28.705  1.00 110.97 ? 47  C   B "C4'" 1 
ATOM   7862  O  "O4'" . C   B 2 48  ? -24.965 15.238  27.802  1.00 110.46 ? 47  C   B "O4'" 1 
ATOM   7863  C  "C3'" . C   B 2 48  ? -26.960 15.720  28.908  1.00 112.29 ? 47  C   B "C3'" 1 
ATOM   7864  O  "O3'" . C   B 2 48  ? -27.834 16.729  29.405  1.00 115.47 ? 47  C   B "O3'" 1 
ATOM   7865  C  "C2'" . C   B 2 48  ? -27.323 15.256  27.503  1.00 110.93 ? 47  C   B "C2'" 1 
ATOM   7866  O  "O2'" . C   B 2 48  ? -27.724 16.296  26.634  1.00 110.48 ? 47  C   B "O2'" 1 
ATOM   7867  C  "C1'" . C   B 2 48  ? -26.002 14.634  27.041  1.00 109.46 ? 47  C   B "C1'" 1 
ATOM   7868  N  N1    . C   B 2 48  ? -25.957 13.172  27.241  1.00 107.73 ? 47  C   B N1    1 
ATOM   7869  C  C2    . C   B 2 48  ? -26.420 12.337  26.216  1.00 106.42 ? 47  C   B C2    1 
ATOM   7870  O  O2    . C   B 2 48  ? -26.833 12.849  25.164  1.00 105.07 ? 47  C   B O2    1 
ATOM   7871  N  N3    . C   B 2 48  ? -26.394 10.995  26.393  1.00 106.90 ? 47  C   B N3    1 
ATOM   7872  C  C4    . C   B 2 48  ? -25.943 10.482  27.542  1.00 106.80 ? 47  C   B C4    1 
ATOM   7873  N  N4    . C   B 2 48  ? -25.935 9.153   27.674  1.00 107.05 ? 47  C   B N4    1 
ATOM   7874  C  C5    . C   B 2 48  ? -25.476 11.309  28.605  1.00 106.45 ? 47  C   B C5    1 
ATOM   7875  C  C6    . C   B 2 48  ? -25.508 12.635  28.417  1.00 106.92 ? 47  C   B C6    1 
ATOM   7876  P  P     . G   B 2 49  A -29.114 16.322  30.280  1.00 118.85 ? 47  G   B P     1 
ATOM   7877  O  OP1   . G   B 2 49  A -29.851 17.567  30.617  1.00 121.64 ? 47  G   B OP1   1 
ATOM   7878  O  OP2   . G   B 2 49  A -28.663 15.422  31.373  1.00 117.56 ? 47  G   B OP2   1 
ATOM   7879  O  "O5'" . G   B 2 49  A -29.990 15.460  29.264  1.00 121.87 ? 47  G   B "O5'" 1 
ATOM   7880  C  "C5'" . G   B 2 49  A -30.826 16.098  28.278  1.00 124.76 ? 47  G   B "C5'" 1 
ATOM   7881  C  "C4'" . G   B 2 49  A -31.582 15.071  27.466  1.00 126.09 ? 47  G   B "C4'" 1 
ATOM   7882  O  "O4'" . G   B 2 49  A -30.665 14.077  26.942  1.00 125.86 ? 47  G   B "O4'" 1 
ATOM   7883  C  "C3'" . G   B 2 49  A -32.616 14.247  28.215  1.00 126.56 ? 47  G   B "C3'" 1 
ATOM   7884  O  "O3'" . G   B 2 49  A -33.841 14.955  28.381  1.00 126.02 ? 47  G   B "O3'" 1 
ATOM   7885  C  "C2'" . G   B 2 49  A -32.774 13.028  27.311  1.00 126.67 ? 47  G   B "C2'" 1 
ATOM   7886  O  "O2'" . G   B 2 49  A -33.712 13.206  26.268  1.00 128.29 ? 47  G   B "O2'" 1 
ATOM   7887  C  "C1'" . G   B 2 49  A -31.355 12.853  26.757  1.00 125.75 ? 47  G   B "C1'" 1 
ATOM   7888  N  N9    . G   B 2 49  A -30.601 11.789  27.413  1.00 125.39 ? 47  G   B N9    1 
ATOM   7889  C  C8    . G   B 2 49  A -29.818 11.892  28.537  1.00 125.14 ? 47  G   B C8    1 
ATOM   7890  N  N7    . G   B 2 49  A -29.274 10.758  28.889  1.00 125.20 ? 47  G   B N7    1 
ATOM   7891  C  C5    . G   B 2 49  A -29.730 9.850   27.943  1.00 124.87 ? 47  G   B C5    1 
ATOM   7892  C  C6    . G   B 2 49  A -29.477 8.459   27.805  1.00 124.92 ? 47  G   B C6    1 
ATOM   7893  O  O6    . G   B 2 49  A -28.777 7.729   28.517  1.00 125.42 ? 47  G   B O6    1 
ATOM   7894  N  N1    . G   B 2 49  A -30.143 7.924   26.706  1.00 124.68 ? 47  G   B N1    1 
ATOM   7895  C  C2    . G   B 2 49  A -30.946 8.635   25.846  1.00 124.63 ? 47  G   B C2    1 
ATOM   7896  N  N2    . G   B 2 49  A -31.501 7.942   24.841  1.00 125.28 ? 47  G   B N2    1 
ATOM   7897  N  N3    . G   B 2 49  A -31.188 9.931   25.963  1.00 125.19 ? 47  G   B N3    1 
ATOM   7898  C  C4    . G   B 2 49  A -30.553 10.470  27.026  1.00 125.30 ? 47  G   B C4    1 
ATOM   7899  P  P     . C   B 2 52  D -36.826 3.763   28.190  1.00 150.33 ? 47  C   B P     1 
ATOM   7900  O  OP1   . C   B 2 52  D -38.073 2.985   28.393  1.00 150.75 ? 47  C   B OP1   1 
ATOM   7901  O  OP2   . C   B 2 52  D -36.469 4.237   26.828  1.00 150.51 ? 47  C   B OP2   1 
ATOM   7902  O  "O5'" . C   B 2 52  D -35.604 2.951   28.812  1.00 143.83 ? 47  C   B "O5'" 1 
ATOM   7903  C  "C5'" . C   B 2 52  D -34.965 1.883   28.086  1.00 141.04 ? 47  C   B "C5'" 1 
ATOM   7904  C  "C4'" . C   B 2 52  D -33.477 1.872   28.358  1.00 140.65 ? 47  C   B "C4'" 1 
ATOM   7905  O  "O4'" . C   B 2 52  D -32.930 3.209   28.165  1.00 142.41 ? 47  C   B "O4'" 1 
ATOM   7906  C  "C3'" . C   B 2 52  D -33.061 1.445   29.765  1.00 139.34 ? 47  C   B "C3'" 1 
ATOM   7907  O  "O3'" . C   B 2 52  D -31.883 0.643   29.689  1.00 137.14 ? 47  C   B "O3'" 1 
ATOM   7908  C  "C2'" . C   B 2 52  D -32.778 2.779   30.450  1.00 139.73 ? 47  C   B "C2'" 1 
ATOM   7909  O  "O2'" . C   B 2 52  D -31.903 2.712   31.558  1.00 137.17 ? 47  C   B "O2'" 1 
ATOM   7910  C  "C1'" . C   B 2 52  D -32.161 3.564   29.297  1.00 141.13 ? 47  C   B "C1'" 1 
ATOM   7911  N  N1    . C   B 2 52  D -32.166 5.033   29.474  1.00 141.42 ? 47  C   B N1    1 
ATOM   7912  C  C2    . C   B 2 52  D -33.093 5.828   28.782  1.00 141.10 ? 47  C   B C2    1 
ATOM   7913  O  O2    . C   B 2 52  D -33.909 5.283   28.024  1.00 141.92 ? 47  C   B O2    1 
ATOM   7914  N  N3    . C   B 2 52  D -33.074 7.171   28.959  1.00 139.73 ? 47  C   B N3    1 
ATOM   7915  C  C4    . C   B 2 52  D -32.181 7.723   29.784  1.00 139.41 ? 47  C   B C4    1 
ATOM   7916  N  N4    . C   B 2 52  D -32.199 9.050   29.929  1.00 138.55 ? 47  C   B N4    1 
ATOM   7917  C  C5    . C   B 2 52  D -31.227 6.939   30.498  1.00 139.87 ? 47  C   B C5    1 
ATOM   7918  C  C6    . C   B 2 52  D -31.255 5.611   30.315  1.00 140.41 ? 47  C   B C6    1 
ATOM   7919  P  P     . G   B 2 53  E -31.598 -0.525  30.758  1.00 133.95 ? 47  G   B P     1 
ATOM   7920  O  OP1   . G   B 2 53  E -32.656 -0.487  31.800  1.00 135.88 ? 47  G   B OP1   1 
ATOM   7921  O  OP2   . G   B 2 53  E -30.172 -0.439  31.160  1.00 134.01 ? 47  G   B OP2   1 
ATOM   7922  O  "O5'" . G   B 2 53  E -31.770 -1.851  29.892  1.00 131.90 ? 47  G   B "O5'" 1 
ATOM   7923  C  "C5'" . G   B 2 53  E -30.842 -2.170  28.835  1.00 129.41 ? 47  G   B "C5'" 1 
ATOM   7924  C  "C4'" . G   B 2 53  E -31.458 -3.150  27.861  1.00 128.30 ? 47  G   B "C4'" 1 
ATOM   7925  O  "O4'" . G   B 2 53  E -32.136 -4.207  28.597  1.00 126.69 ? 47  G   B "O4'" 1 
ATOM   7926  C  "C3'" . G   B 2 53  E -32.502 -2.575  26.907  1.00 126.54 ? 47  G   B "C3'" 1 
ATOM   7927  O  "O3'" . G   B 2 53  E -32.461 -3.241  25.648  1.00 126.90 ? 47  G   B "O3'" 1 
ATOM   7928  C  "C2'" . G   B 2 53  E -33.810 -2.883  27.626  1.00 124.00 ? 47  G   B "C2'" 1 
ATOM   7929  O  "O2'" . G   B 2 53  E -34.943 -2.919  26.783  1.00 121.29 ? 47  G   B "O2'" 1 
ATOM   7930  C  "C1'" . G   B 2 53  E -33.495 -4.259  28.210  1.00 123.08 ? 47  G   B "C1'" 1 
ATOM   7931  N  N9    . G   B 2 53  E -34.287 -4.638  29.376  1.00 120.67 ? 47  G   B N9    1 
ATOM   7932  C  C8    . G   B 2 53  E -34.535 -3.884  30.498  1.00 119.60 ? 47  G   B C8    1 
ATOM   7933  N  N7    . G   B 2 53  E -35.267 -4.506  31.381  1.00 118.58 ? 47  G   B N7    1 
ATOM   7934  C  C5    . G   B 2 53  E -35.508 -5.750  30.814  1.00 119.36 ? 47  G   B C5    1 
ATOM   7935  C  C6    . G   B 2 53  E -36.246 -6.859  31.307  1.00 118.98 ? 47  G   B C6    1 
ATOM   7936  O  O6    . G   B 2 53  E -36.853 -6.967  32.379  1.00 117.74 ? 47  G   B O6    1 
ATOM   7937  N  N1    . G   B 2 53  E -36.236 -7.922  30.407  1.00 118.88 ? 47  G   B N1    1 
ATOM   7938  C  C2    . G   B 2 53  E -35.599 -7.919  29.189  1.00 118.96 ? 47  G   B C2    1 
ATOM   7939  N  N2    . G   B 2 53  E -35.704 -9.041  28.461  1.00 118.68 ? 47  G   B N2    1 
ATOM   7940  N  N3    . G   B 2 53  E -34.908 -6.892  28.720  1.00 119.29 ? 47  G   B N3    1 
ATOM   7941  C  C4    . G   B 2 53  E -34.905 -5.849  29.578  1.00 119.78 ? 47  G   B C4    1 
ATOM   7942  P  P     . C   B 2 54  F -31.482 -2.730  24.488  1.00 128.07 ? 47  C   B P     1 
ATOM   7943  O  OP1   . C   B 2 54  F -31.361 -3.813  23.480  1.00 127.68 ? 47  C   B OP1   1 
ATOM   7944  O  OP2   . C   B 2 54  F -30.257 -2.175  25.120  1.00 128.39 ? 47  C   B OP2   1 
ATOM   7945  O  "O5'" . C   B 2 54  F -32.296 -1.526  23.835  1.00 127.39 ? 47  C   B "O5'" 1 
ATOM   7946  C  "C5'" . C   B 2 54  F -31.709 -0.730  22.789  1.00 125.68 ? 47  C   B "C5'" 1 
ATOM   7947  C  "C4'" . C   B 2 54  F -32.434 0.588   22.658  1.00 123.70 ? 47  C   B "C4'" 1 
ATOM   7948  O  "O4'" . C   B 2 54  F -32.648 1.166   23.974  1.00 123.39 ? 47  C   B "O4'" 1 
ATOM   7949  C  "C3'" . C   B 2 54  F -31.696 1.668   21.882  1.00 121.98 ? 47  C   B "C3'" 1 
ATOM   7950  O  "O3'" . C   B 2 54  F -31.874 1.496   20.478  1.00 118.75 ? 47  C   B "O3'" 1 
ATOM   7951  C  "C2'" . C   B 2 54  F -32.330 2.942   22.426  1.00 122.78 ? 47  C   B "C2'" 1 
ATOM   7952  O  "O2'" . C   B 2 54  F -33.558 3.290   21.816  1.00 121.50 ? 47  C   B "O2'" 1 
ATOM   7953  C  "C1'" . C   B 2 54  F -32.529 2.578   23.900  1.00 123.66 ? 47  C   B "C1'" 1 
ATOM   7954  N  N1    . C   B 2 54  F -31.414 3.006   24.769  1.00 124.92 ? 47  C   B N1    1 
ATOM   7955  C  C2    . C   B 2 54  F -31.493 4.253   25.404  1.00 126.34 ? 47  C   B C2    1 
ATOM   7956  O  O2    . C   B 2 54  F -32.497 4.959   25.221  1.00 127.72 ? 47  C   B O2    1 
ATOM   7957  N  N3    . C   B 2 54  F -30.473 4.657   26.198  1.00 125.32 ? 47  C   B N3    1 
ATOM   7958  C  C4    . C   B 2 54  F -29.407 3.869   26.367  1.00 124.41 ? 47  C   B C4    1 
ATOM   7959  N  N4    . C   B 2 54  F -28.426 4.307   27.160  1.00 124.73 ? 47  C   B N4    1 
ATOM   7960  C  C5    . C   B 2 54  F -29.300 2.598   25.731  1.00 124.71 ? 47  C   B C5    1 
ATOM   7961  C  C6    . C   B 2 54  F -30.315 2.211   24.946  1.00 124.82 ? 47  C   B C6    1 
ATOM   7962  P  P     . G   B 2 55  G -30.653 1.740   19.465  1.00 115.63 ? 47  G   B P     1 
ATOM   7963  O  OP1   . G   B 2 55  G -31.086 1.299   18.114  1.00 115.39 ? 47  G   B OP1   1 
ATOM   7964  O  OP2   . G   B 2 55  G -29.426 1.153   20.064  1.00 115.03 ? 47  G   B OP2   1 
ATOM   7965  O  "O5'" . G   B 2 55  G -30.509 3.327   19.456  1.00 114.02 ? 47  G   B "O5'" 1 
ATOM   7966  C  "C5'" . G   B 2 55  G -31.481 4.144   18.775  1.00 111.48 ? 47  G   B "C5'" 1 
ATOM   7967  C  "C4'" . G   B 2 55  G -31.175 5.615   18.945  1.00 108.53 ? 47  G   B "C4'" 1 
ATOM   7968  O  "O4'" . G   B 2 55  G -31.331 6.001   20.333  1.00 106.72 ? 47  G   B "O4'" 1 
ATOM   7969  C  "C3'" . G   B 2 55  G -29.761 6.069   18.619  1.00 106.33 ? 47  G   B "C3'" 1 
ATOM   7970  O  "O3'" . G   B 2 55  G -29.519 6.191   17.219  1.00 104.44 ? 47  G   B "O3'" 1 
ATOM   7971  C  "C2'" . G   B 2 55  G -29.698 7.414   19.334  1.00 105.35 ? 47  G   B "C2'" 1 
ATOM   7972  O  "O2'" . G   B 2 55  G -30.225 8.501   18.600  1.00 104.93 ? 47  G   B "O2'" 1 
ATOM   7973  C  "C1'" . G   B 2 55  G -30.528 7.140   20.591  1.00 105.08 ? 47  G   B "C1'" 1 
ATOM   7974  N  N9    . G   B 2 55  G -29.695 6.875   21.759  1.00 104.56 ? 47  G   B N9    1 
ATOM   7975  C  C8    . G   B 2 55  G -29.246 5.656   22.210  1.00 103.88 ? 47  G   B C8    1 
ATOM   7976  N  N7    . G   B 2 55  G -28.497 5.749   23.275  1.00 104.53 ? 47  G   B N7    1 
ATOM   7977  C  C5    . G   B 2 55  G -28.436 7.111   23.535  1.00 104.95 ? 47  G   B C5    1 
ATOM   7978  C  C6    . G   B 2 55  G -27.765 7.823   24.565  1.00 103.66 ? 47  G   B C6    1 
ATOM   7979  O  O6    . G   B 2 55  G -27.070 7.375   25.485  1.00 101.06 ? 47  G   B O6    1 
ATOM   7980  N  N1    . G   B 2 55  G -27.970 9.196   24.457  1.00 104.69 ? 47  G   B N1    1 
ATOM   7981  C  C2    . G   B 2 55  G -28.724 9.807   23.483  1.00 106.60 ? 47  G   B C2    1 
ATOM   7982  N  N2    . G   B 2 55  G -28.802 11.146  23.543  1.00 106.81 ? 47  G   B N2    1 
ATOM   7983  N  N3    . G   B 2 55  G -29.349 9.155   22.515  1.00 107.15 ? 47  G   B N3    1 
ATOM   7984  C  C4    . G   B 2 55  G -29.164 7.820   22.602  1.00 105.76 ? 47  G   B C4    1 
ATOM   7985  P  P     . C   B 2 56  H -28.014 6.246   16.659  1.00 101.23 ? 47  C   B P     1 
ATOM   7986  O  OP1   . C   B 2 56  H -28.078 6.306   15.176  1.00 102.19 ? 47  C   B OP1   1 
ATOM   7987  O  OP2   . C   B 2 56  H -27.233 5.166   17.315  1.00 99.77  ? 47  C   B OP2   1 
ATOM   7988  O  "O5'" . C   B 2 56  H -27.472 7.644   17.198  1.00 96.59  ? 47  C   B "O5'" 1 
ATOM   7989  C  "C5'" . C   B 2 56  H -27.723 8.870   16.485  1.00 93.14  ? 47  C   B "C5'" 1 
ATOM   7990  C  "C4'" . C   B 2 56  H -27.365 10.069  17.333  1.00 90.73  ? 47  C   B "C4'" 1 
ATOM   7991  O  "O4'" . C   B 2 56  H -27.762 9.847   18.712  1.00 89.68  ? 47  C   B "O4'" 1 
ATOM   7992  C  "C3'" . C   B 2 56  H -25.887 10.403  17.442  1.00 89.02  ? 47  C   B "C3'" 1 
ATOM   7993  O  "O3'" . C   B 2 56  H -25.386 11.087  16.297  1.00 89.69  ? 47  C   B "O3'" 1 
ATOM   7994  C  "C2'" . C   B 2 56  H -25.857 11.267  18.698  1.00 87.43  ? 47  C   B "C2'" 1 
ATOM   7995  O  "O2'" . C   B 2 56  H -26.197 12.626  18.513  1.00 85.66  ? 47  C   B "O2'" 1 
ATOM   7996  C  "C1'" . C   B 2 56  H -26.899 10.572  19.574  1.00 87.83  ? 47  C   B "C1'" 1 
ATOM   7997  N  N1    . C   B 2 56  H -26.289 9.640   20.543  1.00 87.64  ? 47  C   B N1    1 
ATOM   7998  C  C2    . C   B 2 56  H -25.914 10.129  21.801  1.00 87.52  ? 47  C   B C2    1 
ATOM   7999  O  O2    . C   B 2 56  H -26.136 11.318  22.074  1.00 87.25  ? 47  C   B O2    1 
ATOM   8000  N  N3    . C   B 2 56  H -25.341 9.287   22.693  1.00 87.43  ? 47  C   B N3    1 
ATOM   8001  C  C4    . C   B 2 56  H -25.119 8.012   22.361  1.00 87.56  ? 47  C   B C4    1 
ATOM   8002  N  N4    . C   B 2 56  H -24.548 7.218   23.270  1.00 87.31  ? 47  C   B N4    1 
ATOM   8003  C  C5    . C   B 2 56  H -25.474 7.494   21.081  1.00 87.86  ? 47  C   B C5    1 
ATOM   8004  C  C6    . C   B 2 56  H -26.042 8.337   20.208  1.00 87.57  ? 47  C   B C6    1 
ATOM   8005  P  P     . U   B 2 57  I -23.832 10.980  15.904  1.00 88.84  ? 47  U   B P     1 
ATOM   8006  O  OP1   . U   B 2 57  I -23.583 11.902  14.767  1.00 90.37  ? 47  U   B OP1   1 
ATOM   8007  O  OP2   . U   B 2 57  I -23.485 9.542   15.770  1.00 88.01  ? 47  U   B OP2   1 
ATOM   8008  O  "O5'" . U   B 2 57  I -23.087 11.555  17.191  1.00 87.50  ? 47  U   B "O5'" 1 
ATOM   8009  C  "C5'" . U   B 2 57  I -23.013 12.970  17.450  1.00 87.02  ? 47  U   B "C5'" 1 
ATOM   8010  C  "C4'" . U   B 2 57  I -22.418 13.234  18.816  1.00 86.83  ? 47  U   B "C4'" 1 
ATOM   8011  O  "O4'" . U   B 2 57  I -23.058 12.396  19.814  1.00 86.82  ? 47  U   B "O4'" 1 
ATOM   8012  C  "C3'" . U   B 2 57  I -20.939 12.922  18.964  1.00 86.98  ? 47  U   B "C3'" 1 
ATOM   8013  O  "O3'" . U   B 2 57  I -20.146 13.986  18.447  1.00 86.69  ? 47  U   B "O3'" 1 
ATOM   8014  C  "C2'" . U   B 2 57  I -20.796 12.739  20.472  1.00 86.94  ? 47  U   B "C2'" 1 
ATOM   8015  O  "O2'" . U   B 2 57  I -20.622 13.938  21.201  1.00 85.52  ? 47  U   B "O2'" 1 
ATOM   8016  C  "C1'" . U   B 2 57  I -22.126 12.074  20.834  1.00 87.08  ? 47  U   B "C1'" 1 
ATOM   8017  N  N1    . U   B 2 57  I -22.040 10.608  20.969  1.00 88.28  ? 47  U   B N1    1 
ATOM   8018  C  C2    . U   B 2 57  I -21.551 10.105  22.163  1.00 88.02  ? 47  U   B C2    1 
ATOM   8019  O  O2    . U   B 2 57  I -21.197 10.818  23.086  1.00 89.06  ? 47  U   B O2    1 
ATOM   8020  N  N3    . U   B 2 57  I -21.487 8.735   22.230  1.00 87.46  ? 47  U   B N3    1 
ATOM   8021  C  C4    . U   B 2 57  I -21.850 7.832   21.253  1.00 88.17  ? 47  U   B C4    1 
ATOM   8022  O  O4    . U   B 2 57  I -21.733 6.625   21.469  1.00 87.97  ? 47  U   B O4    1 
ATOM   8023  C  C5    . U   B 2 57  I -22.343 8.427   20.048  1.00 89.18  ? 47  U   B C5    1 
ATOM   8024  C  C6    . U   B 2 57  I -22.416 9.760   19.947  1.00 89.53  ? 47  U   B C6    1 
ATOM   8025  P  P     . G   B 2 58  J -18.673 13.697  17.892  1.00 86.84  ? 47  G   B P     1 
ATOM   8026  O  OP1   . G   B 2 58  J -18.103 14.984  17.415  1.00 87.49  ? 47  G   B OP1   1 
ATOM   8027  O  OP2   . G   B 2 58  J -18.745 12.537  16.965  1.00 84.57  ? 47  G   B OP2   1 
ATOM   8028  O  "O5'" . G   B 2 58  J -17.882 13.244  19.197  1.00 86.70  ? 47  G   B "O5'" 1 
ATOM   8029  C  "C5'" . G   B 2 58  J -17.405 14.201  20.161  1.00 86.46  ? 47  G   B "C5'" 1 
ATOM   8030  C  "C4'" . G   B 2 58  J -16.741 13.490  21.317  1.00 86.17  ? 47  G   B "C4'" 1 
ATOM   8031  O  "O4'" . G   B 2 58  J -17.645 12.495  21.862  1.00 85.24  ? 47  G   B "O4'" 1 
ATOM   8032  C  "C3'" . G   B 2 58  J -15.484 12.707  20.971  1.00 86.06  ? 47  G   B "C3'" 1 
ATOM   8033  O  "O3'" . G   B 2 58  J -14.345 13.567  20.941  1.00 86.61  ? 47  G   B "O3'" 1 
ATOM   8034  C  "C2'" . G   B 2 58  J -15.419 11.678  22.095  1.00 85.48  ? 47  G   B "C2'" 1 
ATOM   8035  O  "O2'" . G   B 2 58  J -14.793 12.139  23.276  1.00 84.96  ? 47  G   B "O2'" 1 
ATOM   8036  C  "C1'" . G   B 2 58  J -16.901 11.392  22.350  1.00 84.74  ? 47  G   B "C1'" 1 
ATOM   8037  N  N9    . G   B 2 58  J -17.392 10.177  21.707  1.00 83.97  ? 47  G   B N9    1 
ATOM   8038  C  C8    . G   B 2 58  J -17.958 10.063  20.460  1.00 84.63  ? 47  G   B C8    1 
ATOM   8039  N  N7    . G   B 2 58  J -18.304 8.840   20.164  1.00 85.34  ? 47  G   B N7    1 
ATOM   8040  C  C5    . G   B 2 58  J -17.945 8.101   21.282  1.00 85.15  ? 47  G   B C5    1 
ATOM   8041  C  C6    . G   B 2 58  J -18.074 6.711   21.547  1.00 85.47  ? 47  G   B C6    1 
ATOM   8042  O  O6    . G   B 2 58  J -18.548 5.829   20.820  1.00 85.35  ? 47  G   B O6    1 
ATOM   8043  N  N1    . G   B 2 58  J -17.580 6.382   22.806  1.00 85.58  ? 47  G   B N1    1 
ATOM   8044  C  C2    . G   B 2 58  J -17.032 7.274   23.697  1.00 85.22  ? 47  G   B C2    1 
ATOM   8045  N  N2    . G   B 2 58  J -16.611 6.763   24.864  1.00 85.47  ? 47  G   B N2    1 
ATOM   8046  N  N3    . G   B 2 58  J -16.905 8.571   23.461  1.00 84.07  ? 47  G   B N3    1 
ATOM   8047  C  C4    . G   B 2 58  J -17.381 8.912   22.244  1.00 84.17  ? 47  G   B C4    1 
ATOM   8048  P  P     . U   B 2 59  ? -13.136 13.304  19.910  1.00 88.01  ? 48  U   B P     1 
ATOM   8049  O  OP1   . U   B 2 59  ? -12.551 14.621  19.546  1.00 88.84  ? 48  U   B OP1   1 
ATOM   8050  O  OP2   . U   B 2 59  ? -13.610 12.391  18.836  1.00 86.55  ? 48  U   B OP2   1 
ATOM   8051  O  "O5'" . U   B 2 59  ? -12.074 12.511  20.792  1.00 87.78  ? 48  U   B "O5'" 1 
ATOM   8052  C  "C5'" . U   B 2 59  ? -11.555 13.066  22.015  1.00 86.52  ? 48  U   B "C5'" 1 
ATOM   8053  C  "C4'" . U   B 2 59  ? -10.253 12.394  22.382  1.00 85.58  ? 48  U   B "C4'" 1 
ATOM   8054  O  "O4'" . U   B 2 59  ? -10.449 10.953  22.430  1.00 85.23  ? 48  U   B "O4'" 1 
ATOM   8055  C  "C3'" . U   B 2 59  ? -9.089  12.641  21.421  1.00 84.15  ? 48  U   B "C3'" 1 
ATOM   8056  O  "O3'" . U   B 2 59  ? -7.896  12.955  22.136  1.00 81.25  ? 48  U   B "O3'" 1 
ATOM   8057  C  "C2'" . U   B 2 59  ? -8.987  11.327  20.648  1.00 84.76  ? 48  U   B "C2'" 1 
ATOM   8058  O  "O2'" . U   B 2 59  ? -7.695  11.016  20.168  1.00 85.50  ? 48  U   B "O2'" 1 
ATOM   8059  C  "C1'" . U   B 2 59  ? -9.416  10.318  21.709  1.00 86.03  ? 48  U   B "C1'" 1 
ATOM   8060  N  N1    . U   B 2 59  ? -9.932  9.054   21.160  1.00 87.49  ? 48  U   B N1    1 
ATOM   8061  C  C2    . U   B 2 59  ? -9.163  7.912   21.315  1.00 88.65  ? 48  U   B C2    1 
ATOM   8062  O  O2    . U   B 2 59  ? -8.082  7.909   21.878  1.00 89.40  ? 48  U   B O2    1 
ATOM   8063  N  N3    . U   B 2 59  ? -9.705  6.774   20.770  1.00 88.25  ? 48  U   B N3    1 
ATOM   8064  C  C4    . U   B 2 59  ? -10.908 6.656   20.106  1.00 88.19  ? 48  U   B C4    1 
ATOM   8065  O  O4    . U   B 2 59  ? -11.258 5.556   19.675  1.00 87.99  ? 48  U   B O4    1 
ATOM   8066  C  C5    . U   B 2 59  ? -11.645 7.878   19.988  1.00 88.68  ? 48  U   B C5    1 
ATOM   8067  C  C6    . U   B 2 59  ? -11.144 9.007   20.505  1.00 88.01  ? 48  U   B C6    1 
ATOM   8068  P  P     . G   B 2 60  ? -6.753  13.851  21.457  1.00 77.69  ? 49  G   B P     1 
ATOM   8069  O  OP1   . G   B 2 60  ? -6.749  13.568  19.999  1.00 77.86  ? 49  G   B OP1   1 
ATOM   8070  O  OP2   . G   B 2 60  ? -5.506  13.670  22.238  1.00 78.33  ? 49  G   B OP2   1 
ATOM   8071  O  "O5'" . G   B 2 60  ? -7.278  15.338  21.680  1.00 77.03  ? 49  G   B "O5'" 1 
ATOM   8072  C  "C5'" . G   B 2 60  ? -7.661  15.804  22.986  1.00 77.35  ? 49  G   B "C5'" 1 
ATOM   8073  C  "C4'" . G   B 2 60  ? -7.390  17.285  23.122  1.00 78.66  ? 49  G   B "C4'" 1 
ATOM   8074  O  "O4'" . G   B 2 60  ? -5.954  17.522  23.174  1.00 78.97  ? 49  G   B "O4'" 1 
ATOM   8075  C  "C3'" . G   B 2 60  ? -7.891  18.168  21.988  1.00 79.59  ? 49  G   B "C3'" 1 
ATOM   8076  O  "O3'" . G   B 2 60  ? -9.266  18.506  22.159  1.00 80.88  ? 49  G   B "O3'" 1 
ATOM   8077  C  "C2'" . G   B 2 60  ? -6.957  19.365  22.090  1.00 79.52  ? 49  G   B "C2'" 1 
ATOM   8078  O  "O2'" . G   B 2 60  ? -7.298  20.275  23.117  1.00 79.29  ? 49  G   B "O2'" 1 
ATOM   8079  C  "C1'" . G   B 2 60  ? -5.629  18.677  22.415  1.00 78.57  ? 49  G   B "C1'" 1 
ATOM   8080  N  N9    . G   B 2 60  ? -4.856  18.262  21.245  1.00 77.89  ? 49  G   B N9    1 
ATOM   8081  C  C8    . G   B 2 60  ? -4.418  16.992  20.951  1.00 77.84  ? 49  G   B C8    1 
ATOM   8082  N  N7    . G   B 2 60  ? -3.741  16.930  19.837  1.00 77.89  ? 49  G   B N7    1 
ATOM   8083  C  C5    . G   B 2 60  ? -3.724  18.237  19.370  1.00 77.82  ? 49  G   B C5    1 
ATOM   8084  C  C6    . G   B 2 60  ? -3.137  18.788  18.200  1.00 77.79  ? 49  G   B C6    1 
ATOM   8085  O  O6    . G   B 2 60  ? -2.493  18.211  17.316  1.00 77.29  ? 49  G   B O6    1 
ATOM   8086  N  N1    . G   B 2 60  ? -3.359  20.159  18.113  1.00 78.28  ? 49  G   B N1    1 
ATOM   8087  C  C2    . G   B 2 60  ? -4.058  20.906  19.031  1.00 78.51  ? 49  G   B C2    1 
ATOM   8088  N  N2    . G   B 2 60  ? -4.170  22.218  18.770  1.00 78.81  ? 49  G   B N2    1 
ATOM   8089  N  N3    . G   B 2 60  ? -4.607  20.404  20.127  1.00 78.39  ? 49  G   B N3    1 
ATOM   8090  C  C4    . G   B 2 60  ? -4.404  19.073  20.230  1.00 77.98  ? 49  G   B C4    1 
ATOM   8091  P  P     . C   B 2 61  ? -10.263 18.521  20.900  1.00 81.99  ? 50  C   B P     1 
ATOM   8092  O  OP1   . C   B 2 61  ? -11.641 18.735  21.409  1.00 82.18  ? 50  C   B OP1   1 
ATOM   8093  O  OP2   . C   B 2 61  ? -9.971  17.333  20.056  1.00 81.69  ? 50  C   B OP2   1 
ATOM   8094  O  "O5'" . C   B 2 61  ? -9.818  19.826  20.102  1.00 80.16  ? 50  C   B "O5'" 1 
ATOM   8095  C  "C5'" . C   B 2 61  ? -9.923  21.130  20.701  1.00 79.72  ? 50  C   B "C5'" 1 
ATOM   8096  C  "C4'" . C   B 2 61  ? -9.487  22.207  19.733  1.00 80.01  ? 50  C   B "C4'" 1 
ATOM   8097  O  "O4'" . C   B 2 61  ? -8.047  22.156  19.538  1.00 79.73  ? 50  C   B "O4'" 1 
ATOM   8098  C  "C3'" . C   B 2 61  ? -10.038 22.121  18.319  1.00 81.03  ? 50  C   B "C3'" 1 
ATOM   8099  O  "O3'" . C   B 2 61  ? -11.396 22.539  18.204  1.00 82.55  ? 50  C   B "O3'" 1 
ATOM   8100  C  "C2'" . C   B 2 61  ? -9.052  23.001  17.565  1.00 80.65  ? 50  C   B "C2'" 1 
ATOM   8101  O  "O2'" . C   B 2 61  ? -9.276  24.388  17.723  1.00 78.42  ? 50  C   B "O2'" 1 
ATOM   8102  C  "C1'" . C   B 2 61  ? -7.733  22.587  18.220  1.00 81.00  ? 50  C   B "C1'" 1 
ATOM   8103  N  N1    . C   B 2 61  ? -7.053  21.490  17.499  1.00 82.96  ? 50  C   B N1    1 
ATOM   8104  C  C2    . C   B 2 61  ? -6.352  21.795  16.325  1.00 84.19  ? 50  C   B C2    1 
ATOM   8105  O  O2    . C   B 2 61  ? -6.316  22.971  15.934  1.00 86.05  ? 50  C   B O2    1 
ATOM   8106  N  N3    . C   B 2 61  ? -5.733  20.800  15.646  1.00 83.74  ? 50  C   B N3    1 
ATOM   8107  C  C4    . C   B 2 61  ? -5.800  19.543  16.095  1.00 83.73  ? 50  C   B C4    1 
ATOM   8108  N  N4    . C   B 2 61  ? -5.173  18.595  15.396  1.00 84.32  ? 50  C   B N4    1 
ATOM   8109  C  C5    . C   B 2 61  ? -6.511  19.205  17.284  1.00 83.86  ? 50  C   B C5    1 
ATOM   8110  C  C6    . C   B 2 61  ? -7.123  20.198  17.944  1.00 83.76  ? 50  C   B C6    1 
ATOM   8111  P  P     . G   B 2 62  ? -12.321 21.957  17.025  1.00 82.43  ? 51  G   B P     1 
ATOM   8112  O  OP1   . G   B 2 62  ? -13.688 22.506  17.201  1.00 83.89  ? 51  G   B OP1   1 
ATOM   8113  O  OP2   . G   B 2 62  ? -12.131 20.485  16.968  1.00 81.67  ? 51  G   B OP2   1 
ATOM   8114  O  "O5'" . G   B 2 62  ? -11.667 22.587  15.716  1.00 84.23  ? 51  G   B "O5'" 1 
ATOM   8115  C  "C5'" . G   B 2 62  ? -11.830 23.983  15.397  1.00 86.33  ? 51  G   B "C5'" 1 
ATOM   8116  C  "C4'" . G   B 2 62  ? -11.332 24.270  14.000  1.00 87.96  ? 51  G   B "C4'" 1 
ATOM   8117  O  "O4'" . G   B 2 62  ? -9.903  24.036  13.919  1.00 90.00  ? 51  G   B "O4'" 1 
ATOM   8118  C  "C3'" . G   B 2 62  ? -11.899 23.395  12.896  1.00 88.97  ? 51  G   B "C3'" 1 
ATOM   8119  O  "O3'" . G   B 2 62  ? -13.219 23.784  12.530  1.00 89.21  ? 51  G   B "O3'" 1 
ATOM   8120  C  "C2'" . G   B 2 62  ? -10.866 23.585  11.791  1.00 89.48  ? 51  G   B "C2'" 1 
ATOM   8121  O  "O2'" . G   B 2 62  ? -11.061 24.754  11.020  1.00 87.53  ? 51  G   B "O2'" 1 
ATOM   8122  C  "C1'" . G   B 2 62  ? -9.565  23.648  12.596  1.00 90.95  ? 51  G   B "C1'" 1 
ATOM   8123  N  N9    . G   B 2 62  ? -8.857  22.371  12.648  1.00 93.00  ? 51  G   B N9    1 
ATOM   8124  C  C8    . G   B 2 62  ? -8.881  21.442  13.661  1.00 93.20  ? 51  G   B C8    1 
ATOM   8125  N  N7    . G   B 2 62  ? -8.145  20.393  13.411  1.00 94.36  ? 51  G   B N7    1 
ATOM   8126  C  C5    . G   B 2 62  ? -7.608  20.641  12.155  1.00 95.02  ? 51  G   B C5    1 
ATOM   8127  C  C6    . G   B 2 62  ? -6.729  19.859  11.360  1.00 95.64  ? 51  G   B C6    1 
ATOM   8128  O  O6    . G   B 2 62  ? -6.237  18.752  11.614  1.00 94.62  ? 51  G   B O6    1 
ATOM   8129  N  N1    . G   B 2 62  ? -6.437  20.486  10.152  1.00 96.23  ? 51  G   B N1    1 
ATOM   8130  C  C2    . G   B 2 62  ? -6.924  21.710  9.760   1.00 95.98  ? 51  G   B C2    1 
ATOM   8131  N  N2    . G   B 2 62  ? -6.524  22.152  8.557   1.00 95.96  ? 51  G   B N2    1 
ATOM   8132  N  N3    . G   B 2 62  ? -7.742  22.449  10.493  1.00 95.71  ? 51  G   B N3    1 
ATOM   8133  C  C4    . G   B 2 62  ? -8.040  21.857  11.669  1.00 94.71  ? 51  G   B C4    1 
ATOM   8134  P  P     . G   B 2 63  ? -14.122 22.810  11.635  1.00 88.04  ? 52  G   B P     1 
ATOM   8135  O  OP1   . G   B 2 63  ? -15.446 23.455  11.447  1.00 90.88  ? 52  G   B OP1   1 
ATOM   8136  O  OP2   . G   B 2 63  ? -14.049 21.444  12.215  1.00 86.90  ? 52  G   B OP2   1 
ATOM   8137  O  "O5'" . G   B 2 63  ? -13.377 22.838  10.229  1.00 87.88  ? 52  G   B "O5'" 1 
ATOM   8138  C  "C5'" . G   B 2 63  ? -13.346 21.683  9.378   1.00 87.38  ? 52  G   B "C5'" 1 
ATOM   8139  C  "C4'" . G   B 2 63  ? -12.448 21.943  8.196   1.00 87.22  ? 52  G   B "C4'" 1 
ATOM   8140  O  "O4'" . G   B 2 63  ? -11.077 22.146  8.649   1.00 86.39  ? 52  G   B "O4'" 1 
ATOM   8141  C  "C3'" . G   B 2 63  ? -12.361 20.808  7.189   1.00 87.42  ? 52  G   B "C3'" 1 
ATOM   8142  O  "O3'" . G   B 2 63  ? -13.449 20.836  6.273   1.00 87.87  ? 52  G   B "O3'" 1 
ATOM   8143  C  "C2'" . G   B 2 63  ? -10.988 21.045  6.579   1.00 87.00  ? 52  G   B "C2'" 1 
ATOM   8144  O  "O2'" . G   B 2 63  ? -10.951 22.096  5.634   1.00 86.60  ? 52  G   B "O2'" 1 
ATOM   8145  C  "C1'" . G   B 2 63  ? -10.187 21.406  7.828   1.00 86.23  ? 52  G   B "C1'" 1 
ATOM   8146  N  N9    . G   B 2 63  ? -9.730  20.235  8.575   1.00 85.33  ? 52  G   B N9    1 
ATOM   8147  C  C8    . G   B 2 63  ? -10.117 19.849  9.837   1.00 84.25  ? 52  G   B C8    1 
ATOM   8148  N  N7    . G   B 2 63  ? -9.543  18.745  10.232  1.00 84.02  ? 52  G   B N7    1 
ATOM   8149  C  C5    . G   B 2 63  ? -8.733  18.377  9.168   1.00 84.66  ? 52  G   B C5    1 
ATOM   8150  C  C6    . G   B 2 63  ? -7.863  17.265  9.015   1.00 85.27  ? 52  G   B C6    1 
ATOM   8151  O  O6    . G   B 2 63  ? -7.632  16.352  9.817   1.00 85.21  ? 52  G   B O6    1 
ATOM   8152  N  N1    . G   B 2 63  ? -7.230  17.276  7.776   1.00 86.18  ? 52  G   B N1    1 
ATOM   8153  C  C2    . G   B 2 63  ? -7.408  18.234  6.807   1.00 86.84  ? 52  G   B C2    1 
ATOM   8154  N  N2    . G   B 2 63  ? -6.705  18.072  5.675   1.00 87.45  ? 52  G   B N2    1 
ATOM   8155  N  N3    . G   B 2 63  ? -8.211  19.279  6.939   1.00 86.41  ? 52  G   B N3    1 
ATOM   8156  C  C4    . G   B 2 63  ? -8.836  19.287  8.137   1.00 85.35  ? 52  G   B C4    1 
ATOM   8157  P  P     . G   B 2 64  ? -14.209 19.478  5.905   1.00 88.55  ? 53  G   B P     1 
ATOM   8158  O  OP1   . G   B 2 64  ? -15.260 19.800  4.906   1.00 89.30  ? 53  G   B OP1   1 
ATOM   8159  O  OP2   . G   B 2 64  ? -14.588 18.802  7.173   1.00 86.75  ? 53  G   B OP2   1 
ATOM   8160  O  "O5'" . G   B 2 64  ? -13.073 18.631  5.176   1.00 89.37  ? 53  G   B "O5'" 1 
ATOM   8161  C  "C5'" . G   B 2 64  ? -12.522 19.092  3.927   1.00 89.64  ? 53  G   B "C5'" 1 
ATOM   8162  C  "C4'" . G   B 2 64  ? -11.384 18.210  3.470   1.00 89.60  ? 53  G   B "C4'" 1 
ATOM   8163  O  "O4'" . G   B 2 64  ? -10.377 18.105  4.509   1.00 88.32  ? 53  G   B "O4'" 1 
ATOM   8164  C  "C3'" . G   B 2 64  ? -11.723 16.760  3.165   1.00 90.71  ? 53  G   B "C3'" 1 
ATOM   8165  O  "O3'" . G   B 2 64  ? -12.383 16.607  1.909   1.00 92.23  ? 53  G   B "O3'" 1 
ATOM   8166  C  "C2'" . G   B 2 64  ? -10.343 16.115  3.210   1.00 90.46  ? 53  G   B "C2'" 1 
ATOM   8167  O  "O2'" . G   B 2 64  ? -9.581  16.281  2.031   1.00 90.47  ? 53  G   B "O2'" 1 
ATOM   8168  C  "C1'" . G   B 2 64  ? -9.696  16.866  4.378   1.00 89.00  ? 53  G   B "C1'" 1 
ATOM   8169  N  N9    . G   B 2 64  ? -9.785  16.143  5.644   1.00 88.21  ? 53  G   B N9    1 
ATOM   8170  C  C8    . G   B 2 64  ? -10.558 16.456  6.737   1.00 86.90  ? 53  G   B C8    1 
ATOM   8171  N  N7    . G   B 2 64  ? -10.423 15.607  7.719   1.00 87.20  ? 53  G   B N7    1 
ATOM   8172  C  C5    . G   B 2 64  ? -9.509  14.676  7.246   1.00 88.19  ? 53  G   B C5    1 
ATOM   8173  C  C6    . G   B 2 64  ? -8.969  13.518  7.868   1.00 88.27  ? 53  G   B C6    1 
ATOM   8174  O  O6    . G   B 2 64  ? -9.201  13.069  8.997   1.00 87.83  ? 53  G   B O6    1 
ATOM   8175  N  N1    . G   B 2 64  ? -8.075  12.857  7.031   1.00 88.31  ? 53  G   B N1    1 
ATOM   8176  C  C2    . G   B 2 64  ? -7.740  13.258  5.759   1.00 88.59  ? 53  G   B C2    1 
ATOM   8177  N  N2    . G   B 2 64  ? -6.855  12.488  5.107   1.00 89.46  ? 53  G   B N2    1 
ATOM   8178  N  N3    . G   B 2 64  ? -8.235  14.335  5.170   1.00 88.51  ? 53  G   B N3    1 
ATOM   8179  C  C4    . G   B 2 64  ? -9.106  14.992  5.966   1.00 88.40  ? 53  G   B C4    1 
ATOM   8180  P  P     . U   B 2 65  ? -13.375 15.368  1.657   1.00 93.11  ? 54  U   B P     1 
ATOM   8181  O  OP1   . U   B 2 65  ? -14.028 15.564  0.338   1.00 94.04  ? 54  U   B OP1   1 
ATOM   8182  O  OP2   . U   B 2 65  ? -14.216 15.190  2.870   1.00 90.43  ? 54  U   B OP2   1 
ATOM   8183  O  "O5'" . U   B 2 65  ? -12.382 14.129  1.532   1.00 92.46  ? 54  U   B "O5'" 1 
ATOM   8184  C  "C5'" . U   B 2 65  ? -11.524 13.975  0.385   1.00 92.69  ? 54  U   B "C5'" 1 
ATOM   8185  C  "C4'" . U   B 2 65  ? -10.612 12.782  0.558   1.00 93.46  ? 54  U   B "C4'" 1 
ATOM   8186  O  "O4'" . U   B 2 65  ? -9.878  12.890  1.804   1.00 92.67  ? 54  U   B "O4'" 1 
ATOM   8187  C  "C3'" . U   B 2 65  ? -11.299 11.430  0.656   1.00 95.10  ? 54  U   B "C3'" 1 
ATOM   8188  O  "O3'" . U   B 2 65  ? -11.645 10.943  -0.636  1.00 98.63  ? 54  U   B "O3'" 1 
ATOM   8189  C  "C2'" . U   B 2 65  ? -10.240 10.578  1.349   1.00 94.29  ? 54  U   B "C2'" 1 
ATOM   8190  O  "O2'" . U   B 2 65  ? -9.294  9.995   0.475   1.00 94.83  ? 54  U   B "O2'" 1 
ATOM   8191  C  "C1'" . U   B 2 65  ? -9.588  11.591  2.295   1.00 92.83  ? 54  U   B "C1'" 1 
ATOM   8192  N  N1    . U   B 2 65  ? -10.068 11.486  3.684   1.00 91.59  ? 54  U   B N1    1 
ATOM   8193  C  C2    . U   B 2 65  ? -9.485  10.527  4.494   1.00 91.11  ? 54  U   B C2    1 
ATOM   8194  O  O2    . U   B 2 65  ? -8.597  9.784   4.110   1.00 91.81  ? 54  U   B O2    1 
ATOM   8195  N  N3    . U   B 2 65  ? -9.978  10.476  5.774   1.00 89.89  ? 54  U   B N3    1 
ATOM   8196  C  C4    . U   B 2 65  ? -10.976 11.259  6.317   1.00 88.53  ? 54  U   B C4    1 
ATOM   8197  O  O4    . U   B 2 65  ? -11.308 11.091  7.491   1.00 87.11  ? 54  U   B O4    1 
ATOM   8198  C  C5    . U   B 2 65  ? -11.532 12.222  5.417   1.00 88.98  ? 54  U   B C5    1 
ATOM   8199  C  C6    . U   B 2 65  ? -11.075 12.299  4.161   1.00 90.26  ? 54  U   B C6    1 
ATOM   8200  P  P     . U   B 2 66  ? -13.077 10.275  -0.887  1.00 101.29 ? 55  U   B P     1 
ATOM   8201  O  OP1   . U   B 2 66  ? -13.135 9.834   -2.304  1.00 100.84 ? 55  U   B OP1   1 
ATOM   8202  O  OP2   . U   B 2 66  ? -14.116 11.198  -0.360  1.00 100.53 ? 55  U   B OP2   1 
ATOM   8203  O  "O5'" . U   B 2 66  ? -13.036 8.986   0.048   1.00 100.16 ? 55  U   B "O5'" 1 
ATOM   8204  C  "C5'" . U   B 2 66  ? -12.260 7.830   -0.317  1.00 99.37  ? 55  U   B "C5'" 1 
ATOM   8205  C  "C4'" . U   B 2 66  ? -12.287 6.802   0.790   1.00 98.19  ? 55  U   B "C4'" 1 
ATOM   8206  O  "O4'" . U   B 2 66  ? -11.782 7.387   2.017   1.00 96.78  ? 55  U   B "O4'" 1 
ATOM   8207  C  "C3'" . U   B 2 66  ? -13.655 6.269   1.182   1.00 97.63  ? 55  U   B "C3'" 1 
ATOM   8208  O  "O3'" . U   B 2 66  ? -14.114 5.273   0.273   1.00 98.18  ? 55  U   B "O3'" 1 
ATOM   8209  C  "C2'" . U   B 2 66  ? -13.392 5.726   2.584   1.00 96.98  ? 55  U   B "C2'" 1 
ATOM   8210  O  "O2'" . U   B 2 66  ? -12.859 4.416   2.600   1.00 97.35  ? 55  U   B "O2'" 1 
ATOM   8211  C  "C1'" . U   B 2 66  ? -12.377 6.737   3.128   1.00 95.49  ? 55  U   B "C1'" 1 
ATOM   8212  N  N1    . U   B 2 66  ? -12.972 7.757   4.009   1.00 93.56  ? 55  U   B N1    1 
ATOM   8213  C  C2    . U   B 2 66  ? -12.828 7.597   5.377   1.00 93.02  ? 55  U   B C2    1 
ATOM   8214  O  O2    . U   B 2 66  ? -12.229 6.660   5.877   1.00 94.05  ? 55  U   B O2    1 
ATOM   8215  N  N3    . U   B 2 66  ? -13.412 8.580   6.137   1.00 91.77  ? 55  U   B N3    1 
ATOM   8216  C  C4    . U   B 2 66  ? -14.112 9.680   5.687   1.00 91.12  ? 55  U   B C4    1 
ATOM   8217  O  O4    . U   B 2 66  ? -14.578 10.478  6.502   1.00 91.10  ? 55  U   B O4    1 
ATOM   8218  C  C5    . U   B 2 66  ? -14.221 9.774   4.263   1.00 91.36  ? 55  U   B C5    1 
ATOM   8219  C  C6    . U   B 2 66  ? -13.664 8.832   3.492   1.00 92.47  ? 55  U   B C6    1 
ATOM   8220  P  P     . C   B 2 67  ? -15.674 5.171   -0.088  1.00 98.64  ? 56  C   B P     1 
ATOM   8221  O  OP1   . C   B 2 67  ? -15.885 3.923   -0.865  1.00 100.00 ? 56  C   B OP1   1 
ATOM   8222  O  OP2   . C   B 2 67  ? -16.105 6.474   -0.658  1.00 97.55  ? 56  C   B OP2   1 
ATOM   8223  O  "O5'" . C   B 2 67  ? -16.363 5.002   1.338   1.00 97.08  ? 56  C   B "O5'" 1 
ATOM   8224  C  "C5'" . C   B 2 67  ? -17.787 4.822   1.462   1.00 95.44  ? 56  C   B "C5'" 1 
ATOM   8225  C  "C4'" . C   B 2 67  ? -18.116 3.950   2.653   1.00 94.00  ? 56  C   B "C4'" 1 
ATOM   8226  O  "O4'" . C   B 2 67  ? -17.719 2.580   2.384   1.00 93.58  ? 56  C   B "O4'" 1 
ATOM   8227  C  "C3'" . C   B 2 67  ? -17.416 4.295   3.959   1.00 92.51  ? 56  C   B "C3'" 1 
ATOM   8228  O  "O3'" . C   B 2 67  ? -18.074 5.360   4.642   1.00 90.91  ? 56  C   B "O3'" 1 
ATOM   8229  C  "C2'" . C   B 2 67  ? -17.492 2.977   4.721   1.00 92.40  ? 56  C   B "C2'" 1 
ATOM   8230  O  "O2'" . C   B 2 67  ? -18.705 2.779   5.419   1.00 91.24  ? 56  C   B "O2'" 1 
ATOM   8231  C  "C1'" . C   B 2 67  ? -17.323 1.952   3.594   1.00 93.58  ? 56  C   B "C1'" 1 
ATOM   8232  N  N1    . C   B 2 67  ? -15.942 1.444   3.444   1.00 94.94  ? 56  C   B N1    1 
ATOM   8233  C  C2    . C   B 2 67  ? -15.432 0.583   4.425   1.00 95.05  ? 56  C   B C2    1 
ATOM   8234  O  O2    . C   B 2 67  ? -16.152 0.273   5.386   1.00 93.84  ? 56  C   B O2    1 
ATOM   8235  N  N3    . C   B 2 67  ? -14.169 0.111   4.300   1.00 95.22  ? 56  C   B N3    1 
ATOM   8236  C  C4    . C   B 2 67  ? -13.424 0.466   3.249   1.00 96.23  ? 56  C   B C4    1 
ATOM   8237  N  N4    . C   B 2 67  ? -12.185 -0.023  3.166   1.00 96.62  ? 56  C   B N4    1 
ATOM   8238  C  C5    . C   B 2 67  ? -13.918 1.341   2.237   1.00 96.78  ? 56  C   B C5    1 
ATOM   8239  C  C6    . C   B 2 67  ? -15.170 1.802   2.372   1.00 96.01  ? 56  C   B C6    1 
ATOM   8240  P  P     . A   B 2 68  ? -17.223 6.444   5.464   1.00 89.47  ? 57  A   B P     1 
ATOM   8241  O  OP1   . A   B 2 68  ? -18.178 7.338   6.166   1.00 89.74  ? 57  A   B OP1   1 
ATOM   8242  O  OP2   . A   B 2 68  ? -16.217 7.034   4.545   1.00 88.89  ? 57  A   B OP2   1 
ATOM   8243  O  "O5'" . A   B 2 68  ? -16.459 5.558   6.546   1.00 88.45  ? 57  A   B "O5'" 1 
ATOM   8244  C  "C5'" . A   B 2 68  ? -17.142 5.068   7.718   1.00 88.12  ? 57  A   B "C5'" 1 
ATOM   8245  C  "C4'" . A   B 2 68  ? -16.215 4.239   8.577   1.00 87.92  ? 57  A   B "C4'" 1 
ATOM   8246  O  "O4'" . A   B 2 68  ? -15.718 3.104   7.823   1.00 88.38  ? 57  A   B "O4'" 1 
ATOM   8247  C  "C3'" . A   B 2 68  ? -14.951 4.932   9.074   1.00 87.73  ? 57  A   B "C3'" 1 
ATOM   8248  O  "O3'" . A   B 2 68  ? -15.238 5.747   10.209  1.00 87.71  ? 57  A   B "O3'" 1 
ATOM   8249  C  "C2'" . A   B 2 68  ? -14.043 3.747   9.392   1.00 87.15  ? 57  A   B "C2'" 1 
ATOM   8250  O  "O2'" . A   B 2 68  ? -14.260 3.186   10.672  1.00 86.50  ? 57  A   B "O2'" 1 
ATOM   8251  C  "C1'" . A   B 2 68  ? -14.427 2.750   8.293   1.00 87.33  ? 57  A   B "C1'" 1 
ATOM   8252  N  N9    . A   B 2 68  ? -13.505 2.719   7.154   1.00 86.63  ? 57  A   B N9    1 
ATOM   8253  C  C8    . A   B 2 68  ? -13.633 3.353   5.942   1.00 86.39  ? 57  A   B C8    1 
ATOM   8254  N  N7    . A   B 2 68  ? -12.640 3.122   5.118   1.00 85.47  ? 57  A   B N7    1 
ATOM   8255  C  C5    . A   B 2 68  ? -11.804 2.276   5.832   1.00 86.16  ? 57  A   B C5    1 
ATOM   8256  C  C6    . A   B 2 68  ? -10.576 1.668   5.513   1.00 86.79  ? 57  A   B C6    1 
ATOM   8257  N  N6    . A   B 2 68  ? -9.954  1.826   4.342   1.00 87.31  ? 57  A   B N6    1 
ATOM   8258  N  N1    . A   B 2 68  ? -10.002 0.880   6.450   1.00 86.61  ? 57  A   B N1    1 
ATOM   8259  C  C2    . A   B 2 68  ? -10.627 0.722   7.625   1.00 86.84  ? 57  A   B C2    1 
ATOM   8260  N  N3    . A   B 2 68  ? -11.781 1.243   8.042   1.00 86.51  ? 57  A   B N3    1 
ATOM   8261  C  C4    . A   B 2 68  ? -12.326 2.017   7.087   1.00 86.41  ? 57  A   B C4    1 
ATOM   8262  P  P     . A   B 2 69  ? -14.437 7.119   10.449  1.00 87.00  ? 58  A   B P     1 
ATOM   8263  O  OP1   . A   B 2 69  ? -14.932 7.725   11.712  1.00 85.74  ? 58  A   B OP1   1 
ATOM   8264  O  OP2   . A   B 2 69  ? -14.486 7.912   9.193   1.00 85.92  ? 58  A   B OP2   1 
ATOM   8265  O  "O5'" . A   B 2 69  ? -12.938 6.625   10.669  1.00 86.63  ? 58  A   B "O5'" 1 
ATOM   8266  C  "C5'" . A   B 2 69  ? -12.571 5.795   11.792  1.00 84.55  ? 58  A   B "C5'" 1 
ATOM   8267  C  "C4'" . A   B 2 69  ? -11.338 6.342   12.472  1.00 82.68  ? 58  A   B "C4'" 1 
ATOM   8268  O  "O4'" . A   B 2 69  ? -10.227 6.320   11.534  1.00 81.97  ? 58  A   B "O4'" 1 
ATOM   8269  C  "C3'" . A   B 2 69  ? -11.444 7.781   12.977  1.00 81.62  ? 58  A   B "C3'" 1 
ATOM   8270  O  "O3'" . A   B 2 69  ? -10.790 7.938   14.233  1.00 81.95  ? 58  A   B "O3'" 1 
ATOM   8271  C  "C2'" . A   B 2 69  ? -10.785 8.586   11.861  1.00 80.90  ? 58  A   B "C2'" 1 
ATOM   8272  O  "O2'" . A   B 2 69  ? -10.235 9.819   12.279  1.00 81.33  ? 58  A   B "O2'" 1 
ATOM   8273  C  "C1'" . A   B 2 69  ? -9.696  7.621   11.390  1.00 80.91  ? 58  A   B "C1'" 1 
ATOM   8274  N  N9    . A   B 2 69  ? -9.269  7.788   9.999   1.00 80.88  ? 58  A   B N9    1 
ATOM   8275  C  C8    . A   B 2 69  ? -9.842  8.544   9.005   1.00 80.97  ? 58  A   B C8    1 
ATOM   8276  N  N7    . A   B 2 69  ? -9.212  8.472   7.857   1.00 80.82  ? 58  A   B N7    1 
ATOM   8277  C  C5    . A   B 2 69  ? -8.154  7.612   8.111   1.00 80.61  ? 58  A   B C5    1 
ATOM   8278  C  C6    . A   B 2 69  ? -7.117  7.121   7.296   1.00 81.14  ? 58  A   B C6    1 
ATOM   8279  N  N6    . A   B 2 69  ? -6.966  7.450   6.011   1.00 81.38  ? 58  A   B N6    1 
ATOM   8280  N  N1    . A   B 2 69  ? -6.224  6.276   7.857   1.00 81.59  ? 58  A   B N1    1 
ATOM   8281  C  C2    . A   B 2 69  ? -6.375  5.947   9.148   1.00 81.75  ? 58  A   B C2    1 
ATOM   8282  N  N3    . A   B 2 69  ? -7.309  6.339   10.013  1.00 80.84  ? 58  A   B N3    1 
ATOM   8283  C  C4    . A   B 2 69  ? -8.178  7.180   9.425   1.00 80.61  ? 58  A   B C4    1 
ATOM   8284  P  P     . G   B 2 70  ? -11.640 7.916   15.593  1.00 82.17  ? 59  G   B P     1 
ATOM   8285  O  OP1   . G   B 2 70  ? -12.103 6.523   15.827  1.00 81.27  ? 59  G   B OP1   1 
ATOM   8286  O  OP2   . G   B 2 70  ? -12.629 9.023   15.538  1.00 82.55  ? 59  G   B OP2   1 
ATOM   8287  O  "O5'" . G   B 2 70  ? -10.558 8.287   16.702  1.00 82.32  ? 59  G   B "O5'" 1 
ATOM   8288  C  "C5'" . G   B 2 70  ? -9.942  9.589   16.740  1.00 82.29  ? 59  G   B "C5'" 1 
ATOM   8289  C  "C4'" . G   B 2 70  ? -8.579  9.520   17.390  1.00 82.26  ? 59  G   B "C4'" 1 
ATOM   8290  O  "O4'" . G   B 2 70  ? -8.562  8.480   18.403  1.00 81.78  ? 59  G   B "O4'" 1 
ATOM   8291  C  "C3'" . G   B 2 70  ? -7.417  9.171   16.473  1.00 82.79  ? 59  G   B "C3'" 1 
ATOM   8292  O  "O3'" . G   B 2 70  ? -6.944  10.322  15.779  1.00 82.62  ? 59  G   B "O3'" 1 
ATOM   8293  C  "C2'" . G   B 2 70  ? -6.384  8.621   17.452  1.00 82.40  ? 59  G   B "C2'" 1 
ATOM   8294  O  "O2'" . G   B 2 70  ? -5.595  9.613   18.077  1.00 82.12  ? 59  G   B "O2'" 1 
ATOM   8295  C  "C1'" . G   B 2 70  ? -7.269  7.900   18.473  1.00 82.69  ? 59  G   B "C1'" 1 
ATOM   8296  N  N9    . G   B 2 70  ? -7.382  6.463   18.234  1.00 83.80  ? 59  G   B N9    1 
ATOM   8297  C  C8    . G   B 2 70  ? -8.466  5.781   17.735  1.00 84.49  ? 59  G   B C8    1 
ATOM   8298  N  N7    . G   B 2 70  ? -8.262  4.495   17.636  1.00 85.27  ? 59  G   B N7    1 
ATOM   8299  C  C5    . G   B 2 70  ? -6.963  4.318   18.090  1.00 85.01  ? 59  G   B C5    1 
ATOM   8300  C  C6    . G   B 2 70  ? -6.187  3.135   18.218  1.00 84.71  ? 59  G   B C6    1 
ATOM   8301  O  O6    . G   B 2 70  ? -6.502  1.972   17.938  1.00 83.78  ? 59  G   B O6    1 
ATOM   8302  N  N1    . G   B 2 70  ? -4.921  3.406   18.729  1.00 85.18  ? 59  G   B N1    1 
ATOM   8303  C  C2    . G   B 2 70  ? -4.458  4.654   19.074  1.00 85.75  ? 59  G   B C2    1 
ATOM   8304  N  N2    . G   B 2 70  ? -3.205  4.713   19.549  1.00 86.23  ? 59  G   B N2    1 
ATOM   8305  N  N3    . G   B 2 70  ? -5.173  5.764   18.960  1.00 85.41  ? 59  G   B N3    1 
ATOM   8306  C  C4    . G   B 2 70  ? -6.407  5.522   18.467  1.00 84.78  ? 59  G   B C4    1 
ATOM   8307  P  P     . U   B 2 71  ? -6.604  10.237  14.215  1.00 82.15  ? 60  U   B P     1 
ATOM   8308  O  OP1   . U   B 2 71  ? -5.869  11.471  13.837  1.00 82.41  ? 60  U   B OP1   1 
ATOM   8309  O  OP2   . U   B 2 71  ? -7.847  9.873   13.491  1.00 81.06  ? 60  U   B OP2   1 
ATOM   8310  O  "O5'" . U   B 2 71  ? -5.618  8.989   14.127  1.00 82.63  ? 60  U   B "O5'" 1 
ATOM   8311  C  "C5'" . U   B 2 71  ? -4.272  9.061   14.632  1.00 83.96  ? 60  U   B "C5'" 1 
ATOM   8312  C  "C4'" . U   B 2 71  ? -3.562  7.749   14.402  1.00 84.99  ? 60  U   B "C4'" 1 
ATOM   8313  O  "O4'" . U   B 2 71  ? -4.361  6.667   14.954  1.00 86.04  ? 60  U   B "O4'" 1 
ATOM   8314  C  "C3'" . U   B 2 71  ? -3.305  7.396   12.939  1.00 86.37  ? 60  U   B "C3'" 1 
ATOM   8315  O  "O3'" . U   B 2 71  ? -1.970  6.942   12.739  1.00 89.45  ? 60  U   B "O3'" 1 
ATOM   8316  C  "C2'" . U   B 2 71  ? -4.344  6.317   12.643  1.00 86.35  ? 60  U   B "C2'" 1 
ATOM   8317  O  "O2'" . U   B 2 71  ? -3.954  5.395   11.644  1.00 85.04  ? 60  U   B "O2'" 1 
ATOM   8318  C  "C1'" . U   B 2 71  ? -4.471  5.633   14.002  1.00 87.56  ? 60  U   B "C1'" 1 
ATOM   8319  N  N1    . U   B 2 71  ? -5.757  4.944   14.205  1.00 89.98  ? 60  U   B N1    1 
ATOM   8320  C  C2    . U   B 2 71  ? -5.751  3.564   14.318  1.00 91.63  ? 60  U   B C2    1 
ATOM   8321  O  O2    . U   B 2 71  ? -4.732  2.896   14.261  1.00 93.86  ? 60  U   B O2    1 
ATOM   8322  N  N3    . U   B 2 71  ? -6.987  2.995   14.503  1.00 91.80  ? 60  U   B N3    1 
ATOM   8323  C  C4    . U   B 2 71  ? -8.203  3.644   14.579  1.00 92.16  ? 60  U   B C4    1 
ATOM   8324  O  O4    . U   B 2 71  ? -9.231  2.987   14.750  1.00 93.78  ? 60  U   B O4    1 
ATOM   8325  C  C5    . U   B 2 71  ? -8.126  5.068   14.453  1.00 91.54  ? 60  U   B C5    1 
ATOM   8326  C  C6    . U   B 2 71  ? -6.935  5.655   14.275  1.00 90.77  ? 60  U   B C6    1 
ATOM   8327  P  P     . C   B 2 72  ? -0.849  7.957   12.209  1.00 90.62  ? 61  C   B P     1 
ATOM   8328  O  OP1   . C   B 2 72  ? 0.460   7.255   12.253  1.00 90.28  ? 61  C   B OP1   1 
ATOM   8329  O  OP2   . C   B 2 72  ? -1.015  9.244   12.933  1.00 89.78  ? 61  C   B OP2   1 
ATOM   8330  O  "O5'" . C   B 2 72  ? -1.264  8.190   10.688  1.00 89.53  ? 61  C   B "O5'" 1 
ATOM   8331  C  "C5'" . C   B 2 72  ? -0.883  7.254   9.660   1.00 89.16  ? 61  C   B "C5'" 1 
ATOM   8332  C  "C4'" . C   B 2 72  ? -1.361  7.711   8.299   1.00 88.92  ? 61  C   B "C4'" 1 
ATOM   8333  O  "O4'" . C   B 2 72  ? -2.770  7.389   8.132   1.00 88.20  ? 61  C   B "O4'" 1 
ATOM   8334  C  "C3'" . C   B 2 72  ? -1.282  9.201   8.002   1.00 89.56  ? 61  C   B "C3'" 1 
ATOM   8335  O  "O3'" . C   B 2 72  ? 0.030   9.613   7.625   1.00 91.68  ? 61  C   B "O3'" 1 
ATOM   8336  C  "C2'" . C   B 2 72  ? -2.295  9.337   6.874   1.00 89.39  ? 61  C   B "C2'" 1 
ATOM   8337  O  "O2'" . C   B 2 72  ? -1.822  8.935   5.605   1.00 89.74  ? 61  C   B "O2'" 1 
ATOM   8338  C  "C1'" . C   B 2 72  ? -3.403  8.400   7.360   1.00 88.40  ? 61  C   B "C1'" 1 
ATOM   8339  N  N1    . C   B 2 72  ? -4.425  9.070   8.191   1.00 87.86  ? 61  C   B N1    1 
ATOM   8340  C  C2    . C   B 2 72  ? -5.308  9.970   7.578   1.00 86.87  ? 61  C   B C2    1 
ATOM   8341  O  O2    . C   B 2 72  ? -5.207  10.175  6.358   1.00 85.34  ? 61  C   B O2    1 
ATOM   8342  N  N3    . C   B 2 72  ? -6.247  10.591  8.329   1.00 86.77  ? 61  C   B N3    1 
ATOM   8343  C  C4    . C   B 2 72  ? -6.325  10.343  9.639   1.00 86.48  ? 61  C   B C4    1 
ATOM   8344  N  N4    . C   B 2 72  ? -7.268  10.977  10.341  1.00 85.78  ? 61  C   B N4    1 
ATOM   8345  C  C5    . C   B 2 72  ? -5.441  9.432   10.288  1.00 86.76  ? 61  C   B C5    1 
ATOM   8346  C  C6    . C   B 2 72  ? -4.514  8.824   9.534   1.00 87.28  ? 61  C   B C6    1 
ATOM   8347  P  P     . C   B 2 73  ? 0.545   11.099  7.955   1.00 92.67  ? 62  C   B P     1 
ATOM   8348  O  OP1   . C   B 2 73  ? 2.000   11.159  7.661   1.00 94.44  ? 62  C   B OP1   1 
ATOM   8349  O  OP2   . C   B 2 73  ? 0.058   11.474  9.307   1.00 94.00  ? 62  C   B OP2   1 
ATOM   8350  O  "O5'" . C   B 2 73  ? -0.217  11.994  6.881   1.00 90.53  ? 62  C   B "O5'" 1 
ATOM   8351  C  "C5'" . C   B 2 73  ? 0.089   11.902  5.480   1.00 90.97  ? 62  C   B "C5'" 1 
ATOM   8352  C  "C4'" . C   B 2 73  ? -0.734  12.894  4.690   1.00 92.30  ? 62  C   B "C4'" 1 
ATOM   8353  O  "O4'" . C   B 2 73  ? -2.149  12.577  4.803   1.00 91.74  ? 62  C   B "O4'" 1 
ATOM   8354  C  "C3'" . C   B 2 73  ? -0.650  14.348  5.130   1.00 93.48  ? 62  C   B "C3'" 1 
ATOM   8355  O  "O3'" . C   B 2 73  ? 0.543   14.979  4.670   1.00 96.59  ? 62  C   B "O3'" 1 
ATOM   8356  C  "C2'" . C   B 2 73  ? -1.924  14.917  4.521   1.00 92.37  ? 62  C   B "C2'" 1 
ATOM   8357  O  "O2'" . C   B 2 73  ? -1.834  15.189  3.136   1.00 91.42  ? 62  C   B "O2'" 1 
ATOM   8358  C  "C1'" . C   B 2 73  ? -2.909  13.780  4.798   1.00 91.17  ? 62  C   B "C1'" 1 
ATOM   8359  N  N1    . C   B 2 73  ? -3.607  13.913  6.095   1.00 89.43  ? 62  C   B N1    1 
ATOM   8360  C  C2    . C   B 2 73  ? -4.673  14.818  6.198   1.00 87.32  ? 62  C   B C2    1 
ATOM   8361  O  O2    . C   B 2 73  ? -5.001  15.477  5.200   1.00 85.76  ? 62  C   B O2    1 
ATOM   8362  N  N3    . C   B 2 73  ? -5.316  14.948  7.382   1.00 85.59  ? 62  C   B N3    1 
ATOM   8363  C  C4    . C   B 2 73  ? -4.931  14.221  8.435   1.00 85.63  ? 62  C   B C4    1 
ATOM   8364  N  N4    . C   B 2 73  ? -5.594  14.381  9.583   1.00 85.38  ? 62  C   B N4    1 
ATOM   8365  C  C5    . C   B 2 73  ? -3.849  13.297  8.358   1.00 86.35  ? 62  C   B C5    1 
ATOM   8366  C  C6    . C   B 2 73  ? -3.219  13.178  7.182   1.00 87.82  ? 62  C   B C6    1 
ATOM   8367  P  P     . C   B 2 74  ? 1.321   16.036  5.601   1.00 97.32  ? 63  C   B P     1 
ATOM   8368  O  OP1   . C   B 2 74  ? 2.662   16.270  5.009   1.00 99.04  ? 63  C   B OP1   1 
ATOM   8369  O  OP2   . C   B 2 74  ? 1.213   15.590  7.015   1.00 96.65  ? 63  C   B OP2   1 
ATOM   8370  O  "O5'" . C   B 2 74  ? 0.464   17.366  5.428   1.00 97.26  ? 63  C   B "O5'" 1 
ATOM   8371  C  "C5'" . C   B 2 74  ? 0.273   17.967  4.134   1.00 98.44  ? 63  C   B "C5'" 1 
ATOM   8372  C  "C4'" . C   B 2 74  ? -0.672  19.145  4.220   1.00 99.04  ? 63  C   B "C4'" 1 
ATOM   8373  O  "O4'" . C   B 2 74  ? -2.036  18.678  4.412   1.00 98.23  ? 63  C   B "O4'" 1 
ATOM   8374  C  "C3'" . C   B 2 74  ? -0.455  20.116  5.372   1.00 99.85  ? 63  C   B "C3'" 1 
ATOM   8375  O  "O3'" . C   B 2 74  ? 0.635   21.009  5.153   1.00 102.21 ? 63  C   B "O3'" 1 
ATOM   8376  C  "C2'" . C   B 2 74  ? -1.815  20.799  5.443   1.00 98.23  ? 63  C   B "C2'" 1 
ATOM   8377  O  "O2'" . C   B 2 74  ? -2.026  21.801  4.470   1.00 98.13  ? 63  C   B "O2'" 1 
ATOM   8378  C  "C1'" . C   B 2 74  ? -2.748  19.609  5.215   1.00 97.13  ? 63  C   B "C1'" 1 
ATOM   8379  N  N1    . C   B 2 74  ? -3.149  18.951  6.476   1.00 95.51  ? 63  C   B N1    1 
ATOM   8380  C  C2    . C   B 2 74  ? -4.217  19.491  7.204   1.00 94.11  ? 63  C   B C2    1 
ATOM   8381  O  O2    . C   B 2 74  ? -4.803  20.489  6.760   1.00 93.31  ? 63  C   B O2    1 
ATOM   8382  N  N3    . C   B 2 74  ? -4.585  18.906  8.369   1.00 93.20  ? 63  C   B N3    1 
ATOM   8383  C  C4    . C   B 2 74  ? -3.927  17.832  8.814   1.00 93.08  ? 63  C   B C4    1 
ATOM   8384  N  N4    . C   B 2 74  ? -4.325  17.287  9.966   1.00 92.61  ? 63  C   B N4    1 
ATOM   8385  C  C5    . C   B 2 74  ? -2.831  17.270  8.098   1.00 94.01  ? 63  C   B C5    1 
ATOM   8386  C  C6    . C   B 2 74  ? -2.475  17.859  6.949   1.00 94.95  ? 63  C   B C6    1 
ATOM   8387  P  P     . G   B 2 75  ? 1.510   21.538  6.394   1.00 102.68 ? 64  G   B P     1 
ATOM   8388  O  OP1   . G   B 2 75  ? 2.635   22.342  5.855   1.00 105.10 ? 64  G   B OP1   1 
ATOM   8389  O  OP2   . G   B 2 75  ? 1.795   20.389  7.293   1.00 102.08 ? 64  G   B OP2   1 
ATOM   8390  O  "O5'" . G   B 2 75  ? 0.512   22.531  7.135   1.00 101.07 ? 64  G   B "O5'" 1 
ATOM   8391  C  "C5'" . G   B 2 75  ? 0.097   23.752  6.502   1.00 101.53 ? 64  G   B "C5'" 1 
ATOM   8392  C  "C4'" . G   B 2 75  ? -0.974  24.429  7.320   1.00 102.75 ? 64  G   B "C4'" 1 
ATOM   8393  O  "O4'" . G   B 2 75  ? -2.092  23.524  7.519   1.00 103.21 ? 64  G   B "O4'" 1 
ATOM   8394  C  "C3'" . G   B 2 75  ? -0.586  24.828  8.734   1.00 103.41 ? 64  G   B "C3'" 1 
ATOM   8395  O  "O3'" . G   B 2 75  ? 0.198   26.016  8.769   1.00 104.43 ? 64  G   B "O3'" 1 
ATOM   8396  C  "C2'" . G   B 2 75  ? -1.951  24.976  9.393   1.00 103.12 ? 64  G   B "C2'" 1 
ATOM   8397  O  "O2'" . G   B 2 75  ? -2.592  26.210  9.137   1.00 101.87 ? 64  G   B "O2'" 1 
ATOM   8398  C  "C1'" . G   B 2 75  ? -2.713  23.808  8.764   1.00 103.39 ? 64  G   B "C1'" 1 
ATOM   8399  N  N9    . G   B 2 75  ? -2.681  22.607  9.595   1.00 103.18 ? 64  G   B N9    1 
ATOM   8400  C  C8    . G   B 2 75  ? -1.933  21.469  9.405   1.00 103.36 ? 64  G   B C8    1 
ATOM   8401  N  N7    . G   B 2 75  ? -2.115  20.575  10.339  1.00 103.02 ? 64  G   B N7    1 
ATOM   8402  C  C5    . G   B 2 75  ? -3.030  21.161  11.202  1.00 103.10 ? 64  G   B C5    1 
ATOM   8403  C  C6    . G   B 2 75  ? -3.608  20.670  12.403  1.00 102.97 ? 64  G   B C6    1 
ATOM   8404  O  O6    . G   B 2 75  ? -3.422  19.581  12.959  1.00 104.68 ? 64  G   B O6    1 
ATOM   8405  N  N1    . G   B 2 75  ? -4.489  21.592  12.962  1.00 102.11 ? 64  G   B N1    1 
ATOM   8406  C  C2    . G   B 2 75  ? -4.777  22.829  12.435  1.00 102.08 ? 64  G   B C2    1 
ATOM   8407  N  N2    . G   B 2 75  ? -5.654  23.578  13.120  1.00 101.42 ? 64  G   B N2    1 
ATOM   8408  N  N3    . G   B 2 75  ? -4.244  23.298  11.318  1.00 102.13 ? 64  G   B N3    1 
ATOM   8409  C  C4    . G   B 2 75  ? -3.386  22.417  10.758  1.00 102.90 ? 64  G   B C4    1 
ATOM   8410  P  P     . C   B 2 76  ? 1.084   26.354  10.060  1.00 104.01 ? 65  C   B P     1 
ATOM   8411  O  OP1   . C   B 2 76  ? 1.802   27.628  9.803   1.00 104.94 ? 65  C   B OP1   1 
ATOM   8412  O  OP2   . C   B 2 76  ? 1.855   25.137  10.424  1.00 102.99 ? 65  C   B OP2   1 
ATOM   8413  O  "O5'" . C   B 2 76  ? -0.013  26.621  11.182  1.00 101.78 ? 65  C   B "O5'" 1 
ATOM   8414  C  "C5'" . C   B 2 76  ? 0.334   26.610  12.577  1.00 100.78 ? 65  C   B "C5'" 1 
ATOM   8415  C  "C4'" . C   B 2 76  ? -0.913  26.697  13.421  1.00 100.21 ? 65  C   B "C4'" 1 
ATOM   8416  O  "O4'" . C   B 2 76  ? -1.813  25.607  13.080  1.00 100.70 ? 65  C   B "O4'" 1 
ATOM   8417  C  "C3'" . C   B 2 76  ? -0.691  26.582  14.921  1.00 99.19  ? 65  C   B "C3'" 1 
ATOM   8418  O  "O3'" . C   B 2 76  ? -0.407  27.872  15.456  1.00 96.77  ? 65  C   B "O3'" 1 
ATOM   8419  C  "C2'" . C   B 2 76  ? -2.018  26.014  15.406  1.00 100.01 ? 65  C   B "C2'" 1 
ATOM   8420  O  "O2'" . C   B 2 76  ? -3.021  26.985  15.626  1.00 100.76 ? 65  C   B "O2'" 1 
ATOM   8421  C  "C1'" . C   B 2 76  ? -2.386  25.069  14.260  1.00 100.98 ? 65  C   B "C1'" 1 
ATOM   8422  N  N1    . C   B 2 76  ? -1.898  23.685  14.441  1.00 102.58 ? 65  C   B N1    1 
ATOM   8423  C  C2    . C   B 2 76  ? -2.498  22.882  15.420  1.00 102.21 ? 65  C   B C2    1 
ATOM   8424  O  O2    . C   B 2 76  ? -3.412  23.358  16.110  1.00 100.33 ? 65  C   B O2    1 
ATOM   8425  N  N3    . C   B 2 76  ? -2.061  21.613  15.594  1.00 103.04 ? 65  C   B N3    1 
ATOM   8426  C  C4    . C   B 2 76  ? -1.072  21.137  14.832  1.00 103.69 ? 65  C   B C4    1 
ATOM   8427  N  N4    . C   B 2 76  ? -0.673  19.879  15.037  1.00 103.70 ? 65  C   B N4    1 
ATOM   8428  C  C5    . C   B 2 76  ? -0.446  21.931  13.827  1.00 104.23 ? 65  C   B C5    1 
ATOM   8429  C  C6    . C   B 2 76  ? -0.886  23.187  13.666  1.00 103.97 ? 65  C   B C6    1 
ATOM   8430  P  P     . U   B 2 77  ? 0.780   28.078  16.512  1.00 94.42  ? 66  U   B P     1 
ATOM   8431  O  OP1   . U   B 2 77  ? 1.086   29.530  16.577  1.00 95.33  ? 66  U   B OP1   1 
ATOM   8432  O  OP2   . U   B 2 77  ? 1.865   27.115  16.193  1.00 93.25  ? 66  U   B OP2   1 
ATOM   8433  O  "O5'" . U   B 2 77  ? 0.107   27.661  17.893  1.00 90.94  ? 66  U   B "O5'" 1 
ATOM   8434  C  "C5'" . U   B 2 77  ? -1.052  28.352  18.395  1.00 88.72  ? 66  U   B "C5'" 1 
ATOM   8435  C  "C4'" . U   B 2 77  ? -1.738  27.522  19.453  1.00 88.20  ? 66  U   B "C4'" 1 
ATOM   8436  O  "O4'" . U   B 2 77  ? -2.159  26.256  18.886  1.00 88.08  ? 66  U   B "O4'" 1 
ATOM   8437  C  "C3'" . U   B 2 77  ? -0.883  27.125  20.646  1.00 87.82  ? 66  U   B "C3'" 1 
ATOM   8438  O  "O3'" . U   B 2 77  ? -0.810  28.193  21.588  1.00 87.43  ? 66  U   B "O3'" 1 
ATOM   8439  C  "C2'" . U   B 2 77  ? -1.621  25.902  21.180  1.00 87.21  ? 66  U   B "C2'" 1 
ATOM   8440  O  "O2'" . U   B 2 77  ? -2.674  26.188  22.079  1.00 86.11  ? 66  U   B "O2'" 1 
ATOM   8441  C  "C1'" . U   B 2 77  ? -2.145  25.258  19.893  1.00 87.38  ? 66  U   B "C1'" 1 
ATOM   8442  N  N1    . U   B 2 77  ? -1.337  24.117  19.428  1.00 87.61  ? 66  U   B N1    1 
ATOM   8443  C  C2    . U   B 2 77  ? -1.498  22.911  20.088  1.00 87.17  ? 66  U   B C2    1 
ATOM   8444  O  O2    . U   B 2 77  ? -2.272  22.762  21.018  1.00 85.96  ? 66  U   B O2    1 
ATOM   8445  N  N3    . U   B 2 77  ? -0.725  21.882  19.607  1.00 87.46  ? 66  U   B N3    1 
ATOM   8446  C  C4    . U   B 2 77  ? 0.176   21.931  18.563  1.00 87.06  ? 66  U   B C4    1 
ATOM   8447  O  O4    . U   B 2 77  ? 0.803   20.916  18.255  1.00 85.41  ? 66  U   B O4    1 
ATOM   8448  C  C5    . U   B 2 77  ? 0.292   23.213  17.938  1.00 87.93  ? 66  U   B C5    1 
ATOM   8449  C  C6    . U   B 2 77  ? -0.447  24.237  18.381  1.00 88.22  ? 66  U   B C6    1 
ATOM   8450  P  P     . C   B 2 78  ? 0.567   28.526  22.342  1.00 85.36  ? 67  C   B P     1 
ATOM   8451  O  OP1   . C   B 2 78  ? 0.389   29.800  23.083  1.00 86.36  ? 67  C   B OP1   1 
ATOM   8452  O  OP2   . C   B 2 78  ? 1.679   28.395  21.365  1.00 84.02  ? 67  C   B OP2   1 
ATOM   8453  O  "O5'" . C   B 2 78  ? 0.681   27.355  23.414  1.00 84.97  ? 67  C   B "O5'" 1 
ATOM   8454  C  "C5'" . C   B 2 78  ? -0.281  27.231  24.476  1.00 85.26  ? 67  C   B "C5'" 1 
ATOM   8455  C  "C4'" . C   B 2 78  ? -0.257  25.835  25.054  1.00 85.50  ? 67  C   B "C4'" 1 
ATOM   8456  O  "O4'" . C   B 2 78  ? -0.582  24.864  24.027  1.00 85.73  ? 67  C   B "O4'" 1 
ATOM   8457  C  "C3'" . C   B 2 78  ? 1.079   25.348  25.587  1.00 84.97  ? 67  C   B "C3'" 1 
ATOM   8458  O  "O3'" . C   B 2 78  ? 1.361   25.888  26.873  1.00 85.98  ? 67  C   B "O3'" 1 
ATOM   8459  C  "C2'" . C   B 2 78  ? 0.877   23.838  25.599  1.00 84.25  ? 67  C   B "C2'" 1 
ATOM   8460  O  "O2'" . C   B 2 78  ? 0.193   23.349  26.734  1.00 82.59  ? 67  C   B "O2'" 1 
ATOM   8461  C  "C1'" . C   B 2 78  ? 0.048   23.629  24.330  1.00 85.16  ? 67  C   B "C1'" 1 
ATOM   8462  N  N1    . C   B 2 78  ? 0.857   23.202  23.169  1.00 86.05  ? 67  C   B N1    1 
ATOM   8463  C  C2    . C   B 2 78  ? 1.025   21.831  22.938  1.00 86.49  ? 67  C   B C2    1 
ATOM   8464  O  O2    . C   B 2 78  ? 0.484   21.021  23.705  1.00 86.47  ? 67  C   B O2    1 
ATOM   8465  N  N3    . C   B 2 78  ? 1.774   21.425  21.885  1.00 86.68  ? 67  C   B N3    1 
ATOM   8466  C  C4    . C   B 2 78  ? 2.347   22.328  21.086  1.00 87.21  ? 67  C   B C4    1 
ATOM   8467  N  N4    . C   B 2 78  ? 3.074   21.882  20.058  1.00 88.38  ? 67  C   B N4    1 
ATOM   8468  C  C5    . C   B 2 78  ? 2.196   23.729  21.302  1.00 86.69  ? 67  C   B C5    1 
ATOM   8469  C  C6    . C   B 2 78  ? 1.459   24.118  22.351  1.00 86.42  ? 67  C   B C6    1 
ATOM   8470  P  P     . C   B 2 79  ? 2.876   26.040  27.365  1.00 87.72  ? 68  C   B P     1 
ATOM   8471  O  OP1   . C   B 2 79  ? 2.857   26.676  28.708  1.00 87.22  ? 68  C   B OP1   1 
ATOM   8472  O  OP2   . C   B 2 79  ? 3.659   26.667  26.269  1.00 86.74  ? 68  C   B OP2   1 
ATOM   8473  O  "O5'" . C   B 2 79  ? 3.354   24.528  27.523  1.00 87.32  ? 68  C   B "O5'" 1 
ATOM   8474  C  "C5'" . C   B 2 79  ? 2.941   23.748  28.660  1.00 87.07  ? 68  C   B "C5'" 1 
ATOM   8475  C  "C4'" . C   B 2 79  ? 3.384   22.309  28.527  1.00 85.47  ? 68  C   B "C4'" 1 
ATOM   8476  O  "O4'" . C   B 2 79  ? 2.906   21.733  27.283  1.00 85.63  ? 68  C   B "O4'" 1 
ATOM   8477  C  "C3'" . C   B 2 79  ? 4.878   22.056  28.451  1.00 84.30  ? 68  C   B "C3'" 1 
ATOM   8478  O  "O3'" . C   B 2 79  ? 5.550   22.217  29.695  1.00 82.79  ? 68  C   B "O3'" 1 
ATOM   8479  C  "C2'" . C   B 2 79  ? 4.903   20.626  27.928  1.00 84.33  ? 68  C   B "C2'" 1 
ATOM   8480  O  "O2'" . C   B 2 79  ? 4.659   19.654  28.924  1.00 84.72  ? 68  C   B "O2'" 1 
ATOM   8481  C  "C1'" . C   B 2 79  ? 3.768   20.668  26.903  1.00 83.85  ? 68  C   B "C1'" 1 
ATOM   8482  N  N1    . C   B 2 79  ? 4.247   20.900  25.525  1.00 82.54  ? 68  C   B N1    1 
ATOM   8483  C  C2    . C   B 2 79  ? 4.591   19.794  24.739  1.00 82.64  ? 68  C   B C2    1 
ATOM   8484  O  O2    . C   B 2 79  ? 4.462   18.655  25.214  1.00 84.15  ? 68  C   B O2    1 
ATOM   8485  N  N3    . C   B 2 79  ? 5.042   19.992  23.478  1.00 82.62  ? 68  C   B N3    1 
ATOM   8486  C  C4    . C   B 2 79  ? 5.169   21.234  23.003  1.00 83.08  ? 68  C   B C4    1 
ATOM   8487  N  N4    . C   B 2 79  ? 5.618   21.383  21.754  1.00 83.91  ? 68  C   B N4    1 
ATOM   8488  C  C5    . C   B 2 79  ? 4.839   22.378  23.786  1.00 82.69  ? 68  C   B C5    1 
ATOM   8489  C  C6    . C   B 2 79  ? 4.394   22.168  25.032  1.00 82.08  ? 68  C   B C6    1 
ATOM   8490  P  P     . G   B 2 80  ? 7.126   22.520  29.718  1.00 81.55  ? 69  G   B P     1 
ATOM   8491  O  OP1   . G   B 2 80  ? 7.533   22.705  31.135  1.00 82.06  ? 69  G   B OP1   1 
ATOM   8492  O  OP2   . G   B 2 80  ? 7.410   23.595  28.732  1.00 80.39  ? 69  G   B OP2   1 
ATOM   8493  O  "O5'" . G   B 2 80  ? 7.761   21.167  29.166  1.00 76.50  ? 69  G   B "O5'" 1 
ATOM   8494  C  "C5'" . G   B 2 80  ? 8.355   20.223  30.075  1.00 71.24  ? 69  G   B "C5'" 1 
ATOM   8495  C  "C4'" . G   B 2 80  ? 8.659   18.908  29.398  1.00 67.65  ? 69  G   B "C4'" 1 
ATOM   8496  O  "O4'" . G   B 2 80  ? 7.865   18.741  28.194  1.00 65.97  ? 69  G   B "O4'" 1 
ATOM   8497  C  "C3'" . G   B 2 80  ? 10.084  18.736  28.909  1.00 65.63  ? 69  G   B "C3'" 1 
ATOM   8498  O  "O3'" . G   B 2 80  ? 10.964  18.463  29.994  1.00 63.78  ? 69  G   B "O3'" 1 
ATOM   8499  C  "C2'" . G   B 2 80  ? 9.924   17.594  27.916  1.00 65.04  ? 69  G   B "C2'" 1 
ATOM   8500  O  "O2'" . G   B 2 80  ? 9.838   16.321  28.522  1.00 65.35  ? 69  G   B "O2'" 1 
ATOM   8501  C  "C1'" . G   B 2 80  ? 8.593   17.962  27.255  1.00 64.46  ? 69  G   B "C1'" 1 
ATOM   8502  N  N9    . G   B 2 80  ? 8.739   18.732  26.023  1.00 62.98  ? 69  G   B N9    1 
ATOM   8503  C  C8    . G   B 2 80  ? 8.316   20.019  25.789  1.00 63.03  ? 69  G   B C8    1 
ATOM   8504  N  N7    . G   B 2 80  ? 8.579   20.434  24.580  1.00 63.00  ? 69  G   B N7    1 
ATOM   8505  C  C5    . G   B 2 80  ? 9.211   19.356  23.977  1.00 61.82  ? 69  G   B C5    1 
ATOM   8506  C  C6    . G   B 2 80  ? 9.731   19.212  22.664  1.00 61.54  ? 69  G   B C6    1 
ATOM   8507  O  O6    . G   B 2 80  ? 9.734   20.037  21.742  1.00 61.54  ? 69  G   B O6    1 
ATOM   8508  N  N1    . G   B 2 80  ? 10.291  17.953  22.470  1.00 61.40  ? 69  G   B N1    1 
ATOM   8509  C  C2    . G   B 2 80  ? 10.348  16.959  23.417  1.00 61.41  ? 69  G   B C2    1 
ATOM   8510  N  N2    . G   B 2 80  ? 10.930  15.811  23.039  1.00 61.06  ? 69  G   B N2    1 
ATOM   8511  N  N3    . G   B 2 80  ? 9.866   17.080  24.645  1.00 61.54  ? 69  G   B N3    1 
ATOM   8512  C  C4    . G   B 2 80  ? 9.315   18.296  24.853  1.00 61.87  ? 69  G   B C4    1 
ATOM   8513  P  P     . G   B 2 81  ? 12.436  19.088  30.011  1.00 61.67  ? 70  G   B P     1 
ATOM   8514  O  OP1   . G   B 2 81  ? 13.063  18.753  31.316  1.00 61.70  ? 70  G   B OP1   1 
ATOM   8515  O  OP2   . G   B 2 81  ? 12.343  20.509  29.588  1.00 61.47  ? 70  G   B OP2   1 
ATOM   8516  O  "O5'" . G   B 2 81  ? 13.180  18.258  28.875  1.00 59.42  ? 70  G   B "O5'" 1 
ATOM   8517  C  "C5'" . G   B 2 81  ? 13.386  16.841  29.027  1.00 58.60  ? 70  G   B "C5'" 1 
ATOM   8518  C  "C4'" . G   B 2 81  ? 14.058  16.262  27.805  1.00 57.73  ? 70  G   B "C4'" 1 
ATOM   8519  O  "O4'" . G   B 2 81  ? 13.146  16.286  26.674  1.00 57.63  ? 70  G   B "O4'" 1 
ATOM   8520  C  "C3'" . G   B 2 81  ? 15.280  17.000  27.285  1.00 57.15  ? 70  G   B "C3'" 1 
ATOM   8521  O  "O3'" . G   B 2 81  ? 16.440  16.777  28.081  1.00 57.27  ? 70  G   B "O3'" 1 
ATOM   8522  C  "C2'" . G   B 2 81  ? 15.365  16.465  25.863  1.00 56.16  ? 70  G   B "C2'" 1 
ATOM   8523  O  "O2'" . G   B 2 81  ? 15.905  15.167  25.743  1.00 54.67  ? 70  G   B "O2'" 1 
ATOM   8524  C  "C1'" . G   B 2 81  ? 13.887  16.448  25.473  1.00 56.49  ? 70  G   B "C1'" 1 
ATOM   8525  N  N9    . G   B 2 81  ? 13.462  17.682  24.819  1.00 56.01  ? 70  G   B N9    1 
ATOM   8526  C  C8    . G   B 2 81  ? 12.763  18.729  25.372  1.00 55.90  ? 70  G   B C8    1 
ATOM   8527  N  N7    . G   B 2 81  ? 12.541  19.698  24.527  1.00 55.67  ? 70  G   B N7    1 
ATOM   8528  C  C5    . G   B 2 81  ? 13.134  19.270  23.348  1.00 55.25  ? 70  G   B C5    1 
ATOM   8529  C  C6    . G   B 2 81  ? 13.216  19.899  22.079  1.00 54.97  ? 70  G   B C6    1 
ATOM   8530  O  O6    . G   B 2 81  ? 12.768  20.999  21.733  1.00 54.29  ? 70  G   B O6    1 
ATOM   8531  N  N1    . G   B 2 81  ? 13.908  19.113  21.162  1.00 55.19  ? 70  G   B N1    1 
ATOM   8532  C  C2    . G   B 2 81  ? 14.451  17.879  21.431  1.00 55.83  ? 70  G   B C2    1 
ATOM   8533  N  N2    . G   B 2 81  ? 15.081  17.272  20.414  1.00 56.87  ? 70  G   B N2    1 
ATOM   8534  N  N3    . G   B 2 81  ? 14.378  17.281  22.609  1.00 55.84  ? 70  G   B N3    1 
ATOM   8535  C  C4    . G   B 2 81  ? 13.710  18.028  23.513  1.00 55.68  ? 70  G   B C4    1 
ATOM   8536  P  P     . G   B 2 82  ? 17.508  17.956  28.293  1.00 56.51  ? 71  G   B P     1 
ATOM   8537  O  OP1   . G   B 2 82  ? 18.542  17.470  29.241  1.00 56.21  ? 71  G   B OP1   1 
ATOM   8538  O  OP2   . G   B 2 82  ? 16.768  19.208  28.595  1.00 55.85  ? 71  G   B OP2   1 
ATOM   8539  O  "O5'" . G   B 2 82  ? 18.173  18.094  26.853  1.00 56.21  ? 71  G   B "O5'" 1 
ATOM   8540  C  "C5'" . G   B 2 82  ? 19.018  17.045  26.351  1.00 56.86  ? 71  G   B "C5'" 1 
ATOM   8541  C  "C4'" . G   B 2 82  ? 19.347  17.264  24.895  1.00 57.24  ? 71  G   B "C4'" 1 
ATOM   8542  O  "O4'" . G   B 2 82  ? 18.130  17.441  24.125  1.00 57.47  ? 71  G   B "O4'" 1 
ATOM   8543  C  "C3'" . G   B 2 82  ? 20.150  18.509  24.563  1.00 57.61  ? 71  G   B "C3'" 1 
ATOM   8544  O  "O3'" . G   B 2 82  ? 21.528  18.367  24.889  1.00 58.75  ? 71  G   B "O3'" 1 
ATOM   8545  C  "C2'" . G   B 2 82  ? 19.878  18.651  23.071  1.00 57.43  ? 71  G   B "C2'" 1 
ATOM   8546  O  "O2'" . G   B 2 82  ? 20.648  17.800  22.247  1.00 57.61  ? 71  G   B "O2'" 1 
ATOM   8547  C  "C1'" . G   B 2 82  ? 18.400  18.264  23.000  1.00 57.43  ? 71  G   B "C1'" 1 
ATOM   8548  N  N9    . G   B 2 82  ? 17.503  19.417  23.032  1.00 57.31  ? 71  G   B N9    1 
ATOM   8549  C  C8    . G   B 2 82  ? 16.748  19.866  24.089  1.00 57.25  ? 71  G   B C8    1 
ATOM   8550  N  N7    . G   B 2 82  ? 16.051  20.932  23.804  1.00 56.18  ? 71  G   B N7    1 
ATOM   8551  C  C5    . G   B 2 82  ? 16.369  21.207  22.481  1.00 56.20  ? 71  G   B C5    1 
ATOM   8552  C  C6    . G   B 2 82  ? 15.920  22.246  21.624  1.00 56.39  ? 71  G   B C6    1 
ATOM   8553  O  O6    . G   B 2 82  ? 15.124  23.160  21.872  1.00 56.39  ? 71  G   B O6    1 
ATOM   8554  N  N1    . G   B 2 82  ? 16.495  22.151  20.360  1.00 56.61  ? 71  G   B N1    1 
ATOM   8555  C  C2    . G   B 2 82  ? 17.388  21.182  19.969  1.00 57.30  ? 71  G   B C2    1 
ATOM   8556  N  N2    . G   B 2 82  ? 17.833  21.258  18.706  1.00 57.55  ? 71  G   B N2    1 
ATOM   8557  N  N3    . G   B 2 82  ? 17.814  20.209  20.759  1.00 56.97  ? 71  G   B N3    1 
ATOM   8558  C  C4    . G   B 2 82  ? 17.265  20.281  21.991  1.00 56.78  ? 71  G   B C4    1 
ATOM   8559  P  P     . U   B 2 83  ? 22.354  19.629  25.424  1.00 58.92  ? 72  U   B P     1 
ATOM   8560  O  OP1   . U   B 2 83  ? 23.778  19.225  25.548  1.00 59.15  ? 72  U   B OP1   1 
ATOM   8561  O  OP2   . U   B 2 83  ? 21.642  20.182  26.605  1.00 57.99  ? 72  U   B OP2   1 
ATOM   8562  O  "O5'" . U   B 2 83  ? 22.221  20.672  24.227  1.00 59.56  ? 72  U   B "O5'" 1 
ATOM   8563  C  "C5'" . U   B 2 83  ? 22.901  20.452  22.978  1.00 60.61  ? 72  U   B "C5'" 1 
ATOM   8564  C  "C4'" . U   B 2 83  ? 22.582  21.549  21.988  1.00 61.28  ? 72  U   B "C4'" 1 
ATOM   8565  O  "O4'" . U   B 2 83  ? 21.157  21.598  21.725  1.00 61.19  ? 72  U   B "O4'" 1 
ATOM   8566  C  "C3'" . U   B 2 83  ? 22.906  22.968  22.420  1.00 62.74  ? 72  U   B "C3'" 1 
ATOM   8567  O  "O3'" . U   B 2 83  ? 24.297  23.240  22.288  1.00 64.13  ? 72  U   B "O3'" 1 
ATOM   8568  C  "C2'" . U   B 2 83  ? 22.053  23.782  21.456  1.00 63.12  ? 72  U   B "C2'" 1 
ATOM   8569  O  "O2'" . U   B 2 83  ? 22.645  23.954  20.184  1.00 64.72  ? 72  U   B "O2'" 1 
ATOM   8570  C  "C1'" . U   B 2 83  ? 20.791  22.920  21.362  1.00 62.34  ? 72  U   B "C1'" 1 
ATOM   8571  N  N1    . U   B 2 83  ? 19.718  23.381  22.257  1.00 63.03  ? 72  U   B N1    1 
ATOM   8572  C  C2    . U   B 2 83  ? 18.818  24.309  21.759  1.00 64.11  ? 72  U   B C2    1 
ATOM   8573  O  O2    . U   B 2 83  ? 18.867  24.735  20.618  1.00 63.86  ? 72  U   B O2    1 
ATOM   8574  N  N3    . U   B 2 83  ? 17.853  24.712  22.649  1.00 64.93  ? 72  U   B N3    1 
ATOM   8575  C  C4    . U   B 2 83  ? 17.700  24.303  23.958  1.00 65.15  ? 72  U   B C4    1 
ATOM   8576  O  O4    . U   B 2 83  ? 16.776  24.761  24.633  1.00 66.34  ? 72  U   B O4    1 
ATOM   8577  C  C5    . U   B 2 83  ? 18.673  23.352  24.402  1.00 64.62  ? 72  U   B C5    1 
ATOM   8578  C  C6    . U   B 2 83  ? 19.630  22.939  23.560  1.00 63.91  ? 72  U   B C6    1 
ATOM   8579  P  P     . A   B 2 84  ? 24.961  24.503  23.022  1.00 64.80  ? 73  A   B P     1 
ATOM   8580  O  OP1   . A   B 2 84  ? 24.038  24.981  24.085  1.00 64.23  ? 73  A   B OP1   1 
ATOM   8581  O  OP2   . A   B 2 84  ? 25.428  25.445  21.974  1.00 65.00  ? 73  A   B OP2   1 
ATOM   8582  O  "O5'" . A   B 2 84  ? 26.244  23.872  23.725  1.00 65.98  ? 73  A   B "O5'" 1 
ATOM   8583  C  "C5'" . A   B 2 84  ? 26.190  22.601  24.406  1.00 67.59  ? 73  A   B "C5'" 1 
ATOM   8584  C  "C4'" . A   B 2 84  ? 27.245  21.670  23.857  1.00 68.94  ? 73  A   B "C4'" 1 
ATOM   8585  O  "O4'" . A   B 2 84  ? 26.900  21.285  22.496  1.00 69.16  ? 73  A   B "O4'" 1 
ATOM   8586  C  "C3'" . A   B 2 84  ? 28.661  22.250  23.783  1.00 70.10  ? 73  A   B "C3'" 1 
ATOM   8587  O  "O3'" . A   B 2 84  ? 29.627  21.292  24.195  1.00 71.15  ? 73  A   B "O3'" 1 
ATOM   8588  C  "C2'" . A   B 2 84  ? 28.823  22.569  22.301  1.00 70.10  ? 73  A   B "C2'" 1 
ATOM   8589  O  "O2'" . A   B 2 84  ? 30.157  22.610  21.834  1.00 69.66  ? 73  A   B "O2'" 1 
ATOM   8590  C  "C1'" . A   B 2 84  ? 28.041  21.420  21.678  1.00 70.43  ? 73  A   B "C1'" 1 
ATOM   8591  N  N9    . A   B 2 84  ? 27.611  21.662  20.302  1.00 71.72  ? 73  A   B N9    1 
ATOM   8592  C  C8    . A   B 2 84  ? 26.656  22.537  19.846  1.00 72.24  ? 73  A   B C8    1 
ATOM   8593  N  N7    . A   B 2 84  ? 26.508  22.526  18.544  1.00 72.71  ? 73  A   B N7    1 
ATOM   8594  C  C5    . A   B 2 84  ? 27.427  21.581  18.112  1.00 72.89  ? 73  A   B C5    1 
ATOM   8595  C  C6    . A   B 2 84  ? 27.762  21.101  16.833  1.00 74.02  ? 73  A   B C6    1 
ATOM   8596  N  N6    . A   B 2 84  ? 27.183  21.527  15.708  1.00 74.88  ? 73  A   B N6    1 
ATOM   8597  N  N1    . A   B 2 84  ? 28.725  20.156  16.748  1.00 74.50  ? 73  A   B N1    1 
ATOM   8598  C  C2    . A   B 2 84  ? 29.305  19.727  17.879  1.00 73.53  ? 73  A   B C2    1 
ATOM   8599  N  N3    . A   B 2 84  ? 29.077  20.103  19.136  1.00 72.51  ? 73  A   B N3    1 
ATOM   8600  C  C4    . A   B 2 84  ? 28.120  21.047  19.184  1.00 72.24  ? 73  A   B C4    1 
ATOM   8601  P  P     . C   B 2 85  ? 30.950  21.771  24.946  1.00 71.19  ? 74  C   B P     1 
ATOM   8602  O  OP1   . C   B 2 85  ? 31.449  22.991  24.262  1.00 70.49  ? 74  C   B OP1   1 
ATOM   8603  O  OP2   . C   B 2 85  ? 31.844  20.595  25.098  1.00 70.67  ? 74  C   B OP2   1 
ATOM   8604  O  "O5'" . C   B 2 85  ? 30.400  22.204  26.376  1.00 71.37  ? 74  C   B "O5'" 1 
ATOM   8605  C  "C5'" . C   B 2 85  ? 29.659  21.289  27.204  1.00 71.80  ? 74  C   B "C5'" 1 
ATOM   8606  C  "C4'" . C   B 2 85  ? 29.624  21.792  28.627  1.00 72.05  ? 74  C   B "C4'" 1 
ATOM   8607  O  "O4'" . C   B 2 85  ? 30.983  22.045  29.084  1.00 71.62  ? 74  C   B "O4'" 1 
ATOM   8608  C  "C3'" . C   B 2 85  ? 28.862  23.099  28.838  1.00 72.64  ? 74  C   B "C3'" 1 
ATOM   8609  O  "O3'" . C   B 2 85  ? 28.182  23.126  30.090  1.00 74.24  ? 74  C   B "O3'" 1 
ATOM   8610  C  "C2'" . C   B 2 85  ? 29.977  24.138  28.833  1.00 72.12  ? 74  C   B "C2'" 1 
ATOM   8611  O  "O2'" . C   B 2 85  ? 29.637  25.343  29.487  1.00 71.76  ? 74  C   B "O2'" 1 
ATOM   8612  C  "C1'" . C   B 2 85  ? 31.082  23.374  29.557  1.00 72.05  ? 74  C   B "C1'" 1 
ATOM   8613  N  N1    . C   B 2 85  ? 32.444  23.873  29.290  1.00 72.19  ? 74  C   B N1    1 
ATOM   8614  C  C2    . C   B 2 85  ? 33.131  24.552  30.305  1.00 72.72  ? 74  C   B C2    1 
ATOM   8615  O  O2    . C   B 2 85  ? 32.577  24.714  31.403  1.00 73.23  ? 74  C   B O2    1 
ATOM   8616  N  N3    . C   B 2 85  ? 34.381  25.013  30.064  1.00 72.78  ? 74  C   B N3    1 
ATOM   8617  C  C4    . C   B 2 85  ? 34.944  24.819  28.869  1.00 72.91  ? 74  C   B C4    1 
ATOM   8618  N  N4    . C   B 2 85  ? 36.178  25.290  28.676  1.00 73.37  ? 74  C   B N4    1 
ATOM   8619  C  C5    . C   B 2 85  ? 34.268  24.132  27.819  1.00 72.35  ? 74  C   B C5    1 
ATOM   8620  C  C6    . C   B 2 85  ? 33.031  23.681  28.069  1.00 72.14  ? 74  C   B C6    1 
ATOM   8621  P  P     . C   B 2 86  ? 26.817  22.312  30.297  1.00 75.34  ? 75  C   B P     1 
ATOM   8622  O  OP1   . C   B 2 86  ? 26.475  21.635  29.017  1.00 74.98  ? 75  C   B OP1   1 
ATOM   8623  O  OP2   . C   B 2 86  ? 25.828  23.220  30.933  1.00 76.08  ? 75  C   B OP2   1 
ATOM   8624  O  "O5'" . C   B 2 86  ? 27.224  21.189  31.353  1.00 75.13  ? 75  C   B "O5'" 1 
ATOM   8625  C  "C5'" . C   B 2 86  ? 27.499  21.505  32.735  1.00 74.75  ? 75  C   B "C5'" 1 
ATOM   8626  C  "C4'" . C   B 2 86  ? 26.612  20.688  33.646  1.00 74.79  ? 75  C   B "C4'" 1 
ATOM   8627  O  "O4'" . C   B 2 86  ? 25.228  20.907  33.285  1.00 74.95  ? 75  C   B "O4'" 1 
ATOM   8628  C  "C3'" . C   B 2 86  ? 26.802  19.179  33.574  1.00 75.49  ? 75  C   B "C3'" 1 
ATOM   8629  O  "O3'" . C   B 2 86  ? 27.833  18.762  34.471  1.00 76.13  ? 75  C   B "O3'" 1 
ATOM   8630  C  "C2'" . C   B 2 86  ? 25.439  18.634  34.001  1.00 75.93  ? 75  C   B "C2'" 1 
ATOM   8631  O  "O2'" . C   B 2 86  ? 25.321  18.366  35.385  1.00 75.91  ? 75  C   B "O2'" 1 
ATOM   8632  C  "C1'" . C   B 2 86  ? 24.473  19.742  33.561  1.00 76.06  ? 75  C   B "C1'" 1 
ATOM   8633  N  N1    . C   B 2 86  ? 23.652  19.409  32.376  1.00 76.57  ? 75  C   B N1    1 
ATOM   8634  C  C2    . C   B 2 86  ? 22.688  18.397  32.484  1.00 76.43  ? 75  C   B C2    1 
ATOM   8635  O  O2    . C   B 2 86  ? 22.564  17.798  33.564  1.00 75.82  ? 75  C   B O2    1 
ATOM   8636  N  N3    . C   B 2 86  ? 21.926  18.091  31.407  1.00 77.03  ? 75  C   B N3    1 
ATOM   8637  C  C4    . C   B 2 86  ? 22.091  18.758  30.262  1.00 76.96  ? 75  C   B C4    1 
ATOM   8638  N  N4    . C   B 2 86  ? 21.318  18.424  29.226  1.00 76.97  ? 75  C   B N4    1 
ATOM   8639  C  C5    . C   B 2 86  ? 23.058  19.797  30.127  1.00 76.85  ? 75  C   B C5    1 
ATOM   8640  C  C6    . C   B 2 86  ? 23.807  20.089  31.199  1.00 76.97  ? 75  C   B C6    1 
ATOM   8641  P  P     . A   B 2 87  ? 29.144  17.987  33.938  1.00 76.08  ? 76  A   B P     1 
ATOM   8642  O  OP1   . A   B 2 87  ? 30.213  18.133  34.958  1.00 75.86  ? 76  A   B OP1   1 
ATOM   8643  O  OP2   . A   B 2 87  ? 29.409  18.412  32.540  1.00 77.10  ? 76  A   B OP2   1 
ATOM   8644  O  "O5'" . A   B 2 87  ? 28.689  16.460  33.933  1.00 76.03  ? 76  A   B "O5'" 1 
ATOM   8645  C  "C5'" . A   B 2 87  ? 28.291  15.786  35.142  1.00 76.76  ? 76  A   B "C5'" 1 
ATOM   8646  C  "C4'" . A   B 2 87  ? 27.161  14.825  34.859  1.00 77.34  ? 76  A   B "C4'" 1 
ATOM   8647  O  "O4'" . A   B 2 87  ? 26.066  15.536  34.224  1.00 78.06  ? 76  A   B "O4'" 1 
ATOM   8648  C  "C3'" . A   B 2 87  ? 27.478  13.684  33.897  1.00 77.94  ? 76  A   B "C3'" 1 
ATOM   8649  O  "O3'" . A   B 2 87  ? 28.110  12.596  34.564  1.00 78.44  ? 76  A   B "O3'" 1 
ATOM   8650  C  "C2'" . A   B 2 87  ? 26.095  13.315  33.373  1.00 77.77  ? 76  A   B "C2'" 1 
ATOM   8651  O  "O2'" . A   B 2 87  ? 25.395  12.452  34.244  1.00 77.10  ? 76  A   B "O2'" 1 
ATOM   8652  C  "C1'" . A   B 2 87  ? 25.410  14.681  33.301  1.00 78.31  ? 76  A   B "C1'" 1 
ATOM   8653  N  N9    . A   B 2 87  ? 25.451  15.304  31.975  1.00 78.87  ? 76  A   B N9    1 
ATOM   8654  C  C8    . A   B 2 87  ? 26.492  15.986  31.395  1.00 78.12  ? 76  A   B C8    1 
ATOM   8655  N  N7    . A   B 2 87  ? 26.224  16.437  30.193  1.00 77.98  ? 76  A   B N7    1 
ATOM   8656  C  C5    . A   B 2 87  ? 24.920  16.023  29.965  1.00 78.28  ? 76  A   B C5    1 
ATOM   8657  C  C6    . A   B 2 87  ? 24.053  16.184  28.867  1.00 77.71  ? 76  A   B C6    1 
ATOM   8658  N  N6    . A   B 2 87  ? 24.387  16.833  27.749  1.00 77.27  ? 76  A   B N6    1 
ATOM   8659  N  N1    . A   B 2 87  ? 22.816  15.649  28.960  1.00 78.54  ? 76  A   B N1    1 
ATOM   8660  C  C2    . A   B 2 87  ? 22.480  14.999  30.083  1.00 79.22  ? 76  A   B C2    1 
ATOM   8661  N  N3    . A   B 2 87  ? 23.206  14.781  31.179  1.00 80.07  ? 76  A   B N3    1 
ATOM   8662  C  C4    . A   B 2 87  ? 24.430  15.325  31.055  1.00 79.24  ? 76  A   B C4    1 
ATOM   8663  N  N     . MET C 1 21  ? -32.867 41.294  49.556  1.00 126.49 ? 1   MET D N     1 
ATOM   8664  C  CA    . MET C 1 21  ? -32.261 40.161  50.323  1.00 126.72 ? 1   MET D CA    1 
ATOM   8665  C  C     . MET C 1 21  ? -32.347 38.858  49.525  1.00 125.75 ? 1   MET D C     1 
ATOM   8666  O  O     . MET C 1 21  ? -33.441 38.438  49.142  1.00 125.57 ? 1   MET D O     1 
ATOM   8667  C  CB    . MET C 1 21  ? -32.968 39.985  51.676  1.00 128.49 ? 1   MET D CB    1 
ATOM   8668  C  CG    . MET C 1 21  ? -32.112 39.317  52.745  1.00 130.48 ? 1   MET D CG    1 
ATOM   8669  S  SD    . MET C 1 21  ? -33.038 38.420  54.013  1.00 132.04 ? 1   MET D SD    1 
ATOM   8670  C  CE    . MET C 1 21  ? -34.417 39.519  54.327  1.00 130.49 ? 1   MET D CE    1 
ATOM   8671  N  N     . GLN C 1 22  ? -31.196 38.233  49.272  1.00 125.28 ? 2   GLN D N     1 
ATOM   8672  C  CA    . GLN C 1 22  ? -31.153 36.911  48.631  1.00 126.28 ? 2   GLN D CA    1 
ATOM   8673  C  C     . GLN C 1 22  ? -31.688 35.844  49.589  1.00 125.92 ? 2   GLN D C     1 
ATOM   8674  O  O     . GLN C 1 22  ? -31.514 35.951  50.805  1.00 126.44 ? 2   GLN D O     1 
ATOM   8675  C  CB    . GLN C 1 22  ? -29.728 36.554  48.182  1.00 126.66 ? 2   GLN D CB    1 
ATOM   8676  C  CG    . GLN C 1 22  ? -29.259 37.289  46.929  1.00 127.03 ? 2   GLN D CG    1 
ATOM   8677  C  CD    . GLN C 1 22  ? -29.830 36.729  45.631  1.00 127.49 ? 2   GLN D CD    1 
ATOM   8678  O  OE1   . GLN C 1 22  ? -30.643 35.801  45.632  1.00 127.96 ? 2   GLN D OE1   1 
ATOM   8679  N  NE2   . GLN C 1 22  ? -29.400 37.298  44.511  1.00 126.61 ? 2   GLN D NE2   1 
ATOM   8680  N  N     . GLU C 1 23  ? -32.337 34.823  49.031  1.00 125.26 ? 3   GLU D N     1 
ATOM   8681  C  CA    . GLU C 1 23  ? -32.980 33.774  49.829  1.00 125.12 ? 3   GLU D CA    1 
ATOM   8682  C  C     . GLU C 1 23  ? -31.969 32.875  50.547  1.00 124.95 ? 3   GLU D C     1 
ATOM   8683  O  O     . GLU C 1 23  ? -32.213 32.466  51.683  1.00 126.33 ? 3   GLU D O     1 
ATOM   8684  C  CB    . GLU C 1 23  ? -33.915 32.924  48.960  1.00 125.62 ? 3   GLU D CB    1 
ATOM   8685  C  CG    . GLU C 1 23  ? -34.831 31.999  49.754  1.00 125.70 ? 3   GLU D CG    1 
ATOM   8686  C  CD    . GLU C 1 23  ? -35.952 31.404  48.920  1.00 126.10 ? 3   GLU D CD    1 
ATOM   8687  O  OE1   . GLU C 1 23  ? -35.785 31.262  47.689  1.00 127.56 ? 3   GLU D OE1   1 
ATOM   8688  O  OE2   . GLU C 1 23  ? -37.006 31.070  49.501  1.00 125.78 ? 3   GLU D OE2   1 
ATOM   8689  N  N     . GLN C 1 24  ? -30.851 32.572  49.887  1.00 123.14 ? 4   GLN D N     1 
ATOM   8690  C  CA    . GLN C 1 24  ? -29.782 31.769  50.487  1.00 123.50 ? 4   GLN D CA    1 
ATOM   8691  C  C     . GLN C 1 24  ? -28.733 32.662  51.159  1.00 124.52 ? 4   GLN D C     1 
ATOM   8692  O  O     . GLN C 1 24  ? -28.427 33.751  50.666  1.00 123.16 ? 4   GLN D O     1 
ATOM   8693  C  CB    . GLN C 1 24  ? -29.118 30.887  49.426  1.00 123.65 ? 4   GLN D CB    1 
ATOM   8694  C  CG    . GLN C 1 24  ? -28.275 29.759  50.008  1.00 124.45 ? 4   GLN D CG    1 
ATOM   8695  C  CD    . GLN C 1 24  ? -27.672 28.854  48.948  1.00 124.63 ? 4   GLN D CD    1 
ATOM   8696  O  OE1   . GLN C 1 24  ? -27.340 29.295  47.847  1.00 124.98 ? 4   GLN D OE1   1 
ATOM   8697  N  NE2   . GLN C 1 24  ? -27.517 27.578  49.284  1.00 124.36 ? 4   GLN D NE2   1 
ATOM   8698  N  N     . TYR C 1 25  ? -28.193 32.185  52.282  1.00 125.56 ? 5   TYR D N     1 
ATOM   8699  C  CA    . TYR C 1 25  ? -27.101 32.864  52.994  1.00 124.51 ? 5   TYR D CA    1 
ATOM   8700  C  C     . TYR C 1 25  ? -25.789 32.653  52.238  1.00 123.64 ? 5   TYR D C     1 
ATOM   8701  O  O     . TYR C 1 25  ? -25.456 31.521  51.881  1.00 121.96 ? 5   TYR D O     1 
ATOM   8702  C  CB    . TYR C 1 25  ? -26.985 32.335  54.432  1.00 124.77 ? 5   TYR D CB    1 
ATOM   8703  C  CG    . TYR C 1 25  ? -25.768 32.828  55.196  1.00 125.00 ? 5   TYR D CG    1 
ATOM   8704  C  CD1   . TYR C 1 25  ? -25.535 34.192  55.374  1.00 125.38 ? 5   TYR D CD1   1 
ATOM   8705  C  CD2   . TYR C 1 25  ? -24.854 31.927  55.752  1.00 124.69 ? 5   TYR D CD2   1 
ATOM   8706  C  CE1   . TYR C 1 25  ? -24.424 34.647  56.075  1.00 125.62 ? 5   TYR D CE1   1 
ATOM   8707  C  CE2   . TYR C 1 25  ? -23.741 32.372  56.456  1.00 125.33 ? 5   TYR D CE2   1 
ATOM   8708  C  CZ    . TYR C 1 25  ? -23.529 33.732  56.615  1.00 125.86 ? 5   TYR D CZ    1 
ATOM   8709  O  OH    . TYR C 1 25  ? -22.427 34.177  57.313  1.00 125.50 ? 5   TYR D OH    1 
ATOM   8710  N  N     . ARG C 1 26  ? -25.050 33.741  52.012  1.00 124.12 ? 6   ARG D N     1 
ATOM   8711  C  CA    . ARG C 1 26  ? -23.833 33.715  51.194  1.00 125.38 ? 6   ARG D CA    1 
ATOM   8712  C  C     . ARG C 1 26  ? -22.755 34.641  51.793  1.00 125.20 ? 6   ARG D C     1 
ATOM   8713  O  O     . ARG C 1 26  ? -22.766 35.848  51.545  1.00 123.88 ? 6   ARG D O     1 
ATOM   8714  C  CB    . ARG C 1 26  ? -24.180 34.110  49.753  1.00 126.93 ? 6   ARG D CB    1 
ATOM   8715  C  CG    . ARG C 1 26  ? -23.167 33.664  48.706  1.00 127.96 ? 6   ARG D CG    1 
ATOM   8716  C  CD    . ARG C 1 26  ? -23.788 33.624  47.315  1.00 128.19 ? 6   ARG D CD    1 
ATOM   8717  N  NE    . ARG C 1 26  ? -24.803 32.572  47.192  1.00 128.37 ? 6   ARG D NE    1 
ATOM   8718  C  CZ    . ARG C 1 26  ? -25.603 32.387  46.139  1.00 127.38 ? 6   ARG D CZ    1 
ATOM   8719  N  NH1   . ARG C 1 26  ? -25.535 33.181  45.070  1.00 127.71 ? 6   ARG D NH1   1 
ATOM   8720  N  NH2   . ARG C 1 26  ? -26.487 31.390  46.155  1.00 126.13 ? 6   ARG D NH2   1 
ATOM   8721  N  N     . PRO C 1 27  ? -21.822 34.075  52.591  1.00 126.16 ? 7   PRO D N     1 
ATOM   8722  C  CA    . PRO C 1 27  ? -20.861 34.898  53.340  1.00 125.71 ? 7   PRO D CA    1 
ATOM   8723  C  C     . PRO C 1 27  ? -19.734 35.524  52.510  1.00 124.47 ? 7   PRO D C     1 
ATOM   8724  O  O     . PRO C 1 27  ? -19.305 36.633  52.828  1.00 122.85 ? 7   PRO D O     1 
ATOM   8725  C  CB    . PRO C 1 27  ? -20.288 33.916  54.365  1.00 127.09 ? 7   PRO D CB    1 
ATOM   8726  C  CG    . PRO C 1 27  ? -20.386 32.591  53.705  1.00 127.14 ? 7   PRO D CG    1 
ATOM   8727  C  CD    . PRO C 1 27  ? -21.611 32.635  52.838  1.00 126.96 ? 7   PRO D CD    1 
ATOM   8728  N  N     . GLU C 1 28  ? -19.255 34.830  51.476  1.00 125.11 ? 8   GLU D N     1 
ATOM   8729  C  CA    . GLU C 1 28  ? -18.199 35.373  50.596  1.00 125.44 ? 8   GLU D CA    1 
ATOM   8730  C  C     . GLU C 1 28  ? -18.568 36.713  49.930  1.00 125.31 ? 8   GLU D C     1 
ATOM   8731  O  O     . GLU C 1 28  ? -17.685 37.526  49.645  1.00 124.91 ? 8   GLU D O     1 
ATOM   8732  C  CB    . GLU C 1 28  ? -17.754 34.353  49.531  1.00 125.89 ? 8   GLU D CB    1 
ATOM   8733  C  CG    . GLU C 1 28  ? -18.827 33.889  48.546  1.00 127.34 ? 8   GLU D CG    1 
ATOM   8734  C  CD    . GLU C 1 28  ? -19.333 32.482  48.822  1.00 128.39 ? 8   GLU D CD    1 
ATOM   8735  O  OE1   . GLU C 1 28  ? -19.675 32.184  49.985  1.00 129.35 ? 8   GLU D OE1   1 
ATOM   8736  O  OE2   . GLU C 1 28  ? -19.395 31.675  47.871  1.00 129.15 ? 8   GLU D OE2   1 
ATOM   8737  N  N     . GLU C 1 29  ? -19.863 36.928  49.692  1.00 125.27 ? 9   GLU D N     1 
ATOM   8738  C  CA    . GLU C 1 29  ? -20.380 38.202  49.181  1.00 125.02 ? 9   GLU D CA    1 
ATOM   8739  C  C     . GLU C 1 29  ? -20.639 39.210  50.307  1.00 124.08 ? 9   GLU D C     1 
ATOM   8740  O  O     . GLU C 1 29  ? -20.276 40.382  50.190  1.00 123.95 ? 9   GLU D O     1 
ATOM   8741  C  CB    . GLU C 1 29  ? -21.678 37.973  48.398  1.00 125.41 ? 9   GLU D CB    1 
ATOM   8742  C  CG    . GLU C 1 29  ? -21.542 37.008  47.227  1.00 125.18 ? 9   GLU D CG    1 
ATOM   8743  C  CD    . GLU C 1 29  ? -22.788 36.938  46.360  1.00 124.64 ? 9   GLU D CD    1 
ATOM   8744  O  OE1   . GLU C 1 29  ? -23.905 37.157  46.876  1.00 124.05 ? 9   GLU D OE1   1 
ATOM   8745  O  OE2   . GLU C 1 29  ? -22.650 36.656  45.152  1.00 124.90 ? 9   GLU D OE2   1 
ATOM   8746  N  N     . ILE C 1 30  ? -21.263 38.743  51.388  1.00 123.01 ? 10  ILE D N     1 
ATOM   8747  C  CA    . ILE C 1 30  ? -21.712 39.612  52.486  1.00 121.55 ? 10  ILE D CA    1 
ATOM   8748  C  C     . ILE C 1 30  ? -20.565 40.102  53.378  1.00 118.81 ? 10  ILE D C     1 
ATOM   8749  O  O     . ILE C 1 30  ? -20.473 41.296  53.664  1.00 117.81 ? 10  ILE D O     1 
ATOM   8750  C  CB    . ILE C 1 30  ? -22.776 38.902  53.366  1.00 122.98 ? 10  ILE D CB    1 
ATOM   8751  C  CG1   . ILE C 1 30  ? -24.044 38.613  52.548  1.00 124.49 ? 10  ILE D CG1   1 
ATOM   8752  C  CG2   . ILE C 1 30  ? -23.134 39.742  54.592  1.00 122.71 ? 10  ILE D CG2   1 
ATOM   8753  C  CD1   . ILE C 1 30  ? -24.947 37.554  53.150  1.00 125.00 ? 10  ILE D CD1   1 
ATOM   8754  N  N     . GLU C 1 31  ? -19.709 39.182  53.817  1.00 116.72 ? 11  GLU D N     1 
ATOM   8755  C  CA    . GLU C 1 31  ? -18.736 39.464  54.884  1.00 115.16 ? 11  GLU D CA    1 
ATOM   8756  C  C     . GLU C 1 31  ? -17.631 40.449  54.491  1.00 114.62 ? 11  GLU D C     1 
ATOM   8757  O  O     . GLU C 1 31  ? -17.282 41.326  55.283  1.00 115.03 ? 11  GLU D O     1 
ATOM   8758  C  CB    . GLU C 1 31  ? -18.116 38.162  55.412  1.00 113.48 ? 11  GLU D CB    1 
ATOM   8759  C  CG    . GLU C 1 31  ? -19.123 37.228  56.072  1.00 111.66 ? 11  GLU D CG    1 
ATOM   8760  C  CD    . GLU C 1 31  ? -18.487 36.026  56.746  1.00 110.13 ? 11  GLU D CD    1 
ATOM   8761  O  OE1   . GLU C 1 31  ? -17.310 35.713  56.461  1.00 108.05 ? 11  GLU D OE1   1 
ATOM   8762  O  OE2   . GLU C 1 31  ? -19.175 35.382  57.566  1.00 108.74 ? 11  GLU D OE2   1 
ATOM   8763  N  N     . SER C 1 32  ? -17.094 40.311  53.278  1.00 113.17 ? 12  SER D N     1 
ATOM   8764  C  CA    . SER C 1 32  ? -16.042 41.215  52.782  1.00 111.42 ? 12  SER D CA    1 
ATOM   8765  C  C     . SER C 1 32  ? -16.523 42.664  52.603  1.00 109.90 ? 12  SER D C     1 
ATOM   8766  O  O     . SER C 1 32  ? -15.729 43.600  52.726  1.00 108.93 ? 12  SER D O     1 
ATOM   8767  C  CB    . SER C 1 32  ? -15.447 40.687  51.472  1.00 111.11 ? 12  SER D CB    1 
ATOM   8768  O  OG    . SER C 1 32  ? -16.454 40.472  50.500  1.00 112.60 ? 12  SER D OG    1 
ATOM   8769  N  N     . LYS C 1 33  ? -17.814 42.838  52.313  1.00 109.05 ? 13  LYS D N     1 
ATOM   8770  C  CA    . LYS C 1 33  ? -18.441 44.164  52.244  1.00 109.31 ? 13  LYS D CA    1 
ATOM   8771  C  C     . LYS C 1 33  ? -18.550 44.811  53.628  1.00 108.50 ? 13  LYS D C     1 
ATOM   8772  O  O     . LYS C 1 33  ? -18.247 45.996  53.786  1.00 109.78 ? 13  LYS D O     1 
ATOM   8773  C  CB    . LYS C 1 33  ? -19.834 44.062  51.607  1.00 109.81 ? 13  LYS D CB    1 
ATOM   8774  C  CG    . LYS C 1 33  ? -20.533 45.394  51.361  1.00 110.13 ? 13  LYS D CG    1 
ATOM   8775  C  CD    . LYS C 1 33  ? -21.952 45.190  50.852  1.00 110.63 ? 13  LYS D CD    1 
ATOM   8776  C  CE    . LYS C 1 33  ? -22.768 46.470  50.935  1.00 110.77 ? 13  LYS D CE    1 
ATOM   8777  N  NZ    . LYS C 1 33  ? -24.195 46.246  50.573  1.00 110.89 ? 13  LYS D NZ    1 
ATOM   8778  N  N     . VAL C 1 34  ? -18.990 44.031  54.615  1.00 107.11 ? 14  VAL D N     1 
ATOM   8779  C  CA    . VAL C 1 34  ? -19.176 44.523  55.989  1.00 106.24 ? 14  VAL D CA    1 
ATOM   8780  C  C     . VAL C 1 34  ? -17.828 44.849  56.652  1.00 104.71 ? 14  VAL D C     1 
ATOM   8781  O  O     . VAL C 1 34  ? -17.730 45.822  57.403  1.00 104.71 ? 14  VAL D O     1 
ATOM   8782  C  CB    . VAL C 1 34  ? -19.996 43.521  56.846  1.00 107.62 ? 14  VAL D CB    1 
ATOM   8783  C  CG1   . VAL C 1 34  ? -20.052 43.946  58.311  1.00 108.09 ? 14  VAL D CG1   1 
ATOM   8784  C  CG2   . VAL C 1 34  ? -21.411 43.382  56.294  1.00 108.30 ? 14  VAL D CG2   1 
ATOM   8785  N  N     . GLN C 1 35  ? -16.806 44.038  56.377  1.00 103.33 ? 15  GLN D N     1 
ATOM   8786  C  CA    . GLN C 1 35  ? -15.430 44.333  56.808  1.00 102.61 ? 15  GLN D CA    1 
ATOM   8787  C  C     . GLN C 1 35  ? -14.915 45.638  56.203  1.00 103.70 ? 15  GLN D C     1 
ATOM   8788  O  O     . GLN C 1 35  ? -14.304 46.451  56.899  1.00 102.61 ? 15  GLN D O     1 
ATOM   8789  C  CB    . GLN C 1 35  ? -14.482 43.196  56.418  1.00 101.49 ? 15  GLN D CB    1 
ATOM   8790  C  CG    . GLN C 1 35  ? -14.671 41.920  57.221  1.00 101.12 ? 15  GLN D CG    1 
ATOM   8791  C  CD    . GLN C 1 35  ? -14.005 40.715  56.581  1.00 101.45 ? 15  GLN D CD    1 
ATOM   8792  O  OE1   . GLN C 1 35  ? -13.101 40.850  55.754  1.00 100.82 ? 15  GLN D OE1   1 
ATOM   8793  N  NE2   . GLN C 1 35  ? -14.449 39.525  56.967  1.00 102.38 ? 15  GLN D NE2   1 
ATOM   8794  N  N     . LEU C 1 36  ? -15.166 45.820  54.907  1.00 106.19 ? 16  LEU D N     1 
ATOM   8795  C  CA    . LEU C 1 36  ? -14.778 47.037  54.186  1.00 107.82 ? 16  LEU D CA    1 
ATOM   8796  C  C     . LEU C 1 36  ? -15.516 48.285  54.689  1.00 105.21 ? 16  LEU D C     1 
ATOM   8797  O  O     . LEU C 1 36  ? -14.954 49.382  54.681  1.00 104.74 ? 16  LEU D O     1 
ATOM   8798  C  CB    . LEU C 1 36  ? -15.012 46.856  52.678  1.00 110.68 ? 16  LEU D CB    1 
ATOM   8799  C  CG    . LEU C 1 36  ? -14.540 47.954  51.717  1.00 113.00 ? 16  LEU D CG    1 
ATOM   8800  C  CD1   . LEU C 1 36  ? -13.046 48.215  51.845  1.00 113.59 ? 16  LEU D CD1   1 
ATOM   8801  C  CD2   . LEU C 1 36  ? -14.894 47.570  50.287  1.00 113.68 ? 16  LEU D CD2   1 
ATOM   8802  N  N     . HIS C 1 37  ? -16.768 48.112  55.116  1.00 102.60 ? 17  HIS D N     1 
ATOM   8803  C  CA    . HIS C 1 37  ? -17.554 49.199  55.709  1.00 101.81 ? 17  HIS D CA    1 
ATOM   8804  C  C     . HIS C 1 37  ? -16.939 49.710  57.018  1.00 100.99 ? 17  HIS D C     1 
ATOM   8805  O  O     . HIS C 1 37  ? -16.839 50.923  57.222  1.00 99.33  ? 17  HIS D O     1 
ATOM   8806  C  CB    . HIS C 1 37  ? -19.004 48.749  55.946  1.00 102.16 ? 17  HIS D CB    1 
ATOM   8807  C  CG    . HIS C 1 37  ? -19.857 49.778  56.622  1.00 102.44 ? 17  HIS D CG    1 
ATOM   8808  N  ND1   . HIS C 1 37  ? -20.038 49.811  57.988  1.00 101.93 ? 17  HIS D ND1   1 
ATOM   8809  C  CD2   . HIS C 1 37  ? -20.574 50.812  56.123  1.00 102.44 ? 17  HIS D CD2   1 
ATOM   8810  C  CE1   . HIS C 1 37  ? -20.831 50.820  58.301  1.00 101.73 ? 17  HIS D CE1   1 
ATOM   8811  N  NE2   . HIS C 1 37  ? -21.170 51.444  57.187  1.00 102.00 ? 17  HIS D NE2   1 
ATOM   8812  N  N     . TRP C 1 38  ? -16.536 48.785  57.891  1.00 101.09 ? 18  TRP D N     1 
ATOM   8813  C  CA    . TRP C 1 38  ? -15.924 49.136  59.183  1.00 100.25 ? 18  TRP D CA    1 
ATOM   8814  C  C     . TRP C 1 38  ? -14.584 49.864  59.029  1.00 101.73 ? 18  TRP D C     1 
ATOM   8815  O  O     . TRP C 1 38  ? -14.276 50.762  59.815  1.00 101.56 ? 18  TRP D O     1 
ATOM   8816  C  CB    . TRP C 1 38  ? -15.725 47.893  60.067  1.00 98.14  ? 18  TRP D CB    1 
ATOM   8817  C  CG    . TRP C 1 38  ? -16.996 47.214  60.520  1.00 96.67  ? 18  TRP D CG    1 
ATOM   8818  C  CD1   . TRP C 1 38  ? -18.195 47.809  60.806  1.00 96.28  ? 18  TRP D CD1   1 
ATOM   8819  C  CD2   . TRP C 1 38  ? -17.176 45.814  60.770  1.00 95.53  ? 18  TRP D CD2   1 
ATOM   8820  N  NE1   . TRP C 1 38  ? -19.113 46.864  61.200  1.00 95.46  ? 18  TRP D NE1   1 
ATOM   8821  C  CE2   . TRP C 1 38  ? -18.515 45.632  61.189  1.00 95.36  ? 18  TRP D CE2   1 
ATOM   8822  C  CE3   . TRP C 1 38  ? -16.339 44.693  60.673  1.00 95.03  ? 18  TRP D CE3   1 
ATOM   8823  C  CZ2   . TRP C 1 38  ? -19.037 44.371  61.513  1.00 94.94  ? 18  TRP D CZ2   1 
ATOM   8824  C  CZ3   . TRP C 1 38  ? -16.858 43.437  60.994  1.00 94.49  ? 18  TRP D CZ3   1 
ATOM   8825  C  CH2   . TRP C 1 38  ? -18.197 43.289  61.406  1.00 94.47  ? 18  TRP D CH2   1 
ATOM   8826  N  N     . ASP C 1 39  ? -13.799 49.473  58.023  1.00 104.03 ? 19  ASP D N     1 
ATOM   8827  C  CA    . ASP C 1 39  ? -12.490 50.088  57.759  1.00 105.33 ? 19  ASP D CA    1 
ATOM   8828  C  C     . ASP C 1 39  ? -12.606 51.539  57.284  1.00 106.69 ? 19  ASP D C     1 
ATOM   8829  O  O     . ASP C 1 39  ? -11.876 52.408  57.765  1.00 107.63 ? 19  ASP D O     1 
ATOM   8830  C  CB    . ASP C 1 39  ? -11.696 49.270  56.727  1.00 105.55 ? 19  ASP D CB    1 
ATOM   8831  C  CG    . ASP C 1 39  ? -11.253 47.911  57.258  1.00 106.19 ? 19  ASP D CG    1 
ATOM   8832  O  OD1   . ASP C 1 39  ? -11.815 47.434  58.267  1.00 107.58 ? 19  ASP D OD1   1 
ATOM   8833  O  OD2   . ASP C 1 39  ? -10.337 47.313  56.656  1.00 106.36 ? 19  ASP D OD2   1 
ATOM   8834  N  N     . GLU C 1 40  ? -13.518 51.790  56.344  1.00 107.92 ? 20  GLU D N     1 
ATOM   8835  C  CA    . GLU C 1 40  ? -13.702 53.131  55.771  1.00 108.96 ? 20  GLU D CA    1 
ATOM   8836  C  C     . GLU C 1 40  ? -14.391 54.094  56.738  1.00 107.77 ? 20  GLU D C     1 
ATOM   8837  O  O     . GLU C 1 40  ? -13.954 55.236  56.889  1.00 107.10 ? 20  GLU D O     1 
ATOM   8838  C  CB    . GLU C 1 40  ? -14.478 53.059  54.452  1.00 110.75 ? 20  GLU D CB    1 
ATOM   8839  C  CG    . GLU C 1 40  ? -13.711 52.359  53.338  1.00 112.54 ? 20  GLU D CG    1 
ATOM   8840  C  CD    . GLU C 1 40  ? -14.423 52.387  51.994  1.00 114.06 ? 20  GLU D CD    1 
ATOM   8841  O  OE1   . GLU C 1 40  ? -15.597 52.811  51.930  1.00 115.91 ? 20  GLU D OE1   1 
ATOM   8842  O  OE2   . GLU C 1 40  ? -13.799 51.975  50.992  1.00 113.83 ? 20  GLU D OE2   1 
ATOM   8843  N  N     . LYS C 1 41  ? -15.457 53.631  57.388  1.00 107.59 ? 21  LYS D N     1 
ATOM   8844  C  CA    . LYS C 1 41  ? -16.187 54.449  58.367  1.00 108.38 ? 21  LYS D CA    1 
ATOM   8845  C  C     . LYS C 1 41  ? -15.455 54.633  59.703  1.00 106.53 ? 21  LYS D C     1 
ATOM   8846  O  O     . LYS C 1 41  ? -15.801 55.543  60.459  1.00 105.31 ? 21  LYS D O     1 
ATOM   8847  C  CB    . LYS C 1 41  ? -17.585 53.868  58.626  1.00 110.69 ? 21  LYS D CB    1 
ATOM   8848  C  CG    . LYS C 1 41  ? -18.499 53.830  57.408  1.00 113.56 ? 21  LYS D CG    1 
ATOM   8849  C  CD    . LYS C 1 41  ? -18.766 55.220  56.846  1.00 115.99 ? 21  LYS D CD    1 
ATOM   8850  C  CE    . LYS C 1 41  ? -19.920 55.227  55.855  1.00 118.12 ? 21  LYS D CE    1 
ATOM   8851  N  NZ    . LYS C 1 41  ? -21.250 55.248  56.526  1.00 119.37 ? 21  LYS D NZ    1 
ATOM   8852  N  N     . ARG C 1 42  ? -14.468 53.776  59.990  1.00 105.49 ? 22  ARG D N     1 
ATOM   8853  C  CA    . ARG C 1 42  ? -13.683 53.818  61.236  1.00 104.06 ? 22  ARG D CA    1 
ATOM   8854  C  C     . ARG C 1 42  ? -14.591 53.621  62.453  1.00 102.26 ? 22  ARG D C     1 
ATOM   8855  O  O     . ARG C 1 42  ? -14.689 54.488  63.327  1.00 103.26 ? 22  ARG D O     1 
ATOM   8856  C  CB    . ARG C 1 42  ? -12.858 55.114  61.347  1.00 104.98 ? 22  ARG D CB    1 
ATOM   8857  C  CG    . ARG C 1 42  ? -11.883 55.344  60.200  1.00 105.31 ? 22  ARG D CG    1 
ATOM   8858  C  CD    . ARG C 1 42  ? -11.240 56.722  60.281  1.00 104.75 ? 22  ARG D CD    1 
ATOM   8859  N  NE    . ARG C 1 42  ? -10.388 57.004  59.123  1.00 103.97 ? 22  ARG D NE    1 
ATOM   8860  C  CZ    . ARG C 1 42  ? -9.144  56.551  58.939  1.00 102.85 ? 22  ARG D CZ    1 
ATOM   8861  N  NH1   . ARG C 1 42  ? -8.547  55.763  59.834  1.00 102.44 ? 22  ARG D NH1   1 
ATOM   8862  N  NH2   . ARG C 1 42  ? -8.483  56.888  57.834  1.00 102.61 ? 22  ARG D NH2   1 
ATOM   8863  N  N     . THR C 1 43  ? -15.254 52.467  62.487  1.00 99.74  ? 23  THR D N     1 
ATOM   8864  C  CA    . THR C 1 43  ? -16.261 52.161  63.506  1.00 98.57  ? 23  THR D CA    1 
ATOM   8865  C  C     . THR C 1 43  ? -15.640 51.944  64.887  1.00 97.19  ? 23  THR D C     1 
ATOM   8866  O  O     . THR C 1 43  ? -16.134 52.485  65.879  1.00 97.01  ? 23  THR D O     1 
ATOM   8867  C  CB    . THR C 1 43  ? -17.090 50.914  63.118  1.00 98.20  ? 23  THR D CB    1 
ATOM   8868  O  OG1   . THR C 1 43  ? -17.557 51.046  61.770  1.00 98.05  ? 23  THR D OG1   1 
ATOM   8869  C  CG2   . THR C 1 43  ? -18.292 50.732  64.047  1.00 97.79  ? 23  THR D CG2   1 
ATOM   8870  N  N     . PHE C 1 44  ? -14.557 51.167  64.938  1.00 95.76  ? 24  PHE D N     1 
ATOM   8871  C  CA    . PHE C 1 44  ? -13.909 50.785  66.201  1.00 94.96  ? 24  PHE D CA    1 
ATOM   8872  C  C     . PHE C 1 44  ? -12.658 51.606  66.557  1.00 94.26  ? 24  PHE D C     1 
ATOM   8873  O  O     . PHE C 1 44  ? -11.876 51.198  67.421  1.00 94.19  ? 24  PHE D O     1 
ATOM   8874  C  CB    . PHE C 1 44  ? -13.582 49.286  66.173  1.00 95.02  ? 24  PHE D CB    1 
ATOM   8875  C  CG    . PHE C 1 44  ? -14.778 48.419  65.902  1.00 95.82  ? 24  PHE D CG    1 
ATOM   8876  C  CD1   . PHE C 1 44  ? -15.684 48.127  66.919  1.00 95.91  ? 24  PHE D CD1   1 
ATOM   8877  C  CD2   . PHE C 1 44  ? -15.016 47.911  64.628  1.00 96.33  ? 24  PHE D CD2   1 
ATOM   8878  C  CE1   . PHE C 1 44  ? -16.798 47.336  66.672  1.00 95.74  ? 24  PHE D CE1   1 
ATOM   8879  C  CE2   . PHE C 1 44  ? -16.127 47.119  64.375  1.00 95.87  ? 24  PHE D CE2   1 
ATOM   8880  C  CZ    . PHE C 1 44  ? -17.019 46.831  65.398  1.00 95.64  ? 24  PHE D CZ    1 
ATOM   8881  N  N     . GLU C 1 45  ? -12.472 52.757  65.904  1.00 93.11  ? 25  GLU D N     1 
ATOM   8882  C  CA    . GLU C 1 45  ? -11.453 53.726  66.314  1.00 91.65  ? 25  GLU D CA    1 
ATOM   8883  C  C     . GLU C 1 45  ? -12.073 54.681  67.323  1.00 89.80  ? 25  GLU D C     1 
ATOM   8884  O  O     . GLU C 1 45  ? -13.094 55.309  67.035  1.00 89.36  ? 25  GLU D O     1 
ATOM   8885  C  CB    . GLU C 1 45  ? -10.900 54.500  65.119  1.00 93.03  ? 25  GLU D CB    1 
ATOM   8886  C  CG    . GLU C 1 45  ? -10.145 53.626  64.125  1.00 93.67  ? 25  GLU D CG    1 
ATOM   8887  C  CD    . GLU C 1 45  ? -9.284  54.411  63.147  1.00 93.94  ? 25  GLU D CD    1 
ATOM   8888  O  OE1   . GLU C 1 45  ? -9.337  55.662  63.135  1.00 93.54  ? 25  GLU D OE1   1 
ATOM   8889  O  OE2   . GLU C 1 45  ? -8.544  53.767  62.375  1.00 94.34  ? 25  GLU D OE2   1 
ATOM   8890  N  N     . VAL C 1 46  ? -11.446 54.792  68.493  1.00 89.10  ? 26  VAL D N     1 
ATOM   8891  C  CA    . VAL C 1 46  ? -12.019 55.515  69.632  1.00 88.83  ? 26  VAL D CA    1 
ATOM   8892  C  C     . VAL C 1 46  ? -11.014 56.481  70.253  1.00 88.36  ? 26  VAL D C     1 
ATOM   8893  O  O     . VAL C 1 46  ? -9.812  56.209  70.272  1.00 87.89  ? 26  VAL D O     1 
ATOM   8894  C  CB    . VAL C 1 46  ? -12.545 54.543  70.717  1.00 88.94  ? 26  VAL D CB    1 
ATOM   8895  C  CG1   . VAL C 1 46  ? -13.751 53.777  70.194  1.00 89.30  ? 26  VAL D CG1   1 
ATOM   8896  C  CG2   . VAL C 1 46  ? -11.464 53.573  71.190  1.00 88.72  ? 26  VAL D CG2   1 
ATOM   8897  N  N     . THR C 1 47  ? -11.527 57.606  70.752  1.00 88.70  ? 27  THR D N     1 
ATOM   8898  C  CA    . THR C 1 47  ? -10.729 58.622  71.440  1.00 88.85  ? 27  THR D CA    1 
ATOM   8899  C  C     . THR C 1 47  ? -11.036 58.593  72.937  1.00 88.64  ? 27  THR D C     1 
ATOM   8900  O  O     . THR C 1 47  ? -11.950 57.891  73.380  1.00 88.50  ? 27  THR D O     1 
ATOM   8901  C  CB    . THR C 1 47  ? -11.020 60.029  70.878  1.00 89.03  ? 27  THR D CB    1 
ATOM   8902  O  OG1   . THR C 1 47  ? -12.420 60.317  70.987  1.00 89.27  ? 27  THR D OG1   1 
ATOM   8903  C  CG2   . THR C 1 47  ? -10.600 60.120  69.417  1.00 89.08  ? 27  THR D CG2   1 
ATOM   8904  N  N     . GLU C 1 48  ? -10.275 59.368  73.707  1.00 88.51  ? 28  GLU D N     1 
ATOM   8905  C  CA    . GLU C 1 48  ? -10.445 59.437  75.161  1.00 89.02  ? 28  GLU D CA    1 
ATOM   8906  C  C     . GLU C 1 48  ? -11.636 60.341  75.502  1.00 91.04  ? 28  GLU D C     1 
ATOM   8907  O  O     . GLU C 1 48  ? -11.465 61.486  75.934  1.00 91.04  ? 28  GLU D O     1 
ATOM   8908  C  CB    . GLU C 1 48  ? -9.157  59.927  75.842  1.00 88.37  ? 28  GLU D CB    1 
ATOM   8909  C  CG    . GLU C 1 48  ? -8.003  58.925  75.819  1.00 88.48  ? 28  GLU D CG    1 
ATOM   8910  C  CD    . GLU C 1 48  ? -7.256  58.858  74.492  1.00 87.63  ? 28  GLU D CD    1 
ATOM   8911  O  OE1   . GLU C 1 48  ? -6.928  59.922  73.926  1.00 87.83  ? 28  GLU D OE1   1 
ATOM   8912  O  OE2   . GLU C 1 48  ? -6.982  57.736  74.017  1.00 85.57  ? 28  GLU D OE2   1 
ATOM   8913  N  N     . ASP C 1 49  ? -12.841 59.803  75.303  1.00 92.76  ? 29  ASP D N     1 
ATOM   8914  C  CA    . ASP C 1 49  ? -14.088 60.560  75.441  1.00 94.18  ? 29  ASP D CA    1 
ATOM   8915  C  C     . ASP C 1 49  ? -14.535 60.579  76.906  1.00 95.17  ? 29  ASP D C     1 
ATOM   8916  O  O     . ASP C 1 49  ? -14.968 59.559  77.444  1.00 95.73  ? 29  ASP D O     1 
ATOM   8917  C  CB    . ASP C 1 49  ? -15.177 59.943  74.544  1.00 95.14  ? 29  ASP D CB    1 
ATOM   8918  C  CG    . ASP C 1 49  ? -16.448 60.794  74.459  1.00 95.24  ? 29  ASP D CG    1 
ATOM   8919  O  OD1   . ASP C 1 49  ? -16.484 61.929  74.984  1.00 95.45  ? 29  ASP D OD1   1 
ATOM   8920  O  OD2   . ASP C 1 49  ? -17.426 60.314  73.845  1.00 94.68  ? 29  ASP D OD2   1 
ATOM   8921  N  N     . GLU C 1 50  ? -14.437 61.749  77.535  1.00 96.05  ? 30  GLU D N     1 
ATOM   8922  C  CA    . GLU C 1 50  ? -14.747 61.903  78.962  1.00 96.01  ? 30  GLU D CA    1 
ATOM   8923  C  C     . GLU C 1 50  ? -16.237 61.748  79.286  1.00 94.49  ? 30  GLU D C     1 
ATOM   8924  O  O     . GLU C 1 50  ? -16.583 61.316  80.387  1.00 92.46  ? 30  GLU D O     1 
ATOM   8925  C  CB    . GLU C 1 50  ? -14.242 63.258  79.484  1.00 97.15  ? 30  GLU D CB    1 
ATOM   8926  C  CG    . GLU C 1 50  ? -12.727 63.440  79.444  1.00 97.89  ? 30  GLU D CG    1 
ATOM   8927  C  CD    . GLU C 1 50  ? -12.009 62.849  80.651  1.00 98.38  ? 30  GLU D CD    1 
ATOM   8928  O  OE1   . GLU C 1 50  ? -12.339 61.717  81.065  1.00 97.76  ? 30  GLU D OE1   1 
ATOM   8929  O  OE2   . GLU C 1 50  ? -11.099 63.518  81.185  1.00 99.11  ? 30  GLU D OE2   1 
ATOM   8930  N  N     . SER C 1 51  ? -17.106 62.099  78.337  1.00 95.25  ? 31  SER D N     1 
ATOM   8931  C  CA    . SER C 1 51  ? -18.558 61.993  78.526  1.00 97.47  ? 31  SER D CA    1 
ATOM   8932  C  C     . SER C 1 51  ? -19.042 60.542  78.631  1.00 98.38  ? 31  SER D C     1 
ATOM   8933  O  O     . SER C 1 51  ? -19.885 60.230  79.475  1.00 99.96  ? 31  SER D O     1 
ATOM   8934  C  CB    . SER C 1 51  ? -19.304 62.711  77.394  1.00 97.90  ? 31  SER D CB    1 
ATOM   8935  O  OG    . SER C 1 51  ? -18.941 62.189  76.127  1.00 98.52  ? 31  SER D OG    1 
ATOM   8936  N  N     . LYS C 1 52  ? -18.507 59.668  77.777  1.00 98.15  ? 32  LYS D N     1 
ATOM   8937  C  CA    . LYS C 1 52  ? -18.859 58.240  77.788  1.00 97.19  ? 32  LYS D CA    1 
ATOM   8938  C  C     . LYS C 1 52  ? -18.097 57.467  78.866  1.00 94.95  ? 32  LYS D C     1 
ATOM   8939  O  O     . LYS C 1 52  ? -17.017 57.879  79.298  1.00 95.41  ? 32  LYS D O     1 
ATOM   8940  C  CB    . LYS C 1 52  ? -18.589 57.605  76.419  1.00 98.83  ? 32  LYS D CB    1 
ATOM   8941  C  CG    . LYS C 1 52  ? -19.513 58.091  75.315  1.00 100.48 ? 32  LYS D CG    1 
ATOM   8942  C  CD    . LYS C 1 52  ? -19.223 57.385  74.001  1.00 101.48 ? 32  LYS D CD    1 
ATOM   8943  C  CE    . LYS C 1 52  ? -20.255 57.735  72.941  1.00 102.42 ? 32  LYS D CE    1 
ATOM   8944  N  NZ    . LYS C 1 52  ? -20.002 57.020  71.660  1.00 102.92 ? 32  LYS D NZ    1 
ATOM   8945  N  N     . GLU C 1 53  ? -18.675 56.342  79.285  1.00 91.75  ? 33  GLU D N     1 
ATOM   8946  C  CA    . GLU C 1 53  ? -18.045 55.435  80.245  1.00 89.76  ? 33  GLU D CA    1 
ATOM   8947  C  C     . GLU C 1 53  ? -17.078 54.512  79.500  1.00 88.28  ? 33  GLU D C     1 
ATOM   8948  O  O     . GLU C 1 53  ? -17.470 53.849  78.541  1.00 87.39  ? 33  GLU D O     1 
ATOM   8949  C  CB    . GLU C 1 53  ? -19.112 54.611  80.972  1.00 90.01  ? 33  GLU D CB    1 
ATOM   8950  C  CG    . GLU C 1 53  ? -18.623 53.919  82.238  1.00 90.50  ? 33  GLU D CG    1 
ATOM   8951  C  CD    . GLU C 1 53  ? -19.627 52.924  82.800  1.00 91.06  ? 33  GLU D CD    1 
ATOM   8952  O  OE1   . GLU C 1 53  ? -20.839 53.057  82.522  1.00 91.52  ? 33  GLU D OE1   1 
ATOM   8953  O  OE2   . GLU C 1 53  ? -19.200 52.003  83.528  1.00 91.00  ? 33  GLU D OE2   1 
ATOM   8954  N  N     . LYS C 1 54  ? -15.821 54.476  79.941  1.00 86.84  ? 34  LYS D N     1 
ATOM   8955  C  CA    . LYS C 1 54  ? -14.776 53.685  79.272  1.00 84.91  ? 34  LYS D CA    1 
ATOM   8956  C  C     . LYS C 1 54  ? -14.865 52.189  79.587  1.00 83.09  ? 34  LYS D C     1 
ATOM   8957  O  O     . LYS C 1 54  ? -15.388 51.796  80.632  1.00 83.65  ? 34  LYS D O     1 
ATOM   8958  C  CB    . LYS C 1 54  ? -13.378 54.217  79.633  1.00 84.85  ? 34  LYS D CB    1 
ATOM   8959  C  CG    . LYS C 1 54  ? -12.928 53.990  81.076  1.00 85.10  ? 34  LYS D CG    1 
ATOM   8960  C  CD    . LYS C 1 54  ? -12.016 52.779  81.229  1.00 85.85  ? 34  LYS D CD    1 
ATOM   8961  C  CE    . LYS C 1 54  ? -11.600 52.587  82.677  1.00 86.97  ? 34  LYS D CE    1 
ATOM   8962  N  NZ    . LYS C 1 54  ? -10.875 51.305  82.887  1.00 87.32  ? 34  LYS D NZ    1 
ATOM   8963  N  N     . TYR C 1 55  ? -14.345 51.369  78.674  1.00 80.78  ? 35  TYR D N     1 
ATOM   8964  C  CA    . TYR C 1 55  ? -14.135 49.939  78.924  1.00 78.76  ? 35  TYR D CA    1 
ATOM   8965  C  C     . TYR C 1 55  ? -12.945 49.422  78.107  1.00 76.08  ? 35  TYR D C     1 
ATOM   8966  O  O     . TYR C 1 55  ? -12.999 49.393  76.877  1.00 75.28  ? 35  TYR D O     1 
ATOM   8967  C  CB    . TYR C 1 55  ? -15.395 49.118  78.610  1.00 79.40  ? 35  TYR D CB    1 
ATOM   8968  C  CG    . TYR C 1 55  ? -15.361 47.725  79.210  1.00 79.65  ? 35  TYR D CG    1 
ATOM   8969  C  CD1   . TYR C 1 55  ? -14.685 46.679  78.572  1.00 79.69  ? 35  TYR D CD1   1 
ATOM   8970  C  CD2   . TYR C 1 55  ? -15.988 47.453  80.427  1.00 79.79  ? 35  TYR D CD2   1 
ATOM   8971  C  CE1   . TYR C 1 55  ? -14.639 45.406  79.127  1.00 79.62  ? 35  TYR D CE1   1 
ATOM   8972  C  CE2   . TYR C 1 55  ? -15.951 46.181  80.989  1.00 79.83  ? 35  TYR D CE2   1 
ATOM   8973  C  CZ    . TYR C 1 55  ? -15.277 45.162  80.335  1.00 79.54  ? 35  TYR D CZ    1 
ATOM   8974  O  OH    . TYR C 1 55  ? -15.237 43.902  80.886  1.00 78.89  ? 35  TYR D OH    1 
ATOM   8975  N  N     . TYR C 1 56  ? -11.879 49.019  78.798  1.00 73.40  ? 36  TYR D N     1 
ATOM   8976  C  CA    . TYR C 1 56  ? -10.681 48.473  78.157  1.00 71.91  ? 36  TYR D CA    1 
ATOM   8977  C  C     . TYR C 1 56  ? -10.775 46.942  78.152  1.00 71.70  ? 36  TYR D C     1 
ATOM   8978  O  O     . TYR C 1 56  ? -10.648 46.301  79.200  1.00 73.09  ? 36  TYR D O     1 
ATOM   8979  C  CB    . TYR C 1 56  ? -9.426  48.944  78.909  1.00 71.09  ? 36  TYR D CB    1 
ATOM   8980  C  CG    . TYR C 1 56  ? -8.086  48.810  78.185  1.00 69.91  ? 36  TYR D CG    1 
ATOM   8981  C  CD1   . TYR C 1 56  ? -7.914  47.984  77.062  1.00 69.03  ? 36  TYR D CD1   1 
ATOM   8982  C  CD2   . TYR C 1 56  ? -6.967  49.496  78.659  1.00 69.51  ? 36  TYR D CD2   1 
ATOM   8983  C  CE1   . TYR C 1 56  ? -6.684  47.875  76.433  1.00 68.11  ? 36  TYR D CE1   1 
ATOM   8984  C  CE2   . TYR C 1 56  ? -5.734  49.384  78.035  1.00 68.70  ? 36  TYR D CE2   1 
ATOM   8985  C  CZ    . TYR C 1 56  ? -5.601  48.571  76.925  1.00 67.94  ? 36  TYR D CZ    1 
ATOM   8986  O  OH    . TYR C 1 56  ? -4.388  48.455  76.303  1.00 68.05  ? 36  TYR D OH    1 
ATOM   8987  N  N     . CYS C 1 57  ? -11.006 46.374  76.967  1.00 69.70  ? 37  CYS D N     1 
ATOM   8988  C  CA    . CYS C 1 57  ? -11.021 44.926  76.761  1.00 67.92  ? 37  CYS D CA    1 
ATOM   8989  C  C     . CYS C 1 57  ? -9.791  44.530  75.943  1.00 67.02  ? 37  CYS D C     1 
ATOM   8990  O  O     . CYS C 1 57  ? -9.776  44.681  74.719  1.00 66.17  ? 37  CYS D O     1 
ATOM   8991  C  CB    . CYS C 1 57  ? -12.309 44.508  76.048  1.00 67.75  ? 37  CYS D CB    1 
ATOM   8992  S  SG    . CYS C 1 57  ? -12.467 42.728  75.772  1.00 68.37  ? 37  CYS D SG    1 
ATOM   8993  N  N     . LEU C 1 58  ? -8.763  44.030  76.632  1.00 66.67  ? 38  LEU D N     1 
ATOM   8994  C  CA    . LEU C 1 58  ? -7.472  43.702  76.019  1.00 66.63  ? 38  LEU D CA    1 
ATOM   8995  C  C     . LEU C 1 58  ? -7.313  42.201  75.808  1.00 66.54  ? 38  LEU D C     1 
ATOM   8996  O  O     . LEU C 1 58  ? -7.663  41.409  76.683  1.00 66.06  ? 38  LEU D O     1 
ATOM   8997  C  CB    . LEU C 1 58  ? -6.330  44.210  76.906  1.00 66.86  ? 38  LEU D CB    1 
ATOM   8998  C  CG    . LEU C 1 58  ? -4.881  44.000  76.441  1.00 66.95  ? 38  LEU D CG    1 
ATOM   8999  C  CD1   . LEU C 1 58  ? -4.628  44.631  75.083  1.00 67.31  ? 38  LEU D CD1   1 
ATOM   9000  C  CD2   . LEU C 1 58  ? -3.910  44.565  77.465  1.00 67.18  ? 38  LEU D CD2   1 
ATOM   9001  N  N     . SER C 1 59  ? -6.787  41.826  74.641  1.00 67.04  ? 39  SER D N     1 
ATOM   9002  C  CA    . SER C 1 59  ? -6.334  40.460  74.369  1.00 67.69  ? 39  SER D CA    1 
ATOM   9003  C  C     . SER C 1 59  ? -4.818  40.466  74.198  1.00 67.91  ? 39  SER D C     1 
ATOM   9004  O  O     . SER C 1 59  ? -4.244  41.464  73.758  1.00 68.51  ? 39  SER D O     1 
ATOM   9005  C  CB    . SER C 1 59  ? -7.007  39.901  73.114  1.00 67.85  ? 39  SER D CB    1 
ATOM   9006  O  OG    . SER C 1 59  ? -8.372  39.608  73.355  1.00 68.01  ? 39  SER D OG    1 
ATOM   9007  N  N     . MET C 1 60  ? -4.176  39.351  74.547  1.00 68.41  ? 40  MET D N     1 
ATOM   9008  C  CA    . MET C 1 60  ? -2.714  39.244  74.486  1.00 68.97  ? 40  MET D CA    1 
ATOM   9009  C  C     . MET C 1 60  ? -2.215  39.262  73.042  1.00 70.31  ? 40  MET D C     1 
ATOM   9010  O  O     . MET C 1 60  ? -2.658  38.457  72.221  1.00 71.34  ? 40  MET D O     1 
ATOM   9011  C  CB    . MET C 1 60  ? -2.230  37.970  75.180  1.00 68.94  ? 40  MET D CB    1 
ATOM   9012  C  CG    . MET C 1 60  ? -2.450  37.955  76.684  1.00 69.06  ? 40  MET D CG    1 
ATOM   9013  S  SD    . MET C 1 60  ? -1.549  36.623  77.505  1.00 69.06  ? 40  MET D SD    1 
ATOM   9014  C  CE    . MET C 1 60  ? -1.900  36.986  79.224  1.00 68.96  ? 40  MET D CE    1 
ATOM   9015  N  N     . LEU C 1 61  ? -1.296  40.181  72.743  1.00 71.04  ? 41  LEU D N     1 
ATOM   9016  C  CA    . LEU C 1 61  ? -0.786  40.358  71.377  1.00 71.63  ? 41  LEU D CA    1 
ATOM   9017  C  C     . LEU C 1 61  ? 0.059   39.149  70.935  1.00 73.28  ? 41  LEU D C     1 
ATOM   9018  O  O     . LEU C 1 61  ? 0.806   38.596  71.744  1.00 72.90  ? 41  LEU D O     1 
ATOM   9019  C  CB    . LEU C 1 61  ? 0.003   41.674  71.238  1.00 71.58  ? 41  LEU D CB    1 
ATOM   9020  C  CG    . LEU C 1 61  ? 1.498   41.770  71.583  1.00 71.69  ? 41  LEU D CG    1 
ATOM   9021  C  CD1   . LEU C 1 61  ? 1.992   43.181  71.302  1.00 71.22  ? 41  LEU D CD1   1 
ATOM   9022  C  CD2   . LEU C 1 61  ? 1.819   41.391  73.021  1.00 72.05  ? 41  LEU D CD2   1 
ATOM   9023  N  N     . PRO C 1 62  ? -0.057  38.734  69.654  1.00 75.67  ? 42  PRO D N     1 
ATOM   9024  C  CA    . PRO C 1 62  ? 0.613   37.518  69.195  1.00 76.92  ? 42  PRO D CA    1 
ATOM   9025  C  C     . PRO C 1 62  ? 2.052   37.736  68.725  1.00 78.38  ? 42  PRO D C     1 
ATOM   9026  O  O     . PRO C 1 62  ? 2.427   38.858  68.373  1.00 78.57  ? 42  PRO D O     1 
ATOM   9027  C  CB    . PRO C 1 62  ? -0.249  37.098  68.006  1.00 76.33  ? 42  PRO D CB    1 
ATOM   9028  C  CG    . PRO C 1 62  ? -0.686  38.394  67.413  1.00 75.45  ? 42  PRO D CG    1 
ATOM   9029  C  CD    . PRO C 1 62  ? -0.777  39.388  68.543  1.00 75.25  ? 42  PRO D CD    1 
ATOM   9030  N  N     . TYR C 1 63  ? 2.837   36.657  68.725  1.00 79.77  ? 43  TYR D N     1 
ATOM   9031  C  CA    . TYR C 1 63  ? 4.129   36.626  68.042  1.00 80.49  ? 43  TYR D CA    1 
ATOM   9032  C  C     . TYR C 1 63  ? 3.860   36.297  66.571  1.00 79.97  ? 43  TYR D C     1 
ATOM   9033  O  O     . TYR C 1 63  ? 3.151   35.326  66.285  1.00 80.66  ? 43  TYR D O     1 
ATOM   9034  C  CB    . TYR C 1 63  ? 5.061   35.570  68.650  1.00 82.18  ? 43  TYR D CB    1 
ATOM   9035  C  CG    . TYR C 1 63  ? 6.394   35.461  67.932  1.00 85.13  ? 43  TYR D CG    1 
ATOM   9036  C  CD1   . TYR C 1 63  ? 7.463   36.289  68.274  1.00 86.44  ? 43  TYR D CD1   1 
ATOM   9037  C  CD2   . TYR C 1 63  ? 6.580   34.542  66.894  1.00 87.22  ? 43  TYR D CD2   1 
ATOM   9038  C  CE1   . TYR C 1 63  ? 8.681   36.201  67.612  1.00 88.08  ? 43  TYR D CE1   1 
ATOM   9039  C  CE2   . TYR C 1 63  ? 7.794   34.449  66.224  1.00 88.71  ? 43  TYR D CE2   1 
ATOM   9040  C  CZ    . TYR C 1 63  ? 8.843   35.279  66.587  1.00 89.34  ? 43  TYR D CZ    1 
ATOM   9041  O  OH    . TYR C 1 63  ? 10.050  35.194  65.930  1.00 90.67  ? 43  TYR D OH    1 
ATOM   9042  N  N     . PRO C 1 64  ? 4.424   37.091  65.635  1.00 79.14  ? 44  PRO D N     1 
ATOM   9043  C  CA    . PRO C 1 64  ? 4.187   36.836  64.214  1.00 79.11  ? 44  PRO D CA    1 
ATOM   9044  C  C     . PRO C 1 64  ? 4.985   35.625  63.713  1.00 80.07  ? 44  PRO D C     1 
ATOM   9045  O  O     . PRO C 1 64  ? 6.088   35.768  63.180  1.00 79.51  ? 44  PRO D O     1 
ATOM   9046  C  CB    . PRO C 1 64  ? 4.631   38.143  63.552  1.00 78.76  ? 44  PRO D CB    1 
ATOM   9047  C  CG    . PRO C 1 64  ? 5.711   38.646  64.442  1.00 78.81  ? 44  PRO D CG    1 
ATOM   9048  C  CD    . PRO C 1 64  ? 5.324   38.243  65.836  1.00 78.80  ? 44  PRO D CD    1 
ATOM   9049  N  N     . SER C 1 65  ? 4.412   34.439  63.910  1.00 82.43  ? 45  SER D N     1 
ATOM   9050  C  CA    . SER C 1 65  ? 5.058   33.173  63.545  1.00 84.28  ? 45  SER D CA    1 
ATOM   9051  C  C     . SER C 1 65  ? 5.036   32.921  62.038  1.00 85.83  ? 45  SER D C     1 
ATOM   9052  O  O     . SER C 1 65  ? 6.027   32.458  61.467  1.00 85.80  ? 45  SER D O     1 
ATOM   9053  C  CB    . SER C 1 65  ? 4.385   32.002  64.271  1.00 84.27  ? 45  SER D CB    1 
ATOM   9054  O  OG    . SER C 1 65  ? 3.000   31.938  63.973  1.00 84.01  ? 45  SER D OG    1 
ATOM   9055  N  N     . GLY C 1 66  ? 3.905   33.228  61.407  1.00 87.88  ? 46  GLY D N     1 
ATOM   9056  C  CA    . GLY C 1 66  ? 3.709   32.982  59.976  1.00 89.20  ? 46  GLY D CA    1 
ATOM   9057  C  C     . GLY C 1 66  ? 2.239   32.959  59.609  1.00 90.33  ? 46  GLY D C     1 
ATOM   9058  O  O     . GLY C 1 66  ? 1.809   33.655  58.688  1.00 89.97  ? 46  GLY D O     1 
ATOM   9059  N  N     . ARG C 1 67  ? 1.478   32.151  60.344  1.00 93.03  ? 47  ARG D N     1 
ATOM   9060  C  CA    . ARG C 1 67  ? 0.036   32.012  60.145  1.00 94.83  ? 47  ARG D CA    1 
ATOM   9061  C  C     . ARG C 1 67  ? -0.679  31.773  61.474  1.00 92.01  ? 47  ARG D C     1 
ATOM   9062  O  O     . ARG C 1 67  ? -0.077  31.284  62.435  1.00 90.04  ? 47  ARG D O     1 
ATOM   9063  C  CB    . ARG C 1 67  ? -0.256  30.864  59.172  1.00 99.18  ? 47  ARG D CB    1 
ATOM   9064  C  CG    . ARG C 1 67  ? 0.508   29.575  59.462  1.00 102.76 ? 47  ARG D CG    1 
ATOM   9065  C  CD    . ARG C 1 67  ? 0.005   28.415  58.613  1.00 105.79 ? 47  ARG D CD    1 
ATOM   9066  N  NE    . ARG C 1 67  ? 0.101   28.693  57.177  1.00 107.92 ? 47  ARG D NE    1 
ATOM   9067  C  CZ    . ARG C 1 67  ? -0.398  27.921  56.208  1.00 109.34 ? 47  ARG D CZ    1 
ATOM   9068  N  NH1   . ARG C 1 67  ? -1.050  26.790  56.487  1.00 109.95 ? 47  ARG D NH1   1 
ATOM   9069  N  NH2   . ARG C 1 67  ? -0.243  28.287  54.937  1.00 109.95 ? 47  ARG D NH2   1 
ATOM   9070  N  N     . LEU C 1 68  ? -1.965  32.118  61.512  1.00 89.98  ? 48  LEU D N     1 
ATOM   9071  C  CA    . LEU C 1 68  ? -2.799  31.906  62.697  1.00 88.53  ? 48  LEU D CA    1 
ATOM   9072  C  C     . LEU C 1 68  ? -3.153  30.430  62.883  1.00 87.61  ? 48  LEU D C     1 
ATOM   9073  O  O     . LEU C 1 68  ? -3.012  29.618  61.962  1.00 87.85  ? 48  LEU D O     1 
ATOM   9074  C  CB    . LEU C 1 68  ? -4.094  32.723  62.604  1.00 88.01  ? 48  LEU D CB    1 
ATOM   9075  C  CG    . LEU C 1 68  ? -3.984  34.251  62.544  1.00 87.60  ? 48  LEU D CG    1 
ATOM   9076  C  CD1   . LEU C 1 68  ? -5.340  34.875  62.247  1.00 87.01  ? 48  LEU D CD1   1 
ATOM   9077  C  CD2   . LEU C 1 68  ? -3.425  34.813  63.843  1.00 87.97  ? 48  LEU D CD2   1 
ATOM   9078  N  N     . HIS C 1 69  ? -3.606  30.103  64.092  1.00 85.76  ? 49  HIS D N     1 
ATOM   9079  C  CA    . HIS C 1 69  ? -4.160  28.781  64.413  1.00 84.01  ? 49  HIS D CA    1 
ATOM   9080  C  C     . HIS C 1 69  ? -5.365  28.939  65.341  1.00 82.59  ? 49  HIS D C     1 
ATOM   9081  O  O     . HIS C 1 69  ? -5.654  30.044  65.801  1.00 82.36  ? 49  HIS D O     1 
ATOM   9082  C  CB    . HIS C 1 69  ? -3.091  27.857  65.019  1.00 83.36  ? 49  HIS D CB    1 
ATOM   9083  C  CG    . HIS C 1 69  ? -2.234  28.510  66.057  1.00 83.03  ? 49  HIS D CG    1 
ATOM   9084  N  ND1   . HIS C 1 69  ? -2.675  28.767  67.336  1.00 82.70  ? 49  HIS D ND1   1 
ATOM   9085  C  CD2   . HIS C 1 69  ? -0.953  28.945  66.006  1.00 83.18  ? 49  HIS D CD2   1 
ATOM   9086  C  CE1   . HIS C 1 69  ? -1.706  29.340  68.026  1.00 83.09  ? 49  HIS D CE1   1 
ATOM   9087  N  NE2   . HIS C 1 69  ? -0.649  29.457  67.243  1.00 83.03  ? 49  HIS D NE2   1 
ATOM   9088  N  N     . MET C 1 70  ? -6.065  27.838  65.610  1.00 81.99  ? 50  MET D N     1 
ATOM   9089  C  CA    . MET C 1 70  ? -7.320  27.878  66.382  1.00 81.32  ? 50  MET D CA    1 
ATOM   9090  C  C     . MET C 1 70  ? -7.136  28.369  67.823  1.00 79.70  ? 50  MET D C     1 
ATOM   9091  O  O     . MET C 1 70  ? -8.091  28.853  68.436  1.00 78.38  ? 50  MET D O     1 
ATOM   9092  C  CB    . MET C 1 70  ? -8.020  26.508  66.383  1.00 81.80  ? 50  MET D CB    1 
ATOM   9093  C  CG    . MET C 1 70  ? -8.237  25.864  65.014  1.00 81.70  ? 50  MET D CG    1 
ATOM   9094  S  SD    . MET C 1 70  ? -8.687  26.993  63.679  1.00 82.22  ? 50  MET D SD    1 
ATOM   9095  C  CE    . MET C 1 70  ? -10.252 27.630  64.275  1.00 81.79  ? 50  MET D CE    1 
ATOM   9096  N  N     . GLY C 1 71  ? -5.920  28.238  68.355  1.00 79.32  ? 51  GLY D N     1 
ATOM   9097  C  CA    . GLY C 1 71  ? -5.542  28.860  69.622  1.00 79.69  ? 51  GLY D CA    1 
ATOM   9098  C  C     . GLY C 1 71  ? -5.675  30.373  69.607  1.00 79.68  ? 51  GLY D C     1 
ATOM   9099  O  O     . GLY C 1 71  ? -6.200  30.961  70.557  1.00 81.20  ? 51  GLY D O     1 
ATOM   9100  N  N     . HIS C 1 72  ? -5.197  31.001  68.530  1.00 78.39  ? 52  HIS D N     1 
ATOM   9101  C  CA    . HIS C 1 72  ? -5.364  32.448  68.325  1.00 77.28  ? 52  HIS D CA    1 
ATOM   9102  C  C     . HIS C 1 72  ? -6.831  32.817  68.119  1.00 75.96  ? 52  HIS D C     1 
ATOM   9103  O  O     . HIS C 1 72  ? -7.325  33.766  68.727  1.00 74.83  ? 52  HIS D O     1 
ATOM   9104  C  CB    . HIS C 1 72  ? -4.543  32.951  67.127  1.00 77.18  ? 52  HIS D CB    1 
ATOM   9105  C  CG    . HIS C 1 72  ? -3.067  32.991  67.374  1.00 77.03  ? 52  HIS D CG    1 
ATOM   9106  N  ND1   . HIS C 1 72  ? -2.160  32.314  66.588  1.00 76.76  ? 52  HIS D ND1   1 
ATOM   9107  C  CD2   . HIS C 1 72  ? -2.342  33.633  68.319  1.00 77.32  ? 52  HIS D CD2   1 
ATOM   9108  C  CE1   . HIS C 1 72  ? -0.938  32.539  67.038  1.00 77.42  ? 52  HIS D CE1   1 
ATOM   9109  N  NE2   . HIS C 1 72  ? -1.021  33.333  68.090  1.00 77.91  ? 52  HIS D NE2   1 
ATOM   9110  N  N     . VAL C 1 73  ? -7.518  32.050  67.272  1.00 75.83  ? 53  VAL D N     1 
ATOM   9111  C  CA    . VAL C 1 73  ? -8.913  32.327  66.910  1.00 75.95  ? 53  VAL D CA    1 
ATOM   9112  C  C     . VAL C 1 73  ? -9.811  32.306  68.147  1.00 75.36  ? 53  VAL D C     1 
ATOM   9113  O  O     . VAL C 1 73  ? -10.652 33.189  68.314  1.00 74.80  ? 53  VAL D O     1 
ATOM   9114  C  CB    . VAL C 1 73  ? -9.442  31.338  65.839  1.00 76.29  ? 53  VAL D CB    1 
ATOM   9115  C  CG1   . VAL C 1 73  ? -10.942 31.518  65.604  1.00 76.60  ? 53  VAL D CG1   1 
ATOM   9116  C  CG2   . VAL C 1 73  ? -8.682  31.518  64.529  1.00 76.50  ? 53  VAL D CG2   1 
ATOM   9117  N  N     . ARG C 1 74  ? -9.619  31.311  69.010  1.00 75.00  ? 54  ARG D N     1 
ATOM   9118  C  CA    . ARG C 1 74  ? -10.387 31.214  70.255  1.00 75.36  ? 54  ARG D CA    1 
ATOM   9119  C  C     . ARG C 1 74  ? -10.114 32.396  71.190  1.00 74.54  ? 54  ARG D C     1 
ATOM   9120  O  O     . ARG C 1 74  ? -11.046 32.943  71.782  1.00 74.66  ? 54  ARG D O     1 
ATOM   9121  C  CB    . ARG C 1 74  ? -10.097 29.895  70.980  1.00 75.31  ? 54  ARG D CB    1 
ATOM   9122  C  CG    . ARG C 1 74  ? -11.111 29.555  72.062  1.00 75.30  ? 54  ARG D CG    1 
ATOM   9123  C  CD    . ARG C 1 74  ? -10.746 28.267  72.776  1.00 75.40  ? 54  ARG D CD    1 
ATOM   9124  N  NE    . ARG C 1 74  ? -11.739 27.895  73.783  1.00 74.48  ? 54  ARG D NE    1 
ATOM   9125  C  CZ    . ARG C 1 74  ? -11.602 26.901  74.662  1.00 74.23  ? 54  ARG D CZ    1 
ATOM   9126  N  NH1   . ARG C 1 74  ? -10.502 26.147  74.692  1.00 73.98  ? 54  ARG D NH1   1 
ATOM   9127  N  NH2   . ARG C 1 74  ? -12.580 26.658  75.529  1.00 75.04  ? 54  ARG D NH2   1 
ATOM   9128  N  N     . ASN C 1 75  ? -8.844  32.786  71.307  1.00 72.60  ? 55  ASN D N     1 
ATOM   9129  C  CA    . ASN C 1 75  ? -8.440  33.899  72.178  1.00 71.13  ? 55  ASN D CA    1 
ATOM   9130  C  C     . ASN C 1 75  ? -9.111  35.208  71.761  1.00 70.39  ? 55  ASN D C     1 
ATOM   9131  O  O     . ASN C 1 75  ? -9.700  35.900  72.594  1.00 70.34  ? 55  ASN D O     1 
ATOM   9132  C  CB    . ASN C 1 75  ? -6.910  34.068  72.173  1.00 71.11  ? 55  ASN D CB    1 
ATOM   9133  C  CG    . ASN C 1 75  ? -6.391  34.811  73.396  1.00 71.53  ? 55  ASN D CG    1 
ATOM   9134  O  OD1   . ASN C 1 75  ? -5.687  34.235  74.225  1.00 72.02  ? 55  ASN D OD1   1 
ATOM   9135  N  ND2   . ASN C 1 75  ? -6.733  36.090  73.514  1.00 71.21  ? 55  ASN D ND2   1 
ATOM   9136  N  N     . TYR C 1 76  ? -9.037  35.522  70.468  1.00 69.94  ? 56  TYR D N     1 
ATOM   9137  C  CA    . TYR C 1 76  ? -9.509  36.809  69.940  1.00 69.61  ? 56  TYR D CA    1 
ATOM   9138  C  C     . TYR C 1 76  ? -11.007 36.855  69.631  1.00 68.77  ? 56  TYR D C     1 
ATOM   9139  O  O     . TYR C 1 76  ? -11.584 37.942  69.584  1.00 68.35  ? 56  TYR D O     1 
ATOM   9140  C  CB    . TYR C 1 76  ? -8.692  37.206  68.705  1.00 69.86  ? 56  TYR D CB    1 
ATOM   9141  C  CG    . TYR C 1 76  ? -7.199  37.280  68.975  1.00 70.20  ? 56  TYR D CG    1 
ATOM   9142  C  CD1   . TYR C 1 76  ? -6.695  38.055  70.025  1.00 70.06  ? 56  TYR D CD1   1 
ATOM   9143  C  CD2   . TYR C 1 76  ? -6.287  36.568  68.191  1.00 70.25  ? 56  TYR D CD2   1 
ATOM   9144  C  CE1   . TYR C 1 76  ? -5.334  38.117  70.285  1.00 70.06  ? 56  TYR D CE1   1 
ATOM   9145  C  CE2   . TYR C 1 76  ? -4.922  36.624  68.445  1.00 70.42  ? 56  TYR D CE2   1 
ATOM   9146  C  CZ    . TYR C 1 76  ? -4.450  37.400  69.491  1.00 70.13  ? 56  TYR D CZ    1 
ATOM   9147  O  OH    . TYR C 1 76  ? -3.101  37.464  69.746  1.00 69.54  ? 56  TYR D OH    1 
ATOM   9148  N  N     . THR C 1 77  ? -11.631 35.695  69.415  1.00 68.30  ? 57  THR D N     1 
ATOM   9149  C  CA    . THR C 1 77  ? -13.092 35.613  69.304  1.00 68.25  ? 57  THR D CA    1 
ATOM   9150  C  C     . THR C 1 77  ? -13.747 35.902  70.660  1.00 68.19  ? 57  THR D C     1 
ATOM   9151  O  O     . THR C 1 77  ? -14.721 36.653  70.725  1.00 67.78  ? 57  THR D O     1 
ATOM   9152  C  CB    . THR C 1 77  ? -13.558 34.238  68.773  1.00 68.43  ? 57  THR D CB    1 
ATOM   9153  O  OG1   . THR C 1 77  ? -12.943 33.981  67.505  1.00 67.64  ? 57  THR D OG1   1 
ATOM   9154  C  CG2   . THR C 1 77  ? -15.078 34.196  68.601  1.00 68.35  ? 57  THR D CG2   1 
ATOM   9155  N  N     . ILE C 1 78  ? -13.207 35.308  71.728  1.00 67.92  ? 58  ILE D N     1 
ATOM   9156  C  CA    . ILE C 1 78  ? -13.662 35.579  73.103  1.00 67.50  ? 58  ILE D CA    1 
ATOM   9157  C  C     . ILE C 1 78  ? -13.579 37.077  73.404  1.00 67.18  ? 58  ILE D C     1 
ATOM   9158  O  O     . ILE C 1 78  ? -14.534 37.664  73.912  1.00 66.85  ? 58  ILE D O     1 
ATOM   9159  C  CB    . ILE C 1 78  ? -12.845 34.779  74.155  1.00 67.62  ? 58  ILE D CB    1 
ATOM   9160  C  CG1   . ILE C 1 78  ? -13.197 33.287  74.085  1.00 67.69  ? 58  ILE D CG1   1 
ATOM   9161  C  CG2   . ILE C 1 78  ? -13.107 35.283  75.575  1.00 68.05  ? 58  ILE D CG2   1 
ATOM   9162  C  CD1   . ILE C 1 78  ? -12.163 32.370  74.708  1.00 67.56  ? 58  ILE D CD1   1 
ATOM   9163  N  N     . GLY C 1 79  ? -12.434 37.677  73.085  1.00 67.48  ? 59  GLY D N     1 
ATOM   9164  C  CA    . GLY C 1 79  ? -12.211 39.104  73.300  1.00 68.92  ? 59  GLY D CA    1 
ATOM   9165  C  C     . GLY C 1 79  ? -13.177 39.995  72.542  1.00 69.66  ? 59  GLY D C     1 
ATOM   9166  O  O     . GLY C 1 79  ? -13.708 40.957  73.102  1.00 70.49  ? 59  GLY D O     1 
ATOM   9167  N  N     . ASP C 1 80  ? -13.408 39.668  71.272  1.00 70.62  ? 60  ASP D N     1 
ATOM   9168  C  CA    . ASP C 1 80  ? -14.289 40.462  70.408  1.00 71.68  ? 60  ASP D CA    1 
ATOM   9169  C  C     . ASP C 1 80  ? -15.759 40.357  70.826  1.00 72.49  ? 60  ASP D C     1 
ATOM   9170  O  O     . ASP C 1 80  ? -16.501 41.336  70.717  1.00 73.20  ? 60  ASP D O     1 
ATOM   9171  C  CB    . ASP C 1 80  ? -14.126 40.048  68.938  1.00 71.94  ? 60  ASP D CB    1 
ATOM   9172  C  CG    . ASP C 1 80  ? -14.657 41.092  67.971  1.00 71.62  ? 60  ASP D CG    1 
ATOM   9173  O  OD1   . ASP C 1 80  ? -14.234 42.264  68.061  1.00 71.24  ? 60  ASP D OD1   1 
ATOM   9174  O  OD2   . ASP C 1 80  ? -15.485 40.741  67.104  1.00 71.16  ? 60  ASP D OD2   1 
ATOM   9175  N  N     . VAL C 1 81  ? -16.167 39.175  71.293  1.00 72.48  ? 61  VAL D N     1 
ATOM   9176  C  CA    . VAL C 1 81  ? -17.512 38.962  71.850  1.00 72.10  ? 61  VAL D CA    1 
ATOM   9177  C  C     . VAL C 1 81  ? -17.750 39.874  73.056  1.00 70.92  ? 61  VAL D C     1 
ATOM   9178  O  O     . VAL C 1 81  ? -18.795 40.513  73.155  1.00 70.93  ? 61  VAL D O     1 
ATOM   9179  C  CB    . VAL C 1 81  ? -17.741 37.474  72.235  1.00 73.10  ? 61  VAL D CB    1 
ATOM   9180  C  CG1   . VAL C 1 81  ? -18.970 37.291  73.125  1.00 73.67  ? 61  VAL D CG1   1 
ATOM   9181  C  CG2   . VAL C 1 81  ? -17.875 36.617  70.981  1.00 74.05  ? 61  VAL D CG2   1 
ATOM   9182  N  N     . ILE C 1 82  ? -16.777 39.929  73.960  1.00 70.55  ? 62  ILE D N     1 
ATOM   9183  C  CA    . ILE C 1 82  ? -16.859 40.801  75.133  1.00 71.51  ? 62  ILE D CA    1 
ATOM   9184  C  C     . ILE C 1 82  ? -16.755 42.275  74.709  1.00 72.30  ? 62  ILE D C     1 
ATOM   9185  O  O     . ILE C 1 82  ? -17.452 43.126  75.260  1.00 73.30  ? 62  ILE D O     1 
ATOM   9186  C  CB    . ILE C 1 82  ? -15.786 40.435  76.192  1.00 71.89  ? 62  ILE D CB    1 
ATOM   9187  C  CG1   . ILE C 1 82  ? -16.023 39.012  76.721  1.00 71.82  ? 62  ILE D CG1   1 
ATOM   9188  C  CG2   . ILE C 1 82  ? -15.800 41.418  77.362  1.00 72.13  ? 62  ILE D CG2   1 
ATOM   9189  C  CD1   . ILE C 1 82  ? -14.782 38.352  77.282  1.00 72.10  ? 62  ILE D CD1   1 
ATOM   9190  N  N     . ALA C 1 83  ? -15.903 42.563  73.724  1.00 72.64  ? 63  ALA D N     1 
ATOM   9191  C  CA    . ALA C 1 83  ? -15.731 43.928  73.205  1.00 73.75  ? 63  ALA D CA    1 
ATOM   9192  C  C     . ALA C 1 83  ? -17.013 44.500  72.592  1.00 74.88  ? 63  ALA D C     1 
ATOM   9193  O  O     . ALA C 1 83  ? -17.408 45.625  72.909  1.00 75.12  ? 63  ALA D O     1 
ATOM   9194  C  CB    . ALA C 1 83  ? -14.605 43.964  72.181  1.00 74.22  ? 63  ALA D CB    1 
ATOM   9195  N  N     . ARG C 1 84  ? -17.649 43.718  71.720  1.00 75.42  ? 64  ARG D N     1 
ATOM   9196  C  CA    . ARG C 1 84  ? -18.908 44.117  71.070  1.00 74.67  ? 64  ARG D CA    1 
ATOM   9197  C  C     . ARG C 1 84  ? -20.092 44.158  72.039  1.00 74.87  ? 64  ARG D C     1 
ATOM   9198  O  O     . ARG C 1 84  ? -20.963 45.021  71.910  1.00 75.19  ? 64  ARG D O     1 
ATOM   9199  C  CB    . ARG C 1 84  ? -19.230 43.186  69.897  1.00 74.15  ? 64  ARG D CB    1 
ATOM   9200  C  CG    . ARG C 1 84  ? -18.265 43.322  68.733  1.00 73.67  ? 64  ARG D CG    1 
ATOM   9201  C  CD    . ARG C 1 84  ? -18.421 42.187  67.737  1.00 73.28  ? 64  ARG D CD    1 
ATOM   9202  N  NE    . ARG C 1 84  ? -17.613 42.415  66.540  1.00 72.88  ? 64  ARG D NE    1 
ATOM   9203  C  CZ    . ARG C 1 84  ? -17.923 43.255  65.550  1.00 72.72  ? 64  ARG D CZ    1 
ATOM   9204  N  NH1   . ARG C 1 84  ? -19.050 43.972  65.569  1.00 72.96  ? 64  ARG D NH1   1 
ATOM   9205  N  NH2   . ARG C 1 84  ? -17.093 43.374  64.517  1.00 72.35  ? 64  ARG D NH2   1 
ATOM   9206  N  N     . TYR C 1 85  ? -20.124 43.219  72.988  1.00 74.28  ? 65  TYR D N     1 
ATOM   9207  C  CA    . TYR C 1 85  ? -21.141 43.196  74.050  1.00 74.04  ? 65  TYR D CA    1 
ATOM   9208  C  C     . TYR C 1 85  ? -21.117 44.477  74.882  1.00 74.56  ? 65  TYR D C     1 
ATOM   9209  O  O     . TYR C 1 85  ? -22.157 45.105  75.088  1.00 74.87  ? 65  TYR D O     1 
ATOM   9210  C  CB    . TYR C 1 85  ? -20.946 41.974  74.963  1.00 74.52  ? 65  TYR D CB    1 
ATOM   9211  C  CG    . TYR C 1 85  ? -21.738 42.017  76.258  1.00 74.98  ? 65  TYR D CG    1 
ATOM   9212  C  CD1   . TYR C 1 85  ? -23.121 41.837  76.260  1.00 75.77  ? 65  TYR D CD1   1 
ATOM   9213  C  CD2   . TYR C 1 85  ? -21.103 42.239  77.484  1.00 74.85  ? 65  TYR D CD2   1 
ATOM   9214  C  CE1   . TYR C 1 85  ? -23.851 41.877  77.442  1.00 76.11  ? 65  TYR D CE1   1 
ATOM   9215  C  CE2   . TYR C 1 85  ? -21.823 42.281  78.671  1.00 75.27  ? 65  TYR D CE2   1 
ATOM   9216  C  CZ    . TYR C 1 85  ? -23.197 42.099  78.647  1.00 75.82  ? 65  TYR D CZ    1 
ATOM   9217  O  OH    . TYR C 1 85  ? -23.917 42.141  79.820  1.00 74.85  ? 65  TYR D OH    1 
ATOM   9218  N  N     . GLN C 1 86  ? -19.927 44.850  75.348  1.00 75.50  ? 66  GLN D N     1 
ATOM   9219  C  CA    . GLN C 1 86  ? -19.747 46.049  76.178  1.00 76.59  ? 66  GLN D CA    1 
ATOM   9220  C  C     . GLN C 1 86  ? -20.021 47.354  75.423  1.00 77.80  ? 66  GLN D C     1 
ATOM   9221  O  O     . GLN C 1 86  ? -20.455 48.336  76.033  1.00 78.81  ? 66  GLN D O     1 
ATOM   9222  C  CB    . GLN C 1 86  ? -18.340 46.080  76.792  1.00 76.34  ? 66  GLN D CB    1 
ATOM   9223  C  CG    . GLN C 1 86  ? -18.080 44.975  77.812  1.00 76.04  ? 66  GLN D CG    1 
ATOM   9224  C  CD    . GLN C 1 86  ? -18.804 45.170  79.135  1.00 75.74  ? 66  GLN D CD    1 
ATOM   9225  O  OE1   . GLN C 1 86  ? -19.186 46.282  79.503  1.00 75.04  ? 66  GLN D OE1   1 
ATOM   9226  N  NE2   . GLN C 1 86  ? -18.989 44.075  79.864  1.00 75.73  ? 66  GLN D NE2   1 
ATOM   9227  N  N     . ARG C 1 87  ? -19.767 47.366  74.113  1.00 78.24  ? 67  ARG D N     1 
ATOM   9228  C  CA    . ARG C 1 87  ? -20.133 48.507  73.267  1.00 79.15  ? 67  ARG D CA    1 
ATOM   9229  C  C     . ARG C 1 87  ? -21.654 48.660  73.189  1.00 78.77  ? 67  ARG D C     1 
ATOM   9230  O  O     . ARG C 1 87  ? -22.172 49.774  73.303  1.00 76.90  ? 67  ARG D O     1 
ATOM   9231  C  CB    . ARG C 1 87  ? -19.531 48.382  71.859  1.00 80.49  ? 67  ARG D CB    1 
ATOM   9232  C  CG    . ARG C 1 87  ? -20.029 49.450  70.892  1.00 82.41  ? 67  ARG D CG    1 
ATOM   9233  C  CD    . ARG C 1 87  ? -19.182 49.595  69.638  1.00 83.76  ? 67  ARG D CD    1 
ATOM   9234  N  NE    . ARG C 1 87  ? -18.251 50.724  69.743  1.00 85.70  ? 67  ARG D NE    1 
ATOM   9235  C  CZ    . ARG C 1 87  ? -17.781 51.450  68.723  1.00 87.21  ? 67  ARG D CZ    1 
ATOM   9236  N  NH1   . ARG C 1 87  ? -18.133 51.203  67.458  1.00 88.09  ? 67  ARG D NH1   1 
ATOM   9237  N  NH2   . ARG C 1 87  ? -16.940 52.453  68.972  1.00 87.57  ? 67  ARG D NH2   1 
ATOM   9238  N  N     . MET C 1 88  ? -22.358 47.544  73.003  1.00 79.58  ? 68  MET D N     1 
ATOM   9239  C  CA    . MET C 1 88  ? -23.826 47.542  72.950  1.00 79.77  ? 68  MET D CA    1 
ATOM   9240  C  C     . MET C 1 88  ? -24.483 47.964  74.272  1.00 78.34  ? 68  MET D C     1 
ATOM   9241  O  O     . MET C 1 88  ? -25.589 48.504  74.260  1.00 77.92  ? 68  MET D O     1 
ATOM   9242  C  CB    . MET C 1 88  ? -24.355 46.173  72.499  1.00 80.88  ? 68  MET D CB    1 
ATOM   9243  C  CG    . MET C 1 88  ? -24.065 45.864  71.036  1.00 82.09  ? 68  MET D CG    1 
ATOM   9244  S  SD    . MET C 1 88  ? -24.538 44.197  70.531  1.00 84.23  ? 68  MET D SD    1 
ATOM   9245  C  CE    . MET C 1 88  ? -26.308 44.392  70.349  1.00 84.10  ? 68  MET D CE    1 
ATOM   9246  N  N     . LEU C 1 89  ? -23.804 47.729  75.398  1.00 77.53  ? 69  LEU D N     1 
ATOM   9247  C  CA    . LEU C 1 89  ? -24.254 48.246  76.701  1.00 78.06  ? 69  LEU D CA    1 
ATOM   9248  C  C     . LEU C 1 89  ? -24.195 49.779  76.809  1.00 79.13  ? 69  LEU D C     1 
ATOM   9249  O  O     . LEU C 1 89  ? -24.873 50.356  77.661  1.00 78.96  ? 69  LEU D O     1 
ATOM   9250  C  CB    . LEU C 1 89  ? -23.447 47.627  77.855  1.00 77.08  ? 69  LEU D CB    1 
ATOM   9251  C  CG    . LEU C 1 89  ? -23.653 46.144  78.181  1.00 76.27  ? 69  LEU D CG    1 
ATOM   9252  C  CD1   . LEU C 1 89  ? -22.635 45.705  79.223  1.00 76.44  ? 69  LEU D CD1   1 
ATOM   9253  C  CD2   . LEU C 1 89  ? -25.067 45.867  78.671  1.00 76.04  ? 69  LEU D CD2   1 
ATOM   9254  N  N     . GLY C 1 90  ? -23.379 50.422  75.968  1.00 80.22  ? 70  GLY D N     1 
ATOM   9255  C  CA    . GLY C 1 90  ? -23.279 51.886  75.901  1.00 80.95  ? 70  GLY D CA    1 
ATOM   9256  C  C     . GLY C 1 90  ? -21.871 52.440  76.063  1.00 81.28  ? 70  GLY D C     1 
ATOM   9257  O  O     . GLY C 1 90  ? -21.618 53.596  75.713  1.00 81.73  ? 70  GLY D O     1 
ATOM   9258  N  N     . LYS C 1 91  ? -20.956 51.622  76.582  1.00 81.27  ? 71  LYS D N     1 
ATOM   9259  C  CA    . LYS C 1 91  ? -19.608 52.072  76.933  1.00 81.37  ? 71  LYS D CA    1 
ATOM   9260  C  C     . LYS C 1 91  ? -18.716 52.310  75.712  1.00 80.60  ? 71  LYS D C     1 
ATOM   9261  O  O     . LYS C 1 91  ? -18.900 51.688  74.663  1.00 79.78  ? 71  LYS D O     1 
ATOM   9262  C  CB    . LYS C 1 91  ? -18.947 51.055  77.873  1.00 82.21  ? 71  LYS D CB    1 
ATOM   9263  C  CG    . LYS C 1 91  ? -19.635 50.939  79.229  1.00 83.32  ? 71  LYS D CG    1 
ATOM   9264  C  CD    . LYS C 1 91  ? -19.457 49.562  79.849  1.00 84.24  ? 71  LYS D CD    1 
ATOM   9265  C  CE    . LYS C 1 91  ? -20.258 49.427  81.135  1.00 84.44  ? 71  LYS D CE    1 
ATOM   9266  N  NZ    . LYS C 1 91  ? -20.247 48.032  81.656  1.00 84.67  ? 71  LYS D NZ    1 
ATOM   9267  N  N     . ASN C 1 92  ? -17.760 53.227  75.867  1.00 80.33  ? 72  ASN D N     1 
ATOM   9268  C  CA    . ASN C 1 92  ? -16.742 53.503  74.851  1.00 80.22  ? 72  ASN D CA    1 
ATOM   9269  C  C     . ASN C 1 92  ? -15.649 52.438  74.976  1.00 80.59  ? 72  ASN D C     1 
ATOM   9270  O  O     . ASN C 1 92  ? -14.817 52.501  75.885  1.00 82.45  ? 72  ASN D O     1 
ATOM   9271  C  CB    . ASN C 1 92  ? -16.167 54.920  75.049  1.00 79.90  ? 72  ASN D CB    1 
ATOM   9272  C  CG    . ASN C 1 92  ? -15.124 55.299  74.005  1.00 79.08  ? 72  ASN D CG    1 
ATOM   9273  O  OD1   . ASN C 1 92  ? -15.123 54.788  72.885  1.00 79.69  ? 72  ASN D OD1   1 
ATOM   9274  N  ND2   . ASN C 1 92  ? -14.235 56.217  74.370  1.00 77.27  ? 72  ASN D ND2   1 
ATOM   9275  N  N     . VAL C 1 93  ? -15.666 51.459  74.070  1.00 79.07  ? 73  VAL D N     1 
ATOM   9276  C  CA    . VAL C 1 93  ? -14.796 50.281  74.168  1.00 77.28  ? 73  VAL D CA    1 
ATOM   9277  C  C     . VAL C 1 93  ? -13.491 50.467  73.392  1.00 75.85  ? 73  VAL D C     1 
ATOM   9278  O  O     . VAL C 1 93  ? -13.496 50.978  72.269  1.00 75.45  ? 73  VAL D O     1 
ATOM   9279  C  CB    . VAL C 1 93  ? -15.513 49.005  73.666  1.00 77.59  ? 73  VAL D CB    1 
ATOM   9280  C  CG1   . VAL C 1 93  ? -14.620 47.773  73.821  1.00 77.07  ? 73  VAL D CG1   1 
ATOM   9281  C  CG2   . VAL C 1 93  ? -16.824 48.814  74.417  1.00 78.44  ? 73  VAL D CG2   1 
ATOM   9282  N  N     . LEU C 1 94  ? -12.388 50.038  74.007  1.00 74.17  ? 74  LEU D N     1 
ATOM   9283  C  CA    . LEU C 1 94  ? -11.072 49.987  73.369  1.00 73.46  ? 74  LEU D CA    1 
ATOM   9284  C  C     . LEU C 1 94  ? -10.628 48.531  73.267  1.00 72.40  ? 74  LEU D C     1 
ATOM   9285  O  O     . LEU C 1 94  ? -10.332 47.900  74.284  1.00 72.65  ? 74  LEU D O     1 
ATOM   9286  C  CB    . LEU C 1 94  ? -10.052 50.797  74.183  1.00 73.92  ? 74  LEU D CB    1 
ATOM   9287  C  CG    . LEU C 1 94  ? -8.552  50.607  73.908  1.00 74.05  ? 74  LEU D CG    1 
ATOM   9288  C  CD1   . LEU C 1 94  ? -8.222  50.842  72.442  1.00 74.32  ? 74  LEU D CD1   1 
ATOM   9289  C  CD2   . LEU C 1 94  ? -7.730  51.530  74.795  1.00 73.83  ? 74  LEU D CD2   1 
ATOM   9290  N  N     . GLN C 1 95  ? -10.603 48.002  72.043  1.00 71.80  ? 75  GLN D N     1 
ATOM   9291  C  CA    . GLN C 1 95  ? -9.994  46.702  71.759  1.00 72.17  ? 75  GLN D CA    1 
ATOM   9292  C  C     . GLN C 1 95  ? -8.812  46.917  70.808  1.00 71.39  ? 75  GLN D C     1 
ATOM   9293  O  O     . GLN C 1 95  ? -9.009  47.087  69.606  1.00 70.05  ? 75  GLN D O     1 
ATOM   9294  C  CB    . GLN C 1 95  ? -11.010 45.724  71.157  1.00 72.77  ? 75  GLN D CB    1 
ATOM   9295  C  CG    . GLN C 1 95  ? -10.492 44.288  71.123  1.00 73.50  ? 75  GLN D CG    1 
ATOM   9296  C  CD    . GLN C 1 95  ? -11.451 43.288  70.502  1.00 73.12  ? 75  GLN D CD    1 
ATOM   9297  O  OE1   . GLN C 1 95  ? -11.500 42.134  70.921  1.00 72.88  ? 75  GLN D OE1   1 
ATOM   9298  N  NE2   . GLN C 1 95  ? -12.201 43.716  69.491  1.00 73.53  ? 75  GLN D NE2   1 
ATOM   9299  N  N     . PRO C 1 96  ? -7.577  46.937  71.348  1.00 72.11  ? 76  PRO D N     1 
ATOM   9300  C  CA    . PRO C 1 96  ? -6.394  47.122  70.513  1.00 72.50  ? 76  PRO D CA    1 
ATOM   9301  C  C     . PRO C 1 96  ? -5.801  45.807  70.015  1.00 71.97  ? 76  PRO D C     1 
ATOM   9302  O  O     . PRO C 1 96  ? -6.174  44.732  70.492  1.00 71.59  ? 76  PRO D O     1 
ATOM   9303  C  CB    . PRO C 1 96  ? -5.418  47.807  71.464  1.00 73.33  ? 76  PRO D CB    1 
ATOM   9304  C  CG    . PRO C 1 96  ? -5.759  47.247  72.802  1.00 73.00  ? 76  PRO D CG    1 
ATOM   9305  C  CD    . PRO C 1 96  ? -7.220  46.885  72.779  1.00 72.87  ? 76  PRO D CD    1 
ATOM   9306  N  N     . ILE C 1 97  ? -4.885  45.917  69.055  1.00 71.51  ? 77  ILE D N     1 
ATOM   9307  C  CA    . ILE C 1 97  ? -4.107  44.779  68.552  1.00 71.46  ? 77  ILE D CA    1 
ATOM   9308  C  C     . ILE C 1 97  ? -2.711  45.266  68.157  1.00 71.50  ? 77  ILE D C     1 
ATOM   9309  O  O     . ILE C 1 97  ? -2.562  46.375  67.638  1.00 72.35  ? 77  ILE D O     1 
ATOM   9310  C  CB    . ILE C 1 97  ? -4.821  44.073  67.363  1.00 71.22  ? 77  ILE D CB    1 
ATOM   9311  C  CG1   . ILE C 1 97  ? -4.088  42.794  66.925  1.00 71.07  ? 77  ILE D CG1   1 
ATOM   9312  C  CG2   . ILE C 1 97  ? -4.988  45.007  66.168  1.00 71.27  ? 77  ILE D CG2   1 
ATOM   9313  C  CD1   . ILE C 1 97  ? -4.110  41.678  67.947  1.00 71.28  ? 77  ILE D CD1   1 
ATOM   9314  N  N     . GLY C 1 98  ? -1.699  44.439  68.425  1.00 70.70  ? 78  GLY D N     1 
ATOM   9315  C  CA    . GLY C 1 98  ? -0.305  44.743  68.082  1.00 69.51  ? 78  GLY D CA    1 
ATOM   9316  C  C     . GLY C 1 98  ? 0.464   43.496  67.700  1.00 68.68  ? 78  GLY D C     1 
ATOM   9317  O  O     . GLY C 1 98  ? -0.139  42.469  67.392  1.00 68.21  ? 78  GLY D O     1 
ATOM   9318  N  N     . TRP C 1 99  ? 1.794   43.592  67.708  1.00 68.50  ? 79  TRP D N     1 
ATOM   9319  C  CA    . TRP C 1 99  ? 2.673   42.495  67.281  1.00 69.06  ? 79  TRP D CA    1 
ATOM   9320  C  C     . TRP C 1 99  ? 3.931   42.419  68.151  1.00 70.32  ? 79  TRP D C     1 
ATOM   9321  O  O     . TRP C 1 99  ? 4.785   43.306  68.091  1.00 71.19  ? 79  TRP D O     1 
ATOM   9322  C  CB    . TRP C 1 99  ? 3.062   42.664  65.801  1.00 68.53  ? 79  TRP D CB    1 
ATOM   9323  C  CG    . TRP C 1 99  ? 1.876   42.840  64.888  1.00 68.25  ? 79  TRP D CG    1 
ATOM   9324  C  CD1   . TRP C 1 99  ? 1.410   44.013  64.363  1.00 67.75  ? 79  TRP D CD1   1 
ATOM   9325  C  CD2   . TRP C 1 99  ? 0.984   41.815  64.431  1.00 67.62  ? 79  TRP D CD2   1 
ATOM   9326  N  NE1   . TRP C 1 99  ? 0.293   43.781  63.597  1.00 67.27  ? 79  TRP D NE1   1 
ATOM   9327  C  CE2   . TRP C 1 99  ? 0.007   42.441  63.623  1.00 67.07  ? 79  TRP D CE2   1 
ATOM   9328  C  CE3   . TRP C 1 99  ? 0.917   40.426  64.621  1.00 67.15  ? 79  TRP D CE3   1 
ATOM   9329  C  CZ2   . TRP C 1 99  ? -1.024  41.724  63.000  1.00 66.51  ? 79  TRP D CZ2   1 
ATOM   9330  C  CZ3   . TRP C 1 99  ? -0.110  39.714  64.002  1.00 66.49  ? 79  TRP D CZ3   1 
ATOM   9331  C  CH2   . TRP C 1 99  ? -1.065  40.367  63.202  1.00 66.37  ? 79  TRP D CH2   1 
ATOM   9332  N  N     . ASP C 1 100 ? 4.033   41.363  68.962  1.00 71.79  ? 80  ASP D N     1 
ATOM   9333  C  CA    . ASP C 1 100 ? 5.232   41.096  69.763  1.00 72.80  ? 80  ASP D CA    1 
ATOM   9334  C  C     . ASP C 1 100 ? 6.295   40.521  68.823  1.00 73.15  ? 80  ASP D C     1 
ATOM   9335  O  O     . ASP C 1 100 ? 6.428   39.306  68.682  1.00 72.70  ? 80  ASP D O     1 
ATOM   9336  C  CB    . ASP C 1 100 ? 4.906   40.133  70.920  1.00 73.68  ? 80  ASP D CB    1 
ATOM   9337  C  CG    . ASP C 1 100 ? 6.063   39.954  71.903  1.00 74.55  ? 80  ASP D CG    1 
ATOM   9338  O  OD1   . ASP C 1 100 ? 7.019   40.762  71.894  1.00 76.53  ? 80  ASP D OD1   1 
ATOM   9339  O  OD2   . ASP C 1 100 ? 6.004   38.997  72.704  1.00 74.11  ? 80  ASP D OD2   1 
ATOM   9340  N  N     . ALA C 1 101 ? 7.050   41.414  68.189  1.00 74.04  ? 81  ALA D N     1 
ATOM   9341  C  CA    . ALA C 1 101 ? 7.852   41.070  67.006  1.00 75.70  ? 81  ALA D CA    1 
ATOM   9342  C  C     . ALA C 1 101 ? 9.188   40.374  67.291  1.00 76.40  ? 81  ALA D C     1 
ATOM   9343  O  O     . ALA C 1 101 ? 9.582   39.476  66.542  1.00 75.97  ? 81  ALA D O     1 
ATOM   9344  C  CB    . ALA C 1 101 ? 8.082   42.311  66.164  1.00 75.91  ? 81  ALA D CB    1 
ATOM   9345  N  N     . PHE C 1 102 ? 9.889   40.800  68.343  1.00 78.02  ? 82  PHE D N     1 
ATOM   9346  C  CA    . PHE C 1 102 ? 11.189  40.206  68.696  1.00 80.11  ? 82  PHE D CA    1 
ATOM   9347  C  C     . PHE C 1 102 ? 11.046  38.778  69.222  1.00 81.88  ? 82  PHE D C     1 
ATOM   9348  O  O     . PHE C 1 102 ? 10.023  38.430  69.820  1.00 83.09  ? 82  PHE D O     1 
ATOM   9349  C  CB    . PHE C 1 102 ? 11.932  41.052  69.744  1.00 80.25  ? 82  PHE D CB    1 
ATOM   9350  C  CG    . PHE C 1 102 ? 12.571  42.306  69.198  1.00 80.18  ? 82  PHE D CG    1 
ATOM   9351  C  CD1   . PHE C 1 102 ? 13.407  42.262  68.080  1.00 80.22  ? 82  PHE D CD1   1 
ATOM   9352  C  CD2   . PHE C 1 102 ? 12.385  43.528  69.838  1.00 80.53  ? 82  PHE D CD2   1 
ATOM   9353  C  CE1   . PHE C 1 102 ? 14.009  43.414  67.595  1.00 80.10  ? 82  PHE D CE1   1 
ATOM   9354  C  CE2   . PHE C 1 102 ? 12.991  44.681  69.360  1.00 80.80  ? 82  PHE D CE2   1 
ATOM   9355  C  CZ    . PHE C 1 102 ? 13.802  44.624  68.236  1.00 80.65  ? 82  PHE D CZ    1 
ATOM   9356  N  N     . GLY C 1 103 ? 12.086  37.969  69.012  1.00 83.20  ? 83  GLY D N     1 
ATOM   9357  C  CA    . GLY C 1 103 ? 12.081  36.569  69.434  1.00 85.58  ? 83  GLY D CA    1 
ATOM   9358  C  C     . GLY C 1 103 ? 13.134  35.677  68.799  1.00 87.83  ? 83  GLY D C     1 
ATOM   9359  O  O     . GLY C 1 103 ? 13.758  36.033  67.800  1.00 88.06  ? 83  GLY D O     1 
ATOM   9360  N  N     . LEU C 1 104 ? 13.316  34.508  69.409  1.00 91.40  ? 84  LEU D N     1 
ATOM   9361  C  CA    . LEU C 1 104 ? 14.208  33.455  68.911  1.00 93.65  ? 84  LEU D CA    1 
ATOM   9362  C  C     . LEU C 1 104 ? 13.735  32.772  67.612  1.00 94.98  ? 84  LEU D C     1 
ATOM   9363  O  O     . LEU C 1 104 ? 14.578  32.404  66.789  1.00 96.19  ? 84  LEU D O     1 
ATOM   9364  C  CB    . LEU C 1 104 ? 14.428  32.396  70.007  1.00 94.80  ? 84  LEU D CB    1 
ATOM   9365  C  CG    . LEU C 1 104 ? 15.326  31.184  69.729  1.00 95.38  ? 84  LEU D CG    1 
ATOM   9366  C  CD1   . LEU C 1 104 ? 16.758  31.605  69.439  1.00 95.68  ? 84  LEU D CD1   1 
ATOM   9367  C  CD2   . LEU C 1 104 ? 15.282  30.227  70.911  1.00 95.47  ? 84  LEU D CD2   1 
ATOM   9368  N  N     . PRO C 1 105 ? 12.406  32.574  67.428  1.00 96.11  ? 85  PRO D N     1 
ATOM   9369  C  CA    . PRO C 1 105 ? 11.935  31.914  66.193  1.00 97.86  ? 85  PRO D CA    1 
ATOM   9370  C  C     . PRO C 1 105 ? 12.251  32.638  64.874  1.00 99.85  ? 85  PRO D C     1 
ATOM   9371  O  O     . PRO C 1 105 ? 12.321  31.986  63.830  1.00 100.96 ? 85  PRO D O     1 
ATOM   9372  C  CB    . PRO C 1 105 ? 10.415  31.822  66.394  1.00 97.61  ? 85  PRO D CB    1 
ATOM   9373  C  CG    . PRO C 1 105 ? 10.213  31.898  67.863  1.00 97.10  ? 85  PRO D CG    1 
ATOM   9374  C  CD    . PRO C 1 105 ? 11.293  32.801  68.371  1.00 96.34  ? 85  PRO D CD    1 
ATOM   9375  N  N     . ALA C 1 106 ? 12.426  33.960  64.923  1.00 101.63 ? 86  ALA D N     1 
ATOM   9376  C  CA    . ALA C 1 106 ? 12.807  34.750  63.745  1.00 102.71 ? 86  ALA D CA    1 
ATOM   9377  C  C     . ALA C 1 106 ? 14.187  34.374  63.204  1.00 103.92 ? 86  ALA D C     1 
ATOM   9378  O  O     . ALA C 1 106 ? 14.376  34.283  61.990  1.00 104.13 ? 86  ALA D O     1 
ATOM   9379  C  CB    . ALA C 1 106 ? 12.757  36.236  64.066  1.00 102.74 ? 86  ALA D CB    1 
ATOM   9380  N  N     . GLU C 1 107 ? 15.142  34.163  64.108  1.00 105.83 ? 87  GLU D N     1 
ATOM   9381  C  CA    . GLU C 1 107 ? 16.486  33.710  63.732  1.00 108.44 ? 87  GLU D CA    1 
ATOM   9382  C  C     . GLU C 1 107 ? 16.525  32.241  63.308  1.00 111.66 ? 87  GLU D C     1 
ATOM   9383  O  O     . GLU C 1 107 ? 17.350  31.865  62.474  1.00 111.85 ? 87  GLU D O     1 
ATOM   9384  C  CB    . GLU C 1 107 ? 17.476  33.944  64.870  1.00 107.86 ? 87  GLU D CB    1 
ATOM   9385  C  CG    . GLU C 1 107 ? 17.689  35.414  65.176  1.00 107.74 ? 87  GLU D CG    1 
ATOM   9386  C  CD    . GLU C 1 107 ? 18.707  35.662  66.270  1.00 108.18 ? 87  GLU D CD    1 
ATOM   9387  O  OE1   . GLU C 1 107 ? 19.420  34.720  66.685  1.00 107.78 ? 87  GLU D OE1   1 
ATOM   9388  O  OE2   . GLU C 1 107 ? 18.792  36.821  66.714  1.00 108.63 ? 87  GLU D OE2   1 
ATOM   9389  N  N     . GLY C 1 108 ? 15.651  31.417  63.891  1.00 114.52 ? 88  GLY D N     1 
ATOM   9390  C  CA    . GLY C 1 108 ? 15.517  30.011  63.502  1.00 117.02 ? 88  GLY D CA    1 
ATOM   9391  C  C     . GLY C 1 108 ? 15.150  29.836  62.038  1.00 119.48 ? 88  GLY D C     1 
ATOM   9392  O  O     . GLY C 1 108 ? 15.734  29.004  61.342  1.00 119.86 ? 88  GLY D O     1 
ATOM   9393  N  N     . ALA C 1 109 ? 14.183  30.627  61.577  1.00 123.07 ? 89  ALA D N     1 
ATOM   9394  C  CA    . ALA C 1 109 ? 13.799  30.657  60.163  1.00 126.43 ? 89  ALA D CA    1 
ATOM   9395  C  C     . ALA C 1 109 ? 14.860  31.335  59.289  1.00 129.54 ? 89  ALA D C     1 
ATOM   9396  O  O     . ALA C 1 109 ? 15.084  30.918  58.153  1.00 130.87 ? 89  ALA D O     1 
ATOM   9397  C  CB    . ALA C 1 109 ? 12.457  31.358  59.995  1.00 126.29 ? 89  ALA D CB    1 
ATOM   9398  N  N     . ALA C 1 110 ? 15.502  32.375  59.823  1.00 132.81 ? 90  ALA D N     1 
ATOM   9399  C  CA    . ALA C 1 110 ? 16.506  33.155  59.086  1.00 135.19 ? 90  ALA D CA    1 
ATOM   9400  C  C     . ALA C 1 110 ? 17.767  32.381  58.671  1.00 137.63 ? 90  ALA D C     1 
ATOM   9401  O  O     . ALA C 1 110 ? 18.371  32.708  57.650  1.00 138.69 ? 90  ALA D O     1 
ATOM   9402  C  CB    . ALA C 1 110 ? 16.903  34.389  59.887  1.00 135.42 ? 90  ALA D CB    1 
ATOM   9403  N  N     . VAL C 1 111 ? 18.167  31.383  59.464  1.00 139.76 ? 91  VAL D N     1 
ATOM   9404  C  CA    . VAL C 1 111 ? 19.365  30.575  59.179  1.00 140.48 ? 91  VAL D CA    1 
ATOM   9405  C  C     . VAL C 1 111 ? 19.029  29.354  58.313  1.00 140.20 ? 91  VAL D C     1 
ATOM   9406  O  O     . VAL C 1 111 ? 19.755  29.059  57.361  1.00 138.63 ? 91  VAL D O     1 
ATOM   9407  C  CB    . VAL C 1 111 ? 20.076  30.129  60.482  1.00 141.85 ? 91  VAL D CB    1 
ATOM   9408  C  CG1   . VAL C 1 111 ? 21.270  29.223  60.183  1.00 141.56 ? 91  VAL D CG1   1 
ATOM   9409  C  CG2   . VAL C 1 111 ? 20.530  31.348  61.280  1.00 141.97 ? 91  VAL D CG2   1 
ATOM   9410  N  N     . LYS C 1 112 ? 17.950  28.647  58.657  1.00 141.67 ? 92  LYS D N     1 
ATOM   9411  C  CA    . LYS C 1 112 ? 17.492  27.475  57.887  1.00 142.15 ? 92  LYS D CA    1 
ATOM   9412  C  C     . LYS C 1 112 ? 17.144  27.852  56.446  1.00 139.56 ? 92  LYS D C     1 
ATOM   9413  O  O     . LYS C 1 112 ? 17.549  27.166  55.505  1.00 139.12 ? 92  LYS D O     1 
ATOM   9414  C  CB    . LYS C 1 112 ? 16.278  26.815  58.555  1.00 144.62 ? 92  LYS D CB    1 
ATOM   9415  C  CG    . LYS C 1 112 ? 16.584  26.109  59.867  1.00 146.59 ? 92  LYS D CG    1 
ATOM   9416  C  CD    . LYS C 1 112 ? 15.323  25.528  60.491  1.00 147.87 ? 92  LYS D CD    1 
ATOM   9417  C  CE    . LYS C 1 112 ? 15.612  24.860  61.826  1.00 148.61 ? 92  LYS D CE    1 
ATOM   9418  N  NZ    . LYS C 1 112 ? 14.374  24.360  62.485  1.00 148.48 ? 92  LYS D NZ    1 
ATOM   9419  N  N     . ASN C 1 113 ? 16.392  28.941  56.297  1.00 137.04 ? 93  ASN D N     1 
ATOM   9420  C  CA    . ASN C 1 113 ? 16.081  29.528  54.990  1.00 135.40 ? 93  ASN D CA    1 
ATOM   9421  C  C     . ASN C 1 113 ? 17.087  30.647  54.696  1.00 132.99 ? 93  ASN D C     1 
ATOM   9422  O  O     . ASN C 1 113 ? 18.004  30.875  55.489  1.00 133.16 ? 93  ASN D O     1 
ATOM   9423  C  CB    . ASN C 1 113 ? 14.647  30.067  54.980  1.00 136.31 ? 93  ASN D CB    1 
ATOM   9424  C  CG    . ASN C 1 113 ? 13.633  29.034  55.437  1.00 137.05 ? 93  ASN D CG    1 
ATOM   9425  O  OD1   . ASN C 1 113 ? 12.910  29.246  56.410  1.00 139.49 ? 93  ASN D OD1   1 
ATOM   9426  N  ND2   . ASN C 1 113 ? 13.585  27.903  54.742  1.00 135.42 ? 93  ASN D ND2   1 
ATOM   9427  N  N     . ASN C 1 114 ? 16.925  31.323  53.558  1.00 129.65 ? 94  ASN D N     1 
ATOM   9428  C  CA    . ASN C 1 114 ? 17.840  32.385  53.129  1.00 126.68 ? 94  ASN D CA    1 
ATOM   9429  C  C     . ASN C 1 114 ? 17.133  33.748  53.163  1.00 124.27 ? 94  ASN D C     1 
ATOM   9430  O  O     . ASN C 1 114 ? 16.911  34.381  52.125  1.00 125.89 ? 94  ASN D O     1 
ATOM   9431  C  CB    . ASN C 1 114 ? 18.388  32.055  51.729  1.00 126.23 ? 94  ASN D CB    1 
ATOM   9432  C  CG    . ASN C 1 114 ? 19.643  32.842  51.373  1.00 126.48 ? 94  ASN D CG    1 
ATOM   9433  O  OD1   . ASN C 1 114 ? 20.013  33.809  52.042  1.00 126.97 ? 94  ASN D OD1   1 
ATOM   9434  N  ND2   . ASN C 1 114 ? 20.306  32.422  50.303  1.00 127.48 ? 94  ASN D ND2   1 
ATOM   9435  N  N     . THR C 1 115 ? 16.778  34.181  54.373  1.00 120.05 ? 95  THR D N     1 
ATOM   9436  C  CA    . THR C 1 115 ? 16.140  35.487  54.607  1.00 117.20 ? 95  THR D CA    1 
ATOM   9437  C  C     . THR C 1 115 ? 16.647  36.089  55.918  1.00 113.47 ? 95  THR D C     1 
ATOM   9438  O  O     . THR C 1 115 ? 17.038  35.357  56.826  1.00 113.44 ? 95  THR D O     1 
ATOM   9439  C  CB    . THR C 1 115 ? 14.599  35.367  54.680  1.00 117.85 ? 95  THR D CB    1 
ATOM   9440  O  OG1   . THR C 1 115 ? 14.126  34.472  53.666  1.00 120.55 ? 95  THR D OG1   1 
ATOM   9441  C  CG2   . THR C 1 115 ? 13.927  36.729  54.495  1.00 117.55 ? 95  THR D CG2   1 
ATOM   9442  N  N     . ALA C 1 116 ? 16.644  37.420  56.007  1.00 108.93 ? 96  ALA D N     1 
ATOM   9443  C  CA    . ALA C 1 116 ? 17.002  38.118  57.249  1.00 105.78 ? 96  ALA D CA    1 
ATOM   9444  C  C     . ALA C 1 116 ? 15.819  38.086  58.233  1.00 103.55 ? 96  ALA D C     1 
ATOM   9445  O  O     . ALA C 1 116 ? 14.682  37.859  57.812  1.00 102.68 ? 96  ALA D O     1 
ATOM   9446  C  CB    . ALA C 1 116 ? 17.425  39.552  56.956  1.00 105.23 ? 96  ALA D CB    1 
ATOM   9447  N  N     . PRO C 1 117 ? 16.076  38.313  59.544  1.00 100.90 ? 97  PRO D N     1 
ATOM   9448  C  CA    . PRO C 1 117 ? 14.988  38.244  60.532  1.00 98.55  ? 97  PRO D CA    1 
ATOM   9449  C  C     . PRO C 1 117 ? 13.928  39.345  60.417  1.00 97.15  ? 97  PRO D C     1 
ATOM   9450  O  O     . PRO C 1 117 ? 12.742  39.054  60.573  1.00 97.45  ? 97  PRO D O     1 
ATOM   9451  C  CB    . PRO C 1 117 ? 15.724  38.351  61.878  1.00 99.06  ? 97  PRO D CB    1 
ATOM   9452  C  CG    . PRO C 1 117 ? 17.128  37.962  61.578  1.00 99.92  ? 97  PRO D CG    1 
ATOM   9453  C  CD    . PRO C 1 117 ? 17.372  38.526  60.213  1.00 100.95 ? 97  PRO D CD    1 
ATOM   9454  N  N     . ALA C 1 118 ? 14.349  40.583  60.156  1.00 95.53  ? 98  ALA D N     1 
ATOM   9455  C  CA    . ALA C 1 118 ? 13.410  41.715  60.068  1.00 94.79  ? 98  ALA D CA    1 
ATOM   9456  C  C     . ALA C 1 118 ? 12.406  41.600  58.900  1.00 94.34  ? 98  ALA D C     1 
ATOM   9457  O  O     . ALA C 1 118 ? 11.202  41.707  59.137  1.00 93.47  ? 98  ALA D O     1 
ATOM   9458  C  CB    . ALA C 1 118 ? 14.149  43.056  60.043  1.00 95.08  ? 98  ALA D CB    1 
ATOM   9459  N  N     . PRO C 1 119 ? 12.886  41.368  57.653  1.00 94.98  ? 99  PRO D N     1 
ATOM   9460  C  CA    . PRO C 1 119 ? 11.959  41.104  56.533  1.00 95.27  ? 99  PRO D CA    1 
ATOM   9461  C  C     . PRO C 1 119 ? 11.002  39.933  56.773  1.00 94.89  ? 99  PRO D C     1 
ATOM   9462  O  O     . PRO C 1 119 ? 9.820   40.026  56.434  1.00 95.44  ? 99  PRO D O     1 
ATOM   9463  C  CB    . PRO C 1 119 ? 12.896  40.773  55.366  1.00 95.88  ? 99  PRO D CB    1 
ATOM   9464  C  CG    . PRO C 1 119 ? 14.168  41.457  55.692  1.00 95.97  ? 99  PRO D CG    1 
ATOM   9465  C  CD    . PRO C 1 119 ? 14.285  41.438  57.187  1.00 95.64  ? 99  PRO D CD    1 
ATOM   9466  N  N     . TRP C 1 120 ? 11.525  38.847  57.344  1.00 93.54  ? 100 TRP D N     1 
ATOM   9467  C  CA    . TRP C 1 120 ? 10.727  37.673  57.715  1.00 92.02  ? 100 TRP D CA    1 
ATOM   9468  C  C     . TRP C 1 120 ? 9.626   38.020  58.721  1.00 90.02  ? 100 TRP D C     1 
ATOM   9469  O  O     . TRP C 1 120 ? 8.516   37.503  58.622  1.00 89.82  ? 100 TRP D O     1 
ATOM   9470  C  CB    . TRP C 1 120 ? 11.636  36.576  58.288  1.00 92.74  ? 100 TRP D CB    1 
ATOM   9471  C  CG    . TRP C 1 120 ? 10.948  35.270  58.569  1.00 93.30  ? 100 TRP D CG    1 
ATOM   9472  C  CD1   . TRP C 1 120 ? 10.767  34.234  57.699  1.00 93.43  ? 100 TRP D CD1   1 
ATOM   9473  C  CD2   . TRP C 1 120 ? 10.367  34.857  59.812  1.00 94.09  ? 100 TRP D CD2   1 
ATOM   9474  N  NE1   . TRP C 1 120 ? 10.101  33.203  58.319  1.00 93.96  ? 100 TRP D NE1   1 
ATOM   9475  C  CE2   . TRP C 1 120 ? 9.843   33.558  59.616  1.00 94.54  ? 100 TRP D CE2   1 
ATOM   9476  C  CE3   . TRP C 1 120 ? 10.231  35.460  61.071  1.00 93.62  ? 100 TRP D CE3   1 
ATOM   9477  C  CZ2   . TRP C 1 120 ? 9.194   32.848  60.636  1.00 94.74  ? 100 TRP D CZ2   1 
ATOM   9478  C  CZ3   . TRP C 1 120 ? 9.582   34.754  62.087  1.00 93.95  ? 100 TRP D CZ3   1 
ATOM   9479  C  CH2   . TRP C 1 120 ? 9.075   33.460  61.860  1.00 94.44  ? 100 TRP D CH2   1 
ATOM   9480  N  N     . THR C 1 121 ? 9.941   38.894  59.677  1.00 88.31  ? 101 THR D N     1 
ATOM   9481  C  CA    . THR C 1 121 ? 8.978   39.329  60.690  1.00 87.72  ? 101 THR D CA    1 
ATOM   9482  C  C     . THR C 1 121 ? 7.869   40.202  60.092  1.00 87.49  ? 101 THR D C     1 
ATOM   9483  O  O     . THR C 1 121 ? 6.688   39.952  60.337  1.00 88.00  ? 101 THR D O     1 
ATOM   9484  C  CB    . THR C 1 121 ? 9.673   40.095  61.838  1.00 87.40  ? 101 THR D CB    1 
ATOM   9485  O  OG1   . THR C 1 121 ? 10.780  39.330  62.326  1.00 87.53  ? 101 THR D OG1   1 
ATOM   9486  C  CG2   . THR C 1 121 ? 8.712   40.356  62.990  1.00 87.56  ? 101 THR D CG2   1 
ATOM   9487  N  N     . TYR C 1 122 ? 8.250   41.212  59.310  1.00 86.98  ? 102 TYR D N     1 
ATOM   9488  C  CA    . TYR C 1 122 ? 7.279   42.144  58.713  1.00 86.89  ? 102 TYR D CA    1 
ATOM   9489  C  C     . TYR C 1 122 ? 6.339   41.489  57.691  1.00 86.43  ? 102 TYR D C     1 
ATOM   9490  O  O     . TYR C 1 122 ? 5.186   41.908  57.565  1.00 85.33  ? 102 TYR D O     1 
ATOM   9491  C  CB    . TYR C 1 122 ? 7.983   43.356  58.083  1.00 87.66  ? 102 TYR D CB    1 
ATOM   9492  C  CG    . TYR C 1 122 ? 8.596   44.312  59.093  1.00 87.72  ? 102 TYR D CG    1 
ATOM   9493  C  CD1   . TYR C 1 122 ? 7.800   44.975  60.030  1.00 88.10  ? 102 TYR D CD1   1 
ATOM   9494  C  CD2   . TYR C 1 122 ? 9.969   44.572  59.100  1.00 87.33  ? 102 TYR D CD2   1 
ATOM   9495  C  CE1   . TYR C 1 122 ? 8.353   45.852  60.953  1.00 87.84  ? 102 TYR D CE1   1 
ATOM   9496  C  CE2   . TYR C 1 122 ? 10.531  45.449  60.019  1.00 87.34  ? 102 TYR D CE2   1 
ATOM   9497  C  CZ    . TYR C 1 122 ? 9.721   46.086  60.942  1.00 87.80  ? 102 TYR D CZ    1 
ATOM   9498  O  OH    . TYR C 1 122 ? 10.276  46.956  61.852  1.00 87.90  ? 102 TYR D OH    1 
ATOM   9499  N  N     . ASP C 1 123 ? 6.830   40.479  56.970  1.00 87.43  ? 103 ASP D N     1 
ATOM   9500  C  CA    . ASP C 1 123 ? 5.988   39.687  56.055  1.00 89.13  ? 103 ASP D CA    1 
ATOM   9501  C  C     . ASP C 1 123 ? 4.957   38.836  56.804  1.00 87.33  ? 103 ASP D C     1 
ATOM   9502  O  O     . ASP C 1 123 ? 3.817   38.701  56.352  1.00 87.67  ? 103 ASP D O     1 
ATOM   9503  C  CB    . ASP C 1 123 ? 6.840   38.783  55.147  1.00 91.56  ? 103 ASP D CB    1 
ATOM   9504  C  CG    . ASP C 1 123 ? 7.517   39.549  54.019  1.00 93.61  ? 103 ASP D CG    1 
ATOM   9505  O  OD1   . ASP C 1 123 ? 7.895   40.723  54.223  1.00 96.11  ? 103 ASP D OD1   1 
ATOM   9506  O  OD2   . ASP C 1 123 ? 7.673   38.968  52.923  1.00 93.83  ? 103 ASP D OD2   1 
ATOM   9507  N  N     . ASN C 1 124 ? 5.368   38.260  57.934  1.00 84.30  ? 104 ASN D N     1 
ATOM   9508  C  CA    . ASN C 1 124 ? 4.463   37.488  58.794  1.00 81.83  ? 104 ASN D CA    1 
ATOM   9509  C  C     . ASN C 1 124 ? 3.419   38.381  59.466  1.00 82.03  ? 104 ASN D C     1 
ATOM   9510  O  O     . ASN C 1 124 ? 2.271   37.966  59.640  1.00 84.59  ? 104 ASN D O     1 
ATOM   9511  C  CB    . ASN C 1 124 ? 5.247   36.713  59.861  1.00 80.29  ? 104 ASN D CB    1 
ATOM   9512  C  CG    . ASN C 1 124 ? 6.143   35.640  59.270  1.00 79.44  ? 104 ASN D CG    1 
ATOM   9513  O  OD1   . ASN C 1 124 ? 6.249   35.493  58.052  1.00 79.27  ? 104 ASN D OD1   1 
ATOM   9514  N  ND2   . ASN C 1 124 ? 6.801   34.886  60.138  1.00 78.50  ? 104 ASN D ND2   1 
ATOM   9515  N  N     . ILE C 1 125 ? 3.823   39.593  59.850  1.00 80.59  ? 105 ILE D N     1 
ATOM   9516  C  CA    . ILE C 1 125 ? 2.894   40.597  60.386  1.00 79.72  ? 105 ILE D CA    1 
ATOM   9517  C  C     . ILE C 1 125 ? 1.813   40.928  59.353  1.00 80.18  ? 105 ILE D C     1 
ATOM   9518  O  O     . ILE C 1 125 ? 0.626   40.908  59.676  1.00 80.21  ? 105 ILE D O     1 
ATOM   9519  C  CB    . ILE C 1 125 ? 3.635   41.883  60.845  1.00 78.96  ? 105 ILE D CB    1 
ATOM   9520  C  CG1   . ILE C 1 125 ? 4.423   41.602  62.131  1.00 78.76  ? 105 ILE D CG1   1 
ATOM   9521  C  CG2   . ILE C 1 125 ? 2.661   43.038  61.084  1.00 78.86  ? 105 ILE D CG2   1 
ATOM   9522  C  CD1   . ILE C 1 125 ? 5.518   42.604  62.431  1.00 78.71  ? 105 ILE D CD1   1 
ATOM   9523  N  N     . ALA C 1 126 ? 2.235   41.215  58.121  1.00 80.64  ? 106 ALA D N     1 
ATOM   9524  C  CA    . ALA C 1 126 ? 1.316   41.587  57.036  1.00 80.33  ? 106 ALA D CA    1 
ATOM   9525  C  C     . ALA C 1 126 ? 0.347   40.467  56.640  1.00 79.90  ? 106 ALA D C     1 
ATOM   9526  O  O     . ALA C 1 126 ? -0.823  40.735  56.356  1.00 79.40  ? 106 ALA D O     1 
ATOM   9527  C  CB    . ALA C 1 126 ? 2.100   42.053  55.818  1.00 80.53  ? 106 ALA D CB    1 
ATOM   9528  N  N     . TYR C 1 127 ? 0.835   39.225  56.622  1.00 79.93  ? 107 TYR D N     1 
ATOM   9529  C  CA    . TYR C 1 127 ? 0.005   38.059  56.293  1.00 80.62  ? 107 TYR D CA    1 
ATOM   9530  C  C     . TYR C 1 127 ? -1.050  37.808  57.370  1.00 80.60  ? 107 TYR D C     1 
ATOM   9531  O  O     . TYR C 1 127 ? -2.238  37.680  57.064  1.00 80.30  ? 107 TYR D O     1 
ATOM   9532  C  CB    . TYR C 1 127 ? 0.876   36.808  56.113  1.00 81.68  ? 107 TYR D CB    1 
ATOM   9533  C  CG    . TYR C 1 127 ? 0.140   35.606  55.552  1.00 83.19  ? 107 TYR D CG    1 
ATOM   9534  C  CD1   . TYR C 1 127 ? 0.048   35.400  54.174  1.00 83.83  ? 107 TYR D CD1   1 
ATOM   9535  C  CD2   . TYR C 1 127 ? -0.458  34.669  56.397  1.00 84.24  ? 107 TYR D CD2   1 
ATOM   9536  C  CE1   . TYR C 1 127 ? -0.623  34.299  53.655  1.00 83.95  ? 107 TYR D CE1   1 
ATOM   9537  C  CE2   . TYR C 1 127 ? -1.132  33.566  55.887  1.00 84.24  ? 107 TYR D CE2   1 
ATOM   9538  C  CZ    . TYR C 1 127 ? -1.211  33.385  54.518  1.00 83.86  ? 107 TYR D CZ    1 
ATOM   9539  O  OH    . TYR C 1 127 ? -1.877  32.294  54.011  1.00 83.86  ? 107 TYR D OH    1 
ATOM   9540  N  N     . MET C 1 128 ? -0.602  37.742  58.623  1.00 80.48  ? 108 MET D N     1 
ATOM   9541  C  CA    . MET C 1 128 ? -1.489  37.491  59.767  1.00 79.90  ? 108 MET D CA    1 
ATOM   9542  C  C     . MET C 1 128 ? -2.445  38.650  60.064  1.00 79.46  ? 108 MET D C     1 
ATOM   9543  O  O     . MET C 1 128 ? -3.534  38.427  60.594  1.00 79.08  ? 108 MET D O     1 
ATOM   9544  C  CB    . MET C 1 128 ? -0.670  37.149  61.016  1.00 79.88  ? 108 MET D CB    1 
ATOM   9545  C  CG    . MET C 1 128 ? 0.041   35.809  60.923  1.00 80.22  ? 108 MET D CG    1 
ATOM   9546  S  SD    . MET C 1 128 ? 1.326   35.604  62.168  1.00 81.32  ? 108 MET D SD    1 
ATOM   9547  C  CE    . MET C 1 128 ? 0.364   35.616  63.679  1.00 80.62  ? 108 MET D CE    1 
ATOM   9548  N  N     . LYS C 1 129 ? -2.038  39.876  59.731  1.00 79.70  ? 109 LYS D N     1 
ATOM   9549  C  CA    . LYS C 1 129 ? -2.927  41.045  59.805  1.00 80.32  ? 109 LYS D CA    1 
ATOM   9550  C  C     . LYS C 1 129 ? -4.150  40.889  58.895  1.00 80.05  ? 109 LYS D C     1 
ATOM   9551  O  O     . LYS C 1 129 ? -5.250  41.305  59.261  1.00 78.91  ? 109 LYS D O     1 
ATOM   9552  C  CB    . LYS C 1 129 ? -2.162  42.329  59.447  1.00 81.24  ? 109 LYS D CB    1 
ATOM   9553  C  CG    . LYS C 1 129 ? -3.004  43.597  59.419  1.00 82.36  ? 109 LYS D CG    1 
ATOM   9554  C  CD    . LYS C 1 129 ? -2.135  44.841  59.360  1.00 83.36  ? 109 LYS D CD    1 
ATOM   9555  C  CE    . LYS C 1 129 ? -2.981  46.092  59.190  1.00 84.26  ? 109 LYS D CE    1 
ATOM   9556  N  NZ    . LYS C 1 129 ? -2.144  47.309  59.006  1.00 85.17  ? 109 LYS D NZ    1 
ATOM   9557  N  N     . ASN C 1 130 ? -3.946  40.297  57.717  1.00 80.41  ? 110 ASN D N     1 
ATOM   9558  C  CA    . ASN C 1 130 ? -5.032  40.049  56.764  1.00 81.48  ? 110 ASN D CA    1 
ATOM   9559  C  C     . ASN C 1 130 ? -6.005  38.974  57.266  1.00 83.12  ? 110 ASN D C     1 
ATOM   9560  O  O     . ASN C 1 130 ? -7.220  39.118  57.106  1.00 82.71  ? 110 ASN D O     1 
ATOM   9561  C  CB    . ASN C 1 130 ? -4.463  39.649  55.395  1.00 80.86  ? 110 ASN D CB    1 
ATOM   9562  C  CG    . ASN C 1 130 ? -5.504  39.692  54.288  1.00 80.40  ? 110 ASN D CG    1 
ATOM   9563  O  OD1   . ASN C 1 130 ? -6.262  40.655  54.167  1.00 79.59  ? 110 ASN D OD1   1 
ATOM   9564  N  ND2   . ASN C 1 130 ? -5.535  38.649  53.466  1.00 80.52  ? 110 ASN D ND2   1 
ATOM   9565  N  N     . GLN C 1 131 ? -5.469  37.909  57.867  1.00 84.23  ? 111 GLN D N     1 
ATOM   9566  C  CA    . GLN C 1 131 ? -6.294  36.829  58.430  1.00 85.09  ? 111 GLN D CA    1 
ATOM   9567  C  C     . GLN C 1 131 ? -7.174  37.307  59.590  1.00 86.65  ? 111 GLN D C     1 
ATOM   9568  O  O     . GLN C 1 131 ? -8.309  36.848  59.734  1.00 87.32  ? 111 GLN D O     1 
ATOM   9569  C  CB    . GLN C 1 131 ? -5.429  35.647  58.891  1.00 84.84  ? 111 GLN D CB    1 
ATOM   9570  C  CG    . GLN C 1 131 ? -4.694  34.924  57.771  1.00 84.98  ? 111 GLN D CG    1 
ATOM   9571  C  CD    . GLN C 1 131 ? -4.082  33.605  58.218  1.00 84.34  ? 111 GLN D CD    1 
ATOM   9572  O  OE1   . GLN C 1 131 ? -3.418  33.531  59.253  1.00 82.77  ? 111 GLN D OE1   1 
ATOM   9573  N  NE2   . GLN C 1 131 ? -4.299  32.555  57.432  1.00 84.34  ? 111 GLN D NE2   1 
ATOM   9574  N  N     . LEU C 1 132 ? -6.645  38.218  60.409  1.00 88.20  ? 112 LEU D N     1 
ATOM   9575  C  CA    . LEU C 1 132 ? -7.410  38.831  61.505  1.00 89.58  ? 112 LEU D CA    1 
ATOM   9576  C  C     . LEU C 1 132 ? -8.555  39.709  60.998  1.00 90.49  ? 112 LEU D C     1 
ATOM   9577  O  O     . LEU C 1 132 ? -9.649  39.685  61.564  1.00 92.98  ? 112 LEU D O     1 
ATOM   9578  C  CB    . LEU C 1 132 ? -6.499  39.660  62.424  1.00 90.09  ? 112 LEU D CB    1 
ATOM   9579  C  CG    . LEU C 1 132 ? -5.523  38.897  63.328  1.00 90.34  ? 112 LEU D CG    1 
ATOM   9580  C  CD1   . LEU C 1 132 ? -4.507  39.850  63.940  1.00 90.14  ? 112 LEU D CD1   1 
ATOM   9581  C  CD2   . LEU C 1 132 ? -6.256  38.134  64.423  1.00 90.57  ? 112 LEU D CD2   1 
ATOM   9582  N  N     . LYS C 1 133 ? -8.298  40.486  59.946  1.00 90.55  ? 113 LYS D N     1 
ATOM   9583  C  CA    . LYS C 1 133 ? -9.333  41.335  59.342  1.00 90.96  ? 113 LYS D CA    1 
ATOM   9584  C  C     . LYS C 1 133 ? -10.440 40.525  58.661  1.00 90.78  ? 113 LYS D C     1 
ATOM   9585  O  O     . LYS C 1 133 ? -11.602 40.932  58.689  1.00 91.02  ? 113 LYS D O     1 
ATOM   9586  C  CB    . LYS C 1 133 ? -8.724  42.343  58.358  1.00 91.86  ? 113 LYS D CB    1 
ATOM   9587  C  CG    . LYS C 1 133 ? -7.980  43.484  59.036  1.00 92.58  ? 113 LYS D CG    1 
ATOM   9588  C  CD    . LYS C 1 133 ? -7.732  44.644  58.088  1.00 93.66  ? 113 LYS D CD    1 
ATOM   9589  C  CE    . LYS C 1 133 ? -7.094  45.817  58.815  1.00 95.15  ? 113 LYS D CE    1 
ATOM   9590  N  NZ    . LYS C 1 133 ? -7.048  47.044  57.973  1.00 95.93  ? 113 LYS D NZ    1 
ATOM   9591  N  N     . MET C 1 134 ? -10.082 39.387  58.063  1.00 91.16  ? 114 MET D N     1 
ATOM   9592  C  CA    . MET C 1 134 ? -11.073 38.484  57.456  1.00 91.76  ? 114 MET D CA    1 
ATOM   9593  C  C     . MET C 1 134 ? -11.962 37.787  58.493  1.00 89.28  ? 114 MET D C     1 
ATOM   9594  O  O     . MET C 1 134 ? -13.128 37.504  58.209  1.00 87.98  ? 114 MET D O     1 
ATOM   9595  C  CB    . MET C 1 134 ? -10.400 37.451  56.543  1.00 95.05  ? 114 MET D CB    1 
ATOM   9596  C  CG    . MET C 1 134 ? -9.948  38.032  55.210  1.00 97.53  ? 114 MET D CG    1 
ATOM   9597  S  SD    . MET C 1 134 ? -9.359  36.790  54.044  1.00 101.01 ? 114 MET D SD    1 
ATOM   9598  C  CE    . MET C 1 134 ? -7.814  36.309  54.812  1.00 101.72 ? 114 MET D CE    1 
ATOM   9599  N  N     . LEU C 1 135 ? -11.415 37.511  59.678  1.00 87.53  ? 115 LEU D N     1 
ATOM   9600  C  CA    . LEU C 1 135 ? -12.209 36.993  60.807  1.00 85.48  ? 115 LEU D CA    1 
ATOM   9601  C  C     . LEU C 1 135 ? -13.203 38.027  61.354  1.00 83.85  ? 115 LEU D C     1 
ATOM   9602  O  O     . LEU C 1 135 ? -14.221 37.657  61.941  1.00 83.01  ? 115 LEU D O     1 
ATOM   9603  C  CB    . LEU C 1 135 ? -11.298 36.489  61.934  1.00 84.38  ? 115 LEU D CB    1 
ATOM   9604  C  CG    . LEU C 1 135 ? -10.528 35.203  61.612  1.00 84.38  ? 115 LEU D CG    1 
ATOM   9605  C  CD1   . LEU C 1 135 ? -9.303  35.048  62.502  1.00 84.93  ? 115 LEU D CD1   1 
ATOM   9606  C  CD2   . LEU C 1 135 ? -11.430 33.983  61.731  1.00 84.46  ? 115 LEU D CD2   1 
ATOM   9607  N  N     . GLY C 1 136 ? -12.890 39.311  61.179  1.00 82.47  ? 116 GLY D N     1 
ATOM   9608  C  CA    . GLY C 1 136 ? -13.828 40.401  61.444  1.00 81.64  ? 116 GLY D CA    1 
ATOM   9609  C  C     . GLY C 1 136 ? -13.841 40.878  62.882  1.00 81.02  ? 116 GLY D C     1 
ATOM   9610  O  O     . GLY C 1 136 ? -14.902 41.194  63.425  1.00 81.11  ? 116 GLY D O     1 
ATOM   9611  N  N     . PHE C 1 137 ? -12.659 40.947  63.493  1.00 80.09  ? 117 PHE D N     1 
ATOM   9612  C  CA    . PHE C 1 137 ? -12.522 41.430  64.864  1.00 79.22  ? 117 PHE D CA    1 
ATOM   9613  C  C     . PHE C 1 137 ? -12.462 42.954  64.835  1.00 78.90  ? 117 PHE D C     1 
ATOM   9614  O  O     . PHE C 1 137 ? -11.621 43.528  64.140  1.00 79.10  ? 117 PHE D O     1 
ATOM   9615  C  CB    . PHE C 1 137 ? -11.259 40.865  65.521  1.00 78.49  ? 117 PHE D CB    1 
ATOM   9616  C  CG    . PHE C 1 137 ? -11.178 39.358  65.507  1.00 78.35  ? 117 PHE D CG    1 
ATOM   9617  C  CD1   . PHE C 1 137 ? -12.251 38.577  65.943  1.00 78.25  ? 117 PHE D CD1   1 
ATOM   9618  C  CD2   . PHE C 1 137 ? -10.020 38.715  65.071  1.00 77.25  ? 117 PHE D CD2   1 
ATOM   9619  C  CE1   . PHE C 1 137 ? -12.172 37.190  65.931  1.00 77.90  ? 117 PHE D CE1   1 
ATOM   9620  C  CE2   . PHE C 1 137 ? -9.938  37.328  65.060  1.00 76.98  ? 117 PHE D CE2   1 
ATOM   9621  C  CZ    . PHE C 1 137 ? -11.014 36.565  65.490  1.00 77.21  ? 117 PHE D CZ    1 
ATOM   9622  N  N     . GLY C 1 138 ? -13.358 43.601  65.579  1.00 78.18  ? 118 GLY D N     1 
ATOM   9623  C  CA    . GLY C 1 138 ? -13.434 45.060  65.625  1.00 78.27  ? 118 GLY D CA    1 
ATOM   9624  C  C     . GLY C 1 138 ? -12.308 45.687  66.422  1.00 77.74  ? 118 GLY D C     1 
ATOM   9625  O  O     . GLY C 1 138 ? -12.514 46.137  67.551  1.00 76.95  ? 118 GLY D O     1 
ATOM   9626  N  N     . TYR C 1 139 ? -11.120 45.722  65.821  1.00 77.97  ? 119 TYR D N     1 
ATOM   9627  C  CA    . TYR C 1 139 ? -9.933  46.300  66.450  1.00 78.16  ? 119 TYR D CA    1 
ATOM   9628  C  C     . TYR C 1 139 ? -9.790  47.780  66.099  1.00 77.85  ? 119 TYR D C     1 
ATOM   9629  O  O     . TYR C 1 139 ? -10.283 48.236  65.063  1.00 77.63  ? 119 TYR D O     1 
ATOM   9630  C  CB    . TYR C 1 139 ? -8.660  45.553  66.021  1.00 78.78  ? 119 TYR D CB    1 
ATOM   9631  C  CG    . TYR C 1 139 ? -8.484  44.174  66.630  1.00 79.54  ? 119 TYR D CG    1 
ATOM   9632  C  CD1   . TYR C 1 139 ? -8.463  43.998  68.015  1.00 80.57  ? 119 TYR D CD1   1 
ATOM   9633  C  CD2   . TYR C 1 139 ? -8.302  43.045  65.825  1.00 79.69  ? 119 TYR D CD2   1 
ATOM   9634  C  CE1   . TYR C 1 139 ? -8.289  42.741  68.579  1.00 80.44  ? 119 TYR D CE1   1 
ATOM   9635  C  CE2   . TYR C 1 139 ? -8.123  41.784  66.383  1.00 79.48  ? 119 TYR D CE2   1 
ATOM   9636  C  CZ    . TYR C 1 139 ? -8.121  41.639  67.760  1.00 79.60  ? 119 TYR D CZ    1 
ATOM   9637  O  OH    . TYR C 1 139 ? -7.948  40.399  68.324  1.00 78.32  ? 119 TYR D OH    1 
ATOM   9638  N  N     . ASP C 1 140 ? -9.112  48.515  66.978  1.00 77.61  ? 120 ASP D N     1 
ATOM   9639  C  CA    . ASP C 1 140 ? -8.718  49.897  66.724  1.00 76.78  ? 120 ASP D CA    1 
ATOM   9640  C  C     . ASP C 1 140 ? -7.362  49.862  66.022  1.00 74.96  ? 120 ASP D C     1 
ATOM   9641  O  O     . ASP C 1 140 ? -6.312  49.832  66.670  1.00 75.01  ? 120 ASP D O     1 
ATOM   9642  C  CB    . ASP C 1 140 ? -8.651  50.685  68.042  1.00 78.36  ? 120 ASP D CB    1 
ATOM   9643  C  CG    . ASP C 1 140 ? -8.488  52.185  67.832  1.00 79.37  ? 120 ASP D CG    1 
ATOM   9644  O  OD1   . ASP C 1 140 ? -7.974  52.609  66.777  1.00 79.71  ? 120 ASP D OD1   1 
ATOM   9645  O  OD2   . ASP C 1 140 ? -8.886  52.952  68.736  1.00 80.56  ? 120 ASP D OD2   1 
ATOM   9646  N  N     . TRP C 1 141 ? -7.398  49.861  64.691  1.00 73.16  ? 121 TRP D N     1 
ATOM   9647  C  CA    . TRP C 1 141 ? -6.181  49.733  63.878  1.00 72.69  ? 121 TRP D CA    1 
ATOM   9648  C  C     . TRP C 1 141 ? -5.309  50.997  63.821  1.00 73.44  ? 121 TRP D C     1 
ATOM   9649  O  O     . TRP C 1 141 ? -4.160  50.924  63.377  1.00 73.53  ? 121 TRP D O     1 
ATOM   9650  C  CB    . TRP C 1 141 ? -6.525  49.250  62.461  1.00 71.02  ? 121 TRP D CB    1 
ATOM   9651  C  CG    . TRP C 1 141 ? -6.915  47.804  62.421  1.00 68.89  ? 121 TRP D CG    1 
ATOM   9652  C  CD1   . TRP C 1 141 ? -8.177  47.296  62.315  1.00 67.80  ? 121 TRP D CD1   1 
ATOM   9653  C  CD2   . TRP C 1 141 ? -6.033  46.678  62.503  1.00 67.66  ? 121 TRP D CD2   1 
ATOM   9654  N  NE1   . TRP C 1 141 ? -8.136  45.921  62.317  1.00 67.35  ? 121 TRP D NE1   1 
ATOM   9655  C  CE2   . TRP C 1 141 ? -6.833  45.515  62.432  1.00 67.21  ? 121 TRP D CE2   1 
ATOM   9656  C  CE3   . TRP C 1 141 ? -4.643  46.538  62.626  1.00 67.18  ? 121 TRP D CE3   1 
ATOM   9657  C  CZ2   . TRP C 1 141 ? -6.289  44.225  62.481  1.00 66.92  ? 121 TRP D CZ2   1 
ATOM   9658  C  CZ3   . TRP C 1 141 ? -4.100  45.253  62.674  1.00 66.80  ? 121 TRP D CZ3   1 
ATOM   9659  C  CH2   . TRP C 1 141 ? -4.925  44.115  62.604  1.00 66.94  ? 121 TRP D CH2   1 
ATOM   9660  N  N     . SER C 1 142 ? -5.840  52.142  64.260  1.00 73.96  ? 122 SER D N     1 
ATOM   9661  C  CA    . SER C 1 142 ? -5.025  53.355  64.426  1.00 74.38  ? 122 SER D CA    1 
ATOM   9662  C  C     . SER C 1 142 ? -4.017  53.226  65.577  1.00 74.26  ? 122 SER D C     1 
ATOM   9663  O  O     . SER C 1 142 ? -2.975  53.885  65.560  1.00 73.90  ? 122 SER D O     1 
ATOM   9664  C  CB    . SER C 1 142 ? -5.903  54.598  64.630  1.00 74.51  ? 122 SER D CB    1 
ATOM   9665  O  OG    . SER C 1 142 ? -6.662  54.523  65.823  1.00 74.30  ? 122 SER D OG    1 
ATOM   9666  N  N     . ARG C 1 143 ? -4.328  52.373  66.558  1.00 74.64  ? 123 ARG D N     1 
ATOM   9667  C  CA    . ARG C 1 143 ? -3.445  52.104  67.700  1.00 74.57  ? 123 ARG D CA    1 
ATOM   9668  C  C     . ARG C 1 143 ? -2.616  50.816  67.514  1.00 74.83  ? 123 ARG D C     1 
ATOM   9669  O  O     . ARG C 1 143 ? -2.369  50.087  68.480  1.00 74.39  ? 123 ARG D O     1 
ATOM   9670  C  CB    . ARG C 1 143 ? -4.278  52.007  68.988  1.00 74.06  ? 123 ARG D CB    1 
ATOM   9671  C  CG    . ARG C 1 143 ? -5.172  53.206  69.276  1.00 73.93  ? 123 ARG D CG    1 
ATOM   9672  C  CD    . ARG C 1 143 ? -6.157  52.889  70.391  1.00 74.02  ? 123 ARG D CD    1 
ATOM   9673  N  NE    . ARG C 1 143 ? -7.007  54.034  70.733  1.00 73.45  ? 123 ARG D NE    1 
ATOM   9674  C  CZ    . ARG C 1 143 ? -6.716  54.986  71.626  1.00 73.17  ? 123 ARG D CZ    1 
ATOM   9675  N  NH1   . ARG C 1 143 ? -5.572  54.981  72.314  1.00 73.33  ? 123 ARG D NH1   1 
ATOM   9676  N  NH2   . ARG C 1 143 ? -7.589  55.969  71.838  1.00 73.10  ? 123 ARG D NH2   1 
ATOM   9677  N  N     . GLU C 1 144 ? -2.173  50.547  66.285  1.00 75.75  ? 124 GLU D N     1 
ATOM   9678  C  CA    . GLU C 1 144 ? -1.381  49.350  65.987  1.00 76.47  ? 124 GLU D CA    1 
ATOM   9679  C  C     . GLU C 1 144 ? 0.063   49.546  66.446  1.00 76.12  ? 124 GLU D C     1 
ATOM   9680  O  O     . GLU C 1 144 ? 0.590   50.661  66.396  1.00 76.17  ? 124 GLU D O     1 
ATOM   9681  C  CB    . GLU C 1 144 ? -1.424  49.031  64.487  1.00 77.15  ? 124 GLU D CB    1 
ATOM   9682  C  CG    . GLU C 1 144 ? -0.913  47.640  64.124  1.00 77.79  ? 124 GLU D CG    1 
ATOM   9683  C  CD    . GLU C 1 144 ? -0.943  47.353  62.630  1.00 78.27  ? 124 GLU D CD    1 
ATOM   9684  O  OE1   . GLU C 1 144 ? -1.621  48.087  61.878  1.00 78.56  ? 124 GLU D OE1   1 
ATOM   9685  O  OE2   . GLU C 1 144 ? -0.283  46.381  62.202  1.00 78.06  ? 124 GLU D OE2   1 
ATOM   9686  N  N     . LEU C 1 145 ? 0.688   48.457  66.893  1.00 75.92  ? 125 LEU D N     1 
ATOM   9687  C  CA    . LEU C 1 145 ? 2.071   48.475  67.375  1.00 76.59  ? 125 LEU D CA    1 
ATOM   9688  C  C     . LEU C 1 145 ? 2.845   47.259  66.883  1.00 76.25  ? 125 LEU D C     1 
ATOM   9689  O  O     . LEU C 1 145 ? 2.308   46.152  66.824  1.00 76.42  ? 125 LEU D O     1 
ATOM   9690  C  CB    . LEU C 1 145 ? 2.106   48.490  68.906  1.00 77.77  ? 125 LEU D CB    1 
ATOM   9691  C  CG    . LEU C 1 145 ? 1.594   49.739  69.624  1.00 79.09  ? 125 LEU D CG    1 
ATOM   9692  C  CD1   . LEU C 1 145 ? 1.540   49.488  71.123  1.00 79.33  ? 125 LEU D CD1   1 
ATOM   9693  C  CD2   . LEU C 1 145 ? 2.465   50.949  69.317  1.00 80.00  ? 125 LEU D CD2   1 
ATOM   9694  N  N     . ALA C 1 146 ? 4.106   47.489  66.525  1.00 76.34  ? 126 ALA D N     1 
ATOM   9695  C  CA    . ALA C 1 146 ? 5.076   46.428  66.284  1.00 76.80  ? 126 ALA D CA    1 
ATOM   9696  C  C     . ALA C 1 146 ? 6.260   46.711  67.198  1.00 77.13  ? 126 ALA D C     1 
ATOM   9697  O  O     . ALA C 1 146 ? 6.884   47.767  67.097  1.00 77.89  ? 126 ALA D O     1 
ATOM   9698  C  CB    . ALA C 1 146 ? 5.509   46.417  64.829  1.00 77.21  ? 126 ALA D CB    1 
ATOM   9699  N  N     . THR C 1 147 ? 6.569   45.768  68.085  1.00 76.98  ? 127 THR D N     1 
ATOM   9700  C  CA    . THR C 1 147 ? 7.570   45.985  69.134  1.00 76.88  ? 127 THR D CA    1 
ATOM   9701  C  C     . THR C 1 147 ? 9.026   46.015  68.638  1.00 76.27  ? 127 THR D C     1 
ATOM   9702  O  O     . THR C 1 147 ? 9.915   46.423  69.389  1.00 75.53  ? 127 THR D O     1 
ATOM   9703  C  CB    . THR C 1 147 ? 7.439   44.932  70.254  1.00 78.28  ? 127 THR D CB    1 
ATOM   9704  O  OG1   . THR C 1 147 ? 7.620   43.616  69.714  1.00 78.44  ? 127 THR D OG1   1 
ATOM   9705  C  CG2   . THR C 1 147 ? 6.071   45.030  70.925  1.00 78.42  ? 127 THR D CG2   1 
ATOM   9706  N  N     . CYS C 1 148 ? 9.264   45.596  67.392  1.00 75.42  ? 128 CYS D N     1 
ATOM   9707  C  CA    . CYS C 1 148 ? 10.598  45.650  66.780  1.00 75.36  ? 128 CYS D CA    1 
ATOM   9708  C  C     . CYS C 1 148 ? 10.940  47.006  66.151  1.00 74.99  ? 128 CYS D C     1 
ATOM   9709  O  O     . CYS C 1 148 ? 12.082  47.217  65.740  1.00 73.46  ? 128 CYS D O     1 
ATOM   9710  C  CB    . CYS C 1 148 ? 10.754  44.551  65.724  1.00 75.97  ? 128 CYS D CB    1 
ATOM   9711  S  SG    . CYS C 1 148 ? 9.610   44.684  64.330  1.00 77.01  ? 128 CYS D SG    1 
ATOM   9712  N  N     . THR C 1 149 ? 9.963   47.910  66.062  1.00 75.51  ? 129 THR D N     1 
ATOM   9713  C  CA    . THR C 1 149 ? 10.186  49.245  65.509  1.00 76.78  ? 129 THR D CA    1 
ATOM   9714  C  C     . THR C 1 149 ? 10.855  50.156  66.550  1.00 78.85  ? 129 THR D C     1 
ATOM   9715  O  O     . THR C 1 149 ? 10.470  50.118  67.721  1.00 80.30  ? 129 THR D O     1 
ATOM   9716  C  CB    . THR C 1 149 ? 8.862   49.894  65.064  1.00 76.31  ? 129 THR D CB    1 
ATOM   9717  O  OG1   . THR C 1 149 ? 7.949   49.935  66.167  1.00 75.54  ? 129 THR D OG1   1 
ATOM   9718  C  CG2   . THR C 1 149 ? 8.234   49.108  63.920  1.00 76.40  ? 129 THR D CG2   1 
ATOM   9719  N  N     . PRO C 1 150 ? 11.848  50.980  66.134  1.00 80.10  ? 130 PRO D N     1 
ATOM   9720  C  CA    . PRO C 1 150 ? 12.484  51.967  67.030  1.00 80.23  ? 130 PRO D CA    1 
ATOM   9721  C  C     . PRO C 1 150 ? 11.538  52.930  67.762  1.00 80.17  ? 130 PRO D C     1 
ATOM   9722  O  O     . PRO C 1 150 ? 11.882  53.406  68.842  1.00 79.81  ? 130 PRO D O     1 
ATOM   9723  C  CB    . PRO C 1 150 ? 13.396  52.754  66.086  1.00 81.08  ? 130 PRO D CB    1 
ATOM   9724  C  CG    . PRO C 1 150 ? 13.758  51.778  65.030  1.00 81.28  ? 130 PRO D CG    1 
ATOM   9725  C  CD    . PRO C 1 150 ? 12.543  50.918  64.833  1.00 81.00  ? 130 PRO D CD    1 
ATOM   9726  N  N     . GLU C 1 151 ? 10.371  53.213  67.181  1.00 80.96  ? 131 GLU D N     1 
ATOM   9727  C  CA    . GLU C 1 151 ? 9.363   54.068  67.822  1.00 82.39  ? 131 GLU D CA    1 
ATOM   9728  C  C     . GLU C 1 151 ? 8.809   53.475  69.127  1.00 80.93  ? 131 GLU D C     1 
ATOM   9729  O  O     . GLU C 1 151 ? 8.391   54.225  70.011  1.00 80.69  ? 131 GLU D O     1 
ATOM   9730  C  CB    . GLU C 1 151 ? 8.199   54.370  66.863  1.00 85.67  ? 131 GLU D CB    1 
ATOM   9731  C  CG    . GLU C 1 151 ? 8.527   55.356  65.744  1.00 88.96  ? 131 GLU D CG    1 
ATOM   9732  C  CD    . GLU C 1 151 ? 9.171   54.710  64.528  1.00 91.74  ? 131 GLU D CD    1 
ATOM   9733  O  OE1   . GLU C 1 151 ? 8.572   53.773  63.957  1.00 93.47  ? 131 GLU D OE1   1 
ATOM   9734  O  OE2   . GLU C 1 151 ? 10.275  55.147  64.136  1.00 94.35  ? 131 GLU D OE2   1 
ATOM   9735  N  N     . TYR C 1 152 ? 8.801   52.143  69.235  1.00 79.50  ? 132 TYR D N     1 
ATOM   9736  C  CA    . TYR C 1 152 ? 8.328   51.453  70.437  1.00 78.70  ? 132 TYR D CA    1 
ATOM   9737  C  C     . TYR C 1 152 ? 9.435   51.281  71.479  1.00 78.36  ? 132 TYR D C     1 
ATOM   9738  O  O     . TYR C 1 152 ? 9.322   51.800  72.591  1.00 78.22  ? 132 TYR D O     1 
ATOM   9739  C  CB    . TYR C 1 152 ? 7.730   50.084  70.083  1.00 78.33  ? 132 TYR D CB    1 
ATOM   9740  C  CG    . TYR C 1 152 ? 7.127   49.368  71.275  1.00 77.65  ? 132 TYR D CG    1 
ATOM   9741  C  CD1   . TYR C 1 152 ? 5.863   49.716  71.754  1.00 77.05  ? 132 TYR D CD1   1 
ATOM   9742  C  CD2   . TYR C 1 152 ? 7.826   48.355  71.936  1.00 76.79  ? 132 TYR D CD2   1 
ATOM   9743  C  CE1   . TYR C 1 152 ? 5.309   49.071  72.851  1.00 76.33  ? 132 TYR D CE1   1 
ATOM   9744  C  CE2   . TYR C 1 152 ? 7.281   47.705  73.034  1.00 76.20  ? 132 TYR D CE2   1 
ATOM   9745  C  CZ    . TYR C 1 152 ? 6.023   48.066  73.487  1.00 76.02  ? 132 TYR D CZ    1 
ATOM   9746  O  OH    . TYR C 1 152 ? 5.480   47.425  74.573  1.00 75.66  ? 132 TYR D OH    1 
ATOM   9747  N  N     . TYR C 1 153 ? 10.500  50.560  71.117  1.00 78.58  ? 133 TYR D N     1 
ATOM   9748  C  CA    . TYR C 1 153 ? 11.518  50.134  72.098  1.00 79.44  ? 133 TYR D CA    1 
ATOM   9749  C  C     . TYR C 1 153 ? 12.506  51.212  72.569  1.00 79.91  ? 133 TYR D C     1 
ATOM   9750  O  O     . TYR C 1 153 ? 13.353  50.934  73.418  1.00 80.06  ? 133 TYR D O     1 
ATOM   9751  C  CB    . TYR C 1 153 ? 12.271  48.870  71.624  1.00 79.34  ? 133 TYR D CB    1 
ATOM   9752  C  CG    . TYR C 1 153 ? 13.249  49.048  70.475  1.00 79.46  ? 133 TYR D CG    1 
ATOM   9753  C  CD1   . TYR C 1 153 ? 14.550  49.508  70.696  1.00 79.73  ? 133 TYR D CD1   1 
ATOM   9754  C  CD2   . TYR C 1 153 ? 12.888  48.714  69.170  1.00 80.14  ? 133 TYR D CD2   1 
ATOM   9755  C  CE1   . TYR C 1 153 ? 15.447  49.659  69.646  1.00 80.13  ? 133 TYR D CE1   1 
ATOM   9756  C  CE2   . TYR C 1 153 ? 13.781  48.859  68.116  1.00 80.29  ? 133 TYR D CE2   1 
ATOM   9757  C  CZ    . TYR C 1 153 ? 15.057  49.332  68.356  1.00 80.09  ? 133 TYR D CZ    1 
ATOM   9758  O  OH    . TYR C 1 153 ? 15.936  49.472  67.306  1.00 79.65  ? 133 TYR D OH    1 
ATOM   9759  N  N     . ARG C 1 154 ? 12.409  52.427  72.029  1.00 81.00  ? 134 ARG D N     1 
ATOM   9760  C  CA    . ARG C 1 154 ? 13.161  53.569  72.567  1.00 81.95  ? 134 ARG D CA    1 
ATOM   9761  C  C     . ARG C 1 154 ? 12.777  53.926  74.010  1.00 81.67  ? 134 ARG D C     1 
ATOM   9762  O  O     . ARG C 1 154 ? 13.631  54.352  74.789  1.00 83.17  ? 134 ARG D O     1 
ATOM   9763  C  CB    . ARG C 1 154 ? 13.013  54.810  71.668  1.00 83.24  ? 134 ARG D CB    1 
ATOM   9764  C  CG    . ARG C 1 154 ? 11.617  55.421  71.568  1.00 84.23  ? 134 ARG D CG    1 
ATOM   9765  C  CD    . ARG C 1 154 ? 11.674  56.825  70.987  1.00 84.86  ? 134 ARG D CD    1 
ATOM   9766  N  NE    . ARG C 1 154 ? 12.362  57.763  71.877  1.00 85.03  ? 134 ARG D NE    1 
ATOM   9767  C  CZ    . ARG C 1 154 ? 12.675  59.024  71.573  1.00 86.70  ? 134 ARG D CZ    1 
ATOM   9768  N  NH1   . ARG C 1 154 ? 12.366  59.546  70.385  1.00 87.55  ? 134 ARG D NH1   1 
ATOM   9769  N  NH2   . ARG C 1 154 ? 13.306  59.778  72.472  1.00 87.58  ? 134 ARG D NH2   1 
ATOM   9770  N  N     . TRP C 1 155 ? 11.503  53.744  74.358  1.00 79.89  ? 135 TRP D N     1 
ATOM   9771  C  CA    . TRP C 1 155 ? 10.974  54.199  75.648  1.00 79.74  ? 135 TRP D CA    1 
ATOM   9772  C  C     . TRP C 1 155 ? 11.314  53.252  76.795  1.00 80.16  ? 135 TRP D C     1 
ATOM   9773  O  O     . TRP C 1 155 ? 11.520  53.701  77.923  1.00 80.64  ? 135 TRP D O     1 
ATOM   9774  C  CB    . TRP C 1 155 ? 9.461   54.430  75.564  1.00 79.62  ? 135 TRP D CB    1 
ATOM   9775  C  CG    . TRP C 1 155 ? 9.087   55.392  74.477  1.00 80.04  ? 135 TRP D CG    1 
ATOM   9776  C  CD1   . TRP C 1 155 ? 8.304   55.137  73.389  1.00 80.18  ? 135 TRP D CD1   1 
ATOM   9777  C  CD2   . TRP C 1 155 ? 9.511   56.756  74.355  1.00 81.00  ? 135 TRP D CD2   1 
ATOM   9778  N  NE1   . TRP C 1 155 ? 8.200   56.260  72.603  1.00 80.20  ? 135 TRP D NE1   1 
ATOM   9779  C  CE2   . TRP C 1 155 ? 8.933   57.268  73.171  1.00 80.87  ? 135 TRP D CE2   1 
ATOM   9780  C  CE3   . TRP C 1 155 ? 10.320  57.598  75.133  1.00 80.99  ? 135 TRP D CE3   1 
ATOM   9781  C  CZ2   . TRP C 1 155 ? 9.136   58.588  72.746  1.00 80.90  ? 135 TRP D CZ2   1 
ATOM   9782  C  CZ3   . TRP C 1 155 ? 10.523  58.911  74.710  1.00 80.90  ? 135 TRP D CZ3   1 
ATOM   9783  C  CH2   . TRP C 1 155 ? 9.933   59.390  73.526  1.00 80.91  ? 135 TRP D CH2   1 
ATOM   9784  N  N     . GLU C 1 156 ? 11.363  51.951  76.509  1.00 80.20  ? 136 GLU D N     1 
ATOM   9785  C  CA    . GLU C 1 156 ? 11.849  50.958  77.480  1.00 80.15  ? 136 GLU D CA    1 
ATOM   9786  C  C     . GLU C 1 156 ? 13.361  51.058  77.719  1.00 80.93  ? 136 GLU D C     1 
ATOM   9787  O  O     . GLU C 1 156 ? 13.837  50.720  78.806  1.00 82.29  ? 136 GLU D O     1 
ATOM   9788  C  CB    . GLU C 1 156 ? 11.457  49.530  77.067  1.00 79.20  ? 136 GLU D CB    1 
ATOM   9789  C  CG    . GLU C 1 156 ? 12.147  48.977  75.825  1.00 78.19  ? 136 GLU D CG    1 
ATOM   9790  C  CD    . GLU C 1 156 ? 11.724  47.556  75.501  1.00 77.47  ? 136 GLU D CD    1 
ATOM   9791  O  OE1   . GLU C 1 156 ? 10.523  47.242  75.629  1.00 76.20  ? 136 GLU D OE1   1 
ATOM   9792  O  OE2   . GLU C 1 156 ? 12.596  46.755  75.107  1.00 77.09  ? 136 GLU D OE2   1 
ATOM   9793  N  N     . GLN C 1 157 ? 14.106  51.503  76.703  1.00 80.81  ? 137 GLN D N     1 
ATOM   9794  C  CA    . GLN C 1 157 ? 15.544  51.774  76.848  1.00 80.17  ? 137 GLN D CA    1 
ATOM   9795  C  C     . GLN C 1 157 ? 15.799  52.935  77.810  1.00 80.02  ? 137 GLN D C     1 
ATOM   9796  O  O     . GLN C 1 157 ? 16.616  52.816  78.722  1.00 79.77  ? 137 GLN D O     1 
ATOM   9797  C  CB    . GLN C 1 157 ? 16.203  52.059  75.490  1.00 79.50  ? 137 GLN D CB    1 
ATOM   9798  C  CG    . GLN C 1 157 ? 16.455  50.810  74.657  1.00 79.86  ? 137 GLN D CG    1 
ATOM   9799  C  CD    . GLN C 1 157 ? 16.954  51.113  73.253  1.00 79.77  ? 137 GLN D CD    1 
ATOM   9800  O  OE1   . GLN C 1 157 ? 16.507  52.063  72.608  1.00 80.44  ? 137 GLN D OE1   1 
ATOM   9801  N  NE2   . GLN C 1 157 ? 17.877  50.291  72.766  1.00 78.44  ? 137 GLN D NE2   1 
ATOM   9802  N  N     . LYS C 1 158 ? 15.089  54.045  77.609  1.00 80.22  ? 138 LYS D N     1 
ATOM   9803  C  CA    . LYS C 1 158 ? 15.180  55.199  78.515  1.00 80.69  ? 138 LYS D CA    1 
ATOM   9804  C  C     . LYS C 1 158 ? 14.640  54.881  79.915  1.00 79.15  ? 138 LYS D C     1 
ATOM   9805  O  O     . LYS C 1 158 ? 15.110  55.449  80.901  1.00 80.79  ? 138 LYS D O     1 
ATOM   9806  C  CB    . LYS C 1 158 ? 14.449  56.415  77.937  1.00 82.38  ? 138 LYS D CB    1 
ATOM   9807  C  CG    . LYS C 1 158 ? 14.733  57.713  78.682  1.00 83.90  ? 138 LYS D CG    1 
ATOM   9808  C  CD    . LYS C 1 158 ? 14.284  58.930  77.892  1.00 85.97  ? 138 LYS D CD    1 
ATOM   9809  C  CE    . LYS C 1 158 ? 14.688  60.217  78.592  1.00 87.89  ? 138 LYS D CE    1 
ATOM   9810  N  NZ    . LYS C 1 158 ? 14.430  61.417  77.747  1.00 89.37  ? 138 LYS D NZ    1 
ATOM   9811  N  N     . PHE C 1 159 ? 13.655  53.987  79.991  1.00 76.12  ? 139 PHE D N     1 
ATOM   9812  C  CA    . PHE C 1 159 ? 13.145  53.497  81.274  1.00 73.67  ? 139 PHE D CA    1 
ATOM   9813  C  C     . PHE C 1 159 ? 14.184  52.634  81.998  1.00 71.78  ? 139 PHE D C     1 
ATOM   9814  O  O     . PHE C 1 159 ? 14.318  52.722  83.217  1.00 71.35  ? 139 PHE D O     1 
ATOM   9815  C  CB    . PHE C 1 159 ? 11.845  52.711  81.070  1.00 73.14  ? 139 PHE D CB    1 
ATOM   9816  C  CG    . PHE C 1 159 ? 11.089  52.448  82.341  1.00 72.68  ? 139 PHE D CG    1 
ATOM   9817  C  CD1   . PHE C 1 159 ? 10.465  53.491  83.019  1.00 72.27  ? 139 PHE D CD1   1 
ATOM   9818  C  CD2   . PHE C 1 159 ? 10.986  51.160  82.857  1.00 72.45  ? 139 PHE D CD2   1 
ATOM   9819  C  CE1   . PHE C 1 159 ? 9.762   53.257  84.191  1.00 72.09  ? 139 PHE D CE1   1 
ATOM   9820  C  CE2   . PHE C 1 159 ? 10.281  50.920  84.027  1.00 73.07  ? 139 PHE D CE2   1 
ATOM   9821  C  CZ    . PHE C 1 159 ? 9.669   51.971  84.695  1.00 72.68  ? 139 PHE D CZ    1 
ATOM   9822  N  N     . PHE C 1 160 ? 14.912  51.809  81.244  1.00 69.93  ? 140 PHE D N     1 
ATOM   9823  C  CA    . PHE C 1 160 ? 15.981  50.966  81.799  1.00 68.97  ? 140 PHE D CA    1 
ATOM   9824  C  C     . PHE C 1 160 ? 17.137  51.787  82.383  1.00 70.09  ? 140 PHE D C     1 
ATOM   9825  O  O     . PHE C 1 160 ? 17.753  51.371  83.368  1.00 71.14  ? 140 PHE D O     1 
ATOM   9826  C  CB    . PHE C 1 160 ? 16.508  50.002  80.732  1.00 67.69  ? 140 PHE D CB    1 
ATOM   9827  C  CG    . PHE C 1 160 ? 17.453  48.959  81.261  1.00 67.28  ? 140 PHE D CG    1 
ATOM   9828  C  CD1   . PHE C 1 160 ? 16.968  47.817  81.888  1.00 67.39  ? 140 PHE D CD1   1 
ATOM   9829  C  CD2   . PHE C 1 160 ? 18.831  49.108  81.121  1.00 66.96  ? 140 PHE D CD2   1 
ATOM   9830  C  CE1   . PHE C 1 160 ? 17.837  46.847  82.370  1.00 67.14  ? 140 PHE D CE1   1 
ATOM   9831  C  CE2   . PHE C 1 160 ? 19.704  48.142  81.602  1.00 66.62  ? 140 PHE D CE2   1 
ATOM   9832  C  CZ    . PHE C 1 160 ? 19.206  47.009  82.225  1.00 66.62  ? 140 PHE D CZ    1 
ATOM   9833  N  N     . THR C 1 161 ? 17.431  52.937  81.774  1.00 71.03  ? 141 THR D N     1 
ATOM   9834  C  CA    . THR C 1 161 ? 18.432  53.867  82.306  1.00 71.86  ? 141 THR D CA    1 
ATOM   9835  C  C     . THR C 1 161 ? 17.922  54.585  83.559  1.00 74.15  ? 141 THR D C     1 
ATOM   9836  O  O     . THR C 1 161 ? 18.695  54.832  84.486  1.00 75.50  ? 141 THR D O     1 
ATOM   9837  C  CB    . THR C 1 161 ? 18.864  54.917  81.261  1.00 71.27  ? 141 THR D CB    1 
ATOM   9838  O  OG1   . THR C 1 161 ? 17.723  55.656  80.811  1.00 70.95  ? 141 THR D OG1   1 
ATOM   9839  C  CG2   . THR C 1 161 ? 19.541  54.248  80.071  1.00 70.82  ? 141 THR D CG2   1 
ATOM   9840  N  N     . GLU C 1 162 ? 16.630  54.921  83.576  1.00 76.30  ? 142 GLU D N     1 
ATOM   9841  C  CA    . GLU C 1 162 ? 15.980  55.500  84.764  1.00 77.50  ? 142 GLU D CA    1 
ATOM   9842  C  C     . GLU C 1 162 ? 15.954  54.524  85.949  1.00 76.57  ? 142 GLU D C     1 
ATOM   9843  O  O     . GLU C 1 162 ? 16.130  54.940  87.096  1.00 76.22  ? 142 GLU D O     1 
ATOM   9844  C  CB    . GLU C 1 162 ? 14.556  55.980  84.438  1.00 79.43  ? 142 GLU D CB    1 
ATOM   9845  C  CG    . GLU C 1 162 ? 14.502  57.255  83.601  1.00 81.10  ? 142 GLU D CG    1 
ATOM   9846  C  CD    . GLU C 1 162 ? 13.141  57.508  82.960  1.00 82.99  ? 142 GLU D CD    1 
ATOM   9847  O  OE1   . GLU C 1 162 ? 12.113  57.026  83.486  1.00 83.81  ? 142 GLU D OE1   1 
ATOM   9848  O  OE2   . GLU C 1 162 ? 13.097  58.206  81.923  1.00 84.10  ? 142 GLU D OE2   1 
ATOM   9849  N  N     . LEU C 1 163 ? 15.730  53.239  85.667  1.00 75.94  ? 143 LEU D N     1 
ATOM   9850  C  CA    . LEU C 1 163 ? 15.790  52.191  86.696  1.00 76.09  ? 143 LEU D CA    1 
ATOM   9851  C  C     . LEU C 1 163 ? 17.206  51.980  87.242  1.00 77.02  ? 143 LEU D C     1 
ATOM   9852  O  O     . LEU C 1 163 ? 17.364  51.627  88.412  1.00 78.59  ? 143 LEU D O     1 
ATOM   9853  C  CB    . LEU C 1 163 ? 15.242  50.859  86.165  1.00 75.58  ? 143 LEU D CB    1 
ATOM   9854  C  CG    . LEU C 1 163 ? 13.743  50.770  85.861  1.00 75.90  ? 143 LEU D CG    1 
ATOM   9855  C  CD1   . LEU C 1 163 ? 13.441  49.477  85.117  1.00 75.94  ? 143 LEU D CD1   1 
ATOM   9856  C  CD2   . LEU C 1 163 ? 12.905  50.863  87.128  1.00 76.68  ? 143 LEU D CD2   1 
ATOM   9857  N  N     . TYR C 1 164 ? 18.221  52.181  86.397  1.00 77.30  ? 144 TYR D N     1 
ATOM   9858  C  CA    . TYR C 1 164 ? 19.627  52.072  86.815  1.00 77.98  ? 144 TYR D CA    1 
ATOM   9859  C  C     . TYR C 1 164 ? 20.033  53.159  87.817  1.00 79.33  ? 144 TYR D C     1 
ATOM   9860  O  O     . TYR C 1 164 ? 20.772  52.879  88.765  1.00 78.14  ? 144 TYR D O     1 
ATOM   9861  C  CB    . TYR C 1 164 ? 20.561  52.105  85.598  1.00 77.06  ? 144 TYR D CB    1 
ATOM   9862  C  CG    . TYR C 1 164 ? 22.026  51.920  85.941  1.00 76.51  ? 144 TYR D CG    1 
ATOM   9863  C  CD1   . TYR C 1 164 ? 22.579  50.646  86.071  1.00 76.04  ? 144 TYR D CD1   1 
ATOM   9864  C  CD2   . TYR C 1 164 ? 22.861  53.022  86.137  1.00 76.07  ? 144 TYR D CD2   1 
ATOM   9865  C  CE1   . TYR C 1 164 ? 23.920  50.474  86.387  1.00 75.80  ? 144 TYR D CE1   1 
ATOM   9866  C  CE2   . TYR C 1 164 ? 24.202  52.860  86.456  1.00 75.73  ? 144 TYR D CE2   1 
ATOM   9867  C  CZ    . TYR C 1 164 ? 24.728  51.587  86.577  1.00 75.40  ? 144 TYR D CZ    1 
ATOM   9868  O  OH    . TYR C 1 164 ? 26.056  51.428  86.890  1.00 75.12  ? 144 TYR D OH    1 
ATOM   9869  N  N     . LYS C 1 165 ? 19.562  54.386  87.599  1.00 81.95  ? 145 LYS D N     1 
ATOM   9870  C  CA    . LYS C 1 165 ? 19.827  55.501  88.522  1.00 84.77  ? 145 LYS D CA    1 
ATOM   9871  C  C     . LYS C 1 165 ? 19.082  55.369  89.859  1.00 84.49  ? 145 LYS D C     1 
ATOM   9872  O  O     . LYS C 1 165 ? 19.586  55.821  90.890  1.00 85.11  ? 145 LYS D O     1 
ATOM   9873  C  CB    . LYS C 1 165 ? 19.514  56.853  87.861  1.00 87.28  ? 145 LYS D CB    1 
ATOM   9874  C  CG    . LYS C 1 165 ? 20.582  57.305  86.874  1.00 89.26  ? 145 LYS D CG    1 
ATOM   9875  C  CD    . LYS C 1 165 ? 20.103  58.442  85.980  1.00 90.71  ? 145 LYS D CD    1 
ATOM   9876  C  CE    . LYS C 1 165 ? 19.285  57.928  84.803  1.00 91.35  ? 145 LYS D CE    1 
ATOM   9877  N  NZ    . LYS C 1 165 ? 18.831  59.021  83.899  1.00 92.15  ? 145 LYS D NZ    1 
ATOM   9878  N  N     . LYS C 1 166 ? 17.894  54.762  89.839  1.00 83.91  ? 146 LYS D N     1 
ATOM   9879  C  CA    . LYS C 1 166 ? 17.157  54.447  91.075  1.00 83.98  ? 146 LYS D CA    1 
ATOM   9880  C  C     . LYS C 1 166 ? 17.788  53.310  91.892  1.00 83.51  ? 146 LYS D C     1 
ATOM   9881  O  O     . LYS C 1 166 ? 17.545  53.213  93.096  1.00 84.97  ? 146 LYS D O     1 
ATOM   9882  C  CB    . LYS C 1 166 ? 15.690  54.108  90.776  1.00 84.95  ? 146 LYS D CB    1 
ATOM   9883  C  CG    . LYS C 1 166 ? 14.820  55.315  90.457  1.00 86.22  ? 146 LYS D CG    1 
ATOM   9884  C  CD    . LYS C 1 166 ? 13.340  54.960  90.503  1.00 87.35  ? 146 LYS D CD    1 
ATOM   9885  C  CE    . LYS C 1 166 ? 12.458  56.196  90.451  1.00 87.94  ? 146 LYS D CE    1 
ATOM   9886  N  NZ    . LYS C 1 166 ? 11.030  55.855  90.704  1.00 88.82  ? 146 LYS D NZ    1 
ATOM   9887  N  N     . GLY C 1 167 ? 18.572  52.450  91.237  1.00 82.18  ? 147 GLY D N     1 
ATOM   9888  C  CA    . GLY C 1 167 ? 19.261  51.332  91.894  1.00 81.54  ? 147 GLY D CA    1 
ATOM   9889  C  C     . GLY C 1 167 ? 18.525  50.001  91.837  1.00 80.82  ? 147 GLY D C     1 
ATOM   9890  O  O     . GLY C 1 167 ? 18.825  49.095  92.619  1.00 79.85  ? 147 GLY D O     1 
ATOM   9891  N  N     . LEU C 1 168 ? 17.575  49.879  90.908  1.00 81.14  ? 148 LEU D N     1 
ATOM   9892  C  CA    . LEU C 1 168 ? 16.790  48.656  90.721  1.00 80.80  ? 148 LEU D CA    1 
ATOM   9893  C  C     . LEU C 1 168 ? 17.380  47.737  89.643  1.00 80.78  ? 148 LEU D C     1 
ATOM   9894  O  O     . LEU C 1 168 ? 16.853  46.649  89.411  1.00 80.79  ? 148 LEU D O     1 
ATOM   9895  C  CB    . LEU C 1 168 ? 15.340  49.012  90.372  1.00 80.41  ? 148 LEU D CB    1 
ATOM   9896  C  CG    . LEU C 1 168 ? 14.609  49.936  91.356  1.00 80.47  ? 148 LEU D CG    1 
ATOM   9897  C  CD1   . LEU C 1 168 ? 13.270  50.368  90.783  1.00 80.55  ? 148 LEU D CD1   1 
ATOM   9898  C  CD2   . LEU C 1 168 ? 14.419  49.270  92.711  1.00 80.75  ? 148 LEU D CD2   1 
ATOM   9899  N  N     . VAL C 1 169 ? 18.452  48.179  88.981  1.00 81.05  ? 149 VAL D N     1 
ATOM   9900  C  CA    . VAL C 1 169 ? 19.206  47.353  88.035  1.00 82.06  ? 149 VAL D CA    1 
ATOM   9901  C  C     . VAL C 1 169 ? 20.574  47.052  88.640  1.00 82.84  ? 149 VAL D C     1 
ATOM   9902  O  O     . VAL C 1 169 ? 21.156  47.901  89.319  1.00 84.34  ? 149 VAL D O     1 
ATOM   9903  C  CB    . VAL C 1 169 ? 19.393  48.068  86.676  1.00 82.30  ? 149 VAL D CB    1 
ATOM   9904  C  CG1   . VAL C 1 169 ? 20.191  47.202  85.705  1.00 82.18  ? 149 VAL D CG1   1 
ATOM   9905  C  CG2   . VAL C 1 169 ? 18.041  48.434  86.076  1.00 82.49  ? 149 VAL D CG2   1 
ATOM   9906  N  N     . TYR C 1 170 ? 21.075  45.843  88.394  1.00 83.79  ? 150 TYR D N     1 
ATOM   9907  C  CA    . TYR C 1 170 ? 22.407  45.436  88.851  1.00 85.56  ? 150 TYR D CA    1 
ATOM   9908  C  C     . TYR C 1 170 ? 22.966  44.309  87.978  1.00 87.61  ? 150 TYR D C     1 
ATOM   9909  O  O     . TYR C 1 170 ? 22.208  43.503  87.433  1.00 88.70  ? 150 TYR D O     1 
ATOM   9910  C  CB    . TYR C 1 170 ? 22.370  45.020  90.333  1.00 85.04  ? 150 TYR D CB    1 
ATOM   9911  C  CG    . TYR C 1 170 ? 21.765  43.654  90.604  1.00 83.78  ? 150 TYR D CG    1 
ATOM   9912  C  CD1   . TYR C 1 170 ? 20.406  43.411  90.388  1.00 83.19  ? 150 TYR D CD1   1 
ATOM   9913  C  CD2   . TYR C 1 170 ? 22.551  42.604  91.086  1.00 82.81  ? 150 TYR D CD2   1 
ATOM   9914  C  CE1   . TYR C 1 170 ? 19.850  42.162  90.635  1.00 82.29  ? 150 TYR D CE1   1 
ATOM   9915  C  CE2   . TYR C 1 170 ? 22.003  41.355  91.338  1.00 82.44  ? 150 TYR D CE2   1 
ATOM   9916  C  CZ    . TYR C 1 170 ? 20.654  41.137  91.109  1.00 82.11  ? 150 TYR D CZ    1 
ATOM   9917  O  OH    . TYR C 1 170 ? 20.109  39.899  91.355  1.00 81.05  ? 150 TYR D OH    1 
ATOM   9918  N  N     . LYS C 1 171 ? 24.291  44.269  87.849  1.00 89.78  ? 151 LYS D N     1 
ATOM   9919  C  CA    . LYS C 1 171 ? 24.972  43.244  87.061  1.00 92.20  ? 151 LYS D CA    1 
ATOM   9920  C  C     . LYS C 1 171 ? 25.458  42.123  87.973  1.00 93.66  ? 151 LYS D C     1 
ATOM   9921  O  O     . LYS C 1 171 ? 25.879  42.380  89.102  1.00 93.38  ? 151 LYS D O     1 
ATOM   9922  C  CB    . LYS C 1 171 ? 26.152  43.854  86.302  1.00 93.96  ? 151 LYS D CB    1 
ATOM   9923  C  CG    . LYS C 1 171 ? 26.591  43.043  85.091  1.00 95.20  ? 151 LYS D CG    1 
ATOM   9924  C  CD    . LYS C 1 171 ? 27.604  43.798  84.243  1.00 96.13  ? 151 LYS D CD    1 
ATOM   9925  C  CE    . LYS C 1 171 ? 27.685  43.230  82.835  1.00 96.62  ? 151 LYS D CE    1 
ATOM   9926  N  NZ    . LYS C 1 171 ? 28.631  43.999  81.982  1.00 97.81  ? 151 LYS D NZ    1 
ATOM   9927  N  N     . LYS C 1 172 ? 25.379  40.885  87.489  1.00 97.04  ? 152 LYS D N     1 
ATOM   9928  C  CA    . LYS C 1 172 ? 25.916  39.727  88.214  1.00 100.40 ? 152 LYS D CA    1 
ATOM   9929  C  C     . LYS C 1 172 ? 26.185  38.551  87.277  1.00 102.12 ? 152 LYS D C     1 
ATOM   9930  O  O     . LYS C 1 172 ? 25.727  38.534  86.132  1.00 100.75 ? 152 LYS D O     1 
ATOM   9931  C  CB    . LYS C 1 172 ? 24.978  39.301  89.362  1.00 101.54 ? 152 LYS D CB    1 
ATOM   9932  C  CG    . LYS C 1 172 ? 23.864  38.326  88.987  1.00 102.13 ? 152 LYS D CG    1 
ATOM   9933  C  CD    . LYS C 1 172 ? 22.860  38.160  90.117  1.00 102.62 ? 152 LYS D CD    1 
ATOM   9934  C  CE    . LYS C 1 172 ? 22.066  36.869  89.990  1.00 102.96 ? 152 LYS D CE    1 
ATOM   9935  N  NZ    . LYS C 1 172 ? 21.098  36.704  91.109  1.00 103.35 ? 152 LYS D NZ    1 
ATOM   9936  N  N     . THR C 1 173 ? 26.921  37.570  87.792  1.00 106.14 ? 153 THR D N     1 
ATOM   9937  C  CA    . THR C 1 173 ? 27.250  36.350  87.058  1.00 108.45 ? 153 THR D CA    1 
ATOM   9938  C  C     . THR C 1 173 ? 26.081  35.365  87.136  1.00 109.83 ? 153 THR D C     1 
ATOM   9939  O  O     . THR C 1 173 ? 25.468  35.213  88.196  1.00 110.06 ? 153 THR D O     1 
ATOM   9940  C  CB    . THR C 1 173 ? 28.522  35.693  87.630  1.00 109.72 ? 153 THR D CB    1 
ATOM   9941  O  OG1   . THR C 1 173 ? 29.555  36.680  87.761  1.00 111.65 ? 153 THR D OG1   1 
ATOM   9942  C  CG2   . THR C 1 173 ? 29.016  34.579  86.729  1.00 110.06 ? 153 THR D CG2   1 
ATOM   9943  N  N     . SER C 1 174 ? 25.785  34.700  86.017  1.00 111.46 ? 154 SER D N     1 
ATOM   9944  C  CA    . SER C 1 174 ? 24.631  33.797  85.915  1.00 113.20 ? 154 SER D CA    1 
ATOM   9945  C  C     . SER C 1 174 ? 24.910  32.584  85.025  1.00 115.25 ? 154 SER D C     1 
ATOM   9946  O  O     . SER C 1 174 ? 25.742  32.643  84.115  1.00 113.66 ? 154 SER D O     1 
ATOM   9947  C  CB    . SER C 1 174 ? 23.417  34.561  85.381  1.00 113.13 ? 154 SER D CB    1 
ATOM   9948  O  OG    . SER C 1 174 ? 22.250  33.755  85.401  1.00 112.39 ? 154 SER D OG    1 
ATOM   9949  N  N     . ALA C 1 175 ? 24.190  31.495  85.296  1.00 118.50 ? 155 ALA D N     1 
ATOM   9950  C  CA    . ALA C 1 175 ? 24.339  30.237  84.560  1.00 121.29 ? 155 ALA D CA    1 
ATOM   9951  C  C     . ALA C 1 175 ? 23.638  30.313  83.206  1.00 123.71 ? 155 ALA D C     1 
ATOM   9952  O  O     . ALA C 1 175 ? 22.558  30.896  83.092  1.00 125.09 ? 155 ALA D O     1 
ATOM   9953  C  CB    . ALA C 1 175 ? 23.784  29.079  85.374  1.00 121.43 ? 155 ALA D CB    1 
ATOM   9954  N  N     . VAL C 1 176 ? 24.264  29.717  82.190  1.00 126.85 ? 156 VAL D N     1 
ATOM   9955  C  CA    . VAL C 1 176 ? 23.792  29.781  80.801  1.00 129.64 ? 156 VAL D CA    1 
ATOM   9956  C  C     . VAL C 1 176 ? 24.073  28.456  80.086  1.00 133.21 ? 156 VAL D C     1 
ATOM   9957  O  O     . VAL C 1 176 ? 25.143  27.871  80.261  1.00 135.50 ? 156 VAL D O     1 
ATOM   9958  C  CB    . VAL C 1 176 ? 24.489  30.934  80.034  1.00 128.25 ? 156 VAL D CB    1 
ATOM   9959  C  CG1   . VAL C 1 176 ? 24.082  30.946  78.563  1.00 127.77 ? 156 VAL D CG1   1 
ATOM   9960  C  CG2   . VAL C 1 176 ? 24.185  32.278  80.690  1.00 128.32 ? 156 VAL D CG2   1 
ATOM   9961  N  N     . ASN C 1 177 ? 23.117  28.001  79.273  1.00 135.90 ? 157 ASN D N     1 
ATOM   9962  C  CA    . ASN C 1 177 ? 23.281  26.781  78.472  1.00 136.95 ? 157 ASN D CA    1 
ATOM   9963  C  C     . ASN C 1 177 ? 24.214  27.060  77.289  1.00 141.05 ? 157 ASN D C     1 
ATOM   9964  O  O     . ASN C 1 177 ? 23.794  27.629  76.278  1.00 140.87 ? 157 ASN D O     1 
ATOM   9965  C  CB    . ASN C 1 177 ? 21.924  26.262  77.972  1.00 134.78 ? 157 ASN D CB    1 
ATOM   9966  C  CG    . ASN C 1 177 ? 20.987  25.866  79.102  1.00 133.70 ? 157 ASN D CG    1 
ATOM   9967  O  OD1   . ASN C 1 177 ? 21.414  25.604  80.227  1.00 133.52 ? 157 ASN D OD1   1 
ATOM   9968  N  ND2   . ASN C 1 177 ? 19.695  25.816  78.801  1.00 132.14 ? 157 ASN D ND2   1 
ATOM   9969  N  N     . TRP C 1 178 ? 25.475  26.654  77.436  1.00 146.81 ? 158 TRP D N     1 
ATOM   9970  C  CA    . TRP C 1 178 ? 26.545  26.955  76.481  1.00 151.60 ? 158 TRP D CA    1 
ATOM   9971  C  C     . TRP C 1 178 ? 27.062  25.670  75.832  1.00 159.15 ? 158 TRP D C     1 
ATOM   9972  O  O     . TRP C 1 178 ? 27.574  24.791  76.530  1.00 160.94 ? 158 TRP D O     1 
ATOM   9973  C  CB    . TRP C 1 178 ? 27.687  27.665  77.223  1.00 149.83 ? 158 TRP D CB    1 
ATOM   9974  C  CG    . TRP C 1 178 ? 28.908  27.981  76.394  1.00 147.58 ? 158 TRP D CG    1 
ATOM   9975  C  CD1   . TRP C 1 178 ? 30.001  27.184  76.205  1.00 147.07 ? 158 TRP D CD1   1 
ATOM   9976  C  CD2   . TRP C 1 178 ? 29.164  29.190  75.668  1.00 146.16 ? 158 TRP D CD2   1 
ATOM   9977  N  NE1   . TRP C 1 178 ? 30.915  27.815  75.396  1.00 146.63 ? 158 TRP D NE1   1 
ATOM   9978  C  CE2   . TRP C 1 178 ? 30.429  29.048  75.053  1.00 145.28 ? 158 TRP D CE2   1 
ATOM   9979  C  CE3   . TRP C 1 178 ? 28.447  30.378  75.472  1.00 146.32 ? 158 TRP D CE3   1 
ATOM   9980  C  CZ2   . TRP C 1 178 ? 30.993  30.052  74.255  1.00 144.51 ? 158 TRP D CZ2   1 
ATOM   9981  C  CZ3   . TRP C 1 178 ? 29.008  31.378  74.675  1.00 145.31 ? 158 TRP D CZ3   1 
ATOM   9982  C  CH2   . TRP C 1 178 ? 30.269  31.205  74.076  1.00 144.57 ? 158 TRP D CH2   1 
ATOM   9983  N  N     . CYS C 1 179 ? 26.923  25.564  74.507  1.00 167.43 ? 159 CYS D N     1 
ATOM   9984  C  CA    . CYS C 1 179 ? 27.557  24.485  73.743  1.00 173.17 ? 159 CYS D CA    1 
ATOM   9985  C  C     . CYS C 1 179 ? 28.973  24.940  73.366  1.00 170.10 ? 159 CYS D C     1 
ATOM   9986  O  O     . CYS C 1 179 ? 29.127  25.975  72.711  1.00 167.78 ? 159 CYS D O     1 
ATOM   9987  C  CB    . CYS C 1 179 ? 26.751  24.129  72.484  1.00 181.70 ? 159 CYS D CB    1 
ATOM   9988  S  SG    . CYS C 1 179 ? 27.177  22.505  71.796  1.00 192.58 ? 159 CYS D SG    1 
ATOM   9989  N  N     . PRO C 1 180 ? 30.011  24.180  73.781  1.00 167.09 ? 160 PRO D N     1 
ATOM   9990  C  CA    . PRO C 1 180 ? 31.396  24.593  73.517  1.00 165.47 ? 160 PRO D CA    1 
ATOM   9991  C  C     . PRO C 1 180 ? 31.846  24.445  72.056  1.00 164.80 ? 160 PRO D C     1 
ATOM   9992  O  O     . PRO C 1 180 ? 32.823  25.083  71.658  1.00 164.49 ? 160 PRO D O     1 
ATOM   9993  C  CB    . PRO C 1 180 ? 32.210  23.664  74.422  1.00 165.00 ? 160 PRO D CB    1 
ATOM   9994  C  CG    . PRO C 1 180 ? 31.393  22.426  74.507  1.00 165.07 ? 160 PRO D CG    1 
ATOM   9995  C  CD    . PRO C 1 180 ? 29.957  22.865  74.449  1.00 165.58 ? 160 PRO D CD    1 
ATOM   9996  N  N     . ASN C 1 181 ? 31.149  23.615  71.278  1.00 164.13 ? 161 ASN D N     1 
ATOM   9997  C  CA    . ASN C 1 181 ? 31.486  23.377  69.872  1.00 162.80 ? 161 ASN D CA    1 
ATOM   9998  C  C     . ASN C 1 181 ? 31.238  24.620  69.011  1.00 163.30 ? 161 ASN D C     1 
ATOM   9999  O  O     . ASN C 1 181 ? 32.139  25.082  68.309  1.00 162.13 ? 161 ASN D O     1 
ATOM   10000 C  CB    . ASN C 1 181 ? 30.679  22.182  69.335  1.00 161.21 ? 161 ASN D CB    1 
ATOM   10001 C  CG    . ASN C 1 181 ? 31.119  21.737  67.948  1.00 159.72 ? 161 ASN D CG    1 
ATOM   10002 O  OD1   . ASN C 1 181 ? 32.280  21.884  67.566  1.00 160.04 ? 161 ASN D OD1   1 
ATOM   10003 N  ND2   . ASN C 1 181 ? 30.184  21.174  67.191  1.00 158.23 ? 161 ASN D ND2   1 
ATOM   10004 N  N     . ASP C 1 182 ? 30.021  25.157  69.086  1.00 164.93 ? 162 ASP D N     1 
ATOM   10005 C  CA    . ASP C 1 182 ? 29.617  26.324  68.283  1.00 165.88 ? 162 ASP D CA    1 
ATOM   10006 C  C     . ASP C 1 182 ? 30.059  27.682  68.847  1.00 166.39 ? 162 ASP D C     1 
ATOM   10007 O  O     . ASP C 1 182 ? 30.075  28.666  68.105  1.00 165.81 ? 162 ASP D O     1 
ATOM   10008 C  CB    . ASP C 1 182 ? 28.093  26.338  68.089  1.00 165.52 ? 162 ASP D CB    1 
ATOM   10009 C  CG    . ASP C 1 182 ? 27.582  25.129  67.320  1.00 164.68 ? 162 ASP D CG    1 
ATOM   10010 O  OD1   . ASP C 1 182 ? 28.210  24.738  66.312  1.00 164.53 ? 162 ASP D OD1   1 
ATOM   10011 O  OD2   . ASP C 1 182 ? 26.536  24.575  67.717  1.00 164.11 ? 162 ASP D OD2   1 
ATOM   10012 N  N     . GLN C 1 183 ? 30.401  27.733  70.139  1.00 166.79 ? 163 GLN D N     1 
ATOM   10013 C  CA    . GLN C 1 183 ? 30.778  28.976  70.841  1.00 166.20 ? 163 GLN D CA    1 
ATOM   10014 C  C     . GLN C 1 183 ? 29.612  29.981  70.918  1.00 165.96 ? 163 GLN D C     1 
ATOM   10015 O  O     . GLN C 1 183 ? 29.804  31.186  70.717  1.00 166.40 ? 163 GLN D O     1 
ATOM   10016 C  CB    . GLN C 1 183 ? 32.021  29.638  70.207  1.00 165.82 ? 163 GLN D CB    1 
ATOM   10017 C  CG    . GLN C 1 183 ? 33.204  28.710  69.951  1.00 165.95 ? 163 GLN D CG    1 
ATOM   10018 C  CD    . GLN C 1 183 ? 33.836  28.161  71.219  1.00 166.48 ? 163 GLN D CD    1 
ATOM   10019 O  OE1   . GLN C 1 183 ? 33.654  28.700  72.312  1.00 167.74 ? 163 GLN D OE1   1 
ATOM   10020 N  NE2   . GLN C 1 183 ? 34.599  27.085  71.073  1.00 166.34 ? 163 GLN D NE2   1 
ATOM   10021 N  N     . THR C 1 184 ? 28.412  29.476  71.219  1.00 163.15 ? 164 THR D N     1 
ATOM   10022 C  CA    . THR C 1 184 ? 27.186  30.292  71.251  1.00 159.48 ? 164 THR D CA    1 
ATOM   10023 C  C     . THR C 1 184 ? 26.232  29.823  72.357  1.00 156.83 ? 164 THR D C     1 
ATOM   10024 O  O     . THR C 1 184 ? 26.197  28.637  72.694  1.00 156.34 ? 164 THR D O     1 
ATOM   10025 C  CB    . THR C 1 184 ? 26.439  30.243  69.895  1.00 159.70 ? 164 THR D CB    1 
ATOM   10026 O  OG1   . THR C 1 184 ? 27.362  30.443  68.817  1.00 160.57 ? 164 THR D OG1   1 
ATOM   10027 C  CG2   . THR C 1 184 ? 25.349  31.314  69.819  1.00 159.82 ? 164 THR D CG2   1 
ATOM   10028 N  N     . VAL C 1 185 ? 25.464  30.766  72.905  1.00 153.56 ? 165 VAL D N     1 
ATOM   10029 C  CA    . VAL C 1 185 ? 24.442  30.479  73.920  1.00 150.73 ? 165 VAL D CA    1 
ATOM   10030 C  C     . VAL C 1 185 ? 23.194  29.873  73.268  1.00 148.51 ? 165 VAL